data_4OIR
# 
_entry.id   4OIR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OIR         
NDB   NA2891       
RCSB  RCSB084544   
WWPDB D_1000084544 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OIN . unspecified 
PDB 4OIO . unspecified 
PDB 4OIP . unspecified 
PDB 4OIQ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OIR 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
'Arnold, E.'    3 
# 
_citation.id                        primary 
_citation.title                     
;GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
;
_citation.journal_abbrev            Elife 
_citation.journal_volume            3 
_citation.page_first                e02450 
_citation.page_last                 e02450 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24755292 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'            1  
primary 'Degen, D.'            2  
primary 'Ho, M.X.'             3  
primary 'Sineva, E.'           4  
primary 'Ebright, K.Y.'        5  
primary 'Ebright, Y.W.'        6  
primary 'Mekler, V.'           7  
primary 'Vahedian-Movahed, H.' 8  
primary 'Feng, Y.'             9  
primary 'Yin, R.'              10 
primary 'Tuske, S.'            11 
primary 'Irschik, H.'          12 
primary 'Jansen, R.'           13 
primary 'Maffioli, S.'         14 
primary 'Donadio, S.'          15 
primary 'Arnold, E.'           16 
primary 'Ebright, R.H.'        17 
# 
_cell.entry_id           4OIR 
_cell.length_a           183.700 
_cell.length_b           105.010 
_cell.length_c           295.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.79 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OIR 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                 33878.758  2   
2.7.7.6 ? ? ?                                 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                  125436.539 1   
2.7.7.6 ? ? ?                                 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1   2.7.7.6 ? ? ?                                 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                 11533.316  1   
2.7.7.6 ? ? ?                                 
5  polymer     man 'DNA directed RNA polymerase sigma factor A'                                                50769.398  1   ? ? 
? ?                                 
6  polymer     syn "5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*GP*G)-3'"                    6480.172   1   ? ? 
? 'promoter DNA template strand'    
7  polymer     syn "5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G)-3'" 8421.432   1   ? ? 
? 'promoter DNA nontemplate strand' 
8  polymer     syn GE23077                                                                                     739.687    1   ? ? 
? ?                                 
9  non-polymer syn 'MAGNESIUM ION'                                                                             24.305     4   ? ? 
? ?                                 
10 non-polymer syn 'rifamycin SV'                                                                              699.784    1   ? ? 
? ?                                 
11 non-polymer syn 'ZINC ION'                                                                                  65.409     2   ? ? 
? ?                                 
12 non-polymer syn '(2Z)-2-methylbut-2-enoic acid'                                                             100.116    1   ? ? 
? ?                                 
13 water       nat water                                                                                       18.015     123 ? ? 
? ?                                 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha, RNA polymerase subunit alpha, Transcriptase subunit alpha' 
2 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta'    
3 
;RNAP subunit beta', RNA polymerase subunit beta', Transcriptase subunit beta'
;
4 'RNAP omega subunit, RNA polymerase omega subunit, Transcriptase subunit omega' 
5 'RNA polymerase sigma factor'                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEA
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEA
;
A,B ? 
2 'polypeptide(L)'        no no  
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no  
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no  
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no  
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no  
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCGAGGG G   ? 
7 polydeoxyribonucleotide no no  
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H   ? 
8 'polypeptide(L)'        no yes '(2RA)(DSN)(DVA)(R2T)(2TL)(0QZ)(FGL)' XSVXTXG I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    2RA n 
8 2    DSN n 
8 3    DVA n 
8 4    R2T n 
8 5    2TL n 
8 6    0QZ n 
8 7    FGL n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              8 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Actinomadura sp.' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       1989 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8   Q5SHR6 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8   Q8RQE9 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8   Q8RQE8 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8   Q8RQE7 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 UNP Q5SKW1_THET8 Q5SKW1 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
6 PDB 4OIR         4OIR   6 CCTGCATCCGTGAGTCGAGGG 1 ? 
7 PDB 4OIR         4OIR   7 TATAATGGGAGCTGTCACGGATGCAGG 1 ? 
8 PDB 4OIR         4OIR   8 '(2RA)(DSN)(DVA)(R2T)(2TL)(0QZ)(FGL)' 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OIR A 1  ? 305  ? Q5SHR6 1 ? 305  ? 1 305  
2 1 4OIR B 1  ? 305  ? Q5SHR6 1 ? 305  ? 1 305  
3 2 4OIR C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4 3 4OIR D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5 4 4OIR E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6 5 4OIR F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7 6 4OIR G 1  ? 21   ? 4OIR   1 ? 21   ? 1 21   
8 7 4OIR H 1  ? 27   ? 4OIR   1 ? 27   ? 1 27   
9 8 4OIR I 1  ? 7    ? 4OIR   1 ? 7    ? 1 7    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 4OIR MET F 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 1  
6 4OIR GLY F 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 2  
6 4OIR SER F 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 3  
6 4OIR SER F 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 4  
6 4OIR HIS F 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 5  
6 4OIR HIS F 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 6  
6 4OIR HIS F 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 7  
6 4OIR HIS F 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 8  
6 4OIR HIS F 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 9  
6 4OIR HIS F 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 10 
6 4OIR SER F 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  11 
6 4OIR SER F 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  12 
6 4OIR GLY F 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  13 
6 4OIR LEU F 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  14 
6 4OIR VAL F 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  15 
6 4OIR PRO F 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  16 
6 4OIR ARG F 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  17 
6 4OIR GLY F 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  18 
6 4OIR SER F 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  19 
6 4OIR HIS F 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0QZ 'D-peptide linking' . D-Isoserine                          '(2R)-3-amino-2-hydroxypropanoic acid' 'C3 H7 N O3'      105.093 
2RA 'D-peptide linking' n 3-amino-D-alanine                    'diaminopropanoic acid'                'C3 H8 N2 O2'     104.108 
2TL 'D-peptide linking' . D-allothreonine                      ?                                      'C4 H9 N O3'      119.119 
ALA 'L-peptide linking' y ALANINE                              ?                                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                                      'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                                      'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                                      'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                                      'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                                      'C10 H14 N5 O7 P' 347.221 
DSN 'D-peptide linking' . D-SERINE                             ?                                      'C3 H7 N O3'      105.093 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                                      'C10 H15 N2 O8 P' 322.208 
DVA 'D-peptide linking' . D-VALINE                             ?                                      'C5 H11 N O2'     117.146 
FGL 'L-peptide linking' n '2-AMINOPROPANEDIOIC ACID'           ?                                      'C3 H5 N O4'      119.076 
GLN 'L-peptide linking' y GLUTAMINE                            ?                                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                                      'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                                      'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                                      'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                                      'C6 H15 N2 O2 1'  147.195 
MB8 non-polymer         . '(2Z)-2-methylbut-2-enoic acid'      ?                                      'C5 H8 O2'        100.116 
MET 'L-peptide linking' y METHIONINE                           ?                                      'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                                      'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                                      'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                                      'C5 H9 N O2'      115.130 
R2T 'L-peptide linking' . beta,gamma-dihydroxyglutamine        ?                                      'C5 H10 N2 O5'    178.143 
RFV non-polymer         . 'rifamycin SV'                       ?                                      'C37 H49 N O12'   699.784 
SER 'L-peptide linking' y SERINE                               ?                                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                                      'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                                      'Zn 2'            65.409  
# 
_exptl.entry_id          4OIR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.19 
_exptl_crystal.density_percent_sol   61.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl, pH 8.4, 200 mM potassium chloride, 50 mM magnesium chloride, 9.5% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-03-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     4OIR 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.10 
_reflns.number_obs                   98567 
_reflns.number_all                   101511 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            0.140 
_reflns.pdbx_Rsym_value              0.140 
_reflns.pdbx_netI_over_sigmaI        7.6 
_reflns.B_iso_Wilson_estimate        63.48 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.10 
_reflns_shell.d_res_low              3.15 
_reflns_shell.percent_possible_all   77.9 
_reflns_shell.Rmerge_I_obs           0.727 
_reflns_shell.pdbx_Rsym_value        0.727 
_reflns_shell.meanI_over_sigI_obs    1.3 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3894 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4OIR 
_refine.ls_number_reflns_obs                     83131 
_refine.ls_number_reflns_all                     100594 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.496 
_refine.ls_d_res_high                            3.105 
_refine.ls_percent_reflns_obs                    82.64 
_refine.ls_R_factor_obs                          0.2087 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2063 
_refine.ls_R_factor_R_free                       0.2533 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  4159 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               59.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4G7H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.pdbx_overall_phase_error                 27.31 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27718 
_refine_hist.pdbx_number_atoms_nucleic_acid   823 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             123 
_refine_hist.number_atoms_total               28722 
_refine_hist.d_res_high                       3.105 
_refine_hist.d_res_low                        47.496 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.004  ? ? 29216 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.813  ? ? 39677 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 14.288 ? ? 11314 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.066  ? ? 4468  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 5056  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.105  3.1405  215  0.3245 7.00  0.3000 . . 16  . . . . 'X-RAY DIFFRACTION' 
. 3.1405 3.1774  519  0.2963 16.0  0.3056 . . 26  . . . . 'X-RAY DIFFRACTION' 
. 3.1774 3.2162  808  0.3267 25.0  0.3769 . . 33  . . . . 'X-RAY DIFFRACTION' 
. 3.2162 3.2569  1176 0.3084 37.0  0.3013 . . 59  . . . . 'X-RAY DIFFRACTION' 
. 3.2569 3.2997  1540 0.2994 48.0  0.3201 . . 81  . . . . 'X-RAY DIFFRACTION' 
. 3.2997 3.3449  1725 0.3000 56.0  0.3551 . . 93  . . . . 'X-RAY DIFFRACTION' 
. 3.3449 3.3927  2016 0.3078 63.0  0.3249 . . 123 . . . . 'X-RAY DIFFRACTION' 
. 3.3927 3.4433  2275 0.2998 71.0  0.3151 . . 114 . . . . 'X-RAY DIFFRACTION' 
. 3.4433 3.4971  2448 0.2930 78.0  0.3370 . . 134 . . . . 'X-RAY DIFFRACTION' 
. 3.4971 3.5544  2706 0.2790 86.0  0.3410 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 3.5544 3.6157  2897 0.2682 91.0  0.3391 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.6157 3.6814  3101 0.2569 99.0  0.3252 . . 174 . . . . 'X-RAY DIFFRACTION' 
. 3.6814 3.7522  3209 0.2451 100.0 0.3481 . . 160 . . . . 'X-RAY DIFFRACTION' 
. 3.7522 3.8288  3140 0.2343 100.0 0.2938 . . 171 . . . . 'X-RAY DIFFRACTION' 
. 3.8288 3.9120  3199 0.2260 100.0 0.3036 . . 164 . . . . 'X-RAY DIFFRACTION' 
. 3.9120 4.0029  3144 0.2162 100.0 0.2736 . . 173 . . . . 'X-RAY DIFFRACTION' 
. 4.0029 4.1030  3184 0.2038 100.0 0.2624 . . 163 . . . . 'X-RAY DIFFRACTION' 
. 4.1030 4.2138  3211 0.1977 100.0 0.2760 . . 168 . . . . 'X-RAY DIFFRACTION' 
. 4.2138 4.3378  3139 0.1913 100.0 0.2276 . . 166 . . . . 'X-RAY DIFFRACTION' 
. 4.3378 4.4777  3196 0.1764 100.0 0.2345 . . 168 . . . . 'X-RAY DIFFRACTION' 
. 4.4777 4.6376  3194 0.1775 100.0 0.2298 . . 159 . . . . 'X-RAY DIFFRACTION' 
. 4.6376 4.8231  3198 0.1739 100.0 0.2193 . . 173 . . . . 'X-RAY DIFFRACTION' 
. 4.8231 5.0424  3176 0.1773 100.0 0.2100 . . 172 . . . . 'X-RAY DIFFRACTION' 
. 5.0424 5.3079  3195 0.1829 100.0 0.2611 . . 166 . . . . 'X-RAY DIFFRACTION' 
. 5.3079 5.6399  3163 0.1870 100.0 0.2458 . . 166 . . . . 'X-RAY DIFFRACTION' 
. 5.6399 6.0746  3218 0.1966 100.0 0.2437 . . 162 . . . . 'X-RAY DIFFRACTION' 
. 6.0746 6.6844  3218 0.1932 100.0 0.2496 . . 165 . . . . 'X-RAY DIFFRACTION' 
. 6.6844 7.6482  3217 0.1809 100.0 0.2406 . . 173 . . . . 'X-RAY DIFFRACTION' 
. 7.6482 9.6227  3268 0.1561 100.0 0.1770 . . 169 . . . . 'X-RAY DIFFRACTION' 
. 9.6227 47.5013 3277 0.1793 99.0  0.1756 . . 177 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OIR 
_struct.title                     
'Crystal structure of Thermus thermophilus RNA polymerase transcription initiation complex soaked with GE23077 and rifamycin SV' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase subunit alpha (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta' (E.C.2.7.7.6), DNA-directed RNA polymerase subunit omega (E.C.2.7.7.6), DNA directed RNA polymerase sigma factor A
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OIR 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/ANTIBIOTIC' 
_struct_keywords.text            
;GE23077, transcription inhibitor, transcription open complex, transcription initiation complex, rifamycin SV, i site, i+1 site, RNA polymerase, DNA/RNA/NTP binding, polymerization of ribonucleotides, nucleoid, TRANSCRIPTION, TRANSFERASE-ANTIBIOTIC complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 11 ? 
M N N 11 ? 
N N N 9  ? 
O N N 9  ? 
P N N 9  ? 
Q N N 12 ? 
R N N 13 ? 
S N N 13 ? 
T N N 13 ? 
U N N 13 ? 
V N N 13 ? 
W N N 13 ? 
X N N 13 ? 
Y N N 13 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   2   ASP A 74   ? GLU A 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   3   ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   6   TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   7   GLY B 31   ? ILE B 48   ? GLY B 31   ILE B 48   1 ? 18 
HELX_P HELX_P8   8   ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   9   ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  10  PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  11  THR B 206  ? LEU B 222  ? THR B 206  LEU B 222  1 ? 17 
HELX_P HELX_P12  12  THR B 223  ? SER B 226  ? THR B 223  SER B 226  5 ? 4  
HELX_P HELX_P13  13  THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P14  14  PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P15  15  VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P16  16  PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P17  17  LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P18  18  ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P19  19  LEU C 217  ? LEU C 221  ? LEU C 217  LEU C 221  5 ? 5  
HELX_P HELX_P20  20  ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P21  21  ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P22  22  LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P23  23  GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P24  24  VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P25  25  THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P26  26  THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P27  27  SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P28  28  ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P29  29  GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P30  30  HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P31  31  THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P32  32  SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P33  33  ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  34  PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  35  ASP C 554  ? GLN C 567  ? ASP C 554  GLN C 567  1 ? 14 
HELX_P HELX_P36  36  LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P37  37  ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P38  38  GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P39  39  SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P40  40  THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P41  41  PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P42  42  LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P43  43  LEU C 882  ? LEU C 897  ? LEU C 882  LEU C 897  1 ? 16 
HELX_P HELX_P44  44  LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P45  45  ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P46  46  THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P47  47  MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P48  48  GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P49  49  ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P50  50  ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P51  51  PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P52  52  SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P53  53  ILE D 84   ? ARG D 89   ? ILE D 84   ARG D 89   1 ? 6  
HELX_P HELX_P54  54  HIS D 101  ? ASP D 107  ? HIS D 101  ASP D 107  1 ? 7  
HELX_P HELX_P55  55  SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P56  56  SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P57  57  THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P58  58  ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P59  59  ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P60  60  GLY D 457  ? LEU D 468  ? GLY D 457  LEU D 468  1 ? 12 
HELX_P HELX_P61  61  ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P62  62  SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P63  63  ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P64  64  PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P65  65  SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P66  66  ILE D 566  ? ASP D 583  ? ILE D 566  ASP D 583  1 ? 18 
HELX_P HELX_P67  67  SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P68  68  GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P69  69  LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P70  70  PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P71  71  ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P72  72  LYS D 684  ? HIS D 696  ? LYS D 684  HIS D 696  1 ? 13 
HELX_P HELX_P73  73  HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P74  74  HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P75  75  VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P76  76  SER D 752  ? MET D 763  ? SER D 752  MET D 763  1 ? 12 
HELX_P HELX_P77  77  LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P78  78  ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P79  79  THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P80  80  VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P81  81  ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P82  82  SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P83  83  ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P84  84  GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P85  85  GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P86  86  GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P87  87  THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P88  88  ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P89  89  ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P90  90  THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P91  91  LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P92  92  SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P93  93  GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P94  94  ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P95  95  PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P96  96  GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P97  97  ASP D 1331 ? LYS D 1339 ? ASP D 1331 LYS D 1339 1 ? 9  
HELX_P HELX_P98  98  GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P99  99  HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P100 100 LYS D 1397 ? GLU D 1410 ? LYS D 1397 GLU D 1410 1 ? 14 
HELX_P HELX_P101 101 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P102 102 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P103 103 ASN D 1442 ? ALA D 1453 ? ASN D 1442 ALA D 1453 1 ? 12 
HELX_P HELX_P104 104 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P105 105 ALA D 1474 ? GLY D 1477 ? ALA D 1474 GLY D 1477 5 ? 4  
HELX_P HELX_P106 106 SER D 1478 ? PHE D 1483 ? SER D 1478 PHE D 1483 1 ? 6  
HELX_P HELX_P107 107 GLN D 1489 ? ALA D 1502 ? GLN D 1489 ALA D 1502 1 ? 14 
HELX_P HELX_P108 108 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P109 109 SER E 15   ? GLY E 34   ? SER E 15   GLY E 34   1 ? 20 
HELX_P HELX_P110 110 GLU E 41   ? ARG E 45   ? GLU E 41   ARG E 45   5 ? 5  
HELX_P HELX_P111 111 ASN E 59   ? THR E 70   ? ASN E 59   THR E 70   1 ? 12 
HELX_P HELX_P112 112 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P113 113 ASP F 99   ? VAL F 111  ? ASP F 79   VAL F 91   1 ? 13 
HELX_P HELX_P114 114 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P115 115 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P116 116 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P117 117 PRO F 187  ? LYS F 220  ? PRO F 167  LYS F 200  1 ? 34 
HELX_P HELX_P118 118 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P119 119 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P120 120 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P121 121 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P122 122 THR F 307  ? MET F 315  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P123 123 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P124 124 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P125 125 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P126 126 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P127 127 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P128 128 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P129 129 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? I 2RA 1    C   ? ? ? 1_555 I DSN 2  N  ? ? I 2RA 1    I DSN 2    1_555 ? ? ? ? ? ? ?            1.476 ? 
covale2  covale ? ? I DSN 2    C   ? ? ? 1_555 I DVA 3  N  ? ? I DSN 2    I DVA 3    1_555 ? ? ? ? ? ? ?            1.476 ? 
covale3  covale ? ? I DVA 3    C   ? ? ? 1_555 I R2T 4  N  ? ? I DVA 3    I R2T 4    1_555 ? ? ? ? ? ? ?            1.454 ? 
covale4  covale ? ? I R2T 4    C   ? ? ? 1_555 I 2TL 5  N  ? ? I R2T 4    I 2TL 5    1_555 ? ? ? ? ? ? ?            1.467 ? 
covale5  covale ? ? I 2TL 5    C   ? ? ? 1_555 I 0QZ 6  N  ? ? I 2TL 5    I 0QZ 6    1_555 ? ? ? ? ? ? ?            1.462 ? 
covale6  covale ? ? I 0QZ 6    C   ? ? ? 1_555 I FGL 7  N  ? ? I 0QZ 6    I FGL 7    1_555 ? ? ? ? ? ? ?            1.441 ? 
metalc1  metalc ? ? D ASP 741  OD1 ? ? ? 1_555 N MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc2  metalc ? ? D ASP 743  OD1 ? ? ? 1_555 N MG  .  MG ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.048 ? 
metalc3  metalc ? ? N MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2003 D HOH 2104 1_555 ? ? ? ? ? ? ?            2.048 ? 
metalc4  metalc ? ? N MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2003 D HOH 2106 1_555 ? ? ? ? ? ? ?            2.065 ? 
metalc5  metalc ? ? N MG  .    MG  ? ? ? 1_555 U HOH .  O  ? ? D MG  2003 D HOH 2105 1_555 ? ? ? ? ? ? ?            2.074 ? 
metalc6  metalc ? ? D ASP 739  OD1 ? ? ? 1_555 N MG  .  MG ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            2.105 ? 
metalc7  metalc ? ? F GLY 316  O   ? ? ? 1_555 P MG  .  MG ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?            2.223 ? 
metalc8  metalc ? ? D CYS 76   SG  ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.233 ? 
metalc9  metalc ? ? D CYS 60   SG  ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.248 ? 
metalc10 metalc ? ? D CYS 1112 SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.251 ? 
metalc11 metalc ? ? D CYS 1194 SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.259 ? 
metalc12 metalc ? ? D CYS 1201 SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.267 ? 
metalc13 metalc ? ? D CYS 1204 SG  ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc14 metalc ? ? D CYS 58   SG  ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.359 ? 
metalc15 metalc ? ? D LYS 840  O   ? ? ? 1_555 J MG  .  MG ? ? D LYS 840  B MG  401  1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc16 metalc ? ? D CYS 73   SG  ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc17 metalc ? ? F TRP 319  O   ? ? ? 1_555 P MG  .  MG ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.740 ? 
metalc18 metalc ? ? D ILE 900  O   ? ? ? 1_555 O MG  .  MG ? ? D ILE 900  D MG  2004 1_555 ? ? ? ? ? ? ?            2.949 ? 
covale7  covale ? ? I 2RA 1    NG  ? ? ? 1_555 Q MB8 .  C  ? ? I 2RA 1    I MB8 101  1_555 ? ? ? ? ? ? ?            1.452 ? 
covale8  covale ? ? I 2RA 1    N   ? ? ? 1_555 I FGL 7  C  ? ? I 2RA 1    I FGL 7    1_555 ? ? ? ? ? ? ?            1.456 ? 
hydrog1  hydrog ? ? G DG  4    N1  ? ? ? 1_555 H DC  24 N3 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DG  4    N2  ? ? ? 1_555 H DC  24 O2 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DG  4    O6  ? ? ? 1_555 H DC  24 N4 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DC  5    N3  ? ? ? 1_555 H DG  23 N1 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DC  5    N4  ? ? ? 1_555 H DG  23 O6 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DC  5    O2  ? ? ? 1_555 H DG  23 N2 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DA  6    N1  ? ? ? 1_555 H DT  22 N3 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DA  6    N6  ? ? ? 1_555 H DT  22 O4 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DT  7    N3  ? ? ? 1_555 H DA  21 N1 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DT  7    O4  ? ? ? 1_555 H DA  21 N6 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DC  8    N4  ? ? ? 1_555 H DG  20 O6 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog12 hydrog ? ? G DC  9    N3  ? ? ? 1_555 H DG  19 N1 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DC  9    N4  ? ? ? 1_555 H DG  19 O6 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DC  9    O2  ? ? ? 1_555 H DG  19 N2 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DG  10   N1  ? ? ? 1_555 H DC  18 O2 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog16 hydrog ? ? G DT  11   N3  ? ? ? 1_555 H DA  17 N1 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog17 hydrog ? ? G DG  12   N1  ? ? ? 1_555 H DC  16 N3 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog18 hydrog ? ? G DA  13   N1  ? ? ? 1_555 H DT  15 N3 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -12.78 
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -9.51  
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 0.31   
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -4.82  
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -4.10  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 8 ? 
Y  ? 4 ? 
Z  ? 3 ? 
AA ? 2 ? 
AB ? 8 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 2 ? 
AF ? 3 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 4 ? 
AJ ? 3 ? 
AK ? 3 ? 
AL ? 4 ? 
AM ? 3 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 3 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 4 ? 
AX ? 3 ? 
AY ? 2 ? 
AZ ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
X  5 6 ? anti-parallel 
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? parallel      
AB 6 7 ? anti-parallel 
AB 7 8 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? parallel      
AQ 1 2 ? parallel      
AQ 2 3 ? anti-parallel 
AR 1 2 ? parallel      
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
A  2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
A  3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
A  4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
B  1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
B  2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
B  3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
B  4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
C  1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
C  2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
D  1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
D  2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
E  1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
E  2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
F  1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
F  2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
F  3 ASP B 193  ? THR B 201  ? ASP B 193  THR B 201  
F  4 VAL B 174  ? ASP B 183  ? VAL B 174  ASP B 183  
G  1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
G  2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
G  3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
G  4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
H  1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
H  2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
I  1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
I  2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
J  1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
J  2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
K  1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
K  2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
K  3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
L  1 LEU C 64   ? LEU C 73   ? LEU C 64   LEU C 73   
L  2 GLN C 91   ? HIS C 102  ? GLN C 91   HIS C 102  
L  3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
M  1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
M  2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
M  3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
N  1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
N  2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
N  3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
N  4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
O  1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
O  2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
O  3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
O  4 VAL C 182  ? LYS C 185  ? VAL C 182  LYS C 185  
O  5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
P  1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
P  2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
Q  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
Q  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
Q  3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
R  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
R  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
R  3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
R  4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
R  5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
R  6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
S  1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
S  2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
T  1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
T  2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
T  3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
U  1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
U  2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
U  3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
U  4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
V  1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
V  2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
W  1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
W  2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
X  1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
X  2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
X  3 LYS C 838  ? ALA C 840  ? LYS C 838  ALA C 840  
X  4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
X  5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
X  6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
X  7 GLY C 669  ? ILE C 676  ? GLY C 669  ILE C 676  
X  8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
Y  1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
Y  2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
Y  3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
Y  4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
Z  1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
Z  2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
Z  3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AA 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AA 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AB 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AB 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AB 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AB 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AB 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AB 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AB 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AB 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AC 1 ARG C 1031 ? PHE C 1032 ? ARG C 1031 PHE C 1032 
AC 2 LYS D 621  ? ARG D 622  ? LYS D 621  ARG D 622  
AD 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AE 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AE 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AF 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AF 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AF 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AG 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AG 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AH 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AH 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AH 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AH 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AH 5 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AI 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AI 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AI 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AI 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AJ 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AJ 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AJ 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AK 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AK 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AK 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AL 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AL 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AL 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AL 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AM 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AM 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AM 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AN 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AN 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AN 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AN 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AO 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AO 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AP 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AP 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AP 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AQ 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AQ 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AQ 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AR 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AR 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AR 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AS 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AS 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AT 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AT 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AU 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AU 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AV 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AV 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AW 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AW 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AW 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AW 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AX 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AX 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AX 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AY 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AY 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AZ 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AZ 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
A  2 3 N GLY A 21   ? N GLY A 21   O ILE A 199  ? O ILE A 199  
A  3 4 O TRP A 200  ? O TRP A 200  N ARG A 176  ? N ARG A 176  
B  1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
B  2 3 O ARG A 143  ? O ARG A 143  N THR A 54   ? N THR A 54   
B  3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
C  1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
D  1 2 N LYS A 107  ? N LYS A 107  O LEU A 132  ? O LEU A 132  
E  1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
F  1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
F  2 3 N PHE B 23   ? N PHE B 23   O LEU B 197  ? O LEU B 197  
F  3 4 O TRP B 200  ? O TRP B 200  N ARG B 176  ? N ARG B 176  
G  1 2 N ALA B 103  ? N ALA B 103  O LEU B 138  ? O LEU B 138  
G  2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
G  3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
H  1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
I  1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
J  1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
K  1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
K  2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
L  1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
L  2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
M  1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
M  2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
N  1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
N  2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
N  3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
O  1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
O  2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
O  3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
O  4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
P  1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
Q  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
Q  2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
R  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
R  2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
R  3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
R  4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
R  5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
S  1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
T  1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
T  2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
U  1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
U  2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
U  3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
V  1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
W  1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
X  1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
X  2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
X  3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
X  4 5 O ALA C 850  ? O ALA C 850  N ILE C 688  ? N ILE C 688  
X  5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
X  6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
X  7 8 N VAL C 672  ? N VAL C 672  O MET C 992  ? O MET C 992  
Y  1 2 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
Y  2 3 O ARG C 824  ? O ARG C 824  N VAL C 804  ? N VAL C 804  
Y  3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
Z  1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
Z  2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AA 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AB 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AB 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AB 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AB 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AB 5 6 O VAL D 719  ? O VAL D 719  N LEU D 644  ? N LEU D 644  
AB 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AB 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AC 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD 2 3 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AE 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AF 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AF 2 3 N ILE D 133  ? N ILE D 133  O ARG D 455  ? O ARG D 455  
AG 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AH 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AH 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AH 3 4 N LEU D 223  ? N LEU D 223  O LEU D 333  ? O LEU D 333  
AH 4 5 O PHE D 336  ? O PHE D 336  N GLN D 321  ? N GLN D 321  
AI 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AI 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AI 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AJ 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AJ 2 3 O LEU D 304  ? O LEU D 304  N PHE D 251  ? N PHE D 251  
AK 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AK 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AL 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AL 2 3 O ARG D 273  ? O ARG D 273  N VAL D 258  ? N VAL D 258  
AL 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AM 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AM 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AN 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AN 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AN 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AO 1 2 N ALA D 422  ? N ALA D 422  O VAL D 427  ? O VAL D 427  
AP 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AP 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AQ 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AQ 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AR 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AR 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AS 1 2 N VAL D 1106 ? N VAL D 1106 O VAL D 1200 ? O VAL D 1200 
AT 1 2 N VAL D 1120 ? N VAL D 1120 O VAL D 1186 ? O VAL D 1186 
AU 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AV 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AW 1 2 O LYS D 1301 ? O LYS D 1301 N VAL D 1294 ? N VAL D 1294 
AW 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AW 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AX 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AX 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AY 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AZ 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 401'   
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE RFV C 1201' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2001'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 2002'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 2003'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG D 2004'  
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG F 2001'  
AC8 Software ? ? ? ? 18 'BINDING SITE FOR GE23077'            
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  GLU B 154  ? GLU B 154  . ? 1_555 ? 
2  AC1 3  ASP B 168  ? ASP B 168  . ? 1_555 ? 
3  AC1 3  LYS D 840  ? LYS D 840  . ? 1_555 ? 
4  AC2 12 GLN C 390  ? GLN C 390  . ? 1_555 ? 
5  AC2 12 SER C 392  ? SER C 392  . ? 1_555 ? 
6  AC2 12 GLN C 393  ? GLN C 393  . ? 1_555 ? 
7  AC2 12 PHE C 394  ? PHE C 394  . ? 1_555 ? 
8  AC2 12 ARG C 405  ? ARG C 405  . ? 1_555 ? 
9  AC2 12 HIS C 406  ? HIS C 406  . ? 1_555 ? 
10 AC2 12 ARG C 409  ? ARG C 409  . ? 1_555 ? 
11 AC2 12 SER C 411  ? SER C 411  . ? 1_555 ? 
12 AC2 12 ARG C 420  ? ARG C 420  . ? 1_555 ? 
13 AC2 12 ASN C 448  ? ASN C 448  . ? 1_555 ? 
14 AC2 12 ILE C 452  ? ILE C 452  . ? 1_555 ? 
15 AC2 12 ASP F 343  ? ASP F 323  . ? 1_555 ? 
16 AC3 4  CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
17 AC3 4  CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
18 AC3 4  CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
19 AC3 4  CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
20 AC4 4  CYS D 58   ? CYS D 58   . ? 1_555 ? 
21 AC4 4  CYS D 60   ? CYS D 60   . ? 1_555 ? 
22 AC4 4  CYS D 73   ? CYS D 73   . ? 1_555 ? 
23 AC4 4  CYS D 76   ? CYS D 76   . ? 1_555 ? 
24 AC5 6  ASP D 739  ? ASP D 739  . ? 1_555 ? 
25 AC5 6  ASP D 741  ? ASP D 741  . ? 1_555 ? 
26 AC5 6  ASP D 743  ? ASP D 743  . ? 1_555 ? 
27 AC5 6  HOH U .    ? HOH D 2104 . ? 1_555 ? 
28 AC5 6  HOH U .    ? HOH D 2105 . ? 1_555 ? 
29 AC5 6  HOH U .    ? HOH D 2106 . ? 1_555 ? 
30 AC6 2  TRP D 897  ? TRP D 897  . ? 1_555 ? 
31 AC6 2  ILE D 900  ? ILE D 900  . ? 1_555 ? 
32 AC7 3  ALA F 312  ? ALA F 292  . ? 1_555 ? 
33 AC7 3  GLY F 316  ? GLY F 296  . ? 1_555 ? 
34 AC7 3  TRP F 319  ? TRP F 299  . ? 1_555 ? 
35 AC8 18 THR A 54   ? THR A 54   . ? 1_555 ? 
36 AC8 18 ARG A 146  ? ARG A 146  . ? 1_555 ? 
37 AC8 18 ILE A 158  ? ILE A 158  . ? 1_555 ? 
38 AC8 18 PHE A 171  ? PHE A 171  . ? 1_555 ? 
39 AC8 18 ALA B 8    ? ALA B 8    . ? 1_555 ? 
40 AC8 18 PRO B 9    ? PRO B 9    . ? 1_555 ? 
41 AC8 18 GLU B 29   ? GLU B 29   . ? 1_555 ? 
42 AC8 18 ARG B 189  ? ARG B 189  . ? 1_555 ? 
43 AC8 18 GLU C 445  ? GLU C 445  . ? 1_555 ? 
44 AC8 18 GLY C 446  ? GLY C 446  . ? 1_555 ? 
45 AC8 18 ARG C 557  ? ARG C 557  . ? 1_555 ? 
46 AC8 18 MET C 560  ? MET C 560  . ? 1_555 ? 
47 AC8 18 ASN C 563  ? ASN C 563  . ? 1_555 ? 
48 AC8 18 GLN C 567  ? GLN C 567  . ? 1_555 ? 
49 AC8 18 LYS C 838  ? LYS C 838  . ? 1_555 ? 
50 AC8 18 LYS C 846  ? LYS C 846  . ? 1_555 ? 
51 AC8 18 HOH U .    ? HOH D 2107 . ? 1_555 ? 
52 AC8 18 DG  G 17   ? DG  G 17   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OIR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OIR 
_atom_sites.fract_transf_matrix[1][1]   0.005444 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000842 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009523 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003426 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? -15.858 18.424  144.469 1.00 71.87  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? -15.902 17.399  143.432 1.00 83.43  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? -14.866 17.672  142.343 1.00 84.05  ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? -15.013 17.226  141.205 1.00 80.98  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? -17.304 17.312  142.824 1.00 91.58  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? -17.425 16.189  141.967 1.00 78.61  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? -13.819 18.407  142.704 1.00 87.37  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? -12.745 18.744  141.774 1.00 84.74  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? -11.457 18.006  142.132 1.00 77.63  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? -10.928 18.170  143.232 1.00 87.28  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? -12.501 20.258  141.779 1.00 80.58  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? -11.201 20.694  141.116 1.00 75.26  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? -11.237 20.486  139.611 1.00 73.67  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? -9.898  20.831  138.971 1.00 68.20  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? -9.468  22.225  139.271 1.00 76.02  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? -10.955 17.194  141.204 1.00 63.01  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? -9.697  16.483  141.413 1.00 58.51  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? -8.559  17.488  141.533 1.00 57.55  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? -8.610  18.564  140.942 1.00 65.62  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? -9.414  15.531  140.251 1.00 62.84  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? -9.002  14.087  140.560 1.00 60.64  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? -8.023  14.013  141.723 1.00 57.46  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? -10.225 13.230  140.835 1.00 56.59  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? -7.536  17.138  142.305 1.00 56.85  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? -6.383  18.013  142.492 1.00 61.03  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? -5.070  17.275  142.243 1.00 52.71  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? -5.076  16.135  141.775 1.00 54.04  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? -6.413  18.676  143.871 1.00 64.76  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? -7.555  19.675  144.030 1.00 69.64  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? -7.508  20.391  145.368 1.00 82.99  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? -8.648  21.393  145.497 1.00 78.58  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? -8.624  22.098  146.810 1.00 81.95  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? -3.953  17.930  142.555 1.00 46.57  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? -2.628  17.442  142.174 1.00 52.63  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? -2.354  16.009  142.634 1.00 54.35  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? -2.332  15.727  143.831 1.00 61.80  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? -1.556  18.378  142.713 1.00 55.76  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? -2.142  15.103  141.665 1.00 52.41  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? -1.920  13.666  141.854 1.00 49.60  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? -0.501  13.323  142.290 1.00 48.76  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? 0.431   14.099  142.069 1.00 38.78  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? -2.174  13.082  140.457 1.00 47.94  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? -2.781  14.193  139.654 1.00 55.34  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? -2.230  15.443  140.239 1.00 55.81  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? -0.350  12.153  142.902 1.00 52.52  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 0.961   11.654  143.288 1.00 50.21  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 1.749   11.188  142.060 1.00 51.05  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 1.201   10.552  141.134 1.00 52.99  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 0.873   10.546  144.382 1.00 55.53  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? 0.160   9.309   143.865 1.00 59.75  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 2.257   10.189  144.908 1.00 57.87  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 3.033   11.546  142.070 1.00 52.12  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 3.961   11.321  140.969 1.00 53.29  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 5.054   10.342  141.392 1.00 51.57  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 5.925   10.677  142.193 1.00 56.20  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 4.572   12.667  140.563 1.00 57.11  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 5.658   12.572  139.525 1.00 64.99  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 6.922   13.079  139.785 1.00 71.87  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 5.416   11.999  138.287 1.00 63.48  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 7.926   13.007  138.832 1.00 68.90  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 6.416   11.925  137.331 1.00 61.98  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 7.672   12.430  137.605 1.00 59.04  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 5.008   9.134   140.842 1.00 43.78  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 5.950   8.081   141.203 1.00 46.59  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 7.023   7.928   140.128 1.00 46.73  ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 6.745   8.097   138.941 1.00 48.65  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 5.221   6.739   141.403 1.00 43.48  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 4.085   6.938   142.255 1.00 41.29  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 6.147   5.697   142.024 1.00 38.31  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 8.246   7.616   140.549 1.00 43.69  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 9.373   7.483   139.631 1.00 36.78  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 10.153  6.193   139.864 1.00 37.56  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 10.687  5.975   140.950 1.00 44.63  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 10.344  8.672   139.771 1.00 38.72  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 11.658  8.378   139.059 1.00 44.91  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 9.706   9.946   139.240 1.00 37.64  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 10.217  5.344   138.842 1.00 41.07  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 11.013  4.117   138.901 1.00 46.50  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 12.128  4.153   137.856 1.00 50.84  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 11.929  4.658   136.754 1.00 60.21  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 10.128  2.885   138.692 1.00 37.22  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 9.157   2.621   139.832 1.00 41.25  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 8.397   1.318   139.629 1.00 45.31  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 7.161   1.504   138.873 1.00 51.18  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 5.948   1.529   139.420 1.00 65.76  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 5.807   1.376   140.731 1.00 81.74  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 4.874   1.704   138.658 1.00 53.64  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 13.303  3.633   138.203 1.00 47.27  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 14.453  3.692   137.302 1.00 47.54  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 15.307  2.428   137.330 1.00 61.67  ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 15.497  1.816   138.382 1.00 67.93  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 15.385  4.879   137.639 1.00 52.30  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 15.814  4.778   139.003 1.00 59.79  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 14.685  6.218   137.425 1.00 50.30  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 15.817  2.043   136.162 1.00 70.59  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 16.874  1.039   136.068 1.00 69.29  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 18.010  1.602   135.226 1.00 61.37  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 17.864  1.777   134.018 1.00 63.15  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 16.359  -0.249  135.423 1.00 61.35  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 15.238  -0.935  136.185 1.00 82.12  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 14.884  -2.288  135.598 1.00 97.08  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 15.670  -2.882  134.856 1.00 93.38  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 13.695  -2.783  135.925 1.00 100.66 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 19.147  1.866   135.863 1.00 64.30  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 20.289  2.444   135.178 1.00 61.99  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 19.979  3.786   134.540 1.00 53.09  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 19.010  4.449   134.907 1.00 50.30  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 20.808  4.182   133.578 1.00 56.61  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 20.588  5.414   132.827 1.00 56.30  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 19.728  5.123   131.603 1.00 54.30  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 19.358  6.029   130.856 1.00 48.51  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 21.924  6.018   132.383 1.00 53.14  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 22.879  6.352   133.517 1.00 46.15  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 24.108  7.089   133.004 1.00 40.34  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 23.748  8.280   132.240 1.00 47.20  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 23.547  9.481   132.774 1.00 50.14  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 23.673  9.655   134.083 1.00 47.03  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 23.219  10.508  132.000 1.00 48.17  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 19.413  3.845   131.415 1.00 59.59  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 18.715  3.366   130.225 1.00 60.96  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 17.196  3.524   130.313 1.00 58.94  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 16.590  4.251   129.528 1.00 57.98  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 19.052  1.890   129.976 1.00 65.45  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 20.511  1.508   130.220 1.00 63.47  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 21.393  1.711   129.001 1.00 59.92  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 21.271  2.763   128.339 1.00 62.92  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 22.211  0.814   128.703 1.00 55.73  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 16.592  2.826   131.271 1.00 57.51  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 15.144  2.653   131.325 1.00 49.76  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 14.503  3.382   132.503 1.00 50.19  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 15.148  3.604   133.527 1.00 53.47  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 14.820  1.159   131.399 1.00 48.22  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 13.352  0.839   131.542 1.00 50.32  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 12.877  0.142   132.646 1.00 52.41  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 12.440  1.231   130.572 1.00 51.81  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 11.531  -0.157  132.776 1.00 57.86  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 11.094  0.942   130.695 1.00 52.06  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 10.644  0.246   131.795 1.00 56.40  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 9.304   -0.043  131.909 1.00 53.30  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 13.239  3.770   132.345 1.00 46.68  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 12.491  4.371   133.436 1.00 47.32  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 10.984  4.287   133.280 1.00 44.60  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 10.475  4.185   132.167 1.00 52.44  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 10.271  4.332   134.403 1.00 45.06  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 8.809   4.340   134.417 1.00 39.46  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 8.337   5.526   135.237 1.00 37.70  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 8.903   5.822   136.287 1.00 46.81  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 8.258   3.059   135.040 1.00 34.23  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 8.681   1.787   134.349 1.00 37.36  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 7.999   0.567   134.933 1.00 45.69  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 7.108   0.744   135.789 1.00 42.42  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 8.351   -0.566  134.540 1.00 50.39  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 7.306   6.213   134.762 1.00 30.74  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 6.852   7.422   135.434 1.00 36.03  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 5.340   7.418   135.590 1.00 43.34  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 4.609   7.494   134.609 1.00 48.37  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 7.338   8.652   134.664 1.00 32.72  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 8.814   8.629   134.381 1.00 40.72  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 9.705   9.249   135.235 1.00 50.85  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 9.314   7.954   133.279 1.00 45.57  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 11.067  9.211   134.985 1.00 52.83  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 10.672  7.908   133.028 1.00 45.70  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 11.549  8.540   133.881 1.00 47.23  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 4.871   7.353   136.831 1.00 43.55  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 3.447   7.178   137.080 1.00 39.43  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 2.799   8.440   137.635 1.00 42.78  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 3.359   9.114   138.493 1.00 47.75  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 3.183   5.994   138.034 1.00 40.86  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 1.689   5.718   138.150 1.00 39.71  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 3.916   4.753   137.549 1.00 39.51  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 1.616   8.758   137.126 1.00 41.62  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? 0.841   9.876   137.632 1.00 43.56  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? -0.550  9.364   137.991 1.00 45.79  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? -1.294  8.909   137.106 1.00 43.59  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? 0.742   10.961  136.563 1.00 37.31  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 0.774   12.414  137.030 1.00 45.16  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 2.143   12.757  137.576 1.00 40.47  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? 0.401   13.348  135.892 1.00 51.64  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? -0.891  9.387   139.282 1.00 49.29  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? -2.241  8.968   139.688 1.00 48.80  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? -2.776  9.665   140.937 1.00 45.23  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? -2.001  10.090  141.783 1.00 44.97  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? -2.311  7.449   139.871 1.00 46.75  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? -1.620  6.926   141.111 1.00 43.28  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? -1.968  5.476   141.386 1.00 53.19  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? -3.130  5.086   141.134 1.00 43.19  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? -1.078  4.727   141.848 1.00 56.76  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? -4.110  9.780   141.062 1.00 44.69  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? -5.155  9.558   140.057 1.00 46.02  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? -5.359  10.778  139.153 1.00 53.11  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? -5.114  11.909  139.584 1.00 51.18  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? -6.399  9.329   140.913 1.00 49.45  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? -6.173  10.191  142.096 1.00 45.74  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? -4.688  10.149  142.366 1.00 51.13  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? -5.823  10.547  137.928 1.00 53.86  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? -6.145  11.629  136.998 1.00 49.24  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? -7.601  11.539  136.554 1.00 47.69  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? -8.225  10.484  136.671 1.00 50.86  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? -5.221  11.581  135.780 1.00 38.86  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? -3.781  12.033  136.022 1.00 42.69  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? -2.867  11.554  134.910 1.00 40.57  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? -3.726  13.546  136.143 1.00 49.92  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? -8.145  12.645  136.052 1.00 43.55  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? -9.518  12.651  135.556 1.00 47.59  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? -9.637  11.740  134.344 1.00 49.17  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? -8.648  11.482  133.660 1.00 55.07  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? -9.966  14.069  135.194 1.00 57.09  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? -10.442 14.905  136.376 1.00 69.20  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? -11.806 14.475  136.891 1.00 80.13  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? -12.479 13.670  136.210 1.00 77.17  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? -12.206 14.946  137.978 1.00 85.67  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? -10.846 11.251  134.084 1.00 45.21  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? -11.071 10.305  132.994 1.00 45.89  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? -10.661 10.867  131.635 1.00 52.32  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? -11.054 11.975  131.265 1.00 57.03  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? -12.536 9.870   132.952 1.00 51.69  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? -12.862 8.920   131.812 1.00 59.37  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? -14.348 8.619   131.750 1.00 61.26  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? -15.148 9.836   131.664 1.00 59.06  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? -15.425 10.468  130.529 1.00 57.80  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? -14.963 9.998   129.377 1.00 57.55  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? -16.163 11.571  130.545 1.00 55.56  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? -9.863  10.097  130.901 1.00 44.44  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? -9.431  10.496  129.575 1.00 41.57  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? -8.124  11.266  129.573 1.00 44.60  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? -7.461  11.367  128.541 1.00 50.26  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? -7.748  11.813  130.724 1.00 41.67  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? -6.522  12.597  130.826 1.00 39.10  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? -5.268  11.728  130.810 1.00 40.52  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? -4.152  12.237  130.678 1.00 36.60  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? -6.545  13.474  132.075 1.00 42.40  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? -7.179  14.814  131.858 1.00 42.26  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? -8.492  14.913  131.430 1.00 45.87  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? -6.463  15.977  132.091 1.00 39.92  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? -9.079  16.150  131.231 1.00 54.65  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? -7.042  17.217  131.897 1.00 41.76  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? -8.352  17.304  131.465 1.00 49.62  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? -5.456  10.419  130.950 1.00 38.23  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? -4.358  9.483   130.813 1.00 39.18  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? -3.783  9.590   129.416 1.00 39.44  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? -2.565  9.617   129.229 1.00 39.88  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? -4.676  9.668   128.434 1.00 42.04  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? -4.289  9.850   127.039 1.00 41.25  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? -3.878  11.294  126.748 1.00 36.95  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? -2.851  11.536  126.109 1.00 40.06  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? -5.425  9.426   126.086 1.00 33.32  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? -5.183  9.961   124.684 1.00 35.82  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? -5.559  7.911   126.074 1.00 34.71  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? -4.679  12.242  127.227 1.00 33.96  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? -4.423  13.665  127.018 1.00 37.08  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? -3.017  14.070  127.462 1.00 38.95  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? -2.345  14.850  126.790 1.00 37.70  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? -5.457  14.541  127.761 1.00 43.05  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? -6.784  14.139  127.399 1.00 40.46  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? -5.262  16.011  127.415 1.00 38.35  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? -2.583  13.557  128.608 1.00 40.95  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? -1.216  13.785  129.065 1.00 38.14  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? -0.210  12.833  128.426 1.00 37.92  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 0.890   13.239  128.056 1.00 34.33  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? -1.129  13.693  130.588 1.00 41.76  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? -1.305  15.014  131.335 1.00 51.25  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? -1.068  14.820  132.827 1.00 51.69  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? -0.373  16.077  130.763 1.00 48.03  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? -0.597  11.565  128.305 1.00 42.61  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? 0.315   10.512  127.888 1.00 38.60  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 0.816   10.582  126.458 1.00 38.17  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 2.019   10.503  126.210 1.00 37.99  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? -0.105  10.725  125.511 1.00 39.78  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? 0.256   10.697  124.091 1.00 39.33  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 1.127   11.849  123.556 1.00 32.45  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 2.108   11.591  122.860 1.00 32.80  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? -0.983  10.494  123.212 1.00 37.37  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? -0.626  10.146  121.789 1.00 34.08  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? -0.209  9.024   121.500 1.00 33.95  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? -0.790  11.106  120.885 1.00 34.19  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 0.771   13.113  123.859 1.00 27.37  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 1.598   14.224  123.380 1.00 26.12  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 3.046   14.080  123.801 1.00 31.34  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 3.942   14.333  122.999 1.00 38.43  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 0.995   15.434  124.088 1.00 26.98  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? -0.392  15.066  124.311 1.00 32.77  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? -0.412  13.604  124.584 1.00 34.81  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 3.270   13.679  125.046 1.00 32.05  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 4.627   13.503  125.540 1.00 36.16  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 5.357   12.453  124.710 1.00 38.28  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 6.515   12.644  124.344 1.00 39.62  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 4.630   13.131  127.026 1.00 37.18  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 4.127   14.208  127.992 1.00 31.87  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 4.093   13.684  129.417 1.00 29.87  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 4.983   15.462  127.897 1.00 29.50  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 4.667   11.360  124.395 1.00 36.21  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 5.252   10.306  123.572 1.00 36.08  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 5.730   10.853  122.236 1.00 35.86  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 6.834   10.548  121.789 1.00 40.27  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 4.253   9.176   123.325 1.00 33.57  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 4.762   8.152   122.326 1.00 30.88  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 3.783   7.021   122.112 1.00 34.07  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 4.426   5.892   121.448 1.00 35.16  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 4.425   5.693   120.135 1.00 34.09  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 3.805   6.546   119.330 1.00 34.58  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 5.043   4.635   119.628 1.00 30.18  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 4.892   11.666  121.605 1.00 34.14  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 5.227   12.240  120.310 1.00 36.62  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 6.462   13.128  120.420 1.00 41.60  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 7.355   13.071  119.572 1.00 46.91  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 4.039   13.021  119.736 1.00 36.28  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 2.792   12.170  119.512 1.00 33.38  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 1.676   12.961  118.845 1.00 31.08  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 2.110   13.563  117.589 1.00 35.47  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 2.223   12.900  116.443 1.00 35.63  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 1.940   11.606  116.388 1.00 34.12  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 2.627   13.528  115.349 1.00 38.15  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 6.518   13.932  121.478 1.00 38.52  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 7.637   14.846  121.682 1.00 37.74  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 8.898   14.079  122.073 1.00 38.75  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 10.004  14.428  121.654 1.00 42.55  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 7.306   15.916  122.741 1.00 31.72  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 6.049   16.683  122.338 1.00 30.94  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 8.459   16.883  122.909 1.00 35.04  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 5.577   17.660  123.384 1.00 40.25  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 8.724   13.024  122.864 1.00 35.39  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 9.841   12.176  123.268 1.00 36.04  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 10.490  11.488  122.070 1.00 35.74  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 11.714  11.445  121.956 1.00 38.40  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 9.384   11.126  124.284 1.00 36.04  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 9.082   11.590  125.710 1.00 33.14  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 8.442   10.463  126.495 1.00 32.88  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 10.340  12.081  126.405 1.00 36.40  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 9.663   10.959  121.175 1.00 33.14  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 10.156  10.210  120.025 1.00 33.93  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 10.840  11.085  118.972 1.00 44.39  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 11.671  10.601  118.201 1.00 45.69  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 9.019   9.407   119.390 1.00 26.79  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 8.540   8.219   120.227 1.00 29.01  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 7.254   7.642   119.674 1.00 26.65  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 9.615   7.148   120.293 1.00 33.96  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 10.506  12.372  118.951 1.00 46.67  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 11.004  13.263  117.907 1.00 41.63  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 11.999  14.317  118.393 1.00 41.41  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 13.185  14.254  118.074 1.00 42.12  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 9.836   13.960  117.208 1.00 38.12  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 9.201   14.876  118.082 1.00 40.23  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 11.512  15.269  119.182 1.00 39.86  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 12.219  16.534  119.396 1.00 45.13  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 13.251  16.558  120.527 1.00 43.34  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 13.811  17.613  120.832 1.00 32.87  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 11.215  17.676  119.576 1.00 38.81  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 10.490  17.895  118.379 1.00 42.81  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 13.496  15.410  121.150 1.00 45.97  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 14.495  15.327  122.212 1.00 42.32  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 15.911  15.341  121.650 1.00 41.44  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 16.301  14.426  120.926 1.00 46.24  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 14.322  14.058  123.059 1.00 39.87  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 12.915  14.006  123.652 1.00 38.81  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 15.373  14.007  124.153 1.00 37.00  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 12.502  15.279  124.350 1.00 42.10  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 16.687  16.383  121.989 1.00 43.43  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 18.067  16.536  121.516 1.00 44.96  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 18.958  15.389  121.975 1.00 40.33  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 18.656  14.734  122.971 1.00 37.07  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 18.519  17.845  122.173 1.00 40.45  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 17.258  18.582  122.454 1.00 43.64  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 16.262  17.525  122.815 1.00 45.94  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 20.047  15.159  121.250 1.00 42.90  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 20.948  14.062  121.549 1.00 51.60  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 22.229  14.130  120.739 1.00 57.41  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 22.564  15.172  120.170 1.00 55.31  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 22.953  13.017  120.691 1.00 53.87  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 24.217  12.968  119.967 1.00 55.39  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 24.233  11.884  118.898 1.00 52.08  ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 23.588  10.843  119.040 1.00 53.58  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 25.393  12.714  120.916 1.00 52.63  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 25.197  11.462  121.585 1.00 44.46  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 25.504  13.836  121.941 1.00 52.10  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 24.978  12.145  117.828 1.00 47.73  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 25.185  11.171  116.763 1.00 50.27  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 26.463  11.489  115.990 1.00 51.58  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 26.946  12.622  116.013 1.00 49.81  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 23.991  11.146  115.827 1.00 55.90  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 27.001  10.489  115.300 1.00 48.79  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 28.218  10.674  114.522 1.00 46.99  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 27.865  11.324  113.191 1.00 45.34  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 27.146  10.737  112.385 1.00 52.42  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 28.882  9.315   114.244 1.00 36.68  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 30.302  9.504   113.746 1.00 37.12  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 28.865  8.466   115.496 1.00 34.54  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 28.364  12.534  112.957 1.00 38.63  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 28.045  13.240  111.718 1.00 43.71  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 29.063  13.097  110.581 1.00 44.58  ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 28.763  13.456  109.441 1.00 42.50  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 27.779  14.738  111.970 1.00 47.29  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 29.001  15.397  112.324 1.00 47.98  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 26.767  14.908  113.086 1.00 53.67  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 30.252  12.571  110.870 1.00 46.10  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 31.255  12.427  109.804 1.00 38.31  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 32.320  11.368  110.085 1.00 33.81  ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 32.563  11.015  111.231 1.00 40.45  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 31.923  13.776  109.514 1.00 39.45  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 32.972  13.641  108.571 1.00 42.30  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 32.958  10.866  109.033 1.00 32.55  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 34.030  9.883   109.187 1.00 36.11  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 35.163  10.126  108.199 1.00 42.40  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 34.924  10.311  107.006 1.00 43.86  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 33.526  8.435   108.974 1.00 34.24  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 34.692  7.455   108.961 1.00 29.71  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 32.524  8.047   110.042 1.00 42.67  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 36.397  10.128  108.692 1.00 44.67  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 37.549  10.076  107.801 1.00 45.60  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 38.441  8.891   108.129 1.00 46.42  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 38.876  8.728   109.265 1.00 51.71  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 38.373  11.361  107.854 1.00 48.72  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 39.718  11.218  107.170 1.00 51.92  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 39.816  11.195  105.785 1.00 54.34  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 40.887  11.095  107.910 1.00 55.74  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 41.041  11.061  105.156 1.00 59.58  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 42.116  10.958  107.290 1.00 60.99  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 42.188  10.943  105.914 1.00 62.82  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 43.410  10.808  105.295 1.00 61.69  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 38.707  8.064   107.128 1.00 44.73  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 39.690  7.006   107.272 1.00 50.33  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 40.853  7.337   106.353 1.00 53.29  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 40.650  7.850   105.254 1.00 57.99  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 39.110  5.633   106.893 1.00 47.27  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 37.771  5.409   107.593 1.00 42.30  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 40.088  4.520   107.242 1.00 41.78  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 37.128  4.086   107.248 1.00 44.07  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 42.072  7.068   106.806 1.00 49.59  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 43.240  7.273   105.965 1.00 54.97  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 43.266  6.214   104.865 1.00 56.46  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 42.878  5.064   105.091 1.00 49.44  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 44.524  7.223   106.795 1.00 64.82  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 45.773  7.629   106.026 1.00 78.23  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 47.044  7.460   106.838 1.00 80.79  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 46.946  7.061   108.019 1.00 72.66  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 48.138  7.724   106.293 1.00 78.46  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 43.715  6.620   103.679 1.00 54.96  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 43.761  5.755   102.498 1.00 54.22  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 42.375  5.299   102.043 1.00 51.61  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 42.232  4.256   101.405 1.00 48.93  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 44.685  4.552   102.720 1.00 47.49  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 46.103  4.963   103.059 1.00 61.34  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 46.488  6.108   102.733 1.00 59.30  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 46.835  4.141   103.650 1.00 70.54  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 41.359  6.090   102.374 1.00 51.45  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 40.001  5.836   101.907 1.00 41.29  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 39.396  7.110   101.331 1.00 48.00  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 39.170  8.087   102.048 1.00 49.26  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 39.100  5.330   103.038 1.00 39.57  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 37.664  5.250   102.564 1.00 40.66  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 39.580  3.977   103.532 1.00 45.88  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 39.137  7.089   100.029 1.00 45.02  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 38.644  8.262   99.320  1.00 44.92  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 37.133  8.463   99.446  1.00 47.84  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 36.645  9.596   99.436  1.00 46.05  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 39.051  8.184   97.850  1.00 46.02  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 40.535  7.885   97.632  1.00 44.83  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 40.861  7.794   96.150  1.00 46.63  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 41.399  8.936   98.312  1.00 49.19  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 36.397  7.362   99.561  1.00 43.65  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 34.940  7.421   99.583  1.00 35.64  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 34.332  6.245   100.337 1.00 38.40  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 35.042  5.340   100.773 1.00 38.90  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 34.408  7.439   98.155  1.00 38.63  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 34.906  6.304   97.315  1.00 42.05  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 34.579  4.989   97.569  1.00 36.50  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 35.713  6.287   96.227  1.00 44.02  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 35.157  4.212   96.670  1.00 39.54  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 35.852  4.975   95.845  1.00 42.15  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 33.006  6.247   100.449 1.00 34.94  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 32.292  5.262   101.258 1.00 33.87  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 32.297  3.865   100.639 1.00 33.72  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 32.125  2.865   101.334 1.00 33.43  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 30.849  5.720   101.486 1.00 32.50  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 30.067  4.854   102.464 1.00 42.58  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 28.583  5.165   102.470 1.00 49.90  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 28.181  6.153   101.819 1.00 57.79  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 27.818  4.418   103.122 1.00 43.08  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 32.525  3.805   99.334  1.00 35.50  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 32.312  2.585   98.556  1.00 37.98  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 33.526  1.668   98.472  1.00 38.44  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 33.528  0.710   97.705  1.00 37.93  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 31.789  2.921   97.161  1.00 35.06  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 30.484  3.658   97.174  1.00 34.78  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 30.436  5.017   96.898  1.00 33.69  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 29.306  2.996   97.485  1.00 28.93  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 29.233  5.699   96.917  1.00 37.55  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 28.099  3.674   97.507  1.00 32.60  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 28.062  5.027   97.223  1.00 33.90  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 34.551  1.966   99.260  1.00 38.61  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 35.854  1.330   99.105  1.00 41.37  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 36.176  0.372   100.248 1.00 40.27  ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 35.585  0.450   101.323 1.00 38.05  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 36.942  2.398   98.999  1.00 41.65  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 36.603  3.534   99.777  1.00 38.33  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 37.079  -0.568  99.982  1.00 44.26  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 37.466  -1.570  100.969 1.00 44.79  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 38.903  -1.375  101.450 1.00 51.55  ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 39.800  -1.104  100.651 1.00 59.94  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 37.320  -2.989  100.401 1.00 43.54  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 35.968  -3.200  99.979  1.00 44.05  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 37.673  -4.018  101.452 1.00 54.45  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 39.111  -1.518  102.759 1.00 53.58  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 40.433  -1.381  103.367 1.00 55.22  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 41.125  -2.737  103.512 1.00 53.41  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 40.531  -3.685  104.033 1.00 46.81  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 40.339  -0.728  104.760 1.00 48.71  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 39.463  0.526   104.706 1.00 50.89  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 41.727  -0.401  105.297 1.00 47.36  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 39.194  1.148   106.063 1.00 43.05  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 42.383  -2.832  103.045 1.00 52.83  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 43.189  -4.056  103.132 1.00 44.20  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 43.396  -4.488  104.576 1.00 49.87  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 43.690  -3.652  105.431 1.00 52.96  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 44.530  -3.634  102.529 1.00 44.55  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 44.207  -2.485  101.649 1.00 49.93  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 43.094  -1.758  102.329 1.00 51.03  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 43.241  -5.781  104.842 1.00 49.23  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 43.371  -6.297  106.191 1.00 50.91  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 42.087  -6.172  106.988 1.00 48.20  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 41.929  -6.811  108.026 1.00 49.39  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 41.165  -5.346  106.502 1.00 54.13  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 39.882  -5.154  107.168 1.00 45.74  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 38.768  -5.918  106.454 1.00 43.08  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 38.544  -5.744  105.254 1.00 41.23  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 39.502  -3.662  107.264 1.00 44.46  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 38.240  -3.494  108.091 1.00 41.17  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 40.640  -2.860  107.872 1.00 46.13  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 38.078  -6.763  107.211 1.00 40.61  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 36.992  -7.581  106.686 1.00 42.71  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 35.804  -6.725  106.254 1.00 46.32  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 35.297  -6.865  105.139 1.00 50.76  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 36.555  -8.599  107.743 1.00 35.89  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 35.434  -9.523  107.314 1.00 35.81  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 35.139  -10.556 108.389 1.00 40.06  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 33.933  -11.403 108.024 1.00 49.95  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 33.675  -12.484 109.016 1.00 47.23  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 35.368  -5.836  107.140 1.00 41.73  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 34.234  -4.964  106.858 1.00 37.30  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 34.558  -3.941  105.775 1.00 36.46  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 35.637  -3.350  105.768 1.00 37.73  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 33.782  -4.239  108.130 1.00 37.27  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 33.069  -5.118  109.160 1.00 49.32  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 34.023  -5.849  110.096 1.00 50.38  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 35.072  -6.335  109.623 1.00 51.13  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 33.722  -5.935  111.308 1.00 44.94  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 33.620  -3.749  104.853 1.00 37.20  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 33.699  -2.664  103.881 1.00 36.17  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 33.342  -1.351  104.569 1.00 34.91  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 32.679  -1.356  105.605 1.00 40.20  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 32.740  -2.927  102.727 1.00 36.65  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 31.351  -3.305  103.205 1.00 50.41  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 30.473  -2.417  103.247 1.00 48.68  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 31.143  -4.488  103.552 1.00 56.74  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 33.777  -0.231  104.000 1.00 29.79  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 33.544  1.076   104.618 1.00 34.50  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 32.055  1.364   104.844 1.00 38.20  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 31.685  2.009   105.828 1.00 40.52  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 34.232  2.222   103.825 1.00 32.10  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 33.696  3.587   104.236 1.00 29.91  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 35.733  2.169   104.029 1.00 31.15  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 31.203  0.859   103.955 1.00 35.28  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 29.761  1.005   104.121 1.00 34.77  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 29.326  0.378   105.439 1.00 38.31  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 28.549  0.965   106.201 1.00 44.43  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 28.978  0.345   102.972 1.00 33.26  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 27.487  0.590   103.137 1.00 29.05  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 29.456  0.871   101.635 1.00 35.74  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 29.851  -0.812  105.713 1.00 34.40  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 29.517  -1.521  106.943 1.00 40.42  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 30.148  -0.864  108.166 1.00 37.10  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 29.543  -0.824  109.231 1.00 37.35  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 29.935  -2.989  106.859 1.00 41.03  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 29.473  -3.822  108.040 1.00 34.36  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 29.713  -5.298  107.833 1.00 40.70  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 29.382  -6.084  108.745 1.00 41.64  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 30.230  -5.671  106.756 1.00 37.46  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 31.367  -0.356  108.010 1.00 37.73  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 32.048  0.324   109.106 1.00 37.44  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 31.254  1.547   109.546 1.00 39.84  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 31.045  1.763   110.739 1.00 44.62  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 33.477  0.736   108.720 1.00 34.77  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 34.326  -0.507  108.451 1.00 38.24  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 34.107  1.580   109.820 1.00 33.27  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 35.740  -0.198  108.024 1.00 39.69  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 30.801  2.335   108.576 1.00 39.90  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 29.959  3.493   108.858 1.00 38.75  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 28.618  3.048   109.439 1.00 38.73  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 28.077  3.697   110.340 1.00 36.81  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 29.749  4.357   107.598 1.00 34.88  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 31.073  4.987   107.171 1.00 35.28  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 28.726  5.443   107.850 1.00 32.68  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 30.981  5.798   105.906 1.00 38.51  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 28.095  1.930   108.938 1.00 40.27  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 26.868  1.358   109.493 1.00 44.13  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 27.012  1.038   110.980 1.00 40.03  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 26.074  1.226   111.755 1.00 40.75  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 26.449  0.096   108.735 1.00 40.30  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 25.603  0.253   107.474 1.00 30.73  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 24.909  -1.061  107.174 1.00 28.17  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 24.591  1.378   107.624 1.00 35.11  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 28.187  0.551   111.366 1.00 35.39  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 28.475  0.251   112.762 1.00 32.36  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 28.685  1.527   113.564 1.00 37.58  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 28.274  1.625   114.721 1.00 40.39  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 29.700  -0.657  112.876 1.00 31.23  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 29.443  -2.053  112.339 1.00 42.15  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 28.309  -2.533  112.347 1.00 43.97  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 30.498  -2.713  111.870 1.00 40.33  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 29.317  2.510   112.933 1.00 37.89  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 29.588  3.788   113.579 1.00 34.31  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 28.308  4.549   113.875 1.00 35.57  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 28.267  5.355   114.802 1.00 43.93  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 30.522  4.636   112.718 1.00 32.14  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 31.968  4.142   112.686 1.00 38.80  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 32.707  4.691   111.477 1.00 43.89  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 32.678  4.526   113.972 1.00 43.68  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 27.266  4.293   113.088 1.00 41.30  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 25.969  4.934   113.304 1.00 43.63  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 25.441  4.667   114.709 1.00 50.66  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 24.847  5.544   115.338 1.00 53.06  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 24.942  4.454   112.274 1.00 38.97  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 25.181  4.961   110.867 1.00 44.48  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 24.102  4.480   109.909 1.00 52.99  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 22.744  5.082   110.241 1.00 49.90  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 21.722  4.735   109.210 1.00 44.06  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 25.678  3.455   115.201 1.00 49.40  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 25.116  3.021   116.474 1.00 50.37  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 25.952  3.431   117.685 1.00 50.62  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 25.597  3.119   118.822 1.00 54.51  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 24.890  1.510   116.466 1.00 45.19  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 23.784  1.068   115.527 1.00 47.35  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 23.493  -0.415  115.630 1.00 77.68  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 22.449  -0.854  115.103 1.00 78.62  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 24.309  -1.143  116.238 1.00 85.49  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 27.055  4.131   117.444 1.00 44.40  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 27.900  4.605   118.535 1.00 46.11  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 27.172  5.634   119.394 1.00 49.48  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 26.621  6.610   118.880 1.00 49.38  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 29.198  5.202   117.994 1.00 50.34  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 30.249  5.552   119.049 1.00 45.58  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 30.789  4.284   119.691 1.00 46.82  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 31.375  6.379   118.446 1.00 44.38  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 27.176  5.406   120.705 1.00 47.45  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 26.521  6.302   121.651 1.00 45.13  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 27.548  7.164   122.382 1.00 48.11  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 28.328  6.663   123.190 1.00 50.66  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 25.706  5.512   122.689 1.00 44.50  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 24.836  6.452   123.507 1.00 53.36  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 24.857  4.453   122.005 1.00 41.70  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 27.543  8.462   122.102 1.00 50.48  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 28.528  9.366   122.685 1.00 50.64  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 27.890  10.373  123.637 1.00 53.46  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 27.175  11.275  123.207 1.00 55.06  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 29.288  10.140  121.592 1.00 48.61  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 30.314  11.068  122.219 1.00 45.51  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 29.950  9.174   120.615 1.00 47.72  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 28.164  10.224  124.930 1.00 56.12  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 27.624  11.134  125.934 1.00 57.09  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 28.554  12.309  126.228 1.00 54.77  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 29.744  12.124  126.501 1.00 47.46  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 27.315  10.399  127.239 1.00 56.54  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 26.709  11.314  128.290 1.00 60.91  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 26.764  10.732  129.689 1.00 62.01  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 26.312  11.714  130.672 1.00 63.28  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 26.269  11.499  131.982 1.00 62.74  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 26.652  10.330  132.478 1.00 68.93  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 25.843  12.456  132.796 1.00 56.29  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 27.994  13.515  126.178 1.00 50.95  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 28.730  14.724  126.522 1.00 53.41  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 28.444  15.120  127.963 1.00 63.54  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 27.291  15.326  128.340 1.00 69.70  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 28.342  15.880  125.598 1.00 57.51  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 28.853  15.740  124.192 1.00 55.93  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 29.696  14.701  123.840 1.00 56.02  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 28.496  16.662  123.223 1.00 59.69  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 30.164  14.579  122.545 1.00 54.26  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 28.962  16.546  121.928 1.00 60.53  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 29.797  15.503  121.589 1.00 57.14  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 29.496  15.225  128.768 1.00 66.96  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 29.354  15.664  130.151 1.00 63.98  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 29.194  17.180  130.211 1.00 60.24  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 28.538  17.712  131.105 1.00 55.93  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 30.553  15.216  130.995 1.00 65.27  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 30.589  13.764  131.488 1.00 67.81  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 29.269  13.391  132.149 1.00 64.73  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 30.924  12.784  130.370 1.00 64.10  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 29.795  17.868  129.247 1.00 63.68  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 29.719  19.321  129.175 1.00 67.52  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 28.511  19.777  128.356 1.00 69.99  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 28.332  19.353  127.213 1.00 67.00  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 31.014  19.882  128.580 1.00 74.13  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 31.185  21.372  128.832 1.00 74.35  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 30.223  22.140  128.804 1.00 69.41  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 32.424  21.786  129.074 1.00 73.93  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 27.668  20.634  128.952 1.00 69.44  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 26.489  21.208  128.294 1.00 66.24  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 26.859  22.202  127.202 1.00 69.52  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 26.034  22.501  126.341 1.00 70.56  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 25.780  21.951  129.431 1.00 66.04  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 26.327  21.363  130.686 1.00 78.59  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 27.740  21.012  130.371 1.00 72.47  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 28.083  22.715  127.249 1.00 68.70  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 28.516  23.748  126.314 1.00 71.45  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 29.262  23.180  125.108 1.00 81.57  ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 29.672  23.927  124.218 1.00 86.65  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 29.401  24.766  127.034 1.00 79.05  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 28.817  25.166  128.261 1.00 87.16  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 29.427  21.861  125.075 1.00 81.92  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 30.239  21.214  124.047 1.00 74.36  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 29.382  20.760  122.867 1.00 79.57  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 28.608  19.809  122.981 1.00 75.62  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 30.961  20.016  124.667 1.00 69.60  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 31.873  19.125  123.827 1.00 64.00  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 32.936  19.948  123.122 1.00 66.82  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 32.506  18.070  124.726 1.00 61.10  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 29.526  21.446  121.735 1.00 78.65  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 28.713  21.157  120.554 1.00 77.33  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 29.281  20.102  119.599 1.00 72.62  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 28.541  19.537  118.793 1.00 72.51  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 28.448  22.450  119.774 1.00 81.98  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 27.689  23.518  120.549 1.00 81.39  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 26.190  23.282  120.566 1.00 84.74  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 25.712  22.206  120.204 1.00 82.83  ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 25.438  24.294  120.983 1.00 82.89  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 30.582  19.838  119.678 1.00 68.44  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 31.207  18.892  118.753 1.00 62.15  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 32.456  18.207  119.304 1.00 57.81  ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 33.259  18.825  120.003 1.00 52.93  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 31.551  19.566  117.413 1.00 57.76  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 32.435  18.719  116.669 1.00 60.48  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 32.223  20.907  117.650 1.00 65.16  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 32.627  16.932  118.963 1.00 55.26  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 33.798  16.173  119.396 1.00 54.03  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 34.317  15.278  118.276 1.00 57.64  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 33.535  14.617  117.589 1.00 61.55  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 33.488  15.300  120.634 1.00 51.43  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 34.625  14.335  120.913 1.00 47.72  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 33.250  16.168  121.846 1.00 65.93  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 35.634  15.261  118.091 1.00 50.90  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 36.241  14.363  117.119 1.00 44.29  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 37.006  13.233  117.802 1.00 38.24  ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 38.099  13.434  118.330 1.00 40.55  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 37.190  15.121  116.175 1.00 55.38  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 36.452  16.116  115.452 1.00 55.17  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 37.844  14.161  115.190 1.00 50.02  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 36.430  12.036  117.753 1.00 39.95  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 37.036  10.845  118.335 1.00 42.66  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 38.125  10.314  117.424 1.00 43.40  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 37.946  10.245  116.209 1.00 50.14  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 35.985  9.753   118.535 1.00 41.39  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 35.338  9.575   119.908 1.00 49.31  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 34.655  10.846  120.365 1.00 45.87  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 34.347  8.426   119.863 1.00 51.35  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 39.251  9.928   118.011 1.00 47.92  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 40.351  9.376   117.234 1.00 46.48  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 40.501  7.890   117.521 1.00 51.32  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 40.428  7.462   118.673 1.00 58.56  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 41.653  10.107  117.553 1.00 38.79  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 41.569  11.634  117.543 1.00 48.36  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 42.939  12.250  117.774 1.00 63.65  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 40.966  12.137  116.242 1.00 52.79  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 40.694  7.102   116.470 1.00 47.23  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 40.956  5.680   116.639 1.00 49.40  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 42.185  5.293   115.833 1.00 55.22  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 42.326  5.676   114.675 1.00 54.90  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 39.743  4.844   116.215 1.00 52.41  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 39.698  3.356   116.592 1.00 55.42  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 38.255  2.884   116.687 1.00 55.38  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 40.468  2.479   115.607 1.00 45.20  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 43.089  4.554   116.461 1.00 59.74  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 44.240  4.015   115.759 1.00 54.53  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 44.437  2.579   116.217 1.00 56.27  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 44.618  2.323   117.408 1.00 65.45  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 45.482  4.864   116.034 1.00 54.08  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 46.377  5.063   114.822 1.00 57.56  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 47.183  6.351   114.927 1.00 64.75  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 46.273  7.574   114.927 1.00 69.87  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 47.034  8.857   114.965 1.00 60.38  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 44.381  1.643   115.276 1.00 47.59  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 44.476  0.228   115.614 1.00 61.46  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 45.126  -0.573  114.494 1.00 64.86  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 45.146  -0.139  113.341 1.00 71.74  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 43.100  -0.331  115.938 1.00 58.14  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 45.646  -1.748  114.838 1.00 61.82  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 46.358  -2.581  113.876 1.00 57.72  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 46.527  -4.012  114.373 1.00 60.82  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 46.063  -4.364  115.459 1.00 58.98  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 47.727  -1.971  113.561 1.00 69.21  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 48.555  -1.648  114.794 1.00 79.84  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 49.840  -0.916  114.462 1.00 89.04  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 50.559  -0.519  115.405 1.00 83.59  ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 50.128  -0.737  113.259 1.00 92.60  ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 47.187  -4.832  113.556 1.00 67.85  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 47.467  -6.218  113.889 1.00 62.87  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 46.202  -7.047  113.948 1.00 56.93  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 45.108  -6.518  113.761 1.00 60.27  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 46.338  -8.358  114.192 1.00 53.98  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 45.135  -9.154  114.446 1.00 51.80  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 44.445  -8.626  115.691 1.00 59.72  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 45.106  -8.525  116.727 1.00 68.33  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 45.691  -10.551 114.739 1.00 50.91  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 47.029  -10.577 114.098 1.00 61.18  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 47.562  -9.175  114.201 1.00 61.23  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 43.152  -8.318  115.589 1.00 59.93  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 42.355  -7.845  116.725 1.00 59.86  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 40.942  -7.543  116.255 1.00 56.64  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 40.691  -7.459  115.056 1.00 59.18  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 42.951  -6.577  117.358 1.00 61.70  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 42.601  -5.283  116.635 1.00 55.46  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 43.072  -4.065  117.423 1.00 55.00  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 42.384  -3.976  118.779 1.00 47.06  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 42.843  -2.792  119.564 1.00 54.58  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 40.018  -7.382  117.194 1.00 53.04  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 38.690  -6.899  116.848 1.00 47.91  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 38.495  -5.513  117.432 1.00 44.91  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 38.308  -5.361  118.638 1.00 47.14  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 37.617  -7.846  117.374 1.00 43.14  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 37.687  -9.234  116.779 1.00 39.76  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 36.441  -10.043 117.065 1.00 58.87  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 35.719  -9.708  118.031 1.00 50.97  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 36.179  -11.008 116.317 1.00 75.99  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 38.507  -4.502  116.571 1.00 39.34  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 38.435  -3.133  117.046 1.00 46.76  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 37.017  -2.797  117.486 1.00 52.44  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 36.073  -2.814  116.680 1.00 50.54  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 38.877  -2.140  115.962 1.00 48.51  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 38.912  -0.724  116.522 1.00 46.19  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 40.236  -2.536  115.409 1.00 49.70  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 36.902  -2.475  118.774 1.00 53.79  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 35.641  -2.123  119.412 1.00 50.52  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 35.595  -0.633  119.716 1.00 50.09  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 36.536  0.103   119.420 1.00 50.87  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 35.462  -2.916  120.706 1.00 48.40  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 35.577  -4.421  120.539 1.00 53.07  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 34.395  -4.987  119.776 1.00 54.65  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 34.509  -6.495  119.626 1.00 63.09  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 33.293  -7.088  119.003 1.00 68.45  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 34.501  -0.200  120.332 1.00 51.87  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 34.288  1.212   120.621 1.00 58.85  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 35.223  1.738   121.707 1.00 64.78  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 35.507  2.935   121.758 1.00 69.28  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 32.836  1.453   121.006 1.00 68.32  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 35.692  0.843   122.574 1.00 66.51  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 36.609  1.210   123.654 1.00 62.21  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 37.922  1.789   123.135 1.00 62.89  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 38.552  2.611   123.800 1.00 59.60  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 36.915  -0.005  124.533 1.00 56.94  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 36.102  -0.086  125.810 1.00 60.47  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 36.423  -1.354  126.579 1.00 59.17  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 36.522  -2.510  125.690 1.00 60.59  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 35.506  -3.309  125.380 1.00 61.21  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 34.301  -3.086  125.887 1.00 64.15  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 35.696  -4.335  124.561 1.00 56.73  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 38.321  1.363   121.941 1.00 59.30  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 39.636  1.691   121.400 1.00 50.55  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 39.789  3.155   120.990 1.00 50.01  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 40.882  3.593   120.633 1.00 52.80  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 39.970  0.765   120.231 1.00 50.53  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 39.984  -0.696  120.636 1.00 50.59  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 41.057  -1.190  121.041 1.00 57.86  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 38.921  -1.346  120.557 1.00 46.70  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 38.695  3.908   121.037 1.00 49.13  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 38.762  5.343   120.798 1.00 52.75  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 39.575  6.025   121.885 1.00 53.53  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 39.391  5.750   123.070 1.00 56.20  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 37.362  5.954   120.752 1.00 58.07  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 36.669  5.781   119.436 1.00 63.74  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 35.572  4.943   119.320 1.00 59.19  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 37.118  6.453   118.310 1.00 57.48  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 34.932  4.783   118.107 1.00 60.81  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 36.485  6.296   117.093 1.00 56.13  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 35.390  5.459   116.990 1.00 59.37  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 40.473  6.915   121.477 1.00 52.27  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 41.265  7.679   122.430 1.00 55.44  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 40.354  8.581   123.255 1.00 55.53  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 39.588  9.369   122.699 1.00 50.81  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 42.331  8.509   121.713 1.00 54.88  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 43.360  7.722   120.900 1.00 46.20  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 44.521  8.618   120.490 1.00 38.46  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 43.850  6.511   121.681 1.00 46.71  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 40.433  8.455   124.590 1.00 56.97  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 39.569  9.179   125.529 1.00 52.24  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 39.698  10.693  125.398 1.00 48.44  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 40.798  11.207  125.193 1.00 46.97  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 40.087  8.729   126.899 1.00 49.58  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 40.765  7.423   126.642 1.00 51.30  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 41.374  7.558   125.285 1.00 49.37  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 38.574  11.392  125.507 1.00 46.12  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 38.572  12.848  125.513 1.00 55.09  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 37.912  13.322  126.806 1.00 66.27  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 37.083  12.614  127.383 1.00 59.45  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 37.829  13.429  124.283 1.00 54.38  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 38.075  14.930  124.153 1.00 44.95  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 38.270  12.723  123.014 1.00 53.60  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 38.297  14.508  127.267 1.00 74.20  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 37.748  15.078  128.490 1.00 70.34  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 36.274  15.434  128.326 1.00 66.11  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 35.882  16.047  127.330 1.00 60.24  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 38.549  16.300  128.910 1.00 77.50  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 35.473  15.043  129.314 1.00 70.55  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 34.029  15.271  129.310 1.00 79.89  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 33.335  14.603  128.123 1.00 73.23  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 32.422  15.169  127.518 1.00 69.16  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 33.704  16.768  129.370 1.00 84.98  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 34.189  17.416  130.653 1.00 89.50  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 34.315  16.699  131.671 1.00 79.73  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 34.444  18.640  130.644 1.00 93.21  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 33.797  13.401  127.788 1.00 64.80  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 33.171  12.575  126.765 1.00 58.04  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 33.186  11.122  127.221 1.00 58.66  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 34.246  10.589  127.549 1.00 62.05  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 33.932  12.670  125.427 1.00 60.11  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 33.426  11.619  124.452 1.00 67.97  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 33.814  14.067  124.830 1.00 56.08  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 32.025  10.473  127.235 1.00 55.49  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 31.968  9.064   127.627 1.00 64.29  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 31.188  8.198   126.644 1.00 63.40  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 30.064  8.527   126.271 1.00 63.01  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 31.371  8.899   129.028 1.00 64.34  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 31.342  7.447   129.498 1.00 58.17  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 30.329  7.195   130.601 1.00 70.04  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 29.723  8.171   131.097 1.00 74.86  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 30.137  6.016   130.966 1.00 59.44  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 31.779  7.074   126.251 1.00 60.33  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 31.115  6.140   125.351 1.00 57.09  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 30.211  5.217   126.160 1.00 55.81  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 30.682  4.450   126.999 1.00 61.77  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 32.135  5.300   124.549 1.00 52.81  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 32.760  6.134   123.427 1.00 53.58  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 31.473  4.063   123.963 1.00 53.74  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 33.860  7.074   123.878 1.00 57.23  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 28.910  5.289   125.900 1.00 49.26  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 27.933  4.566   126.703 1.00 46.83  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 27.846  3.096   126.313 1.00 45.33  ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 27.342  2.278   127.078 1.00 54.56  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 26.555  5.224   126.603 1.00 53.27  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 26.545  6.720   126.909 1.00 62.62  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 26.969  7.134   128.615 1.00 61.71  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 25.794  6.119   129.507 1.00 63.50  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 28.331  2.766   125.121 1.00 45.55  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 28.364  1.375   124.675 1.00 56.42  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 29.743  0.963   124.158 1.00 62.77  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 29.986  0.928   122.953 1.00 68.82  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 27.271  1.093   123.636 1.00 62.48  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 27.373  1.987   122.411 1.00 58.48  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 27.919  3.089   122.472 1.00 52.93  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 26.848  1.510   121.288 1.00 55.99  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 30.653  0.646   125.085 1.00 56.27  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 32.045  0.318   124.773 1.00 58.40  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 32.194  -1.021  124.053 1.00 62.55  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 33.185  -1.221  123.353 1.00 68.68  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 32.690  0.247   126.155 1.00 65.13  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 31.591  -0.177  127.048 1.00 66.13  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 30.368  0.510   126.522 1.00 59.82  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 31.226  -1.917  124.220 1.00 63.37  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 31.297  -3.248  123.618 1.00 69.21  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 30.891  -3.277  122.146 1.00 70.89  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 31.017  -4.311  121.484 1.00 62.52  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 30.439  -4.239  124.403 1.00 73.01  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 31.106  -4.700  125.674 1.00 82.17  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 30.731  -5.778  126.184 1.00 96.18  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 32.012  -3.987  126.158 1.00 75.00  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 30.393  -2.149  121.646 1.00 68.02  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 29.963  -2.050  120.257 1.00 61.69  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 31.106  -2.406  119.319 1.00 58.32  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 32.192  -1.833  119.404 1.00 57.85  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 29.458  -0.637  119.949 1.00 61.42  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 29.143  -0.336  118.480 1.00 58.30  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 28.011  -1.219  117.968 1.00 57.76  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 28.810  1.134   118.288 1.00 44.71  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 30.857  -3.359  118.428 1.00 52.52  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 31.874  -3.775  117.474 1.00 55.32  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 32.024  -2.740  116.369 1.00 47.50  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 31.038  -2.167  115.912 1.00 51.67  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 31.529  -5.136  116.869 1.00 54.04  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 32.493  -5.587  115.817 1.00 46.86  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 33.643  -6.285  116.111 1.00 47.65  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 32.486  -5.424  114.472 1.00 50.91  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 34.298  -6.543  114.993 1.00 49.76  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 33.619  -6.028  113.984 1.00 47.48  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 33.260  -2.501  115.948 1.00 41.40  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 33.515  -1.617  114.817 1.00 43.75  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 34.097  -2.378  113.633 1.00 46.74  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 33.489  -2.424  112.563 1.00 48.74  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 34.409  -0.420  115.183 1.00 44.34  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 33.604  0.603   115.983 1.00 46.38  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 34.960  0.240   113.924 1.00 41.76  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 34.302  1.931   116.150 1.00 52.70  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 35.274  -2.968  113.810 1.00 44.68  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 35.888  -3.679  112.693 1.00 41.95  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 36.584  -4.962  113.115 1.00 43.91  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 36.870  -5.165  114.289 1.00 55.20  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 36.856  -2.769  111.957 1.00 38.54  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 36.846  -5.832  112.149 1.00 36.32  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 37.672  -7.004  112.395 1.00 40.59  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 38.972  -6.853  111.617 1.00 44.13  ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 38.975  -6.881  110.389 1.00 51.49  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 36.956  -8.313  112.000 1.00 41.79  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 35.857  -8.545  112.891 1.00 42.35  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 37.913  -9.494  112.078 1.00 42.18  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 40.074  -6.674  112.337 1.00 46.23  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 41.369  -6.450  111.704 1.00 42.75  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 42.249  -7.694  111.708 1.00 48.57  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 42.400  -8.375  112.729 1.00 58.52  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 42.102  -5.274  112.349 1.00 47.74  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 41.846  -3.888  111.752 1.00 49.73  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 40.371  -3.518  111.799 1.00 40.26  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 42.685  -2.846  112.473 1.00 55.18  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 42.834  -7.957  110.545 1.00 52.49  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 43.644  -9.138  110.282 1.00 55.34  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 45.105  -8.827  110.592 1.00 62.65  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 45.426  -7.726  111.044 1.00 61.84  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 43.503  -9.489  108.804 1.00 57.88  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 43.760  -10.924 108.426 1.00 56.79  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 43.609  -11.136 106.933 1.00 59.32  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 43.887  -10.192 106.161 1.00 54.54  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 43.195  -12.237 106.531 1.00 57.51  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 45.991  -9.786  110.340 1.00 60.97  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 47.415  -9.557  110.544 1.00 66.55  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 47.907  -8.562  109.503 1.00 62.19  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 47.745  -8.774  108.302 1.00 56.25  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 48.202  -10.865 110.434 1.00 65.32  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 49.353  -10.991 111.431 1.00 70.43  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 50.252  -9.764  111.465 1.00 72.29  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 50.264  -9.065  112.501 1.00 68.84  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 50.951  -9.502  110.462 1.00 67.00  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 48.506  -7.472  109.968 1.00 63.22  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 48.970  -6.429  109.075 1.00 61.21  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 47.857  -5.470  108.706 1.00 57.03  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 48.104  -4.410  108.134 1.00 56.56  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 46.625  -5.847  109.031 1.00 58.24  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 45.482  -4.988  108.793 1.00 57.81  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 45.574  -3.754  109.663 1.00 62.49  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 45.701  -3.857  110.882 1.00 68.80  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 45.508  -2.583  109.039 1.00 60.70  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 45.714  -1.334  109.758 1.00 62.31  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 44.546  -0.368  109.570 1.00 57.52  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 44.172  -0.043  108.444 1.00 57.45  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 47.029  -0.693  109.310 1.00 65.83  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 47.553  0.408   110.221 1.00 74.83  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 49.072  0.528   110.120 1.00 80.13  ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 49.618  -0.243  109.004 1.00 93.60  ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 49.850  0.251   107.790 1.00 96.96  ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 49.580  1.522   107.527 1.00 108.68 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 50.347  -0.527  106.836 1.00 83.56  ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 43.972  0.084   110.680 1.00 55.33  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 42.848  1.011   110.634 1.00 53.55  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 43.150  2.299   111.397 1.00 54.24  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 43.569  2.266   112.554 1.00 62.64  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 41.586  0.353   111.198 1.00 53.05  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 40.304  1.191   111.192 1.00 47.78  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 39.803  1.399   109.775 1.00 50.71  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 39.232  0.543   112.048 1.00 51.38  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 42.940  3.430   110.735 1.00 50.12  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1  139  ? 43.102  4.735   111.362 1.00 51.47  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1  139  ? 41.910  5.634   111.035 1.00 56.40  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1  139  ? 41.659  5.937   109.870 1.00 68.03  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1  139  ? 44.414  5.378   110.907 1.00 54.00  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1  139  ? 44.654  6.734   111.542 1.00 70.68  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1  139  ? 44.020  7.092   112.536 1.00 75.32  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1  139  ? 45.579  7.498   110.970 1.00 72.27  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1  140  ? 41.176  6.055   112.062 1.00 55.17  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1  140  ? 39.948  6.822   111.861 1.00 52.13  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1  140  ? 39.879  8.106   112.670 1.00 42.80  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1  140  ? 40.427  8.198   113.769 1.00 57.68  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1  140  ? 38.720  5.983   112.220 1.00 48.69  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1  140  ? 38.542  4.717   111.416 1.00 53.63  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1  140  ? 36.844  4.132   111.557 1.00 72.86  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1  140  ? 36.557  4.358   113.311 1.00 57.70  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1  141  ? 39.186  9.090   112.113 1.00 34.82  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1  141  ? 38.776  10.270  112.853 1.00 42.74  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1  141  ? 37.283  10.467  112.627 1.00 44.77  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1  141  ? 36.859  10.771  111.510 1.00 50.70  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1  141  ? 39.539  11.499  112.365 1.00 41.92  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1  141  ? 41.043  11.384  112.499 1.00 46.00  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1  141  ? 41.772  12.489  111.766 1.00 57.62  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1  141  ? 41.096  13.348  111.160 1.00 54.44  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1  141  ? 43.021  12.497  111.794 1.00 69.19  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1  142  ? 36.487  10.299  113.680 1.00 40.76  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1  142  ? 35.037  10.443  113.550 1.00 41.63  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1  142  ? 34.542  11.739  114.190 1.00 43.18  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1  142  ? 35.068  12.181  115.206 1.00 53.25  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1  142  ? 34.264  9.215   114.112 1.00 32.93  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1  142  ? 35.061  7.939   113.891 1.00 39.00  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1  142  ? 33.941  9.388   115.580 1.00 35.40  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1  143  ? 33.549  12.363  113.572 1.00 41.12  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1  143  ? 32.982  13.588  114.115 1.00 44.19  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1  143  ? 31.555  13.376  114.603 1.00 48.83  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1  143  ? 30.658  13.009  113.823 1.00 50.67  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1  143  ? 33.041  14.735  113.101 1.00 40.95  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1  143  ? 32.138  15.901  113.466 1.00 38.98  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1  143  ? 32.476  17.155  112.691 1.00 41.89  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1  143  ? 31.425  18.161  112.816 1.00 49.54  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1  143  ? 31.584  19.451  112.534 1.00 57.83  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1  143  ? 32.760  19.901  112.119 1.00 60.39  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1  143  ? 30.568  20.293  112.675 1.00 55.40  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1  144  ? 31.376  13.612  115.903 1.00 51.73  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  144  ? 30.092  13.503  116.580 1.00 48.29  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  144  ? 29.618  14.891  117.007 1.00 52.95  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  144  ? 30.396  15.683  117.549 1.00 51.04  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  144  ? 30.210  12.618  117.835 1.00 44.70  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  144  ? 28.871  12.506  118.541 1.00 46.61  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  144  ? 30.742  11.242  117.469 1.00 45.01  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1  145  ? 28.341  15.178  116.765 1.00 53.75  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1  145  ? 27.769  16.487  117.070 1.00 54.19  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1  145  ? 26.494  16.405  117.903 1.00 59.19  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1  145  ? 25.889  15.341  118.041 1.00 57.34  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1  145  ? 27.461  17.251  115.781 1.00 53.77  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1  145  ? 28.668  17.972  115.224 1.00 64.20  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1  145  ? 28.875  19.149  115.591 1.00 70.72  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1  145  ? 29.403  17.368  114.415 1.00 65.57  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1  146  ? 26.103  17.547  118.461 1.00 65.30  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1  146  ? 24.798  17.704  119.085 1.00 60.88  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1  146  ? 23.797  18.127  118.021 1.00 53.95  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1  146  ? 24.053  19.050  117.250 1.00 53.84  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1  146  ? 24.840  18.777  120.173 1.00 73.50  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1  146  ? 25.532  18.373  121.462 1.00 75.45  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1  146  ? 25.416  19.495  122.487 1.00 73.09  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1  146  ? 25.949  19.120  123.794 1.00 76.54  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1  146  ? 25.252  18.482  124.729 1.00 78.28  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1  146  ? 23.991  18.138  124.498 1.00 68.13  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1  146  ? 25.816  18.183  125.892 1.00 75.04  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1  147  ? 22.655  17.454  117.982 1.00 52.83  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1  147  ? 21.615  17.797  117.034 1.00 53.27  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1  147  ? 20.267  17.304  117.510 1.00 49.16  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1  147  ? 20.168  16.647  118.545 1.00 47.37  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1  148  ? 19.225  17.618  116.752 1.00 52.23  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1  148  ? 17.882  17.184  117.107 1.00 47.23  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1  148  ? 17.180  16.525  115.919 1.00 42.30  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1  148  ? 17.203  17.039  114.797 1.00 38.97  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1  148  ? 17.037  18.351  117.684 1.00 42.70  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1  148  ? 16.924  19.496  116.681 1.00 49.03  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1  148  ? 15.665  17.860  118.112 1.00 43.61  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1  149  ? 16.579  15.368  116.171 1.00 37.05  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1  149  ? 15.852  14.653  115.141 1.00 40.26  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1  149  ? 16.751  13.839  114.233 1.00 38.54  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1  149  ? 17.863  13.467  114.611 1.00 38.14  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1  150  ? 16.258  13.564  113.028 1.00 38.11  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1  150  ? 16.981  12.754  112.055 1.00 36.18  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1  150  ? 17.399  13.580  110.849 1.00 35.33  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1  150  ? 16.562  13.985  110.045 1.00 40.33  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1  150  ? 16.115  11.578  111.599 1.00 36.15  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1  150  ? 16.600  10.912  110.333 1.00 36.07  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1  150  ? 17.789  10.197  110.315 1.00 39.00  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1  150  ? 15.863  10.989  109.157 1.00 35.92  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1  150  ? 18.239  9.583   109.158 1.00 42.37  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1  150  ? 16.304  10.378  107.993 1.00 38.16  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1  150  ? 17.494  9.677   108.000 1.00 40.82  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1  150  ? 17.944  9.064   106.853 1.00 41.86  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1  151  ? 18.700  13.821  110.726 1.00 34.95  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1  151  ? 19.229  14.602  109.618 1.00 34.64  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1  151  ? 20.105  13.732  108.728 1.00 40.13  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1  151  ? 21.203  13.342  109.130 1.00 38.40  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1  151  ? 20.049  15.804  110.116 1.00 42.56  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1  151  ? 20.620  16.576  108.941 1.00 51.23  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1  151  ? 19.190  16.711  110.984 1.00 46.98  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1  152  ? 19.614  13.423  107.514 1.00 44.23  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1  152  ? 20.302  12.561  106.545 1.00 43.87  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1  152  ? 21.630  13.154  106.090 1.00 45.99  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1  152  ? 21.787  14.375  106.086 1.00 46.69  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1  152  ? 19.324  12.507  105.366 1.00 38.87  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1  152  ? 17.999  12.841  105.951 1.00 39.66  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1  152  ? 18.291  13.844  107.024 1.00 43.77  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1  153  ? 22.567  12.292  105.706 1.00 44.37  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  153  ? 23.885  12.734  105.266 1.00 41.03  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  153  ? 23.781  13.669  104.070 1.00 40.46  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  153  ? 24.588  14.583  103.916 1.00 44.85  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  153  ? 24.762  11.540  104.929 1.00 43.72  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  154  ? 22.780  13.439  103.228 1.00 46.72  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  154  ? 22.584  14.252  102.036 1.00 48.28  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  154  ? 22.247  15.690  102.410 1.00 48.21  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  154  ? 22.539  16.617  101.656 1.00 51.08  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  154  ? 21.477  13.667  101.152 1.00 48.85  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1  154  ? 21.640  12.185  100.827 1.00 57.45  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1  154  ? 20.946  11.276  101.834 1.00 61.67  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1  154  ? 19.697  11.312  101.910 1.00 58.02  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1  154  ? 21.649  10.524  102.547 1.00 55.27  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1  155  ? 21.621  15.869  103.570 1.00 47.81  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1  155  ? 21.210  17.197  104.015 1.00 47.82  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1  155  ? 22.333  18.038  104.632 1.00 46.49  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1  155  ? 22.507  19.200  104.270 1.00 52.94  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1  155  ? 20.026  17.100  104.982 1.00 45.29  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1  155  ? 19.352  18.432  105.254 1.00 53.62  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1  155  ? 18.951  19.112  103.952 1.00 72.96  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1  155  ? 18.392  20.507  104.196 1.00 87.73  ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1  155  ? 18.080  21.219  102.922 1.00 78.27  ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1  156  ? 23.083  17.465  105.571 1.00 43.44  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1  156  ? 24.147  18.222  106.237 1.00 46.96  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1  156  ? 25.477  18.281  105.478 1.00 47.84  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1  156  ? 26.119  19.330  105.429 1.00 53.31  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1  156  ? 24.341  17.785  107.699 1.00 49.07  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1  156  ? 24.771  16.360  107.868 1.00 42.73  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1  156  ? 26.065  15.942  107.651 1.00 46.00  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1  156  ? 24.081  15.263  108.260 1.00 40.47  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1  156  ? 26.153  14.645  107.889 1.00 43.04  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1  156  ? 24.963  14.209  108.261 1.00 42.55  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1  157  ? 25.884  17.155  104.898 1.00 47.52  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1  157  ? 27.124  17.076  104.142 1.00 44.37  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1  157  ? 28.363  17.487  104.920 1.00 43.69  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1  157  ? 29.333  17.979  104.345 1.00 38.50  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1  158  ? 28.331  17.284  106.232 1.00 51.27  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1  158  ? 29.424  17.701  107.102 1.00 50.46  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1  158  ? 30.715  16.939  106.825 1.00 47.97  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1  158  ? 30.753  15.709  106.885 1.00 47.27  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1  158  ? 29.051  17.516  108.583 1.00 46.34  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1  158  ? 27.889  18.436  108.955 1.00 43.66  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1  158  ? 30.251  17.778  109.477 1.00 46.87  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1  158  ? 27.492  18.338  110.404 1.00 57.58  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1  159  ? 31.776  17.685  106.538 1.00 45.16  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  159  ? 33.087  17.100  106.312 1.00 49.90  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  159  ? 34.160  17.956  106.962 1.00 55.87  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  159  ? 34.209  19.170  106.756 1.00 55.14  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  159  ? 33.363  16.951  104.814 1.00 50.36  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  159  ? 32.611  15.806  104.159 1.00 47.95  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  159  ? 32.460  16.011  102.658 1.00 49.79  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  159  ? 33.786  15.905  101.932 1.00 49.49  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  159  ? 33.608  16.055  100.460 1.00 52.76  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1  160  ? 35.011  17.319  107.760 1.00 62.13  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1  160  ? 36.135  18.007  108.382 1.00 66.97  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1  160  ? 37.290  18.184  107.394 1.00 63.49  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1  160  ? 37.998  19.191  107.428 1.00 57.75  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1  160  ? 36.589  17.267  109.645 1.00 65.34  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1  160  ? 35.734  17.605  110.858 1.00 64.92  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1  160  ? 34.788  18.409  110.714 1.00 64.57  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1  160  ? 36.004  17.067  111.955 1.00 57.17  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1  161  ? 37.471  17.206  106.510 1.00 60.61  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1  161  ? 38.502  17.296  105.481 1.00 60.76  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1  161  ? 38.016  16.789  104.122 1.00 57.53  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1  161  ? 36.853  16.420  103.968 1.00 57.70  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1  161  ? 39.769  16.554  105.913 1.00 61.10  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1  161  ? 39.611  15.053  106.037 1.00 53.94  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1  161  ? 40.931  14.412  106.422 1.00 62.36  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1  161  ? 41.284  14.680  107.813 1.00 72.38  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1  161  ? 42.480  14.436  108.341 1.00 76.15  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1  161  ? 43.449  13.926  107.591 1.00 71.24  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1  161  ? 42.709  14.710  109.619 1.00 73.49  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1  162  ? 38.920  16.771  103.147 1.00 58.19  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1  162  ? 38.572  16.462  101.760 1.00 60.32  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1  162  ? 38.045  15.041  101.557 1.00 53.70  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1  162  ? 37.073  14.831  100.832 1.00 59.39  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1  162  ? 39.774  16.694  100.816 1.00 69.45  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1  162  ? 40.319  18.118  100.973 1.00 71.63  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1  162  ? 39.382  16.424  99.371  1.00 57.83  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1  162  ? 39.361  19.202  100.522 1.00 64.24  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1  163  ? 38.686  14.068  102.194 1.00 50.16  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1  163  ? 38.294  12.670  102.031 1.00 54.70  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1  163  ? 37.255  12.188  103.041 1.00 45.54  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1  163  ? 36.931  11.002  103.087 1.00 43.50  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1  163  ? 39.517  11.749  102.038 1.00 59.67  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1  163  ? 40.142  11.601  100.664 1.00 60.50  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1  163  ? 39.454  11.676  99.644  1.00 58.80  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1  163  ? 41.453  11.387  100.630 1.00 63.30  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1  164  ? 36.752  13.106  103.857 1.00 46.84  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1  164  ? 35.741  12.773  104.855 1.00 46.48  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1  164  ? 34.452  12.265  104.210 1.00 46.68  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1  164  ? 34.101  12.659  103.098 1.00 48.30  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1  164  ? 35.453  13.976  105.744 1.00 50.23  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1  165  ? 33.754  11.383  104.920 1.00 41.25  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1  165  ? 32.500  10.820  104.438 1.00 33.23  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1  165  ? 31.332  11.241  105.319 1.00 35.70  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1  165  ? 31.254  10.841  106.481 1.00 35.20  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1  165  ? 32.548  9.291   104.439 1.00 31.65  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1  165  ? 33.781  8.797   103.685 1.00 32.92  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1  165  ? 31.271  8.723   103.843 1.00 36.30  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1  165  ? 33.996  7.307   103.799 1.00 37.05  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1  166  ? 30.420  12.054  104.769 1.00 33.49  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1  166  ? 29.201  12.433  105.489 1.00 40.15  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1  166  ? 28.376  11.208  105.877 1.00 41.88  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1  166  ? 28.208  10.284  105.076 1.00 35.61  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1  166  ? 28.448  13.289  104.467 1.00 38.75  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1  166  ? 29.513  13.856  103.608 1.00 32.79  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1  166  ? 30.546  12.771  103.489 1.00 34.41  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1  167  ? 27.871  11.211  107.107 1.00 46.02  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1  167  ? 27.150  10.070  107.657 1.00 46.64  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1  167  ? 25.758  10.471  108.144 1.00 45.81  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1  167  ? 25.596  11.518  108.771 1.00 43.53  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1  167  ? 27.931  9.455   108.835 1.00 41.41  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1  167  ? 27.172  8.282   109.430 1.00 45.00  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1  167  ? 29.316  9.028   108.385 1.00 38.59  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1  168  ? 24.760  9.642   107.842 1.00 45.28  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1  168  ? 23.405  9.841   108.351 1.00 46.28  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1  168  ? 23.404  9.841   109.877 1.00 51.13  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1  168  ? 23.988  8.957   110.509 1.00 49.77  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1  168  ? 22.468  8.747   107.835 1.00 45.08  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1  168  ? 22.247  8.826   106.341 1.00 51.84  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1  168  ? 22.051  9.945   105.822 1.00 48.09  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1  168  ? 22.274  7.765   105.683 1.00 60.27  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1  169  ? 22.745  10.832  110.468 1.00 45.26  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1  169  ? 22.771  10.992  111.915 1.00 46.60  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1  169  ? 21.383  10.943  112.545 1.00 47.06  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1  169  ? 20.514  11.753  112.217 1.00 44.89  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1  169  ? 23.476  12.291  112.288 1.00 45.70  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1  170  ? 21.180  9.986   113.446 1.00 40.76  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1  170  ? 19.985  9.972   114.275 1.00 36.68  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1  170  ? 20.364  10.485  115.653 1.00 42.79  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1  170  ? 21.033  9.799   116.429 1.00 45.42  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1  170  ? 19.390  8.563   114.402 1.00 34.31  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1  170  ? 18.262  8.555   115.424 1.00 39.41  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1  170  ? 18.887  8.085   113.054 1.00 35.32  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1  171  ? 19.922  11.697  115.957 1.00 40.56  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1  171  ? 20.327  12.353  117.188 1.00 47.53  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1  171  ? 19.561  11.842  118.396 1.00 49.22  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1  171  ? 20.136  11.674  119.472 1.00 48.67  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1  171  ? 20.170  13.866  117.061 1.00 45.33  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1  171  ? 21.096  14.484  116.057 1.00 50.09  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1  171  ? 22.468  14.445  116.246 1.00 52.98  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1  171  ? 20.598  15.110  114.927 1.00 52.58  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1  171  ? 23.326  15.012  115.325 1.00 50.72  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1  171  ? 21.452  15.683  114.003 1.00 56.03  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1  171  ? 22.817  15.633  114.202 1.00 52.15  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1  172  ? 18.272  11.576  118.202 1.00 47.76  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1  172  ? 17.369  11.282  119.308 1.00 45.01  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1  172  ? 17.872  10.125  120.160 1.00 51.15  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1  172  ? 18.026  9.004   119.673 1.00 53.90  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1  172  ? 15.961  10.980  118.789 1.00 49.11  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1  172  ? 15.059  10.742  119.858 1.00 44.41  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1  173  ? 18.149  10.413  121.441 1.00 51.06  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1  173  ? 18.608  9.456   122.451 1.00 47.41  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1  173  ? 17.500  8.489   122.849 1.00 47.78  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1  173  ? 17.775  7.446   123.440 1.00 47.52  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1  173  ? 18.974  10.353  123.631 1.00 39.13  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1  173  ? 18.086  11.527  123.480 1.00 42.84  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1  173  ? 17.989  11.764  122.007 1.00 43.99  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1  174  ? 16.259  8.840   122.527 1.00 46.51  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1  174  ? 15.115  8.027   122.911 1.00 44.24  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1  174  ? 14.926  6.842   121.973 1.00 38.98  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1  174  ? 14.661  7.018   120.785 1.00 39.11  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1  174  ? 13.833  8.865   122.874 1.00 40.19  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1  174  ? 12.642  8.024   123.280 1.00 34.98  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1  174  ? 13.978  10.082  123.771 1.00 44.30  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1  175  ? 15.061  5.634   122.515 1.00 34.14  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1  175  ? 14.829  4.420   121.741 1.00 30.79  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1  175  ? 13.363  3.993   121.663 1.00 34.88  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1  175  ? 12.884  3.615   120.596 1.00 39.01  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1  175  ? 15.703  3.274   122.249 1.00 32.86  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1  175  ? 17.186  3.541   122.074 1.00 48.38  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1  175  ? 18.003  2.258   122.070 1.00 67.51  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1  175  ? 19.399  2.517   121.725 1.00 75.05  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1  175  ? 19.868  2.555   120.481 1.00 74.02  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1  175  ? 19.054  2.347   119.453 1.00 65.68  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1  175  ? 21.153  2.802   120.263 1.00 75.15  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1  176  ? 12.654  4.044   122.787 1.00 37.28  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1  176  ? 11.251  3.621   122.797 1.00 32.60  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1  176  ? 10.410  4.342   123.852 1.00 33.10  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1  176  ? 10.878  4.603   124.957 1.00 34.98  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1  176  ? 11.159  2.102   122.986 1.00 34.12  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1  176  ? 9.744   1.564   123.139 1.00 40.34  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1  176  ? 9.346   0.653   121.987 1.00 48.34  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1  176  ? 10.221  -0.510  121.858 1.00 46.28  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1  176  ? 10.157  -1.586  122.634 1.00 47.18  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1  176  ? 9.264   -1.651  123.614 1.00 45.97  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1  176  ? 10.993  -2.596  122.437 1.00 54.82  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1  177  ? 9.164   4.655   123.510 1.00 34.43  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1  177  ? 8.241   5.273   124.457 1.00 32.47  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1  177  ? 6.868   4.611   124.404 1.00 37.02  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1  177  ? 6.224   4.580   123.356 1.00 40.05  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1  177  ? 8.061   6.778   124.185 1.00 28.81  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1  177  ? 6.941   7.337   125.041 1.00 31.26  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1  177  ? 9.346   7.523   124.447 1.00 28.27  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1  178  ? 6.421   4.083   125.537 1.00 37.26  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1  178  ? 5.082   3.516   125.628 1.00 35.28  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1  178  ? 4.345   4.197   126.767 1.00 39.92  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1  178  ? 4.973   4.729   127.674 1.00 40.16  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1  178  ? 5.154   2.021   125.866 1.00 31.17  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1  179  ? 3.019   4.206   126.725 1.00 42.80  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1  179  ? 2.274   4.697   127.879 1.00 39.29  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1  179  ? 1.005   3.900   128.165 1.00 42.43  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1  179  ? 0.274   3.504   127.257 1.00 40.90  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1  179  ? 2.037   6.216   127.824 1.00 35.04  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1  179  ? 0.887   6.636   126.959 1.00 34.95  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1  179  ? -0.346  6.921   127.519 1.00 39.74  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1  179  ? 1.044   6.778   125.594 1.00 39.72  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1  179  ? -1.408  7.322   126.731 1.00 37.94  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1  179  ? -0.015  7.179   124.799 1.00 45.15  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1  179  ? -1.243  7.451   125.370 1.00 40.46  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1  180  ? 0.778   3.670   129.453 1.00 42.25  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1  180  ? -0.224  2.740   129.939 1.00 39.22  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1  180  ? -1.273  3.491   130.737 1.00 34.18  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1  180  ? -0.949  4.176   131.703 1.00 38.36  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1  180  ? 0.450   1.716   130.853 1.00 45.76  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1  180  ? -0.205  0.357   130.875 1.00 49.36  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1  180  ? 0.179   -0.481  129.677 1.00 59.34  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1  180  ? -0.462  -1.489  129.381 1.00 72.71  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1  180  ? 1.237   -0.071  128.980 1.00 49.14  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1  181  ? -2.529  3.365   130.337 1.00 29.31  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1  181  ? -3.611  3.963   131.101 1.00 34.80  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1  181  ? -4.400  2.876   131.814 1.00 44.47  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1  181  ? -5.056  2.052   131.174 1.00 39.88  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1  181  ? -4.550  4.794   130.216 1.00 34.82  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1  181  ? -5.785  5.214   131.002 1.00 37.65  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1  181  ? -3.819  6.011   129.674 1.00 34.80  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1  182  ? -4.328  2.871   133.143 1.00 48.18  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1  182  ? -5.022  1.850   133.923 1.00 42.61  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1  182  ? -6.118  2.432   134.806 1.00 44.45  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1  182  ? -6.070  3.599   135.185 1.00 43.51  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1  182  ? -4.029  1.027   134.746 1.00 43.70  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1  182  ? -3.257  0.021   133.908 1.00 53.97  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1  182  ? -2.124  -0.634  134.666 1.00 59.84  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1  182  ? -1.494  -1.557  134.104 1.00 55.25  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1  182  ? -1.861  -0.223  135.817 1.00 62.46  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1  183  ? -7.112  1.609   135.120 1.00 48.78  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1  183  ? -8.262  2.062   135.891 1.00 51.40  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1  183  ? -7.935  2.239   137.374 1.00 49.97  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1  183  ? -7.382  1.339   138.008 1.00 44.07  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1  183  ? -9.429  1.089   135.714 1.00 54.64  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1  183  ? -10.735 1.652   136.228 1.00 57.93  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1  183  ? -10.863 2.893   136.281 1.00 54.96  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1  183  ? -11.634 0.858   136.575 1.00 68.25  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1  184  ? -8.280  3.405   137.917 1.00 50.39  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1  184  ? -8.064  3.694   139.333 1.00 48.57  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1  184  ? -9.215  4.514   139.918 1.00 51.40  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1  184  ? -10.145 4.903   139.201 1.00 49.91  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1  184  ? -6.734  4.444   139.566 1.00 44.39  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1  184  ? -6.477  4.557   140.972 1.00 47.39  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1  184  ? -6.792  5.832   138.954 1.00 46.03  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1  185  ? -9.137  4.786   141.219 1.00 60.03  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1  185  ? -10.215 5.469   141.931 1.00 61.97  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1  185  ? -9.724  6.283   143.131 1.00 58.41  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1  185  ? -8.690  5.976   143.728 1.00 54.13  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1  185  ? -11.264 4.455   142.397 1.00 67.17  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1  185  ? -10.703 3.322   143.250 1.00 65.52  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1  185  ? -11.810 2.457   143.846 1.00 74.86  ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1  185  ? -12.653 3.203   144.779 1.00 83.17  ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1  185  ? -13.970 3.346   144.653 1.00 81.53  ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1  185  ? -14.607 2.786   143.633 1.00 78.82  ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1  185  ? -14.651 4.045   145.551 1.00 77.72  ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1  186  ? -10.475 7.326   143.470 1.00 55.09  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1  186  ? -10.214 8.118   144.666 1.00 58.84  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1  186  ? -11.524 8.379   145.392 1.00 68.72  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1  186  ? -12.424 9.017   144.845 1.00 68.74  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1  186  ? -9.562  9.454   144.307 1.00 62.82  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1  186  ? -9.280  10.388  145.488 1.00 58.36  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1  186  ? -8.046  9.926   146.243 1.00 56.04  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1  186  ? -9.114  11.829  145.027 1.00 57.67  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1  187  ? -11.625 7.899   146.626 1.00 68.91  ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1  187  ? -12.852 8.045   147.385 1.00 70.71  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1  187  ? -14.004 7.357   146.681 1.00 70.95  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1  187  ? -13.933 6.167   146.372 1.00 62.26  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1  188  ? -15.066 8.111   146.418 1.00 78.28  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1  188  ? -16.247 7.566   145.759 1.00 83.53  ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1  188  ? -16.166 7.704   144.242 1.00 82.73  ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1  188  ? -17.042 7.219   143.523 1.00 81.88  ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1  188  ? -17.519 8.241   146.282 1.00 96.23  ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1  188  ? -17.808 7.973   147.754 1.00 99.82  ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1  188  ? -18.126 6.515   148.034 1.00 92.14  ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1  188  ? -18.675 5.813   147.184 1.00 95.12  ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1  188  ? -17.778 6.052   149.230 1.00 73.85  ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1  189  ? -15.114 8.362   143.761 1.00 77.10  ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  189  ? -14.923 8.552   142.327 1.00 65.11  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  189  ? -14.455 7.261   141.665 1.00 66.18  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  189  ? -13.644 6.525   142.224 1.00 60.95  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  189  ? -13.906 9.658   142.058 1.00 53.94  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  189  ? -14.166 10.949  142.806 1.00 63.71  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  189  ? -13.030 11.929  142.575 1.00 69.55  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  189  ? -13.053 13.046  143.514 1.00 73.31  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  189  ? -13.550 14.246  143.236 1.00 75.95  ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  189  ? -13.526 15.201  144.155 1.00 78.47  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  189  ? -14.067 14.490  142.039 1.00 76.84  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1  190  ? -14.966 6.997   140.467 1.00 70.13  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1  190  ? -14.599 5.801   139.719 1.00 62.67  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1  190  ? -14.217 6.146   138.287 1.00 57.18  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1  190  ? -14.447 7.264   137.822 1.00 60.12  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1  190  ? -15.747 4.782   139.672 1.00 64.12  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1  190  ? -16.880 5.371   139.021 1.00 65.54  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1  190  ? -16.134 4.343   141.076 1.00 67.71  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1  191  ? -13.628 5.171   137.602 1.00 54.42  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  191  ? -13.188 5.327   136.219 1.00 59.55  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  191  ? -12.133 6.426   136.075 1.00 58.17  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  191  ? -12.072 7.112   135.055 1.00 54.45  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  191  ? -14.380 5.576   135.287 1.00 57.05  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  191  ? -14.052 5.295   133.832 1.00 68.56  ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  191  ? -13.033 4.620   133.571 1.00 65.88  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  191  ? -14.817 5.743   132.952 1.00 74.89  ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1  192  ? -11.308 6.592   137.106 1.00 52.79  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1  192  ? -10.195 7.531   137.032 1.00 43.99  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1  192  ? -9.014  6.918   136.286 1.00 44.45  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1  192  ? -8.872  5.696   136.231 1.00 46.59  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1  192  ? -9.775  7.997   138.426 1.00 44.73  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1  192  ? -10.797 8.857   139.169 1.00 49.11  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1  192  ? -10.172 9.473   140.410 1.00 47.57  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1  192  ? -11.366 9.934   138.254 1.00 49.50  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1  193  ? -8.175  7.768   135.706 1.00 42.53  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1  193  ? -7.021  7.298   134.947 1.00 43.02  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1  193  ? -5.735  7.288   135.771 1.00 38.68  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1  193  ? -5.449  8.225   136.517 1.00 37.34  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1  193  ? -6.808  8.147   133.687 1.00 49.42  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1  193  ? -7.900  7.952   132.651 1.00 45.84  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1  193  ? -7.901  8.702   131.652 1.00 40.36  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1  193  ? -8.755  7.061   132.835 1.00 49.21  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1  194  ? -4.966  6.217   135.618 1.00 36.16  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1  194  ? -3.635  6.112   136.197 1.00 36.37  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1  194  ? -2.643  5.985   135.056 1.00 39.94  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1  194  ? -2.640  4.976   134.341 1.00 43.05  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1  194  ? -3.541  4.882   137.094 1.00 42.24  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1  194  ? -2.141  4.578   137.598 1.00 41.15  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1  194  ? -2.126  3.270   138.372 1.00 49.08  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1  194  ? -0.731  2.917   138.853 1.00 54.68  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1  194  ? -0.709  1.577   139.503 1.00 57.45  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1  195  ? -1.807  7.006   134.884 1.00 39.87  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1  195  ? -0.913  7.062   133.729 1.00 34.17  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1  195  ? 0.469   6.510   134.046 1.00 38.15  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1  195  ? 1.017   6.778   135.109 1.00 43.09  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1  195  ? -0.788  8.498   133.220 1.00 28.57  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1  195  ? 0.286   8.729   132.156 1.00 31.71  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1  195  ? -0.094  8.038   130.856 1.00 33.22  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1  195  ? 0.532   10.214  131.938 1.00 33.99  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1  196  ? 1.029   5.731   133.126 1.00 38.63  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1  196  ? 2.402   5.265   133.274 1.00 41.38  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1  196  ? 3.210   5.439   131.988 1.00 46.32  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1  196  ? 2.929   4.801   130.980 1.00 47.03  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1  196  ? 2.451   3.791   133.699 1.00 39.67  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1  196  ? 1.538   3.573   134.780 1.00 44.92  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1  196  ? 3.857   3.416   134.140 1.00 43.65  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1  197  ? 4.228   6.292   132.037 1.00 41.92  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1  197  ? 5.117   6.500   130.902 1.00 38.03  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1  197  ? 6.346   5.610   131.013 1.00 39.87  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1  197  ? 7.173   5.796   131.901 1.00 48.16  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1  197  ? 5.563   7.961   130.835 1.00 37.26  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1  197  ? 4.678   8.957   130.092 1.00 38.94  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1  197  ? 5.207   10.360  130.303 1.00 40.60  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1  197  ? 4.629   8.626   128.610 1.00 31.20  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1  198  ? 6.464   4.645   130.110 1.00 35.88  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1  198  ? 7.650   3.806   130.041 1.00 35.95  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1  198  ? 8.595   4.348   128.975 1.00 41.06  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1  198  ? 8.192   4.577   127.831 1.00 46.88  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1  198  ? 7.271   2.360   129.739 1.00 32.94  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1  198  ? 6.126   1.851   130.585 1.00 35.12  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1  198  ? 6.287   0.377   130.874 1.00 42.44  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1  198  ? 6.393   -0.417  129.656 1.00 45.80  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1  198  ? 6.726   -1.703  129.635 1.00 52.02  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1  198  ? 6.801   -2.355  128.482 1.00 53.85  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1  198  ? 6.988   -2.336  130.770 1.00 54.93  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1  199  ? 9.850   4.556   129.363 1.00 40.88  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  199  ? 10.838  5.188   128.497 1.00 37.09  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  199  ? 12.146  4.399   128.444 1.00 40.97  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  199  ? 12.752  4.115   129.479 1.00 54.52  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  199  ? 11.148  6.627   128.968 1.00 34.92  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  199  ? 9.877   7.480   128.968 1.00 34.54  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  199  ? 12.219  7.261   128.096 1.00 35.33  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  199  ? 10.103  8.908   129.403 1.00 37.00  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1  200  ? 12.568  4.047   127.233 1.00 35.28  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1  200  ? 13.870  3.434   126.999 1.00 34.72  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1  200  ? 14.732  4.383   126.176 1.00 39.29  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1  200  ? 14.317  4.825   125.099 1.00 42.70  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1  200  ? 13.729  2.137   126.206 1.00 34.68  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1  200  ? 12.964  1.042   126.866 1.00 35.63  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1  200  ? 13.480  -0.059  127.479 1.00 36.57  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1  200  ? 11.541  0.917   126.945 1.00 38.76  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1  200  ? 12.466  -0.858  127.949 1.00 39.87  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1  200  ? 11.265  -0.281  127.632 1.00 42.01  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1  200  ? 10.473  1.704   126.509 1.00 37.60  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1  200  ? 9.967   -0.707  127.895 1.00 46.80  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1  200  ? 9.187   1.278   126.768 1.00 40.53  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1  200  ? 8.944   0.084   127.455 1.00 46.89  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1  201  ? 15.933  4.678   126.665 1.00 40.32  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1  201  ? 16.873  5.507   125.916 1.00 41.12  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1  201  ? 18.215  4.810   125.730 1.00 48.21  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1  201  ? 18.391  3.660   126.136 1.00 48.55  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1  201  ? 17.118  6.861   126.595 1.00 45.05  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1  201  ? 17.845  6.662   127.813 1.00 53.93  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1  201  ? 15.799  7.561   126.889 1.00 48.62  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1  202  ? 19.158  5.522   125.118 1.00 51.19  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1  202  ? 20.466  4.965   124.780 1.00 56.37  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1  202  ? 21.498  5.192   125.882 1.00 57.59  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1  202  ? 22.650  4.771   125.763 1.00 58.21  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1  202  ? 20.974  5.560   123.461 1.00 58.45  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1  202  ? 21.194  7.064   123.542 1.00 51.54  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1  202  ? 20.640  7.703   124.459 1.00 50.55  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1  202  ? 21.916  7.611   122.682 1.00 47.98  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1  203  ? 21.083  5.865   126.950 1.00 52.59  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1  203  ? 21.978  6.151   128.054 1.00 51.95  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1  203  ? 22.686  7.483   127.905 1.00 50.97  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1  203  ? 23.205  8.022   128.882 1.00 50.70  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1  204  ? 22.716  8.007   126.682 1.00 50.92  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1  204  ? 23.283  9.327   126.425 1.00 51.14  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1  204  ? 22.612  10.351  127.331 1.00 51.88  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1  204  ? 23.278  11.149  127.990 1.00 52.79  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1  204  ? 23.099  9.715   124.960 1.00 51.69  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  204  ? 23.552  11.037  124.725 1.00 62.63  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1  205  ? 21.283  10.322  127.350 1.00 52.49  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  205  ? 20.516  11.001  128.386 1.00 59.61  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  205  ? 19.579  9.982   129.033 1.00 54.68  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  205  ? 19.171  9.007   128.400 1.00 48.91  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  205  ? 19.725  12.229  127.854 1.00 49.91  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  205  ? 20.588  13.055  126.904 1.00 42.23  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  205  ? 18.428  11.802  127.184 1.00 42.35  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1  206  ? 19.266  10.194  130.304 1.00 52.57  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1  206  ? 18.415  9.274   131.038 1.00 49.09  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1  206  ? 16.958  9.514   130.654 1.00 50.53  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1  206  ? 16.633  10.567  130.104 1.00 51.66  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1  206  ? 18.601  9.460   132.553 1.00 58.25  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1  206  ? 18.057  10.723  132.952 1.00 57.16  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1  206  ? 20.076  9.406   132.912 1.00 55.84  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1  207  ? 16.079  8.531   130.919 1.00 51.52  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1  207  ? 14.647  8.696   130.642 1.00 51.70  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1  207  ? 14.058  9.950   131.283 1.00 51.12  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1  207  ? 13.310  10.682  130.632 1.00 47.95  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1  207  ? 14.029  7.457   131.292 1.00 46.69  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1  207  ? 15.089  6.435   131.209 1.00 44.37  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1  207  ? 16.393  7.159   131.362 1.00 49.21  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1  208  ? 14.406  10.190  132.544 1.00 48.59  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1  208  ? 13.825  11.284  133.316 1.00 48.88  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1  208  ? 14.181  12.656  132.745 1.00 47.51  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1  208  ? 13.329  13.543  132.676 1.00 50.03  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1  208  ? 14.239  11.175  134.788 1.00 52.93  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1  208  ? 13.724  12.214  135.789 1.00 44.70  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1  208  ? 12.235  12.451  135.627 1.00 40.34  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1  208  ? 14.036  11.762  137.205 1.00 39.87  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1  209  ? 15.436  12.826  132.338 1.00 43.79  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1  209  ? 15.868  14.064  131.704 1.00 48.21  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1  209  ? 15.006  14.330  130.481 1.00 48.34  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1  209  ? 14.455  15.421  130.312 1.00 47.79  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1  209  ? 17.333  13.966  131.279 1.00 54.88  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1  209  ? 18.306  13.743  132.419 1.00 54.22  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1  209  ? 19.738  13.631  131.939 1.00 57.70  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1  209  ? 20.474  12.761  132.453 1.00 58.55  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1  209  ? 20.126  14.415  131.048 1.00 61.60  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1  210  ? 14.894  13.306  129.640 1.00 53.42  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1  210  ? 14.099  13.370  128.423 1.00 52.19  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1  210  ? 12.672  13.795  128.729 1.00 46.23  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1  210  ? 12.154  14.723  128.115 1.00 42.95  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1  210  ? 14.113  12.023  127.715 1.00 50.22  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1  211  ? 12.049  13.114  129.686 1.00 43.11  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1  211  ? 10.683  13.422  130.092 1.00 44.87  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1  211  ? 10.543  14.877  130.525 1.00 46.24  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1  211  ? 9.578   15.555  130.165 1.00 44.94  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1  211  ? 10.245  12.494  131.225 1.00 44.56  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1  211  ? 8.959   12.870  131.965 1.00 43.86  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1  211  ? 7.774   12.951  131.008 1.00 40.73  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1  211  ? 8.684   11.878  133.087 1.00 42.72  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1  212  ? 11.517  15.352  131.292 1.00 49.17  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1  212  ? 11.488  16.720  131.794 1.00 53.47  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1  212  ? 11.589  17.761  130.682 1.00 48.88  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1  212  ? 10.809  18.715  130.647 1.00 51.32  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1  212  ? 12.581  16.935  132.845 1.00 58.78  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1  212  ? 12.300  16.191  134.140 1.00 51.06  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1  212  ? 11.178  16.205  134.645 1.00 49.16  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1  212  ? 13.320  15.532  134.680 1.00 49.88  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1  213  ? 12.540  17.579  129.770 1.00 47.55  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1  213  ? 12.699  18.543  128.685 1.00 49.93  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1  213  ? 11.580  18.433  127.654 1.00 44.68  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1  213  ? 11.301  19.390  126.935 1.00 48.38  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1  213  ? 14.083  18.449  128.030 1.00 51.68  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1  213  ? 14.538  17.047  127.673 1.00 50.98  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1  213  ? 16.034  16.979  127.415 1.00 54.50  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1  213  ? 16.623  17.911  126.867 1.00 53.36  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1  213  ? 16.657  15.877  127.820 1.00 53.15  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1  214  ? 10.933  17.274  127.601 1.00 39.18  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1  214  ? 9.789   17.077  126.717 1.00 39.47  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1  214  ? 8.593   17.825  127.277 1.00 41.59  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1  214  ? 7.855   18.487  126.542 1.00 42.15  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1  214  ? 9.471   15.602  126.573 1.00 35.08  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1  215  ? 8.405   17.708  128.588 1.00 41.88  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1  215  ? 7.390   18.482  129.286 1.00 43.87  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1  215  ? 7.635   19.969  129.052 1.00 44.81  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1  215  ? 6.718   20.713  128.698 1.00 43.07  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1  215  ? 7.396   18.182  130.798 1.00 47.33  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1  215  ? 6.661   19.269  131.571 1.00 51.22  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1  215  ? 6.783   16.816  131.068 1.00 48.54  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1  216  ? 8.885   20.387  129.231 1.00 47.05  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1  216  ? 9.261   21.777  129.007 1.00 49.88  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1  216  ? 8.924   22.211  127.585 1.00 53.32  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1  216  ? 8.469   23.335  127.364 1.00 59.13  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1  216  ? 10.749  21.993  129.298 1.00 48.56  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1  216  ? 11.210  23.435  129.129 1.00 54.96  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1  216  ? 10.392  24.415  129.955 1.00 62.44  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1  216  ? 10.034  24.081  131.104 1.00 66.20  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1  216  ? 10.103  25.521  129.451 1.00 61.33  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1  217  ? 9.140   21.312  126.628 1.00 48.55  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1  217  ? 8.779   21.573  125.238 1.00 51.17  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1  217  ? 7.271   21.791  125.086 1.00 52.40  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1  217  ? 6.837   22.739  124.429 1.00 54.45  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1  217  ? 9.244   20.435  124.298 1.00 48.15  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1  217  ? 10.758  20.497  124.092 1.00 50.65  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1  217  ? 8.547   20.526  122.950 1.00 47.59  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1  217  ? 11.313  19.344  123.280 1.00 46.63  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1  218  ? 6.477   20.921  125.703 1.00 42.72  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1  218  ? 5.026   21.026  125.598 1.00 38.93  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1  218  ? 4.503   22.322  126.218 1.00 48.33  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1  218  ? 3.621   22.977  125.657 1.00 49.68  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1  218  ? 4.352   19.811  126.235 1.00 43.08  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1  218  ? 2.837   19.705  126.066 1.00 44.18  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1  218  ? 2.432   20.017  124.637 1.00 37.58  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1  218  ? 2.368   18.317  126.457 1.00 41.15  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1  219  ? 5.059   22.689  127.370 1.00 50.37  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1  219  ? 4.688   23.930  128.046 1.00 50.76  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1  219  ? 5.051   25.129  127.178 1.00 53.13  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1  219  ? 4.223   26.015  126.931 1.00 52.46  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1  219  ? 5.392   24.026  129.405 1.00 51.72  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1  219  ? 4.779   25.032  130.383 1.00 58.75  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1  219  ? 5.371   26.425  130.222 1.00 56.61  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1  219  ? 6.824   26.416  130.372 1.00 62.99  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1  219  ? 7.601   27.483  130.210 1.00 60.84  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1  219  ? 7.067   28.655  129.890 1.00 52.75  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1  219  ? 8.914   27.379  130.367 1.00 56.33  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1  220  ? 6.297   25.142  126.712 1.00 52.43  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  220  ? 6.805   26.232  125.890 1.00 56.51  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  220  ? 6.005   26.380  124.600 1.00 55.01  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  220  ? 5.878   27.478  124.061 1.00 58.43  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  220  ? 8.285   26.015  125.570 1.00 60.47  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  220  ? 8.937   27.180  124.849 1.00 68.00  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  220  ? 10.383  26.909  124.500 1.00 79.75  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  220  ? 10.861  25.789  124.781 1.00 85.09  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  220  ? 11.040  27.815  123.946 1.00 87.16  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1  221  ? 5.470   25.270  124.106 1.00 52.18  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1  221  ? 4.616   25.314  122.926 1.00 56.80  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1  221  ? 3.241   25.857  123.286 1.00 52.72  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1  221  ? 2.612   26.560  122.493 1.00 48.14  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1  221  ? 4.499   23.933  122.280 1.00 54.81  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1  221  ? 5.401   23.743  121.102 1.00 45.46  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1  221  ? 6.738   23.434  121.230 1.00 39.93  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1  221  ? 5.162   23.835  119.773 1.00 46.87  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1  221  ? 7.280   23.334  120.030 1.00 47.26  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1  221  ? 6.345   23.574  119.128 1.00 50.47  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1  222  ? 2.780   25.530  124.490 1.00 54.08  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1  222  ? 1.521   26.067  124.988 1.00 48.07  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1  222  ? 1.620   27.577  125.180 1.00 52.52  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1  222  ? 0.609   28.278  125.184 1.00 53.57  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1  222  ? 1.121   25.379  126.292 1.00 41.51  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1  222  ? 0.519   23.984  126.130 1.00 37.75  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1  222  ? 0.536   23.238  127.448 1.00 46.52  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1  222  ? -0.898  24.089  125.598 1.00 38.51  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1  223  ? 2.847   28.071  125.331 1.00 55.09  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1  223  ? 3.093   29.507  125.433 1.00 55.54  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1  223  ? 2.624   30.247  124.184 1.00 59.43  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1  223  ? 2.226   31.408  124.251 1.00 70.64  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1  223  ? 4.594   29.804  125.631 1.00 57.93  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1  223  ? 5.100   29.023  126.719 1.00 67.44  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1  223  ? 4.830   31.282  125.914 1.00 66.21  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1  224  ? 2.652   29.560  123.047 1.00 61.75  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1  224  ? 2.422   30.199  121.751 1.00 66.63  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1  224  ? 1.004   30.745  121.553 1.00 71.39  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1  224  ? 0.733   31.439  120.572 1.00 78.32  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1  224  ? 2.797   29.245  120.610 1.00 69.30  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1  224  ? 4.255   28.833  120.618 1.00 75.38  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1  224  ? 5.218   29.625  121.238 1.00 69.24  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1  224  ? 4.670   27.652  120.011 1.00 68.53  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1  224  ? 6.551   29.254  121.253 1.00 69.11  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1  224  ? 6.004   27.273  120.020 1.00 68.62  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1  224  ? 6.940   28.079  120.643 1.00 71.64  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1  224  ? 8.268   27.713  120.659 1.00 71.27  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1  225  ? 0.106   30.433  122.482 1.00 68.78  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1  225  ? -1.265  30.931  122.418 1.00 70.63  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1  225  ? -1.436  32.253  123.168 1.00 77.92  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1  225  ? -2.492  32.882  123.093 1.00 80.79  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1  225  ? -2.235  29.893  122.988 1.00 62.07  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1  225  ? -2.317  28.627  122.184 1.00 59.22  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1  225  ? -1.400  27.607  122.375 1.00 62.23  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1  225  ? -3.321  28.450  121.247 1.00 56.00  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1  225  ? -1.477  26.437  121.638 1.00 54.11  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1  225  ? -3.405  27.284  120.510 1.00 49.37  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1  225  ? -2.481  26.276  120.706 1.00 48.59  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1  226  ? -0.394  32.673  123.881 1.00 78.46  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1  226  ? -0.494  33.800  124.810 1.00 88.01  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1  226  ? -0.700  35.167  124.151 1.00 94.37  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1  226  ? -1.137  36.115  124.807 1.00 97.08  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1  226  ? 0.728   33.846  125.734 1.00 85.38  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1  226  ? 1.923   34.021  124.993 1.00 93.84  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1  227  ? -0.386  35.275  122.865 1.00 84.41  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1  227  ? -0.557  36.544  122.165 1.00 87.00  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1  227  ? -1.474  36.436  120.950 1.00 87.71  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1  227  ? -1.003  36.266  119.823 1.00 86.79  ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1  227  ? 0.799   37.129  121.761 1.00 90.87  ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1  227  ? 0.683   38.535  121.201 1.00 82.02  ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1  227  ? -0.291  39.240  121.460 1.00 79.62  ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1  227  ? 1.679   38.948  120.427 1.00 82.67  ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1  228  ? -2.792  36.536  121.180 1.00 83.70  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  228  ? -3.792  36.493  120.108 1.00 81.34  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  228  ? -3.630  37.666  119.148 1.00 80.72  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  228  ? -3.089  38.702  119.532 1.00 81.44  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  228  ? -5.119  36.611  120.863 1.00 81.79  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  228  ? -4.812  36.160  122.253 1.00 86.07  ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  228  ? -3.417  36.630  122.510 1.00 82.83  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  229  ? -4.090  37.500  117.913 1.00 84.87  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  229  ? -3.983  38.559  116.917 1.00 87.57  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  229  ? -5.172  38.535  115.961 1.00 88.07  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  229  ? -5.651  37.469  115.575 1.00 86.39  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  229  ? -2.668  38.429  116.149 1.00 79.52  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  229  ? -2.137  39.738  115.602 1.00 87.67  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  229  ? -0.624  39.766  115.561 1.00 91.32  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  229  ? 0.035   38.782  115.901 1.00 84.15  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  229  ? -0.062  40.899  115.152 1.00 87.73  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . ALA A 1  230  ? -5.644  39.717  115.581 1.00 89.99  ? 230  ALA A N     1 
ATOM   1784  C  CA    . ALA A 1  230  ? -6.820  39.832  114.726 1.00 96.13  ? 230  ALA A CA    1 
ATOM   1785  C  C     . ALA A 1  230  ? -6.530  39.388  113.296 1.00 101.17 ? 230  ALA A C     1 
ATOM   1786  O  O     . ALA A 1  230  ? -5.460  39.667  112.754 1.00 106.01 ? 230  ALA A O     1 
ATOM   1787  C  CB    . ALA A 1  230  ? -7.349  41.259  114.743 1.00 101.32 ? 230  ALA A CB    1 
ATOM   1788  N  N     . ALA A 1  231  ? -7.489  38.692  112.692 1.00 102.62 ? 231  ALA A N     1 
ATOM   1789  C  CA    . ALA A 1  231  ? -7.364  38.255  111.306 1.00 105.98 ? 231  ALA A CA    1 
ATOM   1790  C  C     . ALA A 1  231  ? -7.739  39.383  110.350 1.00 118.24 ? 231  ALA A C     1 
ATOM   1791  O  O     . ALA A 1  231  ? -8.849  39.914  110.403 1.00 113.91 ? 231  ALA A O     1 
ATOM   1792  C  CB    . ALA A 1  231  ? -8.228  37.032  111.052 1.00 92.49  ? 231  ALA A CB    1 
ATOM   1793  N  N     . ALA A 1  232  ? -6.809  39.736  109.469 1.00 125.67 ? 232  ALA A N     1 
ATOM   1794  C  CA    . ALA A 1  232  ? -6.998  40.849  108.546 1.00 121.62 ? 232  ALA A CA    1 
ATOM   1795  C  C     . ALA A 1  232  ? -7.661  40.395  107.247 1.00 126.78 ? 232  ALA A C     1 
ATOM   1796  O  O     . ALA A 1  232  ? -7.791  41.175  106.303 1.00 131.78 ? 232  ALA A O     1 
ATOM   1797  C  CB    . ALA A 1  232  ? -5.667  41.535  108.261 1.00 101.64 ? 232  ALA A CB    1 
ATOM   1798  N  N     . VAL A 1  233  ? -8.060  39.125  107.209 1.00 124.78 ? 233  VAL A N     1 
ATOM   1799  C  CA    . VAL A 1  233  ? -8.691  38.524  106.034 1.00 129.85 ? 233  VAL A CA    1 
ATOM   1800  C  C     . VAL A 1  233  ? -9.873  39.341  105.510 1.00 132.61 ? 233  VAL A C     1 
ATOM   1801  O  O     . VAL A 1  233  ? -10.036 39.508  104.300 1.00 131.53 ? 233  VAL A O     1 
ATOM   1802  C  CB    . VAL A 1  233  ? -9.176  37.090  106.336 1.00 130.51 ? 233  VAL A CB    1 
ATOM   1803  C  CG1   . VAL A 1  233  ? -9.637  36.401  105.059 1.00 119.84 ? 233  VAL A CG1   1 
ATOM   1804  C  CG2   . VAL A 1  233  ? -8.074  36.288  107.012 1.00 127.54 ? 233  VAL A CG2   1 
ATOM   1805  N  N     . ALA A 1  234  ? -10.691 39.849  106.427 1.00 129.04 ? 234  ALA A N     1 
ATOM   1806  C  CA    . ALA A 1  234  ? -11.851 40.654  106.057 1.00 124.25 ? 234  ALA A CA    1 
ATOM   1807  C  C     . ALA A 1  234  ? -11.430 41.996  105.461 1.00 124.01 ? 234  ALA A C     1 
ATOM   1808  O  O     . ALA A 1  234  ? -11.558 43.041  106.101 1.00 117.39 ? 234  ALA A O     1 
ATOM   1809  C  CB    . ALA A 1  234  ? -12.757 40.864  107.261 1.00 108.24 ? 234  ALA A CB    1 
ATOM   1810  N  N     . LEU B 1  2    ? 21.530  20.221  110.407 1.00 101.79 ? 2    LEU B N     1 
ATOM   1811  C  CA    . LEU B 1  2    ? 21.886  19.985  111.801 1.00 111.00 ? 2    LEU B CA    1 
ATOM   1812  C  C     . LEU B 1  2    ? 21.583  21.218  112.647 1.00 124.42 ? 2    LEU B C     1 
ATOM   1813  O  O     . LEU B 1  2    ? 20.748  21.170  113.552 1.00 129.61 ? 2    LEU B O     1 
ATOM   1814  C  CB    . LEU B 1  2    ? 23.364  19.598  111.920 1.00 92.82  ? 2    LEU B CB    1 
ATOM   1815  C  CG    . LEU B 1  2    ? 23.867  19.053  113.260 1.00 83.04  ? 2    LEU B CG    1 
ATOM   1816  C  CD1   . LEU B 1  2    ? 25.025  18.111  113.018 1.00 77.99  ? 2    LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B 1  2    ? 24.299  20.167  114.203 1.00 85.95  ? 2    LEU B CD2   1 
ATOM   1818  N  N     . ASP B 1  3    ? 22.270  22.318  112.351 1.00 119.07 ? 3    ASP B N     1 
ATOM   1819  C  CA    . ASP B 1  3    ? 22.044  23.572  113.058 1.00 117.63 ? 3    ASP B CA    1 
ATOM   1820  C  C     . ASP B 1  3    ? 20.661  24.089  112.687 1.00 127.05 ? 3    ASP B C     1 
ATOM   1821  O  O     . ASP B 1  3    ? 20.349  24.252  111.507 1.00 131.57 ? 3    ASP B O     1 
ATOM   1822  C  CB    . ASP B 1  3    ? 23.115  24.600  112.686 1.00 115.38 ? 3    ASP B CB    1 
ATOM   1823  C  CG    . ASP B 1  3    ? 24.524  24.111  112.981 1.00 109.55 ? 3    ASP B CG    1 
ATOM   1824  O  OD1   . ASP B 1  3    ? 24.719  23.431  114.010 1.00 105.36 ? 3    ASP B OD1   1 
ATOM   1825  O  OD2   . ASP B 1  3    ? 25.437  24.406  112.182 1.00 102.85 ? 3    ASP B OD2   1 
ATOM   1826  N  N     . SER B 1  4    ? 19.832  24.344  113.695 1.00 130.78 ? 4    SER B N     1 
ATOM   1827  C  CA    . SER B 1  4    ? 18.421  24.635  113.453 1.00 130.35 ? 4    SER B CA    1 
ATOM   1828  C  C     . SER B 1  4    ? 17.977  26.022  113.910 1.00 126.24 ? 4    SER B C     1 
ATOM   1829  O  O     . SER B 1  4    ? 18.414  26.524  114.947 1.00 124.48 ? 4    SER B O     1 
ATOM   1830  C  CB    . SER B 1  4    ? 17.538  23.562  114.099 1.00 123.06 ? 4    SER B CB    1 
ATOM   1831  O  OG    . SER B 1  4    ? 17.822  23.431  115.481 1.00 116.21 ? 4    SER B OG    1 
ATOM   1832  N  N     . LYS B 1  5    ? 17.098  26.628  113.117 1.00 122.44 ? 5    LYS B N     1 
ATOM   1833  C  CA    . LYS B 1  5    ? 16.494  27.911  113.449 1.00 126.38 ? 5    LYS B CA    1 
ATOM   1834  C  C     . LYS B 1  5    ? 14.978  27.756  113.493 1.00 125.87 ? 5    LYS B C     1 
ATOM   1835  O  O     . LYS B 1  5    ? 14.393  27.073  112.653 1.00 127.72 ? 5    LYS B O     1 
ATOM   1836  C  CB    . LYS B 1  5    ? 16.879  28.965  112.410 1.00 124.55 ? 5    LYS B CB    1 
ATOM   1837  C  CG    . LYS B 1  5    ? 16.585  28.549  110.974 1.00 115.61 ? 5    LYS B CG    1 
ATOM   1838  C  CD    . LYS B 1  5    ? 16.745  29.704  109.999 1.00 104.39 ? 5    LYS B CD    1 
ATOM   1839  C  CE    . LYS B 1  5    ? 16.360  29.281  108.589 1.00 81.01  ? 5    LYS B CE    1 
ATOM   1840  N  NZ    . LYS B 1  5    ? 16.421  30.410  107.624 1.00 55.74  ? 5    LYS B NZ    1 
ATOM   1841  N  N     . LEU B 1  6    ? 14.340  28.376  114.479 1.00 125.08 ? 6    LEU B N     1 
ATOM   1842  C  CA    . LEU B 1  6    ? 12.888  28.298  114.586 1.00 125.02 ? 6    LEU B CA    1 
ATOM   1843  C  C     . LEU B 1  6    ? 12.277  29.623  115.021 1.00 120.52 ? 6    LEU B C     1 
ATOM   1844  O  O     . LEU B 1  6    ? 12.694  30.206  116.021 1.00 121.35 ? 6    LEU B O     1 
ATOM   1845  C  CB    . LEU B 1  6    ? 12.491  27.186  115.557 1.00 124.18 ? 6    LEU B CB    1 
ATOM   1846  C  CG    . LEU B 1  6    ? 11.232  26.381  115.228 1.00 121.43 ? 6    LEU B CG    1 
ATOM   1847  C  CD1   . LEU B 1  6    ? 10.879  26.480  113.746 1.00 104.18 ? 6    LEU B CD1   1 
ATOM   1848  C  CD2   . LEU B 1  6    ? 11.435  24.927  115.639 1.00 102.99 ? 6    LEU B CD2   1 
ATOM   1849  N  N     . LYS B 1  7    ? 11.289  30.097  114.268 1.00 117.51 ? 7    LYS B N     1 
ATOM   1850  C  CA    . LYS B 1  7    ? 10.577  31.310  114.651 1.00 111.83 ? 7    LYS B CA    1 
ATOM   1851  C  C     . LYS B 1  7    ? 9.311   30.978  115.435 1.00 103.00 ? 7    LYS B C     1 
ATOM   1852  O  O     . LYS B 1  7    ? 8.624   30.000  115.134 1.00 98.91  ? 7    LYS B O     1 
ATOM   1853  C  CB    . LYS B 1  7    ? 10.251  32.184  113.431 1.00 95.92  ? 7    LYS B CB    1 
ATOM   1854  C  CG    . LYS B 1  7    ? 9.348   31.543  112.385 1.00 84.10  ? 7    LYS B CG    1 
ATOM   1855  C  CD    . LYS B 1  7    ? 8.612   32.616  111.581 1.00 83.32  ? 7    LYS B CD    1 
ATOM   1856  C  CE    . LYS B 1  7    ? 7.428   33.201  112.360 1.00 72.08  ? 7    LYS B CE    1 
ATOM   1857  N  NZ    . LYS B 1  7    ? 6.957   34.498  111.776 1.00 55.42  ? 7    LYS B NZ    1 
ATOM   1858  N  N     . ALA B 1  8    ? 9.021   31.790  116.450 1.00 96.96  ? 8    ALA B N     1 
ATOM   1859  C  CA    . ALA B 1  8    ? 7.813   31.633  117.252 1.00 80.83  ? 8    ALA B CA    1 
ATOM   1860  C  C     . ALA B 1  8    ? 6.586   31.888  116.394 1.00 76.82  ? 8    ALA B C     1 
ATOM   1861  O  O     . ALA B 1  8    ? 6.468   32.944  115.774 1.00 78.38  ? 8    ALA B O     1 
ATOM   1862  C  CB    . ALA B 1  8    ? 7.834   32.586  118.432 1.00 72.60  ? 8    ALA B CB    1 
ATOM   1863  N  N     . PRO B 1  9    ? 5.660   30.921  116.367 1.00 71.72  ? 9    PRO B N     1 
ATOM   1864  C  CA    . PRO B 1  9    ? 4.476   30.968  115.502 1.00 71.44  ? 9    PRO B CA    1 
ATOM   1865  C  C     . PRO B 1  9    ? 3.597   32.172  115.810 1.00 66.89  ? 9    PRO B C     1 
ATOM   1866  O  O     . PRO B 1  9    ? 3.657   32.706  116.916 1.00 73.56  ? 9    PRO B O     1 
ATOM   1867  C  CB    . PRO B 1  9    ? 3.723   29.687  115.867 1.00 74.66  ? 9    PRO B CB    1 
ATOM   1868  C  CG    . PRO B 1  9    ? 4.734   28.800  116.500 1.00 72.70  ? 9    PRO B CG    1 
ATOM   1869  C  CD    . PRO B 1  9    ? 5.699   29.703  117.193 1.00 69.97  ? 9    PRO B CD    1 
ATOM   1870  N  N     . VAL B 1  10   ? 2.788   32.587  114.843 1.00 60.12  ? 10   VAL B N     1 
ATOM   1871  C  CA    . VAL B 1  10   ? 1.882   33.707  115.046 1.00 68.58  ? 10   VAL B CA    1 
ATOM   1872  C  C     . VAL B 1  10   ? 0.448   33.219  115.269 1.00 74.17  ? 10   VAL B C     1 
ATOM   1873  O  O     . VAL B 1  10   ? -0.115  32.497  114.443 1.00 66.79  ? 10   VAL B O     1 
ATOM   1874  C  CB    . VAL B 1  10   ? 1.953   34.708  113.872 1.00 70.08  ? 10   VAL B CB    1 
ATOM   1875  C  CG1   . VAL B 1  10   ? 1.910   33.975  112.538 1.00 70.85  ? 10   VAL B CG1   1 
ATOM   1876  C  CG2   . VAL B 1  10   ? 0.839   35.742  113.975 1.00 77.70  ? 10   VAL B CG2   1 
ATOM   1877  N  N     . PHE B 1  11   ? -0.132  33.618  116.398 1.00 77.71  ? 11   PHE B N     1 
ATOM   1878  C  CA    . PHE B 1  11   ? -1.464  33.167  116.790 1.00 72.31  ? 11   PHE B CA    1 
ATOM   1879  C  C     . PHE B 1  11   ? -2.530  34.028  116.119 1.00 67.81  ? 11   PHE B C     1 
ATOM   1880  O  O     . PHE B 1  11   ? -2.589  35.238  116.335 1.00 74.38  ? 11   PHE B O     1 
ATOM   1881  C  CB    . PHE B 1  11   ? -1.604  33.225  118.316 1.00 75.15  ? 11   PHE B CB    1 
ATOM   1882  C  CG    . PHE B 1  11   ? -2.810  32.501  118.853 1.00 77.14  ? 11   PHE B CG    1 
ATOM   1883  C  CD1   . PHE B 1  11   ? -3.247  31.325  118.268 1.00 71.21  ? 11   PHE B CD1   1 
ATOM   1884  C  CD2   . PHE B 1  11   ? -3.492  32.987  119.959 1.00 80.02  ? 11   PHE B CD2   1 
ATOM   1885  C  CE1   . PHE B 1  11   ? -4.352  30.654  118.765 1.00 68.50  ? 11   PHE B CE1   1 
ATOM   1886  C  CE2   . PHE B 1  11   ? -4.597  32.320  120.462 1.00 76.76  ? 11   PHE B CE2   1 
ATOM   1887  C  CZ    . PHE B 1  11   ? -5.027  31.151  119.864 1.00 68.15  ? 11   PHE B CZ    1 
ATOM   1888  N  N     . THR B 1  12   ? -3.370  33.398  115.305 1.00 61.54  ? 12   THR B N     1 
ATOM   1889  C  CA    . THR B 1  12   ? -4.373  34.118  114.529 1.00 64.20  ? 12   THR B CA    1 
ATOM   1890  C  C     . THR B 1  12   ? -5.788  33.803  115.003 1.00 66.67  ? 12   THR B C     1 
ATOM   1891  O  O     . THR B 1  12   ? -6.170  32.638  115.118 1.00 62.78  ? 12   THR B O     1 
ATOM   1892  C  CB    . THR B 1  12   ? -4.261  33.781  113.035 1.00 70.42  ? 12   THR B CB    1 
ATOM   1893  O  OG1   . THR B 1  12   ? -2.912  33.987  112.598 1.00 69.86  ? 12   THR B OG1   1 
ATOM   1894  C  CG2   . THR B 1  12   ? -5.203  34.654  112.216 1.00 76.70  ? 12   THR B CG2   1 
ATOM   1895  N  N     . VAL B 1  13   ? -6.565  34.848  115.268 1.00 75.52  ? 13   VAL B N     1 
ATOM   1896  C  CA    . VAL B 1  13   ? -7.907  34.682  115.814 1.00 70.19  ? 13   VAL B CA    1 
ATOM   1897  C  C     . VAL B 1  13   ? -8.978  35.288  114.912 1.00 63.74  ? 13   VAL B C     1 
ATOM   1898  O  O     . VAL B 1  13   ? -8.863  36.431  114.475 1.00 65.07  ? 13   VAL B O     1 
ATOM   1899  C  CB    . VAL B 1  13   ? -8.024  35.315  117.213 1.00 71.57  ? 13   VAL B CB    1 
ATOM   1900  C  CG1   . VAL B 1  13   ? -9.312  34.879  117.880 1.00 63.31  ? 13   VAL B CG1   1 
ATOM   1901  C  CG2   . VAL B 1  13   ? -6.827  34.935  118.073 1.00 72.60  ? 13   VAL B CG2   1 
ATOM   1902  N  N     . ARG B 1  14   ? -10.017 34.508  114.638 1.00 65.06  ? 14   ARG B N     1 
ATOM   1903  C  CA    . ARG B 1  14   ? -11.142 34.967  113.835 1.00 67.25  ? 14   ARG B CA    1 
ATOM   1904  C  C     . ARG B 1  14   ? -12.432 34.589  114.561 1.00 72.58  ? 14   ARG B C     1 
ATOM   1905  O  O     . ARG B 1  14   ? -12.740 33.407  114.702 1.00 68.61  ? 14   ARG B O     1 
ATOM   1906  C  CB    . ARG B 1  14   ? -11.083 34.302  112.459 1.00 70.95  ? 14   ARG B CB    1 
ATOM   1907  C  CG    . ARG B 1  14   ? -11.723 35.088  111.327 1.00 83.05  ? 14   ARG B CG    1 
ATOM   1908  C  CD    . ARG B 1  14   ? -10.957 34.902  110.011 1.00 90.93  ? 14   ARG B CD    1 
ATOM   1909  N  NE    . ARG B 1  14   ? -10.825 33.500  109.610 1.00 90.54  ? 14   ARG B NE    1 
ATOM   1910  C  CZ    . ARG B 1  14   ? -9.725  32.769  109.772 1.00 91.41  ? 14   ARG B CZ    1 
ATOM   1911  N  NH1   . ARG B 1  14   ? -8.645  33.299  110.331 1.00 98.62  ? 14   ARG B NH1   1 
ATOM   1912  N  NH2   . ARG B 1  14   ? -9.703  31.502  109.376 1.00 78.48  ? 14   ARG B NH2   1 
ATOM   1913  N  N     . THR B 1  15   ? -13.190 35.589  115.010 1.00 78.46  ? 15   THR B N     1 
ATOM   1914  C  CA    . THR B 1  15   ? -14.337 35.345  115.890 1.00 76.56  ? 15   THR B CA    1 
ATOM   1915  C  C     . THR B 1  15   ? -15.643 35.973  115.414 1.00 77.34  ? 15   THR B C     1 
ATOM   1916  O  O     . THR B 1  15   ? -15.686 37.153  115.067 1.00 80.16  ? 15   THR B O     1 
ATOM   1917  C  CB    . THR B 1  15   ? -14.078 35.881  117.312 1.00 76.35  ? 15   THR B CB    1 
ATOM   1918  O  OG1   . THR B 1  15   ? -13.842 37.293  117.256 1.00 76.92  ? 15   THR B OG1   1 
ATOM   1919  C  CG2   . THR B 1  15   ? -12.880 35.198  117.940 1.00 77.95  ? 15   THR B CG2   1 
ATOM   1920  N  N     . GLN B 1  16   ? -16.711 35.181  115.423 1.00 76.99  ? 16   GLN B N     1 
ATOM   1921  C  CA    . GLN B 1  16   ? -18.046 35.706  115.166 1.00 87.23  ? 16   GLN B CA    1 
ATOM   1922  C  C     . GLN B 1  16   ? -18.888 35.602  116.429 1.00 96.72  ? 16   GLN B C     1 
ATOM   1923  O  O     . GLN B 1  16   ? -19.318 34.511  116.810 1.00 88.14  ? 16   GLN B O     1 
ATOM   1924  C  CB    . GLN B 1  16   ? -18.722 34.928  114.040 1.00 84.79  ? 16   GLN B CB    1 
ATOM   1925  C  CG    . GLN B 1  16   ? -17.944 34.905  112.740 1.00 92.11  ? 16   GLN B CG    1 
ATOM   1926  C  CD    . GLN B 1  16   ? -18.644 34.098  111.666 1.00 102.91 ? 16   GLN B CD    1 
ATOM   1927  O  OE1   . GLN B 1  16   ? -19.803 33.711  111.821 1.00 104.39 ? 16   GLN B OE1   1 
ATOM   1928  N  NE2   . GLN B 1  16   ? -17.941 33.837  110.569 1.00 94.48  ? 16   GLN B NE2   1 
ATOM   1929  N  N     . GLY B 1  17   ? -19.144 36.745  117.059 1.00 104.36 ? 17   GLY B N     1 
ATOM   1930  C  CA    . GLY B 1  17   ? -19.890 36.786  118.304 1.00 99.73  ? 17   GLY B CA    1 
ATOM   1931  C  C     . GLY B 1  17   ? -19.246 35.969  119.409 1.00 83.43  ? 17   GLY B C     1 
ATOM   1932  O  O     . GLY B 1  17   ? -18.033 35.760  119.419 1.00 81.04  ? 17   GLY B O     1 
ATOM   1933  N  N     . ARG B 1  18   ? -20.066 35.514  120.350 1.00 78.35  ? 18   ARG B N     1 
ATOM   1934  C  CA    . ARG B 1  18   ? -19.593 34.674  121.443 1.00 81.69  ? 18   ARG B CA    1 
ATOM   1935  C  C     . ARG B 1  18   ? -19.824 33.199  121.133 1.00 80.67  ? 18   ARG B C     1 
ATOM   1936  O  O     . ARG B 1  18   ? -19.467 32.326  121.924 1.00 79.44  ? 18   ARG B O     1 
ATOM   1937  C  CB    . ARG B 1  18   ? -20.309 35.047  122.744 1.00 82.44  ? 18   ARG B CB    1 
ATOM   1938  C  CG    . ARG B 1  18   ? -20.119 36.495  123.170 1.00 81.88  ? 18   ARG B CG    1 
ATOM   1939  C  CD    . ARG B 1  18   ? -21.071 36.873  124.295 1.00 71.02  ? 18   ARG B CD    1 
ATOM   1940  N  NE    . ARG B 1  18   ? -20.978 35.954  125.424 1.00 66.16  ? 18   ARG B NE    1 
ATOM   1941  C  CZ    . ARG B 1  18   ? -20.072 36.051  126.391 1.00 67.24  ? 18   ARG B CZ    1 
ATOM   1942  N  NH1   . ARG B 1  18   ? -20.062 35.170  127.382 1.00 63.20  ? 18   ARG B NH1   1 
ATOM   1943  N  NH2   . ARG B 1  18   ? -19.173 37.027  126.367 1.00 65.70  ? 18   ARG B NH2   1 
ATOM   1944  N  N     . GLU B 1  19   ? -20.437 32.930  119.985 1.00 83.46  ? 19   GLU B N     1 
ATOM   1945  C  CA    . GLU B 1  19   ? -20.844 31.574  119.624 1.00 80.69  ? 19   GLU B CA    1 
ATOM   1946  C  C     . GLU B 1  19   ? -19.791 30.753  118.877 1.00 77.46  ? 19   GLU B C     1 
ATOM   1947  O  O     . GLU B 1  19   ? -19.912 29.531  118.779 1.00 70.71  ? 19   GLU B O     1 
ATOM   1948  C  CB    . GLU B 1  19   ? -22.117 31.632  118.777 1.00 82.37  ? 19   GLU B CB    1 
ATOM   1949  C  CG    . GLU B 1  19   ? -23.337 32.143  119.514 1.00 76.14  ? 19   GLU B CG    1 
ATOM   1950  C  CD    . GLU B 1  19   ? -23.980 31.071  120.359 1.00 75.20  ? 19   GLU B CD    1 
ATOM   1951  O  OE1   . GLU B 1  19   ? -24.934 31.383  121.102 1.00 85.65  ? 19   GLU B OE1   1 
ATOM   1952  O  OE2   . GLU B 1  19   ? -23.532 29.910  120.273 1.00 76.40  ? 19   GLU B OE2   1 
ATOM   1953  N  N     . TYR B 1  20   ? -18.764 31.413  118.352 1.00 76.70  ? 20   TYR B N     1 
ATOM   1954  C  CA    . TYR B 1  20   ? -17.843 30.738  117.442 1.00 68.09  ? 20   TYR B CA    1 
ATOM   1955  C  C     . TYR B 1  20   ? -16.485 31.428  117.331 1.00 69.75  ? 20   TYR B C     1 
ATOM   1956  O  O     . TYR B 1  20   ? -16.351 32.613  117.633 1.00 76.53  ? 20   TYR B O     1 
ATOM   1957  C  CB    . TYR B 1  20   ? -18.489 30.626  116.056 1.00 68.22  ? 20   TYR B CB    1 
ATOM   1958  C  CG    . TYR B 1  20   ? -17.642 29.917  115.027 1.00 72.02  ? 20   TYR B CG    1 
ATOM   1959  C  CD1   . TYR B 1  20   ? -16.924 30.632  114.077 1.00 77.97  ? 20   TYR B CD1   1 
ATOM   1960  C  CD2   . TYR B 1  20   ? -17.553 28.533  115.011 1.00 74.61  ? 20   TYR B CD2   1 
ATOM   1961  C  CE1   . TYR B 1  20   ? -16.143 29.986  113.135 1.00 73.72  ? 20   TYR B CE1   1 
ATOM   1962  C  CE2   . TYR B 1  20   ? -16.775 27.878  114.074 1.00 74.02  ? 20   TYR B CE2   1 
ATOM   1963  C  CZ    . TYR B 1  20   ? -16.072 28.608  113.139 1.00 72.12  ? 20   TYR B CZ    1 
ATOM   1964  O  OH    . TYR B 1  20   ? -15.300 27.954  112.208 1.00 67.42  ? 20   TYR B OH    1 
ATOM   1965  N  N     . GLY B 1  21   ? -15.483 30.674  116.890 1.00 63.55  ? 21   GLY B N     1 
ATOM   1966  C  CA    . GLY B 1  21   ? -14.181 31.235  116.581 1.00 73.33  ? 21   GLY B CA    1 
ATOM   1967  C  C     . GLY B 1  21   ? -13.298 30.276  115.803 1.00 73.39  ? 21   GLY B C     1 
ATOM   1968  O  O     . GLY B 1  21   ? -13.470 29.060  115.879 1.00 70.43  ? 21   GLY B O     1 
ATOM   1969  N  N     . GLU B 1  22   ? -12.349 30.826  115.049 1.00 69.54  ? 22   GLU B N     1 
ATOM   1970  C  CA    . GLU B 1  22   ? -11.350 30.023  114.354 1.00 56.47  ? 22   GLU B CA    1 
ATOM   1971  C  C     . GLU B 1  22   ? -9.975  30.394  114.873 1.00 57.90  ? 22   GLU B C     1 
ATOM   1972  O  O     . GLU B 1  22   ? -9.705  31.561  115.152 1.00 65.24  ? 22   GLU B O     1 
ATOM   1973  C  CB    . GLU B 1  22   ? -11.404 30.250  112.845 1.00 62.51  ? 22   GLU B CB    1 
ATOM   1974  C  CG    . GLU B 1  22   ? -12.678 29.768  112.182 1.00 71.78  ? 22   GLU B CG    1 
ATOM   1975  C  CD    . GLU B 1  22   ? -12.564 29.730  110.669 1.00 78.24  ? 22   GLU B CD    1 
ATOM   1976  O  OE1   . GLU B 1  22   ? -11.432 29.561  110.164 1.00 80.85  ? 22   GLU B OE1   1 
ATOM   1977  O  OE2   . GLU B 1  22   ? -13.603 29.873  109.988 1.00 68.94  ? 22   GLU B OE2   1 
ATOM   1978  N  N     . PHE B 1  23   ? -9.106  29.401  115.009 1.00 52.91  ? 23   PHE B N     1 
ATOM   1979  C  CA    . PHE B 1  23   ? -7.792  29.637  115.590 1.00 54.96  ? 23   PHE B CA    1 
ATOM   1980  C  C     . PHE B 1  23   ? -6.681  29.004  114.761 1.00 54.28  ? 23   PHE B C     1 
ATOM   1981  O  O     . PHE B 1  23   ? -6.620  27.785  114.610 1.00 55.26  ? 23   PHE B O     1 
ATOM   1982  C  CB    . PHE B 1  23   ? -7.763  29.135  117.033 1.00 54.58  ? 23   PHE B CB    1 
ATOM   1983  C  CG    . PHE B 1  23   ? -8.739  29.840  117.932 1.00 58.17  ? 23   PHE B CG    1 
ATOM   1984  C  CD1   . PHE B 1  23   ? -8.326  30.889  118.736 1.00 57.36  ? 23   PHE B CD1   1 
ATOM   1985  C  CD2   . PHE B 1  23   ? -10.074 29.463  117.963 1.00 57.29  ? 23   PHE B CD2   1 
ATOM   1986  C  CE1   . PHE B 1  23   ? -9.221  31.542  119.557 1.00 62.33  ? 23   PHE B CE1   1 
ATOM   1987  C  CE2   . PHE B 1  23   ? -10.975 30.116  118.777 1.00 58.46  ? 23   PHE B CE2   1 
ATOM   1988  C  CZ    . PHE B 1  23   ? -10.548 31.156  119.578 1.00 66.64  ? 23   PHE B CZ    1 
ATOM   1989  N  N     . VAL B 1  24   ? -5.802  29.845  114.229 1.00 53.67  ? 24   VAL B N     1 
ATOM   1990  C  CA    . VAL B 1  24   ? -4.746  29.386  113.338 1.00 56.23  ? 24   VAL B CA    1 
ATOM   1991  C  C     . VAL B 1  24   ? -3.364  29.610  113.938 1.00 59.44  ? 24   VAL B C     1 
ATOM   1992  O  O     . VAL B 1  24   ? -2.989  30.739  114.255 1.00 66.50  ? 24   VAL B O     1 
ATOM   1993  C  CB    . VAL B 1  24   ? -4.815  30.098  111.974 1.00 64.51  ? 24   VAL B CB    1 
ATOM   1994  C  CG1   . VAL B 1  24   ? -3.674  29.640  111.080 1.00 62.58  ? 24   VAL B CG1   1 
ATOM   1995  C  CG2   . VAL B 1  24   ? -6.164  29.851  111.308 1.00 67.40  ? 24   VAL B CG2   1 
ATOM   1996  N  N     . LEU B 1  25   ? -2.607  28.531  114.096 1.00 50.69  ? 25   LEU B N     1 
ATOM   1997  C  CA    . LEU B 1  25   ? -1.249  28.640  114.596 1.00 49.09  ? 25   LEU B CA    1 
ATOM   1998  C  C     . LEU B 1  25   ? -0.275  28.096  113.559 1.00 63.10  ? 25   LEU B C     1 
ATOM   1999  O  O     . LEU B 1  25   ? -0.228  26.891  113.314 1.00 69.71  ? 25   LEU B O     1 
ATOM   2000  C  CB    . LEU B 1  25   ? -1.114  27.867  115.907 1.00 42.02  ? 25   LEU B CB    1 
ATOM   2001  C  CG    . LEU B 1  25   ? 0.118   28.159  116.761 1.00 50.58  ? 25   LEU B CG    1 
ATOM   2002  C  CD1   . LEU B 1  25   ? 0.122   29.612  117.199 1.00 64.55  ? 25   LEU B CD1   1 
ATOM   2003  C  CD2   . LEU B 1  25   ? 0.160   27.237  117.968 1.00 49.53  ? 25   LEU B CD2   1 
ATOM   2004  N  N     . GLU B 1  26   ? 0.498   28.990  112.948 1.00 66.68  ? 26   GLU B N     1 
ATOM   2005  C  CA    . GLU B 1  26   ? 1.503   28.602  111.961 1.00 63.87  ? 26   GLU B CA    1 
ATOM   2006  C  C     . GLU B 1  26   ? 2.698   29.550  112.017 1.00 62.64  ? 26   GLU B C     1 
ATOM   2007  O  O     . GLU B 1  26   ? 2.552   30.700  112.426 1.00 74.85  ? 26   GLU B O     1 
ATOM   2008  C  CB    . GLU B 1  26   ? 0.897   28.590  110.552 1.00 58.23  ? 26   GLU B CB    1 
ATOM   2009  C  CG    . GLU B 1  26   ? 0.280   29.914  110.116 1.00 66.51  ? 26   GLU B CG    1 
ATOM   2010  C  CD    . GLU B 1  26   ? -0.247  29.877  108.687 1.00 70.14  ? 26   GLU B CD    1 
ATOM   2011  O  OE1   . GLU B 1  26   ? 0.076   28.917  107.955 1.00 57.62  ? 26   GLU B OE1   1 
ATOM   2012  O  OE2   . GLU B 1  26   ? -0.984  30.808  108.295 1.00 68.02  ? 26   GLU B OE2   1 
ATOM   2013  N  N     . PRO B 1  27   ? 3.890   29.074  111.618 1.00 57.82  ? 27   PRO B N     1 
ATOM   2014  C  CA    . PRO B 1  27   ? 4.268   27.693  111.300 1.00 59.82  ? 27   PRO B CA    1 
ATOM   2015  C  C     . PRO B 1  27   ? 4.590   26.889  112.557 1.00 64.05  ? 27   PRO B C     1 
ATOM   2016  O  O     . PRO B 1  27   ? 4.949   27.475  113.580 1.00 65.09  ? 27   PRO B O     1 
ATOM   2017  C  CB    . PRO B 1  27   ? 5.533   27.876  110.468 1.00 64.50  ? 27   PRO B CB    1 
ATOM   2018  C  CG    . PRO B 1  27   ? 6.165   29.089  111.057 1.00 71.00  ? 27   PRO B CG    1 
ATOM   2019  C  CD    . PRO B 1  27   ? 5.026   29.998  111.445 1.00 66.07  ? 27   PRO B CD    1 
ATOM   2020  N  N     . LEU B 1  28   ? 4.483   25.567  112.474 1.00 56.73  ? 28   LEU B N     1 
ATOM   2021  C  CA    . LEU B 1  28   ? 4.858   24.694  113.581 1.00 48.61  ? 28   LEU B CA    1 
ATOM   2022  C  C     . LEU B 1  28   ? 5.829   23.628  113.105 1.00 50.09  ? 28   LEU B C     1 
ATOM   2023  O  O     . LEU B 1  28   ? 5.834   23.270  111.929 1.00 55.00  ? 28   LEU B O     1 
ATOM   2024  C  CB    . LEU B 1  28   ? 3.624   24.026  114.186 1.00 56.46  ? 28   LEU B CB    1 
ATOM   2025  C  CG    . LEU B 1  28   ? 2.921   24.738  115.339 1.00 49.35  ? 28   LEU B CG    1 
ATOM   2026  C  CD1   . LEU B 1  28   ? 1.610   24.042  115.660 1.00 41.79  ? 28   LEU B CD1   1 
ATOM   2027  C  CD2   . LEU B 1  28   ? 3.823   24.773  116.563 1.00 54.39  ? 28   LEU B CD2   1 
ATOM   2028  N  N     . GLU B 1  29   ? 6.644   23.118  114.024 1.00 51.78  ? 29   GLU B N     1 
ATOM   2029  C  CA    . GLU B 1  29   ? 7.589   22.055  113.697 1.00 58.53  ? 29   GLU B CA    1 
ATOM   2030  C  C     . GLU B 1  29   ? 6.824   20.785  113.329 1.00 53.13  ? 29   GLU B C     1 
ATOM   2031  O  O     . GLU B 1  29   ? 5.676   20.611  113.732 1.00 59.67  ? 29   GLU B O     1 
ATOM   2032  C  CB    . GLU B 1  29   ? 8.539   21.800  114.872 1.00 64.40  ? 29   GLU B CB    1 
ATOM   2033  C  CG    . GLU B 1  29   ? 9.743   20.922  114.539 1.00 70.86  ? 29   GLU B CG    1 
ATOM   2034  C  CD    . GLU B 1  29   ? 10.659  21.546  113.499 1.00 76.21  ? 29   GLU B CD    1 
ATOM   2035  O  OE1   . GLU B 1  29   ? 10.397  21.374  112.288 1.00 66.37  ? 29   GLU B OE1   1 
ATOM   2036  O  OE2   . GLU B 1  29   ? 11.643  22.206  113.895 1.00 80.50  ? 29   GLU B OE2   1 
ATOM   2037  N  N     . ARG B 1  30   ? 7.459   19.908  112.560 1.00 47.91  ? 30   ARG B N     1 
ATOM   2038  C  CA    . ARG B 1  30   ? 6.799   18.721  112.026 1.00 46.55  ? 30   ARG B CA    1 
ATOM   2039  C  C     . ARG B 1  30   ? 6.165   17.831  113.090 1.00 46.96  ? 30   ARG B C     1 
ATOM   2040  O  O     . ARG B 1  30   ? 6.823   17.416  114.043 1.00 48.99  ? 30   ARG B O     1 
ATOM   2041  C  CB    . ARG B 1  30   ? 7.790   17.897  111.211 1.00 56.54  ? 30   ARG B CB    1 
ATOM   2042  C  CG    . ARG B 1  30   ? 7.245   16.555  110.768 1.00 66.23  ? 30   ARG B CG    1 
ATOM   2043  C  CD    . ARG B 1  30   ? 8.251   15.825  109.904 1.00 59.06  ? 30   ARG B CD    1 
ATOM   2044  N  NE    . ARG B 1  30   ? 8.773   14.632  110.560 1.00 47.80  ? 30   ARG B NE    1 
ATOM   2045  C  CZ    . ARG B 1  30   ? 9.955   14.092  110.285 1.00 53.63  ? 30   ARG B CZ    1 
ATOM   2046  N  NH1   . ARG B 1  30   ? 10.744  14.647  109.374 1.00 54.18  ? 30   ARG B NH1   1 
ATOM   2047  N  NH2   . ARG B 1  30   ? 10.353  13.003  110.928 1.00 62.50  ? 30   ARG B NH2   1 
ATOM   2048  N  N     . GLY B 1  31   ? 4.883   17.530  112.908 1.00 43.09  ? 31   GLY B N     1 
ATOM   2049  C  CA    . GLY B 1  31   ? 4.163   16.663  113.821 1.00 46.65  ? 31   GLY B CA    1 
ATOM   2050  C  C     . GLY B 1  31   ? 3.475   17.401  114.956 1.00 43.57  ? 31   GLY B C     1 
ATOM   2051  O  O     . GLY B 1  31   ? 2.548   16.878  115.576 1.00 38.40  ? 31   GLY B O     1 
ATOM   2052  N  N     . PHE B 1  32   ? 3.924   18.623  115.226 1.00 48.60  ? 32   PHE B N     1 
ATOM   2053  C  CA    . PHE B 1  32   ? 3.394   19.404  116.341 1.00 44.67  ? 32   PHE B CA    1 
ATOM   2054  C  C     . PHE B 1  32   ? 2.010   19.982  116.075 1.00 40.83  ? 32   PHE B C     1 
ATOM   2055  O  O     . PHE B 1  32   ? 1.403   20.581  116.958 1.00 45.27  ? 32   PHE B O     1 
ATOM   2056  C  CB    . PHE B 1  32   ? 4.365   20.511  116.752 1.00 42.75  ? 32   PHE B CB    1 
ATOM   2057  C  CG    . PHE B 1  32   ? 5.432   20.054  117.700 1.00 37.80  ? 32   PHE B CG    1 
ATOM   2058  C  CD1   . PHE B 1  32   ? 6.690   19.717  117.236 1.00 40.13  ? 32   PHE B CD1   1 
ATOM   2059  C  CD2   . PHE B 1  32   ? 5.173   19.955  119.055 1.00 38.82  ? 32   PHE B CD2   1 
ATOM   2060  C  CE1   . PHE B 1  32   ? 7.674   19.295  118.107 1.00 41.10  ? 32   PHE B CE1   1 
ATOM   2061  C  CE2   . PHE B 1  32   ? 6.153   19.534  119.933 1.00 44.50  ? 32   PHE B CE2   1 
ATOM   2062  C  CZ    . PHE B 1  32   ? 7.405   19.202  119.457 1.00 44.43  ? 32   PHE B CZ    1 
ATOM   2063  N  N     . GLY B 1  33   ? 1.517   19.815  114.856 1.00 38.56  ? 33   GLY B N     1 
ATOM   2064  C  CA    . GLY B 1  33   ? 0.158   20.212  114.553 1.00 46.42  ? 33   GLY B CA    1 
ATOM   2065  C  C     . GLY B 1  33   ? -0.835  19.404  115.368 1.00 40.32  ? 33   GLY B C     1 
ATOM   2066  O  O     . GLY B 1  33   ? -1.707  19.961  116.034 1.00 37.80  ? 33   GLY B O     1 
ATOM   2067  N  N     . VAL B 1  34   ? -0.695  18.084  115.320 1.00 37.60  ? 34   VAL B N     1 
ATOM   2068  C  CA    . VAL B 1  34   ? -1.612  17.193  116.017 1.00 38.11  ? 34   VAL B CA    1 
ATOM   2069  C  C     . VAL B 1  34   ? -1.181  16.972  117.460 1.00 41.21  ? 34   VAL B C     1 
ATOM   2070  O  O     . VAL B 1  34   ? -1.953  16.470  118.277 1.00 40.18  ? 34   VAL B O     1 
ATOM   2071  C  CB    . VAL B 1  34   ? -1.703  15.828  115.315 1.00 45.67  ? 34   VAL B CB    1 
ATOM   2072  C  CG1   . VAL B 1  34   ? -2.112  16.009  113.863 1.00 51.02  ? 34   VAL B CG1   1 
ATOM   2073  C  CG2   . VAL B 1  34   ? -0.373  15.092  115.411 1.00 39.75  ? 34   VAL B CG2   1 
ATOM   2074  N  N     . THR B 1  35   ? 0.054   17.353  117.771 1.00 38.90  ? 35   THR B N     1 
ATOM   2075  C  CA    . THR B 1  35   ? 0.578   17.198  119.122 1.00 34.83  ? 35   THR B CA    1 
ATOM   2076  C  C     . THR B 1  35   ? -0.141  18.139  120.090 1.00 35.33  ? 35   THR B C     1 
ATOM   2077  O  O     . THR B 1  35   ? -0.503  17.741  121.193 1.00 34.49  ? 35   THR B O     1 
ATOM   2078  C  CB    . THR B 1  35   ? 2.104   17.418  119.168 1.00 35.19  ? 35   THR B CB    1 
ATOM   2079  O  OG1   . THR B 1  35   ? 2.760   16.354  118.467 1.00 33.21  ? 35   THR B OG1   1 
ATOM   2080  C  CG2   . THR B 1  35   ? 2.603   17.440  120.599 1.00 35.53  ? 35   THR B CG2   1 
ATOM   2081  N  N     . LEU B 1  36   ? -0.342  19.386  119.677 1.00 36.41  ? 36   LEU B N     1 
ATOM   2082  C  CA    . LEU B 1  36   ? -1.146  20.323  120.456 1.00 30.83  ? 36   LEU B CA    1 
ATOM   2083  C  C     . LEU B 1  36   ? -2.634  20.120  120.202 1.00 33.46  ? 36   LEU B C     1 
ATOM   2084  O  O     . LEU B 1  36   ? -3.457  20.343  121.082 1.00 42.44  ? 36   LEU B O     1 
ATOM   2085  C  CB    . LEU B 1  36   ? -0.776  21.769  120.127 1.00 30.51  ? 36   LEU B CB    1 
ATOM   2086  C  CG    . LEU B 1  36   ? 0.705   22.142  120.094 1.00 35.51  ? 36   LEU B CG    1 
ATOM   2087  C  CD1   . LEU B 1  36   ? 0.856   23.638  119.861 1.00 37.89  ? 36   LEU B CD1   1 
ATOM   2088  C  CD2   . LEU B 1  36   ? 1.414   21.712  121.367 1.00 34.13  ? 36   LEU B CD2   1 
ATOM   2089  N  N     . GLY B 1  37   ? -2.971  19.696  118.989 1.00 38.85  ? 37   GLY B N     1 
ATOM   2090  C  CA    . GLY B 1  37   ? -4.353  19.668  118.539 1.00 48.09  ? 37   GLY B CA    1 
ATOM   2091  C  C     . GLY B 1  37   ? -5.289  18.723  119.269 1.00 39.94  ? 37   GLY B C     1 
ATOM   2092  O  O     . GLY B 1  37   ? -6.326  19.139  119.780 1.00 40.52  ? 37   GLY B O     1 
ATOM   2093  N  N     . ASN B 1  38   ? -4.933  17.445  119.308 1.00 38.67  ? 38   ASN B N     1 
ATOM   2094  C  CA    . ASN B 1  38   ? -5.761  16.456  119.991 1.00 37.69  ? 38   ASN B CA    1 
ATOM   2095  C  C     . ASN B 1  38   ? -6.010  16.693  121.485 1.00 41.89  ? 38   ASN B C     1 
ATOM   2096  O  O     . ASN B 1  38   ? -7.152  16.586  121.927 1.00 51.42  ? 38   ASN B O     1 
ATOM   2097  C  CB    . ASN B 1  38   ? -5.256  15.033  119.733 1.00 39.86  ? 38   ASN B CB    1 
ATOM   2098  C  CG    . ASN B 1  38   ? -5.894  14.410  118.507 1.00 50.76  ? 38   ASN B CG    1 
ATOM   2099  O  OD1   . ASN B 1  38   ? -7.089  14.587  118.261 1.00 55.43  ? 38   ASN B OD1   1 
ATOM   2100  N  ND2   . ASN B 1  38   ? -5.101  13.684  117.726 1.00 46.11  ? 38   ASN B ND2   1 
ATOM   2101  N  N     . PRO B 1  39   ? -4.959  17.015  122.266 1.00 40.20  ? 39   PRO B N     1 
ATOM   2102  C  CA    . PRO B 1  39   ? -5.189  17.225  123.701 1.00 41.76  ? 39   PRO B CA    1 
ATOM   2103  C  C     . PRO B 1  39   ? -6.186  18.338  123.969 1.00 40.92  ? 39   PRO B C     1 
ATOM   2104  O  O     . PRO B 1  39   ? -7.096  18.167  124.784 1.00 41.48  ? 39   PRO B O     1 
ATOM   2105  C  CB    . PRO B 1  39   ? -3.816  17.660  124.217 1.00 40.43  ? 39   PRO B CB    1 
ATOM   2106  C  CG    . PRO B 1  39   ? -2.865  17.125  123.252 1.00 37.52  ? 39   PRO B CG    1 
ATOM   2107  C  CD    . PRO B 1  39   ? -3.534  17.157  121.925 1.00 41.19  ? 39   PRO B CD    1 
ATOM   2108  N  N     . LEU B 1  40   ? -6.012  19.459  123.276 1.00 37.24  ? 40   LEU B N     1 
ATOM   2109  C  CA    . LEU B 1  40   ? -6.892  20.602  123.449 1.00 38.71  ? 40   LEU B CA    1 
ATOM   2110  C  C     . LEU B 1  40   ? -8.329  20.242  123.111 1.00 41.09  ? 40   LEU B C     1 
ATOM   2111  O  O     . LEU B 1  40   ? -9.258  20.707  123.772 1.00 40.34  ? 40   LEU B O     1 
ATOM   2112  C  CB    . LEU B 1  40   ? -6.420  21.788  122.609 1.00 33.08  ? 40   LEU B CB    1 
ATOM   2113  C  CG    . LEU B 1  40   ? -5.027  22.304  122.965 1.00 35.62  ? 40   LEU B CG    1 
ATOM   2114  C  CD1   . LEU B 1  40   ? -4.746  23.629  122.272 1.00 30.63  ? 40   LEU B CD1   1 
ATOM   2115  C  CD2   . LEU B 1  40   ? -4.880  22.431  124.473 1.00 41.23  ? 40   LEU B CD2   1 
ATOM   2116  N  N     . ARG B 1  41   ? -8.509  19.402  122.096 1.00 38.81  ? 41   ARG B N     1 
ATOM   2117  C  CA    . ARG B 1  41   ? -9.849  18.946  121.747 1.00 40.62  ? 41   ARG B CA    1 
ATOM   2118  C  C     . ARG B 1  41   ? -10.474 18.186  122.919 1.00 38.71  ? 41   ARG B C     1 
ATOM   2119  O  O     . ARG B 1  41   ? -11.590 18.495  123.338 1.00 40.64  ? 41   ARG B O     1 
ATOM   2120  C  CB    . ARG B 1  41   ? -9.845  18.079  120.488 1.00 37.26  ? 41   ARG B CB    1 
ATOM   2121  C  CG    . ARG B 1  41   ? -11.245 17.677  120.030 1.00 32.28  ? 41   ARG B CG    1 
ATOM   2122  C  CD    . ARG B 1  41   ? -11.208 16.622  118.938 1.00 35.70  ? 41   ARG B CD    1 
ATOM   2123  N  NE    . ARG B 1  41   ? -12.550 16.249  118.486 1.00 40.96  ? 41   ARG B NE    1 
ATOM   2124  C  CZ    . ARG B 1  41   ? -13.176 15.120  118.818 1.00 43.40  ? 41   ARG B CZ    1 
ATOM   2125  N  NH1   . ARG B 1  41   ? -12.587 14.235  119.613 1.00 37.70  ? 41   ARG B NH1   1 
ATOM   2126  N  NH2   . ARG B 1  41   ? -14.394 14.873  118.353 1.00 35.55  ? 41   ARG B NH2   1 
ATOM   2127  N  N     . ARG B 1  42   ? -9.752  17.198  123.445 1.00 34.03  ? 42   ARG B N     1 
ATOM   2128  C  CA    . ARG B 1  42   ? -10.239 16.401  124.569 1.00 37.11  ? 42   ARG B CA    1 
ATOM   2129  C  C     . ARG B 1  42   ? -10.569 17.304  125.755 1.00 42.75  ? 42   ARG B C     1 
ATOM   2130  O  O     . ARG B 1  42   ? -11.667 17.247  126.314 1.00 40.63  ? 42   ARG B O     1 
ATOM   2131  C  CB    . ARG B 1  42   ? -9.196  15.359  124.991 1.00 35.40  ? 42   ARG B CB    1 
ATOM   2132  C  CG    . ARG B 1  42   ? -8.654  14.495  123.864 1.00 34.24  ? 42   ARG B CG    1 
ATOM   2133  C  CD    . ARG B 1  42   ? -7.547  13.573  124.363 1.00 34.13  ? 42   ARG B CD    1 
ATOM   2134  N  NE    . ARG B 1  42   ? -8.059  12.476  125.178 1.00 31.86  ? 42   ARG B NE    1 
ATOM   2135  C  CZ    . ARG B 1  42   ? -8.428  11.300  124.684 1.00 33.80  ? 42   ARG B CZ    1 
ATOM   2136  N  NH1   . ARG B 1  42   ? -8.337  11.077  123.382 1.00 35.28  ? 42   ARG B NH1   1 
ATOM   2137  N  NH2   . ARG B 1  42   ? -8.886  10.348  125.485 1.00 33.37  ? 42   ARG B NH2   1 
ATOM   2138  N  N     . ILE B 1  43   ? -9.609  18.145  126.122 1.00 41.79  ? 43   ILE B N     1 
ATOM   2139  C  CA    . ILE B 1  43   ? -9.760  19.065  127.243 1.00 41.20  ? 43   ILE B CA    1 
ATOM   2140  C  C     . ILE B 1  43   ? -10.944 20.028  127.061 1.00 43.10  ? 43   ILE B C     1 
ATOM   2141  O  O     . ILE B 1  43   ? -11.715 20.254  127.993 1.00 48.49  ? 43   ILE B O     1 
ATOM   2142  C  CB    . ILE B 1  43   ? -8.449  19.847  127.485 1.00 36.75  ? 43   ILE B CB    1 
ATOM   2143  C  CG1   . ILE B 1  43   ? -7.361  18.911  128.021 1.00 33.27  ? 43   ILE B CG1   1 
ATOM   2144  C  CG2   . ILE B 1  43   ? -8.669  21.003  128.440 1.00 37.86  ? 43   ILE B CG2   1 
ATOM   2145  C  CD1   . ILE B 1  43   ? -6.031  19.596  128.252 1.00 36.18  ? 43   ILE B CD1   1 
ATOM   2146  N  N     . LEU B 1  44   ? -11.090 20.577  125.858 1.00 40.48  ? 44   LEU B N     1 
ATOM   2147  C  CA    . LEU B 1  44   ? -12.173 21.517  125.558 1.00 44.28  ? 44   LEU B CA    1 
ATOM   2148  C  C     . LEU B 1  44   ? -13.571 20.927  125.756 1.00 46.78  ? 44   LEU B C     1 
ATOM   2149  O  O     . LEU B 1  44   ? -14.409 21.503  126.460 1.00 56.68  ? 44   LEU B O     1 
ATOM   2150  C  CB    . LEU B 1  44   ? -12.031 22.070  124.137 1.00 40.41  ? 44   LEU B CB    1 
ATOM   2151  C  CG    . LEU B 1  44   ? -11.110 23.273  123.934 1.00 41.18  ? 44   LEU B CG    1 
ATOM   2152  C  CD1   . LEU B 1  44   ? -10.877 23.539  122.452 1.00 40.46  ? 44   LEU B CD1   1 
ATOM   2153  C  CD2   . LEU B 1  44   ? -11.729 24.483  124.599 1.00 46.24  ? 44   LEU B CD2   1 
ATOM   2154  N  N     . LEU B 1  45   ? -13.815 19.781  125.129 1.00 42.12  ? 45   LEU B N     1 
ATOM   2155  C  CA    . LEU B 1  45   ? -15.102 19.104  125.232 1.00 44.17  ? 45   LEU B CA    1 
ATOM   2156  C  C     . LEU B 1  45   ? -15.372 18.555  126.640 1.00 48.24  ? 45   LEU B C     1 
ATOM   2157  O  O     . LEU B 1  45   ? -16.442 18.777  127.207 1.00 56.36  ? 45   LEU B O     1 
ATOM   2158  C  CB    . LEU B 1  45   ? -15.179 17.969  124.209 1.00 41.12  ? 45   LEU B CB    1 
ATOM   2159  C  CG    . LEU B 1  45   ? -15.194 18.319  122.716 1.00 38.95  ? 45   LEU B CG    1 
ATOM   2160  C  CD1   . LEU B 1  45   ? -14.337 17.337  121.938 1.00 39.78  ? 45   LEU B CD1   1 
ATOM   2161  C  CD2   . LEU B 1  45   ? -16.616 18.301  122.181 1.00 41.68  ? 45   LEU B CD2   1 
ATOM   2162  N  N     . SER B 1  46   ? -14.406 17.828  127.196 1.00 42.96  ? 46   SER B N     1 
ATOM   2163  C  CA    . SER B 1  46   ? -14.610 17.142  128.474 1.00 47.05  ? 46   SER B CA    1 
ATOM   2164  C  C     . SER B 1  46   ? -14.582 18.030  129.727 1.00 52.14  ? 46   SER B C     1 
ATOM   2165  O  O     . SER B 1  46   ? -15.494 17.986  130.555 1.00 56.06  ? 46   SER B O     1 
ATOM   2166  C  CB    . SER B 1  46   ? -13.578 16.022  128.642 1.00 58.16  ? 46   SER B CB    1 
ATOM   2167  O  OG    . SER B 1  46   ? -12.336 16.549  129.077 1.00 61.36  ? 46   SER B OG    1 
ATOM   2168  N  N     . SER B 1  47   ? -13.512 18.802  129.879 1.00 49.60  ? 47   SER B N     1 
ATOM   2169  C  CA    . SER B 1  47   ? -13.207 19.435  131.159 1.00 46.07  ? 47   SER B CA    1 
ATOM   2170  C  C     . SER B 1  47   ? -13.605 20.901  131.382 1.00 48.83  ? 47   SER B C     1 
ATOM   2171  O  O     . SER B 1  47   ? -13.416 21.417  132.481 1.00 53.34  ? 47   SER B O     1 
ATOM   2172  C  CB    . SER B 1  47   ? -11.716 19.284  131.447 1.00 51.87  ? 47   SER B CB    1 
ATOM   2173  O  OG    . SER B 1  47   ? -11.317 20.185  132.460 1.00 66.55  ? 47   SER B OG    1 
ATOM   2174  N  N     . ILE B 1  48   ? -14.146 21.576  130.374 1.00 48.43  ? 48   ILE B N     1 
ATOM   2175  C  CA    . ILE B 1  48   ? -14.457 22.999  130.528 1.00 48.75  ? 48   ILE B CA    1 
ATOM   2176  C  C     . ILE B 1  48   ? -15.747 23.212  131.321 1.00 55.62  ? 48   ILE B C     1 
ATOM   2177  O  O     . ILE B 1  48   ? -16.805 22.715  130.932 1.00 56.10  ? 48   ILE B O     1 
ATOM   2178  C  CB    . ILE B 1  48   ? -14.519 23.728  129.169 1.00 51.48  ? 48   ILE B CB    1 
ATOM   2179  C  CG1   . ILE B 1  48   ? -13.160 23.649  128.470 1.00 49.96  ? 48   ILE B CG1   1 
ATOM   2180  C  CG2   . ILE B 1  48   ? -14.932 25.185  129.349 1.00 51.88  ? 48   ILE B CG2   1 
ATOM   2181  C  CD1   . ILE B 1  48   ? -12.030 24.289  129.244 1.00 49.95  ? 48   ILE B CD1   1 
ATOM   2182  N  N     . PRO B 1  49   ? -15.649 23.951  132.444 1.00 57.74  ? 49   PRO B N     1 
ATOM   2183  C  CA    . PRO B 1  49   ? -16.723 24.217  133.413 1.00 51.18  ? 49   PRO B CA    1 
ATOM   2184  C  C     . PRO B 1  49   ? -17.977 24.818  132.786 1.00 52.42  ? 49   PRO B C     1 
ATOM   2185  O  O     . PRO B 1  49   ? -17.891 25.790  132.035 1.00 51.32  ? 49   PRO B O     1 
ATOM   2186  C  CB    . PRO B 1  49   ? -16.089 25.240  134.360 1.00 50.29  ? 49   PRO B CB    1 
ATOM   2187  C  CG    . PRO B 1  49   ? -14.632 24.992  134.264 1.00 50.99  ? 49   PRO B CG    1 
ATOM   2188  C  CD    . PRO B 1  49   ? -14.386 24.599  132.840 1.00 53.00  ? 49   PRO B CD    1 
ATOM   2189  N  N     . GLY B 1  50   ? -19.134 24.252  133.111 1.00 54.51  ? 50   GLY B N     1 
ATOM   2190  C  CA    . GLY B 1  50   ? -20.390 24.737  132.572 1.00 56.94  ? 50   GLY B CA    1 
ATOM   2191  C  C     . GLY B 1  50   ? -21.568 24.392  133.459 1.00 60.57  ? 50   GLY B C     1 
ATOM   2192  O  O     . GLY B 1  50   ? -21.397 23.849  134.550 1.00 64.49  ? 50   GLY B O     1 
ATOM   2193  N  N     . THR B 1  51   ? -22.770 24.714  132.990 1.00 58.48  ? 51   THR B N     1 
ATOM   2194  C  CA    . THR B 1  51   ? -23.981 24.492  133.770 1.00 52.86  ? 51   THR B CA    1 
ATOM   2195  C  C     . THR B 1  51   ? -25.016 23.711  132.967 1.00 51.81  ? 51   THR B C     1 
ATOM   2196  O  O     . THR B 1  51   ? -25.157 23.912  131.760 1.00 60.51  ? 51   THR B O     1 
ATOM   2197  C  CB    . THR B 1  51   ? -24.602 25.823  134.208 1.00 59.02  ? 51   THR B CB    1 
ATOM   2198  O  OG1   . THR B 1  51   ? -25.071 26.530  133.054 1.00 68.69  ? 51   THR B OG1   1 
ATOM   2199  C  CG2   . THR B 1  51   ? -23.572 26.677  134.935 1.00 63.36  ? 51   THR B CG2   1 
ATOM   2200  N  N     . ALA B 1  52   ? -25.744 22.827  133.642 1.00 46.70  ? 52   ALA B N     1 
ATOM   2201  C  CA    . ALA B 1  52   ? -26.740 21.993  132.973 1.00 54.77  ? 52   ALA B CA    1 
ATOM   2202  C  C     . ALA B 1  52   ? -27.973 21.742  133.834 1.00 57.43  ? 52   ALA B C     1 
ATOM   2203  O  O     . ALA B 1  52   ? -27.945 21.936  135.050 1.00 58.67  ? 52   ALA B O     1 
ATOM   2204  C  CB    . ALA B 1  52   ? -26.124 20.675  132.563 1.00 53.04  ? 52   ALA B CB    1 
ATOM   2205  N  N     . VAL B 1  53   ? -29.051 21.292  133.199 1.00 51.24  ? 53   VAL B N     1 
ATOM   2206  C  CA    . VAL B 1  53   ? -30.257 20.944  133.934 1.00 49.96  ? 53   VAL B CA    1 
ATOM   2207  C  C     . VAL B 1  53   ? -30.234 19.452  134.253 1.00 58.77  ? 53   VAL B C     1 
ATOM   2208  O  O     . VAL B 1  53   ? -30.414 18.611  133.368 1.00 59.00  ? 53   VAL B O     1 
ATOM   2209  C  CB    . VAL B 1  53   ? -31.519 21.264  133.109 1.00 46.33  ? 53   VAL B CB    1 
ATOM   2210  C  CG1   . VAL B 1  53   ? -32.758 20.723  133.796 1.00 56.20  ? 53   VAL B CG1   1 
ATOM   2211  C  CG2   . VAL B 1  53   ? -31.640 22.762  132.879 1.00 40.64  ? 53   VAL B CG2   1 
ATOM   2212  N  N     . THR B 1  54   ? -30.009 19.135  135.526 1.00 56.33  ? 54   THR B N     1 
ATOM   2213  C  CA    . THR B 1  54   ? -29.911 17.749  135.981 1.00 50.69  ? 54   THR B CA    1 
ATOM   2214  C  C     . THR B 1  54   ? -31.250 17.073  136.292 1.00 56.47  ? 54   THR B C     1 
ATOM   2215  O  O     . THR B 1  54   ? -31.435 15.892  135.996 1.00 57.49  ? 54   THR B O     1 
ATOM   2216  C  CB    . THR B 1  54   ? -28.970 17.618  137.189 1.00 40.03  ? 54   THR B CB    1 
ATOM   2217  O  OG1   . THR B 1  54   ? -29.497 18.366  138.287 1.00 50.64  ? 54   THR B OG1   1 
ATOM   2218  C  CG2   . THR B 1  54   ? -27.593 18.150  136.842 1.00 46.37  ? 54   THR B CG2   1 
ATOM   2219  N  N     . SER B 1  55   ? -32.174 17.816  136.898 1.00 58.03  ? 55   SER B N     1 
ATOM   2220  C  CA    . SER B 1  55   ? -33.441 17.235  137.343 1.00 58.17  ? 55   SER B CA    1 
ATOM   2221  C  C     . SER B 1  55   ? -34.625 18.190  137.164 1.00 53.72  ? 55   SER B C     1 
ATOM   2222  O  O     . SER B 1  55   ? -34.494 19.402  137.340 1.00 48.02  ? 55   SER B O     1 
ATOM   2223  C  CB    . SER B 1  55   ? -33.331 16.786  138.805 1.00 57.90  ? 55   SER B CB    1 
ATOM   2224  O  OG    . SER B 1  55   ? -34.342 15.851  139.138 1.00 58.94  ? 55   SER B OG    1 
ATOM   2225  N  N     . VAL B 1  56   ? -35.780 17.633  136.807 1.00 51.06  ? 56   VAL B N     1 
ATOM   2226  C  CA    . VAL B 1  56   ? -36.986 18.424  136.578 1.00 49.05  ? 56   VAL B CA    1 
ATOM   2227  C  C     . VAL B 1  56   ? -38.220 17.764  137.183 1.00 57.34  ? 56   VAL B C     1 
ATOM   2228  O  O     . VAL B 1  56   ? -38.456 16.575  136.973 1.00 61.49  ? 56   VAL B O     1 
ATOM   2229  C  CB    . VAL B 1  56   ? -37.252 18.615  135.074 1.00 51.72  ? 56   VAL B CB    1 
ATOM   2230  C  CG1   . VAL B 1  56   ? -38.517 19.430  134.857 1.00 56.40  ? 56   VAL B CG1   1 
ATOM   2231  C  CG2   . VAL B 1  56   ? -36.068 19.282  134.401 1.00 60.20  ? 56   VAL B CG2   1 
ATOM   2232  N  N     . TYR B 1  57   ? -39.006 18.539  137.927 1.00 61.67  ? 57   TYR B N     1 
ATOM   2233  C  CA    . TYR B 1  57   ? -40.277 18.061  138.469 1.00 64.06  ? 57   TYR B CA    1 
ATOM   2234  C  C     . TYR B 1  57   ? -41.455 18.829  137.878 1.00 60.50  ? 57   TYR B C     1 
ATOM   2235  O  O     . TYR B 1  57   ? -41.465 20.057  137.886 1.00 57.43  ? 57   TYR B O     1 
ATOM   2236  C  CB    . TYR B 1  57   ? -40.293 18.179  139.997 1.00 74.91  ? 57   TYR B CB    1 
ATOM   2237  C  CG    . TYR B 1  57   ? -41.668 18.016  140.621 1.00 76.04  ? 57   TYR B CG    1 
ATOM   2238  C  CD1   . TYR B 1  57   ? -42.307 16.780  140.637 1.00 68.71  ? 57   TYR B CD1   1 
ATOM   2239  C  CD2   . TYR B 1  57   ? -42.321 19.098  141.206 1.00 75.28  ? 57   TYR B CD2   1 
ATOM   2240  C  CE1   . TYR B 1  57   ? -43.561 16.628  141.210 1.00 70.35  ? 57   TYR B CE1   1 
ATOM   2241  C  CE2   . TYR B 1  57   ? -43.575 18.954  141.781 1.00 70.57  ? 57   TYR B CE2   1 
ATOM   2242  C  CZ    . TYR B 1  57   ? -44.190 17.718  141.779 1.00 72.18  ? 57   TYR B CZ    1 
ATOM   2243  O  OH    . TYR B 1  57   ? -45.436 17.572  142.347 1.00 64.46  ? 57   TYR B OH    1 
ATOM   2244  N  N     . ILE B 1  58   ? -42.443 18.101  137.365 1.00 62.09  ? 58   ILE B N     1 
ATOM   2245  C  CA    . ILE B 1  58   ? -43.660 18.713  136.835 1.00 70.18  ? 58   ILE B CA    1 
ATOM   2246  C  C     . ILE B 1  58   ? -44.889 18.155  137.547 1.00 72.44  ? 58   ILE B C     1 
ATOM   2247  O  O     . ILE B 1  58   ? -45.047 16.937  137.653 1.00 67.62  ? 58   ILE B O     1 
ATOM   2248  C  CB    . ILE B 1  58   ? -43.818 18.465  135.323 1.00 64.43  ? 58   ILE B CB    1 
ATOM   2249  C  CG1   . ILE B 1  58   ? -42.546 18.856  134.572 1.00 65.96  ? 58   ILE B CG1   1 
ATOM   2250  C  CG2   . ILE B 1  58   ? -45.005 19.242  134.777 1.00 64.52  ? 58   ILE B CG2   1 
ATOM   2251  C  CD1   . ILE B 1  58   ? -42.622 18.582  133.086 1.00 59.81  ? 58   ILE B CD1   1 
ATOM   2252  N  N     . GLU B 1  59   ? -45.754 19.048  138.026 1.00 69.56  ? 59   GLU B N     1 
ATOM   2253  C  CA    . GLU B 1  59   ? -46.952 18.647  138.761 1.00 72.60  ? 59   GLU B CA    1 
ATOM   2254  C  C     . GLU B 1  59   ? -47.814 17.681  137.958 1.00 71.35  ? 59   GLU B C     1 
ATOM   2255  O  O     . GLU B 1  59   ? -47.956 17.825  136.744 1.00 67.58  ? 59   GLU B O     1 
ATOM   2256  C  CB    . GLU B 1  59   ? -47.784 19.867  139.174 1.00 81.10  ? 59   GLU B CB    1 
ATOM   2257  C  CG    . GLU B 1  59   ? -47.332 20.535  140.467 1.00 83.54  ? 59   GLU B CG    1 
ATOM   2258  C  CD    . GLU B 1  59   ? -48.297 21.611  140.945 1.00 74.64  ? 59   GLU B CD    1 
ATOM   2259  O  OE1   . GLU B 1  59   ? -47.897 22.434  141.796 1.00 73.05  ? 59   GLU B OE1   1 
ATOM   2260  O  OE2   . GLU B 1  59   ? -49.455 21.632  140.476 1.00 61.91  ? 59   GLU B OE2   1 
ATOM   2261  N  N     . ASP B 1  60   ? -48.369 16.692  138.653 1.00 79.17  ? 60   ASP B N     1 
ATOM   2262  C  CA    . ASP B 1  60   ? -49.257 15.696  138.055 1.00 81.81  ? 60   ASP B CA    1 
ATOM   2263  C  C     . ASP B 1  60   ? -48.590 14.887  136.937 1.00 79.40  ? 60   ASP B C     1 
ATOM   2264  O  O     . ASP B 1  60   ? -49.264 14.389  136.033 1.00 77.38  ? 60   ASP B O     1 
ATOM   2265  C  CB    . ASP B 1  60   ? -50.550 16.353  137.559 1.00 84.47  ? 60   ASP B CB    1 
ATOM   2266  C  CG    . ASP B 1  60   ? -51.207 17.224  138.618 1.00 83.60  ? 60   ASP B CG    1 
ATOM   2267  O  OD1   . ASP B 1  60   ? -51.169 16.850  139.810 1.00 82.72  ? 60   ASP B OD1   1 
ATOM   2268  O  OD2   . ASP B 1  60   ? -51.759 18.285  138.258 1.00 77.13  ? 60   ASP B OD2   1 
ATOM   2269  N  N     . VAL B 1  61   ? -47.267 14.756  137.007 1.00 78.07  ? 61   VAL B N     1 
ATOM   2270  C  CA    . VAL B 1  61   ? -46.516 13.968  136.034 1.00 70.50  ? 61   VAL B CA    1 
ATOM   2271  C  C     . VAL B 1  61   ? -45.715 12.868  136.724 1.00 73.76  ? 61   VAL B C     1 
ATOM   2272  O  O     . VAL B 1  61   ? -44.774 13.151  137.470 1.00 68.18  ? 61   VAL B O     1 
ATOM   2273  C  CB    . VAL B 1  61   ? -45.554 14.851  135.224 1.00 66.58  ? 61   VAL B CB    1 
ATOM   2274  C  CG1   . VAL B 1  61   ? -44.689 13.994  134.321 1.00 74.94  ? 61   VAL B CG1   1 
ATOM   2275  C  CG2   . VAL B 1  61   ? -46.331 15.870  134.412 1.00 70.23  ? 61   VAL B CG2   1 
ATOM   2276  N  N     . LEU B 1  62   ? -46.086 11.616  136.466 1.00 76.89  ? 62   LEU B N     1 
ATOM   2277  C  CA    . LEU B 1  62   ? -45.470 10.476  137.146 1.00 81.02  ? 62   LEU B CA    1 
ATOM   2278  C  C     . LEU B 1  62   ? -44.091 10.098  136.604 1.00 79.80  ? 62   LEU B C     1 
ATOM   2279  O  O     . LEU B 1  62   ? -43.149 9.912   137.375 1.00 76.68  ? 62   LEU B O     1 
ATOM   2280  C  CB    . LEU B 1  62   ? -46.399 9.256   137.128 1.00 84.18  ? 62   LEU B CB    1 
ATOM   2281  C  CG    . LEU B 1  62   ? -47.580 9.268   138.106 1.00 86.87  ? 62   LEU B CG    1 
ATOM   2282  C  CD1   . LEU B 1  62   ? -48.322 7.935   138.091 1.00 67.66  ? 62   LEU B CD1   1 
ATOM   2283  C  CD2   . LEU B 1  62   ? -47.118 9.611   139.517 1.00 77.76  ? 62   LEU B CD2   1 
ATOM   2284  N  N     . HIS B 1  63   ? -43.972 9.984   135.284 1.00 81.15  ? 63   HIS B N     1 
ATOM   2285  C  CA    . HIS B 1  63   ? -42.690 9.622   134.680 1.00 82.09  ? 63   HIS B CA    1 
ATOM   2286  C  C     . HIS B 1  63   ? -42.379 10.369  133.382 1.00 75.96  ? 63   HIS B C     1 
ATOM   2287  O  O     . HIS B 1  63   ? -43.140 11.232  132.948 1.00 74.32  ? 63   HIS B O     1 
ATOM   2288  C  CB    . HIS B 1  63   ? -42.573 8.103   134.487 1.00 80.60  ? 63   HIS B CB    1 
ATOM   2289  C  CG    . HIS B 1  63   ? -43.707 7.495   133.723 1.00 79.11  ? 63   HIS B CG    1 
ATOM   2290  N  ND1   . HIS B 1  63   ? -43.642 7.242   132.370 1.00 82.32  ? 63   HIS B ND1   1 
ATOM   2291  C  CD2   . HIS B 1  63   ? -44.932 7.080   134.125 1.00 80.95  ? 63   HIS B CD2   1 
ATOM   2292  C  CE1   . HIS B 1  63   ? -44.779 6.700   131.970 1.00 81.41  ? 63   HIS B CE1   1 
ATOM   2293  N  NE2   . HIS B 1  63   ? -45.579 6.592   133.015 1.00 82.90  ? 63   HIS B NE2   1 
ATOM   2294  N  N     . GLU B 1  64   ? -41.251 10.019  132.774 1.00 74.06  ? 64   GLU B N     1 
ATOM   2295  C  CA    . GLU B 1  64   ? -40.689 10.774  131.656 1.00 72.01  ? 64   GLU B CA    1 
ATOM   2296  C  C     . GLU B 1  64   ? -41.519 10.699  130.375 1.00 68.92  ? 64   GLU B C     1 
ATOM   2297  O  O     . GLU B 1  64   ? -41.601 11.669  129.622 1.00 65.50  ? 64   GLU B O     1 
ATOM   2298  C  CB    . GLU B 1  64   ? -39.260 10.296  131.384 1.00 70.65  ? 64   GLU B CB    1 
ATOM   2299  C  CG    . GLU B 1  64   ? -38.496 11.113  130.359 1.00 71.74  ? 64   GLU B CG    1 
ATOM   2300  C  CD    . GLU B 1  64   ? -37.077 10.612  130.161 1.00 81.14  ? 64   GLU B CD    1 
ATOM   2301  O  OE1   . GLU B 1  64   ? -36.248 11.367  129.608 1.00 81.83  ? 64   GLU B OE1   1 
ATOM   2302  O  OE2   . GLU B 1  64   ? -36.791 9.462   130.557 1.00 81.89  ? 64   GLU B OE2   1 
ATOM   2303  N  N     . PHE B 1  65   ? -42.130 9.547   130.126 1.00 66.94  ? 65   PHE B N     1 
ATOM   2304  C  CA    . PHE B 1  65   ? -42.848 9.331   128.875 1.00 71.10  ? 65   PHE B CA    1 
ATOM   2305  C  C     . PHE B 1  65   ? -44.341 9.621   128.985 1.00 71.11  ? 65   PHE B C     1 
ATOM   2306  O  O     . PHE B 1  65   ? -45.094 9.425   128.030 1.00 64.94  ? 65   PHE B O     1 
ATOM   2307  C  CB    . PHE B 1  65   ? -42.593 7.916   128.357 1.00 71.95  ? 65   PHE B CB    1 
ATOM   2308  C  CG    . PHE B 1  65   ? -41.137 7.570   128.265 1.00 65.20  ? 65   PHE B CG    1 
ATOM   2309  C  CD1   . PHE B 1  65   ? -40.342 8.130   127.281 1.00 59.08  ? 65   PHE B CD1   1 
ATOM   2310  C  CD2   . PHE B 1  65   ? -40.559 6.700   129.172 1.00 76.39  ? 65   PHE B CD2   1 
ATOM   2311  C  CE1   . PHE B 1  65   ? -38.999 7.824   127.197 1.00 60.45  ? 65   PHE B CE1   1 
ATOM   2312  C  CE2   . PHE B 1  65   ? -39.215 6.389   129.094 1.00 83.22  ? 65   PHE B CE2   1 
ATOM   2313  C  CZ    . PHE B 1  65   ? -38.435 6.952   128.104 1.00 70.11  ? 65   PHE B CZ    1 
ATOM   2314  N  N     . SER B 1  66   ? -44.763 10.086  130.155 1.00 73.78  ? 66   SER B N     1 
ATOM   2315  C  CA    . SER B 1  66   ? -46.150 10.479  130.363 1.00 75.47  ? 66   SER B CA    1 
ATOM   2316  C  C     . SER B 1  66   ? -46.470 11.723  129.541 1.00 79.50  ? 66   SER B C     1 
ATOM   2317  O  O     . SER B 1  66   ? -45.570 12.462  129.139 1.00 71.62  ? 66   SER B O     1 
ATOM   2318  C  CB    . SER B 1  66   ? -46.419 10.742  131.846 1.00 82.52  ? 66   SER B CB    1 
ATOM   2319  O  OG    . SER B 1  66   ? -46.154 9.591   132.630 1.00 84.62  ? 66   SER B OG    1 
ATOM   2320  N  N     . THR B 1  67   ? -47.754 11.948  129.288 1.00 87.16  ? 67   THR B N     1 
ATOM   2321  C  CA    . THR B 1  67   ? -48.185 13.101  128.508 1.00 76.30  ? 67   THR B CA    1 
ATOM   2322  C  C     . THR B 1  67   ? -48.874 14.133  129.390 1.00 71.12  ? 67   THR B C     1 
ATOM   2323  O  O     . THR B 1  67   ? -49.526 13.787  130.375 1.00 71.48  ? 67   THR B O     1 
ATOM   2324  C  CB    . THR B 1  67   ? -49.134 12.693  127.368 1.00 71.27  ? 67   THR B CB    1 
ATOM   2325  O  OG1   . THR B 1  67   ? -49.745 13.866  126.817 1.00 79.00  ? 67   THR B OG1   1 
ATOM   2326  C  CG2   . THR B 1  67   ? -50.218 11.755  127.882 1.00 62.67  ? 67   THR B CG2   1 
ATOM   2327  N  N     . ILE B 1  68   ? -48.722 15.402  129.033 1.00 67.76  ? 68   ILE B N     1 
ATOM   2328  C  CA    . ILE B 1  68   ? -49.319 16.483  129.803 1.00 71.74  ? 68   ILE B CA    1 
ATOM   2329  C  C     . ILE B 1  68   ? -50.570 17.024  129.123 1.00 83.10  ? 68   ILE B C     1 
ATOM   2330  O  O     . ILE B 1  68   ? -50.481 17.650  128.066 1.00 85.57  ? 68   ILE B O     1 
ATOM   2331  C  CB    . ILE B 1  68   ? -48.333 17.646  130.002 1.00 72.35  ? 68   ILE B CB    1 
ATOM   2332  C  CG1   . ILE B 1  68   ? -47.050 17.151  130.669 1.00 71.59  ? 68   ILE B CG1   1 
ATOM   2333  C  CG2   . ILE B 1  68   ? -48.974 18.750  130.826 1.00 73.28  ? 68   ILE B CG2   1 
ATOM   2334  C  CD1   . ILE B 1  68   ? -46.027 18.242  130.898 1.00 72.34  ? 68   ILE B CD1   1 
ATOM   2335  N  N     . PRO B 1  69   ? -51.742 16.775  129.727 1.00 84.20  ? 69   PRO B N     1 
ATOM   2336  C  CA    . PRO B 1  69   ? -53.007 17.338  129.243 1.00 80.12  ? 69   PRO B CA    1 
ATOM   2337  C  C     . PRO B 1  69   ? -52.984 18.861  129.309 1.00 77.73  ? 69   PRO B C     1 
ATOM   2338  O  O     . PRO B 1  69   ? -52.604 19.426  130.337 1.00 70.53  ? 69   PRO B O     1 
ATOM   2339  C  CB    . PRO B 1  69   ? -54.035 16.787  130.234 1.00 77.26  ? 69   PRO B CB    1 
ATOM   2340  C  CG    . PRO B 1  69   ? -53.406 15.555  130.791 1.00 76.89  ? 69   PRO B CG    1 
ATOM   2341  C  CD    . PRO B 1  69   ? -51.945 15.864  130.866 1.00 77.55  ? 69   PRO B CD    1 
ATOM   2342  N  N     . GLY B 1  70   ? -53.383 19.511  128.221 1.00 75.60  ? 70   GLY B N     1 
ATOM   2343  C  CA    . GLY B 1  70   ? -53.389 20.961  128.157 1.00 80.87  ? 70   GLY B CA    1 
ATOM   2344  C  C     . GLY B 1  70   ? -52.138 21.522  127.509 1.00 86.17  ? 70   GLY B C     1 
ATOM   2345  O  O     . GLY B 1  70   ? -52.064 22.714  127.201 1.00 81.72  ? 70   GLY B O     1 
ATOM   2346  N  N     . VAL B 1  71   ? -51.149 20.656  127.310 1.00 89.67  ? 71   VAL B N     1 
ATOM   2347  C  CA    . VAL B 1  71   ? -49.904 21.028  126.646 1.00 86.45  ? 71   VAL B CA    1 
ATOM   2348  C  C     . VAL B 1  71   ? -49.672 20.088  125.467 1.00 81.66  ? 71   VAL B C     1 
ATOM   2349  O  O     . VAL B 1  71   ? -49.915 18.884  125.573 1.00 75.39  ? 71   VAL B O     1 
ATOM   2350  C  CB    . VAL B 1  71   ? -48.708 20.945  127.615 1.00 81.35  ? 71   VAL B CB    1 
ATOM   2351  C  CG1   . VAL B 1  71   ? -47.429 21.408  126.929 1.00 84.30  ? 71   VAL B CG1   1 
ATOM   2352  C  CG2   . VAL B 1  71   ? -48.975 21.774  128.863 1.00 77.96  ? 71   VAL B CG2   1 
ATOM   2353  N  N     . LYS B 1  72   ? -49.214 20.629  124.341 1.00 73.76  ? 72   LYS B N     1 
ATOM   2354  C  CA    . LYS B 1  72   ? -49.032 19.803  123.150 1.00 75.30  ? 72   LYS B CA    1 
ATOM   2355  C  C     . LYS B 1  72   ? -47.783 18.921  123.204 1.00 75.97  ? 72   LYS B C     1 
ATOM   2356  O  O     . LYS B 1  72   ? -47.851 17.732  122.891 1.00 75.19  ? 72   LYS B O     1 
ATOM   2357  C  CB    . LYS B 1  72   ? -49.064 20.640  121.864 1.00 79.16  ? 72   LYS B CB    1 
ATOM   2358  C  CG    . LYS B 1  72   ? -48.003 21.721  121.755 1.00 77.65  ? 72   LYS B CG    1 
ATOM   2359  C  CD    . LYS B 1  72   ? -47.654 21.967  120.294 1.00 72.78  ? 72   LYS B CD    1 
ATOM   2360  C  CE    . LYS B 1  72   ? -48.909 22.090  119.442 1.00 63.73  ? 72   LYS B CE    1 
ATOM   2361  N  NZ    . LYS B 1  72   ? -48.605 21.985  117.988 1.00 61.35  ? 72   LYS B NZ    1 
ATOM   2362  N  N     . GLU B 1  73   ? -46.651 19.495  123.602 1.00 72.27  ? 73   GLU B N     1 
ATOM   2363  C  CA    . GLU B 1  73   ? -45.420 18.724  123.722 1.00 65.96  ? 73   GLU B CA    1 
ATOM   2364  C  C     . GLU B 1  73   ? -45.561 17.717  124.850 1.00 65.74  ? 73   GLU B C     1 
ATOM   2365  O  O     . GLU B 1  73   ? -46.153 18.023  125.885 1.00 68.84  ? 73   GLU B O     1 
ATOM   2366  C  CB    . GLU B 1  73   ? -44.226 19.636  124.010 1.00 62.15  ? 73   GLU B CB    1 
ATOM   2367  C  CG    . GLU B 1  73   ? -44.011 20.746  122.997 1.00 73.48  ? 73   GLU B CG    1 
ATOM   2368  C  CD    . GLU B 1  73   ? -44.427 22.100  123.530 1.00 72.57  ? 73   GLU B CD    1 
ATOM   2369  O  OE1   . GLU B 1  73   ? -45.248 22.139  124.471 1.00 72.17  ? 73   GLU B OE1   1 
ATOM   2370  O  OE2   . GLU B 1  73   ? -43.927 23.124  123.013 1.00 63.50  ? 73   GLU B OE2   1 
ATOM   2371  N  N     . ASP B 1  74   ? -45.023 16.517  124.660 1.00 70.89  ? 74   ASP B N     1 
ATOM   2372  C  CA    . ASP B 1  74   ? -44.986 15.556  125.754 1.00 71.62  ? 74   ASP B CA    1 
ATOM   2373  C  C     . ASP B 1  74   ? -43.876 15.940  126.729 1.00 66.28  ? 74   ASP B C     1 
ATOM   2374  O  O     . ASP B 1  74   ? -43.134 16.895  126.491 1.00 62.73  ? 74   ASP B O     1 
ATOM   2375  C  CB    . ASP B 1  74   ? -44.816 14.116  125.243 1.00 67.03  ? 74   ASP B CB    1 
ATOM   2376  C  CG    . ASP B 1  74   ? -43.651 13.958  124.277 1.00 65.24  ? 74   ASP B CG    1 
ATOM   2377  O  OD1   . ASP B 1  74   ? -42.564 14.516  124.534 1.00 64.63  ? 74   ASP B OD1   1 
ATOM   2378  O  OD2   . ASP B 1  74   ? -43.826 13.260  123.255 1.00 61.95  ? 74   ASP B OD2   1 
ATOM   2379  N  N     . VAL B 1  75   ? -43.762 15.194  127.820 1.00 64.59  ? 75   VAL B N     1 
ATOM   2380  C  CA    . VAL B 1  75   ? -42.764 15.496  128.835 1.00 63.04  ? 75   VAL B CA    1 
ATOM   2381  C  C     . VAL B 1  75   ? -41.364 15.422  128.233 1.00 59.96  ? 75   VAL B C     1 
ATOM   2382  O  O     . VAL B 1  75   ? -40.506 16.256  128.524 1.00 58.49  ? 75   VAL B O     1 
ATOM   2383  C  CB    . VAL B 1  75   ? -42.891 14.546  130.043 1.00 61.37  ? 75   VAL B CB    1 
ATOM   2384  C  CG1   . VAL B 1  75   ? -41.723 14.728  130.997 1.00 62.28  ? 75   VAL B CG1   1 
ATOM   2385  C  CG2   . VAL B 1  75   ? -44.209 14.781  130.760 1.00 57.63  ? 75   VAL B CG2   1 
ATOM   2386  N  N     . VAL B 1  76   ? -41.158 14.438  127.363 1.00 61.45  ? 76   VAL B N     1 
ATOM   2387  C  CA    . VAL B 1  76   ? -39.864 14.226  126.724 1.00 56.13  ? 76   VAL B CA    1 
ATOM   2388  C  C     . VAL B 1  76   ? -39.406 15.445  125.933 1.00 50.51  ? 76   VAL B C     1 
ATOM   2389  O  O     . VAL B 1  76   ? -38.245 15.843  126.013 1.00 45.90  ? 76   VAL B O     1 
ATOM   2390  C  CB    . VAL B 1  76   ? -39.899 13.014  125.781 1.00 49.38  ? 76   VAL B CB    1 
ATOM   2391  C  CG1   . VAL B 1  76   ? -38.490 12.649  125.348 1.00 46.52  ? 76   VAL B CG1   1 
ATOM   2392  C  CG2   . VAL B 1  76   ? -40.574 11.836  126.462 1.00 53.95  ? 76   VAL B CG2   1 
ATOM   2393  N  N     . GLU B 1  77   ? -40.324 16.038  125.176 1.00 53.67  ? 77   GLU B N     1 
ATOM   2394  C  CA    . GLU B 1  77   ? -39.997 17.182  124.332 1.00 54.22  ? 77   GLU B CA    1 
ATOM   2395  C  C     . GLU B 1  77   ? -39.647 18.411  125.167 1.00 49.53  ? 77   GLU B C     1 
ATOM   2396  O  O     . GLU B 1  77   ? -38.872 19.265  124.736 1.00 45.09  ? 77   GLU B O     1 
ATOM   2397  C  CB    . GLU B 1  77   ? -41.150 17.495  123.372 1.00 56.59  ? 77   GLU B CB    1 
ATOM   2398  C  CG    . GLU B 1  77   ? -40.809 18.505  122.278 1.00 60.13  ? 77   GLU B CG    1 
ATOM   2399  C  CD    . GLU B 1  77   ? -39.830 17.963  121.246 1.00 58.76  ? 77   GLU B CD    1 
ATOM   2400  O  OE1   . GLU B 1  77   ? -39.155 18.779  120.580 1.00 56.68  ? 77   GLU B OE1   1 
ATOM   2401  O  OE2   . GLU B 1  77   ? -39.739 16.726  121.092 1.00 55.09  ? 77   GLU B OE2   1 
ATOM   2402  N  N     . ILE B 1  78   ? -40.216 18.493  126.366 1.00 50.22  ? 78   ILE B N     1 
ATOM   2403  C  CA    . ILE B 1  78   ? -39.941 19.615  127.258 1.00 54.64  ? 78   ILE B CA    1 
ATOM   2404  C  C     . ILE B 1  78   ? -38.576 19.446  127.924 1.00 50.70  ? 78   ILE B C     1 
ATOM   2405  O  O     . ILE B 1  78   ? -37.843 20.416  128.121 1.00 46.04  ? 78   ILE B O     1 
ATOM   2406  C  CB    . ILE B 1  78   ? -41.042 19.773  128.326 1.00 54.39  ? 78   ILE B CB    1 
ATOM   2407  C  CG1   . ILE B 1  78   ? -42.421 19.791  127.662 1.00 54.44  ? 78   ILE B CG1   1 
ATOM   2408  C  CG2   . ILE B 1  78   ? -40.823 21.043  129.139 1.00 51.54  ? 78   ILE B CG2   1 
ATOM   2409  C  CD1   . ILE B 1  78   ? -43.571 19.863  128.636 1.00 52.59  ? 78   ILE B CD1   1 
ATOM   2410  N  N     . ILE B 1  79   ? -38.244 18.204  128.261 1.00 53.74  ? 79   ILE B N     1 
ATOM   2411  C  CA    . ILE B 1  79   ? -36.939 17.870  128.821 1.00 52.02  ? 79   ILE B CA    1 
ATOM   2412  C  C     . ILE B 1  79   ? -35.831 18.224  127.832 1.00 50.89  ? 79   ILE B C     1 
ATOM   2413  O  O     . ILE B 1  79   ? -34.791 18.770  128.210 1.00 44.67  ? 79   ILE B O     1 
ATOM   2414  C  CB    . ILE B 1  79   ? -36.857 16.371  129.182 1.00 50.34  ? 79   ILE B CB    1 
ATOM   2415  C  CG1   . ILE B 1  79   ? -37.787 16.056  130.353 1.00 47.36  ? 79   ILE B CG1   1 
ATOM   2416  C  CG2   . ILE B 1  79   ? -35.433 15.969  129.527 1.00 56.09  ? 79   ILE B CG2   1 
ATOM   2417  C  CD1   . ILE B 1  79   ? -37.732 14.618  130.795 1.00 51.70  ? 79   ILE B CD1   1 
ATOM   2418  N  N     . LEU B 1  80   ? -36.069 17.911  126.561 1.00 52.71  ? 80   LEU B N     1 
ATOM   2419  C  CA    . LEU B 1  80   ? -35.140 18.250  125.491 1.00 45.68  ? 80   LEU B CA    1 
ATOM   2420  C  C     . LEU B 1  80   ? -34.936 19.760  125.425 1.00 47.93  ? 80   LEU B C     1 
ATOM   2421  O  O     . LEU B 1  80   ? -33.805 20.245  125.421 1.00 44.30  ? 80   LEU B O     1 
ATOM   2422  C  CB    . LEU B 1  80   ? -35.665 17.736  124.150 1.00 37.84  ? 80   LEU B CB    1 
ATOM   2423  C  CG    . LEU B 1  80   ? -35.792 16.225  123.984 1.00 36.46  ? 80   LEU B CG    1 
ATOM   2424  C  CD1   . LEU B 1  80   ? -36.415 15.894  122.644 1.00 45.59  ? 80   LEU B CD1   1 
ATOM   2425  C  CD2   . LEU B 1  80   ? -34.436 15.564  124.120 1.00 41.59  ? 80   LEU B CD2   1 
ATOM   2426  N  N     . ASN B 1  81   ? -36.042 20.497  125.382 1.00 50.93  ? 81   ASN B N     1 
ATOM   2427  C  CA    . ASN B 1  81   ? -35.991 21.952  125.356 1.00 47.76  ? 81   ASN B CA    1 
ATOM   2428  C  C     . ASN B 1  81   ? -35.255 22.494  126.573 1.00 45.72  ? 81   ASN B C     1 
ATOM   2429  O  O     . ASN B 1  81   ? -34.599 23.532  126.506 1.00 50.48  ? 81   ASN B O     1 
ATOM   2430  C  CB    . ASN B 1  81   ? -37.403 22.541  125.276 1.00 48.70  ? 81   ASN B CB    1 
ATOM   2431  C  CG    . ASN B 1  81   ? -38.042 22.347  123.910 1.00 54.68  ? 81   ASN B CG    1 
ATOM   2432  O  OD1   . ASN B 1  81   ? -37.369 22.406  122.880 1.00 58.92  ? 81   ASN B OD1   1 
ATOM   2433  N  ND2   . ASN B 1  81   ? -39.350 22.117  123.896 1.00 52.25  ? 81   ASN B ND2   1 
ATOM   2434  N  N     . LEU B 1  82   ? -35.358 21.774  127.683 1.00 43.64  ? 82   LEU B N     1 
ATOM   2435  C  CA    . LEU B 1  82   ? -34.663 22.155  128.902 1.00 46.77  ? 82   LEU B CA    1 
ATOM   2436  C  C     . LEU B 1  82   ? -33.169 21.864  128.816 1.00 48.05  ? 82   LEU B C     1 
ATOM   2437  O  O     . LEU B 1  82   ? -32.373 22.460  129.541 1.00 53.55  ? 82   LEU B O     1 
ATOM   2438  C  CB    . LEU B 1  82   ? -35.275 21.447  130.108 1.00 48.12  ? 82   LEU B CB    1 
ATOM   2439  C  CG    . LEU B 1  82   ? -36.555 22.089  130.635 1.00 48.56  ? 82   LEU B CG    1 
ATOM   2440  C  CD1   . LEU B 1  82   ? -37.275 21.146  131.576 1.00 54.11  ? 82   LEU B CD1   1 
ATOM   2441  C  CD2   . LEU B 1  82   ? -36.221 23.394  131.334 1.00 52.13  ? 82   LEU B CD2   1 
ATOM   2442  N  N     . LYS B 1  83   ? -32.789 20.946  127.933 1.00 44.51  ? 83   LYS B N     1 
ATOM   2443  C  CA    . LYS B 1  83   ? -31.381 20.620  127.754 1.00 39.82  ? 83   LYS B CA    1 
ATOM   2444  C  C     . LYS B 1  83   ? -30.653 21.740  127.020 1.00 45.53  ? 83   LYS B C     1 
ATOM   2445  O  O     . LYS B 1  83   ? -29.451 21.931  127.204 1.00 46.39  ? 83   LYS B O     1 
ATOM   2446  C  CB    . LYS B 1  83   ? -31.212 19.307  126.989 1.00 41.42  ? 83   LYS B CB    1 
ATOM   2447  C  CG    . LYS B 1  83   ? -31.579 18.054  127.766 1.00 36.63  ? 83   LYS B CG    1 
ATOM   2448  C  CD    . LYS B 1  83   ? -31.238 16.821  126.946 1.00 42.58  ? 83   LYS B CD    1 
ATOM   2449  C  CE    . LYS B 1  83   ? -31.539 15.531  127.689 1.00 52.28  ? 83   LYS B CE    1 
ATOM   2450  N  NZ    . LYS B 1  83   ? -31.210 14.331  126.860 1.00 45.48  ? 83   LYS B NZ    1 
ATOM   2451  N  N     . GLU B 1  84   ? -31.386 22.482  126.194 1.00 49.22  ? 84   GLU B N     1 
ATOM   2452  C  CA    . GLU B 1  84   ? -30.786 23.545  125.390 1.00 52.02  ? 84   GLU B CA    1 
ATOM   2453  C  C     . GLU B 1  84   ? -30.752 24.887  126.119 1.00 53.50  ? 84   GLU B C     1 
ATOM   2454  O  O     . GLU B 1  84   ? -30.252 25.878  125.586 1.00 57.94  ? 84   GLU B O     1 
ATOM   2455  C  CB    . GLU B 1  84   ? -31.511 23.692  124.049 1.00 47.26  ? 84   GLU B CB    1 
ATOM   2456  C  CG    . GLU B 1  84   ? -31.522 22.426  123.207 1.00 52.74  ? 84   GLU B CG    1 
ATOM   2457  C  CD    . GLU B 1  84   ? -32.042 22.663  121.803 1.00 52.58  ? 84   GLU B CD    1 
ATOM   2458  O  OE1   . GLU B 1  84   ? -31.850 23.782  121.281 1.00 57.41  ? 84   GLU B OE1   1 
ATOM   2459  O  OE2   . GLU B 1  84   ? -32.645 21.734  121.225 1.00 47.60  ? 84   GLU B OE2   1 
ATOM   2460  N  N     . LEU B 1  85   ? -31.286 24.915  127.335 1.00 49.64  ? 85   LEU B N     1 
ATOM   2461  C  CA    . LEU B 1  85   ? -31.259 26.122  128.152 1.00 52.01  ? 85   LEU B CA    1 
ATOM   2462  C  C     . LEU B 1  85   ? -29.832 26.459  128.576 1.00 55.13  ? 85   LEU B C     1 
ATOM   2463  O  O     . LEU B 1  85   ? -29.130 25.619  129.140 1.00 53.91  ? 85   LEU B O     1 
ATOM   2464  C  CB    . LEU B 1  85   ? -32.148 25.947  129.384 1.00 50.83  ? 85   LEU B CB    1 
ATOM   2465  C  CG    . LEU B 1  85   ? -32.121 27.079  130.412 1.00 57.14  ? 85   LEU B CG    1 
ATOM   2466  C  CD1   . LEU B 1  85   ? -32.570 28.388  129.781 1.00 65.69  ? 85   LEU B CD1   1 
ATOM   2467  C  CD2   . LEU B 1  85   ? -32.983 26.736  131.620 1.00 53.93  ? 85   LEU B CD2   1 
ATOM   2468  N  N     . VAL B 1  86   ? -29.407 27.689  128.303 1.00 55.23  ? 86   VAL B N     1 
ATOM   2469  C  CA    . VAL B 1  86   ? -28.064 28.128  128.670 1.00 54.37  ? 86   VAL B CA    1 
ATOM   2470  C  C     . VAL B 1  86   ? -28.113 29.060  129.871 1.00 60.60  ? 86   VAL B C     1 
ATOM   2471  O  O     . VAL B 1  86   ? -28.555 30.203  129.762 1.00 68.48  ? 86   VAL B O     1 
ATOM   2472  C  CB    . VAL B 1  86   ? -27.371 28.854  127.506 1.00 54.53  ? 86   VAL B CB    1 
ATOM   2473  C  CG1   . VAL B 1  86   ? -25.952 29.238  127.892 1.00 57.79  ? 86   VAL B CG1   1 
ATOM   2474  C  CG2   . VAL B 1  86   ? -27.368 27.978  126.268 1.00 62.67  ? 86   VAL B CG2   1 
ATOM   2475  N  N     . VAL B 1  87   ? -27.641 28.571  131.012 1.00 59.44  ? 87   VAL B N     1 
ATOM   2476  C  CA    . VAL B 1  87   ? -27.699 29.329  132.256 1.00 62.31  ? 87   VAL B CA    1 
ATOM   2477  C  C     . VAL B 1  87   ? -26.306 29.703  132.747 1.00 66.91  ? 87   VAL B C     1 
ATOM   2478  O  O     . VAL B 1  87   ? -25.422 28.853  132.843 1.00 72.32  ? 87   VAL B O     1 
ATOM   2479  C  CB    . VAL B 1  87   ? -28.442 28.543  133.355 1.00 64.43  ? 87   VAL B CB    1 
ATOM   2480  C  CG1   . VAL B 1  87   ? -28.181 29.150  134.725 1.00 70.24  ? 87   VAL B CG1   1 
ATOM   2481  C  CG2   . VAL B 1  87   ? -29.935 28.495  133.055 1.00 61.15  ? 87   VAL B CG2   1 
ATOM   2482  N  N     . ARG B 1  88   ? -26.117 30.980  133.060 1.00 68.65  ? 88   ARG B N     1 
ATOM   2483  C  CA    . ARG B 1  88   ? -24.817 31.472  133.491 1.00 76.04  ? 88   ARG B CA    1 
ATOM   2484  C  C     . ARG B 1  88   ? -24.823 31.899  134.960 1.00 80.83  ? 88   ARG B C     1 
ATOM   2485  O  O     . ARG B 1  88   ? -25.680 32.673  135.389 1.00 78.82  ? 88   ARG B O     1 
ATOM   2486  C  CB    . ARG B 1  88   ? -24.388 32.637  132.602 1.00 72.97  ? 88   ARG B CB    1 
ATOM   2487  C  CG    . ARG B 1  88   ? -22.972 33.114  132.833 1.00 70.25  ? 88   ARG B CG    1 
ATOM   2488  C  CD    . ARG B 1  88   ? -22.650 34.252  131.889 1.00 72.56  ? 88   ARG B CD    1 
ATOM   2489  N  NE    . ARG B 1  88   ? -21.278 34.719  132.041 1.00 72.85  ? 88   ARG B NE    1 
ATOM   2490  C  CZ    . ARG B 1  88   ? -20.750 35.706  131.328 1.00 70.38  ? 88   ARG B CZ    1 
ATOM   2491  N  NH1   . ARG B 1  88   ? -21.485 36.329  130.416 1.00 71.84  ? 88   ARG B NH1   1 
ATOM   2492  N  NH2   . ARG B 1  88   ? -19.491 36.069  131.526 1.00 67.84  ? 88   ARG B NH2   1 
ATOM   2493  N  N     . PHE B 1  89   ? -23.865 31.385  135.725 1.00 79.50  ? 89   PHE B N     1 
ATOM   2494  C  CA    . PHE B 1  89   ? -23.722 31.753  137.130 1.00 75.06  ? 89   PHE B CA    1 
ATOM   2495  C  C     . PHE B 1  89   ? -22.750 32.917  137.263 1.00 81.51  ? 89   PHE B C     1 
ATOM   2496  O  O     . PHE B 1  89   ? -21.571 32.789  136.934 1.00 79.69  ? 89   PHE B O     1 
ATOM   2497  C  CB    . PHE B 1  89   ? -23.218 30.568  137.958 1.00 71.64  ? 89   PHE B CB    1 
ATOM   2498  C  CG    . PHE B 1  89   ? -24.195 29.427  138.059 1.00 71.09  ? 89   PHE B CG    1 
ATOM   2499  C  CD1   . PHE B 1  89   ? -25.517 29.585  137.675 1.00 68.28  ? 89   PHE B CD1   1 
ATOM   2500  C  CD2   . PHE B 1  89   ? -23.789 28.195  138.548 1.00 72.63  ? 89   PHE B CD2   1 
ATOM   2501  C  CE1   . PHE B 1  89   ? -26.413 28.533  137.770 1.00 64.01  ? 89   PHE B CE1   1 
ATOM   2502  C  CE2   . PHE B 1  89   ? -24.680 27.140  138.647 1.00 64.56  ? 89   PHE B CE2   1 
ATOM   2503  C  CZ    . PHE B 1  89   ? -25.993 27.310  138.258 1.00 60.08  ? 89   PHE B CZ    1 
ATOM   2504  N  N     . LEU B 1  90   ? -23.247 34.053  137.745 1.00 83.71  ? 90   LEU B N     1 
ATOM   2505  C  CA    . LEU B 1  90   ? -22.412 35.239  137.912 1.00 84.03  ? 90   LEU B CA    1 
ATOM   2506  C  C     . LEU B 1  90   ? -21.539 35.131  139.154 1.00 80.23  ? 90   LEU B C     1 
ATOM   2507  O  O     . LEU B 1  90   ? -20.489 35.768  139.244 1.00 81.73  ? 90   LEU B O     1 
ATOM   2508  C  CB    . LEU B 1  90   ? -23.263 36.511  137.988 1.00 85.45  ? 90   LEU B CB    1 
ATOM   2509  C  CG    . LEU B 1  90   ? -23.925 37.028  136.708 1.00 83.43  ? 90   LEU B CG    1 
ATOM   2510  C  CD1   . LEU B 1  90   ? -22.955 36.976  135.534 1.00 77.90  ? 90   LEU B CD1   1 
ATOM   2511  C  CD2   . LEU B 1  90   ? -25.190 36.251  136.397 1.00 81.34  ? 90   LEU B CD2   1 
ATOM   2512  N  N     . ASN B 1  91   ? -21.979 34.324  140.113 1.00 77.93  ? 91   ASN B N     1 
ATOM   2513  C  CA    . ASN B 1  91   ? -21.241 34.160  141.357 1.00 79.94  ? 91   ASN B CA    1 
ATOM   2514  C  C     . ASN B 1  91   ? -20.507 32.825  141.386 1.00 77.25  ? 91   ASN B C     1 
ATOM   2515  O  O     . ASN B 1  91   ? -21.132 31.767  141.309 1.00 76.93  ? 91   ASN B O     1 
ATOM   2516  C  CB    . ASN B 1  91   ? -22.174 34.283  142.562 1.00 82.07  ? 91   ASN B CB    1 
ATOM   2517  C  CG    . ASN B 1  91   ? -21.422 34.410  143.872 1.00 90.50  ? 91   ASN B CG    1 
ATOM   2518  O  OD1   . ASN B 1  91   ? -20.320 34.957  143.918 1.00 90.38  ? 91   ASN B OD1   1 
ATOM   2519  N  ND2   . ASN B 1  91   ? -22.015 33.904  144.947 1.00 79.26  ? 91   ASN B ND2   1 
ATOM   2520  N  N     . PRO B 1  92   ? -19.170 32.875  141.506 1.00 77.71  ? 92   PRO B N     1 
ATOM   2521  C  CA    . PRO B 1  92   ? -18.308 31.688  141.496 1.00 82.71  ? 92   PRO B CA    1 
ATOM   2522  C  C     . PRO B 1  92   ? -18.562 30.799  142.704 1.00 84.99  ? 92   PRO B C     1 
ATOM   2523  O  O     . PRO B 1  92   ? -18.173 29.630  142.714 1.00 85.83  ? 92   PRO B O     1 
ATOM   2524  C  CB    . PRO B 1  92   ? -16.899 32.283  141.570 1.00 84.00  ? 92   PRO B CB    1 
ATOM   2525  C  CG    . PRO B 1  92   ? -17.085 33.598  142.238 1.00 84.07  ? 92   PRO B CG    1 
ATOM   2526  C  CD    . PRO B 1  92   ? -18.401 34.109  141.736 1.00 82.98  ? 92   PRO B CD    1 
ATOM   2527  N  N     . SER B 1  93   ? -19.211 31.359  143.716 1.00 80.27  ? 93   SER B N     1 
ATOM   2528  C  CA    . SER B 1  93   ? -19.518 30.619  144.928 1.00 88.36  ? 93   SER B CA    1 
ATOM   2529  C  C     . SER B 1  93   ? -20.694 29.670  144.707 1.00 94.73  ? 93   SER B C     1 
ATOM   2530  O  O     . SER B 1  93   ? -20.795 28.630  145.361 1.00 96.38  ? 93   SER B O     1 
ATOM   2531  C  CB    . SER B 1  93   ? -19.837 31.590  146.066 1.00 86.14  ? 93   SER B CB    1 
ATOM   2532  O  OG    . SER B 1  93   ? -18.832 32.580  146.196 1.00 88.45  ? 93   SER B OG    1 
ATOM   2533  N  N     . LEU B 1  94   ? -21.569 30.023  143.769 1.00 87.20  ? 94   LEU B N     1 
ATOM   2534  C  CA    . LEU B 1  94   ? -22.831 29.313  143.596 1.00 79.40  ? 94   LEU B CA    1 
ATOM   2535  C  C     . LEU B 1  94   ? -22.656 28.014  142.815 1.00 75.89  ? 94   LEU B C     1 
ATOM   2536  O  O     . LEU B 1  94   ? -22.315 28.033  141.633 1.00 78.04  ? 94   LEU B O     1 
ATOM   2537  C  CB    . LEU B 1  94   ? -23.799 30.232  142.851 1.00 77.15  ? 94   LEU B CB    1 
ATOM   2538  C  CG    . LEU B 1  94   ? -25.084 29.656  142.267 1.00 77.21  ? 94   LEU B CG    1 
ATOM   2539  C  CD1   . LEU B 1  94   ? -25.942 29.075  143.364 1.00 73.92  ? 94   LEU B CD1   1 
ATOM   2540  C  CD2   . LEU B 1  94   ? -25.830 30.746  141.518 1.00 82.63  ? 94   LEU B CD2   1 
ATOM   2541  N  N     . GLN B 1  95   ? -22.894 26.886  143.480 1.00 71.71  ? 95   GLN B N     1 
ATOM   2542  C  CA    . GLN B 1  95   ? -22.788 25.585  142.824 1.00 68.06  ? 95   GLN B CA    1 
ATOM   2543  C  C     . GLN B 1  95   ? -24.085 25.022  142.235 1.00 65.31  ? 95   GLN B C     1 
ATOM   2544  O  O     . GLN B 1  95   ? -24.043 24.181  141.337 1.00 66.07  ? 95   GLN B O     1 
ATOM   2545  C  CB    . GLN B 1  95   ? -22.186 24.567  143.796 1.00 66.67  ? 95   GLN B CB    1 
ATOM   2546  C  CG    . GLN B 1  95   ? -20.849 24.988  144.380 1.00 71.18  ? 95   GLN B CG    1 
ATOM   2547  C  CD    . GLN B 1  95   ? -19.702 24.149  143.860 1.00 85.00  ? 95   GLN B CD    1 
ATOM   2548  O  OE1   . GLN B 1  95   ? -18.734 24.673  143.309 1.00 93.99  ? 95   GLN B OE1   1 
ATOM   2549  N  NE2   . GLN B 1  95   ? -19.802 22.836  144.037 1.00 87.61  ? 95   GLN B NE2   1 
ATOM   2550  N  N     . THR B 1  96   ? -25.232 25.481  142.728 1.00 62.18  ? 96   THR B N     1 
ATOM   2551  C  CA    . THR B 1  96   ? -26.511 24.914  142.293 1.00 56.87  ? 96   THR B CA    1 
ATOM   2552  C  C     . THR B 1  96   ? -27.703 25.852  142.473 1.00 59.93  ? 96   THR B C     1 
ATOM   2553  O  O     . THR B 1  96   ? -27.758 26.618  143.430 1.00 65.87  ? 96   THR B O     1 
ATOM   2554  C  CB    . THR B 1  96   ? -26.806 23.579  143.008 1.00 56.77  ? 96   THR B CB    1 
ATOM   2555  O  OG1   . THR B 1  96   ? -28.170 23.206  142.784 1.00 52.83  ? 96   THR B OG1   1 
ATOM   2556  C  CG2   . THR B 1  96   ? -26.565 23.711  144.501 1.00 66.93  ? 96   THR B CG2   1 
ATOM   2557  N  N     . VAL B 1  97   ? -28.672 25.762  141.566 1.00 60.08  ? 97   VAL B N     1 
ATOM   2558  C  CA    . VAL B 1  97   ? -29.883 26.575  141.641 1.00 55.17  ? 97   VAL B CA    1 
ATOM   2559  C  C     . VAL B 1  97   ? -31.108 25.720  141.321 1.00 64.50  ? 97   VAL B C     1 
ATOM   2560  O  O     . VAL B 1  97   ? -31.019 24.757  140.559 1.00 66.90  ? 97   VAL B O     1 
ATOM   2561  C  CB    . VAL B 1  97   ? -29.847 27.761  140.644 1.00 53.94  ? 97   VAL B CB    1 
ATOM   2562  C  CG1   . VAL B 1  97   ? -30.965 28.746  140.940 1.00 63.91  ? 97   VAL B CG1   1 
ATOM   2563  C  CG2   . VAL B 1  97   ? -28.512 28.473  140.693 1.00 57.95  ? 97   VAL B CG2   1 
ATOM   2564  N  N     . THR B 1  98   ? -32.246 26.065  141.915 1.00 69.92  ? 98   THR B N     1 
ATOM   2565  C  CA    . THR B 1  98   ? -33.517 25.457  141.544 1.00 67.46  ? 98   THR B CA    1 
ATOM   2566  C  C     . THR B 1  98   ? -34.438 26.532  140.979 1.00 61.93  ? 98   THR B C     1 
ATOM   2567  O  O     . THR B 1  98   ? -34.883 27.417  141.705 1.00 62.03  ? 98   THR B O     1 
ATOM   2568  C  CB    . THR B 1  98   ? -34.197 24.777  142.747 1.00 66.79  ? 98   THR B CB    1 
ATOM   2569  O  OG1   . THR B 1  98   ? -33.347 23.743  143.258 1.00 73.01  ? 98   THR B OG1   1 
ATOM   2570  C  CG2   . THR B 1  98   ? -35.533 24.171  142.334 1.00 62.38  ? 98   THR B CG2   1 
ATOM   2571  N  N     . LEU B 1  99   ? -34.720 26.451  139.683 1.00 62.47  ? 99   LEU B N     1 
ATOM   2572  C  CA    . LEU B 1  99   ? -35.561 27.442  139.020 1.00 59.81  ? 99   LEU B CA    1 
ATOM   2573  C  C     . LEU B 1  99   ? -37.011 26.981  138.956 1.00 63.10  ? 99   LEU B C     1 
ATOM   2574  O  O     . LEU B 1  99   ? -37.304 25.887  138.476 1.00 61.62  ? 99   LEU B O     1 
ATOM   2575  C  CB    . LEU B 1  99   ? -35.048 27.744  137.610 1.00 56.85  ? 99   LEU B CB    1 
ATOM   2576  C  CG    . LEU B 1  99   ? -33.804 28.625  137.455 1.00 66.01  ? 99   LEU B CG    1 
ATOM   2577  C  CD1   . LEU B 1  99   ? -32.532 27.883  137.840 1.00 61.89  ? 99   LEU B CD1   1 
ATOM   2578  C  CD2   . LEU B 1  99   ? -33.708 29.157  136.031 1.00 67.41  ? 99   LEU B CD2   1 
ATOM   2579  N  N     . LEU B 1  100  ? -37.916 27.824  139.442 1.00 65.89  ? 100  LEU B N     1 
ATOM   2580  C  CA    . LEU B 1  100  ? -39.334 27.496  139.449 1.00 62.85  ? 100  LEU B CA    1 
ATOM   2581  C  C     . LEU B 1  100  ? -40.053 28.205  138.312 1.00 63.68  ? 100  LEU B C     1 
ATOM   2582  O  O     . LEU B 1  100  ? -39.719 29.340  137.964 1.00 62.97  ? 100  LEU B O     1 
ATOM   2583  C  CB    . LEU B 1  100  ? -39.983 27.874  140.786 1.00 72.14  ? 100  LEU B CB    1 
ATOM   2584  C  CG    . LEU B 1  100  ? -39.671 27.042  142.036 1.00 73.96  ? 100  LEU B CG    1 
ATOM   2585  C  CD1   . LEU B 1  100  ? -38.356 27.464  142.678 1.00 71.34  ? 100  LEU B CD1   1 
ATOM   2586  C  CD2   . LEU B 1  100  ? -40.816 27.124  143.041 1.00 73.04  ? 100  LEU B CD2   1 
ATOM   2587  N  N     . LEU B 1  101  ? -41.025 27.519  137.721 1.00 68.93  ? 101  LEU B N     1 
ATOM   2588  C  CA    . LEU B 1  101  ? -41.872 28.114  136.695 1.00 71.11  ? 101  LEU B CA    1 
ATOM   2589  C  C     . LEU B 1  101  ? -43.320 27.647  136.827 1.00 74.37  ? 101  LEU B C     1 
ATOM   2590  O  O     . LEU B 1  101  ? -43.596 26.448  136.878 1.00 76.72  ? 101  LEU B O     1 
ATOM   2591  C  CB    . LEU B 1  101  ? -41.330 27.793  135.302 1.00 71.10  ? 101  LEU B CB    1 
ATOM   2592  C  CG    . LEU B 1  101  ? -42.068 28.414  134.119 1.00 68.67  ? 101  LEU B CG    1 
ATOM   2593  C  CD1   . LEU B 1  101  ? -41.066 29.009  133.147 1.00 68.57  ? 101  LEU B CD1   1 
ATOM   2594  C  CD2   . LEU B 1  101  ? -42.946 27.378  133.428 1.00 63.13  ? 101  LEU B CD2   1 
ATOM   2595  N  N     . LYS B 1  102  ? -44.242 28.602  136.878 1.00 74.98  ? 102  LYS B N     1 
ATOM   2596  C  CA    . LYS B 1  102  ? -45.665 28.295  136.964 1.00 72.72  ? 102  LYS B CA    1 
ATOM   2597  C  C     . LYS B 1  102  ? -46.421 29.119  135.934 1.00 65.75  ? 102  LYS B C     1 
ATOM   2598  O  O     . LYS B 1  102  ? -46.294 30.342  135.896 1.00 63.43  ? 102  LYS B O     1 
ATOM   2599  C  CB    . LYS B 1  102  ? -46.201 28.594  138.366 1.00 76.86  ? 102  LYS B CB    1 
ATOM   2600  C  CG    . LYS B 1  102  ? -45.432 27.910  139.488 1.00 88.56  ? 102  LYS B CG    1 
ATOM   2601  C  CD    . LYS B 1  102  ? -45.894 28.380  140.861 1.00 88.55  ? 102  LYS B CD    1 
ATOM   2602  C  CE    . LYS B 1  102  ? -45.020 27.795  141.962 1.00 82.14  ? 102  LYS B CE    1 
ATOM   2603  N  NZ    . LYS B 1  102  ? -45.448 28.241  143.315 1.00 79.01  ? 102  LYS B NZ    1 
ATOM   2604  N  N     . ALA B 1  103  ? -47.198 28.446  135.094 1.00 60.36  ? 103  ALA B N     1 
ATOM   2605  C  CA    . ALA B 1  103  ? -47.976 29.128  134.069 1.00 63.93  ? 103  ALA B CA    1 
ATOM   2606  C  C     . ALA B 1  103  ? -49.174 28.294  133.628 1.00 75.64  ? 103  ALA B C     1 
ATOM   2607  O  O     . ALA B 1  103  ? -49.202 27.078  133.823 1.00 72.29  ? 103  ALA B O     1 
ATOM   2608  C  CB    . ALA B 1  103  ? -47.097 29.468  132.877 1.00 62.35  ? 103  ALA B CB    1 
ATOM   2609  N  N     . GLU B 1  104  ? -50.160 28.956  133.030 1.00 84.22  ? 104  GLU B N     1 
ATOM   2610  C  CA    . GLU B 1  104  ? -51.347 28.277  132.522 1.00 84.10  ? 104  GLU B CA    1 
ATOM   2611  C  C     . GLU B 1  104  ? -52.031 29.091  131.424 1.00 89.66  ? 104  GLU B C     1 
ATOM   2612  O  O     . GLU B 1  104  ? -51.574 30.179  131.067 1.00 90.23  ? 104  GLU B O     1 
ATOM   2613  C  CB    . GLU B 1  104  ? -52.335 27.985  133.657 1.00 90.38  ? 104  GLU B CB    1 
ATOM   2614  C  CG    . GLU B 1  104  ? -52.877 29.223  134.359 1.00 90.53  ? 104  GLU B CG    1 
ATOM   2615  C  CD    . GLU B 1  104  ? -53.983 28.899  135.347 1.00 87.78  ? 104  GLU B CD    1 
ATOM   2616  O  OE1   . GLU B 1  104  ? -54.408 29.813  136.085 1.00 92.55  ? 104  GLU B OE1   1 
ATOM   2617  O  OE2   . GLU B 1  104  ? -54.430 27.733  135.383 1.00 80.68  ? 104  GLU B OE2   1 
ATOM   2618  N  N     . GLY B 1  105  ? -53.125 28.556  130.890 1.00 86.56  ? 105  GLY B N     1 
ATOM   2619  C  CA    . GLY B 1  105  ? -53.899 29.249  129.876 1.00 89.05  ? 105  GLY B CA    1 
ATOM   2620  C  C     . GLY B 1  105  ? -53.245 29.230  128.508 1.00 87.94  ? 105  GLY B C     1 
ATOM   2621  O  O     . GLY B 1  105  ? -52.234 28.558  128.310 1.00 88.64  ? 105  GLY B O     1 
ATOM   2622  N  N     . PRO B 1  106  ? -53.823 29.972  127.552 1.00 89.32  ? 106  PRO B N     1 
ATOM   2623  C  CA    . PRO B 1  106  ? -53.315 30.049  126.176 1.00 90.43  ? 106  PRO B CA    1 
ATOM   2624  C  C     . PRO B 1  106  ? -52.053 30.904  126.067 1.00 91.52  ? 106  PRO B C     1 
ATOM   2625  O  O     . PRO B 1  106  ? -52.121 32.071  125.680 1.00 92.70  ? 106  PRO B O     1 
ATOM   2626  C  CB    . PRO B 1  106  ? -54.471 30.704  125.416 1.00 91.71  ? 106  PRO B CB    1 
ATOM   2627  C  CG    . PRO B 1  106  ? -55.182 31.512  126.444 1.00 104.77 ? 106  PRO B CG    1 
ATOM   2628  C  CD    . PRO B 1  106  ? -55.070 30.737  127.727 1.00 95.18  ? 106  PRO B CD    1 
ATOM   2629  N  N     . LYS B 1  107  ? -50.911 30.314  126.404 1.00 87.44  ? 107  LYS B N     1 
ATOM   2630  C  CA    . LYS B 1  107  ? -49.639 31.025  126.383 1.00 79.87  ? 107  LYS B CA    1 
ATOM   2631  C  C     . LYS B 1  107  ? -48.497 30.070  126.033 1.00 80.71  ? 107  LYS B C     1 
ATOM   2632  O  O     . LYS B 1  107  ? -48.518 28.899  126.417 1.00 78.54  ? 107  LYS B O     1 
ATOM   2633  C  CB    . LYS B 1  107  ? -49.392 31.680  127.744 1.00 77.92  ? 107  LYS B CB    1 
ATOM   2634  C  CG    . LYS B 1  107  ? -48.083 32.442  127.867 1.00 79.96  ? 107  LYS B CG    1 
ATOM   2635  C  CD    . LYS B 1  107  ? -47.835 32.844  129.313 1.00 84.91  ? 107  LYS B CD    1 
ATOM   2636  C  CE    . LYS B 1  107  ? -46.492 33.532  129.486 1.00 79.89  ? 107  LYS B CE    1 
ATOM   2637  N  NZ    . LYS B 1  107  ? -46.214 33.832  130.920 1.00 77.59  ? 107  LYS B NZ    1 
ATOM   2638  N  N     . GLU B 1  108  ? -47.508 30.570  125.297 1.00 80.49  ? 108  GLU B N     1 
ATOM   2639  C  CA    . GLU B 1  108  ? -46.332 29.777  124.954 1.00 70.45  ? 108  GLU B CA    1 
ATOM   2640  C  C     . GLU B 1  108  ? -45.163 30.160  125.854 1.00 76.50  ? 108  GLU B C     1 
ATOM   2641  O  O     . GLU B 1  108  ? -44.606 31.254  125.740 1.00 73.88  ? 108  GLU B O     1 
ATOM   2642  C  CB    . GLU B 1  108  ? -45.948 29.979  123.487 1.00 68.36  ? 108  GLU B CB    1 
ATOM   2643  C  CG    . GLU B 1  108  ? -47.035 29.597  122.498 1.00 79.86  ? 108  GLU B CG    1 
ATOM   2644  C  CD    . GLU B 1  108  ? -46.597 29.773  121.057 1.00 85.50  ? 108  GLU B CD    1 
ATOM   2645  O  OE1   . GLU B 1  108  ? -45.372 29.841  120.813 1.00 81.74  ? 108  GLU B OE1   1 
ATOM   2646  O  OE2   . GLU B 1  108  ? -47.475 29.846  120.170 1.00 80.98  ? 108  GLU B OE2   1 
ATOM   2647  N  N     . VAL B 1  109  ? -44.790 29.247  126.743 1.00 77.51  ? 109  VAL B N     1 
ATOM   2648  C  CA    . VAL B 1  109  ? -43.755 29.521  127.729 1.00 74.78  ? 109  VAL B CA    1 
ATOM   2649  C  C     . VAL B 1  109  ? -42.361 29.547  127.115 1.00 69.68  ? 109  VAL B C     1 
ATOM   2650  O  O     . VAL B 1  109  ? -41.918 28.574  126.505 1.00 69.07  ? 109  VAL B O     1 
ATOM   2651  C  CB    . VAL B 1  109  ? -43.774 28.477  128.859 1.00 76.28  ? 109  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B 1  109  ? -42.659 28.754  129.856 1.00 71.26  ? 109  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B 1  109  ? -45.129 28.469  129.548 1.00 74.85  ? 109  VAL B CG2   1 
ATOM   2654  N  N     . LYS B 1  110  ? -41.671 30.667  127.292 1.00 63.58  ? 110  LYS B N     1 
ATOM   2655  C  CA    . LYS B 1  110  ? -40.284 30.786  126.871 1.00 63.77  ? 110  LYS B CA    1 
ATOM   2656  C  C     . LYS B 1  110  ? -39.372 30.742  128.094 1.00 63.65  ? 110  LYS B C     1 
ATOM   2657  O  O     . LYS B 1  110  ? -39.850 30.612  129.218 1.00 70.26  ? 110  LYS B O     1 
ATOM   2658  C  CB    . LYS B 1  110  ? -40.079 32.073  126.071 1.00 74.31  ? 110  LYS B CB    1 
ATOM   2659  C  CG    . LYS B 1  110  ? -40.797 32.077  124.724 1.00 76.79  ? 110  LYS B CG    1 
ATOM   2660  C  CD    . LYS B 1  110  ? -40.193 31.049  123.774 1.00 73.05  ? 110  LYS B CD    1 
ATOM   2661  C  CE    . LYS B 1  110  ? -40.865 31.053  122.404 1.00 65.47  ? 110  LYS B CE    1 
ATOM   2662  N  NZ    . LYS B 1  110  ? -42.216 30.424  122.417 1.00 64.34  ? 110  LYS B NZ    1 
ATOM   2663  N  N     . ALA B 1  111  ? -38.065 30.849  127.879 1.00 60.46  ? 111  ALA B N     1 
ATOM   2664  C  CA    . ALA B 1  111  ? -37.104 30.751  128.977 1.00 63.80  ? 111  ALA B CA    1 
ATOM   2665  C  C     . ALA B 1  111  ? -37.092 32.012  129.834 1.00 76.71  ? 111  ALA B C     1 
ATOM   2666  O  O     . ALA B 1  111  ? -36.489 32.045  130.908 1.00 79.48  ? 111  ALA B O     1 
ATOM   2667  C  CB    . ALA B 1  111  ? -35.715 30.454  128.443 1.00 63.92  ? 111  ALA B CB    1 
ATOM   2668  N  N     . ARG B 1  112  ? -37.765 33.046  129.346 1.00 76.77  ? 112  ARG B N     1 
ATOM   2669  C  CA    . ARG B 1  112  ? -37.871 34.310  130.056 1.00 79.79  ? 112  ARG B CA    1 
ATOM   2670  C  C     . ARG B 1  112  ? -38.748 34.153  131.293 1.00 81.09  ? 112  ARG B C     1 
ATOM   2671  O  O     . ARG B 1  112  ? -38.524 34.803  132.316 1.00 79.32  ? 112  ARG B O     1 
ATOM   2672  C  CB    . ARG B 1  112  ? -38.484 35.356  129.129 1.00 78.49  ? 112  ARG B CB    1 
ATOM   2673  C  CG    . ARG B 1  112  ? -38.228 36.793  129.527 1.00 83.19  ? 112  ARG B CG    1 
ATOM   2674  C  CD    . ARG B 1  112  ? -38.992 37.730  128.610 1.00 86.15  ? 112  ARG B CD    1 
ATOM   2675  N  NE    . ARG B 1  112  ? -39.261 37.115  127.311 1.00 88.91  ? 112  ARG B NE    1 
ATOM   2676  C  CZ    . ARG B 1  112  ? -38.439 37.175  126.266 1.00 97.33  ? 112  ARG B CZ    1 
ATOM   2677  N  NH1   . ARG B 1  112  ? -37.285 37.822  126.362 1.00 93.74  ? 112  ARG B NH1   1 
ATOM   2678  N  NH2   . ARG B 1  112  ? -38.771 36.583  125.125 1.00 91.36  ? 112  ARG B NH2   1 
ATOM   2679  N  N     . ASP B 1  113  ? -39.738 33.271  131.188 1.00 78.48  ? 113  ASP B N     1 
ATOM   2680  C  CA    . ASP B 1  113  ? -40.771 33.116  132.209 1.00 76.02  ? 113  ASP B CA    1 
ATOM   2681  C  C     . ASP B 1  113  ? -40.257 32.550  133.529 1.00 78.11  ? 113  ASP B C     1 
ATOM   2682  O  O     . ASP B 1  113  ? -40.945 32.623  134.548 1.00 86.47  ? 113  ASP B O     1 
ATOM   2683  C  CB    . ASP B 1  113  ? -41.907 32.244  131.674 1.00 69.87  ? 113  ASP B CB    1 
ATOM   2684  C  CG    . ASP B 1  113  ? -42.430 32.734  130.341 1.00 80.17  ? 113  ASP B CG    1 
ATOM   2685  O  OD1   . ASP B 1  113  ? -43.530 32.303  129.937 1.00 85.14  ? 113  ASP B OD1   1 
ATOM   2686  O  OD2   . ASP B 1  113  ? -41.740 33.554  129.699 1.00 78.47  ? 113  ASP B OD2   1 
ATOM   2687  N  N     . PHE B 1  114  ? -39.058 31.977  133.510 1.00 73.90  ? 114  PHE B N     1 
ATOM   2688  C  CA    . PHE B 1  114  ? -38.433 31.503  134.737 1.00 78.23  ? 114  PHE B CA    1 
ATOM   2689  C  C     . PHE B 1  114  ? -38.214 32.669  135.695 1.00 83.91  ? 114  PHE B C     1 
ATOM   2690  O  O     . PHE B 1  114  ? -37.647 33.694  135.315 1.00 83.11  ? 114  PHE B O     1 
ATOM   2691  C  CB    . PHE B 1  114  ? -37.099 30.815  134.438 1.00 77.76  ? 114  PHE B CB    1 
ATOM   2692  C  CG    . PHE B 1  114  ? -37.238 29.390  133.983 1.00 74.79  ? 114  PHE B CG    1 
ATOM   2693  C  CD1   . PHE B 1  114  ? -37.421 28.371  134.903 1.00 70.81  ? 114  PHE B CD1   1 
ATOM   2694  C  CD2   . PHE B 1  114  ? -37.177 29.067  132.639 1.00 73.63  ? 114  PHE B CD2   1 
ATOM   2695  C  CE1   . PHE B 1  114  ? -37.547 27.059  134.491 1.00 64.47  ? 114  PHE B CE1   1 
ATOM   2696  C  CE2   . PHE B 1  114  ? -37.302 27.756  132.222 1.00 66.75  ? 114  PHE B CE2   1 
ATOM   2697  C  CZ    . PHE B 1  114  ? -37.488 26.751  133.150 1.00 62.32  ? 114  PHE B CZ    1 
ATOM   2698  N  N     . LEU B 1  115  ? -38.677 32.513  136.932 1.00 79.90  ? 115  LEU B N     1 
ATOM   2699  C  CA    . LEU B 1  115  ? -38.496 33.547  137.944 1.00 76.62  ? 115  LEU B CA    1 
ATOM   2700  C  C     . LEU B 1  115  ? -37.016 33.777  138.219 1.00 76.40  ? 115  LEU B C     1 
ATOM   2701  O  O     . LEU B 1  115  ? -36.293 32.842  138.570 1.00 70.01  ? 115  LEU B O     1 
ATOM   2702  C  CB    . LEU B 1  115  ? -39.226 33.182  139.236 1.00 76.34  ? 115  LEU B CB    1 
ATOM   2703  C  CG    . LEU B 1  115  ? -40.753 33.208  139.166 1.00 79.49  ? 115  LEU B CG    1 
ATOM   2704  C  CD1   . LEU B 1  115  ? -41.354 32.960  140.541 1.00 83.88  ? 115  LEU B CD1   1 
ATOM   2705  C  CD2   . LEU B 1  115  ? -41.242 34.529  138.592 1.00 70.08  ? 115  LEU B CD2   1 
ATOM   2706  N  N     . PRO B 1  116  ? -36.565 35.031  138.052 1.00 79.27  ? 116  PRO B N     1 
ATOM   2707  C  CA    . PRO B 1  116  ? -35.165 35.446  138.203 1.00 76.49  ? 116  PRO B CA    1 
ATOM   2708  C  C     . PRO B 1  116  ? -34.566 35.001  139.531 1.00 66.72  ? 116  PRO B C     1 
ATOM   2709  O  O     . PRO B 1  116  ? -35.254 35.000  140.549 1.00 75.91  ? 116  PRO B O     1 
ATOM   2710  C  CB    . PRO B 1  116  ? -35.250 36.974  138.156 1.00 71.78  ? 116  PRO B CB    1 
ATOM   2711  C  CG    . PRO B 1  116  ? -36.460 37.251  137.340 1.00 76.55  ? 116  PRO B CG    1 
ATOM   2712  C  CD    . PRO B 1  116  ? -37.436 36.163  137.686 1.00 80.09  ? 116  PRO B CD    1 
ATOM   2713  N  N     . VAL B 1  117  ? -33.295 34.616  139.509 1.00 60.52  ? 117  VAL B N     1 
ATOM   2714  C  CA    . VAL B 1  117  ? -32.595 34.209  140.719 1.00 58.77  ? 117  VAL B CA    1 
ATOM   2715  C  C     . VAL B 1  117  ? -31.327 35.051  140.872 1.00 68.49  ? 117  VAL B C     1 
ATOM   2716  O  O     . VAL B 1  117  ? -30.799 35.574  139.889 1.00 64.57  ? 117  VAL B O     1 
ATOM   2717  C  CB    . VAL B 1  117  ? -32.257 32.701  140.693 1.00 56.03  ? 117  VAL B CB    1 
ATOM   2718  C  CG1   . VAL B 1  117  ? -31.762 32.228  142.054 1.00 55.88  ? 117  VAL B CG1   1 
ATOM   2719  C  CG2   . VAL B 1  117  ? -33.478 31.896  140.278 1.00 55.70  ? 117  VAL B CG2   1 
ATOM   2720  N  N     . ALA B 1  118  ? -30.861 35.201  142.108 1.00 73.21  ? 118  ALA B N     1 
ATOM   2721  C  CA    . ALA B 1  118  ? -29.683 36.008  142.402 1.00 80.47  ? 118  ALA B CA    1 
ATOM   2722  C  C     . ALA B 1  118  ? -28.443 35.496  141.677 1.00 82.42  ? 118  ALA B C     1 
ATOM   2723  O  O     . ALA B 1  118  ? -28.081 34.325  141.802 1.00 83.05  ? 118  ALA B O     1 
ATOM   2724  C  CB    . ALA B 1  118  ? -29.437 36.049  143.904 1.00 82.74  ? 118  ALA B CB    1 
ATOM   2725  N  N     . ASP B 1  119  ? -27.800 36.391  140.930 1.00 81.53  ? 119  ASP B N     1 
ATOM   2726  C  CA    . ASP B 1  119  ? -26.573 36.078  140.197 1.00 91.24  ? 119  ASP B CA    1 
ATOM   2727  C  C     . ASP B 1  119  ? -26.729 34.885  139.250 1.00 91.17  ? 119  ASP B C     1 
ATOM   2728  O  O     . ASP B 1  119  ? -25.811 34.077  139.094 1.00 88.92  ? 119  ASP B O     1 
ATOM   2729  C  CB    . ASP B 1  119  ? -25.403 35.853  141.165 1.00 97.18  ? 119  ASP B CB    1 
ATOM   2730  C  CG    . ASP B 1  119  ? -25.122 37.068  142.036 1.00 95.67  ? 119  ASP B CG    1 
ATOM   2731  O  OD1   . ASP B 1  119  ? -25.406 38.200  141.589 1.00 91.98  ? 119  ASP B OD1   1 
ATOM   2732  O  OD2   . ASP B 1  119  ? -24.616 36.891  143.166 1.00 88.50  ? 119  ASP B OD2   1 
ATOM   2733  N  N     . VAL B 1  120  ? -27.899 34.780  138.625 1.00 88.19  ? 120  VAL B N     1 
ATOM   2734  C  CA    . VAL B 1  120  ? -28.157 33.743  137.631 1.00 81.86  ? 120  VAL B CA    1 
ATOM   2735  C  C     . VAL B 1  120  ? -28.677 34.377  136.345 1.00 81.36  ? 120  VAL B C     1 
ATOM   2736  O  O     . VAL B 1  120  ? -29.767 34.948  136.322 1.00 87.21  ? 120  VAL B O     1 
ATOM   2737  C  CB    . VAL B 1  120  ? -29.186 32.708  138.135 1.00 74.22  ? 120  VAL B CB    1 
ATOM   2738  C  CG1   . VAL B 1  120  ? -29.564 31.744  137.020 1.00 68.22  ? 120  VAL B CG1   1 
ATOM   2739  C  CG2   . VAL B 1  120  ? -28.642 31.955  139.339 1.00 66.21  ? 120  VAL B CG2   1 
ATOM   2740  N  N     . GLU B 1  121  ? -27.894 34.273  135.277 1.00 80.00  ? 121  GLU B N     1 
ATOM   2741  C  CA    . GLU B 1  121  ? -28.250 34.898  134.008 1.00 78.83  ? 121  GLU B CA    1 
ATOM   2742  C  C     . GLU B 1  121  ? -28.691 33.869  132.980 1.00 78.67  ? 121  GLU B C     1 
ATOM   2743  O  O     . GLU B 1  121  ? -27.999 32.878  132.744 1.00 77.95  ? 121  GLU B O     1 
ATOM   2744  C  CB    . GLU B 1  121  ? -27.069 35.699  133.456 1.00 80.08  ? 121  GLU B CB    1 
ATOM   2745  C  CG    . GLU B 1  121  ? -27.295 36.278  132.070 1.00 76.18  ? 121  GLU B CG    1 
ATOM   2746  C  CD    . GLU B 1  121  ? -26.053 36.949  131.513 1.00 88.42  ? 121  GLU B CD    1 
ATOM   2747  O  OE1   . GLU B 1  121  ? -26.113 37.462  130.375 1.00 91.92  ? 121  GLU B OE1   1 
ATOM   2748  O  OE2   . GLU B 1  121  ? -25.016 36.963  132.212 1.00 83.49  ? 121  GLU B OE2   1 
ATOM   2749  N  N     . ILE B 1  122  ? -29.844 34.111  132.367 1.00 72.06  ? 122  ILE B N     1 
ATOM   2750  C  CA    . ILE B 1  122  ? -30.322 33.253  131.295 1.00 66.84  ? 122  ILE B CA    1 
ATOM   2751  C  C     . ILE B 1  122  ? -29.912 33.831  129.943 1.00 70.50  ? 122  ILE B C     1 
ATOM   2752  O  O     . ILE B 1  122  ? -30.406 34.880  129.525 1.00 62.83  ? 122  ILE B O     1 
ATOM   2753  C  CB    . ILE B 1  122  ? -31.843 33.066  131.359 1.00 62.24  ? 122  ILE B CB    1 
ATOM   2754  C  CG1   . ILE B 1  122  ? -32.231 32.399  132.678 1.00 59.55  ? 122  ILE B CG1   1 
ATOM   2755  C  CG2   . ILE B 1  122  ? -32.326 32.234  130.185 1.00 70.58  ? 122  ILE B CG2   1 
ATOM   2756  C  CD1   . ILE B 1  122  ? -33.709 32.101  132.799 1.00 78.73  ? 122  ILE B CD1   1 
ATOM   2757  N  N     . MET B 1  123  ? -29.005 33.131  129.267 1.00 74.28  ? 123  MET B N     1 
ATOM   2758  C  CA    . MET B 1  123  ? -28.413 33.611  128.024 1.00 66.71  ? 123  MET B CA    1 
ATOM   2759  C  C     . MET B 1  123  ? -29.399 33.558  126.865 1.00 63.70  ? 123  MET B C     1 
ATOM   2760  O  O     . MET B 1  123  ? -29.342 34.384  125.955 1.00 71.62  ? 123  MET B O     1 
ATOM   2761  C  CB    . MET B 1  123  ? -27.164 32.795  127.682 1.00 58.25  ? 123  MET B CB    1 
ATOM   2762  C  CG    . MET B 1  123  ? -26.097 32.797  128.767 1.00 67.31  ? 123  MET B CG    1 
ATOM   2763  S  SD    . MET B 1  123  ? -25.291 34.397  128.983 1.00 78.14  ? 123  MET B SD    1 
ATOM   2764  C  CE    . MET B 1  123  ? -24.606 34.650  127.348 1.00 78.55  ? 123  MET B CE    1 
ATOM   2765  N  N     . ASN B 1  124  ? -30.306 32.589  126.903 1.00 60.54  ? 124  ASN B N     1 
ATOM   2766  C  CA    . ASN B 1  124  ? -31.268 32.402  125.822 1.00 66.76  ? 124  ASN B CA    1 
ATOM   2767  C  C     . ASN B 1  124  ? -32.718 32.490  126.287 1.00 66.59  ? 124  ASN B C     1 
ATOM   2768  O  O     . ASN B 1  124  ? -33.428 31.487  126.296 1.00 69.78  ? 124  ASN B O     1 
ATOM   2769  C  CB    . ASN B 1  124  ? -31.026 31.060  125.124 1.00 74.11  ? 124  ASN B CB    1 
ATOM   2770  C  CG    . ASN B 1  124  ? -30.939 29.896  126.101 1.00 68.42  ? 124  ASN B CG    1 
ATOM   2771  O  OD1   . ASN B 1  124  ? -30.502 30.057  127.242 1.00 67.37  ? 124  ASN B OD1   1 
ATOM   2772  N  ND2   . ASN B 1  124  ? -31.355 28.717  125.654 1.00 55.17  ? 124  ASN B ND2   1 
ATOM   2773  N  N     . PRO B 1  125  ? -33.168 33.698  126.656 1.00 70.55  ? 125  PRO B N     1 
ATOM   2774  C  CA    . PRO B 1  125  ? -34.512 33.870  127.222 1.00 78.01  ? 125  PRO B CA    1 
ATOM   2775  C  C     . PRO B 1  125  ? -35.635 33.611  126.216 1.00 73.48  ? 125  PRO B C     1 
ATOM   2776  O  O     . PRO B 1  125  ? -36.765 33.336  126.620 1.00 72.81  ? 125  PRO B O     1 
ATOM   2777  C  CB    . PRO B 1  125  ? -34.516 35.337  127.663 1.00 81.29  ? 125  PRO B CB    1 
ATOM   2778  C  CG    . PRO B 1  125  ? -33.529 35.998  126.769 1.00 79.39  ? 125  PRO B CG    1 
ATOM   2779  C  CD    . PRO B 1  125  ? -32.455 34.981  126.522 1.00 70.30  ? 125  PRO B CD    1 
ATOM   2780  N  N     . ASP B 1  126  ? -35.324 33.692  124.927 1.00 66.66  ? 126  ASP B N     1 
ATOM   2781  C  CA    . ASP B 1  126  ? -36.327 33.481  123.888 1.00 72.46  ? 126  ASP B CA    1 
ATOM   2782  C  C     . ASP B 1  126  ? -36.476 32.007  123.520 1.00 73.54  ? 126  ASP B C     1 
ATOM   2783  O  O     . ASP B 1  126  ? -37.262 31.662  122.637 1.00 76.95  ? 126  ASP B O     1 
ATOM   2784  C  CB    . ASP B 1  126  ? -36.000 34.307  122.639 1.00 88.20  ? 126  ASP B CB    1 
ATOM   2785  C  CG    . ASP B 1  126  ? -36.264 35.791  122.831 1.00 98.45  ? 126  ASP B CG    1 
ATOM   2786  O  OD1   . ASP B 1  126  ? -36.719 36.444  121.868 1.00 94.20  ? 126  ASP B OD1   1 
ATOM   2787  O  OD2   . ASP B 1  126  ? -36.013 36.307  123.941 1.00 99.74  ? 126  ASP B OD2   1 
ATOM   2788  N  N     . LEU B 1  127  ? -35.712 31.146  124.189 1.00 70.36  ? 127  LEU B N     1 
ATOM   2789  C  CA    . LEU B 1  127  ? -35.787 29.705  123.951 1.00 65.83  ? 127  LEU B CA    1 
ATOM   2790  C  C     . LEU B 1  127  ? -37.173 29.157  124.263 1.00 62.03  ? 127  LEU B C     1 
ATOM   2791  O  O     . LEU B 1  127  ? -37.770 29.505  125.281 1.00 71.29  ? 127  LEU B O     1 
ATOM   2792  C  CB    . LEU B 1  127  ? -34.748 28.959  124.790 1.00 63.44  ? 127  LEU B CB    1 
ATOM   2793  C  CG    . LEU B 1  127  ? -34.830 27.432  124.701 1.00 57.02  ? 127  LEU B CG    1 
ATOM   2794  C  CD1   . LEU B 1  127  ? -34.307 26.955  123.359 1.00 59.16  ? 127  LEU B CD1   1 
ATOM   2795  C  CD2   . LEU B 1  127  ? -34.086 26.761  125.845 1.00 60.38  ? 127  LEU B CD2   1 
ATOM   2796  N  N     . HIS B 1  128  ? -37.674 28.292  123.387 1.00 55.43  ? 128  HIS B N     1 
ATOM   2797  C  CA    . HIS B 1  128  ? -38.994 27.697  123.558 1.00 59.18  ? 128  HIS B CA    1 
ATOM   2798  C  C     . HIS B 1  128  ? -38.956 26.513  124.529 1.00 65.94  ? 128  HIS B C     1 
ATOM   2799  O  O     . HIS B 1  128  ? -38.115 25.619  124.395 1.00 64.69  ? 128  HIS B O     1 
ATOM   2800  C  CB    . HIS B 1  128  ? -39.552 27.273  122.197 1.00 56.37  ? 128  HIS B CB    1 
ATOM   2801  C  CG    . HIS B 1  128  ? -40.980 26.823  122.229 1.00 64.10  ? 128  HIS B CG    1 
ATOM   2802  N  ND1   . HIS B 1  128  ? -41.801 27.012  123.324 1.00 70.10  ? 128  HIS B ND1   1 
ATOM   2803  C  CD2   . HIS B 1  128  ? -41.732 26.195  121.300 1.00 73.07  ? 128  HIS B CD2   1 
ATOM   2804  C  CE1   . HIS B 1  128  ? -42.995 26.516  123.062 1.00 68.31  ? 128  HIS B CE1   1 
ATOM   2805  N  NE2   . HIS B 1  128  ? -42.984 26.013  121.842 1.00 70.79  ? 128  HIS B NE2   1 
ATOM   2806  N  N     . ILE B 1  129  ? -39.860 26.537  125.512 1.00 65.46  ? 129  ILE B N     1 
ATOM   2807  C  CA    . ILE B 1  129  ? -40.030 25.445  126.473 1.00 57.85  ? 129  ILE B CA    1 
ATOM   2808  C  C     . ILE B 1  129  ? -41.297 24.647  126.159 1.00 65.85  ? 129  ILE B C     1 
ATOM   2809  O  O     . ILE B 1  129  ? -41.215 23.478  125.781 1.00 64.40  ? 129  ILE B O     1 
ATOM   2810  C  CB    . ILE B 1  129  ? -40.076 25.942  127.944 1.00 48.47  ? 129  ILE B CB    1 
ATOM   2811  C  CG1   . ILE B 1  129  ? -38.677 26.267  128.453 1.00 49.85  ? 129  ILE B CG1   1 
ATOM   2812  C  CG2   . ILE B 1  129  ? -40.654 24.877  128.863 1.00 59.72  ? 129  ILE B CG2   1 
ATOM   2813  C  CD1   . ILE B 1  129  ? -38.111 27.525  127.899 1.00 60.30  ? 129  ILE B CD1   1 
ATOM   2814  N  N     . ALA B 1  130  ? -42.462 25.277  126.302 1.00 67.43  ? 130  ALA B N     1 
ATOM   2815  C  CA    . ALA B 1  130  ? -43.736 24.611  126.023 1.00 69.62  ? 130  ALA B CA    1 
ATOM   2816  C  C     . ALA B 1  130  ? -44.824 25.590  125.584 1.00 66.42  ? 130  ALA B C     1 
ATOM   2817  O  O     . ALA B 1  130  ? -44.743 26.783  125.875 1.00 69.91  ? 130  ALA B O     1 
ATOM   2818  C  CB    . ALA B 1  130  ? -44.200 23.823  127.244 1.00 71.13  ? 130  ALA B CB    1 
ATOM   2819  N  N     . THR B 1  131  ? -45.834 25.077  124.880 1.00 66.77  ? 131  THR B N     1 
ATOM   2820  C  CA    . THR B 1  131  ? -47.034 25.851  124.555 1.00 70.75  ? 131  THR B CA    1 
ATOM   2821  C  C     . THR B 1  131  ? -48.245 25.265  125.276 1.00 72.44  ? 131  THR B C     1 
ATOM   2822  O  O     . THR B 1  131  ? -48.433 24.046  125.297 1.00 66.71  ? 131  THR B O     1 
ATOM   2823  C  CB    . THR B 1  131  ? -47.344 25.860  123.040 1.00 74.25  ? 131  THR B CB    1 
ATOM   2824  O  OG1   . THR B 1  131  ? -48.405 24.938  122.759 1.00 80.83  ? 131  THR B OG1   1 
ATOM   2825  C  CG2   . THR B 1  131  ? -46.126 25.477  122.234 1.00 73.63  ? 131  THR B CG2   1 
ATOM   2826  N  N     . LEU B 1  132  ? -49.066 26.134  125.858 1.00 73.35  ? 132  LEU B N     1 
ATOM   2827  C  CA    . LEU B 1  132  ? -50.250 25.689  126.581 1.00 75.70  ? 132  LEU B CA    1 
ATOM   2828  C  C     . LEU B 1  132  ? -51.522 26.232  125.943 1.00 75.74  ? 132  LEU B C     1 
ATOM   2829  O  O     . LEU B 1  132  ? -51.558 27.374  125.486 1.00 72.06  ? 132  LEU B O     1 
ATOM   2830  C  CB    . LEU B 1  132  ? -50.180 26.107  128.051 1.00 72.78  ? 132  LEU B CB    1 
ATOM   2831  C  CG    . LEU B 1  132  ? -49.116 25.440  128.924 1.00 75.15  ? 132  LEU B CG    1 
ATOM   2832  C  CD1   . LEU B 1  132  ? -47.753 26.100  128.761 1.00 69.17  ? 132  LEU B CD1   1 
ATOM   2833  C  CD2   . LEU B 1  132  ? -49.546 25.444  130.381 1.00 86.45  ? 132  LEU B CD2   1 
ATOM   2834  N  N     . GLU B 1  133  ? -52.560 25.403  125.907 1.00 72.98  ? 133  GLU B N     1 
ATOM   2835  C  CA    . GLU B 1  133  ? -53.849 25.813  125.369 1.00 77.43  ? 133  GLU B CA    1 
ATOM   2836  C  C     . GLU B 1  133  ? -54.760 26.268  126.501 1.00 79.47  ? 133  GLU B C     1 
ATOM   2837  O  O     . GLU B 1  133  ? -54.321 26.406  127.643 1.00 81.28  ? 133  GLU B O     1 
ATOM   2838  C  CB    . GLU B 1  133  ? -54.503 24.662  124.605 1.00 81.13  ? 133  GLU B CB    1 
ATOM   2839  C  CG    . GLU B 1  133  ? -53.527 23.803  123.819 1.00 85.09  ? 133  GLU B CG    1 
ATOM   2840  C  CD    . GLU B 1  133  ? -53.376 22.414  124.410 1.00 86.91  ? 133  GLU B CD    1 
ATOM   2841  O  OE1   . GLU B 1  133  ? -54.231 22.020  125.231 1.00 81.11  ? 133  GLU B OE1   1 
ATOM   2842  O  OE2   . GLU B 1  133  ? -52.403 21.715  124.054 1.00 88.25  ? 133  GLU B OE2   1 
ATOM   2843  N  N     . GLU B 1  134  ? -56.025 26.511  126.178 1.00 78.43  ? 134  GLU B N     1 
ATOM   2844  C  CA    . GLU B 1  134  ? -57.016 26.849  127.189 1.00 82.48  ? 134  GLU B CA    1 
ATOM   2845  C  C     . GLU B 1  134  ? -57.193 25.688  128.159 1.00 79.06  ? 134  GLU B C     1 
ATOM   2846  O  O     . GLU B 1  134  ? -57.445 24.556  127.745 1.00 74.44  ? 134  GLU B O     1 
ATOM   2847  C  CB    . GLU B 1  134  ? -58.359 27.183  126.534 1.00 91.17  ? 134  GLU B CB    1 
ATOM   2848  C  CG    . GLU B 1  134  ? -58.390 28.514  125.800 1.00 95.34  ? 134  GLU B CG    1 
ATOM   2849  C  CD    . GLU B 1  134  ? -58.535 29.699  126.737 1.00 93.17  ? 134  GLU B CD    1 
ATOM   2850  O  OE1   . GLU B 1  134  ? -58.413 30.849  126.265 1.00 91.13  ? 134  GLU B OE1   1 
ATOM   2851  O  OE2   . GLU B 1  134  ? -58.777 29.482  127.944 1.00 87.55  ? 134  GLU B OE2   1 
ATOM   2852  N  N     . GLY B 1  135  ? -57.056 25.973  129.449 1.00 82.75  ? 135  GLY B N     1 
ATOM   2853  C  CA    . GLY B 1  135  ? -57.243 24.965  130.476 1.00 84.66  ? 135  GLY B CA    1 
ATOM   2854  C  C     . GLY B 1  135  ? -55.979 24.196  130.807 1.00 81.12  ? 135  GLY B C     1 
ATOM   2855  O  O     . GLY B 1  135  ? -55.961 23.381  131.730 1.00 78.82  ? 135  GLY B O     1 
ATOM   2856  N  N     . GLY B 1  136  ? -54.917 24.450  130.051 1.00 82.12  ? 136  GLY B N     1 
ATOM   2857  C  CA    . GLY B 1  136  ? -53.649 23.790  130.294 1.00 76.26  ? 136  GLY B CA    1 
ATOM   2858  C  C     . GLY B 1  136  ? -52.890 24.464  131.414 1.00 78.25  ? 136  GLY B C     1 
ATOM   2859  O  O     . GLY B 1  136  ? -52.933 25.684  131.552 1.00 79.39  ? 136  GLY B O     1 
ATOM   2860  N  N     . ARG B 1  137  ? -52.191 23.667  132.216 1.00 79.85  ? 137  ARG B N     1 
ATOM   2861  C  CA    . ARG B 1  137  ? -51.420 24.193  133.336 1.00 87.11  ? 137  ARG B CA    1 
ATOM   2862  C  C     . ARG B 1  137  ? -50.016 23.601  133.350 1.00 81.25  ? 137  ARG B C     1 
ATOM   2863  O  O     . ARG B 1  137  ? -49.829 22.415  133.070 1.00 75.75  ? 137  ARG B O     1 
ATOM   2864  C  CB    . ARG B 1  137  ? -52.122 23.894  134.666 1.00 89.56  ? 137  ARG B CB    1 
ATOM   2865  C  CG    . ARG B 1  137  ? -53.528 24.463  134.785 1.00 91.98  ? 137  ARG B CG    1 
ATOM   2866  C  CD    . ARG B 1  137  ? -54.198 24.028  136.081 1.00 96.26  ? 137  ARG B CD    1 
ATOM   2867  N  NE    . ARG B 1  137  ? -53.632 24.691  137.253 1.00 107.58 ? 137  ARG B NE    1 
ATOM   2868  C  CZ    . ARG B 1  137  ? -54.131 25.796  137.800 1.00 108.98 ? 137  ARG B CZ    1 
ATOM   2869  N  NH1   . ARG B 1  137  ? -55.211 26.368  137.282 1.00 96.09  ? 137  ARG B NH1   1 
ATOM   2870  N  NH2   . ARG B 1  137  ? -53.553 26.331  138.868 1.00 104.99 ? 137  ARG B NH2   1 
ATOM   2871  N  N     . LEU B 1  138  ? -49.030 24.432  133.669 1.00 73.76  ? 138  LEU B N     1 
ATOM   2872  C  CA    . LEU B 1  138  ? -47.661 23.958  133.809 1.00 71.08  ? 138  LEU B CA    1 
ATOM   2873  C  C     . LEU B 1  138  ? -47.018 24.465  135.098 1.00 74.82  ? 138  LEU B C     1 
ATOM   2874  O  O     . LEU B 1  138  ? -46.794 25.664  135.269 1.00 73.50  ? 138  LEU B O     1 
ATOM   2875  C  CB    . LEU B 1  138  ? -46.823 24.382  132.602 1.00 69.68  ? 138  LEU B CB    1 
ATOM   2876  C  CG    . LEU B 1  138  ? -45.372 23.903  132.588 1.00 65.50  ? 138  LEU B CG    1 
ATOM   2877  C  CD1   . LEU B 1  138  ? -45.312 22.385  132.501 1.00 64.96  ? 138  LEU B CD1   1 
ATOM   2878  C  CD2   . LEU B 1  138  ? -44.611 24.544  131.443 1.00 63.86  ? 138  LEU B CD2   1 
ATOM   2879  N  N     . ASN B 1  139  ? -46.721 23.537  136.001 1.00 73.23  ? 139  ASN B N     1 
ATOM   2880  C  CA    . ASN B 1  139  ? -46.004 23.854  137.226 1.00 73.34  ? 139  ASN B CA    1 
ATOM   2881  C  C     . ASN B 1  139  ? -44.738 23.015  137.270 1.00 74.14  ? 139  ASN B C     1 
ATOM   2882  O  O     . ASN B 1  139  ? -44.808 21.792  137.400 1.00 70.57  ? 139  ASN B O     1 
ATOM   2883  C  CB    . ASN B 1  139  ? -46.883 23.560  138.444 1.00 80.14  ? 139  ASN B CB    1 
ATOM   2884  C  CG    . ASN B 1  139  ? -46.317 24.134  139.737 1.00 90.81  ? 139  ASN B CG    1 
ATOM   2885  O  OD1   . ASN B 1  139  ? -46.843 25.108  140.274 1.00 99.77  ? 139  ASN B OD1   1 
ATOM   2886  N  ND2   . ASN B 1  139  ? -45.258 23.518  140.253 1.00 85.02  ? 139  ASN B ND2   1 
ATOM   2887  N  N     . MET B 1  140  ? -43.582 23.663  137.158 1.00 72.48  ? 140  MET B N     1 
ATOM   2888  C  CA    . MET B 1  140  ? -42.323 22.925  137.128 1.00 72.36  ? 140  MET B CA    1 
ATOM   2889  C  C     . MET B 1  140  ? -41.164 23.597  137.861 1.00 64.32  ? 140  MET B C     1 
ATOM   2890  O  O     . MET B 1  140  ? -41.099 24.822  137.977 1.00 55.88  ? 140  MET B O     1 
ATOM   2891  C  CB    . MET B 1  140  ? -41.911 22.588  135.689 1.00 73.82  ? 140  MET B CB    1 
ATOM   2892  C  CG    . MET B 1  140  ? -41.607 23.796  134.813 1.00 78.48  ? 140  MET B CG    1 
ATOM   2893  S  SD    . MET B 1  140  ? -40.609 23.372  133.368 1.00 75.98  ? 140  MET B SD    1 
ATOM   2894  C  CE    . MET B 1  140  ? -41.568 22.029  132.673 1.00 55.59  ? 140  MET B CE    1 
ATOM   2895  N  N     . GLU B 1  141  ? -40.254 22.766  138.357 1.00 62.74  ? 141  GLU B N     1 
ATOM   2896  C  CA    . GLU B 1  141  ? -39.036 23.229  139.002 1.00 61.84  ? 141  GLU B CA    1 
ATOM   2897  C  C     . GLU B 1  141  ? -37.860 22.493  138.374 1.00 61.76  ? 141  GLU B C     1 
ATOM   2898  O  O     . GLU B 1  141  ? -37.852 21.264  138.320 1.00 67.29  ? 141  GLU B O     1 
ATOM   2899  C  CB    . GLU B 1  141  ? -39.089 22.942  140.503 1.00 73.10  ? 141  GLU B CB    1 
ATOM   2900  C  CG    . GLU B 1  141  ? -40.358 23.434  141.187 1.00 85.91  ? 141  GLU B CG    1 
ATOM   2901  C  CD    . GLU B 1  141  ? -40.475 22.964  142.627 1.00 87.06  ? 141  GLU B CD    1 
ATOM   2902  O  OE1   . GLU B 1  141  ? -39.438 22.600  143.225 1.00 83.45  ? 141  GLU B OE1   1 
ATOM   2903  O  OE2   . GLU B 1  141  ? -41.609 22.955  143.157 1.00 74.06  ? 141  GLU B OE2   1 
ATOM   2904  N  N     . VAL B 1  142  ? -36.872 23.240  137.893 1.00 57.46  ? 142  VAL B N     1 
ATOM   2905  C  CA    . VAL B 1  142  ? -35.708 22.627  137.258 1.00 55.81  ? 142  VAL B CA    1 
ATOM   2906  C  C     . VAL B 1  142  ? -34.435 22.819  138.086 1.00 56.01  ? 142  VAL B C     1 
ATOM   2907  O  O     . VAL B 1  142  ? -34.181 23.897  138.622 1.00 60.48  ? 142  VAL B O     1 
ATOM   2908  C  CB    . VAL B 1  142  ? -35.505 23.140  135.813 1.00 56.64  ? 142  VAL B CB    1 
ATOM   2909  C  CG1   . VAL B 1  142  ? -36.714 22.803  134.959 1.00 50.64  ? 142  VAL B CG1   1 
ATOM   2910  C  CG2   . VAL B 1  142  ? -35.253 24.638  135.798 1.00 62.12  ? 142  VAL B CG2   1 
ATOM   2911  N  N     . ARG B 1  143  ? -33.645 21.758  138.195 1.00 54.15  ? 143  ARG B N     1 
ATOM   2912  C  CA    . ARG B 1  143  ? -32.432 21.781  139.006 1.00 59.01  ? 143  ARG B CA    1 
ATOM   2913  C  C     . ARG B 1  143  ? -31.198 22.020  138.144 1.00 57.24  ? 143  ARG B C     1 
ATOM   2914  O  O     . ARG B 1  143  ? -30.864 21.206  137.285 1.00 62.11  ? 143  ARG B O     1 
ATOM   2915  C  CB    . ARG B 1  143  ? -32.292 20.467  139.778 1.00 62.41  ? 143  ARG B CB    1 
ATOM   2916  C  CG    . ARG B 1  143  ? -30.920 20.236  140.387 1.00 66.72  ? 143  ARG B CG    1 
ATOM   2917  C  CD    . ARG B 1  143  ? -30.876 20.561  141.871 1.00 75.93  ? 143  ARG B CD    1 
ATOM   2918  N  NE    . ARG B 1  143  ? -29.582 20.208  142.453 1.00 75.29  ? 143  ARG B NE    1 
ATOM   2919  C  CZ    . ARG B 1  143  ? -29.273 18.999  142.910 1.00 63.34  ? 143  ARG B CZ    1 
ATOM   2920  N  NH1   . ARG B 1  143  ? -30.167 18.021  142.858 1.00 60.05  ? 143  ARG B NH1   1 
ATOM   2921  N  NH2   . ARG B 1  143  ? -28.071 18.768  143.421 1.00 53.05  ? 143  ARG B NH2   1 
ATOM   2922  N  N     . VAL B 1  144  ? -30.522 23.139  138.376 1.00 54.40  ? 144  VAL B N     1 
ATOM   2923  C  CA    . VAL B 1  144  ? -29.351 23.497  137.583 1.00 54.37  ? 144  VAL B CA    1 
ATOM   2924  C  C     . VAL B 1  144  ? -28.079 23.452  138.420 1.00 54.55  ? 144  VAL B C     1 
ATOM   2925  O  O     . VAL B 1  144  ? -27.927 24.212  139.374 1.00 59.83  ? 144  VAL B O     1 
ATOM   2926  C  CB    . VAL B 1  144  ? -29.502 24.900  136.959 1.00 52.79  ? 144  VAL B CB    1 
ATOM   2927  C  CG1   . VAL B 1  144  ? -28.214 25.321  136.275 1.00 50.12  ? 144  VAL B CG1   1 
ATOM   2928  C  CG2   . VAL B 1  144  ? -30.664 24.921  135.978 1.00 51.74  ? 144  VAL B CG2   1 
ATOM   2929  N  N     . ASP B 1  145  ? -27.164 22.561  138.055 1.00 52.02  ? 145  ASP B N     1 
ATOM   2930  C  CA    . ASP B 1  145  ? -25.912 22.420  138.789 1.00 55.40  ? 145  ASP B CA    1 
ATOM   2931  C  C     . ASP B 1  145  ? -24.717 22.805  137.933 1.00 50.95  ? 145  ASP B C     1 
ATOM   2932  O  O     . ASP B 1  145  ? -24.762 22.719  136.707 1.00 54.53  ? 145  ASP B O     1 
ATOM   2933  C  CB    . ASP B 1  145  ? -25.736 20.981  139.279 1.00 55.30  ? 145  ASP B CB    1 
ATOM   2934  C  CG    . ASP B 1  145  ? -26.907 20.500  140.107 1.00 64.37  ? 145  ASP B CG    1 
ATOM   2935  O  OD1   . ASP B 1  145  ? -27.874 19.981  139.513 1.00 65.59  ? 145  ASP B OD1   1 
ATOM   2936  O  OD2   . ASP B 1  145  ? -26.860 20.634  141.349 1.00 67.97  ? 145  ASP B OD2   1 
ATOM   2937  N  N     . ARG B 1  146  ? -23.645 23.236  138.586 1.00 53.61  ? 146  ARG B N     1 
ATOM   2938  C  CA    . ARG B 1  146  ? -22.386 23.460  137.896 1.00 56.93  ? 146  ARG B CA    1 
ATOM   2939  C  C     . ARG B 1  146  ? -21.668 22.129  137.761 1.00 52.27  ? 146  ARG B C     1 
ATOM   2940  O  O     . ARG B 1  146  ? -21.699 21.305  138.674 1.00 53.07  ? 146  ARG B O     1 
ATOM   2941  C  CB    . ARG B 1  146  ? -21.515 24.459  138.658 1.00 61.21  ? 146  ARG B CB    1 
ATOM   2942  C  CG    . ARG B 1  146  ? -20.163 24.712  138.012 1.00 59.01  ? 146  ARG B CG    1 
ATOM   2943  C  CD    . ARG B 1  146  ? -19.796 26.182  138.072 1.00 77.06  ? 146  ARG B CD    1 
ATOM   2944  N  NE    . ARG B 1  146  ? -19.707 26.666  139.446 1.00 88.35  ? 146  ARG B NE    1 
ATOM   2945  C  CZ    . ARG B 1  146  ? -19.521 27.940  139.779 1.00 91.48  ? 146  ARG B CZ    1 
ATOM   2946  N  NH1   . ARG B 1  146  ? -19.408 28.867  138.835 1.00 87.04  ? 146  ARG B NH1   1 
ATOM   2947  N  NH2   . ARG B 1  146  ? -19.452 28.288  141.056 1.00 90.89  ? 146  ARG B NH2   1 
ATOM   2948  N  N     . GLY B 1  147  ? -21.032 21.915  136.615 1.00 52.98  ? 147  GLY B N     1 
ATOM   2949  C  CA    . GLY B 1  147  ? -20.317 20.678  136.370 1.00 58.92  ? 147  GLY B CA    1 
ATOM   2950  C  C     . GLY B 1  147  ? -19.454 20.744  135.127 1.00 59.08  ? 147  GLY B C     1 
ATOM   2951  O  O     . GLY B 1  147  ? -19.263 21.814  134.544 1.00 53.18  ? 147  GLY B O     1 
ATOM   2952  N  N     . VAL B 1  148  ? -18.929 19.593  134.721 1.00 58.85  ? 148  VAL B N     1 
ATOM   2953  C  CA    . VAL B 1  148  ? -18.057 19.523  133.556 1.00 58.07  ? 148  VAL B CA    1 
ATOM   2954  C  C     . VAL B 1  148  ? -18.408 18.353  132.638 1.00 55.65  ? 148  VAL B C     1 
ATOM   2955  O  O     . VAL B 1  148  ? -18.679 17.242  133.100 1.00 51.25  ? 148  VAL B O     1 
ATOM   2956  C  CB    . VAL B 1  148  ? -16.573 19.427  133.965 1.00 48.62  ? 148  VAL B CB    1 
ATOM   2957  C  CG1   . VAL B 1  148  ? -16.084 20.761  134.510 1.00 47.39  ? 148  VAL B CG1   1 
ATOM   2958  C  CG2   . VAL B 1  148  ? -16.373 18.320  134.986 1.00 48.72  ? 148  VAL B CG2   1 
ATOM   2959  N  N     . GLY B 1  149  ? -18.409 18.618  131.335 1.00 52.00  ? 149  GLY B N     1 
ATOM   2960  C  CA    . GLY B 1  149  ? -18.628 17.582  130.343 1.00 50.26  ? 149  GLY B CA    1 
ATOM   2961  C  C     . GLY B 1  149  ? -20.059 17.109  130.196 1.00 46.66  ? 149  GLY B C     1 
ATOM   2962  O  O     . GLY B 1  149  ? -20.997 17.906  130.207 1.00 46.68  ? 149  GLY B O     1 
ATOM   2963  N  N     . TYR B 1  150  ? -20.220 15.798  130.046 1.00 41.24  ? 150  TYR B N     1 
ATOM   2964  C  CA    . TYR B 1  150  ? -21.523 15.206  129.777 1.00 43.50  ? 150  TYR B CA    1 
ATOM   2965  C  C     . TYR B 1  150  ? -21.804 14.041  130.720 1.00 43.76  ? 150  TYR B C     1 
ATOM   2966  O  O     . TYR B 1  150  ? -21.089 13.039  130.717 1.00 41.33  ? 150  TYR B O     1 
ATOM   2967  C  CB    . TYR B 1  150  ? -21.580 14.730  128.324 1.00 40.69  ? 150  TYR B CB    1 
ATOM   2968  C  CG    . TYR B 1  150  ? -22.943 14.270  127.851 1.00 38.25  ? 150  TYR B CG    1 
ATOM   2969  C  CD1   . TYR B 1  150  ? -23.843 15.169  127.297 1.00 36.70  ? 150  TYR B CD1   1 
ATOM   2970  C  CD2   . TYR B 1  150  ? -23.320 12.934  127.935 1.00 34.03  ? 150  TYR B CD2   1 
ATOM   2971  C  CE1   . TYR B 1  150  ? -25.082 14.757  126.852 1.00 34.09  ? 150  TYR B CE1   1 
ATOM   2972  C  CE2   . TYR B 1  150  ? -24.560 12.513  127.492 1.00 32.59  ? 150  TYR B CE2   1 
ATOM   2973  C  CZ    . TYR B 1  150  ? -25.436 13.431  126.951 1.00 31.95  ? 150  TYR B CZ    1 
ATOM   2974  O  OH    . TYR B 1  150  ? -26.674 13.029  126.505 1.00 35.16  ? 150  TYR B OH    1 
ATOM   2975  N  N     . VAL B 1  151  ? -22.835 14.195  131.544 1.00 42.75  ? 151  VAL B N     1 
ATOM   2976  C  CA    . VAL B 1  151  ? -23.284 13.128  132.430 1.00 38.54  ? 151  VAL B CA    1 
ATOM   2977  C  C     . VAL B 1  151  ? -24.722 12.701  132.124 1.00 39.35  ? 151  VAL B C     1 
ATOM   2978  O  O     . VAL B 1  151  ? -25.653 13.499  132.272 1.00 33.83  ? 151  VAL B O     1 
ATOM   2979  C  CB    . VAL B 1  151  ? -23.172 13.542  133.907 1.00 42.49  ? 151  VAL B CB    1 
ATOM   2980  C  CG1   . VAL B 1  151  ? -23.442 12.347  134.811 1.00 48.79  ? 151  VAL B CG1   1 
ATOM   2981  C  CG2   . VAL B 1  151  ? -21.795 14.129  134.187 1.00 37.00  ? 151  VAL B CG2   1 
ATOM   2982  N  N     . PRO B 1  152  ? -24.906 11.442  131.689 1.00 41.26  ? 152  PRO B N     1 
ATOM   2983  C  CA    . PRO B 1  152  ? -26.241 10.891  131.422 1.00 43.33  ? 152  PRO B CA    1 
ATOM   2984  C  C     . PRO B 1  152  ? -27.100 10.876  132.684 1.00 46.83  ? 152  PRO B C     1 
ATOM   2985  O  O     . PRO B 1  152  ? -26.557 10.874  133.789 1.00 51.56  ? 152  PRO B O     1 
ATOM   2986  C  CB    . PRO B 1  152  ? -25.945 9.455   130.977 1.00 37.87  ? 152  PRO B CB    1 
ATOM   2987  C  CG    . PRO B 1  152  ? -24.531 9.477   130.510 1.00 34.69  ? 152  PRO B CG    1 
ATOM   2988  C  CD    . PRO B 1  152  ? -23.838 10.474  131.386 1.00 34.60  ? 152  PRO B CD    1 
ATOM   2989  N  N     . ALA B 1  153  ? -28.420 10.861  132.524 1.00 48.76  ? 153  ALA B N     1 
ATOM   2990  C  CA    . ALA B 1  153  ? -29.327 10.868  133.668 1.00 51.68  ? 153  ALA B CA    1 
ATOM   2991  C  C     . ALA B 1  153  ? -29.131 9.644   134.554 1.00 50.66  ? 153  ALA B C     1 
ATOM   2992  O  O     . ALA B 1  153  ? -29.028 9.764   135.776 1.00 52.07  ? 153  ALA B O     1 
ATOM   2993  C  CB    . ALA B 1  153  ? -30.770 10.953  133.201 1.00 54.10  ? 153  ALA B CB    1 
ATOM   2994  N  N     . GLU B 1  154  ? -29.068 8.472   133.928 1.00 51.46  ? 154  GLU B N     1 
ATOM   2995  C  CA    . GLU B 1  154  ? -28.897 7.217   134.652 1.00 47.21  ? 154  GLU B CA    1 
ATOM   2996  C  C     . GLU B 1  154  ? -27.594 7.170   135.453 1.00 50.10  ? 154  GLU B C     1 
ATOM   2997  O  O     . GLU B 1  154  ? -27.442 6.331   136.337 1.00 54.50  ? 154  GLU B O     1 
ATOM   2998  C  CB    . GLU B 1  154  ? -28.957 6.026   133.690 1.00 52.41  ? 154  GLU B CB    1 
ATOM   2999  C  CG    . GLU B 1  154  ? -29.169 6.394   132.217 1.00 63.61  ? 154  GLU B CG    1 
ATOM   3000  C  CD    . GLU B 1  154  ? -30.631 6.635   131.871 1.00 67.93  ? 154  GLU B CD    1 
ATOM   3001  O  OE1   . GLU B 1  154  ? -30.914 7.100   130.743 1.00 59.78  ? 154  GLU B OE1   1 
ATOM   3002  O  OE2   . GLU B 1  154  ? -31.496 6.353   132.728 1.00 67.36  ? 154  GLU B OE2   1 
ATOM   3003  N  N     . LYS B 1  155  ? -26.648 8.050   135.133 1.00 49.78  ? 155  LYS B N     1 
ATOM   3004  C  CA    . LYS B 1  155  ? -25.382 8.107   135.868 1.00 55.49  ? 155  LYS B CA    1 
ATOM   3005  C  C     . LYS B 1  155  ? -25.409 8.876   137.200 1.00 56.30  ? 155  LYS B C     1 
ATOM   3006  O  O     . LYS B 1  155  ? -24.905 8.376   138.205 1.00 65.01  ? 155  LYS B O     1 
ATOM   3007  C  CB    . LYS B 1  155  ? -24.238 8.583   134.966 1.00 54.66  ? 155  LYS B CB    1 
ATOM   3008  C  CG    . LYS B 1  155  ? -23.811 7.533   133.946 1.00 63.63  ? 155  LYS B CG    1 
ATOM   3009  C  CD    . LYS B 1  155  ? -23.373 6.243   134.634 1.00 55.70  ? 155  LYS B CD    1 
ATOM   3010  C  CE    . LYS B 1  155  ? -23.652 5.016   133.770 1.00 59.56  ? 155  LYS B CE    1 
ATOM   3011  N  NZ    . LYS B 1  155  ? -22.976 5.068   132.440 1.00 47.60  ? 155  LYS B NZ    1 
ATOM   3012  N  N     . HIS B 1  156  ? -25.969 10.083  137.217 1.00 52.05  ? 156  HIS B N     1 
ATOM   3013  C  CA    . HIS B 1  156  ? -26.115 10.800  138.490 1.00 57.51  ? 156  HIS B CA    1 
ATOM   3014  C  C     . HIS B 1  156  ? -27.353 10.396  139.305 1.00 64.40  ? 156  HIS B C     1 
ATOM   3015  O  O     . HIS B 1  156  ? -27.305 10.363  140.538 1.00 64.01  ? 156  HIS B O     1 
ATOM   3016  C  CB    . HIS B 1  156  ? -25.984 12.330  138.342 1.00 57.24  ? 156  HIS B CB    1 
ATOM   3017  C  CG    . HIS B 1  156  ? -27.024 12.969  137.473 1.00 54.60  ? 156  HIS B CG    1 
ATOM   3018  N  ND1   . HIS B 1  156  ? -28.369 12.678  137.568 1.00 57.87  ? 156  HIS B ND1   1 
ATOM   3019  C  CD2   . HIS B 1  156  ? -26.915 13.922  136.518 1.00 51.09  ? 156  HIS B CD2   1 
ATOM   3020  C  CE1   . HIS B 1  156  ? -29.039 13.405  136.693 1.00 54.12  ? 156  HIS B CE1   1 
ATOM   3021  N  NE2   . HIS B 1  156  ? -28.180 14.169  136.043 1.00 56.73  ? 156  HIS B NE2   1 
ATOM   3022  N  N     . GLY B 1  157  ? -28.448 10.096  138.608 1.00 61.84  ? 157  GLY B N     1 
ATOM   3023  C  CA    . GLY B 1  157  ? -29.680 9.623   139.222 1.00 60.91  ? 157  GLY B CA    1 
ATOM   3024  C  C     . GLY B 1  157  ? -30.266 10.462  140.346 1.00 67.10  ? 157  GLY B C     1 
ATOM   3025  O  O     . GLY B 1  157  ? -30.965 9.931   141.212 1.00 68.81  ? 157  GLY B O     1 
ATOM   3026  N  N     . ILE B 1  158  ? -30.005 11.767  140.334 1.00 64.86  ? 158  ILE B N     1 
ATOM   3027  C  CA    . ILE B 1  158  ? -30.398 12.622  141.456 1.00 69.47  ? 158  ILE B CA    1 
ATOM   3028  C  C     . ILE B 1  158  ? -31.874 13.049  141.459 1.00 71.25  ? 158  ILE B C     1 
ATOM   3029  O  O     . ILE B 1  158  ? -32.436 13.418  140.426 1.00 63.95  ? 158  ILE B O     1 
ATOM   3030  C  CB    . ILE B 1  158  ? -29.480 13.864  141.596 1.00 56.14  ? 158  ILE B CB    1 
ATOM   3031  C  CG1   . ILE B 1  158  ? -29.682 14.840  140.437 1.00 55.39  ? 158  ILE B CG1   1 
ATOM   3032  C  CG2   . ILE B 1  158  ? -28.019 13.443  141.705 1.00 51.43  ? 158  ILE B CG2   1 
ATOM   3033  C  CD1   . ILE B 1  158  ? -28.855 16.099  140.565 1.00 61.94  ? 158  ILE B CD1   1 
ATOM   3034  N  N     . LYS B 1  159  ? -32.493 12.980  142.637 1.00 75.75  ? 159  LYS B N     1 
ATOM   3035  C  CA    . LYS B 1  159  ? -33.879 13.404  142.819 1.00 70.23  ? 159  LYS B CA    1 
ATOM   3036  C  C     . LYS B 1  159  ? -34.076 14.162  144.132 1.00 73.30  ? 159  LYS B C     1 
ATOM   3037  O  O     . LYS B 1  159  ? -33.714 13.668  145.200 1.00 75.19  ? 159  LYS B O     1 
ATOM   3038  C  CB    . LYS B 1  159  ? -34.819 12.195  142.813 1.00 65.96  ? 159  LYS B CB    1 
ATOM   3039  C  CG    . LYS B 1  159  ? -34.913 11.435  141.503 1.00 60.23  ? 159  LYS B CG    1 
ATOM   3040  C  CD    . LYS B 1  159  ? -36.054 10.427  141.560 1.00 52.87  ? 159  LYS B CD    1 
ATOM   3041  C  CE    . LYS B 1  159  ? -36.073 9.526   140.339 1.00 59.30  ? 159  LYS B CE    1 
ATOM   3042  N  NZ    . LYS B 1  159  ? -34.861 8.664   140.273 1.00 68.23  ? 159  LYS B NZ    1 
ATOM   3043  N  N     . ASP B 1  160  ? -34.647 15.361  144.051 1.00 72.13  ? 160  ASP B N     1 
ATOM   3044  C  CA    . ASP B 1  160  ? -35.099 16.074  145.245 1.00 67.43  ? 160  ASP B CA    1 
ATOM   3045  C  C     . ASP B 1  160  ? -36.472 15.575  145.700 1.00 65.30  ? 160  ASP B C     1 
ATOM   3046  O  O     . ASP B 1  160  ? -36.790 15.582  146.889 1.00 70.97  ? 160  ASP B O     1 
ATOM   3047  C  CB    . ASP B 1  160  ? -35.122 17.594  145.017 1.00 72.84  ? 160  ASP B CB    1 
ATOM   3048  C  CG    . ASP B 1  160  ? -35.167 17.973  143.543 1.00 79.51  ? 160  ASP B CG    1 
ATOM   3049  O  OD1   . ASP B 1  160  ? -34.087 18.032  142.919 1.00 86.85  ? 160  ASP B OD1   1 
ATOM   3050  O  OD2   . ASP B 1  160  ? -36.272 18.230  143.013 1.00 65.04  ? 160  ASP B OD2   1 
ATOM   3051  N  N     . ARG B 1  161  ? -37.277 15.136  144.739 1.00 60.48  ? 161  ARG B N     1 
ATOM   3052  C  CA    . ARG B 1  161  ? -38.649 14.718  144.994 1.00 56.21  ? 161  ARG B CA    1 
ATOM   3053  C  C     . ARG B 1  161  ? -38.858 13.299  144.476 1.00 65.17  ? 161  ARG B C     1 
ATOM   3054  O  O     . ARG B 1  161  ? -38.033 12.783  143.725 1.00 77.83  ? 161  ARG B O     1 
ATOM   3055  C  CB    . ARG B 1  161  ? -39.613 15.676  144.299 1.00 55.97  ? 161  ARG B CB    1 
ATOM   3056  C  CG    . ARG B 1  161  ? -40.965 15.828  144.969 1.00 64.78  ? 161  ARG B CG    1 
ATOM   3057  C  CD    . ARG B 1  161  ? -41.739 16.947  144.300 1.00 68.57  ? 161  ARG B CD    1 
ATOM   3058  N  NE    . ARG B 1  161  ? -40.842 18.024  143.890 1.00 67.40  ? 161  ARG B NE    1 
ATOM   3059  C  CZ    . ARG B 1  161  ? -40.815 19.234  144.437 1.00 63.82  ? 161  ARG B CZ    1 
ATOM   3060  N  NH1   . ARG B 1  161  ? -41.652 19.541  145.418 1.00 58.69  ? 161  ARG B NH1   1 
ATOM   3061  N  NH2   . ARG B 1  161  ? -39.956 20.141  143.992 1.00 65.19  ? 161  ARG B NH2   1 
ATOM   3062  N  N     . ILE B 1  162  ? -39.949 12.660  144.886 1.00 62.72  ? 162  ILE B N     1 
ATOM   3063  C  CA    . ILE B 1  162  ? -40.248 11.312  144.412 1.00 62.53  ? 162  ILE B CA    1 
ATOM   3064  C  C     . ILE B 1  162  ? -40.622 11.316  142.927 1.00 67.35  ? 162  ILE B C     1 
ATOM   3065  O  O     . ILE B 1  162  ? -40.331 10.364  142.202 1.00 75.04  ? 162  ILE B O     1 
ATOM   3066  C  CB    . ILE B 1  162  ? -41.355 10.634  145.260 1.00 65.86  ? 162  ILE B CB    1 
ATOM   3067  C  CG1   . ILE B 1  162  ? -41.585 9.190   144.803 1.00 64.09  ? 162  ILE B CG1   1 
ATOM   3068  C  CG2   . ILE B 1  162  ? -42.648 11.435  145.212 1.00 71.15  ? 162  ILE B CG2   1 
ATOM   3069  C  CD1   . ILE B 1  162  ? -40.367 8.303   144.935 1.00 55.91  ? 162  ILE B CD1   1 
ATOM   3070  N  N     . ASN B 1  163  ? -41.251 12.396  142.475 1.00 65.58  ? 163  ASN B N     1 
ATOM   3071  C  CA    . ASN B 1  163  ? -41.646 12.517  141.073 1.00 73.60  ? 163  ASN B CA    1 
ATOM   3072  C  C     . ASN B 1  163  ? -40.651 13.283  140.199 1.00 70.01  ? 163  ASN B C     1 
ATOM   3073  O  O     . ASN B 1  163  ? -40.912 13.520  139.019 1.00 66.72  ? 163  ASN B O     1 
ATOM   3074  C  CB    . ASN B 1  163  ? -43.044 13.129  140.953 1.00 81.65  ? 163  ASN B CB    1 
ATOM   3075  C  CG    . ASN B 1  163  ? -44.139 12.156  141.344 1.00 88.09  ? 163  ASN B CG    1 
ATOM   3076  O  OD1   . ASN B 1  163  ? -43.975 10.940  141.227 1.00 86.68  ? 163  ASN B OD1   1 
ATOM   3077  N  ND2   . ASN B 1  163  ? -45.267 12.687  141.808 1.00 83.16  ? 163  ASN B ND2   1 
ATOM   3078  N  N     . ALA B 1  164  ? -39.522 13.678  140.783 1.00 68.83  ? 164  ALA B N     1 
ATOM   3079  C  CA    . ALA B 1  164  ? -38.485 14.401  140.046 1.00 62.11  ? 164  ALA B CA    1 
ATOM   3080  C  C     . ALA B 1  164  ? -37.794 13.493  139.032 1.00 68.33  ? 164  ALA B C     1 
ATOM   3081  O  O     . ALA B 1  164  ? -37.430 12.361  139.351 1.00 73.04  ? 164  ALA B O     1 
ATOM   3082  C  CB    . ALA B 1  164  ? -37.466 15.003  141.005 1.00 57.18  ? 164  ALA B CB    1 
ATOM   3083  N  N     . ILE B 1  165  ? -37.612 13.997  137.814 1.00 64.67  ? 165  ILE B N     1 
ATOM   3084  C  CA    . ILE B 1  165  ? -37.019 13.211  136.736 1.00 58.01  ? 165  ILE B CA    1 
ATOM   3085  C  C     . ILE B 1  165  ? -35.581 13.630  136.443 1.00 59.19  ? 165  ILE B C     1 
ATOM   3086  O  O     . ILE B 1  165  ? -35.314 14.803  136.178 1.00 53.11  ? 165  ILE B O     1 
ATOM   3087  C  CB    . ILE B 1  165  ? -37.841 13.322  135.439 1.00 48.09  ? 165  ILE B CB    1 
ATOM   3088  C  CG1   . ILE B 1  165  ? -39.327 13.116  135.729 1.00 51.37  ? 165  ILE B CG1   1 
ATOM   3089  C  CG2   . ILE B 1  165  ? -37.347 12.318  134.410 1.00 53.52  ? 165  ILE B CG2   1 
ATOM   3090  C  CD1   . ILE B 1  165  ? -40.202 13.163  134.498 1.00 54.07  ? 165  ILE B CD1   1 
ATOM   3091  N  N     . PRO B 1  166  ? -34.647 12.667  136.494 1.00 60.94  ? 166  PRO B N     1 
ATOM   3092  C  CA    . PRO B 1  166  ? -33.244 12.933  136.164 1.00 58.32  ? 166  PRO B CA    1 
ATOM   3093  C  C     . PRO B 1  166  ? -33.075 13.208  134.675 1.00 59.10  ? 166  PRO B C     1 
ATOM   3094  O  O     . PRO B 1  166  ? -33.637 12.488  133.848 1.00 60.44  ? 166  PRO B O     1 
ATOM   3095  C  CB    . PRO B 1  166  ? -32.543 11.627  136.545 1.00 60.45  ? 166  PRO B CB    1 
ATOM   3096  C  CG    . PRO B 1  166  ? -33.597 10.586  136.418 1.00 59.56  ? 166  PRO B CG    1 
ATOM   3097  C  CD    . PRO B 1  166  ? -34.875 11.253  136.841 1.00 62.79  ? 166  PRO B CD    1 
ATOM   3098  N  N     . VAL B 1  167  ? -32.305 14.239  134.344 1.00 58.75  ? 167  VAL B N     1 
ATOM   3099  C  CA    . VAL B 1  167  ? -32.086 14.630  132.956 1.00 55.86  ? 167  VAL B CA    1 
ATOM   3100  C  C     . VAL B 1  167  ? -30.615 14.462  132.602 1.00 55.57  ? 167  VAL B C     1 
ATOM   3101  O  O     . VAL B 1  167  ? -29.743 14.741  133.427 1.00 52.88  ? 167  VAL B O     1 
ATOM   3102  C  CB    . VAL B 1  167  ? -32.497 16.103  132.724 1.00 53.16  ? 167  VAL B CB    1 
ATOM   3103  C  CG1   . VAL B 1  167  ? -32.222 16.530  131.290 1.00 50.05  ? 167  VAL B CG1   1 
ATOM   3104  C  CG2   . VAL B 1  167  ? -33.963 16.304  133.068 1.00 62.55  ? 167  VAL B CG2   1 
ATOM   3105  N  N     . ASP B 1  168  ? -30.342 13.987  131.388 1.00 54.12  ? 168  ASP B N     1 
ATOM   3106  C  CA    . ASP B 1  168  ? -28.975 13.930  130.892 1.00 43.11  ? 168  ASP B CA    1 
ATOM   3107  C  C     . ASP B 1  168  ? -28.422 15.346  130.977 1.00 40.28  ? 168  ASP B C     1 
ATOM   3108  O  O     . ASP B 1  168  ? -29.003 16.285  130.433 1.00 39.69  ? 168  ASP B O     1 
ATOM   3109  C  CB    . ASP B 1  168  ? -28.953 13.435  129.443 1.00 41.07  ? 168  ASP B CB    1 
ATOM   3110  C  CG    . ASP B 1  168  ? -29.718 12.131  129.252 1.00 46.58  ? 168  ASP B CG    1 
ATOM   3111  O  OD1   . ASP B 1  168  ? -29.502 11.188  130.043 1.00 51.73  ? 168  ASP B OD1   1 
ATOM   3112  O  OD2   . ASP B 1  168  ? -30.539 12.048  128.312 1.00 42.26  ? 168  ASP B OD2   1 
ATOM   3113  N  N     . ALA B 1  169  ? -27.305 15.506  131.673 1.00 37.36  ? 169  ALA B N     1 
ATOM   3114  C  CA    . ALA B 1  169  ? -26.786 16.839  131.940 1.00 40.11  ? 169  ALA B CA    1 
ATOM   3115  C  C     . ALA B 1  169  ? -25.665 17.201  130.981 1.00 45.40  ? 169  ALA B C     1 
ATOM   3116  O  O     . ALA B 1  169  ? -24.608 16.570  130.995 1.00 47.09  ? 169  ALA B O     1 
ATOM   3117  C  CB    . ALA B 1  169  ? -26.302 16.937  133.377 1.00 44.63  ? 169  ALA B CB    1 
ATOM   3118  N  N     . VAL B 1  170  ? -25.880 18.225  130.159 1.00 44.21  ? 170  VAL B N     1 
ATOM   3119  C  CA    . VAL B 1  170  ? -24.820 18.674  129.272 1.00 40.42  ? 170  VAL B CA    1 
ATOM   3120  C  C     . VAL B 1  170  ? -24.184 19.909  129.883 1.00 44.84  ? 170  VAL B C     1 
ATOM   3121  O  O     . VAL B 1  170  ? -24.694 21.022  129.745 1.00 43.19  ? 170  VAL B O     1 
ATOM   3122  C  CB    . VAL B 1  170  ? -25.395 19.081  127.910 1.00 37.71  ? 170  VAL B CB    1 
ATOM   3123  C  CG1   . VAL B 1  170  ? -24.273 19.365  126.925 1.00 54.90  ? 170  VAL B CG1   1 
ATOM   3124  C  CG2   . VAL B 1  170  ? -26.327 18.003  127.378 1.00 35.79  ? 170  VAL B CG2   1 
ATOM   3125  N  N     . PHE B 1  171  ? -23.030 19.714  130.507 1.00 44.50  ? 171  PHE B N     1 
ATOM   3126  C  CA    . PHE B 1  171  ? -22.366 20.796  131.214 1.00 50.98  ? 171  PHE B CA    1 
ATOM   3127  C  C     . PHE B 1  171  ? -21.557 21.635  130.254 1.00 59.48  ? 171  PHE B C     1 
ATOM   3128  O  O     . PHE B 1  171  ? -21.518 22.861  130.365 1.00 62.71  ? 171  PHE B O     1 
ATOM   3129  C  CB    . PHE B 1  171  ? -21.477 20.262  132.338 1.00 51.30  ? 171  PHE B CB    1 
ATOM   3130  C  CG    . PHE B 1  171  ? -22.243 19.686  133.492 1.00 52.31  ? 171  PHE B CG    1 
ATOM   3131  C  CD1   . PHE B 1  171  ? -23.061 20.491  134.266 1.00 53.43  ? 171  PHE B CD1   1 
ATOM   3132  C  CD2   . PHE B 1  171  ? -22.143 18.342  133.808 1.00 51.36  ? 171  PHE B CD2   1 
ATOM   3133  C  CE1   . PHE B 1  171  ? -23.769 19.965  135.328 1.00 52.90  ? 171  PHE B CE1   1 
ATOM   3134  C  CE2   . PHE B 1  171  ? -22.849 17.810  134.870 1.00 49.42  ? 171  PHE B CE2   1 
ATOM   3135  C  CZ    . PHE B 1  171  ? -23.663 18.623  135.630 1.00 46.50  ? 171  PHE B CZ    1 
ATOM   3136  N  N     . SER B 1  172  ? -20.927 20.956  129.301 1.00 58.46  ? 172  SER B N     1 
ATOM   3137  C  CA    . SER B 1  172  ? -19.962 21.581  128.412 1.00 59.93  ? 172  SER B CA    1 
ATOM   3138  C  C     . SER B 1  172  ? -20.546 22.806  127.724 1.00 57.93  ? 172  SER B C     1 
ATOM   3139  O  O     . SER B 1  172  ? -21.548 22.711  127.015 1.00 59.78  ? 172  SER B O     1 
ATOM   3140  C  CB    . SER B 1  172  ? -19.485 20.570  127.364 1.00 55.21  ? 172  SER B CB    1 
ATOM   3141  O  OG    . SER B 1  172  ? -18.582 21.162  126.447 1.00 57.25  ? 172  SER B OG    1 
ATOM   3142  N  N     . PRO B 1  173  ? -19.927 23.972  127.956 1.00 51.20  ? 173  PRO B N     1 
ATOM   3143  C  CA    . PRO B 1  173  ? -20.272 25.185  127.216 1.00 53.87  ? 173  PRO B CA    1 
ATOM   3144  C  C     . PRO B 1  173  ? -19.816 25.045  125.772 1.00 59.46  ? 173  PRO B C     1 
ATOM   3145  O  O     . PRO B 1  173  ? -20.286 25.776  124.906 1.00 63.68  ? 173  PRO B O     1 
ATOM   3146  C  CB    . PRO B 1  173  ? -19.463 26.271  127.930 1.00 57.87  ? 173  PRO B CB    1 
ATOM   3147  C  CG    . PRO B 1  173  ? -18.326 25.550  128.540 1.00 51.36  ? 173  PRO B CG    1 
ATOM   3148  C  CD    . PRO B 1  173  ? -18.861 24.212  128.943 1.00 49.95  ? 173  PRO B CD    1 
ATOM   3149  N  N     . VAL B 1  174  ? -18.911 24.099  125.529 1.00 56.88  ? 174  VAL B N     1 
ATOM   3150  C  CA    . VAL B 1  174  ? -18.385 23.827  124.197 1.00 51.61  ? 174  VAL B CA    1 
ATOM   3151  C  C     . VAL B 1  174  ? -19.264 22.816  123.464 1.00 50.36  ? 174  VAL B C     1 
ATOM   3152  O  O     . VAL B 1  174  ? -19.407 21.675  123.906 1.00 51.97  ? 174  VAL B O     1 
ATOM   3153  C  CB    . VAL B 1  174  ? -16.955 23.261  124.284 1.00 47.14  ? 174  VAL B CB    1 
ATOM   3154  C  CG1   . VAL B 1  174  ? -16.485 22.787  122.923 1.00 49.26  ? 174  VAL B CG1   1 
ATOM   3155  C  CG2   . VAL B 1  174  ? -16.006 24.300  124.855 1.00 47.01  ? 174  VAL B CG2   1 
ATOM   3156  N  N     . ARG B 1  175  ? -19.863 23.241  122.355 1.00 46.81  ? 175  ARG B N     1 
ATOM   3157  C  CA    . ARG B 1  175  ? -20.720 22.363  121.559 1.00 50.98  ? 175  ARG B CA    1 
ATOM   3158  C  C     . ARG B 1  175  ? -19.947 21.453  120.599 1.00 49.41  ? 175  ARG B C     1 
ATOM   3159  O  O     . ARG B 1  175  ? -20.332 20.302  120.377 1.00 47.21  ? 175  ARG B O     1 
ATOM   3160  C  CB    . ARG B 1  175  ? -21.780 23.171  120.804 1.00 51.37  ? 175  ARG B CB    1 
ATOM   3161  C  CG    . ARG B 1  175  ? -22.644 24.036  121.706 1.00 57.40  ? 175  ARG B CG    1 
ATOM   3162  C  CD    . ARG B 1  175  ? -24.027 24.277  121.117 1.00 62.98  ? 175  ARG B CD    1 
ATOM   3163  N  NE    . ARG B 1  175  ? -24.888 24.998  122.050 1.00 76.50  ? 175  ARG B NE    1 
ATOM   3164  C  CZ    . ARG B 1  175  ? -25.536 24.430  123.065 1.00 83.27  ? 175  ARG B CZ    1 
ATOM   3165  N  NH1   . ARG B 1  175  ? -25.425 23.125  123.282 1.00 78.96  ? 175  ARG B NH1   1 
ATOM   3166  N  NH2   . ARG B 1  175  ? -26.296 25.166  123.866 1.00 70.14  ? 175  ARG B NH2   1 
ATOM   3167  N  N     . ARG B 1  176  ? -18.880 21.979  120.006 1.00 40.83  ? 176  ARG B N     1 
ATOM   3168  C  CA    . ARG B 1  176  ? -18.055 21.191  119.097 1.00 41.91  ? 176  ARG B CA    1 
ATOM   3169  C  C     . ARG B 1  176  ? -16.616 21.701  119.011 1.00 41.80  ? 176  ARG B C     1 
ATOM   3170  O  O     . ARG B 1  176  ? -16.364 22.900  119.124 1.00 42.79  ? 176  ARG B O     1 
ATOM   3171  C  CB    . ARG B 1  176  ? -18.696 21.148  117.702 1.00 50.12  ? 176  ARG B CB    1 
ATOM   3172  C  CG    . ARG B 1  176  ? -17.852 20.458  116.635 1.00 55.90  ? 176  ARG B CG    1 
ATOM   3173  C  CD    . ARG B 1  176  ? -18.711 19.839  115.550 1.00 67.93  ? 176  ARG B CD    1 
ATOM   3174  N  NE    . ARG B 1  176  ? -19.413 20.834  114.743 1.00 66.86  ? 176  ARG B NE    1 
ATOM   3175  C  CZ    . ARG B 1  176  ? -19.064 21.174  113.506 1.00 60.01  ? 176  ARG B CZ    1 
ATOM   3176  N  NH1   . ARG B 1  176  ? -18.020 20.599  112.923 1.00 56.57  ? 176  ARG B NH1   1 
ATOM   3177  N  NH2   . ARG B 1  176  ? -19.764 22.088  112.849 1.00 56.66  ? 176  ARG B NH2   1 
ATOM   3178  N  N     . VAL B 1  177  ? -15.675 20.781  118.813 1.00 40.72  ? 177  VAL B N     1 
ATOM   3179  C  CA    . VAL B 1  177  ? -14.301 21.140  118.485 1.00 38.52  ? 177  VAL B CA    1 
ATOM   3180  C  C     . VAL B 1  177  ? -13.836 20.356  117.264 1.00 44.61  ? 177  VAL B C     1 
ATOM   3181  O  O     . VAL B 1  177  ? -13.905 19.127  117.237 1.00 48.28  ? 177  VAL B O     1 
ATOM   3182  C  CB    . VAL B 1  177  ? -13.332 20.864  119.647 1.00 39.96  ? 177  VAL B CB    1 
ATOM   3183  C  CG1   . VAL B 1  177  ? -11.898 21.159  119.223 1.00 39.47  ? 177  VAL B CG1   1 
ATOM   3184  C  CG2   . VAL B 1  177  ? -13.707 21.694  120.856 1.00 43.42  ? 177  VAL B CG2   1 
ATOM   3185  N  N     . ALA B 1  178  ? -13.366 21.076  116.253 1.00 41.41  ? 178  ALA B N     1 
ATOM   3186  C  CA    . ALA B 1  178  ? -12.854 20.457  115.042 1.00 41.24  ? 178  ALA B CA    1 
ATOM   3187  C  C     . ALA B 1  178  ? -11.507 21.073  114.682 1.00 41.91  ? 178  ALA B C     1 
ATOM   3188  O  O     . ALA B 1  178  ? -11.393 22.288  114.538 1.00 48.72  ? 178  ALA B O     1 
ATOM   3189  C  CB    . ALA B 1  178  ? -13.843 20.634  113.903 1.00 42.92  ? 178  ALA B CB    1 
ATOM   3190  N  N     . PHE B 1  179  ? -10.483 20.238  114.546 1.00 37.35  ? 179  PHE B N     1 
ATOM   3191  C  CA    . PHE B 1  179  ? -9.156  20.745  114.224 1.00 39.18  ? 179  PHE B CA    1 
ATOM   3192  C  C     . PHE B 1  179  ? -8.544  20.017  113.038 1.00 47.07  ? 179  PHE B C     1 
ATOM   3193  O  O     . PHE B 1  179  ? -8.760  18.820  112.846 1.00 51.22  ? 179  PHE B O     1 
ATOM   3194  C  CB    . PHE B 1  179  ? -8.229  20.662  115.437 1.00 48.05  ? 179  PHE B CB    1 
ATOM   3195  C  CG    . PHE B 1  179  ? -7.517  19.349  115.570 1.00 47.86  ? 179  PHE B CG    1 
ATOM   3196  C  CD1   . PHE B 1  179  ? -6.162  19.254  115.298 1.00 48.78  ? 179  PHE B CD1   1 
ATOM   3197  C  CD2   . PHE B 1  179  ? -8.199  18.211  115.966 1.00 46.01  ? 179  PHE B CD2   1 
ATOM   3198  C  CE1   . PHE B 1  179  ? -5.501  18.049  115.421 1.00 50.73  ? 179  PHE B CE1   1 
ATOM   3199  C  CE2   . PHE B 1  179  ? -7.546  17.003  116.091 1.00 47.86  ? 179  PHE B CE2   1 
ATOM   3200  C  CZ    . PHE B 1  179  ? -6.194  16.921  115.818 1.00 57.33  ? 179  PHE B CZ    1 
ATOM   3201  N  N     . GLN B 1  180  ? -7.775  20.754  112.246 1.00 48.85  ? 180  GLN B N     1 
ATOM   3202  C  CA    . GLN B 1  180  ? -7.169  20.211  111.043 1.00 50.73  ? 180  GLN B CA    1 
ATOM   3203  C  C     . GLN B 1  180  ? -5.760  20.767  110.869 1.00 52.22  ? 180  GLN B C     1 
ATOM   3204  O  O     . GLN B 1  180  ? -5.515  21.946  111.118 1.00 53.35  ? 180  GLN B O     1 
ATOM   3205  C  CB    . GLN B 1  180  ? -8.025  20.561  109.829 1.00 47.47  ? 180  GLN B CB    1 
ATOM   3206  C  CG    . GLN B 1  180  ? -7.572  19.909  108.544 1.00 57.93  ? 180  GLN B CG    1 
ATOM   3207  C  CD    . GLN B 1  180  ? -8.338  20.418  107.343 1.00 74.67  ? 180  GLN B CD    1 
ATOM   3208  O  OE1   . GLN B 1  180  ? -8.893  21.519  107.366 1.00 78.28  ? 180  GLN B OE1   1 
ATOM   3209  N  NE2   . GLN B 1  180  ? -8.379  19.617  106.285 1.00 78.17  ? 180  GLN B NE2   1 
ATOM   3210  N  N     . VAL B 1  181  ? -4.834  19.913  110.447 1.00 52.50  ? 181  VAL B N     1 
ATOM   3211  C  CA    . VAL B 1  181  ? -3.460  20.341  110.221 1.00 53.17  ? 181  VAL B CA    1 
ATOM   3212  C  C     . VAL B 1  181  ? -3.109  20.295  108.742 1.00 52.25  ? 181  VAL B C     1 
ATOM   3213  O  O     . VAL B 1  181  ? -3.155  19.241  108.110 1.00 49.19  ? 181  VAL B O     1 
ATOM   3214  C  CB    . VAL B 1  181  ? -2.463  19.487  111.013 1.00 48.71  ? 181  VAL B CB    1 
ATOM   3215  C  CG1   . VAL B 1  181  ? -1.039  19.988  110.793 1.00 48.10  ? 181  VAL B CG1   1 
ATOM   3216  C  CG2   . VAL B 1  181  ? -2.825  19.509  112.482 1.00 43.40  ? 181  VAL B CG2   1 
ATOM   3217  N  N     . GLU B 1  182  ? -2.766  21.456  108.200 1.00 61.69  ? 182  GLU B N     1 
ATOM   3218  C  CA    . GLU B 1  182  ? -2.426  21.578  106.793 1.00 68.57  ? 182  GLU B CA    1 
ATOM   3219  C  C     . GLU B 1  182  ? -0.935  21.843  106.635 1.00 74.74  ? 182  GLU B C     1 
ATOM   3220  O  O     . GLU B 1  182  ? -0.334  22.571  107.427 1.00 70.40  ? 182  GLU B O     1 
ATOM   3221  C  CB    . GLU B 1  182  ? -3.232  22.711  106.158 1.00 68.73  ? 182  GLU B CB    1 
ATOM   3222  C  CG    . GLU B 1  182  ? -4.726  22.632  106.438 1.00 71.49  ? 182  GLU B CG    1 
ATOM   3223  C  CD    . GLU B 1  182  ? -5.429  23.961  106.234 1.00 81.03  ? 182  GLU B CD    1 
ATOM   3224  O  OE1   . GLU B 1  182  ? -6.533  24.144  106.790 1.00 75.87  ? 182  GLU B OE1   1 
ATOM   3225  O  OE2   . GLU B 1  182  ? -4.876  24.823  105.520 1.00 83.42  ? 182  GLU B OE2   1 
ATOM   3226  N  N     . ASP B 1  183  ? -0.339  21.239  105.612 1.00 76.61  ? 183  ASP B N     1 
ATOM   3227  C  CA    . ASP B 1  183  ? 1.064   21.472  105.313 1.00 68.48  ? 183  ASP B CA    1 
ATOM   3228  C  C     . ASP B 1  183  ? 1.245   22.871  104.752 1.00 66.48  ? 183  ASP B C     1 
ATOM   3229  O  O     . ASP B 1  183  ? 0.594   23.248  103.778 1.00 66.99  ? 183  ASP B O     1 
ATOM   3230  C  CB    . ASP B 1  183  ? 1.582   20.436  104.314 1.00 74.25  ? 183  ASP B CB    1 
ATOM   3231  C  CG    . ASP B 1  183  ? 1.712   19.052  104.923 1.00 88.03  ? 183  ASP B CG    1 
ATOM   3232  O  OD1   . ASP B 1  183  ? 1.235   18.079  104.299 1.00 85.49  ? 183  ASP B OD1   1 
ATOM   3233  O  OD2   . ASP B 1  183  ? 2.296   18.937  106.023 1.00 89.57  ? 183  ASP B OD2   1 
ATOM   3234  N  N     . THR B 1  184  ? 2.126   23.642  105.379 1.00 69.02  ? 184  THR B N     1 
ATOM   3235  C  CA    . THR B 1  184  ? 2.471   24.962  104.878 1.00 65.85  ? 184  THR B CA    1 
ATOM   3236  C  C     . THR B 1  184  ? 3.977   25.133  104.936 1.00 73.08  ? 184  THR B C     1 
ATOM   3237  O  O     . THR B 1  184  ? 4.665   24.393  105.634 1.00 75.35  ? 184  THR B O     1 
ATOM   3238  C  CB    . THR B 1  184  ? 1.810   26.074  105.691 1.00 66.93  ? 184  THR B CB    1 
ATOM   3239  O  OG1   . THR B 1  184  ? 1.961   27.320  104.999 1.00 77.34  ? 184  THR B OG1   1 
ATOM   3240  C  CG2   . THR B 1  184  ? 2.450   26.178  107.066 1.00 63.70  ? 184  THR B CG2   1 
ATOM   3241  N  N     . ARG B 1  185  ? 4.496   26.111  104.208 1.00 81.40  ? 185  ARG B N     1 
ATOM   3242  C  CA    . ARG B 1  185  ? 5.941   26.228  104.089 1.00 91.05  ? 185  ARG B CA    1 
ATOM   3243  C  C     . ARG B 1  185  ? 6.493   27.572  104.540 1.00 85.12  ? 185  ARG B C     1 
ATOM   3244  O  O     . ARG B 1  185  ? 5.899   28.623  104.291 1.00 82.62  ? 185  ARG B O     1 
ATOM   3245  C  CB    . ARG B 1  185  ? 6.388   25.929  102.654 1.00 90.70  ? 185  ARG B CB    1 
ATOM   3246  C  CG    . ARG B 1  185  ? 5.939   26.945  101.626 1.00 85.52  ? 185  ARG B CG    1 
ATOM   3247  C  CD    . ARG B 1  185  ? 6.630   26.718  100.293 1.00 77.66  ? 185  ARG B CD    1 
ATOM   3248  N  NE    . ARG B 1  185  ? 6.565   27.907  99.451  1.00 68.39  ? 185  ARG B NE    1 
ATOM   3249  C  CZ    . ARG B 1  185  ? 7.467   28.883  99.472  1.00 74.25  ? 185  ARG B CZ    1 
ATOM   3250  N  NH1   . ARG B 1  185  ? 8.509   28.808  100.290 1.00 81.95  ? 185  ARG B NH1   1 
ATOM   3251  N  NH2   . ARG B 1  185  ? 7.329   29.934  98.677  1.00 73.96  ? 185  ARG B NH2   1 
ATOM   3252  N  N     . LEU B 1  186  ? 7.632   27.523  105.220 1.00 86.17  ? 186  LEU B N     1 
ATOM   3253  C  CA    . LEU B 1  186  ? 8.393   28.726  105.500 1.00 92.78  ? 186  LEU B CA    1 
ATOM   3254  C  C     . LEU B 1  186  ? 9.693   28.622  104.724 1.00 98.89  ? 186  LEU B C     1 
ATOM   3255  O  O     . LEU B 1  186  ? 10.558  27.815  105.062 1.00 95.18  ? 186  LEU B O     1 
ATOM   3256  C  CB    . LEU B 1  186  ? 8.692   28.848  106.994 1.00 89.30  ? 186  LEU B CB    1 
ATOM   3257  C  CG    . LEU B 1  186  ? 9.174   30.231  107.441 1.00 83.53  ? 186  LEU B CG    1 
ATOM   3258  C  CD1   . LEU B 1  186  ? 8.020   31.228  107.411 1.00 85.14  ? 186  LEU B CD1   1 
ATOM   3259  C  CD2   . LEU B 1  186  ? 9.825   30.196  108.817 1.00 81.06  ? 186  LEU B CD2   1 
ATOM   3260  N  N     . GLY B 1  187  ? 9.830   29.429  103.677 1.00 103.68 ? 187  GLY B N     1 
ATOM   3261  C  CA    . GLY B 1  187  ? 11.035  29.390  102.872 1.00 99.16  ? 187  GLY B CA    1 
ATOM   3262  C  C     . GLY B 1  187  ? 11.211  28.049  102.185 1.00 96.49  ? 187  GLY B C     1 
ATOM   3263  O  O     . GLY B 1  187  ? 10.366  27.630  101.392 1.00 84.50  ? 187  GLY B O     1 
ATOM   3264  N  N     . GLN B 1  188  ? 12.322  27.381  102.486 1.00 101.97 ? 188  GLN B N     1 
ATOM   3265  C  CA    . GLN B 1  188  ? 12.678  26.126  101.825 1.00 104.98 ? 188  GLN B CA    1 
ATOM   3266  C  C     . GLN B 1  188  ? 11.836  24.883  102.175 1.00 114.07 ? 188  GLN B C     1 
ATOM   3267  O  O     . GLN B 1  188  ? 11.593  24.047  101.304 1.00 111.60 ? 188  GLN B O     1 
ATOM   3268  C  CB    . GLN B 1  188  ? 14.167  25.818  102.024 1.00 97.92  ? 188  GLN B CB    1 
ATOM   3269  C  CG    . GLN B 1  188  ? 14.961  25.767  100.726 1.00 97.06  ? 188  GLN B CG    1 
ATOM   3270  C  CD    . GLN B 1  188  ? 14.243  24.988  99.637  1.00 99.31  ? 188  GLN B CD    1 
ATOM   3271  O  OE1   . GLN B 1  188  ? 13.646  25.572  98.734  1.00 93.25  ? 188  GLN B OE1   1 
ATOM   3272  N  NE2   . GLN B 1  188  ? 14.301  23.663  99.718  1.00 97.93  ? 188  GLN B NE2   1 
ATOM   3273  N  N     . ARG B 1  189  ? 11.402  24.750  103.429 1.00 113.02 ? 189  ARG B N     1 
ATOM   3274  C  CA    . ARG B 1  189  ? 10.749  23.511  103.891 1.00 103.53 ? 189  ARG B CA    1 
ATOM   3275  C  C     . ARG B 1  189  ? 9.220   23.494  103.732 1.00 97.21  ? 189  ARG B C     1 
ATOM   3276  O  O     . ARG B 1  189  ? 8.527   24.369  104.248 1.00 94.43  ? 189  ARG B O     1 
ATOM   3277  C  CB    . ARG B 1  189  ? 11.132  23.224  105.342 1.00 96.43  ? 189  ARG B CB    1 
ATOM   3278  C  CG    . ARG B 1  189  ? 12.089  24.247  105.917 1.00 93.24  ? 189  ARG B CG    1 
ATOM   3279  C  CD    . ARG B 1  189  ? 12.308  24.020  107.390 1.00 103.44 ? 189  ARG B CD    1 
ATOM   3280  N  NE    . ARG B 1  189  ? 13.242  24.987  107.952 1.00 107.24 ? 189  ARG B NE    1 
ATOM   3281  C  CZ    . ARG B 1  189  ? 13.521  25.074  109.247 1.00 100.29 ? 189  ARG B CZ    1 
ATOM   3282  N  NH1   . ARG B 1  189  ? 14.384  25.978  109.688 1.00 101.64 ? 189  ARG B NH1   1 
ATOM   3283  N  NH2   . ARG B 1  189  ? 12.930  24.254  110.102 1.00 89.44  ? 189  ARG B NH2   1 
ATOM   3284  N  N     . THR B 1  190  ? 8.702   22.483  103.034 1.00 95.19  ? 190  THR B N     1 
ATOM   3285  C  CA    . THR B 1  190  ? 7.279   22.445  102.679 1.00 89.21  ? 190  THR B CA    1 
ATOM   3286  C  C     . THR B 1  190  ? 6.367   21.730  103.693 1.00 90.10  ? 190  THR B C     1 
ATOM   3287  O  O     . THR B 1  190  ? 5.144   21.852  103.623 1.00 83.04  ? 190  THR B O     1 
ATOM   3288  C  CB    . THR B 1  190  ? 7.057   21.813  101.276 1.00 83.34  ? 190  THR B CB    1 
ATOM   3289  O  OG1   . THR B 1  190  ? 8.007   22.339  100.344 1.00 87.60  ? 190  THR B OG1   1 
ATOM   3290  C  CG2   . THR B 1  190  ? 5.659   22.105  100.750 1.00 68.38  ? 190  THR B CG2   1 
ATOM   3291  N  N     . ASP B 1  191  ? 6.949   21.002  104.642 1.00 93.47  ? 191  ASP B N     1 
ATOM   3292  C  CA    . ASP B 1  191  ? 6.151   20.161  105.540 1.00 91.72  ? 191  ASP B CA    1 
ATOM   3293  C  C     . ASP B 1  191  ? 5.636   20.847  106.819 1.00 90.07  ? 191  ASP B C     1 
ATOM   3294  O  O     . ASP B 1  191  ? 4.734   20.326  107.481 1.00 84.63  ? 191  ASP B O     1 
ATOM   3295  C  CB    . ASP B 1  191  ? 6.902   18.862  105.877 1.00 92.07  ? 191  ASP B CB    1 
ATOM   3296  C  CG    . ASP B 1  191  ? 6.172   18.008  106.911 1.00 101.83 ? 191  ASP B CG    1 
ATOM   3297  O  OD1   . ASP B 1  191  ? 6.589   18.022  108.088 1.00 92.17  ? 191  ASP B OD1   1 
ATOM   3298  O  OD2   . ASP B 1  191  ? 5.171   17.342  106.558 1.00 107.90 ? 191  ASP B OD2   1 
ATOM   3299  N  N     . LEU B 1  192  ? 6.177   22.022  107.141 1.00 82.95  ? 192  LEU B N     1 
ATOM   3300  C  CA    . LEU B 1  192  ? 5.896   22.693  108.420 1.00 73.38  ? 192  LEU B CA    1 
ATOM   3301  C  C     . LEU B 1  192  ? 4.391   22.824  108.714 1.00 71.29  ? 192  LEU B C     1 
ATOM   3302  O  O     . LEU B 1  192  ? 3.600   23.192  107.841 1.00 76.41  ? 192  LEU B O     1 
ATOM   3303  C  CB    . LEU B 1  192  ? 6.605   24.059  108.497 1.00 73.22  ? 192  LEU B CB    1 
ATOM   3304  C  CG    . LEU B 1  192  ? 8.121   24.142  108.770 1.00 72.88  ? 192  LEU B CG    1 
ATOM   3305  C  CD1   . LEU B 1  192  ? 8.427   24.629  110.187 1.00 72.88  ? 192  LEU B CD1   1 
ATOM   3306  C  CD2   . LEU B 1  192  ? 8.844   22.825  108.511 1.00 81.61  ? 192  LEU B CD2   1 
ATOM   3307  N  N     . ASP B 1  193  ? 4.005   22.503  109.946 1.00 59.94  ? 193  ASP B N     1 
ATOM   3308  C  CA    . ASP B 1  193  ? 2.593   22.330  110.281 1.00 60.74  ? 193  ASP B CA    1 
ATOM   3309  C  C     . ASP B 1  193  ? 1.822   23.632  110.490 1.00 59.32  ? 193  ASP B C     1 
ATOM   3310  O  O     . ASP B 1  193  ? 2.325   24.582  111.092 1.00 57.45  ? 193  ASP B O     1 
ATOM   3311  C  CB    . ASP B 1  193  ? 2.434   21.413  111.499 1.00 60.17  ? 193  ASP B CB    1 
ATOM   3312  C  CG    . ASP B 1  193  ? 2.513   19.937  111.135 1.00 69.03  ? 193  ASP B CG    1 
ATOM   3313  O  OD1   . ASP B 1  193  ? 2.155   19.587  109.988 1.00 80.67  ? 193  ASP B OD1   1 
ATOM   3314  O  OD2   . ASP B 1  193  ? 2.927   19.124  111.992 1.00 62.11  ? 193  ASP B OD2   1 
ATOM   3315  N  N     . LYS B 1  194  ? 0.599   23.659  109.970 1.00 57.23  ? 194  LYS B N     1 
ATOM   3316  C  CA    . LYS B 1  194  ? -0.325  24.758  110.203 1.00 57.76  ? 194  LYS B CA    1 
ATOM   3317  C  C     . LYS B 1  194  ? -1.550  24.216  110.925 1.00 61.66  ? 194  LYS B C     1 
ATOM   3318  O  O     . LYS B 1  194  ? -2.313  23.427  110.366 1.00 63.13  ? 194  LYS B O     1 
ATOM   3319  C  CB    . LYS B 1  194  ? -0.747  25.409  108.884 1.00 61.69  ? 194  LYS B CB    1 
ATOM   3320  C  CG    . LYS B 1  194  ? -1.851  26.453  109.043 1.00 67.23  ? 194  LYS B CG    1 
ATOM   3321  C  CD    . LYS B 1  194  ? -2.420  26.907  107.702 1.00 64.94  ? 194  LYS B CD    1 
ATOM   3322  C  CE    . LYS B 1  194  ? -3.515  27.953  107.890 1.00 51.18  ? 194  LYS B CE    1 
ATOM   3323  N  NZ    . LYS B 1  194  ? -4.091  28.420  106.601 1.00 41.22  ? 194  LYS B NZ    1 
ATOM   3324  N  N     . LEU B 1  195  ? -1.736  24.642  112.168 1.00 56.61  ? 195  LEU B N     1 
ATOM   3325  C  CA    . LEU B 1  195  ? -2.864  24.183  112.965 1.00 52.14  ? 195  LEU B CA    1 
ATOM   3326  C  C     . LEU B 1  195  ? -4.042  25.149  112.885 1.00 53.58  ? 195  LEU B C     1 
ATOM   3327  O  O     . LEU B 1  195  ? -3.936  26.306  113.287 1.00 55.14  ? 195  LEU B O     1 
ATOM   3328  C  CB    . LEU B 1  195  ? -2.441  23.997  114.423 1.00 49.55  ? 195  LEU B CB    1 
ATOM   3329  C  CG    . LEU B 1  195  ? -3.563  23.764  115.437 1.00 44.68  ? 195  LEU B CG    1 
ATOM   3330  C  CD1   . LEU B 1  195  ? -4.260  22.427  115.212 1.00 42.65  ? 195  LEU B CD1   1 
ATOM   3331  C  CD2   . LEU B 1  195  ? -3.014  23.856  116.845 1.00 43.51  ? 195  LEU B CD2   1 
ATOM   3332  N  N     . THR B 1  196  ? -5.163  24.666  112.359 1.00 49.73  ? 196  THR B N     1 
ATOM   3333  C  CA    . THR B 1  196  ? -6.391  25.450  112.323 1.00 48.30  ? 196  THR B CA    1 
ATOM   3334  C  C     . THR B 1  196  ? -7.416  24.834  113.262 1.00 47.67  ? 196  THR B C     1 
ATOM   3335  O  O     . THR B 1  196  ? -7.813  23.684  113.087 1.00 50.49  ? 196  THR B O     1 
ATOM   3336  C  CB    . THR B 1  196  ? -6.990  25.509  110.910 1.00 57.22  ? 196  THR B CB    1 
ATOM   3337  O  OG1   . THR B 1  196  ? -5.977  25.896  109.973 1.00 70.05  ? 196  THR B OG1   1 
ATOM   3338  C  CG2   . THR B 1  196  ? -8.137  26.510  110.860 1.00 53.08  ? 196  THR B CG2   1 
ATOM   3339  N  N     . LEU B 1  197  ? -7.844  25.603  114.258 1.00 53.05  ? 197  LEU B N     1 
ATOM   3340  C  CA    . LEU B 1  197  ? -8.770  25.106  115.270 1.00 45.45  ? 197  LEU B CA    1 
ATOM   3341  C  C     . LEU B 1  197  ? -10.118 25.825  115.217 1.00 48.69  ? 197  LEU B C     1 
ATOM   3342  O  O     . LEU B 1  197  ? -10.177 27.042  115.038 1.00 57.29  ? 197  LEU B O     1 
ATOM   3343  C  CB    . LEU B 1  197  ? -8.151  25.252  116.659 1.00 43.12  ? 197  LEU B CB    1 
ATOM   3344  C  CG    . LEU B 1  197  ? -8.998  24.742  117.821 1.00 54.53  ? 197  LEU B CG    1 
ATOM   3345  C  CD1   . LEU B 1  197  ? -9.237  23.248  117.688 1.00 51.59  ? 197  LEU B CD1   1 
ATOM   3346  C  CD2   . LEU B 1  197  ? -8.333  25.070  119.146 1.00 57.53  ? 197  LEU B CD2   1 
ATOM   3347  N  N     . ARG B 1  198  ? -11.199 25.065  115.375 1.00 39.22  ? 198  ARG B N     1 
ATOM   3348  C  CA    . ARG B 1  198  ? -12.548 25.619  115.321 1.00 39.45  ? 198  ARG B CA    1 
ATOM   3349  C  C     . ARG B 1  198  ? -13.347 25.176  116.544 1.00 44.04  ? 198  ARG B C     1 
ATOM   3350  O  O     . ARG B 1  198  ? -13.369 23.995  116.882 1.00 49.28  ? 198  ARG B O     1 
ATOM   3351  C  CB    . ARG B 1  198  ? -13.252 25.167  114.043 1.00 44.40  ? 198  ARG B CB    1 
ATOM   3352  C  CG    . ARG B 1  198  ? -12.460 25.419  112.769 1.00 50.61  ? 198  ARG B CG    1 
ATOM   3353  C  CD    . ARG B 1  198  ? -12.963 24.552  111.625 1.00 54.53  ? 198  ARG B CD    1 
ATOM   3354  N  NE    . ARG B 1  198  ? -14.363 24.819  111.307 1.00 61.73  ? 198  ARG B NE    1 
ATOM   3355  C  CZ    . ARG B 1  198  ? -15.102 24.066  110.498 1.00 62.48  ? 198  ARG B CZ    1 
ATOM   3356  N  NH1   . ARG B 1  198  ? -16.369 24.388  110.267 1.00 57.62  ? 198  ARG B NH1   1 
ATOM   3357  N  NH2   . ARG B 1  198  ? -14.579 22.989  109.925 1.00 56.32  ? 198  ARG B NH2   1 
ATOM   3358  N  N     . ILE B 1  199  ? -13.997 26.125  117.210 1.00 47.51  ? 199  ILE B N     1 
ATOM   3359  C  CA    . ILE B 1  199  ? -14.708 25.833  118.452 1.00 36.04  ? 199  ILE B CA    1 
ATOM   3360  C  C     . ILE B 1  199  ? -16.112 26.426  118.463 1.00 45.91  ? 199  ILE B C     1 
ATOM   3361  O  O     . ILE B 1  199  ? -16.307 27.590  118.118 1.00 57.65  ? 199  ILE B O     1 
ATOM   3362  C  CB    . ILE B 1  199  ? -13.953 26.384  119.676 1.00 34.57  ? 199  ILE B CB    1 
ATOM   3363  C  CG1   . ILE B 1  199  ? -12.466 26.029  119.606 1.00 40.37  ? 199  ILE B CG1   1 
ATOM   3364  C  CG2   . ILE B 1  199  ? -14.574 25.861  120.959 1.00 40.18  ? 199  ILE B CG2   1 
ATOM   3365  C  CD1   . ILE B 1  199  ? -11.646 26.603  120.740 1.00 43.43  ? 199  ILE B CD1   1 
ATOM   3366  N  N     . TRP B 1  200  ? -17.086 25.617  118.867 1.00 43.98  ? 200  TRP B N     1 
ATOM   3367  C  CA    . TRP B 1  200  ? -18.461 26.074  119.024 1.00 48.78  ? 200  TRP B CA    1 
ATOM   3368  C  C     . TRP B 1  200  ? -18.793 26.155  120.509 1.00 55.82  ? 200  TRP B C     1 
ATOM   3369  O  O     . TRP B 1  200  ? -18.384 25.293  121.287 1.00 50.52  ? 200  TRP B O     1 
ATOM   3370  C  CB    . TRP B 1  200  ? -19.432 25.101  118.352 1.00 53.37  ? 200  TRP B CB    1 
ATOM   3371  C  CG    . TRP B 1  200  ? -19.508 25.190  116.854 1.00 50.94  ? 200  TRP B CG    1 
ATOM   3372  C  CD1   . TRP B 1  200  ? -20.575 25.608  116.116 1.00 55.66  ? 200  TRP B CD1   1 
ATOM   3373  C  CD2   . TRP B 1  200  ? -18.486 24.835  115.914 1.00 49.48  ? 200  TRP B CD2   1 
ATOM   3374  N  NE1   . TRP B 1  200  ? -20.281 25.541  114.776 1.00 56.50  ? 200  TRP B NE1   1 
ATOM   3375  C  CE2   . TRP B 1  200  ? -19.004 25.071  114.626 1.00 49.22  ? 200  TRP B CE2   1 
ATOM   3376  C  CE3   . TRP B 1  200  ? -17.183 24.345  116.036 1.00 50.69  ? 200  TRP B CE3   1 
ATOM   3377  C  CZ2   . TRP B 1  200  ? -18.265 24.836  113.471 1.00 55.31  ? 200  TRP B CZ2   1 
ATOM   3378  C  CZ3   . TRP B 1  200  ? -16.453 24.111  114.890 1.00 52.07  ? 200  TRP B CZ3   1 
ATOM   3379  C  CH2   . TRP B 1  200  ? -16.994 24.357  113.624 1.00 58.68  ? 200  TRP B CH2   1 
ATOM   3380  N  N     . THR B 1  201  ? -19.531 27.190  120.903 1.00 66.79  ? 201  THR B N     1 
ATOM   3381  C  CA    . THR B 1  201  ? -19.973 27.325  122.290 1.00 63.12  ? 201  THR B CA    1 
ATOM   3382  C  C     . THR B 1  201  ? -21.461 27.652  122.371 1.00 67.62  ? 201  THR B C     1 
ATOM   3383  O  O     . THR B 1  201  ? -22.128 27.784  121.346 1.00 75.10  ? 201  THR B O     1 
ATOM   3384  C  CB    . THR B 1  201  ? -19.177 28.403  123.059 1.00 60.81  ? 201  THR B CB    1 
ATOM   3385  O  OG1   . THR B 1  201  ? -19.363 29.681  122.438 1.00 69.94  ? 201  THR B OG1   1 
ATOM   3386  C  CG2   . THR B 1  201  ? -17.691 28.065  123.095 1.00 52.93  ? 201  THR B CG2   1 
ATOM   3387  N  N     . ASP B 1  202  ? -21.980 27.766  123.592 1.00 63.43  ? 202  ASP B N     1 
ATOM   3388  C  CA    . ASP B 1  202  ? -23.380 28.133  123.792 1.00 67.87  ? 202  ASP B CA    1 
ATOM   3389  C  C     . ASP B 1  202  ? -23.563 29.624  124.075 1.00 67.37  ? 202  ASP B C     1 
ATOM   3390  O  O     . ASP B 1  202  ? -24.688 30.108  124.206 1.00 60.53  ? 202  ASP B O     1 
ATOM   3391  C  CB    . ASP B 1  202  ? -24.016 27.293  124.906 1.00 71.10  ? 202  ASP B CB    1 
ATOM   3392  C  CG    . ASP B 1  202  ? -23.219 27.324  126.200 1.00 74.58  ? 202  ASP B CG    1 
ATOM   3393  O  OD1   . ASP B 1  202  ? -22.412 28.260  126.392 1.00 74.82  ? 202  ASP B OD1   1 
ATOM   3394  O  OD2   . ASP B 1  202  ? -23.406 26.409  127.031 1.00 70.37  ? 202  ASP B OD2   1 
ATOM   3395  N  N     . GLY B 1  203  ? -22.452 30.347  124.168 1.00 66.28  ? 203  GLY B N     1 
ATOM   3396  C  CA    . GLY B 1  203  ? -22.497 31.773  124.432 1.00 70.66  ? 203  GLY B CA    1 
ATOM   3397  C  C     . GLY B 1  203  ? -22.189 32.131  125.873 1.00 73.58  ? 203  GLY B C     1 
ATOM   3398  O  O     . GLY B 1  203  ? -21.848 33.276  126.173 1.00 73.62  ? 203  GLY B O     1 
ATOM   3399  N  N     . SER B 1  204  ? -22.315 31.156  126.768 1.00 66.79  ? 204  SER B N     1 
ATOM   3400  C  CA    . SER B 1  204  ? -22.005 31.373  128.177 1.00 64.65  ? 204  SER B CA    1 
ATOM   3401  C  C     . SER B 1  204  ? -20.511 31.617  128.365 1.00 68.60  ? 204  SER B C     1 
ATOM   3402  O  O     . SER B 1  204  ? -20.104 32.533  129.078 1.00 71.88  ? 204  SER B O     1 
ATOM   3403  C  CB    . SER B 1  204  ? -22.460 30.183  129.020 1.00 58.83  ? 204  SER B CB    1 
ATOM   3404  O  OG    . SER B 1  204  ? -21.830 28.990  128.595 1.00 61.21  ? 204  SER B OG    1 
ATOM   3405  N  N     . VAL B 1  205  ? -19.698 30.785  127.723 1.00 68.91  ? 205  VAL B N     1 
ATOM   3406  C  CA    . VAL B 1  205  ? -18.256 30.995  127.689 1.00 66.91  ? 205  VAL B CA    1 
ATOM   3407  C  C     . VAL B 1  205  ? -17.824 31.132  126.232 1.00 70.12  ? 205  VAL B C     1 
ATOM   3408  O  O     . VAL B 1  205  ? -18.191 30.309  125.396 1.00 70.03  ? 205  VAL B O     1 
ATOM   3409  C  CB    . VAL B 1  205  ? -17.495 29.826  128.340 1.00 59.69  ? 205  VAL B CB    1 
ATOM   3410  C  CG1   . VAL B 1  205  ? -16.052 30.221  128.607 1.00 58.07  ? 205  VAL B CG1   1 
ATOM   3411  C  CG2   . VAL B 1  205  ? -18.174 29.402  129.629 1.00 63.14  ? 205  VAL B CG2   1 
ATOM   3412  N  N     . THR B 1  206  ? -17.058 32.175  125.925 1.00 65.57  ? 206  THR B N     1 
ATOM   3413  C  CA    . THR B 1  206  ? -16.634 32.421  124.550 1.00 61.74  ? 206  THR B CA    1 
ATOM   3414  C  C     . THR B 1  206  ? -15.543 31.433  124.145 1.00 67.42  ? 206  THR B C     1 
ATOM   3415  O  O     . THR B 1  206  ? -14.783 30.968  124.996 1.00 65.62  ? 206  THR B O     1 
ATOM   3416  C  CB    . THR B 1  206  ? -16.118 33.862  124.360 1.00 58.97  ? 206  THR B CB    1 
ATOM   3417  O  OG1   . THR B 1  206  ? -14.710 33.911  124.619 1.00 58.51  ? 206  THR B OG1   1 
ATOM   3418  C  CG2   . THR B 1  206  ? -16.846 34.820  125.288 1.00 69.92  ? 206  THR B CG2   1 
ATOM   3419  N  N     . PRO B 1  207  ? -15.474 31.098  122.843 1.00 67.62  ? 207  PRO B N     1 
ATOM   3420  C  CA    . PRO B 1  207  ? -14.471 30.167  122.314 1.00 59.39  ? 207  PRO B CA    1 
ATOM   3421  C  C     . PRO B 1  207  ? -13.042 30.551  122.688 1.00 63.08  ? 207  PRO B C     1 
ATOM   3422  O  O     . PRO B 1  207  ? -12.264 29.674  123.070 1.00 59.18  ? 207  PRO B O     1 
ATOM   3423  C  CB    . PRO B 1  207  ? -14.672 30.275  120.802 1.00 63.20  ? 207  PRO B CB    1 
ATOM   3424  C  CG    . PRO B 1  207  ? -16.112 30.601  120.655 1.00 62.85  ? 207  PRO B CG    1 
ATOM   3425  C  CD    . PRO B 1  207  ? -16.427 31.518  121.800 1.00 69.75  ? 207  PRO B CD    1 
ATOM   3426  N  N     . LEU B 1  208  ? -12.703 31.834  122.582 1.00 65.10  ? 208  LEU B N     1 
ATOM   3427  C  CA    . LEU B 1  208  ? -11.377 32.297  122.983 1.00 67.47  ? 208  LEU B CA    1 
ATOM   3428  C  C     . LEU B 1  208  ? -11.157 32.052  124.474 1.00 67.89  ? 208  LEU B C     1 
ATOM   3429  O  O     . LEU B 1  208  ? -10.098 31.573  124.882 1.00 70.46  ? 208  LEU B O     1 
ATOM   3430  C  CB    . LEU B 1  208  ? -11.178 33.778  122.645 1.00 65.76  ? 208  LEU B CB    1 
ATOM   3431  C  CG    . LEU B 1  208  ? -9.881  34.411  123.167 1.00 66.82  ? 208  LEU B CG    1 
ATOM   3432  C  CD1   . LEU B 1  208  ? -8.658  33.659  122.667 1.00 62.60  ? 208  LEU B CD1   1 
ATOM   3433  C  CD2   . LEU B 1  208  ? -9.796  35.880  122.786 1.00 73.99  ? 208  LEU B CD2   1 
ATOM   3434  N  N     . GLU B 1  209  ? -12.162 32.381  125.280 1.00 63.08  ? 209  GLU B N     1 
ATOM   3435  C  CA    . GLU B 1  209  ? -12.118 32.084  126.705 1.00 59.52  ? 209  GLU B CA    1 
ATOM   3436  C  C     . GLU B 1  209  ? -12.008 30.581  126.895 1.00 58.50  ? 209  GLU B C     1 
ATOM   3437  O  O     . GLU B 1  209  ? -11.229 30.106  127.719 1.00 61.34  ? 209  GLU B O     1 
ATOM   3438  C  CB    . GLU B 1  209  ? -13.366 32.618  127.415 1.00 64.68  ? 209  GLU B CB    1 
ATOM   3439  C  CG    . GLU B 1  209  ? -13.423 34.138  127.530 1.00 73.12  ? 209  GLU B CG    1 
ATOM   3440  C  CD    . GLU B 1  209  ? -14.742 34.638  128.096 1.00 70.61  ? 209  GLU B CD    1 
ATOM   3441  O  OE1   . GLU B 1  209  ? -15.035 35.845  127.951 1.00 59.82  ? 209  GLU B OE1   1 
ATOM   3442  O  OE2   . GLU B 1  209  ? -15.487 33.825  128.684 1.00 75.70  ? 209  GLU B OE2   1 
ATOM   3443  N  N     . ALA B 1  210  ? -12.782 29.839  126.108 1.00 56.83  ? 210  ALA B N     1 
ATOM   3444  C  CA    . ALA B 1  210  ? -12.798 28.382  126.182 1.00 59.15  ? 210  ALA B CA    1 
ATOM   3445  C  C     . ALA B 1  210  ? -11.422 27.774  125.913 1.00 63.03  ? 210  ALA B C     1 
ATOM   3446  O  O     . ALA B 1  210  ? -10.973 26.891  126.647 1.00 60.91  ? 210  ALA B O     1 
ATOM   3447  C  CB    . ALA B 1  210  ? -13.831 27.813  125.219 1.00 46.69  ? 210  ALA B CB    1 
ATOM   3448  N  N     . LEU B 1  211  ? -10.755 28.248  124.865 1.00 58.62  ? 211  LEU B N     1 
ATOM   3449  C  CA    . LEU B 1  211  ? -9.444  27.720  124.502 1.00 58.82  ? 211  LEU B CA    1 
ATOM   3450  C  C     . LEU B 1  211  ? -8.375  28.109  125.519 1.00 59.10  ? 211  LEU B C     1 
ATOM   3451  O  O     . LEU B 1  211  ? -7.478  27.322  125.820 1.00 62.92  ? 211  LEU B O     1 
ATOM   3452  C  CB    . LEU B 1  211  ? -9.034  28.174  123.099 1.00 56.35  ? 211  LEU B CB    1 
ATOM   3453  C  CG    . LEU B 1  211  ? -7.662  27.691  122.614 1.00 45.89  ? 211  LEU B CG    1 
ATOM   3454  C  CD1   . LEU B 1  211  ? -7.563  26.176  122.674 1.00 39.69  ? 211  LEU B CD1   1 
ATOM   3455  C  CD2   . LEU B 1  211  ? -7.375  28.193  121.208 1.00 49.59  ? 211  LEU B CD2   1 
ATOM   3456  N  N     . ASN B 1  212  ? -8.472  29.325  126.045 1.00 57.14  ? 212  ASN B N     1 
ATOM   3457  C  CA    . ASN B 1  212  ? -7.528  29.782  127.056 1.00 59.18  ? 212  ASN B CA    1 
ATOM   3458  C  C     . ASN B 1  212  ? -7.626  28.936  128.319 1.00 56.90  ? 212  ASN B C     1 
ATOM   3459  O  O     . ASN B 1  212  ? -6.616  28.621  128.949 1.00 53.63  ? 212  ASN B O     1 
ATOM   3460  C  CB    . ASN B 1  212  ? -7.742  31.263  127.371 1.00 54.58  ? 212  ASN B CB    1 
ATOM   3461  C  CG    . ASN B 1  212  ? -7.230  32.169  126.268 1.00 57.96  ? 212  ASN B CG    1 
ATOM   3462  O  OD1   . ASN B 1  212  ? -6.146  31.952  125.728 1.00 58.47  ? 212  ASN B OD1   1 
ATOM   3463  N  ND2   . ASN B 1  212  ? -8.012  33.185  125.922 1.00 62.89  ? 212  ASN B ND2   1 
ATOM   3464  N  N     . GLN B 1  213  ? -8.849  28.562  128.676 1.00 53.03  ? 213  GLN B N     1 
ATOM   3465  C  CA    . GLN B 1  213  ? -9.065  27.682  129.815 1.00 55.75  ? 213  GLN B CA    1 
ATOM   3466  C  C     . GLN B 1  213  ? -8.459  26.318  129.524 1.00 52.40  ? 213  GLN B C     1 
ATOM   3467  O  O     . GLN B 1  213  ? -7.859  25.694  130.397 1.00 55.37  ? 213  GLN B O     1 
ATOM   3468  C  CB    . GLN B 1  213  ? -10.559 27.539  130.115 1.00 61.47  ? 213  GLN B CB    1 
ATOM   3469  C  CG    . GLN B 1  213  ? -11.229 28.812  130.610 1.00 61.25  ? 213  GLN B CG    1 
ATOM   3470  C  CD    . GLN B 1  213  ? -12.702 28.612  130.920 1.00 65.02  ? 213  GLN B CD    1 
ATOM   3471  O  OE1   . GLN B 1  213  ? -13.139 27.501  131.227 1.00 63.76  ? 213  GLN B OE1   1 
ATOM   3472  N  NE2   . GLN B 1  213  ? -13.477 29.688  130.836 1.00 67.16  ? 213  GLN B NE2   1 
ATOM   3473  N  N     . ALA B 1  214  ? -8.612  25.871  128.282 1.00 54.02  ? 214  ALA B N     1 
ATOM   3474  C  CA    . ALA B 1  214  ? -8.134  24.560  127.863 1.00 56.24  ? 214  ALA B CA    1 
ATOM   3475  C  C     . ALA B 1  214  ? -6.618  24.429  127.968 1.00 52.64  ? 214  ALA B C     1 
ATOM   3476  O  O     . ALA B 1  214  ? -6.112  23.411  128.442 1.00 51.33  ? 214  ALA B O     1 
ATOM   3477  C  CB    . ALA B 1  214  ? -8.596  24.256  126.444 1.00 57.87  ? 214  ALA B CB    1 
ATOM   3478  N  N     . VAL B 1  215  ? -5.898  25.457  127.525 1.00 47.25  ? 215  VAL B N     1 
ATOM   3479  C  CA    . VAL B 1  215  ? -4.438  25.423  127.548 1.00 47.58  ? 215  VAL B CA    1 
ATOM   3480  C  C     . VAL B 1  215  ? -3.908  25.572  128.969 1.00 52.27  ? 215  VAL B C     1 
ATOM   3481  O  O     . VAL B 1  215  ? -2.786  25.162  129.271 1.00 48.68  ? 215  VAL B O     1 
ATOM   3482  C  CB    . VAL B 1  215  ? -3.815  26.504  126.634 1.00 54.93  ? 215  VAL B CB    1 
ATOM   3483  C  CG1   . VAL B 1  215  ? -4.346  26.365  125.216 1.00 58.18  ? 215  VAL B CG1   1 
ATOM   3484  C  CG2   . VAL B 1  215  ? -4.089  27.900  127.173 1.00 60.05  ? 215  VAL B CG2   1 
ATOM   3485  N  N     . GLU B 1  216  ? -4.729  26.150  129.840 1.00 55.03  ? 216  GLU B N     1 
ATOM   3486  C  CA    . GLU B 1  216  ? -4.358  26.325  131.238 1.00 52.92  ? 216  GLU B CA    1 
ATOM   3487  C  C     . GLU B 1  216  ? -4.424  24.996  131.980 1.00 47.96  ? 216  GLU B C     1 
ATOM   3488  O  O     . GLU B 1  216  ? -3.519  24.654  132.742 1.00 47.84  ? 216  GLU B O     1 
ATOM   3489  C  CB    . GLU B 1  216  ? -5.267  27.357  131.908 1.00 52.35  ? 216  GLU B CB    1 
ATOM   3490  C  CG    . GLU B 1  216  ? -4.971  27.583  133.383 1.00 58.63  ? 216  GLU B CG    1 
ATOM   3491  C  CD    . GLU B 1  216  ? -3.565  28.105  133.633 1.00 62.88  ? 216  GLU B CD    1 
ATOM   3492  O  OE1   . GLU B 1  216  ? -3.057  27.918  134.759 1.00 65.18  ? 216  GLU B OE1   1 
ATOM   3493  O  OE2   . GLU B 1  216  ? -2.968  28.707  132.715 1.00 60.19  ? 216  GLU B OE2   1 
ATOM   3494  N  N     . ILE B 1  217  ? -5.504  24.256  131.749 1.00 43.69  ? 217  ILE B N     1 
ATOM   3495  C  CA    . ILE B 1  217  ? -5.684  22.933  132.333 1.00 43.20  ? 217  ILE B CA    1 
ATOM   3496  C  C     . ILE B 1  217  ? -4.523  22.024  131.953 1.00 51.54  ? 217  ILE B C     1 
ATOM   3497  O  O     . ILE B 1  217  ? -3.971  21.315  132.796 1.00 53.52  ? 217  ILE B O     1 
ATOM   3498  C  CB    . ILE B 1  217  ? -6.996  22.290  131.849 1.00 39.20  ? 217  ILE B CB    1 
ATOM   3499  C  CG1   . ILE B 1  217  ? -8.192  23.145  132.265 1.00 41.54  ? 217  ILE B CG1   1 
ATOM   3500  C  CG2   . ILE B 1  217  ? -7.136  20.875  132.389 1.00 34.23  ? 217  ILE B CG2   1 
ATOM   3501  C  CD1   . ILE B 1  217  ? -9.490  22.735  131.612 1.00 46.73  ? 217  ILE B CD1   1 
ATOM   3502  N  N     . LEU B 1  218  ? -4.155  22.062  130.676 1.00 50.83  ? 218  LEU B N     1 
ATOM   3503  C  CA    . LEU B 1  218  ? -3.074  21.233  130.157 1.00 47.03  ? 218  LEU B CA    1 
ATOM   3504  C  C     . LEU B 1  218  ? -1.739  21.613  130.784 1.00 51.38  ? 218  LEU B C     1 
ATOM   3505  O  O     . LEU B 1  218  ? -0.973  20.745  131.205 1.00 52.63  ? 218  LEU B O     1 
ATOM   3506  C  CB    . LEU B 1  218  ? -2.995  21.354  128.633 1.00 44.44  ? 218  LEU B CB    1 
ATOM   3507  C  CG    . LEU B 1  218  ? -1.929  20.532  127.902 1.00 43.73  ? 218  LEU B CG    1 
ATOM   3508  C  CD1   . LEU B 1  218  ? -2.016  19.062  128.277 1.00 47.74  ? 218  LEU B CD1   1 
ATOM   3509  C  CD2   . LEU B 1  218  ? -2.068  20.708  126.398 1.00 35.36  ? 218  LEU B CD2   1 
ATOM   3510  N  N     . ARG B 1  219  ? -1.472  22.913  130.851 1.00 48.33  ? 219  ARG B N     1 
ATOM   3511  C  CA    . ARG B 1  219  ? -0.205  23.405  131.375 1.00 49.42  ? 219  ARG B CA    1 
ATOM   3512  C  C     . ARG B 1  219  ? -0.027  23.052  132.849 1.00 53.34  ? 219  ARG B C     1 
ATOM   3513  O  O     . ARG B 1  219  ? 1.073   22.706  133.283 1.00 50.31  ? 219  ARG B O     1 
ATOM   3514  C  CB    . ARG B 1  219  ? -0.092  24.915  131.179 1.00 46.85  ? 219  ARG B CB    1 
ATOM   3515  C  CG    . ARG B 1  219  ? 1.250   25.485  131.595 1.00 52.40  ? 219  ARG B CG    1 
ATOM   3516  C  CD    . ARG B 1  219  ? 1.095   26.921  132.034 1.00 61.99  ? 219  ARG B CD    1 
ATOM   3517  N  NE    . ARG B 1  219  ? -0.022  27.063  132.963 1.00 64.43  ? 219  ARG B NE    1 
ATOM   3518  C  CZ    . ARG B 1  219  ? 0.055   26.820  134.267 1.00 61.98  ? 219  ARG B CZ    1 
ATOM   3519  N  NH1   . ARG B 1  219  ? 1.201   26.420  134.804 1.00 67.48  ? 219  ARG B NH1   1 
ATOM   3520  N  NH2   . ARG B 1  219  ? -1.013  26.975  135.037 1.00 56.57  ? 219  ARG B NH2   1 
ATOM   3521  N  N     . GLU B 1  220  ? -1.112  23.138  133.614 1.00 53.84  ? 220  GLU B N     1 
ATOM   3522  C  CA    . GLU B 1  220  ? -1.071  22.804  135.034 1.00 56.90  ? 220  GLU B CA    1 
ATOM   3523  C  C     . GLU B 1  220  ? -0.713  21.337  135.233 1.00 58.49  ? 220  GLU B C     1 
ATOM   3524  O  O     . GLU B 1  220  ? 0.016   20.984  136.160 1.00 60.81  ? 220  GLU B O     1 
ATOM   3525  C  CB    . GLU B 1  220  ? -2.409  23.111  135.713 1.00 59.96  ? 220  GLU B CB    1 
ATOM   3526  C  CG    . GLU B 1  220  ? -2.446  22.727  137.190 1.00 62.51  ? 220  GLU B CG    1 
ATOM   3527  C  CD    . GLU B 1  220  ? -3.787  23.003  137.845 1.00 77.18  ? 220  GLU B CD    1 
ATOM   3528  O  OE1   . GLU B 1  220  ? -4.669  23.596  137.186 1.00 72.39  ? 220  GLU B OE1   1 
ATOM   3529  O  OE2   . GLU B 1  220  ? -3.957  22.625  139.024 1.00 81.43  ? 220  GLU B OE2   1 
ATOM   3530  N  N     . HIS B 1  221  ? -1.229  20.486  134.352 1.00 57.44  ? 221  HIS B N     1 
ATOM   3531  C  CA    . HIS B 1  221  ? -0.947  19.059  134.417 1.00 55.46  ? 221  HIS B CA    1 
ATOM   3532  C  C     . HIS B 1  221  ? 0.526   18.765  134.153 1.00 60.77  ? 221  HIS B C     1 
ATOM   3533  O  O     . HIS B 1  221  ? 1.062   17.765  134.629 1.00 64.79  ? 221  HIS B O     1 
ATOM   3534  C  CB    . HIS B 1  221  ? -1.831  18.289  133.436 1.00 49.82  ? 221  HIS B CB    1 
ATOM   3535  C  CG    . HIS B 1  221  ? -3.225  18.066  133.930 1.00 55.37  ? 221  HIS B CG    1 
ATOM   3536  N  ND1   . HIS B 1  221  ? -4.169  19.070  133.975 1.00 52.06  ? 221  HIS B ND1   1 
ATOM   3537  C  CD2   . HIS B 1  221  ? -3.835  16.956  134.409 1.00 57.12  ? 221  HIS B CD2   1 
ATOM   3538  C  CE1   . HIS B 1  221  ? -5.300  18.587  134.456 1.00 54.55  ? 221  HIS B CE1   1 
ATOM   3539  N  NE2   . HIS B 1  221  ? -5.124  17.306  134.727 1.00 56.28  ? 221  HIS B NE2   1 
ATOM   3540  N  N     . LEU B 1  222  ? 1.179   19.645  133.400 1.00 56.26  ? 222  LEU B N     1 
ATOM   3541  C  CA    . LEU B 1  222  ? 2.597   19.485  133.098 1.00 55.96  ? 222  LEU B CA    1 
ATOM   3542  C  C     . LEU B 1  222  ? 3.459   19.777  134.322 1.00 57.77  ? 222  LEU B C     1 
ATOM   3543  O  O     . LEU B 1  222  ? 4.633   19.409  134.372 1.00 63.14  ? 222  LEU B O     1 
ATOM   3544  C  CB    . LEU B 1  222  ? 3.004   20.384  131.929 1.00 57.27  ? 222  LEU B CB    1 
ATOM   3545  C  CG    . LEU B 1  222  ? 2.378   20.041  130.576 1.00 53.94  ? 222  LEU B CG    1 
ATOM   3546  C  CD1   . LEU B 1  222  ? 2.861   21.001  129.501 1.00 45.88  ? 222  LEU B CD1   1 
ATOM   3547  C  CD2   . LEU B 1  222  ? 2.684   18.598  130.192 1.00 51.78  ? 222  LEU B CD2   1 
ATOM   3548  N  N     . THR B 1  223  ? 2.869   20.440  135.310 1.00 58.21  ? 223  THR B N     1 
ATOM   3549  C  CA    . THR B 1  223  ? 3.570   20.744  136.548 1.00 54.36  ? 223  THR B CA    1 
ATOM   3550  C  C     . THR B 1  223  ? 3.469   19.575  137.518 1.00 54.48  ? 223  THR B C     1 
ATOM   3551  O  O     . THR B 1  223  ? 4.155   19.544  138.536 1.00 61.81  ? 223  THR B O     1 
ATOM   3552  C  CB    . THR B 1  223  ? 2.996   21.998  137.223 1.00 50.99  ? 223  THR B CB    1 
ATOM   3553  O  OG1   . THR B 1  223  ? 1.632   21.760  137.589 1.00 55.12  ? 223  THR B OG1   1 
ATOM   3554  C  CG2   . THR B 1  223  ? 3.061   23.188  136.281 1.00 52.63  ? 223  THR B CG2   1 
ATOM   3555  N  N     . TYR B 1  224  ? 2.615   18.611  137.192 1.00 51.41  ? 224  TYR B N     1 
ATOM   3556  C  CA    . TYR B 1  224  ? 2.403   17.451  138.052 1.00 55.19  ? 224  TYR B CA    1 
ATOM   3557  C  C     . TYR B 1  224  ? 3.565   16.462  137.996 1.00 60.31  ? 224  TYR B C     1 
ATOM   3558  O  O     . TYR B 1  224  ? 3.596   15.486  138.745 1.00 62.08  ? 224  TYR B O     1 
ATOM   3559  C  CB    . TYR B 1  224  ? 1.089   16.751  137.701 1.00 53.72  ? 224  TYR B CB    1 
ATOM   3560  C  CG    . TYR B 1  224  ? -0.137  17.552  138.074 1.00 61.58  ? 224  TYR B CG    1 
ATOM   3561  C  CD1   . TYR B 1  224  ? -0.069  18.552  139.036 1.00 62.13  ? 224  TYR B CD1   1 
ATOM   3562  C  CD2   . TYR B 1  224  ? -1.362  17.309  137.467 1.00 62.84  ? 224  TYR B CD2   1 
ATOM   3563  C  CE1   . TYR B 1  224  ? -1.185  19.289  139.381 1.00 65.75  ? 224  TYR B CE1   1 
ATOM   3564  C  CE2   . TYR B 1  224  ? -2.487  18.040  137.808 1.00 63.79  ? 224  TYR B CE2   1 
ATOM   3565  C  CZ    . TYR B 1  224  ? -2.392  19.029  138.766 1.00 70.08  ? 224  TYR B CZ    1 
ATOM   3566  O  OH    . TYR B 1  224  ? -3.505  19.763  139.112 1.00 74.38  ? 224  TYR B OH    1 
ATOM   3567  N  N     . PHE B 1  225  ? 4.515   16.720  137.103 1.00 61.64  ? 225  PHE B N     1 
ATOM   3568  C  CA    . PHE B 1  225  ? 5.704   15.883  136.967 1.00 68.72  ? 225  PHE B CA    1 
ATOM   3569  C  C     . PHE B 1  225  ? 6.848   16.382  137.851 1.00 80.47  ? 225  PHE B C     1 
ATOM   3570  O  O     . PHE B 1  225  ? 7.972   15.885  137.765 1.00 78.59  ? 225  PHE B O     1 
ATOM   3571  C  CB    . PHE B 1  225  ? 6.153   15.808  135.505 1.00 60.37  ? 225  PHE B CB    1 
ATOM   3572  C  CG    . PHE B 1  225  ? 5.146   15.166  134.594 1.00 55.41  ? 225  PHE B CG    1 
ATOM   3573  C  CD1   . PHE B 1  225  ? 4.259   15.940  133.863 1.00 57.61  ? 225  PHE B CD1   1 
ATOM   3574  C  CD2   . PHE B 1  225  ? 5.083   13.789  134.471 1.00 50.23  ? 225  PHE B CD2   1 
ATOM   3575  C  CE1   . PHE B 1  225  ? 3.330   15.351  133.024 1.00 52.52  ? 225  PHE B CE1   1 
ATOM   3576  C  CE2   . PHE B 1  225  ? 4.157   13.195  133.633 1.00 48.00  ? 225  PHE B CE2   1 
ATOM   3577  C  CZ    . PHE B 1  225  ? 3.279   13.977  132.910 1.00 45.80  ? 225  PHE B CZ    1 
ATOM   3578  N  N     . SER B 1  226  ? 6.555   17.377  138.687 1.00 79.88  ? 226  SER B N     1 
ATOM   3579  C  CA    . SER B 1  226  ? 7.576   18.050  139.491 1.00 82.37  ? 226  SER B CA    1 
ATOM   3580  C  C     . SER B 1  226  ? 8.081   17.251  140.700 1.00 84.38  ? 226  SER B C     1 
ATOM   3581  O  O     . SER B 1  226  ? 9.231   16.813  140.723 1.00 92.49  ? 226  SER B O     1 
ATOM   3582  C  CB    . SER B 1  226  ? 7.065   19.419  139.951 1.00 79.44  ? 226  SER B CB    1 
ATOM   3583  O  OG    . SER B 1  226  ? 6.653   20.205  138.845 1.00 73.23  ? 226  SER B OG    1 
ATOM   3584  N  N     . ASN B 1  227  ? 7.229   17.068  141.703 1.00 72.85  ? 227  ASN B N     1 
ATOM   3585  C  CA    . ASN B 1  227  ? 7.669   16.452  142.952 1.00 71.09  ? 227  ASN B CA    1 
ATOM   3586  C  C     . ASN B 1  227  ? 7.254   14.989  143.111 1.00 76.76  ? 227  ASN B C     1 
ATOM   3587  O  O     . ASN B 1  227  ? 6.066   14.667  143.069 1.00 78.66  ? 227  ASN B O     1 
ATOM   3588  C  CB    . ASN B 1  227  ? 7.185   17.274  144.149 1.00 76.14  ? 227  ASN B CB    1 
ATOM   3589  C  CG    . ASN B 1  227  ? 7.728   16.759  145.468 1.00 86.16  ? 227  ASN B CG    1 
ATOM   3590  O  OD1   . ASN B 1  227  ? 7.058   16.010  146.180 1.00 84.33  ? 227  ASN B OD1   1 
ATOM   3591  N  ND2   . ASN B 1  227  ? 8.950   17.159  145.799 1.00 92.58  ? 227  ASN B ND2   1 
ATOM   3592  N  N     . PRO B 1  228  ? 8.243   14.098  143.286 1.00 74.58  ? 228  PRO B N     1 
ATOM   3593  C  CA    . PRO B 1  228  ? 8.018   12.667  143.529 1.00 65.57  ? 228  PRO B CA    1 
ATOM   3594  C  C     . PRO B 1  228  ? 7.488   12.392  144.934 1.00 59.06  ? 228  PRO B C     1 
ATOM   3595  O  O     . PRO B 1  228  ? 7.743   11.311  145.468 1.00 50.01  ? 228  PRO B O     1 
ATOM   3596  C  CB    . PRO B 1  228  ? 9.418   12.060  143.376 1.00 62.75  ? 228  PRO B CB    1 
ATOM   3597  C  CG    . PRO B 1  228  ? 10.212  13.086  142.625 1.00 65.10  ? 228  PRO B CG    1 
ATOM   3598  C  CD    . PRO B 1  228  ? 9.668   14.399  143.077 1.00 70.43  ? 228  PRO B CD    1 
ATOM   3599  N  N     . MET C 2  1    ? 19.108  -17.568 114.536 1.00 76.06  ? 1    MET C N     1 
ATOM   3600  C  CA    . MET C 2  1    ? 17.795  -18.005 114.996 1.00 72.37  ? 1    MET C CA    1 
ATOM   3601  C  C     . MET C 2  1    ? 17.450  -19.401 114.476 1.00 82.48  ? 1    MET C C     1 
ATOM   3602  O  O     . MET C 2  1    ? 17.970  -19.839 113.448 1.00 83.68  ? 1    MET C O     1 
ATOM   3603  C  CB    . MET C 2  1    ? 16.715  -17.009 114.569 1.00 63.35  ? 1    MET C CB    1 
ATOM   3604  C  CG    . MET C 2  1    ? 16.231  -17.164 113.128 1.00 62.87  ? 1    MET C CG    1 
ATOM   3605  S  SD    . MET C 2  1    ? 17.150  -16.189 111.918 1.00 96.11  ? 1    MET C SD    1 
ATOM   3606  C  CE    . MET C 2  1    ? 18.401  -17.352 111.377 1.00 76.54  ? 1    MET C CE    1 
ATOM   3607  N  N     . GLU C 2  2    ? 16.570  -20.095 115.194 1.00 75.95  ? 2    GLU C N     1 
ATOM   3608  C  CA    . GLU C 2  2    ? 16.139  -21.428 114.791 1.00 70.76  ? 2    GLU C CA    1 
ATOM   3609  C  C     . GLU C 2  2    ? 15.243  -21.362 113.560 1.00 57.42  ? 2    GLU C C     1 
ATOM   3610  O  O     . GLU C 2  2    ? 14.295  -20.584 113.514 1.00 53.95  ? 2    GLU C O     1 
ATOM   3611  C  CB    . GLU C 2  2    ? 15.398  -22.132 115.933 1.00 67.68  ? 2    GLU C CB    1 
ATOM   3612  C  CG    . GLU C 2  2    ? 14.723  -23.437 115.516 1.00 72.93  ? 2    GLU C CG    1 
ATOM   3613  C  CD    . GLU C 2  2    ? 13.912  -24.070 116.633 1.00 79.38  ? 2    GLU C CD    1 
ATOM   3614  O  OE1   . GLU C 2  2    ? 14.292  -23.911 117.812 1.00 85.92  ? 2    GLU C OE1   1 
ATOM   3615  O  OE2   . GLU C 2  2    ? 12.892  -24.727 116.329 1.00 68.05  ? 2    GLU C OE2   1 
ATOM   3616  N  N     . ILE C 2  3    ? 15.547  -22.184 112.564 1.00 50.71  ? 3    ILE C N     1 
ATOM   3617  C  CA    . ILE C 2  3    ? 14.696  -22.282 111.391 1.00 49.04  ? 3    ILE C CA    1 
ATOM   3618  C  C     . ILE C 2  3    ? 13.847  -23.538 111.518 1.00 53.55  ? 3    ILE C C     1 
ATOM   3619  O  O     . ILE C 2  3    ? 14.363  -24.650 111.407 1.00 61.59  ? 3    ILE C O     1 
ATOM   3620  C  CB    . ILE C 2  3    ? 15.528  -22.386 110.099 1.00 48.76  ? 3    ILE C CB    1 
ATOM   3621  C  CG1   . ILE C 2  3    ? 16.667  -21.363 110.105 1.00 57.65  ? 3    ILE C CG1   1 
ATOM   3622  C  CG2   . ILE C 2  3    ? 14.641  -22.217 108.875 1.00 36.60  ? 3    ILE C CG2   1 
ATOM   3623  C  CD1   . ILE C 2  3    ? 16.201  -19.931 110.196 1.00 58.80  ? 3    ILE C CD1   1 
ATOM   3624  N  N     . LYS C 2  4    ? 12.549  -23.368 111.748 1.00 42.87  ? 4    LYS C N     1 
ATOM   3625  C  CA    . LYS C 2  4    ? 11.669  -24.527 111.887 1.00 41.75  ? 4    LYS C CA    1 
ATOM   3626  C  C     . LYS C 2  4    ? 11.039  -24.901 110.549 1.00 44.08  ? 4    LYS C C     1 
ATOM   3627  O  O     . LYS C 2  4    ? 10.468  -24.055 109.864 1.00 46.36  ? 4    LYS C O     1 
ATOM   3628  C  CB    . LYS C 2  4    ? 10.578  -24.271 112.927 1.00 51.28  ? 4    LYS C CB    1 
ATOM   3629  C  CG    . LYS C 2  4    ? 9.708   -25.490 113.198 1.00 59.47  ? 4    LYS C CG    1 
ATOM   3630  C  CD    . LYS C 2  4    ? 8.596   -25.191 114.190 1.00 66.04  ? 4    LYS C CD    1 
ATOM   3631  C  CE    . LYS C 2  4    ? 7.810   -26.453 114.538 1.00 72.25  ? 4    LYS C CE    1 
ATOM   3632  N  NZ    . LYS C 2  4    ? 7.270   -27.141 113.327 1.00 54.93  ? 4    LYS C NZ    1 
ATOM   3633  N  N     . ARG C 2  5    ? 11.136  -26.173 110.177 1.00 43.66  ? 5    ARG C N     1 
ATOM   3634  C  CA    . ARG C 2  5    ? 10.615  -26.617 108.889 1.00 42.70  ? 5    ARG C CA    1 
ATOM   3635  C  C     . ARG C 2  5    ? 9.316   -27.387 109.058 1.00 41.05  ? 5    ARG C C     1 
ATOM   3636  O  O     . ARG C 2  5    ? 9.105   -28.048 110.074 1.00 49.53  ? 5    ARG C O     1 
ATOM   3637  C  CB    . ARG C 2  5    ? 11.647  -27.468 108.140 1.00 46.39  ? 5    ARG C CB    1 
ATOM   3638  C  CG    . ARG C 2  5    ? 11.219  -28.913 107.905 1.00 51.09  ? 5    ARG C CG    1 
ATOM   3639  C  CD    . ARG C 2  5    ? 12.161  -29.634 106.957 1.00 57.86  ? 5    ARG C CD    1 
ATOM   3640  N  NE    . ARG C 2  5    ? 12.121  -29.068 105.611 1.00 58.64  ? 5    ARG C NE    1 
ATOM   3641  C  CZ    . ARG C 2  5    ? 13.047  -28.255 105.110 1.00 60.01  ? 5    ARG C CZ    1 
ATOM   3642  N  NH1   . ARG C 2  5    ? 14.100  -27.907 105.841 1.00 54.41  ? 5    ARG C NH1   1 
ATOM   3643  N  NH2   . ARG C 2  5    ? 12.922  -27.793 103.873 1.00 50.03  ? 5    ARG C NH2   1 
ATOM   3644  N  N     . PHE C 2  6    ? 8.441   -27.276 108.065 1.00 38.51  ? 6    PHE C N     1 
ATOM   3645  C  CA    . PHE C 2  6    ? 7.186   -28.008 108.069 1.00 40.50  ? 6    PHE C CA    1 
ATOM   3646  C  C     . PHE C 2  6    ? 7.164   -29.013 106.928 1.00 53.37  ? 6    PHE C C     1 
ATOM   3647  O  O     . PHE C 2  6    ? 8.101   -29.093 106.131 1.00 54.92  ? 6    PHE C O     1 
ATOM   3648  C  CB    . PHE C 2  6    ? 5.998   -27.051 107.917 1.00 38.43  ? 6    PHE C CB    1 
ATOM   3649  C  CG    . PHE C 2  6    ? 5.926   -25.991 108.977 1.00 36.06  ? 6    PHE C CG    1 
ATOM   3650  C  CD1   . PHE C 2  6    ? 5.151   -26.173 110.107 1.00 41.15  ? 6    PHE C CD1   1 
ATOM   3651  C  CD2   . PHE C 2  6    ? 6.629   -24.807 108.840 1.00 39.94  ? 6    PHE C CD2   1 
ATOM   3652  C  CE1   . PHE C 2  6    ? 5.086   -25.198 111.084 1.00 43.95  ? 6    PHE C CE1   1 
ATOM   3653  C  CE2   . PHE C 2  6    ? 6.566   -23.827 109.813 1.00 42.60  ? 6    PHE C CE2   1 
ATOM   3654  C  CZ    . PHE C 2  6    ? 5.794   -24.022 110.936 1.00 41.40  ? 6    PHE C CZ    1 
ATOM   3655  N  N     . GLY C 2  7    ? 6.079   -29.776 106.864 1.00 63.72  ? 7    GLY C N     1 
ATOM   3656  C  CA    . GLY C 2  7    ? 5.787   -30.657 105.748 1.00 69.54  ? 7    GLY C CA    1 
ATOM   3657  C  C     . GLY C 2  7    ? 6.240   -32.099 105.894 1.00 72.24  ? 7    GLY C C     1 
ATOM   3658  O  O     . GLY C 2  7    ? 7.316   -32.391 106.420 1.00 70.06  ? 7    GLY C O     1 
ATOM   3659  N  N     . ARG C 2  8    ? 5.404   -33.002 105.392 1.00 69.91  ? 8    ARG C N     1 
ATOM   3660  C  CA    . ARG C 2  8    ? 5.649   -34.435 105.483 1.00 69.32  ? 8    ARG C CA    1 
ATOM   3661  C  C     . ARG C 2  8    ? 6.187   -35.065 104.199 1.00 68.43  ? 8    ARG C C     1 
ATOM   3662  O  O     . ARG C 2  8    ? 6.469   -36.263 104.164 1.00 78.47  ? 8    ARG C O     1 
ATOM   3663  C  CB    . ARG C 2  8    ? 4.382   -35.148 105.967 1.00 81.61  ? 8    ARG C CB    1 
ATOM   3664  C  CG    . ARG C 2  8    ? 3.941   -34.669 107.344 1.00 89.22  ? 8    ARG C CG    1 
ATOM   3665  C  CD    . ARG C 2  8    ? 2.529   -35.096 107.702 1.00 93.73  ? 8    ARG C CD    1 
ATOM   3666  N  NE    . ARG C 2  8    ? 2.088   -34.445 108.934 1.00 100.84 ? 8    ARG C NE    1 
ATOM   3667  C  CZ    . ARG C 2  8    ? 0.892   -34.615 109.490 1.00 107.68 ? 8    ARG C CZ    1 
ATOM   3668  N  NH1   . ARG C 2  8    ? 0.003   -35.423 108.927 1.00 113.86 ? 8    ARG C NH1   1 
ATOM   3669  N  NH2   . ARG C 2  8    ? 0.586   -33.976 110.612 1.00 98.15  ? 8    ARG C NH2   1 
ATOM   3670  N  N     . ILE C 2  9    ? 6.328   -34.263 103.148 1.00 67.36  ? 9    ILE C N     1 
ATOM   3671  C  CA    . ILE C 2  9    ? 6.763   -34.787 101.854 1.00 71.15  ? 9    ILE C CA    1 
ATOM   3672  C  C     . ILE C 2  9    ? 8.280   -34.935 101.774 1.00 74.05  ? 9    ILE C C     1 
ATOM   3673  O  O     . ILE C 2  9    ? 9.022   -33.969 101.949 1.00 71.20  ? 9    ILE C O     1 
ATOM   3674  C  CB    . ILE C 2  9    ? 6.257   -33.926 100.677 1.00 62.10  ? 9    ILE C CB    1 
ATOM   3675  C  CG1   . ILE C 2  9    ? 4.728   -33.943 100.625 1.00 64.15  ? 9    ILE C CG1   1 
ATOM   3676  C  CG2   . ILE C 2  9    ? 6.825   -34.435 99.364  1.00 57.90  ? 9    ILE C CG2   1 
ATOM   3677  C  CD1   . ILE C 2  9    ? 4.146   -33.211 99.437  1.00 59.58  ? 9    ILE C CD1   1 
ATOM   3678  N  N     . ARG C 2  10   ? 8.729   -36.157 101.506 1.00 74.56  ? 10   ARG C N     1 
ATOM   3679  C  CA    . ARG C 2  10   ? 10.152  -36.459 101.434 1.00 71.70  ? 10   ARG C CA    1 
ATOM   3680  C  C     . ARG C 2  10   ? 10.610  -36.486 99.978  1.00 70.18  ? 10   ARG C C     1 
ATOM   3681  O  O     . ARG C 2  10   ? 10.188  -37.345 99.202  1.00 68.19  ? 10   ARG C O     1 
ATOM   3682  C  CB    . ARG C 2  10   ? 10.432  -37.807 102.106 1.00 76.51  ? 10   ARG C CB    1 
ATOM   3683  C  CG    . ARG C 2  10   ? 11.881  -38.032 102.524 1.00 84.94  ? 10   ARG C CG    1 
ATOM   3684  C  CD    . ARG C 2  10   ? 12.455  -39.284 101.873 1.00 88.74  ? 10   ARG C CD    1 
ATOM   3685  N  NE    . ARG C 2  10   ? 11.507  -40.396 101.886 1.00 81.95  ? 10   ARG C NE    1 
ATOM   3686  C  CZ    . ARG C 2  10   ? 11.677  -41.532 101.216 1.00 90.35  ? 10   ARG C CZ    1 
ATOM   3687  N  NH1   . ARG C 2  10   ? 10.759  -42.488 101.283 1.00 91.59  ? 10   ARG C NH1   1 
ATOM   3688  N  NH2   . ARG C 2  10   ? 12.764  -41.713 100.476 1.00 83.84  ? 10   ARG C NH2   1 
ATOM   3689  N  N     . GLU C 2  11   ? 11.465  -35.539 99.607  1.00 67.45  ? 11   GLU C N     1 
ATOM   3690  C  CA    . GLU C 2  11   ? 11.984  -35.483 98.246  1.00 60.61  ? 11   GLU C CA    1 
ATOM   3691  C  C     . GLU C 2  11   ? 13.052  -36.543 98.037  1.00 56.64  ? 11   GLU C C     1 
ATOM   3692  O  O     . GLU C 2  11   ? 14.061  -36.570 98.742  1.00 58.53  ? 11   GLU C O     1 
ATOM   3693  C  CB    . GLU C 2  11   ? 12.559  -34.099 97.933  1.00 64.28  ? 11   GLU C CB    1 
ATOM   3694  C  CG    . GLU C 2  11   ? 11.597  -33.164 97.216  1.00 60.87  ? 11   GLU C CG    1 
ATOM   3695  C  CD    . GLU C 2  11   ? 10.700  -32.398 98.167  1.00 66.88  ? 11   GLU C CD    1 
ATOM   3696  O  OE1   . GLU C 2  11   ? 11.213  -31.895 99.189  1.00 75.78  ? 11   GLU C OE1   1 
ATOM   3697  O  OE2   . GLU C 2  11   ? 9.485   -32.296 97.890  1.00 60.02  ? 11   GLU C OE2   1 
ATOM   3698  N  N     . VAL C 2  12   ? 12.830  -37.411 97.059  1.00 53.96  ? 12   VAL C N     1 
ATOM   3699  C  CA    . VAL C 2  12   ? 13.770  -38.485 96.770  1.00 57.72  ? 12   VAL C CA    1 
ATOM   3700  C  C     . VAL C 2  12   ? 15.048  -37.952 96.130  1.00 59.21  ? 12   VAL C C     1 
ATOM   3701  O  O     . VAL C 2  12   ? 16.152  -38.264 96.574  1.00 65.59  ? 12   VAL C O     1 
ATOM   3702  C  CB    . VAL C 2  12   ? 13.132  -39.563 95.875  1.00 54.65  ? 12   VAL C CB    1 
ATOM   3703  C  CG1   . VAL C 2  12   ? 14.199  -40.457 95.265  1.00 58.15  ? 12   VAL C CG1   1 
ATOM   3704  C  CG2   . VAL C 2  12   ? 12.145  -40.380 96.683  1.00 63.61  ? 12   VAL C CG2   1 
ATOM   3705  N  N     . ILE C 2  13   ? 14.892  -37.138 95.092  1.00 58.40  ? 13   ILE C N     1 
ATOM   3706  C  CA    . ILE C 2  13   ? 16.036  -36.541 94.416  1.00 52.63  ? 13   ILE C CA    1 
ATOM   3707  C  C     . ILE C 2  13   ? 15.994  -35.026 94.549  1.00 51.43  ? 13   ILE C C     1 
ATOM   3708  O  O     . ILE C 2  13   ? 14.916  -34.433 94.582  1.00 53.97  ? 13   ILE C O     1 
ATOM   3709  C  CB    . ILE C 2  13   ? 16.064  -36.916 92.925  1.00 40.86  ? 13   ILE C CB    1 
ATOM   3710  C  CG1   . ILE C 2  13   ? 14.719  -36.598 92.271  1.00 37.89  ? 13   ILE C CG1   1 
ATOM   3711  C  CG2   . ILE C 2  13   ? 16.388  -38.388 92.757  1.00 51.20  ? 13   ILE C CG2   1 
ATOM   3712  C  CD1   . ILE C 2  13   ? 14.704  -36.827 90.782  1.00 38.97  ? 13   ILE C CD1   1 
ATOM   3713  N  N     . PRO C 2  14   ? 17.171  -34.389 94.635  1.00 44.40  ? 14   PRO C N     1 
ATOM   3714  C  CA    . PRO C 2  14   ? 17.211  -32.930 94.724  1.00 42.18  ? 14   PRO C CA    1 
ATOM   3715  C  C     . PRO C 2  14   ? 17.078  -32.310 93.341  1.00 42.47  ? 14   PRO C C     1 
ATOM   3716  O  O     . PRO C 2  14   ? 17.000  -33.030 92.347  1.00 41.53  ? 14   PRO C O     1 
ATOM   3717  C  CB    . PRO C 2  14   ? 18.608  -32.664 95.281  1.00 40.24  ? 14   PRO C CB    1 
ATOM   3718  C  CG    . PRO C 2  14   ? 19.426  -33.772 94.724  1.00 38.61  ? 14   PRO C CG    1 
ATOM   3719  C  CD    . PRO C 2  14   ? 18.520  -34.980 94.687  1.00 40.97  ? 14   PRO C CD    1 
ATOM   3720  N  N     . LEU C 2  15   ? 17.061  -30.986 93.279  1.00 42.10  ? 15   LEU C N     1 
ATOM   3721  C  CA    . LEU C 2  15   ? 16.985  -30.296 92.002  1.00 38.28  ? 15   LEU C CA    1 
ATOM   3722  C  C     . LEU C 2  15   ? 18.295  -30.413 91.238  1.00 34.44  ? 15   LEU C C     1 
ATOM   3723  O  O     . LEU C 2  15   ? 19.364  -30.158 91.791  1.00 35.75  ? 15   LEU C O     1 
ATOM   3724  C  CB    . LEU C 2  15   ? 16.634  -28.826 92.214  1.00 41.24  ? 15   LEU C CB    1 
ATOM   3725  C  CG    . LEU C 2  15   ? 15.193  -28.573 92.642  1.00 32.10  ? 15   LEU C CG    1 
ATOM   3726  C  CD1   . LEU C 2  15   ? 14.992  -27.108 92.898  1.00 23.80  ? 15   LEU C CD1   1 
ATOM   3727  C  CD2   . LEU C 2  15   ? 14.260  -29.046 91.556  1.00 35.22  ? 15   LEU C CD2   1 
ATOM   3728  N  N     . PRO C 2  16   ? 18.212  -30.783 89.952  1.00 34.18  ? 16   PRO C N     1 
ATOM   3729  C  CA    . PRO C 2  16   ? 19.373  -30.905 89.065  1.00 38.93  ? 16   PRO C CA    1 
ATOM   3730  C  C     . PRO C 2  16   ? 20.092  -29.567 88.942  1.00 36.90  ? 16   PRO C C     1 
ATOM   3731  O  O     . PRO C 2  16   ? 19.516  -28.550 89.327  1.00 33.12  ? 16   PRO C O     1 
ATOM   3732  C  CB    . PRO C 2  16   ? 18.745  -31.298 87.722  1.00 36.04  ? 16   PRO C CB    1 
ATOM   3733  C  CG    . PRO C 2  16   ? 17.329  -30.858 87.814  1.00 35.62  ? 16   PRO C CG    1 
ATOM   3734  C  CD    . PRO C 2  16   ? 16.952  -31.058 89.245  1.00 35.03  ? 16   PRO C CD    1 
ATOM   3735  N  N     . PRO C 2  17   ? 21.346  -29.568 88.458  1.00 40.68  ? 17   PRO C N     1 
ATOM   3736  C  CA    . PRO C 2  17   ? 22.011  -28.276 88.278  1.00 40.59  ? 17   PRO C CA    1 
ATOM   3737  C  C     . PRO C 2  17   ? 21.138  -27.424 87.375  1.00 37.69  ? 17   PRO C C     1 
ATOM   3738  O  O     . PRO C 2  17   ? 20.733  -27.882 86.311  1.00 40.48  ? 17   PRO C O     1 
ATOM   3739  C  CB    . PRO C 2  17   ? 23.313  -28.648 87.566  1.00 43.38  ? 17   PRO C CB    1 
ATOM   3740  C  CG    . PRO C 2  17   ? 23.543  -30.080 87.914  1.00 42.12  ? 17   PRO C CG    1 
ATOM   3741  C  CD    . PRO C 2  17   ? 22.179  -30.690 87.994  1.00 39.24  ? 17   PRO C CD    1 
ATOM   3742  N  N     . LEU C 2  18   ? 20.836  -26.208 87.806  1.00 35.08  ? 18   LEU C N     1 
ATOM   3743  C  CA    . LEU C 2  18   ? 19.812  -25.410 87.148  1.00 34.64  ? 18   LEU C CA    1 
ATOM   3744  C  C     . LEU C 2  18   ? 20.280  -24.835 85.812  1.00 38.80  ? 18   LEU C C     1 
ATOM   3745  O  O     . LEU C 2  18   ? 19.477  -24.625 84.902  1.00 39.55  ? 18   LEU C O     1 
ATOM   3746  C  CB    . LEU C 2  18   ? 19.326  -24.306 88.088  1.00 37.03  ? 18   LEU C CB    1 
ATOM   3747  C  CG    . LEU C 2  18   ? 18.741  -24.822 89.408  1.00 36.80  ? 18   LEU C CG    1 
ATOM   3748  C  CD1   . LEU C 2  18   ? 18.567  -23.700 90.425  1.00 25.21  ? 18   LEU C CD1   1 
ATOM   3749  C  CD2   . LEU C 2  18   ? 17.419  -25.542 89.170  1.00 34.25  ? 18   LEU C CD2   1 
ATOM   3750  N  N     . THR C 2  19   ? 21.581  -24.603 85.687  1.00 32.48  ? 19   THR C N     1 
ATOM   3751  C  CA    . THR C 2  19   ? 22.126  -24.054 84.454  1.00 28.57  ? 19   THR C CA    1 
ATOM   3752  C  C     . THR C 2  19   ? 22.500  -25.160 83.472  1.00 31.05  ? 19   THR C C     1 
ATOM   3753  O  O     . THR C 2  19   ? 23.009  -24.882 82.385  1.00 27.12  ? 19   THR C O     1 
ATOM   3754  C  CB    . THR C 2  19   ? 23.360  -23.168 84.723  1.00 33.13  ? 19   THR C CB    1 
ATOM   3755  O  OG1   . THR C 2  19   ? 24.376  -23.940 85.374  1.00 40.37  ? 19   THR C OG1   1 
ATOM   3756  C  CG2   . THR C 2  19   ? 22.987  -21.992 85.609  1.00 33.11  ? 19   THR C CG2   1 
ATOM   3757  N  N     . GLU C 2  20   ? 22.232  -26.409 83.854  1.00 35.40  ? 20   GLU C N     1 
ATOM   3758  C  CA    . GLU C 2  20   ? 22.660  -27.570 83.069  1.00 36.14  ? 20   GLU C CA    1 
ATOM   3759  C  C     . GLU C 2  20   ? 22.198  -27.521 81.619  1.00 30.36  ? 20   GLU C C     1 
ATOM   3760  O  O     . GLU C 2  20   ? 22.884  -28.019 80.733  1.00 35.33  ? 20   GLU C O     1 
ATOM   3761  C  CB    . GLU C 2  20   ? 22.214  -28.891 83.713  1.00 37.33  ? 20   GLU C CB    1 
ATOM   3762  C  CG    . GLU C 2  20   ? 20.773  -29.288 83.422  1.00 40.41  ? 20   GLU C CG    1 
ATOM   3763  C  CD    . GLU C 2  20   ? 20.491  -30.750 83.723  1.00 52.08  ? 20   GLU C CD    1 
ATOM   3764  O  OE1   . GLU C 2  20   ? 21.359  -31.598 83.428  1.00 51.70  ? 20   GLU C OE1   1 
ATOM   3765  O  OE2   . GLU C 2  20   ? 19.398  -31.051 84.253  1.00 48.28  ? 20   GLU C OE2   1 
ATOM   3766  N  N     . ILE C 2  21   ? 21.040  -26.917 81.383  1.00 30.12  ? 21   ILE C N     1 
ATOM   3767  C  CA    . ILE C 2  21   ? 20.530  -26.767 80.031  1.00 27.03  ? 21   ILE C CA    1 
ATOM   3768  C  C     . ILE C 2  21   ? 21.569  -26.032 79.179  1.00 26.51  ? 21   ILE C C     1 
ATOM   3769  O  O     . ILE C 2  21   ? 22.055  -26.569 78.176  1.00 34.22  ? 21   ILE C O     1 
ATOM   3770  C  CB    . ILE C 2  21   ? 19.142  -26.072 80.039  1.00 18.12  ? 21   ILE C CB    1 
ATOM   3771  C  CG1   . ILE C 2  21   ? 18.781  -25.518 78.666  1.00 18.81  ? 21   ILE C CG1   1 
ATOM   3772  C  CG2   . ILE C 2  21   ? 19.090  -24.977 81.087  1.00 18.49  ? 21   ILE C CG2   1 
ATOM   3773  C  CD1   . ILE C 2  21   ? 17.406  -24.899 78.637  1.00 20.85  ? 21   ILE C CD1   1 
ATOM   3774  N  N     . GLN C 2  22   ? 21.961  -24.844 79.625  1.00 22.38  ? 22   GLN C N     1 
ATOM   3775  C  CA    . GLN C 2  22   ? 22.955  -24.050 78.918  1.00 25.05  ? 22   GLN C CA    1 
ATOM   3776  C  C     . GLN C 2  22   ? 24.313  -24.753 78.815  1.00 29.86  ? 22   GLN C C     1 
ATOM   3777  O  O     . GLN C 2  22   ? 24.804  -25.030 77.702  1.00 31.60  ? 22   GLN C O     1 
ATOM   3778  C  CB    . GLN C 2  22   ? 23.142  -22.700 79.625  1.00 28.13  ? 22   GLN C CB    1 
ATOM   3779  C  CG    . GLN C 2  22   ? 21.904  -21.819 79.676  1.00 18.93  ? 22   GLN C CG    1 
ATOM   3780  C  CD    . GLN C 2  22   ? 21.744  -20.960 78.436  1.00 22.43  ? 22   GLN C CD    1 
ATOM   3781  O  OE1   . GLN C 2  22   ? 22.724  -20.466 77.872  1.00 20.03  ? 22   GLN C OE1   1 
ATOM   3782  N  NE2   . GLN C 2  22   ? 20.501  -20.777 78.004  1.00 21.68  ? 22   GLN C NE2   1 
ATOM   3783  N  N     . VAL C 2  23   ? 24.903  -25.061 79.971  1.00 26.98  ? 23   VAL C N     1 
ATOM   3784  C  CA    . VAL C 2  23   ? 26.272  -25.571 80.019  1.00 24.71  ? 23   VAL C CA    1 
ATOM   3785  C  C     . VAL C 2  23   ? 26.424  -26.899 79.293  1.00 24.34  ? 23   VAL C C     1 
ATOM   3786  O  O     . VAL C 2  23   ? 27.327  -27.052 78.477  1.00 23.01  ? 23   VAL C O     1 
ATOM   3787  C  CB    . VAL C 2  23   ? 26.783  -25.729 81.458  1.00 24.09  ? 23   VAL C CB    1 
ATOM   3788  C  CG1   . VAL C 2  23   ? 28.300  -25.637 81.491  1.00 21.48  ? 23   VAL C CG1   1 
ATOM   3789  C  CG2   . VAL C 2  23   ? 26.180  -24.665 82.354  1.00 34.61  ? 23   VAL C CG2   1 
ATOM   3790  N  N     . GLU C 2  24   ? 25.540  -27.849 79.581  1.00 27.02  ? 24   GLU C N     1 
ATOM   3791  C  CA    . GLU C 2  24   ? 25.587  -29.145 78.907  1.00 29.36  ? 24   GLU C CA    1 
ATOM   3792  C  C     . GLU C 2  24   ? 25.275  -29.065 77.421  1.00 29.30  ? 24   GLU C C     1 
ATOM   3793  O  O     . GLU C 2  24   ? 25.883  -29.793 76.636  1.00 34.48  ? 24   GLU C O     1 
ATOM   3794  C  CB    . GLU C 2  24   ? 24.688  -30.184 79.584  1.00 28.89  ? 24   GLU C CB    1 
ATOM   3795  C  CG    . GLU C 2  24   ? 25.250  -30.722 80.887  1.00 40.32  ? 24   GLU C CG    1 
ATOM   3796  C  CD    . GLU C 2  24   ? 26.626  -31.343 80.716  1.00 55.27  ? 24   GLU C CD    1 
ATOM   3797  O  OE1   . GLU C 2  24   ? 27.493  -31.125 81.593  1.00 53.47  ? 24   GLU C OE1   1 
ATOM   3798  O  OE2   . GLU C 2  24   ? 26.839  -32.057 79.710  1.00 58.60  ? 24   GLU C OE2   1 
ATOM   3799  N  N     . SER C 2  25   ? 24.336  -28.202 77.028  1.00 34.17  ? 25   SER C N     1 
ATOM   3800  C  CA    . SER C 2  25   ? 24.097  -27.996 75.596  1.00 31.24  ? 25   SER C CA    1 
ATOM   3801  C  C     . SER C 2  25   ? 25.369  -27.544 74.878  1.00 26.83  ? 25   SER C C     1 
ATOM   3802  O  O     . SER C 2  25   ? 25.818  -28.185 73.918  1.00 25.33  ? 25   SER C O     1 
ATOM   3803  C  CB    . SER C 2  25   ? 22.980  -26.980 75.355  1.00 25.51  ? 25   SER C CB    1 
ATOM   3804  O  OG    . SER C 2  25   ? 22.918  -26.593 73.996  1.00 22.64  ? 25   SER C OG    1 
ATOM   3805  N  N     . TYR C 2  26   ? 25.962  -26.455 75.362  1.00 26.75  ? 26   TYR C N     1 
ATOM   3806  C  CA    . TYR C 2  26   ? 27.144  -25.902 74.706  1.00 25.99  ? 26   TYR C CA    1 
ATOM   3807  C  C     . TYR C 2  26   ? 28.347  -26.851 74.748  1.00 32.19  ? 26   TYR C C     1 
ATOM   3808  O  O     . TYR C 2  26   ? 29.071  -26.987 73.759  1.00 36.23  ? 26   TYR C O     1 
ATOM   3809  C  CB    . TYR C 2  26   ? 27.508  -24.539 75.297  1.00 23.64  ? 26   TYR C CB    1 
ATOM   3810  C  CG    . TYR C 2  26   ? 28.186  -23.624 74.305  1.00 21.45  ? 26   TYR C CG    1 
ATOM   3811  C  CD1   . TYR C 2  26   ? 27.595  -23.345 73.082  1.00 21.14  ? 26   TYR C CD1   1 
ATOM   3812  C  CD2   . TYR C 2  26   ? 29.410  -23.034 74.591  1.00 27.66  ? 26   TYR C CD2   1 
ATOM   3813  C  CE1   . TYR C 2  26   ? 28.205  -22.511 72.170  1.00 22.73  ? 26   TYR C CE1   1 
ATOM   3814  C  CE2   . TYR C 2  26   ? 30.029  -22.193 73.684  1.00 21.13  ? 26   TYR C CE2   1 
ATOM   3815  C  CZ    . TYR C 2  26   ? 29.419  -21.938 72.477  1.00 21.88  ? 26   TYR C CZ    1 
ATOM   3816  O  OH    . TYR C 2  26   ? 30.023  -21.108 71.568  1.00 29.09  ? 26   TYR C OH    1 
ATOM   3817  N  N     . ARG C 2  27   ? 28.552  -27.504 75.889  1.00 33.61  ? 27   ARG C N     1 
ATOM   3818  C  CA    . ARG C 2  27   ? 29.636  -28.472 76.042  1.00 30.17  ? 27   ARG C CA    1 
ATOM   3819  C  C     . ARG C 2  27   ? 29.460  -29.597 75.034  1.00 26.83  ? 27   ARG C C     1 
ATOM   3820  O  O     . ARG C 2  27   ? 30.409  -30.000 74.367  1.00 29.10  ? 27   ARG C O     1 
ATOM   3821  C  CB    . ARG C 2  27   ? 29.646  -29.037 77.464  1.00 39.58  ? 27   ARG C CB    1 
ATOM   3822  C  CG    . ARG C 2  27   ? 30.957  -29.672 77.906  1.00 42.36  ? 27   ARG C CG    1 
ATOM   3823  C  CD    . ARG C 2  27   ? 30.802  -30.338 79.273  1.00 46.53  ? 27   ARG C CD    1 
ATOM   3824  N  NE    . ARG C 2  27   ? 30.912  -31.794 79.190  1.00 73.53  ? 27   ARG C NE    1 
ATOM   3825  C  CZ    . ARG C 2  27   ? 29.934  -32.601 78.785  1.00 74.51  ? 27   ARG C CZ    1 
ATOM   3826  N  NH1   . ARG C 2  27   ? 30.129  -33.914 78.743  1.00 72.11  ? 27   ARG C NH1   1 
ATOM   3827  N  NH2   . ARG C 2  27   ? 28.761  -32.100 78.416  1.00 60.40  ? 27   ARG C NH2   1 
ATOM   3828  N  N     . ARG C 2  28   ? 28.230  -30.090 74.922  1.00 29.67  ? 28   ARG C N     1 
ATOM   3829  C  CA    . ARG C 2  28   ? 27.901  -31.130 73.954  1.00 33.29  ? 28   ARG C CA    1 
ATOM   3830  C  C     . ARG C 2  28   ? 28.211  -30.653 72.540  1.00 37.30  ? 28   ARG C C     1 
ATOM   3831  O  O     . ARG C 2  28   ? 28.668  -31.428 71.699  1.00 38.77  ? 28   ARG C O     1 
ATOM   3832  C  CB    . ARG C 2  28   ? 26.422  -31.512 74.063  1.00 39.39  ? 28   ARG C CB    1 
ATOM   3833  C  CG    . ARG C 2  28   ? 26.031  -32.791 73.335  1.00 52.29  ? 28   ARG C CG    1 
ATOM   3834  C  CD    . ARG C 2  28   ? 26.372  -34.027 74.156  1.00 69.89  ? 28   ARG C CD    1 
ATOM   3835  N  NE    . ARG C 2  28   ? 25.869  -35.252 73.539  1.00 90.81  ? 28   ARG C NE    1 
ATOM   3836  C  CZ    . ARG C 2  28   ? 26.575  -36.016 72.710  1.00 90.25  ? 28   ARG C CZ    1 
ATOM   3837  N  NH1   . ARG C 2  28   ? 27.821  -35.684 72.397  1.00 74.44  ? 28   ARG C NH1   1 
ATOM   3838  N  NH2   . ARG C 2  28   ? 26.035  -37.114 72.195  1.00 85.28  ? 28   ARG C NH2   1 
ATOM   3839  N  N     . ALA C 2  29   ? 27.972  -29.371 72.281  1.00 40.00  ? 29   ALA C N     1 
ATOM   3840  C  CA    . ALA C 2  29   ? 28.224  -28.823 70.950  1.00 35.12  ? 29   ALA C CA    1 
ATOM   3841  C  C     . ALA C 2  29   ? 29.712  -28.726 70.614  1.00 34.26  ? 29   ALA C C     1 
ATOM   3842  O  O     . ALA C 2  29   ? 30.125  -29.089 69.513  1.00 41.39  ? 29   ALA C O     1 
ATOM   3843  C  CB    . ALA C 2  29   ? 27.547  -27.469 70.784  1.00 33.79  ? 29   ALA C CB    1 
ATOM   3844  N  N     . LEU C 2  30   ? 30.516  -28.240 71.556  1.00 35.11  ? 30   LEU C N     1 
ATOM   3845  C  CA    . LEU C 2  30   ? 31.937  -28.003 71.287  1.00 37.66  ? 30   LEU C CA    1 
ATOM   3846  C  C     . LEU C 2  30   ? 32.833  -29.244 71.328  1.00 38.00  ? 30   LEU C C     1 
ATOM   3847  O  O     . LEU C 2  30   ? 33.681  -29.422 70.451  1.00 31.64  ? 30   LEU C O     1 
ATOM   3848  C  CB    . LEU C 2  30   ? 32.499  -26.932 72.224  1.00 30.29  ? 30   LEU C CB    1 
ATOM   3849  C  CG    . LEU C 2  30   ? 31.986  -25.515 71.979  1.00 26.22  ? 30   LEU C CG    1 
ATOM   3850  C  CD1   . LEU C 2  30   ? 32.768  -24.515 72.814  1.00 27.70  ? 30   LEU C CD1   1 
ATOM   3851  C  CD2   . LEU C 2  30   ? 32.065  -25.171 70.499  1.00 30.96  ? 30   LEU C CD2   1 
ATOM   3852  N  N     . GLN C 2  31   ? 32.639  -30.091 72.337  1.00 37.14  ? 31   GLN C N     1 
ATOM   3853  C  CA    . GLN C 2  31   ? 33.513  -31.240 72.566  1.00 34.21  ? 31   GLN C CA    1 
ATOM   3854  C  C     . GLN C 2  31   ? 34.972  -30.795 72.642  1.00 35.70  ? 31   GLN C C     1 
ATOM   3855  O  O     . GLN C 2  31   ? 35.845  -31.396 72.019  1.00 46.43  ? 31   GLN C O     1 
ATOM   3856  C  CB    . GLN C 2  31   ? 33.346  -32.293 71.463  1.00 36.44  ? 31   GLN C CB    1 
ATOM   3857  C  CG    . GLN C 2  31   ? 31.975  -32.951 71.394  1.00 34.59  ? 31   GLN C CG    1 
ATOM   3858  C  CD    . GLN C 2  31   ? 31.847  -33.897 70.209  1.00 36.25  ? 31   GLN C CD    1 
ATOM   3859  O  OE1   . GLN C 2  31   ? 31.680  -35.105 70.379  1.00 34.22  ? 31   GLN C OE1   1 
ATOM   3860  N  NE2   . GLN C 2  31   ? 31.927  -33.349 69.002  1.00 35.76  ? 31   GLN C NE2   1 
ATOM   3861  N  N     . ALA C 2  32   ? 35.230  -29.734 73.396  1.00 29.40  ? 32   ALA C N     1 
ATOM   3862  C  CA    . ALA C 2  32   ? 36.580  -29.190 73.503  1.00 35.03  ? 32   ALA C CA    1 
ATOM   3863  C  C     . ALA C 2  32   ? 37.505  -30.078 74.335  1.00 45.42  ? 32   ALA C C     1 
ATOM   3864  O  O     . ALA C 2  32   ? 38.720  -30.079 74.136  1.00 53.31  ? 32   ALA C O     1 
ATOM   3865  C  CB    . ALA C 2  32   ? 36.541  -27.782 74.073  1.00 39.36  ? 32   ALA C CB    1 
ATOM   3866  N  N     . ASP C 2  33   ? 36.930  -30.822 75.275  1.00 49.99  ? 33   ASP C N     1 
ATOM   3867  C  CA    . ASP C 2  33   ? 37.714  -31.705 76.133  1.00 53.04  ? 33   ASP C CA    1 
ATOM   3868  C  C     . ASP C 2  33   ? 37.825  -33.121 75.576  1.00 51.99  ? 33   ASP C C     1 
ATOM   3869  O  O     . ASP C 2  33   ? 38.564  -33.951 76.106  1.00 59.02  ? 33   ASP C O     1 
ATOM   3870  C  CB    . ASP C 2  33   ? 37.138  -31.730 77.548  1.00 56.92  ? 33   ASP C CB    1 
ATOM   3871  C  CG    . ASP C 2  33   ? 37.447  -30.465 78.317  1.00 65.77  ? 33   ASP C CG    1 
ATOM   3872  O  OD1   . ASP C 2  33   ? 37.850  -29.471 77.677  1.00 57.07  ? 33   ASP C OD1   1 
ATOM   3873  O  OD2   . ASP C 2  33   ? 37.288  -30.464 79.556  1.00 84.51  ? 33   ASP C OD2   1 
ATOM   3874  N  N     . VAL C 2  34   ? 37.087  -33.395 74.508  1.00 42.70  ? 34   VAL C N     1 
ATOM   3875  C  CA    . VAL C 2  34   ? 37.170  -34.687 73.847  1.00 40.61  ? 34   VAL C CA    1 
ATOM   3876  C  C     . VAL C 2  34   ? 38.276  -34.662 72.805  1.00 48.08  ? 34   VAL C C     1 
ATOM   3877  O  O     . VAL C 2  34   ? 38.309  -33.769 71.957  1.00 52.51  ? 34   VAL C O     1 
ATOM   3878  C  CB    . VAL C 2  34   ? 35.848  -35.053 73.155  1.00 37.50  ? 34   VAL C CB    1 
ATOM   3879  C  CG1   . VAL C 2  34   ? 35.989  -36.362 72.400  1.00 37.24  ? 34   VAL C CG1   1 
ATOM   3880  C  CG2   . VAL C 2  34   ? 34.728  -35.142 74.172  1.00 43.34  ? 34   VAL C CG2   1 
ATOM   3881  N  N     . PRO C 2  35   ? 39.197  -35.635 72.874  1.00 47.11  ? 35   PRO C N     1 
ATOM   3882  C  CA    . PRO C 2  35   ? 40.228  -35.810 71.846  1.00 43.85  ? 35   PRO C CA    1 
ATOM   3883  C  C     . PRO C 2  35   ? 39.590  -36.092 70.489  1.00 41.85  ? 35   PRO C C     1 
ATOM   3884  O  O     . PRO C 2  35   ? 38.618  -36.843 70.427  1.00 48.32  ? 35   PRO C O     1 
ATOM   3885  C  CB    . PRO C 2  35   ? 41.004  -37.036 72.335  1.00 45.90  ? 35   PRO C CB    1 
ATOM   3886  C  CG    . PRO C 2  35   ? 40.083  -37.726 73.283  1.00 46.05  ? 35   PRO C CG    1 
ATOM   3887  C  CD    . PRO C 2  35   ? 39.314  -36.637 73.944  1.00 45.08  ? 35   PRO C CD    1 
ATOM   3888  N  N     . PRO C 2  36   ? 40.140  -35.501 69.418  1.00 34.08  ? 36   PRO C N     1 
ATOM   3889  C  CA    . PRO C 2  36   ? 39.571  -35.488 68.066  1.00 39.29  ? 36   PRO C CA    1 
ATOM   3890  C  C     . PRO C 2  36   ? 39.086  -36.845 67.568  1.00 48.75  ? 36   PRO C C     1 
ATOM   3891  O  O     . PRO C 2  36   ? 38.017  -36.922 66.963  1.00 55.49  ? 36   PRO C O     1 
ATOM   3892  C  CB    . PRO C 2  36   ? 40.745  -35.015 67.211  1.00 42.34  ? 36   PRO C CB    1 
ATOM   3893  C  CG    . PRO C 2  36   ? 41.504  -34.121 68.111  1.00 45.81  ? 36   PRO C CG    1 
ATOM   3894  C  CD    . PRO C 2  36   ? 41.395  -34.733 69.485  1.00 48.88  ? 36   PRO C CD    1 
ATOM   3895  N  N     . GLU C 2  37   ? 39.852  -37.899 67.823  1.00 59.01  ? 37   GLU C N     1 
ATOM   3896  C  CA    . GLU C 2  37   ? 39.486  -39.229 67.343  1.00 66.08  ? 37   GLU C CA    1 
ATOM   3897  C  C     . GLU C 2  37   ? 38.279  -39.801 68.091  1.00 66.14  ? 37   GLU C C     1 
ATOM   3898  O  O     . GLU C 2  37   ? 37.594  -40.694 67.590  1.00 70.16  ? 37   GLU C O     1 
ATOM   3899  C  CB    . GLU C 2  37   ? 40.677  -40.189 67.440  1.00 60.67  ? 37   GLU C CB    1 
ATOM   3900  C  CG    . GLU C 2  37   ? 41.055  -40.592 68.862  1.00 61.71  ? 37   GLU C CG    1 
ATOM   3901  C  CD    . GLU C 2  37   ? 41.963  -39.584 69.547  1.00 61.52  ? 37   GLU C CD    1 
ATOM   3902  O  OE1   . GLU C 2  37   ? 42.445  -38.651 68.868  1.00 56.61  ? 37   GLU C OE1   1 
ATOM   3903  O  OE2   . GLU C 2  37   ? 42.198  -39.732 70.766  1.00 58.48  ? 37   GLU C OE2   1 
ATOM   3904  N  N     . LYS C 2  38   ? 38.021  -39.282 69.288  1.00 57.26  ? 38   LYS C N     1 
ATOM   3905  C  CA    . LYS C 2  38   ? 36.938  -39.787 70.125  1.00 57.73  ? 38   LYS C CA    1 
ATOM   3906  C  C     . LYS C 2  38   ? 35.637  -38.989 69.995  1.00 65.18  ? 38   LYS C C     1 
ATOM   3907  O  O     . LYS C 2  38   ? 34.627  -39.330 70.617  1.00 63.55  ? 38   LYS C O     1 
ATOM   3908  C  CB    . LYS C 2  38   ? 37.376  -39.827 71.590  1.00 51.74  ? 38   LYS C CB    1 
ATOM   3909  C  CG    . LYS C 2  38   ? 38.463  -40.840 71.889  1.00 46.39  ? 38   LYS C CG    1 
ATOM   3910  C  CD    . LYS C 2  38   ? 38.669  -40.978 73.387  1.00 43.63  ? 38   LYS C CD    1 
ATOM   3911  C  CE    . LYS C 2  38   ? 39.639  -42.096 73.714  1.00 51.42  ? 38   LYS C CE    1 
ATOM   3912  N  NZ    . LYS C 2  38   ? 39.804  -42.262 75.183  1.00 60.00  ? 38   LYS C NZ    1 
ATOM   3913  N  N     . ARG C 2  39   ? 35.658  -37.932 69.190  1.00 54.81  ? 39   ARG C N     1 
ATOM   3914  C  CA    . ARG C 2  39   ? 34.489  -37.069 69.052  1.00 48.70  ? 39   ARG C CA    1 
ATOM   3915  C  C     . ARG C 2  39   ? 33.331  -37.764 68.347  1.00 49.62  ? 39   ARG C C     1 
ATOM   3916  O  O     . ARG C 2  39   ? 33.503  -38.338 67.273  1.00 55.95  ? 39   ARG C O     1 
ATOM   3917  C  CB    . ARG C 2  39   ? 34.857  -35.772 68.324  1.00 47.22  ? 39   ARG C CB    1 
ATOM   3918  C  CG    . ARG C 2  39   ? 35.609  -34.787 69.199  1.00 44.81  ? 39   ARG C CG    1 
ATOM   3919  C  CD    . ARG C 2  39   ? 36.064  -33.554 68.443  1.00 34.53  ? 39   ARG C CD    1 
ATOM   3920  N  NE    . ARG C 2  39   ? 36.782  -32.644 69.330  1.00 32.20  ? 39   ARG C NE    1 
ATOM   3921  C  CZ    . ARG C 2  39   ? 37.709  -31.781 68.928  1.00 37.85  ? 39   ARG C CZ    1 
ATOM   3922  N  NH1   . ARG C 2  39   ? 38.039  -31.709 67.645  1.00 34.22  ? 39   ARG C NH1   1 
ATOM   3923  N  NH2   . ARG C 2  39   ? 38.311  -30.995 69.813  1.00 37.84  ? 39   ARG C NH2   1 
ATOM   3924  N  N     . GLU C 2  40   ? 32.156  -37.716 68.967  1.00 50.69  ? 40   GLU C N     1 
ATOM   3925  C  CA    . GLU C 2  40   ? 30.927  -38.186 68.332  1.00 55.86  ? 40   GLU C CA    1 
ATOM   3926  C  C     . GLU C 2  40   ? 30.554  -37.220 67.225  1.00 48.31  ? 40   GLU C C     1 
ATOM   3927  O  O     . GLU C 2  40   ? 31.059  -36.097 67.188  1.00 46.79  ? 40   GLU C O     1 
ATOM   3928  C  CB    . GLU C 2  40   ? 29.776  -38.276 69.334  1.00 49.89  ? 40   GLU C CB    1 
ATOM   3929  C  CG    . GLU C 2  40   ? 29.874  -39.430 70.310  1.00 60.03  ? 40   GLU C CG    1 
ATOM   3930  C  CD    . GLU C 2  40   ? 28.558  -39.695 71.010  1.00 75.02  ? 40   GLU C CD    1 
ATOM   3931  O  OE1   . GLU C 2  40   ? 27.498  -39.471 70.385  1.00 71.60  ? 40   GLU C OE1   1 
ATOM   3932  O  OE2   . GLU C 2  40   ? 28.582  -40.121 72.184  1.00 81.33  ? 40   GLU C OE2   1 
ATOM   3933  N  N     . ASN C 2  41   ? 29.673  -37.638 66.323  1.00 48.08  ? 41   ASN C N     1 
ATOM   3934  C  CA    . ASN C 2  41   ? 29.281  -36.739 65.256  1.00 47.63  ? 41   ASN C CA    1 
ATOM   3935  C  C     . ASN C 2  41   ? 28.077  -35.944 65.739  1.00 48.67  ? 41   ASN C C     1 
ATOM   3936  O  O     . ASN C 2  41   ? 26.941  -36.418 65.718  1.00 46.65  ? 41   ASN C O     1 
ATOM   3937  C  CB    . ASN C 2  41   ? 28.904  -37.556 64.020  1.00 50.09  ? 41   ASN C CB    1 
ATOM   3938  C  CG    . ASN C 2  41   ? 28.646  -36.695 62.805  1.00 52.26  ? 41   ASN C CG    1 
ATOM   3939  O  OD1   . ASN C 2  41   ? 29.251  -35.640 62.644  1.00 55.82  ? 41   ASN C OD1   1 
ATOM   3940  N  ND2   . ASN C 2  41   ? 27.746  -37.144 61.938  1.00 57.84  ? 41   ASN C ND2   1 
ATOM   3941  N  N     . VAL C 2  42   ? 28.357  -34.705 66.131  1.00 44.60  ? 42   VAL C N     1 
ATOM   3942  C  CA    . VAL C 2  42   ? 27.391  -33.782 66.709  1.00 34.44  ? 42   VAL C CA    1 
ATOM   3943  C  C     . VAL C 2  42   ? 27.993  -32.389 66.610  1.00 39.33  ? 42   VAL C C     1 
ATOM   3944  O  O     . VAL C 2  42   ? 29.204  -32.249 66.433  1.00 44.70  ? 42   VAL C O     1 
ATOM   3945  C  CB    . VAL C 2  42   ? 27.129  -34.070 68.202  1.00 38.13  ? 42   VAL C CB    1 
ATOM   3946  C  CG1   . VAL C 2  42   ? 26.151  -35.226 68.392  1.00 38.91  ? 42   VAL C CG1   1 
ATOM   3947  C  CG2   . VAL C 2  42   ? 28.438  -34.320 68.934  1.00 48.87  ? 42   VAL C CG2   1 
ATOM   3948  N  N     . GLY C 2  43   ? 27.157  -31.363 66.740  1.00 37.78  ? 43   GLY C N     1 
ATOM   3949  C  CA    . GLY C 2  43   ? 27.631  -29.991 66.827  1.00 35.83  ? 43   GLY C CA    1 
ATOM   3950  C  C     . GLY C 2  43   ? 28.546  -29.549 65.699  1.00 39.23  ? 43   GLY C C     1 
ATOM   3951  O  O     . GLY C 2  43   ? 28.299  -29.854 64.529  1.00 38.09  ? 43   GLY C O     1 
ATOM   3952  N  N     . ILE C 2  44   ? 29.613  -28.834 66.049  1.00 34.17  ? 44   ILE C N     1 
ATOM   3953  C  CA    . ILE C 2  44   ? 30.504  -28.289 65.033  1.00 31.51  ? 44   ILE C CA    1 
ATOM   3954  C  C     . ILE C 2  44   ? 31.265  -29.397 64.320  1.00 35.80  ? 44   ILE C C     1 
ATOM   3955  O  O     . ILE C 2  44   ? 31.641  -29.249 63.153  1.00 42.46  ? 44   ILE C O     1 
ATOM   3956  C  CB    . ILE C 2  44   ? 31.474  -27.233 65.601  1.00 30.07  ? 44   ILE C CB    1 
ATOM   3957  C  CG1   . ILE C 2  44   ? 32.437  -27.853 66.605  1.00 33.78  ? 44   ILE C CG1   1 
ATOM   3958  C  CG2   . ILE C 2  44   ? 30.706  -26.100 66.255  1.00 33.31  ? 44   ILE C CG2   1 
ATOM   3959  C  CD1   . ILE C 2  44   ? 33.420  -26.851 67.161  1.00 33.69  ? 44   ILE C CD1   1 
ATOM   3960  N  N     . GLN C 2  45   ? 31.472  -30.511 65.017  1.00 33.56  ? 45   GLN C N     1 
ATOM   3961  C  CA    . GLN C 2  45   ? 32.036  -31.698 64.389  1.00 36.17  ? 45   GLN C CA    1 
ATOM   3962  C  C     . GLN C 2  45   ? 31.124  -32.138 63.251  1.00 38.32  ? 45   GLN C C     1 
ATOM   3963  O  O     . GLN C 2  45   ? 31.578  -32.371 62.129  1.00 38.97  ? 45   GLN C O     1 
ATOM   3964  C  CB    . GLN C 2  45   ? 32.199  -32.828 65.404  1.00 41.79  ? 45   GLN C CB    1 
ATOM   3965  C  CG    . GLN C 2  45   ? 32.655  -34.154 64.801  1.00 43.88  ? 45   GLN C CG    1 
ATOM   3966  C  CD    . GLN C 2  45   ? 34.121  -34.156 64.393  1.00 44.45  ? 45   GLN C CD    1 
ATOM   3967  O  OE1   . GLN C 2  45   ? 34.857  -33.203 64.654  1.00 37.32  ? 45   GLN C OE1   1 
ATOM   3968  N  NE2   . GLN C 2  45   ? 34.551  -35.237 63.751  1.00 53.95  ? 45   GLN C NE2   1 
ATOM   3969  N  N     . ALA C 2  46   ? 29.829  -32.223 63.544  1.00 38.34  ? 46   ALA C N     1 
ATOM   3970  C  CA    . ALA C 2  46   ? 28.839  -32.599 62.540  1.00 40.47  ? 46   ALA C CA    1 
ATOM   3971  C  C     . ALA C 2  46   ? 28.752  -31.588 61.398  1.00 41.84  ? 46   ALA C C     1 
ATOM   3972  O  O     . ALA C 2  46   ? 28.502  -31.961 60.252  1.00 43.45  ? 46   ALA C O     1 
ATOM   3973  C  CB    . ALA C 2  46   ? 27.480  -32.801 63.183  1.00 39.58  ? 46   ALA C CB    1 
ATOM   3974  N  N     . ALA C 2  47   ? 28.958  -30.312 61.715  1.00 45.01  ? 47   ALA C N     1 
ATOM   3975  C  CA    . ALA C 2  47   ? 28.972  -29.264 60.697  1.00 39.68  ? 47   ALA C CA    1 
ATOM   3976  C  C     . ALA C 2  47   ? 30.114  -29.491 59.716  1.00 40.54  ? 47   ALA C C     1 
ATOM   3977  O  O     . ALA C 2  47   ? 29.917  -29.463 58.494  1.00 47.68  ? 47   ALA C O     1 
ATOM   3978  C  CB    . ALA C 2  47   ? 29.098  -27.899 61.342  1.00 34.77  ? 47   ALA C CB    1 
ATOM   3979  N  N     . PHE C 2  48   ? 31.309  -29.713 60.259  1.00 40.99  ? 48   PHE C N     1 
ATOM   3980  C  CA    . PHE C 2  48   ? 32.465  -30.033 59.429  1.00 41.80  ? 48   PHE C CA    1 
ATOM   3981  C  C     . PHE C 2  48   ? 32.194  -31.275 58.581  1.00 42.51  ? 48   PHE C C     1 
ATOM   3982  O  O     . PHE C 2  48   ? 32.480  -31.289 57.382  1.00 41.79  ? 48   PHE C O     1 
ATOM   3983  C  CB    . PHE C 2  48   ? 33.715  -30.244 60.285  1.00 34.89  ? 48   PHE C CB    1 
ATOM   3984  C  CG    . PHE C 2  48   ? 34.412  -28.970 60.684  1.00 30.39  ? 48   PHE C CG    1 
ATOM   3985  C  CD1   . PHE C 2  48   ? 34.411  -28.547 62.006  1.00 30.01  ? 48   PHE C CD1   1 
ATOM   3986  C  CD2   . PHE C 2  48   ? 35.084  -28.208 59.743  1.00 27.13  ? 48   PHE C CD2   1 
ATOM   3987  C  CE1   . PHE C 2  48   ? 35.060  -27.385 62.381  1.00 25.66  ? 48   PHE C CE1   1 
ATOM   3988  C  CE2   . PHE C 2  48   ? 35.735  -27.043 60.112  1.00 27.81  ? 48   PHE C CE2   1 
ATOM   3989  C  CZ    . PHE C 2  48   ? 35.722  -26.632 61.433  1.00 27.13  ? 48   PHE C CZ    1 
ATOM   3990  N  N     . ARG C 2  49   ? 31.631  -32.307 59.205  1.00 37.78  ? 49   ARG C N     1 
ATOM   3991  C  CA    . ARG C 2  49   ? 31.323  -33.548 58.498  1.00 44.89  ? 49   ARG C CA    1 
ATOM   3992  C  C     . ARG C 2  49   ? 30.336  -33.340 57.348  1.00 54.12  ? 49   ARG C C     1 
ATOM   3993  O  O     . ARG C 2  49   ? 30.426  -34.009 56.318  1.00 66.67  ? 49   ARG C O     1 
ATOM   3994  C  CB    . ARG C 2  49   ? 30.787  -34.606 59.462  1.00 48.34  ? 49   ARG C CB    1 
ATOM   3995  C  CG    . ARG C 2  49   ? 31.776  -35.026 60.535  1.00 54.11  ? 49   ARG C CG    1 
ATOM   3996  C  CD    . ARG C 2  49   ? 32.979  -35.753 59.956  1.00 61.74  ? 49   ARG C CD    1 
ATOM   3997  N  NE    . ARG C 2  49   ? 32.683  -37.152 59.670  1.00 67.91  ? 49   ARG C NE    1 
ATOM   3998  C  CZ    . ARG C 2  49   ? 32.334  -37.612 58.474  1.00 74.68  ? 49   ARG C CZ    1 
ATOM   3999  N  NH1   . ARG C 2  49   ? 32.242  -36.782 57.443  1.00 70.73  ? 49   ARG C NH1   1 
ATOM   4000  N  NH2   . ARG C 2  49   ? 32.081  -38.904 58.309  1.00 86.01  ? 49   ARG C NH2   1 
ATOM   4001  N  N     . GLU C 2  50   ? 29.394  -32.418 57.525  1.00 45.88  ? 50   GLU C N     1 
ATOM   4002  C  CA    . GLU C 2  50   ? 28.430  -32.115 56.472  1.00 43.64  ? 50   GLU C CA    1 
ATOM   4003  C  C     . GLU C 2  50   ? 29.071  -31.349 55.325  1.00 48.76  ? 50   GLU C C     1 
ATOM   4004  O  O     . GLU C 2  50   ? 28.898  -31.707 54.161  1.00 53.14  ? 50   GLU C O     1 
ATOM   4005  C  CB    . GLU C 2  50   ? 27.251  -31.307 57.014  1.00 52.71  ? 50   GLU C CB    1 
ATOM   4006  C  CG    . GLU C 2  50   ? 26.256  -32.107 57.829  1.00 70.05  ? 50   GLU C CG    1 
ATOM   4007  C  CD    . GLU C 2  50   ? 24.964  -31.350 58.059  1.00 76.65  ? 50   GLU C CD    1 
ATOM   4008  O  OE1   . GLU C 2  50   ? 24.231  -31.697 59.009  1.00 83.22  ? 50   GLU C OE1   1 
ATOM   4009  O  OE2   . GLU C 2  50   ? 24.680  -30.412 57.283  1.00 76.13  ? 50   GLU C OE2   1 
ATOM   4010  N  N     . THR C 2  51   ? 29.805  -30.290 55.659  1.00 50.85  ? 51   THR C N     1 
ATOM   4011  C  CA    . THR C 2  51   ? 30.377  -29.413 54.639  1.00 50.76  ? 51   THR C CA    1 
ATOM   4012  C  C     . THR C 2  51   ? 31.387  -30.140 53.751  1.00 55.92  ? 51   THR C C     1 
ATOM   4013  O  O     . THR C 2  51   ? 31.316  -30.066 52.521  1.00 54.13  ? 51   THR C O     1 
ATOM   4014  C  CB    . THR C 2  51   ? 31.046  -28.171 55.265  1.00 42.99  ? 51   THR C CB    1 
ATOM   4015  O  OG1   . THR C 2  51   ? 30.138  -27.543 56.178  1.00 45.54  ? 51   THR C OG1   1 
ATOM   4016  C  CG2   . THR C 2  51   ? 31.434  -27.173 54.188  1.00 39.12  ? 51   THR C CG2   1 
ATOM   4017  N  N     . PHE C 2  52   ? 32.323  -30.840 54.387  1.00 56.27  ? 52   PHE C N     1 
ATOM   4018  C  CA    . PHE C 2  52   ? 33.379  -31.562 53.682  1.00 54.26  ? 52   PHE C CA    1 
ATOM   4019  C  C     . PHE C 2  52   ? 32.973  -32.999 53.342  1.00 57.60  ? 52   PHE C C     1 
ATOM   4020  O  O     . PHE C 2  52   ? 32.136  -33.587 54.030  1.00 59.69  ? 52   PHE C O     1 
ATOM   4021  C  CB    . PHE C 2  52   ? 34.658  -31.549 54.520  1.00 44.26  ? 52   PHE C CB    1 
ATOM   4022  C  CG    . PHE C 2  52   ? 35.229  -30.178 54.727  1.00 39.88  ? 52   PHE C CG    1 
ATOM   4023  C  CD1   . PHE C 2  52   ? 36.007  -29.583 53.749  1.00 47.20  ? 52   PHE C CD1   1 
ATOM   4024  C  CD2   . PHE C 2  52   ? 34.989  -29.482 55.896  1.00 37.00  ? 52   PHE C CD2   1 
ATOM   4025  C  CE1   . PHE C 2  52   ? 36.537  -28.320 53.934  1.00 38.72  ? 52   PHE C CE1   1 
ATOM   4026  C  CE2   . PHE C 2  52   ? 35.517  -28.219 56.086  1.00 39.55  ? 52   PHE C CE2   1 
ATOM   4027  C  CZ    . PHE C 2  52   ? 36.292  -27.638 55.101  1.00 30.68  ? 52   PHE C CZ    1 
ATOM   4028  N  N     . PRO C 2  53   ? 33.570  -33.580 52.284  1.00 52.30  ? 53   PRO C N     1 
ATOM   4029  C  CA    . PRO C 2  53   ? 34.588  -33.025 51.384  1.00 51.63  ? 53   PRO C CA    1 
ATOM   4030  C  C     . PRO C 2  53   ? 34.025  -32.082 50.321  1.00 57.81  ? 53   PRO C C     1 
ATOM   4031  O  O     . PRO C 2  53   ? 32.854  -32.175 49.954  1.00 65.15  ? 53   PRO C O     1 
ATOM   4032  C  CB    . PRO C 2  53   ? 35.163  -34.271 50.717  1.00 58.57  ? 53   PRO C CB    1 
ATOM   4033  C  CG    . PRO C 2  53   ? 34.012  -35.205 50.662  1.00 55.56  ? 53   PRO C CG    1 
ATOM   4034  C  CD    . PRO C 2  53   ? 33.230  -34.968 51.924  1.00 50.95  ? 53   PRO C CD    1 
ATOM   4035  N  N     . ILE C 2  54   ? 34.875  -31.187 49.830  1.00 52.75  ? 54   ILE C N     1 
ATOM   4036  C  CA    . ILE C 2  54   ? 34.504  -30.251 48.779  1.00 58.44  ? 54   ILE C CA    1 
ATOM   4037  C  C     . ILE C 2  54   ? 35.167  -30.677 47.471  1.00 74.79  ? 54   ILE C C     1 
ATOM   4038  O  O     . ILE C 2  54   ? 36.357  -30.988 47.452  1.00 80.39  ? 54   ILE C O     1 
ATOM   4039  C  CB    . ILE C 2  54   ? 34.970  -28.829 49.133  1.00 55.03  ? 54   ILE C CB    1 
ATOM   4040  C  CG1   . ILE C 2  54   ? 34.550  -28.464 50.557  1.00 45.37  ? 54   ILE C CG1   1 
ATOM   4041  C  CG2   . ILE C 2  54   ? 34.432  -27.821 48.135  1.00 62.86  ? 54   ILE C CG2   1 
ATOM   4042  C  CD1   . ILE C 2  54   ? 35.016  -27.094 50.987  1.00 40.24  ? 54   ILE C CD1   1 
ATOM   4043  N  N     . GLU C 2  55   ? 34.408  -30.691 46.377  1.00 74.98  ? 55   GLU C N     1 
ATOM   4044  C  CA    . GLU C 2  55   ? 34.953  -31.145 45.096  1.00 75.78  ? 55   GLU C CA    1 
ATOM   4045  C  C     . GLU C 2  55   ? 34.892  -30.089 43.992  1.00 82.58  ? 55   GLU C C     1 
ATOM   4046  O  O     . GLU C 2  55   ? 34.382  -28.988 44.200  1.00 84.52  ? 55   GLU C O     1 
ATOM   4047  C  CB    . GLU C 2  55   ? 34.239  -32.415 44.636  1.00 73.37  ? 55   GLU C CB    1 
ATOM   4048  C  CG    . GLU C 2  55   ? 34.237  -33.524 45.667  1.00 75.53  ? 55   GLU C CG    1 
ATOM   4049  C  CD    . GLU C 2  55   ? 33.773  -34.844 45.090  1.00 94.43  ? 55   GLU C CD    1 
ATOM   4050  O  OE1   . GLU C 2  55   ? 33.340  -35.716 45.874  1.00 91.51  ? 55   GLU C OE1   1 
ATOM   4051  O  OE2   . GLU C 2  55   ? 33.846  -35.011 43.854  1.00 96.08  ? 55   GLU C OE2   1 
ATOM   4052  N  N     . GLU C 2  56   ? 35.414  -30.449 42.820  1.00 84.32  ? 56   GLU C N     1 
ATOM   4053  C  CA    . GLU C 2  56   ? 35.434  -29.570 41.652  1.00 84.71  ? 56   GLU C CA    1 
ATOM   4054  C  C     . GLU C 2  56   ? 36.192  -28.270 41.911  1.00 79.84  ? 56   GLU C C     1 
ATOM   4055  O  O     . GLU C 2  56   ? 36.423  -27.480 40.995  1.00 79.12  ? 56   GLU C O     1 
ATOM   4056  C  CB    . GLU C 2  56   ? 34.010  -29.270 41.177  1.00 84.86  ? 56   GLU C CB    1 
ATOM   4057  C  CG    . GLU C 2  56   ? 33.200  -30.511 40.850  1.00 92.03  ? 56   GLU C CG    1 
ATOM   4058  C  CD    . GLU C 2  56   ? 31.720  -30.216 40.717  1.00 103.18 ? 56   GLU C CD    1 
ATOM   4059  O  OE1   . GLU C 2  56   ? 31.007  -31.019 40.079  1.00 111.64 ? 56   GLU C OE1   1 
ATOM   4060  O  OE2   . GLU C 2  56   ? 31.270  -29.182 41.257  1.00 91.47  ? 56   GLU C OE2   1 
ATOM   4061  N  N     . GLY C 2  63   ? 40.218  -32.606 38.912  1.00 87.44  ? 63   GLY C N     1 
ATOM   4062  C  CA    . GLY C 2  63   ? 39.624  -31.617 39.792  1.00 99.29  ? 63   GLY C CA    1 
ATOM   4063  C  C     . GLY C 2  63   ? 40.098  -31.769 41.224  1.00 94.48  ? 63   GLY C C     1 
ATOM   4064  O  O     . GLY C 2  63   ? 40.207  -32.882 41.734  1.00 92.11  ? 63   GLY C O     1 
ATOM   4065  N  N     . LEU C 2  64   ? 40.379  -30.646 41.877  1.00 83.04  ? 64   LEU C N     1 
ATOM   4066  C  CA    . LEU C 2  64   ? 40.893  -30.663 43.242  1.00 75.38  ? 64   LEU C CA    1 
ATOM   4067  C  C     . LEU C 2  64   ? 39.846  -31.131 44.253  1.00 81.51  ? 64   LEU C C     1 
ATOM   4068  O  O     . LEU C 2  64   ? 38.643  -31.024 44.012  1.00 87.80  ? 64   LEU C O     1 
ATOM   4069  C  CB    . LEU C 2  64   ? 41.409  -29.278 43.633  1.00 76.56  ? 64   LEU C CB    1 
ATOM   4070  C  CG    . LEU C 2  64   ? 42.566  -28.727 42.800  1.00 84.53  ? 64   LEU C CG    1 
ATOM   4071  C  CD1   . LEU C 2  64   ? 42.919  -27.313 43.238  1.00 72.66  ? 64   LEU C CD1   1 
ATOM   4072  C  CD2   . LEU C 2  64   ? 43.771  -29.641 42.910  1.00 90.87  ? 64   LEU C CD2   1 
ATOM   4073  N  N     . VAL C 2  65   ? 40.320  -31.659 45.379  1.00 75.37  ? 65   VAL C N     1 
ATOM   4074  C  CA    . VAL C 2  65   ? 39.452  -32.098 46.470  1.00 65.64  ? 65   VAL C CA    1 
ATOM   4075  C  C     . VAL C 2  65   ? 40.008  -31.645 47.821  1.00 66.78  ? 65   VAL C C     1 
ATOM   4076  O  O     . VAL C 2  65   ? 41.134  -31.990 48.183  1.00 67.88  ? 65   VAL C O     1 
ATOM   4077  C  CB    . VAL C 2  65   ? 39.280  -33.635 46.478  1.00 59.16  ? 65   VAL C CB    1 
ATOM   4078  C  CG1   . VAL C 2  65   ? 38.633  -34.097 47.772  1.00 48.15  ? 65   VAL C CG1   1 
ATOM   4079  C  CG2   . VAL C 2  65   ? 38.464  -34.090 45.276  1.00 69.06  ? 65   VAL C CG2   1 
ATOM   4080  N  N     . LEU C 2  66   ? 39.218  -30.866 48.558  1.00 64.40  ? 66   LEU C N     1 
ATOM   4081  C  CA    . LEU C 2  66   ? 39.607  -30.397 49.889  1.00 54.80  ? 66   LEU C CA    1 
ATOM   4082  C  C     . LEU C 2  66   ? 38.833  -31.163 50.956  1.00 51.55  ? 66   LEU C C     1 
ATOM   4083  O  O     . LEU C 2  66   ? 37.603  -31.190 50.938  1.00 55.07  ? 66   LEU C O     1 
ATOM   4084  C  CB    . LEU C 2  66   ? 39.346  -28.895 50.023  1.00 52.69  ? 66   LEU C CB    1 
ATOM   4085  C  CG    . LEU C 2  66   ? 39.831  -28.188 51.292  1.00 48.21  ? 66   LEU C CG    1 
ATOM   4086  C  CD1   . LEU C 2  66   ? 41.334  -28.340 51.455  1.00 53.98  ? 66   LEU C CD1   1 
ATOM   4087  C  CD2   . LEU C 2  66   ? 39.445  -26.716 51.260  1.00 45.06  ? 66   LEU C CD2   1 
ATOM   4088  N  N     . ASP C 2  67   ? 39.550  -31.783 51.887  1.00 47.54  ? 67   ASP C N     1 
ATOM   4089  C  CA    . ASP C 2  67   ? 38.909  -32.695 52.830  1.00 48.93  ? 67   ASP C CA    1 
ATOM   4090  C  C     . ASP C 2  67   ? 39.197  -32.379 54.300  1.00 47.17  ? 67   ASP C C     1 
ATOM   4091  O  O     . ASP C 2  67   ? 40.219  -31.783 54.638  1.00 49.12  ? 67   ASP C O     1 
ATOM   4092  C  CB    . ASP C 2  67   ? 39.298  -34.140 52.507  1.00 55.31  ? 67   ASP C CB    1 
ATOM   4093  C  CG    . ASP C 2  67   ? 38.334  -35.147 53.098  1.00 61.70  ? 67   ASP C CG    1 
ATOM   4094  O  OD1   . ASP C 2  67   ? 37.155  -34.789 53.307  1.00 60.29  ? 67   ASP C OD1   1 
ATOM   4095  O  OD2   . ASP C 2  67   ? 38.753  -36.296 53.350  1.00 69.52  ? 67   ASP C OD2   1 
ATOM   4096  N  N     . PHE C 2  68   ? 38.280  -32.796 55.166  1.00 45.82  ? 68   PHE C N     1 
ATOM   4097  C  CA    . PHE C 2  68   ? 38.363  -32.513 56.595  1.00 45.69  ? 68   PHE C CA    1 
ATOM   4098  C  C     . PHE C 2  68   ? 38.951  -33.685 57.371  1.00 49.59  ? 68   PHE C C     1 
ATOM   4099  O  O     . PHE C 2  68   ? 38.644  -34.844 57.093  1.00 55.62  ? 68   PHE C O     1 
ATOM   4100  C  CB    . PHE C 2  68   ? 36.972  -32.178 57.133  1.00 39.68  ? 68   PHE C CB    1 
ATOM   4101  C  CG    . PHE C 2  68   ? 36.905  -32.043 58.628  1.00 35.70  ? 68   PHE C CG    1 
ATOM   4102  C  CD1   . PHE C 2  68   ? 37.489  -30.964 59.268  1.00 32.37  ? 68   PHE C CD1   1 
ATOM   4103  C  CD2   . PHE C 2  68   ? 36.231  -32.983 59.390  1.00 38.05  ? 68   PHE C CD2   1 
ATOM   4104  C  CE1   . PHE C 2  68   ? 37.417  -30.833 60.643  1.00 30.38  ? 68   PHE C CE1   1 
ATOM   4105  C  CE2   . PHE C 2  68   ? 36.154  -32.857 60.766  1.00 38.77  ? 68   PHE C CE2   1 
ATOM   4106  C  CZ    . PHE C 2  68   ? 36.747  -31.780 61.392  1.00 32.83  ? 68   PHE C CZ    1 
ATOM   4107  N  N     . LEU C 2  69   ? 39.799  -33.376 58.344  1.00 45.19  ? 69   LEU C N     1 
ATOM   4108  C  CA    . LEU C 2  69   ? 40.379  -34.394 59.207  1.00 39.59  ? 69   LEU C CA    1 
ATOM   4109  C  C     . LEU C 2  69   ? 39.867  -34.228 60.633  1.00 41.57  ? 69   LEU C C     1 
ATOM   4110  O  O     . LEU C 2  69   ? 39.166  -35.093 61.160  1.00 49.57  ? 69   LEU C O     1 
ATOM   4111  C  CB    . LEU C 2  69   ? 41.906  -34.311 59.185  1.00 43.85  ? 69   LEU C CB    1 
ATOM   4112  C  CG    . LEU C 2  69   ? 42.578  -34.549 57.833  1.00 44.92  ? 69   LEU C CG    1 
ATOM   4113  C  CD1   . LEU C 2  69   ? 44.086  -34.426 57.956  1.00 41.95  ? 69   LEU C CD1   1 
ATOM   4114  C  CD2   . LEU C 2  69   ? 42.189  -35.910 57.284  1.00 48.99  ? 69   LEU C CD2   1 
ATOM   4115  N  N     . GLU C 2  70   ? 40.222  -33.107 61.250  1.00 39.94  ? 70   GLU C N     1 
ATOM   4116  C  CA    . GLU C 2  70   ? 39.802  -32.811 62.612  1.00 38.50  ? 70   GLU C CA    1 
ATOM   4117  C  C     . GLU C 2  70   ? 39.897  -31.311 62.867  1.00 41.66  ? 70   GLU C C     1 
ATOM   4118  O  O     . GLU C 2  70   ? 40.350  -30.554 62.005  1.00 41.97  ? 70   GLU C O     1 
ATOM   4119  C  CB    . GLU C 2  70   ? 40.701  -33.551 63.597  1.00 41.33  ? 70   GLU C CB    1 
ATOM   4120  C  CG    . GLU C 2  70   ? 42.166  -33.160 63.474  1.00 47.39  ? 70   GLU C CG    1 
ATOM   4121  C  CD    . GLU C 2  70   ? 43.069  -33.972 64.376  1.00 56.14  ? 70   GLU C CD    1 
ATOM   4122  O  OE1   . GLU C 2  70   ? 44.136  -33.456 64.772  1.00 62.41  ? 70   GLU C OE1   1 
ATOM   4123  O  OE2   . GLU C 2  70   ? 42.714  -35.128 64.683  1.00 62.35  ? 70   GLU C OE2   1 
ATOM   4124  N  N     . TYR C 2  71   ? 39.480  -30.882 64.054  1.00 38.01  ? 71   TYR C N     1 
ATOM   4125  C  CA    . TYR C 2  71   ? 39.685  -29.498 64.463  1.00 36.04  ? 71   TYR C CA    1 
ATOM   4126  C  C     . TYR C 2  71   ? 40.232  -29.436 65.880  1.00 36.66  ? 71   TYR C C     1 
ATOM   4127  O  O     . TYR C 2  71   ? 40.349  -30.456 66.560  1.00 37.75  ? 71   TYR C O     1 
ATOM   4128  C  CB    . TYR C 2  71   ? 38.383  -28.686 64.364  1.00 36.28  ? 71   TYR C CB    1 
ATOM   4129  C  CG    . TYR C 2  71   ? 37.296  -29.096 65.342  1.00 34.75  ? 71   TYR C CG    1 
ATOM   4130  C  CD1   . TYR C 2  71   ? 37.264  -28.585 66.636  1.00 29.95  ? 71   TYR C CD1   1 
ATOM   4131  C  CD2   . TYR C 2  71   ? 36.292  -29.982 64.963  1.00 33.74  ? 71   TYR C CD2   1 
ATOM   4132  C  CE1   . TYR C 2  71   ? 36.274  -28.957 67.528  1.00 28.12  ? 71   TYR C CE1   1 
ATOM   4133  C  CE2   . TYR C 2  71   ? 35.297  -30.356 65.849  1.00 31.42  ? 71   TYR C CE2   1 
ATOM   4134  C  CZ    . TYR C 2  71   ? 35.293  -29.842 67.129  1.00 29.76  ? 71   TYR C CZ    1 
ATOM   4135  O  OH    . TYR C 2  71   ? 34.304  -30.213 68.012  1.00 31.89  ? 71   TYR C OH    1 
ATOM   4136  N  N     . ARG C 2  72   ? 40.555  -28.228 66.324  1.00 32.49  ? 72   ARG C N     1 
ATOM   4137  C  CA    . ARG C 2  72   ? 40.967  -28.021 67.701  1.00 34.52  ? 72   ARG C CA    1 
ATOM   4138  C  C     . ARG C 2  72   ? 40.634  -26.607 68.156  1.00 33.12  ? 72   ARG C C     1 
ATOM   4139  O  O     . ARG C 2  72   ? 40.736  -25.650 67.381  1.00 31.42  ? 72   ARG C O     1 
ATOM   4140  C  CB    . ARG C 2  72   ? 42.462  -28.307 67.869  1.00 37.10  ? 72   ARG C CB    1 
ATOM   4141  C  CG    . ARG C 2  72   ? 43.363  -27.365 67.094  1.00 37.12  ? 72   ARG C CG    1 
ATOM   4142  C  CD    . ARG C 2  72   ? 44.826  -27.564 67.449  1.00 31.85  ? 72   ARG C CD    1 
ATOM   4143  N  NE    . ARG C 2  72   ? 45.652  -26.490 66.906  1.00 31.89  ? 72   ARG C NE    1 
ATOM   4144  C  CZ    . ARG C 2  72   ? 46.010  -25.409 67.590  1.00 28.21  ? 72   ARG C CZ    1 
ATOM   4145  N  NH1   . ARG C 2  72   ? 45.624  -25.262 68.851  1.00 20.05  ? 72   ARG C NH1   1 
ATOM   4146  N  NH2   . ARG C 2  72   ? 46.759  -24.478 67.014  1.00 30.54  ? 72   ARG C NH2   1 
ATOM   4147  N  N     . LEU C 2  73   ? 40.237  -26.484 69.418  1.00 30.70  ? 73   LEU C N     1 
ATOM   4148  C  CA    . LEU C 2  73   ? 39.980  -25.185 70.019  1.00 30.23  ? 73   LEU C CA    1 
ATOM   4149  C  C     . LEU C 2  73   ? 41.080  -24.869 71.016  1.00 31.01  ? 73   LEU C C     1 
ATOM   4150  O  O     . LEU C 2  73   ? 41.344  -25.649 71.933  1.00 33.86  ? 73   LEU C O     1 
ATOM   4151  C  CB    . LEU C 2  73   ? 38.616  -25.162 70.714  1.00 37.35  ? 73   LEU C CB    1 
ATOM   4152  C  CG    . LEU C 2  73   ? 37.374  -25.213 69.820  1.00 32.72  ? 73   LEU C CG    1 
ATOM   4153  C  CD1   . LEU C 2  73   ? 36.102  -25.226 70.658  1.00 24.55  ? 73   LEU C CD1   1 
ATOM   4154  C  CD2   . LEU C 2  73   ? 37.366  -24.045 68.851  1.00 27.34  ? 73   LEU C CD2   1 
ATOM   4155  N  N     . GLY C 2  74   ? 41.707  -23.712 70.843  1.00 28.03  ? 74   GLY C N     1 
ATOM   4156  C  CA    . GLY C 2  74   ? 42.837  -23.328 71.663  1.00 30.31  ? 74   GLY C CA    1 
ATOM   4157  C  C     . GLY C 2  74   ? 42.391  -22.693 72.962  1.00 34.20  ? 74   GLY C C     1 
ATOM   4158  O  O     . GLY C 2  74   ? 41.334  -23.025 73.496  1.00 34.44  ? 74   GLY C O     1 
ATOM   4159  N  N     . GLU C 2  75   ? 43.204  -21.780 73.475  1.00 36.40  ? 75   GLU C N     1 
ATOM   4160  C  CA    . GLU C 2  75   ? 42.912  -21.137 74.744  1.00 34.50  ? 75   GLU C CA    1 
ATOM   4161  C  C     . GLU C 2  75   ? 42.599  -19.667 74.511  1.00 36.41  ? 75   GLU C C     1 
ATOM   4162  O  O     . GLU C 2  75   ? 43.111  -19.061 73.571  1.00 41.15  ? 75   GLU C O     1 
ATOM   4163  C  CB    . GLU C 2  75   ? 44.110  -21.277 75.682  1.00 38.74  ? 75   GLU C CB    1 
ATOM   4164  C  CG    . GLU C 2  75   ? 44.415  -22.709 76.086  1.00 50.99  ? 75   GLU C CG    1 
ATOM   4165  C  CD    . GLU C 2  75   ? 43.431  -23.245 77.110  1.00 77.50  ? 75   GLU C CD    1 
ATOM   4166  O  OE1   . GLU C 2  75   ? 43.174  -24.469 77.107  1.00 90.33  ? 75   GLU C OE1   1 
ATOM   4167  O  OE2   . GLU C 2  75   ? 42.921  -22.443 77.924  1.00 73.90  ? 75   GLU C OE2   1 
ATOM   4168  N  N     . PRO C 2  76   ? 41.748  -19.090 75.368  1.00 36.47  ? 76   PRO C N     1 
ATOM   4169  C  CA    . PRO C 2  76   ? 41.351  -17.687 75.234  1.00 38.91  ? 76   PRO C CA    1 
ATOM   4170  C  C     . PRO C 2  76   ? 42.547  -16.748 75.309  1.00 39.60  ? 76   PRO C C     1 
ATOM   4171  O  O     . PRO C 2  76   ? 43.363  -16.883 76.218  1.00 45.02  ? 76   PRO C O     1 
ATOM   4172  C  CB    . PRO C 2  76   ? 40.448  -17.466 76.451  1.00 49.60  ? 76   PRO C CB    1 
ATOM   4173  C  CG    . PRO C 2  76   ? 39.935  -18.816 76.797  1.00 45.14  ? 76   PRO C CG    1 
ATOM   4174  C  CD    . PRO C 2  76   ? 41.050  -19.760 76.479  1.00 44.25  ? 76   PRO C CD    1 
ATOM   4175  N  N     . PRO C 2  77   ? 42.649  -15.805 74.360  1.00 41.13  ? 77   PRO C N     1 
ATOM   4176  C  CA    . PRO C 2  77   ? 43.699  -14.781 74.380  1.00 43.78  ? 77   PRO C CA    1 
ATOM   4177  C  C     . PRO C 2  77   ? 43.578  -13.849 75.583  1.00 46.60  ? 77   PRO C C     1 
ATOM   4178  O  O     . PRO C 2  77   ? 44.567  -13.228 75.972  1.00 50.46  ? 77   PRO C O     1 
ATOM   4179  C  CB    . PRO C 2  77   ? 43.461  -14.003 73.080  1.00 44.65  ? 77   PRO C CB    1 
ATOM   4180  C  CG    . PRO C 2  77   ? 42.045  -14.294 72.706  1.00 52.37  ? 77   PRO C CG    1 
ATOM   4181  C  CD    . PRO C 2  77   ? 41.797  -15.697 73.164  1.00 47.48  ? 77   PRO C CD    1 
ATOM   4182  N  N     . PHE C 2  78   ? 42.381  -13.739 76.152  1.00 45.45  ? 78   PHE C N     1 
ATOM   4183  C  CA    . PHE C 2  78   ? 42.179  -12.919 77.343  1.00 46.15  ? 78   PHE C CA    1 
ATOM   4184  C  C     . PHE C 2  78   ? 41.175  -13.556 78.305  1.00 45.59  ? 78   PHE C C     1 
ATOM   4185  O  O     . PHE C 2  78   ? 40.182  -14.139 77.871  1.00 45.33  ? 78   PHE C O     1 
ATOM   4186  C  CB    . PHE C 2  78   ? 41.705  -11.518 76.946  1.00 54.80  ? 78   PHE C CB    1 
ATOM   4187  C  CG    . PHE C 2  78   ? 42.627  -10.810 75.988  1.00 54.31  ? 78   PHE C CG    1 
ATOM   4188  C  CD1   . PHE C 2  78   ? 42.435  -10.910 74.618  1.00 49.43  ? 78   PHE C CD1   1 
ATOM   4189  C  CD2   . PHE C 2  78   ? 43.679  -10.043 76.458  1.00 41.04  ? 78   PHE C CD2   1 
ATOM   4190  C  CE1   . PHE C 2  78   ? 43.277  -10.260 73.738  1.00 46.34  ? 78   PHE C CE1   1 
ATOM   4191  C  CE2   . PHE C 2  78   ? 44.522  -9.391  75.585  1.00 39.01  ? 78   PHE C CE2   1 
ATOM   4192  C  CZ    . PHE C 2  78   ? 44.322  -9.499  74.222  1.00 47.22  ? 78   PHE C CZ    1 
ATOM   4193  N  N     . PRO C 2  79   ? 41.423  -13.428 79.619  1.00 46.41  ? 79   PRO C N     1 
ATOM   4194  C  CA    . PRO C 2  79   ? 40.527  -13.968 80.649  1.00 47.06  ? 79   PRO C CA    1 
ATOM   4195  C  C     . PRO C 2  79   ? 39.210  -13.201 80.711  1.00 48.77  ? 79   PRO C C     1 
ATOM   4196  O  O     . PRO C 2  79   ? 39.128  -12.096 80.175  1.00 53.21  ? 79   PRO C O     1 
ATOM   4197  C  CB    . PRO C 2  79   ? 41.323  -13.776 81.942  1.00 48.88  ? 79   PRO C CB    1 
ATOM   4198  C  CG    . PRO C 2  79   ? 42.241  -12.650 81.653  1.00 53.31  ? 79   PRO C CG    1 
ATOM   4199  C  CD    . PRO C 2  79   ? 42.611  -12.786 80.207  1.00 50.16  ? 79   PRO C CD    1 
ATOM   4200  N  N     . GLN C 2  80   ? 38.204  -13.784 81.357  1.00 45.74  ? 80   GLN C N     1 
ATOM   4201  C  CA    . GLN C 2  80   ? 36.850  -13.231 81.363  1.00 44.27  ? 80   GLN C CA    1 
ATOM   4202  C  C     . GLN C 2  80   ? 36.764  -11.779 81.836  1.00 52.73  ? 80   GLN C C     1 
ATOM   4203  O  O     . GLN C 2  80   ? 36.186  -10.936 81.150  1.00 52.62  ? 80   GLN C O     1 
ATOM   4204  C  CB    . GLN C 2  80   ? 35.911  -14.115 82.187  1.00 38.76  ? 80   GLN C CB    1 
ATOM   4205  C  CG    . GLN C 2  80   ? 35.659  -15.478 81.566  1.00 38.19  ? 80   GLN C CG    1 
ATOM   4206  C  CD    . GLN C 2  80   ? 34.777  -16.362 82.424  1.00 40.79  ? 80   GLN C CD    1 
ATOM   4207  O  OE1   . GLN C 2  80   ? 33.961  -15.875 83.209  1.00 39.63  ? 80   GLN C OE1   1 
ATOM   4208  N  NE2   . GLN C 2  80   ? 34.941  -17.672 82.282  1.00 37.12  ? 80   GLN C NE2   1 
ATOM   4209  N  N     . ASP C 2  81   ? 37.336  -11.496 83.004  1.00 61.69  ? 81   ASP C N     1 
ATOM   4210  C  CA    . ASP C 2  81   ? 37.328  -10.143 83.561  1.00 58.89  ? 81   ASP C CA    1 
ATOM   4211  C  C     . ASP C 2  81   ? 37.993  -9.137  82.622  1.00 50.58  ? 81   ASP C C     1 
ATOM   4212  O  O     . ASP C 2  81   ? 37.450  -8.061  82.351  1.00 53.40  ? 81   ASP C O     1 
ATOM   4213  C  CB    . ASP C 2  81   ? 38.009  -10.123 84.935  1.00 64.98  ? 81   ASP C CB    1 
ATOM   4214  C  CG    . ASP C 2  81   ? 39.220  -11.045 85.004  1.00 76.10  ? 81   ASP C CG    1 
ATOM   4215  O  OD1   . ASP C 2  81   ? 40.338  -10.548 85.268  1.00 72.61  ? 81   ASP C OD1   1 
ATOM   4216  O  OD2   . ASP C 2  81   ? 39.052  -12.269 84.806  1.00 75.42  ? 81   ASP C OD2   1 
ATOM   4217  N  N     . GLU C 2  82   ? 39.167  -9.503  82.121  1.00 48.39  ? 82   GLU C N     1 
ATOM   4218  C  CA    . GLU C 2  82   ? 39.900  -8.656  81.193  1.00 52.43  ? 82   GLU C CA    1 
ATOM   4219  C  C     . GLU C 2  82   ? 39.076  -8.393  79.936  1.00 47.43  ? 82   GLU C C     1 
ATOM   4220  O  O     . GLU C 2  82   ? 39.066  -7.279  79.408  1.00 44.98  ? 82   GLU C O     1 
ATOM   4221  C  CB    . GLU C 2  82   ? 41.235  -9.306  80.839  1.00 49.28  ? 82   GLU C CB    1 
ATOM   4222  C  CG    . GLU C 2  82   ? 42.111  -8.477  79.927  1.00 56.21  ? 82   GLU C CG    1 
ATOM   4223  C  CD    . GLU C 2  82   ? 43.555  -8.919  79.971  1.00 62.40  ? 82   GLU C CD    1 
ATOM   4224  O  OE1   . GLU C 2  82   ? 43.926  -9.629  80.931  1.00 60.04  ? 82   GLU C OE1   1 
ATOM   4225  O  OE2   . GLU C 2  82   ? 44.319  -8.556  79.050  1.00 65.85  ? 82   GLU C OE2   1 
ATOM   4226  N  N     . CYS C 2  83   ? 38.378  -9.424  79.470  1.00 43.06  ? 83   CYS C N     1 
ATOM   4227  C  CA    . CYS C 2  83   ? 37.477  -9.292  78.334  1.00 42.81  ? 83   CYS C CA    1 
ATOM   4228  C  C     . CYS C 2  83   ? 36.362  -8.299  78.637  1.00 43.70  ? 83   CYS C C     1 
ATOM   4229  O  O     . CYS C 2  83   ? 35.992  -7.487  77.787  1.00 39.98  ? 83   CYS C O     1 
ATOM   4230  C  CB    . CYS C 2  83   ? 36.875  -10.649 77.966  1.00 39.85  ? 83   CYS C CB    1 
ATOM   4231  S  SG    . CYS C 2  83   ? 37.778  -11.543 76.691  1.00 39.97  ? 83   CYS C SG    1 
ATOM   4232  N  N     . ARG C 2  84   ? 35.829  -8.372  79.851  1.00 41.12  ? 84   ARG C N     1 
ATOM   4233  C  CA    . ARG C 2  84   ? 34.764  -7.471  80.270  1.00 40.56  ? 84   ARG C CA    1 
ATOM   4234  C  C     . ARG C 2  84   ? 35.244  -6.024  80.288  1.00 43.61  ? 84   ARG C C     1 
ATOM   4235  O  O     . ARG C 2  84   ? 34.506  -5.115  79.904  1.00 42.85  ? 84   ARG C O     1 
ATOM   4236  C  CB    . ARG C 2  84   ? 34.228  -7.865  81.649  1.00 40.56  ? 84   ARG C CB    1 
ATOM   4237  C  CG    . ARG C 2  84   ? 33.374  -9.127  81.665  1.00 41.34  ? 84   ARG C CG    1 
ATOM   4238  C  CD    . ARG C 2  84   ? 32.805  -9.394  83.055  1.00 36.97  ? 84   ARG C CD    1 
ATOM   4239  N  NE    . ARG C 2  84   ? 31.786  -10.441 83.050  1.00 30.09  ? 84   ARG C NE    1 
ATOM   4240  C  CZ    . ARG C 2  84   ? 32.019  -11.716 83.344  1.00 38.84  ? 84   ARG C CZ    1 
ATOM   4241  N  NH1   . ARG C 2  84   ? 33.241  -12.110 83.674  1.00 46.09  ? 84   ARG C NH1   1 
ATOM   4242  N  NH2   . ARG C 2  84   ? 31.030  -12.598 83.311  1.00 42.10  ? 84   ARG C NH2   1 
ATOM   4243  N  N     . GLU C 2  85   ? 36.483  -5.811  80.725  1.00 42.44  ? 85   GLU C N     1 
ATOM   4244  C  CA    . GLU C 2  85   ? 36.999  -4.452  80.861  1.00 44.31  ? 85   GLU C CA    1 
ATOM   4245  C  C     . GLU C 2  85   ? 37.428  -3.833  79.531  1.00 50.63  ? 85   GLU C C     1 
ATOM   4246  O  O     . GLU C 2  85   ? 37.164  -2.657  79.272  1.00 55.19  ? 85   GLU C O     1 
ATOM   4247  C  CB    . GLU C 2  85   ? 38.159  -4.399  81.853  1.00 44.51  ? 85   GLU C CB    1 
ATOM   4248  C  CG    . GLU C 2  85   ? 38.528  -2.982  82.261  1.00 59.06  ? 85   GLU C CG    1 
ATOM   4249  C  CD    . GLU C 2  85   ? 40.023  -2.787  82.423  1.00 81.34  ? 85   GLU C CD    1 
ATOM   4250  O  OE1   . GLU C 2  85   ? 40.775  -3.777  82.294  1.00 82.06  ? 85   GLU C OE1   1 
ATOM   4251  O  OE2   . GLU C 2  85   ? 40.447  -1.638  82.674  1.00 81.84  ? 85   GLU C OE2   1 
ATOM   4252  N  N     . LYS C 2  86   ? 38.081  -4.628  78.689  1.00 48.07  ? 86   LYS C N     1 
ATOM   4253  C  CA    . LYS C 2  86   ? 38.616  -4.130  77.421  1.00 46.29  ? 86   LYS C CA    1 
ATOM   4254  C  C     . LYS C 2  86   ? 37.576  -4.137  76.301  1.00 41.65  ? 86   LYS C C     1 
ATOM   4255  O  O     . LYS C 2  86   ? 37.898  -3.845  75.150  1.00 42.93  ? 86   LYS C O     1 
ATOM   4256  C  CB    . LYS C 2  86   ? 39.864  -4.915  77.002  1.00 40.77  ? 86   LYS C CB    1 
ATOM   4257  C  CG    . LYS C 2  86   ? 41.056  -4.716  77.928  1.00 48.27  ? 86   LYS C CG    1 
ATOM   4258  C  CD    . LYS C 2  86   ? 42.336  -5.302  77.344  1.00 54.12  ? 86   LYS C CD    1 
ATOM   4259  C  CE    . LYS C 2  86   ? 43.531  -5.034  78.254  1.00 55.65  ? 86   LYS C CE    1 
ATOM   4260  N  NZ    . LYS C 2  86   ? 44.811  -5.554  77.690  1.00 45.17  ? 86   LYS C NZ    1 
ATOM   4261  N  N     . ASP C 2  87   ? 36.342  -4.492  76.651  1.00 46.10  ? 87   ASP C N     1 
ATOM   4262  C  CA    . ASP C 2  87   ? 35.228  -4.561  75.702  1.00 44.36  ? 87   ASP C CA    1 
ATOM   4263  C  C     . ASP C 2  87   ? 35.499  -5.566  74.591  1.00 41.94  ? 87   ASP C C     1 
ATOM   4264  O  O     . ASP C 2  87   ? 35.173  -5.328  73.427  1.00 40.98  ? 87   ASP C O     1 
ATOM   4265  C  CB    . ASP C 2  87   ? 34.889  -3.182  75.123  1.00 43.93  ? 87   ASP C CB    1 
ATOM   4266  C  CG    . ASP C 2  87   ? 34.127  -2.305  76.104  1.00 62.43  ? 87   ASP C CG    1 
ATOM   4267  O  OD1   . ASP C 2  87   ? 34.174  -2.583  77.324  1.00 60.45  ? 87   ASP C OD1   1 
ATOM   4268  O  OD2   . ASP C 2  87   ? 33.481  -1.334  75.653  1.00 74.85  ? 87   ASP C OD2   1 
ATOM   4269  N  N     . LEU C 2  88   ? 36.099  -6.690  74.971  1.00 37.77  ? 88   LEU C N     1 
ATOM   4270  C  CA    . LEU C 2  88   ? 36.414  -7.756  74.033  1.00 35.91  ? 88   LEU C CA    1 
ATOM   4271  C  C     . LEU C 2  88   ? 35.375  -8.863  74.098  1.00 33.85  ? 88   LEU C C     1 
ATOM   4272  O  O     . LEU C 2  88   ? 34.384  -8.761  74.818  1.00 34.37  ? 88   LEU C O     1 
ATOM   4273  C  CB    . LEU C 2  88   ? 37.793  -8.340  74.335  1.00 37.37  ? 88   LEU C CB    1 
ATOM   4274  C  CG    . LEU C 2  88   ? 38.961  -7.357  74.372  1.00 40.54  ? 88   LEU C CG    1 
ATOM   4275  C  CD1   . LEU C 2  88   ? 40.273  -8.111  74.486  1.00 40.01  ? 88   LEU C CD1   1 
ATOM   4276  C  CD2   . LEU C 2  88   ? 38.956  -6.455  73.145  1.00 45.42  ? 88   LEU C CD2   1 
ATOM   4277  N  N     . THR C 2  89   ? 35.612  -9.923  73.337  1.00 32.00  ? 89   THR C N     1 
ATOM   4278  C  CA    . THR C 2  89   ? 34.755  -11.098 73.377  1.00 34.35  ? 89   THR C CA    1 
ATOM   4279  C  C     . THR C 2  89   ? 35.540  -12.289 73.911  1.00 34.28  ? 89   THR C C     1 
ATOM   4280  O  O     . THR C 2  89   ? 36.635  -12.582 73.431  1.00 30.28  ? 89   THR C O     1 
ATOM   4281  C  CB    . THR C 2  89   ? 34.181  -11.422 71.982  1.00 32.72  ? 89   THR C CB    1 
ATOM   4282  O  OG1   . THR C 2  89   ? 33.075  -10.553 71.713  1.00 33.70  ? 89   THR C OG1   1 
ATOM   4283  C  CG2   . THR C 2  89   ? 33.701  -12.862 71.907  1.00 31.84  ? 89   THR C CG2   1 
ATOM   4284  N  N     . TYR C 2  90   ? 34.977  -12.977 74.900  1.00 33.72  ? 90   TYR C N     1 
ATOM   4285  C  CA    . TYR C 2  90   ? 35.636  -14.141 75.467  1.00 37.90  ? 90   TYR C CA    1 
ATOM   4286  C  C     . TYR C 2  90   ? 35.436  -15.293 74.496  1.00 36.67  ? 90   TYR C C     1 
ATOM   4287  O  O     . TYR C 2  90   ? 34.313  -15.741 74.269  1.00 37.11  ? 90   TYR C O     1 
ATOM   4288  C  CB    . TYR C 2  90   ? 35.021  -14.476 76.829  1.00 40.94  ? 90   TYR C CB    1 
ATOM   4289  C  CG    . TYR C 2  90   ? 35.709  -15.595 77.583  1.00 43.44  ? 90   TYR C CG    1 
ATOM   4290  C  CD1   . TYR C 2  90   ? 36.964  -15.411 78.150  1.00 42.89  ? 90   TYR C CD1   1 
ATOM   4291  C  CD2   . TYR C 2  90   ? 35.092  -16.829 77.747  1.00 37.56  ? 90   TYR C CD2   1 
ATOM   4292  C  CE1   . TYR C 2  90   ? 37.593  -16.428 78.843  1.00 44.26  ? 90   TYR C CE1   1 
ATOM   4293  C  CE2   . TYR C 2  90   ? 35.712  -17.850 78.441  1.00 41.40  ? 90   TYR C CE2   1 
ATOM   4294  C  CZ    . TYR C 2  90   ? 36.961  -17.645 78.988  1.00 46.72  ? 90   TYR C CZ    1 
ATOM   4295  O  OH    . TYR C 2  90   ? 37.581  -18.662 79.680  1.00 52.37  ? 90   TYR C OH    1 
ATOM   4296  N  N     . GLN C 2  91   ? 36.540  -15.781 73.942  1.00 35.73  ? 91   GLN C N     1 
ATOM   4297  C  CA    . GLN C 2  91   ? 36.482  -16.730 72.840  1.00 32.05  ? 91   GLN C CA    1 
ATOM   4298  C  C     . GLN C 2  91   ? 37.780  -17.516 72.696  1.00 33.39  ? 91   GLN C C     1 
ATOM   4299  O  O     . GLN C 2  91   ? 38.830  -17.098 73.185  1.00 31.14  ? 91   GLN C O     1 
ATOM   4300  C  CB    . GLN C 2  91   ? 36.188  -15.985 71.542  1.00 29.93  ? 91   GLN C CB    1 
ATOM   4301  C  CG    . GLN C 2  91   ? 37.174  -14.869 71.259  1.00 36.92  ? 91   GLN C CG    1 
ATOM   4302  C  CD    . GLN C 2  91   ? 36.788  -14.037 70.057  1.00 41.41  ? 91   GLN C CD    1 
ATOM   4303  O  OE1   . GLN C 2  91   ? 35.777  -14.300 69.404  1.00 42.72  ? 91   GLN C OE1   1 
ATOM   4304  N  NE2   . GLN C 2  91   ? 37.595  -13.027 69.754  1.00 44.95  ? 91   GLN C NE2   1 
ATOM   4305  N  N     . ALA C 2  92   ? 37.696  -18.649 72.005  1.00 34.04  ? 92   ALA C N     1 
ATOM   4306  C  CA    . ALA C 2  92   ? 38.853  -19.503 71.764  1.00 32.28  ? 92   ALA C CA    1 
ATOM   4307  C  C     . ALA C 2  92   ? 39.103  -19.619 70.269  1.00 28.56  ? 92   ALA C C     1 
ATOM   4308  O  O     . ALA C 2  92   ? 38.159  -19.646 69.478  1.00 32.96  ? 92   ALA C O     1 
ATOM   4309  C  CB    . ALA C 2  92   ? 38.628  -20.883 72.369  1.00 30.81  ? 92   ALA C CB    1 
ATOM   4310  N  N     . PRO C 2  93   ? 40.381  -19.691 69.874  1.00 30.03  ? 93   PRO C N     1 
ATOM   4311  C  CA    . PRO C 2  93   ? 40.725  -19.814 68.456  1.00 29.48  ? 93   PRO C CA    1 
ATOM   4312  C  C     . PRO C 2  93   ? 40.285  -21.162 67.904  1.00 27.60  ? 93   PRO C C     1 
ATOM   4313  O  O     . PRO C 2  93   ? 40.347  -22.160 68.619  1.00 36.18  ? 93   PRO C O     1 
ATOM   4314  C  CB    . PRO C 2  93   ? 42.252  -19.716 68.462  1.00 29.99  ? 93   PRO C CB    1 
ATOM   4315  C  CG    . PRO C 2  93   ? 42.658  -20.160 69.825  1.00 28.61  ? 93   PRO C CG    1 
ATOM   4316  C  CD    . PRO C 2  93   ? 41.575  -19.667 70.736  1.00 31.41  ? 93   PRO C CD    1 
ATOM   4317  N  N     . LEU C 2  94   ? 39.834  -21.189 66.655  1.00 23.52  ? 94   LEU C N     1 
ATOM   4318  C  CA    . LEU C 2  94   ? 39.420  -22.440 66.031  1.00 28.02  ? 94   LEU C CA    1 
ATOM   4319  C  C     . LEU C 2  94   ? 40.335  -22.816 64.873  1.00 33.19  ? 94   LEU C C     1 
ATOM   4320  O  O     . LEU C 2  94   ? 40.362  -22.136 63.845  1.00 33.97  ? 94   LEU C O     1 
ATOM   4321  C  CB    . LEU C 2  94   ? 37.972  -22.357 65.547  1.00 29.83  ? 94   LEU C CB    1 
ATOM   4322  C  CG    . LEU C 2  94   ? 37.496  -23.513 64.662  1.00 29.16  ? 94   LEU C CG    1 
ATOM   4323  C  CD1   . LEU C 2  94   ? 37.538  -24.842 65.404  1.00 28.49  ? 94   LEU C CD1   1 
ATOM   4324  C  CD2   . LEU C 2  94   ? 36.103  -23.239 64.132  1.00 27.06  ? 94   LEU C CD2   1 
ATOM   4325  N  N     . TYR C 2  95   ? 41.081  -23.905 65.047  1.00 35.53  ? 95   TYR C N     1 
ATOM   4326  C  CA    . TYR C 2  95   ? 41.993  -24.384 64.013  1.00 31.90  ? 95   TYR C CA    1 
ATOM   4327  C  C     . TYR C 2  95   ? 41.435  -25.644 63.364  1.00 30.91  ? 95   TYR C C     1 
ATOM   4328  O  O     . TYR C 2  95   ? 40.821  -26.471 64.037  1.00 32.85  ? 95   TYR C O     1 
ATOM   4329  C  CB    . TYR C 2  95   ? 43.377  -24.651 64.605  1.00 29.27  ? 95   TYR C CB    1 
ATOM   4330  C  CG    . TYR C 2  95   ? 44.051  -23.413 65.154  1.00 27.77  ? 95   TYR C CG    1 
ATOM   4331  C  CD1   . TYR C 2  95   ? 43.850  -23.011 66.466  1.00 27.60  ? 95   TYR C CD1   1 
ATOM   4332  C  CD2   . TYR C 2  95   ? 44.884  -22.644 64.356  1.00 34.94  ? 95   TYR C CD2   1 
ATOM   4333  C  CE1   . TYR C 2  95   ? 44.465  -21.878 66.969  1.00 30.03  ? 95   TYR C CE1   1 
ATOM   4334  C  CE2   . TYR C 2  95   ? 45.502  -21.509 64.848  1.00 36.86  ? 95   TYR C CE2   1 
ATOM   4335  C  CZ    . TYR C 2  95   ? 45.290  -21.130 66.155  1.00 34.84  ? 95   TYR C CZ    1 
ATOM   4336  O  OH    . TYR C 2  95   ? 45.906  -19.999 66.644  1.00 36.57  ? 95   TYR C OH    1 
ATOM   4337  N  N     . ALA C 2  96   ? 41.640  -25.787 62.058  1.00 28.22  ? 96   ALA C N     1 
ATOM   4338  C  CA    . ALA C 2  96   ? 41.097  -26.936 61.337  1.00 31.34  ? 96   ALA C CA    1 
ATOM   4339  C  C     . ALA C 2  96   ? 42.122  -27.610 60.424  1.00 46.90  ? 96   ALA C C     1 
ATOM   4340  O  O     . ALA C 2  96   ? 42.720  -26.970 59.553  1.00 44.95  ? 96   ALA C O     1 
ATOM   4341  C  CB    . ALA C 2  96   ? 39.867  -26.533 60.547  1.00 27.13  ? 96   ALA C CB    1 
ATOM   4342  N  N     . ARG C 2  97   ? 42.310  -28.912 60.626  1.00 46.68  ? 97   ARG C N     1 
ATOM   4343  C  CA    . ARG C 2  97   ? 43.261  -29.678 59.834  1.00 45.26  ? 97   ARG C CA    1 
ATOM   4344  C  C     . ARG C 2  97   ? 42.595  -30.148 58.549  1.00 42.37  ? 97   ARG C C     1 
ATOM   4345  O  O     . ARG C 2  97   ? 41.627  -30.907 58.581  1.00 38.94  ? 97   ARG C O     1 
ATOM   4346  C  CB    . ARG C 2  97   ? 43.767  -30.882 60.632  1.00 53.08  ? 97   ARG C CB    1 
ATOM   4347  C  CG    . ARG C 2  97   ? 45.014  -31.552 60.059  1.00 61.66  ? 97   ARG C CG    1 
ATOM   4348  C  CD    . ARG C 2  97   ? 46.283  -30.793 60.430  1.00 58.71  ? 97   ARG C CD    1 
ATOM   4349  N  NE    . ARG C 2  97   ? 46.335  -30.489 61.860  1.00 67.96  ? 97   ARG C NE    1 
ATOM   4350  C  CZ    . ARG C 2  97   ? 46.803  -31.317 62.790  1.00 74.86  ? 97   ARG C CZ    1 
ATOM   4351  N  NH1   . ARG C 2  97   ? 47.262  -32.514 62.447  1.00 79.64  ? 97   ARG C NH1   1 
ATOM   4352  N  NH2   . ARG C 2  97   ? 46.809  -30.948 64.067  1.00 62.42  ? 97   ARG C NH2   1 
ATOM   4353  N  N     . LEU C 2  98   ? 43.122  -29.695 57.418  1.00 44.13  ? 98   LEU C N     1 
ATOM   4354  C  CA    . LEU C 2  98   ? 42.543  -30.028 56.126  1.00 43.63  ? 98   LEU C CA    1 
ATOM   4355  C  C     . LEU C 2  98   ? 43.597  -30.609 55.192  1.00 54.09  ? 98   LEU C C     1 
ATOM   4356  O  O     . LEU C 2  98   ? 44.797  -30.422 55.405  1.00 63.47  ? 98   LEU C O     1 
ATOM   4357  C  CB    . LEU C 2  98   ? 41.932  -28.778 55.490  1.00 49.04  ? 98   LEU C CB    1 
ATOM   4358  C  CG    . LEU C 2  98   ? 40.867  -28.021 56.285  1.00 45.39  ? 98   LEU C CG    1 
ATOM   4359  C  CD1   . LEU C 2  98   ? 40.440  -26.766 55.540  1.00 36.42  ? 98   LEU C CD1   1 
ATOM   4360  C  CD2   . LEU C 2  98   ? 39.670  -28.917 56.557  1.00 41.62  ? 98   LEU C CD2   1 
ATOM   4361  N  N     . GLN C 2  99   ? 43.150  -31.315 54.156  1.00 58.98  ? 99   GLN C N     1 
ATOM   4362  C  CA    . GLN C 2  99   ? 44.066  -31.780 53.117  1.00 65.69  ? 99   GLN C CA    1 
ATOM   4363  C  C     . GLN C 2  99   ? 43.524  -31.605 51.691  1.00 62.51  ? 99   GLN C C     1 
ATOM   4364  O  O     . GLN C 2  99   ? 42.442  -32.087 51.349  1.00 56.10  ? 99   GLN C O     1 
ATOM   4365  C  CB    . GLN C 2  99   ? 44.522  -33.224 53.371  1.00 64.52  ? 99   GLN C CB    1 
ATOM   4366  C  CG    . GLN C 2  99   ? 43.434  -34.278 53.267  1.00 66.15  ? 99   GLN C CG    1 
ATOM   4367  C  CD    . GLN C 2  99   ? 43.985  -35.686 53.374  1.00 73.31  ? 99   GLN C CD    1 
ATOM   4368  O  OE1   . GLN C 2  99   ? 43.391  -36.638 52.865  1.00 68.34  ? 99   GLN C OE1   1 
ATOM   4369  N  NE2   . GLN C 2  99   ? 45.129  -35.825 54.039  1.00 67.46  ? 99   GLN C NE2   1 
ATOM   4370  N  N     . LEU C 2  100  ? 44.297  -30.895 50.875  1.00 68.47  ? 100  LEU C N     1 
ATOM   4371  C  CA    . LEU C 2  100  ? 43.993  -30.681 49.468  1.00 64.52  ? 100  LEU C CA    1 
ATOM   4372  C  C     . LEU C 2  100  ? 44.510  -31.874 48.679  1.00 63.70  ? 100  LEU C C     1 
ATOM   4373  O  O     . LEU C 2  100  ? 45.638  -32.328 48.891  1.00 72.78  ? 100  LEU C O     1 
ATOM   4374  C  CB    . LEU C 2  100  ? 44.666  -29.392 48.985  1.00 63.40  ? 100  LEU C CB    1 
ATOM   4375  C  CG    . LEU C 2  100  ? 44.202  -28.679 47.711  1.00 62.18  ? 100  LEU C CG    1 
ATOM   4376  C  CD1   . LEU C 2  100  ? 44.803  -27.285 47.659  1.00 68.78  ? 100  LEU C CD1   1 
ATOM   4377  C  CD2   . LEU C 2  100  ? 44.576  -29.447 46.457  1.00 72.23  ? 100  LEU C CD2   1 
ATOM   4378  N  N     . ILE C 2  101  ? 43.682  -32.380 47.770  1.00 60.84  ? 101  ILE C N     1 
ATOM   4379  C  CA    . ILE C 2  101  ? 44.041  -33.541 46.963  1.00 71.43  ? 101  ILE C CA    1 
ATOM   4380  C  C     . ILE C 2  101  ? 43.711  -33.329 45.488  1.00 88.40  ? 101  ILE C C     1 
ATOM   4381  O  O     . ILE C 2  101  ? 42.555  -33.105 45.134  1.00 98.89  ? 101  ILE C O     1 
ATOM   4382  C  CB    . ILE C 2  101  ? 43.298  -34.802 47.442  1.00 60.34  ? 101  ILE C CB    1 
ATOM   4383  C  CG1   . ILE C 2  101  ? 43.703  -35.153 48.873  1.00 65.38  ? 101  ILE C CG1   1 
ATOM   4384  C  CG2   . ILE C 2  101  ? 43.576  -35.968 46.513  1.00 59.39  ? 101  ILE C CG2   1 
ATOM   4385  C  CD1   . ILE C 2  101  ? 42.971  -36.346 49.433  1.00 67.22  ? 101  ILE C CD1   1 
ATOM   4386  N  N     . HIS C 2  102  ? 44.724  -33.399 44.629  1.00 89.68  ? 102  HIS C N     1 
ATOM   4387  C  CA    . HIS C 2  102  ? 44.487  -33.384 43.190  1.00 97.80  ? 102  HIS C CA    1 
ATOM   4388  C  C     . HIS C 2  102  ? 44.232  -34.819 42.733  1.00 102.68 ? 102  HIS C C     1 
ATOM   4389  O  O     . HIS C 2  102  ? 45.033  -35.712 43.010  1.00 99.18  ? 102  HIS C O     1 
ATOM   4390  C  CB    . HIS C 2  102  ? 45.681  -32.781 42.440  1.00 95.57  ? 102  HIS C CB    1 
ATOM   4391  C  CG    . HIS C 2  102  ? 45.342  -32.271 41.070  1.00 107.14 ? 102  HIS C CG    1 
ATOM   4392  N  ND1   . HIS C 2  102  ? 44.593  -32.996 40.167  1.00 107.76 ? 102  HIS C ND1   1 
ATOM   4393  C  CD2   . HIS C 2  102  ? 45.655  -31.109 40.449  1.00 100.80 ? 102  HIS C CD2   1 
ATOM   4394  C  CE1   . HIS C 2  102  ? 44.456  -32.302 39.052  1.00 99.77  ? 102  HIS C CE1   1 
ATOM   4395  N  NE2   . HIS C 2  102  ? 45.090  -31.152 39.197  1.00 98.95  ? 102  HIS C NE2   1 
ATOM   4396  N  N     . LYS C 2  103  ? 43.108  -35.040 42.056  1.00 105.09 ? 103  LYS C N     1 
ATOM   4397  C  CA    . LYS C 2  103  ? 42.743  -36.375 41.589  1.00 104.55 ? 103  LYS C CA    1 
ATOM   4398  C  C     . LYS C 2  103  ? 43.800  -36.946 40.649  1.00 113.60 ? 103  LYS C C     1 
ATOM   4399  O  O     . LYS C 2  103  ? 44.368  -38.008 40.908  1.00 115.56 ? 103  LYS C O     1 
ATOM   4400  C  CB    . LYS C 2  103  ? 41.393  -36.345 40.867  1.00 107.86 ? 103  LYS C CB    1 
ATOM   4401  C  CG    . LYS C 2  103  ? 40.202  -36.012 41.747  1.00 106.17 ? 103  LYS C CG    1 
ATOM   4402  C  CD    . LYS C 2  103  ? 38.950  -35.810 40.904  1.00 105.41 ? 103  LYS C CD    1 
ATOM   4403  C  CE    . LYS C 2  103  ? 37.785  -35.313 41.745  1.00 110.76 ? 103  LYS C CE    1 
ATOM   4404  N  NZ    . LYS C 2  103  ? 36.575  -35.052 40.917  1.00 116.44 ? 103  LYS C NZ    1 
ATOM   4405  N  N     . ASP C 2  104  ? 44.057  -36.230 39.560  1.00 111.17 ? 104  ASP C N     1 
ATOM   4406  C  CA    . ASP C 2  104  ? 45.005  -36.675 38.546  1.00 105.76 ? 104  ASP C CA    1 
ATOM   4407  C  C     . ASP C 2  104  ? 46.436  -36.765 39.072  1.00 112.02 ? 104  ASP C C     1 
ATOM   4408  O  O     . ASP C 2  104  ? 47.054  -37.830 39.029  1.00 114.74 ? 104  ASP C O     1 
ATOM   4409  C  CB    . ASP C 2  104  ? 44.950  -35.749 37.330  1.00 107.85 ? 104  ASP C CB    1 
ATOM   4410  C  CG    . ASP C 2  104  ? 43.562  -35.662 36.730  1.00 118.57 ? 104  ASP C CG    1 
ATOM   4411  O  OD1   . ASP C 2  104  ? 42.835  -36.678 36.761  1.00 118.99 ? 104  ASP C OD1   1 
ATOM   4412  O  OD2   . ASP C 2  104  ? 43.196  -34.577 36.230  1.00 126.23 ? 104  ASP C OD2   1 
ATOM   4413  N  N     . THR C 2  105  ? 46.949  -35.646 39.577  1.00 114.25 ? 105  THR C N     1 
ATOM   4414  C  CA    . THR C 2  105  ? 48.339  -35.558 40.023  1.00 108.92 ? 105  THR C CA    1 
ATOM   4415  C  C     . THR C 2  105  ? 48.629  -36.494 41.194  1.00 101.23 ? 105  THR C C     1 
ATOM   4416  O  O     . THR C 2  105  ? 49.733  -37.023 41.321  1.00 96.14  ? 105  THR C O     1 
ATOM   4417  C  CB    . THR C 2  105  ? 48.708  -34.112 40.430  1.00 97.28  ? 105  THR C CB    1 
ATOM   4418  O  OG1   . THR C 2  105  ? 48.306  -33.204 39.397  1.00 100.30 ? 105  THR C OG1   1 
ATOM   4419  C  CG2   . THR C 2  105  ? 50.207  -33.979 40.659  1.00 87.68  ? 105  THR C CG2   1 
ATOM   4420  N  N     . GLY C 2  106  ? 47.629  -36.699 42.044  1.00 104.27 ? 106  GLY C N     1 
ATOM   4421  C  CA    . GLY C 2  106  ? 47.808  -37.483 43.251  1.00 101.57 ? 106  GLY C CA    1 
ATOM   4422  C  C     . GLY C 2  106  ? 48.477  -36.659 44.335  1.00 107.91 ? 106  GLY C C     1 
ATOM   4423  O  O     . GLY C 2  106  ? 48.755  -37.158 45.427  1.00 105.10 ? 106  GLY C O     1 
ATOM   4424  N  N     . LEU C 2  107  ? 48.733  -35.390 44.025  1.00 112.12 ? 107  LEU C N     1 
ATOM   4425  C  CA    . LEU C 2  107  ? 49.375  -34.468 44.957  1.00 103.47 ? 107  LEU C CA    1 
ATOM   4426  C  C     . LEU C 2  107  ? 48.515  -34.237 46.194  1.00 94.95  ? 107  LEU C C     1 
ATOM   4427  O  O     . LEU C 2  107  ? 47.342  -33.873 46.091  1.00 87.17  ? 107  LEU C O     1 
ATOM   4428  C  CB    . LEU C 2  107  ? 49.668  -33.132 44.268  1.00 105.51 ? 107  LEU C CB    1 
ATOM   4429  C  CG    . LEU C 2  107  ? 50.279  -32.030 45.136  1.00 104.33 ? 107  LEU C CG    1 
ATOM   4430  C  CD1   . LEU C 2  107  ? 51.626  -32.470 45.693  1.00 98.49  ? 107  LEU C CD1   1 
ATOM   4431  C  CD2   . LEU C 2  107  ? 50.413  -30.730 44.351  1.00 102.44 ? 107  LEU C CD2   1 
ATOM   4432  N  N     . ILE C 2  108  ? 49.111  -34.446 47.363  1.00 89.71  ? 108  ILE C N     1 
ATOM   4433  C  CA    . ILE C 2  108  ? 48.405  -34.296 48.628  1.00 82.69  ? 108  ILE C CA    1 
ATOM   4434  C  C     . ILE C 2  108  ? 49.109  -33.280 49.521  1.00 78.06  ? 108  ILE C C     1 
ATOM   4435  O  O     . ILE C 2  108  ? 50.280  -33.446 49.861  1.00 83.72  ? 108  ILE C O     1 
ATOM   4436  C  CB    . ILE C 2  108  ? 48.299  -35.641 49.371  1.00 75.04  ? 108  ILE C CB    1 
ATOM   4437  C  CG1   . ILE C 2  108  ? 47.526  -36.654 48.524  1.00 77.84  ? 108  ILE C CG1   1 
ATOM   4438  C  CG2   . ILE C 2  108  ? 47.633  -35.453 50.722  1.00 68.68  ? 108  ILE C CG2   1 
ATOM   4439  C  CD1   . ILE C 2  108  ? 47.425  -38.024 49.152  1.00 77.80  ? 108  ILE C CD1   1 
ATOM   4440  N  N     . LYS C 2  109  ? 48.391  -32.227 49.895  1.00 68.14  ? 109  LYS C N     1 
ATOM   4441  C  CA    . LYS C 2  109  ? 48.959  -31.180 50.739  1.00 71.42  ? 109  LYS C CA    1 
ATOM   4442  C  C     . LYS C 2  109  ? 48.129  -31.000 52.012  1.00 72.28  ? 109  LYS C C     1 
ATOM   4443  O  O     . LYS C 2  109  ? 46.947  -30.680 51.945  1.00 74.47  ? 109  LYS C O     1 
ATOM   4444  C  CB    . LYS C 2  109  ? 49.061  -29.867 49.953  1.00 67.24  ? 109  LYS C CB    1 
ATOM   4445  C  CG    . LYS C 2  109  ? 49.218  -28.612 50.805  1.00 79.02  ? 109  LYS C CG    1 
ATOM   4446  C  CD    . LYS C 2  109  ? 50.578  -28.526 51.484  1.00 73.96  ? 109  LYS C CD    1 
ATOM   4447  C  CE    . LYS C 2  109  ? 50.672  -27.273 52.345  1.00 63.95  ? 109  LYS C CE    1 
ATOM   4448  N  NZ    . LYS C 2  109  ? 52.013  -27.113 52.974  1.00 72.77  ? 109  LYS C NZ    1 
ATOM   4449  N  N     . GLU C 2  110  ? 48.750  -31.207 53.169  1.00 66.69  ? 110  GLU C N     1 
ATOM   4450  C  CA    . GLU C 2  110  ? 48.034  -31.159 54.444  1.00 61.34  ? 110  GLU C CA    1 
ATOM   4451  C  C     . GLU C 2  110  ? 48.421  -29.947 55.288  1.00 62.22  ? 110  GLU C C     1 
ATOM   4452  O  O     . GLU C 2  110  ? 49.604  -29.686 55.504  1.00 66.19  ? 110  GLU C O     1 
ATOM   4453  C  CB    . GLU C 2  110  ? 48.278  -32.448 55.227  1.00 55.00  ? 110  GLU C CB    1 
ATOM   4454  C  CG    . GLU C 2  110  ? 47.738  -32.435 56.640  1.00 62.56  ? 110  GLU C CG    1 
ATOM   4455  C  CD    . GLU C 2  110  ? 47.846  -33.792 57.304  1.00 79.14  ? 110  GLU C CD    1 
ATOM   4456  O  OE1   . GLU C 2  110  ? 47.813  -33.852 58.554  1.00 82.63  ? 110  GLU C OE1   1 
ATOM   4457  O  OE2   . GLU C 2  110  ? 47.959  -34.800 56.573  1.00 72.76  ? 110  GLU C OE2   1 
ATOM   4458  N  N     . ASP C 2  111  ? 47.424  -29.208 55.767  1.00 56.75  ? 111  ASP C N     1 
ATOM   4459  C  CA    . ASP C 2  111  ? 47.700  -27.995 56.531  1.00 55.72  ? 111  ASP C CA    1 
ATOM   4460  C  C     . ASP C 2  111  ? 46.608  -27.642 57.549  1.00 50.33  ? 111  ASP C C     1 
ATOM   4461  O  O     . ASP C 2  111  ? 45.422  -27.900 57.328  1.00 52.07  ? 111  ASP C O     1 
ATOM   4462  C  CB    . ASP C 2  111  ? 47.935  -26.822 55.573  1.00 66.61  ? 111  ASP C CB    1 
ATOM   4463  C  CG    . ASP C 2  111  ? 48.861  -25.769 56.152  1.00 74.64  ? 111  ASP C CG    1 
ATOM   4464  O  OD1   . ASP C 2  111  ? 48.744  -24.589 55.754  1.00 68.60  ? 111  ASP C OD1   1 
ATOM   4465  O  OD2   . ASP C 2  111  ? 49.709  -26.122 57.001  1.00 75.48  ? 111  ASP C OD2   1 
ATOM   4466  N  N     . GLU C 2  112  ? 47.022  -27.045 58.663  1.00 43.89  ? 112  GLU C N     1 
ATOM   4467  C  CA    . GLU C 2  112  ? 46.089  -26.554 59.671  1.00 38.41  ? 112  GLU C CA    1 
ATOM   4468  C  C     . GLU C 2  112  ? 45.803  -25.081 59.422  1.00 46.47  ? 112  GLU C C     1 
ATOM   4469  O  O     . GLU C 2  112  ? 46.694  -24.241 59.549  1.00 50.62  ? 112  GLU C O     1 
ATOM   4470  C  CB    . GLU C 2  112  ? 46.660  -26.747 61.081  1.00 34.70  ? 112  GLU C CB    1 
ATOM   4471  C  CG    . GLU C 2  112  ? 45.834  -26.096 62.192  1.00 40.76  ? 112  GLU C CG    1 
ATOM   4472  C  CD    . GLU C 2  112  ? 46.296  -26.477 63.602  1.00 44.95  ? 112  GLU C CD    1 
ATOM   4473  O  OE1   . GLU C 2  112  ? 47.198  -25.805 64.150  1.00 35.97  ? 112  GLU C OE1   1 
ATOM   4474  O  OE2   . GLU C 2  112  ? 45.744  -27.444 64.170  1.00 42.63  ? 112  GLU C OE2   1 
ATOM   4475  N  N     . VAL C 2  113  ? 44.556  -24.770 59.073  1.00 45.24  ? 113  VAL C N     1 
ATOM   4476  C  CA    . VAL C 2  113  ? 44.164  -23.395 58.767  1.00 35.74  ? 113  VAL C CA    1 
ATOM   4477  C  C     . VAL C 2  113  ? 43.384  -22.761 59.913  1.00 37.56  ? 113  VAL C C     1 
ATOM   4478  O  O     . VAL C 2  113  ? 42.649  -23.438 60.635  1.00 38.14  ? 113  VAL C O     1 
ATOM   4479  C  CB    . VAL C 2  113  ? 43.318  -23.314 57.484  1.00 36.36  ? 113  VAL C CB    1 
ATOM   4480  C  CG1   . VAL C 2  113  ? 44.152  -23.686 56.276  1.00 48.80  ? 113  VAL C CG1   1 
ATOM   4481  C  CG2   . VAL C 2  113  ? 42.109  -24.221 57.591  1.00 43.84  ? 113  VAL C CG2   1 
ATOM   4482  N  N     . PHE C 2  114  ? 43.560  -21.455 60.074  1.00 45.58  ? 114  PHE C N     1 
ATOM   4483  C  CA    . PHE C 2  114  ? 42.914  -20.714 61.151  1.00 41.86  ? 114  PHE C CA    1 
ATOM   4484  C  C     . PHE C 2  114  ? 41.536  -20.216 60.716  1.00 45.02  ? 114  PHE C C     1 
ATOM   4485  O  O     . PHE C 2  114  ? 41.418  -19.422 59.782  1.00 49.14  ? 114  PHE C O     1 
ATOM   4486  C  CB    . PHE C 2  114  ? 43.800  -19.543 61.579  1.00 36.27  ? 114  PHE C CB    1 
ATOM   4487  C  CG    . PHE C 2  114  ? 43.142  -18.601 62.541  1.00 39.74  ? 114  PHE C CG    1 
ATOM   4488  C  CD1   . PHE C 2  114  ? 43.058  -18.911 63.887  1.00 37.39  ? 114  PHE C CD1   1 
ATOM   4489  C  CD2   . PHE C 2  114  ? 42.619  -17.395 62.101  1.00 47.06  ? 114  PHE C CD2   1 
ATOM   4490  C  CE1   . PHE C 2  114  ? 42.457  -18.042 64.777  1.00 36.72  ? 114  PHE C CE1   1 
ATOM   4491  C  CE2   . PHE C 2  114  ? 42.018  -16.522 62.987  1.00 50.55  ? 114  PHE C CE2   1 
ATOM   4492  C  CZ    . PHE C 2  114  ? 41.938  -16.846 64.327  1.00 41.01  ? 114  PHE C CZ    1 
ATOM   4493  N  N     . LEU C 2  115  ? 40.501  -20.690 61.404  1.00 38.50  ? 115  LEU C N     1 
ATOM   4494  C  CA    . LEU C 2  115  ? 39.118  -20.404 61.029  1.00 35.79  ? 115  LEU C CA    1 
ATOM   4495  C  C     . LEU C 2  115  ? 38.466  -19.229 61.760  1.00 39.75  ? 115  LEU C C     1 
ATOM   4496  O  O     . LEU C 2  115  ? 37.273  -18.985 61.595  1.00 49.85  ? 115  LEU C O     1 
ATOM   4497  C  CB    . LEU C 2  115  ? 38.254  -21.654 61.179  1.00 31.77  ? 115  LEU C CB    1 
ATOM   4498  C  CG    . LEU C 2  115  ? 38.643  -22.807 60.258  1.00 30.84  ? 115  LEU C CG    1 
ATOM   4499  C  CD1   . LEU C 2  115  ? 37.533  -23.841 60.208  1.00 30.35  ? 115  LEU C CD1   1 
ATOM   4500  C  CD2   . LEU C 2  115  ? 38.965  -22.292 58.870  1.00 31.82  ? 115  LEU C CD2   1 
ATOM   4501  N  N     . GLY C 2  116  ? 39.237  -18.506 62.564  1.00 33.31  ? 116  GLY C N     1 
ATOM   4502  C  CA    . GLY C 2  116  ? 38.679  -17.446 63.384  1.00 33.39  ? 116  GLY C CA    1 
ATOM   4503  C  C     . GLY C 2  116  ? 38.385  -17.930 64.790  1.00 38.38  ? 116  GLY C C     1 
ATOM   4504  O  O     . GLY C 2  116  ? 38.989  -18.897 65.251  1.00 45.90  ? 116  GLY C O     1 
ATOM   4505  N  N     . HIS C 2  117  ? 37.463  -17.265 65.479  1.00 37.23  ? 117  HIS C N     1 
ATOM   4506  C  CA    . HIS C 2  117  ? 37.220  -17.559 66.890  1.00 32.54  ? 117  HIS C CA    1 
ATOM   4507  C  C     . HIS C 2  117  ? 35.788  -17.981 67.215  1.00 32.29  ? 117  HIS C C     1 
ATOM   4508  O  O     . HIS C 2  117  ? 34.834  -17.522 66.585  1.00 32.81  ? 117  HIS C O     1 
ATOM   4509  C  CB    . HIS C 2  117  ? 37.595  -16.350 67.745  1.00 33.04  ? 117  HIS C CB    1 
ATOM   4510  C  CG    . HIS C 2  117  ? 39.065  -16.089 67.808  1.00 31.70  ? 117  HIS C CG    1 
ATOM   4511  N  ND1   . HIS C 2  117  ? 39.786  -16.178 68.979  1.00 36.39  ? 117  HIS C ND1   1 
ATOM   4512  C  CD2   . HIS C 2  117  ? 39.952  -15.746 66.845  1.00 37.63  ? 117  HIS C CD2   1 
ATOM   4513  C  CE1   . HIS C 2  117  ? 41.054  -15.900 68.735  1.00 40.84  ? 117  HIS C CE1   1 
ATOM   4514  N  NE2   . HIS C 2  117  ? 41.181  -15.635 67.447  1.00 46.92  ? 117  HIS C NE2   1 
ATOM   4515  N  N     . ILE C 2  118  ? 35.655  -18.868 68.198  1.00 26.55  ? 118  ILE C N     1 
ATOM   4516  C  CA    . ILE C 2  118  ? 34.354  -19.240 68.749  1.00 29.23  ? 118  ILE C CA    1 
ATOM   4517  C  C     . ILE C 2  118  ? 34.220  -18.808 70.210  1.00 31.92  ? 118  ILE C C     1 
ATOM   4518  O  O     . ILE C 2  118  ? 35.026  -19.209 71.051  1.00 31.67  ? 118  ILE C O     1 
ATOM   4519  C  CB    . ILE C 2  118  ? 34.094  -20.753 68.653  1.00 27.26  ? 118  ILE C CB    1 
ATOM   4520  C  CG1   . ILE C 2  118  ? 34.071  -21.199 67.197  1.00 28.00  ? 118  ILE C CG1   1 
ATOM   4521  C  CG2   . ILE C 2  118  ? 32.769  -21.111 69.311  1.00 28.58  ? 118  ILE C CG2   1 
ATOM   4522  C  CD1   . ILE C 2  118  ? 33.664  -22.638 67.032  1.00 41.49  ? 118  ILE C CD1   1 
ATOM   4523  N  N     . PRO C 2  119  ? 33.208  -17.978 70.515  1.00 27.41  ? 119  PRO C N     1 
ATOM   4524  C  CA    . PRO C 2  119  ? 32.972  -17.531 71.892  1.00 29.37  ? 119  PRO C CA    1 
ATOM   4525  C  C     . PRO C 2  119  ? 32.795  -18.706 72.857  1.00 29.76  ? 119  PRO C C     1 
ATOM   4526  O  O     . PRO C 2  119  ? 32.174  -19.708 72.503  1.00 28.00  ? 119  PRO C O     1 
ATOM   4527  C  CB    . PRO C 2  119  ? 31.670  -16.732 71.779  1.00 27.41  ? 119  PRO C CB    1 
ATOM   4528  C  CG    . PRO C 2  119  ? 31.621  -16.288 70.362  1.00 22.16  ? 119  PRO C CG    1 
ATOM   4529  C  CD    . PRO C 2  119  ? 32.221  -17.416 69.579  1.00 24.18  ? 119  PRO C CD    1 
ATOM   4530  N  N     . LEU C 2  120  ? 33.349  -18.583 74.059  1.00 33.74  ? 120  LEU C N     1 
ATOM   4531  C  CA    . LEU C 2  120  ? 33.252  -19.643 75.059  1.00 31.71  ? 120  LEU C CA    1 
ATOM   4532  C  C     . LEU C 2  120  ? 32.202  -19.304 76.102  1.00 30.91  ? 120  LEU C C     1 
ATOM   4533  O  O     . LEU C 2  120  ? 32.048  -18.140 76.478  1.00 35.71  ? 120  LEU C O     1 
ATOM   4534  C  CB    . LEU C 2  120  ? 34.600  -19.857 75.749  1.00 29.22  ? 120  LEU C CB    1 
ATOM   4535  C  CG    . LEU C 2  120  ? 35.754  -20.363 74.886  1.00 27.05  ? 120  LEU C CG    1 
ATOM   4536  C  CD1   . LEU C 2  120  ? 36.983  -20.578 75.743  1.00 29.31  ? 120  LEU C CD1   1 
ATOM   4537  C  CD2   . LEU C 2  120  ? 35.366  -21.645 74.170  1.00 27.32  ? 120  LEU C CD2   1 
ATOM   4538  N  N     . MET C 2  121  ? 31.479  -20.318 76.569  1.00 25.54  ? 121  MET C N     1 
ATOM   4539  C  CA    . MET C 2  121  ? 30.507  -20.121 77.635  1.00 23.04  ? 121  MET C CA    1 
ATOM   4540  C  C     . MET C 2  121  ? 31.210  -20.110 78.981  1.00 23.36  ? 121  MET C C     1 
ATOM   4541  O  O     . MET C 2  121  ? 32.040  -20.973 79.257  1.00 27.90  ? 121  MET C O     1 
ATOM   4542  C  CB    . MET C 2  121  ? 29.436  -21.210 77.615  1.00 21.26  ? 121  MET C CB    1 
ATOM   4543  C  CG    . MET C 2  121  ? 28.512  -21.177 78.821  1.00 25.79  ? 121  MET C CG    1 
ATOM   4544  S  SD    . MET C 2  121  ? 27.124  -22.321 78.699  1.00 22.36  ? 121  MET C SD    1 
ATOM   4545  C  CE    . MET C 2  121  ? 26.367  -21.754 77.184  1.00 23.55  ? 121  MET C CE    1 
ATOM   4546  N  N     . THR C 2  122  ? 30.882  -19.128 79.814  1.00 25.18  ? 122  THR C N     1 
ATOM   4547  C  CA    . THR C 2  122  ? 31.488  -19.024 81.132  1.00 27.08  ? 122  THR C CA    1 
ATOM   4548  C  C     . THR C 2  122  ? 30.912  -20.090 82.050  1.00 32.66  ? 122  THR C C     1 
ATOM   4549  O  O     . THR C 2  122  ? 30.032  -20.857 81.653  1.00 30.52  ? 122  THR C O     1 
ATOM   4550  C  CB    . THR C 2  122  ? 31.253  -17.645 81.765  1.00 25.83  ? 122  THR C CB    1 
ATOM   4551  O  OG1   . THR C 2  122  ? 29.960  -17.611 82.379  1.00 31.96  ? 122  THR C OG1   1 
ATOM   4552  C  CG2   . THR C 2  122  ? 31.349  -16.554 80.714  1.00 24.13  ? 122  THR C CG2   1 
ATOM   4553  N  N     . GLU C 2  123  ? 31.405  -20.126 83.282  1.00 35.41  ? 123  GLU C N     1 
ATOM   4554  C  CA    . GLU C 2  123  ? 31.017  -21.166 84.222  1.00 39.85  ? 123  GLU C CA    1 
ATOM   4555  C  C     . GLU C 2  123  ? 29.524  -21.110 84.529  1.00 35.29  ? 123  GLU C C     1 
ATOM   4556  O  O     . GLU C 2  123  ? 28.849  -22.140 84.536  1.00 34.82  ? 123  GLU C O     1 
ATOM   4557  C  CB    . GLU C 2  123  ? 31.835  -21.056 85.509  1.00 48.18  ? 123  GLU C CB    1 
ATOM   4558  C  CG    . GLU C 2  123  ? 31.743  -22.278 86.409  1.00 49.95  ? 123  GLU C CG    1 
ATOM   4559  C  CD    . GLU C 2  123  ? 32.405  -22.060 87.758  1.00 63.57  ? 123  GLU C CD    1 
ATOM   4560  O  OE1   . GLU C 2  123  ? 32.386  -22.995 88.589  1.00 67.18  ? 123  GLU C OE1   1 
ATOM   4561  O  OE2   . GLU C 2  123  ? 32.941  -20.954 87.988  1.00 63.60  ? 123  GLU C OE2   1 
ATOM   4562  N  N     . ASP C 2  124  ? 29.007  -19.906 84.760  1.00 31.53  ? 124  ASP C N     1 
ATOM   4563  C  CA    . ASP C 2  124  ? 27.601  -19.738 85.131  1.00 34.86  ? 124  ASP C CA    1 
ATOM   4564  C  C     . ASP C 2  124  ? 26.631  -19.972 83.970  1.00 32.94  ? 124  ASP C C     1 
ATOM   4565  O  O     . ASP C 2  124  ? 25.415  -19.924 84.149  1.00 34.43  ? 124  ASP C O     1 
ATOM   4566  C  CB    . ASP C 2  124  ? 27.346  -18.390 85.825  1.00 34.15  ? 124  ASP C CB    1 
ATOM   4567  C  CG    . ASP C 2  124  ? 27.413  -17.214 84.875  1.00 38.95  ? 124  ASP C CG    1 
ATOM   4568  O  OD1   . ASP C 2  124  ? 28.515  -16.656 84.686  1.00 45.13  ? 124  ASP C OD1   1 
ATOM   4569  O  OD2   . ASP C 2  124  ? 26.357  -16.836 84.328  1.00 37.74  ? 124  ASP C OD2   1 
ATOM   4570  N  N     . GLY C 2  125  ? 27.174  -20.230 82.784  1.00 31.76  ? 125  GLY C N     1 
ATOM   4571  C  CA    . GLY C 2  125  ? 26.353  -20.546 81.629  1.00 30.39  ? 125  GLY C CA    1 
ATOM   4572  C  C     . GLY C 2  125  ? 25.936  -19.350 80.797  1.00 36.17  ? 125  GLY C C     1 
ATOM   4573  O  O     . GLY C 2  125  ? 24.880  -19.361 80.160  1.00 34.50  ? 125  GLY C O     1 
ATOM   4574  N  N     . SER C 2  126  ? 26.764  -18.311 80.811  1.00 33.60  ? 126  SER C N     1 
ATOM   4575  C  CA    . SER C 2  126  ? 26.518  -17.117 80.012  1.00 26.34  ? 126  SER C CA    1 
ATOM   4576  C  C     . SER C 2  126  ? 27.630  -16.923 78.987  1.00 23.69  ? 126  SER C C     1 
ATOM   4577  O  O     . SER C 2  126  ? 28.507  -17.769 78.851  1.00 29.37  ? 126  SER C O     1 
ATOM   4578  C  CB    . SER C 2  126  ? 26.408  -15.886 80.913  1.00 34.65  ? 126  SER C CB    1 
ATOM   4579  O  OG    . SER C 2  126  ? 27.568  -15.737 81.715  1.00 38.89  ? 126  SER C OG    1 
ATOM   4580  N  N     . PHE C 2  127  ? 27.575  -15.813 78.258  1.00 25.44  ? 127  PHE C N     1 
ATOM   4581  C  CA    . PHE C 2  127  ? 28.615  -15.450 77.301  1.00 23.75  ? 127  PHE C CA    1 
ATOM   4582  C  C     . PHE C 2  127  ? 29.071  -14.012 77.517  1.00 25.48  ? 127  PHE C C     1 
ATOM   4583  O  O     . PHE C 2  127  ? 28.367  -13.217 78.136  1.00 28.45  ? 127  PHE C O     1 
ATOM   4584  C  CB    . PHE C 2  127  ? 28.095  -15.579 75.874  1.00 22.12  ? 127  PHE C CB    1 
ATOM   4585  C  CG    . PHE C 2  127  ? 27.916  -16.991 75.413  1.00 23.22  ? 127  PHE C CG    1 
ATOM   4586  C  CD1   . PHE C 2  127  ? 26.682  -17.604 75.485  1.00 24.21  ? 127  PHE C CD1   1 
ATOM   4587  C  CD2   . PHE C 2  127  ? 28.980  -17.698 74.887  1.00 28.69  ? 127  PHE C CD2   1 
ATOM   4588  C  CE1   . PHE C 2  127  ? 26.514  -18.900 75.048  1.00 24.72  ? 127  PHE C CE1   1 
ATOM   4589  C  CE2   . PHE C 2  127  ? 28.818  -18.996 74.450  1.00 25.65  ? 127  PHE C CE2   1 
ATOM   4590  C  CZ    . PHE C 2  127  ? 27.585  -19.597 74.531  1.00 23.65  ? 127  PHE C CZ    1 
ATOM   4591  N  N     . ILE C 2  128  ? 30.251  -13.678 77.006  1.00 25.18  ? 128  ILE C N     1 
ATOM   4592  C  CA    . ILE C 2  128  ? 30.688  -12.288 76.976  1.00 26.73  ? 128  ILE C CA    1 
ATOM   4593  C  C     . ILE C 2  128  ? 30.929  -11.885 75.531  1.00 32.39  ? 128  ILE C C     1 
ATOM   4594  O  O     . ILE C 2  128  ? 31.875  -12.355 74.900  1.00 37.77  ? 128  ILE C O     1 
ATOM   4595  C  CB    . ILE C 2  128  ? 31.985  -12.068 77.779  1.00 27.19  ? 128  ILE C CB    1 
ATOM   4596  C  CG1   . ILE C 2  128  ? 31.807  -12.517 79.230  1.00 34.73  ? 128  ILE C CG1   1 
ATOM   4597  C  CG2   . ILE C 2  128  ? 32.394  -10.607 77.734  1.00 26.75  ? 128  ILE C CG2   1 
ATOM   4598  C  CD1   . ILE C 2  128  ? 33.075  -12.439 80.053  1.00 32.43  ? 128  ILE C CD1   1 
ATOM   4599  N  N     . ILE C 2  129  ? 30.077  -11.009 75.009  1.00 30.33  ? 129  ILE C N     1 
ATOM   4600  C  CA    . ILE C 2  129  ? 30.182  -10.589 73.617  1.00 29.64  ? 129  ILE C CA    1 
ATOM   4601  C  C     . ILE C 2  129  ? 30.437  -9.092  73.512  1.00 33.22  ? 129  ILE C C     1 
ATOM   4602  O  O     . ILE C 2  129  ? 29.589  -8.281  73.890  1.00 32.99  ? 129  ILE C O     1 
ATOM   4603  C  CB    . ILE C 2  129  ? 28.915  -10.939 72.824  1.00 25.26  ? 129  ILE C CB    1 
ATOM   4604  C  CG1   . ILE C 2  129  ? 28.615  -12.431 72.936  1.00 23.64  ? 129  ILE C CG1   1 
ATOM   4605  C  CG2   . ILE C 2  129  ? 29.079  -10.546 71.368  1.00 29.25  ? 129  ILE C CG2   1 
ATOM   4606  C  CD1   . ILE C 2  129  ? 29.717  -13.307 72.399  1.00 27.26  ? 129  ILE C CD1   1 
ATOM   4607  N  N     . ASN C 2  130  ? 31.612  -8.741  72.998  1.00 31.36  ? 130  ASN C N     1 
ATOM   4608  C  CA    . ASN C 2  130  ? 32.031  -7.348  72.869  1.00 34.33  ? 130  ASN C CA    1 
ATOM   4609  C  C     . ASN C 2  130  ? 32.025  -6.611  74.208  1.00 39.14  ? 130  ASN C C     1 
ATOM   4610  O  O     . ASN C 2  130  ? 31.826  -5.397  74.263  1.00 42.23  ? 130  ASN C O     1 
ATOM   4611  C  CB    . ASN C 2  130  ? 31.188  -6.609  71.823  1.00 35.99  ? 130  ASN C CB    1 
ATOM   4612  C  CG    . ASN C 2  130  ? 31.502  -7.049  70.400  1.00 47.17  ? 130  ASN C CG    1 
ATOM   4613  O  OD1   . ASN C 2  130  ? 32.665  -7.094  69.991  1.00 44.62  ? 130  ASN C OD1   1 
ATOM   4614  N  ND2   . ASN C 2  130  ? 30.463  -7.381  69.640  1.00 42.72  ? 130  ASN C ND2   1 
ATOM   4615  N  N     . GLY C 2  131  ? 32.243  -7.362  75.285  1.00 33.88  ? 131  GLY C N     1 
ATOM   4616  C  CA    . GLY C 2  131  ? 32.361  -6.788  76.611  1.00 35.57  ? 131  GLY C CA    1 
ATOM   4617  C  C     . GLY C 2  131  ? 31.109  -6.936  77.448  1.00 33.71  ? 131  GLY C C     1 
ATOM   4618  O  O     . GLY C 2  131  ? 31.155  -6.835  78.676  1.00 37.41  ? 131  GLY C O     1 
ATOM   4619  N  N     . ALA C 2  132  ? 29.986  -7.180  76.784  1.00 29.72  ? 132  ALA C N     1 
ATOM   4620  C  CA    . ALA C 2  132  ? 28.705  -7.279  77.472  1.00 31.68  ? 132  ALA C CA    1 
ATOM   4621  C  C     . ALA C 2  132  ? 28.334  -8.725  77.765  1.00 29.80  ? 132  ALA C C     1 
ATOM   4622  O  O     . ALA C 2  132  ? 28.566  -9.612  76.946  1.00 34.62  ? 132  ALA C O     1 
ATOM   4623  C  CB    . ALA C 2  132  ? 27.619  -6.614  76.649  1.00 34.50  ? 132  ALA C CB    1 
ATOM   4624  N  N     . ASP C 2  133  ? 27.756  -8.962  78.937  1.00 27.88  ? 133  ASP C N     1 
ATOM   4625  C  CA    . ASP C 2  133  ? 27.274  -10.292 79.280  1.00 28.95  ? 133  ASP C CA    1 
ATOM   4626  C  C     . ASP C 2  133  ? 25.976  -10.571 78.539  1.00 25.10  ? 133  ASP C C     1 
ATOM   4627  O  O     . ASP C 2  133  ? 25.025  -9.799  78.630  1.00 24.52  ? 133  ASP C O     1 
ATOM   4628  C  CB    . ASP C 2  133  ? 27.052  -10.422 80.787  1.00 39.16  ? 133  ASP C CB    1 
ATOM   4629  C  CG    . ASP C 2  133  ? 28.349  -10.422 81.572  1.00 45.20  ? 133  ASP C CG    1 
ATOM   4630  O  OD1   . ASP C 2  133  ? 29.291  -9.711  81.164  1.00 46.13  ? 133  ASP C OD1   1 
ATOM   4631  O  OD2   . ASP C 2  133  ? 28.424  -11.135 82.597  1.00 49.49  ? 133  ASP C OD2   1 
ATOM   4632  N  N     . ARG C 2  134  ? 25.947  -11.674 77.798  1.00 24.93  ? 134  ARG C N     1 
ATOM   4633  C  CA    . ARG C 2  134  ? 24.773  -12.056 77.023  1.00 22.45  ? 134  ARG C CA    1 
ATOM   4634  C  C     . ARG C 2  134  ? 24.393  -13.509 77.274  1.00 20.17  ? 134  ARG C C     1 
ATOM   4635  O  O     . ARG C 2  134  ? 25.255  -14.373 77.373  1.00 23.80  ? 134  ARG C O     1 
ATOM   4636  C  CB    . ARG C 2  134  ? 25.024  -11.853 75.528  1.00 21.94  ? 134  ARG C CB    1 
ATOM   4637  C  CG    . ARG C 2  134  ? 25.281  -10.417 75.124  1.00 24.90  ? 134  ARG C CG    1 
ATOM   4638  C  CD    . ARG C 2  134  ? 25.309  -10.266 73.613  1.00 20.57  ? 134  ARG C CD    1 
ATOM   4639  N  NE    . ARG C 2  134  ? 24.773  -8.970  73.214  1.00 26.64  ? 134  ARG C NE    1 
ATOM   4640  C  CZ    . ARG C 2  134  ? 23.486  -8.737  72.974  1.00 26.72  ? 134  ARG C CZ    1 
ATOM   4641  N  NH1   . ARG C 2  134  ? 22.598  -9.717  73.081  1.00 18.40  ? 134  ARG C NH1   1 
ATOM   4642  N  NH2   . ARG C 2  134  ? 23.084  -7.523  72.622  1.00 39.20  ? 134  ARG C NH2   1 
ATOM   4643  N  N     . VAL C 2  135  ? 23.096  -13.769 77.373  1.00 15.67  ? 135  VAL C N     1 
ATOM   4644  C  CA    . VAL C 2  135  ? 22.584  -15.118 77.550  1.00 17.69  ? 135  VAL C CA    1 
ATOM   4645  C  C     . VAL C 2  135  ? 21.886  -15.557 76.273  1.00 19.54  ? 135  VAL C C     1 
ATOM   4646  O  O     . VAL C 2  135  ? 21.104  -14.795 75.701  1.00 25.65  ? 135  VAL C O     1 
ATOM   4647  C  CB    . VAL C 2  135  ? 21.576  -15.175 78.713  1.00 22.38  ? 135  VAL C CB    1 
ATOM   4648  C  CG1   . VAL C 2  135  ? 20.912  -16.544 78.787  1.00 19.07  ? 135  VAL C CG1   1 
ATOM   4649  C  CG2   . VAL C 2  135  ? 22.260  -14.823 80.030  1.00 22.27  ? 135  VAL C CG2   1 
ATOM   4650  N  N     . ILE C 2  136  ? 22.177  -16.772 75.815  1.00 18.86  ? 136  ILE C N     1 
ATOM   4651  C  CA    . ILE C 2  136  ? 21.474  -17.322 74.660  1.00 20.48  ? 136  ILE C CA    1 
ATOM   4652  C  C     . ILE C 2  136  ? 20.232  -18.060 75.130  1.00 21.21  ? 136  ILE C C     1 
ATOM   4653  O  O     . ILE C 2  136  ? 20.322  -19.059 75.843  1.00 23.26  ? 136  ILE C O     1 
ATOM   4654  C  CB    . ILE C 2  136  ? 22.340  -18.300 73.857  1.00 18.36  ? 136  ILE C CB    1 
ATOM   4655  C  CG1   . ILE C 2  136  ? 23.595  -17.604 73.338  1.00 18.41  ? 136  ILE C CG1   1 
ATOM   4656  C  CG2   . ILE C 2  136  ? 21.538  -18.883 72.698  1.00 14.21  ? 136  ILE C CG2   1 
ATOM   4657  C  CD1   . ILE C 2  136  ? 23.340  -16.689 72.166  1.00 21.12  ? 136  ILE C CD1   1 
ATOM   4658  N  N     . VAL C 2  137  ? 19.071  -17.568 74.722  1.00 19.07  ? 137  VAL C N     1 
ATOM   4659  C  CA    . VAL C 2  137  ? 17.816  -18.135 75.181  1.00 19.05  ? 137  VAL C CA    1 
ATOM   4660  C  C     . VAL C 2  137  ? 17.352  -19.271 74.281  1.00 24.48  ? 137  VAL C C     1 
ATOM   4661  O  O     . VAL C 2  137  ? 17.189  -19.093 73.074  1.00 26.88  ? 137  VAL C O     1 
ATOM   4662  C  CB    . VAL C 2  137  ? 16.729  -17.062 75.278  1.00 17.57  ? 137  VAL C CB    1 
ATOM   4663  C  CG1   . VAL C 2  137  ? 15.357  -17.700 75.415  1.00 21.54  ? 137  VAL C CG1   1 
ATOM   4664  C  CG2   . VAL C 2  137  ? 17.022  -16.142 76.450  1.00 19.07  ? 137  VAL C CG2   1 
ATOM   4665  N  N     . SER C 2  138  ? 17.148  -20.439 74.885  1.00 22.64  ? 138  SER C N     1 
ATOM   4666  C  CA    . SER C 2  138  ? 16.684  -21.624 74.175  1.00 17.36  ? 138  SER C CA    1 
ATOM   4667  C  C     . SER C 2  138  ? 15.341  -21.361 73.511  1.00 19.04  ? 138  SER C C     1 
ATOM   4668  O  O     . SER C 2  138  ? 14.535  -20.582 74.013  1.00 26.55  ? 138  SER C O     1 
ATOM   4669  C  CB    . SER C 2  138  ? 16.570  -22.792 75.148  1.00 21.69  ? 138  SER C CB    1 
ATOM   4670  O  OG    . SER C 2  138  ? 16.888  -22.371 76.465  1.00 25.36  ? 138  SER C OG    1 
ATOM   4671  N  N     . GLN C 2  139  ? 15.103  -22.011 72.379  1.00 19.13  ? 139  GLN C N     1 
ATOM   4672  C  CA    . GLN C 2  139  ? 13.920  -21.727 71.576  1.00 21.78  ? 139  GLN C CA    1 
ATOM   4673  C  C     . GLN C 2  139  ? 12.996  -22.933 71.467  1.00 23.85  ? 139  GLN C C     1 
ATOM   4674  O  O     . GLN C 2  139  ? 13.447  -24.037 71.204  1.00 25.69  ? 139  GLN C O     1 
ATOM   4675  C  CB    . GLN C 2  139  ? 14.341  -21.265 70.179  1.00 22.37  ? 139  GLN C CB    1 
ATOM   4676  C  CG    . GLN C 2  139  ? 13.193  -21.068 69.207  1.00 24.52  ? 139  GLN C CG    1 
ATOM   4677  C  CD    . GLN C 2  139  ? 13.664  -20.625 67.837  1.00 29.65  ? 139  GLN C CD    1 
ATOM   4678  O  OE1   . GLN C 2  139  ? 13.930  -21.449 66.961  1.00 34.91  ? 139  GLN C OE1   1 
ATOM   4679  N  NE2   . GLN C 2  139  ? 13.771  -19.315 67.644  1.00 32.39  ? 139  GLN C NE2   1 
ATOM   4680  N  N     . ILE C 2  140  ? 11.699  -22.724 71.663  1.00 26.11  ? 140  ILE C N     1 
ATOM   4681  C  CA    . ILE C 2  140  ? 10.736  -23.809 71.486  1.00 28.41  ? 140  ILE C CA    1 
ATOM   4682  C  C     . ILE C 2  140  ? 10.126  -23.782 70.084  1.00 27.92  ? 140  ILE C C     1 
ATOM   4683  O  O     . ILE C 2  140  ? 9.769   -22.719 69.570  1.00 27.27  ? 140  ILE C O     1 
ATOM   4684  C  CB    . ILE C 2  140  ? 9.629   -23.786 72.569  1.00 26.26  ? 140  ILE C CB    1 
ATOM   4685  C  CG1   . ILE C 2  140  ? 8.776   -25.055 72.501  1.00 31.18  ? 140  ILE C CG1   1 
ATOM   4686  C  CG2   . ILE C 2  140  ? 8.770   -22.539 72.452  1.00 20.27  ? 140  ILE C CG2   1 
ATOM   4687  C  CD1   . ILE C 2  140  ? 7.885   -25.256 73.713  1.00 26.59  ? 140  ILE C CD1   1 
ATOM   4688  N  N     . HIS C 2  141  ? 10.032  -24.948 69.451  1.00 28.64  ? 141  HIS C N     1 
ATOM   4689  C  CA    . HIS C 2  141  ? 9.424   -25.014 68.124  1.00 30.82  ? 141  HIS C CA    1 
ATOM   4690  C  C     . HIS C 2  141  ? 8.759   -26.352 67.847  1.00 34.45  ? 141  HIS C C     1 
ATOM   4691  O  O     . HIS C 2  141  ? 8.716   -27.230 68.713  1.00 32.72  ? 141  HIS C O     1 
ATOM   4692  C  CB    . HIS C 2  141  ? 10.449  -24.713 67.033  1.00 25.73  ? 141  HIS C CB    1 
ATOM   4693  C  CG    . HIS C 2  141  ? 11.461  -25.796 66.838  1.00 30.20  ? 141  HIS C CG    1 
ATOM   4694  N  ND1   . HIS C 2  141  ? 12.023  -26.076 65.611  1.00 35.01  ? 141  HIS C ND1   1 
ATOM   4695  C  CD2   . HIS C 2  141  ? 12.019  -26.665 67.714  1.00 30.73  ? 141  HIS C CD2   1 
ATOM   4696  C  CE1   . HIS C 2  141  ? 12.880  -27.073 65.738  1.00 35.14  ? 141  HIS C CE1   1 
ATOM   4697  N  NE2   . HIS C 2  141  ? 12.896  -27.448 67.004  1.00 35.27  ? 141  HIS C NE2   1 
ATOM   4698  N  N     . ARG C 2  142  ? 8.239   -26.496 66.632  1.00 36.25  ? 142  ARG C N     1 
ATOM   4699  C  CA    . ARG C 2  142  ? 7.589   -27.733 66.224  1.00 37.90  ? 142  ARG C CA    1 
ATOM   4700  C  C     . ARG C 2  142  ? 8.614   -28.771 65.798  1.00 41.98  ? 142  ARG C C     1 
ATOM   4701  O  O     . ARG C 2  142  ? 9.377   -28.555 64.855  1.00 42.56  ? 142  ARG C O     1 
ATOM   4702  C  CB    . ARG C 2  142  ? 6.607   -27.475 65.085  1.00 41.36  ? 142  ARG C CB    1 
ATOM   4703  C  CG    . ARG C 2  142  ? 5.393   -26.672 65.496  1.00 57.99  ? 142  ARG C CG    1 
ATOM   4704  C  CD    . ARG C 2  142  ? 4.352   -26.667 64.395  1.00 66.24  ? 142  ARG C CD    1 
ATOM   4705  N  NE    . ARG C 2  142  ? 3.971   -28.020 64.005  1.00 49.32  ? 142  ARG C NE    1 
ATOM   4706  C  CZ    . ARG C 2  142  ? 3.089   -28.297 63.053  1.00 55.29  ? 142  ARG C CZ    1 
ATOM   4707  N  NH1   . ARG C 2  142  ? 2.495   -27.313 62.392  1.00 57.96  ? 142  ARG C NH1   1 
ATOM   4708  N  NH2   . ARG C 2  142  ? 2.801   -29.557 62.760  1.00 62.88  ? 142  ARG C NH2   1 
ATOM   4709  N  N     . SER C 2  143  ? 8.617   -29.901 66.498  1.00 42.41  ? 143  SER C N     1 
ATOM   4710  C  CA    . SER C 2  143  ? 9.555   -30.978 66.217  1.00 44.80  ? 143  SER C CA    1 
ATOM   4711  C  C     . SER C 2  143  ? 9.369   -31.516 64.811  1.00 43.20  ? 143  SER C C     1 
ATOM   4712  O  O     . SER C 2  143  ? 8.244   -31.748 64.377  1.00 45.72  ? 143  SER C O     1 
ATOM   4713  C  CB    . SER C 2  143  ? 9.386   -32.117 67.221  1.00 45.71  ? 143  SER C CB    1 
ATOM   4714  O  OG    . SER C 2  143  ? 9.990   -33.305 66.738  1.00 48.13  ? 143  SER C OG    1 
ATOM   4715  N  N     . PRO C 2  144  ? 10.481  -31.711 64.093  1.00 42.03  ? 144  PRO C N     1 
ATOM   4716  C  CA    . PRO C 2  144  ? 10.435  -32.347 62.778  1.00 44.83  ? 144  PRO C CA    1 
ATOM   4717  C  C     . PRO C 2  144  ? 9.831   -33.742 62.879  1.00 53.50  ? 144  PRO C C     1 
ATOM   4718  O  O     . PRO C 2  144  ? 9.836   -34.344 63.955  1.00 56.81  ? 144  PRO C O     1 
ATOM   4719  C  CB    . PRO C 2  144  ? 11.910  -32.439 62.388  1.00 54.11  ? 144  PRO C CB    1 
ATOM   4720  C  CG    . PRO C 2  144  ? 12.553  -31.322 63.116  1.00 52.24  ? 144  PRO C CG    1 
ATOM   4721  C  CD    . PRO C 2  144  ? 11.833  -31.236 64.428  1.00 49.10  ? 144  PRO C CD    1 
ATOM   4722  N  N     . GLY C 2  145  ? 9.294   -34.234 61.769  1.00 47.61  ? 145  GLY C N     1 
ATOM   4723  C  CA    . GLY C 2  145  ? 8.660   -35.535 61.743  1.00 44.71  ? 145  GLY C CA    1 
ATOM   4724  C  C     . GLY C 2  145  ? 7.541   -35.554 60.727  1.00 45.31  ? 145  GLY C C     1 
ATOM   4725  O  O     . GLY C 2  145  ? 7.517   -34.749 59.791  1.00 46.58  ? 145  GLY C O     1 
ATOM   4726  N  N     . VAL C 2  146  ? 6.614   -36.487 60.913  1.00 51.38  ? 146  VAL C N     1 
ATOM   4727  C  CA    . VAL C 2  146  ? 5.418   -36.562 60.089  1.00 56.21  ? 146  VAL C CA    1 
ATOM   4728  C  C     . VAL C 2  146  ? 4.178   -36.432 60.964  1.00 55.49  ? 146  VAL C C     1 
ATOM   4729  O  O     . VAL C 2  146  ? 4.011   -37.173 61.932  1.00 61.60  ? 146  VAL C O     1 
ATOM   4730  C  CB    . VAL C 2  146  ? 5.350   -37.886 59.312  1.00 57.30  ? 146  VAL C CB    1 
ATOM   4731  C  CG1   . VAL C 2  146  ? 4.019   -38.008 58.592  1.00 64.66  ? 146  VAL C CG1   1 
ATOM   4732  C  CG2   . VAL C 2  146  ? 6.503   -37.979 58.328  1.00 61.27  ? 146  VAL C CG2   1 
ATOM   4733  N  N     . TYR C 2  147  ? 3.314   -35.481 60.626  1.00 52.49  ? 147  TYR C N     1 
ATOM   4734  C  CA    . TYR C 2  147  ? 2.087   -35.268 61.380  1.00 58.58  ? 147  TYR C CA    1 
ATOM   4735  C  C     . TYR C 2  147  ? 0.862   -35.465 60.496  1.00 64.75  ? 147  TYR C C     1 
ATOM   4736  O  O     . TYR C 2  147  ? 0.936   -35.342 59.271  1.00 66.71  ? 147  TYR C O     1 
ATOM   4737  C  CB    . TYR C 2  147  ? 2.055   -33.859 61.978  1.00 56.55  ? 147  TYR C CB    1 
ATOM   4738  C  CG    . TYR C 2  147  ? 3.196   -33.544 62.915  1.00 52.99  ? 147  TYR C CG    1 
ATOM   4739  C  CD1   . TYR C 2  147  ? 4.305   -32.835 62.474  1.00 52.75  ? 147  TYR C CD1   1 
ATOM   4740  C  CD2   . TYR C 2  147  ? 3.161   -33.947 64.243  1.00 55.10  ? 147  TYR C CD2   1 
ATOM   4741  C  CE1   . TYR C 2  147  ? 5.350   -32.540 63.328  1.00 53.41  ? 147  TYR C CE1   1 
ATOM   4742  C  CE2   . TYR C 2  147  ? 4.202   -33.658 65.106  1.00 50.41  ? 147  TYR C CE2   1 
ATOM   4743  C  CZ    . TYR C 2  147  ? 5.293   -32.954 64.644  1.00 50.83  ? 147  TYR C CZ    1 
ATOM   4744  O  OH    . TYR C 2  147  ? 6.332   -32.663 65.498  1.00 48.69  ? 147  TYR C OH    1 
ATOM   4745  N  N     . PHE C 2  148  ? -0.264  -35.772 61.129  1.00 59.18  ? 148  PHE C N     1 
ATOM   4746  C  CA    . PHE C 2  148  ? -1.538  -35.861 60.431  1.00 61.08  ? 148  PHE C CA    1 
ATOM   4747  C  C     . PHE C 2  148  ? -2.580  -35.064 61.198  1.00 64.97  ? 148  PHE C C     1 
ATOM   4748  O  O     . PHE C 2  148  ? -2.896  -35.376 62.345  1.00 64.42  ? 148  PHE C O     1 
ATOM   4749  C  CB    . PHE C 2  148  ? -1.973  -37.317 60.285  1.00 59.24  ? 148  PHE C CB    1 
ATOM   4750  C  CG    . PHE C 2  148  ? -1.008  -38.157 59.506  1.00 59.45  ? 148  PHE C CG    1 
ATOM   4751  C  CD1   . PHE C 2  148  ? -0.002  -38.855 60.151  1.00 59.73  ? 148  PHE C CD1   1 
ATOM   4752  C  CD2   . PHE C 2  148  ? -1.099  -38.239 58.127  1.00 64.32  ? 148  PHE C CD2   1 
ATOM   4753  C  CE1   . PHE C 2  148  ? 0.891   -39.625 59.436  1.00 66.90  ? 148  PHE C CE1   1 
ATOM   4754  C  CE2   . PHE C 2  148  ? -0.209  -39.009 57.405  1.00 65.62  ? 148  PHE C CE2   1 
ATOM   4755  C  CZ    . PHE C 2  148  ? 0.787   -39.702 58.059  1.00 71.84  ? 148  PHE C CZ    1 
ATOM   4756  N  N     . THR C 2  149  ? -3.109  -34.028 60.561  1.00 70.80  ? 149  THR C N     1 
ATOM   4757  C  CA    . THR C 2  149  ? -4.018  -33.121 61.246  1.00 68.75  ? 149  THR C CA    1 
ATOM   4758  C  C     . THR C 2  149  ? -5.327  -32.972 60.471  1.00 74.09  ? 149  THR C C     1 
ATOM   4759  O  O     . THR C 2  149  ? -5.321  -32.968 59.246  1.00 82.61  ? 149  THR C O     1 
ATOM   4760  C  CB    . THR C 2  149  ? -3.349  -31.745 61.471  1.00 66.73  ? 149  THR C CB    1 
ATOM   4761  O  OG1   . THR C 2  149  ? -4.291  -30.833 62.045  1.00 90.30  ? 149  THR C OG1   1 
ATOM   4762  C  CG2   . THR C 2  149  ? -2.824  -31.175 60.157  1.00 60.55  ? 149  THR C CG2   1 
ATOM   4763  N  N     . PRO C 2  150  ? -6.457  -32.867 61.189  1.00 70.62  ? 150  PRO C N     1 
ATOM   4764  C  CA    . PRO C 2  150  ? -7.776  -32.731 60.559  1.00 72.47  ? 150  PRO C CA    1 
ATOM   4765  C  C     . PRO C 2  150  ? -7.856  -31.576 59.560  1.00 78.97  ? 150  PRO C C     1 
ATOM   4766  O  O     . PRO C 2  150  ? -7.370  -30.480 59.840  1.00 74.01  ? 150  PRO C O     1 
ATOM   4767  C  CB    . PRO C 2  150  ? -8.697  -32.454 61.750  1.00 78.14  ? 150  PRO C CB    1 
ATOM   4768  C  CG    . PRO C 2  150  ? -8.032  -33.134 62.893  1.00 74.65  ? 150  PRO C CG    1 
ATOM   4769  C  CD    . PRO C 2  150  ? -6.555  -32.979 62.656  1.00 74.07  ? 150  PRO C CD    1 
ATOM   4770  N  N     . ASP C 2  151  ? -8.459  -31.835 58.402  1.00 87.24  ? 151  ASP C N     1 
ATOM   4771  C  CA    . ASP C 2  151  ? -8.680  -30.809 57.388  1.00 86.17  ? 151  ASP C CA    1 
ATOM   4772  C  C     . ASP C 2  151  ? -9.785  -29.872 57.869  1.00 86.09  ? 151  ASP C C     1 
ATOM   4773  O  O     . ASP C 2  151  ? -10.897 -30.316 58.152  1.00 87.29  ? 151  ASP C O     1 
ATOM   4774  C  CB    . ASP C 2  151  ? -9.073  -31.464 56.056  1.00 88.32  ? 151  ASP C CB    1 
ATOM   4775  C  CG    . ASP C 2  151  ? -8.997  -30.505 54.873  1.00 91.67  ? 151  ASP C CG    1 
ATOM   4776  O  OD1   . ASP C 2  151  ? -9.284  -29.302 55.041  1.00 90.37  ? 151  ASP C OD1   1 
ATOM   4777  O  OD2   . ASP C 2  151  ? -8.655  -30.965 53.760  1.00 87.65  ? 151  ASP C OD2   1 
ATOM   4778  N  N     . PRO C 2  152  ? -9.476  -28.569 57.972  1.00 86.67  ? 152  PRO C N     1 
ATOM   4779  C  CA    . PRO C 2  152  ? -10.442 -27.578 58.462  1.00 88.39  ? 152  PRO C CA    1 
ATOM   4780  C  C     . PRO C 2  152  ? -11.693 -27.488 57.590  1.00 90.44  ? 152  PRO C C     1 
ATOM   4781  O  O     . PRO C 2  152  ? -12.801 -27.390 58.116  1.00 82.39  ? 152  PRO C O     1 
ATOM   4782  C  CB    . PRO C 2  152  ? -9.654  -26.262 58.407  1.00 90.02  ? 152  PRO C CB    1 
ATOM   4783  C  CG    . PRO C 2  152  ? -8.528  -26.518 57.455  1.00 82.45  ? 152  PRO C CG    1 
ATOM   4784  C  CD    . PRO C 2  152  ? -8.177  -27.958 57.645  1.00 84.36  ? 152  PRO C CD    1 
ATOM   4785  N  N     . ALA C 2  153  ? -11.512 -27.529 56.275  1.00 94.61  ? 153  ALA C N     1 
ATOM   4786  C  CA    . ALA C 2  153  ? -12.633 -27.433 55.348  1.00 96.31  ? 153  ALA C CA    1 
ATOM   4787  C  C     . ALA C 2  153  ? -13.426 -28.734 55.299  1.00 93.20  ? 153  ALA C C     1 
ATOM   4788  O  O     . ALA C 2  153  ? -14.582 -28.781 55.715  1.00 92.36  ? 153  ALA C O     1 
ATOM   4789  C  CB    . ALA C 2  153  ? -12.142 -27.056 53.957  1.00 99.28  ? 153  ALA C CB    1 
ATOM   4790  N  N     . ARG C 2  154  ? -12.789 -29.788 54.796  1.00 95.36  ? 154  ARG C N     1 
ATOM   4791  C  CA    . ARG C 2  154  ? -13.433 -31.089 54.635  1.00 97.91  ? 154  ARG C CA    1 
ATOM   4792  C  C     . ARG C 2  154  ? -13.308 -31.922 55.910  1.00 96.89  ? 154  ARG C C     1 
ATOM   4793  O  O     . ARG C 2  154  ? -12.219 -32.387 56.247  1.00 102.03 ? 154  ARG C O     1 
ATOM   4794  C  CB    . ARG C 2  154  ? -12.796 -31.832 53.457  1.00 99.55  ? 154  ARG C CB    1 
ATOM   4795  C  CG    . ARG C 2  154  ? -12.790 -31.030 52.161  1.00 102.13 ? 154  ARG C CG    1 
ATOM   4796  C  CD    . ARG C 2  154  ? -11.613 -31.390 51.259  1.00 100.60 ? 154  ARG C CD    1 
ATOM   4797  N  NE    . ARG C 2  154  ? -11.596 -32.802 50.884  1.00 107.34 ? 154  ARG C NE    1 
ATOM   4798  C  CZ    . ARG C 2  154  ? -12.366 -33.336 49.941  1.00 107.72 ? 154  ARG C CZ    1 
ATOM   4799  N  NH1   . ARG C 2  154  ? -13.233 -32.582 49.280  1.00 105.01 ? 154  ARG C NH1   1 
ATOM   4800  N  NH2   . ARG C 2  154  ? -12.277 -34.630 49.664  1.00 105.47 ? 154  ARG C NH2   1 
ATOM   4801  N  N     . PRO C 2  155  ? -14.431 -32.122 56.620  1.00 89.27  ? 155  PRO C N     1 
ATOM   4802  C  CA    . PRO C 2  155  ? -14.442 -32.819 57.912  1.00 92.75  ? 155  PRO C CA    1 
ATOM   4803  C  C     . PRO C 2  155  ? -13.956 -34.261 57.814  1.00 101.19 ? 155  PRO C C     1 
ATOM   4804  O  O     . PRO C 2  155  ? -13.176 -34.704 58.657  1.00 112.89 ? 155  PRO C O     1 
ATOM   4805  C  CB    . PRO C 2  155  ? -15.921 -32.792 58.312  1.00 88.87  ? 155  PRO C CB    1 
ATOM   4806  C  CG    . PRO C 2  155  ? -16.503 -31.653 57.549  1.00 91.56  ? 155  PRO C CG    1 
ATOM   4807  C  CD    . PRO C 2  155  ? -15.775 -31.657 56.242  1.00 96.76  ? 155  PRO C CD    1 
ATOM   4808  N  N     . GLY C 2  156  ? -14.410 -34.979 56.793  1.00 87.85  ? 156  GLY C N     1 
ATOM   4809  C  CA    . GLY C 2  156  ? -14.062 -36.379 56.639  1.00 91.11  ? 156  GLY C CA    1 
ATOM   4810  C  C     . GLY C 2  156  ? -12.620 -36.625 56.235  1.00 94.56  ? 156  GLY C C     1 
ATOM   4811  O  O     . GLY C 2  156  ? -12.105 -37.732 56.404  1.00 85.86  ? 156  GLY C O     1 
ATOM   4812  N  N     . ARG C 2  157  ? -11.963 -35.597 55.705  1.00 100.30 ? 157  ARG C N     1 
ATOM   4813  C  CA    . ARG C 2  157  ? -10.601 -35.744 55.196  1.00 103.48 ? 157  ARG C CA    1 
ATOM   4814  C  C     . ARG C 2  157  ? -9.538  -35.222 56.161  1.00 99.06  ? 157  ARG C C     1 
ATOM   4815  O  O     . ARG C 2  157  ? -9.855  -34.695 57.230  1.00 91.84  ? 157  ARG C O     1 
ATOM   4816  C  CB    . ARG C 2  157  ? -10.464 -35.063 53.831  1.00 96.79  ? 157  ARG C CB    1 
ATOM   4817  C  CG    . ARG C 2  157  ? -11.405 -35.626 52.785  1.00 99.18  ? 157  ARG C CG    1 
ATOM   4818  C  CD    . ARG C 2  157  ? -11.248 -37.135 52.679  1.00 100.73 ? 157  ARG C CD    1 
ATOM   4819  N  NE    . ARG C 2  157  ? -12.397 -37.766 52.037  1.00 100.76 ? 157  ARG C NE    1 
ATOM   4820  C  CZ    . ARG C 2  157  ? -12.514 -37.948 50.726  1.00 116.43 ? 157  ARG C CZ    1 
ATOM   4821  N  NH1   . ARG C 2  157  ? -11.551 -37.544 49.909  1.00 117.15 ? 157  ARG C NH1   1 
ATOM   4822  N  NH2   . ARG C 2  157  ? -13.597 -38.534 50.231  1.00 121.89 ? 157  ARG C NH2   1 
ATOM   4823  N  N     . TYR C 2  158  ? -8.274  -35.373 55.771  1.00 93.43  ? 158  TYR C N     1 
ATOM   4824  C  CA    . TYR C 2  158  ? -7.151  -34.979 56.616  1.00 87.76  ? 158  TYR C CA    1 
ATOM   4825  C  C     . TYR C 2  158  ? -5.991  -34.417 55.797  1.00 83.95  ? 158  TYR C C     1 
ATOM   4826  O  O     . TYR C 2  158  ? -5.895  -34.643 54.590  1.00 93.48  ? 158  TYR C O     1 
ATOM   4827  C  CB    . TYR C 2  158  ? -6.654  -36.168 57.447  1.00 91.08  ? 158  TYR C CB    1 
ATOM   4828  C  CG    . TYR C 2  158  ? -7.694  -36.793 58.355  1.00 90.32  ? 158  TYR C CG    1 
ATOM   4829  C  CD1   . TYR C 2  158  ? -7.916  -36.300 59.634  1.00 83.34  ? 158  TYR C CD1   1 
ATOM   4830  C  CD2   . TYR C 2  158  ? -8.445  -37.884 57.935  1.00 87.67  ? 158  TYR C CD2   1 
ATOM   4831  C  CE1   . TYR C 2  158  ? -8.863  -36.871 60.466  1.00 85.45  ? 158  TYR C CE1   1 
ATOM   4832  C  CE2   . TYR C 2  158  ? -9.392  -38.461 58.759  1.00 85.23  ? 158  TYR C CE2   1 
ATOM   4833  C  CZ    . TYR C 2  158  ? -9.597  -37.951 60.023  1.00 83.64  ? 158  TYR C CZ    1 
ATOM   4834  O  OH    . TYR C 2  158  ? -10.541 -38.525 60.845  1.00 83.42  ? 158  TYR C OH    1 
ATOM   4835  N  N     . ILE C 2  159  ? -5.111  -33.684 56.471  1.00 80.19  ? 159  ILE C N     1 
ATOM   4836  C  CA    . ILE C 2  159  ? -3.897  -33.151 55.866  1.00 78.37  ? 159  ILE C CA    1 
ATOM   4837  C  C     . ILE C 2  159  ? -2.672  -33.832 56.467  1.00 75.21  ? 159  ILE C C     1 
ATOM   4838  O  O     . ILE C 2  159  ? -2.483  -33.837 57.690  1.00 81.28  ? 159  ILE C O     1 
ATOM   4839  C  CB    . ILE C 2  159  ? -3.764  -31.631 56.100  1.00 87.04  ? 159  ILE C CB    1 
ATOM   4840  C  CG1   . ILE C 2  159  ? -4.898  -30.871 55.411  1.00 85.64  ? 159  ILE C CG1   1 
ATOM   4841  C  CG2   . ILE C 2  159  ? -2.412  -31.130 55.605  1.00 81.44  ? 159  ILE C CG2   1 
ATOM   4842  C  CD1   . ILE C 2  159  ? -4.721  -30.732 53.917  1.00 88.80  ? 159  ILE C CD1   1 
ATOM   4843  N  N     . ALA C 2  160  ? -1.847  -34.412 55.603  1.00 70.10  ? 160  ALA C N     1 
ATOM   4844  C  CA    . ALA C 2  160  ? -0.585  -34.998 56.028  1.00 68.06  ? 160  ALA C CA    1 
ATOM   4845  C  C     . ALA C 2  160  ? 0.531   -33.983 55.823  1.00 73.21  ? 160  ALA C C     1 
ATOM   4846  O  O     . ALA C 2  160  ? 0.607   -33.334 54.780  1.00 75.67  ? 160  ALA C O     1 
ATOM   4847  C  CB    . ALA C 2  160  ? -0.299  -36.266 55.246  1.00 66.61  ? 160  ALA C CB    1 
ATOM   4848  N  N     . SER C 2  161  ? 1.394   -33.839 56.820  1.00 65.11  ? 161  SER C N     1 
ATOM   4849  C  CA    . SER C 2  161  ? 2.485   -32.882 56.723  1.00 58.58  ? 161  SER C CA    1 
ATOM   4850  C  C     . SER C 2  161  ? 3.816   -33.521 57.095  1.00 57.46  ? 161  SER C C     1 
ATOM   4851  O  O     . SER C 2  161  ? 3.905   -34.275 58.061  1.00 58.94  ? 161  SER C O     1 
ATOM   4852  C  CB    . SER C 2  161  ? 2.210   -31.667 57.611  1.00 63.21  ? 161  SER C CB    1 
ATOM   4853  O  OG    . SER C 2  161  ? 0.978   -31.055 57.267  1.00 65.14  ? 161  SER C OG    1 
ATOM   4854  N  N     . ILE C 2  162  ? 4.847   -33.221 56.313  1.00 58.89  ? 162  ILE C N     1 
ATOM   4855  C  CA    . ILE C 2  162  ? 6.189   -33.712 56.591  1.00 60.40  ? 162  ILE C CA    1 
ATOM   4856  C  C     . ILE C 2  162  ? 7.108   -32.523 56.837  1.00 63.39  ? 162  ILE C C     1 
ATOM   4857  O  O     . ILE C 2  162  ? 7.419   -31.766 55.917  1.00 67.71  ? 162  ILE C O     1 
ATOM   4858  C  CB    . ILE C 2  162  ? 6.737   -34.540 55.415  1.00 61.22  ? 162  ILE C CB    1 
ATOM   4859  C  CG1   . ILE C 2  162  ? 5.794   -35.701 55.094  1.00 52.98  ? 162  ILE C CG1   1 
ATOM   4860  C  CG2   . ILE C 2  162  ? 8.132   -35.054 55.728  1.00 63.59  ? 162  ILE C CG2   1 
ATOM   4861  C  CD1   . ILE C 2  162  ? 6.186   -36.477 53.858  1.00 52.89  ? 162  ILE C CD1   1 
ATOM   4862  N  N     . ILE C 2  163  ? 7.542   -32.366 58.084  1.00 57.66  ? 163  ILE C N     1 
ATOM   4863  C  CA    . ILE C 2  163  ? 8.315   -31.193 58.481  1.00 58.79  ? 163  ILE C CA    1 
ATOM   4864  C  C     . ILE C 2  163  ? 9.761   -31.518 58.853  1.00 54.06  ? 163  ILE C C     1 
ATOM   4865  O  O     . ILE C 2  163  ? 10.003  -32.348 59.719  1.00 53.26  ? 163  ILE C O     1 
ATOM   4866  C  CB    . ILE C 2  163  ? 7.638   -30.459 59.651  1.00 63.42  ? 163  ILE C CB    1 
ATOM   4867  C  CG1   . ILE C 2  163  ? 6.193   -30.112 59.291  1.00 61.87  ? 163  ILE C CG1   1 
ATOM   4868  C  CG2   . ILE C 2  163  ? 8.418   -29.207 60.019  1.00 74.18  ? 163  ILE C CG2   1 
ATOM   4869  C  CD1   . ILE C 2  163  ? 5.430   -29.444 60.412  1.00 71.65  ? 163  ILE C CD1   1 
ATOM   4870  N  N     . PRO C 2  164  ? 10.729  -30.886 58.173  1.00 52.95  ? 164  PRO C N     1 
ATOM   4871  C  CA    . PRO C 2  164  ? 12.142  -31.000 58.549  1.00 57.79  ? 164  PRO C CA    1 
ATOM   4872  C  C     . PRO C 2  164  ? 12.567  -29.889 59.507  1.00 60.26  ? 164  PRO C C     1 
ATOM   4873  O  O     . PRO C 2  164  ? 11.742  -29.049 59.865  1.00 65.98  ? 164  PRO C O     1 
ATOM   4874  C  CB    . PRO C 2  164  ? 12.857  -30.834 57.212  1.00 66.01  ? 164  PRO C CB    1 
ATOM   4875  C  CG    . PRO C 2  164  ? 11.981  -29.897 56.461  1.00 70.76  ? 164  PRO C CG    1 
ATOM   4876  C  CD    . PRO C 2  164  ? 10.561  -30.173 56.895  1.00 66.37  ? 164  PRO C CD    1 
ATOM   4877  N  N     . LEU C 2  165  ? 13.836  -29.886 59.908  1.00 57.23  ? 165  LEU C N     1 
ATOM   4878  C  CA    . LEU C 2  165  ? 14.380  -28.837 60.769  1.00 59.60  ? 165  LEU C CA    1 
ATOM   4879  C  C     . LEU C 2  165  ? 14.293  -27.469 60.085  1.00 64.56  ? 165  LEU C C     1 
ATOM   4880  O  O     . LEU C 2  165  ? 14.221  -27.394 58.859  1.00 65.95  ? 165  LEU C O     1 
ATOM   4881  C  CB    . LEU C 2  165  ? 15.833  -29.154 61.133  1.00 63.39  ? 165  LEU C CB    1 
ATOM   4882  C  CG    . LEU C 2  165  ? 16.152  -30.323 62.064  1.00 67.29  ? 165  LEU C CG    1 
ATOM   4883  C  CD1   . LEU C 2  165  ? 17.627  -30.670 61.954  1.00 71.76  ? 165  LEU C CD1   1 
ATOM   4884  C  CD2   . LEU C 2  165  ? 15.799  -29.982 63.502  1.00 64.10  ? 165  LEU C CD2   1 
ATOM   4885  N  N     . PRO C 2  166  ? 14.283  -26.380 60.878  1.00 62.22  ? 166  PRO C N     1 
ATOM   4886  C  CA    . PRO C 2  166  ? 14.157  -25.026 60.322  1.00 73.06  ? 166  PRO C CA    1 
ATOM   4887  C  C     . PRO C 2  166  ? 15.242  -24.673 59.303  1.00 81.59  ? 166  PRO C C     1 
ATOM   4888  O  O     . PRO C 2  166  ? 16.430  -24.867 59.567  1.00 75.59  ? 166  PRO C O     1 
ATOM   4889  C  CB    . PRO C 2  166  ? 14.285  -24.134 61.558  1.00 64.77  ? 166  PRO C CB    1 
ATOM   4890  C  CG    . PRO C 2  166  ? 13.782  -24.978 62.669  1.00 57.48  ? 166  PRO C CG    1 
ATOM   4891  C  CD    . PRO C 2  166  ? 14.244  -26.369 62.351  1.00 53.81  ? 166  PRO C CD    1 
ATOM   4892  N  N     . LYS C 2  167  ? 14.812  -24.173 58.145  1.00 89.27  ? 167  LYS C N     1 
ATOM   4893  C  CA    . LYS C 2  167  ? 15.696  -23.787 57.042  1.00 87.51  ? 167  LYS C CA    1 
ATOM   4894  C  C     . LYS C 2  167  ? 16.578  -24.945 56.571  1.00 83.90  ? 167  LYS C C     1 
ATOM   4895  O  O     . LYS C 2  167  ? 17.629  -24.745 55.963  1.00 82.76  ? 167  LYS C O     1 
ATOM   4896  C  CB    . LYS C 2  167  ? 16.529  -22.554 57.406  1.00 83.84  ? 167  LYS C CB    1 
ATOM   4897  C  CG    . LYS C 2  167  ? 15.686  -21.326 57.716  1.00 84.30  ? 167  LYS C CG    1 
ATOM   4898  C  CD    . LYS C 2  167  ? 16.523  -20.059 57.738  1.00 89.89  ? 167  LYS C CD    1 
ATOM   4899  C  CE    . LYS C 2  167  ? 15.655  -18.833 57.976  1.00 89.17  ? 167  LYS C CE    1 
ATOM   4900  N  NZ    . LYS C 2  167  ? 16.407  -17.567 57.756  1.00 82.37  ? 167  LYS C NZ    1 
ATOM   4901  N  N     . ARG C 2  168  ? 16.125  -26.155 56.875  1.00 76.18  ? 168  ARG C N     1 
ATOM   4902  C  CA    . ARG C 2  168  ? 16.718  -27.399 56.398  1.00 73.01  ? 168  ARG C CA    1 
ATOM   4903  C  C     . ARG C 2  168  ? 15.987  -27.933 55.167  1.00 79.82  ? 168  ARG C C     1 
ATOM   4904  O  O     . ARG C 2  168  ? 16.127  -29.097 54.810  1.00 74.71  ? 168  ARG C O     1 
ATOM   4905  C  CB    . ARG C 2  168  ? 16.839  -28.436 57.513  1.00 78.55  ? 168  ARG C CB    1 
ATOM   4906  C  CG    . ARG C 2  168  ? 17.812  -28.012 58.611  1.00 87.59  ? 168  ARG C CG    1 
ATOM   4907  C  CD    . ARG C 2  168  ? 19.191  -28.640 58.459  1.00 85.06  ? 168  ARG C CD    1 
ATOM   4908  N  NE    . ARG C 2  168  ? 19.880  -28.203 57.248  1.00 91.15  ? 168  ARG C NE    1 
ATOM   4909  C  CZ    . ARG C 2  168  ? 21.115  -28.573 56.920  1.00 92.33  ? 168  ARG C CZ    1 
ATOM   4910  N  NH1   . ARG C 2  168  ? 21.798  -29.384 57.717  1.00 87.03  ? 168  ARG C NH1   1 
ATOM   4911  N  NH2   . ARG C 2  168  ? 21.667  -28.132 55.798  1.00 89.11  ? 168  ARG C NH2   1 
ATOM   4912  N  N     . GLY C 2  169  ? 15.162  -27.084 54.562  1.00 94.38  ? 169  GLY C N     1 
ATOM   4913  C  CA    . GLY C 2  169  ? 14.321  -27.470 53.442  1.00 89.55  ? 169  GLY C CA    1 
ATOM   4914  C  C     . GLY C 2  169  ? 12.829  -27.421 53.722  1.00 93.85  ? 169  GLY C C     1 
ATOM   4915  O  O     . GLY C 2  169  ? 12.409  -27.269 54.868  1.00 97.47  ? 169  GLY C O     1 
ATOM   4916  N  N     . PRO C 2  170  ? 12.021  -27.525 52.655  1.00 90.06  ? 170  PRO C N     1 
ATOM   4917  C  CA    . PRO C 2  170  ? 10.599  -27.158 52.614  1.00 87.00  ? 170  PRO C CA    1 
ATOM   4918  C  C     . PRO C 2  170  ? 9.648   -28.148 53.275  1.00 86.10  ? 170  PRO C C     1 
ATOM   4919  O  O     . PRO C 2  170  ? 9.947   -29.338 53.380  1.00 83.30  ? 170  PRO C O     1 
ATOM   4920  C  CB    . PRO C 2  170  ? 10.310  -27.117 51.115  1.00 84.62  ? 170  PRO C CB    1 
ATOM   4921  C  CG    . PRO C 2  170  ? 11.205  -28.166 50.559  1.00 90.48  ? 170  PRO C CG    1 
ATOM   4922  C  CD    . PRO C 2  170  ? 12.472  -28.094 51.372  1.00 89.49  ? 170  PRO C CD    1 
ATOM   4923  N  N     . TRP C 2  171  ? 8.498   -27.638 53.706  1.00 81.67  ? 171  TRP C N     1 
ATOM   4924  C  CA    . TRP C 2  171  ? 7.426   -28.477 54.222  1.00 77.85  ? 171  TRP C CA    1 
ATOM   4925  C  C     . TRP C 2  171  ? 6.710   -29.128 53.047  1.00 77.53  ? 171  TRP C C     1 
ATOM   4926  O  O     . TRP C 2  171  ? 6.731   -28.601 51.937  1.00 86.11  ? 171  TRP C O     1 
ATOM   4927  C  CB    . TRP C 2  171  ? 6.437   -27.650 55.048  1.00 73.94  ? 171  TRP C CB    1 
ATOM   4928  C  CG    . TRP C 2  171  ? 6.997   -27.133 56.343  1.00 84.16  ? 171  TRP C CG    1 
ATOM   4929  C  CD1   . TRP C 2  171  ? 8.314   -26.945 56.656  1.00 87.44  ? 171  TRP C CD1   1 
ATOM   4930  C  CD2   . TRP C 2  171  ? 6.253   -26.751 57.507  1.00 88.05  ? 171  TRP C CD2   1 
ATOM   4931  N  NE1   . TRP C 2  171  ? 8.434   -26.463 57.937  1.00 83.89  ? 171  TRP C NE1   1 
ATOM   4932  C  CE2   . TRP C 2  171  ? 7.184   -26.336 58.482  1.00 86.45  ? 171  TRP C CE2   1 
ATOM   4933  C  CE3   . TRP C 2  171  ? 4.889   -26.717 57.818  1.00 88.98  ? 171  TRP C CE3   1 
ATOM   4934  C  CZ2   . TRP C 2  171  ? 6.795   -25.892 59.745  1.00 87.97  ? 171  TRP C CZ2   1 
ATOM   4935  C  CZ3   . TRP C 2  171  ? 4.506   -26.275 59.074  1.00 92.53  ? 171  TRP C CZ3   1 
ATOM   4936  C  CH2   . TRP C 2  171  ? 5.455   -25.870 60.021  1.00 88.21  ? 171  TRP C CH2   1 
ATOM   4937  N  N     . ILE C 2  172  ? 6.086   -30.276 53.289  1.00 73.54  ? 172  ILE C N     1 
ATOM   4938  C  CA    . ILE C 2  172  ? 5.372   -30.994 52.236  1.00 74.78  ? 172  ILE C CA    1 
ATOM   4939  C  C     . ILE C 2  172  ? 3.957   -31.353 52.677  1.00 80.56  ? 172  ILE C C     1 
ATOM   4940  O  O     . ILE C 2  172  ? 3.764   -31.909 53.758  1.00 79.22  ? 172  ILE C O     1 
ATOM   4941  C  CB    . ILE C 2  172  ? 6.110   -32.286 51.839  1.00 74.82  ? 172  ILE C CB    1 
ATOM   4942  C  CG1   . ILE C 2  172  ? 7.515   -31.964 51.324  1.00 79.02  ? 172  ILE C CG1   1 
ATOM   4943  C  CG2   . ILE C 2  172  ? 5.317   -33.051 50.794  1.00 78.61  ? 172  ILE C CG2   1 
ATOM   4944  C  CD1   . ILE C 2  172  ? 8.245   -33.159 50.755  1.00 70.31  ? 172  ILE C CD1   1 
ATOM   4945  N  N     . ASP C 2  173  ? 2.966   -31.042 51.845  1.00 87.82  ? 173  ASP C N     1 
ATOM   4946  C  CA    . ASP C 2  173  ? 1.579   -31.336 52.216  1.00 84.13  ? 173  ASP C CA    1 
ATOM   4947  C  C     . ASP C 2  173  ? 0.885   -32.366 51.320  1.00 89.36  ? 173  ASP C C     1 
ATOM   4948  O  O     . ASP C 2  173  ? 0.636   -32.116 50.143  1.00 88.49  ? 173  ASP C O     1 
ATOM   4949  C  CB    . ASP C 2  173  ? 0.748   -30.050 52.284  1.00 86.98  ? 173  ASP C CB    1 
ATOM   4950  C  CG    . ASP C 2  173  ? 1.040   -29.229 53.525  1.00 82.84  ? 173  ASP C CG    1 
ATOM   4951  O  OD1   . ASP C 2  173  ? 2.215   -29.173 53.942  1.00 88.90  ? 173  ASP C OD1   1 
ATOM   4952  O  OD2   . ASP C 2  173  ? 0.091   -28.641 54.088  1.00 80.76  ? 173  ASP C OD2   1 
ATOM   4953  N  N     . LEU C 2  174  ? 0.562   -33.521 51.895  1.00 87.87  ? 174  LEU C N     1 
ATOM   4954  C  CA    . LEU C 2  174  ? -0.205  -34.549 51.195  1.00 84.47  ? 174  LEU C CA    1 
ATOM   4955  C  C     . LEU C 2  174  ? -1.686  -34.439 51.555  1.00 89.71  ? 174  LEU C C     1 
ATOM   4956  O  O     . LEU C 2  174  ? -2.064  -34.579 52.719  1.00 88.46  ? 174  LEU C O     1 
ATOM   4957  C  CB    . LEU C 2  174  ? 0.317   -35.946 51.542  1.00 73.76  ? 174  LEU C CB    1 
ATOM   4958  C  CG    . LEU C 2  174  ? 1.475   -36.526 50.724  1.00 75.81  ? 174  LEU C CG    1 
ATOM   4959  C  CD1   . LEU C 2  174  ? 2.670   -35.586 50.677  1.00 74.20  ? 174  LEU C CD1   1 
ATOM   4960  C  CD2   . LEU C 2  174  ? 1.882   -37.883 51.280  1.00 74.55  ? 174  LEU C CD2   1 
ATOM   4961  N  N     . GLU C 2  175  ? -2.522  -34.189 50.554  1.00 92.31  ? 175  GLU C N     1 
ATOM   4962  C  CA    . GLU C 2  175  ? -3.950  -33.996 50.786  1.00 93.64  ? 175  GLU C CA    1 
ATOM   4963  C  C     . GLU C 2  175  ? -4.766  -34.785 49.770  1.00 96.93  ? 175  GLU C C     1 
ATOM   4964  O  O     . GLU C 2  175  ? -4.358  -34.925 48.623  1.00 97.59  ? 175  GLU C O     1 
ATOM   4965  C  CB    . GLU C 2  175  ? -4.296  -32.505 50.691  1.00 100.63 ? 175  GLU C CB    1 
ATOM   4966  C  CG    . GLU C 2  175  ? -5.781  -32.181 50.803  1.00 99.19  ? 175  GLU C CG    1 
ATOM   4967  C  CD    . GLU C 2  175  ? -6.087  -30.724 50.503  1.00 92.61  ? 175  GLU C CD    1 
ATOM   4968  O  OE1   . GLU C 2  175  ? -5.156  -29.985 50.117  1.00 79.19  ? 175  GLU C OE1   1 
ATOM   4969  O  OE2   . GLU C 2  175  ? -7.261  -30.321 50.652  1.00 94.66  ? 175  GLU C OE2   1 
ATOM   4970  N  N     . VAL C 2  176  ? -5.919  -35.300 50.183  1.00 97.28  ? 176  VAL C N     1 
ATOM   4971  C  CA    . VAL C 2  176  ? -6.803  -35.972 49.239  1.00 102.72 ? 176  VAL C CA    1 
ATOM   4972  C  C     . VAL C 2  176  ? -7.800  -34.964 48.679  1.00 105.52 ? 176  VAL C C     1 
ATOM   4973  O  O     . VAL C 2  176  ? -8.676  -34.473 49.392  1.00 108.66 ? 176  VAL C O     1 
ATOM   4974  C  CB    . VAL C 2  176  ? -7.561  -37.143 49.890  1.00 103.40 ? 176  VAL C CB    1 
ATOM   4975  C  CG1   . VAL C 2  176  ? -8.417  -37.855 48.856  1.00 100.08 ? 176  VAL C CG1   1 
ATOM   4976  C  CG2   . VAL C 2  176  ? -6.583  -38.115 50.533  1.00 94.48  ? 176  VAL C CG2   1 
ATOM   4977  N  N     . GLU C 2  177  ? -7.655  -34.663 47.392  1.00 103.55 ? 177  GLU C N     1 
ATOM   4978  C  CA    . GLU C 2  177  ? -8.452  -33.632 46.737  1.00 107.75 ? 177  GLU C CA    1 
ATOM   4979  C  C     . GLU C 2  177  ? -9.894  -34.100 46.524  1.00 111.40 ? 177  GLU C C     1 
ATOM   4980  O  O     . GLU C 2  177  ? -10.156 -35.304 46.496  1.00 111.58 ? 177  GLU C O     1 
ATOM   4981  C  CB    . GLU C 2  177  ? -7.800  -33.247 45.402  1.00 102.07 ? 177  GLU C CB    1 
ATOM   4982  C  CG    . GLU C 2  177  ? -7.533  -31.756 45.234  1.00 102.43 ? 177  GLU C CG    1 
ATOM   4983  C  CD    . GLU C 2  177  ? -6.817  -31.149 46.427  1.00 100.76 ? 177  GLU C CD    1 
ATOM   4984  O  OE1   . GLU C 2  177  ? -7.389  -30.244 47.072  1.00 86.73  ? 177  GLU C OE1   1 
ATOM   4985  O  OE2   . GLU C 2  177  ? -5.679  -31.575 46.718  1.00 106.03 ? 177  GLU C OE2   1 
ATOM   4986  N  N     . PRO C 2  178  ? -10.837 -33.147 46.398  1.00 111.29 ? 178  PRO C N     1 
ATOM   4987  C  CA    . PRO C 2  178  ? -12.238 -33.467 46.100  1.00 109.40 ? 178  PRO C CA    1 
ATOM   4988  C  C     . PRO C 2  178  ? -12.401 -34.350 44.865  1.00 104.65 ? 178  PRO C C     1 
ATOM   4989  O  O     . PRO C 2  178  ? -13.298 -35.193 44.836  1.00 105.14 ? 178  PRO C O     1 
ATOM   4990  C  CB    . PRO C 2  178  ? -12.854 -32.093 45.836  1.00 109.32 ? 178  PRO C CB    1 
ATOM   4991  C  CG    . PRO C 2  178  ? -12.058 -31.166 46.671  1.00 104.64 ? 178  PRO C CG    1 
ATOM   4992  C  CD    . PRO C 2  178  ? -10.658 -31.715 46.705  1.00 107.43 ? 178  PRO C CD    1 
ATOM   4993  N  N     . ASN C 2  179  ? -11.545 -34.163 43.864  1.00 98.47  ? 179  ASN C N     1 
ATOM   4994  C  CA    . ASN C 2  179  ? -11.648 -34.928 42.625  1.00 106.00 ? 179  ASN C CA    1 
ATOM   4995  C  C     . ASN C 2  179  ? -11.138 -36.363 42.765  1.00 113.84 ? 179  ASN C C     1 
ATOM   4996  O  O     . ASN C 2  179  ? -11.273 -37.171 41.846  1.00 119.14 ? 179  ASN C O     1 
ATOM   4997  C  CB    . ASN C 2  179  ? -10.931 -34.212 41.475  1.00 109.40 ? 179  ASN C CB    1 
ATOM   4998  C  CG    . ASN C 2  179  ? -9.429  -34.410 41.506  1.00 106.15 ? 179  ASN C CG    1 
ATOM   4999  O  OD1   . ASN C 2  179  ? -8.905  -35.359 40.922  1.00 101.32 ? 179  ASN C OD1   1 
ATOM   5000  N  ND2   . ASN C 2  179  ? -8.726  -33.509 42.182  1.00 109.86 ? 179  ASN C ND2   1 
ATOM   5001  N  N     . GLY C 2  180  ? -10.552 -36.671 43.917  1.00 112.62 ? 180  GLY C N     1 
ATOM   5002  C  CA    . GLY C 2  180  ? -10.111 -38.021 44.215  1.00 108.42 ? 180  GLY C CA    1 
ATOM   5003  C  C     . GLY C 2  180  ? -8.616  -38.259 44.108  1.00 106.01 ? 180  GLY C C     1 
ATOM   5004  O  O     . GLY C 2  180  ? -8.099  -39.203 44.704  1.00 108.74 ? 180  GLY C O     1 
ATOM   5005  N  N     . VAL C 2  181  ? -7.915  -37.408 43.364  1.00 102.96 ? 181  VAL C N     1 
ATOM   5006  C  CA    . VAL C 2  181  ? -6.467  -37.549 43.226  1.00 106.41 ? 181  VAL C CA    1 
ATOM   5007  C  C     . VAL C 2  181  ? -5.751  -36.998 44.463  1.00 108.65 ? 181  VAL C C     1 
ATOM   5008  O  O     . VAL C 2  181  ? -6.194  -36.017 45.064  1.00 104.82 ? 181  VAL C O     1 
ATOM   5009  C  CB    . VAL C 2  181  ? -5.932  -36.880 41.929  1.00 95.77  ? 181  VAL C CB    1 
ATOM   5010  C  CG1   . VAL C 2  181  ? -5.983  -35.365 42.033  1.00 89.86  ? 181  VAL C CG1   1 
ATOM   5011  C  CG2   . VAL C 2  181  ? -4.513  -37.345 41.629  1.00 94.94  ? 181  VAL C CG2   1 
ATOM   5012  N  N     . VAL C 2  182  ? -4.658  -37.647 44.855  1.00 107.99 ? 182  VAL C N     1 
ATOM   5013  C  CA    . VAL C 2  182  ? -3.892  -37.211 46.019  1.00 104.40 ? 182  VAL C CA    1 
ATOM   5014  C  C     . VAL C 2  182  ? -2.803  -36.213 45.625  1.00 103.16 ? 182  VAL C C     1 
ATOM   5015  O  O     . VAL C 2  182  ? -1.882  -36.536 44.872  1.00 101.38 ? 182  VAL C O     1 
ATOM   5016  C  CB    . VAL C 2  182  ? -3.290  -38.408 46.792  1.00 100.74 ? 182  VAL C CB    1 
ATOM   5017  C  CG1   . VAL C 2  182  ? -2.729  -39.439 45.831  1.00 107.61 ? 182  VAL C CG1   1 
ATOM   5018  C  CG2   . VAL C 2  182  ? -2.229  -37.936 47.775  1.00 99.91  ? 182  VAL C CG2   1 
ATOM   5019  N  N     . SER C 2  183  ? -2.924  -34.996 46.147  1.00 103.54 ? 183  SER C N     1 
ATOM   5020  C  CA    . SER C 2  183  ? -2.051  -33.894 45.769  1.00 97.70  ? 183  SER C CA    1 
ATOM   5021  C  C     . SER C 2  183  ? -0.962  -33.621 46.798  1.00 93.51  ? 183  SER C C     1 
ATOM   5022  O  O     . SER C 2  183  ? -1.168  -33.757 48.006  1.00 96.38  ? 183  SER C O     1 
ATOM   5023  C  CB    . SER C 2  183  ? -2.867  -32.621 45.544  1.00 87.83  ? 183  SER C CB    1 
ATOM   5024  O  OG    . SER C 2  183  ? -3.473  -32.191 46.750  1.00 81.39  ? 183  SER C OG    1 
ATOM   5025  N  N     . MET C 2  184  ? 0.198   -33.227 46.288  1.00 91.23  ? 184  MET C N     1 
ATOM   5026  C  CA    . MET C 2  184  ? 1.350   -32.881 47.101  1.00 86.34  ? 184  MET C CA    1 
ATOM   5027  C  C     . MET C 2  184  ? 1.689   -31.409 46.884  1.00 92.03  ? 184  MET C C     1 
ATOM   5028  O  O     . MET C 2  184  ? 1.739   -30.933 45.744  1.00 96.19  ? 184  MET C O     1 
ATOM   5029  C  CB    . MET C 2  184  ? 2.532   -33.769 46.716  1.00 77.71  ? 184  MET C CB    1 
ATOM   5030  C  CG    . MET C 2  184  ? 3.856   -33.413 47.364  1.00 77.95  ? 184  MET C CG    1 
ATOM   5031  S  SD    . MET C 2  184  ? 5.104   -34.619 46.880  1.00 87.75  ? 184  MET C SD    1 
ATOM   5032  C  CE    . MET C 2  184  ? 6.604   -33.911 47.544  1.00 72.32  ? 184  MET C CE    1 
ATOM   5033  N  N     . LYS C 2  185  ? 1.901   -30.695 47.987  1.00 85.33  ? 185  LYS C N     1 
ATOM   5034  C  CA    . LYS C 2  185  ? 2.249   -29.280 47.950  1.00 81.11  ? 185  LYS C CA    1 
ATOM   5035  C  C     . LYS C 2  185  ? 3.672   -29.058 48.452  1.00 84.15  ? 185  LYS C C     1 
ATOM   5036  O  O     . LYS C 2  185  ? 3.999   -29.404 49.595  1.00 89.76  ? 185  LYS C O     1 
ATOM   5037  C  CB    . LYS C 2  185  ? 1.273   -28.459 48.794  1.00 81.30  ? 185  LYS C CB    1 
ATOM   5038  C  CG    . LYS C 2  185  ? 1.638   -26.984 48.890  1.00 85.95  ? 185  LYS C CG    1 
ATOM   5039  C  CD    . LYS C 2  185  ? 1.096   -26.355 50.167  1.00 86.58  ? 185  LYS C CD    1 
ATOM   5040  C  CE    . LYS C 2  185  ? -0.422  -26.344 50.188  1.00 75.21  ? 185  LYS C CE    1 
ATOM   5041  N  NZ    . LYS C 2  185  ? -0.976  -25.491 49.103  1.00 77.99  ? 185  LYS C NZ    1 
ATOM   5042  N  N     . VAL C 2  186  ? 4.504   -28.490 47.579  1.00 78.46  ? 186  VAL C N     1 
ATOM   5043  C  CA    . VAL C 2  186  ? 5.890   -28.142 47.887  1.00 75.77  ? 186  VAL C CA    1 
ATOM   5044  C  C     . VAL C 2  186  ? 6.217   -26.788 47.268  1.00 85.90  ? 186  VAL C C     1 
ATOM   5045  O  O     . VAL C 2  186  ? 5.982   -26.583 46.077  1.00 94.47  ? 186  VAL C O     1 
ATOM   5046  C  CB    . VAL C 2  186  ? 6.872   -29.185 47.322  1.00 63.36  ? 186  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C 2  186  ? 8.294   -28.649 47.339  1.00 63.54  ? 186  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C 2  186  ? 6.790   -30.462 48.117  1.00 71.00  ? 186  VAL C CG2   1 
ATOM   5049  N  N     . ASN C 2  187  ? 6.764   -25.875 48.071  1.00 81.19  ? 187  ASN C N     1 
ATOM   5050  C  CA    . ASN C 2  187  ? 7.051   -24.512 47.623  1.00 73.48  ? 187  ASN C CA    1 
ATOM   5051  C  C     . ASN C 2  187  ? 5.813   -23.842 47.038  1.00 76.77  ? 187  ASN C C     1 
ATOM   5052  O  O     . ASN C 2  187  ? 5.899   -23.133 46.035  1.00 79.15  ? 187  ASN C O     1 
ATOM   5053  C  CB    . ASN C 2  187  ? 8.191   -24.489 46.597  1.00 75.71  ? 187  ASN C CB    1 
ATOM   5054  C  CG    . ASN C 2  187  ? 9.555   -24.700 47.226  1.00 73.93  ? 187  ASN C CG    1 
ATOM   5055  O  OD1   . ASN C 2  187  ? 10.249  -25.671 46.921  1.00 72.48  ? 187  ASN C OD1   1 
ATOM   5056  N  ND2   . ASN C 2  187  ? 9.953   -23.782 48.098  1.00 73.90  ? 187  ASN C ND2   1 
ATOM   5057  N  N     . LYS C 2  188  ? 4.667   -24.087 47.669  1.00 80.72  ? 188  LYS C N     1 
ATOM   5058  C  CA    . LYS C 2  188  ? 3.378   -23.585 47.194  1.00 89.82  ? 188  LYS C CA    1 
ATOM   5059  C  C     . LYS C 2  188  ? 3.051   -24.050 45.773  1.00 97.45  ? 188  LYS C C     1 
ATOM   5060  O  O     . LYS C 2  188  ? 2.612   -23.259 44.936  1.00 94.59  ? 188  LYS C O     1 
ATOM   5061  C  CB    . LYS C 2  188  ? 3.307   -22.057 47.299  1.00 84.99  ? 188  LYS C CB    1 
ATOM   5062  C  CG    . LYS C 2  188  ? 3.158   -21.541 48.721  1.00 80.86  ? 188  LYS C CG    1 
ATOM   5063  C  CD    . LYS C 2  188  ? 3.239   -20.024 48.771  1.00 73.92  ? 188  LYS C CD    1 
ATOM   5064  C  CE    . LYS C 2  188  ? 4.658   -19.539 48.517  1.00 73.82  ? 188  LYS C CE    1 
ATOM   5065  N  NZ    . LYS C 2  188  ? 5.598   -19.993 49.580  1.00 67.96  ? 188  LYS C NZ    1 
ATOM   5066  N  N     . ARG C 2  189  ? 3.271   -25.336 45.510  1.00 99.44  ? 189  ARG C N     1 
ATOM   5067  C  CA    . ARG C 2  189  ? 2.935   -25.935 44.221  1.00 96.34  ? 189  ARG C CA    1 
ATOM   5068  C  C     . ARG C 2  189  ? 2.179   -27.248 44.406  1.00 90.73  ? 189  ARG C C     1 
ATOM   5069  O  O     . ARG C 2  189  ? 2.708   -28.201 44.976  1.00 89.13  ? 189  ARG C O     1 
ATOM   5070  C  CB    . ARG C 2  189  ? 4.195   -26.185 43.387  1.00 98.71  ? 189  ARG C CB    1 
ATOM   5071  C  CG    . ARG C 2  189  ? 4.899   -24.931 42.894  1.00 104.47 ? 189  ARG C CG    1 
ATOM   5072  C  CD    . ARG C 2  189  ? 6.133   -25.288 42.076  1.00 113.57 ? 189  ARG C CD    1 
ATOM   5073  N  NE    . ARG C 2  189  ? 6.863   -24.106 41.622  1.00 131.53 ? 189  ARG C NE    1 
ATOM   5074  C  CZ    . ARG C 2  189  ? 6.734   -23.562 40.415  1.00 129.85 ? 189  ARG C CZ    1 
ATOM   5075  N  NH1   . ARG C 2  189  ? 5.900   -24.093 39.530  1.00 126.30 ? 189  ARG C NH1   1 
ATOM   5076  N  NH2   . ARG C 2  189  ? 7.441   -22.486 40.093  1.00 123.54 ? 189  ARG C NH2   1 
ATOM   5077  N  N     . LYS C 2  190  ? 0.944   -27.293 43.918  1.00 85.98  ? 190  LYS C N     1 
ATOM   5078  C  CA    . LYS C 2  190  ? 0.135   -28.506 43.978  1.00 86.42  ? 190  LYS C CA    1 
ATOM   5079  C  C     . LYS C 2  190  ? 0.374   -29.384 42.753  1.00 87.89  ? 190  LYS C C     1 
ATOM   5080  O  O     . LYS C 2  190  ? 0.191   -28.937 41.621  1.00 90.57  ? 190  LYS C O     1 
ATOM   5081  C  CB    . LYS C 2  190  ? -1.350  -28.146 44.060  1.00 82.63  ? 190  LYS C CB    1 
ATOM   5082  C  CG    . LYS C 2  190  ? -1.812  -27.616 45.406  1.00 73.05  ? 190  LYS C CG    1 
ATOM   5083  C  CD    . LYS C 2  190  ? -2.268  -28.747 46.313  1.00 83.10  ? 190  LYS C CD    1 
ATOM   5084  C  CE    . LYS C 2  190  ? -3.131  -28.230 47.456  1.00 80.46  ? 190  LYS C CE    1 
ATOM   5085  N  NZ    . LYS C 2  190  ? -4.381  -27.584 46.963  1.00 67.54  ? 190  LYS C NZ    1 
ATOM   5086  N  N     . PHE C 2  191  ? 0.784   -30.629 42.973  1.00 87.59  ? 191  PHE C N     1 
ATOM   5087  C  CA    . PHE C 2  191  ? 0.927   -31.573 41.863  1.00 90.60  ? 191  PHE C CA    1 
ATOM   5088  C  C     . PHE C 2  191  ? 0.568   -32.992 42.306  1.00 94.49  ? 191  PHE C C     1 
ATOM   5089  O  O     . PHE C 2  191  ? 0.735   -33.331 43.472  1.00 99.35  ? 191  PHE C O     1 
ATOM   5090  C  CB    . PHE C 2  191  ? 2.344   -31.516 41.282  1.00 88.57  ? 191  PHE C CB    1 
ATOM   5091  C  CG    . PHE C 2  191  ? 3.346   -32.345 42.034  1.00 102.79 ? 191  PHE C CG    1 
ATOM   5092  C  CD1   . PHE C 2  191  ? 3.717   -33.598 41.568  1.00 107.13 ? 191  PHE C CD1   1 
ATOM   5093  C  CD2   . PHE C 2  191  ? 3.921   -31.873 43.202  1.00 101.01 ? 191  PHE C CD2   1 
ATOM   5094  C  CE1   . PHE C 2  191  ? 4.639   -34.366 42.255  1.00 102.23 ? 191  PHE C CE1   1 
ATOM   5095  C  CE2   . PHE C 2  191  ? 4.845   -32.636 43.894  1.00 101.59 ? 191  PHE C CE2   1 
ATOM   5096  C  CZ    . PHE C 2  191  ? 5.205   -33.883 43.419  1.00 101.60 ? 191  PHE C CZ    1 
ATOM   5097  N  N     . PRO C 2  192  ? 0.069   -33.826 41.377  1.00 92.94  ? 192  PRO C N     1 
ATOM   5098  C  CA    . PRO C 2  192  ? -0.332  -35.193 41.740  1.00 96.70  ? 192  PRO C CA    1 
ATOM   5099  C  C     . PRO C 2  192  ? 0.828   -36.037 42.267  1.00 100.83 ? 192  PRO C C     1 
ATOM   5100  O  O     . PRO C 2  192  ? 1.882   -36.117 41.635  1.00 95.57  ? 192  PRO C O     1 
ATOM   5101  C  CB    . PRO C 2  192  ? -0.852  -35.770 40.419  1.00 95.41  ? 192  PRO C CB    1 
ATOM   5102  C  CG    . PRO C 2  192  ? -0.220  -34.931 39.360  1.00 105.93 ? 192  PRO C CG    1 
ATOM   5103  C  CD    . PRO C 2  192  ? -0.140  -33.557 39.945  1.00 97.79  ? 192  PRO C CD    1 
ATOM   5104  N  N     . LEU C 2  193  ? 0.609   -36.672 43.415  1.00 102.42 ? 193  LEU C N     1 
ATOM   5105  C  CA    . LEU C 2  193  ? 1.634   -37.457 44.096  1.00 99.66  ? 193  LEU C CA    1 
ATOM   5106  C  C     . LEU C 2  193  ? 2.057   -38.663 43.263  1.00 102.53 ? 193  LEU C C     1 
ATOM   5107  O  O     . LEU C 2  193  ? 3.174   -39.174 43.403  1.00 98.33  ? 193  LEU C O     1 
ATOM   5108  C  CB    . LEU C 2  193  ? 1.110   -37.912 45.461  1.00 90.62  ? 193  LEU C CB    1 
ATOM   5109  C  CG    . LEU C 2  193  ? 2.060   -38.650 46.403  1.00 80.07  ? 193  LEU C CG    1 
ATOM   5110  C  CD1   . LEU C 2  193  ? 3.259   -37.786 46.748  1.00 76.59  ? 193  LEU C CD1   1 
ATOM   5111  C  CD2   . LEU C 2  193  ? 1.323   -39.069 47.662  1.00 76.62  ? 193  LEU C CD2   1 
ATOM   5112  N  N     . VAL C 2  194  ? 1.151   -39.103 42.394  1.00 103.51 ? 194  VAL C N     1 
ATOM   5113  C  CA    . VAL C 2  194  ? 1.385   -40.239 41.513  1.00 102.22 ? 194  VAL C CA    1 
ATOM   5114  C  C     . VAL C 2  194  ? 2.677   -40.072 40.723  1.00 96.24  ? 194  VAL C C     1 
ATOM   5115  O  O     . VAL C 2  194  ? 3.472   -41.007 40.606  1.00 98.72  ? 194  VAL C O     1 
ATOM   5116  C  CB    . VAL C 2  194  ? 0.232   -40.400 40.511  1.00 106.83 ? 194  VAL C CB    1 
ATOM   5117  C  CG1   . VAL C 2  194  ? 0.297   -41.766 39.847  1.00 110.08 ? 194  VAL C CG1   1 
ATOM   5118  C  CG2   . VAL C 2  194  ? -1.110  -40.194 41.204  1.00 108.03 ? 194  VAL C CG2   1 
ATOM   5119  N  N     . LEU C 2  195  ? 2.875   -38.871 40.190  1.00 96.10  ? 195  LEU C N     1 
ATOM   5120  C  CA    . LEU C 2  195  ? 4.053   -38.555 39.391  1.00 100.97 ? 195  LEU C CA    1 
ATOM   5121  C  C     . LEU C 2  195  ? 5.332   -38.813 40.176  1.00 97.82  ? 195  LEU C C     1 
ATOM   5122  O  O     . LEU C 2  195  ? 6.246   -39.500 39.702  1.00 96.77  ? 195  LEU C O     1 
ATOM   5123  C  CB    . LEU C 2  195  ? 4.004   -37.095 38.941  1.00 96.38  ? 195  LEU C CB    1 
ATOM   5124  C  CG    . LEU C 2  195  ? 5.152   -36.606 38.059  1.00 95.41  ? 195  LEU C CG    1 
ATOM   5125  C  CD1   . LEU C 2  195  ? 5.219   -37.405 36.767  1.00 97.41  ? 195  LEU C CD1   1 
ATOM   5126  C  CD2   . LEU C 2  195  ? 4.991   -35.128 37.770  1.00 98.61  ? 195  LEU C CD2   1 
ATOM   5127  N  N     . LEU C 2  196  ? 5.384   -38.266 41.386  1.00 97.05  ? 196  LEU C N     1 
ATOM   5128  C  CA    . LEU C 2  196  ? 6.538   -38.450 42.249  1.00 98.11  ? 196  LEU C CA    1 
ATOM   5129  C  C     . LEU C 2  196  ? 6.739   -39.925 42.566  1.00 99.83  ? 196  LEU C C     1 
ATOM   5130  O  O     . LEU C 2  196  ? 7.867   -40.412 42.578  1.00 98.33  ? 196  LEU C O     1 
ATOM   5131  C  CB    . LEU C 2  196  ? 6.387   -37.655 43.544  1.00 97.07  ? 196  LEU C CB    1 
ATOM   5132  C  CG    . LEU C 2  196  ? 7.626   -37.739 44.437  1.00 96.77  ? 196  LEU C CG    1 
ATOM   5133  C  CD1   . LEU C 2  196  ? 8.815   -37.066 43.760  1.00 87.95  ? 196  LEU C CD1   1 
ATOM   5134  C  CD2   . LEU C 2  196  ? 7.366   -37.144 45.810  1.00 91.21  ? 196  LEU C CD2   1 
ATOM   5135  N  N     . LEU C 2  197  ? 5.641   -40.634 42.813  1.00 98.97  ? 197  LEU C N     1 
ATOM   5136  C  CA    . LEU C 2  197  ? 5.718   -42.067 43.078  1.00 95.10  ? 197  LEU C CA    1 
ATOM   5137  C  C     . LEU C 2  197  ? 6.339   -42.818 41.904  1.00 94.11  ? 197  LEU C C     1 
ATOM   5138  O  O     . LEU C 2  197  ? 7.074   -43.786 42.097  1.00 84.50  ? 197  LEU C O     1 
ATOM   5139  C  CB    . LEU C 2  197  ? 4.340   -42.637 43.418  1.00 89.89  ? 197  LEU C CB    1 
ATOM   5140  C  CG    . LEU C 2  197  ? 3.800   -42.220 44.786  1.00 85.79  ? 197  LEU C CG    1 
ATOM   5141  C  CD1   . LEU C 2  197  ? 2.527   -42.973 45.113  1.00 87.20  ? 197  LEU C CD1   1 
ATOM   5142  C  CD2   . LEU C 2  197  ? 4.849   -42.449 45.862  1.00 82.49  ? 197  LEU C CD2   1 
ATOM   5143  N  N     . ARG C 2  198  ? 6.052   -42.361 40.689  1.00 103.71 ? 198  ARG C N     1 
ATOM   5144  C  CA    . ARG C 2  198  ? 6.657   -42.951 39.501  1.00 107.75 ? 198  ARG C CA    1 
ATOM   5145  C  C     . ARG C 2  198  ? 8.144   -42.617 39.436  1.00 108.77 ? 198  ARG C C     1 
ATOM   5146  O  O     . ARG C 2  198  ? 8.954   -43.446 39.022  1.00 112.82 ? 198  ARG C O     1 
ATOM   5147  C  CB    . ARG C 2  198  ? 5.954   -42.471 38.229  1.00 105.66 ? 198  ARG C CB    1 
ATOM   5148  C  CG    . ARG C 2  198  ? 6.320   -43.268 36.980  1.00 117.21 ? 198  ARG C CG    1 
ATOM   5149  C  CD    . ARG C 2  198  ? 5.852   -44.715 37.095  1.00 126.59 ? 198  ARG C CD    1 
ATOM   5150  N  NE    . ARG C 2  198  ? 6.105   -45.493 35.883  1.00 133.83 ? 198  ARG C NE    1 
ATOM   5151  C  CZ    . ARG C 2  198  ? 7.091   -46.376 35.749  1.00 128.40 ? 198  ARG C CZ    1 
ATOM   5152  N  NH1   . ARG C 2  198  ? 7.240   -47.039 34.610  1.00 123.04 ? 198  ARG C NH1   1 
ATOM   5153  N  NH2   . ARG C 2  198  ? 7.924   -46.602 36.755  1.00 122.99 ? 198  ARG C NH2   1 
ATOM   5154  N  N     . VAL C 2  199  ? 8.497   -41.400 39.843  1.00 104.57 ? 199  VAL C N     1 
ATOM   5155  C  CA    . VAL C 2  199  ? 9.899   -40.982 39.859  1.00 99.70  ? 199  VAL C CA    1 
ATOM   5156  C  C     . VAL C 2  199  ? 10.724  -41.823 40.839  1.00 99.85  ? 199  VAL C C     1 
ATOM   5157  O  O     . VAL C 2  199  ? 11.897  -42.117 40.596  1.00 92.34  ? 199  VAL C O     1 
ATOM   5158  C  CB    . VAL C 2  199  ? 10.040  -39.482 40.198  1.00 94.22  ? 199  VAL C CB    1 
ATOM   5159  C  CG1   . VAL C 2  199  ? 11.504  -39.072 40.242  1.00 98.67  ? 199  VAL C CG1   1 
ATOM   5160  C  CG2   . VAL C 2  199  ? 9.288   -38.639 39.184  1.00 93.90  ? 199  VAL C CG2   1 
ATOM   5161  N  N     . LEU C 2  200  ? 10.095  -42.221 41.941  1.00 108.89 ? 200  LEU C N     1 
ATOM   5162  C  CA    . LEU C 2  200  ? 10.749  -43.054 42.946  1.00 108.94 ? 200  LEU C CA    1 
ATOM   5163  C  C     . LEU C 2  200  ? 10.967  -44.484 42.458  1.00 105.36 ? 200  LEU C C     1 
ATOM   5164  O  O     . LEU C 2  200  ? 11.701  -45.253 43.078  1.00 109.18 ? 200  LEU C O     1 
ATOM   5165  C  CB    . LEU C 2  200  ? 9.944   -43.066 44.250  1.00 110.11 ? 200  LEU C CB    1 
ATOM   5166  C  CG    . LEU C 2  200  ? 10.321  -42.041 45.324  1.00 97.42  ? 200  LEU C CG    1 
ATOM   5167  C  CD1   . LEU C 2  200  ? 11.830  -41.988 45.486  1.00 109.63 ? 200  LEU C CD1   1 
ATOM   5168  C  CD2   . LEU C 2  200  ? 9.759   -40.662 45.026  1.00 85.95  ? 200  LEU C CD2   1 
ATOM   5169  N  N     . GLY C 2  201  ? 10.321  -44.840 41.353  1.00 99.59  ? 201  GLY C N     1 
ATOM   5170  C  CA    . GLY C 2  201  ? 10.490  -46.158 40.772  1.00 100.47 ? 201  GLY C CA    1 
ATOM   5171  C  C     . GLY C 2  201  ? 9.362   -47.121 41.088  1.00 104.05 ? 201  GLY C C     1 
ATOM   5172  O  O     . GLY C 2  201  ? 9.476   -48.321 40.835  1.00 101.86 ? 201  GLY C O     1 
ATOM   5173  N  N     . TYR C 2  202  ? 8.273   -46.600 41.645  1.00 106.28 ? 202  TYR C N     1 
ATOM   5174  C  CA    . TYR C 2  202  ? 7.096   -47.418 41.913  1.00 103.94 ? 202  TYR C CA    1 
ATOM   5175  C  C     . TYR C 2  202  ? 6.339   -47.723 40.639  1.00 107.82 ? 202  TYR C C     1 
ATOM   5176  O  O     . TYR C 2  202  ? 6.238   -46.886 39.744  1.00 107.65 ? 202  TYR C O     1 
ATOM   5177  C  CB    . TYR C 2  202  ? 6.146   -46.727 42.887  1.00 100.56 ? 202  TYR C CB    1 
ATOM   5178  C  CG    . TYR C 2  202  ? 6.592   -46.795 44.319  1.00 90.67  ? 202  TYR C CG    1 
ATOM   5179  C  CD1   . TYR C 2  202  ? 6.610   -48.001 45.001  1.00 99.78  ? 202  TYR C CD1   1 
ATOM   5180  C  CD2   . TYR C 2  202  ? 6.990   -45.654 44.992  1.00 93.58  ? 202  TYR C CD2   1 
ATOM   5181  C  CE1   . TYR C 2  202  ? 7.019   -48.069 46.313  1.00 101.35 ? 202  TYR C CE1   1 
ATOM   5182  C  CE2   . TYR C 2  202  ? 7.399   -45.709 46.304  1.00 94.31  ? 202  TYR C CE2   1 
ATOM   5183  C  CZ    . TYR C 2  202  ? 7.412   -46.919 46.960  1.00 91.70  ? 202  TYR C CZ    1 
ATOM   5184  O  OH    . TYR C 2  202  ? 7.820   -46.982 48.269  1.00 89.89  ? 202  TYR C OH    1 
ATOM   5185  N  N     . ASP C 2  203  ? 5.789   -48.928 40.576  1.00 115.42 ? 203  ASP C N     1 
ATOM   5186  C  CA    . ASP C 2  203  ? 4.966   -49.329 39.450  1.00 124.93 ? 203  ASP C CA    1 
ATOM   5187  C  C     . ASP C 2  203  ? 3.559   -49.637 39.952  1.00 125.14 ? 203  ASP C C     1 
ATOM   5188  O  O     . ASP C 2  203  ? 3.371   -49.917 41.136  1.00 125.49 ? 203  ASP C O     1 
ATOM   5189  C  CB    . ASP C 2  203  ? 5.577   -50.541 38.752  1.00 126.58 ? 203  ASP C CB    1 
ATOM   5190  C  CG    . ASP C 2  203  ? 5.203   -50.612 37.290  1.00 136.24 ? 203  ASP C CG    1 
ATOM   5191  O  OD1   . ASP C 2  203  ? 6.119   -50.712 36.446  1.00 130.28 ? 203  ASP C OD1   1 
ATOM   5192  O  OD2   . ASP C 2  203  ? 3.993   -50.565 36.986  1.00 142.74 ? 203  ASP C OD2   1 
ATOM   5193  N  N     . GLN C 2  204  ? 2.582   -49.577 39.050  1.00 120.29 ? 204  GLN C N     1 
ATOM   5194  C  CA    . GLN C 2  204  ? 1.169   -49.701 39.412  1.00 111.74 ? 204  GLN C CA    1 
ATOM   5195  C  C     . GLN C 2  204  ? 0.859   -50.937 40.257  1.00 117.51 ? 204  GLN C C     1 
ATOM   5196  O  O     . GLN C 2  204  ? -0.011  -50.898 41.129  1.00 113.18 ? 204  GLN C O     1 
ATOM   5197  C  CB    . GLN C 2  204  ? 0.291   -49.674 38.157  1.00 110.04 ? 204  GLN C CB    1 
ATOM   5198  C  CG    . GLN C 2  204  ? -1.200  -49.653 38.447  1.00 114.01 ? 204  GLN C CG    1 
ATOM   5199  C  CD    . GLN C 2  204  ? -2.042  -49.449 37.202  1.00 118.27 ? 204  GLN C CD    1 
ATOM   5200  O  OE1   . GLN C 2  204  ? -1.515  -49.280 36.102  1.00 122.77 ? 204  GLN C OE1   1 
ATOM   5201  N  NE2   . GLN C 2  204  ? -3.360  -49.460 37.371  1.00 110.96 ? 204  GLN C NE2   1 
ATOM   5202  N  N     . GLU C 2  205  ? 1.586   -52.021 40.001  1.00 122.18 ? 205  GLU C N     1 
ATOM   5203  C  CA    . GLU C 2  205  ? 1.432   -53.265 40.751  1.00 125.76 ? 205  GLU C CA    1 
ATOM   5204  C  C     . GLU C 2  205  ? 1.687   -53.058 42.242  1.00 124.54 ? 205  GLU C C     1 
ATOM   5205  O  O     . GLU C 2  205  ? 0.876   -53.455 43.084  1.00 122.82 ? 205  GLU C O     1 
ATOM   5206  C  CB    . GLU C 2  205  ? 2.397   -54.324 40.211  1.00 134.11 ? 205  GLU C CB    1 
ATOM   5207  C  CG    . GLU C 2  205  ? 2.254   -55.696 40.855  1.00 143.48 ? 205  GLU C CG    1 
ATOM   5208  C  CD    . GLU C 2  205  ? 1.170   -56.537 40.206  1.00 155.72 ? 205  GLU C CD    1 
ATOM   5209  O  OE1   . GLU C 2  205  ? 0.652   -56.128 39.145  1.00 163.96 ? 205  GLU C OE1   1 
ATOM   5210  O  OE2   . GLU C 2  205  ? 0.839   -57.609 40.755  1.00 154.33 ? 205  GLU C OE2   1 
ATOM   5211  N  N     . THR C 2  206  ? 2.818   -52.429 42.553  1.00 120.47 ? 206  THR C N     1 
ATOM   5212  C  CA    . THR C 2  206  ? 3.251   -52.216 43.933  1.00 118.20 ? 206  THR C CA    1 
ATOM   5213  C  C     . THR C 2  206  ? 2.261   -51.368 44.734  1.00 114.67 ? 206  THR C C     1 
ATOM   5214  O  O     . THR C 2  206  ? 1.903   -51.712 45.864  1.00 110.75 ? 206  THR C O     1 
ATOM   5215  C  CB    . THR C 2  206  ? 4.642   -51.550 43.982  1.00 109.20 ? 206  THR C CB    1 
ATOM   5216  O  OG1   . THR C 2  206  ? 5.519   -52.195 43.050  1.00 104.93 ? 206  THR C OG1   1 
ATOM   5217  C  CG2   . THR C 2  206  ? 5.231   -51.641 45.382  1.00 105.98 ? 206  THR C CG2   1 
ATOM   5218  N  N     . LEU C 2  207  ? 1.822   -50.259 44.144  1.00 115.04 ? 207  LEU C N     1 
ATOM   5219  C  CA    . LEU C 2  207  ? 0.858   -49.379 44.795  1.00 108.99 ? 207  LEU C CA    1 
ATOM   5220  C  C     . LEU C 2  207  ? -0.505  -50.059 44.903  1.00 112.55 ? 207  LEU C C     1 
ATOM   5221  O  O     . LEU C 2  207  ? -1.261  -49.807 45.844  1.00 110.24 ? 207  LEU C O     1 
ATOM   5222  C  CB    . LEU C 2  207  ? 0.738   -48.051 44.041  1.00 102.58 ? 207  LEU C CB    1 
ATOM   5223  C  CG    . LEU C 2  207  ? 2.033   -47.258 43.832  1.00 97.17  ? 207  LEU C CG    1 
ATOM   5224  C  CD1   . LEU C 2  207  ? 1.757   -45.951 43.104  1.00 91.09  ? 207  LEU C CD1   1 
ATOM   5225  C  CD2   . LEU C 2  207  ? 2.742   -46.998 45.153  1.00 89.48  ? 207  LEU C CD2   1 
ATOM   5226  N  N     . ALA C 2  208  ? -0.809  -50.926 43.938  1.00 118.72 ? 208  ALA C N     1 
ATOM   5227  C  CA    . ALA C 2  208  ? -2.057  -51.683 43.957  1.00 113.97 ? 208  ALA C CA    1 
ATOM   5228  C  C     . ALA C 2  208  ? -2.100  -52.679 45.113  1.00 106.50 ? 208  ALA C C     1 
ATOM   5229  O  O     . ALA C 2  208  ? -3.114  -52.795 45.797  1.00 99.76  ? 208  ALA C O     1 
ATOM   5230  C  CB    . ALA C 2  208  ? -2.275  -52.400 42.630  1.00 106.41 ? 208  ALA C CB    1 
ATOM   5231  N  N     . ARG C 2  209  ? -1.003  -53.399 45.328  1.00 103.74 ? 209  ARG C N     1 
ATOM   5232  C  CA    . ARG C 2  209  ? -0.959  -54.384 46.408  1.00 103.03 ? 209  ARG C CA    1 
ATOM   5233  C  C     . ARG C 2  209  ? -0.760  -53.749 47.785  1.00 109.00 ? 209  ARG C C     1 
ATOM   5234  O  O     . ARG C 2  209  ? -1.230  -54.280 48.793  1.00 105.64 ? 209  ARG C O     1 
ATOM   5235  C  CB    . ARG C 2  209  ? 0.115   -55.448 46.151  1.00 106.98 ? 209  ARG C CB    1 
ATOM   5236  C  CG    . ARG C 2  209  ? 1.501   -54.895 45.878  1.00 112.62 ? 209  ARG C CG    1 
ATOM   5237  C  CD    . ARG C 2  209  ? 2.567   -55.964 46.051  1.00 110.69 ? 209  ARG C CD    1 
ATOM   5238  N  NE    . ARG C 2  209  ? 2.820   -56.250 47.460  1.00 112.73 ? 209  ARG C NE    1 
ATOM   5239  C  CZ    . ARG C 2  209  ? 3.742   -55.631 48.191  1.00 116.68 ? 209  ARG C CZ    1 
ATOM   5240  N  NH1   . ARG C 2  209  ? 4.502   -54.691 47.644  1.00 114.99 ? 209  ARG C NH1   1 
ATOM   5241  N  NH2   . ARG C 2  209  ? 3.907   -55.949 49.468  1.00 115.05 ? 209  ARG C NH2   1 
ATOM   5242  N  N     . GLU C 2  210  ? -0.061  -52.618 47.829  1.00 108.91 ? 210  GLU C N     1 
ATOM   5243  C  CA    . GLU C 2  210  ? 0.179   -51.935 49.097  1.00 100.24 ? 210  GLU C CA    1 
ATOM   5244  C  C     . GLU C 2  210  ? -1.043  -51.155 49.578  1.00 98.30  ? 210  GLU C C     1 
ATOM   5245  O  O     . GLU C 2  210  ? -1.442  -51.261 50.738  1.00 87.18  ? 210  GLU C O     1 
ATOM   5246  C  CB    . GLU C 2  210  ? 1.377   -50.992 48.980  1.00 94.83  ? 210  GLU C CB    1 
ATOM   5247  C  CG    . GLU C 2  210  ? 2.432   -51.201 50.050  1.00 99.36  ? 210  GLU C CG    1 
ATOM   5248  C  CD    . GLU C 2  210  ? 3.241   -52.463 49.827  1.00 105.68 ? 210  GLU C CD    1 
ATOM   5249  O  OE1   . GLU C 2  210  ? 3.929   -52.548 48.788  1.00 106.20 ? 210  GLU C OE1   1 
ATOM   5250  O  OE2   . GLU C 2  210  ? 3.185   -53.369 50.686  1.00 104.04 ? 210  GLU C OE2   1 
ATOM   5251  N  N     . LEU C 2  211  ? -1.625  -50.365 48.680  1.00 106.12 ? 211  LEU C N     1 
ATOM   5252  C  CA    . LEU C 2  211  ? -2.732  -49.473 49.028  1.00 103.00 ? 211  LEU C CA    1 
ATOM   5253  C  C     . LEU C 2  211  ? -4.124  -50.008 48.681  1.00 104.46 ? 211  LEU C C     1 
ATOM   5254  O  O     . LEU C 2  211  ? -5.126  -49.326 48.897  1.00 104.86 ? 211  LEU C O     1 
ATOM   5255  C  CB    . LEU C 2  211  ? -2.527  -48.099 48.386  1.00 94.65  ? 211  LEU C CB    1 
ATOM   5256  C  CG    . LEU C 2  211  ? -1.695  -47.070 49.158  1.00 94.25  ? 211  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C 2  211  ? -0.341  -47.619 49.593  1.00 87.96  ? 211  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C 2  211  ? -1.510  -45.833 48.308  1.00 96.32  ? 211  LEU C CD2   1 
ATOM   5259  N  N     . GLY C 2  212  ? -4.182  -51.219 48.139  1.00 103.99 ? 212  GLY C N     1 
ATOM   5260  C  CA    . GLY C 2  212  ? -5.431  -51.771 47.644  1.00 107.92 ? 212  GLY C CA    1 
ATOM   5261  C  C     . GLY C 2  212  ? -6.474  -52.088 48.699  1.00 109.16 ? 212  GLY C C     1 
ATOM   5262  O  O     . GLY C 2  212  ? -7.673  -52.061 48.420  1.00 109.79 ? 212  GLY C O     1 
ATOM   5263  N  N     . ALA C 2  213  ? -6.021  -52.372 49.916  1.00 100.51 ? 213  ALA C N     1 
ATOM   5264  C  CA    . ALA C 2  213  ? -6.908  -52.819 50.989  1.00 98.11  ? 213  ALA C CA    1 
ATOM   5265  C  C     . ALA C 2  213  ? -7.925  -51.762 51.423  1.00 105.06 ? 213  ALA C C     1 
ATOM   5266  O  O     . ALA C 2  213  ? -8.833  -52.046 52.205  1.00 99.94  ? 213  ALA C O     1 
ATOM   5267  C  CB    . ALA C 2  213  ? -6.088  -53.285 52.185  1.00 91.83  ? 213  ALA C CB    1 
ATOM   5268  N  N     . TYR C 2  214  ? -7.769  -50.547 50.908  1.00 111.81 ? 214  TYR C N     1 
ATOM   5269  C  CA    . TYR C 2  214  ? -8.548  -49.401 51.372  1.00 113.02 ? 214  TYR C CA    1 
ATOM   5270  C  C     . TYR C 2  214  ? -9.847  -49.124 50.617  1.00 115.20 ? 214  TYR C C     1 
ATOM   5271  O  O     . TYR C 2  214  ? -10.326 -49.951 49.841  1.00 115.79 ? 214  TYR C O     1 
ATOM   5272  C  CB    . TYR C 2  214  ? -7.668  -48.152 51.449  1.00 98.69  ? 214  TYR C CB    1 
ATOM   5273  C  CG    . TYR C 2  214  ? -6.531  -48.337 52.420  1.00 87.17  ? 214  TYR C CG    1 
ATOM   5274  C  CD1   . TYR C 2  214  ? -6.767  -48.371 53.787  1.00 83.57  ? 214  TYR C CD1   1 
ATOM   5275  C  CD2   . TYR C 2  214  ? -5.229  -48.510 51.974  1.00 87.85  ? 214  TYR C CD2   1 
ATOM   5276  C  CE1   . TYR C 2  214  ? -5.738  -48.555 54.683  1.00 85.85  ? 214  TYR C CE1   1 
ATOM   5277  C  CE2   . TYR C 2  214  ? -4.190  -48.694 52.864  1.00 85.75  ? 214  TYR C CE2   1 
ATOM   5278  C  CZ    . TYR C 2  214  ? -4.451  -48.715 54.218  1.00 86.18  ? 214  TYR C CZ    1 
ATOM   5279  O  OH    . TYR C 2  214  ? -3.424  -48.897 55.114  1.00 87.27  ? 214  TYR C OH    1 
ATOM   5280  N  N     . GLY C 2  215  ? -10.396 -47.938 50.857  1.00 112.35 ? 215  GLY C N     1 
ATOM   5281  C  CA    . GLY C 2  215  ? -11.734 -47.573 50.432  1.00 115.06 ? 215  GLY C CA    1 
ATOM   5282  C  C     . GLY C 2  215  ? -11.783 -47.042 49.014  1.00 123.97 ? 215  GLY C C     1 
ATOM   5283  O  O     . GLY C 2  215  ? -12.652 -46.234 48.679  1.00 121.99 ? 215  GLY C O     1 
ATOM   5284  N  N     . GLU C 2  216  ? -10.821 -47.478 48.202  1.00 124.63 ? 216  GLU C N     1 
ATOM   5285  C  CA    . GLU C 2  216  ? -10.689 -47.065 46.806  1.00 129.06 ? 216  GLU C CA    1 
ATOM   5286  C  C     . GLU C 2  216  ? -10.287 -45.594 46.696  1.00 134.15 ? 216  GLU C C     1 
ATOM   5287  O  O     . GLU C 2  216  ? -10.627 -44.903 45.735  1.00 135.69 ? 216  GLU C O     1 
ATOM   5288  C  CB    . GLU C 2  216  ? -11.972 -47.367 46.013  1.00 134.53 ? 216  GLU C CB    1 
ATOM   5289  C  CG    . GLU C 2  216  ? -11.798 -47.447 44.501  1.00 135.81 ? 216  GLU C CG    1 
ATOM   5290  C  CD    . GLU C 2  216  ? -12.527 -46.333 43.769  1.00 138.92 ? 216  GLU C CD    1 
ATOM   5291  O  OE1   . GLU C 2  216  ? -13.075 -45.434 44.442  1.00 136.97 ? 216  GLU C OE1   1 
ATOM   5292  O  OE2   . GLU C 2  216  ? -12.556 -46.359 42.520  1.00 136.67 ? 216  GLU C OE2   1 
ATOM   5293  N  N     . LEU C 2  217  ? -9.552  -45.121 47.697  1.00 130.36 ? 217  LEU C N     1 
ATOM   5294  C  CA    . LEU C 2  217  ? -8.871  -43.841 47.590  1.00 118.50 ? 217  LEU C CA    1 
ATOM   5295  C  C     . LEU C 2  217  ? -7.706  -44.069 46.637  1.00 119.21 ? 217  LEU C C     1 
ATOM   5296  O  O     . LEU C 2  217  ? -7.278  -43.163 45.921  1.00 115.87 ? 217  LEU C O     1 
ATOM   5297  C  CB    . LEU C 2  217  ? -8.349  -43.372 48.953  1.00 104.80 ? 217  LEU C CB    1 
ATOM   5298  C  CG    . LEU C 2  217  ? -9.285  -43.304 50.167  1.00 99.86  ? 217  LEU C CG    1 
ATOM   5299  C  CD1   . LEU C 2  217  ? -10.669 -42.808 49.773  1.00 103.88 ? 217  LEU C CD1   1 
ATOM   5300  C  CD2   . LEU C 2  217  ? -9.374  -44.650 50.878  1.00 100.56 ? 217  LEU C CD2   1 
ATOM   5301  N  N     . VAL C 2  218  ? -7.215  -45.308 46.639  1.00 124.50 ? 218  VAL C N     1 
ATOM   5302  C  CA    . VAL C 2  218  ? -6.091  -45.742 45.813  1.00 118.20 ? 218  VAL C CA    1 
ATOM   5303  C  C     . VAL C 2  218  ? -6.335  -45.500 44.322  1.00 115.49 ? 218  VAL C C     1 
ATOM   5304  O  O     . VAL C 2  218  ? -5.403  -45.216 43.570  1.00 116.47 ? 218  VAL C O     1 
ATOM   5305  C  CB    . VAL C 2  218  ? -5.761  -47.238 46.076  1.00 117.77 ? 218  VAL C CB    1 
ATOM   5306  C  CG1   . VAL C 2  218  ? -7.022  -48.091 45.994  1.00 119.07 ? 218  VAL C CG1   1 
ATOM   5307  C  CG2   . VAL C 2  218  ? -4.685  -47.748 45.123  1.00 109.83 ? 218  VAL C CG2   1 
ATOM   5308  N  N     . GLN C 2  219  ? -7.593  -45.593 43.901  1.00 120.86 ? 219  GLN C N     1 
ATOM   5309  C  CA    . GLN C 2  219  ? -7.947  -45.339 42.507  1.00 128.71 ? 219  GLN C CA    1 
ATOM   5310  C  C     . GLN C 2  219  ? -7.714  -43.881 42.110  1.00 126.82 ? 219  GLN C C     1 
ATOM   5311  O  O     . GLN C 2  219  ? -7.580  -43.567 40.927  1.00 125.09 ? 219  GLN C O     1 
ATOM   5312  C  CB    . GLN C 2  219  ? -9.393  -45.756 42.226  1.00 128.29 ? 219  GLN C CB    1 
ATOM   5313  C  CG    . GLN C 2  219  ? -9.539  -47.191 41.735  1.00 125.09 ? 219  GLN C CG    1 
ATOM   5314  C  CD    . GLN C 2  219  ? -9.165  -47.349 40.273  1.00 122.54 ? 219  GLN C CD    1 
ATOM   5315  O  OE1   . GLN C 2  219  ? -9.366  -46.439 39.468  1.00 128.20 ? 219  GLN C OE1   1 
ATOM   5316  N  NE2   . GLN C 2  219  ? -8.616  -48.507 39.922  1.00 106.08 ? 219  GLN C NE2   1 
ATOM   5317  N  N     . GLY C 2  220  ? -7.665  -42.997 43.103  1.00 120.69 ? 220  GLY C N     1 
ATOM   5318  C  CA    . GLY C 2  220  ? -7.317  -41.608 42.867  1.00 110.76 ? 220  GLY C CA    1 
ATOM   5319  C  C     . GLY C 2  220  ? -5.826  -41.465 42.629  1.00 110.47 ? 220  GLY C C     1 
ATOM   5320  O  O     . GLY C 2  220  ? -5.361  -40.477 42.061  1.00 104.55 ? 220  GLY C O     1 
ATOM   5321  N  N     . LEU C 2  221  ? -5.075  -42.466 43.077  1.00 114.01 ? 221  LEU C N     1 
ATOM   5322  C  CA    . LEU C 2  221  ? -3.639  -42.530 42.847  1.00 108.30 ? 221  LEU C CA    1 
ATOM   5323  C  C     . LEU C 2  221  ? -3.360  -43.283 41.544  1.00 117.12 ? 221  LEU C C     1 
ATOM   5324  O  O     . LEU C 2  221  ? -2.219  -43.360 41.089  1.00 121.53 ? 221  LEU C O     1 
ATOM   5325  C  CB    . LEU C 2  221  ? -2.954  -43.226 44.028  1.00 107.65 ? 221  LEU C CB    1 
ATOM   5326  C  CG    . LEU C 2  221  ? -1.427  -43.333 44.057  1.00 112.40 ? 221  LEU C CG    1 
ATOM   5327  C  CD1   . LEU C 2  221  ? -0.792  -41.977 44.297  1.00 105.50 ? 221  LEU C CD1   1 
ATOM   5328  C  CD2   . LEU C 2  221  ? -0.978  -44.335 45.105  1.00 104.37 ? 221  LEU C CD2   1 
ATOM   5329  N  N     . MET C 2  222  ? -4.412  -43.824 40.935  1.00 122.61 ? 222  MET C N     1 
ATOM   5330  C  CA    . MET C 2  222  ? -4.266  -44.608 39.711  1.00 119.35 ? 222  MET C CA    1 
ATOM   5331  C  C     . MET C 2  222  ? -4.429  -43.750 38.458  1.00 115.67 ? 222  MET C C     1 
ATOM   5332  O  O     . MET C 2  222  ? -5.520  -43.261 38.161  1.00 109.71 ? 222  MET C O     1 
ATOM   5333  C  CB    . MET C 2  222  ? -5.276  -45.760 39.685  1.00 114.39 ? 222  MET C CB    1 
ATOM   5334  C  CG    . MET C 2  222  ? -5.011  -46.855 40.711  1.00 120.63 ? 222  MET C CG    1 
ATOM   5335  S  SD    . MET C 2  222  ? -3.533  -47.824 40.346  1.00 118.74 ? 222  MET C SD    1 
ATOM   5336  C  CE    . MET C 2  222  ? -3.474  -48.915 41.766  1.00 104.80 ? 222  MET C CE    1 
ATOM   5337  N  N     . ASP C 2  223  ? -3.334  -43.578 37.725  1.00 115.07 ? 223  ASP C N     1 
ATOM   5338  C  CA    . ASP C 2  223  ? -3.352  -42.824 36.479  1.00 122.69 ? 223  ASP C CA    1 
ATOM   5339  C  C     . ASP C 2  223  ? -2.531  -43.549 35.418  1.00 127.82 ? 223  ASP C C     1 
ATOM   5340  O  O     . ASP C 2  223  ? -1.367  -43.884 35.640  1.00 121.89 ? 223  ASP C O     1 
ATOM   5341  C  CB    . ASP C 2  223  ? -2.817  -41.407 36.695  1.00 117.89 ? 223  ASP C CB    1 
ATOM   5342  C  CG    . ASP C 2  223  ? -3.070  -40.499 35.506  1.00 121.40 ? 223  ASP C CG    1 
ATOM   5343  O  OD1   . ASP C 2  223  ? -2.205  -40.435 34.607  1.00 115.99 ? 223  ASP C OD1   1 
ATOM   5344  O  OD2   . ASP C 2  223  ? -4.135  -39.848 35.471  1.00 124.07 ? 223  ASP C OD2   1 
ATOM   5345  N  N     . GLU C 2  224  ? -3.147  -43.788 34.265  1.00 130.70 ? 224  GLU C N     1 
ATOM   5346  C  CA    . GLU C 2  224  ? -2.522  -44.558 33.193  1.00 130.13 ? 224  GLU C CA    1 
ATOM   5347  C  C     . GLU C 2  224  ? -1.393  -43.806 32.485  1.00 134.40 ? 224  GLU C C     1 
ATOM   5348  O  O     . GLU C 2  224  ? -0.408  -44.411 32.061  1.00 133.31 ? 224  GLU C O     1 
ATOM   5349  C  CB    . GLU C 2  224  ? -3.574  -45.022 32.176  1.00 132.63 ? 224  GLU C CB    1 
ATOM   5350  C  CG    . GLU C 2  224  ? -4.315  -43.898 31.453  1.00 140.02 ? 224  GLU C CG    1 
ATOM   5351  C  CD    . GLU C 2  224  ? -5.316  -43.177 32.341  1.00 142.15 ? 224  GLU C CD    1 
ATOM   5352  O  OE1   . GLU C 2  224  ? -6.312  -43.808 32.753  1.00 141.92 ? 224  GLU C OE1   1 
ATOM   5353  O  OE2   . GLU C 2  224  ? -5.099  -41.981 32.632  1.00 135.93 ? 224  GLU C OE2   1 
ATOM   5354  N  N     . SER C 2  225  ? -1.537  -42.490 32.360  1.00 133.64 ? 225  SER C N     1 
ATOM   5355  C  CA    . SER C 2  225  ? -0.544  -41.676 31.664  1.00 129.84 ? 225  SER C CA    1 
ATOM   5356  C  C     . SER C 2  225  ? 0.768   -41.582 32.442  1.00 130.26 ? 225  SER C C     1 
ATOM   5357  O  O     . SER C 2  225  ? 1.819   -41.288 31.872  1.00 129.24 ? 225  SER C O     1 
ATOM   5358  C  CB    . SER C 2  225  ? -1.099  -40.277 31.375  1.00 121.91 ? 225  SER C CB    1 
ATOM   5359  O  OG    . SER C 2  225  ? -1.610  -39.668 32.548  1.00 111.46 ? 225  SER C OG    1 
ATOM   5360  N  N     . VAL C 2  226  ? 0.698   -41.839 33.744  1.00 132.25 ? 226  VAL C N     1 
ATOM   5361  C  CA    . VAL C 2  226  ? 1.870   -41.763 34.611  1.00 129.52 ? 226  VAL C CA    1 
ATOM   5362  C  C     . VAL C 2  226  ? 2.758   -43.000 34.490  1.00 129.85 ? 226  VAL C C     1 
ATOM   5363  O  O     . VAL C 2  226  ? 3.982   -42.890 34.407  1.00 127.90 ? 226  VAL C O     1 
ATOM   5364  C  CB    . VAL C 2  226  ? 1.459   -41.571 36.083  1.00 124.99 ? 226  VAL C CB    1 
ATOM   5365  C  CG1   . VAL C 2  226  ? 2.684   -41.544 36.981  1.00 116.98 ? 226  VAL C CG1   1 
ATOM   5366  C  CG2   . VAL C 2  226  ? 0.648   -40.294 36.242  1.00 121.95 ? 226  VAL C CG2   1 
ATOM   5367  N  N     . PHE C 2  227  ? 2.137   -44.175 34.472  1.00 130.36 ? 227  PHE C N     1 
ATOM   5368  C  CA    . PHE C 2  227  ? 2.880   -45.428 34.361  1.00 130.88 ? 227  PHE C CA    1 
ATOM   5369  C  C     . PHE C 2  227  ? 3.298   -45.694 32.919  1.00 130.94 ? 227  PHE C C     1 
ATOM   5370  O  O     . PHE C 2  227  ? 4.033   -46.642 32.639  1.00 127.59 ? 227  PHE C O     1 
ATOM   5371  C  CB    . PHE C 2  227  ? 2.060   -46.600 34.908  1.00 133.73 ? 227  PHE C CB    1 
ATOM   5372  C  CG    . PHE C 2  227  ? 1.686   -46.453 36.355  1.00 131.84 ? 227  PHE C CG    1 
ATOM   5373  C  CD1   . PHE C 2  227  ? 2.642   -46.594 37.348  1.00 126.77 ? 227  PHE C CD1   1 
ATOM   5374  C  CD2   . PHE C 2  227  ? 0.380   -46.177 36.723  1.00 125.67 ? 227  PHE C CD2   1 
ATOM   5375  C  CE1   . PHE C 2  227  ? 2.303   -46.455 38.680  1.00 124.65 ? 227  PHE C CE1   1 
ATOM   5376  C  CE2   . PHE C 2  227  ? 0.033   -46.040 38.053  1.00 120.85 ? 227  PHE C CE2   1 
ATOM   5377  C  CZ    . PHE C 2  227  ? 0.995   -46.180 39.033  1.00 127.95 ? 227  PHE C CZ    1 
ATOM   5378  N  N     . ALA C 2  228  ? 2.824   -44.846 32.011  1.00 133.18 ? 228  ALA C N     1 
ATOM   5379  C  CA    . ALA C 2  228  ? 3.159   -44.957 30.596  1.00 131.75 ? 228  ALA C CA    1 
ATOM   5380  C  C     . ALA C 2  228  ? 4.502   -44.299 30.299  1.00 129.46 ? 228  ALA C C     1 
ATOM   5381  O  O     . ALA C 2  228  ? 4.970   -44.308 29.160  1.00 123.24 ? 228  ALA C O     1 
ATOM   5382  C  CB    . ALA C 2  228  ? 2.064   -44.335 29.744  1.00 130.65 ? 228  ALA C CB    1 
ATOM   5383  N  N     . MET C 2  229  ? 5.116   -43.725 31.329  1.00 133.17 ? 229  MET C N     1 
ATOM   5384  C  CA    . MET C 2  229  ? 6.427   -43.103 31.187  1.00 130.16 ? 229  MET C CA    1 
ATOM   5385  C  C     . MET C 2  229  ? 7.409   -43.578 32.258  1.00 128.03 ? 229  MET C C     1 
ATOM   5386  O  O     . MET C 2  229  ? 7.083   -43.623 33.445  1.00 124.53 ? 229  MET C O     1 
ATOM   5387  C  CB    . MET C 2  229  ? 6.308   -41.576 31.197  1.00 121.63 ? 229  MET C CB    1 
ATOM   5388  C  CG    . MET C 2  229  ? 5.438   -41.014 32.307  1.00 116.76 ? 229  MET C CG    1 
ATOM   5389  S  SD    . MET C 2  229  ? 5.281   -39.220 32.207  1.00 113.42 ? 229  MET C SD    1 
ATOM   5390  C  CE    . MET C 2  229  ? 4.097   -38.904 33.512  1.00 116.42 ? 229  MET C CE    1 
ATOM   5391  N  N     . ARG C 2  230  ? 8.613   -43.932 31.818  1.00 126.53 ? 230  ARG C N     1 
ATOM   5392  C  CA    . ARG C 2  230  ? 9.665   -44.423 32.704  1.00 127.78 ? 230  ARG C CA    1 
ATOM   5393  C  C     . ARG C 2  230  ? 10.118  -43.339 33.688  1.00 122.34 ? 230  ARG C C     1 
ATOM   5394  O  O     . ARG C 2  230  ? 9.821   -42.161 33.482  1.00 120.52 ? 230  ARG C O     1 
ATOM   5395  C  CB    . ARG C 2  230  ? 10.843  -44.951 31.873  1.00 131.29 ? 230  ARG C CB    1 
ATOM   5396  C  CG    . ARG C 2  230  ? 10.930  -44.392 30.466  1.00 121.94 ? 230  ARG C CG    1 
ATOM   5397  C  CD    . ARG C 2  230  ? 12.053  -45.061 29.691  1.00 115.22 ? 230  ARG C CD    1 
ATOM   5398  N  NE    . ARG C 2  230  ? 12.019  -44.713 28.275  1.00 124.07 ? 230  ARG C NE    1 
ATOM   5399  C  CZ    . ARG C 2  230  ? 12.629  -43.656 27.751  1.00 130.64 ? 230  ARG C CZ    1 
ATOM   5400  N  NH1   . ARG C 2  230  ? 12.543  -43.417 26.448  1.00 128.33 ? 230  ARG C NH1   1 
ATOM   5401  N  NH2   . ARG C 2  230  ? 13.326  -42.837 28.528  1.00 122.89 ? 230  ARG C NH2   1 
ATOM   5402  N  N     . PRO C 2  231  ? 10.819  -43.735 34.769  1.00 118.59 ? 231  PRO C N     1 
ATOM   5403  C  CA    . PRO C 2  231  ? 11.294  -42.788 35.786  1.00 122.65 ? 231  PRO C CA    1 
ATOM   5404  C  C     . PRO C 2  231  ? 11.981  -41.536 35.232  1.00 123.06 ? 231  PRO C C     1 
ATOM   5405  O  O     . PRO C 2  231  ? 11.796  -40.459 35.797  1.00 120.75 ? 231  PRO C O     1 
ATOM   5406  C  CB    . PRO C 2  231  ? 12.295  -43.625 36.581  1.00 123.03 ? 231  PRO C CB    1 
ATOM   5407  C  CG    . PRO C 2  231  ? 11.721  -44.993 36.537  1.00 116.38 ? 231  PRO C CG    1 
ATOM   5408  C  CD    . PRO C 2  231  ? 11.044  -45.132 35.194  1.00 114.14 ? 231  PRO C CD    1 
ATOM   5409  N  N     . GLU C 2  232  ? 12.750  -41.669 34.155  1.00 125.97 ? 232  GLU C N     1 
ATOM   5410  C  CA    . GLU C 2  232  ? 13.404  -40.513 33.545  1.00 123.89 ? 232  GLU C CA    1 
ATOM   5411  C  C     . GLU C 2  232  ? 12.387  -39.505 33.011  1.00 119.95 ? 232  GLU C C     1 
ATOM   5412  O  O     . GLU C 2  232  ? 12.454  -38.313 33.323  1.00 123.58 ? 232  GLU C O     1 
ATOM   5413  C  CB    . GLU C 2  232  ? 14.356  -40.946 32.424  1.00 128.91 ? 232  GLU C CB    1 
ATOM   5414  C  CG    . GLU C 2  232  ? 15.734  -41.396 32.897  1.00 131.86 ? 232  GLU C CG    1 
ATOM   5415  C  CD    . GLU C 2  232  ? 15.718  -42.753 33.578  1.00 139.98 ? 232  GLU C CD    1 
ATOM   5416  O  OE1   . GLU C 2  232  ? 14.718  -43.487 33.431  1.00 138.72 ? 232  GLU C OE1   1 
ATOM   5417  O  OE2   . GLU C 2  232  ? 16.710  -43.085 34.261  1.00 137.49 ? 232  GLU C OE2   1 
ATOM   5418  N  N     . GLU C 2  233  ? 11.443  -39.994 32.212  1.00 121.35 ? 233  GLU C N     1 
ATOM   5419  C  CA    . GLU C 2  233  ? 10.421  -39.140 31.612  1.00 126.27 ? 233  GLU C CA    1 
ATOM   5420  C  C     . GLU C 2  233  ? 9.533   -38.491 32.674  1.00 117.93 ? 233  GLU C C     1 
ATOM   5421  O  O     . GLU C 2  233  ? 9.166   -37.319 32.560  1.00 116.19 ? 233  GLU C O     1 
ATOM   5422  C  CB    . GLU C 2  233  ? 9.571   -39.936 30.616  1.00 132.30 ? 233  GLU C CB    1 
ATOM   5423  C  CG    . GLU C 2  233  ? 10.360  -40.512 29.445  1.00 129.72 ? 233  GLU C CG    1 
ATOM   5424  C  CD    . GLU C 2  233  ? 9.483   -41.250 28.449  1.00 122.15 ? 233  GLU C CD    1 
ATOM   5425  O  OE1   . GLU C 2  233  ? 8.252   -41.293 28.650  1.00 115.44 ? 233  GLU C OE1   1 
ATOM   5426  O  OE2   . GLU C 2  233  ? 10.026  -41.787 27.461  1.00 122.47 ? 233  GLU C OE2   1 
ATOM   5427  N  N     . ALA C 2  234  ? 9.198   -39.257 33.707  1.00 115.06 ? 234  ALA C N     1 
ATOM   5428  C  CA    . ALA C 2  234  ? 8.401   -38.740 34.811  1.00 112.41 ? 234  ALA C CA    1 
ATOM   5429  C  C     . ALA C 2  234  ? 9.174   -37.658 35.558  1.00 112.17 ? 234  ALA C C     1 
ATOM   5430  O  O     . ALA C 2  234  ? 8.604   -36.650 35.981  1.00 109.95 ? 234  ALA C O     1 
ATOM   5431  C  CB    . ALA C 2  234  ? 8.010   -39.866 35.755  1.00 111.82 ? 234  ALA C CB    1 
ATOM   5432  N  N     . LEU C 2  235  ? 10.478  -37.874 35.708  1.00 114.42 ? 235  LEU C N     1 
ATOM   5433  C  CA    . LEU C 2  235  ? 11.350  -36.916 36.379  1.00 110.78 ? 235  LEU C CA    1 
ATOM   5434  C  C     . LEU C 2  235  ? 11.413  -35.595 35.620  1.00 111.70 ? 235  LEU C C     1 
ATOM   5435  O  O     . LEU C 2  235  ? 11.268  -34.525 36.213  1.00 109.51 ? 235  LEU C O     1 
ATOM   5436  C  CB    . LEU C 2  235  ? 12.757  -37.495 36.545  1.00 109.32 ? 235  LEU C CB    1 
ATOM   5437  C  CG    . LEU C 2  235  ? 13.813  -36.588 37.178  1.00 100.33 ? 235  LEU C CG    1 
ATOM   5438  C  CD1   . LEU C 2  235  ? 13.351  -36.099 38.537  1.00 108.15 ? 235  LEU C CD1   1 
ATOM   5439  C  CD2   . LEU C 2  235  ? 15.138  -37.318 37.301  1.00 93.35  ? 235  LEU C CD2   1 
ATOM   5440  N  N     . ILE C 2  236  ? 11.634  -35.675 34.311  1.00 116.52 ? 236  ILE C N     1 
ATOM   5441  C  CA    . ILE C 2  236  ? 11.680  -34.476 33.476  1.00 115.39 ? 236  ILE C CA    1 
ATOM   5442  C  C     . ILE C 2  236  ? 10.322  -33.769 33.471  1.00 110.59 ? 236  ILE C C     1 
ATOM   5443  O  O     . ILE C 2  236  ? 10.251  -32.537 33.458  1.00 107.48 ? 236  ILE C O     1 
ATOM   5444  C  CB    . ILE C 2  236  ? 12.145  -34.798 32.035  1.00 116.13 ? 236  ILE C CB    1 
ATOM   5445  C  CG1   . ILE C 2  236  ? 13.547  -35.416 32.057  1.00 109.96 ? 236  ILE C CG1   1 
ATOM   5446  C  CG2   . ILE C 2  236  ? 12.136  -33.547 31.169  1.00 109.44 ? 236  ILE C CG2   1 
ATOM   5447  C  CD1   . ILE C 2  236  ? 14.100  -35.749 30.687  1.00 110.31 ? 236  ILE C CD1   1 
ATOM   5448  N  N     . ARG C 2  237  ? 9.251   -34.556 33.504  1.00 109.87 ? 237  ARG C N     1 
ATOM   5449  C  CA    . ARG C 2  237  ? 7.899   -34.016 33.618  1.00 106.62 ? 237  ARG C CA    1 
ATOM   5450  C  C     . ARG C 2  237  ? 7.741   -33.190 34.891  1.00 113.60 ? 237  ARG C C     1 
ATOM   5451  O  O     . ARG C 2  237  ? 7.273   -32.047 34.854  1.00 119.14 ? 237  ARG C O     1 
ATOM   5452  C  CB    . ARG C 2  237  ? 6.876   -35.151 33.616  1.00 113.18 ? 237  ARG C CB    1 
ATOM   5453  C  CG    . ARG C 2  237  ? 5.466   -34.716 33.978  1.00 115.91 ? 237  ARG C CG    1 
ATOM   5454  C  CD    . ARG C 2  237  ? 4.882   -33.794 32.922  1.00 114.88 ? 237  ARG C CD    1 
ATOM   5455  N  NE    . ARG C 2  237  ? 3.481   -33.485 33.188  1.00 115.58 ? 237  ARG C NE    1 
ATOM   5456  C  CZ    . ARG C 2  237  ? 2.673   -32.878 32.325  1.00 117.32 ? 237  ARG C CZ    1 
ATOM   5457  N  NH1   . ARG C 2  237  ? 1.411   -32.638 32.652  1.00 126.16 ? 237  ARG C NH1   1 
ATOM   5458  N  NH2   . ARG C 2  237  ? 3.126   -32.513 31.133  1.00 108.95 ? 237  ARG C NH2   1 
ATOM   5459  N  N     . LEU C 2  238  ? 8.137   -33.777 36.016  1.00 113.17 ? 238  LEU C N     1 
ATOM   5460  C  CA    . LEU C 2  238  ? 8.048   -33.105 37.307  1.00 112.23 ? 238  LEU C CA    1 
ATOM   5461  C  C     . LEU C 2  238  ? 8.915   -31.848 37.346  1.00 112.92 ? 238  LEU C C     1 
ATOM   5462  O  O     . LEU C 2  238  ? 8.525   -30.836 37.930  1.00 105.48 ? 238  LEU C O     1 
ATOM   5463  C  CB    . LEU C 2  238  ? 8.441   -34.060 38.438  1.00 108.04 ? 238  LEU C CB    1 
ATOM   5464  C  CG    . LEU C 2  238  ? 8.380   -33.502 39.861  1.00 101.18 ? 238  LEU C CG    1 
ATOM   5465  C  CD1   . LEU C 2  238  ? 7.022   -32.874 40.132  1.00 101.34 ? 238  LEU C CD1   1 
ATOM   5466  C  CD2   . LEU C 2  238  ? 8.681   -34.592 40.879  1.00 94.18  ? 238  LEU C CD2   1 
ATOM   5467  N  N     . PHE C 2  239  ? 10.086  -31.916 36.717  1.00 114.20 ? 239  PHE C N     1 
ATOM   5468  C  CA    . PHE C 2  239  ? 10.990  -30.772 36.666  1.00 103.71 ? 239  PHE C CA    1 
ATOM   5469  C  C     . PHE C 2  239  ? 10.383  -29.641 35.847  1.00 110.63 ? 239  PHE C C     1 
ATOM   5470  O  O     . PHE C 2  239  ? 10.556  -28.468 36.174  1.00 112.37 ? 239  PHE C O     1 
ATOM   5471  C  CB    . PHE C 2  239  ? 12.351  -31.173 36.092  1.00 95.43  ? 239  PHE C CB    1 
ATOM   5472  C  CG    . PHE C 2  239  ? 13.382  -30.078 36.153  1.00 98.78  ? 239  PHE C CG    1 
ATOM   5473  C  CD1   . PHE C 2  239  ? 13.611  -29.259 35.059  1.00 111.75 ? 239  PHE C CD1   1 
ATOM   5474  C  CD2   . PHE C 2  239  ? 14.119  -29.866 37.305  1.00 96.72  ? 239  PHE C CD2   1 
ATOM   5475  C  CE1   . PHE C 2  239  ? 14.559  -28.252 35.114  1.00 105.16 ? 239  PHE C CE1   1 
ATOM   5476  C  CE2   . PHE C 2  239  ? 15.070  -28.863 37.364  1.00 96.07  ? 239  PHE C CE2   1 
ATOM   5477  C  CZ    . PHE C 2  239  ? 15.289  -28.055 36.267  1.00 96.47  ? 239  PHE C CZ    1 
ATOM   5478  N  N     . THR C 2  240  ? 9.673   -29.997 34.780  1.00 116.99 ? 240  THR C N     1 
ATOM   5479  C  CA    . THR C 2  240  ? 8.963   -29.004 33.981  1.00 118.70 ? 240  THR C CA    1 
ATOM   5480  C  C     . THR C 2  240  ? 7.801   -28.412 34.769  1.00 120.49 ? 240  THR C C     1 
ATOM   5481  O  O     . THR C 2  240  ? 7.439   -27.250 34.580  1.00 120.57 ? 240  THR C O     1 
ATOM   5482  C  CB    . THR C 2  240  ? 8.421   -29.598 32.667  1.00 121.30 ? 240  THR C CB    1 
ATOM   5483  O  OG1   . THR C 2  240  ? 7.645   -30.768 32.952  1.00 126.67 ? 240  THR C OG1   1 
ATOM   5484  C  CG2   . THR C 2  240  ? 9.561   -29.965 31.737  1.00 122.06 ? 240  THR C CG2   1 
ATOM   5485  N  N     . LEU C 2  241  ? 7.219   -29.218 35.654  1.00 122.80 ? 241  LEU C N     1 
ATOM   5486  C  CA    . LEU C 2  241  ? 6.103   -28.760 36.477  1.00 119.62 ? 241  LEU C CA    1 
ATOM   5487  C  C     . LEU C 2  241  ? 6.534   -27.794 37.582  1.00 116.96 ? 241  LEU C C     1 
ATOM   5488  O  O     . LEU C 2  241  ? 5.852   -26.804 37.851  1.00 111.10 ? 241  LEU C O     1 
ATOM   5489  C  CB    . LEU C 2  241  ? 5.354   -29.951 37.081  1.00 113.01 ? 241  LEU C CB    1 
ATOM   5490  C  CG    . LEU C 2  241  ? 4.544   -30.798 36.098  1.00 113.57 ? 241  LEU C CG    1 
ATOM   5491  C  CD1   . LEU C 2  241  ? 3.780   -31.885 36.830  1.00 114.06 ? 241  LEU C CD1   1 
ATOM   5492  C  CD2   . LEU C 2  241  ? 3.596   -29.923 35.294  1.00 113.54 ? 241  LEU C CD2   1 
ATOM   5493  N  N     . LEU C 2  242  ? 7.663   -28.087 38.221  1.00 117.18 ? 242  LEU C N     1 
ATOM   5494  C  CA    . LEU C 2  242  ? 8.142   -27.278 39.339  1.00 118.33 ? 242  LEU C CA    1 
ATOM   5495  C  C     . LEU C 2  242  ? 9.020   -26.099 38.914  1.00 117.31 ? 242  LEU C C     1 
ATOM   5496  O  O     . LEU C 2  242  ? 9.276   -25.193 39.707  1.00 110.77 ? 242  LEU C O     1 
ATOM   5497  C  CB    . LEU C 2  242  ? 8.907   -28.154 40.335  1.00 110.93 ? 242  LEU C CB    1 
ATOM   5498  C  CG    . LEU C 2  242  ? 8.148   -29.329 40.954  1.00 103.18 ? 242  LEU C CG    1 
ATOM   5499  C  CD1   . LEU C 2  242  ? 9.077   -30.162 41.821  1.00 95.41  ? 242  LEU C CD1   1 
ATOM   5500  C  CD2   . LEU C 2  242  ? 6.955   -28.837 41.758  1.00 99.42  ? 242  LEU C CD2   1 
ATOM   5501  N  N     . ARG C 2  243  ? 9.480   -26.108 37.667  1.00 119.41 ? 243  ARG C N     1 
ATOM   5502  C  CA    . ARG C 2  243  ? 10.399  -25.075 37.195  1.00 122.21 ? 243  ARG C CA    1 
ATOM   5503  C  C     . ARG C 2  243  ? 10.003  -24.519 35.828  1.00 128.17 ? 243  ARG C C     1 
ATOM   5504  O  O     . ARG C 2  243  ? 10.577  -24.907 34.809  1.00 128.65 ? 243  ARG C O     1 
ATOM   5505  C  CB    . ARG C 2  243  ? 11.833  -25.618 37.133  1.00 119.43 ? 243  ARG C CB    1 
ATOM   5506  C  CG    . ARG C 2  243  ? 12.376  -26.153 38.454  1.00 112.53 ? 243  ARG C CG    1 
ATOM   5507  C  CD    . ARG C 2  243  ? 12.807  -25.035 39.395  1.00 112.16 ? 243  ARG C CD    1 
ATOM   5508  N  NE    . ARG C 2  243  ? 13.974  -24.314 38.895  1.00 110.28 ? 243  ARG C NE    1 
ATOM   5509  C  CZ    . ARG C 2  243  ? 14.650  -23.409 39.595  1.00 106.39 ? 243  ARG C CZ    1 
ATOM   5510  N  NH1   . ARG C 2  243  ? 15.701  -22.802 39.057  1.00 100.72 ? 243  ARG C NH1   1 
ATOM   5511  N  NH2   . ARG C 2  243  ? 14.279  -23.111 40.833  1.00 102.09 ? 243  ARG C NH2   1 
ATOM   5512  N  N     . PRO C 2  244  ? 9.012   -23.613 35.800  1.00 124.04 ? 244  PRO C N     1 
ATOM   5513  C  CA    . PRO C 2  244  ? 8.633   -22.938 34.553  1.00 117.90 ? 244  PRO C CA    1 
ATOM   5514  C  C     . PRO C 2  244  ? 9.771   -22.075 34.011  1.00 114.81 ? 244  PRO C C     1 
ATOM   5515  O  O     . PRO C 2  244  ? 10.361  -21.298 34.761  1.00 110.95 ? 244  PRO C O     1 
ATOM   5516  C  CB    . PRO C 2  244  ? 7.461   -22.048 34.982  1.00 108.77 ? 244  PRO C CB    1 
ATOM   5517  C  CG    . PRO C 2  244  ? 6.930   -22.681 36.223  1.00 105.47 ? 244  PRO C CG    1 
ATOM   5518  C  CD    . PRO C 2  244  ? 8.131   -23.239 36.918  1.00 114.37 ? 244  PRO C CD    1 
ATOM   5519  N  N     . GLY C 2  245  ? 10.073  -22.217 32.724  1.00 118.78 ? 245  GLY C N     1 
ATOM   5520  C  CA    . GLY C 2  245  ? 11.084  -21.395 32.081  1.00 124.39 ? 245  GLY C CA    1 
ATOM   5521  C  C     . GLY C 2  245  ? 12.490  -21.966 32.127  1.00 125.08 ? 245  GLY C C     1 
ATOM   5522  O  O     . GLY C 2  245  ? 13.346  -21.589 31.327  1.00 126.42 ? 245  GLY C O     1 
ATOM   5523  N  N     . ASP C 2  246  ? 12.730  -22.874 33.067  1.00 120.56 ? 246  ASP C N     1 
ATOM   5524  C  CA    . ASP C 2  246  ? 14.040  -23.499 33.216  1.00 123.58 ? 246  ASP C CA    1 
ATOM   5525  C  C     . ASP C 2  246  ? 14.134  -24.724 32.306  1.00 121.48 ? 246  ASP C C     1 
ATOM   5526  O  O     . ASP C 2  246  ? 13.301  -25.628 32.397  1.00 117.85 ? 246  ASP C O     1 
ATOM   5527  C  CB    . ASP C 2  246  ? 14.262  -23.900 34.678  1.00 124.43 ? 246  ASP C CB    1 
ATOM   5528  C  CG    . ASP C 2  246  ? 15.728  -23.881 35.080  1.00 122.33 ? 246  ASP C CG    1 
ATOM   5529  O  OD1   . ASP C 2  246  ? 16.588  -24.227 34.244  1.00 127.25 ? 246  ASP C OD1   1 
ATOM   5530  O  OD2   . ASP C 2  246  ? 16.020  -23.518 36.240  1.00 109.87 ? 246  ASP C OD2   1 
ATOM   5531  N  N     . PRO C 2  247  ? 15.141  -24.750 31.413  1.00 124.28 ? 247  PRO C N     1 
ATOM   5532  C  CA    . PRO C 2  247  ? 15.328  -25.871 30.482  1.00 120.94 ? 247  PRO C CA    1 
ATOM   5533  C  C     . PRO C 2  247  ? 15.461  -27.215 31.198  1.00 116.63 ? 247  PRO C C     1 
ATOM   5534  O  O     . PRO C 2  247  ? 16.271  -27.345 32.115  1.00 119.49 ? 247  PRO C O     1 
ATOM   5535  C  CB    . PRO C 2  247  ? 16.632  -25.513 29.752  1.00 121.08 ? 247  PRO C CB    1 
ATOM   5536  C  CG    . PRO C 2  247  ? 17.275  -24.435 30.583  1.00 114.80 ? 247  PRO C CG    1 
ATOM   5537  C  CD    . PRO C 2  247  ? 16.138  -23.689 31.195  1.00 118.07 ? 247  PRO C CD    1 
ATOM   5538  N  N     . PRO C 2  248  ? 14.668  -28.209 30.769  1.00 105.77 ? 248  PRO C N     1 
ATOM   5539  C  CA    . PRO C 2  248  ? 14.542  -29.517 31.423  1.00 106.03 ? 248  PRO C CA    1 
ATOM   5540  C  C     . PRO C 2  248  ? 15.663  -30.497 31.082  1.00 106.13 ? 248  PRO C C     1 
ATOM   5541  O  O     . PRO C 2  248  ? 15.379  -31.575 30.558  1.00 103.38 ? 248  PRO C O     1 
ATOM   5542  C  CB    . PRO C 2  248  ? 13.210  -30.055 30.875  1.00 99.91  ? 248  PRO C CB    1 
ATOM   5543  C  CG    . PRO C 2  248  ? 12.562  -28.896 30.162  1.00 98.73  ? 248  PRO C CG    1 
ATOM   5544  C  CD    . PRO C 2  248  ? 13.686  -28.052 29.687  1.00 103.19 ? 248  PRO C CD    1 
ATOM   5545  N  N     . LYS C 2  249  ? 16.907  -30.136 31.380  1.00 106.32 ? 249  LYS C N     1 
ATOM   5546  C  CA    . LYS C 2  249  ? 18.029  -31.041 31.155  1.00 113.12 ? 249  LYS C CA    1 
ATOM   5547  C  C     . LYS C 2  249  ? 17.951  -32.197 32.144  1.00 111.20 ? 249  LYS C C     1 
ATOM   5548  O  O     . LYS C 2  249  ? 17.465  -32.028 33.260  1.00 110.74 ? 249  LYS C O     1 
ATOM   5549  C  CB    . LYS C 2  249  ? 19.362  -30.304 31.300  1.00 116.05 ? 249  LYS C CB    1 
ATOM   5550  C  CG    . LYS C 2  249  ? 20.562  -31.083 30.778  1.00 110.22 ? 249  LYS C CG    1 
ATOM   5551  C  CD    . LYS C 2  249  ? 21.824  -30.235 30.798  1.00 114.56 ? 249  LYS C CD    1 
ATOM   5552  C  CE    . LYS C 2  249  ? 22.982  -30.948 30.118  1.00 99.22  ? 249  LYS C CE    1 
ATOM   5553  N  NZ    . LYS C 2  249  ? 22.676  -31.274 28.698  1.00 86.53  ? 249  LYS C NZ    1 
ATOM   5554  N  N     . ARG C 2  250  ? 18.423  -33.370 31.730  1.00 113.59 ? 250  ARG C N     1 
ATOM   5555  C  CA    . ARG C 2  250  ? 18.324  -34.568 32.558  1.00 107.63 ? 250  ARG C CA    1 
ATOM   5556  C  C     . ARG C 2  250  ? 19.083  -34.422 33.877  1.00 110.09 ? 250  ARG C C     1 
ATOM   5557  O  O     . ARG C 2  250  ? 18.488  -34.513 34.954  1.00 112.84 ? 250  ARG C O     1 
ATOM   5558  C  CB    . ARG C 2  250  ? 18.813  -35.798 31.784  1.00 103.34 ? 250  ARG C CB    1 
ATOM   5559  C  CG    . ARG C 2  250  ? 18.605  -37.128 32.498  1.00 92.91  ? 250  ARG C CG    1 
ATOM   5560  C  CD    . ARG C 2  250  ? 19.874  -37.585 33.203  1.00 95.50  ? 250  ARG C CD    1 
ATOM   5561  N  NE    . ARG C 2  250  ? 19.663  -38.792 33.997  1.00 92.27  ? 250  ARG C NE    1 
ATOM   5562  C  CZ    . ARG C 2  250  ? 20.599  -39.359 34.751  1.00 88.27  ? 250  ARG C CZ    1 
ATOM   5563  N  NH1   . ARG C 2  250  ? 21.814  -38.830 34.814  1.00 73.55  ? 250  ARG C NH1   1 
ATOM   5564  N  NH2   . ARG C 2  250  ? 20.321  -40.456 35.443  1.00 93.11  ? 250  ARG C NH2   1 
ATOM   5565  N  N     . ASP C 2  251  ? 20.387  -34.170 33.792  1.00 112.85 ? 251  ASP C N     1 
ATOM   5566  C  CA    . ASP C 2  251  ? 21.222  -34.091 34.990  1.00 117.58 ? 251  ASP C CA    1 
ATOM   5567  C  C     . ASP C 2  251  ? 20.841  -32.921 35.899  1.00 119.21 ? 251  ASP C C     1 
ATOM   5568  O  O     . ASP C 2  251  ? 21.026  -32.989 37.116  1.00 120.80 ? 251  ASP C O     1 
ATOM   5569  C  CB    . ASP C 2  251  ? 22.714  -34.046 34.634  1.00 115.21 ? 251  ASP C CB    1 
ATOM   5570  C  CG    . ASP C 2  251  ? 23.056  -32.919 33.682  1.00 118.90 ? 251  ASP C CG    1 
ATOM   5571  O  OD1   . ASP C 2  251  ? 23.071  -33.163 32.458  1.00 117.71 ? 251  ASP C OD1   1 
ATOM   5572  O  OD2   . ASP C 2  251  ? 23.316  -31.792 34.155  1.00 115.74 ? 251  ASP C OD2   1 
ATOM   5573  N  N     . LYS C 2  252  ? 20.302  -31.857 35.308  1.00 115.37 ? 252  LYS C N     1 
ATOM   5574  C  CA    . LYS C 2  252  ? 19.833  -30.717 36.089  1.00 112.12 ? 252  LYS C CA    1 
ATOM   5575  C  C     . LYS C 2  252  ? 18.565  -31.075 36.862  1.00 109.87 ? 252  LYS C C     1 
ATOM   5576  O  O     . LYS C 2  252  ? 18.376  -30.639 38.000  1.00 104.11 ? 252  LYS C O     1 
ATOM   5577  C  CB    . LYS C 2  252  ? 19.587  -29.501 35.192  1.00 106.91 ? 252  LYS C CB    1 
ATOM   5578  C  CG    . LYS C 2  252  ? 19.175  -28.255 35.958  1.00 103.21 ? 252  LYS C CG    1 
ATOM   5579  C  CD    . LYS C 2  252  ? 19.135  -27.027 35.067  1.00 109.08 ? 252  LYS C CD    1 
ATOM   5580  C  CE    . LYS C 2  252  ? 18.922  -25.769 35.895  1.00 103.80 ? 252  LYS C CE    1 
ATOM   5581  N  NZ    . LYS C 2  252  ? 18.912  -24.536 35.061  1.00 110.06 ? 252  LYS C NZ    1 
ATOM   5582  N  N     . ALA C 2  253  ? 17.702  -31.875 36.238  1.00 112.67 ? 253  ALA C N     1 
ATOM   5583  C  CA    . ALA C 2  253  ? 16.484  -32.351 36.887  1.00 105.46 ? 253  ALA C CA    1 
ATOM   5584  C  C     . ALA C 2  253  ? 16.810  -33.306 38.033  1.00 103.50 ? 253  ALA C C     1 
ATOM   5585  O  O     . ALA C 2  253  ? 16.277  -33.163 39.140  1.00 100.32 ? 253  ALA C O     1 
ATOM   5586  C  CB    . ALA C 2  253  ? 15.562  -33.018 35.877  1.00 98.82  ? 253  ALA C CB    1 
ATOM   5587  N  N     . VAL C 2  254  ? 17.682  -34.276 37.763  1.00 102.97 ? 254  VAL C N     1 
ATOM   5588  C  CA    . VAL C 2  254  ? 18.156  -35.181 38.807  1.00 105.10 ? 254  VAL C CA    1 
ATOM   5589  C  C     . VAL C 2  254  ? 18.766  -34.384 39.961  1.00 103.67 ? 254  VAL C C     1 
ATOM   5590  O  O     . VAL C 2  254  ? 18.448  -34.631 41.124  1.00 103.94 ? 254  VAL C O     1 
ATOM   5591  C  CB    . VAL C 2  254  ? 19.200  -36.192 38.280  1.00 97.93  ? 254  VAL C CB    1 
ATOM   5592  C  CG1   . VAL C 2  254  ? 19.573  -37.194 39.371  1.00 86.13  ? 254  VAL C CG1   1 
ATOM   5593  C  CG2   . VAL C 2  254  ? 18.681  -36.913 37.047  1.00 95.42  ? 254  VAL C CG2   1 
ATOM   5594  N  N     . ALA C 2  255  ? 19.624  -33.420 39.633  1.00 100.62 ? 255  ALA C N     1 
ATOM   5595  C  CA    . ALA C 2  255  ? 20.269  -32.585 40.645  1.00 92.10  ? 255  ALA C CA    1 
ATOM   5596  C  C     . ALA C 2  255  ? 19.267  -31.799 41.496  1.00 98.72  ? 255  ALA C C     1 
ATOM   5597  O  O     . ALA C 2  255  ? 19.394  -31.755 42.718  1.00 101.13 ? 255  ALA C O     1 
ATOM   5598  C  CB    . ALA C 2  255  ? 21.275  -31.642 40.002  1.00 92.60  ? 255  ALA C CB    1 
ATOM   5599  N  N     . TYR C 2  256  ? 18.277  -31.181 40.854  1.00 98.31  ? 256  TYR C N     1 
ATOM   5600  C  CA    . TYR C 2  256  ? 17.272  -30.404 41.586  1.00 95.35  ? 256  TYR C CA    1 
ATOM   5601  C  C     . TYR C 2  256  ? 16.386  -31.270 42.481  1.00 87.41  ? 256  TYR C C     1 
ATOM   5602  O  O     . TYR C 2  256  ? 16.186  -30.948 43.655  1.00 82.97  ? 256  TYR C O     1 
ATOM   5603  C  CB    . TYR C 2  256  ? 16.404  -29.561 40.640  1.00 96.96  ? 256  TYR C CB    1 
ATOM   5604  C  CG    . TYR C 2  256  ? 15.334  -28.742 41.347  1.00 90.74  ? 256  TYR C CG    1 
ATOM   5605  C  CD1   . TYR C 2  256  ? 15.634  -27.507 41.914  1.00 84.87  ? 256  TYR C CD1   1 
ATOM   5606  C  CD2   . TYR C 2  256  ? 14.023  -29.202 41.442  1.00 88.02  ? 256  TYR C CD2   1 
ATOM   5607  C  CE1   . TYR C 2  256  ? 14.660  -26.756 42.559  1.00 96.58  ? 256  TYR C CE1   1 
ATOM   5608  C  CE2   . TYR C 2  256  ? 13.043  -28.459 42.085  1.00 90.74  ? 256  TYR C CE2   1 
ATOM   5609  C  CZ    . TYR C 2  256  ? 13.366  -27.237 42.641  1.00 99.04  ? 256  TYR C CZ    1 
ATOM   5610  O  OH    . TYR C 2  256  ? 12.393  -26.497 43.281  1.00 85.52  ? 256  TYR C OH    1 
ATOM   5611  N  N     . VAL C 2  257  ? 15.847  -32.356 41.933  1.00 86.76  ? 257  VAL C N     1 
ATOM   5612  C  CA    . VAL C 2  257  ? 14.965  -33.217 42.717  1.00 85.12  ? 257  VAL C CA    1 
ATOM   5613  C  C     . VAL C 2  257  ? 15.736  -33.895 43.858  1.00 89.71  ? 257  VAL C C     1 
ATOM   5614  O  O     . VAL C 2  257  ? 15.197  -34.100 44.945  1.00 88.38  ? 257  VAL C O     1 
ATOM   5615  C  CB    . VAL C 2  257  ? 14.211  -34.245 41.831  1.00 76.54  ? 257  VAL C CB    1 
ATOM   5616  C  CG1   . VAL C 2  257  ? 14.746  -35.653 42.045  1.00 82.01  ? 257  VAL C CG1   1 
ATOM   5617  C  CG2   . VAL C 2  257  ? 12.710  -34.194 42.102  1.00 60.35  ? 257  VAL C CG2   1 
ATOM   5618  N  N     . TYR C 2  258  ? 17.005  -34.212 43.614  1.00 92.57  ? 258  TYR C N     1 
ATOM   5619  C  CA    . TYR C 2  258  ? 17.867  -34.784 44.644  1.00 87.67  ? 258  TYR C CA    1 
ATOM   5620  C  C     . TYR C 2  258  ? 18.158  -33.758 45.731  1.00 85.23  ? 258  TYR C C     1 
ATOM   5621  O  O     . TYR C 2  258  ? 18.194  -34.092 46.916  1.00 85.63  ? 258  TYR C O     1 
ATOM   5622  C  CB    . TYR C 2  258  ? 19.172  -35.286 44.030  1.00 85.20  ? 258  TYR C CB    1 
ATOM   5623  C  CG    . TYR C 2  258  ? 20.274  -35.571 45.022  1.00 79.79  ? 258  TYR C CG    1 
ATOM   5624  C  CD1   . TYR C 2  258  ? 21.304  -34.661 45.223  1.00 83.57  ? 258  TYR C CD1   1 
ATOM   5625  C  CD2   . TYR C 2  258  ? 20.296  -36.757 45.741  1.00 74.51  ? 258  TYR C CD2   1 
ATOM   5626  C  CE1   . TYR C 2  258  ? 22.319  -34.920 46.117  1.00 75.37  ? 258  TYR C CE1   1 
ATOM   5627  C  CE2   . TYR C 2  258  ? 21.308  -37.024 46.639  1.00 72.77  ? 258  TYR C CE2   1 
ATOM   5628  C  CZ    . TYR C 2  258  ? 22.317  -36.101 46.823  1.00 69.43  ? 258  TYR C CZ    1 
ATOM   5629  O  OH    . TYR C 2  258  ? 23.330  -36.355 47.714  1.00 71.38  ? 258  TYR C OH    1 
ATOM   5630  N  N     . GLY C 2  259  ? 18.370  -32.510 45.321  1.00 86.59  ? 259  GLY C N     1 
ATOM   5631  C  CA    . GLY C 2  259  ? 18.576  -31.426 46.263  1.00 92.44  ? 259  GLY C CA    1 
ATOM   5632  C  C     . GLY C 2  259  ? 17.343  -31.153 47.106  1.00 92.30  ? 259  GLY C C     1 
ATOM   5633  O  O     . GLY C 2  259  ? 17.454  -30.733 48.257  1.00 94.96  ? 259  GLY C O     1 
ATOM   5634  N  N     . LEU C 2  260  ? 16.165  -31.385 46.531  1.00 87.92  ? 260  LEU C N     1 
ATOM   5635  C  CA    . LEU C 2  260  ? 14.905  -31.167 47.239  1.00 88.27  ? 260  LEU C CA    1 
ATOM   5636  C  C     . LEU C 2  260  ? 14.532  -32.331 48.170  1.00 83.36  ? 260  LEU C C     1 
ATOM   5637  O  O     . LEU C 2  260  ? 13.922  -32.120 49.224  1.00 78.26  ? 260  LEU C O     1 
ATOM   5638  C  CB    . LEU C 2  260  ? 13.771  -30.892 46.243  1.00 85.21  ? 260  LEU C CB    1 
ATOM   5639  C  CG    . LEU C 2  260  ? 12.609  -30.031 46.741  1.00 79.75  ? 260  LEU C CG    1 
ATOM   5640  C  CD1   . LEU C 2  260  ? 13.022  -28.571 46.741  1.00 90.33  ? 260  LEU C CD1   1 
ATOM   5641  C  CD2   . LEU C 2  260  ? 11.361  -30.246 45.895  1.00 68.73  ? 260  LEU C CD2   1 
ATOM   5642  N  N     . ILE C 2  261  ? 14.891  -33.553 47.782  1.00 80.19  ? 261  ILE C N     1 
ATOM   5643  C  CA    . ILE C 2  261  ? 14.493  -34.732 48.547  1.00 73.20  ? 261  ILE C CA    1 
ATOM   5644  C  C     . ILE C 2  261  ? 15.631  -35.504 49.223  1.00 75.14  ? 261  ILE C C     1 
ATOM   5645  O  O     . ILE C 2  261  ? 15.680  -35.582 50.450  1.00 81.07  ? 261  ILE C O     1 
ATOM   5646  C  CB    . ILE C 2  261  ? 13.668  -35.673 47.679  1.00 73.43  ? 261  ILE C CB    1 
ATOM   5647  C  CG1   . ILE C 2  261  ? 12.516  -34.883 47.054  1.00 70.12  ? 261  ILE C CG1   1 
ATOM   5648  C  CG2   . ILE C 2  261  ? 13.203  -36.897 48.480  1.00 74.66  ? 261  ILE C CG2   1 
ATOM   5649  C  CD1   . ILE C 2  261  ? 11.577  -34.277 48.082  1.00 67.30  ? 261  ILE C CD1   1 
ATOM   5650  N  N     . ALA C 2  262  ? 16.542  -36.065 48.433  1.00 74.86  ? 262  ALA C N     1 
ATOM   5651  C  CA    . ALA C 2  262  ? 17.553  -36.986 48.964  1.00 81.32  ? 262  ALA C CA    1 
ATOM   5652  C  C     . ALA C 2  262  ? 18.887  -36.378 49.431  1.00 80.16  ? 262  ALA C C     1 
ATOM   5653  O  O     . ALA C 2  262  ? 19.778  -37.111 49.860  1.00 78.63  ? 262  ALA C O     1 
ATOM   5654  C  CB    . ALA C 2  262  ? 17.818  -38.101 47.956  1.00 87.92  ? 262  ALA C CB    1 
ATOM   5655  N  N     . ASP C 2  263  ? 19.024  -35.056 49.369  1.00 80.97  ? 263  ASP C N     1 
ATOM   5656  C  CA    . ASP C 2  263  ? 20.288  -34.399 49.726  1.00 82.63  ? 263  ASP C CA    1 
ATOM   5657  C  C     . ASP C 2  263  ? 20.383  -34.070 51.217  1.00 87.85  ? 263  ASP C C     1 
ATOM   5658  O  O     . ASP C 2  263  ? 19.667  -33.197 51.706  1.00 85.97  ? 263  ASP C O     1 
ATOM   5659  C  CB    . ASP C 2  263  ? 20.479  -33.119 48.902  1.00 83.95  ? 263  ASP C CB    1 
ATOM   5660  C  CG    . ASP C 2  263  ? 21.938  -32.812 48.626  1.00 87.62  ? 263  ASP C CG    1 
ATOM   5661  O  OD1   . ASP C 2  263  ? 22.806  -33.371 49.328  1.00 84.19  ? 263  ASP C OD1   1 
ATOM   5662  O  OD2   . ASP C 2  263  ? 22.214  -32.016 47.702  1.00 84.25  ? 263  ASP C OD2   1 
ATOM   5663  N  N     . PRO C 2  264  ? 21.276  -34.768 51.941  1.00 88.23  ? 264  PRO C N     1 
ATOM   5664  C  CA    . PRO C 2  264  ? 21.455  -34.555 53.382  1.00 80.52  ? 264  PRO C CA    1 
ATOM   5665  C  C     . PRO C 2  264  ? 22.058  -33.184 53.654  1.00 85.72  ? 264  PRO C C     1 
ATOM   5666  O  O     . PRO C 2  264  ? 21.833  -32.602 54.716  1.00 85.36  ? 264  PRO C O     1 
ATOM   5667  C  CB    . PRO C 2  264  ? 22.455  -35.650 53.780  1.00 69.88  ? 264  PRO C CB    1 
ATOM   5668  C  CG    . PRO C 2  264  ? 22.437  -36.634 52.654  1.00 71.58  ? 264  PRO C CG    1 
ATOM   5669  C  CD    . PRO C 2  264  ? 22.169  -35.821 51.433  1.00 78.87  ? 264  PRO C CD    1 
ATOM   5670  N  N     . ARG C 2  265  ? 22.819  -32.683 52.685  1.00 87.03  ? 265  ARG C N     1 
ATOM   5671  C  CA    . ARG C 2  265  ? 23.468  -31.382 52.792  1.00 93.95  ? 265  ARG C CA    1 
ATOM   5672  C  C     . ARG C 2  265  ? 22.448  -30.250 52.671  1.00 91.46  ? 265  ARG C C     1 
ATOM   5673  O  O     . ARG C 2  265  ? 22.692  -29.129 53.120  1.00 88.08  ? 265  ARG C O     1 
ATOM   5674  C  CB    . ARG C 2  265  ? 24.557  -31.248 51.719  1.00 91.00  ? 265  ARG C CB    1 
ATOM   5675  C  CG    . ARG C 2  265  ? 25.557  -32.405 51.711  1.00 88.60  ? 265  ARG C CG    1 
ATOM   5676  C  CD    . ARG C 2  265  ? 26.361  -32.477 50.412  1.00 87.07  ? 265  ARG C CD    1 
ATOM   5677  N  NE    . ARG C 2  265  ? 27.512  -31.575 50.403  1.00 90.34  ? 265  ARG C NE    1 
ATOM   5678  C  CZ    . ARG C 2  265  ? 28.734  -31.913 50.807  1.00 79.35  ? 265  ARG C CZ    1 
ATOM   5679  N  NH1   . ARG C 2  265  ? 28.974  -33.137 51.261  1.00 74.87  ? 265  ARG C NH1   1 
ATOM   5680  N  NH2   . ARG C 2  265  ? 29.719  -31.026 50.759  1.00 67.73  ? 265  ARG C NH2   1 
ATOM   5681  N  N     . ARG C 2  266  ? 21.300  -30.552 52.071  1.00 86.65  ? 266  ARG C N     1 
ATOM   5682  C  CA    . ARG C 2  266  ? 20.237  -29.564 51.905  1.00 88.70  ? 266  ARG C CA    1 
ATOM   5683  C  C     . ARG C 2  266  ? 19.000  -29.894 52.745  1.00 84.16  ? 266  ARG C C     1 
ATOM   5684  O  O     . ARG C 2  266  ? 18.611  -29.110 53.608  1.00 84.70  ? 266  ARG C O     1 
ATOM   5685  C  CB    . ARG C 2  266  ? 19.872  -29.379 50.428  1.00 89.77  ? 266  ARG C CB    1 
ATOM   5686  C  CG    . ARG C 2  266  ? 21.017  -28.851 49.569  1.00 85.84  ? 266  ARG C CG    1 
ATOM   5687  C  CD    . ARG C 2  266  ? 20.508  -28.097 48.344  1.00 103.36 ? 266  ARG C CD    1 
ATOM   5688  N  NE    . ARG C 2  266  ? 19.965  -26.784 48.693  1.00 111.74 ? 266  ARG C NE    1 
ATOM   5689  C  CZ    . ARG C 2  266  ? 19.434  -25.933 47.819  1.00 109.59 ? 266  ARG C CZ    1 
ATOM   5690  N  NH1   . ARG C 2  266  ? 18.967  -24.762 48.233  1.00 97.71  ? 266  ARG C NH1   1 
ATOM   5691  N  NH2   . ARG C 2  266  ? 19.368  -26.251 46.533  1.00 104.69 ? 266  ARG C NH2   1 
ATOM   5692  N  N     . TYR C 2  267  ? 18.378  -31.040 52.478  1.00 78.13  ? 267  TYR C N     1 
ATOM   5693  C  CA    . TYR C 2  267  ? 17.196  -31.466 53.229  1.00 76.51  ? 267  TYR C CA    1 
ATOM   5694  C  C     . TYR C 2  267  ? 17.558  -32.344 54.427  1.00 75.98  ? 267  TYR C C     1 
ATOM   5695  O  O     . TYR C 2  267  ? 18.101  -33.434 54.261  1.00 83.73  ? 267  TYR C O     1 
ATOM   5696  C  CB    . TYR C 2  267  ? 16.221  -32.211 52.317  1.00 80.24  ? 267  TYR C CB    1 
ATOM   5697  C  CG    . TYR C 2  267  ? 14.878  -32.503 52.952  1.00 79.68  ? 267  TYR C CG    1 
ATOM   5698  C  CD1   . TYR C 2  267  ? 13.797  -31.653 52.753  1.00 83.14  ? 267  TYR C CD1   1 
ATOM   5699  C  CD2   . TYR C 2  267  ? 14.688  -33.631 53.743  1.00 74.74  ? 267  TYR C CD2   1 
ATOM   5700  C  CE1   . TYR C 2  267  ? 12.566  -31.915 53.327  1.00 84.98  ? 267  TYR C CE1   1 
ATOM   5701  C  CE2   . TYR C 2  267  ? 13.463  -33.899 54.323  1.00 75.59  ? 267  TYR C CE2   1 
ATOM   5702  C  CZ    . TYR C 2  267  ? 12.404  -33.039 54.110  1.00 77.86  ? 267  TYR C CZ    1 
ATOM   5703  O  OH    . TYR C 2  267  ? 11.180  -33.301 54.682  1.00 71.42  ? 267  TYR C OH    1 
ATOM   5704  N  N     . ASP C 2  268  ? 17.254  -31.873 55.634  1.00 67.49  ? 268  ASP C N     1 
ATOM   5705  C  CA    . ASP C 2  268  ? 17.571  -32.643 56.834  1.00 73.98  ? 268  ASP C CA    1 
ATOM   5706  C  C     . ASP C 2  268  ? 16.453  -32.655 57.878  1.00 74.12  ? 268  ASP C C     1 
ATOM   5707  O  O     . ASP C 2  268  ? 16.060  -31.606 58.389  1.00 69.73  ? 268  ASP C O     1 
ATOM   5708  C  CB    . ASP C 2  268  ? 18.869  -32.128 57.467  1.00 77.74  ? 268  ASP C CB    1 
ATOM   5709  C  CG    . ASP C 2  268  ? 19.391  -33.040 58.566  1.00 77.18  ? 268  ASP C CG    1 
ATOM   5710  O  OD1   . ASP C 2  268  ? 19.207  -34.271 58.459  1.00 78.00  ? 268  ASP C OD1   1 
ATOM   5711  O  OD2   . ASP C 2  268  ? 19.990  -32.526 59.535  1.00 68.61  ? 268  ASP C OD2   1 
ATOM   5712  N  N     . LEU C 2  269  ? 15.942  -33.846 58.187  1.00 72.95  ? 269  LEU C N     1 
ATOM   5713  C  CA    . LEU C 2  269  ? 15.111  -34.037 59.370  1.00 59.54  ? 269  LEU C CA    1 
ATOM   5714  C  C     . LEU C 2  269  ? 16.057  -34.073 60.553  1.00 69.89  ? 269  LEU C C     1 
ATOM   5715  O  O     . LEU C 2  269  ? 17.240  -34.368 60.392  1.00 73.83  ? 269  LEU C O     1 
ATOM   5716  C  CB    . LEU C 2  269  ? 14.354  -35.364 59.317  1.00 57.83  ? 269  LEU C CB    1 
ATOM   5717  C  CG    . LEU C 2  269  ? 13.274  -35.623 58.267  1.00 60.64  ? 269  LEU C CG    1 
ATOM   5718  C  CD1   . LEU C 2  269  ? 12.746  -37.041 58.415  1.00 48.94  ? 269  LEU C CD1   1 
ATOM   5719  C  CD2   . LEU C 2  269  ? 12.145  -34.622 58.389  1.00 63.80  ? 269  LEU C CD2   1 
ATOM   5720  N  N     . GLY C 2  270  ? 15.550  -33.780 61.743  1.00 72.72  ? 270  GLY C N     1 
ATOM   5721  C  CA    . GLY C 2  270  ? 16.361  -33.916 62.938  1.00 83.22  ? 270  GLY C CA    1 
ATOM   5722  C  C     . GLY C 2  270  ? 16.520  -35.380 63.297  1.00 76.74  ? 270  GLY C C     1 
ATOM   5723  O  O     . GLY C 2  270  ? 15.879  -36.243 62.695  1.00 77.25  ? 270  GLY C O     1 
ATOM   5724  N  N     . GLU C 2  271  ? 17.379  -35.671 64.268  1.00 64.96  ? 271  GLU C N     1 
ATOM   5725  C  CA    . GLU C 2  271  ? 17.446  -37.018 64.809  1.00 75.53  ? 271  GLU C CA    1 
ATOM   5726  C  C     . GLU C 2  271  ? 16.120  -37.260 65.516  1.00 75.90  ? 271  GLU C C     1 
ATOM   5727  O  O     . GLU C 2  271  ? 15.609  -38.385 65.567  1.00 75.31  ? 271  GLU C O     1 
ATOM   5728  C  CB    . GLU C 2  271  ? 18.616  -37.159 65.782  1.00 80.46  ? 271  GLU C CB    1 
ATOM   5729  C  CG    . GLU C 2  271  ? 19.059  -38.596 66.007  1.00 79.31  ? 271  GLU C CG    1 
ATOM   5730  C  CD    . GLU C 2  271  ? 19.521  -39.271 64.725  1.00 95.35  ? 271  GLU C CD    1 
ATOM   5731  O  OE1   . GLU C 2  271  ? 20.048  -38.573 63.831  1.00 89.29  ? 271  GLU C OE1   1 
ATOM   5732  O  OE2   . GLU C 2  271  ? 19.353  -40.503 64.610  1.00 100.21 ? 271  GLU C OE2   1 
ATOM   5733  N  N     . ALA C 2  272  ? 15.567  -36.172 66.045  1.00 67.40  ? 272  ALA C N     1 
ATOM   5734  C  CA    . ALA C 2  272  ? 14.235  -36.169 66.627  1.00 67.27  ? 272  ALA C CA    1 
ATOM   5735  C  C     . ALA C 2  272  ? 13.190  -36.457 65.556  1.00 63.83  ? 272  ALA C C     1 
ATOM   5736  O  O     . ALA C 2  272  ? 12.272  -37.243 65.774  1.00 61.04  ? 272  ALA C O     1 
ATOM   5737  C  CB    . ALA C 2  272  ? 13.956  -34.831 67.290  1.00 59.30  ? 272  ALA C CB    1 
ATOM   5738  N  N     . GLY C 2  273  ? 13.333  -35.813 64.402  1.00 62.08  ? 273  GLY C N     1 
ATOM   5739  C  CA    . GLY C 2  273  ? 12.428  -36.039 63.289  1.00 67.81  ? 273  GLY C CA    1 
ATOM   5740  C  C     . GLY C 2  273  ? 12.534  -37.460 62.774  1.00 69.75  ? 273  GLY C C     1 
ATOM   5741  O  O     . GLY C 2  273  ? 11.538  -38.077 62.397  1.00 65.27  ? 273  GLY C O     1 
ATOM   5742  N  N     . ARG C 2  274  ? 13.762  -37.966 62.757  1.00 73.91  ? 274  ARG C N     1 
ATOM   5743  C  CA    . ARG C 2  274  ? 14.048  -39.346 62.392  1.00 71.95  ? 274  ARG C CA    1 
ATOM   5744  C  C     . ARG C 2  274  ? 13.281  -40.314 63.292  1.00 73.55  ? 274  ARG C C     1 
ATOM   5745  O  O     . ARG C 2  274  ? 12.394  -41.043 62.829  1.00 70.25  ? 274  ARG C O     1 
ATOM   5746  C  CB    . ARG C 2  274  ? 15.552  -39.593 62.506  1.00 78.87  ? 274  ARG C CB    1 
ATOM   5747  C  CG    . ARG C 2  274  ? 16.049  -40.881 61.882  1.00 81.97  ? 274  ARG C CG    1 
ATOM   5748  C  CD    . ARG C 2  274  ? 17.567  -40.922 61.923  1.00 79.45  ? 274  ARG C CD    1 
ATOM   5749  N  NE    . ARG C 2  274  ? 18.103  -42.151 61.354  1.00 84.92  ? 274  ARG C NE    1 
ATOM   5750  C  CZ    . ARG C 2  274  ? 18.271  -43.276 62.039  1.00 95.24  ? 274  ARG C CZ    1 
ATOM   5751  N  NH1   . ARG C 2  274  ? 17.937  -43.329 63.322  1.00 90.71  ? 274  ARG C NH1   1 
ATOM   5752  N  NH2   . ARG C 2  274  ? 18.769  -44.350 61.441  1.00 103.10 ? 274  ARG C NH2   1 
ATOM   5753  N  N     . TYR C 2  275  ? 13.626  -40.306 64.579  1.00 71.67  ? 275  TYR C N     1 
ATOM   5754  C  CA    . TYR C 2  275  ? 12.966  -41.158 65.567  1.00 69.45  ? 275  TYR C CA    1 
ATOM   5755  C  C     . TYR C 2  275  ? 11.444  -41.032 65.532  1.00 76.97  ? 275  TYR C C     1 
ATOM   5756  O  O     . TYR C 2  275  ? 10.737  -42.036 65.505  1.00 83.61  ? 275  TYR C O     1 
ATOM   5757  C  CB    . TYR C 2  275  ? 13.485  -40.853 66.978  1.00 71.99  ? 275  TYR C CB    1 
ATOM   5758  C  CG    . TYR C 2  275  ? 12.569  -41.326 68.092  1.00 85.31  ? 275  TYR C CG    1 
ATOM   5759  C  CD1   . TYR C 2  275  ? 12.586  -42.647 68.524  1.00 87.94  ? 275  TYR C CD1   1 
ATOM   5760  C  CD2   . TYR C 2  275  ? 11.690  -40.446 68.718  1.00 93.47  ? 275  TYR C CD2   1 
ATOM   5761  C  CE1   . TYR C 2  275  ? 11.749  -43.081 69.543  1.00 89.30  ? 275  TYR C CE1   1 
ATOM   5762  C  CE2   . TYR C 2  275  ? 10.850  -40.870 69.735  1.00 94.37  ? 275  TYR C CE2   1 
ATOM   5763  C  CZ    . TYR C 2  275  ? 10.883  -42.187 70.144  1.00 91.00  ? 275  TYR C CZ    1 
ATOM   5764  O  OH    . TYR C 2  275  ? 10.050  -42.607 71.157  1.00 78.57  ? 275  TYR C OH    1 
ATOM   5765  N  N     . LYS C 2  276  ? 10.948  -39.797 65.532  1.00 78.33  ? 276  LYS C N     1 
ATOM   5766  C  CA    . LYS C 2  276  ? 9.508   -39.545 65.548  1.00 72.35  ? 276  LYS C CA    1 
ATOM   5767  C  C     . LYS C 2  276  ? 8.803   -40.095 64.317  1.00 69.27  ? 276  LYS C C     1 
ATOM   5768  O  O     . LYS C 2  276  ? 7.723   -40.669 64.426  1.00 70.68  ? 276  LYS C O     1 
ATOM   5769  C  CB    . LYS C 2  276  ? 9.210   -38.050 65.680  1.00 71.35  ? 276  LYS C CB    1 
ATOM   5770  C  CG    . LYS C 2  276  ? 9.143   -37.546 67.111  1.00 66.86  ? 276  LYS C CG    1 
ATOM   5771  C  CD    . LYS C 2  276  ? 8.439   -36.195 67.195  1.00 55.27  ? 276  LYS C CD    1 
ATOM   5772  C  CE    . LYS C 2  276  ? 6.925   -36.327 67.041  1.00 55.04  ? 276  LYS C CE    1 
ATOM   5773  N  NZ    . LYS C 2  276  ? 6.467   -36.508 65.632  1.00 53.33  ? 276  LYS C NZ    1 
ATOM   5774  N  N     . ALA C 2  277  ? 9.406   -39.905 63.148  1.00 68.20  ? 277  ALA C N     1 
ATOM   5775  C  CA    . ALA C 2  277  ? 8.839   -40.436 61.915  1.00 63.28  ? 277  ALA C CA    1 
ATOM   5776  C  C     . ALA C 2  277  ? 8.800   -41.955 61.985  1.00 74.95  ? 277  ALA C C     1 
ATOM   5777  O  O     . ALA C 2  277  ? 7.808   -42.580 61.599  1.00 72.21  ? 277  ALA C O     1 
ATOM   5778  C  CB    . ALA C 2  277  ? 9.645   -39.980 60.719  1.00 49.56  ? 277  ALA C CB    1 
ATOM   5779  N  N     . GLU C 2  278  ? 9.883   -42.541 62.492  1.00 77.19  ? 278  GLU C N     1 
ATOM   5780  C  CA    . GLU C 2  278  ? 9.962   -43.988 62.660  1.00 77.68  ? 278  GLU C CA    1 
ATOM   5781  C  C     . GLU C 2  278  ? 8.840   -44.510 63.552  1.00 82.15  ? 278  GLU C C     1 
ATOM   5782  O  O     . GLU C 2  278  ? 8.162   -45.478 63.209  1.00 92.19  ? 278  GLU C O     1 
ATOM   5783  C  CB    . GLU C 2  278  ? 11.314  -44.389 63.252  1.00 78.69  ? 278  GLU C CB    1 
ATOM   5784  C  CG    . GLU C 2  278  ? 12.492  -44.196 62.317  1.00 87.09  ? 278  GLU C CG    1 
ATOM   5785  C  CD    . GLU C 2  278  ? 13.816  -44.511 62.984  1.00 97.56  ? 278  GLU C CD    1 
ATOM   5786  O  OE1   . GLU C 2  278  ? 13.809  -44.867 64.184  1.00 90.95  ? 278  GLU C OE1   1 
ATOM   5787  O  OE2   . GLU C 2  278  ? 14.862  -44.401 62.310  1.00 96.10  ? 278  GLU C OE2   1 
ATOM   5788  N  N     . GLU C 2  279  ? 8.650   -43.859 64.694  1.00 77.46  ? 279  GLU C N     1 
ATOM   5789  C  CA    . GLU C 2  279  ? 7.682   -44.307 65.686  1.00 76.40  ? 279  GLU C CA    1 
ATOM   5790  C  C     . GLU C 2  279  ? 6.251   -44.107 65.194  1.00 78.38  ? 279  GLU C C     1 
ATOM   5791  O  O     . GLU C 2  279  ? 5.383   -44.949 65.421  1.00 85.08  ? 279  GLU C O     1 
ATOM   5792  C  CB    . GLU C 2  279  ? 7.897   -43.561 67.007  1.00 80.54  ? 279  GLU C CB    1 
ATOM   5793  C  CG    . GLU C 2  279  ? 7.637   -44.393 68.258  1.00 95.31  ? 279  GLU C CG    1 
ATOM   5794  C  CD    . GLU C 2  279  ? 8.783   -45.339 68.593  1.00 92.90  ? 279  GLU C CD    1 
ATOM   5795  O  OE1   . GLU C 2  279  ? 8.683   -46.057 69.611  1.00 89.21  ? 279  GLU C OE1   1 
ATOM   5796  O  OE2   . GLU C 2  279  ? 9.784   -45.362 67.845  1.00 79.26  ? 279  GLU C OE2   1 
ATOM   5797  N  N     . LYS C 2  280  ? 6.016   -42.990 64.514  1.00 75.04  ? 280  LYS C N     1 
ATOM   5798  C  CA    . LYS C 2  280  ? 4.686   -42.653 64.019  1.00 74.87  ? 280  LYS C CA    1 
ATOM   5799  C  C     . LYS C 2  280  ? 4.261   -43.560 62.872  1.00 81.31  ? 280  LYS C C     1 
ATOM   5800  O  O     . LYS C 2  280  ? 3.186   -44.157 62.912  1.00 84.31  ? 280  LYS C O     1 
ATOM   5801  C  CB    . LYS C 2  280  ? 4.635   -41.188 63.573  1.00 74.93  ? 280  LYS C CB    1 
ATOM   5802  C  CG    . LYS C 2  280  ? 3.296   -40.750 62.992  1.00 72.38  ? 280  LYS C CG    1 
ATOM   5803  C  CD    . LYS C 2  280  ? 2.179   -40.842 64.022  1.00 71.84  ? 280  LYS C CD    1 
ATOM   5804  C  CE    . LYS C 2  280  ? 0.853   -40.358 63.451  1.00 65.26  ? 280  LYS C CE    1 
ATOM   5805  N  NZ    . LYS C 2  280  ? -0.273  -40.534 64.415  1.00 64.77  ? 280  LYS C NZ    1 
ATOM   5806  N  N     . LEU C 2  281  ? 5.109   -43.666 61.853  1.00 84.32  ? 281  LEU C N     1 
ATOM   5807  C  CA    . LEU C 2  281  ? 4.769   -44.437 60.659  1.00 88.39  ? 281  LEU C CA    1 
ATOM   5808  C  C     . LEU C 2  281  ? 4.972   -45.941 60.833  1.00 89.15  ? 281  LEU C C     1 
ATOM   5809  O  O     . LEU C 2  281  ? 4.506   -46.733 60.012  1.00 87.24  ? 281  LEU C O     1 
ATOM   5810  C  CB    . LEU C 2  281  ? 5.559   -43.935 59.446  1.00 92.69  ? 281  LEU C CB    1 
ATOM   5811  C  CG    . LEU C 2  281  ? 5.149   -42.571 58.884  1.00 85.20  ? 281  LEU C CG    1 
ATOM   5812  C  CD1   . LEU C 2  281  ? 5.963   -42.228 57.646  1.00 72.35  ? 281  LEU C CD1   1 
ATOM   5813  C  CD2   . LEU C 2  281  ? 3.663   -42.551 58.571  1.00 81.57  ? 281  LEU C CD2   1 
ATOM   5814  N  N     . GLY C 2  282  ? 5.664   -46.330 61.900  1.00 89.31  ? 282  GLY C N     1 
ATOM   5815  C  CA    . GLY C 2  282  ? 5.941   -47.732 62.161  1.00 88.28  ? 282  GLY C CA    1 
ATOM   5816  C  C     . GLY C 2  282  ? 6.922   -48.326 61.167  1.00 89.56  ? 282  GLY C C     1 
ATOM   5817  O  O     . GLY C 2  282  ? 6.758   -49.460 60.712  1.00 85.47  ? 282  GLY C O     1 
ATOM   5818  N  N     . ILE C 2  283  ? 7.945   -47.550 60.822  1.00 85.23  ? 283  ILE C N     1 
ATOM   5819  C  CA    . ILE C 2  283  ? 8.966   -47.992 59.881  1.00 84.80  ? 283  ILE C CA    1 
ATOM   5820  C  C     . ILE C 2  283  ? 10.357  -47.723 60.445  1.00 87.76  ? 283  ILE C C     1 
ATOM   5821  O  O     . ILE C 2  283  ? 10.499  -47.320 61.600  1.00 87.08  ? 283  ILE C O     1 
ATOM   5822  C  CB    . ILE C 2  283  ? 8.828   -47.285 58.518  1.00 85.86  ? 283  ILE C CB    1 
ATOM   5823  C  CG1   . ILE C 2  283  ? 9.061   -45.779 58.667  1.00 79.75  ? 283  ILE C CG1   1 
ATOM   5824  C  CG2   . ILE C 2  283  ? 7.461   -47.566 57.903  1.00 81.42  ? 283  ILE C CG2   1 
ATOM   5825  C  CD1   . ILE C 2  283  ? 9.011   -45.019 57.358  1.00 70.32  ? 283  ILE C CD1   1 
ATOM   5826  N  N     . ARG C 2  284  ? 11.381  -47.962 59.632  1.00 83.56  ? 284  ARG C N     1 
ATOM   5827  C  CA    . ARG C 2  284  ? 12.752  -47.663 60.028  1.00 89.54  ? 284  ARG C CA    1 
ATOM   5828  C  C     . ARG C 2  284  ? 13.458  -46.879 58.930  1.00 87.86  ? 284  ARG C C     1 
ATOM   5829  O  O     . ARG C 2  284  ? 13.479  -47.294 57.770  1.00 86.35  ? 284  ARG C O     1 
ATOM   5830  C  CB    . ARG C 2  284  ? 13.521  -48.947 60.344  1.00 89.14  ? 284  ARG C CB    1 
ATOM   5831  C  CG    . ARG C 2  284  ? 14.828  -48.727 61.096  1.00 88.90  ? 284  ARG C CG    1 
ATOM   5832  C  CD    . ARG C 2  284  ? 14.580  -48.080 62.453  1.00 94.42  ? 284  ARG C CD    1 
ATOM   5833  N  NE    . ARG C 2  284  ? 15.769  -48.093 63.305  1.00 109.13 ? 284  ARG C NE    1 
ATOM   5834  C  CZ    . ARG C 2  284  ? 16.672  -47.118 63.349  1.00 107.28 ? 284  ARG C CZ    1 
ATOM   5835  N  NH1   . ARG C 2  284  ? 17.720  -47.216 64.157  1.00 95.44  ? 284  ARG C NH1   1 
ATOM   5836  N  NH2   . ARG C 2  284  ? 16.531  -46.044 62.585  1.00 105.61 ? 284  ARG C NH2   1 
ATOM   5837  N  N     . LEU C 2  285  ? 14.029  -45.739 59.301  1.00 83.02  ? 285  LEU C N     1 
ATOM   5838  C  CA    . LEU C 2  285  ? 14.727  -44.889 58.347  1.00 87.09  ? 285  LEU C CA    1 
ATOM   5839  C  C     . LEU C 2  285  ? 16.221  -45.186 58.337  1.00 90.90  ? 285  LEU C C     1 
ATOM   5840  O  O     . LEU C 2  285  ? 16.823  -45.434 59.382  1.00 89.98  ? 285  LEU C O     1 
ATOM   5841  C  CB    . LEU C 2  285  ? 14.486  -43.413 58.675  1.00 88.62  ? 285  LEU C CB    1 
ATOM   5842  C  CG    . LEU C 2  285  ? 13.530  -42.622 57.776  1.00 77.89  ? 285  LEU C CG    1 
ATOM   5843  C  CD1   . LEU C 2  285  ? 14.187  -42.281 56.450  1.00 74.54  ? 285  LEU C CD1   1 
ATOM   5844  C  CD2   . LEU C 2  285  ? 12.238  -43.387 57.549  1.00 73.72  ? 285  LEU C CD2   1 
ATOM   5845  N  N     . SER C 2  286  ? 16.812  -45.170 57.146  1.00 91.76  ? 286  SER C N     1 
ATOM   5846  C  CA    . SER C 2  286  ? 18.255  -45.304 57.008  1.00 94.06  ? 286  SER C CA    1 
ATOM   5847  C  C     . SER C 2  286  ? 18.909  -43.947 57.232  1.00 92.73  ? 286  SER C C     1 
ATOM   5848  O  O     . SER C 2  286  ? 19.625  -43.742 58.212  1.00 88.28  ? 286  SER C O     1 
ATOM   5849  C  CB    . SER C 2  286  ? 18.616  -45.843 55.623  1.00 95.68  ? 286  SER C CB    1 
ATOM   5850  O  OG    . SER C 2  286  ? 20.005  -45.719 55.372  1.00 108.59 ? 286  SER C OG    1 
ATOM   5851  N  N     . GLY C 2  287  ? 18.649  -43.019 56.317  1.00 93.01  ? 287  GLY C N     1 
ATOM   5852  C  CA    . GLY C 2  287  ? 19.146  -41.664 56.447  1.00 91.45  ? 287  GLY C CA    1 
ATOM   5853  C  C     . GLY C 2  287  ? 18.103  -40.741 57.047  1.00 82.97  ? 287  GLY C C     1 
ATOM   5854  O  O     . GLY C 2  287  ? 17.024  -41.179 57.442  1.00 77.80  ? 287  GLY C O     1 
ATOM   5855  N  N     . ARG C 2  288  ? 18.430  -39.457 57.119  1.00 80.94  ? 288  ARG C N     1 
ATOM   5856  C  CA    . ARG C 2  288  ? 17.514  -38.461 57.659  1.00 75.27  ? 288  ARG C CA    1 
ATOM   5857  C  C     . ARG C 2  288  ? 16.681  -37.775 56.577  1.00 83.03  ? 288  ARG C C     1 
ATOM   5858  O  O     . ARG C 2  288  ? 15.961  -36.819 56.855  1.00 87.27  ? 288  ARG C O     1 
ATOM   5859  C  CB    . ARG C 2  288  ? 18.264  -37.430 58.502  1.00 70.31  ? 288  ARG C CB    1 
ATOM   5860  C  CG    . ARG C 2  288  ? 18.677  -37.952 59.866  1.00 75.94  ? 288  ARG C CG    1 
ATOM   5861  C  CD    . ARG C 2  288  ? 19.303  -36.858 60.709  1.00 83.54  ? 288  ARG C CD    1 
ATOM   5862  N  NE    . ARG C 2  288  ? 20.679  -36.578 60.312  1.00 85.23  ? 288  ARG C NE    1 
ATOM   5863  C  CZ    . ARG C 2  288  ? 21.744  -37.096 60.914  1.00 97.96  ? 288  ARG C CZ    1 
ATOM   5864  N  NH1   . ARG C 2  288  ? 21.588  -37.919 61.943  1.00 88.66  ? 288  ARG C NH1   1 
ATOM   5865  N  NH2   . ARG C 2  288  ? 22.964  -36.790 60.492  1.00 108.33 ? 288  ARG C NH2   1 
ATOM   5866  N  N     . THR C 2  289  ? 16.800  -38.250 55.341  1.00 86.83  ? 289  THR C N     1 
ATOM   5867  C  CA    . THR C 2  289  ? 16.039  -37.682 54.231  1.00 81.47  ? 289  THR C CA    1 
ATOM   5868  C  C     . THR C 2  289  ? 14.790  -38.503 53.916  1.00 82.74  ? 289  THR C C     1 
ATOM   5869  O  O     . THR C 2  289  ? 14.542  -39.536 54.539  1.00 82.92  ? 289  THR C O     1 
ATOM   5870  C  CB    . THR C 2  289  ? 16.901  -37.570 52.963  1.00 89.96  ? 289  THR C CB    1 
ATOM   5871  O  OG1   . THR C 2  289  ? 17.489  -38.844 52.671  1.00 95.37  ? 289  THR C OG1   1 
ATOM   5872  C  CG2   . THR C 2  289  ? 18.005  -36.545 53.161  1.00 88.77  ? 289  THR C CG2   1 
ATOM   5873  N  N     . LEU C 2  290  ? 14.009  -38.035 52.945  1.00 86.62  ? 290  LEU C N     1 
ATOM   5874  C  CA    . LEU C 2  290  ? 12.764  -38.699 52.562  1.00 87.40  ? 290  LEU C CA    1 
ATOM   5875  C  C     . LEU C 2  290  ? 12.975  -39.771 51.494  1.00 90.46  ? 290  LEU C C     1 
ATOM   5876  O  O     . LEU C 2  290  ? 12.096  -40.601 51.253  1.00 83.62  ? 290  LEU C O     1 
ATOM   5877  C  CB    . LEU C 2  290  ? 11.748  -37.671 52.061  1.00 80.89  ? 290  LEU C CB    1 
ATOM   5878  C  CG    . LEU C 2  290  ? 11.505  -36.465 52.969  1.00 75.34  ? 290  LEU C CG    1 
ATOM   5879  C  CD1   . LEU C 2  290  ? 10.454  -35.547 52.372  1.00 71.26  ? 290  LEU C CD1   1 
ATOM   5880  C  CD2   . LEU C 2  290  ? 11.106  -36.907 54.370  1.00 73.26  ? 290  LEU C CD2   1 
ATOM   5881  N  N     . ALA C 2  291  ? 14.144  -39.744 50.861  1.00 97.48  ? 291  ALA C N     1 
ATOM   5882  C  CA    . ALA C 2  291  ? 14.494  -40.717 49.830  1.00 94.65  ? 291  ALA C CA    1 
ATOM   5883  C  C     . ALA C 2  291  ? 16.002  -40.756 49.619  1.00 96.02  ? 291  ALA C C     1 
ATOM   5884  O  O     . ALA C 2  291  ? 16.750  -40.039 50.283  1.00 95.42  ? 291  ALA C O     1 
ATOM   5885  C  CB    . ALA C 2  291  ? 13.785  -40.398 48.525  1.00 82.10  ? 291  ALA C CB    1 
ATOM   5886  N  N     . ARG C 2  292  ? 16.441  -41.595 48.688  1.00 99.30  ? 292  ARG C N     1 
ATOM   5887  C  CA    . ARG C 2  292  ? 17.862  -41.765 48.415  1.00 101.44 ? 292  ARG C CA    1 
ATOM   5888  C  C     . ARG C 2  292  ? 18.160  -41.765 46.925  1.00 107.41 ? 292  ARG C C     1 
ATOM   5889  O  O     . ARG C 2  292  ? 17.275  -41.991 46.097  1.00 102.36 ? 292  ARG C O     1 
ATOM   5890  C  CB    . ARG C 2  292  ? 18.368  -43.082 49.004  1.00 98.68  ? 292  ARG C CB    1 
ATOM   5891  C  CG    . ARG C 2  292  ? 18.490  -43.115 50.508  1.00 91.46  ? 292  ARG C CG    1 
ATOM   5892  C  CD    . ARG C 2  292  ? 18.874  -44.510 50.962  1.00 94.53  ? 292  ARG C CD    1 
ATOM   5893  N  NE    . ARG C 2  292  ? 18.080  -45.525 50.276  1.00 90.97  ? 292  ARG C NE    1 
ATOM   5894  C  CZ    . ARG C 2  292  ? 18.160  -46.828 50.522  1.00 96.25  ? 292  ARG C CZ    1 
ATOM   5895  N  NH1   . ARG C 2  292  ? 18.999  -47.282 51.442  1.00 96.54  ? 292  ARG C NH1   1 
ATOM   5896  N  NH2   . ARG C 2  292  ? 17.398  -47.679 49.848  1.00 101.92 ? 292  ARG C NH2   1 
ATOM   5897  N  N     . PHE C 2  293  ? 19.423  -41.515 46.600  1.00 115.12 ? 293  PHE C N     1 
ATOM   5898  C  CA    . PHE C 2  293  ? 19.935  -41.748 45.262  1.00 119.82 ? 293  PHE C CA    1 
ATOM   5899  C  C     . PHE C 2  293  ? 20.902  -42.923 45.353  1.00 121.40 ? 293  PHE C C     1 
ATOM   5900  O  O     . PHE C 2  293  ? 21.992  -42.800 45.914  1.00 117.83 ? 293  PHE C O     1 
ATOM   5901  C  CB    . PHE C 2  293  ? 20.647  -40.502 44.735  1.00 108.14 ? 293  PHE C CB    1 
ATOM   5902  C  CG    . PHE C 2  293  ? 21.097  -40.617 43.307  1.00 102.78 ? 293  PHE C CG    1 
ATOM   5903  C  CD1   . PHE C 2  293  ? 20.231  -40.320 42.270  1.00 101.64 ? 293  PHE C CD1   1 
ATOM   5904  C  CD2   . PHE C 2  293  ? 22.388  -41.017 43.003  1.00 104.57 ? 293  PHE C CD2   1 
ATOM   5905  C  CE1   . PHE C 2  293  ? 20.641  -40.423 40.957  1.00 105.06 ? 293  PHE C CE1   1 
ATOM   5906  C  CE2   . PHE C 2  293  ? 22.804  -41.123 41.691  1.00 101.97 ? 293  PHE C CE2   1 
ATOM   5907  C  CZ    . PHE C 2  293  ? 21.930  -40.824 40.667  1.00 105.34 ? 293  PHE C CZ    1 
ATOM   5908  N  N     . GLU C 2  294  ? 20.496  -44.065 44.808  1.00 113.23 ? 294  GLU C N     1 
ATOM   5909  C  CA    . GLU C 2  294  ? 21.299  -45.277 44.905  1.00 117.65 ? 294  GLU C CA    1 
ATOM   5910  C  C     . GLU C 2  294  ? 21.353  -46.027 43.578  1.00 125.73 ? 294  GLU C C     1 
ATOM   5911  O  O     . GLU C 2  294  ? 20.318  -46.307 42.969  1.00 122.43 ? 294  GLU C O     1 
ATOM   5912  C  CB    . GLU C 2  294  ? 20.759  -46.188 46.011  1.00 117.62 ? 294  GLU C CB    1 
ATOM   5913  C  CG    . GLU C 2  294  ? 21.520  -47.495 46.169  1.00 122.40 ? 294  GLU C CG    1 
ATOM   5914  C  CD    . GLU C 2  294  ? 20.980  -48.352 47.296  1.00 117.45 ? 294  GLU C CD    1 
ATOM   5915  O  OE1   . GLU C 2  294  ? 21.087  -49.593 47.203  1.00 112.50 ? 294  GLU C OE1   1 
ATOM   5916  O  OE2   . GLU C 2  294  ? 20.451  -47.786 48.277  1.00 117.32 ? 294  GLU C OE2   1 
ATOM   5917  N  N     . ASP C 2  295  ? 22.571  -46.342 43.143  1.00 129.73 ? 295  ASP C N     1 
ATOM   5918  C  CA    . ASP C 2  295  ? 22.814  -47.057 41.891  1.00 123.37 ? 295  ASP C CA    1 
ATOM   5919  C  C     . ASP C 2  295  ? 22.260  -46.313 40.678  1.00 116.81 ? 295  ASP C C     1 
ATOM   5920  O  O     . ASP C 2  295  ? 21.756  -46.927 39.738  1.00 121.21 ? 295  ASP C O     1 
ATOM   5921  C  CB    . ASP C 2  295  ? 22.256  -48.484 41.956  1.00 120.73 ? 295  ASP C CB    1 
ATOM   5922  C  CG    . ASP C 2  295  ? 22.831  -49.284 43.111  1.00 117.41 ? 295  ASP C CG    1 
ATOM   5923  O  OD1   . ASP C 2  295  ? 22.063  -50.019 43.765  1.00 118.43 ? 295  ASP C OD1   1 
ATOM   5924  O  OD2   . ASP C 2  295  ? 24.049  -49.176 43.367  1.00 110.72 ? 295  ASP C OD2   1 
ATOM   5925  N  N     . GLY C 2  296  ? 22.356  -44.987 40.709  1.00 109.98 ? 296  GLY C N     1 
ATOM   5926  C  CA    . GLY C 2  296  ? 21.950  -44.164 39.584  1.00 111.81 ? 296  GLY C CA    1 
ATOM   5927  C  C     . GLY C 2  296  ? 20.498  -43.720 39.594  1.00 113.18 ? 296  GLY C C     1 
ATOM   5928  O  O     . GLY C 2  296  ? 20.124  -42.805 38.863  1.00 115.46 ? 296  GLY C O     1 
ATOM   5929  N  N     . GLU C 2  297  ? 19.677  -44.367 40.417  1.00 112.06 ? 297  GLU C N     1 
ATOM   5930  C  CA    . GLU C 2  297  ? 18.248  -44.059 40.471  1.00 109.46 ? 297  GLU C CA    1 
ATOM   5931  C  C     . GLU C 2  297  ? 17.813  -43.591 41.859  1.00 116.55 ? 297  GLU C C     1 
ATOM   5932  O  O     . GLU C 2  297  ? 18.638  -43.448 42.762  1.00 119.54 ? 297  GLU C O     1 
ATOM   5933  C  CB    . GLU C 2  297  ? 17.423  -45.276 40.042  1.00 110.29 ? 297  GLU C CB    1 
ATOM   5934  C  CG    . GLU C 2  297  ? 17.667  -46.519 40.885  1.00 112.20 ? 297  GLU C CG    1 
ATOM   5935  C  CD    . GLU C 2  297  ? 16.814  -47.699 40.457  1.00 107.40 ? 297  GLU C CD    1 
ATOM   5936  O  OE1   . GLU C 2  297  ? 16.867  -48.745 41.136  1.00 117.68 ? 297  GLU C OE1   1 
ATOM   5937  O  OE2   . GLU C 2  297  ? 16.091  -47.583 39.445  1.00 92.96  ? 297  GLU C OE2   1 
ATOM   5938  N  N     . PHE C 2  298  ? 16.514  -43.350 42.023  1.00 113.17 ? 298  PHE C N     1 
ATOM   5939  C  CA    . PHE C 2  298  ? 15.971  -42.905 43.305  1.00 108.10 ? 298  PHE C CA    1 
ATOM   5940  C  C     . PHE C 2  298  ? 15.208  -44.011 44.033  1.00 108.31 ? 298  PHE C C     1 
ATOM   5941  O  O     . PHE C 2  298  ? 14.424  -44.736 43.424  1.00 111.65 ? 298  PHE C O     1 
ATOM   5942  C  CB    . PHE C 2  298  ? 15.069  -41.686 43.109  1.00 100.54 ? 298  PHE C CB    1 
ATOM   5943  C  CG    . PHE C 2  298  ? 15.805  -40.455 42.673  1.00 96.69  ? 298  PHE C CG    1 
ATOM   5944  C  CD1   . PHE C 2  298  ? 15.794  -40.058 41.347  1.00 98.68  ? 298  PHE C CD1   1 
ATOM   5945  C  CD2   . PHE C 2  298  ? 16.515  -39.699 43.589  1.00 95.85  ? 298  PHE C CD2   1 
ATOM   5946  C  CE1   . PHE C 2  298  ? 16.475  -38.925 40.946  1.00 101.83 ? 298  PHE C CE1   1 
ATOM   5947  C  CE2   . PHE C 2  298  ? 17.197  -38.566 43.195  1.00 88.97  ? 298  PHE C CE2   1 
ATOM   5948  C  CZ    . PHE C 2  298  ? 17.177  -38.179 41.872  1.00 94.92  ? 298  PHE C CZ    1 
ATOM   5949  N  N     . LYS C 2  299  ? 15.437  -44.127 45.340  1.00 107.47 ? 299  LYS C N     1 
ATOM   5950  C  CA    . LYS C 2  299  ? 14.760  -45.134 46.161  1.00 108.76 ? 299  LYS C CA    1 
ATOM   5951  C  C     . LYS C 2  299  ? 13.964  -44.484 47.304  1.00 110.47 ? 299  LYS C C     1 
ATOM   5952  O  O     . LYS C 2  299  ? 14.450  -43.564 47.959  1.00 111.08 ? 299  LYS C O     1 
ATOM   5953  C  CB    . LYS C 2  299  ? 15.774  -46.147 46.704  1.00 103.51 ? 299  LYS C CB    1 
ATOM   5954  C  CG    . LYS C 2  299  ? 16.539  -46.903 45.618  1.00 109.84 ? 299  LYS C CG    1 
ATOM   5955  C  CD    . LYS C 2  299  ? 17.508  -47.917 46.214  1.00 109.72 ? 299  LYS C CD    1 
ATOM   5956  C  CE    . LYS C 2  299  ? 18.225  -48.714 45.131  1.00 106.65 ? 299  LYS C CE    1 
ATOM   5957  N  NZ    . LYS C 2  299  ? 17.282  -49.473 44.266  1.00 104.45 ? 299  LYS C NZ    1 
ATOM   5958  N  N     . ASP C 2  300  ? 12.746  -44.969 47.541  1.00 112.79 ? 300  ASP C N     1 
ATOM   5959  C  CA    . ASP C 2  300  ? 11.817  -44.330 48.478  1.00 106.08 ? 300  ASP C CA    1 
ATOM   5960  C  C     . ASP C 2  300  ? 11.881  -44.884 49.904  1.00 101.55 ? 300  ASP C C     1 
ATOM   5961  O  O     . ASP C 2  300  ? 11.563  -46.050 50.140  1.00 105.87 ? 300  ASP C O     1 
ATOM   5962  C  CB    . ASP C 2  300  ? 10.381  -44.449 47.952  1.00 101.91 ? 300  ASP C CB    1 
ATOM   5963  C  CG    . ASP C 2  300  ? 9.340   -44.041 48.985  1.00 99.34  ? 300  ASP C CG    1 
ATOM   5964  O  OD1   . ASP C 2  300  ? 9.518   -42.989 49.640  1.00 98.08  ? 300  ASP C OD1   1 
ATOM   5965  O  OD2   . ASP C 2  300  ? 8.349   -44.786 49.152  1.00 99.91  ? 300  ASP C OD2   1 
ATOM   5966  N  N     . GLU C 2  301  ? 12.312  -44.043 50.842  1.00 97.56  ? 301  GLU C N     1 
ATOM   5967  C  CA    . GLU C 2  301  ? 12.254  -44.348 52.274  1.00 95.90  ? 301  GLU C CA    1 
ATOM   5968  C  C     . GLU C 2  301  ? 10.918  -44.021 52.945  1.00 97.81  ? 301  GLU C C     1 
ATOM   5969  O  O     . GLU C 2  301  ? 10.425  -44.775 53.787  1.00 94.10  ? 301  GLU C O     1 
ATOM   5970  C  CB    . GLU C 2  301  ? 13.363  -43.606 53.005  1.00 88.32  ? 301  GLU C CB    1 
ATOM   5971  C  CG    . GLU C 2  301  ? 14.392  -44.509 53.641  1.00 82.61  ? 301  GLU C CG    1 
ATOM   5972  C  CD    . GLU C 2  301  ? 15.766  -43.893 53.599  1.00 88.75  ? 301  GLU C CD    1 
ATOM   5973  O  OE1   . GLU C 2  301  ? 16.179  -43.470 52.502  1.00 92.00  ? 301  GLU C OE1   1 
ATOM   5974  O  OE2   . GLU C 2  301  ? 16.426  -43.815 54.655  1.00 87.01  ? 301  GLU C OE2   1 
ATOM   5975  N  N     . VAL C 2  302  ? 10.345  -42.881 52.574  1.00 100.98 ? 302  VAL C N     1 
ATOM   5976  C  CA    . VAL C 2  302  ? 9.280   -42.266 53.365  1.00 91.50  ? 302  VAL C CA    1 
ATOM   5977  C  C     . VAL C 2  302  ? 7.884   -42.240 52.722  1.00 84.27  ? 302  VAL C C     1 
ATOM   5978  O  O     . VAL C 2  302  ? 6.935   -42.758 53.301  1.00 81.95  ? 302  VAL C O     1 
ATOM   5979  C  CB    . VAL C 2  302  ? 9.684   -40.875 53.876  1.00 81.62  ? 302  VAL C CB    1 
ATOM   5980  C  CG1   . VAL C 2  302  ? 8.492   -40.168 54.471  1.00 66.23  ? 302  VAL C CG1   1 
ATOM   5981  C  CG2   . VAL C 2  302  ? 10.802  -40.983 54.915  1.00 80.55  ? 302  VAL C CG2   1 
ATOM   5982  N  N     . PHE C 2  303  ? 7.770   -41.624 51.544  1.00 85.41  ? 303  PHE C N     1 
ATOM   5983  C  CA    . PHE C 2  303  ? 6.473   -41.277 50.935  1.00 81.27  ? 303  PHE C CA    1 
ATOM   5984  C  C     . PHE C 2  303  ? 5.386   -42.358 50.949  1.00 86.75  ? 303  PHE C C     1 
ATOM   5985  O  O     . PHE C 2  303  ? 4.222   -42.063 51.222  1.00 83.96  ? 303  PHE C O     1 
ATOM   5986  C  CB    . PHE C 2  303  ? 6.667   -40.744 49.504  1.00 72.75  ? 303  PHE C CB    1 
ATOM   5987  C  CG    . PHE C 2  303  ? 7.223   -39.359 49.461  1.00 70.51  ? 303  PHE C CG    1 
ATOM   5988  C  CD1   . PHE C 2  303  ? 8.586   -39.149 49.565  1.00 72.03  ? 303  PHE C CD1   1 
ATOM   5989  C  CD2   . PHE C 2  303  ? 6.384   -38.263 49.361  1.00 68.46  ? 303  PHE C CD2   1 
ATOM   5990  C  CE1   . PHE C 2  303  ? 9.108   -37.873 49.553  1.00 69.66  ? 303  PHE C CE1   1 
ATOM   5991  C  CE2   . PHE C 2  303  ? 6.898   -36.982 49.348  1.00 70.33  ? 303  PHE C CE2   1 
ATOM   5992  C  CZ    . PHE C 2  303  ? 8.263   -36.786 49.443  1.00 73.88  ? 303  PHE C CZ    1 
ATOM   5993  N  N     . LEU C 2  304  ? 5.756   -43.602 50.665  1.00 90.13  ? 304  LEU C N     1 
ATOM   5994  C  CA    . LEU C 2  304  ? 4.768   -44.686 50.645  1.00 88.89  ? 304  LEU C CA    1 
ATOM   5995  C  C     . LEU C 2  304  ? 4.178   -45.043 52.023  1.00 83.96  ? 304  LEU C C     1 
ATOM   5996  O  O     . LEU C 2  304  ? 2.959   -45.151 52.146  1.00 83.51  ? 304  LEU C O     1 
ATOM   5997  C  CB    . LEU C 2  304  ? 5.281   -45.927 49.898  1.00 92.82  ? 304  LEU C CB    1 
ATOM   5998  C  CG    . LEU C 2  304  ? 4.280   -47.076 49.741  1.00 87.76  ? 304  LEU C CG    1 
ATOM   5999  C  CD1   . LEU C 2  304  ? 3.139   -46.665 48.827  1.00 76.53  ? 304  LEU C CD1   1 
ATOM   6000  C  CD2   . LEU C 2  304  ? 4.969   -48.326 49.222  1.00 85.40  ? 304  LEU C CD2   1 
ATOM   6001  N  N     . PRO C 2  305  ? 5.029   -45.243 53.051  1.00 78.48  ? 305  PRO C N     1 
ATOM   6002  C  CA    . PRO C 2  305  ? 4.489   -45.338 54.412  1.00 78.94  ? 305  PRO C CA    1 
ATOM   6003  C  C     . PRO C 2  305  ? 3.586   -44.166 54.806  1.00 78.28  ? 305  PRO C C     1 
ATOM   6004  O  O     . PRO C 2  305  ? 2.567   -44.384 55.461  1.00 79.59  ? 305  PRO C O     1 
ATOM   6005  C  CB    . PRO C 2  305  ? 5.754   -45.341 55.266  1.00 79.70  ? 305  PRO C CB    1 
ATOM   6006  C  CG    . PRO C 2  305  ? 6.716   -46.103 54.438  1.00 80.69  ? 305  PRO C CG    1 
ATOM   6007  C  CD    . PRO C 2  305  ? 6.438   -45.686 53.013  1.00 76.90  ? 305  PRO C CD    1 
ATOM   6008  N  N     . THR C 2  306  ? 3.951   -42.949 54.410  1.00 82.77  ? 306  THR C N     1 
ATOM   6009  C  CA    . THR C 2  306  ? 3.167   -41.759 54.744  1.00 79.01  ? 306  THR C CA    1 
ATOM   6010  C  C     . THR C 2  306  ? 1.792   -41.769 54.076  1.00 81.92  ? 306  THR C C     1 
ATOM   6011  O  O     . THR C 2  306  ? 0.773   -41.513 54.722  1.00 81.43  ? 306  THR C O     1 
ATOM   6012  C  CB    . THR C 2  306  ? 3.907   -40.465 54.352  1.00 70.86  ? 306  THR C CB    1 
ATOM   6013  O  OG1   . THR C 2  306  ? 5.111   -40.351 55.120  1.00 68.70  ? 306  THR C OG1   1 
ATOM   6014  C  CG2   . THR C 2  306  ? 3.033   -39.248 54.608  1.00 65.67  ? 306  THR C CG2   1 
ATOM   6015  N  N     . LEU C 2  307  ? 1.771   -42.069 52.781  1.00 84.66  ? 307  LEU C N     1 
ATOM   6016  C  CA    . LEU C 2  307  ? 0.525   -42.165 52.030  1.00 81.64  ? 307  LEU C CA    1 
ATOM   6017  C  C     . LEU C 2  307  ? -0.345  -43.284 52.591  1.00 80.19  ? 307  LEU C C     1 
ATOM   6018  O  O     . LEU C 2  307  ? -1.572  -43.162 52.675  1.00 78.37  ? 307  LEU C O     1 
ATOM   6019  C  CB    . LEU C 2  307  ? 0.825   -42.424 50.556  1.00 74.88  ? 307  LEU C CB    1 
ATOM   6020  C  CG    . LEU C 2  307  ? -0.376  -42.446 49.615  1.00 84.59  ? 307  LEU C CG    1 
ATOM   6021  C  CD1   . LEU C 2  307  ? -1.191  -41.174 49.775  1.00 83.08  ? 307  LEU C CD1   1 
ATOM   6022  C  CD2   . LEU C 2  307  ? 0.095   -42.607 48.179  1.00 95.80  ? 307  LEU C CD2   1 
ATOM   6023  N  N     . ARG C 2  308  ? 0.316   -44.371 52.977  1.00 80.12  ? 308  ARG C N     1 
ATOM   6024  C  CA    . ARG C 2  308  ? -0.336  -45.535 53.561  1.00 79.71  ? 308  ARG C CA    1 
ATOM   6025  C  C     . ARG C 2  308  ? -1.056  -45.139 54.846  1.00 80.21  ? 308  ARG C C     1 
ATOM   6026  O  O     . ARG C 2  308  ? -2.246  -45.414 55.009  1.00 77.46  ? 308  ARG C O     1 
ATOM   6027  C  CB    . ARG C 2  308  ? 0.707   -46.626 53.834  1.00 74.52  ? 308  ARG C CB    1 
ATOM   6028  C  CG    . ARG C 2  308  ? 0.165   -48.044 53.953  1.00 74.18  ? 308  ARG C CG    1 
ATOM   6029  C  CD    . ARG C 2  308  ? -0.335  -48.335 55.356  1.00 83.21  ? 308  ARG C CD    1 
ATOM   6030  N  NE    . ARG C 2  308  ? 0.596   -47.860 56.374  1.00 86.80  ? 308  ARG C NE    1 
ATOM   6031  C  CZ    . ARG C 2  308  ? 0.340   -47.855 57.678  1.00 89.01  ? 308  ARG C CZ    1 
ATOM   6032  N  NH1   . ARG C 2  308  ? -0.825  -48.304 58.128  1.00 83.35  ? 308  ARG C NH1   1 
ATOM   6033  N  NH2   . ARG C 2  308  ? 1.247   -47.401 58.533  1.00 92.37  ? 308  ARG C NH2   1 
ATOM   6034  N  N     . TYR C 2  309  ? -0.330  -44.485 55.750  1.00 80.54  ? 309  TYR C N     1 
ATOM   6035  C  CA    . TYR C 2  309  ? -0.903  -44.034 57.015  1.00 73.52  ? 309  TYR C CA    1 
ATOM   6036  C  C     . TYR C 2  309  ? -2.023  -43.029 56.769  1.00 75.29  ? 309  TYR C C     1 
ATOM   6037  O  O     . TYR C 2  309  ? -3.011  -43.008 57.500  1.00 82.71  ? 309  TYR C O     1 
ATOM   6038  C  CB    . TYR C 2  309  ? 0.178   -43.412 57.907  1.00 72.48  ? 309  TYR C CB    1 
ATOM   6039  C  CG    . TYR C 2  309  ? -0.196  -43.290 59.375  1.00 75.93  ? 309  TYR C CG    1 
ATOM   6040  C  CD1   . TYR C 2  309  ? 0.395   -44.107 60.332  1.00 79.28  ? 309  TYR C CD1   1 
ATOM   6041  C  CD2   . TYR C 2  309  ? -1.129  -42.353 59.806  1.00 74.28  ? 309  TYR C CD2   1 
ATOM   6042  C  CE1   . TYR C 2  309  ? 0.063   -43.997 61.675  1.00 75.45  ? 309  TYR C CE1   1 
ATOM   6043  C  CE2   . TYR C 2  309  ? -1.470  -42.238 61.145  1.00 74.03  ? 309  TYR C CE2   1 
ATOM   6044  C  CZ    . TYR C 2  309  ? -0.871  -43.061 62.074  1.00 71.83  ? 309  TYR C CZ    1 
ATOM   6045  O  OH    . TYR C 2  309  ? -1.207  -42.947 63.405  1.00 68.59  ? 309  TYR C OH    1 
ATOM   6046  N  N     . LEU C 2  310  ? -1.867  -42.199 55.741  1.00 73.53  ? 310  LEU C N     1 
ATOM   6047  C  CA    . LEU C 2  310  ? -2.880  -41.199 55.408  1.00 74.86  ? 310  LEU C CA    1 
ATOM   6048  C  C     . LEU C 2  310  ? -4.201  -41.846 55.007  1.00 75.26  ? 310  LEU C C     1 
ATOM   6049  O  O     . LEU C 2  310  ? -5.259  -41.524 55.561  1.00 76.19  ? 310  LEU C O     1 
ATOM   6050  C  CB    . LEU C 2  310  ? -2.391  -40.281 54.289  1.00 73.79  ? 310  LEU C CB    1 
ATOM   6051  C  CG    . LEU C 2  310  ? -3.433  -39.301 53.745  1.00 67.48  ? 310  LEU C CG    1 
ATOM   6052  C  CD1   . LEU C 2  310  ? -3.941  -38.382 54.846  1.00 62.08  ? 310  LEU C CD1   1 
ATOM   6053  C  CD2   . LEU C 2  310  ? -2.861  -38.499 52.586  1.00 73.54  ? 310  LEU C CD2   1 
ATOM   6054  N  N     . PHE C 2  311  ? -4.139  -42.756 54.040  1.00 77.60  ? 311  PHE C N     1 
ATOM   6055  C  CA    . PHE C 2  311  ? -5.333  -43.470 53.605  1.00 79.02  ? 311  PHE C CA    1 
ATOM   6056  C  C     . PHE C 2  311  ? -5.902  -44.314 54.744  1.00 84.57  ? 311  PHE C C     1 
ATOM   6057  O  O     . PHE C 2  311  ? -7.116  -44.510 54.835  1.00 85.72  ? 311  PHE C O     1 
ATOM   6058  C  CB    . PHE C 2  311  ? -5.034  -44.340 52.379  1.00 82.46  ? 311  PHE C CB    1 
ATOM   6059  C  CG    . PHE C 2  311  ? -4.837  -43.555 51.108  1.00 86.38  ? 311  PHE C CG    1 
ATOM   6060  C  CD1   . PHE C 2  311  ? -5.413  -42.305 50.952  1.00 87.27  ? 311  PHE C CD1   1 
ATOM   6061  C  CD2   . PHE C 2  311  ? -4.076  -44.069 50.070  1.00 86.12  ? 311  PHE C CD2   1 
ATOM   6062  C  CE1   . PHE C 2  311  ? -5.233  -41.582 49.785  1.00 87.76  ? 311  PHE C CE1   1 
ATOM   6063  C  CE2   . PHE C 2  311  ? -3.894  -43.350 48.901  1.00 81.80  ? 311  PHE C CE2   1 
ATOM   6064  C  CZ    . PHE C 2  311  ? -4.472  -42.106 48.759  1.00 84.20  ? 311  PHE C CZ    1 
ATOM   6065  N  N     . ALA C 2  312  ? -5.020  -44.796 55.617  1.00 83.23  ? 312  ALA C N     1 
ATOM   6066  C  CA    . ALA C 2  312  ? -5.429  -45.605 56.763  1.00 85.69  ? 312  ALA C CA    1 
ATOM   6067  C  C     . ALA C 2  312  ? -6.149  -44.772 57.820  1.00 82.49  ? 312  ALA C C     1 
ATOM   6068  O  O     . ALA C 2  312  ? -6.961  -45.292 58.586  1.00 85.69  ? 312  ALA C O     1 
ATOM   6069  C  CB    . ALA C 2  312  ? -4.227  -46.317 57.372  1.00 84.27  ? 312  ALA C CB    1 
ATOM   6070  N  N     . LEU C 2  313  ? -5.836  -43.483 57.868  1.00 80.62  ? 313  LEU C N     1 
ATOM   6071  C  CA    . LEU C 2  313  ? -6.531  -42.564 58.758  1.00 81.16  ? 313  LEU C CA    1 
ATOM   6072  C  C     . LEU C 2  313  ? -7.866  -42.165 58.142  1.00 83.81  ? 313  LEU C C     1 
ATOM   6073  O  O     . LEU C 2  313  ? -8.870  -42.036 58.843  1.00 84.12  ? 313  LEU C O     1 
ATOM   6074  C  CB    . LEU C 2  313  ? -5.680  -41.322 59.035  1.00 75.33  ? 313  LEU C CB    1 
ATOM   6075  C  CG    . LEU C 2  313  ? -6.274  -40.305 60.012  1.00 75.02  ? 313  LEU C CG    1 
ATOM   6076  C  CD1   . LEU C 2  313  ? -6.418  -40.910 61.403  1.00 76.57  ? 313  LEU C CD1   1 
ATOM   6077  C  CD2   . LEU C 2  313  ? -5.431  -39.041 60.056  1.00 72.50  ? 313  LEU C CD2   1 
ATOM   6078  N  N     . THR C 2  314  ? -7.870  -41.973 56.825  1.00 80.45  ? 314  THR C N     1 
ATOM   6079  C  CA    . THR C 2  314  ? -9.090  -41.602 56.114  1.00 81.85  ? 314  THR C CA    1 
ATOM   6080  C  C     . THR C 2  314  ? -10.140 -42.712 56.190  1.00 86.82  ? 314  THR C C     1 
ATOM   6081  O  O     . THR C 2  314  ? -11.329 -42.444 56.376  1.00 83.35  ? 314  THR C O     1 
ATOM   6082  C  CB    . THR C 2  314  ? -8.800  -41.252 54.640  1.00 78.96  ? 314  THR C CB    1 
ATOM   6083  O  OG1   . THR C 2  314  ? -7.934  -40.112 54.583  1.00 81.93  ? 314  THR C OG1   1 
ATOM   6084  C  CG2   . THR C 2  314  ? -10.087 -40.933 53.895  1.00 81.53  ? 314  THR C CG2   1 
ATOM   6085  N  N     . ALA C 2  315  ? -9.690  -43.956 56.064  1.00 87.09  ? 315  ALA C N     1 
ATOM   6086  C  CA    . ALA C 2  315  ? -10.589 -45.108 56.094  1.00 85.87  ? 315  ALA C CA    1 
ATOM   6087  C  C     . ALA C 2  315  ? -11.212 -45.325 57.472  1.00 77.64  ? 315  ALA C C     1 
ATOM   6088  O  O     . ALA C 2  315  ? -12.345 -45.794 57.582  1.00 73.38  ? 315  ALA C O     1 
ATOM   6089  C  CB    . ALA C 2  315  ? -9.857  -46.364 55.638  1.00 87.99  ? 315  ALA C CB    1 
ATOM   6090  N  N     . GLY C 2  316  ? -10.468 -44.980 58.518  1.00 71.67  ? 316  GLY C N     1 
ATOM   6091  C  CA    . GLY C 2  316  ? -10.942 -45.160 59.878  1.00 76.79  ? 316  GLY C CA    1 
ATOM   6092  C  C     . GLY C 2  316  ? -10.322 -46.368 60.554  1.00 80.58  ? 316  GLY C C     1 
ATOM   6093  O  O     . GLY C 2  316  ? -10.746 -46.765 61.640  1.00 80.98  ? 316  GLY C O     1 
ATOM   6094  N  N     . VAL C 2  317  ? -9.320  -46.950 59.898  1.00 79.96  ? 317  VAL C N     1 
ATOM   6095  C  CA    . VAL C 2  317  ? -8.610  -48.124 60.403  1.00 82.31  ? 317  VAL C CA    1 
ATOM   6096  C  C     . VAL C 2  317  ? -8.080  -47.910 61.823  1.00 86.40  ? 317  VAL C C     1 
ATOM   6097  O  O     . VAL C 2  317  ? -7.432  -46.900 62.100  1.00 85.50  ? 317  VAL C O     1 
ATOM   6098  C  CB    . VAL C 2  317  ? -7.434  -48.497 59.471  1.00 77.61  ? 317  VAL C CB    1 
ATOM   6099  C  CG1   . VAL C 2  317  ? -6.786  -49.800 59.911  1.00 80.61  ? 317  VAL C CG1   1 
ATOM   6100  C  CG2   . VAL C 2  317  ? -7.907  -48.588 58.027  1.00 73.14  ? 317  VAL C CG2   1 
ATOM   6101  N  N     . PRO C 2  318  ? -8.368  -48.860 62.731  1.00 90.74  ? 318  PRO C N     1 
ATOM   6102  C  CA    . PRO C 2  318  ? -7.950  -48.779 64.137  1.00 87.79  ? 318  PRO C CA    1 
ATOM   6103  C  C     . PRO C 2  318  ? -6.433  -48.774 64.296  1.00 87.69  ? 318  PRO C C     1 
ATOM   6104  O  O     . PRO C 2  318  ? -5.738  -49.517 63.604  1.00 87.91  ? 318  PRO C O     1 
ATOM   6105  C  CB    . PRO C 2  318  ? -8.533  -50.057 64.749  1.00 80.20  ? 318  PRO C CB    1 
ATOM   6106  C  CG    . PRO C 2  318  ? -9.666  -50.422 63.858  1.00 94.69  ? 318  PRO C CG    1 
ATOM   6107  C  CD    . PRO C 2  318  ? -9.225  -50.032 62.482  1.00 94.07  ? 318  PRO C CD    1 
ATOM   6108  N  N     . GLY C 2  319  ? -5.933  -47.947 65.209  1.00 88.14  ? 319  GLY C N     1 
ATOM   6109  C  CA    . GLY C 2  319  ? -4.503  -47.817 65.419  1.00 85.24  ? 319  GLY C CA    1 
ATOM   6110  C  C     . GLY C 2  319  ? -3.919  -46.659 64.634  1.00 87.26  ? 319  GLY C C     1 
ATOM   6111  O  O     . GLY C 2  319  ? -2.707  -46.585 64.425  1.00 81.81  ? 319  GLY C O     1 
ATOM   6112  N  N     . HIS C 2  320  ? -4.790  -45.756 64.191  1.00 87.02  ? 320  HIS C N     1 
ATOM   6113  C  CA    . HIS C 2  320  ? -4.373  -44.568 63.453  1.00 76.12  ? 320  HIS C CA    1 
ATOM   6114  C  C     . HIS C 2  320  ? -5.103  -43.339 63.984  1.00 73.41  ? 320  HIS C C     1 
ATOM   6115  O  O     . HIS C 2  320  ? -6.327  -43.338 64.115  1.00 75.20  ? 320  HIS C O     1 
ATOM   6116  C  CB    . HIS C 2  320  ? -4.632  -44.742 61.955  1.00 77.15  ? 320  HIS C CB    1 
ATOM   6117  C  CG    . HIS C 2  320  ? -3.890  -45.891 61.345  1.00 77.55  ? 320  HIS C CG    1 
ATOM   6118  N  ND1   . HIS C 2  320  ? -4.258  -47.204 61.543  1.00 80.44  ? 320  HIS C ND1   1 
ATOM   6119  C  CD2   . HIS C 2  320  ? -2.797  -45.923 60.547  1.00 81.18  ? 320  HIS C CD2   1 
ATOM   6120  C  CE1   . HIS C 2  320  ? -3.425  -47.996 60.891  1.00 79.27  ? 320  HIS C CE1   1 
ATOM   6121  N  NE2   . HIS C 2  320  ? -2.530  -47.244 60.278  1.00 71.06  ? 320  HIS C NE2   1 
ATOM   6122  N  N     . GLU C 2  321  ? -4.345  -42.290 64.281  1.00 73.68  ? 321  GLU C N     1 
ATOM   6123  C  CA    . GLU C 2  321  ? -4.892  -41.129 64.969  1.00 70.76  ? 321  GLU C CA    1 
ATOM   6124  C  C     . GLU C 2  321  ? -4.221  -39.841 64.513  1.00 69.32  ? 321  GLU C C     1 
ATOM   6125  O  O     . GLU C 2  321  ? -3.097  -39.859 64.008  1.00 61.66  ? 321  GLU C O     1 
ATOM   6126  C  CB    . GLU C 2  321  ? -4.696  -41.294 66.474  1.00 67.96  ? 321  GLU C CB    1 
ATOM   6127  C  CG    . GLU C 2  321  ? -3.249  -41.572 66.856  1.00 75.45  ? 321  GLU C CG    1 
ATOM   6128  C  CD    . GLU C 2  321  ? -3.089  -41.965 68.308  1.00 82.66  ? 321  GLU C CD    1 
ATOM   6129  O  OE1   . GLU C 2  321  ? -2.005  -42.468 68.670  1.00 79.43  ? 321  GLU C OE1   1 
ATOM   6130  O  OE2   . GLU C 2  321  ? -4.045  -41.770 69.087  1.00 90.35  ? 321  GLU C OE2   1 
ATOM   6131  N  N     . VAL C 2  322  ? -4.916  -38.724 64.701  1.00 65.97  ? 322  VAL C N     1 
ATOM   6132  C  CA    . VAL C 2  322  ? -4.362  -37.414 64.385  1.00 56.48  ? 322  VAL C CA    1 
ATOM   6133  C  C     . VAL C 2  322  ? -3.353  -37.003 65.449  1.00 56.48  ? 322  VAL C C     1 
ATOM   6134  O  O     . VAL C 2  322  ? -3.116  -37.742 66.404  1.00 62.84  ? 322  VAL C O     1 
ATOM   6135  C  CB    . VAL C 2  322  ? -5.463  -36.346 64.286  1.00 52.52  ? 322  VAL C CB    1 
ATOM   6136  C  CG1   . VAL C 2  322  ? -6.399  -36.662 63.134  1.00 62.07  ? 322  VAL C CG1   1 
ATOM   6137  C  CG2   . VAL C 2  322  ? -6.232  -36.263 65.591  1.00 58.68  ? 322  VAL C CG2   1 
ATOM   6138  N  N     . ASP C 2  323  ? -2.762  -35.824 65.289  1.00 52.11  ? 323  ASP C N     1 
ATOM   6139  C  CA    . ASP C 2  323  ? -1.724  -35.374 66.211  1.00 50.08  ? 323  ASP C CA    1 
ATOM   6140  C  C     . ASP C 2  323  ? -1.991  -33.995 66.805  1.00 45.61  ? 323  ASP C C     1 
ATOM   6141  O  O     . ASP C 2  323  ? -2.511  -33.104 66.136  1.00 46.03  ? 323  ASP C O     1 
ATOM   6142  C  CB    . ASP C 2  323  ? -0.358  -35.385 65.525  1.00 54.53  ? 323  ASP C CB    1 
ATOM   6143  C  CG    . ASP C 2  323  ? 0.144   -36.786 65.249  1.00 60.60  ? 323  ASP C CG    1 
ATOM   6144  O  OD1   . ASP C 2  323  ? 0.714   -37.405 66.175  1.00 63.54  ? 323  ASP C OD1   1 
ATOM   6145  O  OD2   . ASP C 2  323  ? -0.026  -37.264 64.108  1.00 60.08  ? 323  ASP C OD2   1 
ATOM   6146  N  N     . ASP C 2  324  ? -1.617  -33.833 68.070  1.00 42.51  ? 324  ASP C N     1 
ATOM   6147  C  CA    . ASP C 2  324  ? -1.722  -32.553 68.755  1.00 44.97  ? 324  ASP C CA    1 
ATOM   6148  C  C     . ASP C 2  324  ? -0.387  -31.832 68.618  1.00 48.39  ? 324  ASP C C     1 
ATOM   6149  O  O     . ASP C 2  324  ? 0.614   -32.259 69.193  1.00 48.05  ? 324  ASP C O     1 
ATOM   6150  C  CB    . ASP C 2  324  ? -2.036  -32.783 70.237  1.00 41.47  ? 324  ASP C CB    1 
ATOM   6151  C  CG    . ASP C 2  324  ? -2.505  -31.522 70.947  1.00 44.99  ? 324  ASP C CG    1 
ATOM   6152  O  OD1   . ASP C 2  324  ? -2.436  -30.427 70.349  1.00 52.18  ? 324  ASP C OD1   1 
ATOM   6153  O  OD2   . ASP C 2  324  ? -2.940  -31.630 72.114  1.00 40.69  ? 324  ASP C OD2   1 
ATOM   6154  N  N     . ILE C 2  325  ? -0.367  -30.738 67.864  1.00 43.96  ? 325  ILE C N     1 
ATOM   6155  C  CA    . ILE C 2  325  ? 0.883   -30.018 67.637  1.00 40.76  ? 325  ILE C CA    1 
ATOM   6156  C  C     . ILE C 2  325  ? 1.276   -29.150 68.830  1.00 40.57  ? 325  ILE C C     1 
ATOM   6157  O  O     . ILE C 2  325  ? 2.368   -28.587 68.861  1.00 42.59  ? 325  ILE C O     1 
ATOM   6158  C  CB    . ILE C 2  325  ? 0.842   -29.169 66.353  1.00 42.91  ? 325  ILE C CB    1 
ATOM   6159  C  CG1   . ILE C 2  325  ? -0.184  -28.043 66.473  1.00 50.24  ? 325  ILE C CG1   1 
ATOM   6160  C  CG2   . ILE C 2  325  ? 0.531   -30.044 65.154  1.00 51.47  ? 325  ILE C CG2   1 
ATOM   6161  C  CD1   . ILE C 2  325  ? -0.228  -27.132 65.258  1.00 47.75  ? 325  ILE C CD1   1 
ATOM   6162  N  N     . ASP C 2  326  ? 0.380   -29.040 69.804  1.00 36.76  ? 326  ASP C N     1 
ATOM   6163  C  CA    . ASP C 2  326  ? 0.680   -28.325 71.037  1.00 38.35  ? 326  ASP C CA    1 
ATOM   6164  C  C     . ASP C 2  326  ? 1.217   -29.280 72.096  1.00 37.99  ? 326  ASP C C     1 
ATOM   6165  O  O     . ASP C 2  326  ? 1.696   -28.851 73.148  1.00 35.30  ? 326  ASP C O     1 
ATOM   6166  C  CB    . ASP C 2  326  ? -0.570  -27.620 71.560  1.00 50.16  ? 326  ASP C CB    1 
ATOM   6167  C  CG    . ASP C 2  326  ? -1.178  -26.684 70.542  1.00 53.45  ? 326  ASP C CG    1 
ATOM   6168  O  OD1   . ASP C 2  326  ? -0.421  -25.902 69.925  1.00 49.54  ? 326  ASP C OD1   1 
ATOM   6169  O  OD2   . ASP C 2  326  ? -2.413  -26.738 70.356  1.00 56.02  ? 326  ASP C OD2   1 
ATOM   6170  N  N     . HIS C 2  327  ? 1.130   -30.576 71.811  1.00 35.21  ? 327  HIS C N     1 
ATOM   6171  C  CA    . HIS C 2  327  ? 1.634   -31.600 72.716  1.00 36.14  ? 327  HIS C CA    1 
ATOM   6172  C  C     . HIS C 2  327  ? 3.147   -31.446 72.829  1.00 32.85  ? 327  HIS C C     1 
ATOM   6173  O  O     . HIS C 2  327  ? 3.829   -31.231 71.827  1.00 34.68  ? 327  HIS C O     1 
ATOM   6174  C  CB    . HIS C 2  327  ? 1.280   -32.993 72.180  1.00 39.12  ? 327  HIS C CB    1 
ATOM   6175  C  CG    . HIS C 2  327  ? 1.333   -34.082 73.209  1.00 33.28  ? 327  HIS C CG    1 
ATOM   6176  N  ND1   . HIS C 2  327  ? 2.512   -34.668 73.616  1.00 27.62  ? 327  HIS C ND1   1 
ATOM   6177  C  CD2   . HIS C 2  327  ? 0.347   -34.708 73.895  1.00 31.23  ? 327  HIS C CD2   1 
ATOM   6178  C  CE1   . HIS C 2  327  ? 2.252   -35.598 74.517  1.00 28.02  ? 327  HIS C CE1   1 
ATOM   6179  N  NE2   . HIS C 2  327  ? 0.946   -35.642 74.706  1.00 27.82  ? 327  HIS C NE2   1 
ATOM   6180  N  N     . LEU C 2  328  ? 3.677   -31.585 74.040  1.00 25.06  ? 328  LEU C N     1 
ATOM   6181  C  CA    . LEU C 2  328  ? 5.103   -31.368 74.269  1.00 24.85  ? 328  LEU C CA    1 
ATOM   6182  C  C     . LEU C 2  328  ? 5.921   -32.585 73.843  1.00 29.90  ? 328  LEU C C     1 
ATOM   6183  O  O     . LEU C 2  328  ? 7.146   -32.613 73.992  1.00 29.68  ? 328  LEU C O     1 
ATOM   6184  C  CB    . LEU C 2  328  ? 5.384   -31.016 75.725  1.00 25.71  ? 328  LEU C CB    1 
ATOM   6185  C  CG    . LEU C 2  328  ? 5.113   -29.569 76.131  1.00 22.62  ? 328  LEU C CG    1 
ATOM   6186  C  CD1   . LEU C 2  328  ? 5.555   -29.330 77.562  1.00 23.55  ? 328  LEU C CD1   1 
ATOM   6187  C  CD2   . LEU C 2  328  ? 5.811   -28.606 75.186  1.00 19.81  ? 328  LEU C CD2   1 
ATOM   6188  N  N     . GLY C 2  329  ? 5.233   -33.601 73.332  1.00 30.07  ? 329  GLY C N     1 
ATOM   6189  C  CA    . GLY C 2  329  ? 5.890   -34.697 72.647  1.00 31.39  ? 329  GLY C CA    1 
ATOM   6190  C  C     . GLY C 2  329  ? 6.119   -34.308 71.200  1.00 34.19  ? 329  GLY C C     1 
ATOM   6191  O  O     . GLY C 2  329  ? 7.000   -34.847 70.533  1.00 36.54  ? 329  GLY C O     1 
ATOM   6192  N  N     . ASN C 2  330  ? 5.296   -33.387 70.705  1.00 36.05  ? 330  ASN C N     1 
ATOM   6193  C  CA    . ASN C 2  330  ? 5.456   -32.857 69.352  1.00 38.51  ? 330  ASN C CA    1 
ATOM   6194  C  C     . ASN C 2  330  ? 6.162   -31.497 69.251  1.00 32.65  ? 330  ASN C C     1 
ATOM   6195  O  O     . ASN C 2  330  ? 6.393   -30.996 68.152  1.00 33.84  ? 330  ASN C O     1 
ATOM   6196  C  CB    . ASN C 2  330  ? 4.106   -32.822 68.631  1.00 41.24  ? 330  ASN C CB    1 
ATOM   6197  C  CG    . ASN C 2  330  ? 3.519   -34.205 68.437  1.00 43.84  ? 330  ASN C CG    1 
ATOM   6198  O  OD1   . ASN C 2  330  ? 4.243   -35.200 68.419  1.00 44.88  ? 330  ASN C OD1   1 
ATOM   6199  N  ND2   . ASN C 2  330  ? 2.201   -34.276 68.290  1.00 48.17  ? 330  ASN C ND2   1 
ATOM   6200  N  N     . ARG C 2  331  ? 6.499   -30.903 70.392  1.00 28.09  ? 331  ARG C N     1 
ATOM   6201  C  CA    . ARG C 2  331  ? 7.241   -29.645 70.404  1.00 28.43  ? 331  ARG C CA    1 
ATOM   6202  C  C     . ARG C 2  331  ? 8.573   -29.831 71.116  1.00 27.63  ? 331  ARG C C     1 
ATOM   6203  O  O     . ARG C 2  331  ? 8.633   -30.424 72.190  1.00 28.27  ? 331  ARG C O     1 
ATOM   6204  C  CB    . ARG C 2  331  ? 6.440   -28.534 71.089  1.00 27.86  ? 331  ARG C CB    1 
ATOM   6205  C  CG    . ARG C 2  331  ? 5.185   -28.105 70.351  1.00 29.96  ? 331  ARG C CG    1 
ATOM   6206  C  CD    . ARG C 2  331  ? 4.440   -27.019 71.120  1.00 35.24  ? 331  ARG C CD    1 
ATOM   6207  N  NE    . ARG C 2  331  ? 5.055   -25.700 70.972  1.00 37.88  ? 331  ARG C NE    1 
ATOM   6208  C  CZ    . ARG C 2  331  ? 4.763   -24.647 71.732  1.00 36.03  ? 331  ARG C CZ    1 
ATOM   6209  N  NH1   . ARG C 2  331  ? 3.873   -24.754 72.708  1.00 46.78  ? 331  ARG C NH1   1 
ATOM   6210  N  NH2   . ARG C 2  331  ? 5.367   -23.487 71.523  1.00 30.92  ? 331  ARG C NH2   1 
ATOM   6211  N  N     . ARG C 2  332  ? 9.644   -29.322 70.521  1.00 30.13  ? 332  ARG C N     1 
ATOM   6212  C  CA    . ARG C 2  332  ? 10.965  -29.509 71.107  1.00 29.90  ? 332  ARG C CA    1 
ATOM   6213  C  C     . ARG C 2  332  ? 11.698  -28.198 71.377  1.00 30.12  ? 332  ARG C C     1 
ATOM   6214  O  O     . ARG C 2  332  ? 11.202  -27.107 71.065  1.00 28.81  ? 332  ARG C O     1 
ATOM   6215  C  CB    . ARG C 2  332  ? 11.820  -30.427 70.227  1.00 33.65  ? 332  ARG C CB    1 
ATOM   6216  C  CG    . ARG C 2  332  ? 11.965  -29.956 68.786  1.00 34.47  ? 332  ARG C CG    1 
ATOM   6217  C  CD    . ARG C 2  332  ? 12.873  -30.877 67.986  1.00 33.98  ? 332  ARG C CD    1 
ATOM   6218  N  NE    . ARG C 2  332  ? 14.180  -31.032 68.619  1.00 32.86  ? 332  ARG C NE    1 
ATOM   6219  C  CZ    . ARG C 2  332  ? 15.261  -30.334 68.289  1.00 26.62  ? 332  ARG C CZ    1 
ATOM   6220  N  NH1   . ARG C 2  332  ? 15.200  -29.430 67.324  1.00 30.51  ? 332  ARG C NH1   1 
ATOM   6221  N  NH2   . ARG C 2  332  ? 16.404  -30.545 68.923  1.00 25.33  ? 332  ARG C NH2   1 
ATOM   6222  N  N     . ILE C 2  333  ? 12.889  -28.325 71.952  1.00 28.56  ? 333  ILE C N     1 
ATOM   6223  C  CA    . ILE C 2  333  ? 13.694  -27.174 72.329  1.00 27.43  ? 333  ILE C CA    1 
ATOM   6224  C  C     . ILE C 2  333  ? 15.040  -27.202 71.623  1.00 30.52  ? 333  ILE C C     1 
ATOM   6225  O  O     . ILE C 2  333  ? 15.781  -28.179 71.714  1.00 35.00  ? 333  ILE C O     1 
ATOM   6226  C  CB    . ILE C 2  333  ? 13.964  -27.144 73.846  1.00 23.56  ? 333  ILE C CB    1 
ATOM   6227  C  CG1   . ILE C 2  333  ? 12.677  -27.391 74.634  1.00 22.87  ? 333  ILE C CG1   1 
ATOM   6228  C  CG2   . ILE C 2  333  ? 14.619  -25.829 74.247  1.00 23.31  ? 333  ILE C CG2   1 
ATOM   6229  C  CD1   . ILE C 2  333  ? 11.605  -26.359 74.395  1.00 29.36  ? 333  ILE C CD1   1 
ATOM   6230  N  N     . ARG C 2  334  ? 15.345  -26.123 70.915  1.00 29.90  ? 334  ARG C N     1 
ATOM   6231  C  CA    . ARG C 2  334  ? 16.661  -25.920 70.346  1.00 25.30  ? 334  ARG C CA    1 
ATOM   6232  C  C     . ARG C 2  334  ? 17.432  -25.105 71.362  1.00 22.69  ? 334  ARG C C     1 
ATOM   6233  O  O     . ARG C 2  334  ? 17.128  -23.935 71.581  1.00 27.76  ? 334  ARG C O     1 
ATOM   6234  C  CB    . ARG C 2  334  ? 16.554  -25.135 69.042  1.00 27.64  ? 334  ARG C CB    1 
ATOM   6235  C  CG    . ARG C 2  334  ? 15.339  -25.492 68.202  1.00 32.09  ? 334  ARG C CG    1 
ATOM   6236  C  CD    . ARG C 2  334  ? 15.286  -24.658 66.938  1.00 27.18  ? 334  ARG C CD    1 
ATOM   6237  N  NE    . ARG C 2  334  ? 16.412  -24.950 66.060  1.00 31.15  ? 334  ARG C NE    1 
ATOM   6238  C  CZ    . ARG C 2  334  ? 16.760  -24.199 65.022  1.00 46.93  ? 334  ARG C CZ    1 
ATOM   6239  N  NH1   . ARG C 2  334  ? 16.069  -23.102 64.736  1.00 46.11  ? 334  ARG C NH1   1 
ATOM   6240  N  NH2   . ARG C 2  334  ? 17.802  -24.541 64.274  1.00 47.91  ? 334  ARG C NH2   1 
ATOM   6241  N  N     . THR C 2  335  ? 18.426  -25.722 71.987  1.00 21.01  ? 335  THR C N     1 
ATOM   6242  C  CA    . THR C 2  335  ? 19.209  -25.045 73.012  1.00 20.72  ? 335  THR C CA    1 
ATOM   6243  C  C     . THR C 2  335  ? 20.351  -24.243 72.389  1.00 20.79  ? 335  THR C C     1 
ATOM   6244  O  O     . THR C 2  335  ? 20.427  -24.118 71.166  1.00 22.46  ? 335  THR C O     1 
ATOM   6245  C  CB    . THR C 2  335  ? 19.744  -26.042 74.051  1.00 23.26  ? 335  THR C CB    1 
ATOM   6246  O  OG1   . THR C 2  335  ? 20.164  -27.242 73.390  1.00 23.83  ? 335  THR C OG1   1 
ATOM   6247  C  CG2   . THR C 2  335  ? 18.655  -26.397 75.048  1.00 27.48  ? 335  THR C CG2   1 
ATOM   6248  N  N     . VAL C 2  336  ? 21.224  -23.697 73.233  1.00 18.45  ? 336  VAL C N     1 
ATOM   6249  C  CA    . VAL C 2  336  ? 22.340  -22.866 72.781  1.00 18.23  ? 336  VAL C CA    1 
ATOM   6250  C  C     . VAL C 2  336  ? 23.175  -23.558 71.711  1.00 28.68  ? 336  VAL C C     1 
ATOM   6251  O  O     . VAL C 2  336  ? 23.439  -22.994 70.639  1.00 31.43  ? 336  VAL C O     1 
ATOM   6252  C  CB    . VAL C 2  336  ? 23.286  -22.527 73.941  1.00 14.22  ? 336  VAL C CB    1 
ATOM   6253  C  CG1   . VAL C 2  336  ? 24.263  -21.452 73.520  1.00 11.09  ? 336  VAL C CG1   1 
ATOM   6254  C  CG2   . VAL C 2  336  ? 22.497  -22.086 75.153  1.00 23.16  ? 336  VAL C CG2   1 
ATOM   6255  N  N     . GLY C 2  337  ? 23.583  -24.787 72.017  1.00 31.27  ? 337  GLY C N     1 
ATOM   6256  C  CA    . GLY C 2  337  ? 24.436  -25.569 71.141  1.00 27.68  ? 337  GLY C CA    1 
ATOM   6257  C  C     . GLY C 2  337  ? 23.867  -25.775 69.754  1.00 24.58  ? 337  GLY C C     1 
ATOM   6258  O  O     . GLY C 2  337  ? 24.591  -25.667 68.766  1.00 23.51  ? 337  GLY C O     1 
ATOM   6259  N  N     . GLU C 2  338  ? 22.571  -26.064 69.676  1.00 21.82  ? 338  GLU C N     1 
ATOM   6260  C  CA    . GLU C 2  338  ? 21.930  -26.300 68.388  1.00 25.34  ? 338  GLU C CA    1 
ATOM   6261  C  C     . GLU C 2  338  ? 21.860  -25.034 67.537  1.00 28.94  ? 338  GLU C C     1 
ATOM   6262  O  O     . GLU C 2  338  ? 22.093  -25.079 66.327  1.00 36.63  ? 338  GLU C O     1 
ATOM   6263  C  CB    . GLU C 2  338  ? 20.535  -26.898 68.566  1.00 25.73  ? 338  GLU C CB    1 
ATOM   6264  C  CG    . GLU C 2  338  ? 19.833  -27.194 67.248  1.00 32.54  ? 338  GLU C CG    1 
ATOM   6265  C  CD    . GLU C 2  338  ? 18.519  -27.926 67.432  1.00 38.49  ? 338  GLU C CD    1 
ATOM   6266  O  OE1   . GLU C 2  338  ? 18.331  -28.563 68.493  1.00 33.54  ? 338  GLU C OE1   1 
ATOM   6267  O  OE2   . GLU C 2  338  ? 17.674  -27.862 66.513  1.00 43.05  ? 338  GLU C OE2   1 
ATOM   6268  N  N     . LEU C 2  339  ? 21.545  -23.908 68.169  1.00 24.22  ? 339  LEU C N     1 
ATOM   6269  C  CA    . LEU C 2  339  ? 21.465  -22.636 67.459  1.00 23.24  ? 339  LEU C CA    1 
ATOM   6270  C  C     . LEU C 2  339  ? 22.839  -22.227 66.930  1.00 22.58  ? 339  LEU C C     1 
ATOM   6271  O  O     . LEU C 2  339  ? 23.013  -21.957 65.724  1.00 33.09  ? 339  LEU C O     1 
ATOM   6272  C  CB    . LEU C 2  339  ? 20.894  -21.553 68.376  1.00 21.45  ? 339  LEU C CB    1 
ATOM   6273  C  CG    . LEU C 2  339  ? 19.505  -21.848 68.955  1.00 21.06  ? 339  LEU C CG    1 
ATOM   6274  C  CD1   . LEU C 2  339  ? 19.095  -20.799 69.971  1.00 16.53  ? 339  LEU C CD1   1 
ATOM   6275  C  CD2   . LEU C 2  339  ? 18.465  -21.953 67.853  1.00 23.49  ? 339  LEU C CD2   1 
ATOM   6276  N  N     . MET C 2  340  ? 23.815  -22.204 67.833  1.00 18.69  ? 340  MET C N     1 
ATOM   6277  C  CA    . MET C 2  340  ? 25.184  -21.859 67.467  1.00 22.49  ? 340  MET C CA    1 
ATOM   6278  C  C     . MET C 2  340  ? 25.711  -22.774 66.361  1.00 27.15  ? 340  MET C C     1 
ATOM   6279  O  O     . MET C 2  340  ? 26.353  -22.313 65.414  1.00 25.69  ? 340  MET C O     1 
ATOM   6280  C  CB    . MET C 2  340  ? 26.097  -21.915 68.693  1.00 22.13  ? 340  MET C CB    1 
ATOM   6281  C  CG    . MET C 2  340  ? 27.474  -21.304 68.477  1.00 25.29  ? 340  MET C CG    1 
ATOM   6282  S  SD    . MET C 2  340  ? 28.650  -22.381 67.628  1.00 30.88  ? 340  MET C SD    1 
ATOM   6283  C  CE    . MET C 2  340  ? 28.858  -23.694 68.830  1.00 28.05  ? 340  MET C CE    1 
ATOM   6284  N  N     . THR C 2  341  ? 25.431  -24.068 66.482  1.00 29.00  ? 341  THR C N     1 
ATOM   6285  C  CA    . THR C 2  341  ? 25.837  -25.035 65.468  1.00 24.71  ? 341  THR C CA    1 
ATOM   6286  C  C     . THR C 2  341  ? 25.164  -24.748 64.131  1.00 29.78  ? 341  THR C C     1 
ATOM   6287  O  O     . THR C 2  341  ? 25.786  -24.891 63.084  1.00 32.72  ? 341  THR C O     1 
ATOM   6288  C  CB    . THR C 2  341  ? 25.534  -26.478 65.907  1.00 22.72  ? 341  THR C CB    1 
ATOM   6289  O  OG1   . THR C 2  341  ? 26.323  -26.791 67.058  1.00 30.36  ? 341  THR C OG1   1 
ATOM   6290  C  CG2   . THR C 2  341  ? 25.855  -27.469 64.799  1.00 23.18  ? 341  THR C CG2   1 
ATOM   6291  N  N     . ASP C 2  342  ? 23.899  -24.336 64.168  1.00 28.42  ? 342  ASP C N     1 
ATOM   6292  C  CA    . ASP C 2  342  ? 23.177  -24.002 62.943  1.00 28.10  ? 342  ASP C CA    1 
ATOM   6293  C  C     . ASP C 2  342  ? 23.876  -22.867 62.208  1.00 30.19  ? 342  ASP C C     1 
ATOM   6294  O  O     . ASP C 2  342  ? 24.173  -22.967 61.004  1.00 34.94  ? 342  ASP C O     1 
ATOM   6295  C  CB    . ASP C 2  342  ? 21.731  -23.614 63.247  1.00 35.07  ? 342  ASP C CB    1 
ATOM   6296  C  CG    . ASP C 2  342  ? 20.728  -24.543 62.591  1.00 46.50  ? 342  ASP C CG    1 
ATOM   6297  O  OD1   . ASP C 2  342  ? 20.993  -25.764 62.543  1.00 52.05  ? 342  ASP C OD1   1 
ATOM   6298  O  OD2   . ASP C 2  342  ? 19.679  -24.052 62.121  1.00 44.53  ? 342  ASP C OD2   1 
ATOM   6299  N  N     . GLN C 2  343  ? 24.157  -21.788 62.933  1.00 24.82  ? 343  GLN C N     1 
ATOM   6300  C  CA    . GLN C 2  343  ? 24.852  -20.671 62.301  1.00 26.49  ? 343  GLN C CA    1 
ATOM   6301  C  C     . GLN C 2  343  ? 26.248  -21.065 61.825  1.00 30.48  ? 343  GLN C C     1 
ATOM   6302  O  O     . GLN C 2  343  ? 26.723  -20.585 60.786  1.00 34.38  ? 343  GLN C O     1 
ATOM   6303  C  CB    . GLN C 2  343  ? 24.905  -19.458 63.225  1.00 29.91  ? 343  GLN C CB    1 
ATOM   6304  C  CG    . GLN C 2  343  ? 23.542  -18.847 63.461  1.00 33.11  ? 343  GLN C CG    1 
ATOM   6305  C  CD    . GLN C 2  343  ? 22.753  -18.701 62.178  1.00 33.21  ? 343  GLN C CD    1 
ATOM   6306  O  OE1   . GLN C 2  343  ? 21.758  -19.398 61.965  1.00 31.56  ? 343  GLN C OE1   1 
ATOM   6307  N  NE2   . GLN C 2  343  ? 23.194  -17.795 61.310  1.00 27.82  ? 343  GLN C NE2   1 
ATOM   6308  N  N     . PHE C 2  344  ? 26.891  -21.956 62.576  1.00 31.04  ? 344  PHE C N     1 
ATOM   6309  C  CA    . PHE C 2  344  ? 28.208  -22.467 62.201  1.00 30.10  ? 344  PHE C CA    1 
ATOM   6310  C  C     . PHE C 2  344  ? 28.141  -23.215 60.873  1.00 29.43  ? 344  PHE C C     1 
ATOM   6311  O  O     . PHE C 2  344  ? 29.041  -23.106 60.037  1.00 29.90  ? 344  PHE C O     1 
ATOM   6312  C  CB    . PHE C 2  344  ? 28.757  -23.391 63.288  1.00 25.43  ? 344  PHE C CB    1 
ATOM   6313  C  CG    . PHE C 2  344  ? 30.227  -23.653 63.167  1.00 25.07  ? 344  PHE C CG    1 
ATOM   6314  C  CD1   . PHE C 2  344  ? 30.698  -24.678 62.370  1.00 28.37  ? 344  PHE C CD1   1 
ATOM   6315  C  CD2   . PHE C 2  344  ? 31.140  -22.865 63.845  1.00 30.53  ? 344  PHE C CD2   1 
ATOM   6316  C  CE1   . PHE C 2  344  ? 32.053  -24.914 62.253  1.00 33.20  ? 344  PHE C CE1   1 
ATOM   6317  C  CE2   . PHE C 2  344  ? 32.496  -23.096 63.732  1.00 26.10  ? 344  PHE C CE2   1 
ATOM   6318  C  CZ    . PHE C 2  344  ? 32.952  -24.122 62.938  1.00 28.85  ? 344  PHE C CZ    1 
ATOM   6319  N  N     . ARG C 2  345  ? 27.061  -23.967 60.691  1.00 29.56  ? 345  ARG C N     1 
ATOM   6320  C  CA    . ARG C 2  345  ? 26.842  -24.747 59.485  1.00 27.39  ? 345  ARG C CA    1 
ATOM   6321  C  C     . ARG C 2  345  ? 26.598  -23.826 58.300  1.00 27.69  ? 345  ARG C C     1 
ATOM   6322  O  O     . ARG C 2  345  ? 27.101  -24.070 57.200  1.00 30.07  ? 345  ARG C O     1 
ATOM   6323  C  CB    . ARG C 2  345  ? 25.657  -25.689 59.679  1.00 30.49  ? 345  ARG C CB    1 
ATOM   6324  C  CG    . ARG C 2  345  ? 25.490  -26.725 58.585  1.00 48.14  ? 345  ARG C CG    1 
ATOM   6325  C  CD    . ARG C 2  345  ? 24.411  -27.722 58.970  1.00 66.48  ? 345  ARG C CD    1 
ATOM   6326  N  NE    . ARG C 2  345  ? 24.741  -28.421 60.210  1.00 69.76  ? 345  ARG C NE    1 
ATOM   6327  C  CZ    . ARG C 2  345  ? 23.849  -29.012 60.999  1.00 74.77  ? 345  ARG C CZ    1 
ATOM   6328  N  NH1   . ARG C 2  345  ? 22.559  -28.985 60.686  1.00 74.62  ? 345  ARG C NH1   1 
ATOM   6329  N  NH2   . ARG C 2  345  ? 24.248  -29.625 62.108  1.00 53.61  ? 345  ARG C NH2   1 
ATOM   6330  N  N     . VAL C 2  346  ? 25.834  -22.761 58.527  1.00 30.09  ? 346  VAL C N     1 
ATOM   6331  C  CA    . VAL C 2  346  ? 25.621  -21.764 57.476  1.00 34.31  ? 346  VAL C CA    1 
ATOM   6332  C  C     . VAL C 2  346  ? 26.937  -21.115 57.023  1.00 33.16  ? 346  VAL C C     1 
ATOM   6333  O  O     . VAL C 2  346  ? 27.258  -21.081 55.819  1.00 35.41  ? 346  VAL C O     1 
ATOM   6334  C  CB    . VAL C 2  346  ? 24.642  -20.669 57.928  1.00 26.90  ? 346  VAL C CB    1 
ATOM   6335  C  CG1   . VAL C 2  346  ? 24.561  -19.572 56.881  1.00 27.66  ? 346  VAL C CG1   1 
ATOM   6336  C  CG2   . VAL C 2  346  ? 23.273  -21.269 58.193  1.00 24.80  ? 346  VAL C CG2   1 
ATOM   6337  N  N     . GLY C 2  347  ? 27.695  -20.608 57.993  1.00 31.10  ? 347  GLY C N     1 
ATOM   6338  C  CA    . GLY C 2  347  ? 28.995  -20.024 57.712  1.00 32.91  ? 347  GLY C CA    1 
ATOM   6339  C  C     . GLY C 2  347  ? 29.904  -20.981 56.958  1.00 38.13  ? 347  GLY C C     1 
ATOM   6340  O  O     . GLY C 2  347  ? 30.581  -20.589 56.004  1.00 40.95  ? 347  GLY C O     1 
ATOM   6341  N  N     . LEU C 2  348  ? 29.904  -22.244 57.380  1.00 35.21  ? 348  LEU C N     1 
ATOM   6342  C  CA    . LEU C 2  348  ? 30.710  -23.274 56.730  1.00 33.79  ? 348  LEU C CA    1 
ATOM   6343  C  C     . LEU C 2  348  ? 30.288  -23.489 55.276  1.00 35.73  ? 348  LEU C C     1 
ATOM   6344  O  O     . LEU C 2  348  ? 31.130  -23.693 54.398  1.00 33.50  ? 348  LEU C O     1 
ATOM   6345  C  CB    . LEU C 2  348  ? 30.620  -24.588 57.507  1.00 31.13  ? 348  LEU C CB    1 
ATOM   6346  C  CG    . LEU C 2  348  ? 31.945  -25.235 57.912  1.00 34.17  ? 348  LEU C CG    1 
ATOM   6347  C  CD1   . LEU C 2  348  ? 32.847  -24.227 58.610  1.00 31.69  ? 348  LEU C CD1   1 
ATOM   6348  C  CD2   . LEU C 2  348  ? 31.694  -26.437 58.809  1.00 33.77  ? 348  LEU C CD2   1 
ATOM   6349  N  N     . ALA C 2  349  ? 28.981  -23.443 55.029  1.00 37.05  ? 349  ALA C N     1 
ATOM   6350  C  CA    . ALA C 2  349  ? 28.462  -23.550 53.670  1.00 33.27  ? 349  ALA C CA    1 
ATOM   6351  C  C     . ALA C 2  349  ? 28.995  -22.417 52.801  1.00 37.91  ? 349  ALA C C     1 
ATOM   6352  O  O     . ALA C 2  349  ? 29.463  -22.645 51.675  1.00 40.51  ? 349  ALA C O     1 
ATOM   6353  C  CB    . ALA C 2  349  ? 26.947  -23.540 53.680  1.00 31.49  ? 349  ALA C CB    1 
ATOM   6354  N  N     . ARG C 2  350  ? 28.928  -21.194 53.326  1.00 36.24  ? 350  ARG C N     1 
ATOM   6355  C  CA    . ARG C 2  350  ? 29.478  -20.048 52.603  1.00 35.33  ? 350  ARG C CA    1 
ATOM   6356  C  C     . ARG C 2  350  ? 30.965  -20.245 52.313  1.00 39.17  ? 350  ARG C C     1 
ATOM   6357  O  O     . ARG C 2  350  ? 31.442  -19.967 51.202  1.00 45.71  ? 350  ARG C O     1 
ATOM   6358  C  CB    . ARG C 2  350  ? 29.237  -18.748 53.372  1.00 35.54  ? 350  ARG C CB    1 
ATOM   6359  C  CG    . ARG C 2  350  ? 27.803  -18.254 53.284  1.00 37.57  ? 350  ARG C CG    1 
ATOM   6360  C  CD    . ARG C 2  350  ? 27.487  -17.223 54.353  1.00 37.26  ? 350  ARG C CD    1 
ATOM   6361  N  NE    . ARG C 2  350  ? 26.052  -16.962 54.433  1.00 39.27  ? 350  ARG C NE    1 
ATOM   6362  C  CZ    . ARG C 2  350  ? 25.440  -16.463 55.503  1.00 39.22  ? 350  ARG C CZ    1 
ATOM   6363  N  NH1   . ARG C 2  350  ? 26.138  -16.172 56.593  1.00 40.73  ? 350  ARG C NH1   1 
ATOM   6364  N  NH2   . ARG C 2  350  ? 24.130  -16.260 55.485  1.00 37.56  ? 350  ARG C NH2   1 
ATOM   6365  N  N     . LEU C 2  351  ? 31.685  -20.751 53.310  1.00 37.65  ? 351  LEU C N     1 
ATOM   6366  C  CA    . LEU C 2  351  ? 33.107  -21.046 53.160  1.00 41.63  ? 351  LEU C CA    1 
ATOM   6367  C  C     . LEU C 2  351  ? 33.363  -22.051 52.036  1.00 43.18  ? 351  LEU C C     1 
ATOM   6368  O  O     . LEU C 2  351  ? 34.350  -21.936 51.309  1.00 42.77  ? 351  LEU C O     1 
ATOM   6369  C  CB    . LEU C 2  351  ? 33.691  -21.557 54.479  1.00 34.25  ? 351  LEU C CB    1 
ATOM   6370  C  CG    . LEU C 2  351  ? 35.208  -21.740 54.549  1.00 30.45  ? 351  LEU C CG    1 
ATOM   6371  C  CD1   . LEU C 2  351  ? 35.717  -21.340 55.919  1.00 33.44  ? 351  LEU C CD1   1 
ATOM   6372  C  CD2   . LEU C 2  351  ? 35.598  -23.176 54.243  1.00 30.50  ? 351  LEU C CD2   1 
ATOM   6373  N  N     . ALA C 2  352  ? 32.471  -23.030 51.897  1.00 40.37  ? 352  ALA C N     1 
ATOM   6374  C  CA    . ALA C 2  352  ? 32.592  -24.033 50.839  1.00 41.03  ? 352  ALA C CA    1 
ATOM   6375  C  C     . ALA C 2  352  ? 32.318  -23.442 49.454  1.00 49.39  ? 352  ALA C C     1 
ATOM   6376  O  O     . ALA C 2  352  ? 32.995  -23.787 48.478  1.00 52.92  ? 352  ALA C O     1 
ATOM   6377  C  CB    . ALA C 2  352  ? 31.667  -25.209 51.109  1.00 39.93  ? 352  ALA C CB    1 
ATOM   6378  N  N     . ARG C 2  353  ? 31.324  -22.558 49.371  1.00 49.28  ? 353  ARG C N     1 
ATOM   6379  C  CA    . ARG C 2  353  ? 31.037  -21.859 48.119  1.00 48.30  ? 353  ARG C CA    1 
ATOM   6380  C  C     . ARG C 2  353  ? 32.276  -21.076 47.677  1.00 48.34  ? 353  ARG C C     1 
ATOM   6381  O  O     . ARG C 2  353  ? 32.724  -21.179 46.524  1.00 56.05  ? 353  ARG C O     1 
ATOM   6382  C  CB    . ARG C 2  353  ? 29.834  -20.923 48.292  1.00 50.46  ? 353  ARG C CB    1 
ATOM   6383  C  CG    . ARG C 2  353  ? 29.075  -20.602 47.005  1.00 62.42  ? 353  ARG C CG    1 
ATOM   6384  C  CD    . ARG C 2  353  ? 29.665  -19.408 46.257  1.00 85.15  ? 353  ARG C CD    1 
ATOM   6385  N  NE    . ARG C 2  353  ? 29.284  -18.126 46.850  1.00 96.64  ? 353  ARG C NE    1 
ATOM   6386  C  CZ    . ARG C 2  353  ? 29.621  -16.938 46.352  1.00 97.28  ? 353  ARG C CZ    1 
ATOM   6387  N  NH1   . ARG C 2  353  ? 30.351  -16.860 45.246  1.00 94.77  ? 353  ARG C NH1   1 
ATOM   6388  N  NH2   . ARG C 2  353  ? 29.229  -15.824 46.958  1.00 79.07  ? 353  ARG C NH2   1 
ATOM   6389  N  N     . GLY C 2  354  ? 32.840  -20.312 48.609  1.00 41.88  ? 354  GLY C N     1 
ATOM   6390  C  CA    . GLY C 2  354  ? 34.057  -19.567 48.338  1.00 46.98  ? 354  GLY C CA    1 
ATOM   6391  C  C     . GLY C 2  354  ? 35.223  -20.454 47.937  1.00 47.54  ? 354  GLY C C     1 
ATOM   6392  O  O     . GLY C 2  354  ? 36.001  -20.105 47.046  1.00 50.80  ? 354  GLY C O     1 
ATOM   6393  N  N     . VAL C 2  355  ? 35.342  -21.605 48.595  1.00 51.60  ? 355  VAL C N     1 
ATOM   6394  C  CA    . VAL C 2  355  ? 36.402  -22.570 48.298  1.00 48.53  ? 355  VAL C CA    1 
ATOM   6395  C  C     . VAL C 2  355  ? 36.313  -23.117 46.873  1.00 50.97  ? 355  VAL C C     1 
ATOM   6396  O  O     . VAL C 2  355  ? 37.315  -23.154 46.161  1.00 55.20  ? 355  VAL C O     1 
ATOM   6397  C  CB    . VAL C 2  355  ? 36.416  -23.739 49.314  1.00 43.90  ? 355  VAL C CB    1 
ATOM   6398  C  CG1   . VAL C 2  355  ? 37.033  -24.986 48.704  1.00 43.91  ? 355  VAL C CG1   1 
ATOM   6399  C  CG2   . VAL C 2  355  ? 37.163  -23.337 50.574  1.00 46.74  ? 355  VAL C CG2   1 
ATOM   6400  N  N     . ARG C 2  356  ? 35.120  -23.537 46.459  1.00 47.81  ? 356  ARG C N     1 
ATOM   6401  C  CA    . ARG C 2  356  ? 34.922  -23.998 45.086  1.00 43.55  ? 356  ARG C CA    1 
ATOM   6402  C  C     . ARG C 2  356  ? 35.225  -22.892 44.075  1.00 50.03  ? 356  ARG C C     1 
ATOM   6403  O  O     . ARG C 2  356  ? 35.941  -23.111 43.084  1.00 53.70  ? 356  ARG C O     1 
ATOM   6404  C  CB    . ARG C 2  356  ? 33.499  -24.522 44.892  1.00 46.08  ? 356  ARG C CB    1 
ATOM   6405  C  CG    . ARG C 2  356  ? 33.338  -25.998 45.208  1.00 53.43  ? 356  ARG C CG    1 
ATOM   6406  C  CD    . ARG C 2  356  ? 31.890  -26.447 45.085  1.00 64.54  ? 356  ARG C CD    1 
ATOM   6407  N  NE    . ARG C 2  356  ? 31.070  -25.968 46.196  1.00 83.12  ? 356  ARG C NE    1 
ATOM   6408  C  CZ    . ARG C 2  356  ? 30.750  -26.700 47.260  1.00 76.66  ? 356  ARG C CZ    1 
ATOM   6409  N  NH1   . ARG C 2  356  ? 29.999  -26.182 48.224  1.00 61.83  ? 356  ARG C NH1   1 
ATOM   6410  N  NH2   . ARG C 2  356  ? 31.177  -27.952 47.359  1.00 72.37  ? 356  ARG C NH2   1 
ATOM   6411  N  N     . GLU C 2  357  ? 34.685  -21.702 44.338  1.00 56.79  ? 357  GLU C N     1 
ATOM   6412  C  CA    . GLU C 2  357  ? 34.912  -20.553 43.464  1.00 58.20  ? 357  GLU C CA    1 
ATOM   6413  C  C     . GLU C 2  357  ? 36.406  -20.274 43.305  1.00 59.23  ? 357  GLU C C     1 
ATOM   6414  O  O     . GLU C 2  357  ? 36.864  -19.896 42.227  1.00 61.80  ? 357  GLU C O     1 
ATOM   6415  C  CB    . GLU C 2  357  ? 34.189  -19.316 44.009  1.00 71.42  ? 357  GLU C CB    1 
ATOM   6416  C  CG    . GLU C 2  357  ? 33.971  -18.201 42.989  1.00 79.35  ? 357  GLU C CG    1 
ATOM   6417  C  CD    . GLU C 2  357  ? 33.130  -17.059 43.545  1.00 87.64  ? 357  GLU C CD    1 
ATOM   6418  O  OE1   . GLU C 2  357  ? 33.176  -16.822 44.772  1.00 84.74  ? 357  GLU C OE1   1 
ATOM   6419  O  OE2   . GLU C 2  357  ? 32.417  -16.402 42.755  1.00 75.23  ? 357  GLU C OE2   1 
ATOM   6420  N  N     . ARG C 2  358  ? 37.162  -20.475 44.383  1.00 63.58  ? 358  ARG C N     1 
ATOM   6421  C  CA    . ARG C 2  358  ? 38.614  -20.297 44.353  1.00 63.27  ? 358  ARG C CA    1 
ATOM   6422  C  C     . ARG C 2  358  ? 39.337  -21.477 43.707  1.00 58.45  ? 358  ARG C C     1 
ATOM   6423  O  O     . ARG C 2  358  ? 40.478  -21.346 43.265  1.00 57.44  ? 358  ARG C O     1 
ATOM   6424  C  CB    . ARG C 2  358  ? 39.163  -20.067 45.764  1.00 61.56  ? 358  ARG C CB    1 
ATOM   6425  C  CG    . ARG C 2  358  ? 38.967  -18.657 46.297  1.00 56.03  ? 358  ARG C CG    1 
ATOM   6426  C  CD    . ARG C 2  358  ? 39.532  -18.532 47.700  1.00 55.05  ? 358  ARG C CD    1 
ATOM   6427  N  NE    . ARG C 2  358  ? 39.563  -17.150 48.165  1.00 64.24  ? 358  ARG C NE    1 
ATOM   6428  C  CZ    . ARG C 2  358  ? 38.568  -16.558 48.816  1.00 74.32  ? 358  ARG C CZ    1 
ATOM   6429  N  NH1   . ARG C 2  358  ? 38.686  -15.295 49.204  1.00 80.03  ? 358  ARG C NH1   1 
ATOM   6430  N  NH2   . ARG C 2  358  ? 37.453  -17.229 49.080  1.00 72.57  ? 358  ARG C NH2   1 
ATOM   6431  N  N     . MET C 2  359  ? 38.678  -22.631 43.666  1.00 59.22  ? 359  MET C N     1 
ATOM   6432  C  CA    . MET C 2  359  ? 39.260  -23.810 43.036  1.00 58.72  ? 359  MET C CA    1 
ATOM   6433  C  C     . MET C 2  359  ? 39.163  -23.737 41.520  1.00 68.96  ? 359  MET C C     1 
ATOM   6434  O  O     . MET C 2  359  ? 40.050  -24.222 40.818  1.00 72.77  ? 359  MET C O     1 
ATOM   6435  C  CB    . MET C 2  359  ? 38.605  -25.100 43.539  1.00 51.48  ? 359  MET C CB    1 
ATOM   6436  C  CG    . MET C 2  359  ? 39.130  -25.580 44.881  1.00 58.61  ? 359  MET C CG    1 
ATOM   6437  S  SD    . MET C 2  359  ? 38.659  -27.278 45.274  1.00 59.23  ? 359  MET C SD    1 
ATOM   6438  C  CE    . MET C 2  359  ? 36.879  -27.179 45.157  1.00 67.35  ? 359  MET C CE    1 
ATOM   6439  N  N     . LEU C 2  360  ? 38.087  -23.137 41.014  1.00 70.46  ? 360  LEU C N     1 
ATOM   6440  C  CA    . LEU C 2  360  ? 37.919  -23.026 39.564  1.00 66.45  ? 360  LEU C CA    1 
ATOM   6441  C  C     . LEU C 2  360  ? 39.059  -22.265 38.886  1.00 74.91  ? 360  LEU C C     1 
ATOM   6442  O  O     . LEU C 2  360  ? 39.754  -22.813 38.032  1.00 90.32  ? 360  LEU C O     1 
ATOM   6443  C  CB    . LEU C 2  360  ? 36.577  -22.383 39.211  1.00 63.73  ? 360  LEU C CB    1 
ATOM   6444  C  CG    . LEU C 2  360  ? 35.508  -23.349 38.699  1.00 65.35  ? 360  LEU C CG    1 
ATOM   6445  C  CD1   . LEU C 2  360  ? 35.241  -24.456 39.713  1.00 57.07  ? 360  LEU C CD1   1 
ATOM   6446  C  CD2   . LEU C 2  360  ? 34.228  -22.601 38.359  1.00 65.16  ? 360  LEU C CD2   1 
ATOM   6447  N  N     . MET C 2  361  ? 39.261  -21.011 39.275  1.00 72.53  ? 361  MET C N     1 
ATOM   6448  C  CA    . MET C 2  361  ? 40.354  -20.214 38.723  1.00 79.02  ? 361  MET C CA    1 
ATOM   6449  C  C     . MET C 2  361  ? 41.613  -20.298 39.582  1.00 93.06  ? 361  MET C C     1 
ATOM   6450  O  O     . MET C 2  361  ? 41.703  -21.131 40.485  1.00 98.79  ? 361  MET C O     1 
ATOM   6451  C  CB    . MET C 2  361  ? 39.926  -18.759 38.519  1.00 77.47  ? 361  MET C CB    1 
ATOM   6452  C  CG    . MET C 2  361  ? 39.041  -18.205 39.616  1.00 81.51  ? 361  MET C CG    1 
ATOM   6453  S  SD    . MET C 2  361  ? 37.537  -17.481 38.937  1.00 98.22  ? 361  MET C SD    1 
ATOM   6454  C  CE    . MET C 2  361  ? 36.874  -18.885 38.042  1.00 74.77  ? 361  MET C CE    1 
ATOM   6455  N  N     . GLY C 2  362  ? 42.588  -19.445 39.284  1.00 97.65  ? 362  GLY C N     1 
ATOM   6456  C  CA    . GLY C 2  362  ? 43.835  -19.419 40.028  1.00 104.48 ? 362  GLY C CA    1 
ATOM   6457  C  C     . GLY C 2  362  ? 44.803  -20.478 39.540  1.00 113.87 ? 362  GLY C C     1 
ATOM   6458  O  O     . GLY C 2  362  ? 44.425  -21.352 38.758  1.00 115.25 ? 362  GLY C O     1 
ATOM   6459  N  N     . SER C 2  363  ? 46.051  -20.399 39.997  1.00 113.47 ? 363  SER C N     1 
ATOM   6460  C  CA    . SER C 2  363  ? 47.072  -21.363 39.600  1.00 119.00 ? 363  SER C CA    1 
ATOM   6461  C  C     . SER C 2  363  ? 46.641  -22.774 39.988  1.00 121.28 ? 363  SER C C     1 
ATOM   6462  O  O     . SER C 2  363  ? 46.330  -23.037 41.148  1.00 114.06 ? 363  SER C O     1 
ATOM   6463  C  CB    . SER C 2  363  ? 48.415  -21.020 40.248  1.00 110.25 ? 363  SER C CB    1 
ATOM   6464  O  OG    . SER C 2  363  ? 49.429  -21.917 39.829  1.00 98.81  ? 363  SER C OG    1 
ATOM   6465  N  N     . GLU C 2  364  ? 46.624  -23.676 39.011  1.00 126.36 ? 364  GLU C N     1 
ATOM   6466  C  CA    . GLU C 2  364  ? 46.123  -25.031 39.228  1.00 124.23 ? 364  GLU C CA    1 
ATOM   6467  C  C     . GLU C 2  364  ? 47.182  -25.968 39.805  1.00 121.00 ? 364  GLU C C     1 
ATOM   6468  O  O     . GLU C 2  364  ? 46.862  -27.049 40.303  1.00 107.21 ? 364  GLU C O     1 
ATOM   6469  C  CB    . GLU C 2  364  ? 45.549  -25.605 37.929  1.00 120.96 ? 364  GLU C CB    1 
ATOM   6470  C  CG    . GLU C 2  364  ? 44.283  -24.906 37.454  1.00 124.17 ? 364  GLU C CG    1 
ATOM   6471  C  CD    . GLU C 2  364  ? 43.120  -25.089 38.413  1.00 120.05 ? 364  GLU C CD    1 
ATOM   6472  O  OE1   . GLU C 2  364  ? 42.381  -24.108 38.649  1.00 106.65 ? 364  GLU C OE1   1 
ATOM   6473  O  OE2   . GLU C 2  364  ? 42.943  -26.215 38.927  1.00 113.22 ? 364  GLU C OE2   1 
ATOM   6474  N  N     . ASP C 2  365  ? 48.441  -25.547 39.739  1.00 121.95 ? 365  ASP C N     1 
ATOM   6475  C  CA    . ASP C 2  365  ? 49.533  -26.321 40.316  1.00 119.69 ? 365  ASP C CA    1 
ATOM   6476  C  C     . ASP C 2  365  ? 49.697  -26.008 41.794  1.00 111.34 ? 365  ASP C C     1 
ATOM   6477  O  O     . ASP C 2  365  ? 49.512  -26.878 42.647  1.00 103.54 ? 365  ASP C O     1 
ATOM   6478  C  CB    . ASP C 2  365  ? 50.851  -26.047 39.591  1.00 124.55 ? 365  ASP C CB    1 
ATOM   6479  C  CG    . ASP C 2  365  ? 52.055  -26.581 40.353  1.00 123.04 ? 365  ASP C CG    1 
ATOM   6480  O  OD1   . ASP C 2  365  ? 51.967  -27.699 40.906  1.00 118.96 ? 365  ASP C OD1   1 
ATOM   6481  O  OD2   . ASP C 2  365  ? 53.086  -25.876 40.410  1.00 120.70 ? 365  ASP C OD2   1 
ATOM   6482  N  N     . SER C 2  366  ? 50.052  -24.762 42.095  1.00 112.82 ? 366  SER C N     1 
ATOM   6483  C  CA    . SER C 2  366  ? 50.320  -24.384 43.472  1.00 110.24 ? 366  SER C CA    1 
ATOM   6484  C  C     . SER C 2  366  ? 49.068  -23.832 44.131  1.00 107.60 ? 366  SER C C     1 
ATOM   6485  O  O     . SER C 2  366  ? 48.631  -22.715 43.847  1.00 107.79 ? 366  SER C O     1 
ATOM   6486  C  CB    . SER C 2  366  ? 51.439  -23.342 43.532  1.00 103.53 ? 366  SER C CB    1 
ATOM   6487  O  OG    . SER C 2  366  ? 51.064  -22.153 42.857  1.00 99.93  ? 366  SER C OG    1 
ATOM   6488  N  N     . LEU C 2  367  ? 48.511  -24.633 45.030  1.00 97.42  ? 367  LEU C N     1 
ATOM   6489  C  CA    . LEU C 2  367  ? 47.400  -24.229 45.870  1.00 82.22  ? 367  LEU C CA    1 
ATOM   6490  C  C     . LEU C 2  367  ? 47.524  -24.997 47.170  1.00 79.31  ? 367  LEU C C     1 
ATOM   6491  O  O     . LEU C 2  367  ? 47.885  -26.173 47.173  1.00 77.60  ? 367  LEU C O     1 
ATOM   6492  C  CB    . LEU C 2  367  ? 46.057  -24.541 45.205  1.00 76.32  ? 367  LEU C CB    1 
ATOM   6493  C  CG    . LEU C 2  367  ? 45.540  -23.536 44.174  1.00 86.27  ? 367  LEU C CG    1 
ATOM   6494  C  CD1   . LEU C 2  367  ? 44.180  -23.956 43.634  1.00 74.63  ? 367  LEU C CD1   1 
ATOM   6495  C  CD2   . LEU C 2  367  ? 45.481  -22.133 44.765  1.00 84.07  ? 367  LEU C CD2   1 
ATOM   6496  N  N     . THR C 2  368  ? 47.224  -24.329 48.273  1.00 77.17  ? 368  THR C N     1 
ATOM   6497  C  CA    . THR C 2  368  ? 47.236  -24.969 49.576  1.00 72.57  ? 368  THR C CA    1 
ATOM   6498  C  C     . THR C 2  368  ? 45.875  -24.748 50.213  1.00 70.05  ? 368  THR C C     1 
ATOM   6499  O  O     . THR C 2  368  ? 45.145  -23.839 49.812  1.00 66.95  ? 368  THR C O     1 
ATOM   6500  C  CB    . THR C 2  368  ? 48.358  -24.401 50.483  1.00 73.63  ? 368  THR C CB    1 
ATOM   6501  O  OG1   . THR C 2  368  ? 48.205  -22.983 50.621  1.00 73.78  ? 368  THR C OG1   1 
ATOM   6502  C  CG2   . THR C 2  368  ? 49.725  -24.698 49.890  1.00 79.50  ? 368  THR C CG2   1 
ATOM   6503  N  N     . PRO C 2  369  ? 45.512  -25.594 51.189  1.00 66.80  ? 369  PRO C N     1 
ATOM   6504  C  CA    . PRO C 2  369  ? 44.280  -25.371 51.949  1.00 57.75  ? 369  PRO C CA    1 
ATOM   6505  C  C     . PRO C 2  369  ? 44.211  -23.957 52.524  1.00 53.91  ? 369  PRO C C     1 
ATOM   6506  O  O     . PRO C 2  369  ? 43.118  -23.435 52.725  1.00 62.99  ? 369  PRO C O     1 
ATOM   6507  C  CB    . PRO C 2  369  ? 44.385  -26.402 53.068  1.00 69.18  ? 369  PRO C CB    1 
ATOM   6508  C  CG    . PRO C 2  369  ? 45.128  -27.532 52.438  1.00 59.19  ? 369  PRO C CG    1 
ATOM   6509  C  CD    . PRO C 2  369  ? 46.128  -26.893 51.514  1.00 63.24  ? 369  PRO C CD    1 
ATOM   6510  N  N     . ALA C 2  370  ? 45.364  -23.345 52.774  1.00 55.87  ? 370  ALA C N     1 
ATOM   6511  C  CA    . ALA C 2  370  ? 45.409  -21.965 53.244  1.00 62.87  ? 370  ALA C CA    1 
ATOM   6512  C  C     . ALA C 2  370  ? 44.979  -20.980 52.156  1.00 55.24  ? 370  ALA C C     1 
ATOM   6513  O  O     . ALA C 2  370  ? 44.297  -19.994 52.436  1.00 58.23  ? 370  ALA C O     1 
ATOM   6514  C  CB    . ALA C 2  370  ? 46.802  -21.622 53.752  1.00 68.82  ? 370  ALA C CB    1 
ATOM   6515  N  N     . LYS C 2  371  ? 45.382  -21.251 50.919  1.00 54.01  ? 371  LYS C N     1 
ATOM   6516  C  CA    . LYS C 2  371  ? 45.072  -20.366 49.799  1.00 62.53  ? 371  LYS C CA    1 
ATOM   6517  C  C     . LYS C 2  371  ? 43.643  -20.543 49.282  1.00 60.54  ? 371  LYS C C     1 
ATOM   6518  O  O     . LYS C 2  371  ? 43.092  -19.648 48.643  1.00 59.75  ? 371  LYS C O     1 
ATOM   6519  C  CB    . LYS C 2  371  ? 46.078  -20.557 48.659  1.00 70.77  ? 371  LYS C CB    1 
ATOM   6520  C  CG    . LYS C 2  371  ? 47.499  -20.122 48.996  1.00 71.25  ? 371  LYS C CG    1 
ATOM   6521  C  CD    . LYS C 2  371  ? 48.429  -20.286 47.800  1.00 74.72  ? 371  LYS C CD    1 
ATOM   6522  C  CE    . LYS C 2  371  ? 49.839  -19.815 48.122  1.00 72.13  ? 371  LYS C CE    1 
ATOM   6523  N  NZ    . LYS C 2  371  ? 50.752  -19.961 46.955  1.00 72.92  ? 371  LYS C NZ    1 
ATOM   6524  N  N     . LEU C 2  372  ? 43.057  -21.708 49.539  1.00 57.13  ? 372  LEU C N     1 
ATOM   6525  C  CA    . LEU C 2  372  ? 41.666  -21.963 49.170  1.00 52.56  ? 372  LEU C CA    1 
ATOM   6526  C  C     . LEU C 2  372  ? 40.660  -21.403 50.177  1.00 57.20  ? 372  LEU C C     1 
ATOM   6527  O  O     . LEU C 2  372  ? 39.590  -20.926 49.796  1.00 60.89  ? 372  LEU C O     1 
ATOM   6528  C  CB    . LEU C 2  372  ? 41.421  -23.461 48.986  1.00 55.43  ? 372  LEU C CB    1 
ATOM   6529  C  CG    . LEU C 2  372  ? 42.012  -24.121 47.743  1.00 60.24  ? 372  LEU C CG    1 
ATOM   6530  C  CD1   . LEU C 2  372  ? 41.580  -25.580 47.670  1.00 50.72  ? 372  LEU C CD1   1 
ATOM   6531  C  CD2   . LEU C 2  372  ? 41.582  -23.367 46.495  1.00 68.20  ? 372  LEU C CD2   1 
ATOM   6532  N  N     . VAL C 2  373  ? 41.005  -21.469 51.460  1.00 47.00  ? 373  VAL C N     1 
ATOM   6533  C  CA    . VAL C 2  373  ? 40.047  -21.197 52.528  1.00 37.65  ? 373  VAL C CA    1 
ATOM   6534  C  C     . VAL C 2  373  ? 40.084  -19.769 53.070  1.00 51.58  ? 373  VAL C C     1 
ATOM   6535  O  O     . VAL C 2  373  ? 41.112  -19.307 53.568  1.00 55.49  ? 373  VAL C O     1 
ATOM   6536  C  CB    . VAL C 2  373  ? 40.233  -22.181 53.697  1.00 36.76  ? 373  VAL C CB    1 
ATOM   6537  C  CG1   . VAL C 2  373  ? 39.418  -21.747 54.906  1.00 36.38  ? 373  VAL C CG1   1 
ATOM   6538  C  CG2   . VAL C 2  373  ? 39.853  -23.585 53.264  1.00 39.94  ? 373  VAL C CG2   1 
ATOM   6539  N  N     . ASN C 2  374  ? 38.947  -19.083 52.967  1.00 52.78  ? 374  ASN C N     1 
ATOM   6540  C  CA    . ASN C 2  374  ? 38.764  -17.774 53.588  1.00 53.56  ? 374  ASN C CA    1 
ATOM   6541  C  C     . ASN C 2  374  ? 37.826  -17.889 54.789  1.00 53.28  ? 374  ASN C C     1 
ATOM   6542  O  O     . ASN C 2  374  ? 36.697  -18.366 54.662  1.00 47.90  ? 374  ASN C O     1 
ATOM   6543  C  CB    . ASN C 2  374  ? 38.218  -16.762 52.576  1.00 48.55  ? 374  ASN C CB    1 
ATOM   6544  C  CG    . ASN C 2  374  ? 38.193  -15.344 53.122  1.00 51.59  ? 374  ASN C CG    1 
ATOM   6545  O  OD1   . ASN C 2  374  ? 38.833  -15.044 54.129  1.00 56.15  ? 374  ASN C OD1   1 
ATOM   6546  N  ND2   . ASN C 2  374  ? 37.454  -14.464 52.456  1.00 53.07  ? 374  ASN C ND2   1 
ATOM   6547  N  N     . SER C 2  375  ? 38.299  -17.454 55.954  1.00 48.27  ? 375  SER C N     1 
ATOM   6548  C  CA    . SER C 2  375  ? 37.548  -17.615 57.196  1.00 41.78  ? 375  SER C CA    1 
ATOM   6549  C  C     . SER C 2  375  ? 36.443  -16.578 57.365  1.00 42.40  ? 375  SER C C     1 
ATOM   6550  O  O     . SER C 2  375  ? 35.559  -16.737 58.205  1.00 41.13  ? 375  SER C O     1 
ATOM   6551  C  CB    . SER C 2  375  ? 38.495  -17.548 58.396  1.00 42.28  ? 375  SER C CB    1 
ATOM   6552  O  OG    . SER C 2  375  ? 39.119  -16.280 58.473  1.00 49.62  ? 375  SER C OG    1 
ATOM   6553  N  N     . ARG C 2  376  ? 36.497  -15.522 56.560  1.00 46.66  ? 376  ARG C N     1 
ATOM   6554  C  CA    . ARG C 2  376  ? 35.593  -14.377 56.705  1.00 46.30  ? 376  ARG C CA    1 
ATOM   6555  C  C     . ARG C 2  376  ? 34.088  -14.682 56.797  1.00 38.45  ? 376  ARG C C     1 
ATOM   6556  O  O     . ARG C 2  376  ? 33.416  -14.143 57.675  1.00 42.48  ? 376  ARG C O     1 
ATOM   6557  C  CB    . ARG C 2  376  ? 35.876  -13.307 55.639  1.00 51.32  ? 376  ARG C CB    1 
ATOM   6558  C  CG    . ARG C 2  376  ? 36.853  -12.219 56.093  1.00 60.46  ? 376  ARG C CG    1 
ATOM   6559  C  CD    . ARG C 2  376  ? 38.117  -12.815 56.707  1.00 62.37  ? 376  ARG C CD    1 
ATOM   6560  N  NE    . ARG C 2  376  ? 39.113  -11.804 57.051  1.00 61.91  ? 376  ARG C NE    1 
ATOM   6561  C  CZ    . ARG C 2  376  ? 39.290  -11.310 58.272  1.00 68.60  ? 376  ARG C CZ    1 
ATOM   6562  N  NH1   . ARG C 2  376  ? 38.535  -11.731 59.279  1.00 66.80  ? 376  ARG C NH1   1 
ATOM   6563  N  NH2   . ARG C 2  376  ? 40.225  -10.394 58.488  1.00 69.23  ? 376  ARG C NH2   1 
ATOM   6564  N  N     . PRO C 2  377  ? 33.553  -15.538 55.906  1.00 33.05  ? 377  PRO C N     1 
ATOM   6565  C  CA    . PRO C 2  377  ? 32.118  -15.820 56.028  1.00 34.98  ? 377  PRO C CA    1 
ATOM   6566  C  C     . PRO C 2  377  ? 31.750  -16.525 57.335  1.00 36.12  ? 377  PRO C C     1 
ATOM   6567  O  O     . PRO C 2  377  ? 30.705  -16.226 57.916  1.00 45.04  ? 377  PRO C O     1 
ATOM   6568  C  CB    . PRO C 2  377  ? 31.836  -16.734 54.830  1.00 29.38  ? 377  PRO C CB    1 
ATOM   6569  C  CG    . PRO C 2  377  ? 33.145  -17.324 54.484  1.00 32.16  ? 377  PRO C CG    1 
ATOM   6570  C  CD    . PRO C 2  377  ? 34.143  -16.241 54.756  1.00 38.92  ? 377  PRO C CD    1 
ATOM   6571  N  N     . LEU C 2  378  ? 32.597  -17.438 57.794  1.00 28.93  ? 378  LEU C N     1 
ATOM   6572  C  CA    . LEU C 2  378  ? 32.332  -18.165 59.030  1.00 30.21  ? 378  LEU C CA    1 
ATOM   6573  C  C     . LEU C 2  378  ? 32.378  -17.235 60.244  1.00 33.18  ? 378  LEU C C     1 
ATOM   6574  O  O     . LEU C 2  378  ? 31.487  -17.263 61.103  1.00 31.46  ? 378  LEU C O     1 
ATOM   6575  C  CB    . LEU C 2  378  ? 33.340  -19.298 59.195  1.00 34.37  ? 378  LEU C CB    1 
ATOM   6576  C  CG    . LEU C 2  378  ? 33.196  -20.175 60.435  1.00 29.49  ? 378  LEU C CG    1 
ATOM   6577  C  CD1   . LEU C 2  378  ? 31.952  -21.032 60.326  1.00 27.72  ? 378  LEU C CD1   1 
ATOM   6578  C  CD2   . LEU C 2  378  ? 34.437  -21.031 60.613  1.00 30.90  ? 378  LEU C CD2   1 
ATOM   6579  N  N     . GLU C 2  379  ? 33.422  -16.413 60.307  1.00 35.37  ? 379  GLU C N     1 
ATOM   6580  C  CA    . GLU C 2  379  ? 33.552  -15.411 61.358  1.00 37.21  ? 379  GLU C CA    1 
ATOM   6581  C  C     . GLU C 2  379  ? 32.348  -14.477 61.373  1.00 35.31  ? 379  GLU C C     1 
ATOM   6582  O  O     . GLU C 2  379  ? 31.744  -14.251 62.418  1.00 34.65  ? 379  GLU C O     1 
ATOM   6583  C  CB    . GLU C 2  379  ? 34.832  -14.592 61.173  1.00 42.79  ? 379  GLU C CB    1 
ATOM   6584  C  CG    . GLU C 2  379  ? 36.119  -15.356 61.436  1.00 47.47  ? 379  GLU C CG    1 
ATOM   6585  C  CD    . GLU C 2  379  ? 37.352  -14.475 61.317  1.00 55.58  ? 379  GLU C CD    1 
ATOM   6586  O  OE1   . GLU C 2  379  ? 37.847  -14.287 60.185  1.00 52.64  ? 379  GLU C OE1   1 
ATOM   6587  O  OE2   . GLU C 2  379  ? 37.824  -13.968 62.357  1.00 58.83  ? 379  GLU C OE2   1 
ATOM   6588  N  N     . ALA C 2  380  ? 32.002  -13.939 60.208  1.00 34.36  ? 380  ALA C N     1 
ATOM   6589  C  CA    . ALA C 2  380  ? 30.874  -13.022 60.102  1.00 33.47  ? 380  ALA C CA    1 
ATOM   6590  C  C     . ALA C 2  380  ? 29.565  -13.705 60.485  1.00 37.52  ? 380  ALA C C     1 
ATOM   6591  O  O     . ALA C 2  380  ? 28.647  -13.059 60.985  1.00 47.82  ? 380  ALA C O     1 
ATOM   6592  C  CB    . ALA C 2  380  ? 30.786  -12.446 58.706  1.00 31.96  ? 380  ALA C CB    1 
ATOM   6593  N  N     . ALA C 2  381  ? 29.499  -15.017 60.280  1.00 33.30  ? 381  ALA C N     1 
ATOM   6594  C  CA    . ALA C 2  381  ? 28.302  -15.787 60.599  1.00 30.79  ? 381  ALA C CA    1 
ATOM   6595  C  C     . ALA C 2  381  ? 28.153  -15.922 62.109  1.00 32.26  ? 381  ALA C C     1 
ATOM   6596  O  O     . ALA C 2  381  ? 27.150  -15.494 62.681  1.00 32.88  ? 381  ALA C O     1 
ATOM   6597  C  CB    . ALA C 2  381  ? 28.354  -17.155 59.946  1.00 26.81  ? 381  ALA C CB    1 
ATOM   6598  N  N     . ILE C 2  382  ? 29.137  -16.550 62.745  1.00 37.26  ? 382  ILE C N     1 
ATOM   6599  C  CA    . ILE C 2  382  ? 29.146  -16.681 64.201  1.00 31.82  ? 382  ILE C CA    1 
ATOM   6600  C  C     . ILE C 2  382  ? 28.965  -15.333 64.908  1.00 34.34  ? 382  ILE C C     1 
ATOM   6601  O  O     . ILE C 2  382  ? 28.146  -15.201 65.827  1.00 33.01  ? 382  ILE C O     1 
ATOM   6602  C  CB    . ILE C 2  382  ? 30.444  -17.340 64.682  1.00 24.09  ? 382  ILE C CB    1 
ATOM   6603  C  CG1   . ILE C 2  382  ? 30.525  -18.774 64.157  1.00 25.20  ? 382  ILE C CG1   1 
ATOM   6604  C  CG2   . ILE C 2  382  ? 30.529  -17.311 66.198  1.00 17.67  ? 382  ILE C CG2   1 
ATOM   6605  C  CD1   . ILE C 2  382  ? 31.856  -19.442 64.413  1.00 37.88  ? 382  ILE C CD1   1 
ATOM   6606  N  N     . ARG C 2  383  ? 29.719  -14.331 64.466  1.00 34.29  ? 383  ARG C N     1 
ATOM   6607  C  CA    . ARG C 2  383  ? 29.628  -13.004 65.061  1.00 34.82  ? 383  ARG C CA    1 
ATOM   6608  C  C     . ARG C 2  383  ? 28.224  -12.430 64.891  1.00 38.18  ? 383  ARG C C     1 
ATOM   6609  O  O     . ARG C 2  383  ? 27.665  -11.872 65.835  1.00 36.89  ? 383  ARG C O     1 
ATOM   6610  C  CB    . ARG C 2  383  ? 30.684  -12.056 64.484  1.00 38.86  ? 383  ARG C CB    1 
ATOM   6611  C  CG    . ARG C 2  383  ? 30.722  -10.693 65.179  1.00 48.57  ? 383  ARG C CG    1 
ATOM   6612  C  CD    . ARG C 2  383  ? 31.921  -9.848  64.762  1.00 49.33  ? 383  ARG C CD    1 
ATOM   6613  N  NE    . ARG C 2  383  ? 32.021  -9.714  63.312  1.00 65.41  ? 383  ARG C NE    1 
ATOM   6614  C  CZ    . ARG C 2  383  ? 32.958  -10.296 62.570  1.00 54.62  ? 383  ARG C CZ    1 
ATOM   6615  N  NH1   . ARG C 2  383  ? 33.893  -11.044 63.144  1.00 46.33  ? 383  ARG C NH1   1 
ATOM   6616  N  NH2   . ARG C 2  383  ? 32.963  -10.122 61.255  1.00 47.67  ? 383  ARG C NH2   1 
ATOM   6617  N  N     . GLU C 2  384  ? 27.657  -12.579 63.694  1.00 36.52  ? 384  GLU C N     1 
ATOM   6618  C  CA    . GLU C 2  384  ? 26.264  -12.203 63.455  1.00 35.41  ? 384  GLU C CA    1 
ATOM   6619  C  C     . GLU C 2  384  ? 25.343  -12.870 64.481  1.00 33.73  ? 384  GLU C C     1 
ATOM   6620  O  O     . GLU C 2  384  ? 24.468  -12.217 65.051  1.00 35.59  ? 384  GLU C O     1 
ATOM   6621  C  CB    . GLU C 2  384  ? 25.835  -12.558 62.021  1.00 38.98  ? 384  GLU C CB    1 
ATOM   6622  C  CG    . GLU C 2  384  ? 24.512  -13.336 61.911  1.00 59.85  ? 384  GLU C CG    1 
ATOM   6623  C  CD    . GLU C 2  384  ? 24.616  -14.602 61.047  1.00 64.36  ? 384  GLU C CD    1 
ATOM   6624  O  OE1   . GLU C 2  384  ? 24.905  -14.482 59.831  1.00 54.79  ? 384  GLU C OE1   1 
ATOM   6625  O  OE2   . GLU C 2  384  ? 24.400  -15.715 61.588  1.00 44.50  ? 384  GLU C OE2   1 
ATOM   6626  N  N     . PHE C 2  385  ? 25.557  -14.158 64.738  1.00 32.69  ? 385  PHE C N     1 
ATOM   6627  C  CA    . PHE C 2  385  ? 24.700  -14.871 65.674  1.00 26.96  ? 385  PHE C CA    1 
ATOM   6628  C  C     . PHE C 2  385  ? 24.812  -14.300 67.071  1.00 22.91  ? 385  PHE C C     1 
ATOM   6629  O  O     . PHE C 2  385  ? 23.806  -14.036 67.713  1.00 22.75  ? 385  PHE C O     1 
ATOM   6630  C  CB    . PHE C 2  385  ? 25.017  -16.365 65.715  1.00 25.72  ? 385  PHE C CB    1 
ATOM   6631  C  CG    . PHE C 2  385  ? 24.235  -17.112 66.759  1.00 18.69  ? 385  PHE C CG    1 
ATOM   6632  C  CD1   . PHE C 2  385  ? 22.896  -17.406 66.559  1.00 18.24  ? 385  PHE C CD1   1 
ATOM   6633  C  CD2   . PHE C 2  385  ? 24.831  -17.511 67.946  1.00 21.31  ? 385  PHE C CD2   1 
ATOM   6634  C  CE1   . PHE C 2  385  ? 22.167  -18.084 67.517  1.00 18.46  ? 385  PHE C CE1   1 
ATOM   6635  C  CE2   . PHE C 2  385  ? 24.103  -18.189 68.907  1.00 22.04  ? 385  PHE C CE2   1 
ATOM   6636  C  CZ    . PHE C 2  385  ? 22.770  -18.475 68.690  1.00 18.04  ? 385  PHE C CZ    1 
ATOM   6637  N  N     . PHE C 2  386  ? 26.031  -14.115 67.556  1.00 21.94  ? 386  PHE C N     1 
ATOM   6638  C  CA    . PHE C 2  386  ? 26.178  -13.677 68.939  1.00 24.44  ? 386  PHE C CA    1 
ATOM   6639  C  C     . PHE C 2  386  ? 25.814  -12.209 69.185  1.00 30.83  ? 386  PHE C C     1 
ATOM   6640  O  O     . PHE C 2  386  ? 25.266  -11.878 70.236  1.00 29.58  ? 386  PHE C O     1 
ATOM   6641  C  CB    . PHE C 2  386  ? 27.567  -14.006 69.479  1.00 23.78  ? 386  PHE C CB    1 
ATOM   6642  C  CG    . PHE C 2  386  ? 27.716  -15.434 69.908  1.00 24.33  ? 386  PHE C CG    1 
ATOM   6643  C  CD1   . PHE C 2  386  ? 28.276  -16.373 69.059  1.00 25.20  ? 386  PHE C CD1   1 
ATOM   6644  C  CD2   . PHE C 2  386  ? 27.279  -15.843 71.156  1.00 27.24  ? 386  PHE C CD2   1 
ATOM   6645  C  CE1   . PHE C 2  386  ? 28.410  -17.689 69.452  1.00 22.18  ? 386  PHE C CE1   1 
ATOM   6646  C  CE2   . PHE C 2  386  ? 27.410  -17.160 71.554  1.00 26.93  ? 386  PHE C CE2   1 
ATOM   6647  C  CZ    . PHE C 2  386  ? 27.976  -18.082 70.698  1.00 26.84  ? 386  PHE C CZ    1 
ATOM   6648  N  N     . SER C 2  387  ? 26.143  -11.333 68.238  1.00 34.25  ? 387  SER C N     1 
ATOM   6649  C  CA    . SER C 2  387  ? 25.780  -9.922  68.359  1.00 25.65  ? 387  SER C CA    1 
ATOM   6650  C  C     . SER C 2  387  ? 24.329  -9.582  68.010  1.00 30.96  ? 387  SER C C     1 
ATOM   6651  O  O     . SER C 2  387  ? 23.626  -8.955  68.803  1.00 36.18  ? 387  SER C O     1 
ATOM   6652  C  CB    . SER C 2  387  ? 26.726  -9.063  67.519  1.00 28.27  ? 387  SER C CB    1 
ATOM   6653  O  OG    . SER C 2  387  ? 28.042  -9.114  68.037  1.00 37.94  ? 387  SER C OG    1 
ATOM   6654  N  N     . ARG C 2  388  ? 23.890  -9.977  66.818  1.00 25.78  ? 388  ARG C N     1 
ATOM   6655  C  CA    . ARG C 2  388  ? 22.591  -9.531  66.308  1.00 24.83  ? 388  ARG C CA    1 
ATOM   6656  C  C     . ARG C 2  388  ? 21.387  -10.481 66.376  1.00 23.48  ? 388  ARG C C     1 
ATOM   6657  O  O     . ARG C 2  388  ? 20.286  -10.094 65.991  1.00 31.70  ? 388  ARG C O     1 
ATOM   6658  C  CB    . ARG C 2  388  ? 22.740  -8.959  64.895  1.00 37.55  ? 388  ARG C CB    1 
ATOM   6659  C  CG    . ARG C 2  388  ? 22.871  -7.440  64.868  1.00 43.71  ? 388  ARG C CG    1 
ATOM   6660  C  CD    . ARG C 2  388  ? 23.574  -6.949  63.608  1.00 52.40  ? 388  ARG C CD    1 
ATOM   6661  N  NE    . ARG C 2  388  ? 24.965  -7.391  63.548  1.00 55.80  ? 388  ARG C NE    1 
ATOM   6662  C  CZ    . ARG C 2  388  ? 25.950  -6.875  64.281  1.00 63.19  ? 388  ARG C CZ    1 
ATOM   6663  N  NH1   . ARG C 2  388  ? 25.701  -5.897  65.146  1.00 57.40  ? 388  ARG C NH1   1 
ATOM   6664  N  NH2   . ARG C 2  388  ? 27.187  -7.343  64.155  1.00 63.55  ? 388  ARG C NH2   1 
ATOM   6665  N  N     . SER C 2  389  ? 21.568  -11.709 66.849  1.00 25.23  ? 389  SER C N     1 
ATOM   6666  C  CA    . SER C 2  389  ? 20.443  -12.645 66.878  1.00 25.97  ? 389  SER C CA    1 
ATOM   6667  C  C     . SER C 2  389  ? 19.473  -12.297 68.000  1.00 22.02  ? 389  SER C C     1 
ATOM   6668  O  O     . SER C 2  389  ? 19.886  -11.913 69.093  1.00 23.56  ? 389  SER C O     1 
ATOM   6669  C  CB    . SER C 2  389  ? 20.917  -14.097 67.000  1.00 24.44  ? 389  SER C CB    1 
ATOM   6670  O  OG    . SER C 2  389  ? 19.827  -15.004 67.040  1.00 22.80  ? 389  SER C OG    1 
ATOM   6671  N  N     . GLN C 2  390  ? 18.182  -12.435 67.719  1.00 19.60  ? 390  GLN C N     1 
ATOM   6672  C  CA    . GLN C 2  390  ? 17.145  -12.117 68.692  1.00 24.52  ? 390  GLN C CA    1 
ATOM   6673  C  C     . GLN C 2  390  ? 17.193  -13.057 69.891  1.00 29.78  ? 390  GLN C C     1 
ATOM   6674  O  O     . GLN C 2  390  ? 16.609  -12.776 70.940  1.00 25.12  ? 390  GLN C O     1 
ATOM   6675  C  CB    . GLN C 2  390  ? 15.768  -12.183 68.037  1.00 30.35  ? 390  GLN C CB    1 
ATOM   6676  C  CG    . GLN C 2  390  ? 15.546  -11.127 66.976  1.00 39.76  ? 390  GLN C CG    1 
ATOM   6677  C  CD    . GLN C 2  390  ? 14.173  -11.218 66.353  1.00 42.03  ? 390  GLN C CD    1 
ATOM   6678  O  OE1   . GLN C 2  390  ? 13.554  -12.283 66.339  1.00 40.18  ? 390  GLN C OE1   1 
ATOM   6679  N  NE2   . GLN C 2  390  ? 13.682  -10.096 65.839  1.00 43.54  ? 390  GLN C NE2   1 
ATOM   6680  N  N     . LEU C 2  391  ? 17.884  -14.179 69.725  1.00 30.99  ? 391  LEU C N     1 
ATOM   6681  C  CA    . LEU C 2  391  ? 18.015  -15.157 70.793  1.00 21.89  ? 391  LEU C CA    1 
ATOM   6682  C  C     . LEU C 2  391  ? 19.252  -14.898 71.650  1.00 23.65  ? 391  LEU C C     1 
ATOM   6683  O  O     . LEU C 2  391  ? 19.415  -15.500 72.712  1.00 28.20  ? 391  LEU C O     1 
ATOM   6684  C  CB    . LEU C 2  391  ? 18.033  -16.570 70.213  1.00 14.30  ? 391  LEU C CB    1 
ATOM   6685  C  CG    . LEU C 2  391  ? 16.700  -16.974 69.589  1.00 16.12  ? 391  LEU C CG    1 
ATOM   6686  C  CD1   . LEU C 2  391  ? 16.864  -18.167 68.678  1.00 27.66  ? 391  LEU C CD1   1 
ATOM   6687  C  CD2   . LEU C 2  391  ? 15.699  -17.285 70.677  1.00 21.50  ? 391  LEU C CD2   1 
ATOM   6688  N  N     . SER C 2  392  ? 20.117  -13.996 71.197  1.00 17.66  ? 392  SER C N     1 
ATOM   6689  C  CA    . SER C 2  392  ? 21.248  -13.573 72.009  1.00 17.00  ? 392  SER C CA    1 
ATOM   6690  C  C     . SER C 2  392  ? 20.833  -12.311 72.740  1.00 22.60  ? 392  SER C C     1 
ATOM   6691  O  O     . SER C 2  392  ? 20.684  -11.254 72.127  1.00 27.18  ? 392  SER C O     1 
ATOM   6692  C  CB    . SER C 2  392  ? 22.470  -13.300 71.132  1.00 18.43  ? 392  SER C CB    1 
ATOM   6693  O  OG    . SER C 2  392  ? 23.578  -12.876 71.908  1.00 17.50  ? 392  SER C OG    1 
ATOM   6694  N  N     . GLN C 2  393  ? 20.659  -12.411 74.053  1.00 22.56  ? 393  GLN C N     1 
ATOM   6695  C  CA    . GLN C 2  393  ? 20.063  -11.310 74.803  1.00 23.11  ? 393  GLN C CA    1 
ATOM   6696  C  C     . GLN C 2  393  ? 20.976  -10.717 75.866  1.00 23.91  ? 393  GLN C C     1 
ATOM   6697  O  O     . GLN C 2  393  ? 21.697  -11.435 76.545  1.00 22.05  ? 393  GLN C O     1 
ATOM   6698  C  CB    . GLN C 2  393  ? 18.741  -11.753 75.430  1.00 20.65  ? 393  GLN C CB    1 
ATOM   6699  C  CG    . GLN C 2  393  ? 17.679  -12.094 74.405  1.00 19.33  ? 393  GLN C CG    1 
ATOM   6700  C  CD    . GLN C 2  393  ? 16.418  -12.646 75.029  1.00 23.60  ? 393  GLN C CD    1 
ATOM   6701  O  OE1   . GLN C 2  393  ? 16.248  -12.633 76.252  1.00 22.87  ? 393  GLN C OE1   1 
ATOM   6702  N  NE2   . GLN C 2  393  ? 15.520  -13.141 74.188  1.00 25.09  ? 393  GLN C NE2   1 
ATOM   6703  N  N     . PHE C 2  394  ? 20.930  -9.394  75.997  1.00 30.60  ? 394  PHE C N     1 
ATOM   6704  C  CA    . PHE C 2  394  ? 21.651  -8.684  77.042  1.00 24.11  ? 394  PHE C CA    1 
ATOM   6705  C  C     . PHE C 2  394  ? 21.237  -9.292  78.377  1.00 21.43  ? 394  PHE C C     1 
ATOM   6706  O  O     . PHE C 2  394  ? 20.051  -9.403  78.670  1.00 26.11  ? 394  PHE C O     1 
ATOM   6707  C  CB    . PHE C 2  394  ? 21.296  -7.196  76.982  1.00 21.68  ? 394  PHE C CB    1 
ATOM   6708  C  CG    . PHE C 2  394  ? 22.282  -6.305  77.674  1.00 25.05  ? 394  PHE C CG    1 
ATOM   6709  C  CD1   . PHE C 2  394  ? 23.617  -6.314  77.313  1.00 26.87  ? 394  PHE C CD1   1 
ATOM   6710  C  CD2   . PHE C 2  394  ? 21.871  -5.439  78.672  1.00 29.78  ? 394  PHE C CD2   1 
ATOM   6711  C  CE1   . PHE C 2  394  ? 24.529  -5.487  77.950  1.00 25.12  ? 394  PHE C CE1   1 
ATOM   6712  C  CE2   . PHE C 2  394  ? 22.776  -4.608  79.308  1.00 27.21  ? 394  PHE C CE2   1 
ATOM   6713  C  CZ    . PHE C 2  394  ? 24.107  -4.635  78.947  1.00 24.27  ? 394  PHE C CZ    1 
ATOM   6714  N  N     . LYS C 2  395  ? 22.218  -9.713  79.167  1.00 22.45  ? 395  LYS C N     1 
ATOM   6715  C  CA    . LYS C 2  395  ? 21.957  -10.494 80.373  1.00 25.35  ? 395  LYS C CA    1 
ATOM   6716  C  C     . LYS C 2  395  ? 21.104  -9.713  81.356  1.00 28.51  ? 395  LYS C C     1 
ATOM   6717  O  O     . LYS C 2  395  ? 21.240  -8.494  81.465  1.00 28.90  ? 395  LYS C O     1 
ATOM   6718  C  CB    . LYS C 2  395  ? 23.282  -10.891 81.031  1.00 32.54  ? 395  LYS C CB    1 
ATOM   6719  C  CG    . LYS C 2  395  ? 23.179  -11.944 82.132  1.00 33.65  ? 395  LYS C CG    1 
ATOM   6720  C  CD    . LYS C 2  395  ? 24.566  -12.281 82.676  1.00 32.98  ? 395  LYS C CD    1 
ATOM   6721  C  CE    . LYS C 2  395  ? 24.533  -13.422 83.678  1.00 35.66  ? 395  LYS C CE    1 
ATOM   6722  N  NZ    . LYS C 2  395  ? 25.892  -13.680 84.237  1.00 44.93  ? 395  LYS C NZ    1 
ATOM   6723  N  N     . ASP C 2  396  ? 20.224  -10.405 82.074  1.00 28.27  ? 396  ASP C N     1 
ATOM   6724  C  CA    . ASP C 2  396  ? 19.463  -9.736  83.113  1.00 26.12  ? 396  ASP C CA    1 
ATOM   6725  C  C     . ASP C 2  396  ? 20.238  -9.923  84.407  1.00 28.24  ? 396  ASP C C     1 
ATOM   6726  O  O     . ASP C 2  396  ? 20.230  -10.999 85.005  1.00 30.28  ? 396  ASP C O     1 
ATOM   6727  C  CB    . ASP C 2  396  ? 18.079  -10.369 83.228  1.00 23.57  ? 396  ASP C CB    1 
ATOM   6728  C  CG    . ASP C 2  396  ? 17.132  -9.556  84.086  1.00 29.45  ? 396  ASP C CG    1 
ATOM   6729  O  OD1   . ASP C 2  396  ? 17.595  -8.621  84.770  1.00 30.49  ? 396  ASP C OD1   1 
ATOM   6730  O  OD2   . ASP C 2  396  ? 15.921  -9.860  84.079  1.00 35.17  ? 396  ASP C OD2   1 
ATOM   6731  N  N     . GLU C 2  397  ? 20.896  -8.853  84.836  1.00 28.11  ? 397  GLU C N     1 
ATOM   6732  C  CA    . GLU C 2  397  ? 21.786  -8.896  85.990  1.00 29.00  ? 397  GLU C CA    1 
ATOM   6733  C  C     . GLU C 2  397  ? 21.230  -8.333  87.300  1.00 31.59  ? 397  GLU C C     1 
ATOM   6734  O  O     . GLU C 2  397  ? 21.969  -8.247  88.282  1.00 40.01  ? 397  GLU C O     1 
ATOM   6735  C  CB    . GLU C 2  397  ? 23.140  -8.266  85.658  1.00 30.68  ? 397  GLU C CB    1 
ATOM   6736  C  CG    . GLU C 2  397  ? 24.120  -9.237  85.013  1.00 34.27  ? 397  GLU C CG    1 
ATOM   6737  C  CD    . GLU C 2  397  ? 25.498  -8.629  84.797  1.00 41.94  ? 397  GLU C CD    1 
ATOM   6738  O  OE1   . GLU C 2  397  ? 26.492  -9.389  84.799  1.00 41.27  ? 397  GLU C OE1   1 
ATOM   6739  O  OE2   . GLU C 2  397  ? 25.587  -7.396  84.618  1.00 36.89  ? 397  GLU C OE2   1 
ATOM   6740  N  N     . THR C 2  398  ? 19.958  -7.934  87.308  1.00 24.49  ? 398  THR C N     1 
ATOM   6741  C  CA    . THR C 2  398  ? 19.391  -7.177  88.424  1.00 21.25  ? 398  THR C CA    1 
ATOM   6742  C  C     . THR C 2  398  ? 19.742  -7.839  89.750  1.00 22.90  ? 398  THR C C     1 
ATOM   6743  O  O     . THR C 2  398  ? 20.374  -7.223  90.606  1.00 22.80  ? 398  THR C O     1 
ATOM   6744  C  CB    . THR C 2  398  ? 17.858  -7.072  88.310  1.00 27.64  ? 398  THR C CB    1 
ATOM   6745  O  OG1   . THR C 2  398  ? 17.478  -6.996  86.929  1.00 35.36  ? 398  THR C OG1   1 
ATOM   6746  C  CG2   . THR C 2  398  ? 17.344  -5.843  89.048  1.00 26.07  ? 398  THR C CG2   1 
ATOM   6747  N  N     . ASN C 2  399  ? 19.377  -9.110  89.889  1.00 23.48  ? 399  ASN C N     1 
ATOM   6748  C  CA    . ASN C 2  399  ? 19.846  -9.926  91.004  1.00 22.27  ? 399  ASN C CA    1 
ATOM   6749  C  C     . ASN C 2  399  ? 20.341  -11.266 90.453  1.00 22.85  ? 399  ASN C C     1 
ATOM   6750  O  O     . ASN C 2  399  ? 20.239  -11.496 89.250  1.00 26.86  ? 399  ASN C O     1 
ATOM   6751  C  CB    . ASN C 2  399  ? 18.737  -10.096 92.051  1.00 17.67  ? 399  ASN C CB    1 
ATOM   6752  C  CG    . ASN C 2  399  ? 17.485  -10.735 91.487  1.00 22.51  ? 399  ASN C CG    1 
ATOM   6753  O  OD1   . ASN C 2  399  ? 17.550  -11.656 90.673  1.00 24.56  ? 399  ASN C OD1   1 
ATOM   6754  N  ND2   . ASN C 2  399  ? 16.330  -10.245 91.920  1.00 21.99  ? 399  ASN C ND2   1 
ATOM   6755  N  N     . PRO C 2  400  ? 20.887  -12.149 91.309  1.00 19.97  ? 400  PRO C N     1 
ATOM   6756  C  CA    . PRO C 2  400  ? 21.301  -13.453 90.773  1.00 21.92  ? 400  PRO C CA    1 
ATOM   6757  C  C     . PRO C 2  400  ? 20.146  -14.281 90.207  1.00 22.52  ? 400  PRO C C     1 
ATOM   6758  O  O     . PRO C 2  400  ? 20.319  -14.981 89.197  1.00 29.44  ? 400  PRO C O     1 
ATOM   6759  C  CB    . PRO C 2  400  ? 21.905  -14.145 91.991  1.00 21.72  ? 400  PRO C CB    1 
ATOM   6760  C  CG    . PRO C 2  400  ? 22.451  -13.026 92.801  1.00 23.70  ? 400  PRO C CG    1 
ATOM   6761  C  CD    . PRO C 2  400  ? 21.483  -11.894 92.634  1.00 20.91  ? 400  PRO C CD    1 
ATOM   6762  N  N     . LEU C 2  401  ? 18.985  -14.196 90.847  1.00 15.32  ? 401  LEU C N     1 
ATOM   6763  C  CA    . LEU C 2  401  ? 17.802  -14.907 90.376  1.00 18.99  ? 401  LEU C CA    1 
ATOM   6764  C  C     . LEU C 2  401  ? 17.420  -14.483 88.958  1.00 25.27  ? 401  LEU C C     1 
ATOM   6765  O  O     . LEU C 2  401  ? 16.883  -15.279 88.189  1.00 25.12  ? 401  LEU C O     1 
ATOM   6766  C  CB    . LEU C 2  401  ? 16.627  -14.684 91.331  1.00 19.31  ? 401  LEU C CB    1 
ATOM   6767  C  CG    . LEU C 2  401  ? 15.268  -15.251 90.915  1.00 16.43  ? 401  LEU C CG    1 
ATOM   6768  C  CD1   . LEU C 2  401  ? 15.346  -16.749 90.687  1.00 18.16  ? 401  LEU C CD1   1 
ATOM   6769  C  CD2   . LEU C 2  401  ? 14.225  -14.926 91.965  1.00 23.24  ? 401  LEU C CD2   1 
ATOM   6770  N  N     . SER C 2  402  ? 17.710  -13.229 88.616  1.00 26.18  ? 402  SER C N     1 
ATOM   6771  C  CA    . SER C 2  402  ? 17.430  -12.702 87.283  1.00 22.61  ? 402  SER C CA    1 
ATOM   6772  C  C     . SER C 2  402  ? 18.223  -13.451 86.222  1.00 24.14  ? 402  SER C C     1 
ATOM   6773  O  O     . SER C 2  402  ? 17.668  -13.896 85.218  1.00 23.98  ? 402  SER C O     1 
ATOM   6774  C  CB    . SER C 2  402  ? 17.773  -11.215 87.215  1.00 23.38  ? 402  SER C CB    1 
ATOM   6775  O  OG    . SER C 2  402  ? 17.218  -10.515 88.311  1.00 27.36  ? 402  SER C OG    1 
ATOM   6776  N  N     . SER C 2  403  ? 19.527  -13.573 86.452  1.00 25.00  ? 403  SER C N     1 
ATOM   6777  C  CA    . SER C 2  403  ? 20.408  -14.299 85.549  1.00 24.65  ? 403  SER C CA    1 
ATOM   6778  C  C     . SER C 2  403  ? 19.969  -15.751 85.457  1.00 28.24  ? 403  SER C C     1 
ATOM   6779  O  O     . SER C 2  403  ? 19.774  -16.285 84.357  1.00 28.34  ? 403  SER C O     1 
ATOM   6780  C  CB    . SER C 2  403  ? 21.850  -14.233 86.047  1.00 24.00  ? 403  SER C CB    1 
ATOM   6781  O  OG    . SER C 2  403  ? 22.230  -12.899 86.322  1.00 29.50  ? 403  SER C OG    1 
ATOM   6782  N  N     . LEU C 2  404  ? 19.809  -16.382 86.619  1.00 28.18  ? 404  LEU C N     1 
ATOM   6783  C  CA    . LEU C 2  404  ? 19.424  -17.790 86.666  1.00 24.67  ? 404  LEU C CA    1 
ATOM   6784  C  C     . LEU C 2  404  ? 18.143  -18.053 85.881  1.00 22.70  ? 404  LEU C C     1 
ATOM   6785  O  O     . LEU C 2  404  ? 18.059  -19.027 85.135  1.00 28.53  ? 404  LEU C O     1 
ATOM   6786  C  CB    . LEU C 2  404  ? 19.259  -18.268 88.109  1.00 26.95  ? 404  LEU C CB    1 
ATOM   6787  C  CG    . LEU C 2  404  ? 18.774  -19.714 88.242  1.00 27.69  ? 404  LEU C CG    1 
ATOM   6788  C  CD1   . LEU C 2  404  ? 19.831  -20.689 87.741  1.00 27.44  ? 404  LEU C CD1   1 
ATOM   6789  C  CD2   . LEU C 2  404  ? 18.374  -20.031 89.671  1.00 27.64  ? 404  LEU C CD2   1 
ATOM   6790  N  N     . ARG C 2  405  ? 17.159  -17.175 86.041  1.00 19.02  ? 405  ARG C N     1 
ATOM   6791  C  CA    . ARG C 2  405  ? 15.884  -17.311 85.348  1.00 21.26  ? 405  ARG C CA    1 
ATOM   6792  C  C     . ARG C 2  405  ? 16.039  -17.048 83.855  1.00 21.69  ? 405  ARG C C     1 
ATOM   6793  O  O     . ARG C 2  405  ? 15.382  -17.687 83.026  1.00 19.93  ? 405  ARG C O     1 
ATOM   6794  C  CB    . ARG C 2  405  ? 14.852  -16.351 85.939  1.00 24.50  ? 405  ARG C CB    1 
ATOM   6795  C  CG    . ARG C 2  405  ? 13.610  -16.169 85.079  1.00 30.08  ? 405  ARG C CG    1 
ATOM   6796  C  CD    . ARG C 2  405  ? 12.753  -15.026 85.585  1.00 24.91  ? 405  ARG C CD    1 
ATOM   6797  N  NE    . ARG C 2  405  ? 11.973  -14.416 84.516  1.00 24.03  ? 405  ARG C NE    1 
ATOM   6798  C  CZ    . ARG C 2  405  ? 11.036  -13.497 84.713  1.00 24.29  ? 405  ARG C CZ    1 
ATOM   6799  N  NH1   . ARG C 2  405  ? 10.760  -13.091 85.941  1.00 21.66  ? 405  ARG C NH1   1 
ATOM   6800  N  NH2   . ARG C 2  405  ? 10.372  -12.987 83.684  1.00 29.12  ? 405  ARG C NH2   1 
ATOM   6801  N  N     . HIS C 2  406  ? 16.914  -16.103 83.524  1.00 20.46  ? 406  HIS C N     1 
ATOM   6802  C  CA    . HIS C 2  406  ? 17.167  -15.734 82.139  1.00 20.18  ? 406  HIS C CA    1 
ATOM   6803  C  C     . HIS C 2  406  ? 17.715  -16.936 81.388  1.00 18.70  ? 406  HIS C C     1 
ATOM   6804  O  O     . HIS C 2  406  ? 17.316  -17.198 80.256  1.00 16.17  ? 406  HIS C O     1 
ATOM   6805  C  CB    . HIS C 2  406  ? 18.148  -14.561 82.070  1.00 21.81  ? 406  HIS C CB    1 
ATOM   6806  C  CG    . HIS C 2  406  ? 18.177  -13.864 80.743  1.00 22.29  ? 406  HIS C CG    1 
ATOM   6807  N  ND1   . HIS C 2  406  ? 18.961  -12.755 80.503  1.00 24.42  ? 406  HIS C ND1   1 
ATOM   6808  C  CD2   . HIS C 2  406  ? 17.518  -14.114 79.587  1.00 22.69  ? 406  HIS C CD2   1 
ATOM   6809  C  CE1   . HIS C 2  406  ? 18.785  -12.353 79.257  1.00 21.36  ? 406  HIS C CE1   1 
ATOM   6810  N  NE2   . HIS C 2  406  ? 17.913  -13.160 78.679  1.00 22.01  ? 406  HIS C NE2   1 
ATOM   6811  N  N     . LYS C 2  407  ? 18.613  -17.674 82.039  1.00 21.27  ? 407  LYS C N     1 
ATOM   6812  C  CA    . LYS C 2  407  ? 19.219  -18.871 81.451  1.00 19.16  ? 407  LYS C CA    1 
ATOM   6813  C  C     . LYS C 2  407  ? 18.213  -20.002 81.260  1.00 17.30  ? 407  LYS C C     1 
ATOM   6814  O  O     . LYS C 2  407  ? 18.381  -20.858 80.390  1.00 18.00  ? 407  LYS C O     1 
ATOM   6815  C  CB    . LYS C 2  407  ? 20.387  -19.352 82.313  1.00 19.61  ? 407  LYS C CB    1 
ATOM   6816  C  CG    . LYS C 2  407  ? 21.555  -18.388 82.337  1.00 23.10  ? 407  LYS C CG    1 
ATOM   6817  C  CD    . LYS C 2  407  ? 22.357  -18.493 83.619  1.00 23.67  ? 407  LYS C CD    1 
ATOM   6818  C  CE    . LYS C 2  407  ? 23.293  -17.301 83.755  1.00 30.14  ? 407  LYS C CE    1 
ATOM   6819  N  NZ    . LYS C 2  407  ? 23.980  -17.247 85.077  1.00 35.98  ? 407  LYS C NZ    1 
ATOM   6820  N  N     . ARG C 2  408  ? 17.170  -19.998 82.080  1.00 15.32  ? 408  ARG C N     1 
ATOM   6821  C  CA    . ARG C 2  408  ? 16.140  -21.032 82.042  1.00 18.26  ? 408  ARG C CA    1 
ATOM   6822  C  C     . ARG C 2  408  ? 14.931  -20.658 81.182  1.00 19.06  ? 408  ARG C C     1 
ATOM   6823  O  O     . ARG C 2  408  ? 13.916  -21.352 81.200  1.00 20.56  ? 408  ARG C O     1 
ATOM   6824  C  CB    . ARG C 2  408  ? 15.696  -21.401 83.457  1.00 21.09  ? 408  ARG C CB    1 
ATOM   6825  C  CG    . ARG C 2  408  ? 16.819  -21.939 84.328  1.00 21.84  ? 408  ARG C CG    1 
ATOM   6826  C  CD    . ARG C 2  408  ? 16.326  -22.245 85.732  1.00 29.28  ? 408  ARG C CD    1 
ATOM   6827  N  NE    . ARG C 2  408  ? 15.236  -23.217 85.718  1.00 38.34  ? 408  ARG C NE    1 
ATOM   6828  C  CZ    . ARG C 2  408  ? 15.410  -24.533 85.772  1.00 36.96  ? 408  ARG C CZ    1 
ATOM   6829  N  NH1   . ARG C 2  408  ? 14.360  -25.342 85.749  1.00 32.44  ? 408  ARG C NH1   1 
ATOM   6830  N  NH2   . ARG C 2  408  ? 16.633  -25.041 85.850  1.00 36.02  ? 408  ARG C NH2   1 
ATOM   6831  N  N     . ARG C 2  409  ? 15.026  -19.544 80.465  1.00 16.20  ? 409  ARG C N     1 
ATOM   6832  C  CA    . ARG C 2  409  ? 13.916  -19.061 79.643  1.00 20.96  ? 409  ARG C CA    1 
ATOM   6833  C  C     . ARG C 2  409  ? 13.681  -19.883 78.369  1.00 17.24  ? 409  ARG C C     1 
ATOM   6834  O  O     . ARG C 2  409  ? 14.628  -20.311 77.715  1.00 19.48  ? 409  ARG C O     1 
ATOM   6835  C  CB    . ARG C 2  409  ? 14.140  -17.592 79.275  1.00 25.36  ? 409  ARG C CB    1 
ATOM   6836  C  CG    . ARG C 2  409  ? 12.963  -16.939 78.566  1.00 21.61  ? 409  ARG C CG    1 
ATOM   6837  C  CD    . ARG C 2  409  ? 13.142  -15.431 78.444  1.00 19.60  ? 409  ARG C CD    1 
ATOM   6838  N  NE    . ARG C 2  409  ? 13.720  -14.824 79.643  1.00 21.54  ? 409  ARG C NE    1 
ATOM   6839  C  CZ    . ARG C 2  409  ? 13.131  -14.785 80.837  1.00 27.43  ? 409  ARG C CZ    1 
ATOM   6840  N  NH1   . ARG C 2  409  ? 13.751  -14.202 81.856  1.00 29.27  ? 409  ARG C NH1   1 
ATOM   6841  N  NH2   . ARG C 2  409  ? 11.934  -15.333 81.024  1.00 25.08  ? 409  ARG C NH2   1 
ATOM   6842  N  N     . ILE C 2  410  ? 12.412  -20.092 78.026  1.00 14.51  ? 410  ILE C N     1 
ATOM   6843  C  CA    . ILE C 2  410  ? 12.033  -20.782 76.796  1.00 17.80  ? 410  ILE C CA    1 
ATOM   6844  C  C     . ILE C 2  410  ? 11.213  -19.855 75.907  1.00 22.10  ? 410  ILE C C     1 
ATOM   6845  O  O     . ILE C 2  410  ? 10.078  -19.507 76.240  1.00 22.80  ? 410  ILE C O     1 
ATOM   6846  C  CB    . ILE C 2  410  ? 11.182  -22.038 77.077  1.00 18.64  ? 410  ILE C CB    1 
ATOM   6847  C  CG1   . ILE C 2  410  ? 11.938  -23.029 77.960  1.00 19.96  ? 410  ILE C CG1   1 
ATOM   6848  C  CG2   . ILE C 2  410  ? 10.787  -22.713 75.779  1.00 18.25  ? 410  ILE C CG2   1 
ATOM   6849  C  CD1   . ILE C 2  410  ? 11.137  -24.271 78.287  1.00 17.24  ? 410  ILE C CD1   1 
ATOM   6850  N  N     . SER C 2  411  ? 11.782  -19.473 74.767  1.00 19.00  ? 411  SER C N     1 
ATOM   6851  C  CA    . SER C 2  411  ? 11.151  -18.502 73.881  1.00 16.38  ? 411  SER C CA    1 
ATOM   6852  C  C     . SER C 2  411  ? 10.628  -19.137 72.599  1.00 19.99  ? 411  SER C C     1 
ATOM   6853  O  O     . SER C 2  411  ? 11.318  -19.928 71.967  1.00 22.50  ? 411  SER C O     1 
ATOM   6854  C  CB    . SER C 2  411  ? 12.141  -17.392 73.536  1.00 18.21  ? 411  SER C CB    1 
ATOM   6855  O  OG    . SER C 2  411  ? 11.600  -16.510 72.568  1.00 25.31  ? 411  SER C OG    1 
ATOM   6856  N  N     . ALA C 2  412  ? 9.406   -18.780 72.215  1.00 23.97  ? 412  ALA C N     1 
ATOM   6857  C  CA    . ALA C 2  412  ? 8.819   -19.265 70.969  1.00 23.76  ? 412  ALA C CA    1 
ATOM   6858  C  C     . ALA C 2  412  ? 9.102   -18.297 69.826  1.00 26.71  ? 412  ALA C C     1 
ATOM   6859  O  O     . ALA C 2  412  ? 8.727   -18.541 68.680  1.00 26.28  ? 412  ALA C O     1 
ATOM   6860  C  CB    . ALA C 2  412  ? 7.324   -19.466 71.132  1.00 22.20  ? 412  ALA C CB    1 
ATOM   6861  N  N     . LEU C 2  413  ? 9.781   -17.204 70.150  1.00 29.36  ? 413  LEU C N     1 
ATOM   6862  C  CA    . LEU C 2  413  ? 10.074  -16.156 69.182  1.00 32.24  ? 413  LEU C CA    1 
ATOM   6863  C  C     . LEU C 2  413  ? 11.387  -16.422 68.452  1.00 34.21  ? 413  LEU C C     1 
ATOM   6864  O  O     . LEU C 2  413  ? 11.952  -17.510 68.550  1.00 35.44  ? 413  LEU C O     1 
ATOM   6865  C  CB    . LEU C 2  413  ? 10.134  -14.803 69.888  1.00 32.46  ? 413  LEU C CB    1 
ATOM   6866  C  CG    . LEU C 2  413  ? 8.919   -14.479 70.755  1.00 26.91  ? 413  LEU C CG    1 
ATOM   6867  C  CD1   . LEU C 2  413  ? 9.000   -13.055 71.271  1.00 37.92  ? 413  LEU C CD1   1 
ATOM   6868  C  CD2   . LEU C 2  413  ? 7.642   -14.696 69.970  1.00 25.48  ? 413  LEU C CD2   1 
ATOM   6869  N  N     . GLY C 2  414  ? 11.859  -15.429 67.705  1.00 37.14  ? 414  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2  414  ? 13.137  -15.527 67.024  1.00 38.29  ? 414  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2  414  ? 13.062  -16.128 65.632  1.00 39.20  ? 414  GLY C C     1 
ATOM   6872  O  O     . GLY C 2  414  ? 11.972  -16.356 65.105  1.00 38.81  ? 414  GLY C O     1 
ATOM   6873  N  N     . PRO C 2  415  ? 14.231  -16.382 65.025  1.00 38.33  ? 415  PRO C N     1 
ATOM   6874  C  CA    . PRO C 2  415  ? 14.338  -16.975 63.688  1.00 38.75  ? 415  PRO C CA    1 
ATOM   6875  C  C     . PRO C 2  415  ? 13.640  -18.326 63.612  1.00 38.61  ? 415  PRO C C     1 
ATOM   6876  O  O     . PRO C 2  415  ? 13.855  -19.178 64.473  1.00 45.04  ? 415  PRO C O     1 
ATOM   6877  C  CB    . PRO C 2  415  ? 15.847  -17.162 63.513  1.00 41.47  ? 415  PRO C CB    1 
ATOM   6878  C  CG    . PRO C 2  415  ? 16.460  -16.148 64.405  1.00 37.26  ? 415  PRO C CG    1 
ATOM   6879  C  CD    . PRO C 2  415  ? 15.551  -16.054 65.591  1.00 35.41  ? 415  PRO C CD    1 
ATOM   6880  N  N     . GLY C 2  416  ? 12.804  -18.514 62.597  1.00 38.05  ? 416  GLY C N     1 
ATOM   6881  C  CA    . GLY C 2  416  ? 12.081  -19.762 62.427  1.00 45.07  ? 416  GLY C CA    1 
ATOM   6882  C  C     . GLY C 2  416  ? 10.962  -19.926 63.437  1.00 43.08  ? 416  GLY C C     1 
ATOM   6883  O  O     . GLY C 2  416  ? 10.170  -20.865 63.360  1.00 43.37  ? 416  GLY C O     1 
ATOM   6884  N  N     . GLY C 2  417  ? 10.894  -19.004 64.389  1.00 39.04  ? 417  GLY C N     1 
ATOM   6885  C  CA    . GLY C 2  417  ? 9.898   -19.068 65.438  1.00 42.38  ? 417  GLY C CA    1 
ATOM   6886  C  C     . GLY C 2  417  ? 8.687   -18.227 65.109  1.00 43.97  ? 417  GLY C C     1 
ATOM   6887  O  O     . GLY C 2  417  ? 8.585   -17.667 64.018  1.00 47.17  ? 417  GLY C O     1 
ATOM   6888  N  N     . LEU C 2  418  ? 7.770   -18.129 66.063  1.00 50.04  ? 418  LEU C N     1 
ATOM   6889  C  CA    . LEU C 2  418  ? 6.534   -17.393 65.846  1.00 48.35  ? 418  LEU C CA    1 
ATOM   6890  C  C     . LEU C 2  418  ? 6.757   -15.894 65.805  1.00 51.60  ? 418  LEU C C     1 
ATOM   6891  O  O     . LEU C 2  418  ? 7.764   -15.374 66.295  1.00 43.38  ? 418  LEU C O     1 
ATOM   6892  C  CB    . LEU C 2  418  ? 5.491   -17.716 66.920  1.00 44.06  ? 418  LEU C CB    1 
ATOM   6893  C  CG    . LEU C 2  418  ? 4.733   -19.042 66.863  1.00 49.07  ? 418  LEU C CG    1 
ATOM   6894  C  CD1   . LEU C 2  418  ? 3.244   -18.808 67.069  1.00 57.72  ? 418  LEU C CD1   1 
ATOM   6895  C  CD2   . LEU C 2  418  ? 4.975   -19.743 65.543  1.00 61.81  ? 418  LEU C CD2   1 
ATOM   6896  N  N     . THR C 2  419  ? 5.798   -15.212 65.198  1.00 65.54  ? 419  THR C N     1 
ATOM   6897  C  CA    . THR C 2  419  ? 5.740   -13.768 65.237  1.00 65.71  ? 419  THR C CA    1 
ATOM   6898  C  C     . THR C 2  419  ? 4.464   -13.419 65.993  1.00 62.79  ? 419  THR C C     1 
ATOM   6899  O  O     . THR C 2  419  ? 3.404   -13.991 65.743  1.00 66.96  ? 419  THR C O     1 
ATOM   6900  C  CB    . THR C 2  419  ? 5.801   -13.164 63.805  1.00 62.19  ? 419  THR C CB    1 
ATOM   6901  O  OG1   . THR C 2  419  ? 6.987   -12.374 63.673  1.00 65.10  ? 419  THR C OG1   1 
ATOM   6902  C  CG2   . THR C 2  419  ? 4.593   -12.297 63.488  1.00 66.07  ? 419  THR C CG2   1 
ATOM   6903  N  N     . ARG C 2  420  ? 4.580   -12.536 66.974  1.00 54.77  ? 420  ARG C N     1 
ATOM   6904  C  CA    . ARG C 2  420  ? 3.403   -12.096 67.697  1.00 64.49  ? 420  ARG C CA    1 
ATOM   6905  C  C     . ARG C 2  420  ? 2.633   -11.196 66.753  1.00 74.49  ? 420  ARG C C     1 
ATOM   6906  O  O     . ARG C 2  420  ? 3.216   -10.666 65.806  1.00 84.21  ? 420  ARG C O     1 
ATOM   6907  C  CB    . ARG C 2  420  ? 3.791   -11.359 68.973  1.00 58.79  ? 420  ARG C CB    1 
ATOM   6908  C  CG    . ARG C 2  420  ? 4.774   -10.226 68.765  1.00 60.42  ? 420  ARG C CG    1 
ATOM   6909  C  CD    . ARG C 2  420  ? 5.573   -9.983  70.038  1.00 59.24  ? 420  ARG C CD    1 
ATOM   6910  N  NE    . ARG C 2  420  ? 6.318   -8.727  70.001  1.00 72.66  ? 420  ARG C NE    1 
ATOM   6911  C  CZ    . ARG C 2  420  ? 7.234   -8.369  70.896  1.00 61.60  ? 420  ARG C CZ    1 
ATOM   6912  N  NH1   . ARG C 2  420  ? 7.533   -9.176  71.904  1.00 55.27  ? 420  ARG C NH1   1 
ATOM   6913  N  NH2   . ARG C 2  420  ? 7.858   -7.203  70.780  1.00 70.19  ? 420  ARG C NH2   1 
ATOM   6914  N  N     . GLU C 2  421  ? 1.337   -11.037 67.029  1.00 73.88  ? 421  GLU C N     1 
ATOM   6915  C  CA    . GLU C 2  421  ? 0.344   -10.450 66.120  1.00 84.92  ? 421  GLU C CA    1 
ATOM   6916  C  C     . GLU C 2  421  ? -0.046  -11.504 65.084  1.00 84.32  ? 421  GLU C C     1 
ATOM   6917  O  O     . GLU C 2  421  ? -1.107  -11.422 64.465  1.00 92.87  ? 421  GLU C O     1 
ATOM   6918  C  CB    . GLU C 2  421  ? 0.870   -9.151  65.476  1.00 93.76  ? 421  GLU C CB    1 
ATOM   6919  C  CG    . GLU C 2  421  ? 0.104   -8.563  64.301  1.00 96.43  ? 421  GLU C CG    1 
ATOM   6920  C  CD    . GLU C 2  421  ? 0.924   -7.491  63.591  1.00 92.29  ? 421  GLU C CD    1 
ATOM   6921  O  OE1   . GLU C 2  421  ? 2.099   -7.764  63.256  1.00 90.65  ? 421  GLU C OE1   1 
ATOM   6922  O  OE2   . GLU C 2  421  ? 0.409   -6.371  63.392  1.00 87.14  ? 421  GLU C OE2   1 
ATOM   6923  N  N     . ARG C 2  422  ? 0.802   -12.519 64.936  1.00 72.14  ? 422  ARG C N     1 
ATOM   6924  C  CA    . ARG C 2  422  ? 0.440   -13.739 64.226  1.00 82.87  ? 422  ARG C CA    1 
ATOM   6925  C  C     . ARG C 2  422  ? 0.074   -14.866 65.208  1.00 82.65  ? 422  ARG C C     1 
ATOM   6926  O  O     . ARG C 2  422  ? -0.432  -15.918 64.809  1.00 83.25  ? 422  ARG C O     1 
ATOM   6927  C  CB    . ARG C 2  422  ? 1.594   -14.148 63.299  1.00 86.07  ? 422  ARG C CB    1 
ATOM   6928  C  CG    . ARG C 2  422  ? 1.401   -15.431 62.505  1.00 97.47  ? 422  ARG C CG    1 
ATOM   6929  C  CD    . ARG C 2  422  ? 2.245   -16.576 63.060  1.00 93.95  ? 422  ARG C CD    1 
ATOM   6930  N  NE    . ARG C 2  422  ? 3.677   -16.390 62.824  1.00 89.68  ? 422  ARG C NE    1 
ATOM   6931  C  CZ    . ARG C 2  422  ? 4.312   -16.766 61.717  1.00 87.97  ? 422  ARG C CZ    1 
ATOM   6932  N  NH1   . ARG C 2  422  ? 5.619   -16.561 61.599  1.00 68.80  ? 422  ARG C NH1   1 
ATOM   6933  N  NH2   . ARG C 2  422  ? 3.643   -17.341 60.725  1.00 96.80  ? 422  ARG C NH2   1 
ATOM   6934  N  N     . ALA C 2  423  ? 0.274   -14.619 66.500  1.00 73.62  ? 423  ALA C N     1 
ATOM   6935  C  CA    . ALA C 2  423  ? 0.139   -15.674 67.504  1.00 58.76  ? 423  ALA C CA    1 
ATOM   6936  C  C     . ALA C 2  423  ? -1.273  -15.795 68.068  1.00 55.75  ? 423  ALA C C     1 
ATOM   6937  O  O     . ALA C 2  423  ? -1.832  -14.826 68.589  1.00 46.97  ? 423  ALA C O     1 
ATOM   6938  C  CB    . ALA C 2  423  ? 1.143   -15.465 68.622  1.00 53.93  ? 423  ALA C CB    1 
ATOM   6939  N  N     . GLY C 2  424  ? -1.832  -17.000 67.970  1.00 59.23  ? 424  GLY C N     1 
ATOM   6940  C  CA    . GLY C 2  424  ? -3.192  -17.264 68.410  1.00 68.02  ? 424  GLY C CA    1 
ATOM   6941  C  C     . GLY C 2  424  ? -3.293  -17.660 69.871  1.00 65.89  ? 424  GLY C C     1 
ATOM   6942  O  O     . GLY C 2  424  ? -2.319  -17.550 70.616  1.00 65.70  ? 424  GLY C O     1 
ATOM   6943  N  N     . PHE C 2  425  ? -4.474  -18.113 70.285  1.00 61.17  ? 425  PHE C N     1 
ATOM   6944  C  CA    . PHE C 2  425  ? -4.695  -18.535 71.666  1.00 56.61  ? 425  PHE C CA    1 
ATOM   6945  C  C     . PHE C 2  425  ? -4.150  -19.934 71.938  1.00 54.92  ? 425  PHE C C     1 
ATOM   6946  O  O     . PHE C 2  425  ? -3.655  -20.212 73.032  1.00 56.16  ? 425  PHE C O     1 
ATOM   6947  C  CB    . PHE C 2  425  ? -6.183  -18.484 72.021  1.00 58.50  ? 425  PHE C CB    1 
ATOM   6948  C  CG    . PHE C 2  425  ? -6.678  -17.110 72.372  1.00 59.62  ? 425  PHE C CG    1 
ATOM   6949  C  CD1   . PHE C 2  425  ? -6.950  -16.772 73.690  1.00 52.81  ? 425  PHE C CD1   1 
ATOM   6950  C  CD2   . PHE C 2  425  ? -6.870  -16.157 71.386  1.00 52.49  ? 425  PHE C CD2   1 
ATOM   6951  C  CE1   . PHE C 2  425  ? -7.406  -15.507 74.016  1.00 49.21  ? 425  PHE C CE1   1 
ATOM   6952  C  CE2   . PHE C 2  425  ? -7.327  -14.892 71.705  1.00 52.50  ? 425  PHE C CE2   1 
ATOM   6953  C  CZ    . PHE C 2  425  ? -7.594  -14.565 73.021  1.00 50.78  ? 425  PHE C CZ    1 
ATOM   6954  N  N     . ASP C 2  426  ? -4.243  -20.808 70.941  1.00 53.59  ? 426  ASP C N     1 
ATOM   6955  C  CA    . ASP C 2  426  ? -3.849  -22.203 71.105  1.00 51.25  ? 426  ASP C CA    1 
ATOM   6956  C  C     . ASP C 2  426  ? -2.366  -22.342 71.425  1.00 50.63  ? 426  ASP C C     1 
ATOM   6957  O  O     . ASP C 2  426  ? -1.965  -23.231 72.178  1.00 54.37  ? 426  ASP C O     1 
ATOM   6958  C  CB    . ASP C 2  426  ? -4.192  -23.008 69.852  1.00 59.05  ? 426  ASP C CB    1 
ATOM   6959  C  CG    . ASP C 2  426  ? -5.635  -22.832 69.426  1.00 70.78  ? 426  ASP C CG    1 
ATOM   6960  O  OD1   . ASP C 2  426  ? -6.401  -22.185 70.172  1.00 63.31  ? 426  ASP C OD1   1 
ATOM   6961  O  OD2   . ASP C 2  426  ? -6.003  -23.345 68.349  1.00 86.14  ? 426  ASP C OD2   1 
ATOM   6962  N  N     . VAL C 2  427  ? -1.559  -21.457 70.852  1.00 49.66  ? 427  VAL C N     1 
ATOM   6963  C  CA    . VAL C 2  427  ? -0.117  -21.477 71.068  1.00 45.27  ? 427  VAL C CA    1 
ATOM   6964  C  C     . VAL C 2  427  ? 0.225   -20.995 72.471  1.00 42.98  ? 427  VAL C C     1 
ATOM   6965  O  O     . VAL C 2  427  ? 1.157   -21.497 73.100  1.00 41.27  ? 427  VAL C O     1 
ATOM   6966  C  CB    . VAL C 2  427  ? 0.607   -20.564 70.067  1.00 46.03  ? 427  VAL C CB    1 
ATOM   6967  C  CG1   . VAL C 2  427  ? 2.086   -20.910 70.013  1.00 43.73  ? 427  VAL C CG1   1 
ATOM   6968  C  CG2   . VAL C 2  427  ? -0.029  -20.674 68.688  1.00 56.26  ? 427  VAL C CG2   1 
ATOM   6969  N  N     . ARG C 2  428  ? -0.538  -20.016 72.950  1.00 40.56  ? 428  ARG C N     1 
ATOM   6970  C  CA    . ARG C 2  428  ? -0.267  -19.368 74.228  1.00 32.79  ? 428  ARG C CA    1 
ATOM   6971  C  C     . ARG C 2  428  ? -0.851  -20.141 75.403  1.00 35.34  ? 428  ARG C C     1 
ATOM   6972  O  O     . ARG C 2  428  ? -0.514  -19.877 76.559  1.00 34.01  ? 428  ARG C O     1 
ATOM   6973  C  CB    . ARG C 2  428  ? -0.830  -17.949 74.224  1.00 27.81  ? 428  ARG C CB    1 
ATOM   6974  C  CG    . ARG C 2  428  ? -0.339  -17.085 73.081  1.00 29.47  ? 428  ARG C CG    1 
ATOM   6975  C  CD    . ARG C 2  428  ? -1.086  -15.766 73.063  1.00 33.04  ? 428  ARG C CD    1 
ATOM   6976  N  NE    . ARG C 2  428  ? -0.185  -14.621 73.116  1.00 32.15  ? 428  ARG C NE    1 
ATOM   6977  C  CZ    . ARG C 2  428  ? 0.042   -13.807 72.093  1.00 30.31  ? 428  ARG C CZ    1 
ATOM   6978  N  NH1   . ARG C 2  428  ? -0.576  -14.011 70.939  1.00 37.07  ? 428  ARG C NH1   1 
ATOM   6979  N  NH2   . ARG C 2  428  ? 0.878   -12.787 72.223  1.00 22.34  ? 428  ARG C NH2   1 
ATOM   6980  N  N     . ASP C 2  429  ? -1.721  -21.099 75.103  1.00 36.94  ? 429  ASP C N     1 
ATOM   6981  C  CA    . ASP C 2  429  ? -2.403  -21.870 76.137  1.00 36.03  ? 429  ASP C CA    1 
ATOM   6982  C  C     . ASP C 2  429  ? -1.438  -22.736 76.931  1.00 29.32  ? 429  ASP C C     1 
ATOM   6983  O  O     . ASP C 2  429  ? -0.326  -23.011 76.487  1.00 33.53  ? 429  ASP C O     1 
ATOM   6984  C  CB    . ASP C 2  429  ? -3.486  -22.755 75.517  1.00 39.07  ? 429  ASP C CB    1 
ATOM   6985  C  CG    . ASP C 2  429  ? -4.858  -22.116 75.564  1.00 46.60  ? 429  ASP C CG    1 
ATOM   6986  O  OD1   . ASP C 2  429  ? -5.151  -21.402 76.547  1.00 48.85  ? 429  ASP C OD1   1 
ATOM   6987  O  OD2   . ASP C 2  429  ? -5.645  -22.330 74.620  1.00 52.63  ? 429  ASP C OD2   1 
ATOM   6988  N  N     . VAL C 2  430  ? -1.866  -23.148 78.118  1.00 27.45  ? 430  VAL C N     1 
ATOM   6989  C  CA    . VAL C 2  430  ? -1.126  -24.135 78.890  1.00 30.05  ? 430  VAL C CA    1 
ATOM   6990  C  C     . VAL C 2  430  ? -1.637  -25.516 78.510  1.00 31.11  ? 430  VAL C C     1 
ATOM   6991  O  O     . VAL C 2  430  ? -2.804  -25.833 78.728  1.00 35.55  ? 430  VAL C O     1 
ATOM   6992  C  CB    . VAL C 2  430  ? -1.304  -23.924 80.406  1.00 30.05  ? 430  VAL C CB    1 
ATOM   6993  C  CG1   . VAL C 2  430  ? -0.836  -25.145 81.173  1.00 30.33  ? 430  VAL C CG1   1 
ATOM   6994  C  CG2   . VAL C 2  430  ? -0.538  -22.695 80.861  1.00 33.49  ? 430  VAL C CG2   1 
ATOM   6995  N  N     . HIS C 2  431  ? -0.768  -26.322 77.912  1.00 26.94  ? 431  HIS C N     1 
ATOM   6996  C  CA    . HIS C 2  431  ? -1.133  -27.667 77.493  1.00 27.01  ? 431  HIS C CA    1 
ATOM   6997  C  C     . HIS C 2  431  ? -1.084  -28.593 78.696  1.00 33.66  ? 431  HIS C C     1 
ATOM   6998  O  O     . HIS C 2  431  ? -0.349  -28.332 79.646  1.00 36.41  ? 431  HIS C O     1 
ATOM   6999  C  CB    . HIS C 2  431  ? -0.168  -28.157 76.418  1.00 31.81  ? 431  HIS C CB    1 
ATOM   7000  C  CG    . HIS C 2  431  ? -0.698  -29.290 75.595  1.00 35.39  ? 431  HIS C CG    1 
ATOM   7001  N  ND1   . HIS C 2  431  ? -0.576  -30.608 75.976  1.00 34.62  ? 431  HIS C ND1   1 
ATOM   7002  C  CD2   . HIS C 2  431  ? -1.338  -29.300 74.402  1.00 35.15  ? 431  HIS C CD2   1 
ATOM   7003  C  CE1   . HIS C 2  431  ? -1.124  -31.382 75.056  1.00 36.17  ? 431  HIS C CE1   1 
ATOM   7004  N  NE2   . HIS C 2  431  ? -1.592  -30.613 74.089  1.00 33.27  ? 431  HIS C NE2   1 
ATOM   7005  N  N     . ARG C 2  432  ? -1.859  -29.673 78.659  1.00 33.94  ? 432  ARG C N     1 
ATOM   7006  C  CA    . ARG C 2  432  ? -1.872  -30.633 79.761  1.00 32.14  ? 432  ARG C CA    1 
ATOM   7007  C  C     . ARG C 2  432  ? -0.493  -31.247 79.976  1.00 35.34  ? 432  ARG C C     1 
ATOM   7008  O  O     . ARG C 2  432  ? -0.158  -31.684 81.077  1.00 37.46  ? 432  ARG C O     1 
ATOM   7009  C  CB    . ARG C 2  432  ? -2.897  -31.738 79.506  1.00 32.73  ? 432  ARG C CB    1 
ATOM   7010  C  CG    . ARG C 2  432  ? -2.627  -32.560 78.259  1.00 32.62  ? 432  ARG C CG    1 
ATOM   7011  C  CD    . ARG C 2  432  ? -3.686  -33.632 78.071  1.00 39.64  ? 432  ARG C CD    1 
ATOM   7012  N  NE    . ARG C 2  432  ? -3.519  -34.351 76.812  1.00 42.26  ? 432  ARG C NE    1 
ATOM   7013  C  CZ    . ARG C 2  432  ? -2.737  -35.415 76.658  1.00 38.48  ? 432  ARG C CZ    1 
ATOM   7014  N  NH1   . ARG C 2  432  ? -2.045  -35.885 77.688  1.00 36.92  ? 432  ARG C NH1   1 
ATOM   7015  N  NH2   . ARG C 2  432  ? -2.646  -36.006 75.474  1.00 36.29  ? 432  ARG C NH2   1 
ATOM   7016  N  N     . THR C 2  433  ? 0.307   -31.261 78.917  1.00 30.92  ? 433  THR C N     1 
ATOM   7017  C  CA    . THR C 2  433  ? 1.629   -31.866 78.958  1.00 30.03  ? 433  THR C CA    1 
ATOM   7018  C  C     . THR C 2  433  ? 2.684   -30.896 79.472  1.00 34.28  ? 433  THR C C     1 
ATOM   7019  O  O     . THR C 2  433  ? 3.866   -31.233 79.535  1.00 37.67  ? 433  THR C O     1 
ATOM   7020  C  CB    . THR C 2  433  ? 2.044   -32.369 77.575  1.00 32.48  ? 433  THR C CB    1 
ATOM   7021  O  OG1   . THR C 2  433  ? 2.055   -31.272 76.653  1.00 34.37  ? 433  THR C OG1   1 
ATOM   7022  C  CG2   . THR C 2  433  ? 1.062   -33.417 77.090  1.00 36.65  ? 433  THR C CG2   1 
ATOM   7023  N  N     . HIS C 2  434  ? 2.259   -29.689 79.832  1.00 32.84  ? 434  HIS C N     1 
ATOM   7024  C  CA    . HIS C 2  434  ? 3.165   -28.724 80.442  1.00 33.18  ? 434  HIS C CA    1 
ATOM   7025  C  C     . HIS C 2  434  ? 3.555   -29.194 81.834  1.00 33.15  ? 434  HIS C C     1 
ATOM   7026  O  O     . HIS C 2  434  ? 4.550   -28.734 82.400  1.00 31.34  ? 434  HIS C O     1 
ATOM   7027  C  CB    . HIS C 2  434  ? 2.512   -27.344 80.538  1.00 36.90  ? 434  HIS C CB    1 
ATOM   7028  C  CG    . HIS C 2  434  ? 2.597   -26.541 79.279  1.00 30.30  ? 434  HIS C CG    1 
ATOM   7029  N  ND1   . HIS C 2  434  ? 2.810   -27.113 78.043  1.00 29.36  ? 434  HIS C ND1   1 
ATOM   7030  C  CD2   . HIS C 2  434  ? 2.504   -25.208 79.066  1.00 26.50  ? 434  HIS C CD2   1 
ATOM   7031  C  CE1   . HIS C 2  434  ? 2.841   -26.166 77.122  1.00 28.13  ? 434  HIS C CE1   1 
ATOM   7032  N  NE2   . HIS C 2  434  ? 2.659   -25.001 77.717  1.00 31.19  ? 434  HIS C NE2   1 
ATOM   7033  N  N     . TYR C 2  435  ? 2.764   -30.122 82.368  1.00 31.95  ? 435  TYR C N     1 
ATOM   7034  C  CA    . TYR C 2  435  ? 2.929   -30.617 83.728  1.00 29.76  ? 435  TYR C CA    1 
ATOM   7035  C  C     . TYR C 2  435  ? 4.348   -31.129 83.962  1.00 29.41  ? 435  TYR C C     1 
ATOM   7036  O  O     . TYR C 2  435  ? 4.840   -31.989 83.235  1.00 36.38  ? 435  TYR C O     1 
ATOM   7037  C  CB    . TYR C 2  435  ? 1.911   -31.733 83.993  1.00 28.69  ? 435  TYR C CB    1 
ATOM   7038  C  CG    . TYR C 2  435  ? 1.790   -32.135 85.442  1.00 31.10  ? 435  TYR C CG    1 
ATOM   7039  C  CD1   . TYR C 2  435  ? 0.819   -31.574 86.258  1.00 29.67  ? 435  TYR C CD1   1 
ATOM   7040  C  CD2   . TYR C 2  435  ? 2.644   -33.077 85.995  1.00 42.06  ? 435  TYR C CD2   1 
ATOM   7041  C  CE1   . TYR C 2  435  ? 0.706   -31.938 87.586  1.00 31.72  ? 435  TYR C CE1   1 
ATOM   7042  C  CE2   . TYR C 2  435  ? 2.538   -33.449 87.321  1.00 42.20  ? 435  TYR C CE2   1 
ATOM   7043  C  CZ    . TYR C 2  435  ? 1.568   -32.877 88.112  1.00 36.13  ? 435  TYR C CZ    1 
ATOM   7044  O  OH    . TYR C 2  435  ? 1.463   -33.248 89.434  1.00 42.23  ? 435  TYR C OH    1 
ATOM   7045  N  N     . GLY C 2  436  ? 5.006   -30.585 84.977  1.00 29.41  ? 436  GLY C N     1 
ATOM   7046  C  CA    . GLY C 2  436  ? 6.360   -30.988 85.311  1.00 31.63  ? 436  GLY C CA    1 
ATOM   7047  C  C     . GLY C 2  436  ? 7.446   -30.520 84.357  1.00 30.41  ? 436  GLY C C     1 
ATOM   7048  O  O     . GLY C 2  436  ? 8.629   -30.722 84.626  1.00 37.75  ? 436  GLY C O     1 
ATOM   7049  N  N     . ARG C 2  437  ? 7.060   -29.888 83.253  1.00 26.32  ? 437  ARG C N     1 
ATOM   7050  C  CA    . ARG C 2  437  ? 8.019   -29.506 82.216  1.00 29.09  ? 437  ARG C CA    1 
ATOM   7051  C  C     . ARG C 2  437  ? 8.179   -27.993 82.066  1.00 33.89  ? 437  ARG C C     1 
ATOM   7052  O  O     . ARG C 2  437  ? 9.270   -27.449 82.261  1.00 31.51  ? 437  ARG C O     1 
ATOM   7053  C  CB    . ARG C 2  437  ? 7.634   -30.140 80.878  1.00 32.40  ? 437  ARG C CB    1 
ATOM   7054  C  CG    . ARG C 2  437  ? 7.706   -31.651 80.901  1.00 31.39  ? 437  ARG C CG    1 
ATOM   7055  C  CD    . ARG C 2  437  ? 7.225   -32.278 79.610  1.00 29.53  ? 437  ARG C CD    1 
ATOM   7056  N  NE    . ARG C 2  437  ? 7.169   -33.726 79.759  1.00 32.39  ? 437  ARG C NE    1 
ATOM   7057  C  CZ    . ARG C 2  437  ? 6.102   -34.388 80.190  1.00 38.74  ? 437  ARG C CZ    1 
ATOM   7058  N  NH1   . ARG C 2  437  ? 4.991   -33.732 80.494  1.00 37.64  ? 437  ARG C NH1   1 
ATOM   7059  N  NH2   . ARG C 2  437  ? 6.143   -35.706 80.312  1.00 44.99  ? 437  ARG C NH2   1 
ATOM   7060  N  N     . ILE C 2  438  ? 7.093   -27.327 81.688  1.00 33.65  ? 438  ILE C N     1 
ATOM   7061  C  CA    . ILE C 2  438  ? 7.076   -25.875 81.561  1.00 30.05  ? 438  ILE C CA    1 
ATOM   7062  C  C     . ILE C 2  438  ? 6.103   -25.299 82.586  1.00 30.24  ? 438  ILE C C     1 
ATOM   7063  O  O     . ILE C 2  438  ? 5.036   -25.869 82.814  1.00 35.58  ? 438  ILE C O     1 
ATOM   7064  C  CB    . ILE C 2  438  ? 6.658   -25.453 80.142  1.00 24.56  ? 438  ILE C CB    1 
ATOM   7065  C  CG1   . ILE C 2  438  ? 7.662   -25.982 79.117  1.00 18.53  ? 438  ILE C CG1   1 
ATOM   7066  C  CG2   . ILE C 2  438  ? 6.558   -23.952 80.038  1.00 25.75  ? 438  ILE C CG2   1 
ATOM   7067  C  CD1   . ILE C 2  438  ? 7.332   -25.605 77.694  1.00 16.68  ? 438  ILE C CD1   1 
ATOM   7068  N  N     . CYS C 2  439  ? 6.474   -24.184 83.209  1.00 25.62  ? 439  CYS C N     1 
ATOM   7069  C  CA    . CYS C 2  439  ? 5.655   -23.585 84.260  1.00 24.64  ? 439  CYS C CA    1 
ATOM   7070  C  C     . CYS C 2  439  ? 4.338   -23.013 83.733  1.00 26.15  ? 439  CYS C C     1 
ATOM   7071  O  O     . CYS C 2  439  ? 4.321   -22.314 82.720  1.00 35.59  ? 439  CYS C O     1 
ATOM   7072  C  CB    . CYS C 2  439  ? 6.439   -22.491 84.974  1.00 26.01  ? 439  CYS C CB    1 
ATOM   7073  S  SG    . CYS C 2  439  ? 5.636   -21.876 86.462  1.00 25.50  ? 439  CYS C SG    1 
ATOM   7074  N  N     . PRO C 2  440  ? 3.222   -23.342 84.403  1.00 24.25  ? 440  PRO C N     1 
ATOM   7075  C  CA    . PRO C 2  440  ? 1.876   -22.829 84.100  1.00 29.89  ? 440  PRO C CA    1 
ATOM   7076  C  C     . PRO C 2  440  ? 1.676   -21.367 84.509  1.00 28.11  ? 440  PRO C C     1 
ATOM   7077  O  O     . PRO C 2  440  ? 0.735   -20.716 84.045  1.00 30.29  ? 440  PRO C O     1 
ATOM   7078  C  CB    . PRO C 2  440  ? 0.958   -23.744 84.913  1.00 22.97  ? 440  PRO C CB    1 
ATOM   7079  C  CG    . PRO C 2  440  ? 1.797   -24.240 86.023  1.00 23.07  ? 440  PRO C CG    1 
ATOM   7080  C  CD    . PRO C 2  440  ? 3.219   -24.267 85.549  1.00 25.38  ? 440  PRO C CD    1 
ATOM   7081  N  N     . VAL C 2  441  ? 2.558   -20.872 85.371  1.00 23.55  ? 441  VAL C N     1 
ATOM   7082  C  CA    . VAL C 2  441  ? 2.417   -19.555 85.979  1.00 18.97  ? 441  VAL C CA    1 
ATOM   7083  C  C     . VAL C 2  441  ? 3.301   -18.468 85.352  1.00 24.07  ? 441  VAL C C     1 
ATOM   7084  O  O     . VAL C 2  441  ? 2.782   -17.482 84.833  1.00 26.46  ? 441  VAL C O     1 
ATOM   7085  C  CB    . VAL C 2  441  ? 2.602   -19.628 87.521  1.00 20.76  ? 441  VAL C CB    1 
ATOM   7086  C  CG1   . VAL C 2  441  ? 3.138   -18.318 88.076  1.00 22.52  ? 441  VAL C CG1   1 
ATOM   7087  C  CG2   . VAL C 2  441  ? 1.284   -19.970 88.194  1.00 23.33  ? 441  VAL C CG2   1 
ATOM   7088  N  N     . GLU C 2  442  ? 4.623   -18.641 85.390  1.00 27.79  ? 442  GLU C N     1 
ATOM   7089  C  CA    . GLU C 2  442  ? 5.521   -17.529 85.090  1.00 23.31  ? 442  GLU C CA    1 
ATOM   7090  C  C     . GLU C 2  442  ? 5.578   -17.251 83.595  1.00 29.90  ? 442  GLU C C     1 
ATOM   7091  O  O     . GLU C 2  442  ? 6.014   -18.091 82.808  1.00 33.69  ? 442  GLU C O     1 
ATOM   7092  C  CB    . GLU C 2  442  ? 6.935   -17.828 85.601  1.00 24.43  ? 442  GLU C CB    1 
ATOM   7093  C  CG    . GLU C 2  442  ? 7.881   -16.630 85.556  1.00 30.94  ? 442  GLU C CG    1 
ATOM   7094  C  CD    . GLU C 2  442  ? 9.351   -17.029 85.478  1.00 35.13  ? 442  GLU C CD    1 
ATOM   7095  O  OE1   . GLU C 2  442  ? 9.785   -17.902 86.265  1.00 29.61  ? 442  GLU C OE1   1 
ATOM   7096  O  OE2   . GLU C 2  442  ? 10.070  -16.470 84.618  1.00 29.11  ? 442  GLU C OE2   1 
ATOM   7097  N  N     . THR C 2  443  ? 5.137   -16.050 83.228  1.00 27.87  ? 443  THR C N     1 
ATOM   7098  C  CA    . THR C 2  443  ? 5.131   -15.578 81.850  1.00 22.91  ? 443  THR C CA    1 
ATOM   7099  C  C     . THR C 2  443  ? 4.861   -14.070 81.922  1.00 22.44  ? 443  THR C C     1 
ATOM   7100  O  O     . THR C 2  443  ? 4.572   -13.554 83.001  1.00 21.74  ? 443  THR C O     1 
ATOM   7101  C  CB    . THR C 2  443  ? 4.029   -16.314 81.048  1.00 20.29  ? 443  THR C CB    1 
ATOM   7102  O  OG1   . THR C 2  443  ? 4.172   -16.062 79.646  1.00 24.90  ? 443  THR C OG1   1 
ATOM   7103  C  CG2   . THR C 2  443  ? 2.652   -15.887 81.500  1.00 20.20  ? 443  THR C CG2   1 
ATOM   7104  N  N     . PRO C 2  444  ? 4.951   -13.351 80.789  1.00 19.49  ? 444  PRO C N     1 
ATOM   7105  C  CA    . PRO C 2  444  ? 4.592   -11.927 80.836  1.00 19.41  ? 444  PRO C CA    1 
ATOM   7106  C  C     . PRO C 2  444  ? 3.088   -11.671 80.825  1.00 17.99  ? 444  PRO C C     1 
ATOM   7107  O  O     . PRO C 2  444  ? 2.320   -12.530 80.401  1.00 20.40  ? 444  PRO C O     1 
ATOM   7108  C  CB    . PRO C 2  444  ? 5.228   -11.368 79.562  1.00 23.56  ? 444  PRO C CB    1 
ATOM   7109  C  CG    . PRO C 2  444  ? 6.348   -12.288 79.270  1.00 22.78  ? 444  PRO C CG    1 
ATOM   7110  C  CD    . PRO C 2  444  ? 5.844   -13.640 79.654  1.00 19.68  ? 444  PRO C CD    1 
ATOM   7111  N  N     . GLU C 2  445  ? 2.679   -10.496 81.294  1.00 17.93  ? 445  GLU C N     1 
ATOM   7112  C  CA    . GLU C 2  445  ? 1.275   -10.099 81.257  1.00 19.98  ? 445  GLU C CA    1 
ATOM   7113  C  C     . GLU C 2  445  ? 0.871   -9.601  79.875  1.00 20.38  ? 445  GLU C C     1 
ATOM   7114  O  O     . GLU C 2  445  ? -0.284  -9.728  79.472  1.00 22.93  ? 445  GLU C O     1 
ATOM   7115  C  CB    . GLU C 2  445  ? 0.997   -8.988  82.268  1.00 17.27  ? 445  GLU C CB    1 
ATOM   7116  C  CG    . GLU C 2  445  ? 1.233   -9.360  83.711  1.00 20.93  ? 445  GLU C CG    1 
ATOM   7117  C  CD    . GLU C 2  445  ? 0.719   -8.297  84.664  1.00 25.56  ? 445  GLU C CD    1 
ATOM   7118  O  OE1   . GLU C 2  445  ? 0.165   -7.290  84.181  1.00 26.89  ? 445  GLU C OE1   1 
ATOM   7119  O  OE2   . GLU C 2  445  ? 0.864   -8.468  85.893  1.00 26.03  ? 445  GLU C OE2   1 
ATOM   7120  N  N     . GLY C 2  446  ? 1.837   -9.050  79.149  1.00 19.62  ? 446  GLY C N     1 
ATOM   7121  C  CA    . GLY C 2  446  ? 1.569   -8.306  77.930  1.00 23.38  ? 446  GLY C CA    1 
ATOM   7122  C  C     . GLY C 2  446  ? 1.574   -9.125  76.652  1.00 25.81  ? 446  GLY C C     1 
ATOM   7123  O  O     . GLY C 2  446  ? 1.135   -10.274 76.640  1.00 24.97  ? 446  GLY C O     1 
ATOM   7124  N  N     . ALA C 2  447  ? 2.040   -8.509  75.568  1.00 19.19  ? 447  ALA C N     1 
ATOM   7125  C  CA    . ALA C 2  447  ? 2.004   -9.112  74.238  1.00 19.04  ? 447  ALA C CA    1 
ATOM   7126  C  C     . ALA C 2  447  ? 2.597   -10.520 74.153  1.00 25.81  ? 447  ALA C C     1 
ATOM   7127  O  O     . ALA C 2  447  ? 2.113   -11.356 73.392  1.00 27.32  ? 447  ALA C O     1 
ATOM   7128  C  CB    . ALA C 2  447  ? 2.686   -8.198  73.238  1.00 24.63  ? 447  ALA C CB    1 
ATOM   7129  N  N     . ASN C 2  448  ? 3.630   -10.780 74.947  1.00 26.79  ? 448  ASN C N     1 
ATOM   7130  C  CA    . ASN C 2  448  ? 4.389   -12.027 74.854  1.00 26.37  ? 448  ASN C CA    1 
ATOM   7131  C  C     . ASN C 2  448  ? 3.817   -13.190 75.654  1.00 28.64  ? 448  ASN C C     1 
ATOM   7132  O  O     . ASN C 2  448  ? 4.430   -14.258 75.727  1.00 27.06  ? 448  ASN C O     1 
ATOM   7133  C  CB    . ASN C 2  448  ? 5.833   -11.802 75.291  1.00 28.40  ? 448  ASN C CB    1 
ATOM   7134  C  CG    . ASN C 2  448  ? 6.660   -11.125 74.233  1.00 31.81  ? 448  ASN C CG    1 
ATOM   7135  O  OD1   . ASN C 2  448  ? 6.519   -11.407 73.044  1.00 31.22  ? 448  ASN C OD1   1 
ATOM   7136  N  ND2   . ASN C 2  448  ? 7.535   -10.222 74.657  1.00 36.14  ? 448  ASN C ND2   1 
ATOM   7137  N  N     . ILE C 2  449  ? 2.660   -12.975 76.271  1.00 26.39  ? 449  ILE C N     1 
ATOM   7138  C  CA    . ILE C 2  449  ? 2.089   -13.965 77.172  1.00 23.29  ? 449  ILE C CA    1 
ATOM   7139  C  C     . ILE C 2  449  ? 1.931   -15.324 76.500  1.00 27.43  ? 449  ILE C C     1 
ATOM   7140  O  O     . ILE C 2  449  ? 1.383   -15.432 75.403  1.00 32.15  ? 449  ILE C O     1 
ATOM   7141  C  CB    . ILE C 2  449  ? 0.749   -13.493 77.757  1.00 19.81  ? 449  ILE C CB    1 
ATOM   7142  C  CG1   . ILE C 2  449  ? 0.155   -14.574 78.650  1.00 21.39  ? 449  ILE C CG1   1 
ATOM   7143  C  CG2   . ILE C 2  449  ? -0.221  -13.122 76.656  1.00 23.29  ? 449  ILE C CG2   1 
ATOM   7144  C  CD1   . ILE C 2  449  ? -1.046  -14.108 79.421  1.00 33.16  ? 449  ILE C CD1   1 
ATOM   7145  N  N     . GLY C 2  450  ? 2.470   -16.351 77.148  1.00 26.75  ? 450  GLY C N     1 
ATOM   7146  C  CA    . GLY C 2  450  ? 2.372   -17.712 76.655  1.00 28.64  ? 450  GLY C CA    1 
ATOM   7147  C  C     . GLY C 2  450  ? 3.413   -18.046 75.607  1.00 26.79  ? 450  GLY C C     1 
ATOM   7148  O  O     . GLY C 2  450  ? 3.683   -19.218 75.347  1.00 29.38  ? 450  GLY C O     1 
ATOM   7149  N  N     . LEU C 2  451  ? 3.988   -17.015 74.993  1.00 29.12  ? 451  LEU C N     1 
ATOM   7150  C  CA    . LEU C 2  451  ? 5.070   -17.201 74.028  1.00 28.59  ? 451  LEU C CA    1 
ATOM   7151  C  C     . LEU C 2  451  ? 6.425   -17.364 74.712  1.00 25.48  ? 451  LEU C C     1 
ATOM   7152  O  O     . LEU C 2  451  ? 7.275   -18.130 74.251  1.00 22.12  ? 451  LEU C O     1 
ATOM   7153  C  CB    . LEU C 2  451  ? 5.105   -16.059 73.012  1.00 21.96  ? 451  LEU C CB    1 
ATOM   7154  C  CG    . LEU C 2  451  ? 3.866   -15.947 72.127  1.00 18.61  ? 451  LEU C CG    1 
ATOM   7155  C  CD1   . LEU C 2  451  ? 4.185   -15.152 70.882  1.00 20.62  ? 451  LEU C CD1   1 
ATOM   7156  C  CD2   . LEU C 2  451  ? 3.336   -17.319 71.762  1.00 26.96  ? 451  LEU C CD2   1 
ATOM   7157  N  N     . ILE C 2  452  ? 6.624   -16.630 75.804  1.00 20.48  ? 452  ILE C N     1 
ATOM   7158  C  CA    . ILE C 2  452  ? 7.825   -16.779 76.616  1.00 18.51  ? 452  ILE C CA    1 
ATOM   7159  C  C     . ILE C 2  452  ? 7.459   -17.476 77.917  1.00 22.14  ? 452  ILE C C     1 
ATOM   7160  O  O     . ILE C 2  452  ? 6.547   -17.049 78.623  1.00 25.39  ? 452  ILE C O     1 
ATOM   7161  C  CB    . ILE C 2  452  ? 8.506   -15.426 76.912  1.00 17.11  ? 452  ILE C CB    1 
ATOM   7162  C  CG1   . ILE C 2  452  ? 9.421   -15.020 75.759  1.00 19.38  ? 452  ILE C CG1   1 
ATOM   7163  C  CG2   . ILE C 2  452  ? 9.348   -15.517 78.169  1.00 19.89  ? 452  ILE C CG2   1 
ATOM   7164  C  CD1   . ILE C 2  452  ? 8.709   -14.615 74.496  1.00 20.89  ? 452  ILE C CD1   1 
ATOM   7165  N  N     . THR C 2  453  ? 8.164   -18.560 78.224  1.00 26.27  ? 453  THR C N     1 
ATOM   7166  C  CA    . THR C 2  453  ? 7.853   -19.362 79.401  1.00 24.20  ? 453  THR C CA    1 
ATOM   7167  C  C     . THR C 2  453  ? 9.114   -19.788 80.148  1.00 21.33  ? 453  THR C C     1 
ATOM   7168  O  O     . THR C 2  453  ? 10.222  -19.425 79.761  1.00 21.00  ? 453  THR C O     1 
ATOM   7169  C  CB    . THR C 2  453  ? 7.019   -20.598 79.023  1.00 30.61  ? 453  THR C CB    1 
ATOM   7170  O  OG1   . THR C 2  453  ? 7.498   -21.141 77.784  1.00 27.92  ? 453  THR C OG1   1 
ATOM   7171  C  CG2   . THR C 2  453  ? 5.552   -20.221 78.860  1.00 30.26  ? 453  THR C CG2   1 
ATOM   7172  N  N     . SER C 2  454  ? 8.942   -20.546 81.227  1.00 22.81  ? 454  SER C N     1 
ATOM   7173  C  CA    . SER C 2  454  ? 10.079  -20.958 82.050  1.00 24.99  ? 454  SER C CA    1 
ATOM   7174  C  C     . SER C 2  454  ? 10.151  -22.464 82.264  1.00 27.58  ? 454  SER C C     1 
ATOM   7175  O  O     . SER C 2  454  ? 9.134   -23.132 82.461  1.00 30.31  ? 454  SER C O     1 
ATOM   7176  C  CB    . SER C 2  454  ? 10.076  -20.236 83.400  1.00 20.91  ? 454  SER C CB    1 
ATOM   7177  O  OG    . SER C 2  454  ? 10.749  -18.993 83.309  1.00 28.51  ? 454  SER C OG    1 
ATOM   7178  N  N     . LEU C 2  455  ? 11.371  -22.986 82.221  1.00 25.91  ? 455  LEU C N     1 
ATOM   7179  C  CA    . LEU C 2  455  ? 11.613  -24.402 82.428  1.00 28.84  ? 455  LEU C CA    1 
ATOM   7180  C  C     . LEU C 2  455  ? 11.285  -24.749 83.867  1.00 28.18  ? 455  LEU C C     1 
ATOM   7181  O  O     . LEU C 2  455  ? 11.678  -24.026 84.779  1.00 31.67  ? 455  LEU C O     1 
ATOM   7182  C  CB    . LEU C 2  455  ? 13.078  -24.725 82.143  1.00 30.00  ? 455  LEU C CB    1 
ATOM   7183  C  CG    . LEU C 2  455  ? 13.467  -26.201 82.097  1.00 29.68  ? 455  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C 2  455  ? 12.644  -26.941 81.052  1.00 25.54  ? 455  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C 2  455  ? 14.947  -26.332 81.802  1.00 32.64  ? 455  LEU C CD2   1 
ATOM   7186  N  N     . ALA C 2  456  ? 10.571  -25.852 84.071  1.00 27.17  ? 456  ALA C N     1 
ATOM   7187  C  CA    . ALA C 2  456  ? 10.214  -26.286 85.420  1.00 30.76  ? 456  ALA C CA    1 
ATOM   7188  C  C     . ALA C 2  456  ? 11.453  -26.697 86.212  1.00 33.37  ? 456  ALA C C     1 
ATOM   7189  O  O     . ALA C 2  456  ? 12.505  -26.980 85.635  1.00 40.80  ? 456  ALA C O     1 
ATOM   7190  C  CB    . ALA C 2  456  ? 9.205   -27.423 85.376  1.00 31.66  ? 456  ALA C CB    1 
ATOM   7191  N  N     . ALA C 2  457  ? 11.322  -26.716 87.534  1.00 28.50  ? 457  ALA C N     1 
ATOM   7192  C  CA    . ALA C 2  457  ? 12.457  -26.945 88.422  1.00 32.11  ? 457  ALA C CA    1 
ATOM   7193  C  C     . ALA C 2  457  ? 13.138  -28.297 88.207  1.00 35.01  ? 457  ALA C C     1 
ATOM   7194  O  O     . ALA C 2  457  ? 14.365  -28.377 88.152  1.00 35.43  ? 457  ALA C O     1 
ATOM   7195  C  CB    . ALA C 2  457  ? 12.028  -26.789 89.871  1.00 32.79  ? 457  ALA C CB    1 
ATOM   7196  N  N     . TYR C 2  458  ? 12.344  -29.354 88.086  1.00 36.93  ? 458  TYR C N     1 
ATOM   7197  C  CA    . TYR C 2  458  ? 12.899  -30.691 87.895  1.00 36.40  ? 458  TYR C CA    1 
ATOM   7198  C  C     . TYR C 2  458  ? 12.985  -31.089 86.427  1.00 36.34  ? 458  TYR C C     1 
ATOM   7199  O  O     . TYR C 2  458  ? 13.478  -32.169 86.104  1.00 45.86  ? 458  TYR C O     1 
ATOM   7200  C  CB    . TYR C 2  458  ? 12.078  -31.734 88.656  1.00 38.65  ? 458  TYR C CB    1 
ATOM   7201  C  CG    . TYR C 2  458  ? 12.438  -31.872 90.116  1.00 35.47  ? 458  TYR C CG    1 
ATOM   7202  C  CD1   . TYR C 2  458  ? 11.634  -31.324 91.104  1.00 34.12  ? 458  TYR C CD1   1 
ATOM   7203  C  CD2   . TYR C 2  458  ? 13.579  -32.556 90.506  1.00 38.75  ? 458  TYR C CD2   1 
ATOM   7204  C  CE1   . TYR C 2  458  ? 11.955  -31.454 92.439  1.00 35.45  ? 458  TYR C CE1   1 
ATOM   7205  C  CE2   . TYR C 2  458  ? 13.909  -32.689 91.838  1.00 40.19  ? 458  TYR C CE2   1 
ATOM   7206  C  CZ    . TYR C 2  458  ? 13.094  -32.135 92.799  1.00 38.48  ? 458  TYR C CZ    1 
ATOM   7207  O  OH    . TYR C 2  458  ? 13.420  -32.263 94.127  1.00 51.35  ? 458  TYR C OH    1 
ATOM   7208  N  N     . ALA C 2  459  ? 12.511  -30.220 85.540  1.00 29.78  ? 459  ALA C N     1 
ATOM   7209  C  CA    . ALA C 2  459  ? 12.473  -30.534 84.116  1.00 25.98  ? 459  ALA C CA    1 
ATOM   7210  C  C     . ALA C 2  459  ? 13.864  -30.612 83.491  1.00 28.26  ? 459  ALA C C     1 
ATOM   7211  O  O     . ALA C 2  459  ? 14.799  -29.934 83.920  1.00 26.32  ? 459  ALA C O     1 
ATOM   7212  C  CB    . ALA C 2  459  ? 11.613  -29.531 83.374  1.00 28.13  ? 459  ALA C CB    1 
ATOM   7213  N  N     . ARG C 2  460  ? 13.986  -31.453 82.470  1.00 30.97  ? 460  ARG C N     1 
ATOM   7214  C  CA    . ARG C 2  460  ? 15.247  -31.646 81.767  1.00 32.60  ? 460  ARG C CA    1 
ATOM   7215  C  C     . ARG C 2  460  ? 15.018  -31.704 80.261  1.00 31.00  ? 460  ARG C C     1 
ATOM   7216  O  O     . ARG C 2  460  ? 13.926  -32.041 79.808  1.00 31.98  ? 460  ARG C O     1 
ATOM   7217  C  CB    . ARG C 2  460  ? 15.905  -32.946 82.217  1.00 35.37  ? 460  ARG C CB    1 
ATOM   7218  C  CG    . ARG C 2  460  ? 16.517  -32.908 83.599  1.00 43.83  ? 460  ARG C CG    1 
ATOM   7219  C  CD    . ARG C 2  460  ? 17.396  -34.129 83.791  1.00 56.70  ? 460  ARG C CD    1 
ATOM   7220  N  NE    . ARG C 2  460  ? 18.183  -34.071 85.016  1.00 64.56  ? 460  ARG C NE    1 
ATOM   7221  C  CZ    . ARG C 2  460  ? 19.166  -34.918 85.301  1.00 70.00  ? 460  ARG C CZ    1 
ATOM   7222  N  NH1   . ARG C 2  460  ? 19.477  -35.879 84.441  1.00 70.67  ? 460  ARG C NH1   1 
ATOM   7223  N  NH2   . ARG C 2  460  ? 19.839  -34.804 86.439  1.00 71.01  ? 460  ARG C NH2   1 
ATOM   7224  N  N     . VAL C 2  461  ? 16.048  -31.381 79.486  1.00 21.12  ? 461  VAL C N     1 
ATOM   7225  C  CA    . VAL C 2  461  ? 15.958  -31.501 78.039  1.00 20.79  ? 461  VAL C CA    1 
ATOM   7226  C  C     . VAL C 2  461  ? 16.863  -32.622 77.553  1.00 24.15  ? 461  VAL C C     1 
ATOM   7227  O  O     . VAL C 2  461  ? 18.074  -32.584 77.767  1.00 22.29  ? 461  VAL C O     1 
ATOM   7228  C  CB    . VAL C 2  461  ? 16.370  -30.206 77.334  1.00 24.89  ? 461  VAL C CB    1 
ATOM   7229  C  CG1   . VAL C 2  461  ? 15.960  -30.261 75.870  1.00 25.16  ? 461  VAL C CG1   1 
ATOM   7230  C  CG2   . VAL C 2  461  ? 15.747  -29.004 78.023  1.00 26.67  ? 461  VAL C CG2   1 
ATOM   7231  N  N     . ASP C 2  462  ? 16.275  -33.616 76.893  1.00 27.73  ? 462  ASP C N     1 
ATOM   7232  C  CA    . ASP C 2  462  ? 17.040  -34.759 76.406  1.00 31.77  ? 462  ASP C CA    1 
ATOM   7233  C  C     . ASP C 2  462  ? 17.889  -34.419 75.182  1.00 42.48  ? 462  ASP C C     1 
ATOM   7234  O  O     . ASP C 2  462  ? 17.857  -33.293 74.685  1.00 48.65  ? 462  ASP C O     1 
ATOM   7235  C  CB    . ASP C 2  462  ? 16.123  -35.957 76.119  1.00 35.83  ? 462  ASP C CB    1 
ATOM   7236  C  CG    . ASP C 2  462  ? 15.067  -35.665 75.058  1.00 38.15  ? 462  ASP C CG    1 
ATOM   7237  O  OD1   . ASP C 2  462  ? 15.369  -34.975 74.063  1.00 37.14  ? 462  ASP C OD1   1 
ATOM   7238  O  OD2   . ASP C 2  462  ? 13.924  -36.145 75.215  1.00 40.88  ? 462  ASP C OD2   1 
ATOM   7239  N  N     . GLU C 2  463  ? 18.631  -35.406 74.692  1.00 47.54  ? 463  GLU C N     1 
ATOM   7240  C  CA    . GLU C 2  463  ? 19.507  -35.219 73.543  1.00 42.75  ? 463  GLU C CA    1 
ATOM   7241  C  C     . GLU C 2  463  ? 18.709  -34.884 72.289  1.00 41.19  ? 463  GLU C C     1 
ATOM   7242  O  O     . GLU C 2  463  ? 19.206  -34.207 71.391  1.00 37.62  ? 463  GLU C O     1 
ATOM   7243  C  CB    . GLU C 2  463  ? 20.345  -36.476 73.314  1.00 47.23  ? 463  GLU C CB    1 
ATOM   7244  C  CG    . GLU C 2  463  ? 21.157  -36.893 74.531  1.00 63.39  ? 463  GLU C CG    1 
ATOM   7245  C  CD    . GLU C 2  463  ? 21.802  -38.255 74.365  1.00 76.20  ? 463  GLU C CD    1 
ATOM   7246  O  OE1   . GLU C 2  463  ? 22.521  -38.691 75.291  1.00 65.29  ? 463  GLU C OE1   1 
ATOM   7247  O  OE2   . GLU C 2  463  ? 21.586  -38.889 73.309  1.00 78.51  ? 463  GLU C OE2   1 
ATOM   7248  N  N     . LEU C 2  464  ? 17.465  -35.353 72.240  1.00 44.94  ? 464  LEU C N     1 
ATOM   7249  C  CA    . LEU C 2  464  ? 16.594  -35.101 71.096  1.00 43.69  ? 464  LEU C CA    1 
ATOM   7250  C  C     . LEU C 2  464  ? 15.912  -33.739 71.191  1.00 38.50  ? 464  LEU C C     1 
ATOM   7251  O  O     . LEU C 2  464  ? 15.312  -33.270 70.225  1.00 34.04  ? 464  LEU C O     1 
ATOM   7252  C  CB    . LEU C 2  464  ? 15.551  -36.212 70.951  1.00 42.37  ? 464  LEU C CB    1 
ATOM   7253  C  CG    . LEU C 2  464  ? 15.896  -37.347 69.981  1.00 44.31  ? 464  LEU C CG    1 
ATOM   7254  C  CD1   . LEU C 2  464  ? 17.255  -37.950 70.295  1.00 48.88  ? 464  LEU C CD1   1 
ATOM   7255  C  CD2   . LEU C 2  464  ? 14.816  -38.417 69.996  1.00 48.66  ? 464  LEU C CD2   1 
ATOM   7256  N  N     . GLY C 2  465  ? 16.005  -33.110 72.360  1.00 40.13  ? 465  GLY C N     1 
ATOM   7257  C  CA    . GLY C 2  465  ? 15.493  -31.764 72.547  1.00 36.53  ? 465  GLY C CA    1 
ATOM   7258  C  C     . GLY C 2  465  ? 14.085  -31.683 73.108  1.00 31.71  ? 465  GLY C C     1 
ATOM   7259  O  O     . GLY C 2  465  ? 13.447  -30.634 73.040  1.00 29.30  ? 465  GLY C O     1 
ATOM   7260  N  N     . PHE C 2  466  ? 13.597  -32.791 73.656  1.00 32.69  ? 466  PHE C N     1 
ATOM   7261  C  CA    . PHE C 2  466  ? 12.280  -32.829 74.282  1.00 28.84  ? 466  PHE C CA    1 
ATOM   7262  C  C     . PHE C 2  466  ? 12.405  -32.653 75.788  1.00 32.69  ? 466  PHE C C     1 
ATOM   7263  O  O     . PHE C 2  466  ? 13.364  -33.125 76.394  1.00 40.87  ? 466  PHE C O     1 
ATOM   7264  C  CB    . PHE C 2  466  ? 11.580  -34.147 73.968  1.00 25.21  ? 466  PHE C CB    1 
ATOM   7265  C  CG    . PHE C 2  466  ? 11.335  -34.358 72.512  1.00 27.49  ? 466  PHE C CG    1 
ATOM   7266  C  CD1   . PHE C 2  466  ? 12.267  -35.012 71.730  1.00 35.94  ? 466  PHE C CD1   1 
ATOM   7267  C  CD2   . PHE C 2  466  ? 10.176  -33.890 71.919  1.00 29.41  ? 466  PHE C CD2   1 
ATOM   7268  C  CE1   . PHE C 2  466  ? 12.044  -35.204 70.381  1.00 46.55  ? 466  PHE C CE1   1 
ATOM   7269  C  CE2   . PHE C 2  466  ? 9.947   -34.076 70.572  1.00 31.56  ? 466  PHE C CE2   1 
ATOM   7270  C  CZ    . PHE C 2  466  ? 10.880  -34.735 69.801  1.00 41.58  ? 466  PHE C CZ    1 
ATOM   7271  N  N     . ILE C 2  467  ? 11.443  -31.965 76.395  1.00 30.34  ? 467  ILE C N     1 
ATOM   7272  C  CA    . ILE C 2  467  ? 11.501  -31.710 77.829  1.00 28.55  ? 467  ILE C CA    1 
ATOM   7273  C  C     . ILE C 2  467  ? 10.981  -32.905 78.618  1.00 31.27  ? 467  ILE C C     1 
ATOM   7274  O  O     . ILE C 2  467  ? 9.917   -33.441 78.314  1.00 35.23  ? 467  ILE C O     1 
ATOM   7275  C  CB    . ILE C 2  467  ? 10.718  -30.449 78.215  1.00 27.39  ? 467  ILE C CB    1 
ATOM   7276  C  CG1   . ILE C 2  467  ? 11.060  -29.306 77.259  1.00 22.27  ? 467  ILE C CG1   1 
ATOM   7277  C  CG2   . ILE C 2  467  ? 11.033  -30.057 79.646  1.00 30.51  ? 467  ILE C CG2   1 
ATOM   7278  C  CD1   . ILE C 2  467  ? 10.305  -28.032 77.530  1.00 20.16  ? 467  ILE C CD1   1 
ATOM   7279  N  N     . ARG C 2  468  ? 11.743  -33.324 79.625  1.00 31.20  ? 468  ARG C N     1 
ATOM   7280  C  CA    . ARG C 2  468  ? 11.389  -34.496 80.420  1.00 33.68  ? 468  ARG C CA    1 
ATOM   7281  C  C     . ARG C 2  468  ? 11.264  -34.172 81.904  1.00 36.59  ? 468  ARG C C     1 
ATOM   7282  O  O     . ARG C 2  468  ? 11.984  -33.321 82.428  1.00 37.53  ? 468  ARG C O     1 
ATOM   7283  C  CB    . ARG C 2  468  ? 12.409  -35.620 80.219  1.00 32.30  ? 468  ARG C CB    1 
ATOM   7284  C  CG    . ARG C 2  468  ? 12.456  -36.173 78.805  1.00 37.93  ? 468  ARG C CG    1 
ATOM   7285  C  CD    . ARG C 2  468  ? 13.702  -37.022 78.594  1.00 45.63  ? 468  ARG C CD    1 
ATOM   7286  N  NE    . ARG C 2  468  ? 13.454  -38.448 78.787  1.00 46.98  ? 468  ARG C NE    1 
ATOM   7287  C  CZ    . ARG C 2  468  ? 13.508  -39.352 77.812  1.00 43.33  ? 468  ARG C CZ    1 
ATOM   7288  N  NH1   . ARG C 2  468  ? 13.806  -38.979 76.575  1.00 38.21  ? 468  ARG C NH1   1 
ATOM   7289  N  NH2   . ARG C 2  468  ? 13.269  -40.631 78.074  1.00 48.88  ? 468  ARG C NH2   1 
ATOM   7290  N  N     . THR C 2  469  ? 10.344  -34.863 82.571  1.00 35.21  ? 469  THR C N     1 
ATOM   7291  C  CA    . THR C 2  469  ? 10.101  -34.670 83.996  1.00 33.19  ? 469  THR C CA    1 
ATOM   7292  C  C     . THR C 2  469  ? 10.210  -36.008 84.725  1.00 38.43  ? 469  THR C C     1 
ATOM   7293  O  O     . THR C 2  469  ? 9.821   -37.042 84.186  1.00 46.48  ? 469  THR C O     1 
ATOM   7294  C  CB    . THR C 2  469  ? 8.712   -34.030 84.245  1.00 37.28  ? 469  THR C CB    1 
ATOM   7295  O  OG1   . THR C 2  469  ? 8.445   -33.973 85.651  1.00 36.10  ? 469  THR C OG1   1 
ATOM   7296  C  CG2   . THR C 2  469  ? 7.612   -34.827 83.554  1.00 37.19  ? 469  THR C CG2   1 
ATOM   7297  N  N     . PRO C 2  470  ? 10.759  -35.996 85.948  1.00 35.76  ? 470  PRO C N     1 
ATOM   7298  C  CA    . PRO C 2  470  ? 10.963  -37.229 86.715  1.00 38.22  ? 470  PRO C CA    1 
ATOM   7299  C  C     . PRO C 2  470  ? 9.687   -37.795 87.338  1.00 34.73  ? 470  PRO C C     1 
ATOM   7300  O  O     . PRO C 2  470  ? 8.791   -37.041 87.711  1.00 35.66  ? 470  PRO C O     1 
ATOM   7301  C  CB    . PRO C 2  470  ? 11.928  -36.788 87.815  1.00 40.28  ? 470  PRO C CB    1 
ATOM   7302  C  CG    . PRO C 2  470  ? 11.631  -35.357 88.014  1.00 34.13  ? 470  PRO C CG    1 
ATOM   7303  C  CD    . PRO C 2  470  ? 11.295  -34.819 86.652  1.00 38.05  ? 470  PRO C CD    1 
ATOM   7304  N  N     . TYR C 2  471  ? 9.616   -39.119 87.442  1.00 36.79  ? 471  TYR C N     1 
ATOM   7305  C  CA    . TYR C 2  471  ? 8.541   -39.784 88.173  1.00 40.02  ? 471  TYR C CA    1 
ATOM   7306  C  C     . TYR C 2  471  ? 9.080   -41.010 88.900  1.00 45.47  ? 471  TYR C C     1 
ATOM   7307  O  O     . TYR C 2  471  ? 9.935   -41.721 88.381  1.00 53.09  ? 471  TYR C O     1 
ATOM   7308  C  CB    . TYR C 2  471  ? 7.404   -40.205 87.239  1.00 42.78  ? 471  TYR C CB    1 
ATOM   7309  C  CG    . TYR C 2  471  ? 6.593   -39.061 86.666  1.00 50.49  ? 471  TYR C CG    1 
ATOM   7310  C  CD1   . TYR C 2  471  ? 6.596   -38.798 85.300  1.00 50.53  ? 471  TYR C CD1   1 
ATOM   7311  C  CD2   . TYR C 2  471  ? 5.819   -38.250 87.487  1.00 46.56  ? 471  TYR C CD2   1 
ATOM   7312  C  CE1   . TYR C 2  471  ? 5.852   -37.756 84.767  1.00 45.23  ? 471  TYR C CE1   1 
ATOM   7313  C  CE2   . TYR C 2  471  ? 5.072   -37.204 86.962  1.00 45.52  ? 471  TYR C CE2   1 
ATOM   7314  C  CZ    . TYR C 2  471  ? 5.094   -36.962 85.602  1.00 45.20  ? 471  TYR C CZ    1 
ATOM   7315  O  OH    . TYR C 2  471  ? 4.354   -35.927 85.075  1.00 39.61  ? 471  TYR C OH    1 
ATOM   7316  N  N     . ARG C 2  472  ? 8.576   -41.251 90.105  1.00 53.37  ? 472  ARG C N     1 
ATOM   7317  C  CA    . ARG C 2  472  ? 8.966   -42.418 90.887  1.00 54.45  ? 472  ARG C CA    1 
ATOM   7318  C  C     . ARG C 2  472  ? 8.246   -43.675 90.420  1.00 55.85  ? 472  ARG C C     1 
ATOM   7319  O  O     . ARG C 2  472  ? 7.058   -43.639 90.099  1.00 54.87  ? 472  ARG C O     1 
ATOM   7320  C  CB    . ARG C 2  472  ? 8.683   -42.191 92.373  1.00 50.70  ? 472  ARG C CB    1 
ATOM   7321  C  CG    . ARG C 2  472  ? 9.781   -41.450 93.105  1.00 55.57  ? 472  ARG C CG    1 
ATOM   7322  C  CD    . ARG C 2  472  ? 9.671   -41.655 94.602  1.00 57.95  ? 472  ARG C CD    1 
ATOM   7323  N  NE    . ARG C 2  472  ? 8.659   -40.797 95.207  1.00 64.43  ? 472  ARG C NE    1 
ATOM   7324  C  CZ    . ARG C 2  472  ? 8.414   -40.739 96.512  1.00 75.38  ? 472  ARG C CZ    1 
ATOM   7325  N  NH1   . ARG C 2  472  ? 9.109   -41.495 97.355  1.00 68.19  ? 472  ARG C NH1   1 
ATOM   7326  N  NH2   . ARG C 2  472  ? 7.473   -39.925 96.975  1.00 75.83  ? 472  ARG C NH2   1 
ATOM   7327  N  N     . ARG C 2  473  ? 8.973   -44.787 90.391  1.00 50.71  ? 473  ARG C N     1 
ATOM   7328  C  CA    . ARG C 2  473  ? 8.391   -46.069 90.027  1.00 54.64  ? 473  ARG C CA    1 
ATOM   7329  C  C     . ARG C 2  473  ? 7.541   -46.610 91.168  1.00 62.78  ? 473  ARG C C     1 
ATOM   7330  O  O     . ARG C 2  473  ? 7.949   -46.577 92.330  1.00 65.43  ? 473  ARG C O     1 
ATOM   7331  C  CB    . ARG C 2  473  ? 9.492   -47.075 89.690  1.00 62.29  ? 473  ARG C CB    1 
ATOM   7332  C  CG    . ARG C 2  473  ? 8.985   -48.480 89.402  1.00 65.04  ? 473  ARG C CG    1 
ATOM   7333  C  CD    . ARG C 2  473  ? 8.591   -48.645 87.945  1.00 59.57  ? 473  ARG C CD    1 
ATOM   7334  N  NE    . ARG C 2  473  ? 9.731   -48.435 87.057  1.00 61.20  ? 473  ARG C NE    1 
ATOM   7335  C  CZ    . ARG C 2  473  ? 9.702   -48.628 85.743  1.00 68.41  ? 473  ARG C CZ    1 
ATOM   7336  N  NH1   . ARG C 2  473  ? 8.587   -49.044 85.156  1.00 64.22  ? 473  ARG C NH1   1 
ATOM   7337  N  NH2   . ARG C 2  473  ? 10.790  -48.407 85.015  1.00 69.85  ? 473  ARG C NH2   1 
ATOM   7338  N  N     . VAL C 2  474  ? 6.355   -47.106 90.832  1.00 59.89  ? 474  VAL C N     1 
ATOM   7339  C  CA    . VAL C 2  474  ? 5.495   -47.748 91.817  1.00 61.64  ? 474  VAL C CA    1 
ATOM   7340  C  C     . VAL C 2  474  ? 5.130   -49.157 91.362  1.00 75.37  ? 474  VAL C C     1 
ATOM   7341  O  O     . VAL C 2  474  ? 4.460   -49.333 90.343  1.00 79.49  ? 474  VAL C O     1 
ATOM   7342  C  CB    . VAL C 2  474  ? 4.208   -46.944 92.059  1.00 54.64  ? 474  VAL C CB    1 
ATOM   7343  C  CG1   . VAL C 2  474  ? 3.275   -47.706 92.983  1.00 62.62  ? 474  VAL C CG1   1 
ATOM   7344  C  CG2   . VAL C 2  474  ? 4.539   -45.583 92.640  1.00 56.06  ? 474  VAL C CG2   1 
ATOM   7345  N  N     . VAL C 2  475  ? 5.579   -50.157 92.117  1.00 77.44  ? 475  VAL C N     1 
ATOM   7346  C  CA    . VAL C 2  475  ? 5.288   -51.554 91.800  1.00 72.60  ? 475  VAL C CA    1 
ATOM   7347  C  C     . VAL C 2  475  ? 4.476   -52.210 92.912  1.00 73.59  ? 475  VAL C C     1 
ATOM   7348  O  O     . VAL C 2  475  ? 4.946   -52.328 94.046  1.00 67.33  ? 475  VAL C O     1 
ATOM   7349  C  CB    . VAL C 2  475  ? 6.577   -52.373 91.569  1.00 56.03  ? 475  VAL C CB    1 
ATOM   7350  C  CG1   . VAL C 2  475  ? 6.243   -53.841 91.382  1.00 57.99  ? 475  VAL C CG1   1 
ATOM   7351  C  CG2   . VAL C 2  475  ? 7.336   -51.847 90.364  1.00 63.04  ? 475  VAL C CG2   1 
ATOM   7352  N  N     . GLY C 2  476  ? 3.258   -52.631 92.576  1.00 67.17  ? 476  GLY C N     1 
ATOM   7353  C  CA    . GLY C 2  476  ? 2.376   -53.295 93.521  1.00 67.23  ? 476  GLY C CA    1 
ATOM   7354  C  C     . GLY C 2  476  ? 2.129   -52.498 94.790  1.00 76.18  ? 476  GLY C C     1 
ATOM   7355  O  O     . GLY C 2  476  ? 2.197   -53.036 95.896  1.00 73.67  ? 476  GLY C O     1 
ATOM   7356  N  N     . GLY C 2  477  ? 1.855   -51.208 94.631  1.00 79.74  ? 477  GLY C N     1 
ATOM   7357  C  CA    . GLY C 2  477  ? 1.563   -50.346 95.762  1.00 67.54  ? 477  GLY C CA    1 
ATOM   7358  C  C     . GLY C 2  477  ? 2.794   -49.925 96.539  1.00 66.68  ? 477  GLY C C     1 
ATOM   7359  O  O     . GLY C 2  477  ? 2.692   -49.183 97.515  1.00 71.72  ? 477  GLY C O     1 
ATOM   7360  N  N     . VAL C 2  478  ? 3.960   -50.398 96.111  1.00 63.71  ? 478  VAL C N     1 
ATOM   7361  C  CA    . VAL C 2  478  ? 5.211   -50.041 96.768  1.00 68.73  ? 478  VAL C CA    1 
ATOM   7362  C  C     . VAL C 2  478  ? 5.935   -48.964 95.971  1.00 73.45  ? 478  VAL C C     1 
ATOM   7363  O  O     . VAL C 2  478  ? 6.239   -49.154 94.792  1.00 73.48  ? 478  VAL C O     1 
ATOM   7364  C  CB    . VAL C 2  478  ? 6.143   -51.257 96.913  1.00 70.82  ? 478  VAL C CB    1 
ATOM   7365  C  CG1   . VAL C 2  478  ? 7.250   -50.955 97.914  1.00 60.86  ? 478  VAL C CG1   1 
ATOM   7366  C  CG2   . VAL C 2  478  ? 5.353   -52.484 97.340  1.00 76.20  ? 478  VAL C CG2   1 
ATOM   7367  N  N     . VAL C 2  479  ? 6.215   -47.835 96.616  1.00 72.54  ? 479  VAL C N     1 
ATOM   7368  C  CA    . VAL C 2  479  ? 6.890   -46.729 95.947  1.00 71.74  ? 479  VAL C CA    1 
ATOM   7369  C  C     . VAL C 2  479  ? 8.399   -46.864 96.102  1.00 68.29  ? 479  VAL C C     1 
ATOM   7370  O  O     . VAL C 2  479  ? 8.929   -46.780 97.210  1.00 73.46  ? 479  VAL C O     1 
ATOM   7371  C  CB    . VAL C 2  479  ? 6.446   -45.364 96.514  1.00 62.64  ? 479  VAL C CB    1 
ATOM   7372  C  CG1   . VAL C 2  479  ? 7.202   -44.234 95.833  1.00 54.92  ? 479  VAL C CG1   1 
ATOM   7373  C  CG2   . VAL C 2  479  ? 4.945   -45.183 96.353  1.00 60.49  ? 479  VAL C CG2   1 
ATOM   7374  N  N     . THR C 2  480  ? 9.087   -47.074 94.986  1.00 55.59  ? 480  THR C N     1 
ATOM   7375  C  CA    . THR C 2  480  ? 10.530  -47.261 95.015  1.00 62.06  ? 480  THR C CA    1 
ATOM   7376  C  C     . THR C 2  480  ? 11.237  -45.915 95.048  1.00 66.24  ? 480  THR C C     1 
ATOM   7377  O  O     . THR C 2  480  ? 10.595  -44.867 95.004  1.00 68.90  ? 480  THR C O     1 
ATOM   7378  C  CB    . THR C 2  480  ? 11.016  -48.032 93.778  1.00 67.81  ? 480  THR C CB    1 
ATOM   7379  O  OG1   . THR C 2  480  ? 10.942  -47.185 92.625  1.00 68.29  ? 480  THR C OG1   1 
ATOM   7380  C  CG2   . THR C 2  480  ? 10.160  -49.268 93.549  1.00 71.88  ? 480  THR C CG2   1 
ATOM   7381  N  N     . ASP C 2  481  ? 12.561  -45.949 95.137  1.00 65.81  ? 481  ASP C N     1 
ATOM   7382  C  CA    . ASP C 2  481  ? 13.359  -44.736 95.006  1.00 64.82  ? 481  ASP C CA    1 
ATOM   7383  C  C     . ASP C 2  481  ? 13.906  -44.591 93.587  1.00 65.34  ? 481  ASP C C     1 
ATOM   7384  O  O     . ASP C 2  481  ? 14.631  -43.642 93.284  1.00 61.61  ? 481  ASP C O     1 
ATOM   7385  C  CB    . ASP C 2  481  ? 14.488  -44.705 96.039  1.00 64.32  ? 481  ASP C CB    1 
ATOM   7386  C  CG    . ASP C 2  481  ? 13.978  -44.477 97.451  1.00 77.97  ? 481  ASP C CG    1 
ATOM   7387  O  OD1   . ASP C 2  481  ? 12.823  -44.024 97.600  1.00 79.59  ? 481  ASP C OD1   1 
ATOM   7388  O  OD2   . ASP C 2  481  ? 14.733  -44.743 98.411  1.00 85.32  ? 481  ASP C OD2   1 
ATOM   7389  N  N     . GLU C 2  482  ? 13.558  -45.540 92.723  1.00 63.48  ? 482  GLU C N     1 
ATOM   7390  C  CA    . GLU C 2  482  ? 13.964  -45.484 91.323  1.00 61.09  ? 482  GLU C CA    1 
ATOM   7391  C  C     . GLU C 2  482  ? 13.210  -44.373 90.604  1.00 66.37  ? 482  GLU C C     1 
ATOM   7392  O  O     . GLU C 2  482  ? 11.977  -44.342 90.609  1.00 65.02  ? 482  GLU C O     1 
ATOM   7393  C  CB    . GLU C 2  482  ? 13.700  -46.819 90.622  1.00 65.07  ? 482  GLU C CB    1 
ATOM   7394  C  CG    . GLU C 2  482  ? 14.154  -46.844 89.166  1.00 69.24  ? 482  GLU C CG    1 
ATOM   7395  C  CD    . GLU C 2  482  ? 13.340  -47.794 88.307  1.00 69.80  ? 482  GLU C CD    1 
ATOM   7396  O  OE1   . GLU C 2  482  ? 13.649  -47.920 87.102  1.00 66.97  ? 482  GLU C OE1   1 
ATOM   7397  O  OE2   . GLU C 2  482  ? 12.388  -48.409 88.834  1.00 64.59  ? 482  GLU C OE2   1 
ATOM   7398  N  N     . VAL C 2  483  ? 13.953  -43.467 89.978  1.00 63.19  ? 483  VAL C N     1 
ATOM   7399  C  CA    . VAL C 2  483  ? 13.352  -42.335 89.287  1.00 48.63  ? 483  VAL C CA    1 
ATOM   7400  C  C     . VAL C 2  483  ? 13.518  -42.462 87.777  1.00 41.82  ? 483  VAL C C     1 
ATOM   7401  O  O     . VAL C 2  483  ? 14.577  -42.850 87.291  1.00 53.51  ? 483  VAL C O     1 
ATOM   7402  C  CB    . VAL C 2  483  ? 13.966  -41.009 89.756  1.00 39.63  ? 483  VAL C CB    1 
ATOM   7403  C  CG1   . VAL C 2  483  ? 13.133  -39.848 89.269  1.00 41.97  ? 483  VAL C CG1   1 
ATOM   7404  C  CG2   . VAL C 2  483  ? 14.077  -40.988 91.270  1.00 45.99  ? 483  VAL C CG2   1 
ATOM   7405  N  N     . VAL C 2  484  ? 12.462  -42.140 87.040  1.00 43.47  ? 484  VAL C N     1 
ATOM   7406  C  CA    . VAL C 2  484  ? 12.491  -42.208 85.585  1.00 49.76  ? 484  VAL C CA    1 
ATOM   7407  C  C     . VAL C 2  484  ? 12.004  -40.904 84.957  1.00 52.46  ? 484  VAL C C     1 
ATOM   7408  O  O     . VAL C 2  484  ? 10.872  -40.476 85.192  1.00 50.98  ? 484  VAL C O     1 
ATOM   7409  C  CB    . VAL C 2  484  ? 11.625  -43.370 85.062  1.00 44.28  ? 484  VAL C CB    1 
ATOM   7410  C  CG1   . VAL C 2  484  ? 11.474  -43.288 83.548  1.00 37.54  ? 484  VAL C CG1   1 
ATOM   7411  C  CG2   . VAL C 2  484  ? 12.222  -44.705 85.480  1.00 54.78  ? 484  VAL C CG2   1 
ATOM   7412  N  N     . TYR C 2  485  ? 12.868  -40.272 84.168  1.00 41.94  ? 485  TYR C N     1 
ATOM   7413  C  CA    . TYR C 2  485  ? 12.492  -39.071 83.433  1.00 37.18  ? 485  TYR C CA    1 
ATOM   7414  C  C     . TYR C 2  485  ? 11.741  -39.451 82.162  1.00 41.01  ? 485  TYR C C     1 
ATOM   7415  O  O     . TYR C 2  485  ? 12.189  -40.310 81.403  1.00 42.83  ? 485  TYR C O     1 
ATOM   7416  C  CB    . TYR C 2  485  ? 13.728  -38.249 83.081  1.00 40.26  ? 485  TYR C CB    1 
ATOM   7417  C  CG    . TYR C 2  485  ? 14.270  -37.415 84.220  1.00 44.44  ? 485  TYR C CG    1 
ATOM   7418  C  CD1   . TYR C 2  485  ? 15.173  -37.945 85.131  1.00 45.28  ? 485  TYR C CD1   1 
ATOM   7419  C  CD2   . TYR C 2  485  ? 13.889  -36.089 84.374  1.00 45.27  ? 485  TYR C CD2   1 
ATOM   7420  C  CE1   . TYR C 2  485  ? 15.675  -37.177 86.166  1.00 47.48  ? 485  TYR C CE1   1 
ATOM   7421  C  CE2   . TYR C 2  485  ? 14.388  -35.316 85.402  1.00 42.15  ? 485  TYR C CE2   1 
ATOM   7422  C  CZ    . TYR C 2  485  ? 15.276  -35.864 86.296  1.00 46.54  ? 485  TYR C CZ    1 
ATOM   7423  O  OH    . TYR C 2  485  ? 15.767  -35.089 87.321  1.00 49.89  ? 485  TYR C OH    1 
ATOM   7424  N  N     . MET C 2  486  ? 10.600  -38.810 81.928  1.00 40.84  ? 486  MET C N     1 
ATOM   7425  C  CA    . MET C 2  486  ? 9.760   -39.171 80.791  1.00 42.04  ? 486  MET C CA    1 
ATOM   7426  C  C     . MET C 2  486  ? 9.474   -38.017 79.837  1.00 40.08  ? 486  MET C C     1 
ATOM   7427  O  O     . MET C 2  486  ? 9.329   -36.869 80.254  1.00 37.39  ? 486  MET C O     1 
ATOM   7428  C  CB    . MET C 2  486  ? 8.424   -39.739 81.271  1.00 41.36  ? 486  MET C CB    1 
ATOM   7429  C  CG    . MET C 2  486  ? 8.532   -40.866 82.269  1.00 41.70  ? 486  MET C CG    1 
ATOM   7430  S  SD    . MET C 2  486  ? 6.919   -41.613 82.548  1.00 48.05  ? 486  MET C SD    1 
ATOM   7431  C  CE    . MET C 2  486  ? 7.222   -42.472 84.085  1.00 49.77  ? 486  MET C CE    1 
ATOM   7432  N  N     . THR C 2  487  ? 9.392   -38.342 78.552  1.00 35.94  ? 487  THR C N     1 
ATOM   7433  C  CA    . THR C 2  487  ? 8.814   -37.443 77.569  1.00 33.81  ? 487  THR C CA    1 
ATOM   7434  C  C     . THR C 2  487  ? 7.303   -37.464 77.754  1.00 37.81  ? 487  THR C C     1 
ATOM   7435  O  O     . THR C 2  487  ? 6.762   -38.397 78.347  1.00 39.95  ? 487  THR C O     1 
ATOM   7436  C  CB    . THR C 2  487  ? 9.134   -37.901 76.148  1.00 34.42  ? 487  THR C CB    1 
ATOM   7437  O  OG1   . THR C 2  487  ? 8.531   -39.179 75.915  1.00 38.67  ? 487  THR C OG1   1 
ATOM   7438  C  CG2   . THR C 2  487  ? 10.636  -38.008 75.954  1.00 35.45  ? 487  THR C CG2   1 
ATOM   7439  N  N     . ALA C 2  488  ? 6.624   -36.438 77.253  1.00 40.02  ? 488  ALA C N     1 
ATOM   7440  C  CA    . ALA C 2  488  ? 5.172   -36.350 77.379  1.00 41.39  ? 488  ALA C CA    1 
ATOM   7441  C  C     . ALA C 2  488  ? 4.474   -37.551 76.744  1.00 42.09  ? 488  ALA C C     1 
ATOM   7442  O  O     . ALA C 2  488  ? 3.480   -38.059 77.275  1.00 42.22  ? 488  ALA C O     1 
ATOM   7443  C  CB    . ALA C 2  488  ? 4.666   -35.051 76.779  1.00 37.74  ? 488  ALA C CB    1 
ATOM   7444  N  N     . THR C 2  489  ? 5.013   -38.008 75.616  1.00 36.53  ? 489  THR C N     1 
ATOM   7445  C  CA    . THR C 2  489  ? 4.474   -39.171 74.925  1.00 34.98  ? 489  THR C CA    1 
ATOM   7446  C  C     . THR C 2  489  ? 4.565   -40.411 75.808  1.00 45.28  ? 489  THR C C     1 
ATOM   7447  O  O     . THR C 2  489  ? 3.644   -41.227 75.843  1.00 50.22  ? 489  THR C O     1 
ATOM   7448  C  CB    . THR C 2  489  ? 5.214   -39.439 73.606  1.00 34.58  ? 489  THR C CB    1 
ATOM   7449  O  OG1   . THR C 2  489  ? 5.203   -38.255 72.797  1.00 39.84  ? 489  THR C OG1   1 
ATOM   7450  C  CG2   . THR C 2  489  ? 4.547   -40.573 72.846  1.00 39.02  ? 489  THR C CG2   1 
ATOM   7451  N  N     . GLU C 2  490  ? 5.676   -40.546 76.525  1.00 45.51  ? 490  GLU C N     1 
ATOM   7452  C  CA    . GLU C 2  490  ? 5.855   -41.666 77.443  1.00 44.18  ? 490  GLU C CA    1 
ATOM   7453  C  C     . GLU C 2  490  ? 5.039   -41.481 78.720  1.00 47.34  ? 490  GLU C C     1 
ATOM   7454  O  O     . GLU C 2  490  ? 4.575   -42.455 79.311  1.00 56.30  ? 490  GLU C O     1 
ATOM   7455  C  CB    . GLU C 2  490  ? 7.335   -41.873 77.771  1.00 46.39  ? 490  GLU C CB    1 
ATOM   7456  C  CG    . GLU C 2  490  ? 7.988   -43.021 77.004  1.00 59.42  ? 490  GLU C CG    1 
ATOM   7457  C  CD    . GLU C 2  490  ? 7.589   -44.395 77.532  1.00 59.51  ? 490  GLU C CD    1 
ATOM   7458  O  OE1   . GLU C 2  490  ? 7.166   -45.247 76.722  1.00 54.00  ? 490  GLU C OE1   1 
ATOM   7459  O  OE2   . GLU C 2  490  ? 7.711   -44.628 78.754  1.00 52.55  ? 490  GLU C OE2   1 
ATOM   7460  N  N     . GLU C 2  491  ? 4.867   -40.233 79.142  1.00 46.55  ? 491  GLU C N     1 
ATOM   7461  C  CA    . GLU C 2  491  ? 4.036   -39.933 80.303  1.00 47.18  ? 491  GLU C CA    1 
ATOM   7462  C  C     . GLU C 2  491  ? 2.592   -40.355 80.052  1.00 46.93  ? 491  GLU C C     1 
ATOM   7463  O  O     . GLU C 2  491  ? 1.913   -40.842 80.954  1.00 46.68  ? 491  GLU C O     1 
ATOM   7464  C  CB    . GLU C 2  491  ? 4.094   -38.440 80.646  1.00 49.87  ? 491  GLU C CB    1 
ATOM   7465  C  CG    . GLU C 2  491  ? 3.137   -38.022 81.760  1.00 49.43  ? 491  GLU C CG    1 
ATOM   7466  C  CD    . GLU C 2  491  ? 3.218   -36.542 82.092  1.00 45.49  ? 491  GLU C CD    1 
ATOM   7467  O  OE1   . GLU C 2  491  ? 2.214   -35.828 81.875  1.00 42.56  ? 491  GLU C OE1   1 
ATOM   7468  O  OE2   . GLU C 2  491  ? 4.279   -36.094 82.578  1.00 39.31  ? 491  GLU C OE2   1 
ATOM   7469  N  N     . ASP C 2  492  ? 2.136   -40.178 78.814  1.00 49.38  ? 492  ASP C N     1 
ATOM   7470  C  CA    . ASP C 2  492  ? 0.767   -40.529 78.434  1.00 47.99  ? 492  ASP C CA    1 
ATOM   7471  C  C     . ASP C 2  492  ? 0.445   -42.017 78.583  1.00 51.45  ? 492  ASP C C     1 
ATOM   7472  O  O     . ASP C 2  492  ? -0.722  -42.403 78.569  1.00 54.99  ? 492  ASP C O     1 
ATOM   7473  C  CB    . ASP C 2  492  ? 0.485   -40.094 76.991  1.00 48.33  ? 492  ASP C CB    1 
ATOM   7474  C  CG    . ASP C 2  492  ? 0.009   -38.657 76.893  1.00 45.86  ? 492  ASP C CG    1 
ATOM   7475  O  OD1   . ASP C 2  492  ? -0.336  -38.223 75.773  1.00 39.34  ? 492  ASP C OD1   1 
ATOM   7476  O  OD2   . ASP C 2  492  ? -0.031  -37.968 77.934  1.00 50.78  ? 492  ASP C OD2   1 
ATOM   7477  N  N     . ARG C 2  493  ? 1.473   -42.848 78.725  1.00 55.48  ? 493  ARG C N     1 
ATOM   7478  C  CA    . ARG C 2  493  ? 1.284   -44.298 78.744  1.00 57.46  ? 493  ARG C CA    1 
ATOM   7479  C  C     . ARG C 2  493  ? 0.954   -44.868 80.122  1.00 57.19  ? 493  ARG C C     1 
ATOM   7480  O  O     . ARG C 2  493  ? 0.614   -46.044 80.242  1.00 65.51  ? 493  ARG C O     1 
ATOM   7481  C  CB    . ARG C 2  493  ? 2.519   -45.013 78.181  1.00 59.24  ? 493  ARG C CB    1 
ATOM   7482  C  CG    . ARG C 2  493  ? 2.776   -44.758 76.702  1.00 66.34  ? 493  ARG C CG    1 
ATOM   7483  C  CD    . ARG C 2  493  ? 3.893   -45.645 76.159  1.00 66.94  ? 493  ARG C CD    1 
ATOM   7484  N  NE    . ARG C 2  493  ? 3.513   -47.056 76.104  1.00 72.54  ? 493  ARG C NE    1 
ATOM   7485  C  CZ    . ARG C 2  493  ? 3.900   -47.975 76.985  1.00 73.00  ? 493  ARG C CZ    1 
ATOM   7486  N  NH1   . ARG C 2  493  ? 4.687   -47.636 77.998  1.00 68.96  ? 493  ARG C NH1   1 
ATOM   7487  N  NH2   . ARG C 2  493  ? 3.503   -49.234 76.852  1.00 66.92  ? 493  ARG C NH2   1 
ATOM   7488  N  N     . TYR C 2  494  ? 1.047   -44.045 81.161  1.00 53.03  ? 494  TYR C N     1 
ATOM   7489  C  CA    . TYR C 2  494  ? 0.927   -44.567 82.520  1.00 53.70  ? 494  TYR C CA    1 
ATOM   7490  C  C     . TYR C 2  494  ? -0.158  -43.904 83.359  1.00 51.38  ? 494  TYR C C     1 
ATOM   7491  O  O     . TYR C 2  494  ? -0.850  -42.992 82.909  1.00 55.14  ? 494  TYR C O     1 
ATOM   7492  C  CB    . TYR C 2  494  ? 2.271   -44.468 83.247  1.00 52.48  ? 494  TYR C CB    1 
ATOM   7493  C  CG    . TYR C 2  494  ? 3.415   -45.094 82.486  1.00 56.47  ? 494  TYR C CG    1 
ATOM   7494  C  CD1   . TYR C 2  494  ? 3.445   -46.460 82.246  1.00 60.55  ? 494  TYR C CD1   1 
ATOM   7495  C  CD2   . TYR C 2  494  ? 4.463   -44.321 82.007  1.00 57.53  ? 494  TYR C CD2   1 
ATOM   7496  C  CE1   . TYR C 2  494  ? 4.483   -47.040 81.548  1.00 63.74  ? 494  TYR C CE1   1 
ATOM   7497  C  CE2   . TYR C 2  494  ? 5.509   -44.893 81.309  1.00 61.99  ? 494  TYR C CE2   1 
ATOM   7498  C  CZ    . TYR C 2  494  ? 5.512   -46.253 81.082  1.00 67.81  ? 494  TYR C CZ    1 
ATOM   7499  O  OH    . TYR C 2  494  ? 6.549   -46.832 80.387  1.00 83.52  ? 494  TYR C OH    1 
ATOM   7500  N  N     . THR C 2  495  ? -0.294  -44.392 84.587  1.00 42.70  ? 495  THR C N     1 
ATOM   7501  C  CA    . THR C 2  495  ? -1.191  -43.810 85.569  1.00 43.87  ? 495  THR C CA    1 
ATOM   7502  C  C     . THR C 2  495  ? -0.325  -43.260 86.693  1.00 48.05  ? 495  THR C C     1 
ATOM   7503  O  O     . THR C 2  495  ? 0.321   -44.022 87.408  1.00 49.11  ? 495  THR C O     1 
ATOM   7504  C  CB    . THR C 2  495  ? -2.154  -44.866 86.132  1.00 46.45  ? 495  THR C CB    1 
ATOM   7505  O  OG1   . THR C 2  495  ? -2.931  -45.427 85.067  1.00 42.62  ? 495  THR C OG1   1 
ATOM   7506  C  CG2   . THR C 2  495  ? -3.083  -44.248 87.157  1.00 50.49  ? 495  THR C CG2   1 
ATOM   7507  N  N     . ILE C 2  496  ? -0.302  -41.938 86.847  1.00 54.96  ? 496  ILE C N     1 
ATOM   7508  C  CA    . ILE C 2  496  ? 0.665   -41.309 87.752  1.00 54.13  ? 496  ILE C CA    1 
ATOM   7509  C  C     . ILE C 2  496  ? 0.047   -40.652 88.990  1.00 47.02  ? 496  ILE C C     1 
ATOM   7510  O  O     . ILE C 2  496  ? -0.648  -39.644 88.886  1.00 51.98  ? 496  ILE C O     1 
ATOM   7511  C  CB    . ILE C 2  496  ? 1.527   -40.271 87.004  1.00 50.43  ? 496  ILE C CB    1 
ATOM   7512  C  CG1   . ILE C 2  496  ? 2.043   -40.863 85.690  1.00 43.71  ? 496  ILE C CG1   1 
ATOM   7513  C  CG2   . ILE C 2  496  ? 2.670   -39.792 87.888  1.00 44.76  ? 496  ILE C CG2   1 
ATOM   7514  C  CD1   . ILE C 2  496  ? 2.856   -39.899 84.860  1.00 41.45  ? 496  ILE C CD1   1 
ATOM   7515  N  N     . ALA C 2  497  ? 0.327   -41.216 90.161  1.00 39.14  ? 497  ALA C N     1 
ATOM   7516  C  CA    . ALA C 2  497  ? -0.246  -40.724 91.411  1.00 43.40  ? 497  ALA C CA    1 
ATOM   7517  C  C     . ALA C 2  497  ? 0.359   -39.397 91.857  1.00 49.22  ? 497  ALA C C     1 
ATOM   7518  O  O     . ALA C 2  497  ? 1.494   -39.073 91.509  1.00 53.45  ? 497  ALA C O     1 
ATOM   7519  C  CB    . ALA C 2  497  ? -0.093  -41.764 92.505  1.00 47.04  ? 497  ALA C CB    1 
ATOM   7520  N  N     . GLN C 2  498  ? -0.407  -38.637 92.635  1.00 49.07  ? 498  GLN C N     1 
ATOM   7521  C  CA    . GLN C 2  498  ? 0.041   -37.343 93.143  1.00 46.98  ? 498  GLN C CA    1 
ATOM   7522  C  C     . GLN C 2  498  ? 1.049   -37.493 94.278  1.00 44.56  ? 498  GLN C C     1 
ATOM   7523  O  O     . GLN C 2  498  ? 1.066   -38.507 94.973  1.00 49.49  ? 498  GLN C O     1 
ATOM   7524  C  CB    . GLN C 2  498  ? -1.156  -36.511 93.608  1.00 51.45  ? 498  GLN C CB    1 
ATOM   7525  C  CG    . GLN C 2  498  ? -1.925  -35.850 92.477  1.00 45.91  ? 498  GLN C CG    1 
ATOM   7526  C  CD    . GLN C 2  498  ? -1.147  -34.719 91.836  1.00 42.25  ? 498  GLN C CD    1 
ATOM   7527  O  OE1   . GLN C 2  498  ? -0.824  -33.724 92.488  1.00 37.52  ? 498  GLN C OE1   1 
ATOM   7528  N  NE2   . GLN C 2  498  ? -0.833  -34.871 90.555  1.00 39.47  ? 498  GLN C NE2   1 
ATOM   7529  N  N     . ALA C 2  499  ? 1.877   -36.470 94.468  1.00 41.71  ? 499  ALA C N     1 
ATOM   7530  C  CA    . ALA C 2  499  ? 2.985   -36.538 95.420  1.00 44.80  ? 499  ALA C CA    1 
ATOM   7531  C  C     . ALA C 2  499  ? 2.574   -36.391 96.883  1.00 45.00  ? 499  ALA C C     1 
ATOM   7532  O  O     . ALA C 2  499  ? 3.352   -36.708 97.781  1.00 51.64  ? 499  ALA C O     1 
ATOM   7533  C  CB    . ALA C 2  499  ? 4.046   -35.504 95.071  1.00 45.11  ? 499  ALA C CB    1 
ATOM   7534  N  N     . ASN C 2  500  ? 1.364   -35.905 97.129  1.00 45.41  ? 500  ASN C N     1 
ATOM   7535  C  CA    . ASN C 2  500  ? 0.925   -35.676 98.500  1.00 52.25  ? 500  ASN C CA    1 
ATOM   7536  C  C     . ASN C 2  500  ? 0.145   -36.854 99.075  1.00 60.00  ? 500  ASN C C     1 
ATOM   7537  O  O     . ASN C 2  500  ? -0.277  -36.825 100.229 1.00 68.88  ? 500  ASN C O     1 
ATOM   7538  C  CB    . ASN C 2  500  ? 0.115   -34.377 98.611  1.00 56.16  ? 500  ASN C CB    1 
ATOM   7539  C  CG    . ASN C 2  500  ? -1.335  -34.544 98.181  1.00 62.62  ? 500  ASN C CG    1 
ATOM   7540  O  OD1   . ASN C 2  500  ? -1.659  -35.372 97.328  1.00 62.64  ? 500  ASN C OD1   1 
ATOM   7541  N  ND2   . ASN C 2  500  ? -2.216  -33.747 98.773  1.00 61.42  ? 500  ASN C ND2   1 
ATOM   7542  N  N     . THR C 2  501  ? -0.044  -37.887 98.259  1.00 60.03  ? 501  THR C N     1 
ATOM   7543  C  CA    . THR C 2  501  ? -0.784  -39.072 98.679  1.00 59.89  ? 501  THR C CA    1 
ATOM   7544  C  C     . THR C 2  501  ? -0.048  -39.807 99.799  1.00 60.62  ? 501  THR C C     1 
ATOM   7545  O  O     . THR C 2  501  ? 1.171   -39.977 99.736  1.00 58.31  ? 501  THR C O     1 
ATOM   7546  C  CB    . THR C 2  501  ? -1.052  -40.020 97.492  1.00 58.91  ? 501  THR C CB    1 
ATOM   7547  O  OG1   . THR C 2  501  ? 0.191   -40.507 96.970  1.00 50.91  ? 501  THR C OG1   1 
ATOM   7548  C  CG2   . THR C 2  501  ? -1.805  -39.284 96.392  1.00 55.38  ? 501  THR C CG2   1 
ATOM   7549  N  N     . PRO C 2  502  ? -0.793  -40.233 100.834 1.00 64.46  ? 502  PRO C N     1 
ATOM   7550  C  CA    . PRO C 2  502  ? -0.241  -40.813 102.066 1.00 62.59  ? 502  PRO C CA    1 
ATOM   7551  C  C     . PRO C 2  502  ? 0.628   -42.044 101.836 1.00 65.96  ? 502  PRO C C     1 
ATOM   7552  O  O     . PRO C 2  502  ? 0.350   -42.859 100.955 1.00 61.50  ? 502  PRO C O     1 
ATOM   7553  C  CB    . PRO C 2  502  ? -1.492  -41.195 102.863 1.00 63.51  ? 502  PRO C CB    1 
ATOM   7554  C  CG    . PRO C 2  502  ? -2.552  -40.288 102.353 1.00 71.69  ? 502  PRO C CG    1 
ATOM   7555  C  CD    . PRO C 2  502  ? -2.261  -40.129 100.892 1.00 68.16  ? 502  PRO C CD    1 
ATOM   7556  N  N     . LEU C 2  503  ? 1.684   -42.159 102.634 1.00 70.46  ? 503  LEU C N     1 
ATOM   7557  C  CA    . LEU C 2  503  ? 2.587   -43.297 102.570 1.00 71.66  ? 503  LEU C CA    1 
ATOM   7558  C  C     . LEU C 2  503  ? 3.034   -43.711 103.966 1.00 80.48  ? 503  LEU C C     1 
ATOM   7559  O  O     . LEU C 2  503  ? 3.449   -42.874 104.769 1.00 77.89  ? 503  LEU C O     1 
ATOM   7560  C  CB    . LEU C 2  503  ? 3.827   -42.954 101.738 1.00 64.24  ? 503  LEU C CB    1 
ATOM   7561  C  CG    . LEU C 2  503  ? 3.683   -42.643 100.249 1.00 61.65  ? 503  LEU C CG    1 
ATOM   7562  C  CD1   . LEU C 2  503  ? 5.010   -42.149 99.700  1.00 66.00  ? 503  LEU C CD1   1 
ATOM   7563  C  CD2   . LEU C 2  503  ? 3.214   -43.863 99.481  1.00 58.82  ? 503  LEU C CD2   1 
ATOM   7564  N  N     . GLU C 2  504  ? 2.946   -45.005 104.253 1.00 80.28  ? 504  GLU C N     1 
ATOM   7565  C  CA    . GLU C 2  504  ? 3.607   -45.568 105.423 1.00 76.60  ? 504  GLU C CA    1 
ATOM   7566  C  C     . GLU C 2  504  ? 4.809   -46.370 104.934 1.00 77.13  ? 504  GLU C C     1 
ATOM   7567  O  O     . GLU C 2  504  ? 4.658   -47.394 104.269 1.00 77.69  ? 504  GLU C O     1 
ATOM   7568  C  CB    . GLU C 2  504  ? 2.646   -46.433 106.243 1.00 75.09  ? 504  GLU C CB    1 
ATOM   7569  C  CG    . GLU C 2  504  ? 1.785   -47.380 105.421 1.00 88.75  ? 504  GLU C CG    1 
ATOM   7570  C  CD    . GLU C 2  504  ? 0.791   -48.149 106.269 1.00 93.94  ? 504  GLU C CD    1 
ATOM   7571  O  OE1   . GLU C 2  504  ? 0.536   -47.726 107.416 1.00 100.13 ? 504  GLU C OE1   1 
ATOM   7572  O  OE2   . GLU C 2  504  ? 0.267   -49.176 105.787 1.00 90.78  ? 504  GLU C OE2   1 
ATOM   7573  N  N     . GLY C 2  505  ? 6.006   -45.885 105.245 1.00 73.05  ? 505  GLY C N     1 
ATOM   7574  C  CA    . GLY C 2  505  ? 7.213   -46.453 104.675 1.00 74.82  ? 505  GLY C CA    1 
ATOM   7575  C  C     . GLY C 2  505  ? 7.230   -46.215 103.178 1.00 69.30  ? 505  GLY C C     1 
ATOM   7576  O  O     . GLY C 2  505  ? 7.082   -45.082 102.723 1.00 83.58  ? 505  GLY C O     1 
ATOM   7577  N  N     . ASN C 2  506  ? 7.417   -47.280 102.408 1.00 56.44  ? 506  ASN C N     1 
ATOM   7578  C  CA    . ASN C 2  506  ? 7.351   -47.193 100.954 1.00 61.98  ? 506  ASN C CA    1 
ATOM   7579  C  C     . ASN C 2  506  ? 5.992   -47.588 100.378 1.00 69.81  ? 506  ASN C C     1 
ATOM   7580  O  O     . ASN C 2  506  ? 5.827   -47.670 99.161  1.00 66.78  ? 506  ASN C O     1 
ATOM   7581  C  CB    . ASN C 2  506  ? 8.470   -48.009 100.313 1.00 61.56  ? 506  ASN C CB    1 
ATOM   7582  C  CG    . ASN C 2  506  ? 9.830   -47.378 100.514 1.00 80.38  ? 506  ASN C CG    1 
ATOM   7583  O  OD1   . ASN C 2  506  ? 10.391  -47.424 101.608 1.00 90.36  ? 506  ASN C OD1   1 
ATOM   7584  N  ND2   . ASN C 2  506  ? 10.366  -46.776 99.459  1.00 82.38  ? 506  ASN C ND2   1 
ATOM   7585  N  N     . ARG C 2  507  ? 5.030   -47.848 101.259 1.00 71.38  ? 507  ARG C N     1 
ATOM   7586  C  CA    . ARG C 2  507  ? 3.718   -48.341 100.841 1.00 77.82  ? 507  ARG C CA    1 
ATOM   7587  C  C     . ARG C 2  507  ? 2.628   -47.269 100.874 1.00 74.01  ? 507  ARG C C     1 
ATOM   7588  O  O     . ARG C 2  507  ? 2.574   -46.446 101.788 1.00 70.69  ? 507  ARG C O     1 
ATOM   7589  C  CB    . ARG C 2  507  ? 3.300   -49.540 101.701 1.00 89.76  ? 507  ARG C CB    1 
ATOM   7590  C  CG    . ARG C 2  507  ? 1.972   -50.170 101.300 1.00 85.55  ? 507  ARG C CG    1 
ATOM   7591  C  CD    . ARG C 2  507  ? 1.662   -51.397 102.140 1.00 91.93  ? 507  ARG C CD    1 
ATOM   7592  N  NE    . ARG C 2  507  ? 2.708   -52.411 102.031 1.00 111.56 ? 507  ARG C NE    1 
ATOM   7593  C  CZ    . ARG C 2  507  ? 2.773   -53.319 101.061 1.00 113.98 ? 507  ARG C CZ    1 
ATOM   7594  N  NH1   . ARG C 2  507  ? 1.852   -53.342 100.106 1.00 105.21 ? 507  ARG C NH1   1 
ATOM   7595  N  NH2   . ARG C 2  507  ? 3.761   -54.204 101.044 1.00 106.09 ? 507  ARG C NH2   1 
ATOM   7596  N  N     . ILE C 2  508  ? 1.757   -47.299 99.870  1.00 69.13  ? 508  ILE C N     1 
ATOM   7597  C  CA    . ILE C 2  508  ? 0.651   -46.356 99.771  1.00 67.04  ? 508  ILE C CA    1 
ATOM   7598  C  C     . ILE C 2  508  ? -0.403  -46.647 100.832 1.00 67.22  ? 508  ILE C C     1 
ATOM   7599  O  O     . ILE C 2  508  ? -0.933  -47.753 100.903 1.00 71.24  ? 508  ILE C O     1 
ATOM   7600  C  CB    . ILE C 2  508  ? 0.002   -46.420 98.382  1.00 68.25  ? 508  ILE C CB    1 
ATOM   7601  C  CG1   . ILE C 2  508  ? 1.075   -46.325 97.296  1.00 64.55  ? 508  ILE C CG1   1 
ATOM   7602  C  CG2   . ILE C 2  508  ? -1.033  -45.317 98.228  1.00 75.69  ? 508  ILE C CG2   1 
ATOM   7603  C  CD1   . ILE C 2  508  ? 0.544   -46.486 95.893  1.00 62.33  ? 508  ILE C CD1   1 
ATOM   7604  N  N     . ALA C 2  509  ? -0.711  -45.643 101.645 1.00 71.89  ? 509  ALA C N     1 
ATOM   7605  C  CA    . ALA C 2  509  ? -1.577  -45.831 102.806 1.00 76.16  ? 509  ALA C CA    1 
ATOM   7606  C  C     . ALA C 2  509  ? -3.055  -45.493 102.574 1.00 75.34  ? 509  ALA C C     1 
ATOM   7607  O  O     . ALA C 2  509  ? -3.859  -45.555 103.503 1.00 88.89  ? 509  ALA C O     1 
ATOM   7608  C  CB    . ALA C 2  509  ? -1.033  -45.050 103.999 1.00 75.26  ? 509  ALA C CB    1 
ATOM   7609  N  N     . ALA C 2  510  ? -3.415  -45.129 101.348 1.00 60.82  ? 510  ALA C N     1 
ATOM   7610  C  CA    . ALA C 2  510  ? -4.799  -44.765 101.055 1.00 66.82  ? 510  ALA C CA    1 
ATOM   7611  C  C     . ALA C 2  510  ? -5.479  -45.796 100.161 1.00 71.58  ? 510  ALA C C     1 
ATOM   7612  O  O     . ALA C 2  510  ? -4.845  -46.384 99.286  1.00 74.68  ? 510  ALA C O     1 
ATOM   7613  C  CB    . ALA C 2  510  ? -4.863  -43.381 100.420 1.00 73.35  ? 510  ALA C CB    1 
ATOM   7614  N  N     . GLU C 2  511  ? -6.771  -46.017 100.387 1.00 69.91  ? 511  GLU C N     1 
ATOM   7615  C  CA    . GLU C 2  511  ? -7.529  -46.955 99.568  1.00 74.36  ? 511  GLU C CA    1 
ATOM   7616  C  C     . GLU C 2  511  ? -7.840  -46.328 98.215  1.00 74.97  ? 511  GLU C C     1 
ATOM   7617  O  O     . GLU C 2  511  ? -7.795  -46.994 97.180  1.00 72.57  ? 511  GLU C O     1 
ATOM   7618  C  CB    . GLU C 2  511  ? -8.829  -47.364 100.263 1.00 83.57  ? 511  GLU C CB    1 
ATOM   7619  C  CG    . GLU C 2  511  ? -9.556  -48.513 99.574  1.00 101.61 ? 511  GLU C CG    1 
ATOM   7620  C  CD    . GLU C 2  511  ? -11.067 -48.430 99.715  1.00 112.26 ? 511  GLU C CD    1 
ATOM   7621  O  OE1   . GLU C 2  511  ? -11.729 -49.490 99.680  1.00 110.01 ? 511  GLU C OE1   1 
ATOM   7622  O  OE2   . GLU C 2  511  ? -11.595 -47.305 99.849  1.00 109.64 ? 511  GLU C OE2   1 
ATOM   7623  N  N     . ARG C 2  512  ? -8.161  -45.039 98.235  1.00 76.64  ? 512  ARG C N     1 
ATOM   7624  C  CA    . ARG C 2  512  ? -8.449  -44.299 97.014  1.00 72.06  ? 512  ARG C CA    1 
ATOM   7625  C  C     . ARG C 2  512  ? -7.382  -43.231 96.796  1.00 70.64  ? 512  ARG C C     1 
ATOM   7626  O  O     . ARG C 2  512  ? -7.283  -42.272 97.562  1.00 74.89  ? 512  ARG C O     1 
ATOM   7627  C  CB    . ARG C 2  512  ? -9.845  -43.674 97.088  1.00 76.48  ? 512  ARG C CB    1 
ATOM   7628  C  CG    . ARG C 2  512  ? -10.953 -44.698 97.311  1.00 83.44  ? 512  ARG C CG    1 
ATOM   7629  C  CD    . ARG C 2  512  ? -12.269 -44.051 97.727  1.00 86.99  ? 512  ARG C CD    1 
ATOM   7630  N  NE    . ARG C 2  512  ? -12.973 -43.430 96.608  1.00 81.01  ? 512  ARG C NE    1 
ATOM   7631  C  CZ    . ARG C 2  512  ? -12.986 -42.124 96.365  1.00 80.21  ? 512  ARG C CZ    1 
ATOM   7632  N  NH1   . ARG C 2  512  ? -12.332 -41.291 97.163  1.00 90.08  ? 512  ARG C NH1   1 
ATOM   7633  N  NH2   . ARG C 2  512  ? -13.657 -41.650 95.323  1.00 68.52  ? 512  ARG C NH2   1 
ATOM   7634  N  N     . VAL C 2  513  ? -6.580  -43.414 95.752  1.00 64.23  ? 513  VAL C N     1 
ATOM   7635  C  CA    . VAL C 2  513  ? -5.461  -42.523 95.469  1.00 58.16  ? 513  VAL C CA    1 
ATOM   7636  C  C     . VAL C 2  513  ? -5.724  -41.678 94.219  1.00 55.13  ? 513  VAL C C     1 
ATOM   7637  O  O     . VAL C 2  513  ? -6.307  -42.155 93.240  1.00 50.84  ? 513  VAL C O     1 
ATOM   7638  C  CB    . VAL C 2  513  ? -4.127  -43.315 95.347  1.00 54.11  ? 513  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C 2  513  ? -4.217  -44.363 94.253  1.00 55.92  ? 513  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C 2  513  ? -2.952  -42.385 95.099  1.00 52.74  ? 513  VAL C CG2   1 
ATOM   7641  N  N     . VAL C 2  514  ? -5.309  -40.415 94.275  1.00 57.68  ? 514  VAL C N     1 
ATOM   7642  C  CA    . VAL C 2  514  ? -5.486  -39.480 93.170  1.00 56.67  ? 514  VAL C CA    1 
ATOM   7643  C  C     . VAL C 2  514  ? -4.353  -39.619 92.161  1.00 53.65  ? 514  VAL C C     1 
ATOM   7644  O  O     . VAL C 2  514  ? -3.178  -39.548 92.524  1.00 50.54  ? 514  VAL C O     1 
ATOM   7645  C  CB    . VAL C 2  514  ? -5.510  -38.026 93.673  1.00 49.81  ? 514  VAL C CB    1 
ATOM   7646  C  CG1   . VAL C 2  514  ? -5.844  -37.080 92.537  1.00 42.16  ? 514  VAL C CG1   1 
ATOM   7647  C  CG2   . VAL C 2  514  ? -6.507  -37.873 94.805  1.00 47.25  ? 514  VAL C CG2   1 
ATOM   7648  N  N     . ALA C 2  515  ? -4.705  -39.809 90.894  1.00 47.31  ? 515  ALA C N     1 
ATOM   7649  C  CA    . ALA C 2  515  ? -3.695  -39.976 89.856  1.00 45.10  ? 515  ALA C CA    1 
ATOM   7650  C  C     . ALA C 2  515  ? -4.089  -39.322 88.534  1.00 46.37  ? 515  ALA C C     1 
ATOM   7651  O  O     . ALA C 2  515  ? -5.163  -38.736 88.410  1.00 47.07  ? 515  ALA C O     1 
ATOM   7652  C  CB    . ALA C 2  515  ? -3.389  -41.450 89.649  1.00 47.82  ? 515  ALA C CB    1 
ATOM   7653  N  N     . ARG C 2  516  ? -3.204  -39.430 87.550  1.00 43.43  ? 516  ARG C N     1 
ATOM   7654  C  CA    . ARG C 2  516  ? -3.436  -38.847 86.238  1.00 44.63  ? 516  ARG C CA    1 
ATOM   7655  C  C     . ARG C 2  516  ? -3.304  -39.896 85.141  1.00 51.73  ? 516  ARG C C     1 
ATOM   7656  O  O     . ARG C 2  516  ? -2.398  -40.736 85.170  1.00 55.56  ? 516  ARG C O     1 
ATOM   7657  C  CB    . ARG C 2  516  ? -2.446  -37.709 85.969  1.00 50.38  ? 516  ARG C CB    1 
ATOM   7658  C  CG    . ARG C 2  516  ? -2.463  -36.595 87.000  1.00 51.80  ? 516  ARG C CG    1 
ATOM   7659  C  CD    . ARG C 2  516  ? -1.525  -35.452 86.618  1.00 42.26  ? 516  ARG C CD    1 
ATOM   7660  N  NE    . ARG C 2  516  ? -0.117  -35.844 86.623  1.00 35.16  ? 516  ARG C NE    1 
ATOM   7661  C  CZ    . ARG C 2  516  ? 0.658   -35.857 85.543  1.00 39.47  ? 516  ARG C CZ    1 
ATOM   7662  N  NH1   . ARG C 2  516  ? 0.168   -35.497 84.364  1.00 40.66  ? 516  ARG C NH1   1 
ATOM   7663  N  NH2   . ARG C 2  516  ? 1.929   -36.225 85.641  1.00 38.35  ? 516  ARG C NH2   1 
ATOM   7664  N  N     . ARG C 2  517  ? -4.223  -39.845 84.183  1.00 48.66  ? 517  ARG C N     1 
ATOM   7665  C  CA    . ARG C 2  517  ? -4.119  -40.629 82.962  1.00 45.68  ? 517  ARG C CA    1 
ATOM   7666  C  C     . ARG C 2  517  ? -4.294  -39.698 81.769  1.00 49.03  ? 517  ARG C C     1 
ATOM   7667  O  O     . ARG C 2  517  ? -5.384  -39.165 81.540  1.00 45.01  ? 517  ARG C O     1 
ATOM   7668  C  CB    . ARG C 2  517  ? -5.176  -41.734 82.941  1.00 51.59  ? 517  ARG C CB    1 
ATOM   7669  C  CG    . ARG C 2  517  ? -4.950  -42.822 83.980  1.00 60.84  ? 517  ARG C CG    1 
ATOM   7670  C  CD    . ARG C 2  517  ? -6.128  -43.786 84.056  1.00 66.52  ? 517  ARG C CD    1 
ATOM   7671  N  NE    . ARG C 2  517  ? -5.875  -44.880 84.991  1.00 60.52  ? 517  ARG C NE    1 
ATOM   7672  C  CZ    . ARG C 2  517  ? -6.805  -45.728 85.419  1.00 62.85  ? 517  ARG C CZ    1 
ATOM   7673  N  NH1   . ARG C 2  517  ? -8.059  -45.606 85.001  1.00 65.87  ? 517  ARG C NH1   1 
ATOM   7674  N  NH2   . ARG C 2  517  ? -6.484  -46.694 86.268  1.00 60.81  ? 517  ARG C NH2   1 
ATOM   7675  N  N     . LYS C 2  518  ? -3.217  -39.521 81.008  1.00 49.83  ? 518  LYS C N     1 
ATOM   7676  C  CA    . LYS C 2  518  ? -3.182  -38.565 79.904  1.00 48.32  ? 518  LYS C CA    1 
ATOM   7677  C  C     . LYS C 2  518  ? -3.615  -37.169 80.346  1.00 50.04  ? 518  LYS C C     1 
ATOM   7678  O  O     . LYS C 2  518  ? -4.291  -36.455 79.610  1.00 50.58  ? 518  LYS C O     1 
ATOM   7679  C  CB    . LYS C 2  518  ? -4.031  -39.044 78.724  1.00 39.58  ? 518  LYS C CB    1 
ATOM   7680  C  CG    . LYS C 2  518  ? -3.314  -40.000 77.782  1.00 39.10  ? 518  LYS C CG    1 
ATOM   7681  C  CD    . LYS C 2  518  ? -4.115  -40.197 76.499  1.00 48.12  ? 518  LYS C CD    1 
ATOM   7682  C  CE    . LYS C 2  518  ? -3.366  -41.046 75.484  1.00 45.65  ? 518  LYS C CE    1 
ATOM   7683  N  NZ    . LYS C 2  518  ? -3.138  -42.433 75.975  1.00 52.47  ? 518  LYS C NZ    1 
ATOM   7684  N  N     . GLY C 2  519  ? -3.232  -36.796 81.562  1.00 48.17  ? 519  GLY C N     1 
ATOM   7685  C  CA    . GLY C 2  519  ? -3.518  -35.471 82.077  1.00 53.26  ? 519  GLY C CA    1 
ATOM   7686  C  C     . GLY C 2  519  ? -4.861  -35.382 82.774  1.00 57.02  ? 519  GLY C C     1 
ATOM   7687  O  O     . GLY C 2  519  ? -5.081  -34.497 83.601  1.00 58.42  ? 519  GLY C O     1 
ATOM   7688  N  N     . GLU C 2  520  ? -5.757  -36.308 82.447  1.00 57.06  ? 520  GLU C N     1 
ATOM   7689  C  CA    . GLU C 2  520  ? -7.091  -36.331 83.036  1.00 56.84  ? 520  GLU C CA    1 
ATOM   7690  C  C     . GLU C 2  520  ? -7.029  -36.883 84.458  1.00 53.47  ? 520  GLU C C     1 
ATOM   7691  O  O     . GLU C 2  520  ? -6.449  -37.942 84.685  1.00 58.57  ? 520  GLU C O     1 
ATOM   7692  C  CB    . GLU C 2  520  ? -8.027  -37.189 82.182  1.00 56.10  ? 520  GLU C CB    1 
ATOM   7693  C  CG    . GLU C 2  520  ? -9.508  -36.890 82.369  1.00 70.05  ? 520  GLU C CG    1 
ATOM   7694  C  CD    . GLU C 2  520  ? -9.962  -35.658 81.602  1.00 81.96  ? 520  GLU C CD    1 
ATOM   7695  O  OE1   . GLU C 2  520  ? -11.178 -35.367 81.613  1.00 81.97  ? 520  GLU C OE1   1 
ATOM   7696  O  OE2   . GLU C 2  520  ? -9.108  -34.984 80.985  1.00 75.60  ? 520  GLU C OE2   1 
ATOM   7697  N  N     . PRO C 2  521  ? -7.614  -36.158 85.425  1.00 55.54  ? 521  PRO C N     1 
ATOM   7698  C  CA    . PRO C 2  521  ? -7.601  -36.603 86.825  1.00 49.25  ? 521  PRO C CA    1 
ATOM   7699  C  C     . PRO C 2  521  ? -8.480  -37.832 87.029  1.00 49.80  ? 521  PRO C C     1 
ATOM   7700  O  O     . PRO C 2  521  ? -9.601  -37.869 86.523  1.00 56.31  ? 521  PRO C O     1 
ATOM   7701  C  CB    . PRO C 2  521  ? -8.194  -35.408 87.582  1.00 40.39  ? 521  PRO C CB    1 
ATOM   7702  C  CG    . PRO C 2  521  ? -8.112  -34.252 86.631  1.00 52.26  ? 521  PRO C CG    1 
ATOM   7703  C  CD    . PRO C 2  521  ? -8.266  -34.849 85.271  1.00 55.07  ? 521  PRO C CD    1 
ATOM   7704  N  N     . VAL C 2  522  ? -7.978  -38.823 87.759  1.00 46.93  ? 522  VAL C N     1 
ATOM   7705  C  CA    . VAL C 2  522  ? -8.752  -40.032 88.019  1.00 53.20  ? 522  VAL C CA    1 
ATOM   7706  C  C     . VAL C 2  522  ? -8.430  -40.638 89.392  1.00 55.55  ? 522  VAL C C     1 
ATOM   7707  O  O     . VAL C 2  522  ? -7.276  -40.639 89.830  1.00 50.43  ? 522  VAL C O     1 
ATOM   7708  C  CB    . VAL C 2  522  ? -8.552  -41.076 86.894  1.00 51.62  ? 522  VAL C CB    1 
ATOM   7709  C  CG1   . VAL C 2  522  ? -7.104  -41.533 86.836  1.00 52.83  ? 522  VAL C CG1   1 
ATOM   7710  C  CG2   . VAL C 2  522  ? -9.492  -42.260 87.078  1.00 67.50  ? 522  VAL C CG2   1 
ATOM   7711  N  N     . ILE C 2  523  ? -9.463  -41.137 90.069  1.00 51.93  ? 523  ILE C N     1 
ATOM   7712  C  CA    . ILE C 2  523  ? -9.301  -41.770 91.375  1.00 54.73  ? 523  ILE C CA    1 
ATOM   7713  C  C     . ILE C 2  523  ? -9.177  -43.279 91.216  1.00 56.76  ? 523  ILE C C     1 
ATOM   7714  O  O     . ILE C 2  523  ? -10.125 -43.944 90.794  1.00 55.24  ? 523  ILE C O     1 
ATOM   7715  C  CB    . ILE C 2  523  ? -10.492 -41.467 92.300  1.00 46.34  ? 523  ILE C CB    1 
ATOM   7716  C  CG1   . ILE C 2  523  ? -10.673 -39.959 92.460  1.00 50.48  ? 523  ILE C CG1   1 
ATOM   7717  C  CG2   . ILE C 2  523  ? -10.287 -42.116 93.657  1.00 52.55  ? 523  ILE C CG2   1 
ATOM   7718  C  CD1   . ILE C 2  523  ? -9.500  -39.276 93.124  1.00 53.75  ? 523  ILE C CD1   1 
ATOM   7719  N  N     . VAL C 2  524  ? -8.010  -43.822 91.553  1.00 53.18  ? 524  VAL C N     1 
ATOM   7720  C  CA    . VAL C 2  524  ? -7.765  -45.245 91.347  1.00 53.99  ? 524  VAL C CA    1 
ATOM   7721  C  C     . VAL C 2  524  ? -7.321  -45.963 92.619  1.00 58.78  ? 524  VAL C C     1 
ATOM   7722  O  O     . VAL C 2  524  ? -7.140  -45.343 93.665  1.00 55.20  ? 524  VAL C O     1 
ATOM   7723  C  CB    . VAL C 2  524  ? -6.694  -45.471 90.263  1.00 53.38  ? 524  VAL C CB    1 
ATOM   7724  C  CG1   . VAL C 2  524  ? -7.129  -44.851 88.944  1.00 48.69  ? 524  VAL C CG1   1 
ATOM   7725  C  CG2   . VAL C 2  524  ? -5.359  -44.898 90.714  1.00 52.53  ? 524  VAL C CG2   1 
ATOM   7726  N  N     . SER C 2  525  ? -7.163  -47.281 92.514  1.00 62.16  ? 525  SER C N     1 
ATOM   7727  C  CA    . SER C 2  525  ? -6.619  -48.095 93.597  1.00 56.59  ? 525  SER C CA    1 
ATOM   7728  C  C     . SER C 2  525  ? -5.109  -48.232 93.439  1.00 57.44  ? 525  SER C C     1 
ATOM   7729  O  O     . SER C 2  525  ? -4.601  -48.197 92.318  1.00 62.68  ? 525  SER C O     1 
ATOM   7730  C  CB    . SER C 2  525  ? -7.280  -49.475 93.614  1.00 63.30  ? 525  SER C CB    1 
ATOM   7731  O  OG    . SER C 2  525  ? -8.633  -49.390 94.031  1.00 74.10  ? 525  SER C OG    1 
ATOM   7732  N  N     . PRO C 2  526  ? -4.386  -48.394 94.561  1.00 54.04  ? 526  PRO C N     1 
ATOM   7733  C  CA    . PRO C 2  526  ? -2.926  -48.559 94.561  1.00 52.60  ? 526  PRO C CA    1 
ATOM   7734  C  C     . PRO C 2  526  ? -2.418  -49.711 93.689  1.00 57.26  ? 526  PRO C C     1 
ATOM   7735  O  O     . PRO C 2  526  ? -1.247  -49.705 93.309  1.00 56.88  ? 526  PRO C O     1 
ATOM   7736  C  CB    . PRO C 2  526  ? -2.612  -48.828 96.032  1.00 52.06  ? 526  PRO C CB    1 
ATOM   7737  C  CG    . PRO C 2  526  ? -3.677  -48.091 96.764  1.00 52.90  ? 526  PRO C CG    1 
ATOM   7738  C  CD    . PRO C 2  526  ? -4.918  -48.248 95.928  1.00 54.77  ? 526  PRO C CD    1 
ATOM   7739  N  N     . GLU C 2  527  ? -3.275  -50.681 93.382  1.00 66.81  ? 527  GLU C N     1 
ATOM   7740  C  CA    . GLU C 2  527  ? -2.909  -51.755 92.460  1.00 65.81  ? 527  GLU C CA    1 
ATOM   7741  C  C     . GLU C 2  527  ? -2.691  -51.205 91.054  1.00 64.70  ? 527  GLU C C     1 
ATOM   7742  O  O     . GLU C 2  527  ? -1.913  -51.756 90.273  1.00 63.44  ? 527  GLU C O     1 
ATOM   7743  C  CB    . GLU C 2  527  ? -3.987  -52.845 92.421  1.00 57.42  ? 527  GLU C CB    1 
ATOM   7744  C  CG    . GLU C 2  527  ? -4.065  -53.712 93.671  1.00 68.36  ? 527  GLU C CG    1 
ATOM   7745  C  CD    . GLU C 2  527  ? -4.782  -53.026 94.819  1.00 73.89  ? 527  GLU C CD    1 
ATOM   7746  O  OE1   . GLU C 2  527  ? -5.399  -51.965 94.586  1.00 77.13  ? 527  GLU C OE1   1 
ATOM   7747  O  OE2   . GLU C 2  527  ? -4.734  -53.548 95.953  1.00 70.51  ? 527  GLU C OE2   1 
ATOM   7748  N  N     . GLU C 2  528  ? -3.387  -50.117 90.740  1.00 62.47  ? 528  GLU C N     1 
ATOM   7749  C  CA    . GLU C 2  528  ? -3.365  -49.546 89.398  1.00 61.34  ? 528  GLU C CA    1 
ATOM   7750  C  C     . GLU C 2  528  ? -2.269  -48.500 89.192  1.00 58.10  ? 528  GLU C C     1 
ATOM   7751  O  O     . GLU C 2  528  ? -2.010  -48.091 88.060  1.00 53.58  ? 528  GLU C O     1 
ATOM   7752  C  CB    . GLU C 2  528  ? -4.725  -48.928 89.077  1.00 51.60  ? 528  GLU C CB    1 
ATOM   7753  C  CG    . GLU C 2  528  ? -5.897  -49.737 89.586  1.00 53.55  ? 528  GLU C CG    1 
ATOM   7754  C  CD    . GLU C 2  528  ? -7.215  -49.017 89.408  1.00 59.30  ? 528  GLU C CD    1 
ATOM   7755  O  OE1   . GLU C 2  528  ? -7.884  -48.748 90.428  1.00 52.72  ? 528  GLU C OE1   1 
ATOM   7756  O  OE2   . GLU C 2  528  ? -7.582  -48.723 88.249  1.00 57.35  ? 528  GLU C OE2   1 
ATOM   7757  N  N     . VAL C 2  529  ? -1.626  -48.068 90.274  1.00 56.13  ? 529  VAL C N     1 
ATOM   7758  C  CA    . VAL C 2  529  ? -0.650  -46.986 90.171  1.00 53.58  ? 529  VAL C CA    1 
ATOM   7759  C  C     . VAL C 2  529  ? 0.702   -47.488 89.675  1.00 53.35  ? 529  VAL C C     1 
ATOM   7760  O  O     . VAL C 2  529  ? 1.374   -48.272 90.344  1.00 61.49  ? 529  VAL C O     1 
ATOM   7761  C  CB    . VAL C 2  529  ? -0.470  -46.263 91.527  1.00 49.60  ? 529  VAL C CB    1 
ATOM   7762  C  CG1   . VAL C 2  529  ? 0.770   -45.384 91.513  1.00 43.86  ? 529  VAL C CG1   1 
ATOM   7763  C  CG2   . VAL C 2  529  ? -1.706  -45.443 91.858  1.00 50.96  ? 529  VAL C CG2   1 
ATOM   7764  N  N     . GLU C 2  530  ? 1.087   -47.023 88.490  1.00 50.97  ? 530  GLU C N     1 
ATOM   7765  C  CA    . GLU C 2  530  ? 2.377   -47.349 87.892  1.00 49.16  ? 530  GLU C CA    1 
ATOM   7766  C  C     . GLU C 2  530  ? 3.513   -46.427 88.366  1.00 56.88  ? 530  GLU C C     1 
ATOM   7767  O  O     . GLU C 2  530  ? 4.624   -46.886 88.641  1.00 58.85  ? 530  GLU C O     1 
ATOM   7768  C  CB    . GLU C 2  530  ? 2.251   -47.372 86.365  1.00 43.47  ? 530  GLU C CB    1 
ATOM   7769  C  CG    . GLU C 2  530  ? 0.995   -48.110 85.896  1.00 48.05  ? 530  GLU C CG    1 
ATOM   7770  C  CD    . GLU C 2  530  ? 0.855   -48.183 84.383  1.00 60.79  ? 530  GLU C CD    1 
ATOM   7771  O  OE1   . GLU C 2  530  ? -0.211  -47.784 83.863  1.00 58.34  ? 530  GLU C OE1   1 
ATOM   7772  O  OE2   . GLU C 2  530  ? 1.797   -48.660 83.715  1.00 63.20  ? 530  GLU C OE2   1 
ATOM   7773  N  N     . PHE C 2  531  ? 3.222   -45.129 88.462  1.00 52.39  ? 531  PHE C N     1 
ATOM   7774  C  CA    . PHE C 2  531  ? 4.213   -44.128 88.860  1.00 46.91  ? 531  PHE C CA    1 
ATOM   7775  C  C     . PHE C 2  531  ? 3.628   -43.085 89.813  1.00 47.00  ? 531  PHE C C     1 
ATOM   7776  O  O     . PHE C 2  531  ? 2.411   -42.983 89.957  1.00 49.73  ? 531  PHE C O     1 
ATOM   7777  C  CB    . PHE C 2  531  ? 4.779   -43.412 87.633  1.00 50.07  ? 531  PHE C CB    1 
ATOM   7778  C  CG    . PHE C 2  531  ? 5.607   -44.287 86.737  1.00 51.91  ? 531  PHE C CG    1 
ATOM   7779  C  CD1   . PHE C 2  531  ? 5.064   -44.836 85.586  1.00 50.60  ? 531  PHE C CD1   1 
ATOM   7780  C  CD2   . PHE C 2  531  ? 6.933   -44.548 87.038  1.00 52.00  ? 531  PHE C CD2   1 
ATOM   7781  C  CE1   . PHE C 2  531  ? 5.826   -45.637 84.757  1.00 50.04  ? 531  PHE C CE1   1 
ATOM   7782  C  CE2   . PHE C 2  531  ? 7.700   -45.347 86.212  1.00 55.35  ? 531  PHE C CE2   1 
ATOM   7783  C  CZ    . PHE C 2  531  ? 7.145   -45.892 85.069  1.00 57.84  ? 531  PHE C CZ    1 
ATOM   7784  N  N     . MET C 2  532  ? 4.497   -42.301 90.447  1.00 42.37  ? 532  MET C N     1 
ATOM   7785  C  CA    . MET C 2  532  ? 4.056   -41.258 91.376  1.00 42.79  ? 532  MET C CA    1 
ATOM   7786  C  C     . MET C 2  532  ? 4.943   -40.015 91.306  1.00 43.82  ? 532  MET C C     1 
ATOM   7787  O  O     . MET C 2  532  ? 6.153   -40.125 91.154  1.00 48.84  ? 532  MET C O     1 
ATOM   7788  C  CB    . MET C 2  532  ? 4.023   -41.798 92.808  1.00 40.66  ? 532  MET C CB    1 
ATOM   7789  C  CG    . MET C 2  532  ? 3.774   -40.747 93.878  1.00 37.18  ? 532  MET C CG    1 
ATOM   7790  S  SD    . MET C 2  532  ? 3.854   -41.426 95.545  1.00 46.76  ? 532  MET C SD    1 
ATOM   7791  C  CE    . MET C 2  532  ? 3.855   -39.936 96.540  1.00 45.16  ? 532  MET C CE    1 
ATOM   7792  N  N     . ASP C 2  533  ? 4.330   -38.838 91.423  1.00 41.74  ? 533  ASP C N     1 
ATOM   7793  C  CA    . ASP C 2  533  ? 5.046   -37.562 91.372  1.00 35.26  ? 533  ASP C CA    1 
ATOM   7794  C  C     . ASP C 2  533  ? 6.205   -37.466 92.366  1.00 33.16  ? 533  ASP C C     1 
ATOM   7795  O  O     . ASP C 2  533  ? 6.086   -37.880 93.517  1.00 42.62  ? 533  ASP C O     1 
ATOM   7796  C  CB    . ASP C 2  533  ? 4.080   -36.398 91.615  1.00 43.43  ? 533  ASP C CB    1 
ATOM   7797  C  CG    . ASP C 2  533  ? 3.217   -36.084 90.406  1.00 50.97  ? 533  ASP C CG    1 
ATOM   7798  O  OD1   . ASP C 2  533  ? 2.822   -37.026 89.684  1.00 50.42  ? 533  ASP C OD1   1 
ATOM   7799  O  OD2   . ASP C 2  533  ? 2.934   -34.887 90.180  1.00 48.39  ? 533  ASP C OD2   1 
ATOM   7800  N  N     . VAL C 2  534  ? 7.320   -36.907 91.908  1.00 26.16  ? 534  VAL C N     1 
ATOM   7801  C  CA    . VAL C 2  534  ? 8.498   -36.719 92.746  1.00 27.33  ? 534  VAL C CA    1 
ATOM   7802  C  C     . VAL C 2  534  ? 8.255   -35.690 93.845  1.00 37.19  ? 534  VAL C C     1 
ATOM   7803  O  O     . VAL C 2  534  ? 8.657   -35.889 94.994  1.00 49.71  ? 534  VAL C O     1 
ATOM   7804  C  CB    . VAL C 2  534  ? 9.709   -36.269 91.905  1.00 34.13  ? 534  VAL C CB    1 
ATOM   7805  C  CG1   . VAL C 2  534  ? 10.869  -35.840 92.799  1.00 34.88  ? 534  VAL C CG1   1 
ATOM   7806  C  CG2   . VAL C 2  534  ? 10.134  -37.376 90.953  1.00 41.03  ? 534  VAL C CG2   1 
ATOM   7807  N  N     . SER C 2  535  ? 7.566   -34.609 93.489  1.00 35.06  ? 535  SER C N     1 
ATOM   7808  C  CA    . SER C 2  535  ? 7.392   -33.461 94.374  1.00 35.94  ? 535  SER C CA    1 
ATOM   7809  C  C     . SER C 2  535  ? 6.478   -32.439 93.712  1.00 35.63  ? 535  SER C C     1 
ATOM   7810  O  O     . SER C 2  535  ? 6.392   -32.395 92.490  1.00 41.28  ? 535  SER C O     1 
ATOM   7811  C  CB    . SER C 2  535  ? 8.750   -32.814 94.657  1.00 36.24  ? 535  SER C CB    1 
ATOM   7812  O  OG    . SER C 2  535  ? 8.612   -31.629 95.418  1.00 35.18  ? 535  SER C OG    1 
ATOM   7813  N  N     . PRO C 2  536  ? 5.769   -31.626 94.515  1.00 34.69  ? 536  PRO C N     1 
ATOM   7814  C  CA    . PRO C 2  536  ? 4.987   -30.527 93.939  1.00 30.90  ? 536  PRO C CA    1 
ATOM   7815  C  C     . PRO C 2  536  ? 5.893   -29.485 93.286  1.00 33.64  ? 536  PRO C C     1 
ATOM   7816  O  O     . PRO C 2  536  ? 5.489   -28.834 92.317  1.00 31.10  ? 536  PRO C O     1 
ATOM   7817  C  CB    . PRO C 2  536  ? 4.276   -29.925 95.156  1.00 27.33  ? 536  PRO C CB    1 
ATOM   7818  C  CG    . PRO C 2  536  ? 5.070   -30.373 96.333  1.00 34.50  ? 536  PRO C CG    1 
ATOM   7819  C  CD    . PRO C 2  536  ? 5.568   -31.735 95.969  1.00 41.50  ? 536  PRO C CD    1 
ATOM   7820  N  N     . LYS C 2  537  ? 7.113   -29.360 93.807  1.00 31.99  ? 537  LYS C N     1 
ATOM   7821  C  CA    . LYS C 2  537  ? 8.099   -28.411 93.298  1.00 30.64  ? 537  LYS C CA    1 
ATOM   7822  C  C     . LYS C 2  537  ? 8.304   -28.523 91.786  1.00 34.98  ? 537  LYS C C     1 
ATOM   7823  O  O     . LYS C 2  537  ? 8.582   -27.530 91.112  1.00 33.06  ? 537  LYS C O     1 
ATOM   7824  C  CB    . LYS C 2  537  ? 9.444   -28.607 94.005  1.00 31.64  ? 537  LYS C CB    1 
ATOM   7825  C  CG    . LYS C 2  537  ? 9.388   -28.573 95.525  1.00 37.84  ? 537  LYS C CG    1 
ATOM   7826  C  CD    . LYS C 2  537  ? 10.788  -28.673 96.118  1.00 29.79  ? 537  LYS C CD    1 
ATOM   7827  C  CE    . LYS C 2  537  ? 10.745  -29.030 97.593  1.00 39.56  ? 537  LYS C CE    1 
ATOM   7828  N  NZ    . LYS C 2  537  ? 9.869   -28.116 98.374  1.00 45.53  ? 537  LYS C NZ    1 
ATOM   7829  N  N     . GLN C 2  538  ? 8.164   -29.736 91.259  1.00 34.93  ? 538  GLN C N     1 
ATOM   7830  C  CA    . GLN C 2  538  ? 8.436   -29.996 89.849  1.00 35.12  ? 538  GLN C CA    1 
ATOM   7831  C  C     . GLN C 2  538  ? 7.396   -29.377 88.926  1.00 29.38  ? 538  GLN C C     1 
ATOM   7832  O  O     . GLN C 2  538  ? 7.635   -29.230 87.727  1.00 31.42  ? 538  GLN C O     1 
ATOM   7833  C  CB    . GLN C 2  538  ? 8.520   -31.500 89.584  1.00 35.73  ? 538  GLN C CB    1 
ATOM   7834  C  CG    . GLN C 2  538  ? 7.177   -32.195 89.550  1.00 30.62  ? 538  GLN C CG    1 
ATOM   7835  C  CD    . GLN C 2  538  ? 7.300   -33.682 89.326  1.00 25.80  ? 538  GLN C CD    1 
ATOM   7836  O  OE1   . GLN C 2  538  ? 6.718   -34.479 90.055  1.00 36.48  ? 538  GLN C OE1   1 
ATOM   7837  N  NE2   . GLN C 2  538  ? 8.054   -34.066 88.307  1.00 26.62  ? 538  GLN C NE2   1 
ATOM   7838  N  N     . VAL C 2  539  ? 6.242   -29.020 89.476  1.00 22.86  ? 539  VAL C N     1 
ATOM   7839  C  CA    . VAL C 2  539  ? 5.170   -28.479 88.649  1.00 29.69  ? 539  VAL C CA    1 
ATOM   7840  C  C     . VAL C 2  539  ? 5.439   -27.029 88.230  1.00 28.93  ? 539  VAL C C     1 
ATOM   7841  O  O     . VAL C 2  539  ? 4.919   -26.562 87.218  1.00 29.05  ? 539  VAL C O     1 
ATOM   7842  C  CB    . VAL C 2  539  ? 3.803   -28.611 89.353  1.00 31.08  ? 539  VAL C CB    1 
ATOM   7843  C  CG1   . VAL C 2  539  ? 2.669   -28.132 88.455  1.00 21.28  ? 539  VAL C CG1   1 
ATOM   7844  C  CG2   . VAL C 2  539  ? 3.581   -30.054 89.751  1.00 41.90  ? 539  VAL C CG2   1 
ATOM   7845  N  N     . PHE C 2  540  ? 6.275   -26.326 88.986  1.00 24.11  ? 540  PHE C N     1 
ATOM   7846  C  CA    . PHE C 2  540  ? 6.490   -24.909 88.716  1.00 24.35  ? 540  PHE C CA    1 
ATOM   7847  C  C     . PHE C 2  540  ? 7.935   -24.532 88.417  1.00 29.92  ? 540  PHE C C     1 
ATOM   7848  O  O     . PHE C 2  540  ? 8.834   -25.370 88.474  1.00 36.11  ? 540  PHE C O     1 
ATOM   7849  C  CB    . PHE C 2  540  ? 5.967   -24.078 89.883  1.00 26.06  ? 540  PHE C CB    1 
ATOM   7850  C  CG    . PHE C 2  540  ? 4.552   -24.386 90.243  1.00 26.00  ? 540  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C 2  540  ? 4.259   -25.106 91.384  1.00 27.26  ? 540  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C 2  540  ? 3.513   -23.975 89.427  1.00 25.96  ? 540  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C 2  540  ? 2.955   -25.397 91.715  1.00 29.75  ? 540  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C 2  540  ? 2.207   -24.262 89.752  1.00 27.80  ? 540  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C 2  540  ? 1.926   -24.975 90.899  1.00 30.89  ? 540  PHE C CZ    1 
ATOM   7856  N  N     . SER C 2  541  ? 8.146   -23.254 88.115  1.00 25.77  ? 541  SER C N     1 
ATOM   7857  C  CA    . SER C 2  541  ? 9.471   -22.736 87.810  1.00 22.33  ? 541  SER C CA    1 
ATOM   7858  C  C     . SER C 2  541  ? 10.231  -22.448 89.093  1.00 24.79  ? 541  SER C C     1 
ATOM   7859  O  O     . SER C 2  541  ? 9.777   -22.791 90.184  1.00 24.80  ? 541  SER C O     1 
ATOM   7860  C  CB    . SER C 2  541  ? 9.361   -21.459 86.982  1.00 25.74  ? 541  SER C CB    1 
ATOM   7861  O  OG    . SER C 2  541  ? 8.591   -20.483 87.661  1.00 25.00  ? 541  SER C OG    1 
ATOM   7862  N  N     . VAL C 2  542  ? 11.390  -21.813 88.962  1.00 25.19  ? 542  VAL C N     1 
ATOM   7863  C  CA    . VAL C 2  542  ? 12.194  -21.466 90.127  1.00 24.97  ? 542  VAL C CA    1 
ATOM   7864  C  C     . VAL C 2  542  ? 11.624  -20.242 90.845  1.00 26.21  ? 542  VAL C C     1 
ATOM   7865  O  O     . VAL C 2  542  ? 11.550  -20.209 92.075  1.00 26.59  ? 542  VAL C O     1 
ATOM   7866  C  CB    . VAL C 2  542  ? 13.671  -21.252 89.748  1.00 20.87  ? 542  VAL C CB    1 
ATOM   7867  C  CG1   . VAL C 2  542  ? 14.411  -20.522 90.853  1.00 23.86  ? 542  VAL C CG1   1 
ATOM   7868  C  CG2   . VAL C 2  542  ? 14.333  -22.591 89.445  1.00 20.51  ? 542  VAL C CG2   1 
ATOM   7869  N  N     . ASN C 2  543  ? 11.202  -19.244 90.077  1.00 27.67  ? 543  ASN C N     1 
ATOM   7870  C  CA    . ASN C 2  543  ? 10.575  -18.064 90.659  1.00 24.81  ? 543  ASN C CA    1 
ATOM   7871  C  C     . ASN C 2  543  ? 9.296   -18.415 91.406  1.00 20.97  ? 543  ASN C C     1 
ATOM   7872  O  O     . ASN C 2  543  ? 9.096   -17.986 92.540  1.00 23.54  ? 543  ASN C O     1 
ATOM   7873  C  CB    . ASN C 2  543  ? 10.283  -17.018 89.583  1.00 27.64  ? 543  ASN C CB    1 
ATOM   7874  C  CG    . ASN C 2  543  ? 11.543  -16.446 88.971  1.00 27.79  ? 543  ASN C CG    1 
ATOM   7875  O  OD1   . ASN C 2  543  ? 12.096  -17.010 88.024  1.00 29.41  ? 543  ASN C OD1   1 
ATOM   7876  N  ND2   . ASN C 2  543  ? 12.004  -15.317 89.507  1.00 16.00  ? 543  ASN C ND2   1 
ATOM   7877  N  N     . THR C 2  544  ? 8.441   -19.205 90.765  1.00 20.84  ? 544  THR C N     1 
ATOM   7878  C  CA    . THR C 2  544  ? 7.169   -19.610 91.354  1.00 25.29  ? 544  THR C CA    1 
ATOM   7879  C  C     . THR C 2  544  ? 7.388   -20.434 92.619  1.00 31.81  ? 544  THR C C     1 
ATOM   7880  O  O     . THR C 2  544  ? 6.627   -20.332 93.585  1.00 29.82  ? 544  THR C O     1 
ATOM   7881  C  CB    . THR C 2  544  ? 6.333   -20.443 90.365  1.00 24.54  ? 544  THR C CB    1 
ATOM   7882  O  OG1   . THR C 2  544  ? 6.328   -19.809 89.083  1.00 27.53  ? 544  THR C OG1   1 
ATOM   7883  C  CG2   . THR C 2  544  ? 4.903   -20.585 90.860  1.00 26.89  ? 544  THR C CG2   1 
ATOM   7884  N  N     . ASN C 2  545  ? 8.444   -21.242 92.614  1.00 32.22  ? 545  ASN C N     1 
ATOM   7885  C  CA    . ASN C 2  545  ? 8.756   -22.096 93.755  1.00 30.94  ? 545  ASN C CA    1 
ATOM   7886  C  C     . ASN C 2  545  ? 9.249   -21.317 94.967  1.00 29.74  ? 545  ASN C C     1 
ATOM   7887  O  O     . ASN C 2  545  ? 9.435   -21.889 96.038  1.00 32.13  ? 545  ASN C O     1 
ATOM   7888  C  CB    . ASN C 2  545  ? 9.788   -23.156 93.372  1.00 27.15  ? 545  ASN C CB    1 
ATOM   7889  C  CG    . ASN C 2  545  ? 9.152   -24.428 92.854  1.00 28.91  ? 545  ASN C CG    1 
ATOM   7890  O  OD1   . ASN C 2  545  ? 8.673   -25.255 93.631  1.00 27.40  ? 545  ASN C OD1   1 
ATOM   7891  N  ND2   . ASN C 2  545  ? 9.152   -24.597 91.537  1.00 25.50  ? 545  ASN C ND2   1 
ATOM   7892  N  N     . LEU C 2  546  ? 9.468   -20.018 94.788  1.00 26.53  ? 546  LEU C N     1 
ATOM   7893  C  CA    . LEU C 2  546  ? 9.943   -19.165 95.869  1.00 25.31  ? 546  LEU C CA    1 
ATOM   7894  C  C     . LEU C 2  546  ? 8.804   -18.459 96.596  1.00 26.04  ? 546  LEU C C     1 
ATOM   7895  O  O     . LEU C 2  546  ? 9.037   -17.716 97.549  1.00 25.11  ? 546  LEU C O     1 
ATOM   7896  C  CB    . LEU C 2  546  ? 10.954  -18.149 95.340  1.00 21.71  ? 546  LEU C CB    1 
ATOM   7897  C  CG    . LEU C 2  546  ? 12.332  -18.750 95.072  1.00 19.88  ? 546  LEU C CG    1 
ATOM   7898  C  CD1   . LEU C 2  546  ? 13.227  -17.779 94.326  1.00 21.43  ? 546  LEU C CD1   1 
ATOM   7899  C  CD2   . LEU C 2  546  ? 12.966  -19.158 96.385  1.00 23.52  ? 546  LEU C CD2   1 
ATOM   7900  N  N     . ILE C 2  547  ? 7.574   -18.701 96.150  1.00 27.27  ? 547  ILE C N     1 
ATOM   7901  C  CA    . ILE C 2  547  ? 6.402   -18.112 96.791  1.00 28.48  ? 547  ILE C CA    1 
ATOM   7902  C  C     . ILE C 2  547  ? 5.804   -19.060 97.825  1.00 30.59  ? 547  ILE C C     1 
ATOM   7903  O  O     . ILE C 2  547  ? 5.174   -20.057 97.470  1.00 33.60  ? 547  ILE C O     1 
ATOM   7904  C  CB    . ILE C 2  547  ? 5.297   -17.782 95.767  1.00 23.31  ? 547  ILE C CB    1 
ATOM   7905  C  CG1   . ILE C 2  547  ? 5.858   -16.973 94.601  1.00 24.26  ? 547  ILE C CG1   1 
ATOM   7906  C  CG2   . ILE C 2  547  ? 4.154   -17.030 96.438  1.00 21.64  ? 547  ILE C CG2   1 
ATOM   7907  C  CD1   . ILE C 2  547  ? 4.818   -16.629 93.558  1.00 21.21  ? 547  ILE C CD1   1 
ATOM   7908  N  N     . PRO C 2  548  ? 5.982   -18.742 99.114  1.00 22.16  ? 548  PRO C N     1 
ATOM   7909  C  CA    . PRO C 2  548  ? 5.393   -19.560 100.175 1.00 21.96  ? 548  PRO C CA    1 
ATOM   7910  C  C     . PRO C 2  548  ? 3.875   -19.435 100.167 1.00 22.35  ? 548  PRO C C     1 
ATOM   7911  O  O     . PRO C 2  548  ? 3.358   -18.468 99.623  1.00 21.87  ? 548  PRO C O     1 
ATOM   7912  C  CB    . PRO C 2  548  ? 5.969   -18.938 101.447 1.00 25.02  ? 548  PRO C CB    1 
ATOM   7913  C  CG    . PRO C 2  548  ? 6.264   -17.529 101.071 1.00 24.84  ? 548  PRO C CG    1 
ATOM   7914  C  CD    . PRO C 2  548  ? 6.717   -17.584 99.648  1.00 21.86  ? 548  PRO C CD    1 
ATOM   7915  N  N     . PHE C 2  549  ? 3.179   -20.406 100.751 1.00 29.33  ? 549  PHE C N     1 
ATOM   7916  C  CA    . PHE C 2  549  ? 1.719   -20.402 100.810 1.00 24.26  ? 549  PHE C CA    1 
ATOM   7917  C  C     . PHE C 2  549  ? 1.073   -20.204 99.444  1.00 21.90  ? 549  PHE C C     1 
ATOM   7918  O  O     . PHE C 2  549  ? 0.003   -19.605 99.344  1.00 21.52  ? 549  PHE C O     1 
ATOM   7919  C  CB    . PHE C 2  549  ? 1.222   -19.317 101.763 1.00 23.21  ? 549  PHE C CB    1 
ATOM   7920  C  CG    . PHE C 2  549  ? 1.676   -19.495 103.181 1.00 24.88  ? 549  PHE C CG    1 
ATOM   7921  C  CD1   . PHE C 2  549  ? 1.242   -20.573 103.930 1.00 28.45  ? 549  PHE C CD1   1 
ATOM   7922  C  CD2   . PHE C 2  549  ? 2.517   -18.569 103.774 1.00 23.71  ? 549  PHE C CD2   1 
ATOM   7923  C  CE1   . PHE C 2  549  ? 1.651   -20.731 105.242 1.00 31.51  ? 549  PHE C CE1   1 
ATOM   7924  C  CE2   . PHE C 2  549  ? 2.928   -18.722 105.083 1.00 20.89  ? 549  PHE C CE2   1 
ATOM   7925  C  CZ    . PHE C 2  549  ? 2.494   -19.803 105.818 1.00 24.08  ? 549  PHE C CZ    1 
ATOM   7926  N  N     . LEU C 2  550  ? 1.722   -20.716 98.401  1.00 22.20  ? 550  LEU C N     1 
ATOM   7927  C  CA    . LEU C 2  550  ? 1.272   -20.516 97.023  1.00 24.31  ? 550  LEU C CA    1 
ATOM   7928  C  C     . LEU C 2  550  ? -0.137  -21.052 96.774  1.00 26.26  ? 550  LEU C C     1 
ATOM   7929  O  O     . LEU C 2  550  ? -0.873  -20.522 95.943  1.00 25.02  ? 550  LEU C O     1 
ATOM   7930  C  CB    . LEU C 2  550  ? 2.250   -21.163 96.036  1.00 23.53  ? 550  LEU C CB    1 
ATOM   7931  C  CG    . LEU C 2  550  ? 1.969   -20.926 94.547  1.00 25.40  ? 550  LEU C CG    1 
ATOM   7932  C  CD1   . LEU C 2  550  ? 2.481   -19.562 94.116  1.00 31.24  ? 550  LEU C CD1   1 
ATOM   7933  C  CD2   . LEU C 2  550  ? 2.563   -22.024 93.677  1.00 27.41  ? 550  LEU C CD2   1 
ATOM   7934  N  N     . GLU C 2  551  ? -0.510  -22.100 97.501  1.00 29.58  ? 551  GLU C N     1 
ATOM   7935  C  CA    . GLU C 2  551  ? -1.803  -22.741 97.298  1.00 28.34  ? 551  GLU C CA    1 
ATOM   7936  C  C     . GLU C 2  551  ? -2.959  -21.813 97.654  1.00 27.98  ? 551  GLU C C     1 
ATOM   7937  O  O     . GLU C 2  551  ? -4.103  -22.055 97.268  1.00 29.73  ? 551  GLU C O     1 
ATOM   7938  C  CB    . GLU C 2  551  ? -1.896  -24.050 98.092  1.00 29.27  ? 551  GLU C CB    1 
ATOM   7939  C  CG    . GLU C 2  551  ? -1.615  -23.921 99.583  1.00 28.67  ? 551  GLU C CG    1 
ATOM   7940  C  CD    . GLU C 2  551  ? -0.154  -24.155 99.930  1.00 29.88  ? 551  GLU C CD    1 
ATOM   7941  O  OE1   . GLU C 2  551  ? 0.148   -24.389 101.121 1.00 40.60  ? 551  GLU C OE1   1 
ATOM   7942  O  OE2   . GLU C 2  551  ? 0.692   -24.108 99.015  1.00 24.39  ? 551  GLU C OE2   1 
ATOM   7943  N  N     . HIS C 2  552  ? -2.653  -20.747 98.387  1.00 26.10  ? 552  HIS C N     1 
ATOM   7944  C  CA    . HIS C 2  552  ? -3.669  -19.790 98.808  1.00 29.19  ? 552  HIS C CA    1 
ATOM   7945  C  C     . HIS C 2  552  ? -3.768  -18.586 97.869  1.00 30.29  ? 552  HIS C C     1 
ATOM   7946  O  O     . HIS C 2  552  ? -4.546  -17.665 98.115  1.00 34.19  ? 552  HIS C O     1 
ATOM   7947  C  CB    . HIS C 2  552  ? -3.398  -19.326 100.241 1.00 25.82  ? 552  HIS C CB    1 
ATOM   7948  C  CG    . HIS C 2  552  ? -3.326  -20.446 101.234 1.00 31.64  ? 552  HIS C CG    1 
ATOM   7949  N  ND1   . HIS C 2  552  ? -4.433  -20.919 101.905 1.00 33.34  ? 552  HIS C ND1   1 
ATOM   7950  C  CD2   . HIS C 2  552  ? -2.280  -21.189 101.665 1.00 34.87  ? 552  HIS C CD2   1 
ATOM   7951  C  CE1   . HIS C 2  552  ? -4.072  -21.902 102.710 1.00 35.35  ? 552  HIS C CE1   1 
ATOM   7952  N  NE2   . HIS C 2  552  ? -2.770  -22.086 102.584 1.00 37.15  ? 552  HIS C NE2   1 
ATOM   7953  N  N     . ASP C 2  553  ? -2.980  -18.595 96.797  1.00 26.19  ? 553  ASP C N     1 
ATOM   7954  C  CA    . ASP C 2  553  ? -2.940  -17.469 95.866  1.00 23.56  ? 553  ASP C CA    1 
ATOM   7955  C  C     . ASP C 2  553  ? -3.581  -17.810 94.524  1.00 24.34  ? 553  ASP C C     1 
ATOM   7956  O  O     . ASP C 2  553  ? -3.378  -18.900 93.994  1.00 29.00  ? 553  ASP C O     1 
ATOM   7957  C  CB    . ASP C 2  553  ? -1.494  -17.017 95.639  1.00 19.86  ? 553  ASP C CB    1 
ATOM   7958  C  CG    . ASP C 2  553  ? -0.835  -16.504 96.906  1.00 21.15  ? 553  ASP C CG    1 
ATOM   7959  O  OD1   . ASP C 2  553  ? 0.394   -16.672 97.056  1.00 17.17  ? 553  ASP C OD1   1 
ATOM   7960  O  OD2   . ASP C 2  553  ? -1.549  -15.928 97.754  1.00 25.30  ? 553  ASP C OD2   1 
ATOM   7961  N  N     . ASP C 2  554  ? -4.350  -16.877 93.972  1.00 22.82  ? 554  ASP C N     1 
ATOM   7962  C  CA    . ASP C 2  554  ? -4.879  -17.048 92.624  1.00 25.84  ? 554  ASP C CA    1 
ATOM   7963  C  C     . ASP C 2  554  ? -3.709  -17.077 91.647  1.00 24.66  ? 554  ASP C C     1 
ATOM   7964  O  O     . ASP C 2  554  ? -2.711  -16.383 91.849  1.00 25.51  ? 554  ASP C O     1 
ATOM   7965  C  CB    . ASP C 2  554  ? -5.851  -15.920 92.266  1.00 29.16  ? 554  ASP C CB    1 
ATOM   7966  C  CG    . ASP C 2  554  ? -6.510  -16.120 90.906  1.00 30.70  ? 554  ASP C CG    1 
ATOM   7967  O  OD1   . ASP C 2  554  ? -7.517  -16.858 90.836  1.00 31.79  ? 554  ASP C OD1   1 
ATOM   7968  O  OD2   . ASP C 2  554  ? -6.029  -15.536 89.910  1.00 25.95  ? 554  ASP C OD2   1 
ATOM   7969  N  N     . ALA C 2  555  ? -3.833  -17.879 90.594  1.00 22.90  ? 555  ALA C N     1 
ATOM   7970  C  CA    . ALA C 2  555  ? -2.738  -18.087 89.649  1.00 23.45  ? 555  ALA C CA    1 
ATOM   7971  C  C     . ALA C 2  555  ? -2.184  -16.796 89.037  1.00 23.07  ? 555  ALA C C     1 
ATOM   7972  O  O     . ALA C 2  555  ? -0.987  -16.703 88.756  1.00 24.36  ? 555  ALA C O     1 
ATOM   7973  C  CB    . ALA C 2  555  ? -3.161  -19.059 88.557  1.00 20.10  ? 555  ALA C CB    1 
ATOM   7974  N  N     . ASN C 2  556  ? -3.046  -15.802 88.842  1.00 21.30  ? 556  ASN C N     1 
ATOM   7975  C  CA    . ASN C 2  556  ? -2.628  -14.544 88.226  1.00 21.75  ? 556  ASN C CA    1 
ATOM   7976  C  C     . ASN C 2  556  ? -1.722  -13.702 89.123  1.00 25.58  ? 556  ASN C C     1 
ATOM   7977  O  O     . ASN C 2  556  ? -0.703  -13.157 88.672  1.00 35.14  ? 556  ASN C O     1 
ATOM   7978  C  CB    . ASN C 2  556  ? -3.843  -13.726 87.787  1.00 21.99  ? 556  ASN C CB    1 
ATOM   7979  C  CG    . ASN C 2  556  ? -4.664  -14.427 86.727  1.00 22.27  ? 556  ASN C CG    1 
ATOM   7980  O  OD1   . ASN C 2  556  ? -4.295  -14.449 85.551  1.00 22.09  ? 556  ASN C OD1   1 
ATOM   7981  N  ND2   . ASN C 2  556  ? -5.790  -15.001 87.136  1.00 19.39  ? 556  ASN C ND2   1 
ATOM   7982  N  N     . ARG C 2  557  ? -2.087  -13.592 90.394  1.00 17.39  ? 557  ARG C N     1 
ATOM   7983  C  CA    . ARG C 2  557  ? -1.258  -12.851 91.328  1.00 19.65  ? 557  ARG C CA    1 
ATOM   7984  C  C     . ARG C 2  557  ? 0.044   -13.610 91.573  1.00 23.37  ? 557  ARG C C     1 
ATOM   7985  O  O     . ARG C 2  557  ? 1.100   -13.004 91.795  1.00 22.41  ? 557  ARG C O     1 
ATOM   7986  C  CB    . ARG C 2  557  ? -2.004  -12.590 92.634  1.00 23.43  ? 557  ARG C CB    1 
ATOM   7987  C  CG    . ARG C 2  557  ? -2.047  -11.120 93.014  1.00 22.64  ? 557  ARG C CG    1 
ATOM   7988  C  CD    . ARG C 2  557  ? -2.780  -10.301 91.966  1.00 23.06  ? 557  ARG C CD    1 
ATOM   7989  N  NE    . ARG C 2  557  ? -2.323  -8.916  91.944  1.00 21.46  ? 557  ARG C NE    1 
ATOM   7990  C  CZ    . ARG C 2  557  ? -2.914  -7.945  91.255  1.00 24.54  ? 557  ARG C CZ    1 
ATOM   7991  N  NH1   . ARG C 2  557  ? -3.999  -8.207  90.533  1.00 21.57  ? 557  ARG C NH1   1 
ATOM   7992  N  NH2   . ARG C 2  557  ? -2.424  -6.712  91.294  1.00 24.63  ? 557  ARG C NH2   1 
ATOM   7993  N  N     . ALA C 2  558  ? -0.040  -14.938 91.516  1.00 22.63  ? 558  ALA C N     1 
ATOM   7994  C  CA    . ALA C 2  558  ? 1.138   -15.791 91.604  1.00 20.41  ? 558  ALA C CA    1 
ATOM   7995  C  C     . ALA C 2  558  ? 2.087   -15.440 90.475  1.00 19.37  ? 558  ALA C C     1 
ATOM   7996  O  O     . ALA C 2  558  ? 3.288   -15.281 90.683  1.00 23.96  ? 558  ALA C O     1 
ATOM   7997  C  CB    . ALA C 2  558  ? 0.745   -17.253 91.522  1.00 20.79  ? 558  ALA C CB    1 
ATOM   7998  N  N     . LEU C 2  559  ? 1.530   -15.321 89.276  1.00 18.47  ? 559  LEU C N     1 
ATOM   7999  C  CA    . LEU C 2  559  ? 2.289   -14.872 88.119  1.00 23.70  ? 559  LEU C CA    1 
ATOM   8000  C  C     . LEU C 2  559  ? 2.992   -13.557 88.426  1.00 25.14  ? 559  LEU C C     1 
ATOM   8001  O  O     . LEU C 2  559  ? 4.208   -13.430 88.246  1.00 23.37  ? 559  LEU C O     1 
ATOM   8002  C  CB    . LEU C 2  559  ? 1.363   -14.718 86.910  1.00 17.60  ? 559  LEU C CB    1 
ATOM   8003  C  CG    . LEU C 2  559  ? 1.897   -14.072 85.634  1.00 16.44  ? 559  LEU C CG    1 
ATOM   8004  C  CD1   . LEU C 2  559  ? 1.203   -14.695 84.454  1.00 26.71  ? 559  LEU C CD1   1 
ATOM   8005  C  CD2   . LEU C 2  559  ? 1.659   -12.575 85.627  1.00 18.34  ? 559  LEU C CD2   1 
ATOM   8006  N  N     . MET C 2  560  ? 2.221   -12.583 88.901  1.00 26.66  ? 560  MET C N     1 
ATOM   8007  C  CA    . MET C 2  560  ? 2.769   -11.254 89.154  1.00 24.63  ? 560  MET C CA    1 
ATOM   8008  C  C     . MET C 2  560  ? 3.936   -11.264 90.138  1.00 24.36  ? 560  MET C C     1 
ATOM   8009  O  O     . MET C 2  560  ? 4.977   -10.664 89.868  1.00 24.04  ? 560  MET C O     1 
ATOM   8010  C  CB    . MET C 2  560  ? 1.678   -10.300 89.628  1.00 23.23  ? 560  MET C CB    1 
ATOM   8011  C  CG    . MET C 2  560  ? 0.555   -10.145 88.634  1.00 23.22  ? 560  MET C CG    1 
ATOM   8012  S  SD    . MET C 2  560  ? -0.551  -8.804  89.075  1.00 32.81  ? 560  MET C SD    1 
ATOM   8013  C  CE    . MET C 2  560  ? -1.830  -9.019  87.842  1.00 30.06  ? 560  MET C CE    1 
ATOM   8014  N  N     . GLY C 2  561  ? 3.765   -11.946 91.267  1.00 21.45  ? 561  GLY C N     1 
ATOM   8015  C  CA    . GLY C 2  561  ? 4.829   -12.041 92.254  1.00 22.40  ? 561  GLY C CA    1 
ATOM   8016  C  C     . GLY C 2  561  ? 6.052   -12.751 91.700  1.00 25.32  ? 561  GLY C C     1 
ATOM   8017  O  O     . GLY C 2  561  ? 7.201   -12.307 91.881  1.00 28.05  ? 561  GLY C O     1 
ATOM   8018  N  N     . SER C 2  562  ? 5.791   -13.859 91.013  1.00 19.33  ? 562  SER C N     1 
ATOM   8019  C  CA    . SER C 2  562  ? 6.836   -14.661 90.405  1.00 18.52  ? 562  SER C CA    1 
ATOM   8020  C  C     . SER C 2  562  ? 7.715   -13.785 89.520  1.00 21.05  ? 562  SER C C     1 
ATOM   8021  O  O     . SER C 2  562  ? 8.934   -13.740 89.695  1.00 19.37  ? 562  SER C O     1 
ATOM   8022  C  CB    . SER C 2  562  ? 6.215   -15.801 89.598  1.00 20.46  ? 562  SER C CB    1 
ATOM   8023  O  OG    . SER C 2  562  ? 7.209   -16.640 89.042  1.00 29.62  ? 562  SER C OG    1 
ATOM   8024  N  N     . ASN C 2  563  ? 7.084   -13.070 88.591  1.00 23.66  ? 563  ASN C N     1 
ATOM   8025  C  CA    . ASN C 2  563  ? 7.794   -12.138 87.721  1.00 20.88  ? 563  ASN C CA    1 
ATOM   8026  C  C     . ASN C 2  563  ? 8.523   -11.066 88.514  1.00 19.17  ? 563  ASN C C     1 
ATOM   8027  O  O     . ASN C 2  563  ? 9.658   -10.706 88.205  1.00 21.71  ? 563  ASN C O     1 
ATOM   8028  C  CB    . ASN C 2  563  ? 6.824   -11.453 86.756  1.00 19.62  ? 563  ASN C CB    1 
ATOM   8029  C  CG    . ASN C 2  563  ? 6.316   -12.381 85.674  1.00 22.07  ? 563  ASN C CG    1 
ATOM   8030  O  OD1   . ASN C 2  563  ? 7.024   -12.682 84.709  1.00 25.60  ? 563  ASN C OD1   1 
ATOM   8031  N  ND2   . ASN C 2  563  ? 5.075   -12.827 85.818  1.00 22.57  ? 563  ASN C ND2   1 
ATOM   8032  N  N     . MET C 2  564  ? 7.862   -10.551 89.539  1.00 17.06  ? 564  MET C N     1 
ATOM   8033  C  CA    . MET C 2  564  ? 8.379   -9.392  90.242  1.00 18.96  ? 564  MET C CA    1 
ATOM   8034  C  C     . MET C 2  564  ? 9.640   -9.674  91.036  1.00 21.99  ? 564  MET C C     1 
ATOM   8035  O  O     . MET C 2  564  ? 10.455  -8.776  91.241  1.00 22.85  ? 564  MET C O     1 
ATOM   8036  C  CB    . MET C 2  564  ? 7.303   -8.756  91.118  1.00 16.10  ? 564  MET C CB    1 
ATOM   8037  C  CG    . MET C 2  564  ? 6.361   -7.888  90.318  1.00 19.25  ? 564  MET C CG    1 
ATOM   8038  S  SD    . MET C 2  564  ? 5.248   -6.935  91.343  1.00 21.58  ? 564  MET C SD    1 
ATOM   8039  C  CE    . MET C 2  564  ? 4.261   -8.239  92.065  1.00 24.89  ? 564  MET C CE    1 
ATOM   8040  N  N     . GLN C 2  565  ? 9.814   -10.915 91.479  1.00 26.41  ? 565  GLN C N     1 
ATOM   8041  C  CA    . GLN C 2  565  ? 11.037  -11.254 92.204  1.00 22.84  ? 565  GLN C CA    1 
ATOM   8042  C  C     . GLN C 2  565  ? 12.285  -10.985 91.364  1.00 19.68  ? 565  GLN C C     1 
ATOM   8043  O  O     . GLN C 2  565  ? 13.320  -10.584 91.889  1.00 20.70  ? 565  GLN C O     1 
ATOM   8044  C  CB    . GLN C 2  565  ? 11.013  -12.703 92.685  1.00 22.83  ? 565  GLN C CB    1 
ATOM   8045  C  CG    . GLN C 2  565  ? 10.253  -12.908 93.976  1.00 20.45  ? 565  GLN C CG    1 
ATOM   8046  C  CD    . GLN C 2  565  ? 10.237  -14.358 94.402  1.00 25.46  ? 565  GLN C CD    1 
ATOM   8047  O  OE1   . GLN C 2  565  ? 10.788  -14.718 95.444  1.00 26.60  ? 565  GLN C OE1   1 
ATOM   8048  N  NE2   . GLN C 2  565  ? 9.605   -15.202 93.594  1.00 21.08  ? 565  GLN C NE2   1 
ATOM   8049  N  N     . THR C 2  566  ? 12.176  -11.190 90.057  1.00 18.72  ? 566  THR C N     1 
ATOM   8050  C  CA    . THR C 2  566  ? 13.293  -10.951 89.151  1.00 20.83  ? 566  THR C CA    1 
ATOM   8051  C  C     . THR C 2  566  ? 13.712  -9.483  89.183  1.00 24.01  ? 566  THR C C     1 
ATOM   8052  O  O     . THR C 2  566  ? 14.871  -9.147  88.944  1.00 27.23  ? 566  THR C O     1 
ATOM   8053  C  CB    . THR C 2  566  ? 12.928  -11.348 87.707  1.00 22.14  ? 566  THR C CB    1 
ATOM   8054  O  OG1   . THR C 2  566  ? 12.435  -12.693 87.689  1.00 21.60  ? 566  THR C OG1   1 
ATOM   8055  C  CG2   . THR C 2  566  ? 14.135  -11.250 86.790  1.00 25.19  ? 566  THR C CG2   1 
ATOM   8056  N  N     . GLN C 2  567  ? 12.763  -8.613  89.504  1.00 24.81  ? 567  GLN C N     1 
ATOM   8057  C  CA    . GLN C 2  567  ? 12.999  -7.175  89.489  1.00 23.03  ? 567  GLN C CA    1 
ATOM   8058  C  C     . GLN C 2  567  ? 13.489  -6.645  90.837  1.00 21.82  ? 567  GLN C C     1 
ATOM   8059  O  O     . GLN C 2  567  ? 13.634  -5.437  91.020  1.00 22.57  ? 567  GLN C O     1 
ATOM   8060  C  CB    . GLN C 2  567  ? 11.728  -6.439  89.057  1.00 23.69  ? 567  GLN C CB    1 
ATOM   8061  C  CG    . GLN C 2  567  ? 11.157  -6.930  87.734  1.00 25.07  ? 567  GLN C CG    1 
ATOM   8062  C  CD    . GLN C 2  567  ? 9.812   -6.306  87.404  1.00 31.45  ? 567  GLN C CD    1 
ATOM   8063  O  OE1   . GLN C 2  567  ? 9.614   -5.102  87.565  1.00 35.33  ? 567  GLN C OE1   1 
ATOM   8064  N  NE2   . GLN C 2  567  ? 8.878   -7.128  86.948  1.00 31.72  ? 567  GLN C NE2   1 
ATOM   8065  N  N     . ALA C 2  568  ? 13.732  -7.549  91.781  1.00 21.07  ? 568  ALA C N     1 
ATOM   8066  C  CA    . ALA C 2  568  ? 14.207  -7.159  93.109  1.00 20.49  ? 568  ALA C CA    1 
ATOM   8067  C  C     . ALA C 2  568  ? 15.621  -6.585  93.083  1.00 20.83  ? 568  ALA C C     1 
ATOM   8068  O  O     . ALA C 2  568  ? 16.543  -7.186  92.530  1.00 24.98  ? 568  ALA C O     1 
ATOM   8069  C  CB    . ALA C 2  568  ? 14.133  -8.333  94.066  1.00 24.46  ? 568  ALA C CB    1 
ATOM   8070  N  N     . VAL C 2  569  ? 15.786  -5.420  93.697  1.00 18.78  ? 569  VAL C N     1 
ATOM   8071  C  CA    . VAL C 2  569  ? 17.075  -4.748  93.728  1.00 19.60  ? 569  VAL C CA    1 
ATOM   8072  C  C     . VAL C 2  569  ? 17.871  -5.137  94.963  1.00 24.23  ? 569  VAL C C     1 
ATOM   8073  O  O     . VAL C 2  569  ? 17.345  -5.093  96.078  1.00 28.40  ? 569  VAL C O     1 
ATOM   8074  C  CB    . VAL C 2  569  ? 16.894  -3.226  93.714  1.00 19.62  ? 569  VAL C CB    1 
ATOM   8075  C  CG1   . VAL C 2  569  ? 18.165  -2.536  94.141  1.00 21.65  ? 569  VAL C CG1   1 
ATOM   8076  C  CG2   . VAL C 2  569  ? 16.486  -2.771  92.337  1.00 20.07  ? 569  VAL C CG2   1 
ATOM   8077  N  N     . PRO C 2  570  ? 19.144  -5.527  94.767  1.00 23.55  ? 570  PRO C N     1 
ATOM   8078  C  CA    . PRO C 2  570  ? 20.037  -5.881  95.876  1.00 25.70  ? 570  PRO C CA    1 
ATOM   8079  C  C     . PRO C 2  570  ? 20.201  -4.717  96.845  1.00 29.32  ? 570  PRO C C     1 
ATOM   8080  O  O     . PRO C 2  570  ? 20.543  -3.610  96.426  1.00 28.08  ? 570  PRO C O     1 
ATOM   8081  C  CB    . PRO C 2  570  ? 21.368  -6.164  95.173  1.00 19.69  ? 570  PRO C CB    1 
ATOM   8082  C  CG    . PRO C 2  570  ? 20.990  -6.553  93.794  1.00 21.44  ? 570  PRO C CG    1 
ATOM   8083  C  CD    . PRO C 2  570  ? 19.789  -5.721  93.458  1.00 22.86  ? 570  PRO C CD    1 
ATOM   8084  N  N     . LEU C 2  571  ? 19.981  -4.981  98.129  1.00 29.84  ? 571  LEU C N     1 
ATOM   8085  C  CA    . LEU C 2  571  ? 20.030  -3.951  99.157  1.00 22.60  ? 571  LEU C CA    1 
ATOM   8086  C  C     . LEU C 2  571  ? 21.257  -4.193  100.007 1.00 25.96  ? 571  LEU C C     1 
ATOM   8087  O  O     . LEU C 2  571  ? 21.712  -5.331  100.124 1.00 29.85  ? 571  LEU C O     1 
ATOM   8088  C  CB    . LEU C 2  571  ? 18.785  -4.020  100.036 1.00 21.86  ? 571  LEU C CB    1 
ATOM   8089  C  CG    . LEU C 2  571  ? 17.434  -3.941  99.329  1.00 25.99  ? 571  LEU C CG    1 
ATOM   8090  C  CD1   . LEU C 2  571  ? 16.304  -4.272  100.289 1.00 24.53  ? 571  LEU C CD1   1 
ATOM   8091  C  CD2   . LEU C 2  571  ? 17.241  -2.560  98.733  1.00 30.87  ? 571  LEU C CD2   1 
ATOM   8092  N  N     . ILE C 2  572  ? 21.804  -3.131  100.590 1.00 22.84  ? 572  ILE C N     1 
ATOM   8093  C  CA    . ILE C 2  572  ? 22.996  -3.267  101.421 1.00 21.29  ? 572  ILE C CA    1 
ATOM   8094  C  C     . ILE C 2  572  ? 22.715  -4.120  102.656 1.00 21.63  ? 572  ILE C C     1 
ATOM   8095  O  O     . ILE C 2  572  ? 23.567  -4.885  103.104 1.00 26.18  ? 572  ILE C O     1 
ATOM   8096  C  CB    . ILE C 2  572  ? 23.591  -1.896  101.827 1.00 19.82  ? 572  ILE C CB    1 
ATOM   8097  C  CG1   . ILE C 2  572  ? 22.568  -1.044  102.574 1.00 22.54  ? 572  ILE C CG1   1 
ATOM   8098  C  CG2   . ILE C 2  572  ? 24.071  -1.138  100.603 1.00 25.98  ? 572  ILE C CG2   1 
ATOM   8099  C  CD1   . ILE C 2  572  ? 23.103  0.314   102.974 1.00 19.90  ? 572  ILE C CD1   1 
ATOM   8100  N  N     . ARG C 2  573  ? 21.515  -3.977  103.200 1.00 19.24  ? 573  ARG C N     1 
ATOM   8101  C  CA    . ARG C 2  573  ? 21.102  -4.710  104.392 1.00 21.65  ? 573  ARG C CA    1 
ATOM   8102  C  C     . ARG C 2  573  ? 20.259  -5.976  104.152 1.00 25.91  ? 573  ARG C C     1 
ATOM   8103  O  O     . ARG C 2  573  ? 19.714  -6.546  105.097 1.00 26.77  ? 573  ARG C O     1 
ATOM   8104  C  CB    . ARG C 2  573  ? 20.457  -3.765  105.403 1.00 26.33  ? 573  ARG C CB    1 
ATOM   8105  C  CG    . ARG C 2  573  ? 21.367  -2.597  105.768 1.00 27.27  ? 573  ARG C CG    1 
ATOM   8106  C  CD    . ARG C 2  573  ? 21.070  -2.062  107.154 1.00 30.46  ? 573  ARG C CD    1 
ATOM   8107  N  NE    . ARG C 2  573  ? 21.408  -3.036  108.186 1.00 28.36  ? 573  ARG C NE    1 
ATOM   8108  C  CZ    . ARG C 2  573  ? 21.128  -2.882  109.474 1.00 32.10  ? 573  ARG C CZ    1 
ATOM   8109  N  NH1   . ARG C 2  573  ? 20.501  -1.790  109.891 1.00 27.47  ? 573  ARG C NH1   1 
ATOM   8110  N  NH2   . ARG C 2  573  ? 21.472  -3.821  110.345 1.00 48.08  ? 573  ARG C NH2   1 
ATOM   8111  N  N     . ALA C 2  574  ? 20.144  -6.392  102.892 1.00 27.72  ? 574  ALA C N     1 
ATOM   8112  C  CA    . ALA C 2  574  ? 19.156  -7.393  102.463 1.00 30.83  ? 574  ALA C CA    1 
ATOM   8113  C  C     . ALA C 2  574  ? 19.080  -8.673  103.307 1.00 27.55  ? 574  ALA C C     1 
ATOM   8114  O  O     . ALA C 2  574  ? 20.100  -9.224  103.718 1.00 27.61  ? 574  ALA C O     1 
ATOM   8115  C  CB    . ALA C 2  574  ? 19.377  -7.746  100.989 1.00 26.92  ? 574  ALA C CB    1 
ATOM   8116  N  N     . GLN C 2  575  ? 17.852  -9.126  103.558 1.00 25.29  ? 575  GLN C N     1 
ATOM   8117  C  CA    . GLN C 2  575  ? 17.599  -10.298 104.393 1.00 26.48  ? 575  GLN C CA    1 
ATOM   8118  C  C     . GLN C 2  575  ? 16.871  -11.411 103.644 1.00 27.49  ? 575  GLN C C     1 
ATOM   8119  O  O     . GLN C 2  575  ? 16.171  -11.160 102.666 1.00 30.27  ? 575  GLN C O     1 
ATOM   8120  C  CB    . GLN C 2  575  ? 16.742  -9.909  105.595 1.00 25.82  ? 575  GLN C CB    1 
ATOM   8121  C  CG    . GLN C 2  575  ? 16.951  -8.500  106.094 1.00 27.05  ? 575  GLN C CG    1 
ATOM   8122  C  CD    . GLN C 2  575  ? 16.059  -8.177  107.275 1.00 34.29  ? 575  GLN C CD    1 
ATOM   8123  O  OE1   . GLN C 2  575  ? 15.218  -7.280  107.204 1.00 40.43  ? 575  GLN C OE1   1 
ATOM   8124  N  NE2   . GLN C 2  575  ? 16.235  -8.909  108.372 1.00 33.48  ? 575  GLN C NE2   1 
ATOM   8125  N  N     . ALA C 2  576  ? 17.030  -12.641 104.120 1.00 27.43  ? 576  ALA C N     1 
ATOM   8126  C  CA    . ALA C 2  576  ? 16.239  -13.761 103.627 1.00 25.82  ? 576  ALA C CA    1 
ATOM   8127  C  C     . ALA C 2  576  ? 14.833  -13.639 104.205 1.00 30.69  ? 576  ALA C C     1 
ATOM   8128  O  O     . ALA C 2  576  ? 14.654  -13.039 105.264 1.00 34.27  ? 576  ALA C O     1 
ATOM   8129  C  CB    . ALA C 2  576  ? 16.874  -15.072 104.048 1.00 28.87  ? 576  ALA C CB    1 
ATOM   8130  N  N     . PRO C 2  577  ? 13.826  -14.200 103.511 1.00 28.47  ? 577  PRO C N     1 
ATOM   8131  C  CA    . PRO C 2  577  ? 12.437  -14.113 103.983 1.00 24.77  ? 577  PRO C CA    1 
ATOM   8132  C  C     . PRO C 2  577  ? 12.209  -14.869 105.291 1.00 26.47  ? 577  PRO C C     1 
ATOM   8133  O  O     . PRO C 2  577  ? 12.803  -15.927 105.486 1.00 32.14  ? 577  PRO C O     1 
ATOM   8134  C  CB    . PRO C 2  577  ? 11.644  -14.795 102.862 1.00 25.49  ? 577  PRO C CB    1 
ATOM   8135  C  CG    . PRO C 2  577  ? 12.542  -14.789 101.674 1.00 24.67  ? 577  PRO C CG    1 
ATOM   8136  C  CD    . PRO C 2  577  ? 13.925  -14.898 102.218 1.00 24.55  ? 577  PRO C CD    1 
ATOM   8137  N  N     . VAL C 2  578  ? 11.361  -14.337 106.168 1.00 28.61  ? 578  VAL C N     1 
ATOM   8138  C  CA    . VAL C 2  578  ? 11.029  -15.021 107.417 1.00 28.84  ? 578  VAL C CA    1 
ATOM   8139  C  C     . VAL C 2  578  ? 10.332  -16.350 107.135 1.00 28.48  ? 578  VAL C C     1 
ATOM   8140  O  O     . VAL C 2  578  ? 10.594  -17.356 107.795 1.00 34.41  ? 578  VAL C O     1 
ATOM   8141  C  CB    . VAL C 2  578  ? 10.155  -14.148 108.336 1.00 28.84  ? 578  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C 2  578  ? 9.587   -14.970 109.479 1.00 31.19  ? 578  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C 2  578  ? 10.969  -12.997 108.888 1.00 31.26  ? 578  VAL C CG2   1 
ATOM   8144  N  N     . VAL C 2  579  ? 9.451   -16.356 106.143 1.00 22.72  ? 579  VAL C N     1 
ATOM   8145  C  CA    . VAL C 2  579  ? 8.851   -17.600 105.686 1.00 26.62  ? 579  VAL C CA    1 
ATOM   8146  C  C     . VAL C 2  579  ? 9.436   -17.977 104.331 1.00 27.32  ? 579  VAL C C     1 
ATOM   8147  O  O     . VAL C 2  579  ? 9.172   -17.309 103.335 1.00 34.03  ? 579  VAL C O     1 
ATOM   8148  C  CB    . VAL C 2  579  ? 7.324   -17.476 105.562 1.00 26.50  ? 579  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C 2  579  ? 6.724   -18.776 105.038 1.00 23.71  ? 579  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C 2  579  ? 6.714   -17.102 106.901 1.00 27.70  ? 579  VAL C CG2   1 
ATOM   8151  N  N     . MET C 2  580  ? 10.239  -19.036 104.289 1.00 24.46  ? 580  MET C N     1 
ATOM   8152  C  CA    . MET C 2  580  ? 10.835  -19.464 103.030 1.00 25.50  ? 580  MET C CA    1 
ATOM   8153  C  C     . MET C 2  580  ? 10.151  -20.705 102.471 1.00 29.99  ? 580  MET C C     1 
ATOM   8154  O  O     . MET C 2  580  ? 9.288   -21.294 103.122 1.00 31.37  ? 580  MET C O     1 
ATOM   8155  C  CB    . MET C 2  580  ? 12.321  -19.739 103.230 1.00 23.90  ? 580  MET C CB    1 
ATOM   8156  C  CG    . MET C 2  580  ? 13.061  -18.592 103.873 1.00 26.17  ? 580  MET C CG    1 
ATOM   8157  S  SD    . MET C 2  580  ? 14.831  -18.880 103.972 1.00 31.68  ? 580  MET C SD    1 
ATOM   8158  C  CE    . MET C 2  580  ? 14.873  -20.425 104.874 1.00 31.33  ? 580  MET C CE    1 
ATOM   8159  N  N     . THR C 2  581  ? 10.537  -21.093 101.259 1.00 26.51  ? 581  THR C N     1 
ATOM   8160  C  CA    . THR C 2  581  ? 10.031  -22.317 100.644 1.00 29.51  ? 581  THR C CA    1 
ATOM   8161  C  C     . THR C 2  581  ? 11.019  -23.475 100.730 1.00 36.56  ? 581  THR C C     1 
ATOM   8162  O  O     . THR C 2  581  ? 10.722  -24.589 100.294 1.00 32.72  ? 581  THR C O     1 
ATOM   8163  C  CB    . THR C 2  581  ? 9.668   -22.095 99.175  1.00 34.21  ? 581  THR C CB    1 
ATOM   8164  O  OG1   . THR C 2  581  ? 10.861  -21.841 98.422  1.00 35.31  ? 581  THR C OG1   1 
ATOM   8165  C  CG2   . THR C 2  581  ? 8.721   -20.916 99.040  1.00 33.03  ? 581  THR C CG2   1 
ATOM   8166  N  N     . GLY C 2  582  ? 12.198  -23.200 101.279 1.00 42.04  ? 582  GLY C N     1 
ATOM   8167  C  CA    . GLY C 2  582  ? 13.261  -24.188 101.339 1.00 37.18  ? 582  GLY C CA    1 
ATOM   8168  C  C     . GLY C 2  582  ? 14.130  -24.203 100.095 1.00 37.42  ? 582  GLY C C     1 
ATOM   8169  O  O     . GLY C 2  582  ? 15.136  -24.909 100.041 1.00 41.57  ? 582  GLY C O     1 
ATOM   8170  N  N     . LEU C 2  583  ? 13.735  -23.433 99.087  1.00 35.14  ? 583  LEU C N     1 
ATOM   8171  C  CA    . LEU C 2  583  ? 14.494  -23.346 97.847  1.00 28.44  ? 583  LEU C CA    1 
ATOM   8172  C  C     . LEU C 2  583  ? 15.415  -22.118 97.822  1.00 30.66  ? 583  LEU C C     1 
ATOM   8173  O  O     . LEU C 2  583  ? 16.117  -21.876 96.841  1.00 32.04  ? 583  LEU C O     1 
ATOM   8174  C  CB    . LEU C 2  583  ? 13.539  -23.347 96.650  1.00 23.37  ? 583  LEU C CB    1 
ATOM   8175  C  CG    . LEU C 2  583  ? 14.125  -23.640 95.271  1.00 23.90  ? 583  LEU C CG    1 
ATOM   8176  C  CD1   . LEU C 2  583  ? 15.185  -24.699 95.401  1.00 35.45  ? 583  LEU C CD1   1 
ATOM   8177  C  CD2   . LEU C 2  583  ? 13.046  -24.090 94.315  1.00 25.41  ? 583  LEU C CD2   1 
ATOM   8178  N  N     . GLU C 2  584  ? 15.417  -21.348 98.905  1.00 30.23  ? 584  GLU C N     1 
ATOM   8179  C  CA    . GLU C 2  584  ? 16.175  -20.096 98.942  1.00 33.27  ? 584  GLU C CA    1 
ATOM   8180  C  C     . GLU C 2  584  ? 17.690  -20.281 98.815  1.00 38.08  ? 584  GLU C C     1 
ATOM   8181  O  O     . GLU C 2  584  ? 18.374  -19.404 98.291  1.00 39.13  ? 584  GLU C O     1 
ATOM   8182  C  CB    . GLU C 2  584  ? 15.847  -19.286 100.205 1.00 37.03  ? 584  GLU C CB    1 
ATOM   8183  C  CG    . GLU C 2  584  ? 14.524  -18.512 100.162 1.00 34.66  ? 584  GLU C CG    1 
ATOM   8184  C  CD    . GLU C 2  584  ? 13.307  -19.414 100.048 1.00 36.94  ? 584  GLU C CD    1 
ATOM   8185  O  OE1   . GLU C 2  584  ? 12.241  -18.926 99.612  1.00 40.01  ? 584  GLU C OE1   1 
ATOM   8186  O  OE2   . GLU C 2  584  ? 13.410  -20.607 100.403 1.00 35.46  ? 584  GLU C OE2   1 
ATOM   8187  N  N     . GLU C 2  585  ? 18.212  -21.405 99.303  1.00 38.90  ? 585  GLU C N     1 
ATOM   8188  C  CA    . GLU C 2  585  ? 19.658  -21.655 99.286  1.00 42.23  ? 585  GLU C CA    1 
ATOM   8189  C  C     . GLU C 2  585  ? 20.198  -22.132 97.934  1.00 42.81  ? 585  GLU C C     1 
ATOM   8190  O  O     . GLU C 2  585  ? 21.229  -21.638 97.452  1.00 43.88  ? 585  GLU C O     1 
ATOM   8191  C  CB    . GLU C 2  585  ? 20.045  -22.641 100.390 1.00 46.77  ? 585  GLU C CB    1 
ATOM   8192  C  CG    . GLU C 2  585  ? 21.414  -22.383 101.004 1.00 53.96  ? 585  GLU C CG    1 
ATOM   8193  C  CD    . GLU C 2  585  ? 21.464  -22.739 102.484 1.00 68.64  ? 585  GLU C CD    1 
ATOM   8194  O  OE1   . GLU C 2  585  ? 20.430  -23.195 103.024 1.00 56.24  ? 585  GLU C OE1   1 
ATOM   8195  O  OE2   . GLU C 2  585  ? 22.533  -22.559 103.109 1.00 73.92  ? 585  GLU C OE2   1 
ATOM   8196  N  N     . ARG C 2  586  ? 19.506  -23.099 97.333  1.00 37.20  ? 586  ARG C N     1 
ATOM   8197  C  CA    . ARG C 2  586  ? 19.935  -23.675 96.059  1.00 39.44  ? 586  ARG C CA    1 
ATOM   8198  C  C     . ARG C 2  586  ? 20.047  -22.627 94.961  1.00 41.44  ? 586  ARG C C     1 
ATOM   8199  O  O     . ARG C 2  586  ? 20.957  -22.680 94.134  1.00 40.05  ? 586  ARG C O     1 
ATOM   8200  C  CB    . ARG C 2  586  ? 18.983  -24.783 95.606  1.00 35.89  ? 586  ARG C CB    1 
ATOM   8201  C  CG    . ARG C 2  586  ? 19.318  -26.161 96.146  1.00 43.33  ? 586  ARG C CG    1 
ATOM   8202  C  CD    . ARG C 2  586  ? 20.713  -26.606 95.727  1.00 35.64  ? 586  ARG C CD    1 
ATOM   8203  N  NE    . ARG C 2  586  ? 20.895  -26.583 94.278  1.00 31.34  ? 586  ARG C NE    1 
ATOM   8204  C  CZ    . ARG C 2  586  ? 20.424  -27.510 93.448  1.00 34.19  ? 586  ARG C CZ    1 
ATOM   8205  N  NH1   . ARG C 2  586  ? 19.725  -28.532 93.922  1.00 35.94  ? 586  ARG C NH1   1 
ATOM   8206  N  NH2   . ARG C 2  586  ? 20.644  -27.412 92.143  1.00 32.69  ? 586  ARG C NH2   1 
ATOM   8207  N  N     . VAL C 2  587  ? 19.115  -21.681 94.956  1.00 41.17  ? 587  VAL C N     1 
ATOM   8208  C  CA    . VAL C 2  587  ? 19.098  -20.632 93.948  1.00 34.16  ? 587  VAL C CA    1 
ATOM   8209  C  C     . VAL C 2  587  ? 20.375  -19.802 94.019  1.00 35.32  ? 587  VAL C C     1 
ATOM   8210  O  O     . VAL C 2  587  ? 20.973  -19.485 92.991  1.00 35.30  ? 587  VAL C O     1 
ATOM   8211  C  CB    . VAL C 2  587  ? 17.855  -19.735 94.091  1.00 30.38  ? 587  VAL C CB    1 
ATOM   8212  C  CG1   . VAL C 2  587  ? 17.921  -18.567 93.125  1.00 23.84  ? 587  VAL C CG1   1 
ATOM   8213  C  CG2   . VAL C 2  587  ? 16.594  -20.550 93.853  1.00 25.40  ? 587  VAL C CG2   1 
ATOM   8214  N  N     . VAL C 2  588  ? 20.803  -19.470 95.233  1.00 35.33  ? 588  VAL C N     1 
ATOM   8215  C  CA    . VAL C 2  588  ? 22.048  -18.732 95.411  1.00 40.96  ? 588  VAL C CA    1 
ATOM   8216  C  C     . VAL C 2  588  ? 23.234  -19.588 95.004  1.00 44.54  ? 588  VAL C C     1 
ATOM   8217  O  O     . VAL C 2  588  ? 24.152  -19.112 94.330  1.00 46.29  ? 588  VAL C O     1 
ATOM   8218  C  CB    . VAL C 2  588  ? 22.263  -18.291 96.864  1.00 44.38  ? 588  VAL C CB    1 
ATOM   8219  C  CG1   . VAL C 2  588  ? 23.525  -17.447 96.976  1.00 45.21  ? 588  VAL C CG1   1 
ATOM   8220  C  CG2   . VAL C 2  588  ? 21.071  -17.514 97.353  1.00 46.42  ? 588  VAL C CG2   1 
ATOM   8221  N  N     . ARG C 2  589  ? 23.213  -20.852 95.415  1.00 41.26  ? 589  ARG C N     1 
ATOM   8222  C  CA    . ARG C 2  589  ? 24.335  -21.740 95.135  1.00 40.33  ? 589  ARG C CA    1 
ATOM   8223  C  C     . ARG C 2  589  ? 24.568  -21.948 93.636  1.00 40.20  ? 589  ARG C C     1 
ATOM   8224  O  O     . ARG C 2  589  ? 25.708  -21.937 93.178  1.00 48.18  ? 589  ARG C O     1 
ATOM   8225  C  CB    . ARG C 2  589  ? 24.168  -23.083 95.850  1.00 40.97  ? 589  ARG C CB    1 
ATOM   8226  C  CG    . ARG C 2  589  ? 25.353  -24.020 95.668  1.00 44.51  ? 589  ARG C CG    1 
ATOM   8227  C  CD    . ARG C 2  589  ? 25.221  -25.287 96.502  1.00 51.32  ? 589  ARG C CD    1 
ATOM   8228  N  NE    . ARG C 2  589  ? 25.431  -25.041 97.928  1.00 55.51  ? 589  ARG C NE    1 
ATOM   8229  C  CZ    . ARG C 2  589  ? 26.625  -24.991 98.512  1.00 50.62  ? 589  ARG C CZ    1 
ATOM   8230  N  NH1   . ARG C 2  589  ? 27.728  -25.161 97.794  1.00 47.40  ? 589  ARG C NH1   1 
ATOM   8231  N  NH2   . ARG C 2  589  ? 26.719  -24.765 99.815  1.00 50.67  ? 589  ARG C NH2   1 
ATOM   8232  N  N     . ASP C 2  590  ? 23.491  -22.122 92.874  1.00 36.85  ? 590  ASP C N     1 
ATOM   8233  C  CA    . ASP C 2  590  ? 23.606  -22.421 91.446  1.00 38.73  ? 590  ASP C CA    1 
ATOM   8234  C  C     . ASP C 2  590  ? 23.943  -21.198 90.593  1.00 38.93  ? 590  ASP C C     1 
ATOM   8235  O  O     . ASP C 2  590  ? 24.587  -21.319 89.549  1.00 41.86  ? 590  ASP C O     1 
ATOM   8236  C  CB    . ASP C 2  590  ? 22.334  -23.098 90.920  1.00 37.52  ? 590  ASP C CB    1 
ATOM   8237  C  CG    . ASP C 2  590  ? 22.214  -24.547 91.361  1.00 36.41  ? 590  ASP C CG    1 
ATOM   8238  O  OD1   . ASP C 2  590  ? 22.632  -24.864 92.493  1.00 40.30  ? 590  ASP C OD1   1 
ATOM   8239  O  OD2   . ASP C 2  590  ? 21.703  -25.370 90.572  1.00 34.79  ? 590  ASP C OD2   1 
ATOM   8240  N  N     . SER C 2  591  ? 23.516  -20.022 91.040  1.00 36.96  ? 591  SER C N     1 
ATOM   8241  C  CA    . SER C 2  591  ? 23.754  -18.794 90.287  1.00 40.53  ? 591  SER C CA    1 
ATOM   8242  C  C     . SER C 2  591  ? 25.215  -18.368 90.363  1.00 46.25  ? 591  SER C C     1 
ATOM   8243  O  O     . SER C 2  591  ? 25.618  -17.402 89.715  1.00 58.93  ? 591  SER C O     1 
ATOM   8244  C  CB    . SER C 2  591  ? 22.862  -17.662 90.798  1.00 44.43  ? 591  SER C CB    1 
ATOM   8245  O  OG    . SER C 2  591  ? 23.411  -17.073 91.964  1.00 45.00  ? 591  SER C OG    1 
ATOM   8246  N  N     . LEU C 2  592  ? 25.992  -19.082 91.173  1.00 46.28  ? 592  LEU C N     1 
ATOM   8247  C  CA    . LEU C 2  592  ? 27.408  -18.788 91.384  1.00 46.88  ? 592  LEU C CA    1 
ATOM   8248  C  C     . LEU C 2  592  ? 27.627  -17.366 91.890  1.00 46.09  ? 592  LEU C C     1 
ATOM   8249  O  O     . LEU C 2  592  ? 28.655  -16.751 91.612  1.00 49.95  ? 592  LEU C O     1 
ATOM   8250  C  CB    . LEU C 2  592  ? 28.224  -19.033 90.110  1.00 41.02  ? 592  LEU C CB    1 
ATOM   8251  C  CG    . LEU C 2  592  ? 28.194  -20.444 89.520  1.00 38.60  ? 592  LEU C CG    1 
ATOM   8252  C  CD1   . LEU C 2  592  ? 29.160  -20.550 88.355  1.00 41.48  ? 592  LEU C CD1   1 
ATOM   8253  C  CD2   . LEU C 2  592  ? 28.522  -21.479 90.578  1.00 46.77  ? 592  LEU C CD2   1 
ATOM   8254  N  N     . ALA C 2  593  ? 26.645  -16.845 92.616  1.00 46.85  ? 593  ALA C N     1 
ATOM   8255  C  CA    . ALA C 2  593  ? 26.775  -15.542 93.253  1.00 56.72  ? 593  ALA C CA    1 
ATOM   8256  C  C     . ALA C 2  593  ? 27.680  -15.631 94.476  1.00 59.74  ? 593  ALA C C     1 
ATOM   8257  O  O     . ALA C 2  593  ? 28.639  -14.866 94.612  1.00 51.27  ? 593  ALA C O     1 
ATOM   8258  C  CB    . ALA C 2  593  ? 25.410  -15.012 93.647  1.00 61.52  ? 593  ALA C CB    1 
ATOM   8259  N  N     . ALA C 2  594  ? 27.363  -16.573 95.361  1.00 53.27  ? 594  ALA C N     1 
ATOM   8260  C  CA    . ALA C 2  594  ? 28.135  -16.792 96.580  1.00 46.30  ? 594  ALA C CA    1 
ATOM   8261  C  C     . ALA C 2  594  ? 29.397  -17.611 96.323  1.00 48.79  ? 594  ALA C C     1 
ATOM   8262  O  O     . ALA C 2  594  ? 29.449  -18.420 95.397  1.00 55.41  ? 594  ALA C O     1 
ATOM   8263  C  CB    . ALA C 2  594  ? 27.275  -17.463 97.634  1.00 46.18  ? 594  ALA C CB    1 
ATOM   8264  N  N     . LEU C 2  595  ? 30.408  -17.401 97.156  1.00 47.87  ? 595  LEU C N     1 
ATOM   8265  C  CA    . LEU C 2  595  ? 31.665  -18.128 97.042  1.00 45.00  ? 595  LEU C CA    1 
ATOM   8266  C  C     . LEU C 2  595  ? 31.690  -19.242 98.085  1.00 46.78  ? 595  LEU C C     1 
ATOM   8267  O  O     . LEU C 2  595  ? 31.379  -19.009 99.253  1.00 42.02  ? 595  LEU C O     1 
ATOM   8268  C  CB    . LEU C 2  595  ? 32.835  -17.165 97.243  1.00 39.14  ? 595  LEU C CB    1 
ATOM   8269  C  CG    . LEU C 2  595  ? 34.241  -17.582 96.811  1.00 42.81  ? 595  LEU C CG    1 
ATOM   8270  C  CD1   . LEU C 2  595  ? 35.011  -16.364 96.340  1.00 46.99  ? 595  LEU C CD1   1 
ATOM   8271  C  CD2   . LEU C 2  595  ? 34.983  -18.261 97.945  1.00 43.86  ? 595  LEU C CD2   1 
ATOM   8272  N  N     . TYR C 2  596  ? 32.052  -20.452 97.666  1.00 46.13  ? 596  TYR C N     1 
ATOM   8273  C  CA    . TYR C 2  596  ? 32.024  -21.602 98.567  1.00 45.97  ? 596  TYR C CA    1 
ATOM   8274  C  C     . TYR C 2  596  ? 33.389  -22.264 98.765  1.00 49.61  ? 596  TYR C C     1 
ATOM   8275  O  O     . TYR C 2  596  ? 34.379  -21.863 98.156  1.00 53.99  ? 596  TYR C O     1 
ATOM   8276  C  CB    . TYR C 2  596  ? 31.008  -22.632 98.073  1.00 47.84  ? 596  TYR C CB    1 
ATOM   8277  C  CG    . TYR C 2  596  ? 29.587  -22.121 98.050  1.00 48.23  ? 596  TYR C CG    1 
ATOM   8278  C  CD1   . TYR C 2  596  ? 29.030  -21.609 96.886  1.00 45.13  ? 596  TYR C CD1   1 
ATOM   8279  C  CD2   . TYR C 2  596  ? 28.801  -22.149 99.194  1.00 50.73  ? 596  TYR C CD2   1 
ATOM   8280  C  CE1   . TYR C 2  596  ? 27.729  -21.141 96.861  1.00 47.05  ? 596  TYR C CE1   1 
ATOM   8281  C  CE2   . TYR C 2  596  ? 27.499  -21.682 99.180  1.00 47.99  ? 596  TYR C CE2   1 
ATOM   8282  C  CZ    . TYR C 2  596  ? 26.967  -21.180 98.012  1.00 47.75  ? 596  TYR C CZ    1 
ATOM   8283  O  OH    . TYR C 2  596  ? 25.671  -20.716 97.996  1.00 41.77  ? 596  TYR C OH    1 
ATOM   8284  N  N     . ALA C 2  597  ? 33.425  -23.289 99.615  1.00 53.47  ? 597  ALA C N     1 
ATOM   8285  C  CA    . ALA C 2  597  ? 34.663  -24.000 99.929  1.00 57.50  ? 597  ALA C CA    1 
ATOM   8286  C  C     . ALA C 2  597  ? 34.790  -25.300 99.135  1.00 61.68  ? 597  ALA C C     1 
ATOM   8287  O  O     . ALA C 2  597  ? 33.886  -26.136 99.146  1.00 55.86  ? 597  ALA C O     1 
ATOM   8288  C  CB    . ALA C 2  597  ? 34.748  -24.275 101.421 1.00 56.81  ? 597  ALA C CB    1 
ATOM   8289  N  N     . GLU C 2  598  ? 35.925  -25.466 98.459  1.00 66.35  ? 598  GLU C N     1 
ATOM   8290  C  CA    . GLU C 2  598  ? 36.128  -26.582 97.537  1.00 70.39  ? 598  GLU C CA    1 
ATOM   8291  C  C     . GLU C 2  598  ? 36.291  -27.925 98.242  1.00 76.79  ? 598  GLU C C     1 
ATOM   8292  O  O     . GLU C 2  598  ? 35.729  -28.932 97.812  1.00 79.43  ? 598  GLU C O     1 
ATOM   8293  C  CB    . GLU C 2  598  ? 37.337  -26.318 96.639  1.00 69.05  ? 598  GLU C CB    1 
ATOM   8294  C  CG    . GLU C 2  598  ? 37.567  -27.382 95.582  1.00 69.22  ? 598  GLU C CG    1 
ATOM   8295  C  CD    . GLU C 2  598  ? 38.786  -27.095 94.730  1.00 83.44  ? 598  GLU C CD    1 
ATOM   8296  O  OE1   . GLU C 2  598  ? 39.462  -26.074 94.983  1.00 82.51  ? 598  GLU C OE1   1 
ATOM   8297  O  OE2   . GLU C 2  598  ? 39.069  -27.890 93.809  1.00 85.07  ? 598  GLU C OE2   1 
ATOM   8298  N  N     . GLU C 2  599  ? 37.073  -27.935 99.316  1.00 77.86  ? 599  GLU C N     1 
ATOM   8299  C  CA    . GLU C 2  599  ? 37.272  -29.139 100.113 1.00 77.94  ? 599  GLU C CA    1 
ATOM   8300  C  C     . GLU C 2  599  ? 37.251  -28.754 101.589 1.00 76.71  ? 599  GLU C C     1 
ATOM   8301  O  O     . GLU C 2  599  ? 37.033  -27.590 101.921 1.00 78.04  ? 599  GLU C O     1 
ATOM   8302  C  CB    . GLU C 2  599  ? 38.601  -29.807 99.752  1.00 76.65  ? 599  GLU C CB    1 
ATOM   8303  C  CG    . GLU C 2  599  ? 38.600  -31.325 99.887  1.00 86.54  ? 599  GLU C CG    1 
ATOM   8304  C  CD    . GLU C 2  599  ? 37.753  -32.008 98.827  1.00 90.08  ? 599  GLU C CD    1 
ATOM   8305  O  OE1   . GLU C 2  599  ? 37.646  -31.463 97.707  1.00 84.52  ? 599  GLU C OE1   1 
ATOM   8306  O  OE2   . GLU C 2  599  ? 37.193  -33.089 99.115  1.00 84.93  ? 599  GLU C OE2   1 
ATOM   8307  N  N     . ASP C 2  600  ? 37.463  -29.722 102.474 1.00 73.64  ? 600  ASP C N     1 
ATOM   8308  C  CA    . ASP C 2  600  ? 37.540  -29.423 103.899 1.00 64.35  ? 600  ASP C CA    1 
ATOM   8309  C  C     . ASP C 2  600  ? 38.858  -28.710 104.160 1.00 61.30  ? 600  ASP C C     1 
ATOM   8310  O  O     . ASP C 2  600  ? 39.830  -28.922 103.439 1.00 72.14  ? 600  ASP C O     1 
ATOM   8311  C  CB    . ASP C 2  600  ? 37.448  -30.703 104.732 1.00 68.05  ? 600  ASP C CB    1 
ATOM   8312  C  CG    . ASP C 2  600  ? 36.438  -31.694 104.174 1.00 73.41  ? 600  ASP C CG    1 
ATOM   8313  O  OD1   . ASP C 2  600  ? 36.587  -32.088 102.998 1.00 78.86  ? 600  ASP C OD1   1 
ATOM   8314  O  OD2   . ASP C 2  600  ? 35.495  -32.074 104.904 1.00 62.46  ? 600  ASP C OD2   1 
ATOM   8315  N  N     . GLY C 2  601  ? 38.895  -27.854 105.174 1.00 58.30  ? 601  GLY C N     1 
ATOM   8316  C  CA    . GLY C 2  601  ? 40.113  -27.122 105.473 1.00 67.39  ? 601  GLY C CA    1 
ATOM   8317  C  C     . GLY C 2  601  ? 39.960  -25.958 106.433 1.00 60.83  ? 601  GLY C C     1 
ATOM   8318  O  O     . GLY C 2  601  ? 38.889  -25.730 106.994 1.00 59.70  ? 601  GLY C O     1 
ATOM   8319  N  N     . GLU C 2  602  ? 41.048  -25.218 106.618 1.00 60.81  ? 602  GLU C N     1 
ATOM   8320  C  CA    . GLU C 2  602  ? 41.068  -24.090 107.540 1.00 67.30  ? 602  GLU C CA    1 
ATOM   8321  C  C     . GLU C 2  602  ? 41.275  -22.785 106.777 1.00 62.11  ? 602  GLU C C     1 
ATOM   8322  O  O     . GLU C 2  602  ? 41.989  -22.750 105.775 1.00 61.04  ? 602  GLU C O     1 
ATOM   8323  C  CB    . GLU C 2  602  ? 42.169  -24.284 108.587 1.00 74.81  ? 602  GLU C CB    1 
ATOM   8324  C  CG    . GLU C 2  602  ? 42.201  -23.227 109.681 1.00 71.80  ? 602  GLU C CG    1 
ATOM   8325  C  CD    . GLU C 2  602  ? 43.215  -23.538 110.764 1.00 69.97  ? 602  GLU C CD    1 
ATOM   8326  O  OE1   . GLU C 2  602  ? 43.564  -24.726 110.930 1.00 67.29  ? 602  GLU C OE1   1 
ATOM   8327  O  OE2   . GLU C 2  602  ? 43.664  -22.592 111.446 1.00 65.17  ? 602  GLU C OE2   1 
ATOM   8328  N  N     . VAL C 2  603  ? 40.657  -21.711 107.259 1.00 62.68  ? 603  VAL C N     1 
ATOM   8329  C  CA    . VAL C 2  603  ? 40.713  -20.432 106.564 1.00 65.11  ? 603  VAL C CA    1 
ATOM   8330  C  C     . VAL C 2  603  ? 41.900  -19.616 107.055 1.00 59.61  ? 603  VAL C C     1 
ATOM   8331  O  O     . VAL C 2  603  ? 41.932  -19.165 108.200 1.00 57.47  ? 603  VAL C O     1 
ATOM   8332  C  CB    . VAL C 2  603  ? 39.416  -19.618 106.767 1.00 62.32  ? 603  VAL C CB    1 
ATOM   8333  C  CG1   . VAL C 2  603  ? 39.514  -18.272 106.066 1.00 56.51  ? 603  VAL C CG1   1 
ATOM   8334  C  CG2   . VAL C 2  603  ? 38.211  -20.400 106.262 1.00 58.23  ? 603  VAL C CG2   1 
ATOM   8335  N  N     . ALA C 2  604  ? 42.874  -19.425 106.172 1.00 56.44  ? 604  ALA C N     1 
ATOM   8336  C  CA    . ALA C 2  604  ? 44.108  -18.740 106.530 1.00 63.50  ? 604  ALA C CA    1 
ATOM   8337  C  C     . ALA C 2  604  ? 43.911  -17.235 106.666 1.00 59.41  ? 604  ALA C C     1 
ATOM   8338  O  O     . ALA C 2  604  ? 44.327  -16.628 107.653 1.00 61.36  ? 604  ALA C O     1 
ATOM   8339  C  CB    . ALA C 2  604  ? 45.192  -19.044 105.507 1.00 65.08  ? 604  ALA C CB    1 
ATOM   8340  N  N     . LYS C 2  605  ? 43.270  -16.632 105.673 1.00 55.26  ? 605  LYS C N     1 
ATOM   8341  C  CA    . LYS C 2  605  ? 43.136  -15.183 105.656 1.00 53.73  ? 605  LYS C CA    1 
ATOM   8342  C  C     . LYS C 2  605  ? 41.726  -14.704 105.317 1.00 55.90  ? 605  LYS C C     1 
ATOM   8343  O  O     . LYS C 2  605  ? 41.031  -15.310 104.502 1.00 58.35  ? 605  LYS C O     1 
ATOM   8344  C  CB    . LYS C 2  605  ? 44.138  -14.575 104.674 1.00 56.00  ? 605  LYS C CB    1 
ATOM   8345  C  CG    . LYS C 2  605  ? 45.594  -14.697 105.085 1.00 51.02  ? 605  LYS C CG    1 
ATOM   8346  C  CD    . LYS C 2  605  ? 46.486  -14.004 104.065 1.00 58.56  ? 605  LYS C CD    1 
ATOM   8347  C  CE    . LYS C 2  605  ? 47.934  -13.947 104.517 1.00 68.46  ? 605  LYS C CE    1 
ATOM   8348  N  NZ    . LYS C 2  605  ? 48.793  -13.293 103.491 1.00 60.75  ? 605  LYS C NZ    1 
ATOM   8349  N  N     . VAL C 2  606  ? 41.309  -13.610 105.952 1.00 57.04  ? 606  VAL C N     1 
ATOM   8350  C  CA    . VAL C 2  606  ? 40.045  -12.959 105.617 1.00 52.40  ? 606  VAL C CA    1 
ATOM   8351  C  C     . VAL C 2  606  ? 40.208  -11.448 105.439 1.00 53.93  ? 606  VAL C C     1 
ATOM   8352  O  O     . VAL C 2  606  ? 40.529  -10.717 106.377 1.00 45.72  ? 606  VAL C O     1 
ATOM   8353  C  CB    . VAL C 2  606  ? 38.952  -13.238 106.662 1.00 56.26  ? 606  VAL C CB    1 
ATOM   8354  C  CG1   . VAL C 2  606  ? 37.740  -12.351 106.412 1.00 50.54  ? 606  VAL C CG1   1 
ATOM   8355  C  CG2   . VAL C 2  606  ? 38.559  -14.706 106.633 1.00 60.03  ? 606  VAL C CG2   1 
ATOM   8356  N  N     . ASP C 2  607  ? 39.966  -10.996 104.216 1.00 61.10  ? 607  ASP C N     1 
ATOM   8357  C  CA    . ASP C 2  607  ? 40.104  -9.597  103.854 1.00 60.02  ? 607  ASP C CA    1 
ATOM   8358  C  C     . ASP C 2  607  ? 38.818  -9.179  103.158 1.00 62.08  ? 607  ASP C C     1 
ATOM   8359  O  O     . ASP C 2  607  ? 38.041  -10.029 102.720 1.00 63.01  ? 607  ASP C O     1 
ATOM   8360  C  CB    . ASP C 2  607  ? 41.289  -9.431  102.902 1.00 58.72  ? 607  ASP C CB    1 
ATOM   8361  C  CG    . ASP C 2  607  ? 41.777  -8.002  102.808 1.00 62.97  ? 607  ASP C CG    1 
ATOM   8362  O  OD1   . ASP C 2  607  ? 41.604  -7.249  103.788 1.00 66.78  ? 607  ASP C OD1   1 
ATOM   8363  O  OD2   . ASP C 2  607  ? 42.343  -7.634  101.756 1.00 61.93  ? 607  ASP C OD2   1 
ATOM   8364  N  N     . GLY C 2  608  ? 38.584  -7.877  103.057 1.00 58.02  ? 608  GLY C N     1 
ATOM   8365  C  CA    . GLY C 2  608  ? 37.429  -7.393  102.330 1.00 52.92  ? 608  GLY C CA    1 
ATOM   8366  C  C     . GLY C 2  608  ? 37.574  -7.673  100.846 1.00 53.02  ? 608  GLY C C     1 
ATOM   8367  O  O     . GLY C 2  608  ? 36.585  -7.858  100.136 1.00 53.06  ? 608  GLY C O     1 
ATOM   8368  N  N     . ASN C 2  609  ? 38.815  -7.684  100.371 1.00 51.01  ? 609  ASN C N     1 
ATOM   8369  C  CA    . ASN C 2  609  ? 39.083  -7.977  98.970  1.00 48.45  ? 609  ASN C CA    1 
ATOM   8370  C  C     . ASN C 2  609  ? 39.405  -9.443  98.666  1.00 48.00  ? 609  ASN C C     1 
ATOM   8371  O  O     . ASN C 2  609  ? 39.401  -9.847  97.503  1.00 48.76  ? 609  ASN C O     1 
ATOM   8372  C  CB    . ASN C 2  609  ? 40.213  -7.078  98.460  1.00 45.33  ? 609  ASN C CB    1 
ATOM   8373  C  CG    . ASN C 2  609  ? 39.957  -5.610  98.738  1.00 45.86  ? 609  ASN C CG    1 
ATOM   8374  O  OD1   . ASN C 2  609  ? 38.815  -5.154  98.709  1.00 45.86  ? 609  ASN C OD1   1 
ATOM   8375  N  ND2   . ASN C 2  609  ? 41.019  -4.862  99.013  1.00 45.35  ? 609  ASN C ND2   1 
ATOM   8376  N  N     . ARG C 2  610  ? 39.666  -10.243 99.697  1.00 43.62  ? 610  ARG C N     1 
ATOM   8377  C  CA    . ARG C 2  610  ? 40.091  -11.625 99.465  1.00 47.84  ? 610  ARG C CA    1 
ATOM   8378  C  C     . ARG C 2  610  ? 39.885  -12.575 100.639 1.00 48.36  ? 610  ARG C C     1 
ATOM   8379  O  O     . ARG C 2  610  ? 39.772  -12.149 101.784 1.00 51.70  ? 610  ARG C O     1 
ATOM   8380  C  CB    . ARG C 2  610  ? 41.559  -11.668 99.022  1.00 56.68  ? 610  ARG C CB    1 
ATOM   8381  C  CG    . ARG C 2  610  ? 42.527  -10.932 99.943  1.00 61.03  ? 610  ARG C CG    1 
ATOM   8382  C  CD    . ARG C 2  610  ? 43.272  -11.874 100.885 1.00 60.18  ? 610  ARG C CD    1 
ATOM   8383  N  NE    . ARG C 2  610  ? 44.388  -11.197 101.546 1.00 62.62  ? 610  ARG C NE    1 
ATOM   8384  C  CZ    . ARG C 2  610  ? 44.496  -11.019 102.860 1.00 63.34  ? 610  ARG C CZ    1 
ATOM   8385  N  NH1   . ARG C 2  610  ? 43.561  -11.482 103.679 1.00 56.25  ? 610  ARG C NH1   1 
ATOM   8386  N  NH2   . ARG C 2  610  ? 45.549  -10.386 103.359 1.00 65.73  ? 610  ARG C NH2   1 
ATOM   8387  N  N     . ILE C 2  611  ? 39.851  -13.868 100.328 1.00 46.46  ? 611  ILE C N     1 
ATOM   8388  C  CA    . ILE C 2  611  ? 39.785  -14.925 101.331 1.00 45.65  ? 611  ILE C CA    1 
ATOM   8389  C  C     . ILE C 2  611  ? 40.782  -16.016 100.970 1.00 55.16  ? 611  ILE C C     1 
ATOM   8390  O  O     . ILE C 2  611  ? 40.665  -16.634 99.914  1.00 61.11  ? 611  ILE C O     1 
ATOM   8391  C  CB    . ILE C 2  611  ? 38.387  -15.573 101.389 1.00 42.68  ? 611  ILE C CB    1 
ATOM   8392  C  CG1   . ILE C 2  611  ? 37.339  -14.578 101.892 1.00 46.01  ? 611  ILE C CG1   1 
ATOM   8393  C  CG2   . ILE C 2  611  ? 38.407  -16.806 102.281 1.00 47.62  ? 611  ILE C CG2   1 
ATOM   8394  C  CD1   . ILE C 2  611  ? 35.951  -15.180 102.035 1.00 41.91  ? 611  ILE C CD1   1 
ATOM   8395  N  N     . VAL C 2  612  ? 41.753  -16.267 101.844 1.00 59.55  ? 612  VAL C N     1 
ATOM   8396  C  CA    . VAL C 2  612  ? 42.755  -17.299 101.576 1.00 56.83  ? 612  VAL C CA    1 
ATOM   8397  C  C     . VAL C 2  612  ? 42.504  -18.563 102.397 1.00 51.29  ? 612  VAL C C     1 
ATOM   8398  O  O     . VAL C 2  612  ? 42.358  -18.506 103.619 1.00 55.36  ? 612  VAL C O     1 
ATOM   8399  C  CB    . VAL C 2  612  ? 44.179  -16.787 101.836 1.00 55.99  ? 612  VAL C CB    1 
ATOM   8400  C  CG1   . VAL C 2  612  ? 45.196  -17.842 101.437 1.00 59.65  ? 612  VAL C CG1   1 
ATOM   8401  C  CG2   . VAL C 2  612  ? 44.419  -15.488 101.077 1.00 51.99  ? 612  VAL C CG2   1 
ATOM   8402  N  N     . VAL C 2  613  ? 42.466  -19.704 101.716 1.00 49.86  ? 613  VAL C N     1 
ATOM   8403  C  CA    . VAL C 2  613  ? 42.068  -20.959 102.346 1.00 63.17  ? 613  VAL C CA    1 
ATOM   8404  C  C     . VAL C 2  613  ? 43.084  -22.089 102.164 1.00 74.50  ? 613  VAL C C     1 
ATOM   8405  O  O     . VAL C 2  613  ? 43.516  -22.377 101.048 1.00 74.00  ? 613  VAL C O     1 
ATOM   8406  C  CB    . VAL C 2  613  ? 40.697  -21.423 101.810 1.00 62.49  ? 613  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 2  613  ? 40.402  -22.855 102.231 1.00 62.15  ? 613  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 2  613  ? 39.604  -20.480 102.282 1.00 64.14  ? 613  VAL C CG2   1 
ATOM   8409  N  N     . ARG C 2  614  ? 43.458  -22.723 103.272 1.00 73.92  ? 614  ARG C N     1 
ATOM   8410  C  CA    . ARG C 2  614  ? 44.296  -23.916 103.236 1.00 72.65  ? 614  ARG C CA    1 
ATOM   8411  C  C     . ARG C 2  614  ? 43.429  -25.162 103.372 1.00 75.52  ? 614  ARG C C     1 
ATOM   8412  O  O     . ARG C 2  614  ? 42.709  -25.319 104.358 1.00 75.19  ? 614  ARG C O     1 
ATOM   8413  C  CB    . ARG C 2  614  ? 45.327  -23.882 104.365 1.00 85.60  ? 614  ARG C CB    1 
ATOM   8414  C  CG    . ARG C 2  614  ? 46.175  -25.144 104.468 1.00 91.41  ? 614  ARG C CG    1 
ATOM   8415  C  CD    . ARG C 2  614  ? 47.139  -25.080 105.646 1.00 90.57  ? 614  ARG C CD    1 
ATOM   8416  N  NE    . ARG C 2  614  ? 47.986  -23.891 105.595 1.00 94.01  ? 614  ARG C NE    1 
ATOM   8417  C  CZ    . ARG C 2  614  ? 49.085  -23.787 104.854 1.00 91.96  ? 614  ARG C CZ    1 
ATOM   8418  N  NH1   . ARG C 2  614  ? 49.791  -22.665 104.870 1.00 80.39  ? 614  ARG C NH1   1 
ATOM   8419  N  NH2   . ARG C 2  614  ? 49.474  -24.801 104.092 1.00 92.36  ? 614  ARG C NH2   1 
ATOM   8420  N  N     . TYR C 2  615  ? 43.499  -26.047 102.382 1.00 80.57  ? 615  TYR C N     1 
ATOM   8421  C  CA    . TYR C 2  615  ? 42.707  -27.275 102.400 1.00 89.09  ? 615  TYR C CA    1 
ATOM   8422  C  C     . TYR C 2  615  ? 43.477  -28.455 102.998 1.00 96.60  ? 615  TYR C C     1 
ATOM   8423  O  O     . TYR C 2  615  ? 44.601  -28.296 103.478 1.00 101.83 ? 615  TYR C O     1 
ATOM   8424  C  CB    . TYR C 2  615  ? 42.207  -27.617 100.991 1.00 87.52  ? 615  TYR C CB    1 
ATOM   8425  C  CG    . TYR C 2  615  ? 41.192  -26.633 100.446 1.00 86.82  ? 615  TYR C CG    1 
ATOM   8426  C  CD1   . TYR C 2  615  ? 41.505  -25.791 99.386  1.00 82.76  ? 615  TYR C CD1   1 
ATOM   8427  C  CD2   . TYR C 2  615  ? 39.921  -26.543 101.000 1.00 79.57  ? 615  TYR C CD2   1 
ATOM   8428  C  CE1   . TYR C 2  615  ? 40.576  -24.890 98.890  1.00 74.77  ? 615  TYR C CE1   1 
ATOM   8429  C  CE2   . TYR C 2  615  ? 38.989  -25.645 100.512 1.00 71.05  ? 615  TYR C CE2   1 
ATOM   8430  C  CZ    . TYR C 2  615  ? 39.320  -24.823 99.459  1.00 70.48  ? 615  TYR C CZ    1 
ATOM   8431  O  OH    . TYR C 2  615  ? 38.388  -23.933 98.979  1.00 62.53  ? 615  TYR C OH    1 
ATOM   8432  N  N     . GLU C 2  616  ? 42.864  -29.636 102.971 1.00 94.28  ? 616  GLU C N     1 
ATOM   8433  C  CA    . GLU C 2  616  ? 43.503  -30.849 103.477 1.00 101.11 ? 616  GLU C CA    1 
ATOM   8434  C  C     . GLU C 2  616  ? 44.669  -31.256 102.586 1.00 102.90 ? 616  GLU C C     1 
ATOM   8435  O  O     . GLU C 2  616  ? 45.547  -32.016 102.996 1.00 100.17 ? 616  GLU C O     1 
ATOM   8436  C  CB    . GLU C 2  616  ? 42.493  -31.995 103.571 1.00 99.87  ? 616  GLU C CB    1 
ATOM   8437  C  CG    . GLU C 2  616  ? 41.391  -31.780 104.597 1.00 100.82 ? 616  GLU C CG    1 
ATOM   8438  C  CD    . GLU C 2  616  ? 41.904  -31.803 106.026 1.00 113.27 ? 616  GLU C CD    1 
ATOM   8439  O  OE1   . GLU C 2  616  ? 42.499  -30.796 106.470 1.00 103.97 ? 616  GLU C OE1   1 
ATOM   8440  O  OE2   . GLU C 2  616  ? 41.707  -32.831 106.708 1.00 132.44 ? 616  GLU C OE2   1 
ATOM   8441  N  N     . ASP C 2  617  ? 44.667  -30.739 101.362 1.00 102.83 ? 617  ASP C N     1 
ATOM   8442  C  CA    . ASP C 2  617  ? 45.731  -31.004 100.407 1.00 98.26  ? 617  ASP C CA    1 
ATOM   8443  C  C     . ASP C 2  617  ? 46.980  -30.202 100.764 1.00 96.48  ? 617  ASP C C     1 
ATOM   8444  O  O     . ASP C 2  617  ? 48.040  -30.386 100.166 1.00 101.58 ? 617  ASP C O     1 
ATOM   8445  C  CB    . ASP C 2  617  ? 45.264  -30.656 98.993  1.00 94.49  ? 617  ASP C CB    1 
ATOM   8446  C  CG    . ASP C 2  617  ? 43.873  -31.189 98.690  1.00 95.61  ? 617  ASP C CG    1 
ATOM   8447  O  OD1   . ASP C 2  617  ? 43.016  -31.176 99.599  1.00 92.50  ? 617  ASP C OD1   1 
ATOM   8448  O  OD2   . ASP C 2  617  ? 43.636  -31.621 97.544  1.00 98.75  ? 617  ASP C OD2   1 
ATOM   8449  N  N     . GLY C 2  618  ? 46.844  -29.309 101.741 1.00 93.12  ? 618  GLY C N     1 
ATOM   8450  C  CA    . GLY C 2  618  ? 47.949  -28.483 102.194 1.00 96.92  ? 618  GLY C CA    1 
ATOM   8451  C  C     . GLY C 2  618  ? 48.187  -27.283 101.296 1.00 94.89  ? 618  GLY C C     1 
ATOM   8452  O  O     . GLY C 2  618  ? 49.013  -26.420 101.599 1.00 87.35  ? 618  GLY C O     1 
ATOM   8453  N  N     . ARG C 2  619  ? 47.456  -27.230 100.188 1.00 88.61  ? 619  ARG C N     1 
ATOM   8454  C  CA    . ARG C 2  619  ? 47.610  -26.162 99.210  1.00 80.00  ? 619  ARG C CA    1 
ATOM   8455  C  C     . ARG C 2  619  ? 46.870  -24.897 99.628  1.00 79.26  ? 619  ARG C C     1 
ATOM   8456  O  O     . ARG C 2  619  ? 45.800  -24.959 100.234 1.00 77.23  ? 619  ARG C O     1 
ATOM   8457  C  CB    . ARG C 2  619  ? 47.116  -26.628 97.840  1.00 82.42  ? 619  ARG C CB    1 
ATOM   8458  C  CG    . ARG C 2  619  ? 45.698  -27.164 97.849  1.00 76.91  ? 619  ARG C CG    1 
ATOM   8459  C  CD    . ARG C 2  619  ? 45.370  -27.866 96.547  1.00 72.25  ? 619  ARG C CD    1 
ATOM   8460  N  NE    . ARG C 2  619  ? 44.055  -28.495 96.590  1.00 81.96  ? 619  ARG C NE    1 
ATOM   8461  C  CZ    . ARG C 2  619  ? 42.956  -27.968 96.062  1.00 85.31  ? 619  ARG C CZ    1 
ATOM   8462  N  NH1   . ARG C 2  619  ? 41.802  -28.614 96.151  1.00 85.16  ? 619  ARG C NH1   1 
ATOM   8463  N  NH2   . ARG C 2  619  ? 43.012  -26.798 95.441  1.00 80.53  ? 619  ARG C NH2   1 
ATOM   8464  N  N     . LEU C 2  620  ? 47.453  -23.748 99.303  1.00 80.68  ? 620  LEU C N     1 
ATOM   8465  C  CA    . LEU C 2  620  ? 46.820  -22.467 99.582  1.00 71.16  ? 620  LEU C CA    1 
ATOM   8466  C  C     . LEU C 2  620  ? 46.069  -21.981 98.354  1.00 72.14  ? 620  LEU C C     1 
ATOM   8467  O  O     . LEU C 2  620  ? 46.672  -21.666 97.328  1.00 68.75  ? 620  LEU C O     1 
ATOM   8468  C  CB    . LEU C 2  620  ? 47.860  -21.427 99.998  1.00 65.66  ? 620  LEU C CB    1 
ATOM   8469  C  CG    . LEU C 2  620  ? 47.643  -20.792 101.371 1.00 70.47  ? 620  LEU C CG    1 
ATOM   8470  C  CD1   . LEU C 2  620  ? 47.648  -21.863 102.443 1.00 72.90  ? 620  LEU C CD1   1 
ATOM   8471  C  CD2   . LEU C 2  620  ? 48.702  -19.739 101.656 1.00 66.77  ? 620  LEU C CD2   1 
ATOM   8472  N  N     . VAL C 2  621  ? 44.746  -21.931 98.465  1.00 71.68  ? 621  VAL C N     1 
ATOM   8473  C  CA    . VAL C 2  621  ? 43.908  -21.421 97.392  1.00 58.81  ? 621  VAL C CA    1 
ATOM   8474  C  C     . VAL C 2  621  ? 43.349  -20.061 97.784  1.00 57.99  ? 621  VAL C C     1 
ATOM   8475  O  O     . VAL C 2  621  ? 42.707  -19.918 98.826  1.00 58.65  ? 621  VAL C O     1 
ATOM   8476  C  CB    . VAL C 2  621  ? 42.747  -22.374 97.080  1.00 60.17  ? 621  VAL C CB    1 
ATOM   8477  C  CG1   . VAL C 2  621  ? 41.915  -21.831 95.929  1.00 62.08  ? 621  VAL C CG1   1 
ATOM   8478  C  CG2   . VAL C 2  621  ? 43.278  -23.760 96.752  1.00 72.83  ? 621  VAL C CG2   1 
ATOM   8479  N  N     . GLU C 2  622  ? 43.608  -19.061 96.951  1.00 57.22  ? 622  GLU C N     1 
ATOM   8480  C  CA    . GLU C 2  622  ? 43.145  -17.712 97.226  1.00 54.20  ? 622  GLU C CA    1 
ATOM   8481  C  C     . GLU C 2  622  ? 41.927  -17.364 96.379  1.00 60.05  ? 622  GLU C C     1 
ATOM   8482  O  O     . GLU C 2  622  ? 41.945  -17.500 95.155  1.00 60.02  ? 622  GLU C O     1 
ATOM   8483  C  CB    . GLU C 2  622  ? 44.256  -16.698 96.972  1.00 53.17  ? 622  GLU C CB    1 
ATOM   8484  C  CG    . GLU C 2  622  ? 43.895  -15.288 97.395  1.00 57.51  ? 622  GLU C CG    1 
ATOM   8485  C  CD    . GLU C 2  622  ? 44.705  -14.242 96.666  1.00 73.36  ? 622  GLU C CD    1 
ATOM   8486  O  OE1   . GLU C 2  622  ? 45.508  -13.545 97.323  1.00 73.49  ? 622  GLU C OE1   1 
ATOM   8487  O  OE2   . GLU C 2  622  ? 44.533  -14.116 95.434  1.00 78.31  ? 622  GLU C OE2   1 
ATOM   8488  N  N     . TYR C 2  623  ? 40.870  -16.913 97.044  1.00 57.20  ? 623  TYR C N     1 
ATOM   8489  C  CA    . TYR C 2  623  ? 39.652  -16.496 96.372  1.00 44.10  ? 623  TYR C CA    1 
ATOM   8490  C  C     . TYR C 2  623  ? 39.494  -14.983 96.456  1.00 44.67  ? 623  TYR C C     1 
ATOM   8491  O  O     . TYR C 2  623  ? 39.262  -14.441 97.536  1.00 46.52  ? 623  TYR C O     1 
ATOM   8492  C  CB    . TYR C 2  623  ? 38.443  -17.179 97.007  1.00 43.28  ? 623  TYR C CB    1 
ATOM   8493  C  CG    . TYR C 2  623  ? 38.484  -18.687 96.946  1.00 46.83  ? 623  TYR C CG    1 
ATOM   8494  C  CD1   . TYR C 2  623  ? 38.115  -19.362 95.793  1.00 53.48  ? 623  TYR C CD1   1 
ATOM   8495  C  CD2   . TYR C 2  623  ? 38.884  -19.436 98.043  1.00 46.57  ? 623  TYR C CD2   1 
ATOM   8496  C  CE1   . TYR C 2  623  ? 38.148  -20.741 95.730  1.00 56.00  ? 623  TYR C CE1   1 
ATOM   8497  C  CE2   . TYR C 2  623  ? 38.919  -20.817 97.989  1.00 49.19  ? 623  TYR C CE2   1 
ATOM   8498  C  CZ    . TYR C 2  623  ? 38.549  -21.463 96.830  1.00 49.65  ? 623  TYR C CZ    1 
ATOM   8499  O  OH    . TYR C 2  623  ? 38.581  -22.838 96.767  1.00 57.56  ? 623  TYR C OH    1 
ATOM   8500  N  N     . PRO C 2  624  ? 39.639  -14.292 95.316  1.00 45.45  ? 624  PRO C N     1 
ATOM   8501  C  CA    . PRO C 2  624  ? 39.411  -12.845 95.262  1.00 45.46  ? 624  PRO C CA    1 
ATOM   8502  C  C     . PRO C 2  624  ? 37.918  -12.538 95.227  1.00 46.36  ? 624  PRO C C     1 
ATOM   8503  O  O     . PRO C 2  624  ? 37.132  -13.353 94.740  1.00 44.89  ? 624  PRO C O     1 
ATOM   8504  C  CB    . PRO C 2  624  ? 40.062  -12.447 93.940  1.00 42.82  ? 624  PRO C CB    1 
ATOM   8505  C  CG    . PRO C 2  624  ? 39.900  -13.652 93.085  1.00 45.96  ? 624  PRO C CG    1 
ATOM   8506  C  CD    . PRO C 2  624  ? 40.035  -14.837 94.007  1.00 43.78  ? 624  PRO C CD    1 
ATOM   8507  N  N     . LEU C 2  625  ? 37.533  -11.373 95.732  1.00 44.91  ? 625  LEU C N     1 
ATOM   8508  C  CA    . LEU C 2  625  ? 36.124  -11.013 95.813  1.00 43.05  ? 625  LEU C CA    1 
ATOM   8509  C  C     . LEU C 2  625  ? 35.757  -9.895  94.843  1.00 44.28  ? 625  LEU C C     1 
ATOM   8510  O  O     . LEU C 2  625  ? 36.444  -8.878  94.765  1.00 46.06  ? 625  LEU C O     1 
ATOM   8511  C  CB    . LEU C 2  625  ? 35.763  -10.597 97.242  1.00 44.50  ? 625  LEU C CB    1 
ATOM   8512  C  CG    . LEU C 2  625  ? 35.997  -11.646 98.331  1.00 43.11  ? 625  LEU C CG    1 
ATOM   8513  C  CD1   . LEU C 2  625  ? 35.485  -11.162 99.682  1.00 38.30  ? 625  LEU C CD1   1 
ATOM   8514  C  CD2   . LEU C 2  625  ? 35.342  -12.958 97.940  1.00 39.49  ? 625  LEU C CD2   1 
ATOM   8515  N  N     . ARG C 2  626  ? 34.668  -10.090 94.107  1.00 47.02  ? 626  ARG C N     1 
ATOM   8516  C  CA    . ARG C 2  626  ? 34.129  -9.037  93.258  1.00 49.31  ? 626  ARG C CA    1 
ATOM   8517  C  C     . ARG C 2  626  ? 33.437  -8.021  94.153  1.00 49.96  ? 626  ARG C C     1 
ATOM   8518  O  O     . ARG C 2  626  ? 32.531  -8.370  94.909  1.00 51.06  ? 626  ARG C O     1 
ATOM   8519  C  CB    . ARG C 2  626  ? 33.135  -9.615  92.248  1.00 54.13  ? 626  ARG C CB    1 
ATOM   8520  C  CG    . ARG C 2  626  ? 32.420  -8.570  91.408  1.00 52.59  ? 626  ARG C CG    1 
ATOM   8521  C  CD    . ARG C 2  626  ? 31.511  -9.200  90.356  1.00 62.33  ? 626  ARG C CD    1 
ATOM   8522  N  NE    . ARG C 2  626  ? 32.256  -9.957  89.351  1.00 71.41  ? 626  ARG C NE    1 
ATOM   8523  C  CZ    . ARG C 2  626  ? 32.286  -11.285 89.284  1.00 67.93  ? 626  ARG C CZ    1 
ATOM   8524  N  NH1   . ARG C 2  626  ? 31.606  -12.010 90.163  1.00 62.20  ? 626  ARG C NH1   1 
ATOM   8525  N  NH2   . ARG C 2  626  ? 32.994  -11.889 88.337  1.00 55.22  ? 626  ARG C NH2   1 
ATOM   8526  N  N     . ARG C 2  627  ? 33.869  -6.767  94.074  1.00 49.20  ? 627  ARG C N     1 
ATOM   8527  C  CA    . ARG C 2  627  ? 33.367  -5.735  94.975  1.00 42.53  ? 627  ARG C CA    1 
ATOM   8528  C  C     . ARG C 2  627  ? 32.897  -4.478  94.249  1.00 47.25  ? 627  ARG C C     1 
ATOM   8529  O  O     . ARG C 2  627  ? 33.679  -3.803  93.578  1.00 48.81  ? 627  ARG C O     1 
ATOM   8530  C  CB    . ARG C 2  627  ? 34.427  -5.377  96.015  1.00 39.17  ? 627  ARG C CB    1 
ATOM   8531  C  CG    . ARG C 2  627  ? 34.473  -6.322  97.199  1.00 43.96  ? 627  ARG C CG    1 
ATOM   8532  C  CD    . ARG C 2  627  ? 33.317  -6.059  98.141  1.00 39.38  ? 627  ARG C CD    1 
ATOM   8533  N  NE    . ARG C 2  627  ? 33.504  -6.718  99.428  1.00 45.48  ? 627  ARG C NE    1 
ATOM   8534  C  CZ    . ARG C 2  627  ? 32.826  -6.407  100.529 1.00 54.25  ? 627  ARG C CZ    1 
ATOM   8535  N  NH1   . ARG C 2  627  ? 31.919  -5.439  100.497 1.00 49.52  ? 627  ARG C NH1   1 
ATOM   8536  N  NH2   . ARG C 2  627  ? 33.055  -7.058  101.662 1.00 55.29  ? 627  ARG C NH2   1 
ATOM   8537  N  N     . PHE C 2  628  ? 31.610  -4.183  94.403  1.00 48.28  ? 628  PHE C N     1 
ATOM   8538  C  CA    . PHE C 2  628  ? 30.975  -3.005  93.823  1.00 39.61  ? 628  PHE C CA    1 
ATOM   8539  C  C     . PHE C 2  628  ? 31.136  -2.930  92.309  1.00 42.59  ? 628  PHE C C     1 
ATOM   8540  O  O     . PHE C 2  628  ? 31.471  -1.881  91.763  1.00 46.01  ? 628  PHE C O     1 
ATOM   8541  C  CB    . PHE C 2  628  ? 31.490  -1.734  94.496  1.00 31.82  ? 628  PHE C CB    1 
ATOM   8542  C  CG    . PHE C 2  628  ? 31.383  -1.762  95.991  1.00 35.29  ? 628  PHE C CG    1 
ATOM   8543  C  CD1   . PHE C 2  628  ? 30.185  -1.471  96.617  1.00 42.60  ? 628  PHE C CD1   1 
ATOM   8544  C  CD2   . PHE C 2  628  ? 32.476  -2.087  96.772  1.00 41.58  ? 628  PHE C CD2   1 
ATOM   8545  C  CE1   . PHE C 2  628  ? 30.082  -1.500  97.994  1.00 46.59  ? 628  PHE C CE1   1 
ATOM   8546  C  CE2   . PHE C 2  628  ? 32.379  -2.116  98.150  1.00 40.29  ? 628  PHE C CE2   1 
ATOM   8547  C  CZ    . PHE C 2  628  ? 31.181  -1.822  98.761  1.00 40.04  ? 628  PHE C CZ    1 
ATOM   8548  N  N     . TYR C 2  629  ? 30.908  -4.054  91.638  1.00 45.82  ? 629  TYR C N     1 
ATOM   8549  C  CA    . TYR C 2  629  ? 30.896  -4.081  90.181  1.00 54.14  ? 629  TYR C CA    1 
ATOM   8550  C  C     . TYR C 2  629  ? 29.525  -3.652  89.674  1.00 47.33  ? 629  TYR C C     1 
ATOM   8551  O  O     . TYR C 2  629  ? 28.503  -3.926  90.306  1.00 40.40  ? 629  TYR C O     1 
ATOM   8552  C  CB    . TYR C 2  629  ? 31.261  -5.472  89.646  1.00 62.15  ? 629  TYR C CB    1 
ATOM   8553  C  CG    . TYR C 2  629  ? 32.747  -5.680  89.414  1.00 82.04  ? 629  TYR C CG    1 
ATOM   8554  C  CD1   . TYR C 2  629  ? 33.665  -5.508  90.448  1.00 78.46  ? 629  TYR C CD1   1 
ATOM   8555  C  CD2   . TYR C 2  629  ? 33.231  -6.058  88.166  1.00 88.95  ? 629  TYR C CD2   1 
ATOM   8556  C  CE1   . TYR C 2  629  ? 35.024  -5.701  90.243  1.00 81.40  ? 629  TYR C CE1   1 
ATOM   8557  C  CE2   . TYR C 2  629  ? 34.590  -6.252  87.952  1.00 97.01  ? 629  TYR C CE2   1 
ATOM   8558  C  CZ    . TYR C 2  629  ? 35.481  -6.072  88.995  1.00 91.08  ? 629  TYR C CZ    1 
ATOM   8559  O  OH    . TYR C 2  629  ? 36.829  -6.263  88.793  1.00 80.84  ? 629  TYR C OH    1 
ATOM   8560  N  N     . ARG C 2  630  ? 29.514  -2.966  88.538  1.00 38.51  ? 630  ARG C N     1 
ATOM   8561  C  CA    . ARG C 2  630  ? 28.278  -2.489  87.940  1.00 24.53  ? 630  ARG C CA    1 
ATOM   8562  C  C     . ARG C 2  630  ? 27.650  -3.600  87.116  1.00 18.26  ? 630  ARG C C     1 
ATOM   8563  O  O     . ARG C 2  630  ? 28.306  -4.187  86.262  1.00 21.56  ? 630  ARG C O     1 
ATOM   8564  C  CB    . ARG C 2  630  ? 28.568  -1.284  87.048  1.00 28.82  ? 630  ARG C CB    1 
ATOM   8565  C  CG    . ARG C 2  630  ? 27.341  -0.503  86.629  1.00 26.37  ? 630  ARG C CG    1 
ATOM   8566  C  CD    . ARG C 2  630  ? 27.668  0.492   85.531  1.00 23.88  ? 630  ARG C CD    1 
ATOM   8567  N  NE    . ARG C 2  630  ? 27.232  0.001   84.230  1.00 23.58  ? 630  ARG C NE    1 
ATOM   8568  C  CZ    . ARG C 2  630  ? 25.999  0.150   83.760  1.00 24.33  ? 630  ARG C CZ    1 
ATOM   8569  N  NH1   . ARG C 2  630  ? 25.087  0.781   84.487  1.00 23.97  ? 630  ARG C NH1   1 
ATOM   8570  N  NH2   . ARG C 2  630  ? 25.676  -0.331  82.567  1.00 26.80  ? 630  ARG C NH2   1 
ATOM   8571  N  N     . SER C 2  631  ? 26.384  -3.900  87.374  1.00 22.38  ? 631  SER C N     1 
ATOM   8572  C  CA    . SER C 2  631  ? 25.699  -4.927  86.601  1.00 27.45  ? 631  SER C CA    1 
ATOM   8573  C  C     . SER C 2  631  ? 25.148  -4.310  85.332  1.00 26.76  ? 631  SER C C     1 
ATOM   8574  O  O     . SER C 2  631  ? 25.238  -3.100  85.141  1.00 30.76  ? 631  SER C O     1 
ATOM   8575  C  CB    . SER C 2  631  ? 24.555  -5.538  87.403  1.00 27.16  ? 631  SER C CB    1 
ATOM   8576  O  OG    . SER C 2  631  ? 23.507  -4.601  87.566  1.00 27.51  ? 631  SER C OG    1 
ATOM   8577  N  N     . ASN C 2  632  ? 24.554  -5.138  84.481  1.00 26.96  ? 632  ASN C N     1 
ATOM   8578  C  CA    . ASN C 2  632  ? 23.988  -4.661  83.226  1.00 30.19  ? 632  ASN C CA    1 
ATOM   8579  C  C     . ASN C 2  632  ? 22.838  -3.688  83.467  1.00 28.39  ? 632  ASN C C     1 
ATOM   8580  O  O     . ASN C 2  632  ? 22.587  -2.787  82.665  1.00 29.66  ? 632  ASN C O     1 
ATOM   8581  C  CB    . ASN C 2  632  ? 23.519  -5.840  82.371  1.00 30.36  ? 632  ASN C CB    1 
ATOM   8582  C  CG    . ASN C 2  632  ? 24.664  -6.534  81.654  1.00 32.59  ? 632  ASN C CG    1 
ATOM   8583  O  OD1   . ASN C 2  632  ? 25.833  -6.226  81.883  1.00 42.95  ? 632  ASN C OD1   1 
ATOM   8584  N  ND2   . ASN C 2  632  ? 24.332  -7.481  80.781  1.00 28.77  ? 632  ASN C ND2   1 
ATOM   8585  N  N     . GLN C 2  633  ? 22.148  -3.882  84.583  1.00 22.94  ? 633  GLN C N     1 
ATOM   8586  C  CA    . GLN C 2  633  ? 21.008  -3.054  84.941  1.00 22.70  ? 633  GLN C CA    1 
ATOM   8587  C  C     . GLN C 2  633  ? 21.398  -1.933  85.904  1.00 25.29  ? 633  GLN C C     1 
ATOM   8588  O  O     . GLN C 2  633  ? 20.546  -1.177  86.372  1.00 26.68  ? 633  GLN C O     1 
ATOM   8589  C  CB    . GLN C 2  633  ? 19.882  -3.914  85.521  1.00 22.52  ? 633  GLN C CB    1 
ATOM   8590  C  CG    . GLN C 2  633  ? 19.069  -4.661  84.472  1.00 20.59  ? 633  GLN C CG    1 
ATOM   8591  C  CD    . GLN C 2  633  ? 19.908  -5.606  83.631  1.00 22.70  ? 633  GLN C CD    1 
ATOM   8592  O  OE1   . GLN C 2  633  ? 20.767  -6.318  84.145  1.00 26.63  ? 633  GLN C OE1   1 
ATOM   8593  N  NE2   . GLN C 2  633  ? 19.667  -5.607  82.327  1.00 24.95  ? 633  GLN C NE2   1 
ATOM   8594  N  N     . GLY C 2  634  ? 22.687  -1.838  86.210  1.00 24.15  ? 634  GLY C N     1 
ATOM   8595  C  CA    . GLY C 2  634  ? 23.184  -0.754  87.037  1.00 26.80  ? 634  GLY C CA    1 
ATOM   8596  C  C     . GLY C 2  634  ? 23.190  -1.041  88.527  1.00 29.79  ? 634  GLY C C     1 
ATOM   8597  O  O     . GLY C 2  634  ? 23.636  -0.208  89.320  1.00 27.47  ? 634  GLY C O     1 
ATOM   8598  N  N     . THR C 2  635  ? 22.694  -2.214  88.915  1.00 29.75  ? 635  THR C N     1 
ATOM   8599  C  CA    . THR C 2  635  ? 22.720  -2.622  90.316  1.00 25.81  ? 635  THR C CA    1 
ATOM   8600  C  C     . THR C 2  635  ? 24.128  -3.058  90.696  1.00 23.48  ? 635  THR C C     1 
ATOM   8601  O  O     . THR C 2  635  ? 24.860  -3.592  89.867  1.00 22.16  ? 635  THR C O     1 
ATOM   8602  C  CB    . THR C 2  635  ? 21.714  -3.758  90.612  1.00 23.28  ? 635  THR C CB    1 
ATOM   8603  O  OG1   . THR C 2  635  ? 22.006  -4.899  89.795  1.00 21.72  ? 635  THR C OG1   1 
ATOM   8604  C  CG2   . THR C 2  635  ? 20.298  -3.294  90.331  1.00 23.40  ? 635  THR C CG2   1 
ATOM   8605  N  N     . ALA C 2  636  ? 24.509  -2.820  91.946  1.00 28.38  ? 636  ALA C N     1 
ATOM   8606  C  CA    . ALA C 2  636  ? 25.862  -3.139  92.395  1.00 27.62  ? 636  ALA C CA    1 
ATOM   8607  C  C     . ALA C 2  636  ? 25.981  -4.582  92.874  1.00 26.41  ? 636  ALA C C     1 
ATOM   8608  O  O     . ALA C 2  636  ? 25.358  -4.979  93.860  1.00 21.18  ? 636  ALA C O     1 
ATOM   8609  C  CB    . ALA C 2  636  ? 26.299  -2.176  93.489  1.00 23.79  ? 636  ALA C CB    1 
ATOM   8610  N  N     . LEU C 2  637  ? 26.808  -5.355  92.180  1.00 33.14  ? 637  LEU C N     1 
ATOM   8611  C  CA    . LEU C 2  637  ? 27.022  -6.749  92.535  1.00 38.21  ? 637  LEU C CA    1 
ATOM   8612  C  C     . LEU C 2  637  ? 28.324  -6.863  93.304  1.00 45.85  ? 637  LEU C C     1 
ATOM   8613  O  O     . LEU C 2  637  ? 29.400  -6.683  92.733  1.00 46.94  ? 637  LEU C O     1 
ATOM   8614  C  CB    . LEU C 2  637  ? 27.103  -7.613  91.277  1.00 30.10  ? 637  LEU C CB    1 
ATOM   8615  C  CG    . LEU C 2  637  ? 25.946  -7.481  90.288  1.00 31.51  ? 637  LEU C CG    1 
ATOM   8616  C  CD1   . LEU C 2  637  ? 26.212  -8.317  89.045  1.00 29.59  ? 637  LEU C CD1   1 
ATOM   8617  C  CD2   . LEU C 2  637  ? 24.623  -7.873  90.940  1.00 28.45  ? 637  LEU C CD2   1 
ATOM   8618  N  N     . ASP C 2  638  ? 28.229  -7.155  94.598  1.00 45.27  ? 638  ASP C N     1 
ATOM   8619  C  CA    . ASP C 2  638  ? 29.427  -7.326  95.412  1.00 47.06  ? 638  ASP C CA    1 
ATOM   8620  C  C     . ASP C 2  638  ? 29.319  -8.470  96.414  1.00 47.59  ? 638  ASP C C     1 
ATOM   8621  O  O     . ASP C 2  638  ? 28.249  -8.751  96.957  1.00 48.98  ? 638  ASP C O     1 
ATOM   8622  C  CB    . ASP C 2  638  ? 29.836  -6.016  96.101  1.00 40.17  ? 638  ASP C CB    1 
ATOM   8623  C  CG    . ASP C 2  638  ? 29.121  -5.786  97.410  1.00 50.00  ? 638  ASP C CG    1 
ATOM   8624  O  OD1   . ASP C 2  638  ? 27.903  -6.046  97.489  1.00 73.60  ? 638  ASP C OD1   1 
ATOM   8625  O  OD2   . ASP C 2  638  ? 29.786  -5.332  98.365  1.00 51.05  ? 638  ASP C OD2   1 
ATOM   8626  N  N     . GLN C 2  639  ? 30.446  -9.132  96.638  1.00 45.04  ? 639  GLN C N     1 
ATOM   8627  C  CA    . GLN C 2  639  ? 30.508  -10.257 97.548  1.00 44.28  ? 639  GLN C CA    1 
ATOM   8628  C  C     . GLN C 2  639  ? 31.120  -9.788  98.857  1.00 45.02  ? 639  GLN C C     1 
ATOM   8629  O  O     . GLN C 2  639  ? 31.995  -8.924  98.862  1.00 45.27  ? 639  GLN C O     1 
ATOM   8630  C  CB    . GLN C 2  639  ? 31.365  -11.367 96.944  1.00 46.14  ? 639  GLN C CB    1 
ATOM   8631  C  CG    . GLN C 2  639  ? 31.090  -11.642 95.475  1.00 39.51  ? 639  GLN C CG    1 
ATOM   8632  C  CD    . GLN C 2  639  ? 32.071  -12.633 94.876  1.00 42.61  ? 639  GLN C CD    1 
ATOM   8633  O  OE1   . GLN C 2  639  ? 33.032  -12.247 94.212  1.00 43.44  ? 639  GLN C OE1   1 
ATOM   8634  N  NE2   . GLN C 2  639  ? 31.833  -13.920 95.110  1.00 41.57  ? 639  GLN C NE2   1 
ATOM   8635  N  N     . ARG C 2  640  ? 30.651  -10.345 99.968  1.00 44.17  ? 640  ARG C N     1 
ATOM   8636  C  CA    . ARG C 2  640  ? 31.239  -10.039 101.266 1.00 47.84  ? 640  ARG C CA    1 
ATOM   8637  C  C     . ARG C 2  640  ? 31.572  -11.334 102.007 1.00 48.39  ? 640  ARG C C     1 
ATOM   8638  O  O     . ARG C 2  640  ? 30.799  -12.288 101.967 1.00 44.35  ? 640  ARG C O     1 
ATOM   8639  C  CB    . ARG C 2  640  ? 30.280  -9.168  102.078 1.00 48.13  ? 640  ARG C CB    1 
ATOM   8640  C  CG    . ARG C 2  640  ? 29.863  -7.896  101.350 1.00 46.51  ? 640  ARG C CG    1 
ATOM   8641  C  CD    . ARG C 2  640  ? 28.617  -7.260  101.953 1.00 60.64  ? 640  ARG C CD    1 
ATOM   8642  N  NE    . ARG C 2  640  ? 27.504  -8.203  102.051 1.00 57.55  ? 640  ARG C NE    1 
ATOM   8643  C  CZ    . ARG C 2  640  ? 26.818  -8.671  101.013 1.00 50.72  ? 640  ARG C CZ    1 
ATOM   8644  N  NH1   . ARG C 2  640  ? 27.127  -8.297  99.777  1.00 49.47  ? 640  ARG C NH1   1 
ATOM   8645  N  NH2   . ARG C 2  640  ? 25.822  -9.523  101.210 1.00 47.62  ? 640  ARG C NH2   1 
ATOM   8646  N  N     . PRO C 2  641  ? 32.736  -11.372 102.680 1.00 51.26  ? 641  PRO C N     1 
ATOM   8647  C  CA    . PRO C 2  641  ? 33.194  -12.581 103.376 1.00 41.81  ? 641  PRO C CA    1 
ATOM   8648  C  C     . PRO C 2  641  ? 32.354  -12.904 104.609 1.00 47.07  ? 641  PRO C C     1 
ATOM   8649  O  O     . PRO C 2  641  ? 32.118  -12.027 105.438 1.00 47.52  ? 641  PRO C O     1 
ATOM   8650  C  CB    . PRO C 2  641  ? 34.623  -12.223 103.785 1.00 46.74  ? 641  PRO C CB    1 
ATOM   8651  C  CG    . PRO C 2  641  ? 34.620  -10.738 103.894 1.00 48.77  ? 641  PRO C CG    1 
ATOM   8652  C  CD    . PRO C 2  641  ? 33.678  -10.250 102.838 1.00 51.70  ? 641  PRO C CD    1 
ATOM   8653  N  N     . ARG C 2  642  ? 31.905  -14.151 104.720 1.00 52.25  ? 642  ARG C N     1 
ATOM   8654  C  CA    . ARG C 2  642  ? 31.116  -14.588 105.872 1.00 52.29  ? 642  ARG C CA    1 
ATOM   8655  C  C     . ARG C 2  642  ? 31.902  -15.363 106.938 1.00 52.89  ? 642  ARG C C     1 
ATOM   8656  O  O     . ARG C 2  642  ? 31.340  -15.760 107.961 1.00 50.64  ? 642  ARG C O     1 
ATOM   8657  C  CB    . ARG C 2  642  ? 29.890  -15.387 105.416 1.00 46.29  ? 642  ARG C CB    1 
ATOM   8658  C  CG    . ARG C 2  642  ? 28.792  -14.527 104.809 1.00 40.91  ? 642  ARG C CG    1 
ATOM   8659  C  CD    . ARG C 2  642  ? 28.266  -13.515 105.818 1.00 48.44  ? 642  ARG C CD    1 
ATOM   8660  N  NE    . ARG C 2  642  ? 27.266  -12.619 105.242 1.00 54.37  ? 642  ARG C NE    1 
ATOM   8661  C  CZ    . ARG C 2  642  ? 27.518  -11.382 104.824 1.00 52.57  ? 642  ARG C CZ    1 
ATOM   8662  N  NH1   . ARG C 2  642  ? 28.744  -10.881 104.918 1.00 45.49  ? 642  ARG C NH1   1 
ATOM   8663  N  NH2   . ARG C 2  642  ? 26.542  -10.642 104.315 1.00 46.97  ? 642  ARG C NH2   1 
ATOM   8664  N  N     . VAL C 2  643  ? 33.191  -15.585 106.698 1.00 53.77  ? 643  VAL C N     1 
ATOM   8665  C  CA    . VAL C 2  643  ? 34.003  -16.374 107.620 1.00 47.58  ? 643  VAL C CA    1 
ATOM   8666  C  C     . VAL C 2  643  ? 35.065  -15.527 108.296 1.00 53.25  ? 643  VAL C C     1 
ATOM   8667  O  O     . VAL C 2  643  ? 35.191  -14.334 108.021 1.00 54.12  ? 643  VAL C O     1 
ATOM   8668  C  CB    . VAL C 2  643  ? 34.709  -17.534 106.910 1.00 45.00  ? 643  VAL C CB    1 
ATOM   8669  C  CG1   . VAL C 2  643  ? 33.694  -18.442 106.239 1.00 50.29  ? 643  VAL C CG1   1 
ATOM   8670  C  CG2   . VAL C 2  643  ? 35.709  -17.000 105.902 1.00 48.26  ? 643  VAL C CG2   1 
ATOM   8671  N  N     . VAL C 2  644  ? 35.837  -16.158 109.174 1.00 58.14  ? 644  VAL C N     1 
ATOM   8672  C  CA    . VAL C 2  644  ? 36.862  -15.455 109.932 1.00 63.62  ? 644  VAL C CA    1 
ATOM   8673  C  C     . VAL C 2  644  ? 38.144  -16.290 109.990 1.00 59.34  ? 644  VAL C C     1 
ATOM   8674  O  O     . VAL C 2  644  ? 38.123  -17.492 109.715 1.00 52.88  ? 644  VAL C O     1 
ATOM   8675  C  CB    . VAL C 2  644  ? 36.361  -15.120 111.354 1.00 59.04  ? 644  VAL C CB    1 
ATOM   8676  C  CG1   . VAL C 2  644  ? 36.417  -16.356 112.240 1.00 61.53  ? 644  VAL C CG1   1 
ATOM   8677  C  CG2   . VAL C 2  644  ? 37.154  -13.956 111.960 1.00 53.71  ? 644  VAL C CG2   1 
ATOM   8678  N  N     . VAL C 2  645  ? 39.255  -15.641 110.334 1.00 58.08  ? 645  VAL C N     1 
ATOM   8679  C  CA    . VAL C 2  645  ? 40.562  -16.289 110.380 1.00 59.01  ? 645  VAL C CA    1 
ATOM   8680  C  C     . VAL C 2  645  ? 40.585  -17.500 111.308 1.00 53.15  ? 645  VAL C C     1 
ATOM   8681  O  O     . VAL C 2  645  ? 40.189  -17.415 112.469 1.00 45.26  ? 645  VAL C O     1 
ATOM   8682  C  CB    . VAL C 2  645  ? 41.660  -15.303 110.827 1.00 51.81  ? 645  VAL C CB    1 
ATOM   8683  C  CG1   . VAL C 2  645  ? 43.021  -15.972 110.790 1.00 46.79  ? 645  VAL C CG1   1 
ATOM   8684  C  CG2   . VAL C 2  645  ? 41.652  -14.067 109.946 1.00 56.68  ? 645  VAL C CG2   1 
ATOM   8685  N  N     . GLY C 2  646  ? 41.044  -18.629 110.779 1.00 57.27  ? 646  GLY C N     1 
ATOM   8686  C  CA    . GLY C 2  646  ? 41.219  -19.832 111.572 1.00 63.03  ? 646  GLY C CA    1 
ATOM   8687  C  C     . GLY C 2  646  ? 40.020  -20.760 111.589 1.00 60.19  ? 646  GLY C C     1 
ATOM   8688  O  O     . GLY C 2  646  ? 40.130  -21.915 112.004 1.00 63.39  ? 646  GLY C O     1 
ATOM   8689  N  N     . GLN C 2  647  ? 38.876  -20.259 111.136 1.00 57.18  ? 647  GLN C N     1 
ATOM   8690  C  CA    . GLN C 2  647  ? 37.641  -21.036 111.153 1.00 62.42  ? 647  GLN C CA    1 
ATOM   8691  C  C     . GLN C 2  647  ? 37.762  -22.339 110.365 1.00 59.22  ? 647  GLN C C     1 
ATOM   8692  O  O     . GLN C 2  647  ? 38.241  -22.348 109.231 1.00 57.86  ? 647  GLN C O     1 
ATOM   8693  C  CB    . GLN C 2  647  ? 36.478  -20.200 110.613 1.00 62.95  ? 647  GLN C CB    1 
ATOM   8694  C  CG    . GLN C 2  647  ? 35.165  -20.960 110.492 1.00 60.62  ? 647  GLN C CG    1 
ATOM   8695  C  CD    . GLN C 2  647  ? 34.032  -20.086 109.996 1.00 58.42  ? 647  GLN C CD    1 
ATOM   8696  O  OE1   . GLN C 2  647  ? 34.102  -18.858 110.068 1.00 57.50  ? 647  GLN C OE1   1 
ATOM   8697  N  NE2   . GLN C 2  647  ? 32.979  -20.715 109.484 1.00 54.35  ? 647  GLN C NE2   1 
ATOM   8698  N  N     . ARG C 2  648  ? 37.336  -23.438 110.979 1.00 54.03  ? 648  ARG C N     1 
ATOM   8699  C  CA    . ARG C 2  648  ? 37.306  -24.727 110.302 1.00 61.37  ? 648  ARG C CA    1 
ATOM   8700  C  C     . ARG C 2  648  ? 36.095  -24.803 109.377 1.00 62.00  ? 648  ARG C C     1 
ATOM   8701  O  O     . ARG C 2  648  ? 34.978  -24.484 109.784 1.00 66.91  ? 648  ARG C O     1 
ATOM   8702  C  CB    . ARG C 2  648  ? 37.250  -25.870 111.317 1.00 68.24  ? 648  ARG C CB    1 
ATOM   8703  C  CG    . ARG C 2  648  ? 38.505  -26.040 112.159 1.00 77.41  ? 648  ARG C CG    1 
ATOM   8704  C  CD    . ARG C 2  648  ? 38.321  -27.164 113.170 1.00 92.32  ? 648  ARG C CD    1 
ATOM   8705  N  NE    . ARG C 2  648  ? 39.507  -27.377 113.996 1.00 108.03 ? 648  ARG C NE    1 
ATOM   8706  C  CZ    . ARG C 2  648  ? 39.555  -28.210 115.032 1.00 99.24  ? 648  ARG C CZ    1 
ATOM   8707  N  NH1   . ARG C 2  648  ? 38.479  -28.908 115.374 1.00 92.68  ? 648  ARG C NH1   1 
ATOM   8708  N  NH2   . ARG C 2  648  ? 40.676  -28.343 115.730 1.00 76.10  ? 648  ARG C NH2   1 
ATOM   8709  N  N     . VAL C 2  649  ? 36.317  -25.221 108.135 1.00 58.58  ? 649  VAL C N     1 
ATOM   8710  C  CA    . VAL C 2  649  ? 35.228  -25.337 107.169 1.00 60.18  ? 649  VAL C CA    1 
ATOM   8711  C  C     . VAL C 2  649  ? 35.266  -26.649 106.388 1.00 63.97  ? 649  VAL C C     1 
ATOM   8712  O  O     . VAL C 2  649  ? 36.295  -27.025 105.827 1.00 68.49  ? 649  VAL C O     1 
ATOM   8713  C  CB    . VAL C 2  649  ? 35.206  -24.150 106.181 1.00 58.22  ? 649  VAL C CB    1 
ATOM   8714  C  CG1   . VAL C 2  649  ? 34.613  -22.915 106.846 1.00 62.36  ? 649  VAL C CG1   1 
ATOM   8715  C  CG2   . VAL C 2  649  ? 36.604  -23.865 105.648 1.00 50.67  ? 649  VAL C CG2   1 
ATOM   8716  N  N     . ARG C 2  650  ? 34.133  -27.343 106.358 1.00 65.28  ? 650  ARG C N     1 
ATOM   8717  C  CA    . ARG C 2  650  ? 34.015  -28.581 105.600 1.00 66.42  ? 650  ARG C CA    1 
ATOM   8718  C  C     . ARG C 2  650  ? 33.818  -28.279 104.121 1.00 67.74  ? 650  ARG C C     1 
ATOM   8719  O  O     . ARG C 2  650  ? 33.897  -27.127 103.697 1.00 68.44  ? 650  ARG C O     1 
ATOM   8720  C  CB    . ARG C 2  650  ? 32.854  -29.425 106.124 1.00 71.24  ? 650  ARG C CB    1 
ATOM   8721  C  CG    . ARG C 2  650  ? 33.025  -29.890 107.560 1.00 88.04  ? 650  ARG C CG    1 
ATOM   8722  C  CD    . ARG C 2  650  ? 31.820  -30.690 108.029 1.00 102.69 ? 650  ARG C CD    1 
ATOM   8723  N  NE    . ARG C 2  650  ? 31.981  -31.176 109.397 1.00 112.49 ? 650  ARG C NE    1 
ATOM   8724  C  CZ    . ARG C 2  650  ? 31.636  -30.487 110.481 1.00 108.96 ? 650  ARG C CZ    1 
ATOM   8725  N  NH1   . ARG C 2  650  ? 31.111  -29.275 110.360 1.00 99.00  ? 650  ARG C NH1   1 
ATOM   8726  N  NH2   . ARG C 2  650  ? 31.818  -31.010 111.686 1.00 109.22 ? 650  ARG C NH2   1 
ATOM   8727  N  N     . LYS C 2  651  ? 33.562  -29.317 103.336 1.00 69.94  ? 651  LYS C N     1 
ATOM   8728  C  CA    . LYS C 2  651  ? 33.364  -29.148 101.904 1.00 66.87  ? 651  LYS C CA    1 
ATOM   8729  C  C     . LYS C 2  651  ? 31.985  -28.555 101.640 1.00 70.90  ? 651  LYS C C     1 
ATOM   8730  O  O     . LYS C 2  651  ? 30.971  -29.102 102.074 1.00 72.53  ? 651  LYS C O     1 
ATOM   8731  C  CB    . LYS C 2  651  ? 33.515  -30.493 101.187 1.00 68.43  ? 651  LYS C CB    1 
ATOM   8732  C  CG    . LYS C 2  651  ? 33.528  -30.414 99.666  1.00 67.77  ? 651  LYS C CG    1 
ATOM   8733  C  CD    . LYS C 2  651  ? 33.646  -31.804 99.048  1.00 68.18  ? 651  LYS C CD    1 
ATOM   8734  C  CE    . LYS C 2  651  ? 33.627  -31.756 97.527  1.00 65.79  ? 651  LYS C CE    1 
ATOM   8735  N  NZ    . LYS C 2  651  ? 34.815  -31.051 96.970  1.00 73.93  ? 651  LYS C NZ    1 
ATOM   8736  N  N     . GLY C 2  652  ? 31.955  -27.424 100.941 1.00 66.27  ? 652  GLY C N     1 
ATOM   8737  C  CA    . GLY C 2  652  ? 30.701  -26.802 100.557 1.00 60.87  ? 652  GLY C CA    1 
ATOM   8738  C  C     . GLY C 2  652  ? 30.237  -25.692 101.482 1.00 65.34  ? 652  GLY C C     1 
ATOM   8739  O  O     . GLY C 2  652  ? 29.188  -25.089 101.253 1.00 67.55  ? 652  GLY C O     1 
ATOM   8740  N  N     . ASP C 2  653  ? 31.009  -25.422 102.530 1.00 67.55  ? 653  ASP C N     1 
ATOM   8741  C  CA    . ASP C 2  653  ? 30.678  -24.345 103.461 1.00 64.84  ? 653  ASP C CA    1 
ATOM   8742  C  C     . ASP C 2  653  ? 30.734  -22.979 102.782 1.00 51.59  ? 653  ASP C C     1 
ATOM   8743  O  O     . ASP C 2  653  ? 31.476  -22.777 101.821 1.00 47.44  ? 653  ASP C O     1 
ATOM   8744  C  CB    . ASP C 2  653  ? 31.609  -24.363 104.679 1.00 66.80  ? 653  ASP C CB    1 
ATOM   8745  C  CG    . ASP C 2  653  ? 31.058  -25.190 105.829 1.00 66.42  ? 653  ASP C CG    1 
ATOM   8746  O  OD1   . ASP C 2  653  ? 31.352  -24.850 106.996 1.00 55.30  ? 653  ASP C OD1   1 
ATOM   8747  O  OD2   . ASP C 2  653  ? 30.335  -26.175 105.568 1.00 70.01  ? 653  ASP C OD2   1 
ATOM   8748  N  N     . LEU C 2  654  ? 29.942  -22.044 103.292 1.00 48.60  ? 654  LEU C N     1 
ATOM   8749  C  CA    . LEU C 2  654  ? 29.901  -20.693 102.751 1.00 46.59  ? 654  LEU C CA    1 
ATOM   8750  C  C     . LEU C 2  654  ? 31.161  -19.909 103.115 1.00 41.33  ? 654  LEU C C     1 
ATOM   8751  O  O     . LEU C 2  654  ? 31.625  -19.956 104.251 1.00 44.04  ? 654  LEU C O     1 
ATOM   8752  C  CB    . LEU C 2  654  ? 28.660  -19.960 103.264 1.00 37.97  ? 654  LEU C CB    1 
ATOM   8753  C  CG    . LEU C 2  654  ? 28.496  -18.506 102.829 1.00 32.72  ? 654  LEU C CG    1 
ATOM   8754  C  CD1   . LEU C 2  654  ? 28.310  -18.423 101.329 1.00 42.45  ? 654  LEU C CD1   1 
ATOM   8755  C  CD2   . LEU C 2  654  ? 27.325  -17.879 103.549 1.00 36.65  ? 654  LEU C CD2   1 
ATOM   8756  N  N     . LEU C 2  655  ? 31.712  -19.195 102.141 1.00 39.09  ? 655  LEU C N     1 
ATOM   8757  C  CA    . LEU C 2  655  ? 32.887  -18.358 102.370 1.00 45.14  ? 655  LEU C CA    1 
ATOM   8758  C  C     . LEU C 2  655  ? 32.561  -16.871 102.204 1.00 46.71  ? 655  LEU C C     1 
ATOM   8759  O  O     . LEU C 2  655  ? 32.728  -16.082 103.134 1.00 44.54  ? 655  LEU C O     1 
ATOM   8760  C  CB    . LEU C 2  655  ? 34.051  -18.788 101.473 1.00 47.45  ? 655  LEU C CB    1 
ATOM   8761  C  CG    . LEU C 2  655  ? 34.650  -20.151 101.837 1.00 41.21  ? 655  LEU C CG    1 
ATOM   8762  C  CD1   . LEU C 2  655  ? 35.719  -20.574 100.848 1.00 33.18  ? 655  LEU C CD1   1 
ATOM   8763  C  CD2   . LEU C 2  655  ? 35.213  -20.113 103.248 1.00 45.00  ? 655  LEU C CD2   1 
ATOM   8764  N  N     . ALA C 2  656  ? 32.124  -16.488 101.010 1.00 49.32  ? 656  ALA C N     1 
ATOM   8765  C  CA    . ALA C 2  656  ? 31.675  -15.119 100.772 1.00 46.81  ? 656  ALA C CA    1 
ATOM   8766  C  C     . ALA C 2  656  ? 30.195  -15.067 100.398 1.00 42.83  ? 656  ALA C C     1 
ATOM   8767  O  O     . ALA C 2  656  ? 29.688  -15.941 99.698  1.00 40.52  ? 656  ALA C O     1 
ATOM   8768  C  CB    . ALA C 2  656  ? 32.519  -14.458 99.698  1.00 48.75  ? 656  ALA C CB    1 
ATOM   8769  N  N     . ASP C 2  657  ? 29.511  -14.030 100.869 1.00 46.08  ? 657  ASP C N     1 
ATOM   8770  C  CA    . ASP C 2  657  ? 28.089  -13.858 100.595 1.00 43.64  ? 657  ASP C CA    1 
ATOM   8771  C  C     . ASP C 2  657  ? 27.898  -13.027 99.336  1.00 42.75  ? 657  ASP C C     1 
ATOM   8772  O  O     . ASP C 2  657  ? 28.343  -11.881 99.266  1.00 43.86  ? 657  ASP C O     1 
ATOM   8773  C  CB    . ASP C 2  657  ? 27.403  -13.167 101.775 1.00 46.95  ? 657  ASP C CB    1 
ATOM   8774  C  CG    . ASP C 2  657  ? 26.046  -13.761 102.091 1.00 43.98  ? 657  ASP C CG    1 
ATOM   8775  O  OD1   . ASP C 2  657  ? 25.496  -14.477 101.228 1.00 41.84  ? 657  ASP C OD1   1 
ATOM   8776  O  OD2   . ASP C 2  657  ? 25.530  -13.507 103.202 1.00 41.91  ? 657  ASP C OD2   1 
ATOM   8777  N  N     . GLY C 2  658  ? 27.228  -13.603 98.345  1.00 44.99  ? 658  GLY C N     1 
ATOM   8778  C  CA    . GLY C 2  658  ? 27.016  -12.925 97.080  1.00 44.69  ? 658  GLY C CA    1 
ATOM   8779  C  C     . GLY C 2  658  ? 26.046  -11.765 97.187  1.00 45.30  ? 658  GLY C C     1 
ATOM   8780  O  O     . GLY C 2  658  ? 25.562  -11.449 98.274  1.00 46.28  ? 658  GLY C O     1 
ATOM   8781  N  N     . PRO C 2  659  ? 25.761  -11.111 96.053  1.00 46.32  ? 659  PRO C N     1 
ATOM   8782  C  CA    . PRO C 2  659  ? 24.781  -10.024 96.041  1.00 42.41  ? 659  PRO C CA    1 
ATOM   8783  C  C     . PRO C 2  659  ? 23.374  -10.574 96.247  1.00 33.78  ? 659  PRO C C     1 
ATOM   8784  O  O     . PRO C 2  659  ? 23.046  -11.627 95.698  1.00 30.75  ? 659  PRO C O     1 
ATOM   8785  C  CB    . PRO C 2  659  ? 24.928  -9.443  94.632  1.00 41.63  ? 659  PRO C CB    1 
ATOM   8786  C  CG    . PRO C 2  659  ? 25.422  -10.582 93.808  1.00 37.21  ? 659  PRO C CG    1 
ATOM   8787  C  CD    . PRO C 2  659  ? 26.323  -11.369 94.716  1.00 48.88  ? 659  PRO C CD    1 
ATOM   8788  N  N     . ALA C 2  660  ? 22.566  -9.869  97.031  1.00 26.86  ? 660  ALA C N     1 
ATOM   8789  C  CA    . ALA C 2  660  ? 21.204  -10.293 97.323  1.00 25.33  ? 660  ALA C CA    1 
ATOM   8790  C  C     . ALA C 2  660  ? 21.189  -11.660 97.989  1.00 30.73  ? 660  ALA C C     1 
ATOM   8791  O  O     . ALA C 2  660  ? 20.342  -12.501 97.692  1.00 30.57  ? 660  ALA C O     1 
ATOM   8792  C  CB    . ALA C 2  660  ? 20.358  -10.303 96.060  1.00 26.86  ? 660  ALA C CB    1 
ATOM   8793  N  N     . SER C 2  661  ? 22.138  -11.873 98.894  1.00 40.77  ? 661  SER C N     1 
ATOM   8794  C  CA    . SER C 2  661  ? 22.244  -13.139 99.607  1.00 44.85  ? 661  SER C CA    1 
ATOM   8795  C  C     . SER C 2  661  ? 22.612  -12.916 101.076 1.00 40.40  ? 661  SER C C     1 
ATOM   8796  O  O     . SER C 2  661  ? 23.507  -12.131 101.390 1.00 40.35  ? 661  SER C O     1 
ATOM   8797  C  CB    . SER C 2  661  ? 23.271  -14.045 98.924  1.00 39.34  ? 661  SER C CB    1 
ATOM   8798  O  OG    . SER C 2  661  ? 23.305  -15.327 99.523  1.00 44.62  ? 661  SER C OG    1 
ATOM   8799  N  N     . GLU C 2  662  ? 21.904  -13.594 101.975 1.00 35.30  ? 662  GLU C N     1 
ATOM   8800  C  CA    . GLU C 2  662  ? 22.201  -13.499 103.399 1.00 38.87  ? 662  GLU C CA    1 
ATOM   8801  C  C     . GLU C 2  662  ? 22.543  -14.871 103.964 1.00 44.25  ? 662  GLU C C     1 
ATOM   8802  O  O     . GLU C 2  662  ? 21.674  -15.738 104.073 1.00 44.31  ? 662  GLU C O     1 
ATOM   8803  C  CB    . GLU C 2  662  ? 21.013  -12.908 104.161 1.00 33.97  ? 662  GLU C CB    1 
ATOM   8804  C  CG    . GLU C 2  662  ? 21.290  -12.652 105.630 1.00 32.65  ? 662  GLU C CG    1 
ATOM   8805  C  CD    . GLU C 2  662  ? 20.027  -12.411 106.432 1.00 31.08  ? 662  GLU C CD    1 
ATOM   8806  O  OE1   . GLU C 2  662  ? 19.000  -13.055 106.134 1.00 30.76  ? 662  GLU C OE1   1 
ATOM   8807  O  OE2   . GLU C 2  662  ? 20.061  -11.577 107.361 1.00 31.80  ? 662  GLU C OE2   1 
ATOM   8808  N  N     . ASN C 2  663  ? 23.808  -15.050 104.337 1.00 44.60  ? 663  ASN C N     1 
ATOM   8809  C  CA    . ASN C 2  663  ? 24.300  -16.316 104.873 1.00 38.55  ? 663  ASN C CA    1 
ATOM   8810  C  C     . ASN C 2  663  ? 23.957  -17.520 103.998 1.00 39.69  ? 663  ASN C C     1 
ATOM   8811  O  O     . ASN C 2  663  ? 23.616  -18.588 104.506 1.00 43.79  ? 663  ASN C O     1 
ATOM   8812  C  CB    . ASN C 2  663  ? 23.798  -16.531 106.305 1.00 37.19  ? 663  ASN C CB    1 
ATOM   8813  C  CG    . ASN C 2  663  ? 24.363  -15.511 107.284 1.00 51.10  ? 663  ASN C CG    1 
ATOM   8814  O  OD1   . ASN C 2  663  ? 25.524  -15.108 107.181 1.00 50.13  ? 663  ASN C OD1   1 
ATOM   8815  N  ND2   . ASN C 2  663  ? 23.541  -15.091 108.241 1.00 49.13  ? 663  ASN C ND2   1 
ATOM   8816  N  N     . GLY C 2  664  ? 24.046  -17.341 102.683 1.00 34.16  ? 664  GLY C N     1 
ATOM   8817  C  CA    . GLY C 2  664  ? 23.764  -18.416 101.748 1.00 42.41  ? 664  GLY C CA    1 
ATOM   8818  C  C     . GLY C 2  664  ? 22.315  -18.495 101.287 1.00 52.55  ? 664  GLY C C     1 
ATOM   8819  O  O     . GLY C 2  664  ? 22.000  -19.222 100.340 1.00 49.89  ? 664  GLY C O     1 
ATOM   8820  N  N     . PHE C 2  665  ? 21.433  -17.754 101.955 1.00 43.10  ? 665  PHE C N     1 
ATOM   8821  C  CA    . PHE C 2  665  ? 20.017  -17.711 101.593 1.00 37.58  ? 665  PHE C CA    1 
ATOM   8822  C  C     . PHE C 2  665  ? 19.730  -16.528 100.671 1.00 38.65  ? 665  PHE C C     1 
ATOM   8823  O  O     . PHE C 2  665  ? 20.352  -15.473 100.802 1.00 36.97  ? 665  PHE C O     1 
ATOM   8824  C  CB    . PHE C 2  665  ? 19.142  -17.621 102.842 1.00 37.31  ? 665  PHE C CB    1 
ATOM   8825  C  CG    . PHE C 2  665  ? 19.207  -18.837 103.726 1.00 42.81  ? 665  PHE C CG    1 
ATOM   8826  C  CD1   . PHE C 2  665  ? 18.321  -19.888 103.549 1.00 43.89  ? 665  PHE C CD1   1 
ATOM   8827  C  CD2   . PHE C 2  665  ? 20.144  -18.924 104.742 1.00 43.92  ? 665  PHE C CD2   1 
ATOM   8828  C  CE1   . PHE C 2  665  ? 18.375  -21.006 104.364 1.00 45.76  ? 665  PHE C CE1   1 
ATOM   8829  C  CE2   . PHE C 2  665  ? 20.203  -20.039 105.561 1.00 40.14  ? 665  PHE C CE2   1 
ATOM   8830  C  CZ    . PHE C 2  665  ? 19.318  -21.080 105.372 1.00 40.80  ? 665  PHE C CZ    1 
ATOM   8831  N  N     . LEU C 2  666  ? 18.797  -16.703 99.739  1.00 30.93  ? 666  LEU C N     1 
ATOM   8832  C  CA    . LEU C 2  666  ? 18.487  -15.656 98.766  1.00 32.11  ? 666  LEU C CA    1 
ATOM   8833  C  C     . LEU C 2  666  ? 17.781  -14.460 99.397  1.00 30.85  ? 666  LEU C C     1 
ATOM   8834  O  O     . LEU C 2  666  ? 16.703  -14.602 99.970  1.00 34.18  ? 666  LEU C O     1 
ATOM   8835  C  CB    . LEU C 2  666  ? 17.621  -16.233 97.645  1.00 31.87  ? 666  LEU C CB    1 
ATOM   8836  C  CG    . LEU C 2  666  ? 17.119  -15.277 96.564  1.00 25.84  ? 666  LEU C CG    1 
ATOM   8837  C  CD1   . LEU C 2  666  ? 18.271  -14.528 95.919  1.00 20.76  ? 666  LEU C CD1   1 
ATOM   8838  C  CD2   . LEU C 2  666  ? 16.325  -16.044 95.520  1.00 22.62  ? 666  LEU C CD2   1 
ATOM   8839  N  N     . ALA C 2  667  ? 18.376  -13.276 99.273  1.00 27.33  ? 667  ALA C N     1 
ATOM   8840  C  CA    . ALA C 2  667  ? 17.781  -12.086 99.877  1.00 32.65  ? 667  ALA C CA    1 
ATOM   8841  C  C     . ALA C 2  667  ? 17.323  -11.067 98.836  1.00 33.98  ? 667  ALA C C     1 
ATOM   8842  O  O     . ALA C 2  667  ? 18.129  -10.313 98.293  1.00 34.55  ? 667  ALA C O     1 
ATOM   8843  C  CB    . ALA C 2  667  ? 18.782  -11.443 100.825 1.00 29.79  ? 667  ALA C CB    1 
ATOM   8844  N  N     . LEU C 2  668  ? 16.018  -10.997 98.607  1.00 23.86  ? 668  LEU C N     1 
ATOM   8845  C  CA    . LEU C 2  668  ? 15.501  -10.073 97.610  1.00 21.41  ? 668  LEU C CA    1 
ATOM   8846  C  C     . LEU C 2  668  ? 14.953  -8.788  98.211  1.00 27.12  ? 668  LEU C C     1 
ATOM   8847  O  O     . LEU C 2  668  ? 14.533  -7.881  97.491  1.00 29.07  ? 668  LEU C O     1 
ATOM   8848  C  CB    . LEU C 2  668  ? 14.459  -10.760 96.736  1.00 18.29  ? 668  LEU C CB    1 
ATOM   8849  C  CG    . LEU C 2  668  ? 15.076  -11.842 95.851  1.00 23.31  ? 668  LEU C CG    1 
ATOM   8850  C  CD1   . LEU C 2  668  ? 14.067  -12.358 94.836  1.00 27.82  ? 668  LEU C CD1   1 
ATOM   8851  C  CD2   . LEU C 2  668  ? 16.327  -11.319 95.161  1.00 16.31  ? 668  LEU C CD2   1 
ATOM   8852  N  N     . GLY C 2  669  ? 14.967  -8.704  99.533  1.00 25.28  ? 669  GLY C N     1 
ATOM   8853  C  CA    . GLY C 2  669  ? 14.371  -7.565  100.199 1.00 27.95  ? 669  GLY C CA    1 
ATOM   8854  C  C     . GLY C 2  669  ? 14.469  -7.626  101.706 1.00 27.93  ? 669  GLY C C     1 
ATOM   8855  O  O     . GLY C 2  669  ? 15.313  -8.328  102.261 1.00 28.98  ? 669  GLY C O     1 
ATOM   8856  N  N     . GLN C 2  670  ? 13.595  -6.880  102.371 1.00 25.33  ? 670  GLN C N     1 
ATOM   8857  C  CA    . GLN C 2  670  ? 13.622  -6.797  103.819 1.00 25.16  ? 670  GLN C CA    1 
ATOM   8858  C  C     . GLN C 2  670  ? 12.409  -7.488  104.425 1.00 29.25  ? 670  GLN C C     1 
ATOM   8859  O  O     . GLN C 2  670  ? 11.350  -7.584  103.795 1.00 31.05  ? 670  GLN C O     1 
ATOM   8860  C  CB    . GLN C 2  670  ? 13.654  -5.332  104.262 1.00 23.89  ? 670  GLN C CB    1 
ATOM   8861  C  CG    . GLN C 2  670  ? 14.641  -4.460  103.496 1.00 28.05  ? 670  GLN C CG    1 
ATOM   8862  C  CD    . GLN C 2  670  ? 16.060  -4.544  104.030 1.00 30.53  ? 670  GLN C CD    1 
ATOM   8863  O  OE1   . GLN C 2  670  ? 16.965  -3.878  103.525 1.00 27.91  ? 670  GLN C OE1   1 
ATOM   8864  N  NE2   . GLN C 2  670  ? 16.260  -5.357  105.061 1.00 31.59  ? 670  GLN C NE2   1 
ATOM   8865  N  N     . ASN C 2  671  ? 12.578  -7.989  105.643 1.00 25.66  ? 671  ASN C N     1 
ATOM   8866  C  CA    . ASN C 2  671  ? 11.452  -8.431  106.444 1.00 20.92  ? 671  ASN C CA    1 
ATOM   8867  C  C     . ASN C 2  671  ? 11.026  -7.279  107.329 1.00 26.54  ? 671  ASN C C     1 
ATOM   8868  O  O     . ASN C 2  671  ? 11.759  -6.886  108.236 1.00 30.62  ? 671  ASN C O     1 
ATOM   8869  C  CB    . ASN C 2  671  ? 11.850  -9.618  107.306 1.00 19.03  ? 671  ASN C CB    1 
ATOM   8870  C  CG    . ASN C 2  671  ? 12.011  -10.881 106.504 1.00 24.21  ? 671  ASN C CG    1 
ATOM   8871  O  OD1   . ASN C 2  671  ? 11.101  -11.292 105.785 1.00 23.37  ? 671  ASN C OD1   1 
ATOM   8872  N  ND2   . ASN C 2  671  ? 13.173  -11.508 106.618 1.00 29.63  ? 671  ASN C ND2   1 
ATOM   8873  N  N     . VAL C 2  672  ? 9.846   -6.728  107.065 1.00 25.21  ? 672  VAL C N     1 
ATOM   8874  C  CA    . VAL C 2  672  ? 9.374   -5.583  107.835 1.00 26.17  ? 672  VAL C CA    1 
ATOM   8875  C  C     . VAL C 2  672  ? 8.106   -5.936  108.591 1.00 27.80  ? 672  VAL C C     1 
ATOM   8876  O  O     . VAL C 2  672  ? 7.392   -6.864  108.217 1.00 27.44  ? 672  VAL C O     1 
ATOM   8877  C  CB    . VAL C 2  672  ? 9.111   -4.352  106.946 1.00 22.93  ? 672  VAL C CB    1 
ATOM   8878  C  CG1   . VAL C 2  672  ? 10.423  -3.745  106.470 1.00 21.52  ? 672  VAL C CG1   1 
ATOM   8879  C  CG2   . VAL C 2  672  ? 8.224   -4.726  105.773 1.00 22.09  ? 672  VAL C CG2   1 
ATOM   8880  N  N     . LEU C 2  673  ? 7.833   -5.196  109.659 1.00 27.82  ? 673  LEU C N     1 
ATOM   8881  C  CA    . LEU C 2  673  ? 6.645   -5.440  110.464 1.00 25.33  ? 673  LEU C CA    1 
ATOM   8882  C  C     . LEU C 2  673  ? 5.497   -4.616  109.903 1.00 23.49  ? 673  LEU C C     1 
ATOM   8883  O  O     . LEU C 2  673  ? 5.524   -3.387  109.931 1.00 24.14  ? 673  LEU C O     1 
ATOM   8884  C  CB    . LEU C 2  673  ? 6.909   -5.070  111.922 1.00 25.19  ? 673  LEU C CB    1 
ATOM   8885  C  CG    . LEU C 2  673  ? 5.775   -5.317  112.916 1.00 26.72  ? 673  LEU C CG    1 
ATOM   8886  C  CD1   . LEU C 2  673  ? 5.357   -6.777  112.896 1.00 26.10  ? 673  LEU C CD1   1 
ATOM   8887  C  CD2   . LEU C 2  673  ? 6.198   -4.895  114.312 1.00 21.45  ? 673  LEU C CD2   1 
ATOM   8888  N  N     . VAL C 2  674  ? 4.486   -5.302  109.388 1.00 20.51  ? 674  VAL C N     1 
ATOM   8889  C  CA    . VAL C 2  674  ? 3.405   -4.626  108.693 1.00 19.83  ? 674  VAL C CA    1 
ATOM   8890  C  C     . VAL C 2  674  ? 2.104   -4.668  109.470 1.00 23.92  ? 674  VAL C C     1 
ATOM   8891  O  O     . VAL C 2  674  ? 1.833   -5.608  110.223 1.00 23.87  ? 674  VAL C O     1 
ATOM   8892  C  CB    . VAL C 2  674  ? 3.170   -5.212  107.286 1.00 22.09  ? 674  VAL C CB    1 
ATOM   8893  C  CG1   . VAL C 2  674  ? 4.498   -5.479  106.596 1.00 28.85  ? 674  VAL C CG1   1 
ATOM   8894  C  CG2   . VAL C 2  674  ? 2.327   -6.477  107.352 1.00 20.25  ? 674  VAL C CG2   1 
ATOM   8895  N  N     . ALA C 2  675  ? 1.314   -3.617  109.296 1.00 25.99  ? 675  ALA C N     1 
ATOM   8896  C  CA    . ALA C 2  675  ? -0.037  -3.569  109.822 1.00 24.81  ? 675  ALA C CA    1 
ATOM   8897  C  C     . ALA C 2  675  ? -0.954  -3.405  108.627 1.00 23.94  ? 675  ALA C C     1 
ATOM   8898  O  O     . ALA C 2  675  ? -0.696  -2.564  107.754 1.00 22.65  ? 675  ALA C O     1 
ATOM   8899  C  CB    . ALA C 2  675  ? -0.195  -2.400  110.778 1.00 20.45  ? 675  ALA C CB    1 
ATOM   8900  N  N     . ILE C 2  676  ? -2.006  -4.215  108.551 1.00 21.38  ? 676  ILE C N     1 
ATOM   8901  C  CA    . ILE C 2  676  ? -2.903  -4.059  107.420 1.00 20.83  ? 676  ILE C CA    1 
ATOM   8902  C  C     . ILE C 2  676  ? -4.172  -3.331  107.851 1.00 21.24  ? 676  ILE C C     1 
ATOM   8903  O  O     . ILE C 2  676  ? -5.109  -3.924  108.377 1.00 22.30  ? 676  ILE C O     1 
ATOM   8904  C  CB    . ILE C 2  676  ? -3.237  -5.429  106.809 1.00 18.91  ? 676  ILE C CB    1 
ATOM   8905  C  CG1   . ILE C 2  676  ? -2.007  -6.342  106.892 1.00 18.14  ? 676  ILE C CG1   1 
ATOM   8906  C  CG2   . ILE C 2  676  ? -3.704  -5.266  105.377 1.00 23.55  ? 676  ILE C CG2   1 
ATOM   8907  C  CD1   . ILE C 2  676  ? -2.157  -7.687  106.211 1.00 13.81  ? 676  ILE C CD1   1 
ATOM   8908  N  N     . MET C 2  677  ? -4.187  -2.033  107.574 1.00 20.97  ? 677  MET C N     1 
ATOM   8909  C  CA    . MET C 2  677  ? -5.304  -1.154  107.874 1.00 19.97  ? 677  MET C CA    1 
ATOM   8910  C  C     . MET C 2  677  ? -5.285  -0.009  106.866 1.00 23.74  ? 677  MET C C     1 
ATOM   8911  O  O     . MET C 2  677  ? -4.216  0.368   106.387 1.00 23.89  ? 677  MET C O     1 
ATOM   8912  C  CB    . MET C 2  677  ? -5.182  -0.612  109.300 1.00 16.26  ? 677  MET C CB    1 
ATOM   8913  C  CG    . MET C 2  677  ? -3.884  0.130   109.574 1.00 16.07  ? 677  MET C CG    1 
ATOM   8914  S  SD    . MET C 2  677  ? -3.829  0.941   111.188 1.00 22.60  ? 677  MET C SD    1 
ATOM   8915  C  CE    . MET C 2  677  ? -5.230  2.054   111.070 1.00 22.94  ? 677  MET C CE    1 
ATOM   8916  N  N     . PRO C 2  678  ? -6.454  0.560   106.543 1.00 21.24  ? 678  PRO C N     1 
ATOM   8917  C  CA    . PRO C 2  678  ? -6.417  1.773   105.721 1.00 20.65  ? 678  PRO C CA    1 
ATOM   8918  C  C     . PRO C 2  678  ? -5.784  2.908   106.523 1.00 21.98  ? 678  PRO C C     1 
ATOM   8919  O  O     . PRO C 2  678  ? -6.002  2.972   107.732 1.00 27.98  ? 678  PRO C O     1 
ATOM   8920  C  CB    . PRO C 2  678  ? -7.900  2.076   105.475 1.00 24.53  ? 678  PRO C CB    1 
ATOM   8921  C  CG    . PRO C 2  678  ? -8.628  0.809   105.796 1.00 17.29  ? 678  PRO C CG    1 
ATOM   8922  C  CD    . PRO C 2  678  ? -7.828  0.144   106.863 1.00 18.60  ? 678  PRO C CD    1 
ATOM   8923  N  N     . PHE C 2  679  ? -4.994  3.771   105.896 1.00 18.18  ? 679  PHE C N     1 
ATOM   8924  C  CA    . PHE C 2  679  ? -4.487  4.921   106.629 1.00 20.68  ? 679  PHE C CA    1 
ATOM   8925  C  C     . PHE C 2  679  ? -4.728  6.227   105.878 1.00 25.42  ? 679  PHE C C     1 
ATOM   8926  O  O     . PHE C 2  679  ? -4.028  6.531   104.912 1.00 24.50  ? 679  PHE C O     1 
ATOM   8927  C  CB    . PHE C 2  679  ? -2.991  4.730   106.879 1.00 21.48  ? 679  PHE C CB    1 
ATOM   8928  C  CG    . PHE C 2  679  ? -2.427  5.636   107.934 1.00 25.73  ? 679  PHE C CG    1 
ATOM   8929  C  CD1   . PHE C 2  679  ? -2.463  5.270   109.270 1.00 24.68  ? 679  PHE C CD1   1 
ATOM   8930  C  CD2   . PHE C 2  679  ? -1.848  6.845   107.592 1.00 24.36  ? 679  PHE C CD2   1 
ATOM   8931  C  CE1   . PHE C 2  679  ? -1.941  6.098   110.243 1.00 23.95  ? 679  PHE C CE1   1 
ATOM   8932  C  CE2   . PHE C 2  679  ? -1.325  7.676   108.562 1.00 21.13  ? 679  PHE C CE2   1 
ATOM   8933  C  CZ    . PHE C 2  679  ? -1.371  7.303   109.887 1.00 20.76  ? 679  PHE C CZ    1 
ATOM   8934  N  N     . ASP C 2  680  ? -5.700  7.002   106.359 1.00 28.82  ? 680  ASP C N     1 
ATOM   8935  C  CA    . ASP C 2  680  ? -5.969  8.376   105.907 1.00 25.66  ? 680  ASP C CA    1 
ATOM   8936  C  C     . ASP C 2  680  ? -5.915  8.617   104.395 1.00 24.29  ? 680  ASP C C     1 
ATOM   8937  O  O     . ASP C 2  680  ? -5.524  9.695   103.950 1.00 21.10  ? 680  ASP C O     1 
ATOM   8938  C  CB    . ASP C 2  680  ? -5.090  9.382   106.651 1.00 27.15  ? 680  ASP C CB    1 
ATOM   8939  C  CG    . ASP C 2  680  ? -5.671  9.774   107.998 1.00 35.72  ? 680  ASP C CG    1 
ATOM   8940  O  OD1   . ASP C 2  680  ? -6.424  8.965   108.584 1.00 34.90  ? 680  ASP C OD1   1 
ATOM   8941  O  OD2   . ASP C 2  680  ? -5.378  10.895  108.470 1.00 45.87  ? 680  ASP C OD2   1 
ATOM   8942  N  N     . GLY C 2  681  ? -6.320  7.619   103.616 1.00 26.04  ? 681  GLY C N     1 
ATOM   8943  C  CA    . GLY C 2  681  ? -6.275  7.710   102.168 1.00 22.01  ? 681  GLY C CA    1 
ATOM   8944  C  C     . GLY C 2  681  ? -4.881  7.719   101.565 1.00 23.99  ? 681  GLY C C     1 
ATOM   8945  O  O     . GLY C 2  681  ? -4.724  7.925   100.362 1.00 27.54  ? 681  GLY C O     1 
ATOM   8946  N  N     . TYR C 2  682  ? -3.859  7.505   102.387 1.00 21.82  ? 682  TYR C N     1 
ATOM   8947  C  CA    . TYR C 2  682  ? -2.491  7.484   101.879 1.00 18.15  ? 682  TYR C CA    1 
ATOM   8948  C  C     . TYR C 2  682  ? -2.130  6.162   101.222 1.00 18.76  ? 682  TYR C C     1 
ATOM   8949  O  O     . TYR C 2  682  ? -1.276  6.119   100.345 1.00 31.12  ? 682  TYR C O     1 
ATOM   8950  C  CB    . TYR C 2  682  ? -1.486  7.847   102.967 1.00 17.92  ? 682  TYR C CB    1 
ATOM   8951  C  CG    . TYR C 2  682  ? -1.476  9.317   103.287 1.00 22.98  ? 682  TYR C CG    1 
ATOM   8952  C  CD1   . TYR C 2  682  ? -0.656  10.190  102.589 1.00 23.24  ? 682  TYR C CD1   1 
ATOM   8953  C  CD2   . TYR C 2  682  ? -2.296  9.839   104.280 1.00 27.33  ? 682  TYR C CD2   1 
ATOM   8954  C  CE1   . TYR C 2  682  ? -0.647  11.541  102.871 1.00 26.82  ? 682  TYR C CE1   1 
ATOM   8955  C  CE2   . TYR C 2  682  ? -2.292  11.190  104.571 1.00 28.19  ? 682  TYR C CE2   1 
ATOM   8956  C  CZ    . TYR C 2  682  ? -1.465  12.036  103.862 1.00 29.78  ? 682  TYR C CZ    1 
ATOM   8957  O  OH    . TYR C 2  682  ? -1.453  13.382  104.142 1.00 34.87  ? 682  TYR C OH    1 
ATOM   8958  N  N     . ASN C 2  683  ? -2.763  5.081   101.658 1.00 17.33  ? 683  ASN C N     1 
ATOM   8959  C  CA    . ASN C 2  683  ? -2.609  3.796   100.983 1.00 19.40  ? 683  ASN C CA    1 
ATOM   8960  C  C     . ASN C 2  683  ? -3.719  3.516   99.967  1.00 20.94  ? 683  ASN C C     1 
ATOM   8961  O  O     . ASN C 2  683  ? -3.823  2.411   99.438  1.00 22.44  ? 683  ASN C O     1 
ATOM   8962  C  CB    . ASN C 2  683  ? -2.439  2.645   101.972 1.00 18.05  ? 683  ASN C CB    1 
ATOM   8963  C  CG    . ASN C 2  683  ? -3.541  2.588   102.988 1.00 18.85  ? 683  ASN C CG    1 
ATOM   8964  O  OD1   . ASN C 2  683  ? -4.669  2.997   102.720 1.00 21.05  ? 683  ASN C OD1   1 
ATOM   8965  N  ND2   . ASN C 2  683  ? -3.222  2.083   104.173 1.00 21.41  ? 683  ASN C ND2   1 
ATOM   8966  N  N     . PHE C 2  684  ? -4.554  4.525   99.730  1.00 19.60  ? 684  PHE C N     1 
ATOM   8967  C  CA    . PHE C 2  684  ? -5.650  4.450   98.763  1.00 22.73  ? 684  PHE C CA    1 
ATOM   8968  C  C     . PHE C 2  684  ? -5.186  3.933   97.397  1.00 21.35  ? 684  PHE C C     1 
ATOM   8969  O  O     . PHE C 2  684  ? -4.168  4.374   96.867  1.00 21.53  ? 684  PHE C O     1 
ATOM   8970  C  CB    . PHE C 2  684  ? -6.291  5.837   98.623  1.00 24.69  ? 684  PHE C CB    1 
ATOM   8971  C  CG    . PHE C 2  684  ? -7.273  5.961   97.488  1.00 19.40  ? 684  PHE C CG    1 
ATOM   8972  C  CD1   . PHE C 2  684  ? -8.590  5.574   97.647  1.00 19.59  ? 684  PHE C CD1   1 
ATOM   8973  C  CD2   . PHE C 2  684  ? -6.883  6.500   96.275  1.00 17.42  ? 684  PHE C CD2   1 
ATOM   8974  C  CE1   . PHE C 2  684  ? -9.491  5.701   96.614  1.00 19.29  ? 684  PHE C CE1   1 
ATOM   8975  C  CE2   . PHE C 2  684  ? -7.781  6.630   95.238  1.00 17.11  ? 684  PHE C CE2   1 
ATOM   8976  C  CZ    . PHE C 2  684  ? -9.086  6.230   95.407  1.00 18.52  ? 684  PHE C CZ    1 
ATOM   8977  N  N     . GLU C 2  685  ? -5.938  2.983   96.846  1.00 21.38  ? 685  GLU C N     1 
ATOM   8978  C  CA    . GLU C 2  685  ? -5.625  2.370   95.550  1.00 23.58  ? 685  GLU C CA    1 
ATOM   8979  C  C     . GLU C 2  685  ? -4.203  1.831   95.395  1.00 24.27  ? 685  GLU C C     1 
ATOM   8980  O  O     . GLU C 2  685  ? -3.480  2.247   94.489  1.00 23.75  ? 685  GLU C O     1 
ATOM   8981  C  CB    . GLU C 2  685  ? -5.961  3.305   94.380  1.00 23.37  ? 685  GLU C CB    1 
ATOM   8982  C  CG    . GLU C 2  685  ? -7.453  3.401   94.054  1.00 29.49  ? 685  GLU C CG    1 
ATOM   8983  C  CD    . GLU C 2  685  ? -8.015  2.140   93.408  1.00 35.57  ? 685  GLU C CD    1 
ATOM   8984  O  OE1   . GLU C 2  685  ? -7.490  1.035   93.668  1.00 33.09  ? 685  GLU C OE1   1 
ATOM   8985  O  OE2   . GLU C 2  685  ? -8.985  2.256   92.625  1.00 32.48  ? 685  GLU C OE2   1 
ATOM   8986  N  N     . ASP C 2  686  ? -3.815  0.935   96.300  1.00 22.65  ? 686  ASP C N     1 
ATOM   8987  C  CA    . ASP C 2  686  ? -2.570  0.169   96.201  1.00 20.83  ? 686  ASP C CA    1 
ATOM   8988  C  C     . ASP C 2  686  ? -1.307  0.956   96.559  1.00 24.28  ? 686  ASP C C     1 
ATOM   8989  O  O     . ASP C 2  686  ? -0.215  0.395   96.558  1.00 32.09  ? 686  ASP C O     1 
ATOM   8990  C  CB    . ASP C 2  686  ? -2.420  -0.513  94.834  1.00 20.67  ? 686  ASP C CB    1 
ATOM   8991  C  CG    . ASP C 2  686  ? -3.671  -1.261  94.410  1.00 29.01  ? 686  ASP C CG    1 
ATOM   8992  O  OD1   . ASP C 2  686  ? -4.138  -1.041  93.272  1.00 29.40  ? 686  ASP C OD1   1 
ATOM   8993  O  OD2   . ASP C 2  686  ? -4.187  -2.067  95.212  1.00 30.05  ? 686  ASP C OD2   1 
ATOM   8994  N  N     . ALA C 2  687  ? -1.451  2.243   96.862  1.00 18.49  ? 687  ALA C N     1 
ATOM   8995  C  CA    . ALA C 2  687  ? -0.334  3.016   97.398  1.00 16.18  ? 687  ALA C CA    1 
ATOM   8996  C  C     . ALA C 2  687  ? 0.063   2.467   98.769  1.00 20.77  ? 687  ALA C C     1 
ATOM   8997  O  O     . ALA C 2  687  ? -0.733  1.809   99.438  1.00 19.37  ? 687  ALA C O     1 
ATOM   8998  C  CB    . ALA C 2  687  ? -0.700  4.478   97.501  1.00 18.63  ? 687  ALA C CB    1 
ATOM   8999  N  N     . ILE C 2  688  ? 1.298   2.729   99.181  1.00 22.72  ? 688  ILE C N     1 
ATOM   9000  C  CA    . ILE C 2  688  ? 1.827   2.161   100.419 1.00 21.51  ? 688  ILE C CA    1 
ATOM   9001  C  C     . ILE C 2  688  ? 2.407   3.240   101.333 1.00 22.44  ? 688  ILE C C     1 
ATOM   9002  O  O     . ILE C 2  688  ? 3.017   4.199   100.861 1.00 24.01  ? 688  ILE C O     1 
ATOM   9003  C  CB    . ILE C 2  688  ? 2.915   1.105   100.112 1.00 17.70  ? 688  ILE C CB    1 
ATOM   9004  C  CG1   . ILE C 2  688  ? 2.350   0.000   99.220  1.00 20.00  ? 688  ILE C CG1   1 
ATOM   9005  C  CG2   . ILE C 2  688  ? 3.466   0.499   101.386 1.00 19.20  ? 688  ILE C CG2   1 
ATOM   9006  C  CD1   . ILE C 2  688  ? 3.307   -1.145  99.008  1.00 25.00  ? 688  ILE C CD1   1 
ATOM   9007  N  N     . VAL C 2  689  ? 2.213   3.085   102.640 1.00 20.20  ? 689  VAL C N     1 
ATOM   9008  C  CA    . VAL C 2  689  ? 2.801   4.007   103.605 1.00 21.01  ? 689  VAL C CA    1 
ATOM   9009  C  C     . VAL C 2  689  ? 3.899   3.331   104.410 1.00 21.30  ? 689  VAL C C     1 
ATOM   9010  O  O     . VAL C 2  689  ? 3.683   2.263   104.981 1.00 24.16  ? 689  VAL C O     1 
ATOM   9011  C  CB    . VAL C 2  689  ? 1.750   4.535   104.579 1.00 16.52  ? 689  VAL C CB    1 
ATOM   9012  C  CG1   . VAL C 2  689  ? 2.371   5.560   105.498 1.00 16.29  ? 689  VAL C CG1   1 
ATOM   9013  C  CG2   . VAL C 2  689  ? 0.598   5.140   103.811 1.00 22.99  ? 689  VAL C CG2   1 
ATOM   9014  N  N     . ILE C 2  690  ? 5.072   3.957   104.466 1.00 18.81  ? 690  ILE C N     1 
ATOM   9015  C  CA    . ILE C 2  690  ? 6.197   3.383   105.199 1.00 21.60  ? 690  ILE C CA    1 
ATOM   9016  C  C     . ILE C 2  690  ? 6.661   4.270   106.344 1.00 23.33  ? 690  ILE C C     1 
ATOM   9017  O  O     . ILE C 2  690  ? 6.406   5.472   106.360 1.00 26.81  ? 690  ILE C O     1 
ATOM   9018  C  CB    . ILE C 2  690  ? 7.405   3.129   104.291 1.00 20.31  ? 690  ILE C CB    1 
ATOM   9019  C  CG1   . ILE C 2  690  ? 8.035   4.458   103.870 1.00 17.91  ? 690  ILE C CG1   1 
ATOM   9020  C  CG2   . ILE C 2  690  ? 6.999   2.289   103.093 1.00 20.20  ? 690  ILE C CG2   1 
ATOM   9021  C  CD1   . ILE C 2  690  ? 9.368   4.307   103.180 1.00 21.74  ? 690  ILE C CD1   1 
ATOM   9022  N  N     . SER C 2  691  ? 7.347   3.660   107.303 1.00 24.29  ? 691  SER C N     1 
ATOM   9023  C  CA    . SER C 2  691  ? 7.880   4.387   108.444 1.00 25.18  ? 691  SER C CA    1 
ATOM   9024  C  C     . SER C 2  691  ? 9.251   4.960   108.135 1.00 27.76  ? 691  SER C C     1 
ATOM   9025  O  O     . SER C 2  691  ? 10.058  4.329   107.451 1.00 29.79  ? 691  SER C O     1 
ATOM   9026  C  CB    . SER C 2  691  ? 7.968   3.475   109.666 1.00 32.66  ? 691  SER C CB    1 
ATOM   9027  O  OG    . SER C 2  691  ? 8.498   4.173   110.781 1.00 35.60  ? 691  SER C OG    1 
ATOM   9028  N  N     . GLU C 2  692  ? 9.512   6.158   108.649 1.00 25.67  ? 692  GLU C N     1 
ATOM   9029  C  CA    . GLU C 2  692  ? 10.803  6.803   108.454 1.00 27.57  ? 692  GLU C CA    1 
ATOM   9030  C  C     . GLU C 2  692  ? 11.912  6.005   109.134 1.00 23.72  ? 692  GLU C C     1 
ATOM   9031  O  O     . GLU C 2  692  ? 13.084  6.131   108.782 1.00 24.25  ? 692  GLU C O     1 
ATOM   9032  C  CB    . GLU C 2  692  ? 10.771  8.241   108.978 1.00 30.59  ? 692  GLU C CB    1 
ATOM   9033  C  CG    . GLU C 2  692  ? 11.935  9.106   108.516 1.00 28.21  ? 692  GLU C CG    1 
ATOM   9034  C  CD    . GLU C 2  692  ? 11.894  10.499  109.110 1.00 32.53  ? 692  GLU C CD    1 
ATOM   9035  O  OE1   . GLU C 2  692  ? 11.376  10.647  110.236 1.00 35.45  ? 692  GLU C OE1   1 
ATOM   9036  O  OE2   . GLU C 2  692  ? 12.374  11.446  108.452 1.00 37.68  ? 692  GLU C OE2   1 
ATOM   9037  N  N     . GLU C 2  693  ? 11.534  5.165   110.095 1.00 28.54  ? 693  GLU C N     1 
ATOM   9038  C  CA    . GLU C 2  693  ? 12.496  4.323   110.803 1.00 38.65  ? 693  GLU C CA    1 
ATOM   9039  C  C     . GLU C 2  693  ? 13.177  3.350   109.833 1.00 33.94  ? 693  GLU C C     1 
ATOM   9040  O  O     . GLU C 2  693  ? 14.234  2.795   110.135 1.00 35.05  ? 693  GLU C O     1 
ATOM   9041  C  CB    . GLU C 2  693  ? 11.831  3.578   111.977 1.00 31.26  ? 693  GLU C CB    1 
ATOM   9042  C  CG    . GLU C 2  693  ? 11.053  2.320   111.577 1.00 43.34  ? 693  GLU C CG    1 
ATOM   9043  C  CD    . GLU C 2  693  ? 10.094  1.824   112.661 1.00 51.09  ? 693  GLU C CD    1 
ATOM   9044  O  OE1   . GLU C 2  693  ? 10.413  0.819   113.339 1.00 46.17  ? 693  GLU C OE1   1 
ATOM   9045  O  OE2   . GLU C 2  693  ? 9.009   2.428   112.822 1.00 49.80  ? 693  GLU C OE2   1 
ATOM   9046  N  N     . LEU C 2  694  ? 12.573  3.161   108.662 1.00 29.07  ? 694  LEU C N     1 
ATOM   9047  C  CA    . LEU C 2  694  ? 13.164  2.331   107.619 1.00 30.95  ? 694  LEU C CA    1 
ATOM   9048  C  C     . LEU C 2  694  ? 14.331  3.038   106.926 1.00 31.23  ? 694  LEU C C     1 
ATOM   9049  O  O     . LEU C 2  694  ? 15.313  2.400   106.543 1.00 28.29  ? 694  LEU C O     1 
ATOM   9050  C  CB    . LEU C 2  694  ? 12.108  1.905   106.595 1.00 27.70  ? 694  LEU C CB    1 
ATOM   9051  C  CG    . LEU C 2  694  ? 11.090  0.862   107.064 1.00 25.50  ? 694  LEU C CG    1 
ATOM   9052  C  CD1   . LEU C 2  694  ? 10.177  0.443   105.925 1.00 23.81  ? 694  LEU C CD1   1 
ATOM   9053  C  CD2   . LEU C 2  694  ? 11.797  -0.347  107.644 1.00 29.33  ? 694  LEU C CD2   1 
ATOM   9054  N  N     . LEU C 2  695  ? 14.224  4.355   106.768 1.00 30.86  ? 695  LEU C N     1 
ATOM   9055  C  CA    . LEU C 2  695  ? 15.313  5.131   106.180 1.00 28.29  ? 695  LEU C CA    1 
ATOM   9056  C  C     . LEU C 2  695  ? 16.407  5.380   107.211 1.00 33.22  ? 695  LEU C C     1 
ATOM   9057  O  O     . LEU C 2  695  ? 17.582  5.506   106.867 1.00 32.83  ? 695  LEU C O     1 
ATOM   9058  C  CB    . LEU C 2  695  ? 14.807  6.466   105.626 1.00 23.13  ? 695  LEU C CB    1 
ATOM   9059  C  CG    . LEU C 2  695  ? 13.666  6.411   104.611 1.00 23.15  ? 695  LEU C CG    1 
ATOM   9060  C  CD1   . LEU C 2  695  ? 13.537  7.732   103.871 1.00 23.60  ? 695  LEU C CD1   1 
ATOM   9061  C  CD2   . LEU C 2  695  ? 13.878  5.276   103.640 1.00 28.57  ? 695  LEU C CD2   1 
ATOM   9062  N  N     . LYS C 2  696  ? 16.008  5.459   108.478 1.00 34.28  ? 696  LYS C N     1 
ATOM   9063  C  CA    . LYS C 2  696  ? 16.945  5.710   109.565 1.00 31.20  ? 696  LYS C CA    1 
ATOM   9064  C  C     . LYS C 2  696  ? 17.931  4.557   109.705 1.00 31.98  ? 696  LYS C C     1 
ATOM   9065  O  O     . LYS C 2  696  ? 19.137  4.774   109.819 1.00 33.02  ? 696  LYS C O     1 
ATOM   9066  C  CB    . LYS C 2  696  ? 16.201  5.941   110.885 1.00 30.46  ? 696  LYS C CB    1 
ATOM   9067  C  CG    . LYS C 2  696  ? 15.440  7.263   110.960 1.00 31.12  ? 696  LYS C CG    1 
ATOM   9068  C  CD    . LYS C 2  696  ? 14.579  7.350   112.223 1.00 36.02  ? 696  LYS C CD    1 
ATOM   9069  C  CE    . LYS C 2  696  ? 13.768  8.646   112.263 1.00 36.88  ? 696  LYS C CE    1 
ATOM   9070  N  NZ    . LYS C 2  696  ? 12.744  8.667   113.350 1.00 26.47  ? 696  LYS C NZ    1 
ATOM   9071  N  N     . ARG C 2  697  ? 17.418  3.331   109.686 1.00 29.10  ? 697  ARG C N     1 
ATOM   9072  C  CA    . ARG C 2  697  ? 18.274  2.155   109.822 1.00 33.57  ? 697  ARG C CA    1 
ATOM   9073  C  C     . ARG C 2  697  ? 18.727  1.586   108.474 1.00 33.92  ? 697  ARG C C     1 
ATOM   9074  O  O     . ARG C 2  697  ? 19.331  0.512   108.409 1.00 33.20  ? 697  ARG C O     1 
ATOM   9075  C  CB    . ARG C 2  697  ? 17.638  1.082   110.719 1.00 34.10  ? 697  ARG C CB    1 
ATOM   9076  C  CG    . ARG C 2  697  ? 16.401  0.390   110.173 1.00 36.10  ? 697  ARG C CG    1 
ATOM   9077  C  CD    . ARG C 2  697  ? 16.040  -0.790  111.071 1.00 34.23  ? 697  ARG C CD    1 
ATOM   9078  N  NE    . ARG C 2  697  ? 14.742  -1.379  110.761 1.00 32.18  ? 697  ARG C NE    1 
ATOM   9079  C  CZ    . ARG C 2  697  ? 13.591  -0.945  111.264 1.00 35.81  ? 697  ARG C CZ    1 
ATOM   9080  N  NH1   . ARG C 2  697  ? 13.580  0.090   112.093 1.00 37.31  ? 697  ARG C NH1   1 
ATOM   9081  N  NH2   . ARG C 2  697  ? 12.452  -1.539  110.937 1.00 36.83  ? 697  ARG C NH2   1 
ATOM   9082  N  N     . ASP C 2  698  ? 18.409  2.311   107.406 1.00 29.91  ? 698  ASP C N     1 
ATOM   9083  C  CA    . ASP C 2  698  ? 18.849  1.969   106.051 1.00 30.57  ? 698  ASP C CA    1 
ATOM   9084  C  C     . ASP C 2  698  ? 18.296  0.647   105.524 1.00 29.91  ? 698  ASP C C     1 
ATOM   9085  O  O     . ASP C 2  698  ? 18.986  -0.080  104.807 1.00 26.22  ? 698  ASP C O     1 
ATOM   9086  C  CB    . ASP C 2  698  ? 20.381  2.000   105.923 1.00 34.17  ? 698  ASP C CB    1 
ATOM   9087  C  CG    . ASP C 2  698  ? 20.920  3.396   105.632 1.00 42.00  ? 698  ASP C CG    1 
ATOM   9088  O  OD1   . ASP C 2  698  ? 21.505  4.015   106.549 1.00 48.10  ? 698  ASP C OD1   1 
ATOM   9089  O  OD2   . ASP C 2  698  ? 20.758  3.873   104.485 1.00 32.37  ? 698  ASP C OD2   1 
ATOM   9090  N  N     . PHE C 2  699  ? 17.052  0.342   105.881 1.00 30.99  ? 699  PHE C N     1 
ATOM   9091  C  CA    . PHE C 2  699  ? 16.317  -0.715  105.200 1.00 25.99  ? 699  PHE C CA    1 
ATOM   9092  C  C     . PHE C 2  699  ? 15.921  -0.189  103.826 1.00 26.70  ? 699  PHE C C     1 
ATOM   9093  O  O     . PHE C 2  699  ? 15.645  1.004   103.673 1.00 27.06  ? 699  PHE C O     1 
ATOM   9094  C  CB    . PHE C 2  699  ? 15.076  -1.126  105.994 1.00 23.80  ? 699  PHE C CB    1 
ATOM   9095  C  CG    . PHE C 2  699  ? 15.324  -2.234  106.979 1.00 28.33  ? 699  PHE C CG    1 
ATOM   9096  C  CD1   . PHE C 2  699  ? 16.569  -2.394  107.566 1.00 29.29  ? 699  PHE C CD1   1 
ATOM   9097  C  CD2   . PHE C 2  699  ? 14.317  -3.127  107.304 1.00 28.79  ? 699  PHE C CD2   1 
ATOM   9098  C  CE1   . PHE C 2  699  ? 16.799  -3.416  108.468 1.00 24.21  ? 699  PHE C CE1   1 
ATOM   9099  C  CE2   . PHE C 2  699  ? 14.543  -4.152  108.203 1.00 27.99  ? 699  PHE C CE2   1 
ATOM   9100  C  CZ    . PHE C 2  699  ? 15.787  -4.296  108.785 1.00 24.87  ? 699  PHE C CZ    1 
ATOM   9101  N  N     . TYR C 2  700  ? 15.904  -1.072  102.831 1.00 24.41  ? 700  TYR C N     1 
ATOM   9102  C  CA    . TYR C 2  700  ? 15.602  -0.689  101.451 1.00 24.47  ? 700  TYR C CA    1 
ATOM   9103  C  C     . TYR C 2  700  ? 16.522  0.416   100.946 1.00 25.27  ? 700  TYR C C     1 
ATOM   9104  O  O     . TYR C 2  700  ? 16.064  1.426   100.417 1.00 28.07  ? 700  TYR C O     1 
ATOM   9105  C  CB    . TYR C 2  700  ? 14.135  -0.275  101.296 1.00 24.02  ? 700  TYR C CB    1 
ATOM   9106  C  CG    . TYR C 2  700  ? 13.176  -1.376  101.657 1.00 20.99  ? 700  TYR C CG    1 
ATOM   9107  C  CD1   . TYR C 2  700  ? 12.377  -1.286  102.785 1.00 21.91  ? 700  TYR C CD1   1 
ATOM   9108  C  CD2   . TYR C 2  700  ? 13.092  -2.522  100.881 1.00 22.63  ? 700  TYR C CD2   1 
ATOM   9109  C  CE1   . TYR C 2  700  ? 11.510  -2.304  103.120 1.00 25.78  ? 700  TYR C CE1   1 
ATOM   9110  C  CE2   . TYR C 2  700  ? 12.229  -3.541  101.205 1.00 19.39  ? 700  TYR C CE2   1 
ATOM   9111  C  CZ    . TYR C 2  700  ? 11.443  -3.429  102.323 1.00 22.50  ? 700  TYR C CZ    1 
ATOM   9112  O  OH    . TYR C 2  700  ? 10.585  -4.448  102.644 1.00 24.38  ? 700  TYR C OH    1 
ATOM   9113  N  N     . THR C 2  701  ? 17.821  0.222   101.135 1.00 28.66  ? 701  THR C N     1 
ATOM   9114  C  CA    . THR C 2  701  ? 18.822  1.133   100.600 1.00 24.45  ? 701  THR C CA    1 
ATOM   9115  C  C     . THR C 2  701  ? 19.730  0.349   99.664  1.00 23.38  ? 701  THR C C     1 
ATOM   9116  O  O     . THR C 2  701  ? 20.220  -0.724  100.017 1.00 26.88  ? 701  THR C O     1 
ATOM   9117  C  CB    . THR C 2  701  ? 19.647  1.798   101.717 1.00 20.90  ? 701  THR C CB    1 
ATOM   9118  O  OG1   . THR C 2  701  ? 18.831  2.757   102.402 1.00 20.24  ? 701  THR C OG1   1 
ATOM   9119  C  CG2   . THR C 2  701  ? 20.854  2.509   101.137 1.00 22.17  ? 701  THR C CG2   1 
ATOM   9120  N  N     . SER C 2  702  ? 19.942  0.879   98.465  1.00 20.15  ? 702  SER C N     1 
ATOM   9121  C  CA    . SER C 2  702  ? 20.659  0.145   97.435  1.00 20.76  ? 702  SER C CA    1 
ATOM   9122  C  C     . SER C 2  702  ? 21.691  1.001   96.725  1.00 23.43  ? 702  SER C C     1 
ATOM   9123  O  O     . SER C 2  702  ? 21.466  2.184   96.483  1.00 28.62  ? 702  SER C O     1 
ATOM   9124  C  CB    . SER C 2  702  ? 19.670  -0.387  96.411  1.00 21.67  ? 702  SER C CB    1 
ATOM   9125  O  OG    . SER C 2  702  ? 18.923  0.673   95.847  1.00 18.28  ? 702  SER C OG    1 
ATOM   9126  N  N     . ILE C 2  703  ? 22.820  0.390   96.381  1.00 23.49  ? 703  ILE C N     1 
ATOM   9127  C  CA    . ILE C 2  703  ? 23.873  1.084   95.653  1.00 23.16  ? 703  ILE C CA    1 
ATOM   9128  C  C     . ILE C 2  703  ? 23.702  0.887   94.149  1.00 26.98  ? 703  ILE C C     1 
ATOM   9129  O  O     . ILE C 2  703  ? 23.473  -0.229  93.680  1.00 28.74  ? 703  ILE C O     1 
ATOM   9130  C  CB    . ILE C 2  703  ? 25.266  0.580   96.067  1.00 21.71  ? 703  ILE C CB    1 
ATOM   9131  C  CG1   . ILE C 2  703  ? 25.483  0.765   97.567  1.00 24.39  ? 703  ILE C CG1   1 
ATOM   9132  C  CG2   . ILE C 2  703  ? 26.343  1.312   95.304  1.00 25.54  ? 703  ILE C CG2   1 
ATOM   9133  C  CD1   . ILE C 2  703  ? 26.864  0.353   98.025  1.00 25.15  ? 703  ILE C CD1   1 
ATOM   9134  N  N     . HIS C 2  704  ? 23.806  1.974   93.393  1.00 26.05  ? 704  HIS C N     1 
ATOM   9135  C  CA    . HIS C 2  704  ? 23.706  1.894   91.941  1.00 26.28  ? 704  HIS C CA    1 
ATOM   9136  C  C     . HIS C 2  704  ? 24.869  2.605   91.260  1.00 30.11  ? 704  HIS C C     1 
ATOM   9137  O  O     . HIS C 2  704  ? 25.294  3.681   91.687  1.00 28.96  ? 704  HIS C O     1 
ATOM   9138  C  CB    . HIS C 2  704  ? 22.373  2.469   91.465  1.00 31.44  ? 704  HIS C CB    1 
ATOM   9139  C  CG    . HIS C 2  704  ? 21.185  1.703   91.953  1.00 29.78  ? 704  HIS C CG    1 
ATOM   9140  N  ND1   . HIS C 2  704  ? 20.441  0.884   91.132  1.00 27.88  ? 704  HIS C ND1   1 
ATOM   9141  C  CD2   . HIS C 2  704  ? 20.620  1.622   93.181  1.00 25.33  ? 704  HIS C CD2   1 
ATOM   9142  C  CE1   . HIS C 2  704  ? 19.465  0.334   91.833  1.00 28.59  ? 704  HIS C CE1   1 
ATOM   9143  N  NE2   . HIS C 2  704  ? 19.550  0.767   93.078  1.00 25.42  ? 704  HIS C NE2   1 
ATOM   9144  N  N     . ILE C 2  705  ? 25.377  1.997   90.194  1.00 29.97  ? 705  ILE C N     1 
ATOM   9145  C  CA    . ILE C 2  705  ? 26.544  2.519   89.494  1.00 30.26  ? 705  ILE C CA    1 
ATOM   9146  C  C     . ILE C 2  705  ? 26.225  2.833   88.035  1.00 29.67  ? 705  ILE C C     1 
ATOM   9147  O  O     . ILE C 2  705  ? 25.633  2.014   87.332  1.00 29.09  ? 705  ILE C O     1 
ATOM   9148  C  CB    . ILE C 2  705  ? 27.714  1.522   89.568  1.00 24.67  ? 705  ILE C CB    1 
ATOM   9149  C  CG1   . ILE C 2  705  ? 28.065  1.235   91.028  1.00 21.82  ? 705  ILE C CG1   1 
ATOM   9150  C  CG2   . ILE C 2  705  ? 28.920  2.053   88.819  1.00 25.35  ? 705  ILE C CG2   1 
ATOM   9151  C  CD1   . ILE C 2  705  ? 29.147  0.218   91.198  1.00 27.93  ? 705  ILE C CD1   1 
ATOM   9152  N  N     . GLU C 2  706  ? 26.605  4.026   87.587  1.00 27.73  ? 706  GLU C N     1 
ATOM   9153  C  CA    . GLU C 2  706  ? 26.364  4.420   86.205  1.00 27.66  ? 706  GLU C CA    1 
ATOM   9154  C  C     . GLU C 2  706  ? 27.662  4.765   85.476  1.00 30.12  ? 706  GLU C C     1 
ATOM   9155  O  O     . GLU C 2  706  ? 28.561  5.379   86.048  1.00 31.38  ? 706  GLU C O     1 
ATOM   9156  C  CB    . GLU C 2  706  ? 25.381  5.588   86.139  1.00 27.42  ? 706  GLU C CB    1 
ATOM   9157  C  CG    . GLU C 2  706  ? 24.860  5.841   84.740  1.00 33.78  ? 706  GLU C CG    1 
ATOM   9158  C  CD    . GLU C 2  706  ? 24.445  4.557   84.047  1.00 36.01  ? 706  GLU C CD    1 
ATOM   9159  O  OE1   . GLU C 2  706  ? 23.576  3.844   84.592  1.00 40.00  ? 706  GLU C OE1   1 
ATOM   9160  O  OE2   . GLU C 2  706  ? 24.996  4.256   82.965  1.00 33.26  ? 706  GLU C OE2   1 
ATOM   9161  N  N     . ARG C 2  707  ? 27.752  4.364   84.211  1.00 30.98  ? 707  ARG C N     1 
ATOM   9162  C  CA    . ARG C 2  707  ? 28.973  4.539   83.431  1.00 29.80  ? 707  ARG C CA    1 
ATOM   9163  C  C     . ARG C 2  707  ? 28.868  5.694   82.440  1.00 28.96  ? 707  ARG C C     1 
ATOM   9164  O  O     . ARG C 2  707  ? 27.914  5.782   81.668  1.00 28.99  ? 707  ARG C O     1 
ATOM   9165  C  CB    . ARG C 2  707  ? 29.322  3.245   82.689  1.00 33.07  ? 707  ARG C CB    1 
ATOM   9166  C  CG    . ARG C 2  707  ? 30.584  3.330   81.849  1.00 43.51  ? 707  ARG C CG    1 
ATOM   9167  C  CD    . ARG C 2  707  ? 30.935  1.985   81.233  1.00 55.88  ? 707  ARG C CD    1 
ATOM   9168  N  NE    . ARG C 2  707  ? 30.881  2.017   79.774  1.00 68.61  ? 707  ARG C NE    1 
ATOM   9169  C  CZ    . ARG C 2  707  ? 31.231  1.002   78.989  1.00 81.20  ? 707  ARG C CZ    1 
ATOM   9170  N  NH1   . ARG C 2  707  ? 31.666  -0.134  79.523  1.00 75.65  ? 707  ARG C NH1   1 
ATOM   9171  N  NH2   . ARG C 2  707  ? 31.150  1.121   77.670  1.00 84.13  ? 707  ARG C NH2   1 
ATOM   9172  N  N     . TYR C 2  708  ? 29.859  6.576   82.468  1.00 26.69  ? 708  TYR C N     1 
ATOM   9173  C  CA    . TYR C 2  708  ? 29.918  7.693   81.536  1.00 25.54  ? 708  TYR C CA    1 
ATOM   9174  C  C     . TYR C 2  708  ? 31.168  7.571   80.672  1.00 28.46  ? 708  TYR C C     1 
ATOM   9175  O  O     . TYR C 2  708  ? 32.238  7.229   81.170  1.00 34.55  ? 708  TYR C O     1 
ATOM   9176  C  CB    . TYR C 2  708  ? 29.893  9.017   82.299  1.00 25.07  ? 708  TYR C CB    1 
ATOM   9177  C  CG    . TYR C 2  708  ? 28.676  9.157   83.185  1.00 23.93  ? 708  TYR C CG    1 
ATOM   9178  C  CD1   . TYR C 2  708  ? 28.741  8.864   84.537  1.00 26.97  ? 708  TYR C CD1   1 
ATOM   9179  C  CD2   . TYR C 2  708  ? 27.455  9.560   82.662  1.00 31.55  ? 708  TYR C CD2   1 
ATOM   9180  C  CE1   . TYR C 2  708  ? 27.625  8.981   85.347  1.00 29.62  ? 708  TYR C CE1   1 
ATOM   9181  C  CE2   . TYR C 2  708  ? 26.334  9.679   83.464  1.00 26.56  ? 708  TYR C CE2   1 
ATOM   9182  C  CZ    . TYR C 2  708  ? 26.426  9.388   84.804  1.00 28.46  ? 708  TYR C CZ    1 
ATOM   9183  O  OH    . TYR C 2  708  ? 25.315  9.504   85.606  1.00 35.08  ? 708  TYR C OH    1 
ATOM   9184  N  N     . GLU C 2  709  ? 31.030  7.839   79.378  1.00 24.60  ? 709  GLU C N     1 
ATOM   9185  C  CA    . GLU C 2  709  ? 32.108  7.577   78.432  1.00 28.92  ? 709  GLU C CA    1 
ATOM   9186  C  C     . GLU C 2  709  ? 32.274  8.733   77.460  1.00 28.42  ? 709  GLU C C     1 
ATOM   9187  O  O     . GLU C 2  709  ? 31.292  9.263   76.952  1.00 30.05  ? 709  GLU C O     1 
ATOM   9188  C  CB    . GLU C 2  709  ? 31.814  6.284   77.665  1.00 41.53  ? 709  GLU C CB    1 
ATOM   9189  C  CG    . GLU C 2  709  ? 32.964  5.744   76.829  1.00 45.55  ? 709  GLU C CG    1 
ATOM   9190  C  CD    . GLU C 2  709  ? 32.638  4.396   76.198  1.00 59.97  ? 709  GLU C CD    1 
ATOM   9191  O  OE1   . GLU C 2  709  ? 31.438  4.087   76.027  1.00 55.81  ? 709  GLU C OE1   1 
ATOM   9192  O  OE2   . GLU C 2  709  ? 33.582  3.641   75.880  1.00 63.04  ? 709  GLU C OE2   1 
ATOM   9193  N  N     . ILE C 2  710  ? 33.520  9.120   77.204  1.00 35.56  ? 710  ILE C N     1 
ATOM   9194  C  CA    . ILE C 2  710  ? 33.809  10.201  76.263  1.00 36.95  ? 710  ILE C CA    1 
ATOM   9195  C  C     . ILE C 2  710  ? 35.056  9.905   75.423  1.00 44.08  ? 710  ILE C C     1 
ATOM   9196  O  O     . ILE C 2  710  ? 36.041  9.362   75.926  1.00 44.50  ? 710  ILE C O     1 
ATOM   9197  C  CB    . ILE C 2  710  ? 33.955  11.561  76.986  1.00 31.30  ? 710  ILE C CB    1 
ATOM   9198  C  CG1   . ILE C 2  710  ? 34.196  12.686  75.978  1.00 31.68  ? 710  ILE C CG1   1 
ATOM   9199  C  CG2   . ILE C 2  710  ? 35.069  11.509  78.020  1.00 35.50  ? 710  ILE C CG2   1 
ATOM   9200  C  CD1   . ILE C 2  710  ? 34.207  14.064  76.594  1.00 39.16  ? 710  ILE C CD1   1 
ATOM   9201  N  N     . GLU C 2  711  ? 34.995  10.251  74.137  1.00 49.41  ? 711  GLU C N     1 
ATOM   9202  C  CA    . GLU C 2  711  ? 36.100  10.011  73.211  1.00 45.31  ? 711  GLU C CA    1 
ATOM   9203  C  C     . GLU C 2  711  ? 36.670  11.316  72.666  1.00 47.82  ? 711  GLU C C     1 
ATOM   9204  O  O     . GLU C 2  711  ? 35.924  12.215  72.277  1.00 46.33  ? 711  GLU C O     1 
ATOM   9205  C  CB    . GLU C 2  711  ? 35.636  9.150   72.035  1.00 41.24  ? 711  GLU C CB    1 
ATOM   9206  C  CG    . GLU C 2  711  ? 35.079  7.794   72.420  1.00 53.91  ? 711  GLU C CG    1 
ATOM   9207  C  CD    . GLU C 2  711  ? 34.419  7.088   71.249  1.00 70.60  ? 711  GLU C CD    1 
ATOM   9208  O  OE1   . GLU C 2  711  ? 34.209  7.739   70.202  1.00 61.58  ? 711  GLU C OE1   1 
ATOM   9209  O  OE2   . GLU C 2  711  ? 34.110  5.883   71.376  1.00 79.38  ? 711  GLU C OE2   1 
ATOM   9210  N  N     . ALA C 2  712  ? 37.995  11.412  72.637  1.00 48.97  ? 712  ALA C N     1 
ATOM   9211  C  CA    . ALA C 2  712  ? 38.664  12.511  71.954  1.00 52.16  ? 712  ALA C CA    1 
ATOM   9212  C  C     . ALA C 2  712  ? 39.311  11.960  70.695  1.00 55.03  ? 712  ALA C C     1 
ATOM   9213  O  O     . ALA C 2  712  ? 40.128  11.045  70.767  1.00 52.23  ? 712  ALA C O     1 
ATOM   9214  C  CB    . ALA C 2  712  ? 39.702  13.141  72.845  1.00 53.43  ? 712  ALA C CB    1 
ATOM   9215  N  N     . ARG C 2  713  ? 38.942  12.513  69.545  1.00 58.27  ? 713  ARG C N     1 
ATOM   9216  C  CA    . ARG C 2  713  ? 39.381  11.970  68.264  1.00 56.55  ? 713  ARG C CA    1 
ATOM   9217  C  C     . ARG C 2  713  ? 40.122  13.003  67.421  1.00 57.76  ? 713  ARG C C     1 
ATOM   9218  O  O     . ARG C 2  713  ? 40.282  14.153  67.829  1.00 60.41  ? 713  ARG C O     1 
ATOM   9219  C  CB    . ARG C 2  713  ? 38.178  11.443  67.482  1.00 57.17  ? 713  ARG C CB    1 
ATOM   9220  C  CG    . ARG C 2  713  ? 37.195  12.529  67.081  1.00 58.94  ? 713  ARG C CG    1 
ATOM   9221  C  CD    . ARG C 2  713  ? 36.098  11.989  66.182  1.00 70.99  ? 713  ARG C CD    1 
ATOM   9222  N  NE    . ARG C 2  713  ? 35.387  13.062  65.492  1.00 75.08  ? 713  ARG C NE    1 
ATOM   9223  C  CZ    . ARG C 2  713  ? 35.643  13.447  64.245  1.00 71.77  ? 713  ARG C CZ    1 
ATOM   9224  N  NH1   . ARG C 2  713  ? 36.589  12.840  63.540  1.00 64.40  ? 713  ARG C NH1   1 
ATOM   9225  N  NH2   . ARG C 2  713  ? 34.946  14.435  63.699  1.00 68.69  ? 713  ARG C NH2   1 
ATOM   9226  N  N     . ASP C 2  714  ? 40.567  12.581  66.241  1.00 57.64  ? 714  ASP C N     1 
ATOM   9227  C  CA    . ASP C 2  714  ? 41.226  13.476  65.295  1.00 55.20  ? 714  ASP C CA    1 
ATOM   9228  C  C     . ASP C 2  714  ? 40.220  14.048  64.309  1.00 54.89  ? 714  ASP C C     1 
ATOM   9229  O  O     . ASP C 2  714  ? 39.384  13.323  63.770  1.00 50.92  ? 714  ASP C O     1 
ATOM   9230  C  CB    . ASP C 2  714  ? 42.324  12.736  64.533  1.00 52.72  ? 714  ASP C CB    1 
ATOM   9231  C  CG    . ASP C 2  714  ? 43.550  12.485  65.377  1.00 57.19  ? 714  ASP C CG    1 
ATOM   9232  O  OD1   . ASP C 2  714  ? 43.987  13.418  66.083  1.00 60.43  ? 714  ASP C OD1   1 
ATOM   9233  O  OD2   . ASP C 2  714  ? 44.075  11.352  65.338  1.00 58.55  ? 714  ASP C OD2   1 
ATOM   9234  N  N     . THR C 2  715  ? 40.308  15.350  64.066  1.00 59.45  ? 715  THR C N     1 
ATOM   9235  C  CA    . THR C 2  715  ? 39.380  16.010  63.160  1.00 64.52  ? 715  THR C CA    1 
ATOM   9236  C  C     . THR C 2  715  ? 40.121  16.725  62.046  1.00 64.76  ? 715  THR C C     1 
ATOM   9237  O  O     . THR C 2  715  ? 41.321  16.978  62.146  1.00 66.25  ? 715  THR C O     1 
ATOM   9238  C  CB    . THR C 2  715  ? 38.518  17.045  63.894  1.00 63.40  ? 715  THR C CB    1 
ATOM   9239  O  OG1   . THR C 2  715  ? 38.492  16.742  65.294  1.00 68.35  ? 715  THR C OG1   1 
ATOM   9240  C  CG2   . THR C 2  715  ? 37.098  17.058  63.339  1.00 69.82  ? 715  THR C CG2   1 
ATOM   9241  N  N     . LYS C 2  716  ? 39.393  17.052  60.986  1.00 65.53  ? 716  LYS C N     1 
ATOM   9242  C  CA    . LYS C 2  716  ? 39.954  17.812  59.881  1.00 71.38  ? 716  LYS C CA    1 
ATOM   9243  C  C     . LYS C 2  716  ? 40.108  19.274  60.283  1.00 73.76  ? 716  LYS C C     1 
ATOM   9244  O  O     . LYS C 2  716  ? 40.809  20.039  59.623  1.00 86.45  ? 716  LYS C O     1 
ATOM   9245  C  CB    . LYS C 2  716  ? 39.070  17.676  58.641  1.00 62.34  ? 716  LYS C CB    1 
ATOM   9246  C  CG    . LYS C 2  716  ? 38.722  16.233  58.316  1.00 55.71  ? 716  LYS C CG    1 
ATOM   9247  C  CD    . LYS C 2  716  ? 38.283  16.063  56.875  1.00 50.43  ? 716  LYS C CD    1 
ATOM   9248  C  CE    . LYS C 2  716  ? 38.122  14.588  56.524  1.00 58.25  ? 716  LYS C CE    1 
ATOM   9249  N  NZ    . LYS C 2  716  ? 39.395  13.820  56.661  1.00 59.80  ? 716  LYS C NZ    1 
ATOM   9250  N  N     . LEU C 2  717  ? 39.441  19.653  61.369  1.00 64.13  ? 717  LEU C N     1 
ATOM   9251  C  CA    . LEU C 2  717  ? 39.547  21.000  61.918  1.00 58.77  ? 717  LEU C CA    1 
ATOM   9252  C  C     . LEU C 2  717  ? 40.563  21.071  63.055  1.00 68.05  ? 717  LEU C C     1 
ATOM   9253  O  O     . LEU C 2  717  ? 40.723  22.115  63.686  1.00 69.16  ? 717  LEU C O     1 
ATOM   9254  C  CB    . LEU C 2  717  ? 38.184  21.505  62.391  1.00 63.33  ? 717  LEU C CB    1 
ATOM   9255  C  CG    . LEU C 2  717  ? 37.100  21.636  61.319  1.00 69.95  ? 717  LEU C CG    1 
ATOM   9256  C  CD1   . LEU C 2  717  ? 36.327  20.333  61.137  1.00 71.69  ? 717  LEU C CD1   1 
ATOM   9257  C  CD2   . LEU C 2  717  ? 36.160  22.780  61.651  1.00 74.37  ? 717  LEU C CD2   1 
ATOM   9258  N  N     . GLY C 2  718  ? 41.250  19.959  63.304  1.00 72.58  ? 718  GLY C N     1 
ATOM   9259  C  CA    . GLY C 2  718  ? 42.185  19.854  64.412  1.00 70.02  ? 718  GLY C CA    1 
ATOM   9260  C  C     . GLY C 2  718  ? 41.705  18.924  65.514  1.00 67.79  ? 718  GLY C C     1 
ATOM   9261  O  O     . GLY C 2  718  ? 40.508  18.687  65.652  1.00 69.17  ? 718  GLY C O     1 
ATOM   9262  N  N     . PRO C 2  719  ? 42.644  18.396  66.314  1.00 67.96  ? 719  PRO C N     1 
ATOM   9263  C  CA    . PRO C 2  719  ? 42.365  17.329  67.283  1.00 71.14  ? 719  PRO C CA    1 
ATOM   9264  C  C     . PRO C 2  719  ? 41.569  17.759  68.517  1.00 69.08  ? 719  PRO C C     1 
ATOM   9265  O  O     . PRO C 2  719  ? 41.759  18.855  69.044  1.00 64.66  ? 719  PRO C O     1 
ATOM   9266  C  CB    . PRO C 2  719  ? 43.767  16.880  67.707  1.00 60.80  ? 719  PRO C CB    1 
ATOM   9267  C  CG    . PRO C 2  719  ? 44.598  18.100  67.559  1.00 57.05  ? 719  PRO C CG    1 
ATOM   9268  C  CD    . PRO C 2  719  ? 44.058  18.808  66.345  1.00 69.92  ? 719  PRO C CD    1 
ATOM   9269  N  N     . GLU C 2  720  ? 40.678  16.879  68.964  1.00 71.73  ? 720  GLU C N     1 
ATOM   9270  C  CA    . GLU C 2  720  ? 40.047  17.013  70.268  1.00 65.51  ? 720  GLU C CA    1 
ATOM   9271  C  C     . GLU C 2  720  ? 41.035  16.508  71.306  1.00 65.94  ? 720  GLU C C     1 
ATOM   9272  O  O     . GLU C 2  720  ? 41.832  15.613  71.023  1.00 66.98  ? 720  GLU C O     1 
ATOM   9273  C  CB    . GLU C 2  720  ? 38.773  16.174  70.338  1.00 52.40  ? 720  GLU C CB    1 
ATOM   9274  C  CG    . GLU C 2  720  ? 37.697  16.589  69.361  1.00 59.41  ? 720  GLU C CG    1 
ATOM   9275  C  CD    . GLU C 2  720  ? 36.465  15.712  69.456  1.00 62.33  ? 720  GLU C CD    1 
ATOM   9276  O  OE1   . GLU C 2  720  ? 36.619  14.497  69.706  1.00 61.13  ? 720  GLU C OE1   1 
ATOM   9277  O  OE2   . GLU C 2  720  ? 35.344  16.239  69.287  1.00 57.10  ? 720  GLU C OE2   1 
ATOM   9278  N  N     . ARG C 2  721  ? 40.993  17.077  72.504  1.00 60.15  ? 721  ARG C N     1 
ATOM   9279  C  CA    . ARG C 2  721  ? 41.888  16.624  73.560  1.00 59.01  ? 721  ARG C CA    1 
ATOM   9280  C  C     . ARG C 2  721  ? 41.268  16.729  74.949  1.00 57.33  ? 721  ARG C C     1 
ATOM   9281  O  O     . ARG C 2  721  ? 40.544  17.679  75.252  1.00 54.00  ? 721  ARG C O     1 
ATOM   9282  C  CB    . ARG C 2  721  ? 43.208  17.393  73.499  1.00 66.86  ? 721  ARG C CB    1 
ATOM   9283  C  CG    . ARG C 2  721  ? 43.041  18.898  73.538  1.00 71.08  ? 721  ARG C CG    1 
ATOM   9284  C  CD    . ARG C 2  721  ? 44.322  19.614  73.145  1.00 73.54  ? 721  ARG C CD    1 
ATOM   9285  N  NE    . ARG C 2  721  ? 44.192  21.058  73.307  1.00 83.67  ? 721  ARG C NE    1 
ATOM   9286  C  CZ    . ARG C 2  721  ? 43.588  21.857  72.432  1.00 90.32  ? 721  ARG C CZ    1 
ATOM   9287  N  NH1   . ARG C 2  721  ? 43.053  21.352  71.328  1.00 92.45  ? 721  ARG C NH1   1 
ATOM   9288  N  NH2   . ARG C 2  721  ? 43.515  23.160  72.663  1.00 91.38  ? 721  ARG C NH2   1 
ATOM   9289  N  N     . ILE C 2  722  ? 41.551  15.738  75.788  1.00 58.02  ? 722  ILE C N     1 
ATOM   9290  C  CA    . ILE C 2  722  ? 41.147  15.790  77.182  1.00 48.82  ? 722  ILE C CA    1 
ATOM   9291  C  C     . ILE C 2  722  ? 42.137  16.671  77.925  1.00 52.10  ? 722  ILE C C     1 
ATOM   9292  O  O     . ILE C 2  722  ? 43.336  16.385  77.965  1.00 53.80  ? 722  ILE C O     1 
ATOM   9293  C  CB    . ILE C 2  722  ? 41.113  14.392  77.822  1.00 48.80  ? 722  ILE C CB    1 
ATOM   9294  C  CG1   . ILE