data_4OMC
# 
_entry.id   4OMC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OMC         
RCSB  RCSB084673   
WWPDB D_1000084673 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OMD .                                  unspecified 
PDB 1P8J 'Crystal structure of mouse furin' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OMC 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dahms, S.O.' 1 
'Than, M.E.'  2 
# 
_citation.id                        primary 
_citation.title                     'X-ray Structures of Human Furin in Complex with Competitive Inhibitors.' 
_citation.journal_abbrev            'Acs Chem.Biol.' 
_citation.journal_volume            9 
_citation.page_first                1113 
_citation.page_last                 1118 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1554-8929 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24666235 
_citation.pdbx_database_id_DOI      10.1021/cb500087x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dahms, S.O.'      1 
primary 'Hardes, K.'       2 
primary 'Becker, G.L.'     3 
primary 'Steinmetzer, T.'  4 
primary 'Brandstetter, H.' 5 
primary 'Than, M.E.'       6 
# 
_cell.entry_id           4OMC 
_cell.length_a           141.178 
_cell.length_b           152.849 
_cell.length_c           168.306 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OMC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Furin                                                                    52388.602 6    3.4.21.75 ? 
'UNP RESIDUES 108-574' ? 
2 polymer     syn 'meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine' 735.926   6    ?         ? ? ? 
3 non-polymer syn 'FORMIC ACID'                                                            46.025    24   ?         ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                            40.078    18   ?         ? ? ? 
5 non-polymer syn 'SODIUM ION'                                                             22.990    6    ?         ? ? ? 
6 water       nat water                                                                    18.015    1346 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dibasic-processing enzyme, Paired basic amino acid residue-cleaving enzyme, PACE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no yes '(2UC)RVR(00S)' XRVRX H,I,J,K,L,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   TYR n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   THR n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  PHE n 
1 12  PRO n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  TYR n 
1 17  LEU n 
1 18  SER n 
1 19  GLY n 
1 20  VAL n 
1 21  THR n 
1 22  GLN n 
1 23  ARG n 
1 24  ASP n 
1 25  LEU n 
1 26  ASN n 
1 27  VAL n 
1 28  LYS n 
1 29  ALA n 
1 30  ALA n 
1 31  TRP n 
1 32  ALA n 
1 33  GLN n 
1 34  GLY n 
1 35  TYR n 
1 36  THR n 
1 37  GLY n 
1 38  HIS n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  VAL n 
1 43  SER n 
1 44  ILE n 
1 45  LEU n 
1 46  ASP n 
1 47  ASP n 
1 48  GLY n 
1 49  ILE n 
1 50  GLU n 
1 51  LYS n 
1 52  ASN n 
1 53  HIS n 
1 54  PRO n 
1 55  ASP n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  ASN n 
1 60  TYR n 
1 61  ASP n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  SER n 
1 66  PHE n 
1 67  ASP n 
1 68  VAL n 
1 69  ASN n 
1 70  ASP n 
1 71  GLN n 
1 72  ASP n 
1 73  PRO n 
1 74  ASP n 
1 75  PRO n 
1 76  GLN n 
1 77  PRO n 
1 78  ARG n 
1 79  TYR n 
1 80  THR n 
1 81  GLN n 
1 82  MET n 
1 83  ASN n 
1 84  ASP n 
1 85  ASN n 
1 86  ARG n 
1 87  HIS n 
1 88  GLY n 
1 89  THR n 
1 90  ARG n 
1 91  CYS n 
1 92  ALA n 
1 93  GLY n 
1 94  GLU n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  VAL n 
1 99  ALA n 
1 100 ASN n 
1 101 ASN n 
1 102 GLY n 
1 103 VAL n 
1 104 CYS n 
1 105 GLY n 
1 106 VAL n 
1 107 GLY n 
1 108 VAL n 
1 109 ALA n 
1 110 TYR n 
1 111 ASN n 
1 112 ALA n 
1 113 ARG n 
1 114 ILE n 
1 115 GLY n 
1 116 GLY n 
1 117 VAL n 
1 118 ARG n 
1 119 MET n 
1 120 LEU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 VAL n 
1 125 THR n 
1 126 ASP n 
1 127 ALA n 
1 128 VAL n 
1 129 GLU n 
1 130 ALA n 
1 131 ARG n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 LEU n 
1 136 ASN n 
1 137 PRO n 
1 138 ASN n 
1 139 HIS n 
1 140 ILE n 
1 141 HIS n 
1 142 ILE n 
1 143 TYR n 
1 144 SER n 
1 145 ALA n 
1 146 SER n 
1 147 TRP n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 ASP n 
1 152 ASP n 
1 153 GLY n 
1 154 LYS n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 GLY n 
1 159 PRO n 
1 160 ALA n 
1 161 ARG n 
1 162 LEU n 
1 163 ALA n 
1 164 GLU n 
1 165 GLU n 
1 166 ALA n 
1 167 PHE n 
1 168 PHE n 
1 169 ARG n 
1 170 GLY n 
1 171 VAL n 
1 172 SER n 
1 173 GLN n 
1 174 GLY n 
1 175 ARG n 
1 176 GLY n 
1 177 GLY n 
1 178 LEU n 
1 179 GLY n 
1 180 SER n 
1 181 ILE n 
1 182 PHE n 
1 183 VAL n 
1 184 TRP n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 ASN n 
1 189 GLY n 
1 190 GLY n 
1 191 ARG n 
1 192 GLU n 
1 193 HIS n 
1 194 ASP n 
1 195 SER n 
1 196 CYS n 
1 197 ASN n 
1 198 CYS n 
1 199 ASP n 
1 200 GLY n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 SER n 
1 205 ILE n 
1 206 TYR n 
1 207 THR n 
1 208 LEU n 
1 209 SER n 
1 210 ILE n 
1 211 SER n 
1 212 SER n 
1 213 ALA n 
1 214 THR n 
1 215 GLN n 
1 216 PHE n 
1 217 GLY n 
1 218 ASN n 
1 219 VAL n 
1 220 PRO n 
1 221 TRP n 
1 222 TYR n 
1 223 SER n 
1 224 GLU n 
1 225 ALA n 
1 226 CYS n 
1 227 SER n 
1 228 SER n 
1 229 THR n 
1 230 LEU n 
1 231 ALA n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 SER n 
1 236 SER n 
1 237 GLY n 
1 238 ASN n 
1 239 GLN n 
1 240 ASN n 
1 241 GLU n 
1 242 LYS n 
1 243 GLN n 
1 244 ILE n 
1 245 VAL n 
1 246 THR n 
1 247 THR n 
1 248 ASP n 
1 249 LEU n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 CYS n 
1 254 THR n 
1 255 GLU n 
1 256 SER n 
1 257 HIS n 
1 258 THR n 
1 259 GLY n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 SER n 
1 264 ALA n 
1 265 PRO n 
1 266 LEU n 
1 267 ALA n 
1 268 ALA n 
1 269 GLY n 
1 270 ILE n 
1 271 ILE n 
1 272 ALA n 
1 273 LEU n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 THR n 
1 283 TRP n 
1 284 ARG n 
1 285 ASP n 
1 286 MET n 
1 287 GLN n 
1 288 HIS n 
1 289 LEU n 
1 290 VAL n 
1 291 VAL n 
1 292 GLN n 
1 293 THR n 
1 294 SER n 
1 295 LYS n 
1 296 PRO n 
1 297 ALA n 
1 298 HIS n 
1 299 LEU n 
1 300 ASN n 
1 301 ALA n 
1 302 ASN n 
1 303 ASP n 
1 304 TRP n 
1 305 ALA n 
1 306 THR n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 GLY n 
1 311 ARG n 
1 312 LYS n 
1 313 VAL n 
1 314 SER n 
1 315 HIS n 
1 316 SER n 
1 317 TYR n 
1 318 GLY n 
1 319 TYR n 
1 320 GLY n 
1 321 LEU n 
1 322 LEU n 
1 323 ASP n 
1 324 ALA n 
1 325 GLY n 
1 326 ALA n 
1 327 MET n 
1 328 VAL n 
1 329 ALA n 
1 330 LEU n 
1 331 ALA n 
1 332 GLN n 
1 333 ASN n 
1 334 TRP n 
1 335 THR n 
1 336 THR n 
1 337 VAL n 
1 338 ALA n 
1 339 PRO n 
1 340 GLN n 
1 341 ARG n 
1 342 LYS n 
1 343 CYS n 
1 344 ILE n 
1 345 ILE n 
1 346 ASP n 
1 347 ILE n 
1 348 LEU n 
1 349 THR n 
1 350 GLU n 
1 351 PRO n 
1 352 LYS n 
1 353 ASP n 
1 354 ILE n 
1 355 GLY n 
1 356 LYS n 
1 357 ARG n 
1 358 LEU n 
1 359 GLU n 
1 360 VAL n 
1 361 ARG n 
1 362 LYS n 
1 363 THR n 
1 364 VAL n 
1 365 THR n 
1 366 ALA n 
1 367 CYS n 
1 368 LEU n 
1 369 GLY n 
1 370 GLU n 
1 371 PRO n 
1 372 ASN n 
1 373 HIS n 
1 374 ILE n 
1 375 THR n 
1 376 ARG n 
1 377 LEU n 
1 378 GLU n 
1 379 HIS n 
1 380 ALA n 
1 381 GLN n 
1 382 ALA n 
1 383 ARG n 
1 384 LEU n 
1 385 THR n 
1 386 LEU n 
1 387 SER n 
1 388 TYR n 
1 389 ASN n 
1 390 ARG n 
1 391 ARG n 
1 392 GLY n 
1 393 ASP n 
1 394 LEU n 
1 395 ALA n 
1 396 ILE n 
1 397 HIS n 
1 398 LEU n 
1 399 VAL n 
1 400 SER n 
1 401 PRO n 
1 402 MET n 
1 403 GLY n 
1 404 THR n 
1 405 ARG n 
1 406 SER n 
1 407 THR n 
1 408 LEU n 
1 409 LEU n 
1 410 ALA n 
1 411 ALA n 
1 412 ARG n 
1 413 PRO n 
1 414 HIS n 
1 415 ASP n 
1 416 TYR n 
1 417 SER n 
1 418 ALA n 
1 419 ASP n 
1 420 GLY n 
1 421 PHE n 
1 422 ASN n 
1 423 ASP n 
1 424 TRP n 
1 425 ALA n 
1 426 PHE n 
1 427 MET n 
1 428 THR n 
1 429 THR n 
1 430 HIS n 
1 431 SER n 
1 432 TRP n 
1 433 ASP n 
1 434 GLU n 
1 435 ASP n 
1 436 PRO n 
1 437 SER n 
1 438 GLY n 
1 439 GLU n 
1 440 TRP n 
1 441 VAL n 
1 442 LEU n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 ASN n 
1 447 THR n 
1 448 SER n 
1 449 GLU n 
1 450 ALA n 
1 451 ASN n 
1 452 ASN n 
1 453 TYR n 
1 454 GLY n 
1 455 THR n 
1 456 LEU n 
1 457 THR n 
1 458 LYS n 
1 459 PHE n 
1 460 THR n 
1 461 LEU n 
1 462 VAL n 
1 463 LEU n 
1 464 TYR n 
1 465 GLY n 
1 466 THR n 
1 467 ALA n 
1 468 SER n 
1 469 GLY n 
1 470 SER n 
1 471 LEU n 
1 472 VAL n 
1 473 PRO n 
1 474 ARG n 
1 475 GLY n 
1 476 SER n 
1 477 HIS n 
1 478 HIS n 
1 479 HIS n 
1 480 HIS n 
1 481 HIS n 
1 482 HIS n 
2 1   2UC n 
2 2   ARG n 
2 3   VAL n 
2 4   ARG n 
2 5   00S n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FUR, FURIN, PACE, PCSK3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 HEK293S 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHLsec 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FURIN_HUMAN P09958 1 
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
108 ? 
2 PDB 4OMC        4OMC   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4OMC A 1 ? 467 ? P09958 108 ? 574 ? 108 574 
2  1 4OMC B 1 ? 467 ? P09958 108 ? 574 ? 108 574 
3  1 4OMC C 1 ? 467 ? P09958 108 ? 574 ? 108 574 
4  1 4OMC D 1 ? 467 ? P09958 108 ? 574 ? 108 574 
5  1 4OMC E 1 ? 467 ? P09958 108 ? 574 ? 108 574 
6  1 4OMC F 1 ? 467 ? P09958 108 ? 574 ? 108 574 
7  2 4OMC H 1 ? 5   ? 4OMC   1   ? 5   ? 1   5   
8  2 4OMC I 1 ? 5   ? 4OMC   1   ? 5   ? 1   5   
9  2 4OMC J 1 ? 5   ? 4OMC   1   ? 5   ? 1   5   
10 2 4OMC K 1 ? 5   ? 4OMC   1   ? 5   ? 1   5   
11 2 4OMC L 1 ? 5   ? 4OMC   1   ? 5   ? 1   5   
12 2 4OMC N 1 ? 5   ? 4OMC   1   ? 5   ? 1   5   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4OMC SER A 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 1  
1 4OMC GLY A 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 2  
1 4OMC SER A 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 3  
1 4OMC LEU A 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 4  
1 4OMC VAL A 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 5  
1 4OMC PRO A 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 6  
1 4OMC ARG A 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 7  
1 4OMC GLY A 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 8  
1 4OMC SER A 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 9  
1 4OMC HIS A 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 10 
1 4OMC HIS A 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 11 
1 4OMC HIS A 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 12 
1 4OMC HIS A 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 13 
1 4OMC HIS A 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 14 
1 4OMC HIS A 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 15 
2 4OMC SER B 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 16 
2 4OMC GLY B 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 17 
2 4OMC SER B 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 18 
2 4OMC LEU B 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 19 
2 4OMC VAL B 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 20 
2 4OMC PRO B 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 21 
2 4OMC ARG B 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 22 
2 4OMC GLY B 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 23 
2 4OMC SER B 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 24 
2 4OMC HIS B 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 25 
2 4OMC HIS B 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 26 
2 4OMC HIS B 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 27 
2 4OMC HIS B 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 28 
2 4OMC HIS B 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 29 
2 4OMC HIS B 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 30 
3 4OMC SER C 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 31 
3 4OMC GLY C 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 32 
3 4OMC SER C 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 33 
3 4OMC LEU C 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 34 
3 4OMC VAL C 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 35 
3 4OMC PRO C 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 36 
3 4OMC ARG C 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 37 
3 4OMC GLY C 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 38 
3 4OMC SER C 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 39 
3 4OMC HIS C 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 40 
3 4OMC HIS C 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 41 
3 4OMC HIS C 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 42 
3 4OMC HIS C 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 43 
3 4OMC HIS C 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 44 
3 4OMC HIS C 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 45 
4 4OMC SER D 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 46 
4 4OMC GLY D 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 47 
4 4OMC SER D 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 48 
4 4OMC LEU D 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 49 
4 4OMC VAL D 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 50 
4 4OMC PRO D 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 51 
4 4OMC ARG D 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 52 
4 4OMC GLY D 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 53 
4 4OMC SER D 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 54 
4 4OMC HIS D 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 55 
4 4OMC HIS D 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 56 
4 4OMC HIS D 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 57 
4 4OMC HIS D 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 58 
4 4OMC HIS D 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 59 
4 4OMC HIS D 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 60 
5 4OMC SER E 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 61 
5 4OMC GLY E 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 62 
5 4OMC SER E 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 63 
5 4OMC LEU E 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 64 
5 4OMC VAL E 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 65 
5 4OMC PRO E 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 66 
5 4OMC ARG E 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 67 
5 4OMC GLY E 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 68 
5 4OMC SER E 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 69 
5 4OMC HIS E 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 70 
5 4OMC HIS E 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 71 
5 4OMC HIS E 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 72 
5 4OMC HIS E 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 73 
5 4OMC HIS E 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 74 
5 4OMC HIS E 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 75 
6 4OMC SER F 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 76 
6 4OMC GLY F 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 77 
6 4OMC SER F 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 78 
6 4OMC LEU F 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 79 
6 4OMC VAL F 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 80 
6 4OMC PRO F 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 81 
6 4OMC ARG F 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 82 
6 4OMC GLY F 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 83 
6 4OMC SER F 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 84 
6 4OMC HIS F 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 85 
6 4OMC HIS F 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 86 
6 4OMC HIS F 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 87 
6 4OMC HIS F 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 88 
6 4OMC HIS F 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 89 
6 4OMC HIS F 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 90 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
00S non-polymer         . '4-(aminomethyl)benzenecarboximidamide' ? 'C8 H11 N3'      149.193 
2UC non-polymer         . '1-[3-(2-oxoethyl)benzyl]guanidine'     ? 'C10 H13 N3 O'   191.230 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                           ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'                           ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                            ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4OMC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_percent_sol   56.82 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'50mM Tris, 2.8M sodium formate, 0.015mM Cymal-7, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-05-29 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.918 
# 
_reflns.entry_id                     4OMC 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   160915 
_reflns.number_all                   161839 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.012 
_reflns.pdbx_netI_over_sigmaI        9.69 
_reflns.B_iso_Wilson_estimate        31.40 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.051 
_reflns_shell.meanI_over_sigI_obs    2.63 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      25523 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4OMC 
_refine.ls_number_reflns_obs                     160803 
_refine.ls_number_reflns_all                     161540 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1848 
_refine.ls_R_factor_R_free                       0.2164 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  8055 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            shells 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        21650 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         96 
_refine_hist.number_atoms_solvent             1346 
_refine_hist.number_atoms_total               23092 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
c_bond_d     0.0079 ? ? ? ? 'X-RAY DIFFRACTION' 
c_mcangle_it 2.710  ? ? ? ? 'X-RAY DIFFRACTION' 
c_mcbond_it  1.827  ? ? ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.3 
_refine_ls_shell.d_res_low                        2.4 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2514 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2927 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             1074 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                19835 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OMC 
_struct.title                     
'X-ray structure of human furin in complex with the competitive inhibitor meta-guanidinomethyl-Phac-RVR-Amba' 
_struct.pdbx_descriptor           'Furin (E.C.3.4.21.75), meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OMC 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'pro-protein convertase, serine protease, competitive inhibitor, protease-inhibitor complex, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 5 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 5 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 5 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 3 ? 
VA N N 3 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 4 ? 
ZA N N 5 ? 
AB N N 3 ? 
BB N N 3 ? 
CB N N 3 ? 
DB N N 3 ? 
EB N N 4 ? 
FB N N 4 ? 
GB N N 4 ? 
HB N N 5 ? 
IB N N 6 ? 
JB N N 6 ? 
KB N N 6 ? 
LB N N 6 ? 
MB N N 6 ? 
NB N N 6 ? 
OB N N 6 ? 
PB N N 6 ? 
QB N N 6 ? 
RB N N 6 ? 
SB N N 6 ? 
TB N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 10  ? GLN A 14  ? LYS A 117 GLN A 121 5 ? 5  
HELX_P HELX_P2  2  ASN A 26  ? GLN A 33  ? ASN A 133 GLN A 140 1 ? 8  
HELX_P HELX_P3  3  ASP A 61  ? SER A 65  ? ASP A 168 SER A 172 5 ? 5  
HELX_P HELX_P4  4  ASN A 83  ? ASN A 85  ? ASN A 190 ASN A 192 5 ? 3  
HELX_P HELX_P5  5  ARG A 86  ? ALA A 97  ? ARG A 193 ALA A 204 1 ? 12 
HELX_P HELX_P6  6  THR A 125 ? GLY A 134 ? THR A 232 GLY A 241 1 ? 10 
HELX_P HELX_P7  7  ALA A 160 ? GLY A 174 ? ALA A 267 GLY A 281 1 ? 15 
HELX_P HELX_P8  8  ARG A 175 ? LEU A 178 ? ARG A 282 LEU A 285 5 ? 4  
HELX_P HELX_P9  9  GLY A 189 ? HIS A 193 ? GLY A 296 HIS A 300 5 ? 5  
HELX_P HELX_P10 10 SER A 195 ? ASP A 199 ? SER A 302 ASP A 306 5 ? 5  
HELX_P HELX_P11 11 GLY A 259 ? ASN A 278 ? GLY A 366 ASN A 385 1 ? 20 
HELX_P HELX_P12 12 THR A 282 ? SER A 294 ? THR A 389 SER A 401 1 ? 13 
HELX_P HELX_P13 13 ASP A 323 ? TRP A 334 ? ASP A 430 TRP A 441 1 ? 12 
HELX_P HELX_P14 14 ARG A 390 ? GLY A 392 ? ARG A 497 GLY A 499 5 ? 3  
HELX_P HELX_P15 15 LYS B 10  ? GLN B 14  ? LYS B 117 GLN B 121 5 ? 5  
HELX_P HELX_P16 16 VAL B 27  ? GLN B 33  ? VAL B 134 GLN B 140 1 ? 7  
HELX_P HELX_P17 17 ASP B 61  ? SER B 65  ? ASP B 168 SER B 172 5 ? 5  
HELX_P HELX_P18 18 ASN B 83  ? ASN B 85  ? ASN B 190 ASN B 192 5 ? 3  
HELX_P HELX_P19 19 ARG B 86  ? ALA B 97  ? ARG B 193 ALA B 204 1 ? 12 
HELX_P HELX_P20 20 THR B 125 ? GLY B 134 ? THR B 232 GLY B 241 1 ? 10 
HELX_P HELX_P21 21 ALA B 160 ? GLY B 174 ? ALA B 267 GLY B 281 1 ? 15 
HELX_P HELX_P22 22 ARG B 175 ? LEU B 178 ? ARG B 282 LEU B 285 5 ? 4  
HELX_P HELX_P23 23 ASN B 188 ? HIS B 193 ? ASN B 295 HIS B 300 5 ? 6  
HELX_P HELX_P24 24 SER B 195 ? ASP B 199 ? SER B 302 ASP B 306 5 ? 5  
HELX_P HELX_P25 25 GLY B 259 ? ASN B 278 ? GLY B 366 ASN B 385 1 ? 20 
HELX_P HELX_P26 26 THR B 282 ? SER B 294 ? THR B 389 SER B 401 1 ? 13 
HELX_P HELX_P27 27 ASP B 323 ? TRP B 334 ? ASP B 430 TRP B 441 1 ? 12 
HELX_P HELX_P28 28 ARG B 390 ? GLY B 392 ? ARG B 497 GLY B 499 5 ? 3  
HELX_P HELX_P29 29 LYS C 10  ? GLN C 14  ? LYS C 117 GLN C 121 5 ? 5  
HELX_P HELX_P30 30 ASN C 26  ? GLN C 33  ? ASN C 133 GLN C 140 1 ? 8  
HELX_P HELX_P31 31 ASP C 61  ? SER C 65  ? ASP C 168 SER C 172 5 ? 5  
HELX_P HELX_P32 32 ASN C 83  ? ASN C 85  ? ASN C 190 ASN C 192 5 ? 3  
HELX_P HELX_P33 33 ARG C 86  ? ALA C 97  ? ARG C 193 ALA C 204 1 ? 12 
HELX_P HELX_P34 34 THR C 125 ? GLY C 134 ? THR C 232 GLY C 241 1 ? 10 
HELX_P HELX_P35 35 ALA C 160 ? GLY C 174 ? ALA C 267 GLY C 281 1 ? 15 
HELX_P HELX_P36 36 ARG C 175 ? LEU C 178 ? ARG C 282 LEU C 285 5 ? 4  
HELX_P HELX_P37 37 ASN C 188 ? HIS C 193 ? ASN C 295 HIS C 300 5 ? 6  
HELX_P HELX_P38 38 SER C 195 ? ASP C 199 ? SER C 302 ASP C 306 5 ? 5  
HELX_P HELX_P39 39 GLY C 259 ? ASN C 278 ? GLY C 366 ASN C 385 1 ? 20 
HELX_P HELX_P40 40 THR C 282 ? SER C 294 ? THR C 389 SER C 401 1 ? 13 
HELX_P HELX_P41 41 ASP C 323 ? TRP C 334 ? ASP C 430 TRP C 441 1 ? 12 
HELX_P HELX_P42 42 ARG C 390 ? GLY C 392 ? ARG C 497 GLY C 499 5 ? 3  
HELX_P HELX_P43 43 LYS D 10  ? GLN D 14  ? LYS D 117 GLN D 121 5 ? 5  
HELX_P HELX_P44 44 ASN D 26  ? GLN D 33  ? ASN D 133 GLN D 140 1 ? 8  
HELX_P HELX_P45 45 ASP D 61  ? SER D 65  ? ASP D 168 SER D 172 5 ? 5  
HELX_P HELX_P46 46 ASN D 83  ? ASN D 85  ? ASN D 190 ASN D 192 5 ? 3  
HELX_P HELX_P47 47 ARG D 86  ? ALA D 97  ? ARG D 193 ALA D 204 1 ? 12 
HELX_P HELX_P48 48 THR D 125 ? GLY D 134 ? THR D 232 GLY D 241 1 ? 10 
HELX_P HELX_P49 49 ALA D 160 ? GLY D 174 ? ALA D 267 GLY D 281 1 ? 15 
HELX_P HELX_P50 50 ARG D 175 ? LEU D 178 ? ARG D 282 LEU D 285 5 ? 4  
HELX_P HELX_P51 51 ASN D 188 ? HIS D 193 ? ASN D 295 HIS D 300 5 ? 6  
HELX_P HELX_P52 52 SER D 195 ? ASP D 199 ? SER D 302 ASP D 306 5 ? 5  
HELX_P HELX_P53 53 GLY D 259 ? ASN D 278 ? GLY D 366 ASN D 385 1 ? 20 
HELX_P HELX_P54 54 THR D 282 ? SER D 294 ? THR D 389 SER D 401 1 ? 13 
HELX_P HELX_P55 55 ASP D 323 ? TRP D 334 ? ASP D 430 TRP D 441 1 ? 12 
HELX_P HELX_P56 56 ARG D 390 ? GLY D 392 ? ARG D 497 GLY D 499 5 ? 3  
HELX_P HELX_P57 57 LYS E 10  ? GLN E 14  ? LYS E 117 GLN E 121 5 ? 5  
HELX_P HELX_P58 58 ASN E 26  ? GLN E 33  ? ASN E 133 GLN E 140 1 ? 8  
HELX_P HELX_P59 59 ASP E 61  ? SER E 65  ? ASP E 168 SER E 172 5 ? 5  
HELX_P HELX_P60 60 ASN E 83  ? ASN E 85  ? ASN E 190 ASN E 192 5 ? 3  
HELX_P HELX_P61 61 ARG E 86  ? ALA E 97  ? ARG E 193 ALA E 204 1 ? 12 
HELX_P HELX_P62 62 THR E 125 ? GLY E 134 ? THR E 232 GLY E 241 1 ? 10 
HELX_P HELX_P63 63 ALA E 160 ? GLY E 174 ? ALA E 267 GLY E 281 1 ? 15 
HELX_P HELX_P64 64 ARG E 175 ? LEU E 178 ? ARG E 282 LEU E 285 5 ? 4  
HELX_P HELX_P65 65 GLY E 189 ? HIS E 193 ? GLY E 296 HIS E 300 5 ? 5  
HELX_P HELX_P66 66 SER E 195 ? ASP E 199 ? SER E 302 ASP E 306 5 ? 5  
HELX_P HELX_P67 67 GLY E 259 ? ASN E 278 ? GLY E 366 ASN E 385 1 ? 20 
HELX_P HELX_P68 68 THR E 282 ? SER E 294 ? THR E 389 SER E 401 1 ? 13 
HELX_P HELX_P69 69 ASP E 323 ? TRP E 334 ? ASP E 430 TRP E 441 1 ? 12 
HELX_P HELX_P70 70 ARG E 390 ? GLY E 392 ? ARG E 497 GLY E 499 5 ? 3  
HELX_P HELX_P71 71 LYS F 10  ? GLN F 14  ? LYS F 117 GLN F 121 5 ? 5  
HELX_P HELX_P72 72 VAL F 27  ? GLN F 33  ? VAL F 134 GLN F 140 1 ? 7  
HELX_P HELX_P73 73 LEU F 56  ? TYR F 60  ? LEU F 163 TYR F 167 5 ? 5  
HELX_P HELX_P74 74 ASP F 61  ? SER F 65  ? ASP F 168 SER F 172 5 ? 5  
HELX_P HELX_P75 75 ASN F 83  ? ASN F 85  ? ASN F 190 ASN F 192 5 ? 3  
HELX_P HELX_P76 76 ARG F 86  ? ALA F 97  ? ARG F 193 ALA F 204 1 ? 12 
HELX_P HELX_P77 77 THR F 125 ? GLY F 134 ? THR F 232 GLY F 241 1 ? 10 
HELX_P HELX_P78 78 ALA F 160 ? GLY F 174 ? ALA F 267 GLY F 281 1 ? 15 
HELX_P HELX_P79 79 ARG F 175 ? LEU F 178 ? ARG F 282 LEU F 285 5 ? 4  
HELX_P HELX_P80 80 GLY F 189 ? HIS F 193 ? GLY F 296 HIS F 300 5 ? 5  
HELX_P HELX_P81 81 SER F 195 ? ASP F 199 ? SER F 302 ASP F 306 5 ? 5  
HELX_P HELX_P82 82 GLY F 259 ? ASN F 278 ? GLY F 366 ASN F 385 1 ? 20 
HELX_P HELX_P83 83 THR F 282 ? SER F 294 ? THR F 389 SER F 401 1 ? 13 
HELX_P HELX_P84 84 ASP F 323 ? TRP F 334 ? ASP F 430 TRP F 441 1 ? 12 
HELX_P HELX_P85 85 ARG F 390 ? GLY F 392 ? ARG F 497 GLY F 499 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? A  CYS 104 SG  ? ? ? 1_555 A  CYS 253 SG  ? ? A CYS 211 A CYS 360 1_555 ? ? ? ? ? ? ? 2.047 ?    
disulf2   disulf ? ? A  CYS 196 SG  ? ? ? 1_555 A  CYS 226 SG  ? ? A CYS 303 A CYS 333 1_555 ? ? ? ? ? ? ? 2.046 ?    
disulf3   disulf ? ? A  CYS 343 SG  ? ? ? 1_555 A  CYS 367 SG  ? ? A CYS 450 A CYS 474 1_555 ? ? ? ? ? ? ? 2.039 ?    
disulf4   disulf ? ? B  CYS 104 SG  ? ? ? 1_555 B  CYS 253 SG  ? ? B CYS 211 B CYS 360 1_555 ? ? ? ? ? ? ? 2.042 ?    
disulf5   disulf ? ? B  CYS 196 SG  ? ? ? 1_555 B  CYS 226 SG  ? ? B CYS 303 B CYS 333 1_555 ? ? ? ? ? ? ? 2.049 ?    
disulf6   disulf ? ? B  CYS 343 SG  ? ? ? 1_555 B  CYS 367 SG  ? ? B CYS 450 B CYS 474 1_555 ? ? ? ? ? ? ? 2.047 ?    
disulf7   disulf ? ? C  CYS 104 SG  ? ? ? 1_555 C  CYS 253 SG  ? ? C CYS 211 C CYS 360 1_555 ? ? ? ? ? ? ? 2.047 ?    
disulf8   disulf ? ? C  CYS 196 SG  ? ? ? 1_555 C  CYS 226 SG  ? ? C CYS 303 C CYS 333 1_555 ? ? ? ? ? ? ? 2.044 ?    
disulf9   disulf ? ? C  CYS 343 SG  ? ? ? 1_555 C  CYS 367 SG  ? ? C CYS 450 C CYS 474 1_555 ? ? ? ? ? ? ? 2.044 ?    
disulf10  disulf ? ? D  CYS 104 SG  ? ? ? 1_555 D  CYS 253 SG  ? ? D CYS 211 D CYS 360 1_555 ? ? ? ? ? ? ? 2.048 ?    
disulf11  disulf ? ? D  CYS 196 SG  ? ? ? 1_555 D  CYS 226 SG  ? ? D CYS 303 D CYS 333 1_555 ? ? ? ? ? ? ? 2.041 ?    
disulf12  disulf ? ? D  CYS 343 SG  ? ? ? 1_555 D  CYS 367 SG  ? ? D CYS 450 D CYS 474 1_555 ? ? ? ? ? ? ? 2.049 ?    
disulf13  disulf ? ? E  CYS 104 SG  ? ? ? 1_555 E  CYS 253 SG  ? ? E CYS 211 E CYS 360 1_555 ? ? ? ? ? ? ? 2.047 ?    
disulf14  disulf ? ? E  CYS 196 SG  ? ? ? 1_555 E  CYS 226 SG  ? ? E CYS 303 E CYS 333 1_555 ? ? ? ? ? ? ? 2.035 ?    
disulf15  disulf ? ? E  CYS 343 SG  ? ? ? 1_555 E  CYS 367 SG  ? ? E CYS 450 E CYS 474 1_555 ? ? ? ? ? ? ? 2.056 ?    
disulf16  disulf ? ? F  CYS 104 SG  ? ? ? 1_555 F  CYS 253 SG  ? ? F CYS 211 F CYS 360 1_555 ? ? ? ? ? ? ? 2.046 ?    
disulf17  disulf ? ? F  CYS 196 SG  ? ? ? 1_555 F  CYS 226 SG  ? ? F CYS 303 F CYS 333 1_555 ? ? ? ? ? ? ? 2.053 ?    
disulf18  disulf ? ? F  CYS 343 SG  ? ? ? 1_555 F  CYS 367 SG  ? ? F CYS 450 F CYS 474 1_555 ? ? ? ? ? ? ? 2.046 ?    
covale1   covale ? ? G  2UC 1   C2  ? ? ? 1_555 G  ARG 2   N   ? ? H 2UC 1   H ARG 2   1_555 ? ? ? ? ? ? ? 1.324 sing 
covale2   covale ? ? H  2UC 1   C2  ? ? ? 1_555 H  ARG 2   N   ? ? I 2UC 1   I ARG 2   1_555 ? ? ? ? ? ? ? 1.321 sing 
covale3   covale ? ? I  2UC 1   C2  ? ? ? 1_555 I  ARG 2   N   ? ? J 2UC 1   J ARG 2   1_555 ? ? ? ? ? ? ? 1.326 sing 
covale4   covale ? ? J  2UC 1   C2  ? ? ? 1_555 J  ARG 2   N   ? ? K 2UC 1   K ARG 2   1_555 ? ? ? ? ? ? ? 1.326 sing 
covale5   covale ? ? K  2UC 1   C2  ? ? ? 1_555 K  ARG 2   N   ? ? L 2UC 1   L ARG 2   1_555 ? ? ? ? ? ? ? 1.325 sing 
covale6   covale ? ? L  2UC 1   C2  ? ? ? 1_555 L  ARG 2   N   ? ? N 2UC 1   N ARG 2   1_555 ? ? ? ? ? ? ? 1.326 sing 
covale7   covale ? ? G  ARG 4   C   ? ? ? 1_555 G  00S 5   N23 ? ? H ARG 4   H 00S 5   1_555 ? ? ? ? ? ? ? 1.326 sing 
covale8   covale ? ? H  ARG 4   C   ? ? ? 1_555 H  00S 5   N23 ? ? I ARG 4   I 00S 5   1_555 ? ? ? ? ? ? ? 1.323 sing 
covale9   covale ? ? I  ARG 4   C   ? ? ? 1_555 I  00S 5   N23 ? ? J ARG 4   J 00S 5   1_555 ? ? ? ? ? ? ? 1.325 sing 
covale10  covale ? ? J  ARG 4   C   ? ? ? 1_555 J  00S 5   N23 ? ? K ARG 4   K 00S 5   1_555 ? ? ? ? ? ? ? 1.328 sing 
covale11  covale ? ? K  ARG 4   C   ? ? ? 1_555 K  00S 5   N23 ? ? L ARG 4   L 00S 5   1_555 ? ? ? ? ? ? ? 1.324 sing 
covale12  covale ? ? L  ARG 4   C   ? ? ? 1_555 L  00S 5   N23 ? ? N ARG 4   N 00S 5   1_555 ? ? ? ? ? ? ? 1.322 sing 
metalc1   metalc ? ? F  ASP 194 OD2 ? ? ? 1_555 FB CA  .   CA  ? ? F ASP 301 F CA  606 1_555 ? ? ? ? ? ? ? 2.198 ?    
metalc2   metalc ? ? PA CA  .   CA  ? ? ? 1_555 LB HOH .   O   ? ? D CA  606 D HOH 838 1_555 ? ? ? ? ? ? ? 2.205 ?    
metalc3   metalc ? ? A  ASP 151 OD1 ? ? ? 1_555 R  CA  .   CA  ? ? A ASP 258 A CA  606 1_555 ? ? ? ? ? ? ? 2.214 ?    
metalc4   metalc ? ? A  SER 204 O   ? ? ? 1_555 T  NA  .   NA  ? ? A SER 311 A NA  608 1_555 ? ? ? ? ? ? ? 2.217 ?    
metalc5   metalc ? ? B  ASP 8   OD2 ? ? ? 1_555 Y  CA  .   CA  ? ? B ASP 115 B CA  605 1_555 ? ? ? ? ? ? ? 2.217 ?    
metalc6   metalc ? ? C  VAL 98  O   ? ? ? 1_555 GA CA  .   CA  ? ? C VAL 205 C CA  605 1_555 ? ? ? ? ? ? ? 2.225 ?    
metalc7   metalc ? ? D  VAL 103 O   ? ? ? 1_555 OA CA  .   CA  ? ? D VAL 210 D CA  605 1_555 ? ? ? ? ? ? ? 2.244 ?    
metalc8   metalc ? ? B  THR 202 O   ? ? ? 1_555 BA NA  .   NA  ? ? B THR 309 B NA  608 1_555 ? ? ? ? ? ? ? 2.244 ?    
metalc9   metalc ? ? A  VAL 98  O   ? ? ? 1_555 Q  CA  .   CA  ? ? A VAL 205 A CA  605 1_555 ? ? ? ? ? ? ? 2.244 ?    
metalc10  metalc ? ? E  VAL 103 O   ? ? ? 1_555 WA CA  .   CA  ? ? E VAL 210 E CA  605 1_555 ? ? ? ? ? ? ? 2.255 ?    
metalc11  metalc ? ? F  ASP 8   OD2 ? ? ? 1_555 EB CA  .   CA  ? ? F ASP 115 F CA  605 1_555 ? ? ? ? ? ? ? 2.257 ?    
metalc12  metalc ? ? B  VAL 103 O   ? ? ? 1_555 Y  CA  .   CA  ? ? B VAL 210 B CA  605 1_555 ? ? ? ? ? ? ? 2.260 ?    
metalc13  metalc ? ? D  GLU 224 OE1 ? ? ? 1_555 PA CA  .   CA  ? ? D GLU 331 D CA  606 1_555 ? ? ? ? ? ? ? 2.261 ?    
metalc14  metalc ? ? D  ASP 67  OD2 ? ? ? 1_555 QA CA  .   CA  ? ? D ASP 174 D CA  607 1_555 ? ? ? ? ? ? ? 2.265 ?    
metalc15  metalc ? ? D  ASP 8   OD2 ? ? ? 1_555 OA CA  .   CA  ? ? D ASP 115 D CA  605 1_555 ? ? ? ? ? ? ? 2.265 ?    
metalc16  metalc ? ? F  VAL 103 O   ? ? ? 1_555 EB CA  .   CA  ? ? F VAL 210 F CA  605 1_555 ? ? ? ? ? ? ? 2.267 ?    
metalc17  metalc ? ? F  SER 204 O   ? ? ? 1_555 HB NA  .   NA  ? ? F SER 311 F NA  608 1_555 ? ? ? ? ? ? ? 2.271 ?    
metalc18  metalc ? ? A  THR 202 O   ? ? ? 1_555 T  NA  .   NA  ? ? A THR 309 A NA  608 1_555 ? ? ? ? ? ? ? 2.271 ?    
metalc19  metalc ? ? F  GLY 105 O   ? ? ? 1_555 EB CA  .   CA  ? ? F GLY 212 F CA  605 1_555 ? ? ? ? ? ? ? 2.273 ?    
metalc20  metalc ? ? D  ASP 151 OD1 ? ? ? 1_555 PA CA  .   CA  ? ? D ASP 258 D CA  606 1_555 ? ? ? ? ? ? ? 2.275 ?    
metalc21  metalc ? ? E  VAL 98  O   ? ? ? 1_555 WA CA  .   CA  ? ? E VAL 205 E CA  605 1_555 ? ? ? ? ? ? ? 2.275 ?    
metalc22  metalc ? ? E  ASP 8   OD2 ? ? ? 1_555 WA CA  .   CA  ? ? E ASP 115 E CA  605 1_555 ? ? ? ? ? ? ? 2.278 ?    
metalc23  metalc ? ? GB CA  .   CA  ? ? ? 1_555 NB HOH .   O   ? ? F CA  607 F HOH 748 1_555 ? ? ? ? ? ? ? 2.278 ?    
metalc24  metalc ? ? E  ASP 151 OD1 ? ? ? 1_555 XA CA  .   CA  ? ? E ASP 258 E CA  606 1_555 ? ? ? ? ? ? ? 2.281 ?    
metalc25  metalc ? ? A  ASP 194 OD2 ? ? ? 1_555 R  CA  .   CA  ? ? A ASP 301 A CA  606 1_555 ? ? ? ? ? ? ? 2.282 ?    
metalc26  metalc ? ? FB CA  .   CA  ? ? ? 1_555 NB HOH .   O   ? ? F CA  606 F HOH 770 1_555 ? ? ? ? ? ? ? 2.282 ?    
metalc27  metalc ? ? C  ASP 194 OD2 ? ? ? 1_555 HA CA  .   CA  ? ? C ASP 301 C CA  606 1_555 ? ? ? ? ? ? ? 2.283 ?    
metalc28  metalc ? ? B  ASP 151 OD1 ? ? ? 1_555 Z  CA  .   CA  ? ? B ASP 258 B CA  606 1_555 ? ? ? ? ? ? ? 2.284 ?    
metalc29  metalc ? ? F  VAL 98  O   ? ? ? 1_555 EB CA  .   CA  ? ? F VAL 205 F CA  605 1_555 ? ? ? ? ? ? ? 2.284 ?    
metalc30  metalc ? ? B  VAL 98  O   ? ? ? 1_555 Y  CA  .   CA  ? ? B VAL 205 B CA  605 1_555 ? ? ? ? ? ? ? 2.286 ?    
metalc31  metalc ? ? R  CA  .   CA  ? ? ? 1_555 IB HOH .   O   ? ? A CA  606 A HOH 758 1_555 ? ? ? ? ? ? ? 2.286 ?    
metalc32  metalc ? ? A  ASP 8   OD2 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 115 A CA  605 1_555 ? ? ? ? ? ? ? 2.287 ?    
metalc33  metalc ? ? C  THR 207 O   ? ? ? 1_555 JA NA  .   NA  ? ? C THR 314 C NA  608 1_555 ? ? ? ? ? ? ? 2.287 ?    
metalc34  metalc ? ? D  SER 204 O   ? ? ? 1_555 RA NA  .   NA  ? ? D SER 311 D NA  608 1_555 ? ? ? ? ? ? ? 2.289 ?    
metalc35  metalc ? ? QA CA  .   CA  ? ? ? 1_555 LB HOH .   O   ? ? D CA  607 D HOH 839 1_555 ? ? ? ? ? ? ? 2.297 ?    
metalc36  metalc ? ? D  VAL 98  O   ? ? ? 1_555 OA CA  .   CA  ? ? D VAL 205 D CA  605 1_555 ? ? ? ? ? ? ? 2.298 ?    
metalc37  metalc ? ? C  ASP 151 OD1 ? ? ? 1_555 HA CA  .   CA  ? ? C ASP 258 C CA  606 1_555 ? ? ? ? ? ? ? 2.299 ?    
metalc38  metalc ? ? C  ASP 8   OD2 ? ? ? 1_555 GA CA  .   CA  ? ? C ASP 115 C CA  605 1_555 ? ? ? ? ? ? ? 2.300 ?    
metalc39  metalc ? ? B  GLY 105 O   ? ? ? 1_555 Y  CA  .   CA  ? ? B GLY 212 B CA  605 1_555 ? ? ? ? ? ? ? 2.307 ?    
metalc40  metalc ? ? C  VAL 103 O   ? ? ? 1_555 GA CA  .   CA  ? ? C VAL 210 C CA  605 1_555 ? ? ? ? ? ? ? 2.319 ?    
metalc41  metalc ? ? F  ASP 151 OD1 ? ? ? 1_555 FB CA  .   CA  ? ? F ASP 258 F CA  606 1_555 ? ? ? ? ? ? ? 2.320 ?    
metalc42  metalc ? ? E  ASP 194 OD2 ? ? ? 1_555 XA CA  .   CA  ? ? E ASP 301 E CA  606 1_555 ? ? ? ? ? ? ? 2.321 ?    
metalc43  metalc ? ? B  GLU 224 OE1 ? ? ? 1_555 Z  CA  .   CA  ? ? B GLU 331 B CA  606 1_555 ? ? ? ? ? ? ? 2.322 ?    
metalc44  metalc ? ? A  VAL 103 O   ? ? ? 1_555 Q  CA  .   CA  ? ? A VAL 210 A CA  605 1_555 ? ? ? ? ? ? ? 2.328 ?    
metalc45  metalc ? ? E  THR 202 O   ? ? ? 1_555 ZA NA  .   NA  ? ? E THR 309 E NA  608 1_555 ? ? ? ? ? ? ? 2.330 ?    
metalc46  metalc ? ? F  GLU 224 OE1 ? ? ? 1_555 FB CA  .   CA  ? ? F GLU 331 F CA  606 1_555 ? ? ? ? ? ? ? 2.331 ?    
metalc47  metalc ? ? C  ASP 55  OD1 ? ? ? 1_555 GA CA  .   CA  ? ? C ASP 162 C CA  605 1_555 ? ? ? ? ? ? ? 2.334 ?    
metalc48  metalc ? ? D  THR 207 O   ? ? ? 1_555 RA NA  .   NA  ? ? D THR 314 D NA  608 1_555 ? ? ? ? ? ? ? 2.336 ?    
metalc49  metalc ? ? E  SER 204 O   ? ? ? 1_555 ZA NA  .   NA  ? ? E SER 311 E NA  608 1_555 ? ? ? ? ? ? ? 2.338 ?    
metalc50  metalc ? ? B  ASP 74  O   ? ? ? 1_555 AA CA  .   CA  ? ? B ASP 181 B CA  607 1_555 ? ? ? ? ? ? ? 2.339 ?    
metalc51  metalc ? ? D  ASP 194 OD2 ? ? ? 1_555 PA CA  .   CA  ? ? D ASP 301 D CA  606 1_555 ? ? ? ? ? ? ? 2.339 ?    
metalc52  metalc ? ? B  ASP 55  OD1 ? ? ? 1_555 Y  CA  .   CA  ? ? B ASP 162 B CA  605 1_555 ? ? ? ? ? ? ? 2.344 ?    
metalc53  metalc ? ? F  THR 207 O   ? ? ? 1_555 HB NA  .   NA  ? ? F THR 314 F NA  608 1_555 ? ? ? ? ? ? ? 2.347 ?    
metalc54  metalc ? ? R  CA  .   CA  ? ? ? 1_555 IB HOH .   O   ? ? A CA  606 A HOH 863 1_555 ? ? ? ? ? ? ? 2.350 ?    
metalc55  metalc ? ? E  ASP 55  OD1 ? ? ? 1_555 WA CA  .   CA  ? ? E ASP 162 E CA  605 1_555 ? ? ? ? ? ? ? 2.351 ?    
metalc56  metalc ? ? D  GLY 105 O   ? ? ? 1_555 OA CA  .   CA  ? ? D GLY 212 D CA  605 1_555 ? ? ? ? ? ? ? 2.352 ?    
metalc57  metalc ? ? JA NA  .   NA  ? ? ? 1_555 KB HOH .   O   ? ? C NA  608 C HOH 720 1_555 ? ? ? ? ? ? ? 2.352 ?    
metalc58  metalc ? ? B  SER 204 O   ? ? ? 1_555 BA NA  .   NA  ? ? B SER 311 B NA  608 1_555 ? ? ? ? ? ? ? 2.360 ?    
metalc59  metalc ? ? C  ASP 72  OD1 ? ? ? 1_555 IA CA  .   CA  ? ? C ASP 179 C CA  607 1_555 ? ? ? ? ? ? ? 2.360 ?    
metalc60  metalc ? ? XA CA  .   CA  ? ? ? 1_555 MB HOH .   O   ? ? E CA  606 E HOH 720 1_555 ? ? ? ? ? ? ? 2.361 ?    
metalc61  metalc ? ? A  GLU 224 OE1 ? ? ? 1_555 R  CA  .   CA  ? ? A GLU 331 A CA  606 1_555 ? ? ? ? ? ? ? 2.362 ?    
metalc62  metalc ? ? ZA NA  .   NA  ? ? ? 1_555 MB HOH .   O   ? ? E NA  608 E HOH 704 1_555 ? ? ? ? ? ? ? 2.362 ?    
metalc63  metalc ? ? HA CA  .   CA  ? ? ? 1_555 KB HOH .   O   ? ? C CA  606 C HOH 788 1_555 ? ? ? ? ? ? ? 2.363 ?    
metalc64  metalc ? ? FB CA  .   CA  ? ? ? 1_555 NB HOH .   O   ? ? F CA  606 F HOH 704 1_555 ? ? ? ? ? ? ? 2.367 ?    
metalc65  metalc ? ? C  THR 202 O   ? ? ? 1_555 JA NA  .   NA  ? ? C THR 309 C NA  608 1_555 ? ? ? ? ? ? ? 2.367 ?    
metalc66  metalc ? ? D  THR 202 O   ? ? ? 1_555 RA NA  .   NA  ? ? D THR 309 D NA  608 1_555 ? ? ? ? ? ? ? 2.368 ?    
metalc67  metalc ? ? C  SER 204 O   ? ? ? 1_555 JA NA  .   NA  ? ? C SER 311 C NA  608 1_555 ? ? ? ? ? ? ? 2.370 ?    
metalc68  metalc ? ? D  ASP 55  OD1 ? ? ? 1_555 OA CA  .   CA  ? ? D ASP 162 D CA  605 1_555 ? ? ? ? ? ? ? 2.373 ?    
metalc69  metalc ? ? A  ASP 55  OD1 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 162 A CA  605 1_555 ? ? ? ? ? ? ? 2.373 ?    
metalc70  metalc ? ? C  ASP 74  O   ? ? ? 1_555 IA CA  .   CA  ? ? C ASP 181 C CA  607 1_555 ? ? ? ? ? ? ? 2.378 ?    
metalc71  metalc ? ? A  GLY 105 O   ? ? ? 1_555 Q  CA  .   CA  ? ? A GLY 212 A CA  605 1_555 ? ? ? ? ? ? ? 2.381 ?    
metalc72  metalc ? ? F  THR 202 O   ? ? ? 1_555 HB NA  .   NA  ? ? F THR 309 F NA  608 1_555 ? ? ? ? ? ? ? 2.383 ?    
metalc73  metalc ? ? F  ASP 74  O   ? ? ? 1_555 GB CA  .   CA  ? ? F ASP 181 F CA  607 1_555 ? ? ? ? ? ? ? 2.384 ?    
metalc74  metalc ? ? E  ASP 67  OD2 ? ? ? 1_555 YA CA  .   CA  ? ? E ASP 174 E CA  607 1_555 ? ? ? ? ? ? ? 2.388 ?    
metalc75  metalc ? ? E  THR 207 O   ? ? ? 1_555 ZA NA  .   NA  ? ? E THR 314 E NA  608 1_555 ? ? ? ? ? ? ? 2.388 ?    
metalc76  metalc ? ? B  ASP 194 OD2 ? ? ? 1_555 Z  CA  .   CA  ? ? B ASP 301 B CA  606 1_555 ? ? ? ? ? ? ? 2.391 ?    
metalc77  metalc ? ? D  ASP 74  O   ? ? ? 1_555 QA CA  .   CA  ? ? D ASP 181 D CA  607 1_555 ? ? ? ? ? ? ? 2.394 ?    
metalc78  metalc ? ? QA CA  .   CA  ? ? ? 1_555 LB HOH .   O   ? ? D CA  607 D HOH 754 1_555 ? ? ? ? ? ? ? 2.395 ?    
metalc79  metalc ? ? E  ASP 74  O   ? ? ? 1_555 YA CA  .   CA  ? ? E ASP 181 E CA  607 1_555 ? ? ? ? ? ? ? 2.395 ?    
metalc80  metalc ? ? PA CA  .   CA  ? ? ? 1_555 LB HOH .   O   ? ? D CA  606 D HOH 710 1_555 ? ? ? ? ? ? ? 2.397 ?    
metalc81  metalc ? ? A  ASP 67  OD2 ? ? ? 1_555 S  CA  .   CA  ? ? A ASP 174 A CA  607 1_555 ? ? ? ? ? ? ? 2.402 ?    
metalc82  metalc ? ? E  GLY 105 O   ? ? ? 1_555 WA CA  .   CA  ? ? E GLY 212 E CA  605 1_555 ? ? ? ? ? ? ? 2.404 ?    
metalc83  metalc ? ? XA CA  .   CA  ? ? ? 1_555 MB HOH .   O   ? ? E CA  606 E HOH 845 1_555 ? ? ? ? ? ? ? 2.405 ?    
metalc84  metalc ? ? XA CA  .   CA  ? ? ? 1_555 MB HOH .   O   ? ? E CA  606 E HOH 721 1_555 ? ? ? ? ? ? ? 2.408 ?    
metalc85  metalc ? ? S  CA  .   CA  ? ? ? 1_555 IB HOH .   O   ? ? A CA  607 A HOH 729 1_555 ? ? ? ? ? ? ? 2.408 ?    
metalc86  metalc ? ? C  GLY 105 O   ? ? ? 1_555 GA CA  .   CA  ? ? C GLY 212 C CA  605 1_555 ? ? ? ? ? ? ? 2.411 ?    
metalc87  metalc ? ? C  GLU 224 OE1 ? ? ? 1_555 HA CA  .   CA  ? ? C GLU 331 C CA  606 1_555 ? ? ? ? ? ? ? 2.411 ?    
metalc88  metalc ? ? A  ASP 74  O   ? ? ? 1_555 S  CA  .   CA  ? ? A ASP 181 A CA  607 1_555 ? ? ? ? ? ? ? 2.418 ?    
metalc89  metalc ? ? B  ASP 67  OD2 ? ? ? 1_555 AA CA  .   CA  ? ? B ASP 174 B CA  607 1_555 ? ? ? ? ? ? ? 2.421 ?    
metalc90  metalc ? ? C  THR 207 OG1 ? ? ? 1_555 JA NA  .   NA  ? ? C THR 314 C NA  608 1_555 ? ? ? ? ? ? ? 2.423 ?    
metalc91  metalc ? ? S  CA  .   CA  ? ? ? 1_555 IB HOH .   O   ? ? A CA  607 A HOH 930 1_555 ? ? ? ? ? ? ? 2.426 ?    
metalc92  metalc ? ? B  THR 207 O   ? ? ? 1_555 BA NA  .   NA  ? ? B THR 314 B NA  608 1_555 ? ? ? ? ? ? ? 2.427 ?    
metalc93  metalc ? ? B  THR 207 OG1 ? ? ? 1_555 BA NA  .   NA  ? ? B THR 314 B NA  608 1_555 ? ? ? ? ? ? ? 2.430 ?    
metalc94  metalc ? ? E  THR 207 OG1 ? ? ? 1_555 ZA NA  .   NA  ? ? E THR 314 E NA  608 1_555 ? ? ? ? ? ? ? 2.435 ?    
metalc95  metalc ? ? F  ASP 55  OD1 ? ? ? 1_555 EB CA  .   CA  ? ? F ASP 162 F CA  605 1_555 ? ? ? ? ? ? ? 2.444 ?    
metalc96  metalc ? ? F  THR 207 OG1 ? ? ? 1_555 HB NA  .   NA  ? ? F THR 314 F NA  608 1_555 ? ? ? ? ? ? ? 2.446 ?    
metalc97  metalc ? ? A  THR 207 O   ? ? ? 1_555 T  NA  .   NA  ? ? A THR 314 A NA  608 1_555 ? ? ? ? ? ? ? 2.446 ?    
metalc98  metalc ? ? RA NA  .   NA  ? ? ? 1_555 LB HOH .   O   ? ? D NA  608 D HOH 722 1_555 ? ? ? ? ? ? ? 2.447 ?    
metalc99  metalc ? ? QA CA  .   CA  ? ? ? 1_555 LB HOH .   O   ? ? D CA  607 D HOH 721 1_555 ? ? ? ? ? ? ? 2.448 ?    
metalc100 metalc ? ? C  ASP 67  OD2 ? ? ? 1_555 IA CA  .   CA  ? ? C ASP 174 C CA  607 1_555 ? ? ? ? ? ? ? 2.448 ?    
metalc101 metalc ? ? YA CA  .   CA  ? ? ? 1_555 MB HOH .   O   ? ? E CA  607 E HOH 847 1_555 ? ? ? ? ? ? ? 2.450 ?    
metalc102 metalc ? ? GB CA  .   CA  ? ? ? 1_555 NB HOH .   O   ? ? F CA  607 F HOH 825 1_555 ? ? ? ? ? ? ? 2.457 ?    
metalc103 metalc ? ? A  GLU 224 OE2 ? ? ? 1_555 R  CA  .   CA  ? ? A GLU 331 A CA  606 1_555 ? ? ? ? ? ? ? 2.458 ?    
metalc104 metalc ? ? T  NA  .   NA  ? ? ? 1_555 IB HOH .   O   ? ? A NA  608 A HOH 787 1_555 ? ? ? ? ? ? ? 2.461 ?    
metalc105 metalc ? ? C  ASN 101 OD1 ? ? ? 1_555 GA CA  .   CA  ? ? C ASN 208 C CA  605 1_555 ? ? ? ? ? ? ? 2.463 ?    
metalc106 metalc ? ? HA CA  .   CA  ? ? ? 1_555 KB HOH .   O   ? ? C CA  606 C HOH 750 1_555 ? ? ? ? ? ? ? 2.464 ?    
metalc107 metalc ? ? IA CA  .   CA  ? ? ? 1_555 KB HOH .   O   ? ? C CA  607 C HOH 859 1_555 ? ? ? ? ? ? ? 2.465 ?    
metalc108 metalc ? ? B  ASP 72  OD1 ? ? ? 1_555 AA CA  .   CA  ? ? B ASP 179 B CA  607 1_555 ? ? ? ? ? ? ? 2.465 ?    
metalc109 metalc ? ? S  CA  .   CA  ? ? ? 1_555 IB HOH .   O   ? ? A CA  607 A HOH 736 1_555 ? ? ? ? ? ? ? 2.470 ?    
metalc110 metalc ? ? E  GLU 224 OE1 ? ? ? 1_555 XA CA  .   CA  ? ? E GLU 331 E CA  606 1_555 ? ? ? ? ? ? ? 2.474 ?    
metalc111 metalc ? ? D  ASP 72  OD2 ? ? ? 1_555 QA CA  .   CA  ? ? D ASP 179 D CA  607 1_555 ? ? ? ? ? ? ? 2.475 ?    
metalc112 metalc ? ? A  ASN 101 OD1 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASN 208 A CA  605 1_555 ? ? ? ? ? ? ? 2.479 ?    
metalc113 metalc ? ? F  ASN 101 OD1 ? ? ? 1_555 EB CA  .   CA  ? ? F ASN 208 F CA  605 1_555 ? ? ? ? ? ? ? 2.482 ?    
metalc114 metalc ? ? B  GLU 224 OE2 ? ? ? 1_555 Z  CA  .   CA  ? ? B GLU 331 B CA  606 1_555 ? ? ? ? ? ? ? 2.494 ?    
metalc115 metalc ? ? PA CA  .   CA  ? ? ? 1_555 LB HOH .   O   ? ? D CA  606 D HOH 726 1_555 ? ? ? ? ? ? ? 2.498 ?    
metalc116 metalc ? ? E  ASN 101 OD1 ? ? ? 1_555 WA CA  .   CA  ? ? E ASN 208 E CA  605 1_555 ? ? ? ? ? ? ? 2.499 ?    
metalc117 metalc ? ? A  ASP 72  OD2 ? ? ? 1_555 S  CA  .   CA  ? ? A ASP 179 A CA  607 1_555 ? ? ? ? ? ? ? 2.499 ?    
metalc118 metalc ? ? HB NA  .   NA  ? ? ? 1_555 NB HOH .   O   ? ? F NA  608 F HOH 716 1_555 ? ? ? ? ? ? ? 2.505 ?    
metalc119 metalc ? ? F  ASP 72  OD1 ? ? ? 1_555 GB CA  .   CA  ? ? F ASP 179 F CA  607 1_555 ? ? ? ? ? ? ? 2.508 ?    
metalc120 metalc ? ? C  ASP 72  OD2 ? ? ? 1_555 IA CA  .   CA  ? ? C ASP 179 C CA  607 1_555 ? ? ? ? ? ? ? 2.510 ?    
metalc121 metalc ? ? F  ASP 67  OD2 ? ? ? 1_555 GB CA  .   CA  ? ? F ASP 174 F CA  607 1_555 ? ? ? ? ? ? ? 2.514 ?    
metalc122 metalc ? ? E  ASP 72  OD2 ? ? ? 1_555 YA CA  .   CA  ? ? E ASP 179 E CA  607 1_555 ? ? ? ? ? ? ? 2.514 ?    
metalc123 metalc ? ? HA CA  .   CA  ? ? ? 1_555 KB HOH .   O   ? ? C CA  606 C HOH 728 1_555 ? ? ? ? ? ? ? 2.514 ?    
metalc124 metalc ? ? B  ASN 101 OD1 ? ? ? 1_555 Y  CA  .   CA  ? ? B ASN 208 B CA  605 1_555 ? ? ? ? ? ? ? 2.516 ?    
metalc125 metalc ? ? R  CA  .   CA  ? ? ? 1_555 IB HOH .   O   ? ? A CA  606 A HOH 773 1_555 ? ? ? ? ? ? ? 2.521 ?    
metalc126 metalc ? ? F  GLU 224 OE2 ? ? ? 1_555 FB CA  .   CA  ? ? F GLU 331 F CA  606 1_555 ? ? ? ? ? ? ? 2.521 ?    
metalc127 metalc ? ? C  GLU 224 OE2 ? ? ? 1_555 HA CA  .   CA  ? ? C GLU 331 C CA  606 1_555 ? ? ? ? ? ? ? 2.524 ?    
metalc128 metalc ? ? D  THR 207 OG1 ? ? ? 1_555 RA NA  .   NA  ? ? D THR 314 D NA  608 1_555 ? ? ? ? ? ? ? 2.524 ?    
metalc129 metalc ? ? D  ASN 101 OD1 ? ? ? 1_555 OA CA  .   CA  ? ? D ASN 208 D CA  605 1_555 ? ? ? ? ? ? ? 2.529 ?    
metalc130 metalc ? ? IA CA  .   CA  ? ? ? 1_555 KB HOH .   O   ? ? C CA  607 C HOH 800 1_555 ? ? ? ? ? ? ? 2.533 ?    
metalc131 metalc ? ? E  GLU 224 OE2 ? ? ? 1_555 XA CA  .   CA  ? ? E GLU 331 E CA  606 1_555 ? ? ? ? ? ? ? 2.533 ?    
metalc132 metalc ? ? D  ASP 72  OD1 ? ? ? 1_555 QA CA  .   CA  ? ? D ASP 179 D CA  607 1_555 ? ? ? ? ? ? ? 2.535 ?    
metalc133 metalc ? ? D  GLU 224 OE2 ? ? ? 1_555 PA CA  .   CA  ? ? D GLU 331 D CA  606 1_555 ? ? ? ? ? ? ? 2.541 ?    
metalc134 metalc ? ? GB CA  .   CA  ? ? ? 1_555 NB HOH .   O   ? ? F CA  607 F HOH 778 1_555 ? ? ? ? ? ? ? 2.543 ?    
metalc135 metalc ? ? F  ASP 72  OD2 ? ? ? 1_555 GB CA  .   CA  ? ? F ASP 179 F CA  607 1_555 ? ? ? ? ? ? ? 2.549 ?    
metalc136 metalc ? ? B  ASP 72  OD2 ? ? ? 1_555 AA CA  .   CA  ? ? B ASP 179 B CA  607 1_555 ? ? ? ? ? ? ? 2.551 ?    
metalc137 metalc ? ? FB CA  .   CA  ? ? ? 1_555 NB HOH .   O   ? ? F CA  606 F HOH 722 1_555 ? ? ? ? ? ? ? 2.580 ?    
metalc138 metalc ? ? A  THR 207 OG1 ? ? ? 1_555 T  NA  .   NA  ? ? A THR 314 A NA  608 1_555 ? ? ? ? ? ? ? 2.596 ?    
metalc139 metalc ? ? A  ASP 72  OD1 ? ? ? 1_555 S  CA  .   CA  ? ? A ASP 179 A CA  607 1_555 ? ? ? ? ? ? ? 2.599 ?    
metalc140 metalc ? ? F  ASP 55  OD2 ? ? ? 1_555 EB CA  .   CA  ? ? F ASP 162 F CA  605 1_555 ? ? ? ? ? ? ? 2.672 ?    
metalc141 metalc ? ? C  ASP 55  OD2 ? ? ? 1_555 GA CA  .   CA  ? ? C ASP 162 C CA  605 1_555 ? ? ? ? ? ? ? 2.674 ?    
metalc142 metalc ? ? D  ASP 55  OD2 ? ? ? 1_555 OA CA  .   CA  ? ? D ASP 162 D CA  605 1_555 ? ? ? ? ? ? ? 2.683 ?    
metalc143 metalc ? ? B  ASP 55  OD2 ? ? ? 1_555 Y  CA  .   CA  ? ? B ASP 162 B CA  605 1_555 ? ? ? ? ? ? ? 2.707 ?    
metalc144 metalc ? ? A  ASP 55  OD2 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 162 A CA  605 1_555 ? ? ? ? ? ? ? 2.715 ?    
metalc145 metalc ? ? E  ASP 72  OD1 ? ? ? 1_555 YA CA  .   CA  ? ? E ASP 179 E CA  607 1_555 ? ? ? ? ? ? ? 2.736 ?    
metalc146 metalc ? ? IA CA  .   CA  ? ? ? 1_555 KB HOH .   O   ? ? C CA  607 C HOH 797 1_555 ? ? ? ? ? ? ? 2.807 ?    
metalc147 metalc ? ? E  ASP 55  OD2 ? ? ? 1_555 WA CA  .   CA  ? ? E ASP 162 E CA  605 1_555 ? ? ? ? ? ? ? 2.817 ?    
metalc148 metalc ? ? Z  CA  .   CA  ? ? ? 1_555 JB HOH .   O   ? ? B CA  606 B HOH 842 1_555 ? ? ? ? ? ? ? 2.294 ?    
metalc149 metalc ? ? AA CA  .   CA  ? ? ? 1_555 JB HOH .   O   ? ? B CA  607 B HOH 771 1_555 ? ? ? ? ? ? ? 2.381 ?    
metalc150 metalc ? ? AA CA  .   CA  ? ? ? 1_555 JB HOH .   O   ? ? B CA  607 B HOH 810 1_555 ? ? ? ? ? ? ? 2.496 ?    
metalc151 metalc ? ? BA NA  .   NA  ? ? ? 1_555 JB HOH .   O   ? ? B NA  608 B HOH 704 1_555 ? ? ? ? ? ? ? 2.501 ?    
metalc152 metalc ? ? Z  CA  .   CA  ? ? ? 1_555 JB HOH .   O   ? ? B CA  606 B HOH 743 1_555 ? ? ? ? ? ? ? 2.557 ?    
metalc153 metalc ? ? AA CA  .   CA  ? ? ? 1_555 JB HOH .   O   ? ? B CA  607 B HOH 843 1_555 ? ? ? ? ? ? ? 2.615 ?    
metalc154 metalc ? ? Z  CA  .   CA  ? ? ? 1_555 JB HOH .   O   ? ? B CA  606 B HOH 717 1_555 ? ? ? ? ? ? ? 2.624 ?    
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 3 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 7 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 3 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 7 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 3 ? 
Q  ? 4 ? 
R  ? 4 ? 
S  ? 7 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 3 ? 
W  ? 4 ? 
X  ? 4 ? 
Y  ? 7 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 3 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 7 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 3 ? 
AI ? 4 ? 
AJ ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
A  5 6 ? parallel      
A  6 7 ? parallel      
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? parallel      
G  2 3 ? parallel      
G  3 4 ? parallel      
G  4 5 ? parallel      
G  5 6 ? parallel      
G  6 7 ? parallel      
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? parallel      
M  2 3 ? parallel      
M  3 4 ? parallel      
M  4 5 ? parallel      
M  5 6 ? parallel      
M  6 7 ? parallel      
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
S  3 4 ? parallel      
S  4 5 ? parallel      
S  5 6 ? parallel      
S  6 7 ? parallel      
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Y  5 6 ? parallel      
Y  6 7 ? parallel      
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AE 5 6 ? parallel      
AE 6 7 ? parallel      
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE A 66  ? ASP A 67  ? PHE A 173 ASP A 174 
A  2 ARG A 113 ? ARG A 118 ? ARG A 220 ARG A 225 
A  3 VAL A 41  ? ASP A 46  ? VAL A 148 ASP A 153 
A  4 ILE A 142 ? ALA A 145 ? ILE A 249 ALA A 252 
A  5 ILE A 181 ? ALA A 185 ? ILE A 288 ALA A 292 
A  6 THR A 207 ? ALA A 213 ? THR A 314 ALA A 320 
A  7 ALA A 231 ? TYR A 234 ? ALA A 338 TYR A 341 
B  1 ILE A 244 ? ASP A 248 ? ILE A 351 ASP A 355 
B  2 LYS A 252 ? HIS A 257 ? LYS A 359 HIS A 364 
C  1 ALA A 305 ? THR A 306 ? ALA A 412 THR A 413 
C  2 LYS A 312 ? VAL A 313 ? LYS A 419 VAL A 420 
D  1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
D  2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
D  3 LYS A 352 ? ASP A 353 ? LYS A 459 ASP A 460 
E  1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
E  2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
E  3 ARG A 376 ? TYR A 388 ? ARG A 483 TYR A 495 
E  4 PHE A 421 ? THR A 428 ? PHE A 528 THR A 535 
F  1 ARG A 357 ? VAL A 364 ? ARG A 464 VAL A 471 
F  2 GLY A 438 ? ASN A 446 ? GLY A 545 ASN A 553 
F  3 LEU A 394 ? VAL A 399 ? LEU A 501 VAL A 506 
F  4 ARG A 405 ? LEU A 409 ? ARG A 512 LEU A 516 
G  1 PHE B 66  ? ASP B 67  ? PHE B 173 ASP B 174 
G  2 ARG B 113 ? ARG B 118 ? ARG B 220 ARG B 225 
G  3 VAL B 41  ? ASP B 46  ? VAL B 148 ASP B 153 
G  4 ILE B 142 ? ALA B 145 ? ILE B 249 ALA B 252 
G  5 ILE B 181 ? ALA B 185 ? ILE B 288 ALA B 292 
G  6 THR B 207 ? ALA B 213 ? THR B 314 ALA B 320 
G  7 ALA B 231 ? TYR B 234 ? ALA B 338 TYR B 341 
H  1 ILE B 244 ? ASP B 248 ? ILE B 351 ASP B 355 
H  2 LYS B 252 ? HIS B 257 ? LYS B 359 HIS B 364 
I  1 ALA B 305 ? THR B 306 ? ALA B 412 THR B 413 
I  2 LYS B 312 ? VAL B 313 ? LYS B 419 VAL B 420 
J  1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
J  2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
J  3 LYS B 352 ? ASP B 353 ? LYS B 459 ASP B 460 
K  1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
K  2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
K  3 ARG B 376 ? TYR B 388 ? ARG B 483 TYR B 495 
K  4 PHE B 421 ? THR B 428 ? PHE B 528 THR B 535 
L  1 ARG B 357 ? VAL B 364 ? ARG B 464 VAL B 471 
L  2 GLY B 438 ? ASN B 446 ? GLY B 545 ASN B 553 
L  3 LEU B 394 ? VAL B 399 ? LEU B 501 VAL B 506 
L  4 ARG B 405 ? LEU B 409 ? ARG B 512 LEU B 516 
M  1 PHE C 66  ? ASP C 67  ? PHE C 173 ASP C 174 
M  2 ARG C 113 ? ARG C 118 ? ARG C 220 ARG C 225 
M  3 VAL C 41  ? ASP C 46  ? VAL C 148 ASP C 153 
M  4 ILE C 142 ? ALA C 145 ? ILE C 249 ALA C 252 
M  5 ILE C 181 ? ALA C 185 ? ILE C 288 ALA C 292 
M  6 THR C 207 ? ALA C 213 ? THR C 314 ALA C 320 
M  7 ALA C 231 ? TYR C 234 ? ALA C 338 TYR C 341 
N  1 ILE C 244 ? ASP C 248 ? ILE C 351 ASP C 355 
N  2 LYS C 252 ? HIS C 257 ? LYS C 359 HIS C 364 
O  1 ALA C 305 ? THR C 306 ? ALA C 412 THR C 413 
O  2 LYS C 312 ? VAL C 313 ? LYS C 419 VAL C 420 
P  1 ARG C 341 ? ASP C 346 ? ARG C 448 ASP C 453 
P  2 GLY C 454 ? THR C 466 ? GLY C 561 THR C 573 
P  3 LYS C 352 ? ASP C 353 ? LYS C 459 ASP C 460 
Q  1 ARG C 341 ? ASP C 346 ? ARG C 448 ASP C 453 
Q  2 GLY C 454 ? THR C 466 ? GLY C 561 THR C 573 
Q  3 ARG C 376 ? TYR C 388 ? ARG C 483 TYR C 495 
Q  4 PHE C 421 ? THR C 428 ? PHE C 528 THR C 535 
R  1 ARG C 357 ? VAL C 364 ? ARG C 464 VAL C 471 
R  2 GLY C 438 ? ASN C 446 ? GLY C 545 ASN C 553 
R  3 LEU C 394 ? VAL C 399 ? LEU C 501 VAL C 506 
R  4 ARG C 405 ? LEU C 409 ? ARG C 512 LEU C 516 
S  1 PHE D 66  ? ASP D 67  ? PHE D 173 ASP D 174 
S  2 ARG D 113 ? ARG D 118 ? ARG D 220 ARG D 225 
S  3 VAL D 41  ? ASP D 46  ? VAL D 148 ASP D 153 
S  4 ILE D 142 ? ALA D 145 ? ILE D 249 ALA D 252 
S  5 ILE D 181 ? ALA D 185 ? ILE D 288 ALA D 292 
S  6 THR D 207 ? ALA D 213 ? THR D 314 ALA D 320 
S  7 ALA D 231 ? TYR D 234 ? ALA D 338 TYR D 341 
T  1 ILE D 244 ? ASP D 248 ? ILE D 351 ASP D 355 
T  2 LYS D 252 ? HIS D 257 ? LYS D 359 HIS D 364 
U  1 ALA D 305 ? THR D 306 ? ALA D 412 THR D 413 
U  2 LYS D 312 ? VAL D 313 ? LYS D 419 VAL D 420 
V  1 ARG D 341 ? ASP D 346 ? ARG D 448 ASP D 453 
V  2 GLY D 454 ? THR D 466 ? GLY D 561 THR D 573 
V  3 LYS D 352 ? ASP D 353 ? LYS D 459 ASP D 460 
W  1 ARG D 341 ? ASP D 346 ? ARG D 448 ASP D 453 
W  2 GLY D 454 ? THR D 466 ? GLY D 561 THR D 573 
W  3 ARG D 376 ? TYR D 388 ? ARG D 483 TYR D 495 
W  4 PHE D 421 ? THR D 428 ? PHE D 528 THR D 535 
X  1 ARG D 357 ? VAL D 364 ? ARG D 464 VAL D 471 
X  2 GLY D 438 ? ASN D 446 ? GLY D 545 ASN D 553 
X  3 LEU D 394 ? VAL D 399 ? LEU D 501 VAL D 506 
X  4 ARG D 405 ? LEU D 409 ? ARG D 512 LEU D 516 
Y  1 PHE E 66  ? ASP E 67  ? PHE E 173 ASP E 174 
Y  2 ARG E 113 ? ARG E 118 ? ARG E 220 ARG E 225 
Y  3 VAL E 41  ? ASP E 46  ? VAL E 148 ASP E 153 
Y  4 ILE E 142 ? ALA E 145 ? ILE E 249 ALA E 252 
Y  5 ILE E 181 ? ALA E 185 ? ILE E 288 ALA E 292 
Y  6 THR E 207 ? ALA E 213 ? THR E 314 ALA E 320 
Y  7 ALA E 231 ? TYR E 234 ? ALA E 338 TYR E 341 
Z  1 ILE E 244 ? ASP E 248 ? ILE E 351 ASP E 355 
Z  2 LYS E 252 ? HIS E 257 ? LYS E 359 HIS E 364 
AA 1 ALA E 305 ? THR E 306 ? ALA E 412 THR E 413 
AA 2 LYS E 312 ? VAL E 313 ? LYS E 419 VAL E 420 
AB 1 ARG E 341 ? ASP E 346 ? ARG E 448 ASP E 453 
AB 2 GLY E 454 ? THR E 466 ? GLY E 561 THR E 573 
AB 3 LYS E 352 ? ASP E 353 ? LYS E 459 ASP E 460 
AC 1 ARG E 341 ? ASP E 346 ? ARG E 448 ASP E 453 
AC 2 GLY E 454 ? THR E 466 ? GLY E 561 THR E 573 
AC 3 ARG E 376 ? TYR E 388 ? ARG E 483 TYR E 495 
AC 4 PHE E 421 ? THR E 428 ? PHE E 528 THR E 535 
AD 1 ARG E 357 ? VAL E 364 ? ARG E 464 VAL E 471 
AD 2 GLY E 438 ? ASN E 446 ? GLY E 545 ASN E 553 
AD 3 LEU E 394 ? VAL E 399 ? LEU E 501 VAL E 506 
AD 4 ARG E 405 ? LEU E 409 ? ARG E 512 LEU E 516 
AE 1 PHE F 66  ? ASP F 67  ? PHE F 173 ASP F 174 
AE 2 ARG F 113 ? ARG F 118 ? ARG F 220 ARG F 225 
AE 3 VAL F 41  ? ASP F 46  ? VAL F 148 ASP F 153 
AE 4 ILE F 142 ? ALA F 145 ? ILE F 249 ALA F 252 
AE 5 ILE F 181 ? ALA F 185 ? ILE F 288 ALA F 292 
AE 6 THR F 207 ? ALA F 213 ? THR F 314 ALA F 320 
AE 7 ALA F 231 ? TYR F 234 ? ALA F 338 TYR F 341 
AF 1 ILE F 244 ? ASP F 248 ? ILE F 351 ASP F 355 
AF 2 LYS F 252 ? HIS F 257 ? LYS F 359 HIS F 364 
AG 1 ALA F 305 ? THR F 306 ? ALA F 412 THR F 413 
AG 2 LYS F 312 ? VAL F 313 ? LYS F 419 VAL F 420 
AH 1 ARG F 341 ? ASP F 346 ? ARG F 448 ASP F 453 
AH 2 GLY F 454 ? THR F 466 ? GLY F 561 THR F 573 
AH 3 LYS F 352 ? ASP F 353 ? LYS F 459 ASP F 460 
AI 1 ARG F 341 ? ASP F 346 ? ARG F 448 ASP F 453 
AI 2 GLY F 454 ? THR F 466 ? GLY F 561 THR F 573 
AI 3 ARG F 376 ? TYR F 388 ? ARG F 483 TYR F 495 
AI 4 PHE F 421 ? THR F 428 ? PHE F 528 THR F 535 
AJ 1 ARG F 357 ? VAL F 364 ? ARG F 464 VAL F 471 
AJ 2 GLY F 438 ? ASN F 446 ? GLY F 545 ASN F 553 
AJ 3 LEU F 394 ? VAL F 399 ? LEU F 501 VAL F 506 
AJ 4 ARG F 405 ? LEU F 409 ? ARG F 512 LEU F 516 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N PHE A 66  ? N PHE A 173 O ARG A 118 ? O ARG A 225 
A  2 3 O GLY A 115 ? O GLY A 222 N VAL A 42  ? N VAL A 149 
A  3 4 N SER A 43  ? N SER A 150 O ILE A 142 ? O ILE A 249 
A  4 5 N TYR A 143 ? N TYR A 250 O VAL A 183 ? O VAL A 290 
A  5 6 N TRP A 184 ? N TRP A 291 O ILE A 210 ? O ILE A 317 
A  6 7 N SER A 211 ? N SER A 318 O ALA A 231 ? O ALA A 338 
B  1 2 N ASP A 248 ? N ASP A 355 O LYS A 252 ? O LYS A 359 
C  1 2 N ALA A 305 ? N ALA A 412 O VAL A 313 ? O VAL A 420 
D  1 2 N ILE A 345 ? N ILE A 452 O LEU A 461 ? O LEU A 568 
D  2 3 O LEU A 456 ? O LEU A 563 N LYS A 352 ? N LYS A 459 
E  1 2 N ILE A 345 ? N ILE A 452 O LEU A 461 ? O LEU A 568 
E  2 3 O THR A 460 ? O THR A 567 N ARG A 383 ? N ARG A 490 
E  3 4 N ALA A 382 ? N ALA A 489 O PHE A 426 ? O PHE A 533 
F  1 2 N VAL A 364 ? N VAL A 471 O GLY A 438 ? O GLY A 545 
F  2 3 O GLU A 443 ? O GLU A 550 N HIS A 397 ? N HIS A 504 
F  3 4 N LEU A 398 ? N LEU A 505 O SER A 406 ? O SER A 513 
G  1 2 N PHE B 66  ? N PHE B 173 O ARG B 118 ? O ARG B 225 
G  2 3 O GLY B 115 ? O GLY B 222 N VAL B 42  ? N VAL B 149 
G  3 4 N SER B 43  ? N SER B 150 O ILE B 142 ? O ILE B 249 
G  4 5 N TYR B 143 ? N TYR B 250 O ILE B 181 ? O ILE B 288 
G  5 6 N TRP B 184 ? N TRP B 291 O ILE B 210 ? O ILE B 317 
G  6 7 N SER B 211 ? N SER B 318 O ALA B 231 ? O ALA B 338 
H  1 2 N ASP B 248 ? N ASP B 355 O LYS B 252 ? O LYS B 359 
I  1 2 N ALA B 305 ? N ALA B 412 O VAL B 313 ? O VAL B 420 
J  1 2 N CYS B 343 ? N CYS B 450 O LEU B 463 ? O LEU B 570 
J  2 3 O LEU B 456 ? O LEU B 563 N LYS B 352 ? N LYS B 459 
K  1 2 N CYS B 343 ? N CYS B 450 O LEU B 463 ? O LEU B 570 
K  2 3 O THR B 460 ? O THR B 567 N ARG B 383 ? N ARG B 490 
K  3 4 N LEU B 384 ? N LEU B 491 O TRP B 424 ? O TRP B 531 
L  1 2 N LEU B 358 ? N LEU B 465 O ILE B 444 ? O ILE B 551 
L  2 3 O GLU B 443 ? O GLU B 550 N HIS B 397 ? N HIS B 504 
L  3 4 N LEU B 398 ? N LEU B 505 O SER B 406 ? O SER B 513 
M  1 2 N PHE C 66  ? N PHE C 173 O ARG C 118 ? O ARG C 225 
M  2 3 O GLY C 115 ? O GLY C 222 N VAL C 42  ? N VAL C 149 
M  3 4 N SER C 43  ? N SER C 150 O ILE C 142 ? O ILE C 249 
M  4 5 N TYR C 143 ? N TYR C 250 O ILE C 181 ? O ILE C 288 
M  5 6 N TRP C 184 ? N TRP C 291 O ILE C 210 ? O ILE C 317 
M  6 7 N SER C 211 ? N SER C 318 O ALA C 231 ? O ALA C 338 
N  1 2 N ASP C 248 ? N ASP C 355 O LYS C 252 ? O LYS C 359 
O  1 2 N ALA C 305 ? N ALA C 412 O VAL C 313 ? O VAL C 420 
P  1 2 N ILE C 345 ? N ILE C 452 O LEU C 461 ? O LEU C 568 
P  2 3 O LEU C 456 ? O LEU C 563 N LYS C 352 ? N LYS C 459 
Q  1 2 N ILE C 345 ? N ILE C 452 O LEU C 461 ? O LEU C 568 
Q  2 3 O THR C 460 ? O THR C 567 N ARG C 383 ? N ARG C 490 
Q  3 4 N LEU C 384 ? N LEU C 491 O TRP C 424 ? O TRP C 531 
R  1 2 N LEU C 358 ? N LEU C 465 O ILE C 444 ? O ILE C 551 
R  2 3 O GLU C 443 ? O GLU C 550 N HIS C 397 ? N HIS C 504 
R  3 4 N LEU C 398 ? N LEU C 505 O SER C 406 ? O SER C 513 
S  1 2 N PHE D 66  ? N PHE D 173 O ARG D 118 ? O ARG D 225 
S  2 3 O VAL D 117 ? O VAL D 224 N ILE D 44  ? N ILE D 151 
S  3 4 N SER D 43  ? N SER D 150 O ILE D 142 ? O ILE D 249 
S  4 5 N TYR D 143 ? N TYR D 250 O VAL D 183 ? O VAL D 290 
S  5 6 N TRP D 184 ? N TRP D 291 O ILE D 210 ? O ILE D 317 
S  6 7 N SER D 211 ? N SER D 318 O ALA D 231 ? O ALA D 338 
T  1 2 N ASP D 248 ? N ASP D 355 O LYS D 252 ? O LYS D 359 
U  1 2 N ALA D 305 ? N ALA D 412 O VAL D 313 ? O VAL D 420 
V  1 2 N ILE D 345 ? N ILE D 452 O LEU D 461 ? O LEU D 568 
V  2 3 O LEU D 456 ? O LEU D 563 N LYS D 352 ? N LYS D 459 
W  1 2 N ILE D 345 ? N ILE D 452 O LEU D 461 ? O LEU D 568 
W  2 3 O THR D 460 ? O THR D 567 N ARG D 383 ? N ARG D 490 
W  3 4 N LEU D 384 ? N LEU D 491 O TRP D 424 ? O TRP D 531 
X  1 2 N VAL D 364 ? N VAL D 471 O GLY D 438 ? O GLY D 545 
X  2 3 O VAL D 441 ? O VAL D 548 N VAL D 399 ? N VAL D 506 
X  3 4 N LEU D 398 ? N LEU D 505 O SER D 406 ? O SER D 513 
Y  1 2 N PHE E 66  ? N PHE E 173 O ARG E 118 ? O ARG E 225 
Y  2 3 O GLY E 115 ? O GLY E 222 N VAL E 42  ? N VAL E 149 
Y  3 4 N SER E 43  ? N SER E 150 O ILE E 142 ? O ILE E 249 
Y  4 5 N TYR E 143 ? N TYR E 250 O ILE E 181 ? O ILE E 288 
Y  5 6 N TRP E 184 ? N TRP E 291 O ILE E 210 ? O ILE E 317 
Y  6 7 N SER E 211 ? N SER E 318 O ALA E 231 ? O ALA E 338 
Z  1 2 N ASP E 248 ? N ASP E 355 O LYS E 252 ? O LYS E 359 
AA 1 2 N ALA E 305 ? N ALA E 412 O VAL E 313 ? O VAL E 420 
AB 1 2 N ILE E 345 ? N ILE E 452 O LEU E 461 ? O LEU E 568 
AB 2 3 O LEU E 456 ? O LEU E 563 N LYS E 352 ? N LYS E 459 
AC 1 2 N ILE E 345 ? N ILE E 452 O LEU E 461 ? O LEU E 568 
AC 2 3 O THR E 460 ? O THR E 567 N ARG E 383 ? N ARG E 490 
AC 3 4 N ALA E 382 ? N ALA E 489 O PHE E 426 ? O PHE E 533 
AD 1 2 N LEU E 358 ? N LEU E 465 O ILE E 444 ? O ILE E 551 
AD 2 3 O GLU E 443 ? O GLU E 550 N HIS E 397 ? N HIS E 504 
AD 3 4 N LEU E 398 ? N LEU E 505 O SER E 406 ? O SER E 513 
AE 1 2 N PHE F 66  ? N PHE F 173 O ARG F 118 ? O ARG F 225 
AE 2 3 O GLY F 115 ? O GLY F 222 N VAL F 42  ? N VAL F 149 
AE 3 4 N SER F 43  ? N SER F 150 O ILE F 142 ? O ILE F 249 
AE 4 5 N TYR F 143 ? N TYR F 250 O ILE F 181 ? O ILE F 288 
AE 5 6 N TRP F 184 ? N TRP F 291 O ILE F 210 ? O ILE F 317 
AE 6 7 N SER F 211 ? N SER F 318 O ALA F 231 ? O ALA F 338 
AF 1 2 N ASP F 248 ? N ASP F 355 O LYS F 252 ? O LYS F 359 
AG 1 2 N ALA F 305 ? N ALA F 412 O VAL F 313 ? O VAL F 420 
AH 1 2 N CYS F 343 ? N CYS F 450 O LEU F 463 ? O LEU F 570 
AH 2 3 O LEU F 456 ? O LEU F 563 N LYS F 352 ? N LYS F 459 
AI 1 2 N CYS F 343 ? N CYS F 450 O LEU F 463 ? O LEU F 570 
AI 2 3 O THR F 460 ? O THR F 567 N ARG F 383 ? N ARG F 490 
AI 3 4 N LEU F 384 ? N LEU F 491 O TRP F 424 ? O TRP F 531 
AJ 1 2 N VAL F 364 ? N VAL F 471 O GLY F 438 ? O GLY F 545 
AJ 2 3 O GLU F 443 ? O GLU F 550 N HIS F 397 ? N HIS F 504 
AJ 3 4 N LEU F 398 ? N LEU F 505 O SER F 406 ? O SER F 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT A 601'                                                                  
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE FMT A 602'                                                                  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT A 603'                                                                  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT A 604'                                                                  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 605'                                                                   
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 606'                                                                   
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 607'                                                                   
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 608'                                                                   
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT B 601'                                                                  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT B 602'                                                                  
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE FMT B 603'                                                                  
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE FMT B 604'                                                                  
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 605'                                                                   
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 606'                                                                   
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 607'                                                                   
BC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA B 608'                                                                   
BC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE FMT C 601'                                                                  
BC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE FMT C 602'                                                                  
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT C 603'                                                                  
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT C 604'                                                                  
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 605'                                                                   
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 606'                                                                   
CC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 607'                                                                   
CC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA C 608'                                                                   
CC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT D 601'                                                                  
CC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT D 602'                                                                  
CC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE FMT D 603'                                                                  
DC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT D 604'                                                                  
DC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 605'                                                                   
DC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 606'                                                                   
DC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 607'                                                                   
DC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA D 608'                                                                   
DC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE FMT E 601'                                                                  
DC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT E 602'                                                                  
DC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT E 603'                                                                  
DC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT E 604'                                                                  
EC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 605'                                                                   
EC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 606'                                                                   
EC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA E 607'                                                                   
EC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA E 608'                                                                   
EC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT F 601'                                                                  
EC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT F 602'                                                                  
EC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT F 603'                                                                  
EC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT F 604'                                                                  
EC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 605'                                                                   
FC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 606'                                                                   
FC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 607'                                                                   
FC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA F 608'                                                                   
FC4 Software ? ? ? ? 24 'BINDING SITE FOR CHAIN H OF META-GUANIDINOMETHYL-PHENYLACETYL-ARG-VAL-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC5 Software ? ? ? ? 23 'BINDING SITE FOR CHAIN I OF META-GUANIDINOMETHYL-PHENYLACETYL-ARG-VAL-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC6 Software ? ? ? ? 25 'BINDING SITE FOR CHAIN J OF META-GUANIDINOMETHYL-PHENYLACETYL-ARG-VAL-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC7 Software ? ? ? ? 26 'BINDING SITE FOR CHAIN K OF META-GUANIDINOMETHYL-PHENYLACETYL-ARG-VAL-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC8 Software ? ? ? ? 26 'BINDING SITE FOR CHAIN L OF META-GUANIDINOMETHYL-PHENYLACETYL-ARG-VAL-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC9 Software ? ? ? ? 27 'BINDING SITE FOR CHAIN N OF META-GUANIDINOMETHYL-PHENYLACETYL-ARG-VAL-ARG- (AMIDOMETHYL)BENZAMIDINE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  ASN A  188 ? ASN A 295 . ? 1_555 ? 
2   AC1 5  THR A  258 ? THR A 365 . ? 1_555 ? 
3   AC1 5  GLY A  259 ? GLY A 366 . ? 1_555 ? 
4   AC1 5  HOH IB .   ? HOH A 762 . ? 1_555 ? 
5   AC1 5  ARG E  191 ? ARG E 298 . ? 2_564 ? 
6   AC2 2  GLY A  420 ? GLY A 527 . ? 1_555 ? 
7   AC2 2  ASN A  422 ? ASN A 529 . ? 1_555 ? 
8   AC3 5  TYR A  206 ? TYR A 313 . ? 1_555 ? 
9   AC3 5  GLN A  340 ? GLN A 447 . ? 1_555 ? 
10  AC3 5  FMT P  .   ? FMT A 604 . ? 1_555 ? 
11  AC3 5  ARG B  169 ? ARG B 276 . ? 1_555 ? 
12  AC3 5  GLN B  173 ? GLN B 280 . ? 1_555 ? 
13  AC4 6  PHE A  168 ? PHE A 275 . ? 1_555 ? 
14  AC4 6  TYR A  206 ? TYR A 313 . ? 1_555 ? 
15  AC4 6  LYS A  342 ? LYS A 449 . ? 1_555 ? 
16  AC4 6  TYR A  464 ? TYR A 571 . ? 1_555 ? 
17  AC4 6  FMT O  .   ? FMT A 603 . ? 1_555 ? 
18  AC4 6  ARG B  169 ? ARG B 276 . ? 1_555 ? 
19  AC5 6  ASP A  8   ? ASP A 115 . ? 1_555 ? 
20  AC5 6  ASP A  55  ? ASP A 162 . ? 1_555 ? 
21  AC5 6  VAL A  98  ? VAL A 205 . ? 1_555 ? 
22  AC5 6  ASN A  101 ? ASN A 208 . ? 1_555 ? 
23  AC5 6  VAL A  103 ? VAL A 210 . ? 1_555 ? 
24  AC5 6  GLY A  105 ? GLY A 212 . ? 1_555 ? 
25  AC6 6  ASP A  151 ? ASP A 258 . ? 1_555 ? 
26  AC6 6  ASP A  194 ? ASP A 301 . ? 1_555 ? 
27  AC6 6  GLU A  224 ? GLU A 331 . ? 1_555 ? 
28  AC6 6  HOH IB .   ? HOH A 758 . ? 1_555 ? 
29  AC6 6  HOH IB .   ? HOH A 773 . ? 1_555 ? 
30  AC6 6  HOH IB .   ? HOH A 863 . ? 1_555 ? 
31  AC7 6  ASP A  67  ? ASP A 174 . ? 1_555 ? 
32  AC7 6  ASP A  72  ? ASP A 179 . ? 1_555 ? 
33  AC7 6  ASP A  74  ? ASP A 181 . ? 1_555 ? 
34  AC7 6  HOH IB .   ? HOH A 729 . ? 1_555 ? 
35  AC7 6  HOH IB .   ? HOH A 736 . ? 1_555 ? 
36  AC7 6  HOH IB .   ? HOH A 930 . ? 1_555 ? 
37  AC8 4  THR A  202 ? THR A 309 . ? 1_555 ? 
38  AC8 4  SER A  204 ? SER A 311 . ? 1_555 ? 
39  AC8 4  THR A  207 ? THR A 314 . ? 1_555 ? 
40  AC8 4  HOH IB .   ? HOH A 787 . ? 1_555 ? 
41  AC9 6  ARG A  169 ? ARG A 276 . ? 1_555 ? 
42  AC9 6  GLN A  173 ? GLN A 280 . ? 1_555 ? 
43  AC9 6  TYR B  206 ? TYR B 313 . ? 1_555 ? 
44  AC9 6  GLN B  340 ? GLN B 447 . ? 1_555 ? 
45  AC9 6  FMT V  .   ? FMT B 602 . ? 1_555 ? 
46  AC9 6  HOH JB .   ? HOH B 750 . ? 1_555 ? 
47  BC1 5  ARG A  169 ? ARG A 276 . ? 1_555 ? 
48  BC1 5  PHE B  168 ? PHE B 275 . ? 1_555 ? 
49  BC1 5  TYR B  206 ? TYR B 313 . ? 1_555 ? 
50  BC1 5  LYS B  342 ? LYS B 449 . ? 1_555 ? 
51  BC1 5  FMT U  .   ? FMT B 601 . ? 1_555 ? 
52  BC2 3  THR B  258 ? THR B 365 . ? 1_555 ? 
53  BC2 3  HOH JB .   ? HOH B 836 . ? 1_555 ? 
54  BC2 3  ARG D  191 ? ARG D 298 . ? 2_554 ? 
55  BC3 3  GLY B  420 ? GLY B 527 . ? 1_555 ? 
56  BC3 3  PHE B  421 ? PHE B 528 . ? 1_555 ? 
57  BC3 3  ASN B  422 ? ASN B 529 . ? 1_555 ? 
58  BC4 6  ASP B  8   ? ASP B 115 . ? 1_555 ? 
59  BC4 6  ASP B  55  ? ASP B 162 . ? 1_555 ? 
60  BC4 6  VAL B  98  ? VAL B 205 . ? 1_555 ? 
61  BC4 6  ASN B  101 ? ASN B 208 . ? 1_555 ? 
62  BC4 6  VAL B  103 ? VAL B 210 . ? 1_555 ? 
63  BC4 6  GLY B  105 ? GLY B 212 . ? 1_555 ? 
64  BC5 6  ASP B  151 ? ASP B 258 . ? 1_555 ? 
65  BC5 6  ASP B  194 ? ASP B 301 . ? 1_555 ? 
66  BC5 6  GLU B  224 ? GLU B 331 . ? 1_555 ? 
67  BC5 6  HOH JB .   ? HOH B 717 . ? 1_555 ? 
68  BC5 6  HOH JB .   ? HOH B 743 . ? 1_555 ? 
69  BC5 6  HOH JB .   ? HOH B 842 . ? 1_555 ? 
70  BC6 6  ASP B  67  ? ASP B 174 . ? 1_555 ? 
71  BC6 6  ASP B  72  ? ASP B 179 . ? 1_555 ? 
72  BC6 6  ASP B  74  ? ASP B 181 . ? 1_555 ? 
73  BC6 6  HOH JB .   ? HOH B 771 . ? 1_555 ? 
74  BC6 6  HOH JB .   ? HOH B 810 . ? 1_555 ? 
75  BC6 6  HOH JB .   ? HOH B 843 . ? 1_555 ? 
76  BC7 4  THR B  202 ? THR B 309 . ? 1_555 ? 
77  BC7 4  SER B  204 ? SER B 311 . ? 1_555 ? 
78  BC7 4  THR B  207 ? THR B 314 . ? 1_555 ? 
79  BC7 4  HOH JB .   ? HOH B 704 . ? 1_555 ? 
80  BC8 3  ASN C  188 ? ASN C 295 . ? 1_555 ? 
81  BC8 3  THR C  258 ? THR C 365 . ? 1_555 ? 
82  BC8 3  GLY C  259 ? GLY C 366 . ? 1_555 ? 
83  BC9 2  GLY C  420 ? GLY C 527 . ? 1_555 ? 
84  BC9 2  ASN C  422 ? ASN C 529 . ? 1_555 ? 
85  CC1 5  TYR C  206 ? TYR C 313 . ? 1_555 ? 
86  CC1 5  GLN C  340 ? GLN C 447 . ? 1_555 ? 
87  CC1 5  FMT FA .   ? FMT C 604 . ? 1_555 ? 
88  CC1 5  ARG D  169 ? ARG D 276 . ? 1_555 ? 
89  CC1 5  GLN D  173 ? GLN D 280 . ? 1_555 ? 
90  CC2 6  PHE C  168 ? PHE C 275 . ? 1_555 ? 
91  CC2 6  TYR C  206 ? TYR C 313 . ? 1_555 ? 
92  CC2 6  LYS C  342 ? LYS C 449 . ? 1_555 ? 
93  CC2 6  TYR C  464 ? TYR C 571 . ? 1_555 ? 
94  CC2 6  FMT EA .   ? FMT C 603 . ? 1_555 ? 
95  CC2 6  ARG D  169 ? ARG D 276 . ? 1_555 ? 
96  CC3 6  ASP C  8   ? ASP C 115 . ? 1_555 ? 
97  CC3 6  ASP C  55  ? ASP C 162 . ? 1_555 ? 
98  CC3 6  VAL C  98  ? VAL C 205 . ? 1_555 ? 
99  CC3 6  ASN C  101 ? ASN C 208 . ? 1_555 ? 
100 CC3 6  VAL C  103 ? VAL C 210 . ? 1_555 ? 
101 CC3 6  GLY C  105 ? GLY C 212 . ? 1_555 ? 
102 CC4 6  ASP C  151 ? ASP C 258 . ? 1_555 ? 
103 CC4 6  ASP C  194 ? ASP C 301 . ? 1_555 ? 
104 CC4 6  GLU C  224 ? GLU C 331 . ? 1_555 ? 
105 CC4 6  HOH KB .   ? HOH C 728 . ? 1_555 ? 
106 CC4 6  HOH KB .   ? HOH C 750 . ? 1_555 ? 
107 CC4 6  HOH KB .   ? HOH C 788 . ? 1_555 ? 
108 CC5 6  ASP C  67  ? ASP C 174 . ? 1_555 ? 
109 CC5 6  ASP C  72  ? ASP C 179 . ? 1_555 ? 
110 CC5 6  ASP C  74  ? ASP C 181 . ? 1_555 ? 
111 CC5 6  HOH KB .   ? HOH C 797 . ? 1_555 ? 
112 CC5 6  HOH KB .   ? HOH C 800 . ? 1_555 ? 
113 CC5 6  HOH KB .   ? HOH C 859 . ? 1_555 ? 
114 CC6 4  THR C  202 ? THR C 309 . ? 1_555 ? 
115 CC6 4  SER C  204 ? SER C 311 . ? 1_555 ? 
116 CC6 4  THR C  207 ? THR C 314 . ? 1_555 ? 
117 CC6 4  HOH KB .   ? HOH C 720 . ? 1_555 ? 
118 CC7 6  ARG C  169 ? ARG C 276 . ? 1_555 ? 
119 CC7 6  GLN C  173 ? GLN C 280 . ? 1_555 ? 
120 CC7 6  TYR D  206 ? TYR D 313 . ? 1_555 ? 
121 CC7 6  GLN D  340 ? GLN D 447 . ? 1_555 ? 
122 CC7 6  FMT LA .   ? FMT D 602 . ? 1_555 ? 
123 CC7 6  HOH LB .   ? HOH D 773 . ? 1_555 ? 
124 CC8 6  ARG C  169 ? ARG C 276 . ? 1_555 ? 
125 CC8 6  PHE D  168 ? PHE D 275 . ? 1_555 ? 
126 CC8 6  TYR D  206 ? TYR D 313 . ? 1_555 ? 
127 CC8 6  LYS D  342 ? LYS D 449 . ? 1_555 ? 
128 CC8 6  TYR D  464 ? TYR D 571 . ? 1_555 ? 
129 CC8 6  FMT KA .   ? FMT D 601 . ? 1_555 ? 
130 CC9 2  THR D  258 ? THR D 365 . ? 1_555 ? 
131 CC9 2  GLY D  259 ? GLY D 366 . ? 1_555 ? 
132 DC1 4  GLY D  420 ? GLY D 527 . ? 1_555 ? 
133 DC1 4  PHE D  421 ? PHE D 528 . ? 1_555 ? 
134 DC1 4  ASN D  422 ? ASN D 529 . ? 1_555 ? 
135 DC1 4  HOH LB .   ? HOH D 907 . ? 1_555 ? 
136 DC2 6  ASP D  8   ? ASP D 115 . ? 1_555 ? 
137 DC2 6  ASP D  55  ? ASP D 162 . ? 1_555 ? 
138 DC2 6  VAL D  98  ? VAL D 205 . ? 1_555 ? 
139 DC2 6  ASN D  101 ? ASN D 208 . ? 1_555 ? 
140 DC2 6  VAL D  103 ? VAL D 210 . ? 1_555 ? 
141 DC2 6  GLY D  105 ? GLY D 212 . ? 1_555 ? 
142 DC3 6  ASP D  151 ? ASP D 258 . ? 1_555 ? 
143 DC3 6  ASP D  194 ? ASP D 301 . ? 1_555 ? 
144 DC3 6  GLU D  224 ? GLU D 331 . ? 1_555 ? 
145 DC3 6  HOH LB .   ? HOH D 710 . ? 1_555 ? 
146 DC3 6  HOH LB .   ? HOH D 726 . ? 1_555 ? 
147 DC3 6  HOH LB .   ? HOH D 838 . ? 1_555 ? 
148 DC4 6  ASP D  67  ? ASP D 174 . ? 1_555 ? 
149 DC4 6  ASP D  72  ? ASP D 179 . ? 1_555 ? 
150 DC4 6  ASP D  74  ? ASP D 181 . ? 1_555 ? 
151 DC4 6  HOH LB .   ? HOH D 721 . ? 1_555 ? 
152 DC4 6  HOH LB .   ? HOH D 754 . ? 1_555 ? 
153 DC4 6  HOH LB .   ? HOH D 839 . ? 1_555 ? 
154 DC5 4  THR D  202 ? THR D 309 . ? 1_555 ? 
155 DC5 4  SER D  204 ? SER D 311 . ? 1_555 ? 
156 DC5 4  THR D  207 ? THR D 314 . ? 1_555 ? 
157 DC5 4  HOH LB .   ? HOH D 722 . ? 1_555 ? 
158 DC6 2  ARG A  191 ? ARG A 298 . ? 2_565 ? 
159 DC6 2  THR E  258 ? THR E 365 . ? 1_555 ? 
160 DC7 4  GLY E  420 ? GLY E 527 . ? 1_555 ? 
161 DC7 4  PHE E  421 ? PHE E 528 . ? 1_555 ? 
162 DC7 4  ASN E  422 ? ASN E 529 . ? 1_555 ? 
163 DC7 4  HOH MB .   ? HOH E 798 . ? 1_555 ? 
164 DC8 4  TYR E  206 ? TYR E 313 . ? 1_555 ? 
165 DC8 4  GLN E  340 ? GLN E 447 . ? 1_555 ? 
166 DC8 4  FMT VA .   ? FMT E 604 . ? 1_555 ? 
167 DC8 4  ARG F  169 ? ARG F 276 . ? 1_555 ? 
168 DC9 6  PHE E  168 ? PHE E 275 . ? 1_555 ? 
169 DC9 6  TYR E  206 ? TYR E 313 . ? 1_555 ? 
170 DC9 6  LYS E  342 ? LYS E 449 . ? 1_555 ? 
171 DC9 6  TYR E  464 ? TYR E 571 . ? 1_555 ? 
172 DC9 6  FMT UA .   ? FMT E 603 . ? 1_555 ? 
173 DC9 6  ARG F  169 ? ARG F 276 . ? 1_555 ? 
174 EC1 6  ASP E  8   ? ASP E 115 . ? 1_555 ? 
175 EC1 6  ASP E  55  ? ASP E 162 . ? 1_555 ? 
176 EC1 6  VAL E  98  ? VAL E 205 . ? 1_555 ? 
177 EC1 6  ASN E  101 ? ASN E 208 . ? 1_555 ? 
178 EC1 6  VAL E  103 ? VAL E 210 . ? 1_555 ? 
179 EC1 6  GLY E  105 ? GLY E 212 . ? 1_555 ? 
180 EC2 6  ASP E  151 ? ASP E 258 . ? 1_555 ? 
181 EC2 6  ASP E  194 ? ASP E 301 . ? 1_555 ? 
182 EC2 6  GLU E  224 ? GLU E 331 . ? 1_555 ? 
183 EC2 6  HOH MB .   ? HOH E 720 . ? 1_555 ? 
184 EC2 6  HOH MB .   ? HOH E 721 . ? 1_555 ? 
185 EC2 6  HOH MB .   ? HOH E 845 . ? 1_555 ? 
186 EC3 4  ASP E  67  ? ASP E 174 . ? 1_555 ? 
187 EC3 4  ASP E  72  ? ASP E 179 . ? 1_555 ? 
188 EC3 4  ASP E  74  ? ASP E 181 . ? 1_555 ? 
189 EC3 4  HOH MB .   ? HOH E 847 . ? 1_555 ? 
190 EC4 4  THR E  202 ? THR E 309 . ? 1_555 ? 
191 EC4 4  SER E  204 ? SER E 311 . ? 1_555 ? 
192 EC4 4  THR E  207 ? THR E 314 . ? 1_555 ? 
193 EC4 4  HOH MB .   ? HOH E 704 . ? 1_555 ? 
194 EC5 4  ARG E  169 ? ARG E 276 . ? 1_555 ? 
195 EC5 4  TYR F  206 ? TYR F 313 . ? 1_555 ? 
196 EC5 4  GLN F  340 ? GLN F 447 . ? 1_555 ? 
197 EC5 4  FMT BB .   ? FMT F 602 . ? 1_555 ? 
198 EC6 5  ARG E  169 ? ARG E 276 . ? 1_555 ? 
199 EC6 5  PHE F  168 ? PHE F 275 . ? 1_555 ? 
200 EC6 5  TYR F  206 ? TYR F 313 . ? 1_555 ? 
201 EC6 5  LYS F  342 ? LYS F 449 . ? 1_555 ? 
202 EC6 5  FMT AB .   ? FMT F 601 . ? 1_555 ? 
203 EC7 5  ARG C  191 ? ARG C 298 . ? 1_555 ? 
204 EC7 5  ASN F  188 ? ASN F 295 . ? 1_555 ? 
205 EC7 5  TRP F  221 ? TRP F 328 . ? 1_555 ? 
206 EC7 5  THR F  258 ? THR F 365 . ? 1_555 ? 
207 EC7 5  HOH NB .   ? HOH F 871 . ? 1_555 ? 
208 EC8 4  GLY F  420 ? GLY F 527 . ? 1_555 ? 
209 EC8 4  PHE F  421 ? PHE F 528 . ? 1_555 ? 
210 EC8 4  ASN F  422 ? ASN F 529 . ? 1_555 ? 
211 EC8 4  HOH NB .   ? HOH F 796 . ? 1_555 ? 
212 EC9 6  ASP F  8   ? ASP F 115 . ? 1_555 ? 
213 EC9 6  ASP F  55  ? ASP F 162 . ? 1_555 ? 
214 EC9 6  VAL F  98  ? VAL F 205 . ? 1_555 ? 
215 EC9 6  ASN F  101 ? ASN F 208 . ? 1_555 ? 
216 EC9 6  VAL F  103 ? VAL F 210 . ? 1_555 ? 
217 EC9 6  GLY F  105 ? GLY F 212 . ? 1_555 ? 
218 FC1 6  ASP F  151 ? ASP F 258 . ? 1_555 ? 
219 FC1 6  ASP F  194 ? ASP F 301 . ? 1_555 ? 
220 FC1 6  GLU F  224 ? GLU F 331 . ? 1_555 ? 
221 FC1 6  HOH NB .   ? HOH F 704 . ? 1_555 ? 
222 FC1 6  HOH NB .   ? HOH F 722 . ? 1_555 ? 
223 FC1 6  HOH NB .   ? HOH F 770 . ? 1_555 ? 
224 FC2 6  ASP F  67  ? ASP F 174 . ? 1_555 ? 
225 FC2 6  ASP F  72  ? ASP F 179 . ? 1_555 ? 
226 FC2 6  ASP F  74  ? ASP F 181 . ? 1_555 ? 
227 FC2 6  HOH NB .   ? HOH F 748 . ? 1_555 ? 
228 FC2 6  HOH NB .   ? HOH F 778 . ? 1_555 ? 
229 FC2 6  HOH NB .   ? HOH F 825 . ? 1_555 ? 
230 FC3 4  THR F  202 ? THR F 309 . ? 1_555 ? 
231 FC3 4  SER F  204 ? SER F 311 . ? 1_555 ? 
232 FC3 4  THR F  207 ? THR F 314 . ? 1_555 ? 
233 FC3 4  HOH NB .   ? HOH F 716 . ? 1_555 ? 
234 FC4 24 ASP A  47  ? ASP A 154 . ? 1_555 ? 
235 FC4 24 ASP A  84  ? ASP A 191 . ? 1_555 ? 
236 FC4 24 ASN A  85  ? ASN A 192 . ? 1_555 ? 
237 FC4 24 HIS A  87  ? HIS A 194 . ? 1_555 ? 
238 FC4 24 VAL A  124 ? VAL A 231 . ? 1_555 ? 
239 FC4 24 THR A  125 ? THR A 232 . ? 1_555 ? 
240 FC4 24 GLU A  129 ? GLU A 236 . ? 1_555 ? 
241 FC4 24 SER A  146 ? SER A 253 . ? 1_555 ? 
242 FC4 24 TRP A  147 ? TRP A 254 . ? 1_555 ? 
243 FC4 24 GLY A  148 ? GLY A 255 . ? 1_555 ? 
244 FC4 24 PRO A  149 ? PRO A 256 . ? 1_555 ? 
245 FC4 24 ASP A  151 ? ASP A 258 . ? 1_555 ? 
246 FC4 24 ASP A  157 ? ASP A 264 . ? 1_555 ? 
247 FC4 24 GLY A  158 ? GLY A 265 . ? 1_555 ? 
248 FC4 24 ALA A  185 ? ALA A 292 . ? 1_555 ? 
249 FC4 24 ASP A  199 ? ASP A 306 . ? 1_555 ? 
250 FC4 24 TYR A  201 ? TYR A 308 . ? 1_555 ? 
251 FC4 24 THR A  260 ? THR A 367 . ? 1_555 ? 
252 FC4 24 SER A  261 ? SER A 368 . ? 1_555 ? 
253 FC4 24 HOH IB .   ? HOH A 715 . ? 1_555 ? 
254 FC4 24 HOH OB .   ? HOH H 101 . ? 1_555 ? 
255 FC4 24 HOH OB .   ? HOH H 102 . ? 1_555 ? 
256 FC4 24 HOH OB .   ? HOH H 103 . ? 1_555 ? 
257 FC4 24 HOH OB .   ? HOH H 105 . ? 1_555 ? 
258 FC5 23 ASP B  47  ? ASP B 154 . ? 1_555 ? 
259 FC5 23 ASP B  84  ? ASP B 191 . ? 1_555 ? 
260 FC5 23 ASN B  85  ? ASN B 192 . ? 1_555 ? 
261 FC5 23 HIS B  87  ? HIS B 194 . ? 1_555 ? 
262 FC5 23 VAL B  124 ? VAL B 231 . ? 1_555 ? 
263 FC5 23 THR B  125 ? THR B 232 . ? 1_555 ? 
264 FC5 23 GLU B  129 ? GLU B 236 . ? 1_555 ? 
265 FC5 23 SER B  146 ? SER B 253 . ? 1_555 ? 
266 FC5 23 TRP B  147 ? TRP B 254 . ? 1_555 ? 
267 FC5 23 GLY B  148 ? GLY B 255 . ? 1_555 ? 
268 FC5 23 PRO B  149 ? PRO B 256 . ? 1_555 ? 
269 FC5 23 ASP B  151 ? ASP B 258 . ? 1_555 ? 
270 FC5 23 ASP B  157 ? ASP B 264 . ? 1_555 ? 
271 FC5 23 GLY B  158 ? GLY B 265 . ? 1_555 ? 
272 FC5 23 ALA B  185 ? ALA B 292 . ? 1_555 ? 
273 FC5 23 ASP B  199 ? ASP B 306 . ? 1_555 ? 
274 FC5 23 TYR B  201 ? TYR B 308 . ? 1_555 ? 
275 FC5 23 THR B  260 ? THR B 367 . ? 1_555 ? 
276 FC5 23 SER B  261 ? SER B 368 . ? 1_555 ? 
277 FC5 23 HOH JB .   ? HOH B 702 . ? 1_555 ? 
278 FC5 23 HOH PB .   ? HOH I 101 . ? 1_555 ? 
279 FC5 23 HOH PB .   ? HOH I 102 . ? 1_555 ? 
280 FC5 23 HOH PB .   ? HOH I 103 . ? 1_555 ? 
281 FC6 25 ASP C  47  ? ASP C 154 . ? 1_555 ? 
282 FC6 25 ASP C  84  ? ASP C 191 . ? 1_555 ? 
283 FC6 25 ASN C  85  ? ASN C 192 . ? 1_555 ? 
284 FC6 25 HIS C  87  ? HIS C 194 . ? 1_555 ? 
285 FC6 25 VAL C  124 ? VAL C 231 . ? 1_555 ? 
286 FC6 25 THR C  125 ? THR C 232 . ? 1_555 ? 
287 FC6 25 GLU C  129 ? GLU C 236 . ? 1_555 ? 
288 FC6 25 SER C  146 ? SER C 253 . ? 1_555 ? 
289 FC6 25 TRP C  147 ? TRP C 254 . ? 1_555 ? 
290 FC6 25 GLY C  148 ? GLY C 255 . ? 1_555 ? 
291 FC6 25 PRO C  149 ? PRO C 256 . ? 1_555 ? 
292 FC6 25 ASP C  151 ? ASP C 258 . ? 1_555 ? 
293 FC6 25 ASP C  157 ? ASP C 264 . ? 1_555 ? 
294 FC6 25 GLY C  158 ? GLY C 265 . ? 1_555 ? 
295 FC6 25 ALA C  185 ? ALA C 292 . ? 1_555 ? 
296 FC6 25 SER C  186 ? SER C 293 . ? 1_555 ? 
297 FC6 25 ASP C  199 ? ASP C 306 . ? 1_555 ? 
298 FC6 25 TYR C  201 ? TYR C 308 . ? 1_555 ? 
299 FC6 25 THR C  260 ? THR C 367 . ? 1_555 ? 
300 FC6 25 SER C  261 ? SER C 368 . ? 1_555 ? 
301 FC6 25 HOH QB .   ? HOH J 101 . ? 1_555 ? 
302 FC6 25 HOH QB .   ? HOH J 102 . ? 1_555 ? 
303 FC6 25 HOH QB .   ? HOH J 103 . ? 1_555 ? 
304 FC6 25 HOH QB .   ? HOH J 104 . ? 1_555 ? 
305 FC6 25 HOH QB .   ? HOH J 105 . ? 1_555 ? 
306 FC7 26 ASP D  47  ? ASP D 154 . ? 1_555 ? 
307 FC7 26 ASP D  84  ? ASP D 191 . ? 1_555 ? 
308 FC7 26 ASN D  85  ? ASN D 192 . ? 1_555 ? 
309 FC7 26 HIS D  87  ? HIS D 194 . ? 1_555 ? 
310 FC7 26 VAL D  124 ? VAL D 231 . ? 1_555 ? 
311 FC7 26 THR D  125 ? THR D 232 . ? 1_555 ? 
312 FC7 26 ASP D  126 ? ASP D 233 . ? 1_555 ? 
313 FC7 26 GLU D  129 ? GLU D 236 . ? 1_555 ? 
314 FC7 26 SER D  146 ? SER D 253 . ? 1_555 ? 
315 FC7 26 TRP D  147 ? TRP D 254 . ? 1_555 ? 
316 FC7 26 GLY D  148 ? GLY D 255 . ? 1_555 ? 
317 FC7 26 PRO D  149 ? PRO D 256 . ? 1_555 ? 
318 FC7 26 ASP D  151 ? ASP D 258 . ? 1_555 ? 
319 FC7 26 ASP D  157 ? ASP D 264 . ? 1_555 ? 
320 FC7 26 GLY D  158 ? GLY D 265 . ? 1_555 ? 
321 FC7 26 ALA D  185 ? ALA D 292 . ? 1_555 ? 
322 FC7 26 ASP D  199 ? ASP D 306 . ? 1_555 ? 
323 FC7 26 TYR D  201 ? TYR D 308 . ? 1_555 ? 
324 FC7 26 THR D  202 ? THR D 309 . ? 1_555 ? 
325 FC7 26 THR D  260 ? THR D 367 . ? 1_555 ? 
326 FC7 26 SER D  261 ? SER D 368 . ? 1_555 ? 
327 FC7 26 HOH RB .   ? HOH K 101 . ? 1_555 ? 
328 FC7 26 HOH RB .   ? HOH K 102 . ? 1_555 ? 
329 FC7 26 HOH RB .   ? HOH K 103 . ? 1_555 ? 
330 FC7 26 HOH RB .   ? HOH K 104 . ? 1_555 ? 
331 FC7 26 HOH RB .   ? HOH K 105 . ? 1_555 ? 
332 FC8 26 ASP E  47  ? ASP E 154 . ? 1_555 ? 
333 FC8 26 ASP E  84  ? ASP E 191 . ? 1_555 ? 
334 FC8 26 ASN E  85  ? ASN E 192 . ? 1_555 ? 
335 FC8 26 HIS E  87  ? HIS E 194 . ? 1_555 ? 
336 FC8 26 VAL E  124 ? VAL E 231 . ? 1_555 ? 
337 FC8 26 THR E  125 ? THR E 232 . ? 1_555 ? 
338 FC8 26 GLU E  129 ? GLU E 236 . ? 1_555 ? 
339 FC8 26 SER E  146 ? SER E 253 . ? 1_555 ? 
340 FC8 26 TRP E  147 ? TRP E 254 . ? 1_555 ? 
341 FC8 26 GLY E  148 ? GLY E 255 . ? 1_555 ? 
342 FC8 26 PRO E  149 ? PRO E 256 . ? 1_555 ? 
343 FC8 26 ASP E  151 ? ASP E 258 . ? 1_555 ? 
344 FC8 26 ASP E  157 ? ASP E 264 . ? 1_555 ? 
345 FC8 26 GLY E  158 ? GLY E 265 . ? 1_555 ? 
346 FC8 26 ALA E  185 ? ALA E 292 . ? 1_555 ? 
347 FC8 26 ASN E  188 ? ASN E 295 . ? 1_555 ? 
348 FC8 26 ASP E  199 ? ASP E 306 . ? 1_555 ? 
349 FC8 26 TYR E  201 ? TYR E 308 . ? 1_555 ? 
350 FC8 26 THR E  260 ? THR E 367 . ? 1_555 ? 
351 FC8 26 SER E  261 ? SER E 368 . ? 1_555 ? 
352 FC8 26 HOH MB .   ? HOH E 703 . ? 1_555 ? 
353 FC8 26 HOH MB .   ? HOH E 781 . ? 1_555 ? 
354 FC8 26 HOH MB .   ? HOH E 834 . ? 1_555 ? 
355 FC8 26 HOH SB .   ? HOH L 101 . ? 1_555 ? 
356 FC8 26 HOH SB .   ? HOH L 102 . ? 1_555 ? 
357 FC8 26 HOH SB .   ? HOH L 103 . ? 1_555 ? 
358 FC9 27 ASP F  47  ? ASP F 154 . ? 1_555 ? 
359 FC9 27 ASP F  84  ? ASP F 191 . ? 1_555 ? 
360 FC9 27 ASN F  85  ? ASN F 192 . ? 1_555 ? 
361 FC9 27 HIS F  87  ? HIS F 194 . ? 1_555 ? 
362 FC9 27 VAL F  124 ? VAL F 231 . ? 1_555 ? 
363 FC9 27 THR F  125 ? THR F 232 . ? 1_555 ? 
364 FC9 27 GLU F  129 ? GLU F 236 . ? 1_555 ? 
365 FC9 27 SER F  146 ? SER F 253 . ? 1_555 ? 
366 FC9 27 TRP F  147 ? TRP F 254 . ? 1_555 ? 
367 FC9 27 GLY F  148 ? GLY F 255 . ? 1_555 ? 
368 FC9 27 PRO F  149 ? PRO F 256 . ? 1_555 ? 
369 FC9 27 ASP F  151 ? ASP F 258 . ? 1_555 ? 
370 FC9 27 ASP F  157 ? ASP F 264 . ? 1_555 ? 
371 FC9 27 GLY F  158 ? GLY F 265 . ? 1_555 ? 
372 FC9 27 ALA F  185 ? ALA F 292 . ? 1_555 ? 
373 FC9 27 ASN F  188 ? ASN F 295 . ? 1_555 ? 
374 FC9 27 ASP F  199 ? ASP F 306 . ? 1_555 ? 
375 FC9 27 TYR F  201 ? TYR F 308 . ? 1_555 ? 
376 FC9 27 THR F  260 ? THR F 367 . ? 1_555 ? 
377 FC9 27 SER F  261 ? SER F 368 . ? 1_555 ? 
378 FC9 27 HOH NB .   ? HOH F 701 . ? 1_555 ? 
379 FC9 27 HOH NB .   ? HOH F 809 . ? 1_555 ? 
380 FC9 27 HOH TB .   ? HOH N 101 . ? 1_555 ? 
381 FC9 27 HOH TB .   ? HOH N 102 . ? 1_555 ? 
382 FC9 27 HOH TB .   ? HOH N 103 . ? 1_555 ? 
383 FC9 27 HOH TB .   ? HOH N 104 . ? 1_555 ? 
384 FC9 27 HOH TB .   ? HOH N 105 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OMC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OMC 
_atom_sites.fract_transf_matrix[1][1]   0.007083 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006542 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005942 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A  1 2   ? -1.036  39.375  25.797  1.00   40.00 ? 109 VAL A N   1 
ATOM   2     C  CA  . VAL A  1 2   ? -0.110  40.214  26.612  1.00   38.86 ? 109 VAL A CA  1 
ATOM   3     C  C   . VAL A  1 2   ? 1.171   40.597  25.847  1.00   38.11 ? 109 VAL A C   1 
ATOM   4     O  O   . VAL A  1 2   ? 1.782   41.629  26.138  1.00   41.97 ? 109 VAL A O   1 
ATOM   5     C  CB  . VAL A  1 2   ? 0.272   39.487  27.921  1.00   39.80 ? 109 VAL A CB  1 
ATOM   6     C  CG1 . VAL A  1 2   ? 1.043   38.209  27.604  1.00   39.71 ? 109 VAL A CG1 1 
ATOM   7     C  CG2 . VAL A  1 2   ? 1.077   40.416  28.823  1.00   37.03 ? 109 VAL A CG2 1 
ATOM   8     N  N   . TYR A  1 3   ? 1.564   39.776  24.872  1.00   32.06 ? 110 TYR A N   1 
ATOM   9     C  CA  . TYR A  1 3   ? 2.762   40.026  24.059  1.00   27.18 ? 110 TYR A CA  1 
ATOM   10    C  C   . TYR A  1 3   ? 2.691   41.297  23.206  1.00   26.10 ? 110 TYR A C   1 
ATOM   11    O  O   . TYR A  1 3   ? 1.658   41.591  22.606  1.00   23.81 ? 110 TYR A O   1 
ATOM   12    C  CB  . TYR A  1 3   ? 3.028   38.835  23.125  1.00   23.61 ? 110 TYR A CB  1 
ATOM   13    C  CG  . TYR A  1 3   ? 4.144   39.082  22.124  1.00   23.90 ? 110 TYR A CG  1 
ATOM   14    C  CD1 . TYR A  1 3   ? 5.476   39.173  22.536  1.00   23.43 ? 110 TYR A CD1 1 
ATOM   15    C  CD2 . TYR A  1 3   ? 3.863   39.282  20.771  1.00   25.29 ? 110 TYR A CD2 1 
ATOM   16    C  CE1 . TYR A  1 3   ? 6.506   39.468  21.622  1.00   23.96 ? 110 TYR A CE1 1 
ATOM   17    C  CE2 . TYR A  1 3   ? 4.885   39.575  19.845  1.00   25.58 ? 110 TYR A CE2 1 
ATOM   18    C  CZ  . TYR A  1 3   ? 6.197   39.668  20.277  1.00   23.90 ? 110 TYR A CZ  1 
ATOM   19    O  OH  . TYR A  1 3   ? 7.185   39.976  19.374  1.00   23.18 ? 110 TYR A OH  1 
ATOM   20    N  N   . GLN A  1 4   ? 3.803   42.031  23.136  1.00   25.72 ? 111 GLN A N   1 
ATOM   21    C  CA  . GLN A  1 4   ? 3.883   43.261  22.337  1.00   23.28 ? 111 GLN A CA  1 
ATOM   22    C  C   . GLN A  1 4   ? 4.770   43.023  21.112  1.00   23.03 ? 111 GLN A C   1 
ATOM   23    O  O   . GLN A  1 4   ? 5.961   42.738  21.245  1.00   20.51 ? 111 GLN A O   1 
ATOM   24    C  CB  . GLN A  1 4   ? 4.487   44.406  23.157  1.00   26.77 ? 111 GLN A CB  1 
ATOM   25    C  CG  . GLN A  1 4   ? 3.778   44.706  24.466  1.00   32.57 ? 111 GLN A CG  1 
ATOM   26    C  CD  . GLN A  1 4   ? 2.284   44.913  24.281  1.00   40.51 ? 111 GLN A CD  1 
ATOM   27    O  OE1 . GLN A  1 4   ? 1.467   44.064  24.678  1.00   42.49 ? 111 GLN A OE1 1 
ATOM   28    N  NE2 . GLN A  1 4   ? 1.913   46.039  23.666  1.00   36.74 ? 111 GLN A NE2 1 
ATOM   29    N  N   . GLU A  1 5   ? 4.197   43.160  19.920  1.00   21.75 ? 112 GLU A N   1 
ATOM   30    C  CA  . GLU A  1 5   ? 4.950   42.942  18.687  1.00   23.94 ? 112 GLU A CA  1 
ATOM   31    C  C   . GLU A  1 5   ? 5.931   44.087  18.384  1.00   25.08 ? 112 GLU A C   1 
ATOM   32    O  O   . GLU A  1 5   ? 5.839   45.176  18.958  1.00   25.64 ? 112 GLU A O   1 
ATOM   33    C  CB  . GLU A  1 5   ? 3.982   42.772  17.518  1.00   20.26 ? 112 GLU A CB  1 
ATOM   34    C  CG  . GLU A  1 5   ? 3.270   44.057  17.152  1.00   23.07 ? 112 GLU A CG  1 
ATOM   35    C  CD  . GLU A  1 5   ? 2.330   43.885  15.977  1.00   26.89 ? 112 GLU A CD  1 
ATOM   36    O  OE1 . GLU A  1 5   ? 1.886   44.910  15.416  1.00   30.31 ? 112 GLU A OE1 1 
ATOM   37    O  OE2 . GLU A  1 5   ? 2.030   42.726  15.613  1.00   28.37 ? 112 GLU A OE2 1 
ATOM   38    N  N   . PRO A  1 6   ? 6.879   43.847  17.466  1.00   24.47 ? 113 PRO A N   1 
ATOM   39    C  CA  . PRO A  1 6   ? 7.896   44.824  17.054  1.00   24.82 ? 113 PRO A CA  1 
ATOM   40    C  C   . PRO A  1 6   ? 7.399   46.202  16.594  1.00   26.69 ? 113 PRO A C   1 
ATOM   41    O  O   . PRO A  1 6   ? 6.374   46.320  15.916  1.00   27.90 ? 113 PRO A O   1 
ATOM   42    C  CB  . PRO A  1 6   ? 8.652   44.080  15.957  1.00   26.79 ? 113 PRO A CB  1 
ATOM   43    C  CG  . PRO A  1 6   ? 8.661   42.649  16.508  1.00   24.10 ? 113 PRO A CG  1 
ATOM   44    C  CD  . PRO A  1 6   ? 7.229   42.485  17.012  1.00   21.71 ? 113 PRO A CD  1 
ATOM   45    N  N   . THR A  1 7   ? 8.156   47.232  16.971  1.00   25.15 ? 114 THR A N   1 
ATOM   46    C  CA  . THR A  1 7   ? 7.842   48.613  16.630  1.00   23.89 ? 114 THR A CA  1 
ATOM   47    C  C   . THR A  1 7   ? 8.744   49.125  15.510  1.00   25.09 ? 114 THR A C   1 
ATOM   48    O  O   . THR A  1 7   ? 8.612   50.274  15.077  1.00   25.21 ? 114 THR A O   1 
ATOM   49    C  CB  . THR A  1 7   ? 8.008   49.521  17.860  1.00   24.22 ? 114 THR A CB  1 
ATOM   50    O  OG1 . THR A  1 7   ? 9.305   49.330  18.440  1.00   26.67 ? 114 THR A OG1 1 
ATOM   51    C  CG2 . THR A  1 7   ? 6.985   49.158  18.911  1.00   20.41 ? 114 THR A CG2 1 
ATOM   52    N  N   . ASP A  1 8   ? 9.649   48.267  15.037  1.00   23.39 ? 115 ASP A N   1 
ATOM   53    C  CA  . ASP A  1 8   ? 10.572  48.639  13.965  1.00   21.53 ? 115 ASP A CA  1 
ATOM   54    C  C   . ASP A  1 8   ? 9.847   49.252  12.771  1.00   21.25 ? 115 ASP A C   1 
ATOM   55    O  O   . ASP A  1 8   ? 8.819   48.751  12.309  1.00   20.50 ? 115 ASP A O   1 
ATOM   56    C  CB  . ASP A  1 8   ? 11.395  47.424  13.548  1.00   19.00 ? 115 ASP A CB  1 
ATOM   57    C  CG  . ASP A  1 8   ? 12.136  46.808  14.723  1.00   21.02 ? 115 ASP A CG  1 
ATOM   58    O  OD1 . ASP A  1 8   ? 11.468  46.201  15.581  1.00   22.46 ? 115 ASP A OD1 1 
ATOM   59    O  OD2 . ASP A  1 8   ? 13.378  46.946  14.805  1.00   18.65 ? 115 ASP A OD2 1 
ATOM   60    N  N   . PRO A  1 9   ? 10.395  50.347  12.243  1.00   20.54 ? 116 PRO A N   1 
ATOM   61    C  CA  . PRO A  1 9   ? 9.783   51.035  11.109  1.00   22.16 ? 116 PRO A CA  1 
ATOM   62    C  C   . PRO A  1 9   ? 9.328   50.171  9.942   1.00   21.83 ? 116 PRO A C   1 
ATOM   63    O  O   . PRO A  1 9   ? 8.267   50.420  9.370   1.00   20.26 ? 116 PRO A O   1 
ATOM   64    C  CB  . PRO A  1 9   ? 10.848  52.075  10.717  1.00   22.37 ? 116 PRO A CB  1 
ATOM   65    C  CG  . PRO A  1 9   ? 12.138  51.442  11.181  1.00   22.81 ? 116 PRO A CG  1 
ATOM   66    C  CD  . PRO A  1 9   ? 11.757  50.852  12.507  1.00   20.15 ? 116 PRO A CD  1 
ATOM   67    N  N   . LYS A  1 10  ? 10.100  49.140  9.620   1.00   21.80 ? 117 LYS A N   1 
ATOM   68    C  CA  . LYS A  1 10  ? 9.796   48.282  8.477   1.00   21.98 ? 117 LYS A CA  1 
ATOM   69    C  C   . LYS A  1 10  ? 9.047   46.984  8.779   1.00   21.92 ? 117 LYS A C   1 
ATOM   70    O  O   . LYS A  1 10  ? 8.728   46.219  7.865   1.00   22.62 ? 117 LYS A O   1 
ATOM   71    C  CB  . LYS A  1 10  ? 11.098  47.954  7.738   1.00   21.74 ? 117 LYS A CB  1 
ATOM   72    C  CG  . LYS A  1 10  ? 11.828  49.173  7.202   1.00   24.94 ? 117 LYS A CG  1 
ATOM   73    C  CD  . LYS A  1 10  ? 10.999  49.822  6.108   1.00   32.72 ? 117 LYS A CD  1 
ATOM   74    C  CE  . LYS A  1 10  ? 11.806  50.848  5.327   1.00   39.84 ? 117 LYS A CE  1 
ATOM   75    N  NZ  . LYS A  1 10  ? 11.015  51.460  4.220   1.00   42.65 ? 117 LYS A NZ  1 
ATOM   76    N  N   . PHE A  1 11  ? 8.757   46.733  10.047  1.00   21.03 ? 118 PHE A N   1 
ATOM   77    C  CA  . PHE A  1 11  ? 8.063   45.510  10.418  1.00   19.95 ? 118 PHE A CA  1 
ATOM   78    C  C   . PHE A  1 11  ? 6.754   45.331  9.658   1.00   22.74 ? 118 PHE A C   1 
ATOM   79    O  O   . PHE A  1 11  ? 6.429   44.228  9.211   1.00   21.30 ? 118 PHE A O   1 
ATOM   80    C  CB  . PHE A  1 11  ? 7.797   45.491  11.917  1.00   21.07 ? 118 PHE A CB  1 
ATOM   81    C  CG  . PHE A  1 11  ? 6.981   44.315  12.371  1.00   22.11 ? 118 PHE A CG  1 
ATOM   82    C  CD1 . PHE A  1 11  ? 7.434   43.008  12.167  1.00   18.82 ? 118 PHE A CD1 1 
ATOM   83    C  CD2 . PHE A  1 11  ? 5.751   44.510  12.988  1.00   17.03 ? 118 PHE A CD2 1 
ATOM   84    C  CE1 . PHE A  1 11  ? 6.673   41.914  12.568  1.00   15.44 ? 118 PHE A CE1 1 
ATOM   85    C  CE2 . PHE A  1 11  ? 4.981   43.418  13.397  1.00   19.43 ? 118 PHE A CE2 1 
ATOM   86    C  CZ  . PHE A  1 11  ? 5.448   42.111  13.183  1.00   17.83 ? 118 PHE A CZ  1 
ATOM   87    N  N   . PRO A  1 12  ? 5.971   46.412  9.517   1.00   24.89 ? 119 PRO A N   1 
ATOM   88    C  CA  . PRO A  1 12  ? 4.695   46.334  8.793   1.00   23.63 ? 119 PRO A CA  1 
ATOM   89    C  C   . PRO A  1 12  ? 4.851   45.836  7.359   1.00   23.90 ? 119 PRO A C   1 
ATOM   90    O  O   . PRO A  1 12  ? 3.898   45.317  6.783   1.00   25.75 ? 119 PRO A O   1 
ATOM   91    C  CB  . PRO A  1 12  ? 4.177   47.769  8.858   1.00   21.49 ? 119 PRO A CB  1 
ATOM   92    C  CG  . PRO A  1 12  ? 4.642   48.201  10.215  1.00   22.39 ? 119 PRO A CG  1 
ATOM   93    C  CD  . PRO A  1 12  ? 6.081   47.691  10.247  1.00   23.71 ? 119 PRO A CD  1 
ATOM   94    N  N   . GLN A  1 13  ? 6.040   46.000  6.778   1.00   24.15 ? 120 GLN A N   1 
ATOM   95    C  CA  . GLN A  1 13  ? 6.257   45.527  5.413   1.00   25.49 ? 120 GLN A CA  1 
ATOM   96    C  C   . GLN A  1 13  ? 6.735   44.082  5.375   1.00   24.46 ? 120 GLN A C   1 
ATOM   97    O  O   . GLN A  1 13  ? 6.836   43.478  4.307   1.00   26.80 ? 120 GLN A O   1 
ATOM   98    C  CB  . GLN A  1 13  ? 7.238   46.434  4.673   1.00   26.71 ? 120 GLN A CB  1 
ATOM   99    C  CG  . GLN A  1 13  ? 6.610   47.756  4.307   1.00   35.38 ? 120 GLN A CG  1 
ATOM   100   C  CD  . GLN A  1 13  ? 7.149   48.876  5.137   1.00   45.25 ? 120 GLN A CD  1 
ATOM   101   O  OE1 . GLN A  1 13  ? 8.209   49.426  4.824   1.00   54.73 ? 120 GLN A OE1 1 
ATOM   102   N  NE2 . GLN A  1 13  ? 6.443   49.222  6.221   1.00   46.00 ? 120 GLN A NE2 1 
ATOM   103   N  N   . GLN A  1 14  ? 7.018   43.517  6.541   1.00   22.01 ? 121 GLN A N   1 
ATOM   104   C  CA  . GLN A  1 14  ? 7.470   42.134  6.590   1.00   22.66 ? 121 GLN A CA  1 
ATOM   105   C  C   . GLN A  1 14  ? 6.227   41.243  6.623   1.00   20.79 ? 121 GLN A C   1 
ATOM   106   O  O   . GLN A  1 14  ? 5.946   40.542  7.596   1.00   18.33 ? 121 GLN A O   1 
ATOM   107   C  CB  . GLN A  1 14  ? 8.389   41.923  7.807   1.00   19.12 ? 121 GLN A CB  1 
ATOM   108   C  CG  . GLN A  1 14  ? 9.634   42.801  7.728   1.00   20.97 ? 121 GLN A CG  1 
ATOM   109   C  CD  . GLN A  1 14  ? 10.633  42.585  8.862   1.00   24.15 ? 121 GLN A CD  1 
ATOM   110   O  OE1 . GLN A  1 14  ? 10.368  42.903  10.020  1.00   22.89 ? 121 GLN A OE1 1 
ATOM   111   N  NE2 . GLN A  1 14  ? 11.796  42.054  8.521   1.00   25.35 ? 121 GLN A NE2 1 
ATOM   112   N  N   . TRP A  1 15  ? 5.480   41.307  5.525   1.00   21.14 ? 122 TRP A N   1 
ATOM   113   C  CA  . TRP A  1 15  ? 4.241   40.558  5.335   1.00   20.30 ? 122 TRP A CA  1 
ATOM   114   C  C   . TRP A  1 15  ? 4.350   39.059  5.587   1.00   23.20 ? 122 TRP A C   1 
ATOM   115   O  O   . TRP A  1 15  ? 3.379   38.437  5.999   1.00   25.83 ? 122 TRP A O   1 
ATOM   116   C  CB  . TRP A  1 15  ? 3.739   40.761  3.909   1.00   16.96 ? 122 TRP A CB  1 
ATOM   117   C  CG  . TRP A  1 15  ? 4.770   40.367  2.904   1.00   17.87 ? 122 TRP A CG  1 
ATOM   118   C  CD1 . TRP A  1 15  ? 5.813   41.121  2.466   1.00   14.60 ? 122 TRP A CD1 1 
ATOM   119   C  CD2 . TRP A  1 15  ? 4.874   39.109  2.236   1.00   17.12 ? 122 TRP A CD2 1 
ATOM   120   N  NE1 . TRP A  1 15  ? 6.559   40.418  1.560   1.00   18.17 ? 122 TRP A NE1 1 
ATOM   121   C  CE2 . TRP A  1 15  ? 6.005   39.177  1.399   1.00   19.59 ? 122 TRP A CE2 1 
ATOM   122   C  CE3 . TRP A  1 15  ? 4.120   37.930  2.266   1.00   19.42 ? 122 TRP A CE3 1 
ATOM   123   C  CZ2 . TRP A  1 15  ? 6.402   38.109  0.595   1.00   20.20 ? 122 TRP A CZ2 1 
ATOM   124   C  CZ3 . TRP A  1 15  ? 4.511   36.870  1.472   1.00   18.69 ? 122 TRP A CZ3 1 
ATOM   125   C  CH2 . TRP A  1 15  ? 5.643   36.965  0.644   1.00   24.34 ? 122 TRP A CH2 1 
ATOM   126   N  N   . TYR A  1 16  ? 5.519   38.481  5.316   1.00   23.58 ? 123 TYR A N   1 
ATOM   127   C  CA  . TYR A  1 16  ? 5.738   37.043  5.498   1.00   23.00 ? 123 TYR A CA  1 
ATOM   128   C  C   . TYR A  1 16  ? 5.856   36.627  6.962   1.00   24.06 ? 123 TYR A C   1 
ATOM   129   O  O   . TYR A  1 16  ? 5.726   35.445  7.291   1.00   23.51 ? 123 TYR A O   1 
ATOM   130   C  CB  . TYR A  1 16  ? 7.006   36.613  4.765   1.00   20.09 ? 123 TYR A CB  1 
ATOM   131   C  CG  . TYR A  1 16  ? 8.146   37.601  4.942   1.00   19.29 ? 123 TYR A CG  1 
ATOM   132   C  CD1 . TYR A  1 16  ? 8.213   38.765  4.164   1.00   14.67 ? 123 TYR A CD1 1 
ATOM   133   C  CD2 . TYR A  1 16  ? 9.128   37.405  5.917   1.00   16.29 ? 123 TYR A CD2 1 
ATOM   134   C  CE1 . TYR A  1 16  ? 9.227   39.708  4.355   1.00   17.12 ? 123 TYR A CE1 1 
ATOM   135   C  CE2 . TYR A  1 16  ? 10.157  38.358  6.123   1.00   14.32 ? 123 TYR A CE2 1 
ATOM   136   C  CZ  . TYR A  1 16  ? 10.195  39.504  5.340   1.00   18.15 ? 123 TYR A CZ  1 
ATOM   137   O  OH  . TYR A  1 16  ? 11.164  40.473  5.552   1.00   20.74 ? 123 TYR A OH  1 
ATOM   138   N  N   . LEU A  1 17  ? 6.110   37.585  7.844   1.00   24.20 ? 124 LEU A N   1 
ATOM   139   C  CA  . LEU A  1 17  ? 6.254   37.256  9.260   1.00   27.95 ? 124 LEU A CA  1 
ATOM   140   C  C   . LEU A  1 17  ? 4.897   37.233  9.932   1.00   32.78 ? 124 LEU A C   1 
ATOM   141   O  O   . LEU A  1 17  ? 4.574   36.307  10.684  1.00   30.66 ? 124 LEU A O   1 
ATOM   142   C  CB  . LEU A  1 17  ? 7.149   38.276  9.965   1.00   22.99 ? 124 LEU A CB  1 
ATOM   143   C  CG  . LEU A  1 17  ? 8.590   38.356  9.475   1.00   26.82 ? 124 LEU A CG  1 
ATOM   144   C  CD1 . LEU A  1 17  ? 9.354   39.403  10.276  1.00   23.65 ? 124 LEU A CD1 1 
ATOM   145   C  CD2 . LEU A  1 17  ? 9.248   36.980  9.612   1.00   25.15 ? 124 LEU A CD2 1 
ATOM   146   N  N   . SER A  1 18  ? 4.107   38.260  9.637   1.00   38.92 ? 125 SER A N   1 
ATOM   147   C  CA  . SER A  1 18  ? 2.784   38.412  10.209  1.00   44.51 ? 125 SER A CA  1 
ATOM   148   C  C   . SER A  1 18  ? 1.930   39.243  9.253   1.00   49.08 ? 125 SER A C   1 
ATOM   149   O  O   . SER A  1 18  ? 2.366   40.291  8.765   1.00   49.02 ? 125 SER A O   1 
ATOM   150   C  CB  . SER A  1 18  ? 2.913   39.114  11.559  1.00   42.91 ? 125 SER A CB  1 
ATOM   151   O  OG  . SER A  1 18  ? 1.693   39.115  12.266  1.00   48.37 ? 125 SER A OG  1 
ATOM   152   N  N   . GLY A  1 19  ? 0.720   38.768  8.981   1.00   54.69 ? 126 GLY A N   1 
ATOM   153   C  CA  . GLY A  1 19  ? -0.154  39.489  8.074   1.00   63.13 ? 126 GLY A CA  1 
ATOM   154   C  C   . GLY A  1 19  ? -1.625  39.346  8.419   1.00   68.39 ? 126 GLY A C   1 
ATOM   155   O  O   . GLY A  1 19  ? -2.027  38.448  9.171   1.00   67.79 ? 126 GLY A O   1 
ATOM   156   N  N   . VAL A  1 20  ? -2.432  40.243  7.866   1.00   72.54 ? 127 VAL A N   1 
ATOM   157   C  CA  . VAL A  1 20  ? -3.863  40.215  8.103   1.00   75.94 ? 127 VAL A CA  1 
ATOM   158   C  C   . VAL A  1 20  ? -4.549  39.472  6.957   1.00   78.23 ? 127 VAL A C   1 
ATOM   159   O  O   . VAL A  1 20  ? -5.652  39.841  6.545   1.00   81.46 ? 127 VAL A O   1 
ATOM   160   C  CB  . VAL A  1 20  ? -4.423  41.649  8.198   1.00   75.86 ? 127 VAL A CB  1 
ATOM   161   C  CG1 . VAL A  1 20  ? -3.780  42.370  9.367   0.0000 75.91 ? 127 VAL A CG1 1 
ATOM   162   C  CG2 . VAL A  1 20  ? -4.163  42.401  6.899   0.0000 75.91 ? 127 VAL A CG2 1 
ATOM   163   N  N   . THR A  1 21  ? -3.901  38.427  6.441   1.00   77.28 ? 128 THR A N   1 
ATOM   164   C  CA  . THR A  1 21  ? -4.477  37.676  5.339   1.00   74.83 ? 128 THR A CA  1 
ATOM   165   C  C   . THR A  1 21  ? -4.270  36.179  5.517   1.00   74.24 ? 128 THR A C   1 
ATOM   166   O  O   . THR A  1 21  ? -4.450  35.405  4.565   1.00   75.35 ? 128 THR A O   1 
ATOM   167   C  CB  . THR A  1 21  ? -3.866  38.114  3.992   1.00   73.85 ? 128 THR A CB  1 
ATOM   168   O  OG1 . THR A  1 21  ? -4.546  37.449  2.921   0.0000 74.43 ? 128 THR A OG1 1 
ATOM   169   C  CG2 . THR A  1 21  ? -2.388  37.772  3.941   0.0000 74.43 ? 128 THR A CG2 1 
ATOM   170   N  N   . GLN A  1 22  ? -3.902  35.776  6.734   1.00   71.02 ? 129 GLN A N   1 
ATOM   171   C  CA  . GLN A  1 22  ? -3.666  34.366  7.044   1.00   67.60 ? 129 GLN A CA  1 
ATOM   172   C  C   . GLN A  1 22  ? -2.708  33.683  6.044   1.00   65.31 ? 129 GLN A C   1 
ATOM   173   O  O   . GLN A  1 22  ? -2.659  32.445  5.953   1.00   65.77 ? 129 GLN A O   1 
ATOM   174   C  CB  . GLN A  1 22  ? -4.998  33.604  7.093   1.00   67.27 ? 129 GLN A CB  1 
ATOM   175   C  CG  . GLN A  1 22  ? -5.858  33.905  8.313   0.0000 66.49 ? 129 GLN A CG  1 
ATOM   176   C  CD  . GLN A  1 22  ? -6.543  35.255  8.249   0.0000 66.15 ? 129 GLN A CD  1 
ATOM   177   O  OE1 . GLN A  1 22  ? -5.893  36.294  8.147   0.0000 65.84 ? 129 GLN A OE1 1 
ATOM   178   N  NE2 . GLN A  1 22  ? -7.870  35.244  8.316   0.0000 65.84 ? 129 GLN A NE2 1 
ATOM   179   N  N   . ARG A  1 23  ? -1.947  34.499  5.309   1.00   59.22 ? 130 ARG A N   1 
ATOM   180   C  CA  . ARG A  1 23  ? -0.980  34.017  4.319   1.00   50.78 ? 130 ARG A CA  1 
ATOM   181   C  C   . ARG A  1 23  ? 0.436   34.450  4.750   1.00   46.43 ? 130 ARG A C   1 
ATOM   182   O  O   . ARG A  1 23  ? 1.057   35.307  4.111   1.00   42.40 ? 130 ARG A O   1 
ATOM   183   C  CB  . ARG A  1 23  ? -1.285  34.614  2.936   1.00   51.82 ? 130 ARG A CB  1 
ATOM   184   C  CG  . ARG A  1 23  ? -2.680  34.335  2.366   1.00   50.91 ? 130 ARG A CG  1 
ATOM   185   C  CD  . ARG A  1 23  ? -2.878  32.875  2.021   0.0000 50.79 ? 130 ARG A CD  1 
ATOM   186   N  NE  . ARG A  1 23  ? -4.153  32.654  1.342   0.0000 50.50 ? 130 ARG A NE  1 
ATOM   187   C  CZ  . ARG A  1 23  ? -5.344  32.868  1.893   0.0000 50.37 ? 130 ARG A CZ  1 
ATOM   188   N  NH1 . ARG A  1 23  ? -5.434  33.308  3.141   0.0000 50.33 ? 130 ARG A NH1 1 
ATOM   189   N  NH2 . ARG A  1 23  ? -6.447  32.643  1.194   0.0000 50.33 ? 130 ARG A NH2 1 
ATOM   190   N  N   . ASP A  1 24  ? 0.931   33.865  5.840   1.00   39.99 ? 131 ASP A N   1 
ATOM   191   C  CA  . ASP A  1 24  ? 2.260   34.184  6.359   1.00   33.09 ? 131 ASP A CA  1 
ATOM   192   C  C   . ASP A  1 24  ? 2.897   32.952  7.007   1.00   30.48 ? 131 ASP A C   1 
ATOM   193   O  O   . ASP A  1 24  ? 2.321   31.865  6.980   1.00   27.25 ? 131 ASP A O   1 
ATOM   194   C  CB  . ASP A  1 24  ? 2.176   35.333  7.371   1.00   34.22 ? 131 ASP A CB  1 
ATOM   195   C  CG  . ASP A  1 24  ? 1.217   35.040  8.505   1.00   35.30 ? 131 ASP A CG  1 
ATOM   196   O  OD1 . ASP A  1 24  ? 1.388   33.997  9.169   1.00   36.43 ? 131 ASP A OD1 1 
ATOM   197   O  OD2 . ASP A  1 24  ? 0.295   35.850  8.733   1.00   39.09 ? 131 ASP A OD2 1 
ATOM   198   N  N   . LEU A  1 25  ? 4.078   33.124  7.591   1.00   26.92 ? 132 LEU A N   1 
ATOM   199   C  CA  . LEU A  1 25  ? 4.792   32.014  8.226   1.00   24.16 ? 132 LEU A CA  1 
ATOM   200   C  C   . LEU A  1 25  ? 4.406   31.805  9.696   1.00   22.30 ? 132 LEU A C   1 
ATOM   201   O  O   . LEU A  1 25  ? 5.012   31.000  10.403  1.00   22.47 ? 132 LEU A O   1 
ATOM   202   C  CB  . LEU A  1 25  ? 6.300   32.239  8.098   1.00   23.87 ? 132 LEU A CB  1 
ATOM   203   C  CG  . LEU A  1 25  ? 6.781   32.337  6.640   1.00   21.08 ? 132 LEU A CG  1 
ATOM   204   C  CD1 . LEU A  1 25  ? 8.239   32.697  6.610   1.00   23.41 ? 132 LEU A CD1 1 
ATOM   205   C  CD2 . LEU A  1 25  ? 6.571   31.026  5.927   1.00   19.57 ? 132 LEU A CD2 1 
ATOM   206   N  N   . ASN A  1 26  ? 3.391   32.531  10.150  1.00   20.37 ? 133 ASN A N   1 
ATOM   207   C  CA  . ASN A  1 26  ? 2.905   32.399  11.518  1.00   16.80 ? 133 ASN A CA  1 
ATOM   208   C  C   . ASN A  1 26  ? 3.980   32.549  12.589  1.00   17.77 ? 133 ASN A C   1 
ATOM   209   O  O   . ASN A  1 26  ? 3.978   31.847  13.611  1.00   20.12 ? 133 ASN A O   1 
ATOM   210   C  CB  . ASN A  1 26  ? 2.200   31.055  11.678  1.00   19.35 ? 133 ASN A CB  1 
ATOM   211   C  CG  . ASN A  1 26  ? 1.262   31.045  12.870  1.00   20.14 ? 133 ASN A CG  1 
ATOM   212   O  OD1 . ASN A  1 26  ? 0.678   32.081  13.217  1.00   18.37 ? 133 ASN A OD1 1 
ATOM   213   N  ND2 . ASN A  1 26  ? 1.107   29.881  13.502  1.00   17.85 ? 133 ASN A ND2 1 
ATOM   214   N  N   . VAL A  1 27  ? 4.884   33.495  12.369  1.00   16.38 ? 134 VAL A N   1 
ATOM   215   C  CA  . VAL A  1 27  ? 5.976   33.747  13.302  1.00   18.67 ? 134 VAL A CA  1 
ATOM   216   C  C   . VAL A  1 27  ? 5.559   34.486  14.579  1.00   19.12 ? 134 VAL A C   1 
ATOM   217   O  O   . VAL A  1 27  ? 6.094   34.232  15.663  1.00   16.69 ? 134 VAL A O   1 
ATOM   218   C  CB  . VAL A  1 27  ? 7.100   34.554  12.615  1.00   18.88 ? 134 VAL A CB  1 
ATOM   219   C  CG1 . VAL A  1 27  ? 8.174   34.910  13.611  1.00   15.17 ? 134 VAL A CG1 1 
ATOM   220   C  CG2 . VAL A  1 27  ? 7.687   33.753  11.468  1.00   16.67 ? 134 VAL A CG2 1 
ATOM   221   N  N   . LYS A  1 28  ? 4.623   35.415  14.449  1.00   17.86 ? 135 LYS A N   1 
ATOM   222   C  CA  . LYS A  1 28  ? 4.169   36.152  15.606  1.00   20.45 ? 135 LYS A CA  1 
ATOM   223   C  C   . LYS A  1 28  ? 3.597   35.182  16.649  1.00   19.81 ? 135 LYS A C   1 
ATOM   224   O  O   . LYS A  1 28  ? 3.803   35.363  17.852  1.00   22.77 ? 135 LYS A O   1 
ATOM   225   C  CB  . LYS A  1 28  ? 3.118   37.196  15.191  1.00   23.61 ? 135 LYS A CB  1 
ATOM   226   C  CG  . LYS A  1 28  ? 2.664   38.057  16.354  1.00   26.40 ? 135 LYS A CG  1 
ATOM   227   C  CD  . LYS A  1 28  ? 1.756   39.200  15.925  1.00   32.79 ? 135 LYS A CD  1 
ATOM   228   C  CE  . LYS A  1 28  ? 1.205   39.937  17.161  1.00   33.95 ? 135 LYS A CE  1 
ATOM   229   N  NZ  . LYS A  1 28  ? 0.289   41.073  16.822  1.00   33.79 ? 135 LYS A NZ  1 
ATOM   230   N  N   . ALA A  1 29  ? 2.887   34.155  16.187  1.00   18.86 ? 136 ALA A N   1 
ATOM   231   C  CA  . ALA A  1 29  ? 2.313   33.159  17.089  1.00   21.73 ? 136 ALA A CA  1 
ATOM   232   C  C   . ALA A  1 29  ? 3.412   32.493  17.919  1.00   21.58 ? 136 ALA A C   1 
ATOM   233   O  O   . ALA A  1 29  ? 3.183   32.101  19.063  1.00   27.01 ? 136 ALA A O   1 
ATOM   234   C  CB  . ALA A  1 29  ? 1.534   32.096  16.292  1.00   17.13 ? 136 ALA A CB  1 
ATOM   235   N  N   . ALA A  1 30  ? 4.604   32.359  17.347  1.00   19.19 ? 137 ALA A N   1 
ATOM   236   C  CA  . ALA A  1 30  ? 5.711   31.747  18.083  1.00   19.12 ? 137 ALA A CA  1 
ATOM   237   C  C   . ALA A  1 30  ? 6.273   32.755  19.083  1.00   18.41 ? 137 ALA A C   1 
ATOM   238   O  O   . ALA A  1 30  ? 6.619   32.399  20.207  1.00   17.76 ? 137 ALA A O   1 
ATOM   239   C  CB  . ALA A  1 30  ? 6.810   31.292  17.126  1.00   16.61 ? 137 ALA A CB  1 
ATOM   240   N  N   . TRP A  1 31  ? 6.391   34.008  18.662  1.00   17.47 ? 138 TRP A N   1 
ATOM   241   C  CA  . TRP A  1 31  ? 6.881   35.045  19.557  1.00   20.69 ? 138 TRP A CA  1 
ATOM   242   C  C   . TRP A  1 31  ? 5.932   35.131  20.753  1.00   24.09 ? 138 TRP A C   1 
ATOM   243   O  O   . TRP A  1 31  ? 6.377   35.228  21.898  1.00   21.67 ? 138 TRP A O   1 
ATOM   244   C  CB  . TRP A  1 31  ? 6.901   36.431  18.889  1.00   20.01 ? 138 TRP A CB  1 
ATOM   245   C  CG  . TRP A  1 31  ? 7.862   36.601  17.762  1.00   19.19 ? 138 TRP A CG  1 
ATOM   246   C  CD1 . TRP A  1 31  ? 9.011   35.881  17.532  1.00   16.91 ? 138 TRP A CD1 1 
ATOM   247   C  CD2 . TRP A  1 31  ? 7.789   37.586  16.721  1.00   18.63 ? 138 TRP A CD2 1 
ATOM   248   N  NE1 . TRP A  1 31  ? 9.652   36.361  16.412  1.00   16.00 ? 138 TRP A NE1 1 
ATOM   249   C  CE2 . TRP A  1 31  ? 8.927   37.405  15.894  1.00   16.07 ? 138 TRP A CE2 1 
ATOM   250   C  CE3 . TRP A  1 31  ? 6.877   38.603  16.408  1.00   14.95 ? 138 TRP A CE3 1 
ATOM   251   C  CZ2 . TRP A  1 31  ? 9.174   38.202  14.778  1.00   14.26 ? 138 TRP A CZ2 1 
ATOM   252   C  CZ3 . TRP A  1 31  ? 7.123   39.398  15.296  1.00   18.57 ? 138 TRP A CZ3 1 
ATOM   253   C  CH2 . TRP A  1 31  ? 8.267   39.192  14.491  1.00   17.23 ? 138 TRP A CH2 1 
ATOM   254   N  N   . ALA A  1 32  ? 4.627   35.110  20.471  1.00   23.14 ? 139 ALA A N   1 
ATOM   255   C  CA  . ALA A  1 32  ? 3.617   35.195  21.519  1.00   24.05 ? 139 ALA A CA  1 
ATOM   256   C  C   . ALA A  1 32  ? 3.730   34.028  22.502  1.00   25.66 ? 139 ALA A C   1 
ATOM   257   O  O   . ALA A  1 32  ? 3.410   34.186  23.682  1.00   22.82 ? 139 ALA A O   1 
ATOM   258   C  CB  . ALA A  1 32  ? 2.223   35.230  20.913  1.00   22.24 ? 139 ALA A CB  1 
ATOM   259   N  N   . GLN A  1 33  ? 4.161   32.859  22.019  1.00   23.44 ? 140 GLN A N   1 
ATOM   260   C  CA  . GLN A  1 33  ? 4.340   31.706  22.898  1.00   22.33 ? 140 GLN A CA  1 
ATOM   261   C  C   . GLN A  1 33  ? 5.617   31.889  23.713  1.00   23.34 ? 140 GLN A C   1 
ATOM   262   O  O   . GLN A  1 33  ? 5.930   31.071  24.570  1.00   21.60 ? 140 GLN A O   1 
ATOM   263   C  CB  . GLN A  1 33  ? 4.412   30.411  22.096  1.00   22.11 ? 140 GLN A CB  1 
ATOM   264   C  CG  . GLN A  1 33  ? 3.070   30.007  21.480  1.00   24.22 ? 140 GLN A CG  1 
ATOM   265   C  CD  . GLN A  1 33  ? 3.136   28.721  20.655  1.00   26.51 ? 140 GLN A CD  1 
ATOM   266   O  OE1 . GLN A  1 33  ? 3.435   27.645  21.171  1.00   32.28 ? 140 GLN A OE1 1 
ATOM   267   N  NE2 . GLN A  1 33  ? 2.847   28.831  19.373  1.00   25.97 ? 140 GLN A NE2 1 
ATOM   268   N  N   . GLY A  1 34  ? 6.349   32.968  23.434  1.00   21.18 ? 141 GLY A N   1 
ATOM   269   C  CA  . GLY A  1 34  ? 7.562   33.264  24.177  1.00   23.84 ? 141 GLY A CA  1 
ATOM   270   C  C   . GLY A  1 34  ? 8.891   32.876  23.547  1.00   25.69 ? 141 GLY A C   1 
ATOM   271   O  O   . GLY A  1 34  ? 9.937   32.906  24.217  1.00   24.38 ? 141 GLY A O   1 
ATOM   272   N  N   . TYR A  1 35  ? 8.881   32.527  22.263  1.00   23.45 ? 142 TYR A N   1 
ATOM   273   C  CA  . TYR A  1 35  ? 10.132  32.122  21.608  1.00   23.09 ? 142 TYR A CA  1 
ATOM   274   C  C   . TYR A  1 35  ? 10.664  33.130  20.603  1.00   21.59 ? 142 TYR A C   1 
ATOM   275   O  O   . TYR A  1 35  ? 9.987   33.474  19.637  1.00   20.25 ? 142 TYR A O   1 
ATOM   276   C  CB  . TYR A  1 35  ? 9.946   30.757  20.962  1.00   18.87 ? 142 TYR A CB  1 
ATOM   277   C  CG  . TYR A  1 35  ? 9.516   29.734  21.979  1.00   22.89 ? 142 TYR A CG  1 
ATOM   278   C  CD1 . TYR A  1 35  ? 10.379  29.340  23.010  1.00   22.77 ? 142 TYR A CD1 1 
ATOM   279   C  CD2 . TYR A  1 35  ? 8.215   29.236  21.982  1.00   23.16 ? 142 TYR A CD2 1 
ATOM   280   C  CE1 . TYR A  1 35  ? 9.952   28.488  24.016  1.00   24.98 ? 142 TYR A CE1 1 
ATOM   281   C  CE2 . TYR A  1 35  ? 7.778   28.377  22.991  1.00   26.14 ? 142 TYR A CE2 1 
ATOM   282   C  CZ  . TYR A  1 35  ? 8.646   28.010  23.999  1.00   28.22 ? 142 TYR A CZ  1 
ATOM   283   O  OH  . TYR A  1 35  ? 8.204   27.162  24.989  1.00   31.61 ? 142 TYR A OH  1 
ATOM   284   N  N   . THR A  1 36  ? 11.888  33.595  20.846  1.00   22.45 ? 143 THR A N   1 
ATOM   285   C  CA  . THR A  1 36  ? 12.515  34.613  19.999  1.00   24.51 ? 143 THR A CA  1 
ATOM   286   C  C   . THR A  1 36  ? 13.936  34.225  19.552  1.00   23.81 ? 143 THR A C   1 
ATOM   287   O  O   . THR A  1 36  ? 14.639  35.004  18.895  1.00   22.64 ? 143 THR A O   1 
ATOM   288   C  CB  . THR A  1 36  ? 12.574  35.954  20.758  1.00   24.15 ? 143 THR A CB  1 
ATOM   289   O  OG1 . THR A  1 36  ? 13.460  35.814  21.867  1.00   29.71 ? 143 THR A OG1 1 
ATOM   290   C  CG2 . THR A  1 36  ? 11.206  36.320  21.297  1.00   23.62 ? 143 THR A CG2 1 
ATOM   291   N  N   . GLY A  1 37  ? 14.354  33.016  19.917  1.00   23.31 ? 144 GLY A N   1 
ATOM   292   C  CA  . GLY A  1 37  ? 15.672  32.540  19.541  1.00   19.92 ? 144 GLY A CA  1 
ATOM   293   C  C   . GLY A  1 37  ? 16.738  32.779  20.597  1.00   19.98 ? 144 GLY A C   1 
ATOM   294   O  O   . GLY A  1 37  ? 17.941  32.573  20.353  1.00   16.23 ? 144 GLY A O   1 
ATOM   295   N  N   . HIS A  1 38  ? 16.309  33.202  21.779  1.00   16.77 ? 145 HIS A N   1 
ATOM   296   C  CA  . HIS A  1 38  ? 17.262  33.470  22.837  1.00   18.99 ? 145 HIS A CA  1 
ATOM   297   C  C   . HIS A  1 38  ? 18.116  32.235  23.109  1.00   19.22 ? 145 HIS A C   1 
ATOM   298   O  O   . HIS A  1 38  ? 17.592  31.128  23.244  1.00   18.32 ? 145 HIS A O   1 
ATOM   299   C  CB  . HIS A  1 38  ? 16.551  33.867  24.134  1.00   20.45 ? 145 HIS A CB  1 
ATOM   300   C  CG  . HIS A  1 38  ? 17.454  33.808  25.319  1.00   24.90 ? 145 HIS A CG  1 
ATOM   301   N  ND1 . HIS A  1 38  ? 18.445  34.743  25.534  1.00   32.10 ? 145 HIS A ND1 1 
ATOM   302   C  CD2 . HIS A  1 38  ? 17.628  32.850  26.263  1.00   25.57 ? 145 HIS A CD2 1 
ATOM   303   C  CE1 . HIS A  1 38  ? 19.193  34.361  26.554  1.00   32.89 ? 145 HIS A CE1 1 
ATOM   304   N  NE2 . HIS A  1 38  ? 18.720  33.214  27.013  1.00   31.28 ? 145 HIS A NE2 1 
ATOM   305   N  N   . GLY A  1 39  ? 19.427  32.420  23.186  1.00   19.70 ? 146 GLY A N   1 
ATOM   306   C  CA  . GLY A  1 39  ? 20.307  31.303  23.479  1.00   19.39 ? 146 GLY A CA  1 
ATOM   307   C  C   . GLY A  1 39  ? 20.737  30.440  22.302  1.00   22.10 ? 146 GLY A C   1 
ATOM   308   O  O   . GLY A  1 39  ? 21.595  29.564  22.455  1.00   18.85 ? 146 GLY A O   1 
ATOM   309   N  N   . ILE A  1 40  ? 20.154  30.675  21.129  1.00   19.79 ? 147 ILE A N   1 
ATOM   310   C  CA  . ILE A  1 40  ? 20.499  29.891  19.944  1.00   17.25 ? 147 ILE A CA  1 
ATOM   311   C  C   . ILE A  1 40  ? 21.506  30.635  19.073  1.00   17.68 ? 147 ILE A C   1 
ATOM   312   O  O   . ILE A  1 40  ? 21.438  31.856  18.933  1.00   17.81 ? 147 ILE A O   1 
ATOM   313   C  CB  . ILE A  1 40  ? 19.250  29.568  19.072  1.00   18.80 ? 147 ILE A CB  1 
ATOM   314   C  CG1 . ILE A  1 40  ? 18.172  28.868  19.904  1.00   12.76 ? 147 ILE A CG1 1 
ATOM   315   C  CG2 . ILE A  1 40  ? 19.674  28.668  17.886  1.00   16.31 ? 147 ILE A CG2 1 
ATOM   316   C  CD1 . ILE A  1 40  ? 18.651  27.614  20.626  1.00   15.09 ? 147 ILE A CD1 1 
ATOM   317   N  N   . VAL A  1 41  ? 22.429  29.891  18.472  1.00   16.62 ? 148 VAL A N   1 
ATOM   318   C  CA  . VAL A  1 41  ? 23.457  30.491  17.639  1.00   17.48 ? 148 VAL A CA  1 
ATOM   319   C  C   . VAL A  1 41  ? 23.318  30.026  16.192  1.00   17.92 ? 148 VAL A C   1 
ATOM   320   O  O   . VAL A  1 41  ? 23.286  28.831  15.908  1.00   16.14 ? 148 VAL A O   1 
ATOM   321   C  CB  . VAL A  1 41  ? 24.872  30.116  18.158  1.00   20.67 ? 148 VAL A CB  1 
ATOM   322   C  CG1 . VAL A  1 41  ? 25.927  30.852  17.359  1.00   16.80 ? 148 VAL A CG1 1 
ATOM   323   C  CG2 . VAL A  1 41  ? 24.989  30.440  19.663  1.00   15.68 ? 148 VAL A CG2 1 
ATOM   324   N  N   . VAL A  1 42  ? 23.244  30.988  15.281  1.00   18.17 ? 149 VAL A N   1 
ATOM   325   C  CA  . VAL A  1 42  ? 23.094  30.713  13.859  1.00   16.13 ? 149 VAL A CA  1 
ATOM   326   C  C   . VAL A  1 42  ? 24.224  31.347  13.086  1.00   18.95 ? 149 VAL A C   1 
ATOM   327   O  O   . VAL A  1 42  ? 24.604  32.495  13.348  1.00   19.98 ? 149 VAL A O   1 
ATOM   328   C  CB  . VAL A  1 42  ? 21.783  31.309  13.319  1.00   17.17 ? 149 VAL A CB  1 
ATOM   329   C  CG1 . VAL A  1 42  ? 21.696  31.107  11.799  1.00   12.93 ? 149 VAL A CG1 1 
ATOM   330   C  CG2 . VAL A  1 42  ? 20.601  30.661  14.022  1.00   13.70 ? 149 VAL A CG2 1 
ATOM   331   N  N   . SER A  1 43  ? 24.759  30.612  12.120  1.00   18.70 ? 150 SER A N   1 
ATOM   332   C  CA  . SER A  1 43  ? 25.839  31.151  11.309  1.00   18.72 ? 150 SER A CA  1 
ATOM   333   C  C   . SER A  1 43  ? 25.459  31.145  9.835   1.00   18.42 ? 150 SER A C   1 
ATOM   334   O  O   . SER A  1 43  ? 24.966  30.140  9.313   1.00   18.13 ? 150 SER A O   1 
ATOM   335   C  CB  . SER A  1 43  ? 27.110  30.333  11.519  1.00   21.96 ? 150 SER A CB  1 
ATOM   336   O  OG  . SER A  1 43  ? 28.193  30.886  10.789  1.00   25.04 ? 150 SER A OG  1 
ATOM   337   N  N   . ILE A  1 44  ? 25.691  32.276  9.178   1.00   16.10 ? 151 ILE A N   1 
ATOM   338   C  CA  . ILE A  1 44  ? 25.403  32.456  7.759   1.00   15.18 ? 151 ILE A CA  1 
ATOM   339   C  C   . ILE A  1 44  ? 26.692  32.186  6.956   1.00   16.75 ? 151 ILE A C   1 
ATOM   340   O  O   . ILE A  1 44  ? 27.635  32.986  7.005   1.00   17.77 ? 151 ILE A O   1 
ATOM   341   C  CB  . ILE A  1 44  ? 24.971  33.931  7.477   1.00   17.80 ? 151 ILE A CB  1 
ATOM   342   C  CG1 . ILE A  1 44  ? 23.844  34.363  8.442   1.00   17.36 ? 151 ILE A CG1 1 
ATOM   343   C  CG2 . ILE A  1 44  ? 24.611  34.109  6.003   1.00   10.15 ? 151 ILE A CG2 1 
ATOM   344   C  CD1 . ILE A  1 44  ? 22.548  33.591  8.319   1.00   15.51 ? 151 ILE A CD1 1 
ATOM   345   N  N   . LEU A  1 45  ? 26.744  31.082  6.217   1.00   14.85 ? 152 LEU A N   1 
ATOM   346   C  CA  . LEU A  1 45  ? 27.938  30.777  5.424   1.00   16.51 ? 152 LEU A CA  1 
ATOM   347   C  C   . LEU A  1 45  ? 27.691  31.462  4.091   1.00   18.91 ? 152 LEU A C   1 
ATOM   348   O  O   . LEU A  1 45  ? 26.903  30.983  3.270   1.00   16.68 ? 152 LEU A O   1 
ATOM   349   C  CB  . LEU A  1 45  ? 28.097  29.263  5.230   1.00   13.47 ? 152 LEU A CB  1 
ATOM   350   C  CG  . LEU A  1 45  ? 27.978  28.399  6.492   1.00   17.70 ? 152 LEU A CG  1 
ATOM   351   C  CD1 . LEU A  1 45  ? 28.396  26.982  6.153   1.00   15.73 ? 152 LEU A CD1 1 
ATOM   352   C  CD2 . LEU A  1 45  ? 28.853  28.933  7.608   1.00   13.26 ? 152 LEU A CD2 1 
ATOM   353   N  N   . ASP A  1 46  ? 28.365  32.585  3.871   1.00   17.20 ? 153 ASP A N   1 
ATOM   354   C  CA  . ASP A  1 46  ? 28.125  33.348  2.655   1.00   16.14 ? 153 ASP A CA  1 
ATOM   355   C  C   . ASP A  1 46  ? 29.312  34.220  2.244   1.00   16.87 ? 153 ASP A C   1 
ATOM   356   O  O   . ASP A  1 46  ? 30.467  33.805  2.369   1.00   18.35 ? 153 ASP A O   1 
ATOM   357   C  CB  . ASP A  1 46  ? 26.880  34.212  2.884   1.00   19.44 ? 153 ASP A CB  1 
ATOM   358   C  CG  . ASP A  1 46  ? 26.084  34.446  1.613   1.00   19.53 ? 153 ASP A CG  1 
ATOM   359   O  OD1 . ASP A  1 46  ? 26.376  35.413  0.871   1.00   20.32 ? 153 ASP A OD1 1 
ATOM   360   O  OD2 . ASP A  1 46  ? 25.165  33.644  1.349   1.00   19.00 ? 153 ASP A OD2 1 
ATOM   361   N  N   . ASP A  1 47  ? 29.029  35.432  1.766   1.00   18.46 ? 154 ASP A N   1 
ATOM   362   C  CA  . ASP A  1 47  ? 30.090  36.342  1.324   1.00   20.43 ? 154 ASP A CA  1 
ATOM   363   C  C   . ASP A  1 47  ? 30.528  37.342  2.383   1.00   20.72 ? 154 ASP A C   1 
ATOM   364   O  O   . ASP A  1 47  ? 31.191  38.335  2.073   1.00   22.22 ? 154 ASP A O   1 
ATOM   365   C  CB  . ASP A  1 47  ? 29.688  37.093  0.042   1.00   19.27 ? 154 ASP A CB  1 
ATOM   366   C  CG  . ASP A  1 47  ? 28.470  37.981  0.220   1.00   20.84 ? 154 ASP A CG  1 
ATOM   367   O  OD1 . ASP A  1 47  ? 28.019  38.194  1.365   1.00   20.70 ? 154 ASP A OD1 1 
ATOM   368   O  OD2 . ASP A  1 47  ? 27.964  38.475  -0.811  1.00   22.13 ? 154 ASP A OD2 1 
ATOM   369   N  N   . GLY A  1 48  ? 30.163  37.068  3.632   1.00   20.19 ? 155 GLY A N   1 
ATOM   370   C  CA  . GLY A  1 48  ? 30.528  37.946  4.730   1.00   15.89 ? 155 GLY A CA  1 
ATOM   371   C  C   . GLY A  1 48  ? 29.317  38.514  5.449   1.00   19.73 ? 155 GLY A C   1 
ATOM   372   O  O   . GLY A  1 48  ? 28.173  38.347  5.007   1.00   19.16 ? 155 GLY A O   1 
ATOM   373   N  N   . ILE A  1 49  ? 29.561  39.184  6.568   1.00   15.96 ? 156 ILE A N   1 
ATOM   374   C  CA  . ILE A  1 49  ? 28.486  39.788  7.333   1.00   18.53 ? 156 ILE A CA  1 
ATOM   375   C  C   . ILE A  1 49  ? 28.941  41.138  7.893   1.00   19.46 ? 156 ILE A C   1 
ATOM   376   O  O   . ILE A  1 49  ? 29.994  41.229  8.517   1.00   19.11 ? 156 ILE A O   1 
ATOM   377   C  CB  . ILE A  1 49  ? 28.043  38.864  8.495   1.00   17.92 ? 156 ILE A CB  1 
ATOM   378   C  CG1 . ILE A  1 49  ? 26.896  39.510  9.272   1.00   21.85 ? 156 ILE A CG1 1 
ATOM   379   C  CG2 . ILE A  1 49  ? 29.201  38.619  9.464   1.00   17.74 ? 156 ILE A CG2 1 
ATOM   380   C  CD1 . ILE A  1 49  ? 26.283  38.593  10.365  1.00   20.31 ? 156 ILE A CD1 1 
ATOM   381   N  N   . GLU A  1 50  ? 28.158  42.186  7.645   1.00   19.86 ? 157 GLU A N   1 
ATOM   382   C  CA  . GLU A  1 50  ? 28.501  43.515  8.140   1.00   20.74 ? 157 GLU A CA  1 
ATOM   383   C  C   . GLU A  1 50  ? 28.164  43.517  9.630   1.00   18.85 ? 157 GLU A C   1 
ATOM   384   O  O   . GLU A  1 50  ? 27.077  43.927  10.032  1.00   20.12 ? 157 GLU A O   1 
ATOM   385   C  CB  . GLU A  1 50  ? 27.697  44.578  7.392   1.00   17.89 ? 157 GLU A CB  1 
ATOM   386   C  CG  . GLU A  1 50  ? 28.185  45.993  7.608   1.00   19.69 ? 157 GLU A CG  1 
ATOM   387   C  CD  . GLU A  1 50  ? 27.507  46.994  6.670   1.00   22.09 ? 157 GLU A CD  1 
ATOM   388   O  OE1 . GLU A  1 50  ? 26.312  47.295  6.871   1.00   24.23 ? 157 GLU A OE1 1 
ATOM   389   O  OE2 . GLU A  1 50  ? 28.167  47.477  5.728   1.00   18.92 ? 157 GLU A OE2 1 
ATOM   390   N  N   . LYS A  1 51  ? 29.108  43.056  10.442  1.00   18.01 ? 158 LYS A N   1 
ATOM   391   C  CA  . LYS A  1 51  ? 28.910  42.948  11.884  1.00   21.69 ? 158 LYS A CA  1 
ATOM   392   C  C   . LYS A  1 51  ? 28.586  44.246  12.614  1.00   23.33 ? 158 LYS A C   1 
ATOM   393   O  O   . LYS A  1 51  ? 28.014  44.225  13.706  1.00   24.12 ? 158 LYS A O   1 
ATOM   394   C  CB  . LYS A  1 51  ? 30.131  42.285  12.529  1.00   22.63 ? 158 LYS A CB  1 
ATOM   395   C  CG  . LYS A  1 51  ? 31.438  43.065  12.403  1.00   25.31 ? 158 LYS A CG  1 
ATOM   396   C  CD  . LYS A  1 51  ? 32.607  42.243  12.961  1.00   25.09 ? 158 LYS A CD  1 
ATOM   397   C  CE  . LYS A  1 51  ? 33.861  43.090  13.102  1.00   27.34 ? 158 LYS A CE  1 
ATOM   398   N  NZ  . LYS A  1 51  ? 34.442  43.549  11.804  1.00   26.71 ? 158 LYS A NZ  1 
ATOM   399   N  N   . ASN A  1 52  ? 28.948  45.371  12.011  1.00   22.91 ? 159 ASN A N   1 
ATOM   400   C  CA  . ASN A  1 52  ? 28.697  46.668  12.609  1.00   25.97 ? 159 ASN A CA  1 
ATOM   401   C  C   . ASN A  1 52  ? 27.371  47.272  12.126  1.00   27.05 ? 159 ASN A C   1 
ATOM   402   O  O   . ASN A  1 52  ? 27.047  48.420  12.452  1.00   27.10 ? 159 ASN A O   1 
ATOM   403   C  CB  . ASN A  1 52  ? 29.865  47.611  12.294  1.00   23.90 ? 159 ASN A CB  1 
ATOM   404   C  CG  . ASN A  1 52  ? 30.117  47.762  10.799  1.00   28.78 ? 159 ASN A CG  1 
ATOM   405   O  OD1 . ASN A  1 52  ? 30.096  46.787  10.039  1.00   29.15 ? 159 ASN A OD1 1 
ATOM   406   N  ND2 . ASN A  1 52  ? 30.378  48.990  10.374  1.00   28.90 ? 159 ASN A ND2 1 
ATOM   407   N  N   . HIS A  1 53  ? 26.607  46.513  11.346  1.00   23.33 ? 160 HIS A N   1 
ATOM   408   C  CA  . HIS A  1 53  ? 25.335  47.034  10.869  1.00   20.62 ? 160 HIS A CA  1 
ATOM   409   C  C   . HIS A  1 53  ? 24.468  47.343  12.090  1.00   22.70 ? 160 HIS A C   1 
ATOM   410   O  O   . HIS A  1 53  ? 24.374  46.534  13.018  1.00   21.23 ? 160 HIS A O   1 
ATOM   411   C  CB  . HIS A  1 53  ? 24.624  46.019  9.971   1.00   18.15 ? 160 HIS A CB  1 
ATOM   412   C  CG  . HIS A  1 53  ? 23.420  46.580  9.287   1.00   19.05 ? 160 HIS A CG  1 
ATOM   413   N  ND1 . HIS A  1 53  ? 22.290  46.972  9.976   1.00   15.95 ? 160 HIS A ND1 1 
ATOM   414   C  CD2 . HIS A  1 53  ? 23.197  46.888  7.985   1.00   17.74 ? 160 HIS A CD2 1 
ATOM   415   C  CE1 . HIS A  1 53  ? 21.426  47.499  9.128   1.00   19.45 ? 160 HIS A CE1 1 
ATOM   416   N  NE2 . HIS A  1 53  ? 21.949  47.463  7.914   1.00   20.24 ? 160 HIS A NE2 1 
ATOM   417   N  N   . PRO A  1 54  ? 23.832  48.528  12.112  1.00   22.93 ? 161 PRO A N   1 
ATOM   418   C  CA  . PRO A  1 54  ? 22.983  48.901  13.246  1.00   21.60 ? 161 PRO A CA  1 
ATOM   419   C  C   . PRO A  1 54  ? 21.866  47.916  13.593  1.00   21.62 ? 161 PRO A C   1 
ATOM   420   O  O   . PRO A  1 54  ? 21.401  47.885  14.734  1.00   20.50 ? 161 PRO A O   1 
ATOM   421   C  CB  . PRO A  1 54  ? 22.471  50.304  12.869  1.00   20.22 ? 161 PRO A CB  1 
ATOM   422   C  CG  . PRO A  1 54  ? 22.704  50.407  11.377  1.00   26.19 ? 161 PRO A CG  1 
ATOM   423   C  CD  . PRO A  1 54  ? 23.986  49.650  11.169  1.00   23.07 ? 161 PRO A CD  1 
ATOM   424   N  N   . ASP A  1 55  ? 21.439  47.094  12.640  1.00   20.77 ? 162 ASP A N   1 
ATOM   425   C  CA  . ASP A  1 55  ? 20.386  46.132  12.964  1.00   23.38 ? 162 ASP A CA  1 
ATOM   426   C  C   . ASP A  1 55  ? 20.945  44.730  13.221  1.00   22.59 ? 162 ASP A C   1 
ATOM   427   O  O   . ASP A  1 55  ? 20.180  43.782  13.433  1.00   22.31 ? 162 ASP A O   1 
ATOM   428   C  CB  . ASP A  1 55  ? 19.318  46.093  11.864  1.00   19.43 ? 162 ASP A CB  1 
ATOM   429   C  CG  . ASP A  1 55  ? 17.897  46.082  12.429  1.00   20.60 ? 162 ASP A CG  1 
ATOM   430   O  OD1 . ASP A  1 55  ? 17.719  46.518  13.584  1.00   18.44 ? 162 ASP A OD1 1 
ATOM   431   O  OD2 . ASP A  1 55  ? 16.952  45.667  11.714  1.00   21.37 ? 162 ASP A OD2 1 
ATOM   432   N  N   . LEU A  1 56  ? 22.277  44.610  13.223  1.00   20.98 ? 163 LEU A N   1 
ATOM   433   C  CA  . LEU A  1 56  ? 22.943  43.323  13.473  1.00   20.51 ? 163 LEU A CA  1 
ATOM   434   C  C   . LEU A  1 56  ? 23.917  43.336  14.663  1.00   22.43 ? 163 LEU A C   1 
ATOM   435   O  O   . LEU A  1 56  ? 24.062  42.336  15.383  1.00   20.61 ? 163 LEU A O   1 
ATOM   436   C  CB  . LEU A  1 56  ? 23.716  42.864  12.234  1.00   18.26 ? 163 LEU A CB  1 
ATOM   437   C  CG  . LEU A  1 56  ? 22.950  42.594  10.934  1.00   21.63 ? 163 LEU A CG  1 
ATOM   438   C  CD1 . LEU A  1 56  ? 23.953  42.286  9.828   1.00   15.91 ? 163 LEU A CD1 1 
ATOM   439   C  CD2 . LEU A  1 56  ? 21.958  41.445  11.125  1.00   15.20 ? 163 LEU A CD2 1 
ATOM   440   N  N   . ALA A  1 57  ? 24.590  44.463  14.867  1.00   23.10 ? 164 ALA A N   1 
ATOM   441   C  CA  . ALA A  1 57  ? 25.574  44.578  15.944  1.00   23.02 ? 164 ALA A CA  1 
ATOM   442   C  C   . ALA A  1 57  ? 25.120  44.002  17.279  1.00   21.22 ? 164 ALA A C   1 
ATOM   443   O  O   . ALA A  1 57  ? 25.858  43.266  17.927  1.00   20.59 ? 164 ALA A O   1 
ATOM   444   C  CB  . ALA A  1 57  ? 25.983  46.036  16.133  1.00   19.37 ? 164 ALA A CB  1 
ATOM   445   N  N   . GLY A  1 58  ? 23.903  44.338  17.676  1.00   18.99 ? 165 GLY A N   1 
ATOM   446   C  CA  . GLY A  1 58  ? 23.395  43.877  18.946  1.00   19.75 ? 165 GLY A CA  1 
ATOM   447   C  C   . GLY A  1 58  ? 23.318  42.376  19.112  1.00   21.76 ? 165 GLY A C   1 
ATOM   448   O  O   . GLY A  1 58  ? 23.340  41.874  20.239  1.00   20.71 ? 165 GLY A O   1 
ATOM   449   N  N   . ASN A  1 59  ? 23.204  41.648  18.006  1.00   22.23 ? 166 ASN A N   1 
ATOM   450   C  CA  . ASN A  1 59  ? 23.129  40.188  18.091  1.00   22.48 ? 166 ASN A CA  1 
ATOM   451   C  C   . ASN A  1 59  ? 24.382  39.496  17.550  1.00   23.78 ? 166 ASN A C   1 
ATOM   452   O  O   . ASN A  1 59  ? 24.513  38.272  17.674  1.00   20.64 ? 166 ASN A O   1 
ATOM   453   C  CB  . ASN A  1 59  ? 21.919  39.659  17.324  1.00   18.46 ? 166 ASN A CB  1 
ATOM   454   C  CG  . ASN A  1 59  ? 20.630  39.928  18.030  1.00   19.92 ? 166 ASN A CG  1 
ATOM   455   O  OD1 . ASN A  1 59  ? 20.608  40.055  19.252  1.00   23.52 ? 166 ASN A OD1 1 
ATOM   456   N  ND2 . ASN A  1 59  ? 19.534  39.996  17.274  1.00   18.64 ? 166 ASN A ND2 1 
ATOM   457   N  N   . TYR A  1 60  ? 25.296  40.273  16.959  1.00   20.23 ? 167 TYR A N   1 
ATOM   458   C  CA  . TYR A  1 60  ? 26.505  39.698  16.377  1.00   21.30 ? 167 TYR A CA  1 
ATOM   459   C  C   . TYR A  1 60  ? 27.294  38.828  17.353  1.00   21.89 ? 167 TYR A C   1 
ATOM   460   O  O   . TYR A  1 60  ? 27.486  39.185  18.518  1.00   21.57 ? 167 TYR A O   1 
ATOM   461   C  CB  . TYR A  1 60  ? 27.424  40.796  15.832  1.00   18.19 ? 167 TYR A CB  1 
ATOM   462   C  CG  . TYR A  1 60  ? 28.670  40.226  15.177  1.00   20.82 ? 167 TYR A CG  1 
ATOM   463   C  CD1 . TYR A  1 60  ? 28.587  39.517  13.973  1.00   15.29 ? 167 TYR A CD1 1 
ATOM   464   C  CD2 . TYR A  1 60  ? 29.926  40.340  15.789  1.00   22.44 ? 167 TYR A CD2 1 
ATOM   465   C  CE1 . TYR A  1 60  ? 29.704  38.933  13.400  1.00   17.68 ? 167 TYR A CE1 1 
ATOM   466   C  CE2 . TYR A  1 60  ? 31.069  39.753  15.216  1.00   18.62 ? 167 TYR A CE2 1 
ATOM   467   C  CZ  . TYR A  1 60  ? 30.948  39.052  14.023  1.00   22.62 ? 167 TYR A CZ  1 
ATOM   468   O  OH  . TYR A  1 60  ? 32.060  38.469  13.446  1.00   21.35 ? 167 TYR A OH  1 
ATOM   469   N  N   . ASP A  1 61  ? 27.753  37.682  16.867  1.00   21.74 ? 168 ASP A N   1 
ATOM   470   C  CA  . ASP A  1 61  ? 28.527  36.757  17.687  1.00   23.21 ? 168 ASP A CA  1 
ATOM   471   C  C   . ASP A  1 61  ? 29.802  36.323  16.969  1.00   23.58 ? 168 ASP A C   1 
ATOM   472   O  O   . ASP A  1 61  ? 29.764  35.537  16.019  1.00   24.80 ? 168 ASP A O   1 
ATOM   473   C  CB  . ASP A  1 61  ? 27.689  35.531  18.050  1.00   23.29 ? 168 ASP A CB  1 
ATOM   474   C  CG  . ASP A  1 61  ? 28.493  34.472  18.778  1.00   27.03 ? 168 ASP A CG  1 
ATOM   475   O  OD1 . ASP A  1 61  ? 29.680  34.709  19.086  1.00   28.48 ? 168 ASP A OD1 1 
ATOM   476   O  OD2 . ASP A  1 61  ? 27.935  33.397  19.046  1.00   28.45 ? 168 ASP A OD2 1 
ATOM   477   N  N   . PRO A  1 62  ? 30.956  36.831  17.428  1.00   24.96 ? 169 PRO A N   1 
ATOM   478   C  CA  . PRO A  1 62  ? 32.281  36.534  16.868  1.00   23.52 ? 169 PRO A CA  1 
ATOM   479   C  C   . PRO A  1 62  ? 32.587  35.047  16.898  1.00   24.91 ? 169 PRO A C   1 
ATOM   480   O  O   . PRO A  1 62  ? 33.302  34.540  16.036  1.00   25.43 ? 169 PRO A O   1 
ATOM   481   C  CB  . PRO A  1 62  ? 33.241  37.303  17.784  1.00   24.40 ? 169 PRO A CB  1 
ATOM   482   C  CG  . PRO A  1 62  ? 32.391  38.354  18.430  1.00   22.41 ? 169 PRO A CG  1 
ATOM   483   C  CD  . PRO A  1 62  ? 31.072  37.667  18.640  1.00   23.86 ? 169 PRO A CD  1 
ATOM   484   N  N   . GLY A  1 63  ? 32.053  34.353  17.900  1.00   21.38 ? 170 GLY A N   1 
ATOM   485   C  CA  . GLY A  1 63  ? 32.304  32.928  18.012  1.00   20.38 ? 170 GLY A CA  1 
ATOM   486   C  C   . GLY A  1 63  ? 31.609  32.115  16.941  1.00   21.77 ? 170 GLY A C   1 
ATOM   487   O  O   . GLY A  1 63  ? 31.917  30.945  16.748  1.00   21.63 ? 170 GLY A O   1 
ATOM   488   N  N   . ALA A  1 64  ? 30.655  32.727  16.249  1.00   19.04 ? 171 ALA A N   1 
ATOM   489   C  CA  . ALA A  1 64  ? 29.928  32.034  15.195  1.00   20.49 ? 171 ALA A CA  1 
ATOM   490   C  C   . ALA A  1 64  ? 30.388  32.564  13.855  1.00   20.20 ? 171 ALA A C   1 
ATOM   491   O  O   . ALA A  1 64  ? 29.736  32.346  12.840  1.00   21.44 ? 171 ALA A O   1 
ATOM   492   C  CB  . ALA A  1 64  ? 28.430  32.272  15.346  1.00   18.44 ? 171 ALA A CB  1 
ATOM   493   N  N   . SER A  1 65  ? 31.525  33.252  13.861  1.00   21.46 ? 172 SER A N   1 
ATOM   494   C  CA  . SER A  1 65  ? 32.041  33.872  12.653  1.00   21.31 ? 172 SER A CA  1 
ATOM   495   C  C   . SER A  1 65  ? 33.496  33.576  12.361  1.00   22.82 ? 172 SER A C   1 
ATOM   496   O  O   . SER A  1 65  ? 34.275  33.206  13.251  1.00   20.95 ? 172 SER A O   1 
ATOM   497   C  CB  . SER A  1 65  ? 31.887  35.398  12.741  1.00   19.44 ? 172 SER A CB  1 
ATOM   498   O  OG  . SER A  1 65  ? 30.556  35.782  13.011  1.00   20.15 ? 172 SER A OG  1 
ATOM   499   N  N   . PHE A  1 66  ? 33.851  33.758  11.092  1.00   22.13 ? 173 PHE A N   1 
ATOM   500   C  CA  . PHE A  1 66  ? 35.219  33.579  10.649  1.00   23.28 ? 173 PHE A CA  1 
ATOM   501   C  C   . PHE A  1 66  ? 35.344  33.977  9.186   1.00   22.79 ? 173 PHE A C   1 
ATOM   502   O  O   . PHE A  1 66  ? 34.349  33.996  8.455   1.00   19.23 ? 173 PHE A O   1 
ATOM   503   C  CB  . PHE A  1 66  ? 35.669  32.134  10.818  1.00   23.09 ? 173 PHE A CB  1 
ATOM   504   C  CG  . PHE A  1 66  ? 37.158  31.988  10.851  1.00   26.81 ? 173 PHE A CG  1 
ATOM   505   C  CD1 . PHE A  1 66  ? 37.866  32.238  12.024  1.00   24.92 ? 173 PHE A CD1 1 
ATOM   506   C  CD2 . PHE A  1 66  ? 37.865  31.654  9.695   1.00   27.21 ? 173 PHE A CD2 1 
ATOM   507   C  CE1 . PHE A  1 66  ? 39.267  32.157  12.049  1.00   26.07 ? 173 PHE A CE1 1 
ATOM   508   C  CE2 . PHE A  1 66  ? 39.265  31.572  9.712   1.00   26.76 ? 173 PHE A CE2 1 
ATOM   509   C  CZ  . PHE A  1 66  ? 39.963  31.824  10.892  1.00   25.49 ? 173 PHE A CZ  1 
ATOM   510   N  N   . ASP A  1 67  ? 36.563  34.302  8.759   1.00   21.08 ? 174 ASP A N   1 
ATOM   511   C  CA  . ASP A  1 67  ? 36.807  34.679  7.371   1.00   22.15 ? 174 ASP A CA  1 
ATOM   512   C  C   . ASP A  1 67  ? 37.703  33.601  6.774   1.00   24.77 ? 174 ASP A C   1 
ATOM   513   O  O   . ASP A  1 67  ? 38.916  33.619  6.953   1.00   26.50 ? 174 ASP A O   1 
ATOM   514   C  CB  . ASP A  1 67  ? 37.499  36.048  7.280   1.00   21.23 ? 174 ASP A CB  1 
ATOM   515   C  CG  . ASP A  1 67  ? 37.781  36.486  5.826   1.00   19.60 ? 174 ASP A CG  1 
ATOM   516   O  OD1 . ASP A  1 67  ? 37.733  35.643  4.913   1.00   16.77 ? 174 ASP A OD1 1 
ATOM   517   O  OD2 . ASP A  1 67  ? 38.075  37.677  5.594   1.00   19.90 ? 174 ASP A OD2 1 
ATOM   518   N  N   . VAL A  1 68  ? 37.090  32.655  6.072   1.00   24.22 ? 175 VAL A N   1 
ATOM   519   C  CA  . VAL A  1 68  ? 37.833  31.566  5.466   1.00   26.67 ? 175 VAL A CA  1 
ATOM   520   C  C   . VAL A  1 68  ? 38.538  32.017  4.189   1.00   25.56 ? 175 VAL A C   1 
ATOM   521   O  O   . VAL A  1 68  ? 39.592  31.498  3.847   1.00   26.97 ? 175 VAL A O   1 
ATOM   522   C  CB  . VAL A  1 68  ? 36.903  30.352  5.141   1.00   27.92 ? 175 VAL A CB  1 
ATOM   523   C  CG1 . VAL A  1 68  ? 37.692  29.271  4.422   1.00   29.28 ? 175 VAL A CG1 1 
ATOM   524   C  CG2 . VAL A  1 68  ? 36.300  29.785  6.417   1.00   25.59 ? 175 VAL A CG2 1 
ATOM   525   N  N   . ASN A  1 69  ? 37.963  32.989  3.493   1.00   25.60 ? 176 ASN A N   1 
ATOM   526   C  CA  . ASN A  1 69  ? 38.561  33.497  2.260   1.00   25.52 ? 176 ASN A CA  1 
ATOM   527   C  C   . ASN A  1 69  ? 39.931  34.156  2.496   1.00   27.79 ? 176 ASN A C   1 
ATOM   528   O  O   . ASN A  1 69  ? 40.859  33.933  1.722   1.00   28.96 ? 176 ASN A O   1 
ATOM   529   C  CB  . ASN A  1 69  ? 37.626  34.510  1.587   1.00   24.42 ? 176 ASN A CB  1 
ATOM   530   C  CG  . ASN A  1 69  ? 36.396  33.862  0.931   1.00   24.85 ? 176 ASN A CG  1 
ATOM   531   O  OD1 . ASN A  1 69  ? 35.300  34.429  0.958   1.00   24.29 ? 176 ASN A OD1 1 
ATOM   532   N  ND2 . ASN A  1 69  ? 36.579  32.696  0.325   1.00   20.37 ? 176 ASN A ND2 1 
ATOM   533   N  N   . ASP A  1 70  ? 40.058  34.975  3.542   1.00   28.60 ? 177 ASP A N   1 
ATOM   534   C  CA  . ASP A  1 70  ? 41.336  35.625  3.834   1.00   29.25 ? 177 ASP A CA  1 
ATOM   535   C  C   . ASP A  1 70  ? 42.040  35.051  5.063   1.00   31.25 ? 177 ASP A C   1 
ATOM   536   O  O   . ASP A  1 70  ? 43.082  35.551  5.475   1.00   31.21 ? 177 ASP A O   1 
ATOM   537   C  CB  . ASP A  1 70  ? 41.164  37.131  4.031   1.00   30.76 ? 177 ASP A CB  1 
ATOM   538   C  CG  . ASP A  1 70  ? 40.860  37.869  2.738   1.00   35.40 ? 177 ASP A CG  1 
ATOM   539   O  OD1 . ASP A  1 70  ? 41.117  37.329  1.632   1.00   36.12 ? 177 ASP A OD1 1 
ATOM   540   O  OD2 . ASP A  1 70  ? 40.367  39.011  2.835   1.00   35.01 ? 177 ASP A OD2 1 
ATOM   541   N  N   . GLN A  1 71  ? 41.466  34.009  5.655   1.00   32.81 ? 178 GLN A N   1 
ATOM   542   C  CA  . GLN A  1 71  ? 42.064  33.377  6.827   1.00   32.17 ? 178 GLN A CA  1 
ATOM   543   C  C   . GLN A  1 71  ? 42.266  34.287  8.026   1.00   31.06 ? 178 GLN A C   1 
ATOM   544   O  O   . GLN A  1 71  ? 43.388  34.471  8.478   1.00   34.10 ? 178 GLN A O   1 
ATOM   545   C  CB  . GLN A  1 71  ? 43.409  32.738  6.465   1.00   32.81 ? 178 GLN A CB  1 
ATOM   546   C  CG  . GLN A  1 71  ? 43.357  31.219  6.400   1.00   39.35 ? 178 GLN A CG  1 
ATOM   547   C  CD  . GLN A  1 71  ? 42.583  30.694  5.200   1.00   38.79 ? 178 GLN A CD  1 
ATOM   548   O  OE1 . GLN A  1 71  ? 42.064  29.578  5.227   0.0000 39.09 ? 178 GLN A OE1 1 
ATOM   549   N  NE2 . GLN A  1 71  ? 42.514  31.491  4.141   0.0000 39.09 ? 178 GLN A NE2 1 
ATOM   550   N  N   . ASP A  1 72  ? 41.191  34.886  8.517   1.00   29.85 ? 179 ASP A N   1 
ATOM   551   C  CA  . ASP A  1 72  ? 41.265  35.713  9.707   1.00   27.15 ? 179 ASP A CA  1 
ATOM   552   C  C   . ASP A  1 72  ? 39.907  35.571  10.369  1.00   28.82 ? 179 ASP A C   1 
ATOM   553   O  O   . ASP A  1 72  ? 38.974  35.043  9.771   1.00   30.37 ? 179 ASP A O   1 
ATOM   554   C  CB  . ASP A  1 72  ? 41.629  37.176  9.392   1.00   25.85 ? 179 ASP A CB  1 
ATOM   555   C  CG  . ASP A  1 72  ? 40.561  37.912  8.626   1.00   26.57 ? 179 ASP A CG  1 
ATOM   556   O  OD1 . ASP A  1 72  ? 39.480  38.143  9.194   1.00   25.64 ? 179 ASP A OD1 1 
ATOM   557   O  OD2 . ASP A  1 72  ? 40.812  38.273  7.453   1.00   27.44 ? 179 ASP A OD2 1 
ATOM   558   N  N   . PRO A  1 73  ? 39.777  36.011  11.620  1.00   28.70 ? 180 PRO A N   1 
ATOM   559   C  CA  . PRO A  1 73  ? 38.475  35.860  12.271  1.00   29.03 ? 180 PRO A CA  1 
ATOM   560   C  C   . PRO A  1 73  ? 37.415  36.921  12.005  1.00   27.06 ? 180 PRO A C   1 
ATOM   561   O  O   . PRO A  1 73  ? 36.314  36.811  12.526  1.00   27.70 ? 180 PRO A O   1 
ATOM   562   C  CB  . PRO A  1 73  ? 38.853  35.766  13.748  1.00   29.29 ? 180 PRO A CB  1 
ATOM   563   C  CG  . PRO A  1 73  ? 40.040  36.682  13.840  1.00   29.88 ? 180 PRO A CG  1 
ATOM   564   C  CD  . PRO A  1 73  ? 40.829  36.384  12.585  1.00   27.60 ? 180 PRO A CD  1 
ATOM   565   N  N   . ASP A  1 74  ? 37.737  37.920  11.186  1.00   25.52 ? 181 ASP A N   1 
ATOM   566   C  CA  . ASP A  1 74  ? 36.819  39.021  10.886  1.00   24.96 ? 181 ASP A CA  1 
ATOM   567   C  C   . ASP A  1 74  ? 36.093  38.823  9.549   1.00   25.87 ? 181 ASP A C   1 
ATOM   568   O  O   . ASP A  1 74  ? 36.684  39.000  8.471   1.00   24.89 ? 181 ASP A O   1 
ATOM   569   C  CB  . ASP A  1 74  ? 37.601  40.336  10.856  1.00   27.36 ? 181 ASP A CB  1 
ATOM   570   C  CG  . ASP A  1 74  ? 36.700  41.566  10.752  1.00   31.59 ? 181 ASP A CG  1 
ATOM   571   O  OD1 . ASP A  1 74  ? 35.489  41.434  10.463  1.00   31.37 ? 181 ASP A OD1 1 
ATOM   572   O  OD2 . ASP A  1 74  ? 37.219  42.680  10.960  1.00   32.45 ? 181 ASP A OD2 1 
ATOM   573   N  N   . PRO A  1 75  ? 34.787  38.495  9.606   1.00   23.99 ? 182 PRO A N   1 
ATOM   574   C  CA  . PRO A  1 75  ? 33.929  38.255  8.439   1.00   21.96 ? 182 PRO A CA  1 
ATOM   575   C  C   . PRO A  1 75  ? 33.412  39.496  7.709   1.00   20.36 ? 182 PRO A C   1 
ATOM   576   O  O   . PRO A  1 75  ? 32.555  39.381  6.840   1.00   19.83 ? 182 PRO A O   1 
ATOM   577   C  CB  . PRO A  1 75  ? 32.791  37.444  9.026   1.00   22.10 ? 182 PRO A CB  1 
ATOM   578   C  CG  . PRO A  1 75  ? 32.581  38.141  10.344  1.00   26.66 ? 182 PRO A CG  1 
ATOM   579   C  CD  . PRO A  1 75  ? 34.007  38.386  10.854  1.00   22.26 ? 182 PRO A CD  1 
ATOM   580   N  N   . GLN A  1 76  ? 33.925  40.674  8.044   1.00   20.66 ? 183 GLN A N   1 
ATOM   581   C  CA  . GLN A  1 76  ? 33.466  41.899  7.390   1.00   21.63 ? 183 GLN A CA  1 
ATOM   582   C  C   . GLN A  1 76  ? 33.491  41.744  5.867   1.00   22.25 ? 183 GLN A C   1 
ATOM   583   O  O   . GLN A  1 76  ? 34.453  41.236  5.308   1.00   21.91 ? 183 GLN A O   1 
ATOM   584   C  CB  . GLN A  1 76  ? 34.360  43.073  7.777   1.00   19.97 ? 183 GLN A CB  1 
ATOM   585   C  CG  . GLN A  1 76  ? 33.775  44.431  7.426   1.00   21.58 ? 183 GLN A CG  1 
ATOM   586   C  CD  . GLN A  1 76  ? 32.665  44.827  8.376   1.00   23.54 ? 183 GLN A CD  1 
ATOM   587   O  OE1 . GLN A  1 76  ? 32.657  44.397  9.522   1.00   26.80 ? 183 GLN A OE1 1 
ATOM   588   N  NE2 . GLN A  1 76  ? 31.740  45.663  7.918   1.00   24.37 ? 183 GLN A NE2 1 
ATOM   589   N  N   . PRO A  1 77  ? 32.431  42.189  5.179   1.00   22.26 ? 184 PRO A N   1 
ATOM   590   C  CA  . PRO A  1 77  ? 32.379  42.078  3.713   1.00   23.78 ? 184 PRO A CA  1 
ATOM   591   C  C   . PRO A  1 77  ? 33.426  42.967  3.038   1.00   23.27 ? 184 PRO A C   1 
ATOM   592   O  O   . PRO A  1 77  ? 33.881  43.950  3.630   1.00   24.31 ? 184 PRO A O   1 
ATOM   593   C  CB  . PRO A  1 77  ? 30.961  42.549  3.370   1.00   22.12 ? 184 PRO A CB  1 
ATOM   594   C  CG  . PRO A  1 77  ? 30.188  42.340  4.637   1.00   23.89 ? 184 PRO A CG  1 
ATOM   595   C  CD  . PRO A  1 77  ? 31.177  42.751  5.705   1.00   23.82 ? 184 PRO A CD  1 
ATOM   596   N  N   . ARG A  1 78  ? 33.800  42.613  1.810   1.00   20.29 ? 185 ARG A N   1 
ATOM   597   C  CA  . ARG A  1 78  ? 34.752  43.394  1.029   1.00   19.41 ? 185 ARG A CA  1 
ATOM   598   C  C   . ARG A  1 78  ? 33.914  44.385  0.236   1.00   21.12 ? 185 ARG A C   1 
ATOM   599   O  O   . ARG A  1 78  ? 33.089  43.978  -0.592  1.00   19.91 ? 185 ARG A O   1 
ATOM   600   C  CB  . ARG A  1 78  ? 35.526  42.494  0.066   1.00   20.33 ? 185 ARG A CB  1 
ATOM   601   C  CG  . ARG A  1 78  ? 36.387  43.261  -0.949  1.00   21.71 ? 185 ARG A CG  1 
ATOM   602   C  CD  . ARG A  1 78  ? 37.299  42.311  -1.719  1.00   17.91 ? 185 ARG A CD  1 
ATOM   603   N  NE  . ARG A  1 78  ? 36.538  41.387  -2.557  1.00   18.58 ? 185 ARG A NE  1 
ATOM   604   C  CZ  . ARG A  1 78  ? 36.096  41.672  -3.779  1.00   21.50 ? 185 ARG A CZ  1 
ATOM   605   N  NH1 . ARG A  1 78  ? 35.401  40.775  -4.471  1.00   16.09 ? 185 ARG A NH1 1 
ATOM   606   N  NH2 . ARG A  1 78  ? 36.368  42.851  -4.323  1.00   20.80 ? 185 ARG A NH2 1 
ATOM   607   N  N   . TYR A  1 79  ? 34.116  45.680  0.482   1.00   20.46 ? 186 TYR A N   1 
ATOM   608   C  CA  . TYR A  1 79  ? 33.329  46.697  -0.211  1.00   24.60 ? 186 TYR A CA  1 
ATOM   609   C  C   . TYR A  1 79  ? 33.760  46.998  -1.638  1.00   25.16 ? 186 TYR A C   1 
ATOM   610   O  O   . TYR A  1 79  ? 34.937  47.170  -1.906  1.00   28.08 ? 186 TYR A O   1 
ATOM   611   C  CB  . TYR A  1 79  ? 33.313  47.992  0.603   1.00   21.37 ? 186 TYR A CB  1 
ATOM   612   C  CG  . TYR A  1 79  ? 32.672  47.828  1.964   1.00   24.21 ? 186 TYR A CG  1 
ATOM   613   C  CD1 . TYR A  1 79  ? 33.413  47.394  3.069   1.00   24.72 ? 186 TYR A CD1 1 
ATOM   614   C  CD2 . TYR A  1 79  ? 31.303  48.024  2.131   1.00   21.95 ? 186 TYR A CD2 1 
ATOM   615   C  CE1 . TYR A  1 79  ? 32.796  47.156  4.304   1.00   22.53 ? 186 TYR A CE1 1 
ATOM   616   C  CE2 . TYR A  1 79  ? 30.676  47.788  3.354   1.00   21.49 ? 186 TYR A CE2 1 
ATOM   617   C  CZ  . TYR A  1 79  ? 31.420  47.354  4.434   1.00   23.83 ? 186 TYR A CZ  1 
ATOM   618   O  OH  . TYR A  1 79  ? 30.777  47.106  5.633   1.00   23.16 ? 186 TYR A OH  1 
ATOM   619   N  N   . THR A  1 80  ? 32.797  47.040  -2.551  1.00   24.99 ? 187 THR A N   1 
ATOM   620   C  CA  . THR A  1 80  ? 33.074  47.347  -3.948  1.00   28.97 ? 187 THR A CA  1 
ATOM   621   C  C   . THR A  1 80  ? 31.948  48.249  -4.457  1.00   36.00 ? 187 THR A C   1 
ATOM   622   O  O   . THR A  1 80  ? 30.850  48.266  -3.886  1.00   34.61 ? 187 THR A O   1 
ATOM   623   C  CB  . THR A  1 80  ? 33.133  46.079  -4.817  1.00   27.22 ? 187 THR A CB  1 
ATOM   624   O  OG1 . THR A  1 80  ? 31.817  45.537  -4.978  1.00   25.66 ? 187 THR A OG1 1 
ATOM   625   C  CG2 . THR A  1 80  ? 34.028  45.040  -4.164  1.00   26.40 ? 187 THR A CG2 1 
ATOM   626   N  N   . GLN A  1 81  ? 32.224  48.997  -5.524  1.00   40.84 ? 188 GLN A N   1 
ATOM   627   C  CA  . GLN A  1 81  ? 31.240  49.912  -6.097  1.00   42.46 ? 188 GLN A CA  1 
ATOM   628   C  C   . GLN A  1 81  ? 29.939  49.205  -6.442  1.00   42.33 ? 188 GLN A C   1 
ATOM   629   O  O   . GLN A  1 81  ? 28.860  49.759  -6.250  1.00   42.41 ? 188 GLN A O   1 
ATOM   630   C  CB  . GLN A  1 81  ? 31.801  50.598  -7.353  1.00   44.02 ? 188 GLN A CB  1 
ATOM   631   C  CG  . GLN A  1 81  ? 31.878  52.124  -7.239  1.00   47.04 ? 188 GLN A CG  1 
ATOM   632   C  CD  . GLN A  1 81  ? 32.388  52.796  -8.508  1.00   46.47 ? 188 GLN A CD  1 
ATOM   633   O  OE1 . GLN A  1 81  ? 33.436  52.430  -9.039  0.0000 46.64 ? 188 GLN A OE1 1 
ATOM   634   N  NE2 . GLN A  1 81  ? 31.649  53.788  -8.991  0.0000 46.64 ? 188 GLN A NE2 1 
ATOM   635   N  N   . MET A  1 82  ? 30.039  47.981  -6.945  1.00   42.44 ? 189 MET A N   1 
ATOM   636   C  CA  . MET A  1 82  ? 28.850  47.220  -7.316  1.00   42.33 ? 189 MET A CA  1 
ATOM   637   C  C   . MET A  1 82  ? 28.148  46.557  -6.124  1.00   40.03 ? 189 MET A C   1 
ATOM   638   O  O   . MET A  1 82  ? 27.072  45.976  -6.284  1.00   36.44 ? 189 MET A O   1 
ATOM   639   C  CB  . MET A  1 82  ? 29.216  46.147  -8.349  1.00   46.88 ? 189 MET A CB  1 
ATOM   640   C  CG  . MET A  1 82  ? 29.410  46.664  -9.766  1.00   55.40 ? 189 MET A CG  1 
ATOM   641   S  SD  . MET A  1 82  ? 30.193  45.423  -10.846 1.00   67.61 ? 189 MET A SD  1 
ATOM   642   C  CE  . MET A  1 82  ? 28.772  44.419  -11.383 1.00   64.82 ? 189 MET A CE  1 
ATOM   643   N  N   . ASN A  1 83  ? 28.751  46.649  -4.940  1.00   35.86 ? 190 ASN A N   1 
ATOM   644   C  CA  . ASN A  1 83  ? 28.188  46.034  -3.741  1.00   33.57 ? 190 ASN A CA  1 
ATOM   645   C  C   . ASN A  1 83  ? 27.967  44.526  -3.910  1.00   32.16 ? 190 ASN A C   1 
ATOM   646   O  O   . ASN A  1 83  ? 26.939  43.974  -3.505  1.00   27.74 ? 190 ASN A O   1 
ATOM   647   C  CB  . ASN A  1 83  ? 26.872  46.704  -3.381  1.00   33.72 ? 190 ASN A CB  1 
ATOM   648   C  CG  . ASN A  1 83  ? 27.065  48.097  -2.844  1.00   33.78 ? 190 ASN A CG  1 
ATOM   649   O  OD1 . ASN A  1 83  ? 27.837  48.310  -1.911  1.00   33.27 ? 190 ASN A OD1 1 
ATOM   650   N  ND2 . ASN A  1 83  ? 26.358  49.054  -3.419  1.00   33.11 ? 190 ASN A ND2 1 
ATOM   651   N  N   . ASP A  1 84  ? 28.950  43.866  -4.501  1.00   30.50 ? 191 ASP A N   1 
ATOM   652   C  CA  . ASP A  1 84  ? 28.888  42.433  -4.744  1.00   31.06 ? 191 ASP A CA  1 
ATOM   653   C  C   . ASP A  1 84  ? 28.710  41.599  -3.488  1.00   28.43 ? 191 ASP A C   1 
ATOM   654   O  O   . ASP A  1 84  ? 28.023  40.578  -3.509  1.00   28.82 ? 191 ASP A O   1 
ATOM   655   C  CB  . ASP A  1 84  ? 30.166  41.972  -5.459  1.00   35.91 ? 191 ASP A CB  1 
ATOM   656   C  CG  . ASP A  1 84  ? 30.457  42.779  -6.710  1.00   40.55 ? 191 ASP A CG  1 
ATOM   657   O  OD1 . ASP A  1 84  ? 30.855  43.959  -6.578  1.00   41.26 ? 191 ASP A OD1 1 
ATOM   658   O  OD2 . ASP A  1 84  ? 30.274  42.237  -7.825  1.00   44.71 ? 191 ASP A OD2 1 
ATOM   659   N  N   . ASN A  1 85  ? 29.313  42.035  -2.389  1.00   24.75 ? 192 ASN A N   1 
ATOM   660   C  CA  . ASN A  1 85  ? 29.250  41.264  -1.156  1.00   25.08 ? 192 ASN A CA  1 
ATOM   661   C  C   . ASN A  1 85  ? 28.214  41.695  -0.127  1.00   26.08 ? 192 ASN A C   1 
ATOM   662   O  O   . ASN A  1 85  ? 28.491  41.725  1.069   1.00   25.05 ? 192 ASN A O   1 
ATOM   663   C  CB  . ASN A  1 85  ? 30.643  41.227  -0.537  1.00   23.48 ? 192 ASN A CB  1 
ATOM   664   C  CG  . ASN A  1 85  ? 31.689  40.725  -1.519  1.00   24.64 ? 192 ASN A CG  1 
ATOM   665   O  OD1 . ASN A  1 85  ? 31.597  39.598  -2.008  1.00   26.69 ? 192 ASN A OD1 1 
ATOM   666   N  ND2 . ASN A  1 85  ? 32.679  41.564  -1.827  1.00   22.12 ? 192 ASN A ND2 1 
ATOM   667   N  N   . ARG A  1 86  ? 27.007  41.988  -0.599  1.00   26.57 ? 193 ARG A N   1 
ATOM   668   C  CA  . ARG A  1 86  ? 25.908  42.406  0.269   1.00   26.16 ? 193 ARG A CA  1 
ATOM   669   C  C   . ARG A  1 86  ? 25.007  41.221  0.612   1.00   24.86 ? 193 ARG A C   1 
ATOM   670   O  O   . ARG A  1 86  ? 24.200  41.293  1.542   1.00   25.98 ? 193 ARG A O   1 
ATOM   671   C  CB  . ARG A  1 86  ? 25.057  43.445  -0.453  1.00   26.17 ? 193 ARG A CB  1 
ATOM   672   C  CG  . ARG A  1 86  ? 24.302  42.831  -1.609  1.00   27.43 ? 193 ARG A CG  1 
ATOM   673   C  CD  . ARG A  1 86  ? 23.627  43.859  -2.484  1.00   32.71 ? 193 ARG A CD  1 
ATOM   674   N  NE  . ARG A  1 86  ? 22.822  43.205  -3.518  1.00   36.65 ? 193 ARG A NE  1 
ATOM   675   C  CZ  . ARG A  1 86  ? 22.028  43.848  -4.372  1.00   41.39 ? 193 ARG A CZ  1 
ATOM   676   N  NH1 . ARG A  1 86  ? 21.939  45.177  -4.321  1.00   42.67 ? 193 ARG A NH1 1 
ATOM   677   N  NH2 . ARG A  1 86  ? 21.300  43.168  -5.258  1.00   38.33 ? 193 ARG A NH2 1 
ATOM   678   N  N   . HIS A  1 87  ? 25.153  40.140  -0.154  1.00   20.60 ? 194 HIS A N   1 
ATOM   679   C  CA  . HIS A  1 87  ? 24.333  38.945  -0.010  1.00   17.70 ? 194 HIS A CA  1 
ATOM   680   C  C   . HIS A  1 87  ? 24.263  38.351  1.393   1.00   17.34 ? 194 HIS A C   1 
ATOM   681   O  O   . HIS A  1 87  ? 23.178  38.147  1.917   1.00   17.65 ? 194 HIS A O   1 
ATOM   682   C  CB  . HIS A  1 87  ? 24.822  37.907  -1.011  1.00   19.90 ? 194 HIS A CB  1 
ATOM   683   C  CG  . HIS A  1 87  ? 23.897  36.753  -1.208  1.00   17.17 ? 194 HIS A CG  1 
ATOM   684   N  ND1 . HIS A  1 87  ? 24.129  35.516  -0.652  1.00   15.09 ? 194 HIS A ND1 1 
ATOM   685   C  CD2 . HIS A  1 87  ? 22.797  36.615  -1.986  1.00   16.99 ? 194 HIS A CD2 1 
ATOM   686   C  CE1 . HIS A  1 87  ? 23.222  34.660  -1.087  1.00   15.69 ? 194 HIS A CE1 1 
ATOM   687   N  NE2 . HIS A  1 87  ? 22.402  35.300  -1.899  1.00   15.40 ? 194 HIS A NE2 1 
ATOM   688   N  N   . GLY A  1 88  ? 25.411  38.091  2.011   1.00   18.48 ? 195 GLY A N   1 
ATOM   689   C  CA  . GLY A  1 88  ? 25.398  37.501  3.339   1.00   15.98 ? 195 GLY A CA  1 
ATOM   690   C  C   . GLY A  1 88  ? 24.708  38.374  4.365   1.00   16.58 ? 195 GLY A C   1 
ATOM   691   O  O   . GLY A  1 88  ? 23.969  37.897  5.228   1.00   16.75 ? 195 GLY A O   1 
ATOM   692   N  N   . THR A  1 89  ? 24.950  39.673  4.273   1.00   17.38 ? 196 THR A N   1 
ATOM   693   C  CA  . THR A  1 89  ? 24.358  40.614  5.213   1.00   16.82 ? 196 THR A CA  1 
ATOM   694   C  C   . THR A  1 89  ? 22.840  40.609  5.080   1.00   18.09 ? 196 THR A C   1 
ATOM   695   O  O   . THR A  1 89  ? 22.116  40.716  6.074   1.00   15.68 ? 196 THR A O   1 
ATOM   696   C  CB  . THR A  1 89  ? 24.937  42.037  4.994   1.00   17.59 ? 196 THR A CB  1 
ATOM   697   O  OG1 . THR A  1 89  ? 26.342  42.029  5.315   1.00   16.17 ? 196 THR A OG1 1 
ATOM   698   C  CG2 . THR A  1 89  ? 24.226  43.062  5.885   1.00   15.90 ? 196 THR A CG2 1 
ATOM   699   N  N   . ARG A  1 90  ? 22.349  40.477  3.853   1.00   17.34 ? 197 ARG A N   1 
ATOM   700   C  CA  . ARG A  1 90  ? 20.909  40.431  3.651   1.00   18.51 ? 197 ARG A CA  1 
ATOM   701   C  C   . ARG A  1 90  ? 20.333  39.167  4.298   1.00   16.98 ? 197 ARG A C   1 
ATOM   702   O  O   . ARG A  1 90  ? 19.306  39.217  4.984   1.00   16.62 ? 197 ARG A O   1 
ATOM   703   C  CB  . ARG A  1 90  ? 20.581  40.483  2.155   1.00   19.24 ? 197 ARG A CB  1 
ATOM   704   C  CG  . ARG A  1 90  ? 20.817  41.859  1.541   1.00   17.67 ? 197 ARG A CG  1 
ATOM   705   C  CD  . ARG A  1 90  ? 20.456  41.931  0.063   1.00   17.95 ? 197 ARG A CD  1 
ATOM   706   N  NE  . ARG A  1 90  ? 20.573  43.301  -0.426  1.00   23.76 ? 197 ARG A NE  1 
ATOM   707   C  CZ  . ARG A  1 90  ? 19.887  43.792  -1.457  1.00   25.03 ? 197 ARG A CZ  1 
ATOM   708   N  NH1 . ARG A  1 90  ? 20.043  45.061  -1.824  1.00   19.86 ? 197 ARG A NH1 1 
ATOM   709   N  NH2 . ARG A  1 90  ? 19.049  43.013  -2.130  1.00   20.76 ? 197 ARG A NH2 1 
ATOM   710   N  N   . CYS A  1 91  ? 21.000  38.039  4.095   1.00   12.93 ? 198 CYS A N   1 
ATOM   711   C  CA  . CYS A  1 91  ? 20.537  36.792  4.694   1.00   15.58 ? 198 CYS A CA  1 
ATOM   712   C  C   . CYS A  1 91  ? 20.606  36.846  6.231   1.00   15.93 ? 198 CYS A C   1 
ATOM   713   O  O   . CYS A  1 91  ? 19.712  36.354  6.913   1.00   19.92 ? 198 CYS A O   1 
ATOM   714   C  CB  . CYS A  1 91  ? 21.367  35.613  4.161   1.00   12.42 ? 198 CYS A CB  1 
ATOM   715   S  SG  . CYS A  1 91  ? 21.132  35.280  2.364   1.00   19.09 ? 198 CYS A SG  1 
ATOM   716   N  N   . ALA A  1 92  ? 21.654  37.454  6.777   1.00   14.25 ? 199 ALA A N   1 
ATOM   717   C  CA  . ALA A  1 92  ? 21.797  37.536  8.228   1.00   18.43 ? 199 ALA A CA  1 
ATOM   718   C  C   . ALA A  1 92  ? 20.628  38.281  8.889   1.00   19.98 ? 199 ALA A C   1 
ATOM   719   O  O   . ALA A  1 92  ? 20.127  37.866  9.936   1.00   20.80 ? 199 ALA A O   1 
ATOM   720   C  CB  . ALA A  1 92  ? 23.117  38.222  8.581   1.00   14.40 ? 199 ALA A CB  1 
ATOM   721   N  N   . GLY A  1 93  ? 20.198  39.381  8.274   1.00   18.24 ? 200 GLY A N   1 
ATOM   722   C  CA  . GLY A  1 93  ? 19.108  40.163  8.823   1.00   17.00 ? 200 GLY A CA  1 
ATOM   723   C  C   . GLY A  1 93  ? 17.785  39.429  8.893   1.00   19.09 ? 200 GLY A C   1 
ATOM   724   O  O   . GLY A  1 93  ? 16.998  39.663  9.806   1.00   19.72 ? 200 GLY A O   1 
ATOM   725   N  N   . GLU A  1 94  ? 17.536  38.535  7.940   1.00   18.89 ? 201 GLU A N   1 
ATOM   726   C  CA  . GLU A  1 94  ? 16.288  37.775  7.916   1.00   17.48 ? 201 GLU A CA  1 
ATOM   727   C  C   . GLU A  1 94  ? 16.207  36.911  9.147   1.00   17.99 ? 201 GLU A C   1 
ATOM   728   O  O   . GLU A  1 94  ? 15.132  36.685  9.699   1.00   18.99 ? 201 GLU A O   1 
ATOM   729   C  CB  . GLU A  1 94  ? 16.231  36.847  6.706   1.00   18.25 ? 201 GLU A CB  1 
ATOM   730   C  CG  . GLU A  1 94  ? 16.171  37.515  5.342   1.00   19.66 ? 201 GLU A CG  1 
ATOM   731   C  CD  . GLU A  1 94  ? 16.082  36.489  4.231   1.00   20.90 ? 201 GLU A CD  1 
ATOM   732   O  OE1 . GLU A  1 94  ? 17.120  36.162  3.611   1.00   19.84 ? 201 GLU A OE1 1 
ATOM   733   O  OE2 . GLU A  1 94  ? 14.964  35.987  3.997   1.00   22.18 ? 201 GLU A OE2 1 
ATOM   734   N  N   . VAL A  1 95  ? 17.362  36.429  9.577   1.00   17.78 ? 202 VAL A N   1 
ATOM   735   C  CA  . VAL A  1 95  ? 17.415  35.554  10.724  1.00   19.98 ? 202 VAL A CA  1 
ATOM   736   C  C   . VAL A  1 95  ? 17.358  36.279  12.048  1.00   22.88 ? 202 VAL A C   1 
ATOM   737   O  O   . VAL A  1 95  ? 16.491  35.995  12.885  1.00   22.86 ? 202 VAL A O   1 
ATOM   738   C  CB  . VAL A  1 95  ? 18.704  34.702  10.726  1.00   20.62 ? 202 VAL A CB  1 
ATOM   739   C  CG1 . VAL A  1 95  ? 18.736  33.814  11.961  1.00   20.06 ? 202 VAL A CG1 1 
ATOM   740   C  CG2 . VAL A  1 95  ? 18.782  33.866  9.460   1.00   18.90 ? 202 VAL A CG2 1 
ATOM   741   N  N   . ALA A  1 96  ? 18.258  37.238  12.231  1.00   22.11 ? 203 ALA A N   1 
ATOM   742   C  CA  . ALA A  1 96  ? 18.333  37.897  13.516  1.00   23.37 ? 203 ALA A CA  1 
ATOM   743   C  C   . ALA A  1 96  ? 18.489  39.415  13.589  1.00   22.87 ? 203 ALA A C   1 
ATOM   744   O  O   . ALA A  1 96  ? 19.213  39.916  14.456  1.00   20.71 ? 203 ALA A O   1 
ATOM   745   C  CB  . ALA A  1 96  ? 19.446  37.225  14.333  1.00   20.43 ? 203 ALA A CB  1 
ATOM   746   N  N   . ALA A  1 97  ? 17.827  40.152  12.703  1.00   21.56 ? 204 ALA A N   1 
ATOM   747   C  CA  . ALA A  1 97  ? 17.902  41.607  12.777  1.00   18.98 ? 204 ALA A CA  1 
ATOM   748   C  C   . ALA A  1 97  ? 17.310  42.002  14.145  1.00   20.01 ? 204 ALA A C   1 
ATOM   749   O  O   . ALA A  1 97  ? 16.323  41.410  14.613  1.00   15.93 ? 204 ALA A O   1 
ATOM   750   C  CB  . ALA A  1 97  ? 17.104  42.239  11.646  1.00   19.22 ? 204 ALA A CB  1 
ATOM   751   N  N   . VAL A  1 98  ? 17.933  42.985  14.793  1.00   19.40 ? 205 VAL A N   1 
ATOM   752   C  CA  . VAL A  1 98  ? 17.489  43.451  16.102  1.00   19.75 ? 205 VAL A CA  1 
ATOM   753   C  C   . VAL A  1 98  ? 16.073  44.020  16.078  1.00   21.22 ? 205 VAL A C   1 
ATOM   754   O  O   . VAL A  1 98  ? 15.683  44.716  15.136  1.00   22.13 ? 205 VAL A O   1 
ATOM   755   C  CB  . VAL A  1 98  ? 18.461  44.523  16.655  1.00   21.29 ? 205 VAL A CB  1 
ATOM   756   C  CG1 . VAL A  1 98  ? 17.965  45.072  17.997  1.00   14.75 ? 205 VAL A CG1 1 
ATOM   757   C  CG2 . VAL A  1 98  ? 19.851  43.909  16.821  1.00   20.53 ? 205 VAL A CG2 1 
ATOM   758   N  N   . ALA A  1 99  ? 15.310  43.721  17.126  1.00   18.69 ? 206 ALA A N   1 
ATOM   759   C  CA  . ALA A  1 99  ? 13.938  44.189  17.224  1.00   22.67 ? 206 ALA A CA  1 
ATOM   760   C  C   . ALA A  1 99  ? 13.794  45.429  18.111  1.00   24.21 ? 206 ALA A C   1 
ATOM   761   O  O   . ALA A  1 99  ? 14.620  45.673  18.989  1.00   20.71 ? 206 ALA A O   1 
ATOM   762   C  CB  . ALA A  1 99  ? 13.049  43.071  17.766  1.00   22.62 ? 206 ALA A CB  1 
ATOM   763   N  N   . ASN A  1 100 ? 12.739  46.202  17.859  1.00   22.84 ? 207 ASN A N   1 
ATOM   764   C  CA  . ASN A  1 100 ? 12.415  47.386  18.641  1.00   21.52 ? 207 ASN A CA  1 
ATOM   765   C  C   . ASN A  1 100 ? 13.556  48.355  18.833  1.00   23.22 ? 207 ASN A C   1 
ATOM   766   O  O   . ASN A  1 100 ? 13.772  48.845  19.941  1.00   20.97 ? 207 ASN A O   1 
ATOM   767   C  CB  . ASN A  1 100 ? 11.907  46.964  20.012  1.00   19.91 ? 207 ASN A CB  1 
ATOM   768   C  CG  . ASN A  1 100 ? 10.812  45.956  19.922  1.00   18.97 ? 207 ASN A CG  1 
ATOM   769   O  OD1 . ASN A  1 100 ? 9.866   46.130  19.151  1.00   22.38 ? 207 ASN A OD1 1 
ATOM   770   N  ND2 . ASN A  1 100 ? 10.919  44.891  20.705  1.00   19.48 ? 207 ASN A ND2 1 
ATOM   771   N  N   . ASN A  1 101 ? 14.279  48.652  17.763  1.00   21.63 ? 208 ASN A N   1 
ATOM   772   C  CA  . ASN A  1 101 ? 15.400  49.563  17.876  1.00   20.77 ? 208 ASN A CA  1 
ATOM   773   C  C   . ASN A  1 101 ? 15.291  50.685  16.856  1.00   21.88 ? 208 ASN A C   1 
ATOM   774   O  O   . ASN A  1 101 ? 16.277  51.349  16.548  1.00   18.50 ? 208 ASN A O   1 
ATOM   775   C  CB  . ASN A  1 101 ? 16.712  48.796  17.699  1.00   21.94 ? 208 ASN A CB  1 
ATOM   776   C  CG  . ASN A  1 101 ? 16.916  48.302  16.282  1.00   23.87 ? 208 ASN A CG  1 
ATOM   777   O  OD1 . ASN A  1 101 ? 15.956  48.058  15.555  1.00   26.35 ? 208 ASN A OD1 1 
ATOM   778   N  ND2 . ASN A  1 101 ? 18.176  48.133  15.890  1.00   23.91 ? 208 ASN A ND2 1 
ATOM   779   N  N   . GLY A  1 102 ? 14.083  50.888  16.337  1.00   21.51 ? 209 GLY A N   1 
ATOM   780   C  CA  . GLY A  1 102 ? 13.859  51.948  15.373  1.00   21.17 ? 209 GLY A CA  1 
ATOM   781   C  C   . GLY A  1 102 ? 14.639  51.826  14.083  1.00   21.68 ? 209 GLY A C   1 
ATOM   782   O  O   . GLY A  1 102 ? 14.726  52.787  13.326  1.00   23.06 ? 209 GLY A O   1 
ATOM   783   N  N   . VAL A  1 103 ? 15.203  50.653  13.819  1.00   22.16 ? 210 VAL A N   1 
ATOM   784   C  CA  . VAL A  1 103 ? 15.953  50.449  12.591  1.00   19.88 ? 210 VAL A CA  1 
ATOM   785   C  C   . VAL A  1 103 ? 15.382  49.315  11.746  1.00   22.49 ? 210 VAL A C   1 
ATOM   786   O  O   . VAL A  1 103 ? 15.112  48.224  12.262  1.00   19.91 ? 210 VAL A O   1 
ATOM   787   C  CB  . VAL A  1 103 ? 17.424  50.089  12.871  1.00   19.45 ? 210 VAL A CB  1 
ATOM   788   C  CG1 . VAL A  1 103 ? 18.167  49.961  11.541  1.00   15.48 ? 210 VAL A CG1 1 
ATOM   789   C  CG2 . VAL A  1 103 ? 18.084  51.131  13.771  1.00   15.91 ? 210 VAL A CG2 1 
ATOM   790   N  N   . CYS A  1 104 ? 15.213  49.590  10.450  1.00   24.01 ? 211 CYS A N   1 
ATOM   791   C  CA  . CYS A  1 104 ? 14.731  48.614  9.483   1.00   22.69 ? 211 CYS A CA  1 
ATOM   792   C  C   . CYS A  1 104 ? 13.597  47.728  10.045  1.00   23.69 ? 211 CYS A C   1 
ATOM   793   O  O   . CYS A  1 104 ? 12.618  48.246  10.599  1.00   21.15 ? 211 CYS A O   1 
ATOM   794   C  CB  . CYS A  1 104 ? 15.936  47.775  9.040   1.00   27.10 ? 211 CYS A CB  1 
ATOM   795   S  SG  . CYS A  1 104 ? 15.855  46.919  7.429   1.00   33.01 ? 211 CYS A SG  1 
ATOM   796   N  N   . GLY A  1 105 ? 13.731  46.406  9.896   1.00   22.21 ? 212 GLY A N   1 
ATOM   797   C  CA  . GLY A  1 105 ? 12.717  45.482  10.383  1.00   21.62 ? 212 GLY A CA  1 
ATOM   798   C  C   . GLY A  1 105 ? 13.218  44.612  11.528  1.00   22.15 ? 212 GLY A C   1 
ATOM   799   O  O   . GLY A  1 105 ? 13.964  45.087  12.396  1.00   19.70 ? 212 GLY A O   1 
ATOM   800   N  N   . VAL A  1 106 ? 12.803  43.346  11.545  1.00   18.16 ? 213 VAL A N   1 
ATOM   801   C  CA  . VAL A  1 106 ? 13.226  42.405  12.589  1.00   19.41 ? 213 VAL A CA  1 
ATOM   802   C  C   . VAL A  1 106 ? 13.485  41.033  12.016  1.00   18.74 ? 213 VAL A C   1 
ATOM   803   O  O   . VAL A  1 106 ? 12.888  40.653  11.002  1.00   18.62 ? 213 VAL A O   1 
ATOM   804   C  CB  . VAL A  1 106 ? 12.157  42.206  13.708  1.00   20.94 ? 213 VAL A CB  1 
ATOM   805   C  CG1 . VAL A  1 106 ? 11.956  43.490  14.475  1.00   25.73 ? 213 VAL A CG1 1 
ATOM   806   C  CG2 . VAL A  1 106 ? 10.834  41.739  13.107  1.00   18.79 ? 213 VAL A CG2 1 
ATOM   807   N  N   . GLY A  1 107 ? 14.370  40.289  12.671  1.00   16.59 ? 214 GLY A N   1 
ATOM   808   C  CA  . GLY A  1 107 ? 14.654  38.942  12.220  1.00   17.79 ? 214 GLY A CA  1 
ATOM   809   C  C   . GLY A  1 107 ? 13.602  37.992  12.774  1.00   19.24 ? 214 GLY A C   1 
ATOM   810   O  O   . GLY A  1 107 ? 12.884  38.330  13.720  1.00   18.05 ? 214 GLY A O   1 
ATOM   811   N  N   . VAL A  1 108 ? 13.486  36.810  12.178  1.00   19.58 ? 215 VAL A N   1 
ATOM   812   C  CA  . VAL A  1 108 ? 12.540  35.813  12.658  1.00   16.62 ? 215 VAL A CA  1 
ATOM   813   C  C   . VAL A  1 108 ? 12.894  35.474  14.107  1.00   18.63 ? 215 VAL A C   1 
ATOM   814   O  O   . VAL A  1 108 ? 12.014  35.375  14.971  1.00   18.73 ? 215 VAL A O   1 
ATOM   815   C  CB  . VAL A  1 108 ? 12.613  34.538  11.797  1.00   17.62 ? 215 VAL A CB  1 
ATOM   816   C  CG1 . VAL A  1 108 ? 11.877  33.399  12.472  1.00   12.86 ? 215 VAL A CG1 1 
ATOM   817   C  CG2 . VAL A  1 108 ? 12.020  34.827  10.405  1.00   10.40 ? 215 VAL A CG2 1 
ATOM   818   N  N   . ALA A  1 109 ? 14.187  35.303  14.368  1.00   15.60 ? 216 ALA A N   1 
ATOM   819   C  CA  . ALA A  1 109 ? 14.679  34.996  15.719  1.00   18.48 ? 216 ALA A CA  1 
ATOM   820   C  C   . ALA A  1 109 ? 15.487  36.209  16.186  1.00   18.25 ? 216 ALA A C   1 
ATOM   821   O  O   . ALA A  1 109 ? 16.712  36.155  16.279  1.00   18.86 ? 216 ALA A O   1 
ATOM   822   C  CB  . ALA A  1 109 ? 15.557  33.770  15.667  1.00   14.17 ? 216 ALA A CB  1 
ATOM   823   N  N   . TYR A  1 110 ? 14.794  37.304  16.471  1.00   18.40 ? 217 TYR A N   1 
ATOM   824   C  CA  . TYR A  1 110 ? 15.460  38.539  16.846  1.00   18.12 ? 217 TYR A CA  1 
ATOM   825   C  C   . TYR A  1 110 ? 16.262  38.562  18.135  1.00   19.15 ? 217 TYR A C   1 
ATOM   826   O  O   . TYR A  1 110 ? 16.892  39.570  18.451  1.00   21.54 ? 217 TYR A O   1 
ATOM   827   C  CB  . TYR A  1 110 ? 14.456  39.689  16.811  1.00   19.12 ? 217 TYR A CB  1 
ATOM   828   C  CG  . TYR A  1 110 ? 13.258  39.550  17.729  1.00   18.98 ? 217 TYR A CG  1 
ATOM   829   C  CD1 . TYR A  1 110 ? 13.385  39.737  19.117  1.00   18.98 ? 217 TYR A CD1 1 
ATOM   830   C  CD2 . TYR A  1 110 ? 11.978  39.376  17.203  1.00   17.60 ? 217 TYR A CD2 1 
ATOM   831   C  CE1 . TYR A  1 110 ? 12.259  39.776  19.949  1.00   17.25 ? 217 TYR A CE1 1 
ATOM   832   C  CE2 . TYR A  1 110 ? 10.846  39.413  18.027  1.00   15.67 ? 217 TYR A CE2 1 
ATOM   833   C  CZ  . TYR A  1 110 ? 10.995  39.622  19.389  1.00   17.44 ? 217 TYR A CZ  1 
ATOM   834   O  OH  . TYR A  1 110 ? 9.878   39.742  20.172  1.00   17.65 ? 217 TYR A OH  1 
ATOM   835   N  N   . ASN A  1 111 ? 16.255  37.465  18.884  1.00   17.18 ? 218 ASN A N   1 
ATOM   836   C  CA  . ASN A  1 111 ? 17.058  37.419  20.109  1.00   20.45 ? 218 ASN A CA  1 
ATOM   837   C  C   . ASN A  1 111 ? 18.163  36.380  20.006  1.00   21.35 ? 218 ASN A C   1 
ATOM   838   O  O   . ASN A  1 111 ? 18.878  36.113  20.972  1.00   21.73 ? 218 ASN A O   1 
ATOM   839   C  CB  . ASN A  1 111 ? 16.209  37.103  21.330  1.00   21.73 ? 218 ASN A CB  1 
ATOM   840   C  CG  . ASN A  1 111 ? 15.626  38.320  21.945  1.00   21.79 ? 218 ASN A CG  1 
ATOM   841   O  OD1 . ASN A  1 111 ? 16.294  39.342  22.059  1.00   26.59 ? 218 ASN A OD1 1 
ATOM   842   N  ND2 . ASN A  1 111 ? 14.376  38.227  22.363  1.00   20.81 ? 218 ASN A ND2 1 
ATOM   843   N  N   . ALA A  1 112 ? 18.297  35.787  18.825  1.00   21.64 ? 219 ALA A N   1 
ATOM   844   C  CA  . ALA A  1 112 ? 19.336  34.793  18.595  1.00   21.42 ? 219 ALA A CA  1 
ATOM   845   C  C   . ALA A  1 112 ? 20.670  35.484  18.354  1.00   21.14 ? 219 ALA A C   1 
ATOM   846   O  O   . ALA A  1 112 ? 20.721  36.679  18.033  1.00   16.76 ? 219 ALA A O   1 
ATOM   847   C  CB  . ALA A  1 112 ? 18.991  33.942  17.388  1.00   17.47 ? 219 ALA A CB  1 
ATOM   848   N  N   . ARG A  1 113 ? 21.753  34.734  18.529  1.00   18.58 ? 220 ARG A N   1 
ATOM   849   C  CA  . ARG A  1 113 ? 23.065  35.281  18.261  1.00   21.12 ? 220 ARG A CA  1 
ATOM   850   C  C   . ARG A  1 113 ? 23.338  34.922  16.814  1.00   20.11 ? 220 ARG A C   1 
ATOM   851   O  O   . ARG A  1 113 ? 23.061  33.801  16.383  1.00   17.57 ? 220 ARG A O   1 
ATOM   852   C  CB  . ARG A  1 113 ? 24.103  34.684  19.199  1.00   25.56 ? 220 ARG A CB  1 
ATOM   853   C  CG  . ARG A  1 113 ? 24.083  35.328  20.576  1.00   32.13 ? 220 ARG A CG  1 
ATOM   854   C  CD  . ARG A  1 113 ? 24.552  34.329  21.603  1.00   39.82 ? 220 ARG A CD  1 
ATOM   855   N  NE  . ARG A  1 113 ? 26.008  34.234  21.689  1.00   44.34 ? 220 ARG A NE  1 
ATOM   856   C  CZ  . ARG A  1 113 ? 26.648  33.274  22.349  1.00   45.08 ? 220 ARG A CZ  1 
ATOM   857   N  NH1 . ARG A  1 113 ? 27.974  33.265  22.390  1.00   45.39 ? 220 ARG A NH1 1 
ATOM   858   N  NH2 . ARG A  1 113 ? 25.955  32.309  22.952  1.00   48.15 ? 220 ARG A NH2 1 
ATOM   859   N  N   . ILE A  1 114 ? 23.855  35.888  16.060  1.00   19.99 ? 221 ILE A N   1 
ATOM   860   C  CA  . ILE A  1 114 ? 24.103  35.694  14.642  1.00   19.46 ? 221 ILE A CA  1 
ATOM   861   C  C   . ILE A  1 114 ? 25.570  35.881  14.261  1.00   20.34 ? 221 ILE A C   1 
ATOM   862   O  O   . ILE A  1 114 ? 26.238  36.832  14.677  1.00   21.01 ? 221 ILE A O   1 
ATOM   863   C  CB  . ILE A  1 114 ? 23.211  36.662  13.812  1.00   18.08 ? 221 ILE A CB  1 
ATOM   864   C  CG1 . ILE A  1 114 ? 23.334  36.353  12.320  1.00   21.67 ? 221 ILE A CG1 1 
ATOM   865   C  CG2 . ILE A  1 114 ? 23.594  38.119  14.100  1.00   18.53 ? 221 ILE A CG2 1 
ATOM   866   C  CD1 . ILE A  1 114 ? 22.474  35.193  11.867  1.00   17.66 ? 221 ILE A CD1 1 
ATOM   867   N  N   . GLY A  1 115 ? 26.071  34.943  13.473  1.00   20.88 ? 222 GLY A N   1 
ATOM   868   C  CA  . GLY A  1 115 ? 27.447  35.006  13.033  1.00   19.40 ? 222 GLY A CA  1 
ATOM   869   C  C   . GLY A  1 115 ? 27.522  34.843  11.531  1.00   21.50 ? 222 GLY A C   1 
ATOM   870   O  O   . GLY A  1 115 ? 26.521  34.541  10.859  1.00   19.91 ? 222 GLY A O   1 
ATOM   871   N  N   . GLY A  1 116 ? 28.713  35.053  10.988  1.00   21.45 ? 223 GLY A N   1 
ATOM   872   C  CA  . GLY A  1 116 ? 28.882  34.898  9.561   1.00   19.57 ? 223 GLY A CA  1 
ATOM   873   C  C   . GLY A  1 116 ? 30.245  34.340  9.190   1.00   21.64 ? 223 GLY A C   1 
ATOM   874   O  O   . GLY A  1 116 ? 31.262  34.682  9.802   1.00   22.48 ? 223 GLY A O   1 
ATOM   875   N  N   . VAL A  1 117 ? 30.265  33.453  8.203   1.00   19.55 ? 224 VAL A N   1 
ATOM   876   C  CA  . VAL A  1 117 ? 31.512  32.902  7.720   1.00   17.97 ? 224 VAL A CA  1 
ATOM   877   C  C   . VAL A  1 117 ? 31.684  33.457  6.312   1.00   19.69 ? 224 VAL A C   1 
ATOM   878   O  O   . VAL A  1 117 ? 30.862  33.209  5.428   1.00   19.19 ? 224 VAL A O   1 
ATOM   879   C  CB  . VAL A  1 117 ? 31.507  31.369  7.623   1.00   17.31 ? 224 VAL A CB  1 
ATOM   880   C  CG1 . VAL A  1 117 ? 32.824  30.906  7.003   1.00   14.35 ? 224 VAL A CG1 1 
ATOM   881   C  CG2 . VAL A  1 117 ? 31.311  30.746  8.989   1.00   10.50 ? 224 VAL A CG2 1 
ATOM   882   N  N   . ARG A  1 118 ? 32.733  34.247  6.121   1.00   19.38 ? 225 ARG A N   1 
ATOM   883   C  CA  . ARG A  1 118 ? 33.013  34.816  4.817   1.00   18.30 ? 225 ARG A CA  1 
ATOM   884   C  C   . ARG A  1 118 ? 33.740  33.715  4.054   1.00   18.20 ? 225 ARG A C   1 
ATOM   885   O  O   . ARG A  1 118 ? 34.910  33.431  4.335   1.00   17.83 ? 225 ARG A O   1 
ATOM   886   C  CB  . ARG A  1 118 ? 33.891  36.067  4.963   1.00   14.62 ? 225 ARG A CB  1 
ATOM   887   C  CG  . ARG A  1 118 ? 34.308  36.720  3.646   1.00   18.07 ? 225 ARG A CG  1 
ATOM   888   C  CD  . ARG A  1 118 ? 34.956  38.107  3.895   1.00   23.67 ? 225 ARG A CD  1 
ATOM   889   N  NE  . ARG A  1 118 ? 35.401  38.756  2.661   1.00   23.92 ? 225 ARG A NE  1 
ATOM   890   C  CZ  . ARG A  1 118 ? 36.643  38.699  2.180   1.00   25.34 ? 225 ARG A CZ  1 
ATOM   891   N  NH1 . ARG A  1 118 ? 36.951  39.313  1.038   1.00   20.47 ? 225 ARG A NH1 1 
ATOM   892   N  NH2 . ARG A  1 118 ? 37.584  38.042  2.848   1.00   22.85 ? 225 ARG A NH2 1 
ATOM   893   N  N   . MET A  1 119 ? 33.038  33.085  3.109   1.00   16.60 ? 226 MET A N   1 
ATOM   894   C  CA  . MET A  1 119 ? 33.622  32.004  2.336   1.00   17.65 ? 226 MET A CA  1 
ATOM   895   C  C   . MET A  1 119 ? 33.280  31.965  0.852   1.00   18.52 ? 226 MET A C   1 
ATOM   896   O  O   . MET A  1 119 ? 33.837  31.158  0.120   1.00   18.21 ? 226 MET A O   1 
ATOM   897   C  CB  . MET A  1 119 ? 33.295  30.658  2.988   1.00   18.50 ? 226 MET A CB  1 
ATOM   898   C  CG  . MET A  1 119 ? 31.841  30.491  3.442   1.00   22.96 ? 226 MET A CG  1 
ATOM   899   S  SD  . MET A  1 119 ? 30.705  30.079  2.131   1.00   22.53 ? 226 MET A SD  1 
ATOM   900   C  CE  . MET A  1 119 ? 31.299  28.463  1.685   1.00   21.99 ? 226 MET A CE  1 
ATOM   901   N  N   . LEU A  1 120 ? 32.387  32.837  0.392   1.00   18.93 ? 227 LEU A N   1 
ATOM   902   C  CA  . LEU A  1 120 ? 32.035  32.859  -1.030  1.00   19.34 ? 227 LEU A CA  1 
ATOM   903   C  C   . LEU A  1 120 ? 32.837  33.876  -1.837  1.00   21.70 ? 227 LEU A C   1 
ATOM   904   O  O   . LEU A  1 120 ? 32.863  33.816  -3.073  1.00   19.07 ? 227 LEU A O   1 
ATOM   905   C  CB  . LEU A  1 120 ? 30.564  33.188  -1.228  1.00   16.70 ? 227 LEU A CB  1 
ATOM   906   C  CG  . LEU A  1 120 ? 29.535  32.183  -0.754  1.00   20.37 ? 227 LEU A CG  1 
ATOM   907   C  CD1 . LEU A  1 120 ? 28.141  32.754  -1.004  1.00   11.38 ? 227 LEU A CD1 1 
ATOM   908   C  CD2 . LEU A  1 120 ? 29.754  30.844  -1.476  1.00   16.89 ? 227 LEU A CD2 1 
ATOM   909   N  N   . ASP A  1 121 ? 33.482  34.809  -1.141  1.00   22.62 ? 228 ASP A N   1 
ATOM   910   C  CA  . ASP A  1 121 ? 34.252  35.852  -1.805  1.00   23.04 ? 228 ASP A CA  1 
ATOM   911   C  C   . ASP A  1 121 ? 35.701  35.430  -2.039  1.00   24.05 ? 228 ASP A C   1 
ATOM   912   O  O   . ASP A  1 121 ? 36.635  35.939  -1.421  1.00   25.75 ? 228 ASP A O   1 
ATOM   913   C  CB  . ASP A  1 121 ? 34.182  37.143  -0.989  1.00   20.20 ? 228 ASP A CB  1 
ATOM   914   C  CG  . ASP A  1 121 ? 34.663  38.346  -1.774  1.00   22.85 ? 228 ASP A CG  1 
ATOM   915   O  OD1 . ASP A  1 121 ? 34.716  38.253  -3.019  1.00   24.43 ? 228 ASP A OD1 1 
ATOM   916   O  OD2 . ASP A  1 121 ? 34.976  39.379  -1.151  1.00   24.51 ? 228 ASP A OD2 1 
ATOM   917   N  N   . GLY A  1 122 ? 35.868  34.496  -2.961  1.00   23.67 ? 229 GLY A N   1 
ATOM   918   C  CA  . GLY A  1 122 ? 37.179  33.977  -3.282  1.00   24.67 ? 229 GLY A CA  1 
ATOM   919   C  C   . GLY A  1 122 ? 36.985  32.614  -3.924  1.00   25.89 ? 229 GLY A C   1 
ATOM   920   O  O   . GLY A  1 122 ? 35.866  32.262  -4.316  1.00   24.14 ? 229 GLY A O   1 
ATOM   921   N  N   . GLU A  1 123 ? 38.059  31.842  -4.040  1.00   28.15 ? 230 GLU A N   1 
ATOM   922   C  CA  . GLU A  1 123 ? 37.960  30.519  -4.635  1.00   29.17 ? 230 GLU A CA  1 
ATOM   923   C  C   . GLU A  1 123 ? 37.237  29.634  -3.620  1.00   27.35 ? 230 GLU A C   1 
ATOM   924   O  O   . GLU A  1 123 ? 37.690  29.493  -2.487  1.00   27.13 ? 230 GLU A O   1 
ATOM   925   C  CB  . GLU A  1 123 ? 39.354  29.957  -4.921  1.00   33.45 ? 230 GLU A CB  1 
ATOM   926   C  CG  . GLU A  1 123 ? 39.419  29.091  -6.183  1.00   42.12 ? 230 GLU A CG  1 
ATOM   927   C  CD  . GLU A  1 123 ? 40.658  28.181  -6.229  1.00   49.74 ? 230 GLU A CD  1 
ATOM   928   O  OE1 . GLU A  1 123 ? 41.781  28.657  -5.919  1.00   51.02 ? 230 GLU A OE1 1 
ATOM   929   O  OE2 . GLU A  1 123 ? 40.504  26.985  -6.584  1.00   49.09 ? 230 GLU A OE2 1 
ATOM   930   N  N   . VAL A  1 124 ? 36.104  29.059  -4.013  1.00   25.18 ? 231 VAL A N   1 
ATOM   931   C  CA  . VAL A  1 124 ? 35.354  28.200  -3.107  1.00   22.59 ? 231 VAL A CA  1 
ATOM   932   C  C   . VAL A  1 124 ? 35.723  26.737  -3.329  1.00   22.96 ? 231 VAL A C   1 
ATOM   933   O  O   . VAL A  1 124 ? 35.128  26.052  -4.163  1.00   22.29 ? 231 VAL A O   1 
ATOM   934   C  CB  . VAL A  1 124 ? 33.835  28.362  -3.295  1.00   24.27 ? 231 VAL A CB  1 
ATOM   935   C  CG1 . VAL A  1 124 ? 33.103  27.459  -2.300  1.00   21.54 ? 231 VAL A CG1 1 
ATOM   936   C  CG2 . VAL A  1 124 ? 33.428  29.830  -3.113  1.00   18.90 ? 231 VAL A CG2 1 
ATOM   937   N  N   . THR A  1 125 ? 36.700  26.266  -2.560  1.00   20.85 ? 232 THR A N   1 
ATOM   938   C  CA  . THR A  1 125 ? 37.187  24.896  -2.655  1.00   20.14 ? 232 THR A CA  1 
ATOM   939   C  C   . THR A  1 125 ? 36.524  23.978  -1.631  1.00   21.21 ? 232 THR A C   1 
ATOM   940   O  O   . THR A  1 125 ? 35.805  24.425  -0.731  1.00   21.43 ? 232 THR A O   1 
ATOM   941   C  CB  . THR A  1 125 ? 38.694  24.849  -2.372  1.00   22.26 ? 232 THR A CB  1 
ATOM   942   O  OG1 . THR A  1 125 ? 38.922  25.327  -1.044  1.00   22.75 ? 232 THR A OG1 1 
ATOM   943   C  CG2 . THR A  1 125 ? 39.460  25.742  -3.337  1.00   19.83 ? 232 THR A CG2 1 
ATOM   944   N  N   . ASP A  1 126 ? 36.809  22.688  -1.758  1.00   20.88 ? 233 ASP A N   1 
ATOM   945   C  CA  . ASP A  1 126 ? 36.290  21.696  -0.833  1.00   20.24 ? 233 ASP A CA  1 
ATOM   946   C  C   . ASP A  1 126 ? 36.764  22.056  0.578   1.00   19.43 ? 233 ASP A C   1 
ATOM   947   O  O   . ASP A  1 126 ? 36.003  21.992  1.532   1.00   18.69 ? 233 ASP A O   1 
ATOM   948   C  CB  . ASP A  1 126 ? 36.790  20.300  -1.229  1.00   20.32 ? 233 ASP A CB  1 
ATOM   949   C  CG  . ASP A  1 126 ? 36.259  19.208  -0.313  1.00   24.43 ? 233 ASP A CG  1 
ATOM   950   O  OD1 . ASP A  1 126 ? 35.059  19.254  0.055   1.00   25.29 ? 233 ASP A OD1 1 
ATOM   951   O  OD2 . ASP A  1 126 ? 37.038  18.297  0.036   1.00   22.45 ? 233 ASP A OD2 1 
ATOM   952   N  N   . ALA A  1 127 ? 38.028  22.443  0.704   1.00   19.76 ? 234 ALA A N   1 
ATOM   953   C  CA  . ALA A  1 127 ? 38.584  22.805  2.005   1.00   19.24 ? 234 ALA A CA  1 
ATOM   954   C  C   . ALA A  1 127 ? 37.854  24.012  2.571   1.00   20.86 ? 234 ALA A C   1 
ATOM   955   O  O   . ALA A  1 127 ? 37.532  24.060  3.759   1.00   20.46 ? 234 ALA A O   1 
ATOM   956   C  CB  . ALA A  1 127 ? 40.062  23.113  1.873   1.00   17.65 ? 234 ALA A CB  1 
ATOM   957   N  N   . VAL A  1 128 ? 37.601  24.996  1.716   1.00   21.52 ? 235 VAL A N   1 
ATOM   958   C  CA  . VAL A  1 128 ? 36.892  26.185  2.158   1.00   22.06 ? 235 VAL A CA  1 
ATOM   959   C  C   . VAL A  1 128 ? 35.519  25.792  2.703   1.00   21.64 ? 235 VAL A C   1 
ATOM   960   O  O   . VAL A  1 128 ? 35.120  26.220  3.787   1.00   22.74 ? 235 VAL A O   1 
ATOM   961   C  CB  . VAL A  1 128 ? 36.720  27.189  1.003   1.00   22.84 ? 235 VAL A CB  1 
ATOM   962   C  CG1 . VAL A  1 128 ? 35.619  28.190  1.335   1.00   19.05 ? 235 VAL A CG1 1 
ATOM   963   C  CG2 . VAL A  1 128 ? 38.042  27.932  0.774   1.00   19.83 ? 235 VAL A CG2 1 
ATOM   964   N  N   . GLU A  1 129 ? 34.808  24.955  1.959   1.00   20.20 ? 236 GLU A N   1 
ATOM   965   C  CA  . GLU A  1 129 ? 33.484  24.521  2.388   1.00   19.11 ? 236 GLU A CA  1 
ATOM   966   C  C   . GLU A  1 129 ? 33.545  23.753  3.701   1.00   20.11 ? 236 GLU A C   1 
ATOM   967   O  O   . GLU A  1 129 ? 32.779  24.030  4.629   1.00   17.25 ? 236 GLU A O   1 
ATOM   968   C  CB  . GLU A  1 129 ? 32.841  23.649  1.306   1.00   17.82 ? 236 GLU A CB  1 
ATOM   969   C  CG  . GLU A  1 129 ? 32.363  24.431  0.079   1.00   16.35 ? 236 GLU A CG  1 
ATOM   970   C  CD  . GLU A  1 129 ? 31.901  23.527  -1.055  1.00   19.11 ? 236 GLU A CD  1 
ATOM   971   O  OE1 . GLU A  1 129 ? 31.514  22.365  -0.789  1.00   21.85 ? 236 GLU A OE1 1 
ATOM   972   O  OE2 . GLU A  1 129 ? 31.907  23.980  -2.216  1.00   19.63 ? 236 GLU A OE2 1 
ATOM   973   N  N   . ALA A  1 130 ? 34.462  22.791  3.785   1.00   18.09 ? 237 ALA A N   1 
ATOM   974   C  CA  . ALA A  1 130 ? 34.584  21.977  4.986   1.00   18.01 ? 237 ALA A CA  1 
ATOM   975   C  C   . ALA A  1 130 ? 34.888  22.815  6.236   1.00   19.10 ? 237 ALA A C   1 
ATOM   976   O  O   . ALA A  1 130 ? 34.320  22.590  7.301   1.00   16.68 ? 237 ALA A O   1 
ATOM   977   C  CB  . ALA A  1 130 ? 35.649  20.922  4.785   1.00   17.13 ? 237 ALA A CB  1 
ATOM   978   N  N   . ARG A  1 131 ? 35.771  23.794  6.106   1.00   17.07 ? 238 ARG A N   1 
ATOM   979   C  CA  . ARG A  1 131 ? 36.107  24.619  7.252   1.00   17.93 ? 238 ARG A CA  1 
ATOM   980   C  C   . ARG A  1 131 ? 34.914  25.482  7.683   1.00   20.36 ? 238 ARG A C   1 
ATOM   981   O  O   . ARG A  1 131 ? 34.771  25.829  8.857   1.00   20.36 ? 238 ARG A O   1 
ATOM   982   C  CB  . ARG A  1 131 ? 37.321  25.502  6.932   1.00   22.10 ? 238 ARG A CB  1 
ATOM   983   C  CG  . ARG A  1 131 ? 38.632  24.734  6.647   1.00   23.81 ? 238 ARG A CG  1 
ATOM   984   C  CD  . ARG A  1 131 ? 39.808  25.689  6.559   1.00   25.64 ? 238 ARG A CD  1 
ATOM   985   N  NE  . ARG A  1 131 ? 40.131  26.226  7.873   1.00   34.52 ? 238 ARG A NE  1 
ATOM   986   C  CZ  . ARG A  1 131 ? 40.572  27.462  8.100   1.00   40.79 ? 238 ARG A CZ  1 
ATOM   987   N  NH1 . ARG A  1 131 ? 40.838  27.847  9.345   1.00   41.60 ? 238 ARG A NH1 1 
ATOM   988   N  NH2 . ARG A  1 131 ? 40.733  28.322  7.095   1.00   42.32 ? 238 ARG A NH2 1 
ATOM   989   N  N   . SER A  1 132 ? 34.061  25.832  6.727   1.00   16.80 ? 239 SER A N   1 
ATOM   990   C  CA  . SER A  1 132 ? 32.895  26.636  7.028   1.00   15.59 ? 239 SER A CA  1 
ATOM   991   C  C   . SER A  1 132 ? 31.805  25.787  7.687   1.00   15.54 ? 239 SER A C   1 
ATOM   992   O  O   . SER A  1 132 ? 31.268  26.151  8.733   1.00   14.84 ? 239 SER A O   1 
ATOM   993   C  CB  . SER A  1 132 ? 32.360  27.269  5.747   1.00   16.67 ? 239 SER A CB  1 
ATOM   994   O  OG  . SER A  1 132 ? 33.367  28.038  5.085   1.00   16.16 ? 239 SER A OG  1 
ATOM   995   N  N   . LEU A  1 133 ? 31.491  24.653  7.076   1.00   16.42 ? 240 LEU A N   1 
ATOM   996   C  CA  . LEU A  1 133 ? 30.464  23.761  7.608   1.00   19.10 ? 240 LEU A CA  1 
ATOM   997   C  C   . LEU A  1 133 ? 30.859  23.197  8.966   1.00   18.81 ? 240 LEU A C   1 
ATOM   998   O  O   . LEU A  1 133 ? 29.998  22.898  9.794   1.00   17.95 ? 240 LEU A O   1 
ATOM   999   C  CB  . LEU A  1 133 ? 30.192  22.610  6.622   1.00   15.22 ? 240 LEU A CB  1 
ATOM   1000  C  CG  . LEU A  1 133 ? 29.554  23.083  5.308   1.00   16.33 ? 240 LEU A CG  1 
ATOM   1001  C  CD1 . LEU A  1 133 ? 29.705  21.999  4.269   1.00   14.73 ? 240 LEU A CD1 1 
ATOM   1002  C  CD2 . LEU A  1 133 ? 28.090  23.450  5.514   1.00   10.15 ? 240 LEU A CD2 1 
ATOM   1003  N  N   . GLY A  1 134 ? 32.161  23.073  9.196   1.00   20.35 ? 241 GLY A N   1 
ATOM   1004  C  CA  . GLY A  1 134 ? 32.633  22.524  10.451  1.00   19.80 ? 241 GLY A CA  1 
ATOM   1005  C  C   . GLY A  1 134 ? 33.103  23.558  11.454  1.00   21.87 ? 241 GLY A C   1 
ATOM   1006  O  O   . GLY A  1 134 ? 33.773  23.216  12.425  1.00   21.59 ? 241 GLY A O   1 
ATOM   1007  N  N   . LEU A  1 135 ? 32.767  24.822  11.232  1.00   17.10 ? 242 LEU A N   1 
ATOM   1008  C  CA  . LEU A  1 135 ? 33.176  25.856  12.162  1.00   18.12 ? 242 LEU A CA  1 
ATOM   1009  C  C   . LEU A  1 135 ? 32.491  25.720  13.514  1.00   19.85 ? 242 LEU A C   1 
ATOM   1010  O  O   . LEU A  1 135 ? 31.268  25.657  13.579  1.00   22.06 ? 242 LEU A O   1 
ATOM   1011  C  CB  . LEU A  1 135 ? 32.843  27.227  11.593  1.00   14.92 ? 242 LEU A CB  1 
ATOM   1012  C  CG  . LEU A  1 135 ? 33.180  28.409  12.498  1.00   16.73 ? 242 LEU A CG  1 
ATOM   1013  C  CD1 . LEU A  1 135 ? 34.682  28.461  12.736  1.00   15.14 ? 242 LEU A CD1 1 
ATOM   1014  C  CD2 . LEU A  1 135 ? 32.709  29.702  11.840  1.00   17.78 ? 242 LEU A CD2 1 
ATOM   1015  N  N   . ASN A  1 136 ? 33.274  25.657  14.587  1.00   21.36 ? 243 ASN A N   1 
ATOM   1016  C  CA  . ASN A  1 136 ? 32.713  25.611  15.943  1.00   23.75 ? 243 ASN A CA  1 
ATOM   1017  C  C   . ASN A  1 136 ? 31.418  24.826  16.106  1.00   20.49 ? 243 ASN A C   1 
ATOM   1018  O  O   . ASN A  1 136 ? 30.427  25.372  16.573  1.00   23.67 ? 243 ASN A O   1 
ATOM   1019  C  CB  . ASN A  1 136 ? 32.425  27.027  16.395  1.00   25.41 ? 243 ASN A CB  1 
ATOM   1020  C  CG  . ASN A  1 136 ? 33.223  27.423  17.582  1.00   30.12 ? 243 ASN A CG  1 
ATOM   1021  O  OD1 . ASN A  1 136 ? 33.435  26.623  18.497  1.00   29.69 ? 243 ASN A OD1 1 
ATOM   1022  N  ND2 . ASN A  1 136 ? 33.657  28.675  17.604  1.00   34.02 ? 243 ASN A ND2 1 
ATOM   1023  N  N   . PRO A  1 137 ? 31.416  23.536  15.761  1.00   21.40 ? 244 PRO A N   1 
ATOM   1024  C  CA  . PRO A  1 137 ? 30.221  22.687  15.867  1.00   20.18 ? 244 PRO A CA  1 
ATOM   1025  C  C   . PRO A  1 137 ? 29.596  22.597  17.265  1.00   19.19 ? 244 PRO A C   1 
ATOM   1026  O  O   . PRO A  1 137 ? 28.461  22.189  17.392  1.00   22.41 ? 244 PRO A O   1 
ATOM   1027  C  CB  . PRO A  1 137 ? 30.718  21.322  15.396  1.00   21.84 ? 244 PRO A CB  1 
ATOM   1028  C  CG  . PRO A  1 137 ? 31.927  21.636  14.598  1.00   22.67 ? 244 PRO A CG  1 
ATOM   1029  C  CD  . PRO A  1 137 ? 32.584  22.736  15.370  1.00   19.13 ? 244 PRO A CD  1 
ATOM   1030  N  N   . ASN A  1 138 ? 30.331  22.953  18.308  1.00   18.27 ? 245 ASN A N   1 
ATOM   1031  C  CA  . ASN A  1 138 ? 29.747  22.893  19.628  1.00   22.42 ? 245 ASN A CA  1 
ATOM   1032  C  C   . ASN A  1 138 ? 29.291  24.232  20.147  1.00   23.11 ? 245 ASN A C   1 
ATOM   1033  O  O   . ASN A  1 138 ? 28.819  24.338  21.275  1.00   24.57 ? 245 ASN A O   1 
ATOM   1034  C  CB  . ASN A  1 138 ? 30.703  22.231  20.607  1.00   26.20 ? 245 ASN A CB  1 
ATOM   1035  C  CG  . ASN A  1 138 ? 30.850  20.748  20.333  1.00   32.98 ? 245 ASN A CG  1 
ATOM   1036  O  OD1 . ASN A  1 138 ? 29.850  20.015  20.265  1.00   31.08 ? 245 ASN A OD1 1 
ATOM   1037  N  ND2 . ASN A  1 138 ? 32.091  20.297  20.153  1.00   32.34 ? 245 ASN A ND2 1 
ATOM   1038  N  N   . HIS A  1 139 ? 29.438  25.266  19.325  1.00   21.76 ? 246 HIS A N   1 
ATOM   1039  C  CA  . HIS A  1 139 ? 28.972  26.590  19.718  1.00   21.08 ? 246 HIS A CA  1 
ATOM   1040  C  C   . HIS A  1 139 ? 27.784  26.961  18.817  1.00   20.99 ? 246 HIS A C   1 
ATOM   1041  O  O   . HIS A  1 139 ? 26.731  27.357  19.301  1.00   19.97 ? 246 HIS A O   1 
ATOM   1042  C  CB  . HIS A  1 139 ? 30.086  27.630  19.570  1.00   19.19 ? 246 HIS A CB  1 
ATOM   1043  C  CG  . HIS A  1 139 ? 29.640  29.024  19.878  1.00   22.42 ? 246 HIS A CG  1 
ATOM   1044  N  ND1 . HIS A  1 139 ? 29.272  29.424  21.147  1.00   23.12 ? 246 HIS A ND1 1 
ATOM   1045  C  CD2 . HIS A  1 139 ? 29.426  30.089  19.071  1.00   22.59 ? 246 HIS A CD2 1 
ATOM   1046  C  CE1 . HIS A  1 139 ? 28.845  30.673  21.105  1.00   20.29 ? 246 HIS A CE1 1 
ATOM   1047  N  NE2 . HIS A  1 139 ? 28.927  31.101  19.858  1.00   22.34 ? 246 HIS A NE2 1 
ATOM   1048  N  N   . ILE A  1 140 ? 27.973  26.808  17.503  1.00   20.30 ? 247 ILE A N   1 
ATOM   1049  C  CA  . ILE A  1 140 ? 26.954  27.108  16.502  1.00   17.53 ? 247 ILE A CA  1 
ATOM   1050  C  C   . ILE A  1 140 ? 25.911  25.992  16.446  1.00   17.89 ? 247 ILE A C   1 
ATOM   1051  O  O   . ILE A  1 140 ? 26.252  24.813  16.396  1.00   18.02 ? 247 ILE A O   1 
ATOM   1052  C  CB  . ILE A  1 140 ? 27.595  27.251  15.105  1.00   16.77 ? 247 ILE A CB  1 
ATOM   1053  C  CG1 . ILE A  1 140 ? 28.537  28.458  15.093  1.00   19.11 ? 247 ILE A CG1 1 
ATOM   1054  C  CG2 . ILE A  1 140 ? 26.521  27.359  14.036  1.00   14.62 ? 247 ILE A CG2 1 
ATOM   1055  C  CD1 . ILE A  1 140 ? 29.482  28.516  13.905  1.00   16.37 ? 247 ILE A CD1 1 
ATOM   1056  N  N   . HIS A  1 141 ? 24.639  26.362  16.440  1.00   15.64 ? 248 HIS A N   1 
ATOM   1057  C  CA  . HIS A  1 141 ? 23.588  25.363  16.387  1.00   16.89 ? 248 HIS A CA  1 
ATOM   1058  C  C   . HIS A  1 141 ? 23.086  25.136  14.974  1.00   16.58 ? 248 HIS A C   1 
ATOM   1059  O  O   . HIS A  1 141 ? 22.863  24.006  14.558  1.00   18.03 ? 248 HIS A O   1 
ATOM   1060  C  CB  . HIS A  1 141 ? 22.400  25.785  17.254  1.00   17.83 ? 248 HIS A CB  1 
ATOM   1061  C  CG  . HIS A  1 141 ? 22.760  26.034  18.684  1.00   24.33 ? 248 HIS A CG  1 
ATOM   1062  N  ND1 . HIS A  1 141 ? 22.707  27.283  19.258  1.00   25.86 ? 248 HIS A ND1 1 
ATOM   1063  C  CD2 . HIS A  1 141 ? 23.213  25.197  19.647  1.00   26.21 ? 248 HIS A CD2 1 
ATOM   1064  C  CE1 . HIS A  1 141 ? 23.112  27.207  20.512  1.00   24.00 ? 248 HIS A CE1 1 
ATOM   1065  N  NE2 . HIS A  1 141 ? 23.426  25.952  20.772  1.00   24.60 ? 248 HIS A NE2 1 
ATOM   1066  N  N   . ILE A  1 142 ? 22.917  26.223  14.237  1.00   16.06 ? 249 ILE A N   1 
ATOM   1067  C  CA  . ILE A  1 142 ? 22.366  26.160  12.899  1.00   14.69 ? 249 ILE A CA  1 
ATOM   1068  C  C   . ILE A  1 142 ? 23.238  26.859  11.878  1.00   16.03 ? 249 ILE A C   1 
ATOM   1069  O  O   . ILE A  1 142 ? 23.724  27.962  12.121  1.00   17.98 ? 249 ILE A O   1 
ATOM   1070  C  CB  . ILE A  1 142 ? 20.993  26.844  12.892  1.00   18.25 ? 249 ILE A CB  1 
ATOM   1071  C  CG1 . ILE A  1 142 ? 20.080  26.158  13.911  1.00   18.52 ? 249 ILE A CG1 1 
ATOM   1072  C  CG2 . ILE A  1 142 ? 20.386  26.852  11.481  1.00   14.45 ? 249 ILE A CG2 1 
ATOM   1073  C  CD1 . ILE A  1 142 ? 18.929  27.047  14.344  1.00   17.45 ? 249 ILE A CD1 1 
ATOM   1074  N  N   . TYR A  1 143 ? 23.423  26.212  10.730  1.00   15.50 ? 250 TYR A N   1 
ATOM   1075  C  CA  . TYR A  1 143 ? 24.208  26.782  9.639   1.00   15.55 ? 250 TYR A CA  1 
ATOM   1076  C  C   . TYR A  1 143 ? 23.233  27.038  8.507   1.00   17.85 ? 250 TYR A C   1 
ATOM   1077  O  O   . TYR A  1 143 ? 22.416  26.166  8.178   1.00   17.22 ? 250 TYR A O   1 
ATOM   1078  C  CB  . TYR A  1 143 ? 25.269  25.805  9.134   1.00   13.68 ? 250 TYR A CB  1 
ATOM   1079  C  CG  . TYR A  1 143 ? 26.298  25.407  10.155  1.00   16.06 ? 250 TYR A CG  1 
ATOM   1080  C  CD1 . TYR A  1 143 ? 25.986  24.504  11.152  1.00   16.06 ? 250 TYR A CD1 1 
ATOM   1081  C  CD2 . TYR A  1 143 ? 27.585  25.953  10.136  1.00   16.92 ? 250 TYR A CD2 1 
ATOM   1082  C  CE1 . TYR A  1 143 ? 26.929  24.145  12.118  1.00   21.34 ? 250 TYR A CE1 1 
ATOM   1083  C  CE2 . TYR A  1 143 ? 28.533  25.607  11.098  1.00   17.34 ? 250 TYR A CE2 1 
ATOM   1084  C  CZ  . TYR A  1 143 ? 28.190  24.697  12.091  1.00   19.43 ? 250 TYR A CZ  1 
ATOM   1085  O  OH  . TYR A  1 143 ? 29.085  24.343  13.079  1.00   21.60 ? 250 TYR A OH  1 
ATOM   1086  N  N   . SER A  1 144 ? 23.316  28.218  7.904   1.00   15.28 ? 251 SER A N   1 
ATOM   1087  C  CA  . SER A  1 144 ? 22.409  28.552  6.809   1.00   16.38 ? 251 SER A CA  1 
ATOM   1088  C  C   . SER A  1 144 ? 23.234  28.803  5.550   1.00   18.44 ? 251 SER A C   1 
ATOM   1089  O  O   . SER A  1 144 ? 24.149  29.630  5.560   1.00   15.39 ? 251 SER A O   1 
ATOM   1090  C  CB  . SER A  1 144 ? 21.598  29.801  7.160   1.00   17.13 ? 251 SER A CB  1 
ATOM   1091  O  OG  . SER A  1 144 ? 20.694  30.130  6.117   1.00   14.98 ? 251 SER A OG  1 
ATOM   1092  N  N   . ALA A  1 145 ? 22.896  28.103  4.467   1.00   13.90 ? 252 ALA A N   1 
ATOM   1093  C  CA  . ALA A  1 145 ? 23.642  28.242  3.229   1.00   13.45 ? 252 ALA A CA  1 
ATOM   1094  C  C   . ALA A  1 145 ? 22.780  28.600  2.031   1.00   16.75 ? 252 ALA A C   1 
ATOM   1095  O  O   . ALA A  1 145 ? 22.025  27.765  1.533   1.00   17.34 ? 252 ALA A O   1 
ATOM   1096  C  CB  . ALA A  1 145 ? 24.401  26.950  2.940   1.00   12.43 ? 252 ALA A CB  1 
ATOM   1097  N  N   . SER A  1 146 ? 22.915  29.837  1.560   1.00   16.05 ? 253 SER A N   1 
ATOM   1098  C  CA  . SER A  1 146 ? 22.176  30.309  0.404   1.00   17.71 ? 253 SER A CA  1 
ATOM   1099  C  C   . SER A  1 146 ? 23.115  30.360  -0.804  1.00   19.14 ? 253 SER A C   1 
ATOM   1100  O  O   . SER A  1 146 ? 23.332  31.416  -1.404  1.00   19.82 ? 253 SER A O   1 
ATOM   1101  C  CB  . SER A  1 146 ? 21.601  31.698  0.686   1.00   19.05 ? 253 SER A CB  1 
ATOM   1102  O  OG  . SER A  1 146 ? 20.652  31.625  1.737   1.00   20.77 ? 253 SER A OG  1 
ATOM   1103  N  N   . TRP A  1 147 ? 23.680  29.209  -1.146  1.00   18.01 ? 254 TRP A N   1 
ATOM   1104  C  CA  . TRP A  1 147 ? 24.613  29.099  -2.262  1.00   19.17 ? 254 TRP A CA  1 
ATOM   1105  C  C   . TRP A  1 147 ? 24.702  27.641  -2.658  1.00   19.68 ? 254 TRP A C   1 
ATOM   1106  O  O   . TRP A  1 147 ? 24.150  26.780  -1.976  1.00   22.60 ? 254 TRP A O   1 
ATOM   1107  C  CB  . TRP A  1 147 ? 26.018  29.610  -1.879  1.00   17.59 ? 254 TRP A CB  1 
ATOM   1108  C  CG  . TRP A  1 147 ? 26.579  29.059  -0.580  1.00   17.33 ? 254 TRP A CG  1 
ATOM   1109  C  CD1 . TRP A  1 147 ? 26.433  29.597  0.660   1.00   15.90 ? 254 TRP A CD1 1 
ATOM   1110  C  CD2 . TRP A  1 147 ? 27.326  27.842  -0.403  1.00   16.72 ? 254 TRP A CD2 1 
ATOM   1111  N  NE1 . TRP A  1 147 ? 27.041  28.799  1.607   1.00   20.07 ? 254 TRP A NE1 1 
ATOM   1112  C  CE2 . TRP A  1 147 ? 27.594  27.713  0.981   1.00   17.53 ? 254 TRP A CE2 1 
ATOM   1113  C  CE3 . TRP A  1 147 ? 27.794  26.852  -1.277  1.00   15.06 ? 254 TRP A CE3 1 
ATOM   1114  C  CZ2 . TRP A  1 147 ? 28.300  26.636  1.510   1.00   15.62 ? 254 TRP A CZ2 1 
ATOM   1115  C  CZ3 . TRP A  1 147 ? 28.500  25.778  -0.751  1.00   14.36 ? 254 TRP A CZ3 1 
ATOM   1116  C  CH2 . TRP A  1 147 ? 28.745  25.678  0.633   1.00   18.66 ? 254 TRP A CH2 1 
ATOM   1117  N  N   . GLY A  1 148 ? 25.382  27.370  -3.764  1.00   18.20 ? 255 GLY A N   1 
ATOM   1118  C  CA  . GLY A  1 148 ? 25.538  26.003  -4.216  1.00   17.33 ? 255 GLY A CA  1 
ATOM   1119  C  C   . GLY A  1 148 ? 26.089  25.962  -5.618  1.00   18.39 ? 255 GLY A C   1 
ATOM   1120  O  O   . GLY A  1 148 ? 26.521  26.990  -6.140  1.00   22.06 ? 255 GLY A O   1 
ATOM   1121  N  N   . PRO A  1 149 ? 26.113  24.786  -6.252  1.00   17.71 ? 256 PRO A N   1 
ATOM   1122  C  CA  . PRO A  1 149 ? 26.622  24.633  -7.618  1.00   19.03 ? 256 PRO A CA  1 
ATOM   1123  C  C   . PRO A  1 149 ? 25.790  25.493  -8.567  1.00   19.94 ? 256 PRO A C   1 
ATOM   1124  O  O   . PRO A  1 149 ? 24.622  25.737  -8.310  1.00   19.94 ? 256 PRO A O   1 
ATOM   1125  C  CB  . PRO A  1 149 ? 26.423  23.145  -7.899  1.00   17.98 ? 256 PRO A CB  1 
ATOM   1126  C  CG  . PRO A  1 149 ? 26.468  22.528  -6.538  1.00   18.83 ? 256 PRO A CG  1 
ATOM   1127  C  CD  . PRO A  1 149 ? 25.714  23.489  -5.688  1.00   15.62 ? 256 PRO A CD  1 
ATOM   1128  N  N   . GLU A  1 150 ? 26.396  25.935  -9.661  1.00   23.60 ? 257 GLU A N   1 
ATOM   1129  C  CA  . GLU A  1 150 ? 25.724  26.763  -10.647 1.00   26.55 ? 257 GLU A CA  1 
ATOM   1130  C  C   . GLU A  1 150 ? 24.422  26.099  -11.108 1.00   26.81 ? 257 GLU A C   1 
ATOM   1131  O  O   . GLU A  1 150 ? 24.367  24.888  -11.296 1.00   26.05 ? 257 GLU A O   1 
ATOM   1132  C  CB  . GLU A  1 150 ? 26.670  26.980  -11.821 1.00   32.32 ? 257 GLU A CB  1 
ATOM   1133  C  CG  . GLU A  1 150 ? 26.189  27.935  -12.891 1.00   39.26 ? 257 GLU A CG  1 
ATOM   1134  C  CD  . GLU A  1 150 ? 27.260  28.170  -13.957 1.00   45.79 ? 257 GLU A CD  1 
ATOM   1135  O  OE1 . GLU A  1 150 ? 26.964  28.850  -14.967 1.00   46.45 ? 257 GLU A OE1 1 
ATOM   1136  O  OE2 . GLU A  1 150 ? 28.401  27.673  -13.774 1.00   45.80 ? 257 GLU A OE2 1 
ATOM   1137  N  N   . ASP A  1 151 ? 23.369  26.896  -11.269 1.00   24.35 ? 258 ASP A N   1 
ATOM   1138  C  CA  . ASP A  1 151 ? 22.081  26.363  -11.695 1.00   25.77 ? 258 ASP A CA  1 
ATOM   1139  C  C   . ASP A  1 151 ? 21.912  26.452  -13.214 1.00   24.99 ? 258 ASP A C   1 
ATOM   1140  O  O   . ASP A  1 151 ? 20.950  27.053  -13.706 1.00   23.78 ? 258 ASP A O   1 
ATOM   1141  C  CB  . ASP A  1 151 ? 20.943  27.129  -11.008 1.00   25.20 ? 258 ASP A CB  1 
ATOM   1142  C  CG  . ASP A  1 151 ? 20.944  26.950  -9.505  1.00   26.95 ? 258 ASP A CG  1 
ATOM   1143  O  OD1 . ASP A  1 151 ? 21.068  25.791  -9.048  1.00   21.48 ? 258 ASP A OD1 1 
ATOM   1144  O  OD2 . ASP A  1 151 ? 20.807  27.967  -8.784  1.00   23.46 ? 258 ASP A OD2 1 
ATOM   1145  N  N   . ASP A  1 152 ? 22.831  25.860  -13.967 1.00   24.24 ? 259 ASP A N   1 
ATOM   1146  C  CA  . ASP A  1 152 ? 22.712  25.952  -15.415 1.00   24.67 ? 259 ASP A CA  1 
ATOM   1147  C  C   . ASP A  1 152 ? 21.766  24.914  -15.996 1.00   25.29 ? 259 ASP A C   1 
ATOM   1148  O  O   . ASP A  1 152 ? 21.471  24.948  -17.182 1.00   25.60 ? 259 ASP A O   1 
ATOM   1149  C  CB  . ASP A  1 152 ? 24.079  25.842  -16.084 1.00   25.53 ? 259 ASP A CB  1 
ATOM   1150  C  CG  . ASP A  1 152 ? 24.802  24.588  -15.705 1.00   28.63 ? 259 ASP A CG  1 
ATOM   1151  O  OD1 . ASP A  1 152 ? 24.148  23.689  -15.150 1.00   29.41 ? 259 ASP A OD1 1 
ATOM   1152  O  OD2 . ASP A  1 152 ? 26.019  24.489  -15.971 1.00   34.63 ? 259 ASP A OD2 1 
ATOM   1153  N  N   . GLY A  1 153 ? 21.276  24.006  -15.159 1.00   22.58 ? 260 GLY A N   1 
ATOM   1154  C  CA  . GLY A  1 153 ? 20.357  23.000  -15.644 1.00   25.87 ? 260 GLY A CA  1 
ATOM   1155  C  C   . GLY A  1 153 ? 21.020  21.911  -16.466 1.00   27.89 ? 260 GLY A C   1 
ATOM   1156  O  O   . GLY A  1 153 ? 20.338  21.159  -17.171 1.00   27.70 ? 260 GLY A O   1 
ATOM   1157  N  N   . LYS A  1 154 ? 22.343  21.817  -16.397 1.00   27.28 ? 261 LYS A N   1 
ATOM   1158  C  CA  . LYS A  1 154 ? 23.032  20.780  -17.148 1.00   30.54 ? 261 LYS A CA  1 
ATOM   1159  C  C   . LYS A  1 154 ? 24.129  20.092  -16.353 1.00   31.46 ? 261 LYS A C   1 
ATOM   1160  O  O   . LYS A  1 154 ? 24.705  19.107  -16.804 1.00   35.00 ? 261 LYS A O   1 
ATOM   1161  C  CB  . LYS A  1 154 ? 23.600  21.331  -18.456 1.00   29.84 ? 261 LYS A CB  1 
ATOM   1162  C  CG  . LYS A  1 154 ? 24.561  22.486  -18.317 1.00   34.91 ? 261 LYS A CG  1 
ATOM   1163  C  CD  . LYS A  1 154 ? 25.083  22.922  -19.696 1.00   36.66 ? 261 LYS A CD  1 
ATOM   1164  C  CE  . LYS A  1 154 ? 25.685  24.327  -19.672 1.00   35.78 ? 261 LYS A CE  1 
ATOM   1165  N  NZ  . LYS A  1 154 ? 26.271  24.708  -20.987 0.0000 36.14 ? 261 LYS A NZ  1 
ATOM   1166  N  N   . THR A  1 155 ? 24.404  20.579  -15.155 1.00   30.26 ? 262 THR A N   1 
ATOM   1167  C  CA  . THR A  1 155 ? 25.439  19.949  -14.362 1.00   32.47 ? 262 THR A CA  1 
ATOM   1168  C  C   . THR A  1 155 ? 24.897  19.131  -13.192 1.00   29.17 ? 262 THR A C   1 
ATOM   1169  O  O   . THR A  1 155 ? 23.776  19.341  -12.725 1.00   27.95 ? 262 THR A O   1 
ATOM   1170  C  CB  . THR A  1 155 ? 26.445  21.000  -13.823 1.00   34.12 ? 262 THR A CB  1 
ATOM   1171  O  OG1 . THR A  1 155 ? 26.409  21.031  -12.395 1.00   40.40 ? 262 THR A OG1 1 
ATOM   1172  C  CG2 . THR A  1 155 ? 26.075  22.350  -14.288 1.00   36.46 ? 262 THR A CG2 1 
ATOM   1173  N  N   . VAL A  1 156 ? 25.710  18.180  -12.752 1.00   24.74 ? 263 VAL A N   1 
ATOM   1174  C  CA  . VAL A  1 156 ? 25.398  17.340  -11.608 1.00   24.89 ? 263 VAL A CA  1 
ATOM   1175  C  C   . VAL A  1 156 ? 26.615  17.562  -10.727 1.00   24.20 ? 263 VAL A C   1 
ATOM   1176  O  O   . VAL A  1 156 ? 27.738  17.225  -11.112 1.00   22.29 ? 263 VAL A O   1 
ATOM   1177  C  CB  . VAL A  1 156 ? 25.303  15.867  -11.994 1.00   21.48 ? 263 VAL A CB  1 
ATOM   1178  C  CG1 . VAL A  1 156 ? 25.073  15.029  -10.758 1.00   23.05 ? 263 VAL A CG1 1 
ATOM   1179  C  CG2 . VAL A  1 156 ? 24.174  15.676  -13.002 1.00   23.20 ? 263 VAL A CG2 1 
ATOM   1180  N  N   . ASP A  1 157 ? 26.403  18.152  -9.557  1.00   24.68 ? 264 ASP A N   1 
ATOM   1181  C  CA  . ASP A  1 157 ? 27.522  18.460  -8.676  1.00   22.16 ? 264 ASP A CA  1 
ATOM   1182  C  C   . ASP A  1 157 ? 27.077  18.383  -7.219  1.00   21.84 ? 264 ASP A C   1 
ATOM   1183  O  O   . ASP A  1 157 ? 25.884  18.411  -6.913  1.00   20.89 ? 264 ASP A O   1 
ATOM   1184  C  CB  . ASP A  1 157 ? 28.040  19.868  -9.029  1.00   23.11 ? 264 ASP A CB  1 
ATOM   1185  C  CG  . ASP A  1 157 ? 29.435  20.163  -8.482  1.00   25.87 ? 264 ASP A CG  1 
ATOM   1186  O  OD1 . ASP A  1 157 ? 30.014  19.331  -7.755  1.00   29.62 ? 264 ASP A OD1 1 
ATOM   1187  O  OD2 . ASP A  1 157 ? 29.957  21.257  -8.788  1.00   28.30 ? 264 ASP A OD2 1 
ATOM   1188  N  N   . GLY A  1 158 ? 28.050  18.282  -6.325  1.00   19.83 ? 265 GLY A N   1 
ATOM   1189  C  CA  . GLY A  1 158 ? 27.756  18.185  -4.913  1.00   22.65 ? 265 GLY A CA  1 
ATOM   1190  C  C   . GLY A  1 158 ? 29.024  18.340  -4.097  1.00   23.13 ? 265 GLY A C   1 
ATOM   1191  O  O   . GLY A  1 158 ? 30.086  18.616  -4.656  1.00   25.46 ? 265 GLY A O   1 
ATOM   1192  N  N   . PRO A  1 159 ? 28.950  18.156  -2.770  1.00   21.48 ? 266 PRO A N   1 
ATOM   1193  C  CA  . PRO A  1 159 ? 30.134  18.294  -1.920  1.00   20.84 ? 266 PRO A CA  1 
ATOM   1194  C  C   . PRO A  1 159 ? 31.232  17.274  -2.205  1.00   19.58 ? 266 PRO A C   1 
ATOM   1195  O  O   . PRO A  1 159 ? 30.950  16.103  -2.471  1.00   20.74 ? 266 PRO A O   1 
ATOM   1196  C  CB  . PRO A  1 159 ? 29.561  18.133  -0.512  1.00   16.59 ? 266 PRO A CB  1 
ATOM   1197  C  CG  . PRO A  1 159 ? 28.463  17.147  -0.733  1.00   16.90 ? 266 PRO A CG  1 
ATOM   1198  C  CD  . PRO A  1 159 ? 27.791  17.720  -1.970  1.00   17.76 ? 266 PRO A CD  1 
ATOM   1199  N  N   . ALA A  1 160 ? 32.478  17.734  -2.162  1.00   17.38 ? 267 ALA A N   1 
ATOM   1200  C  CA  . ALA A  1 160 ? 33.623  16.856  -2.354  1.00   15.86 ? 267 ALA A CA  1 
ATOM   1201  C  C   . ALA A  1 160 ? 33.848  16.206  -0.974  1.00   17.17 ? 267 ALA A C   1 
ATOM   1202  O  O   . ALA A  1 160 ? 33.101  16.480  -0.025  1.00   17.33 ? 267 ALA A O   1 
ATOM   1203  C  CB  . ALA A  1 160 ? 34.831  17.658  -2.792  1.00   13.92 ? 267 ALA A CB  1 
ATOM   1204  N  N   . ARG A  1 161 ? 34.864  15.366  -0.854  1.00   16.93 ? 268 ARG A N   1 
ATOM   1205  C  CA  . ARG A  1 161 ? 35.100  14.629  0.385   1.00   22.17 ? 268 ARG A CA  1 
ATOM   1206  C  C   . ARG A  1 161 ? 35.166  15.343  1.720   1.00   21.35 ? 268 ARG A C   1 
ATOM   1207  O  O   . ARG A  1 161 ? 34.503  14.920  2.674   1.00   23.04 ? 268 ARG A O   1 
ATOM   1208  C  CB  . ARG A  1 161 ? 36.326  13.735  0.218   1.00   24.57 ? 268 ARG A CB  1 
ATOM   1209  C  CG  . ARG A  1 161 ? 36.052  12.618  -0.788  1.00   37.24 ? 268 ARG A CG  1 
ATOM   1210  C  CD  . ARG A  1 161 ? 37.320  11.881  -1.217  1.00   46.53 ? 268 ARG A CD  1 
ATOM   1211  N  NE  . ARG A  1 161 ? 37.091  10.991  -2.361  1.00   51.90 ? 268 ARG A NE  1 
ATOM   1212  C  CZ  . ARG A  1 161 ? 36.331  9.894   -2.336  1.00   52.87 ? 268 ARG A CZ  1 
ATOM   1213  N  NH1 . ARG A  1 161 ? 35.708  9.528   -1.222  1.00   50.12 ? 268 ARG A NH1 1 
ATOM   1214  N  NH2 . ARG A  1 161 ? 36.202  9.158   -3.432  1.00   53.40 ? 268 ARG A NH2 1 
ATOM   1215  N  N   . LEU A  1 162 ? 35.946  16.413  1.810   1.00   20.72 ? 269 LEU A N   1 
ATOM   1216  C  CA  . LEU A  1 162 ? 36.058  17.116  3.079   1.00   19.53 ? 269 LEU A CA  1 
ATOM   1217  C  C   . LEU A  1 162 ? 34.716  17.682  3.501   1.00   21.01 ? 269 LEU A C   1 
ATOM   1218  O  O   . LEU A  1 162 ? 34.333  17.590  4.678   1.00   19.16 ? 269 LEU A O   1 
ATOM   1219  C  CB  . LEU A  1 162 ? 37.107  18.230  2.997   1.00   21.01 ? 269 LEU A CB  1 
ATOM   1220  C  CG  . LEU A  1 162 ? 38.571  17.805  2.842   1.00   20.54 ? 269 LEU A CG  1 
ATOM   1221  C  CD1 . LEU A  1 162 ? 39.436  19.031  2.671   1.00   22.61 ? 269 LEU A CD1 1 
ATOM   1222  C  CD2 . LEU A  1 162 ? 39.022  17.013  4.064   1.00   21.78 ? 269 LEU A CD2 1 
ATOM   1223  N  N   . ALA A  1 163 ? 33.993  18.254  2.544   1.00   19.86 ? 270 ALA A N   1 
ATOM   1224  C  CA  . ALA A  1 163 ? 32.680  18.821  2.844   1.00   22.22 ? 270 ALA A CA  1 
ATOM   1225  C  C   . ALA A  1 163 ? 31.741  17.710  3.307   1.00   22.70 ? 270 ALA A C   1 
ATOM   1226  O  O   . ALA A  1 163 ? 30.988  17.889  4.260   1.00   23.45 ? 270 ALA A O   1 
ATOM   1227  C  CB  . ALA A  1 163 ? 32.103  19.523  1.617   1.00   18.96 ? 270 ALA A CB  1 
ATOM   1228  N  N   . GLU A  1 164 ? 31.789  16.560  2.642   1.00   22.90 ? 271 GLU A N   1 
ATOM   1229  C  CA  . GLU A  1 164 ? 30.933  15.458  3.055   1.00   24.99 ? 271 GLU A CA  1 
ATOM   1230  C  C   . GLU A  1 164 ? 31.282  15.087  4.479   1.00   21.60 ? 271 GLU A C   1 
ATOM   1231  O  O   . GLU A  1 164 ? 30.396  14.894  5.313   1.00   18.66 ? 271 GLU A O   1 
ATOM   1232  C  CB  . GLU A  1 164 ? 31.149  14.217  2.204   1.00   29.93 ? 271 GLU A CB  1 
ATOM   1233  C  CG  . GLU A  1 164 ? 30.703  14.298  0.794   1.00   37.70 ? 271 GLU A CG  1 
ATOM   1234  C  CD  . GLU A  1 164 ? 30.710  12.922  0.172   1.00   42.71 ? 271 GLU A CD  1 
ATOM   1235  O  OE1 . GLU A  1 164 ? 29.865  12.102  0.584   1.00   47.25 ? 271 GLU A OE1 1 
ATOM   1236  O  OE2 . GLU A  1 164 ? 31.563  12.655  -0.706  1.00   46.80 ? 271 GLU A OE2 1 
ATOM   1237  N  N   . GLU A  1 165 ? 32.579  14.969  4.750   1.00   18.82 ? 272 GLU A N   1 
ATOM   1238  C  CA  . GLU A  1 165 ? 33.019  14.599  6.096   1.00   19.73 ? 272 GLU A CA  1 
ATOM   1239  C  C   . GLU A  1 165 ? 32.549  15.622  7.107   1.00   17.69 ? 272 GLU A C   1 
ATOM   1240  O  O   . GLU A  1 165 ? 32.169  15.271  8.221   1.00   17.10 ? 272 GLU A O   1 
ATOM   1241  C  CB  . GLU A  1 165 ? 34.541  14.450  6.148   1.00   19.67 ? 272 GLU A CB  1 
ATOM   1242  C  CG  . GLU A  1 165 ? 35.016  13.226  5.370   1.00   22.51 ? 272 GLU A CG  1 
ATOM   1243  C  CD  . GLU A  1 165 ? 36.518  13.036  5.391   1.00   23.31 ? 272 GLU A CD  1 
ATOM   1244  O  OE1 . GLU A  1 165 ? 36.954  11.879  5.226   1.00   20.16 ? 272 GLU A OE1 1 
ATOM   1245  O  OE2 . GLU A  1 165 ? 37.263  14.028  5.562   1.00   22.93 ? 272 GLU A OE2 1 
ATOM   1246  N  N   . ALA A  1 166 ? 32.544  16.889  6.707   1.00   17.10 ? 273 ALA A N   1 
ATOM   1247  C  CA  . ALA A  1 166 ? 32.099  17.949  7.607   1.00   17.04 ? 273 ALA A CA  1 
ATOM   1248  C  C   . ALA A  1 166 ? 30.625  17.756  7.932   1.00   18.16 ? 273 ALA A C   1 
ATOM   1249  O  O   . ALA A  1 166 ? 30.213  17.890  9.089   1.00   16.09 ? 273 ALA A O   1 
ATOM   1250  C  CB  . ALA A  1 166 ? 32.322  19.325  6.974   1.00   14.68 ? 273 ALA A CB  1 
ATOM   1251  N  N   . PHE A  1 167 ? 29.833  17.431  6.908   1.00   19.19 ? 274 PHE A N   1 
ATOM   1252  C  CA  . PHE A  1 167 ? 28.404  17.214  7.109   1.00   20.67 ? 274 PHE A CA  1 
ATOM   1253  C  C   . PHE A  1 167 ? 28.196  16.068  8.084   1.00   18.73 ? 274 PHE A C   1 
ATOM   1254  O  O   . PHE A  1 167 ? 27.406  16.177  9.019   1.00   18.46 ? 274 PHE A O   1 
ATOM   1255  C  CB  . PHE A  1 167 ? 27.701  16.866  5.791   1.00   16.60 ? 274 PHE A CB  1 
ATOM   1256  C  CG  . PHE A  1 167 ? 27.279  18.060  4.981   1.00   18.63 ? 274 PHE A CG  1 
ATOM   1257  C  CD1 . PHE A  1 167 ? 26.509  19.073  5.550   1.00   19.82 ? 274 PHE A CD1 1 
ATOM   1258  C  CD2 . PHE A  1 167 ? 27.581  18.137  3.619   1.00   18.57 ? 274 PHE A CD2 1 
ATOM   1259  C  CE1 . PHE A  1 167 ? 26.037  20.154  4.773   1.00   19.89 ? 274 PHE A CE1 1 
ATOM   1260  C  CE2 . PHE A  1 167 ? 27.113  19.205  2.833   1.00   17.78 ? 274 PHE A CE2 1 
ATOM   1261  C  CZ  . PHE A  1 167 ? 26.341  20.212  3.408   1.00   16.88 ? 274 PHE A CZ  1 
ATOM   1262  N  N   . PHE A  1 168 ? 28.910  14.971  7.845   1.00   17.60 ? 275 PHE A N   1 
ATOM   1263  C  CA  . PHE A  1 168 ? 28.804  13.776  8.672   1.00   19.97 ? 275 PHE A CA  1 
ATOM   1264  C  C   . PHE A  1 168 ? 29.266  14.010  10.110  1.00   17.15 ? 275 PHE A C   1 
ATOM   1265  O  O   . PHE A  1 168 ? 28.619  13.566  11.042  1.00   16.01 ? 275 PHE A O   1 
ATOM   1266  C  CB  . PHE A  1 168 ? 29.616  12.640  8.043   1.00   26.33 ? 275 PHE A CB  1 
ATOM   1267  C  CG  . PHE A  1 168 ? 28.955  11.295  8.142   1.00   37.25 ? 275 PHE A CG  1 
ATOM   1268  C  CD1 . PHE A  1 168 ? 28.410  10.860  9.345   1.00   41.07 ? 275 PHE A CD1 1 
ATOM   1269  C  CD2 . PHE A  1 168 ? 28.892  10.455  7.033   1.00   42.26 ? 275 PHE A CD2 1 
ATOM   1270  C  CE1 . PHE A  1 168 ? 27.807  9.604   9.455   1.00   45.29 ? 275 PHE A CE1 1 
ATOM   1271  C  CE2 . PHE A  1 168 ? 28.292  9.196   7.127   1.00   45.75 ? 275 PHE A CE2 1 
ATOM   1272  C  CZ  . PHE A  1 168 ? 27.747  8.772   8.349   1.00   46.18 ? 275 PHE A CZ  1 
ATOM   1273  N  N   . ARG A  1 169 ? 30.387  14.701  10.294  1.00   16.15 ? 276 ARG A N   1 
ATOM   1274  C  CA  . ARG A  1 169 ? 30.853  14.978  11.649  1.00   18.47 ? 276 ARG A CA  1 
ATOM   1275  C  C   . ARG A  1 169 ? 29.814  15.889  12.298  1.00   18.57 ? 276 ARG A C   1 
ATOM   1276  O  O   . ARG A  1 169 ? 29.519  15.776  13.485  1.00   18.73 ? 276 ARG A O   1 
ATOM   1277  C  CB  . ARG A  1 169 ? 32.198  15.712  11.641  1.00   20.74 ? 276 ARG A CB  1 
ATOM   1278  C  CG  . ARG A  1 169 ? 33.351  14.965  11.019  1.00   20.69 ? 276 ARG A CG  1 
ATOM   1279  C  CD  . ARG A  1 169 ? 34.548  15.888  10.908  1.00   16.11 ? 276 ARG A CD  1 
ATOM   1280  N  NE  . ARG A  1 169 ? 35.131  16.228  12.203  1.00   19.54 ? 276 ARG A NE  1 
ATOM   1281  C  CZ  . ARG A  1 169 ? 35.931  15.426  12.905  1.00   21.68 ? 276 ARG A CZ  1 
ATOM   1282  N  NH1 . ARG A  1 169 ? 36.415  15.823  14.080  1.00   16.66 ? 276 ARG A NH1 1 
ATOM   1283  N  NH2 . ARG A  1 169 ? 36.252  14.226  12.432  1.00   21.17 ? 276 ARG A NH2 1 
ATOM   1284  N  N   . GLY A  1 170 ? 29.264  16.797  11.500  1.00   17.53 ? 277 GLY A N   1 
ATOM   1285  C  CA  . GLY A  1 170 ? 28.272  17.725  12.012  1.00   19.70 ? 277 GLY A CA  1 
ATOM   1286  C  C   . GLY A  1 170 ? 27.016  17.087  12.592  1.00   20.27 ? 277 GLY A C   1 
ATOM   1287  O  O   . GLY A  1 170 ? 26.639  17.366  13.728  1.00   17.64 ? 277 GLY A O   1 
ATOM   1288  N  N   . VAL A  1 171 ? 26.359  16.218  11.834  1.00   20.19 ? 278 VAL A N   1 
ATOM   1289  C  CA  . VAL A  1 171 ? 25.144  15.601  12.356  1.00   23.24 ? 278 VAL A CA  1 
ATOM   1290  C  C   . VAL A  1 171 ? 25.429  14.550  13.419  1.00   24.08 ? 278 VAL A C   1 
ATOM   1291  O  O   . VAL A  1 171 ? 24.551  14.238  14.222  1.00   25.92 ? 278 VAL A O   1 
ATOM   1292  C  CB  . VAL A  1 171 ? 24.300  14.980  11.228  1.00   22.05 ? 278 VAL A CB  1 
ATOM   1293  C  CG1 . VAL A  1 171 ? 24.059  16.043  10.144  1.00   18.74 ? 278 VAL A CG1 1 
ATOM   1294  C  CG2 . VAL A  1 171 ? 25.001  13.764  10.650  1.00   16.63 ? 278 VAL A CG2 1 
ATOM   1295  N  N   . SER A  1 172 ? 26.655  14.030  13.440  1.00   22.66 ? 279 SER A N   1 
ATOM   1296  C  CA  . SER A  1 172 ? 27.041  13.011  14.419  1.00   24.15 ? 279 SER A CA  1 
ATOM   1297  C  C   . SER A  1 172 ? 27.509  13.588  15.733  1.00   22.68 ? 279 SER A C   1 
ATOM   1298  O  O   . SER A  1 172 ? 27.084  13.155  16.798  1.00   22.94 ? 279 SER A O   1 
ATOM   1299  C  CB  . SER A  1 172 ? 28.192  12.149  13.887  1.00   23.31 ? 279 SER A CB  1 
ATOM   1300  O  OG  . SER A  1 172 ? 27.813  11.456  12.723  1.00   34.45 ? 279 SER A OG  1 
ATOM   1301  N  N   . GLN A  1 173 ? 28.396  14.569  15.642  1.00   22.57 ? 280 GLN A N   1 
ATOM   1302  C  CA  . GLN A  1 173 ? 29.012  15.166  16.815  1.00   24.29 ? 280 GLN A CA  1 
ATOM   1303  C  C   . GLN A  1 173 ? 28.616  16.591  17.150  1.00   22.39 ? 280 GLN A C   1 
ATOM   1304  O  O   . GLN A  1 173 ? 28.745  17.009  18.299  1.00   23.80 ? 280 GLN A O   1 
ATOM   1305  C  CB  . GLN A  1 173 ? 30.536  15.075  16.662  1.00   26.84 ? 280 GLN A CB  1 
ATOM   1306  C  CG  . GLN A  1 173 ? 31.044  13.640  16.596  1.00   35.97 ? 280 GLN A CG  1 
ATOM   1307  C  CD  . GLN A  1 173 ? 32.047  13.399  15.468  1.00   40.76 ? 280 GLN A CD  1 
ATOM   1308  O  OE1 . GLN A  1 173 ? 33.017  14.155  15.299  1.00   42.80 ? 280 GLN A OE1 1 
ATOM   1309  N  NE2 . GLN A  1 173 ? 31.822  12.331  14.699  1.00   42.61 ? 280 GLN A NE2 1 
ATOM   1310  N  N   . GLY A  1 174 ? 28.137  17.342  16.162  1.00   18.80 ? 281 GLY A N   1 
ATOM   1311  C  CA  . GLY A  1 174 ? 27.749  18.714  16.429  1.00   18.98 ? 281 GLY A CA  1 
ATOM   1312  C  C   . GLY A  1 174 ? 26.717  18.842  17.544  1.00   20.93 ? 281 GLY A C   1 
ATOM   1313  O  O   . GLY A  1 174 ? 25.993  17.887  17.853  1.00   18.87 ? 281 GLY A O   1 
ATOM   1314  N  N   . ARG A  1 175 ? 26.643  20.024  18.145  1.00   19.03 ? 282 ARG A N   1 
ATOM   1315  C  CA  . ARG A  1 175 ? 25.687  20.284  19.224  1.00   24.13 ? 282 ARG A CA  1 
ATOM   1316  C  C   . ARG A  1 175 ? 25.699  19.193  20.288  1.00   22.81 ? 282 ARG A C   1 
ATOM   1317  O  O   . ARG A  1 175 ? 24.654  18.661  20.648  1.00   21.24 ? 282 ARG A O   1 
ATOM   1318  C  CB  . ARG A  1 175 ? 24.259  20.403  18.671  1.00   20.85 ? 282 ARG A CB  1 
ATOM   1319  C  CG  . ARG A  1 175 ? 23.937  21.683  17.929  1.00   26.19 ? 282 ARG A CG  1 
ATOM   1320  C  CD  . ARG A  1 175 ? 22.607  21.526  17.180  1.00   24.07 ? 282 ARG A CD  1 
ATOM   1321  N  NE  . ARG A  1 175 ? 21.519  21.397  18.126  1.00   25.01 ? 282 ARG A NE  1 
ATOM   1322  C  CZ  . ARG A  1 175 ? 20.504  20.548  18.021  1.00   20.61 ? 282 ARG A CZ  1 
ATOM   1323  N  NH1 . ARG A  1 175 ? 20.395  19.709  16.994  1.00   18.47 ? 282 ARG A NH1 1 
ATOM   1324  N  NH2 . ARG A  1 175 ? 19.597  20.539  18.976  1.00   22.54 ? 282 ARG A NH2 1 
ATOM   1325  N  N   . GLY A  1 176 ? 26.881  18.857  20.786  1.00   23.95 ? 283 GLY A N   1 
ATOM   1326  C  CA  . GLY A  1 176 ? 26.965  17.828  21.802  1.00   22.22 ? 283 GLY A CA  1 
ATOM   1327  C  C   . GLY A  1 176 ? 26.364  16.485  21.415  1.00   21.21 ? 283 GLY A C   1 
ATOM   1328  O  O   . GLY A  1 176 ? 25.820  15.788  22.266  1.00   22.76 ? 283 GLY A O   1 
ATOM   1329  N  N   . GLY A  1 177 ? 26.450  16.106  20.144  1.00   21.05 ? 284 GLY A N   1 
ATOM   1330  C  CA  . GLY A  1 177 ? 25.899  14.821  19.737  1.00   18.12 ? 284 GLY A CA  1 
ATOM   1331  C  C   . GLY A  1 177 ? 24.484  14.889  19.192  1.00   19.47 ? 284 GLY A C   1 
ATOM   1332  O  O   . GLY A  1 177 ? 24.009  13.924  18.605  1.00   25.66 ? 284 GLY A O   1 
ATOM   1333  N  N   . LEU A  1 178 ? 23.797  16.012  19.375  1.00   18.68 ? 285 LEU A N   1 
ATOM   1334  C  CA  . LEU A  1 178 ? 22.432  16.139  18.856  1.00   20.45 ? 285 LEU A CA  1 
ATOM   1335  C  C   . LEU A  1 178 ? 22.461  16.355  17.337  1.00   20.39 ? 285 LEU A C   1 
ATOM   1336  O  O   . LEU A  1 178 ? 21.486  16.047  16.643  1.00   21.68 ? 285 LEU A O   1 
ATOM   1337  C  CB  . LEU A  1 178 ? 21.695  17.301  19.543  1.00   19.56 ? 285 LEU A CB  1 
ATOM   1338  C  CG  . LEU A  1 178 ? 21.567  17.142  21.063  1.00   21.28 ? 285 LEU A CG  1 
ATOM   1339  C  CD1 . LEU A  1 178 ? 20.954  18.388  21.710  1.00   18.79 ? 285 LEU A CD1 1 
ATOM   1340  C  CD2 . LEU A  1 178 ? 20.717  15.910  21.340  1.00   19.63 ? 285 LEU A CD2 1 
ATOM   1341  N  N   . GLY A  1 179 ? 23.580  16.886  16.832  1.00   17.32 ? 286 GLY A N   1 
ATOM   1342  C  CA  . GLY A  1 179 ? 23.724  17.113  15.403  1.00   14.16 ? 286 GLY A CA  1 
ATOM   1343  C  C   . GLY A  1 179 ? 23.506  18.534  14.892  1.00   16.93 ? 286 GLY A C   1 
ATOM   1344  O  O   . GLY A  1 179 ? 22.475  19.145  15.171  1.00   18.45 ? 286 GLY A O   1 
ATOM   1345  N  N   . SER A  1 180 ? 24.482  19.069  14.159  1.00   15.20 ? 287 SER A N   1 
ATOM   1346  C  CA  . SER A  1 180 ? 24.376  20.406  13.572  1.00   16.35 ? 287 SER A CA  1 
ATOM   1347  C  C   . SER A  1 180 ? 23.149  20.441  12.649  1.00   15.58 ? 287 SER A C   1 
ATOM   1348  O  O   . SER A  1 180 ? 22.830  19.442  12.001  1.00   16.57 ? 287 SER A O   1 
ATOM   1349  C  CB  . SER A  1 180 ? 25.611  20.731  12.709  1.00   14.83 ? 287 SER A CB  1 
ATOM   1350  O  OG  . SER A  1 180 ? 26.816  20.728  13.447  1.00   19.40 ? 287 SER A OG  1 
ATOM   1351  N  N   . ILE A  1 181 ? 22.460  21.578  12.598  1.00   14.62 ? 288 ILE A N   1 
ATOM   1352  C  CA  . ILE A  1 181 ? 21.307  21.732  11.711  1.00   14.94 ? 288 ILE A CA  1 
ATOM   1353  C  C   . ILE A  1 181 ? 21.809  22.492  10.478  1.00   14.98 ? 288 ILE A C   1 
ATOM   1354  O  O   . ILE A  1 181 ? 22.266  23.622  10.589  1.00   20.08 ? 288 ILE A O   1 
ATOM   1355  C  CB  . ILE A  1 181 ? 20.173  22.572  12.350  1.00   15.92 ? 288 ILE A CB  1 
ATOM   1356  C  CG1 . ILE A  1 181 ? 19.688  21.932  13.662  1.00   15.67 ? 288 ILE A CG1 1 
ATOM   1357  C  CG2 . ILE A  1 181 ? 19.015  22.711  11.356  1.00   10.60 ? 288 ILE A CG2 1 
ATOM   1358  C  CD1 . ILE A  1 181 ? 19.210  20.518  13.519  1.00   18.96 ? 288 ILE A CD1 1 
ATOM   1359  N  N   . PHE A  1 182 ? 21.730  21.870  9.311   1.00   15.01 ? 289 PHE A N   1 
ATOM   1360  C  CA  . PHE A  1 182 ? 22.189  22.491  8.068   1.00   14.72 ? 289 PHE A CA  1 
ATOM   1361  C  C   . PHE A  1 182 ? 20.986  22.864  7.182   1.00   15.41 ? 289 PHE A C   1 
ATOM   1362  O  O   . PHE A  1 182 ? 20.311  21.989  6.653   1.00   18.32 ? 289 PHE A O   1 
ATOM   1363  C  CB  . PHE A  1 182 ? 23.096  21.523  7.281   1.00   14.26 ? 289 PHE A CB  1 
ATOM   1364  C  CG  . PHE A  1 182 ? 24.392  21.157  7.984   1.00   16.61 ? 289 PHE A CG  1 
ATOM   1365  C  CD1 . PHE A  1 182 ? 25.421  22.096  8.133   1.00   15.37 ? 289 PHE A CD1 1 
ATOM   1366  C  CD2 . PHE A  1 182 ? 24.593  19.863  8.478   1.00   15.73 ? 289 PHE A CD2 1 
ATOM   1367  C  CE1 . PHE A  1 182 ? 26.633  21.753  8.764   1.00   14.68 ? 289 PHE A CE1 1 
ATOM   1368  C  CE2 . PHE A  1 182 ? 25.803  19.507  9.110   1.00   19.46 ? 289 PHE A CE2 1 
ATOM   1369  C  CZ  . PHE A  1 182 ? 26.824  20.457  9.251   1.00   18.93 ? 289 PHE A CZ  1 
ATOM   1370  N  N   . VAL A  1 183 ? 20.734  24.160  7.021   1.00   14.42 ? 290 VAL A N   1 
ATOM   1371  C  CA  . VAL A  1 183 ? 19.621  24.651  6.211   1.00   16.20 ? 290 VAL A CA  1 
ATOM   1372  C  C   . VAL A  1 183 ? 20.149  25.076  4.846   1.00   17.20 ? 290 VAL A C   1 
ATOM   1373  O  O   . VAL A  1 183 ? 21.124  25.823  4.767   1.00   17.42 ? 290 VAL A O   1 
ATOM   1374  C  CB  . VAL A  1 183 ? 18.948  25.867  6.878   1.00   13.74 ? 290 VAL A CB  1 
ATOM   1375  C  CG1 . VAL A  1 183 ? 17.754  26.303  6.058   1.00   14.62 ? 290 VAL A CG1 1 
ATOM   1376  C  CG2 . VAL A  1 183 ? 18.560  25.528  8.295   1.00   13.63 ? 290 VAL A CG2 1 
ATOM   1377  N  N   . TRP A  1 184 ? 19.498  24.623  3.773   1.00   15.75 ? 291 TRP A N   1 
ATOM   1378  C  CA  . TRP A  1 184 ? 19.967  24.932  2.425   1.00   14.71 ? 291 TRP A CA  1 
ATOM   1379  C  C   . TRP A  1 184 ? 18.909  25.520  1.492   1.00   16.58 ? 291 TRP A C   1 
ATOM   1380  O  O   . TRP A  1 184 ? 17.742  25.128  1.533   1.00   20.44 ? 291 TRP A O   1 
ATOM   1381  C  CB  . TRP A  1 184 ? 20.535  23.649  1.781   1.00   13.34 ? 291 TRP A CB  1 
ATOM   1382  C  CG  . TRP A  1 184 ? 21.807  23.875  1.033   1.00   15.76 ? 291 TRP A CG  1 
ATOM   1383  C  CD1 . TRP A  1 184 ? 21.938  24.332  -0.248  1.00   15.02 ? 291 TRP A CD1 1 
ATOM   1384  C  CD2 . TRP A  1 184 ? 23.135  23.783  1.565   1.00   15.20 ? 291 TRP A CD2 1 
ATOM   1385  N  NE1 . TRP A  1 184 ? 23.267  24.542  -0.546  1.00   13.56 ? 291 TRP A NE1 1 
ATOM   1386  C  CE2 . TRP A  1 184 ? 24.025  24.215  0.546   1.00   14.57 ? 291 TRP A CE2 1 
ATOM   1387  C  CE3 . TRP A  1 184 ? 23.660  23.385  2.806   1.00   13.56 ? 291 TRP A CE3 1 
ATOM   1388  C  CZ2 . TRP A  1 184 ? 25.414  24.260  0.725   1.00   12.54 ? 291 TRP A CZ2 1 
ATOM   1389  C  CZ3 . TRP A  1 184 ? 25.048  23.431  2.991   1.00   16.63 ? 291 TRP A CZ3 1 
ATOM   1390  C  CH2 . TRP A  1 184 ? 25.910  23.869  1.949   1.00   15.84 ? 291 TRP A CH2 1 
ATOM   1391  N  N   . ALA A  1 185 ? 19.322  26.456  0.642   1.00   17.60 ? 292 ALA A N   1 
ATOM   1392  C  CA  . ALA A  1 185 ? 18.423  27.059  -0.351  1.00   17.40 ? 292 ALA A CA  1 
ATOM   1393  C  C   . ALA A  1 185 ? 18.371  26.061  -1.518  1.00   17.44 ? 292 ALA A C   1 
ATOM   1394  O  O   . ALA A  1 185 ? 19.424  25.667  -2.025  1.00   19.49 ? 292 ALA A O   1 
ATOM   1395  C  CB  . ALA A  1 185 ? 18.982  28.390  -0.821  1.00   14.78 ? 292 ALA A CB  1 
ATOM   1396  N  N   . SER A  1 186 ? 17.174  25.647  -1.942  1.00   15.90 ? 293 SER A N   1 
ATOM   1397  C  CA  . SER A  1 186 ? 17.075  24.643  -3.006  1.00   18.18 ? 293 SER A CA  1 
ATOM   1398  C  C   . SER A  1 186 ? 17.564  25.037  -4.396  1.00   18.95 ? 293 SER A C   1 
ATOM   1399  O  O   . SER A  1 186 ? 17.796  24.162  -5.217  1.00   20.58 ? 293 SER A O   1 
ATOM   1400  C  CB  . SER A  1 186 ? 15.646  24.039  -3.097  1.00   17.37 ? 293 SER A CB  1 
ATOM   1401  O  OG  . SER A  1 186 ? 14.612  25.001  -3.265  1.00   19.54 ? 293 SER A OG  1 
ATOM   1402  N  N   . GLY A  1 187 ? 17.734  26.328  -4.673  1.00   19.53 ? 294 GLY A N   1 
ATOM   1403  C  CA  . GLY A  1 187 ? 18.251  26.719  -5.983  1.00   17.67 ? 294 GLY A CA  1 
ATOM   1404  C  C   . GLY A  1 187 ? 17.459  27.731  -6.797  1.00   20.31 ? 294 GLY A C   1 
ATOM   1405  O  O   . GLY A  1 187 ? 16.259  27.906  -6.586  1.00   20.85 ? 294 GLY A O   1 
ATOM   1406  N  N   . ASN A  1 188 ? 18.132  28.402  -7.735  1.00   19.39 ? 295 ASN A N   1 
ATOM   1407  C  CA  . ASN A  1 188 ? 17.489  29.398  -8.583  1.00   18.47 ? 295 ASN A CA  1 
ATOM   1408  C  C   . ASN A  1 188 ? 17.419  28.987  -10.049 1.00   18.34 ? 295 ASN A C   1 
ATOM   1409  O  O   . ASN A  1 188 ? 17.232  29.835  -10.910 1.00   19.08 ? 295 ASN A O   1 
ATOM   1410  C  CB  . ASN A  1 188 ? 18.234  30.739  -8.515  1.00   19.20 ? 295 ASN A CB  1 
ATOM   1411  C  CG  . ASN A  1 188 ? 17.842  31.578  -7.315  1.00   20.83 ? 295 ASN A CG  1 
ATOM   1412  O  OD1 . ASN A  1 188 ? 16.732  31.473  -6.802  1.00   20.04 ? 295 ASN A OD1 1 
ATOM   1413  N  ND2 . ASN A  1 188 ? 18.753  32.444  -6.879  1.00   20.14 ? 295 ASN A ND2 1 
ATOM   1414  N  N   . GLY A  1 189 ? 17.554  27.700  -10.347 1.00   17.96 ? 296 GLY A N   1 
ATOM   1415  C  CA  . GLY A  1 189 ? 17.546  27.274  -11.742 1.00   14.88 ? 296 GLY A CA  1 
ATOM   1416  C  C   . GLY A  1 189 ? 16.220  27.022  -12.435 1.00   17.52 ? 296 GLY A C   1 
ATOM   1417  O  O   . GLY A  1 189 ? 16.181  26.323  -13.460 1.00   13.01 ? 296 GLY A O   1 
ATOM   1418  N  N   . GLY A  1 190 ? 15.135  27.575  -11.900 1.00   16.46 ? 297 GLY A N   1 
ATOM   1419  C  CA  . GLY A  1 190 ? 13.829  27.368  -12.510 1.00   21.48 ? 297 GLY A CA  1 
ATOM   1420  C  C   . GLY A  1 190 ? 13.762  27.674  -14.005 1.00   24.08 ? 297 GLY A C   1 
ATOM   1421  O  O   . GLY A  1 190 ? 13.239  26.889  -14.796 1.00   22.47 ? 297 GLY A O   1 
ATOM   1422  N  N   . ARG A  1 191 ? 14.306  28.814  -14.405 1.00   26.35 ? 298 ARG A N   1 
ATOM   1423  C  CA  . ARG A  1 191 ? 14.287  29.199  -15.808 1.00   27.98 ? 298 ARG A CA  1 
ATOM   1424  C  C   . ARG A  1 191 ? 15.064  28.236  -16.711 1.00   28.47 ? 298 ARG A C   1 
ATOM   1425  O  O   . ARG A  1 191 ? 14.710  28.067  -17.885 1.00   26.24 ? 298 ARG A O   1 
ATOM   1426  C  CB  . ARG A  1 191 ? 14.836  30.612  -15.975 1.00   30.03 ? 298 ARG A CB  1 
ATOM   1427  C  CG  . ARG A  1 191 ? 14.494  31.198  -17.313 1.00   37.56 ? 298 ARG A CG  1 
ATOM   1428  C  CD  . ARG A  1 191 ? 15.712  31.779  -18.001 1.00   43.37 ? 298 ARG A CD  1 
ATOM   1429  N  NE  . ARG A  1 191 ? 15.857  33.206  -17.768 1.00   45.78 ? 298 ARG A NE  1 
ATOM   1430  C  CZ  . ARG A  1 191 ? 16.793  33.752  -16.999 1.00   48.48 ? 298 ARG A CZ  1 
ATOM   1431  N  NH1 . ARG A  1 191 ? 16.842  35.072  -16.857 1.00   49.50 ? 298 ARG A NH1 1 
ATOM   1432  N  NH2 . ARG A  1 191 ? 17.680  32.989  -16.377 1.00   46.69 ? 298 ARG A NH2 1 
ATOM   1433  N  N   . GLU A  1 192 ? 16.114  27.610  -16.174 1.00   27.91 ? 299 GLU A N   1 
ATOM   1434  C  CA  . GLU A  1 192 ? 16.913  26.664  -16.953 1.00   29.31 ? 299 GLU A CA  1 
ATOM   1435  C  C   . GLU A  1 192 ? 16.405  25.235  -16.754 1.00   29.35 ? 299 GLU A C   1 
ATOM   1436  O  O   . GLU A  1 192 ? 17.058  24.274  -17.168 1.00   30.18 ? 299 GLU A O   1 
ATOM   1437  C  CB  . GLU A  1 192 ? 18.394  26.713  -16.557 1.00   31.17 ? 299 GLU A CB  1 
ATOM   1438  C  CG  . GLU A  1 192 ? 18.971  28.096  -16.275 1.00   40.64 ? 299 GLU A CG  1 
ATOM   1439  C  CD  . GLU A  1 192 ? 18.494  29.189  -17.230 1.00   44.63 ? 299 GLU A CD  1 
ATOM   1440  O  OE1 . GLU A  1 192 ? 18.526  28.992  -18.468 1.00   46.76 ? 299 GLU A OE1 1 
ATOM   1441  O  OE2 . GLU A  1 192 ? 18.102  30.262  -16.726 1.00   46.11 ? 299 GLU A OE2 1 
ATOM   1442  N  N   . HIS A  1 193 ? 15.244  25.098  -16.120 1.00   27.79 ? 300 HIS A N   1 
ATOM   1443  C  CA  . HIS A  1 193 ? 14.652  23.784  -15.864 1.00   28.43 ? 300 HIS A CA  1 
ATOM   1444  C  C   . HIS A  1 193 ? 15.557  22.907  -15.015 1.00   27.09 ? 300 HIS A C   1 
ATOM   1445  O  O   . HIS A  1 193 ? 15.559  21.682  -15.172 1.00   25.64 ? 300 HIS A O   1 
ATOM   1446  C  CB  . HIS A  1 193 ? 14.379  23.030  -17.171 1.00   34.38 ? 300 HIS A CB  1 
ATOM   1447  C  CG  . HIS A  1 193 ? 13.595  23.810  -18.173 1.00   42.21 ? 300 HIS A CG  1 
ATOM   1448  N  ND1 . HIS A  1 193 ? 14.189  24.642  -19.101 1.00   47.02 ? 300 HIS A ND1 1 
ATOM   1449  C  CD2 . HIS A  1 193 ? 12.262  23.910  -18.375 1.00   44.03 ? 300 HIS A CD2 1 
ATOM   1450  C  CE1 . HIS A  1 193 ? 13.253  25.223  -19.829 1.00   47.86 ? 300 HIS A CE1 1 
ATOM   1451  N  NE2 . HIS A  1 193 ? 12.074  24.797  -19.409 1.00   48.56 ? 300 HIS A NE2 1 
ATOM   1452  N  N   . ASP A  1 194 ? 16.324  23.518  -14.122 1.00   24.00 ? 301 ASP A N   1 
ATOM   1453  C  CA  . ASP A  1 194 ? 17.225  22.752  -13.279 1.00   23.87 ? 301 ASP A CA  1 
ATOM   1454  C  C   . ASP A  1 194 ? 16.439  21.901  -12.272 1.00   23.45 ? 301 ASP A C   1 
ATOM   1455  O  O   . ASP A  1 194 ? 15.281  22.191  -11.971 1.00   24.94 ? 301 ASP A O   1 
ATOM   1456  C  CB  . ASP A  1 194 ? 18.177  23.699  -12.546 1.00   24.41 ? 301 ASP A CB  1 
ATOM   1457  C  CG  . ASP A  1 194 ? 19.437  23.006  -12.074 1.00   25.42 ? 301 ASP A CG  1 
ATOM   1458  O  OD1 . ASP A  1 194 ? 19.647  21.837  -12.463 1.00   23.99 ? 301 ASP A OD1 1 
ATOM   1459  O  OD2 . ASP A  1 194 ? 20.219  23.630  -11.324 1.00   24.30 ? 301 ASP A OD2 1 
ATOM   1460  N  N   . SER A  1 195 ? 17.069  20.844  -11.772 1.00   23.03 ? 302 SER A N   1 
ATOM   1461  C  CA  . SER A  1 195 ? 16.456  19.952  -10.784 1.00   22.20 ? 302 SER A CA  1 
ATOM   1462  C  C   . SER A  1 195 ? 17.307  19.973  -9.522  1.00   23.25 ? 302 SER A C   1 
ATOM   1463  O  O   . SER A  1 195 ? 18.528  19.803  -9.594  1.00   21.21 ? 302 SER A O   1 
ATOM   1464  C  CB  . SER A  1 195 ? 16.402  18.522  -11.320 1.00   24.82 ? 302 SER A CB  1 
ATOM   1465  O  OG  . SER A  1 195 ? 16.050  17.603  -10.299 1.00   25.44 ? 302 SER A OG  1 
ATOM   1466  N  N   . CYS A  1 196 ? 16.684  20.176  -8.363  1.00   22.81 ? 303 CYS A N   1 
ATOM   1467  C  CA  . CYS A  1 196 ? 17.478  20.215  -7.152  1.00   23.75 ? 303 CYS A CA  1 
ATOM   1468  C  C   . CYS A  1 196 ? 17.954  18.854  -6.670  1.00   21.91 ? 303 CYS A C   1 
ATOM   1469  O  O   . CYS A  1 196 ? 18.619  18.755  -5.638  1.00   24.66 ? 303 CYS A O   1 
ATOM   1470  C  CB  . CYS A  1 196 ? 16.768  20.981  -6.036  1.00   22.60 ? 303 CYS A CB  1 
ATOM   1471  S  SG  . CYS A  1 196 ? 14.965  20.813  -5.941  1.00   28.13 ? 303 CYS A SG  1 
ATOM   1472  N  N   . ASN A  1 197 ? 17.634  17.798  -7.409  1.00   22.38 ? 304 ASN A N   1 
ATOM   1473  C  CA  . ASN A  1 197 ? 18.142  16.475  -7.041  1.00   21.49 ? 304 ASN A CA  1 
ATOM   1474  C  C   . ASN A  1 197 ? 19.500  16.277  -7.727  1.00   21.09 ? 304 ASN A C   1 
ATOM   1475  O  O   . ASN A  1 197 ? 20.192  15.297  -7.476  1.00   22.72 ? 304 ASN A O   1 
ATOM   1476  C  CB  . ASN A  1 197 ? 17.179  15.357  -7.443  1.00   23.82 ? 304 ASN A CB  1 
ATOM   1477  C  CG  . ASN A  1 197 ? 16.035  15.179  -6.444  1.00   28.92 ? 304 ASN A CG  1 
ATOM   1478  O  OD1 . ASN A  1 197 ? 15.981  15.857  -5.420  1.00   31.03 ? 304 ASN A OD1 1 
ATOM   1479  N  ND2 . ASN A  1 197 ? 15.115  14.266  -6.747  1.00   29.95 ? 304 ASN A ND2 1 
ATOM   1480  N  N   . CYS A  1 198 ? 19.877  17.218  -8.587  1.00   17.02 ? 305 CYS A N   1 
ATOM   1481  C  CA  . CYS A  1 198 ? 21.157  17.159  -9.283  1.00   19.27 ? 305 CYS A CA  1 
ATOM   1482  C  C   . CYS A  1 198 ? 22.150  18.041  -8.529  1.00   20.06 ? 305 CYS A C   1 
ATOM   1483  O  O   . CYS A  1 198 ? 23.198  18.414  -9.042  1.00   20.66 ? 305 CYS A O   1 
ATOM   1484  C  CB  . CYS A  1 198 ? 21.003  17.652  -10.730 1.00   18.96 ? 305 CYS A CB  1 
ATOM   1485  S  SG  . CYS A  1 198 ? 20.094  16.476  -11.815 1.00   20.88 ? 305 CYS A SG  1 
ATOM   1486  N  N   . ASP A  1 199 ? 21.791  18.358  -7.294  1.00   19.90 ? 306 ASP A N   1 
ATOM   1487  C  CA  . ASP A  1 199 ? 22.586  19.195  -6.403  1.00   20.45 ? 306 ASP A CA  1 
ATOM   1488  C  C   . ASP A  1 199 ? 22.819  18.347  -5.154  1.00   18.51 ? 306 ASP A C   1 
ATOM   1489  O  O   . ASP A  1 199 ? 21.890  18.060  -4.411  1.00   19.41 ? 306 ASP A O   1 
ATOM   1490  C  CB  . ASP A  1 199 ? 21.778  20.454  -6.053  1.00   18.90 ? 306 ASP A CB  1 
ATOM   1491  C  CG  . ASP A  1 199 ? 22.473  21.342  -5.053  1.00   23.92 ? 306 ASP A CG  1 
ATOM   1492  O  OD1 . ASP A  1 199 ? 23.226  20.815  -4.196  1.00   22.22 ? 306 ASP A OD1 1 
ATOM   1493  O  OD2 . ASP A  1 199 ? 22.240  22.576  -5.113  1.00   24.64 ? 306 ASP A OD2 1 
ATOM   1494  N  N   . GLY A  1 200 ? 24.060  17.949  -4.920  1.00   20.04 ? 307 GLY A N   1 
ATOM   1495  C  CA  . GLY A  1 200 ? 24.359  17.107  -3.770  1.00   18.55 ? 307 GLY A CA  1 
ATOM   1496  C  C   . GLY A  1 200 ? 24.199  17.724  -2.393  1.00   19.89 ? 307 GLY A C   1 
ATOM   1497  O  O   . GLY A  1 200 ? 24.135  16.997  -1.401  1.00   19.91 ? 307 GLY A O   1 
ATOM   1498  N  N   . TYR A  1 201 ? 24.148  19.053  -2.315  1.00   18.95 ? 308 TYR A N   1 
ATOM   1499  C  CA  . TYR A  1 201 ? 23.985  19.724  -1.029  1.00   18.41 ? 308 TYR A CA  1 
ATOM   1500  C  C   . TYR A  1 201 ? 22.526  19.690  -0.622  1.00   18.82 ? 308 TYR A C   1 
ATOM   1501  O  O   . TYR A  1 201 ? 22.199  19.374  0.523   1.00   20.63 ? 308 TYR A O   1 
ATOM   1502  C  CB  . TYR A  1 201 ? 24.456  21.180  -1.112  1.00   18.05 ? 308 TYR A CB  1 
ATOM   1503  C  CG  . TYR A  1 201 ? 25.897  21.293  -1.523  1.00   19.02 ? 308 TYR A CG  1 
ATOM   1504  C  CD1 . TYR A  1 201 ? 26.266  21.310  -2.873  1.00   19.00 ? 308 TYR A CD1 1 
ATOM   1505  C  CD2 . TYR A  1 201 ? 26.902  21.337  -0.560  1.00   16.26 ? 308 TYR A CD2 1 
ATOM   1506  C  CE1 . TYR A  1 201 ? 27.608  21.368  -3.247  1.00   19.04 ? 308 TYR A CE1 1 
ATOM   1507  C  CE2 . TYR A  1 201 ? 28.224  21.394  -0.917  1.00   17.17 ? 308 TYR A CE2 1 
ATOM   1508  C  CZ  . TYR A  1 201 ? 28.580  21.412  -2.255  1.00   17.63 ? 308 TYR A CZ  1 
ATOM   1509  O  OH  . TYR A  1 201 ? 29.913  21.468  -2.565  1.00   17.94 ? 308 TYR A OH  1 
ATOM   1510  N  N   . THR A  1 202 ? 21.646  20.025  -1.557  1.00   18.35 ? 309 THR A N   1 
ATOM   1511  C  CA  . THR A  1 202 ? 20.217  20.011  -1.273  1.00   19.06 ? 309 THR A CA  1 
ATOM   1512  C  C   . THR A  1 202 ? 19.694  18.571  -1.165  1.00   18.55 ? 309 THR A C   1 
ATOM   1513  O  O   . THR A  1 202 ? 18.867  18.252  -0.307  1.00   15.67 ? 309 THR A O   1 
ATOM   1514  C  CB  . THR A  1 202 ? 19.438  20.737  -2.386  1.00   19.80 ? 309 THR A CB  1 
ATOM   1515  O  OG1 . THR A  1 202 ? 19.884  20.274  -3.668  1.00   19.78 ? 309 THR A OG1 1 
ATOM   1516  C  CG2 . THR A  1 202 ? 19.657  22.209  -2.306  1.00   14.86 ? 309 THR A CG2 1 
ATOM   1517  N  N   . ASN A  1 203 ? 20.221  17.706  -2.025  1.00   18.52 ? 310 ASN A N   1 
ATOM   1518  C  CA  . ASN A  1 203 ? 19.820  16.303  -2.100  1.00   17.16 ? 310 ASN A CA  1 
ATOM   1519  C  C   . ASN A  1 203 ? 20.274  15.474  -0.903  1.00   19.73 ? 310 ASN A C   1 
ATOM   1520  O  O   . ASN A  1 203 ? 19.792  14.363  -0.701  1.00   17.97 ? 310 ASN A O   1 
ATOM   1521  C  CB  . ASN A  1 203 ? 20.384  15.706  -3.381  1.00   22.64 ? 310 ASN A CB  1 
ATOM   1522  C  CG  . ASN A  1 203 ? 19.750  14.396  -3.744  1.00   26.16 ? 310 ASN A CG  1 
ATOM   1523  O  OD1 . ASN A  1 203 ? 18.526  14.291  -3.885  1.00   29.51 ? 310 ASN A OD1 1 
ATOM   1524  N  ND2 . ASN A  1 203 ? 20.578  13.380  -3.918  1.00   29.70 ? 310 ASN A ND2 1 
ATOM   1525  N  N   . SER A  1 204 ? 21.191  16.015  -0.103  1.00   18.93 ? 311 SER A N   1 
ATOM   1526  C  CA  . SER A  1 204 ? 21.685  15.292  1.072   1.00   18.62 ? 311 SER A CA  1 
ATOM   1527  C  C   . SER A  1 204 ? 20.623  15.134  2.161   1.00   17.45 ? 311 SER A C   1 
ATOM   1528  O  O   . SER A  1 204 ? 19.774  16.016  2.342   1.00   14.42 ? 311 SER A O   1 
ATOM   1529  C  CB  . SER A  1 204 ? 22.881  16.026  1.686   1.00   17.87 ? 311 SER A CB  1 
ATOM   1530  O  OG  . SER A  1 204 ? 23.222  15.426  2.930   1.00   20.70 ? 311 SER A OG  1 
ATOM   1531  N  N   . ILE A  1 205 ? 20.667  14.026  2.894   1.00   14.81 ? 312 ILE A N   1 
ATOM   1532  C  CA  . ILE A  1 205 ? 19.703  13.851  3.986   1.00   16.88 ? 312 ILE A CA  1 
ATOM   1533  C  C   . ILE A  1 205 ? 20.102  14.705  5.186   1.00   16.71 ? 312 ILE A C   1 
ATOM   1534  O  O   . ILE A  1 205 ? 19.278  14.957  6.057   1.00   20.73 ? 312 ILE A O   1 
ATOM   1535  C  CB  . ILE A  1 205 ? 19.585  12.366  4.480   1.00   13.75 ? 312 ILE A CB  1 
ATOM   1536  C  CG1 . ILE A  1 205 ? 20.874  11.914  5.170   1.00   13.93 ? 312 ILE A CG1 1 
ATOM   1537  C  CG2 . ILE A  1 205 ? 19.272  11.459  3.305   1.00   14.80 ? 312 ILE A CG2 1 
ATOM   1538  C  CD1 . ILE A  1 205 ? 20.768  10.523  5.789   1.00   12.26 ? 312 ILE A CD1 1 
ATOM   1539  N  N   . TYR A  1 206 ? 21.357  15.159  5.220   1.00   15.73 ? 313 TYR A N   1 
ATOM   1540  C  CA  . TYR A  1 206 ? 21.850  15.966  6.338   1.00   17.52 ? 313 TYR A CA  1 
ATOM   1541  C  C   . TYR A  1 206 ? 21.411  17.433  6.285   1.00   18.97 ? 313 TYR A C   1 
ATOM   1542  O  O   . TYR A  1 206 ? 21.587  18.174  7.256   1.00   19.85 ? 313 TYR A O   1 
ATOM   1543  C  CB  . TYR A  1 206 ? 23.387  15.919  6.407   1.00   16.09 ? 313 TYR A CB  1 
ATOM   1544  C  CG  . TYR A  1 206 ? 23.999  14.538  6.276   1.00   16.49 ? 313 TYR A CG  1 
ATOM   1545  C  CD1 . TYR A  1 206 ? 23.521  13.458  7.017   1.00   17.21 ? 313 TYR A CD1 1 
ATOM   1546  C  CD2 . TYR A  1 206 ? 25.060  14.317  5.406   1.00   18.57 ? 313 TYR A CD2 1 
ATOM   1547  C  CE1 . TYR A  1 206 ? 24.084  12.202  6.889   1.00   15.82 ? 313 TYR A CE1 1 
ATOM   1548  C  CE2 . TYR A  1 206 ? 25.630  13.070  5.272   1.00   15.63 ? 313 TYR A CE2 1 
ATOM   1549  C  CZ  . TYR A  1 206 ? 25.139  12.016  6.014   1.00   18.05 ? 313 TYR A CZ  1 
ATOM   1550  O  OH  . TYR A  1 206 ? 25.723  10.777  5.873   1.00   17.86 ? 313 TYR A OH  1 
ATOM   1551  N  N   . THR A  1 207 ? 20.859  17.863  5.154   1.00   18.29 ? 314 THR A N   1 
ATOM   1552  C  CA  . THR A  1 207 ? 20.426  19.252  5.027   1.00   19.57 ? 314 THR A CA  1 
ATOM   1553  C  C   . THR A  1 207 ? 18.912  19.360  4.845   1.00   20.83 ? 314 THR A C   1 
ATOM   1554  O  O   . THR A  1 207 ? 18.288  18.485  4.242   1.00   19.29 ? 314 THR A O   1 
ATOM   1555  C  CB  . THR A  1 207 ? 21.057  19.954  3.791   1.00   20.33 ? 314 THR A CB  1 
ATOM   1556  O  OG1 . THR A  1 207 ? 20.557  19.347  2.593   1.00   15.08 ? 314 THR A OG1 1 
ATOM   1557  C  CG2 . THR A  1 207 ? 22.562  19.836  3.801   1.00   21.33 ? 314 THR A CG2 1 
ATOM   1558  N  N   . LEU A  1 208 ? 18.331  20.433  5.380   1.00   19.81 ? 315 LEU A N   1 
ATOM   1559  C  CA  . LEU A  1 208 ? 16.911  20.684  5.205   1.00   19.24 ? 315 LEU A CA  1 
ATOM   1560  C  C   . LEU A  1 208 ? 16.860  21.606  4.000   1.00   18.65 ? 315 LEU A C   1 
ATOM   1561  O  O   . LEU A  1 208 ? 17.172  22.784  4.101   1.00   18.66 ? 315 LEU A O   1 
ATOM   1562  C  CB  . LEU A  1 208 ? 16.291  21.407  6.402   1.00   17.33 ? 315 LEU A CB  1 
ATOM   1563  C  CG  . LEU A  1 208 ? 16.211  20.662  7.725   1.00   21.24 ? 315 LEU A CG  1 
ATOM   1564  C  CD1 . LEU A  1 208 ? 17.435  21.017  8.532   1.00   20.09 ? 315 LEU A CD1 1 
ATOM   1565  C  CD2 . LEU A  1 208 ? 14.920  21.040  8.483   1.00   13.96 ? 315 LEU A CD2 1 
ATOM   1566  N  N   . SER A  1 209 ? 16.492  21.067  2.848   1.00   18.27 ? 316 SER A N   1 
ATOM   1567  C  CA  . SER A  1 209 ? 16.431  21.878  1.650   1.00   16.89 ? 316 SER A CA  1 
ATOM   1568  C  C   . SER A  1 209 ? 15.107  22.641  1.648   1.00   17.19 ? 316 SER A C   1 
ATOM   1569  O  O   . SER A  1 209 ? 14.042  22.058  1.808   1.00   18.02 ? 316 SER A O   1 
ATOM   1570  C  CB  . SER A  1 209 ? 16.552  20.988  0.417   1.00   15.72 ? 316 SER A CB  1 
ATOM   1571  O  OG  . SER A  1 209 ? 16.646  21.787  -0.748  1.00   19.97 ? 316 SER A OG  1 
ATOM   1572  N  N   . ILE A  1 210 ? 15.185  23.946  1.438   1.00   17.33 ? 317 ILE A N   1 
ATOM   1573  C  CA  . ILE A  1 210 ? 14.016  24.820  1.472   1.00   15.53 ? 317 ILE A CA  1 
ATOM   1574  C  C   . ILE A  1 210 ? 13.727  25.528  0.153   1.00   17.10 ? 317 ILE A C   1 
ATOM   1575  O  O   . ILE A  1 210 ? 14.620  26.149  -0.428  1.00   16.87 ? 317 ILE A O   1 
ATOM   1576  C  CB  . ILE A  1 210 ? 14.218  25.912  2.552   1.00   17.63 ? 317 ILE A CB  1 
ATOM   1577  C  CG1 . ILE A  1 210 ? 14.551  25.256  3.901   1.00   16.40 ? 317 ILE A CG1 1 
ATOM   1578  C  CG2 . ILE A  1 210 ? 12.977  26.819  2.632   1.00   19.99 ? 317 ILE A CG2 1 
ATOM   1579  C  CD1 . ILE A  1 210 ? 13.412  24.395  4.479   1.00   12.76 ? 317 ILE A CD1 1 
ATOM   1580  N  N   . SER A  1 211 ? 12.482  25.442  -0.311  1.00   17.02 ? 318 SER A N   1 
ATOM   1581  C  CA  . SER A  1 211 ? 12.076  26.103  -1.549  1.00   19.10 ? 318 SER A CA  1 
ATOM   1582  C  C   . SER A  1 211 ? 11.310  27.396  -1.273  1.00   19.73 ? 318 SER A C   1 
ATOM   1583  O  O   . SER A  1 211 ? 11.099  27.775  -0.123  1.00   19.98 ? 318 SER A O   1 
ATOM   1584  C  CB  . SER A  1 211 ? 11.227  25.174  -2.421  1.00   20.18 ? 318 SER A CB  1 
ATOM   1585  O  OG  . SER A  1 211 ? 12.032  24.200  -3.063  1.00   20.93 ? 318 SER A OG  1 
ATOM   1586  N  N   . SER A  1 212 ? 10.875  28.057  -2.341  1.00   20.34 ? 319 SER A N   1 
ATOM   1587  C  CA  . SER A  1 212 ? 10.188  29.339  -2.221  1.00   19.98 ? 319 SER A CA  1 
ATOM   1588  C  C   . SER A  1 212 ? 8.766   29.386  -2.761  1.00   20.39 ? 319 SER A C   1 
ATOM   1589  O  O   . SER A  1 212 ? 8.372   28.591  -3.624  1.00   19.15 ? 319 SER A O   1 
ATOM   1590  C  CB  . SER A  1 212 ? 11.008  30.421  -2.942  1.00   18.60 ? 319 SER A CB  1 
ATOM   1591  O  OG  . SER A  1 212 ? 12.335  30.474  -2.457  1.00   15.36 ? 319 SER A OG  1 
ATOM   1592  N  N   . ALA A  1 213 ? 8.012   30.351  -2.251  1.00   19.33 ? 320 ALA A N   1 
ATOM   1593  C  CA  . ALA A  1 213 ? 6.633   30.588  -2.682  1.00   20.69 ? 320 ALA A CA  1 
ATOM   1594  C  C   . ALA A  1 213 ? 6.481   32.101  -2.804  1.00   20.63 ? 320 ALA A C   1 
ATOM   1595  O  O   . ALA A  1 213 ? 7.022   32.849  -1.986  1.00   22.88 ? 320 ALA A O   1 
ATOM   1596  C  CB  . ALA A  1 213 ? 5.637   30.045  -1.654  1.00   16.70 ? 320 ALA A CB  1 
ATOM   1597  N  N   . THR A  1 214 ? 5.753   32.553  -3.820  1.00   21.33 ? 321 THR A N   1 
ATOM   1598  C  CA  . THR A  1 214 ? 5.548   33.983  -4.007  1.00   18.91 ? 321 THR A CA  1 
ATOM   1599  C  C   . THR A  1 214 ? 4.443   34.448  -3.057  1.00   19.61 ? 321 THR A C   1 
ATOM   1600  O  O   . THR A  1 214 ? 3.712   33.637  -2.484  1.00   18.14 ? 321 THR A O   1 
ATOM   1601  C  CB  . THR A  1 214 ? 5.125   34.321  -5.449  1.00   17.30 ? 321 THR A CB  1 
ATOM   1602  O  OG1 . THR A  1 214 ? 3.751   33.971  -5.624  1.00   12.17 ? 321 THR A OG1 1 
ATOM   1603  C  CG2 . THR A  1 214 ? 5.989   33.565  -6.450  1.00   12.24 ? 321 THR A CG2 1 
ATOM   1604  N  N   . GLN A  1 215 ? 4.316   35.757  -2.897  1.00   17.07 ? 322 GLN A N   1 
ATOM   1605  C  CA  . GLN A  1 215 ? 3.313   36.283  -1.998  1.00   20.97 ? 322 GLN A CA  1 
ATOM   1606  C  C   . GLN A  1 215 ? 1.900   35.773  -2.299  1.00   21.78 ? 322 GLN A C   1 
ATOM   1607  O  O   . GLN A  1 215 ? 1.134   35.506  -1.374  1.00   23.12 ? 322 GLN A O   1 
ATOM   1608  C  CB  . GLN A  1 215 ? 3.340   37.814  -2.011  1.00   19.64 ? 322 GLN A CB  1 
ATOM   1609  C  CG  . GLN A  1 215 ? 2.187   38.443  -1.237  1.00   18.46 ? 322 GLN A CG  1 
ATOM   1610  C  CD  . GLN A  1 215 ? 2.284   39.962  -1.156  1.00   24.45 ? 322 GLN A CD  1 
ATOM   1611  O  OE1 . GLN A  1 215 ? 2.854   40.616  -2.032  1.00   25.86 ? 322 GLN A OE1 1 
ATOM   1612  N  NE2 . GLN A  1 215 ? 1.718   40.529  -0.103  1.00   24.72 ? 322 GLN A NE2 1 
ATOM   1613  N  N   . PHE A  1 216 ? 1.547   35.632  -3.574  1.00   22.21 ? 323 PHE A N   1 
ATOM   1614  C  CA  . PHE A  1 216 ? 0.206   35.150  -3.910  1.00   21.33 ? 323 PHE A CA  1 
ATOM   1615  C  C   . PHE A  1 216 ? 0.090   33.633  -3.882  1.00   19.78 ? 323 PHE A C   1 
ATOM   1616  O  O   . PHE A  1 216 ? -0.912  33.073  -4.323  1.00   23.18 ? 323 PHE A O   1 
ATOM   1617  C  CB  . PHE A  1 216 ? -0.250  35.692  -5.273  1.00   21.13 ? 323 PHE A CB  1 
ATOM   1618  C  CG  . PHE A  1 216 ? -0.235  37.201  -5.360  1.00   25.17 ? 323 PHE A CG  1 
ATOM   1619  C  CD1 . PHE A  1 216 ? -0.306  37.979  -4.193  1.00   24.44 ? 323 PHE A CD1 1 
ATOM   1620  C  CD2 . PHE A  1 216 ? -0.136  37.849  -6.601  1.00   22.47 ? 323 PHE A CD2 1 
ATOM   1621  C  CE1 . PHE A  1 216 ? -0.275  39.374  -4.249  1.00   21.89 ? 323 PHE A CE1 1 
ATOM   1622  C  CE2 . PHE A  1 216 ? -0.105  39.242  -6.676  1.00   22.83 ? 323 PHE A CE2 1 
ATOM   1623  C  CZ  . PHE A  1 216 ? -0.174  40.011  -5.495  1.00   25.44 ? 323 PHE A CZ  1 
ATOM   1624  N  N   . GLY A  1 217 ? 1.120   32.968  -3.367  1.00   20.70 ? 324 GLY A N   1 
ATOM   1625  C  CA  . GLY A  1 217 ? 1.092   31.519  -3.257  1.00   18.56 ? 324 GLY A CA  1 
ATOM   1626  C  C   . GLY A  1 217 ? 1.417   30.719  -4.507  1.00   21.87 ? 324 GLY A C   1 
ATOM   1627  O  O   . GLY A  1 217 ? 0.915   29.610  -4.703  1.00   21.81 ? 324 GLY A O   1 
ATOM   1628  N  N   . ASN A  1 218 ? 2.271   31.263  -5.358  1.00   21.34 ? 325 ASN A N   1 
ATOM   1629  C  CA  . ASN A  1 218 ? 2.645   30.564  -6.569  1.00   22.43 ? 325 ASN A CA  1 
ATOM   1630  C  C   . ASN A  1 218 ? 4.107   30.109  -6.577  1.00   23.00 ? 325 ASN A C   1 
ATOM   1631  O  O   . ASN A  1 218 ? 4.918   30.559  -5.762  1.00   22.83 ? 325 ASN A O   1 
ATOM   1632  C  CB  . ASN A  1 218 ? 2.367   31.457  -7.771  1.00   23.01 ? 325 ASN A CB  1 
ATOM   1633  C  CG  . ASN A  1 218 ? 0.880   31.699  -7.970  1.00   21.34 ? 325 ASN A CG  1 
ATOM   1634  O  OD1 . ASN A  1 218 ? 0.113   30.758  -8.064  1.00   22.16 ? 325 ASN A OD1 1 
ATOM   1635  N  ND2 . ASN A  1 218 ? 0.474   32.959  -8.035  1.00   21.08 ? 325 ASN A ND2 1 
ATOM   1636  N  N   . VAL A  1 219 ? 4.418   29.189  -7.485  1.00   17.79 ? 326 VAL A N   1 
ATOM   1637  C  CA  . VAL A  1 219 ? 5.775   28.692  -7.640  1.00   19.52 ? 326 VAL A CA  1 
ATOM   1638  C  C   . VAL A  1 219 ? 6.549   29.767  -8.409  1.00   21.11 ? 326 VAL A C   1 
ATOM   1639  O  O   . VAL A  1 219 ? 6.265   30.035  -9.586  1.00   21.40 ? 326 VAL A O   1 
ATOM   1640  C  CB  . VAL A  1 219 ? 5.806   27.377  -8.461  1.00   20.43 ? 326 VAL A CB  1 
ATOM   1641  C  CG1 . VAL A  1 219 ? 7.244   26.883  -8.595  1.00   19.04 ? 326 VAL A CG1 1 
ATOM   1642  C  CG2 . VAL A  1 219 ? 4.960   26.317  -7.791  1.00   16.88 ? 326 VAL A CG2 1 
ATOM   1643  N  N   . PRO A  1 220 ? 7.550   30.387  -7.767  1.00   19.84 ? 327 PRO A N   1 
ATOM   1644  C  CA  . PRO A  1 220 ? 8.349   31.439  -8.412  1.00   20.66 ? 327 PRO A CA  1 
ATOM   1645  C  C   . PRO A  1 220 ? 9.024   30.964  -9.688  1.00   20.69 ? 327 PRO A C   1 
ATOM   1646  O  O   . PRO A  1 220 ? 9.304   29.779  -9.841  1.00   20.76 ? 327 PRO A O   1 
ATOM   1647  C  CB  . PRO A  1 220 ? 9.380   31.808  -7.345  1.00   20.18 ? 327 PRO A CB  1 
ATOM   1648  C  CG  . PRO A  1 220 ? 8.779   31.323  -6.067  1.00   21.90 ? 327 PRO A CG  1 
ATOM   1649  C  CD  . PRO A  1 220 ? 8.109   30.041  -6.456  1.00   19.73 ? 327 PRO A CD  1 
ATOM   1650  N  N   . TRP A  1 221 ? 9.313   31.900  -10.587 1.00   21.72 ? 328 TRP A N   1 
ATOM   1651  C  CA  . TRP A  1 221 ? 9.974   31.565  -11.843 1.00   21.39 ? 328 TRP A CA  1 
ATOM   1652  C  C   . TRP A  1 221 ? 11.336  30.876  -11.649 1.00   20.95 ? 328 TRP A C   1 
ATOM   1653  O  O   . TRP A  1 221 ? 11.736  30.036  -12.452 1.00   20.21 ? 328 TRP A O   1 
ATOM   1654  C  CB  . TRP A  1 221 ? 10.182  32.827  -12.691 1.00   22.17 ? 328 TRP A CB  1 
ATOM   1655  C  CG  . TRP A  1 221 ? 11.160  33.817  -12.106 1.00   22.05 ? 328 TRP A CG  1 
ATOM   1656  C  CD1 . TRP A  1 221 ? 10.879  34.861  -11.259 1.00   24.64 ? 328 TRP A CD1 1 
ATOM   1657  C  CD2 . TRP A  1 221 ? 12.571  33.852  -12.323 1.00   21.24 ? 328 TRP A CD2 1 
ATOM   1658  N  NE1 . TRP A  1 221 ? 12.030  35.544  -10.942 1.00   21.30 ? 328 TRP A NE1 1 
ATOM   1659  C  CE2 . TRP A  1 221 ? 13.083  34.945  -11.580 1.00   22.49 ? 328 TRP A CE2 1 
ATOM   1660  C  CE3 . TRP A  1 221 ? 13.456  33.062  -13.071 1.00   22.12 ? 328 TRP A CE3 1 
ATOM   1661  C  CZ2 . TRP A  1 221 ? 14.438  35.268  -11.565 1.00   21.72 ? 328 TRP A CZ2 1 
ATOM   1662  C  CZ3 . TRP A  1 221 ? 14.807  33.379  -13.058 1.00   23.11 ? 328 TRP A CZ3 1 
ATOM   1663  C  CH2 . TRP A  1 221 ? 15.285  34.478  -12.306 1.00   26.66 ? 328 TRP A CH2 1 
ATOM   1664  N  N   . TYR A  1 222 ? 12.043  31.240  -10.587 1.00   20.08 ? 329 TYR A N   1 
ATOM   1665  C  CA  . TYR A  1 222 ? 13.367  30.681  -10.308 1.00   20.07 ? 329 TYR A CA  1 
ATOM   1666  C  C   . TYR A  1 222 ? 13.367  29.324  -9.609  1.00   20.86 ? 329 TYR A C   1 
ATOM   1667  O  O   . TYR A  1 222 ? 14.392  28.667  -9.528  1.00   22.47 ? 329 TYR A O   1 
ATOM   1668  C  CB  . TYR A  1 222 ? 14.182  31.686  -9.463  1.00   18.09 ? 329 TYR A CB  1 
ATOM   1669  C  CG  . TYR A  1 222 ? 13.487  32.172  -8.190  1.00   15.75 ? 329 TYR A CG  1 
ATOM   1670  C  CD1 . TYR A  1 222 ? 13.486  31.397  -7.019  1.00   15.84 ? 329 TYR A CD1 1 
ATOM   1671  C  CD2 . TYR A  1 222 ? 12.793  33.388  -8.171  1.00   13.94 ? 329 TYR A CD2 1 
ATOM   1672  C  CE1 . TYR A  1 222 ? 12.798  31.826  -5.851  1.00   10.57 ? 329 TYR A CE1 1 
ATOM   1673  C  CE2 . TYR A  1 222 ? 12.102  33.817  -7.026  1.00   14.11 ? 329 TYR A CE2 1 
ATOM   1674  C  CZ  . TYR A  1 222 ? 12.105  33.030  -5.878  1.00   13.30 ? 329 TYR A CZ  1 
ATOM   1675  O  OH  . TYR A  1 222 ? 11.370  33.425  -4.791  1.00   14.18 ? 329 TYR A OH  1 
ATOM   1676  N  N   . SER A  1 223 ? 12.210  28.901  -9.124  1.00   22.60 ? 330 SER A N   1 
ATOM   1677  C  CA  . SER A  1 223 ? 12.094  27.657  -8.383  1.00   20.82 ? 330 SER A CA  1 
ATOM   1678  C  C   . SER A  1 223 ? 12.505  26.381  -9.099  1.00   19.81 ? 330 SER A C   1 
ATOM   1679  O  O   . SER A  1 223 ? 12.200  26.199  -10.271 1.00   19.61 ? 330 SER A O   1 
ATOM   1680  C  CB  . SER A  1 223 ? 10.657  27.518  -7.874  1.00   20.09 ? 330 SER A CB  1 
ATOM   1681  O  OG  . SER A  1 223 ? 10.457  26.274  -7.245  1.00   22.28 ? 330 SER A OG  1 
ATOM   1682  N  N   . GLU A  1 224 ? 13.200  25.499  -8.378  1.00   20.86 ? 331 GLU A N   1 
ATOM   1683  C  CA  . GLU A  1 224 ? 13.604  24.191  -8.920  1.00   21.46 ? 331 GLU A CA  1 
ATOM   1684  C  C   . GLU A  1 224 ? 12.771  23.132  -8.205  1.00   21.67 ? 331 GLU A C   1 
ATOM   1685  O  O   . GLU A  1 224 ? 12.640  23.162  -6.976  1.00   20.71 ? 331 GLU A O   1 
ATOM   1686  C  CB  . GLU A  1 224 ? 15.089  23.886  -8.661  1.00   16.27 ? 331 GLU A CB  1 
ATOM   1687  C  CG  . GLU A  1 224 ? 16.045  24.905  -9.232  1.00   20.82 ? 331 GLU A CG  1 
ATOM   1688  C  CD  . GLU A  1 224 ? 17.499  24.458  -9.157  1.00   20.16 ? 331 GLU A CD  1 
ATOM   1689  O  OE1 . GLU A  1 224 ? 18.384  25.337  -9.159  1.00   16.43 ? 331 GLU A OE1 1 
ATOM   1690  O  OE2 . GLU A  1 224 ? 17.756  23.231  -9.114  1.00   22.10 ? 331 GLU A OE2 1 
ATOM   1691  N  N   . ALA A  1 225 ? 12.219  22.195  -8.965  1.00   20.48 ? 332 ALA A N   1 
ATOM   1692  C  CA  . ALA A  1 225 ? 11.418  21.132  -8.387  1.00   19.36 ? 332 ALA A CA  1 
ATOM   1693  C  C   . ALA A  1 225 ? 12.246  19.847  -8.258  1.00   21.31 ? 332 ALA A C   1 
ATOM   1694  O  O   . ALA A  1 225 ? 13.108  19.568  -9.094  1.00   20.07 ? 332 ALA A O   1 
ATOM   1695  C  CB  . ALA A  1 225 ? 10.208  20.879  -9.265  1.00   19.56 ? 332 ALA A CB  1 
ATOM   1696  N  N   . CYS A  1 226 ? 11.981  19.075  -7.206  1.00   18.56 ? 333 CYS A N   1 
ATOM   1697  C  CA  . CYS A  1 226 ? 12.661  17.808  -6.988  1.00   19.75 ? 333 CYS A CA  1 
ATOM   1698  C  C   . CYS A  1 226 ? 12.051  17.188  -5.736  1.00   18.69 ? 333 CYS A C   1 
ATOM   1699  O  O   . CYS A  1 226 ? 11.357  17.863  -4.971  1.00   16.63 ? 333 CYS A O   1 
ATOM   1700  C  CB  . CYS A  1 226 ? 14.186  17.996  -6.824  1.00   24.32 ? 333 CYS A CB  1 
ATOM   1701  S  SG  . CYS A  1 226 ? 14.618  18.898  -5.310  1.00   29.66 ? 333 CYS A SG  1 
ATOM   1702  N  N   . SER A  1 227 ? 12.298  15.899  -5.546  1.00   15.23 ? 334 SER A N   1 
ATOM   1703  C  CA  . SER A  1 227 ? 11.769  15.162  -4.409  1.00   18.27 ? 334 SER A CA  1 
ATOM   1704  C  C   . SER A  1 227 ? 12.575  15.313  -3.113  1.00   18.40 ? 334 SER A C   1 
ATOM   1705  O  O   . SER A  1 227 ? 12.111  14.896  -2.057  1.00   22.20 ? 334 SER A O   1 
ATOM   1706  C  CB  . SER A  1 227 ? 11.669  13.666  -4.766  1.00   18.77 ? 334 SER A CB  1 
ATOM   1707  O  OG  . SER A  1 227 ? 12.948  13.144  -5.108  1.00   20.99 ? 334 SER A OG  1 
ATOM   1708  N  N   . SER A  1 228 ? 13.772  15.889  -3.183  1.00   17.57 ? 335 SER A N   1 
ATOM   1709  C  CA  . SER A  1 228 ? 14.587  16.039  -1.981  1.00   17.13 ? 335 SER A CA  1 
ATOM   1710  C  C   . SER A  1 228 ? 14.199  17.242  -1.118  1.00   17.17 ? 335 SER A C   1 
ATOM   1711  O  O   . SER A  1 228 ? 14.548  17.311  0.058   1.00   17.35 ? 335 SER A O   1 
ATOM   1712  C  CB  . SER A  1 228 ? 16.067  16.129  -2.344  1.00   17.82 ? 335 SER A CB  1 
ATOM   1713  O  OG  . SER A  1 228 ? 16.379  17.371  -2.956  1.00   18.75 ? 335 SER A OG  1 
ATOM   1714  N  N   . THR A  1 229 ? 13.479  18.191  -1.699  1.00   16.38 ? 336 THR A N   1 
ATOM   1715  C  CA  . THR A  1 229 ? 13.061  19.363  -0.946  1.00   17.28 ? 336 THR A CA  1 
ATOM   1716  C  C   . THR A  1 229 ? 12.153  18.966  0.217   1.00   18.39 ? 336 THR A C   1 
ATOM   1717  O  O   . THR A  1 229 ? 11.295  18.091  0.077   1.00   20.39 ? 336 THR A O   1 
ATOM   1718  C  CB  . THR A  1 229 ? 12.342  20.346  -1.858  1.00   17.60 ? 336 THR A CB  1 
ATOM   1719  O  OG1 . THR A  1 229 ? 13.276  20.809  -2.835  1.00   15.14 ? 336 THR A OG1 1 
ATOM   1720  C  CG2 . THR A  1 229 ? 11.762  21.512  -1.058  1.00   13.80 ? 336 THR A CG2 1 
ATOM   1721  N  N   . LEU A  1 230 ? 12.341  19.614  1.364   1.00   16.92 ? 337 LEU A N   1 
ATOM   1722  C  CA  . LEU A  1 230 ? 11.560  19.295  2.549   1.00   16.37 ? 337 LEU A CA  1 
ATOM   1723  C  C   . LEU A  1 230 ? 10.382  20.230  2.822   1.00   18.70 ? 337 LEU A C   1 
ATOM   1724  O  O   . LEU A  1 230 ? 9.281   19.776  3.130   1.00   15.90 ? 337 LEU A O   1 
ATOM   1725  C  CB  . LEU A  1 230 ? 12.475  19.270  3.766   1.00   16.14 ? 337 LEU A CB  1 
ATOM   1726  C  CG  . LEU A  1 230 ? 11.931  18.531  4.984   1.00   19.00 ? 337 LEU A CG  1 
ATOM   1727  C  CD1 . LEU A  1 230 ? 11.663  17.051  4.635   1.00   15.64 ? 337 LEU A CD1 1 
ATOM   1728  C  CD2 . LEU A  1 230 ? 12.953  18.652  6.120   1.00   20.68 ? 337 LEU A CD2 1 
ATOM   1729  N  N   . ALA A  1 231 ? 10.603  21.536  2.710   1.00   18.35 ? 338 ALA A N   1 
ATOM   1730  C  CA  . ALA A  1 231 ? 9.536   22.494  2.974   1.00   17.40 ? 338 ALA A CA  1 
ATOM   1731  C  C   . ALA A  1 231 ? 9.773   23.811  2.246   1.00   19.18 ? 338 ALA A C   1 
ATOM   1732  O  O   . ALA A  1 231 ? 10.747  23.957  1.506   1.00   17.36 ? 338 ALA A O   1 
ATOM   1733  C  CB  . ALA A  1 231 ? 9.406   22.735  4.490   1.00   18.19 ? 338 ALA A CB  1 
ATOM   1734  N  N   . THR A  1 232 ? 8.906   24.783  2.505   1.00   18.43 ? 339 THR A N   1 
ATOM   1735  C  CA  . THR A  1 232 ? 8.958   26.061  1.815   1.00   16.42 ? 339 THR A CA  1 
ATOM   1736  C  C   . THR A  1 232 ? 8.766   27.290  2.711   1.00   18.08 ? 339 THR A C   1 
ATOM   1737  O  O   . THR A  1 232 ? 8.081   27.224  3.738   1.00   16.85 ? 339 THR A O   1 
ATOM   1738  C  CB  . THR A  1 232 ? 7.815   26.077  0.742   1.00   19.00 ? 339 THR A CB  1 
ATOM   1739  O  OG1 . THR A  1 232 ? 8.009   24.997  -0.180  1.00   18.07 ? 339 THR A OG1 1 
ATOM   1740  C  CG2 . THR A  1 232 ? 7.732   27.425  -0.005  1.00   13.49 ? 339 THR A CG2 1 
ATOM   1741  N  N   . THR A  1 233 ? 9.384   28.405  2.321   1.00   15.98 ? 340 THR A N   1 
ATOM   1742  C  CA  . THR A  1 233 ? 9.175   29.678  3.010   1.00   16.10 ? 340 THR A CA  1 
ATOM   1743  C  C   . THR A  1 233 ? 8.983   30.702  1.891   1.00   17.36 ? 340 THR A C   1 
ATOM   1744  O  O   . THR A  1 233 ? 9.440   30.506  0.762   1.00   18.64 ? 340 THR A O   1 
ATOM   1745  C  CB  . THR A  1 233 ? 10.370  30.151  3.868   1.00   16.54 ? 340 THR A CB  1 
ATOM   1746  O  OG1 . THR A  1 233 ? 11.501  30.385  3.026   1.00   18.79 ? 340 THR A OG1 1 
ATOM   1747  C  CG2 . THR A  1 233 ? 10.696  29.141  4.958   1.00   13.78 ? 340 THR A CG2 1 
ATOM   1748  N  N   . TYR A  1 234 ? 8.310   31.793  2.204   1.00   16.98 ? 341 TYR A N   1 
ATOM   1749  C  CA  . TYR A  1 234 ? 8.056   32.839  1.220   1.00   17.81 ? 341 TYR A CA  1 
ATOM   1750  C  C   . TYR A  1 234 ? 9.310   33.546  0.738   1.00   18.65 ? 341 TYR A C   1 
ATOM   1751  O  O   . TYR A  1 234 ? 10.307  33.650  1.466   1.00   15.70 ? 341 TYR A O   1 
ATOM   1752  C  CB  . TYR A  1 234 ? 7.134   33.912  1.812   1.00   18.28 ? 341 TYR A CB  1 
ATOM   1753  C  CG  . TYR A  1 234 ? 5.682   33.513  1.906   1.00   19.45 ? 341 TYR A CG  1 
ATOM   1754  C  CD1 . TYR A  1 234 ? 4.910   33.355  0.754   1.00   22.63 ? 341 TYR A CD1 1 
ATOM   1755  C  CD2 . TYR A  1 234 ? 5.081   33.281  3.141   1.00   20.53 ? 341 TYR A CD2 1 
ATOM   1756  C  CE1 . TYR A  1 234 ? 3.578   32.977  0.826   1.00   20.43 ? 341 TYR A CE1 1 
ATOM   1757  C  CE2 . TYR A  1 234 ? 3.746   32.900  3.225   1.00   21.32 ? 341 TYR A CE2 1 
ATOM   1758  C  CZ  . TYR A  1 234 ? 3.001   32.752  2.059   1.00   21.58 ? 341 TYR A CZ  1 
ATOM   1759  O  OH  . TYR A  1 234 ? 1.675   32.384  2.117   1.00   26.38 ? 341 TYR A OH  1 
ATOM   1760  N  N   . SER A  1 235 ? 9.235   34.033  -0.496  1.00   15.82 ? 342 SER A N   1 
ATOM   1761  C  CA  . SER A  1 235 ? 10.293  34.832  -1.089  1.00   17.93 ? 342 SER A CA  1 
ATOM   1762  C  C   . SER A  1 235 ? 9.660   35.737  -2.160  1.00   20.04 ? 342 SER A C   1 
ATOM   1763  O  O   . SER A  1 235 ? 8.459   36.026  -2.101  1.00   20.96 ? 342 SER A O   1 
ATOM   1764  C  CB  . SER A  1 235 ? 11.387  33.966  -1.705  1.00   19.36 ? 342 SER A CB  1 
ATOM   1765  O  OG  . SER A  1 235 ? 12.456  34.809  -2.111  1.00   18.90 ? 342 SER A OG  1 
ATOM   1766  N  N   . SER A  1 236 ? 10.449  36.171  -3.140  1.00   16.85 ? 343 SER A N   1 
ATOM   1767  C  CA  . SER A  1 236 ? 9.952   37.056  -4.190  1.00   18.93 ? 343 SER A CA  1 
ATOM   1768  C  C   . SER A  1 236 ? 9.230   36.359  -5.351  1.00   18.21 ? 343 SER A C   1 
ATOM   1769  O  O   . SER A  1 236 ? 9.339   35.149  -5.531  1.00   19.07 ? 343 SER A O   1 
ATOM   1770  C  CB  . SER A  1 236 ? 11.114  37.884  -4.754  1.00   18.77 ? 343 SER A CB  1 
ATOM   1771  O  OG  . SER A  1 236 ? 12.043  37.059  -5.435  1.00   18.91 ? 343 SER A OG  1 
ATOM   1772  N  N   . GLY A  1 237 ? 8.511   37.158  -6.138  1.00   18.57 ? 344 GLY A N   1 
ATOM   1773  C  CA  . GLY A  1 237 ? 7.776   36.661  -7.286  1.00   20.24 ? 344 GLY A CA  1 
ATOM   1774  C  C   . GLY A  1 237 ? 7.744   37.726  -8.377  1.00   21.74 ? 344 GLY A C   1 
ATOM   1775  O  O   . GLY A  1 237 ? 8.792   38.226  -8.801  1.00   21.69 ? 344 GLY A O   1 
ATOM   1776  N  N   . ASN A  1 238 ? 6.554   38.082  -8.852  1.00   21.58 ? 345 ASN A N   1 
ATOM   1777  C  CA  . ASN A  1 238 ? 6.463   39.098  -9.905  1.00   20.62 ? 345 ASN A CA  1 
ATOM   1778  C  C   . ASN A  1 238 ? 6.513   40.511  -9.320  1.00   16.89 ? 345 ASN A C   1 
ATOM   1779  O  O   . ASN A  1 238 ? 6.609   40.681  -8.115  1.00   13.73 ? 345 ASN A O   1 
ATOM   1780  C  CB  . ASN A  1 238 ? 5.196   38.908  -10.756 1.00   18.69 ? 345 ASN A CB  1 
ATOM   1781  C  CG  . ASN A  1 238 ? 3.908   39.103  -9.961  1.00   20.53 ? 345 ASN A CG  1 
ATOM   1782  O  OD1 . ASN A  1 238 ? 3.787   40.021  -9.143  1.00   21.19 ? 345 ASN A OD1 1 
ATOM   1783  N  ND2 . ASN A  1 238 ? 2.929   38.240  -10.215 1.00   18.52 ? 345 ASN A ND2 1 
ATOM   1784  N  N   . GLN A  1 239 ? 6.426   41.530  -10.165 1.00   18.27 ? 346 GLN A N   1 
ATOM   1785  C  CA  . GLN A  1 239 ? 6.537   42.882  -9.649  1.00   20.89 ? 346 GLN A CA  1 
ATOM   1786  C  C   . GLN A  1 239 ? 5.325   43.417  -8.914  1.00   24.02 ? 346 GLN A C   1 
ATOM   1787  O  O   . GLN A  1 239 ? 5.369   44.531  -8.390  1.00   24.92 ? 346 GLN A O   1 
ATOM   1788  C  CB  . GLN A  1 239 ? 6.992   43.845  -10.759 1.00   18.23 ? 346 GLN A CB  1 
ATOM   1789  C  CG  . GLN A  1 239 ? 8.308   43.373  -11.409 1.00   24.74 ? 346 GLN A CG  1 
ATOM   1790  C  CD  . GLN A  1 239 ? 8.961   44.379  -12.351 1.00   24.75 ? 346 GLN A CD  1 
ATOM   1791  O  OE1 . GLN A  1 239 ? 9.767   44.004  -13.196 1.00   27.82 ? 346 GLN A OE1 1 
ATOM   1792  N  NE2 . GLN A  1 239 ? 8.633   45.651  -12.200 1.00   25.48 ? 346 GLN A NE2 1 
ATOM   1793  N  N   . ASN A  1 240 ? 4.245   42.639  -8.854  1.00   22.53 ? 347 ASN A N   1 
ATOM   1794  C  CA  . ASN A  1 240 ? 3.065   43.082  -8.111  1.00   20.88 ? 347 ASN A CA  1 
ATOM   1795  C  C   . ASN A  1 240 ? 3.125   42.445  -6.734  1.00   23.56 ? 347 ASN A C   1 
ATOM   1796  O  O   . ASN A  1 240 ? 2.316   42.767  -5.854  1.00   22.11 ? 347 ASN A O   1 
ATOM   1797  C  CB  . ASN A  1 240 ? 1.743   42.644  -8.762  1.00   21.15 ? 347 ASN A CB  1 
ATOM   1798  C  CG  . ASN A  1 240 ? 1.592   43.120  -10.188 1.00   26.90 ? 347 ASN A CG  1 
ATOM   1799  O  OD1 . ASN A  1 240 ? 2.056   42.468  -11.120 1.00   31.84 ? 347 ASN A OD1 1 
ATOM   1800  N  ND2 . ASN A  1 240 ? 0.941   44.263  -10.367 1.00   28.80 ? 347 ASN A ND2 1 
ATOM   1801  N  N   . GLU A  1 241 ? 4.064   41.517  -6.557  1.00   21.51 ? 348 GLU A N   1 
ATOM   1802  C  CA  . GLU A  1 241 ? 4.216   40.823  -5.282  1.00   22.31 ? 348 GLU A CA  1 
ATOM   1803  C  C   . GLU A  1 241 ? 5.355   41.430  -4.487  1.00   23.17 ? 348 GLU A C   1 
ATOM   1804  O  O   . GLU A  1 241 ? 6.361   41.857  -5.053  1.00   24.04 ? 348 GLU A O   1 
ATOM   1805  C  CB  . GLU A  1 241 ? 4.455   39.323  -5.517  1.00   19.91 ? 348 GLU A CB  1 
ATOM   1806  C  CG  . GLU A  1 241 ? 3.237   38.646  -6.124  1.00   19.41 ? 348 GLU A CG  1 
ATOM   1807  C  CD  . GLU A  1 241 ? 3.479   37.206  -6.523  1.00   21.64 ? 348 GLU A CD  1 
ATOM   1808  O  OE1 . GLU A  1 241 ? 2.820   36.298  -5.935  1.00   18.65 ? 348 GLU A OE1 1 
ATOM   1809  O  OE2 . GLU A  1 241 ? 4.321   36.995  -7.432  1.00   18.31 ? 348 GLU A OE2 1 
ATOM   1810  N  N   . LYS A  1 242 ? 5.195   41.481  -3.171  1.00   21.88 ? 349 LYS A N   1 
ATOM   1811  C  CA  . LYS A  1 242 ? 6.226   42.055  -2.324  1.00   22.52 ? 349 LYS A CA  1 
ATOM   1812  C  C   . LYS A  1 242 ? 7.409   41.123  -2.158  1.00   22.70 ? 349 LYS A C   1 
ATOM   1813  O  O   . LYS A  1 242 ? 7.323   39.935  -2.474  1.00   21.29 ? 349 LYS A O   1 
ATOM   1814  C  CB  . LYS A  1 242 ? 5.640   42.429  -0.969  1.00   26.50 ? 349 LYS A CB  1 
ATOM   1815  C  CG  . LYS A  1 242 ? 4.623   43.552  -1.080  1.00   33.16 ? 349 LYS A CG  1 
ATOM   1816  C  CD  . LYS A  1 242 ? 3.965   43.839  0.242   1.00   42.83 ? 349 LYS A CD  1 
ATOM   1817  C  CE  . LYS A  1 242 ? 2.724   44.705  0.050   1.00   49.34 ? 349 LYS A CE  1 
ATOM   1818  N  NZ  . LYS A  1 242 ? 1.889   44.707  1.287   1.00   51.74 ? 349 LYS A NZ  1 
ATOM   1819  N  N   . GLN A  1 243 ? 8.518   41.667  -1.665  1.00   20.96 ? 350 GLN A N   1 
ATOM   1820  C  CA  . GLN A  1 243 ? 9.718   40.877  -1.496  1.00   19.78 ? 350 GLN A CA  1 
ATOM   1821  C  C   . GLN A  1 243 ? 10.195  40.851  -0.050  1.00   20.07 ? 350 GLN A C   1 
ATOM   1822  O  O   . GLN A  1 243 ? 9.425   41.173  0.852   1.00   17.08 ? 350 GLN A O   1 
ATOM   1823  C  CB  . GLN A  1 243 ? 10.787  41.395  -2.458  1.00   19.75 ? 350 GLN A CB  1 
ATOM   1824  C  CG  . GLN A  1 243 ? 10.217  41.509  -3.876  1.00   20.45 ? 350 GLN A CG  1 
ATOM   1825  C  CD  . GLN A  1 243 ? 11.255  41.842  -4.927  1.00   24.31 ? 350 GLN A CD  1 
ATOM   1826  O  OE1 . GLN A  1 243 ? 12.181  42.618  -4.679  1.00   25.37 ? 350 GLN A OE1 1 
ATOM   1827  N  NE2 . GLN A  1 243 ? 11.094  41.276  -6.121  1.00   23.55 ? 350 GLN A NE2 1 
ATOM   1828  N  N   . ILE A  1 244 ? 11.446  40.456  0.174   1.00   17.10 ? 351 ILE A N   1 
ATOM   1829  C  CA  . ILE A  1 244 ? 11.960  40.344  1.522   1.00   17.06 ? 351 ILE A CA  1 
ATOM   1830  C  C   . ILE A  1 244 ? 12.663  41.604  2.016   1.00   18.46 ? 351 ILE A C   1 
ATOM   1831  O  O   . ILE A  1 244 ? 13.497  42.191  1.314   1.00   17.22 ? 351 ILE A O   1 
ATOM   1832  C  CB  . ILE A  1 244 ? 12.894  39.122  1.635   1.00   20.31 ? 351 ILE A CB  1 
ATOM   1833  C  CG1 . ILE A  1 244 ? 12.154  37.867  1.145   1.00   18.70 ? 351 ILE A CG1 1 
ATOM   1834  C  CG2 . ILE A  1 244 ? 13.364  38.937  3.082   1.00   19.44 ? 351 ILE A CG2 1 
ATOM   1835  C  CD1 . ILE A  1 244 ? 10.761  37.684  1.729   1.00   19.04 ? 351 ILE A CD1 1 
ATOM   1836  N  N   . VAL A  1 245 ? 12.302  42.007  3.234   1.00   16.85 ? 352 VAL A N   1 
ATOM   1837  C  CA  . VAL A  1 245 ? 12.836  43.205  3.883   1.00   16.27 ? 352 VAL A CA  1 
ATOM   1838  C  C   . VAL A  1 245 ? 13.908  42.798  4.873   1.00   18.57 ? 352 VAL A C   1 
ATOM   1839  O  O   . VAL A  1 245 ? 13.644  42.029  5.801   1.00   21.19 ? 352 VAL A O   1 
ATOM   1840  C  CB  . VAL A  1 245 ? 11.728  43.948  4.654   1.00   19.36 ? 352 VAL A CB  1 
ATOM   1841  C  CG1 . VAL A  1 245 ? 12.316  45.150  5.403   1.00   18.57 ? 352 VAL A CG1 1 
ATOM   1842  C  CG2 . VAL A  1 245 ? 10.626  44.373  3.707   1.00   15.33 ? 352 VAL A CG2 1 
ATOM   1843  N  N   . THR A  1 246 ? 15.113  43.328  4.702   1.00   19.07 ? 353 THR A N   1 
ATOM   1844  C  CA  . THR A  1 246 ? 16.207  42.953  5.581   1.00   16.16 ? 353 THR A CA  1 
ATOM   1845  C  C   . THR A  1 246 ? 17.331  43.986  5.573   1.00   20.03 ? 353 THR A C   1 
ATOM   1846  O  O   . THR A  1 246 ? 17.241  45.016  4.896   1.00   19.43 ? 353 THR A O   1 
ATOM   1847  C  CB  . THR A  1 246 ? 16.763  41.579  5.141   1.00   15.22 ? 353 THR A CB  1 
ATOM   1848  O  OG1 . THR A  1 246 ? 17.785  41.154  6.043   1.00   16.46 ? 353 THR A OG1 1 
ATOM   1849  C  CG2 . THR A  1 246 ? 17.348  41.674  3.705   1.00   13.15 ? 353 THR A CG2 1 
ATOM   1850  N  N   . THR A  1 247 ? 18.384  43.693  6.335   1.00   18.86 ? 354 THR A N   1 
ATOM   1851  C  CA  . THR A  1 247 ? 19.564  44.540  6.452   1.00   18.54 ? 354 THR A CA  1 
ATOM   1852  C  C   . THR A  1 247 ? 20.413  44.465  5.186   1.00   19.31 ? 354 THR A C   1 
ATOM   1853  O  O   . THR A  1 247 ? 20.622  43.378  4.653   1.00   21.42 ? 354 THR A O   1 
ATOM   1854  C  CB  . THR A  1 247 ? 20.413  44.069  7.624   1.00   17.98 ? 354 THR A CB  1 
ATOM   1855  O  OG1 . THR A  1 247 ? 20.580  42.647  7.529   1.00   17.76 ? 354 THR A OG1 1 
ATOM   1856  C  CG2 . THR A  1 247 ? 19.716  44.381  8.941   1.00   17.47 ? 354 THR A CG2 1 
ATOM   1857  N  N   . ASP A  1 248 ? 20.915  45.613  4.724   1.00   19.38 ? 355 ASP A N   1 
ATOM   1858  C  CA  . ASP A  1 248 ? 21.724  45.667  3.505   1.00   18.95 ? 355 ASP A CA  1 
ATOM   1859  C  C   . ASP A  1 248 ? 23.086  46.276  3.776   1.00   20.24 ? 355 ASP A C   1 
ATOM   1860  O  O   . ASP A  1 248 ? 23.280  46.966  4.780   1.00   20.81 ? 355 ASP A O   1 
ATOM   1861  C  CB  . ASP A  1 248 ? 21.004  46.477  2.424   1.00   20.76 ? 355 ASP A CB  1 
ATOM   1862  C  CG  . ASP A  1 248 ? 21.458  46.116  1.004   1.00   21.94 ? 355 ASP A CG  1 
ATOM   1863  O  OD1 . ASP A  1 248 ? 22.207  45.134  0.825   1.00   26.21 ? 355 ASP A OD1 1 
ATOM   1864  O  OD2 . ASP A  1 248 ? 21.043  46.812  0.053   1.00   21.97 ? 355 ASP A OD2 1 
ATOM   1865  N  N   . LEU A  1 249 ? 24.031  45.998  2.884   1.00   19.68 ? 356 LEU A N   1 
ATOM   1866  C  CA  . LEU A  1 249 ? 25.399  46.497  2.995   1.00   19.77 ? 356 LEU A CA  1 
ATOM   1867  C  C   . LEU A  1 249 ? 25.425  48.017  3.143   1.00   22.08 ? 356 LEU A C   1 
ATOM   1868  O  O   . LEU A  1 249 ? 24.523  48.720  2.668   1.00   21.41 ? 356 LEU A O   1 
ATOM   1869  C  CB  . LEU A  1 249 ? 26.186  46.092  1.754   1.00   19.00 ? 356 LEU A CB  1 
ATOM   1870  C  CG  . LEU A  1 249 ? 27.699  45.960  1.835   1.00   22.00 ? 356 LEU A CG  1 
ATOM   1871  C  CD1 . LEU A  1 249 ? 28.080  44.952  2.900   1.00   19.07 ? 356 LEU A CD1 1 
ATOM   1872  C  CD2 . LEU A  1 249 ? 28.222  45.525  0.466   1.00   20.37 ? 356 LEU A CD2 1 
ATOM   1873  N  N   . ARG A  1 250 ? 26.465  48.508  3.810   1.00   22.06 ? 357 ARG A N   1 
ATOM   1874  C  CA  . ARG A  1 250 ? 26.652  49.933  4.053   1.00   22.72 ? 357 ARG A CA  1 
ATOM   1875  C  C   . ARG A  1 250 ? 25.587  50.467  4.999   1.00   23.07 ? 357 ARG A C   1 
ATOM   1876  O  O   . ARG A  1 250 ? 25.111  51.597  4.874   1.00   23.44 ? 357 ARG A O   1 
ATOM   1877  C  CB  . ARG A  1 250 ? 26.672  50.712  2.727   1.00   17.67 ? 357 ARG A CB  1 
ATOM   1878  C  CG  . ARG A  1 250 ? 27.811  50.271  1.811   1.00   22.54 ? 357 ARG A CG  1 
ATOM   1879  C  CD  . ARG A  1 250 ? 27.734  50.946  0.448   1.00   22.77 ? 357 ARG A CD  1 
ATOM   1880  N  NE  . ARG A  1 250 ? 28.616  50.327  -0.543  1.00   24.63 ? 357 ARG A NE  1 
ATOM   1881  C  CZ  . ARG A  1 250 ? 29.937  50.509  -0.623  1.00   27.46 ? 357 ARG A CZ  1 
ATOM   1882  N  NH1 . ARG A  1 250 ? 30.633  49.891  -1.573  1.00   27.05 ? 357 ARG A NH1 1 
ATOM   1883  N  NH2 . ARG A  1 250 ? 30.570  51.309  0.228   1.00   27.63 ? 357 ARG A NH2 1 
ATOM   1884  N  N   . GLN A  1 251 ? 25.213  49.616  5.948   1.00   24.07 ? 358 GLN A N   1 
ATOM   1885  C  CA  . GLN A  1 251 ? 24.252  49.958  6.990   1.00   24.58 ? 358 GLN A CA  1 
ATOM   1886  C  C   . GLN A  1 251 ? 22.905  50.445  6.485   1.00   23.58 ? 358 GLN A C   1 
ATOM   1887  O  O   . GLN A  1 251 ? 22.277  51.301  7.085   1.00   21.42 ? 358 GLN A O   1 
ATOM   1888  C  CB  . GLN A  1 251 ? 24.895  50.992  7.920   1.00   26.42 ? 358 GLN A CB  1 
ATOM   1889  C  CG  . GLN A  1 251 ? 26.295  50.544  8.351   1.00   30.85 ? 358 GLN A CG  1 
ATOM   1890  C  CD  . GLN A  1 251 ? 27.006  51.528  9.254   1.00   36.34 ? 358 GLN A CD  1 
ATOM   1891  O  OE1 . GLN A  1 251 ? 26.559  51.807  10.362  1.00   36.71 ? 358 GLN A OE1 1 
ATOM   1892  N  NE2 . GLN A  1 251 ? 28.129  52.055  8.785   1.00   41.88 ? 358 GLN A NE2 1 
ATOM   1893  N  N   . LYS A  1 252 ? 22.451  49.873  5.383   1.00   24.20 ? 359 LYS A N   1 
ATOM   1894  C  CA  . LYS A  1 252 ? 21.172  50.255  4.823   1.00   25.23 ? 359 LYS A CA  1 
ATOM   1895  C  C   . LYS A  1 252 ? 20.113  49.189  5.062   1.00   26.41 ? 359 LYS A C   1 
ATOM   1896  O  O   . LYS A  1 252 ? 20.370  48.129  5.649   1.00   25.17 ? 359 LYS A O   1 
ATOM   1897  C  CB  . LYS A  1 252 ? 21.314  50.510  3.329   1.00   28.94 ? 359 LYS A CB  1 
ATOM   1898  C  CG  . LYS A  1 252 ? 22.195  51.680  3.012   1.00   32.02 ? 359 LYS A CG  1 
ATOM   1899  C  CD  . LYS A  1 252 ? 22.441  51.743  1.528   1.00   38.78 ? 359 LYS A CD  1 
ATOM   1900  C  CE  . LYS A  1 252 ? 23.514  52.768  1.204   1.00   45.74 ? 359 LYS A CE  1 
ATOM   1901  N  NZ  . LYS A  1 252 ? 24.104  52.521  -0.147  1.00   50.18 ? 359 LYS A NZ  1 
ATOM   1902  N  N   . CYS A  1 253 ? 18.914  49.481  4.593   1.00   23.97 ? 360 CYS A N   1 
ATOM   1903  C  CA  . CYS A  1 253 ? 17.797  48.581  4.750   1.00   26.01 ? 360 CYS A CA  1 
ATOM   1904  C  C   . CYS A  1 253 ? 17.280  48.371  3.341   1.00   25.94 ? 360 CYS A C   1 
ATOM   1905  O  O   . CYS A  1 253 ? 17.202  49.321  2.575   1.00   29.21 ? 360 CYS A O   1 
ATOM   1906  C  CB  . CYS A  1 253 ? 16.750  49.266  5.638   1.00   26.25 ? 360 CYS A CB  1 
ATOM   1907  S  SG  . CYS A  1 253 ? 15.239  48.335  6.085   1.00   37.92 ? 360 CYS A SG  1 
ATOM   1908  N  N   . THR A  1 254 ? 16.967  47.136  2.974   1.00   24.72 ? 361 THR A N   1 
ATOM   1909  C  CA  . THR A  1 254 ? 16.438  46.883  1.641   1.00   23.26 ? 361 THR A CA  1 
ATOM   1910  C  C   . THR A  1 254 ? 15.089  46.182  1.732   1.00   24.50 ? 361 THR A C   1 
ATOM   1911  O  O   . THR A  1 254 ? 14.806  45.481  2.703   1.00   21.70 ? 361 THR A O   1 
ATOM   1912  C  CB  . THR A  1 254 ? 17.366  45.998  0.809   1.00   22.75 ? 361 THR A CB  1 
ATOM   1913  O  OG1 . THR A  1 254 ? 16.757  45.775  -0.470  1.00   21.47 ? 361 THR A OG1 1 
ATOM   1914  C  CG2 . THR A  1 254 ? 17.587  44.641  1.509   1.00   22.33 ? 361 THR A CG2 1 
ATOM   1915  N  N   . GLU A  1 255 ? 14.260  46.370  0.714   1.00   26.03 ? 362 GLU A N   1 
ATOM   1916  C  CA  . GLU A  1 255 ? 12.943  45.743  0.688   1.00   26.04 ? 362 GLU A CA  1 
ATOM   1917  C  C   . GLU A  1 255 ? 12.896  44.836  -0.523  1.00   24.55 ? 362 GLU A C   1 
ATOM   1918  O  O   . GLU A  1 255 ? 11.845  44.308  -0.884  1.00   24.13 ? 362 GLU A O   1 
ATOM   1919  C  CB  . GLU A  1 255 ? 11.841  46.817  0.607   1.00   29.95 ? 362 GLU A CB  1 
ATOM   1920  C  CG  . GLU A  1 255 ? 11.730  47.670  1.899   1.00   35.34 ? 362 GLU A CG  1 
ATOM   1921  C  CD  . GLU A  1 255 ? 10.722  48.829  1.811   1.00   38.54 ? 362 GLU A CD  1 
ATOM   1922  O  OE1 . GLU A  1 255 ? 9.555   48.592  1.444   1.00   40.86 ? 362 GLU A OE1 1 
ATOM   1923  O  OE2 . GLU A  1 255 ? 11.094  49.982  2.126   1.00   39.25 ? 362 GLU A OE2 1 
ATOM   1924  N  N   . SER A  1 256 ? 14.052  44.640  -1.144  1.00   24.88 ? 363 SER A N   1 
ATOM   1925  C  CA  . SER A  1 256 ? 14.103  43.803  -2.328  1.00   27.36 ? 363 SER A CA  1 
ATOM   1926  C  C   . SER A  1 256 ? 15.107  42.654  -2.320  1.00   26.43 ? 363 SER A C   1 
ATOM   1927  O  O   . SER A  1 256 ? 15.847  42.452  -3.290  1.00   26.42 ? 363 SER A O   1 
ATOM   1928  C  CB  . SER A  1 256 ? 14.296  44.686  -3.572  1.00   29.37 ? 363 SER A CB  1 
ATOM   1929  O  OG  . SER A  1 256 ? 15.122  45.792  -3.297  1.00   33.33 ? 363 SER A OG  1 
ATOM   1930  N  N   . HIS A  1 257 ? 15.137  41.902  -1.221  1.00   25.42 ? 364 HIS A N   1 
ATOM   1931  C  CA  . HIS A  1 257 ? 16.004  40.731  -1.139  1.00   23.50 ? 364 HIS A CA  1 
ATOM   1932  C  C   . HIS A  1 257 ? 15.125  39.681  -1.841  1.00   24.28 ? 364 HIS A C   1 
ATOM   1933  O  O   . HIS A  1 257 ? 13.930  39.587  -1.554  1.00   25.95 ? 364 HIS A O   1 
ATOM   1934  C  CB  . HIS A  1 257 ? 16.280  40.384  0.319   1.00   21.50 ? 364 HIS A CB  1 
ATOM   1935  C  CG  . HIS A  1 257 ? 17.236  39.246  0.500   1.00   20.33 ? 364 HIS A CG  1 
ATOM   1936  N  ND1 . HIS A  1 257 ? 18.249  38.972  -0.398  1.00   20.25 ? 364 HIS A ND1 1 
ATOM   1937  C  CD2 . HIS A  1 257 ? 17.331  38.308  1.474   1.00   16.77 ? 364 HIS A CD2 1 
ATOM   1938  C  CE1 . HIS A  1 257 ? 18.923  37.911  0.015   1.00   21.73 ? 364 HIS A CE1 1 
ATOM   1939  N  NE2 . HIS A  1 257 ? 18.386  37.488  1.147   1.00   21.01 ? 364 HIS A NE2 1 
ATOM   1940  N  N   . THR A  1 258 ? 15.705  38.910  -2.760  1.00   23.93 ? 365 THR A N   1 
ATOM   1941  C  CA  . THR A  1 258 ? 14.925  37.976  -3.568  1.00   19.76 ? 365 THR A CA  1 
ATOM   1942  C  C   . THR A  1 258 ? 15.458  36.557  -3.769  1.00   21.47 ? 365 THR A C   1 
ATOM   1943  O  O   . THR A  1 258 ? 16.532  36.196  -3.296  1.00   21.33 ? 365 THR A O   1 
ATOM   1944  C  CB  . THR A  1 258 ? 14.761  38.560  -4.961  1.00   20.93 ? 365 THR A CB  1 
ATOM   1945  O  OG1 . THR A  1 258 ? 16.021  38.482  -5.634  1.00   25.18 ? 365 THR A OG1 1 
ATOM   1946  C  CG2 . THR A  1 258 ? 14.353  40.049  -4.883  1.00   12.36 ? 365 THR A CG2 1 
ATOM   1947  N  N   . GLY A  1 259 ? 14.673  35.765  -4.496  1.00   20.60 ? 366 GLY A N   1 
ATOM   1948  C  CA  . GLY A  1 259 ? 15.051  34.410  -4.842  1.00   18.21 ? 366 GLY A CA  1 
ATOM   1949  C  C   . GLY A  1 259 ? 15.173  33.373  -3.750  1.00   21.69 ? 366 GLY A C   1 
ATOM   1950  O  O   . GLY A  1 259 ? 14.785  33.574  -2.592  1.00   19.89 ? 366 GLY A O   1 
ATOM   1951  N  N   . THR A  1 260 ? 15.735  32.237  -4.146  1.00   19.58 ? 367 THR A N   1 
ATOM   1952  C  CA  . THR A  1 260 ? 15.931  31.122  -3.252  1.00   19.29 ? 367 THR A CA  1 
ATOM   1953  C  C   . THR A  1 260 ? 16.775  31.555  -2.046  1.00   17.06 ? 367 THR A C   1 
ATOM   1954  O  O   . THR A  1 260 ? 16.609  31.029  -0.947  1.00   16.89 ? 367 THR A O   1 
ATOM   1955  C  CB  . THR A  1 260 ? 16.609  29.947  -4.030  1.00   19.40 ? 367 THR A CB  1 
ATOM   1956  O  OG1 . THR A  1 260 ? 16.602  28.769  -3.234  1.00   19.84 ? 367 THR A OG1 1 
ATOM   1957  C  CG2 . THR A  1 260 ? 18.048  30.292  -4.389  1.00   19.11 ? 367 THR A CG2 1 
ATOM   1958  N  N   . SER A  1 261 ? 17.656  32.533  -2.250  1.00   16.53 ? 368 SER A N   1 
ATOM   1959  C  CA  . SER A  1 261 ? 18.540  33.012  -1.179  1.00   18.93 ? 368 SER A CA  1 
ATOM   1960  C  C   . SER A  1 261 ? 17.801  33.481  0.055   1.00   20.07 ? 368 SER A C   1 
ATOM   1961  O  O   . SER A  1 261 ? 18.292  33.333  1.177   1.00   19.63 ? 368 SER A O   1 
ATOM   1962  C  CB  . SER A  1 261 ? 19.421  34.174  -1.665  1.00   20.15 ? 368 SER A CB  1 
ATOM   1963  O  OG  . SER A  1 261 ? 20.377  33.768  -2.631  1.00   19.89 ? 368 SER A OG  1 
ATOM   1964  N  N   . ALA A  1 262 ? 16.620  34.056  -0.154  1.00   19.36 ? 369 ALA A N   1 
ATOM   1965  C  CA  . ALA A  1 262 ? 15.846  34.581  0.953   1.00   19.57 ? 369 ALA A CA  1 
ATOM   1966  C  C   . ALA A  1 262 ? 15.037  33.552  1.726   1.00   18.56 ? 369 ALA A C   1 
ATOM   1967  O  O   . ALA A  1 262 ? 14.627  33.818  2.849   1.00   17.63 ? 369 ALA A O   1 
ATOM   1968  C  CB  . ALA A  1 262 ? 14.924  35.693  0.456   1.00   15.68 ? 369 ALA A CB  1 
ATOM   1969  N  N   . SER A  1 263 ? 14.813  32.378  1.147   1.00   18.02 ? 370 SER A N   1 
ATOM   1970  C  CA  . SER A  1 263 ? 14.003  31.385  1.838   1.00   17.09 ? 370 SER A CA  1 
ATOM   1971  C  C   . SER A  1 263 ? 14.716  30.630  2.935   1.00   17.38 ? 370 SER A C   1 
ATOM   1972  O  O   . SER A  1 263 ? 14.183  30.483  4.028   1.00   20.31 ? 370 SER A O   1 
ATOM   1973  C  CB  . SER A  1 263 ? 13.395  30.413  0.833   1.00   16.34 ? 370 SER A CB  1 
ATOM   1974  O  OG  . SER A  1 263 ? 12.409  31.089  0.063   1.00   21.07 ? 370 SER A OG  1 
ATOM   1975  N  N   . ALA A  1 264 ? 15.931  30.176  2.671   1.00   15.26 ? 371 ALA A N   1 
ATOM   1976  C  CA  . ALA A  1 264 ? 16.651  29.405  3.679   1.00   17.85 ? 371 ALA A CA  1 
ATOM   1977  C  C   . ALA A  1 264 ? 16.818  30.140  5.019   1.00   17.95 ? 371 ALA A C   1 
ATOM   1978  O  O   . ALA A  1 264 ? 16.582  29.577  6.094   1.00   19.28 ? 371 ALA A O   1 
ATOM   1979  C  CB  . ALA A  1 264 ? 18.036  28.965  3.127   1.00   12.48 ? 371 ALA A CB  1 
ATOM   1980  N  N   . PRO A  1 265 ? 17.229  31.409  4.970   1.00   15.60 ? 372 PRO A N   1 
ATOM   1981  C  CA  . PRO A  1 265 ? 17.410  32.160  6.217   1.00   16.97 ? 372 PRO A CA  1 
ATOM   1982  C  C   . PRO A  1 265 ? 16.145  32.209  7.079   1.00   17.92 ? 372 PRO A C   1 
ATOM   1983  O  O   . PRO A  1 265 ? 16.212  32.124  8.313   1.00   17.09 ? 372 PRO A O   1 
ATOM   1984  C  CB  . PRO A  1 265 ? 17.846  33.553  5.735   1.00   16.52 ? 372 PRO A CB  1 
ATOM   1985  C  CG  . PRO A  1 265 ? 18.551  33.268  4.422   1.00   15.20 ? 372 PRO A CG  1 
ATOM   1986  C  CD  . PRO A  1 265 ? 17.667  32.187  3.795   1.00   15.49 ? 372 PRO A CD  1 
ATOM   1987  N  N   . LEU A  1 266 ? 14.993  32.361  6.437   1.00   18.44 ? 373 LEU A N   1 
ATOM   1988  C  CA  . LEU A  1 266 ? 13.741  32.410  7.182   1.00   17.28 ? 373 LEU A CA  1 
ATOM   1989  C  C   . LEU A  1 266 ? 13.514  31.055  7.857   1.00   16.74 ? 373 LEU A C   1 
ATOM   1990  O  O   . LEU A  1 266 ? 13.059  30.977  8.997   1.00   15.22 ? 373 LEU A O   1 
ATOM   1991  C  CB  . LEU A  1 266 ? 12.591  32.738  6.246   1.00   18.19 ? 373 LEU A CB  1 
ATOM   1992  C  CG  . LEU A  1 266 ? 12.593  34.156  5.663   1.00   20.90 ? 373 LEU A CG  1 
ATOM   1993  C  CD1 . LEU A  1 266 ? 11.451  34.281  4.632   1.00   11.84 ? 373 LEU A CD1 1 
ATOM   1994  C  CD2 . LEU A  1 266 ? 12.428  35.172  6.792   1.00   15.22 ? 373 LEU A CD2 1 
ATOM   1995  N  N   . ALA A  1 267 ? 13.850  29.987  7.146   1.00   13.95 ? 374 ALA A N   1 
ATOM   1996  C  CA  . ALA A  1 267 ? 13.702  28.658  7.694   1.00   14.69 ? 374 ALA A CA  1 
ATOM   1997  C  C   . ALA A  1 267 ? 14.676  28.512  8.862   1.00   15.77 ? 374 ALA A C   1 
ATOM   1998  O  O   . ALA A  1 267 ? 14.338  27.958  9.907   1.00   12.38 ? 374 ALA A O   1 
ATOM   1999  C  CB  . ALA A  1 267 ? 13.989  27.613  6.620   1.00   12.42 ? 374 ALA A CB  1 
ATOM   2000  N  N   . ALA A  1 268 ? 15.888  29.030  8.690   1.00   15.90 ? 375 ALA A N   1 
ATOM   2001  C  CA  . ALA A  1 268 ? 16.884  28.930  9.747   1.00   16.58 ? 375 ALA A CA  1 
ATOM   2002  C  C   . ALA A  1 268 ? 16.379  29.629  11.002  1.00   19.15 ? 375 ALA A C   1 
ATOM   2003  O  O   . ALA A  1 268 ? 16.566  29.148  12.129  1.00   18.83 ? 375 ALA A O   1 
ATOM   2004  C  CB  . ALA A  1 268 ? 18.191  29.555  9.291   1.00   18.11 ? 375 ALA A CB  1 
ATOM   2005  N  N   . GLY A  1 269 ? 15.734  30.773  10.805  1.00   19.96 ? 376 GLY A N   1 
ATOM   2006  C  CA  . GLY A  1 269 ? 15.218  31.512  11.942  1.00   18.88 ? 376 GLY A CA  1 
ATOM   2007  C  C   . GLY A  1 269 ? 14.125  30.742  12.659  1.00   18.76 ? 376 GLY A C   1 
ATOM   2008  O  O   . GLY A  1 269 ? 14.118  30.654  13.889  1.00   20.75 ? 376 GLY A O   1 
ATOM   2009  N  N   . ILE A  1 270 ? 13.195  30.181  11.895  1.00   16.59 ? 377 ILE A N   1 
ATOM   2010  C  CA  . ILE A  1 270 ? 12.102  29.433  12.489  1.00   15.89 ? 377 ILE A CA  1 
ATOM   2011  C  C   . ILE A  1 270 ? 12.653  28.248  13.270  1.00   16.64 ? 377 ILE A C   1 
ATOM   2012  O  O   . ILE A  1 270 ? 12.177  27.919  14.358  1.00   18.88 ? 377 ILE A O   1 
ATOM   2013  C  CB  . ILE A  1 270 ? 11.119  28.972  11.400  1.00   16.67 ? 377 ILE A CB  1 
ATOM   2014  C  CG1 . ILE A  1 270 ? 10.405  30.213  10.846  1.00   20.94 ? 377 ILE A CG1 1 
ATOM   2015  C  CG2 . ILE A  1 270 ? 10.139  27.941  11.964  1.00   14.29 ? 377 ILE A CG2 1 
ATOM   2016  C  CD1 . ILE A  1 270 ? 9.359   29.951  9.773   1.00   19.12 ? 377 ILE A CD1 1 
ATOM   2017  N  N   . ILE A  1 271 ? 13.677  27.618  12.719  1.00   15.26 ? 378 ILE A N   1 
ATOM   2018  C  CA  . ILE A  1 271 ? 14.294  26.486  13.378  1.00   17.03 ? 378 ILE A CA  1 
ATOM   2019  C  C   . ILE A  1 271 ? 14.977  26.955  14.666  1.00   17.49 ? 378 ILE A C   1 
ATOM   2020  O  O   . ILE A  1 271 ? 15.034  26.220  15.646  1.00   17.86 ? 378 ILE A O   1 
ATOM   2021  C  CB  . ILE A  1 271 ? 15.290  25.797  12.418  1.00   18.82 ? 378 ILE A CB  1 
ATOM   2022  C  CG1 . ILE A  1 271 ? 14.494  25.125  11.289  1.00   18.69 ? 378 ILE A CG1 1 
ATOM   2023  C  CG2 . ILE A  1 271 ? 16.134  24.756  13.159  1.00   16.98 ? 378 ILE A CG2 1 
ATOM   2024  C  CD1 . ILE A  1 271 ? 15.329  24.639  10.094  1.00   18.93 ? 378 ILE A CD1 1 
ATOM   2025  N  N   . ALA A  1 272 ? 15.479  28.188  14.669  1.00   16.00 ? 379 ALA A N   1 
ATOM   2026  C  CA  . ALA A  1 272 ? 16.119  28.729  15.858  1.00   13.88 ? 379 ALA A CA  1 
ATOM   2027  C  C   . ALA A  1 272 ? 15.068  28.868  16.962  1.00   17.80 ? 379 ALA A C   1 
ATOM   2028  O  O   . ALA A  1 272 ? 15.339  28.572  18.123  1.00   19.42 ? 379 ALA A O   1 
ATOM   2029  C  CB  . ALA A  1 272 ? 16.746  30.085  15.553  1.00   12.87 ? 379 ALA A CB  1 
ATOM   2030  N  N   . LEU A  1 273 ? 13.869  29.321  16.604  1.00   16.04 ? 380 LEU A N   1 
ATOM   2031  C  CA  . LEU A  1 273 ? 12.811  29.466  17.594  1.00   16.79 ? 380 LEU A CA  1 
ATOM   2032  C  C   . LEU A  1 273 ? 12.448  28.086  18.121  1.00   16.68 ? 380 LEU A C   1 
ATOM   2033  O  O   . LEU A  1 273 ? 12.179  27.903  19.310  1.00   16.90 ? 380 LEU A O   1 
ATOM   2034  C  CB  . LEU A  1 273 ? 11.557  30.095  16.973  1.00   16.84 ? 380 LEU A CB  1 
ATOM   2035  C  CG  . LEU A  1 273 ? 11.672  31.445  16.260  1.00   19.89 ? 380 LEU A CG  1 
ATOM   2036  C  CD1 . LEU A  1 273 ? 10.294  31.848  15.776  1.00   16.91 ? 380 LEU A CD1 1 
ATOM   2037  C  CD2 . LEU A  1 273 ? 12.263  32.521  17.188  1.00   18.10 ? 380 LEU A CD2 1 
ATOM   2038  N  N   . THR A  1 274 ? 12.449  27.105  17.229  1.00   16.96 ? 381 THR A N   1 
ATOM   2039  C  CA  . THR A  1 274 ? 12.087  25.747  17.616  1.00   17.13 ? 381 THR A CA  1 
ATOM   2040  C  C   . THR A  1 274 ? 13.096  25.152  18.600  1.00   18.73 ? 381 THR A C   1 
ATOM   2041  O  O   . THR A  1 274 ? 12.716  24.462  19.542  1.00   19.92 ? 381 THR A O   1 
ATOM   2042  C  CB  . THR A  1 274 ? 11.949  24.834  16.363  1.00   17.87 ? 381 THR A CB  1 
ATOM   2043  O  OG1 . THR A  1 274 ? 11.029  25.433  15.434  1.00   17.65 ? 381 THR A OG1 1 
ATOM   2044  C  CG2 . THR A  1 274 ? 11.395  23.453  16.741  1.00   14.81 ? 381 THR A CG2 1 
ATOM   2045  N  N   . LEU A  1 275 ? 14.380  25.417  18.390  1.00   20.24 ? 382 LEU A N   1 
ATOM   2046  C  CA  . LEU A  1 275 ? 15.398  24.889  19.295  1.00   19.52 ? 382 LEU A CA  1 
ATOM   2047  C  C   . LEU A  1 275 ? 15.292  25.540  20.662  1.00   19.83 ? 382 LEU A C   1 
ATOM   2048  O  O   . LEU A  1 275 ? 15.603  24.905  21.669  1.00   18.49 ? 382 LEU A O   1 
ATOM   2049  C  CB  . LEU A  1 275 ? 16.805  25.101  18.730  1.00   17.87 ? 382 LEU A CB  1 
ATOM   2050  C  CG  . LEU A  1 275 ? 17.260  24.077  17.682  1.00   19.34 ? 382 LEU A CG  1 
ATOM   2051  C  CD1 . LEU A  1 275 ? 18.717  24.373  17.305  1.00   22.75 ? 382 LEU A CD1 1 
ATOM   2052  C  CD2 . LEU A  1 275 ? 17.160  22.646  18.226  1.00   14.96 ? 382 LEU A CD2 1 
ATOM   2053  N  N   . GLU A  1 276 ? 14.866  26.805  20.707  1.00   17.91 ? 383 GLU A N   1 
ATOM   2054  C  CA  . GLU A  1 276 ? 14.724  27.460  22.002  1.00   19.62 ? 383 GLU A CA  1 
ATOM   2055  C  C   . GLU A  1 276 ? 13.589  26.751  22.754  1.00   17.89 ? 383 GLU A C   1 
ATOM   2056  O  O   . GLU A  1 276 ? 13.660  26.539  23.960  1.00   15.08 ? 383 GLU A O   1 
ATOM   2057  C  CB  . GLU A  1 276 ? 14.396  28.958  21.865  1.00   19.49 ? 383 GLU A CB  1 
ATOM   2058  C  CG  . GLU A  1 276 ? 14.232  29.624  23.245  1.00   21.54 ? 383 GLU A CG  1 
ATOM   2059  C  CD  . GLU A  1 276 ? 13.924  31.116  23.197  1.00   24.98 ? 383 GLU A CD  1 
ATOM   2060  O  OE1 . GLU A  1 276 ? 13.800  31.695  22.096  1.00   27.23 ? 383 GLU A OE1 1 
ATOM   2061  O  OE2 . GLU A  1 276 ? 13.805  31.715  24.279  1.00   24.54 ? 383 GLU A OE2 1 
ATOM   2062  N  N   . ALA A  1 277 ? 12.547  26.379  22.022  1.00   16.60 ? 384 ALA A N   1 
ATOM   2063  C  CA  . ALA A  1 277 ? 11.415  25.690  22.612  1.00   17.52 ? 384 ALA A CA  1 
ATOM   2064  C  C   . ALA A  1 277 ? 11.825  24.300  23.100  1.00   20.26 ? 384 ALA A C   1 
ATOM   2065  O  O   . ALA A  1 277 ? 11.237  23.778  24.037  1.00   18.74 ? 384 ALA A O   1 
ATOM   2066  C  CB  . ALA A  1 277 ? 10.289  25.579  21.595  1.00   16.95 ? 384 ALA A CB  1 
ATOM   2067  N  N   . ASN A  1 278 ? 12.825  23.701  22.458  1.00   18.39 ? 385 ASN A N   1 
ATOM   2068  C  CA  . ASN A  1 278 ? 13.308  22.382  22.869  1.00   23.30 ? 385 ASN A CA  1 
ATOM   2069  C  C   . ASN A  1 278 ? 14.756  22.171  22.410  1.00   24.80 ? 385 ASN A C   1 
ATOM   2070  O  O   . ASN A  1 278 ? 15.000  21.694  21.297  1.00   25.94 ? 385 ASN A O   1 
ATOM   2071  C  CB  . ASN A  1 278 ? 12.416  21.271  22.292  1.00   24.90 ? 385 ASN A CB  1 
ATOM   2072  C  CG  . ASN A  1 278 ? 12.790  19.884  22.811  1.00   23.65 ? 385 ASN A CG  1 
ATOM   2073  O  OD1 . ASN A  1 278 ? 13.892  19.676  23.316  1.00   24.91 ? 385 ASN A OD1 1 
ATOM   2074  N  ND2 . ASN A  1 278 ? 11.879  18.930  22.673  1.00   21.28 ? 385 ASN A ND2 1 
ATOM   2075  N  N   . LYS A  1 279 ? 15.703  22.520  23.278  1.00   22.90 ? 386 LYS A N   1 
ATOM   2076  C  CA  . LYS A  1 279 ? 17.122  22.409  22.980  1.00   24.65 ? 386 LYS A CA  1 
ATOM   2077  C  C   . LYS A  1 279 ? 17.632  20.984  22.799  1.00   22.59 ? 386 LYS A C   1 
ATOM   2078  O  O   . LYS A  1 279 ? 18.747  20.796  22.333  1.00   24.66 ? 386 LYS A O   1 
ATOM   2079  C  CB  . LYS A  1 279 ? 17.946  23.102  24.078  1.00   24.83 ? 386 LYS A CB  1 
ATOM   2080  C  CG  . LYS A  1 279 ? 17.673  24.610  24.236  1.00   28.38 ? 386 LYS A CG  1 
ATOM   2081  C  CD  . LYS A  1 279 ? 18.465  25.195  25.394  0.0000 27.28 ? 386 LYS A CD  1 
ATOM   2082  C  CE  . LYS A  1 279 ? 18.308  26.704  25.466  0.0000 27.57 ? 386 LYS A CE  1 
ATOM   2083  N  NZ  . LYS A  1 279 ? 18.872  27.375  24.261  0.0000 27.48 ? 386 LYS A NZ  1 
ATOM   2084  N  N   . ASN A  1 280 ? 16.832  19.984  23.149  1.00   22.37 ? 387 ASN A N   1 
ATOM   2085  C  CA  . ASN A  1 280 ? 17.279  18.592  23.019  1.00   26.48 ? 387 ASN A CA  1 
ATOM   2086  C  C   . ASN A  1 280 ? 16.893  17.914  21.704  1.00   24.47 ? 387 ASN A C   1 
ATOM   2087  O  O   . ASN A  1 280 ? 17.136  16.722  21.522  1.00   23.95 ? 387 ASN A O   1 
ATOM   2088  C  CB  . ASN A  1 280 ? 16.772  17.750  24.207  1.00   31.48 ? 387 ASN A CB  1 
ATOM   2089  C  CG  . ASN A  1 280 ? 17.657  17.894  25.449  1.00   41.09 ? 387 ASN A CG  1 
ATOM   2090  O  OD1 . ASN A  1 280 ? 17.352  17.365  26.534  1.00   46.13 ? 387 ASN A OD1 1 
ATOM   2091  N  ND2 . ASN A  1 280 ? 18.766  18.613  25.292  1.00   43.56 ? 387 ASN A ND2 1 
ATOM   2092  N  N   . LEU A  1 281 ? 16.296  18.668  20.786  1.00   20.76 ? 388 LEU A N   1 
ATOM   2093  C  CA  . LEU A  1 281 ? 15.894  18.098  19.499  1.00   19.44 ? 388 LEU A CA  1 
ATOM   2094  C  C   . LEU A  1 281 ? 17.134  17.714  18.699  1.00   18.33 ? 388 LEU A C   1 
ATOM   2095  O  O   . LEU A  1 281 ? 18.078  18.487  18.620  1.00   17.24 ? 388 LEU A O   1 
ATOM   2096  C  CB  . LEU A  1 281 ? 15.078  19.122  18.691  1.00   18.93 ? 388 LEU A CB  1 
ATOM   2097  C  CG  . LEU A  1 281 ? 13.681  19.585  19.159  1.00   19.74 ? 388 LEU A CG  1 
ATOM   2098  C  CD1 . LEU A  1 281 ? 13.168  20.691  18.248  1.00   16.58 ? 388 LEU A CD1 1 
ATOM   2099  C  CD2 . LEU A  1 281 ? 12.701  18.421  19.138  1.00   16.24 ? 388 LEU A CD2 1 
ATOM   2100  N  N   . THR A  1 282 ? 17.134  16.526  18.114  1.00   16.91 ? 389 THR A N   1 
ATOM   2101  C  CA  . THR A  1 282 ? 18.260  16.075  17.302  1.00   14.84 ? 389 THR A CA  1 
ATOM   2102  C  C   . THR A  1 282 ? 18.040  16.589  15.880  1.00   17.63 ? 389 THR A C   1 
ATOM   2103  O  O   . THR A  1 282 ? 16.955  17.079  15.548  1.00   14.19 ? 389 THR A O   1 
ATOM   2104  C  CB  . THR A  1 282 ? 18.324  14.544  17.208  1.00   17.26 ? 389 THR A CB  1 
ATOM   2105  O  OG1 . THR A  1 282 ? 17.191  14.081  16.469  1.00   17.78 ? 389 THR A OG1 1 
ATOM   2106  C  CG2 . THR A  1 282 ? 18.301  13.905  18.589  1.00   16.03 ? 389 THR A CG2 1 
ATOM   2107  N  N   . TRP A  1 283 ? 19.061  16.465  15.035  1.00   16.44 ? 390 TRP A N   1 
ATOM   2108  C  CA  . TRP A  1 283 ? 18.939  16.920  13.662  1.00   16.54 ? 390 TRP A CA  1 
ATOM   2109  C  C   . TRP A  1 283 ? 17.790  16.157  12.961  1.00   18.03 ? 390 TRP A C   1 
ATOM   2110  O  O   . TRP A  1 283 ? 17.138  16.688  12.065  1.00   15.25 ? 390 TRP A O   1 
ATOM   2111  C  CB  . TRP A  1 283 ? 20.272  16.736  12.918  1.00   15.74 ? 390 TRP A CB  1 
ATOM   2112  C  CG  . TRP A  1 283 ? 20.668  15.302  12.674  1.00   17.66 ? 390 TRP A CG  1 
ATOM   2113  C  CD1 . TRP A  1 283 ? 21.279  14.448  13.553  1.00   17.24 ? 390 TRP A CD1 1 
ATOM   2114  C  CD2 . TRP A  1 283 ? 20.466  14.559  11.465  1.00   14.33 ? 390 TRP A CD2 1 
ATOM   2115  N  NE1 . TRP A  1 283 ? 21.470  13.220  12.961  1.00   15.69 ? 390 TRP A NE1 1 
ATOM   2116  C  CE2 . TRP A  1 283 ? 20.981  13.262  11.680  1.00   16.15 ? 390 TRP A CE2 1 
ATOM   2117  C  CE3 . TRP A  1 283 ? 19.895  14.867  10.217  1.00   14.18 ? 390 TRP A CE3 1 
ATOM   2118  C  CZ2 . TRP A  1 283 ? 20.945  12.267  10.694  1.00   16.82 ? 390 TRP A CZ2 1 
ATOM   2119  C  CZ3 . TRP A  1 283 ? 19.854  13.886  9.237   1.00   16.27 ? 390 TRP A CZ3 1 
ATOM   2120  C  CH2 . TRP A  1 283 ? 20.379  12.596  9.481   1.00   17.82 ? 390 TRP A CH2 1 
ATOM   2121  N  N   . ARG A  1 284 ? 17.535  14.913  13.364  1.00   18.20 ? 391 ARG A N   1 
ATOM   2122  C  CA  . ARG A  1 284 ? 16.439  14.160  12.757  1.00   18.62 ? 391 ARG A CA  1 
ATOM   2123  C  C   . ARG A  1 284 ? 15.101  14.623  13.343  1.00   21.16 ? 391 ARG A C   1 
ATOM   2124  O  O   . ARG A  1 284 ? 14.102  14.723  12.624  1.00   19.11 ? 391 ARG A O   1 
ATOM   2125  C  CB  . ARG A  1 284 ? 16.628  12.645  12.958  1.00   20.21 ? 391 ARG A CB  1 
ATOM   2126  C  CG  . ARG A  1 284 ? 17.591  12.016  11.941  1.00   22.54 ? 391 ARG A CG  1 
ATOM   2127  C  CD  . ARG A  1 284 ? 18.002  10.585  12.273  1.00   20.79 ? 391 ARG A CD  1 
ATOM   2128  N  NE  . ARG A  1 284 ? 16.859  9.693   12.448  1.00   22.85 ? 391 ARG A NE  1 
ATOM   2129  C  CZ  . ARG A  1 284 ? 16.575  9.074   13.590  1.00   21.68 ? 391 ARG A CZ  1 
ATOM   2130  N  NH1 . ARG A  1 284 ? 15.514  8.289   13.670  1.00   21.70 ? 391 ARG A NH1 1 
ATOM   2131  N  NH2 . ARG A  1 284 ? 17.360  9.235   14.650  1.00   17.08 ? 391 ARG A NH2 1 
ATOM   2132  N  N   . ASP A  1 285 ? 15.074  14.909  14.642  1.00   20.62 ? 392 ASP A N   1 
ATOM   2133  C  CA  . ASP A  1 285 ? 13.840  15.384  15.266  1.00   20.12 ? 392 ASP A CA  1 
ATOM   2134  C  C   . ASP A  1 285 ? 13.363  16.623  14.513  1.00   21.55 ? 392 ASP A C   1 
ATOM   2135  O  O   . ASP A  1 285 ? 12.178  16.764  14.188  1.00   20.90 ? 392 ASP A O   1 
ATOM   2136  C  CB  . ASP A  1 285 ? 14.065  15.776  16.729  1.00   22.73 ? 392 ASP A CB  1 
ATOM   2137  C  CG  . ASP A  1 285 ? 14.179  14.575  17.652  1.00   24.39 ? 392 ASP A CG  1 
ATOM   2138  O  OD1 . ASP A  1 285 ? 13.494  13.550  17.392  1.00   23.50 ? 392 ASP A OD1 1 
ATOM   2139  O  OD2 . ASP A  1 285 ? 14.941  14.675  18.643  1.00   23.97 ? 392 ASP A OD2 1 
ATOM   2140  N  N   . MET A  1 286 ? 14.299  17.522  14.228  1.00   19.35 ? 393 MET A N   1 
ATOM   2141  C  CA  . MET A  1 286 ? 13.962  18.756  13.541  1.00   17.35 ? 393 MET A CA  1 
ATOM   2142  C  C   . MET A  1 286 ? 13.290  18.491  12.197  1.00   18.65 ? 393 MET A C   1 
ATOM   2143  O  O   . MET A  1 286 ? 12.314  19.163  11.847  1.00   17.53 ? 393 MET A O   1 
ATOM   2144  C  CB  . MET A  1 286 ? 15.213  19.617  13.335  1.00   17.99 ? 393 MET A CB  1 
ATOM   2145  C  CG  . MET A  1 286 ? 14.902  21.033  12.834  1.00   15.52 ? 393 MET A CG  1 
ATOM   2146  S  SD  . MET A  1 286 ? 13.818  21.930  13.983  1.00   18.36 ? 393 MET A SD  1 
ATOM   2147  C  CE  . MET A  1 286 ? 14.899  22.031  15.448  1.00   14.54 ? 393 MET A CE  1 
ATOM   2148  N  N   . GLN A  1 287 ? 13.797  17.524  11.438  1.00   15.12 ? 394 GLN A N   1 
ATOM   2149  C  CA  . GLN A  1 287 ? 13.189  17.237  10.147  1.00   15.86 ? 394 GLN A CA  1 
ATOM   2150  C  C   . GLN A  1 287 ? 11.776  16.662  10.327  1.00   18.37 ? 394 GLN A C   1 
ATOM   2151  O  O   . GLN A  1 287 ? 10.867  16.946  9.532   1.00   16.23 ? 394 GLN A O   1 
ATOM   2152  C  CB  . GLN A  1 287 ? 14.093  16.309  9.319   1.00   13.21 ? 394 GLN A CB  1 
ATOM   2153  C  CG  . GLN A  1 287 ? 15.340  17.031  8.807   1.00   11.25 ? 394 GLN A CG  1 
ATOM   2154  C  CD  . GLN A  1 287 ? 16.128  16.256  7.750   1.00   17.67 ? 394 GLN A CD  1 
ATOM   2155  O  OE1 . GLN A  1 287 ? 15.561  15.581  6.885   1.00   15.15 ? 394 GLN A OE1 1 
ATOM   2156  N  NE2 . GLN A  1 287 ? 17.450  16.387  7.797   1.00   17.70 ? 394 GLN A NE2 1 
ATOM   2157  N  N   . HIS A  1 288 ? 11.584  15.885  11.390  1.00   18.91 ? 395 HIS A N   1 
ATOM   2158  C  CA  . HIS A  1 288 ? 10.269  15.315  11.680  1.00   20.29 ? 395 HIS A CA  1 
ATOM   2159  C  C   . HIS A  1 288 ? 9.281   16.447  11.949  1.00   18.45 ? 395 HIS A C   1 
ATOM   2160  O  O   . HIS A  1 288 ? 8.177   16.456  11.411  1.00   20.59 ? 395 HIS A O   1 
ATOM   2161  C  CB  . HIS A  1 288 ? 10.338  14.394  12.901  1.00   19.57 ? 395 HIS A CB  1 
ATOM   2162  C  CG  . HIS A  1 288 ? 10.743  12.993  12.578  1.00   20.66 ? 395 HIS A CG  1 
ATOM   2163  N  ND1 . HIS A  1 288 ? 9.853   12.056  12.096  1.00   20.78 ? 395 HIS A ND1 1 
ATOM   2164  C  CD2 . HIS A  1 288 ? 11.944  12.372  12.652  1.00   20.45 ? 395 HIS A CD2 1 
ATOM   2165  C  CE1 . HIS A  1 288 ? 10.488  10.916  11.888  1.00   18.61 ? 395 HIS A CE1 1 
ATOM   2166  N  NE2 . HIS A  1 288 ? 11.759  11.081  12.218  1.00   19.94 ? 395 HIS A NE2 1 
ATOM   2167  N  N   . LEU A  1 289 ? 9.681   17.403  12.783  1.00   18.11 ? 396 LEU A N   1 
ATOM   2168  C  CA  . LEU A  1 289 ? 8.812   18.526  13.109  1.00   18.38 ? 396 LEU A CA  1 
ATOM   2169  C  C   . LEU A  1 289 ? 8.357   19.278  11.865  1.00   18.55 ? 396 LEU A C   1 
ATOM   2170  O  O   . LEU A  1 289 ? 7.185   19.643  11.744  1.00   20.85 ? 396 LEU A O   1 
ATOM   2171  C  CB  . LEU A  1 289 ? 9.512   19.490  14.072  1.00   19.27 ? 396 LEU A CB  1 
ATOM   2172  C  CG  . LEU A  1 289 ? 9.760   18.960  15.484  1.00   24.28 ? 396 LEU A CG  1 
ATOM   2173  C  CD1 . LEU A  1 289 ? 10.304  20.082  16.352  1.00   22.96 ? 396 LEU A CD1 1 
ATOM   2174  C  CD2 . LEU A  1 289 ? 8.474   18.424  16.082  1.00   22.98 ? 396 LEU A CD2 1 
ATOM   2175  N  N   . VAL A  1 290 ? 9.282   19.504  10.939  1.00   19.66 ? 397 VAL A N   1 
ATOM   2176  C  CA  . VAL A  1 290 ? 8.978   20.208  9.701   1.00   16.94 ? 397 VAL A CA  1 
ATOM   2177  C  C   . VAL A  1 290 ? 7.959   19.441  8.861   1.00   20.44 ? 397 VAL A C   1 
ATOM   2178  O  O   . VAL A  1 290 ? 6.976   20.016  8.373   1.00   18.34 ? 397 VAL A O   1 
ATOM   2179  C  CB  . VAL A  1 290 ? 10.256  20.429  8.860   1.00   17.97 ? 397 VAL A CB  1 
ATOM   2180  C  CG1 . VAL A  1 290 ? 9.893   20.982  7.477   1.00   11.38 ? 397 VAL A CG1 1 
ATOM   2181  C  CG2 . VAL A  1 290 ? 11.196  21.390  9.590   1.00   12.38 ? 397 VAL A CG2 1 
ATOM   2182  N  N   . VAL A  1 291 ? 8.193   18.145  8.697   1.00   19.87 ? 398 VAL A N   1 
ATOM   2183  C  CA  . VAL A  1 291 ? 7.288   17.321  7.915   1.00   21.82 ? 398 VAL A CA  1 
ATOM   2184  C  C   . VAL A  1 291 ? 5.891   17.359  8.504   1.00   23.76 ? 398 VAL A C   1 
ATOM   2185  O  O   . VAL A  1 291 ? 4.906   17.505  7.775   1.00   21.89 ? 398 VAL A O   1 
ATOM   2186  C  CB  . VAL A  1 291 ? 7.746   15.845  7.866   1.00   22.90 ? 398 VAL A CB  1 
ATOM   2187  C  CG1 . VAL A  1 291 ? 6.630   14.979  7.319   1.00   23.46 ? 398 VAL A CG1 1 
ATOM   2188  C  CG2 . VAL A  1 291 ? 8.964   15.705  6.967   1.00   20.08 ? 398 VAL A CG2 1 
ATOM   2189  N  N   . GLN A  1 292 ? 5.813   17.239  9.825   1.00   22.35 ? 399 GLN A N   1 
ATOM   2190  C  CA  . GLN A  1 292 ? 4.524   17.221  10.500  1.00   24.32 ? 399 GLN A CA  1 
ATOM   2191  C  C   . GLN A  1 292 ? 3.757   18.533  10.550  1.00   25.31 ? 399 GLN A C   1 
ATOM   2192  O  O   . GLN A  1 292 ? 2.541   18.543  10.400  1.00   30.52 ? 399 GLN A O   1 
ATOM   2193  C  CB  . GLN A  1 292 ? 4.684   16.673  11.925  1.00   18.94 ? 399 GLN A CB  1 
ATOM   2194  C  CG  . GLN A  1 292 ? 4.828   15.167  11.950  1.00   23.78 ? 399 GLN A CG  1 
ATOM   2195  C  CD  . GLN A  1 292 ? 4.568   14.575  13.309  1.00   23.02 ? 399 GLN A CD  1 
ATOM   2196  O  OE1 . GLN A  1 292 ? 3.828   15.143  14.110  1.00   27.29 ? 399 GLN A OE1 1 
ATOM   2197  N  NE2 . GLN A  1 292 ? 5.157   13.413  13.575  1.00   23.50 ? 399 GLN A NE2 1 
ATOM   2198  N  N   . THR A  1 293 ? 4.463   19.643  10.722  1.00   25.23 ? 400 THR A N   1 
ATOM   2199  C  CA  . THR A  1 293 ? 3.794   20.926  10.864  1.00   22.33 ? 400 THR A CA  1 
ATOM   2200  C  C   . THR A  1 293 ? 3.653   21.797  9.634   1.00   22.21 ? 400 THR A C   1 
ATOM   2201  O  O   . THR A  1 293 ? 2.896   22.769  9.657   1.00   21.81 ? 400 THR A O   1 
ATOM   2202  C  CB  . THR A  1 293 ? 4.485   21.759  11.949  1.00   23.43 ? 400 THR A CB  1 
ATOM   2203  O  OG1 . THR A  1 293 ? 5.830   22.039  11.533  1.00   21.55 ? 400 THR A OG1 1 
ATOM   2204  C  CG2 . THR A  1 293 ? 4.504   21.000  13.279  1.00   16.28 ? 400 THR A CG2 1 
ATOM   2205  N  N   . SER A  1 294 ? 4.357   21.478  8.558   1.00   20.95 ? 401 SER A N   1 
ATOM   2206  C  CA  . SER A  1 294 ? 4.254   22.327  7.373   1.00   22.93 ? 401 SER A CA  1 
ATOM   2207  C  C   . SER A  1 294 ? 2.889   22.265  6.712   1.00   24.67 ? 401 SER A C   1 
ATOM   2208  O  O   . SER A  1 294 ? 2.262   21.207  6.630   1.00   24.78 ? 401 SER A O   1 
ATOM   2209  C  CB  . SER A  1 294 ? 5.353   21.999  6.374   1.00   22.49 ? 401 SER A CB  1 
ATOM   2210  O  OG  . SER A  1 294 ? 6.607   22.328  6.944   1.00   24.02 ? 401 SER A OG  1 
ATOM   2211  N  N   . LYS A  1 295 ? 2.432   23.430  6.256   1.00   24.50 ? 402 LYS A N   1 
ATOM   2212  C  CA  . LYS A  1 295 ? 1.118   23.567  5.650   1.00   24.88 ? 402 LYS A CA  1 
ATOM   2213  C  C   . LYS A  1 295 ? 1.096   23.776  4.142   1.00   24.95 ? 402 LYS A C   1 
ATOM   2214  O  O   . LYS A  1 295 ? 1.732   24.688  3.617   1.00   25.18 ? 402 LYS A O   1 
ATOM   2215  C  CB  . LYS A  1 295 ? 0.380   24.741  6.298   1.00   26.43 ? 402 LYS A CB  1 
ATOM   2216  C  CG  . LYS A  1 295 ? 0.381   24.756  7.822   1.00   29.72 ? 402 LYS A CG  1 
ATOM   2217  C  CD  . LYS A  1 295 ? -0.442  23.610  8.411   1.00   31.12 ? 402 LYS A CD  1 
ATOM   2218  C  CE  . LYS A  1 295 ? -0.679  23.815  9.909   1.00   28.10 ? 402 LYS A CE  1 
ATOM   2219  N  NZ  . LYS A  1 295 ? 0.591   23.910  10.683  1.00   25.48 ? 402 LYS A NZ  1 
ATOM   2220  N  N   . PRO A  1 296 ? 0.362   22.920  3.423   1.00   25.82 ? 403 PRO A N   1 
ATOM   2221  C  CA  . PRO A  1 296 ? 0.265   23.054  1.970   1.00   26.98 ? 403 PRO A CA  1 
ATOM   2222  C  C   . PRO A  1 296 ? -0.752  24.143  1.611   1.00   29.94 ? 403 PRO A C   1 
ATOM   2223  O  O   . PRO A  1 296 ? -0.528  24.940  0.707   1.00   31.23 ? 403 PRO A O   1 
ATOM   2224  C  CB  . PRO A  1 296 ? -0.195  21.667  1.525   1.00   26.07 ? 403 PRO A CB  1 
ATOM   2225  C  CG  . PRO A  1 296 ? -0.937  21.157  2.695   1.00   27.03 ? 403 PRO A CG  1 
ATOM   2226  C  CD  . PRO A  1 296 ? -0.070  21.578  3.846   1.00   25.23 ? 403 PRO A CD  1 
ATOM   2227  N  N   . ALA A  1 297 ? -1.856  24.180  2.351   1.00   33.60 ? 404 ALA A N   1 
ATOM   2228  C  CA  . ALA A  1 297 ? -2.935  25.138  2.118   1.00   37.77 ? 404 ALA A CA  1 
ATOM   2229  C  C   . ALA A  1 297 ? -2.467  26.516  1.685   1.00   37.84 ? 404 ALA A C   1 
ATOM   2230  O  O   . ALA A  1 297 ? -1.537  27.082  2.268   1.00   41.15 ? 404 ALA A O   1 
ATOM   2231  C  CB  . ALA A  1 297 ? -3.799  25.255  3.366   1.00   41.56 ? 404 ALA A CB  1 
ATOM   2232  N  N   . HIS A  1 298 ? -3.124  27.034  0.652   1.00   37.97 ? 405 HIS A N   1 
ATOM   2233  C  CA  . HIS A  1 298 ? -2.834  28.350  0.081   1.00   39.57 ? 405 HIS A CA  1 
ATOM   2234  C  C   . HIS A  1 298 ? -1.781  28.331  -1.025  1.00   39.13 ? 405 HIS A C   1 
ATOM   2235  O  O   . HIS A  1 298 ? -1.763  29.221  -1.876  1.00   43.32 ? 405 HIS A O   1 
ATOM   2236  C  CB  . HIS A  1 298 ? -2.417  29.332  1.176   1.00   40.87 ? 405 HIS A CB  1 
ATOM   2237  C  CG  . HIS A  1 298 ? -3.496  29.610  2.174   0.0000 40.44 ? 405 HIS A CG  1 
ATOM   2238  N  ND1 . HIS A  1 298 ? -3.232  30.039  3.456   0.0000 40.65 ? 405 HIS A ND1 1 
ATOM   2239  C  CD2 . HIS A  1 298 ? -4.844  29.544  2.069   0.0000 40.65 ? 405 HIS A CD2 1 
ATOM   2240  C  CE1 . HIS A  1 298 ? -4.372  30.226  4.099   0.0000 40.63 ? 405 HIS A CE1 1 
ATOM   2241  N  NE2 . HIS A  1 298 ? -5.364  29.934  3.279   0.0000 40.63 ? 405 HIS A NE2 1 
ATOM   2242  N  N   . LEU A  1 299 ? -0.920  27.316  -1.023  1.00   30.83 ? 406 LEU A N   1 
ATOM   2243  C  CA  . LEU A  1 299 ? 0.118   27.194  -2.041  1.00   27.48 ? 406 LEU A CA  1 
ATOM   2244  C  C   . LEU A  1 299 ? -0.434  26.498  -3.278  1.00   26.91 ? 406 LEU A C   1 
ATOM   2245  O  O   . LEU A  1 299 ? -1.024  25.425  -3.182  1.00   28.61 ? 406 LEU A O   1 
ATOM   2246  C  CB  . LEU A  1 299 ? 1.314   26.409  -1.491  1.00   22.75 ? 406 LEU A CB  1 
ATOM   2247  C  CG  . LEU A  1 299 ? 2.532   27.197  -0.990  1.00   27.40 ? 406 LEU A CG  1 
ATOM   2248  C  CD1 . LEU A  1 299 ? 2.101   28.399  -0.163  1.00   25.24 ? 406 LEU A CD1 1 
ATOM   2249  C  CD2 . LEU A  1 299 ? 3.433   26.273  -0.173  1.00   26.44 ? 406 LEU A CD2 1 
ATOM   2250  N  N   . ASN A  1 300 ? -0.246  27.110  -4.441  1.00   25.79 ? 407 ASN A N   1 
ATOM   2251  C  CA  . ASN A  1 300 ? -0.736  26.542  -5.684  1.00   25.29 ? 407 ASN A CA  1 
ATOM   2252  C  C   . ASN A  1 300 ? 0.354   25.750  -6.388  1.00   24.81 ? 407 ASN A C   1 
ATOM   2253  O  O   . ASN A  1 300 ? 1.473   26.217  -6.550  1.00   23.88 ? 407 ASN A O   1 
ATOM   2254  C  CB  . ASN A  1 300 ? -1.258  27.654  -6.592  1.00   27.88 ? 407 ASN A CB  1 
ATOM   2255  C  CG  . ASN A  1 300 ? -2.320  28.506  -5.898  1.00   35.78 ? 407 ASN A CG  1 
ATOM   2256  O  OD1 . ASN A  1 300 ? -3.344  27.986  -5.436  1.00   40.33 ? 407 ASN A OD1 1 
ATOM   2257  N  ND2 . ASN A  1 300 ? -2.073  29.815  -5.803  1.00   36.16 ? 407 ASN A ND2 1 
ATOM   2258  N  N   . ALA A  1 301 ? 0.015   24.535  -6.790  1.00   25.58 ? 408 ALA A N   1 
ATOM   2259  C  CA  . ALA A  1 301 ? 0.954   23.678  -7.489  1.00   27.97 ? 408 ALA A CA  1 
ATOM   2260  C  C   . ALA A  1 301 ? 0.177   22.676  -8.320  1.00   28.78 ? 408 ALA A C   1 
ATOM   2261  O  O   . ALA A  1 301 ? -0.923  22.277  -7.960  1.00   29.66 ? 408 ALA A O   1 
ATOM   2262  C  CB  . ALA A  1 301 ? 1.853   22.957  -6.499  1.00   27.32 ? 408 ALA A CB  1 
ATOM   2263  N  N   . ASN A  1 302 ? 0.772   22.262  -9.425  1.00   29.65 ? 409 ASN A N   1 
ATOM   2264  C  CA  . ASN A  1 302 ? 0.148   21.326  -10.341 1.00   30.16 ? 409 ASN A CA  1 
ATOM   2265  C  C   . ASN A  1 302 ? 0.344   19.886  -9.877  1.00   30.68 ? 409 ASN A C   1 
ATOM   2266  O  O   . ASN A  1 302 ? -0.307  18.981  -10.382 1.00   30.69 ? 409 ASN A O   1 
ATOM   2267  C  CB  . ASN A  1 302 ? 0.792   21.503  -11.723 1.00   34.14 ? 409 ASN A CB  1 
ATOM   2268  C  CG  . ASN A  1 302 ? -0.039  20.927  -12.845 1.00   37.47 ? 409 ASN A CG  1 
ATOM   2269  O  OD1 . ASN A  1 302 ? -0.520  19.798  -12.765 0.0000 36.18 ? 409 ASN A OD1 1 
ATOM   2270  N  ND2 . ASN A  1 302 ? -0.200  21.699  -13.914 0.0000 36.18 ? 409 ASN A ND2 1 
ATOM   2271  N  N   . ASP A  1 303 ? 1.225   19.662  -8.908  1.00   27.44 ? 410 ASP A N   1 
ATOM   2272  C  CA  . ASP A  1 303 ? 1.496   18.288  -8.500  1.00   25.51 ? 410 ASP A CA  1 
ATOM   2273  C  C   . ASP A  1 303 ? 1.228   17.884  -7.057  1.00   23.99 ? 410 ASP A C   1 
ATOM   2274  O  O   . ASP A  1 303 ? 1.840   16.935  -6.578  1.00   24.30 ? 410 ASP A O   1 
ATOM   2275  C  CB  . ASP A  1 303 ? 2.950   17.950  -8.834  1.00   24.16 ? 410 ASP A CB  1 
ATOM   2276  C  CG  . ASP A  1 303 ? 3.941   18.733  -7.966  1.00   28.73 ? 410 ASP A CG  1 
ATOM   2277  O  OD1 . ASP A  1 303 ? 3.572   19.835  -7.492  1.00   26.23 ? 410 ASP A OD1 1 
ATOM   2278  O  OD2 . ASP A  1 303 ? 5.084   18.253  -7.760  1.00   27.77 ? 410 ASP A OD2 1 
ATOM   2279  N  N   . TRP A  1 304 ? 0.346   18.586  -6.350  1.00   21.70 ? 411 TRP A N   1 
ATOM   2280  C  CA  . TRP A  1 304 ? 0.055   18.184  -4.977  1.00   23.88 ? 411 TRP A CA  1 
ATOM   2281  C  C   . TRP A  1 304 ? -0.481  16.750  -5.018  1.00   25.82 ? 411 TRP A C   1 
ATOM   2282  O  O   . TRP A  1 304 ? -1.356  16.434  -5.819  1.00   26.54 ? 411 TRP A O   1 
ATOM   2283  C  CB  . TRP A  1 304 ? -0.989  19.097  -4.338  1.00   23.17 ? 411 TRP A CB  1 
ATOM   2284  C  CG  . TRP A  1 304 ? -0.438  20.400  -3.830  1.00   24.76 ? 411 TRP A CG  1 
ATOM   2285  C  CD1 . TRP A  1 304 ? -0.738  21.661  -4.284  1.00   21.51 ? 411 TRP A CD1 1 
ATOM   2286  C  CD2 . TRP A  1 304 ? 0.497   20.572  -2.760  1.00   22.31 ? 411 TRP A CD2 1 
ATOM   2287  N  NE1 . TRP A  1 304 ? -0.046  22.603  -3.556  1.00   22.81 ? 411 TRP A NE1 1 
ATOM   2288  C  CE2 . TRP A  1 304 ? 0.720   21.963  -2.616  1.00   24.18 ? 411 TRP A CE2 1 
ATOM   2289  C  CE3 . TRP A  1 304 ? 1.170   19.688  -1.911  1.00   21.27 ? 411 TRP A CE3 1 
ATOM   2290  C  CZ2 . TRP A  1 304 ? 1.594   22.488  -1.652  1.00   22.61 ? 411 TRP A CZ2 1 
ATOM   2291  C  CZ3 . TRP A  1 304 ? 2.041   20.212  -0.954  1.00   22.75 ? 411 TRP A CZ3 1 
ATOM   2292  C  CH2 . TRP A  1 304 ? 2.244   21.597  -0.835  1.00   18.66 ? 411 TRP A CH2 1 
ATOM   2293  N  N   . ALA A  1 305 ? 0.057   15.880  -4.173  1.00   25.23 ? 412 ALA A N   1 
ATOM   2294  C  CA  . ALA A  1 305 ? -0.381  14.493  -4.134  1.00   23.85 ? 412 ALA A CA  1 
ATOM   2295  C  C   . ALA A  1 305 ? -0.334  14.036  -2.694  1.00   25.74 ? 412 ALA A C   1 
ATOM   2296  O  O   . ALA A  1 305 ? 0.508   14.502  -1.922  1.00   28.84 ? 412 ALA A O   1 
ATOM   2297  C  CB  . ALA A  1 305 ? 0.533   13.632  -4.996  1.00   19.48 ? 412 ALA A CB  1 
ATOM   2298  N  N   . THR A  1 306 ? -1.245  13.139  -2.331  1.00   26.51 ? 413 THR A N   1 
ATOM   2299  C  CA  . THR A  1 306 ? -1.318  12.608  -0.970  1.00   28.10 ? 413 THR A CA  1 
ATOM   2300  C  C   . THR A  1 306 ? -0.474  11.336  -0.898  1.00   28.06 ? 413 THR A C   1 
ATOM   2301  O  O   . THR A  1 306 ? -0.625  10.431  -1.713  1.00   29.69 ? 413 THR A O   1 
ATOM   2302  C  CB  . THR A  1 306 ? -2.775  12.287  -0.592  1.00   29.45 ? 413 THR A CB  1 
ATOM   2303  O  OG1 . THR A  1 306 ? -3.586  13.439  -0.851  1.00   27.97 ? 413 THR A OG1 1 
ATOM   2304  C  CG2 . THR A  1 306 ? -2.879  11.921  0.887   1.00   28.01 ? 413 THR A CG2 1 
ATOM   2305  N  N   . ASN A  1 307 ? 0.431   11.275  0.068   1.00   27.52 ? 414 ASN A N   1 
ATOM   2306  C  CA  . ASN A  1 307 ? 1.297   10.116  0.192   1.00   25.82 ? 414 ASN A CA  1 
ATOM   2307  C  C   . ASN A  1 307 ? 0.657   9.035   1.061   1.00   27.73 ? 414 ASN A C   1 
ATOM   2308  O  O   . ASN A  1 307 ? -0.473  9.178   1.531   1.00   27.65 ? 414 ASN A O   1 
ATOM   2309  C  CB  . ASN A  1 307 ? 2.659   10.528  0.762   1.00   21.41 ? 414 ASN A CB  1 
ATOM   2310  C  CG  . ASN A  1 307 ? 2.569   11.035  2.184   1.00   22.41 ? 414 ASN A CG  1 
ATOM   2311  O  OD1 . ASN A  1 307 ? 1.490   11.040  2.792   1.00   21.78 ? 414 ASN A OD1 1 
ATOM   2312  N  ND2 . ASN A  1 307 ? 3.706   11.457  2.732   1.00   23.31 ? 414 ASN A ND2 1 
ATOM   2313  N  N   . GLY A  1 308 ? 1.402   7.960   1.272   1.00   25.41 ? 415 GLY A N   1 
ATOM   2314  C  CA  . GLY A  1 308 ? 0.903   6.840   2.039   1.00   26.25 ? 415 GLY A CA  1 
ATOM   2315  C  C   . GLY A  1 308 ? 0.364   7.114   3.427   1.00   27.69 ? 415 GLY A C   1 
ATOM   2316  O  O   . GLY A  1 308 ? -0.374  6.284   3.951   1.00   25.33 ? 415 GLY A O   1 
ATOM   2317  N  N   . VAL A  1 309 ? 0.718   8.248   4.033   1.00   24.39 ? 416 VAL A N   1 
ATOM   2318  C  CA  . VAL A  1 309 ? 0.223   8.539   5.375   1.00   23.44 ? 416 VAL A CA  1 
ATOM   2319  C  C   . VAL A  1 309 ? -0.735  9.720   5.423   1.00   23.22 ? 416 VAL A C   1 
ATOM   2320  O  O   . VAL A  1 309 ? -0.990  10.289  6.483   1.00   23.79 ? 416 VAL A O   1 
ATOM   2321  C  CB  . VAL A  1 309 ? 1.384   8.776   6.383   1.00   27.17 ? 416 VAL A CB  1 
ATOM   2322  C  CG1 . VAL A  1 309 ? 2.225   7.503   6.504   1.00   30.67 ? 416 VAL A CG1 1 
ATOM   2323  C  CG2 . VAL A  1 309 ? 2.251   9.957   5.942   1.00   28.47 ? 416 VAL A CG2 1 
ATOM   2324  N  N   . GLY A  1 310 ? -1.258  10.100  4.266   1.00   21.76 ? 417 GLY A N   1 
ATOM   2325  C  CA  . GLY A  1 310 ? -2.223  11.184  4.223   1.00   23.72 ? 417 GLY A CA  1 
ATOM   2326  C  C   . GLY A  1 310 ? -1.702  12.606  4.182   1.00   23.84 ? 417 GLY A C   1 
ATOM   2327  O  O   . GLY A  1 310 ? -2.469  13.540  4.390   1.00   23.01 ? 417 GLY A O   1 
ATOM   2328  N  N   . ARG A  1 311 ? -0.411  12.785  3.932   1.00   23.28 ? 418 ARG A N   1 
ATOM   2329  C  CA  . ARG A  1 311 ? 0.126   14.130  3.873   1.00   24.12 ? 418 ARG A CA  1 
ATOM   2330  C  C   . ARG A  1 311 ? 0.305   14.552  2.426   1.00   23.36 ? 418 ARG A C   1 
ATOM   2331  O  O   . ARG A  1 311 ? 0.665   13.745  1.575   1.00   23.89 ? 418 ARG A O   1 
ATOM   2332  C  CB  . ARG A  1 311 ? 1.439   14.223  4.666   1.00   19.86 ? 418 ARG A CB  1 
ATOM   2333  C  CG  . ARG A  1 311 ? 1.169   14.148  6.161   1.00   24.46 ? 418 ARG A CG  1 
ATOM   2334  C  CD  . ARG A  1 311 ? 2.330   14.562  7.065   1.00   24.35 ? 418 ARG A CD  1 
ATOM   2335  N  NE  . ARG A  1 311 ? 3.249   13.462  7.299   1.00   28.06 ? 418 ARG A NE  1 
ATOM   2336  C  CZ  . ARG A  1 311 ? 3.519   12.930  8.491   1.00   24.45 ? 418 ARG A CZ  1 
ATOM   2337  N  NH1 . ARG A  1 311 ? 4.371   11.930  8.563   1.00   26.23 ? 418 ARG A NH1 1 
ATOM   2338  N  NH2 . ARG A  1 311 ? 2.954   13.384  9.601   1.00   20.48 ? 418 ARG A NH2 1 
ATOM   2339  N  N   . LYS A  1 312 ? 0.003   15.813  2.148   1.00   23.27 ? 419 LYS A N   1 
ATOM   2340  C  CA  . LYS A  1 312 ? 0.149   16.363  0.808   1.00   25.08 ? 419 LYS A CA  1 
ATOM   2341  C  C   . LYS A  1 312 ? 1.605   16.751  0.550   1.00   24.53 ? 419 LYS A C   1 
ATOM   2342  O  O   . LYS A  1 312 ? 2.252   17.355  1.403   1.00   24.54 ? 419 LYS A O   1 
ATOM   2343  C  CB  . LYS A  1 312 ? -0.705  17.617  0.668   1.00   29.96 ? 419 LYS A CB  1 
ATOM   2344  C  CG  . LYS A  1 312 ? -2.195  17.403  0.821   1.00   35.10 ? 419 LYS A CG  1 
ATOM   2345  C  CD  . LYS A  1 312 ? -2.797  17.061  -0.509  1.00   36.99 ? 419 LYS A CD  1 
ATOM   2346  C  CE  . LYS A  1 312 ? -4.025  17.906  -0.761  1.00   45.19 ? 419 LYS A CE  1 
ATOM   2347  N  NZ  . LYS A  1 312 ? -5.276  17.211  -0.342  1.00   51.60 ? 419 LYS A NZ  1 
ATOM   2348  N  N   . VAL A  1 313 ? 2.110   16.418  -0.628  1.00   23.12 ? 420 VAL A N   1 
ATOM   2349  C  CA  . VAL A  1 313 ? 3.475   16.768  -0.980  1.00   26.01 ? 420 VAL A CA  1 
ATOM   2350  C  C   . VAL A  1 313 ? 3.538   17.246  -2.418  1.00   24.12 ? 420 VAL A C   1 
ATOM   2351  O  O   . VAL A  1 313 ? 2.760   16.816  -3.261  1.00   23.07 ? 420 VAL A O   1 
ATOM   2352  C  CB  . VAL A  1 313 ? 4.471   15.573  -0.795  1.00   27.17 ? 420 VAL A CB  1 
ATOM   2353  C  CG1 . VAL A  1 313 ? 5.229   15.718  0.500   1.00   30.29 ? 420 VAL A CG1 1 
ATOM   2354  C  CG2 . VAL A  1 313 ? 3.733   14.265  -0.770  1.00   30.65 ? 420 VAL A CG2 1 
ATOM   2355  N  N   . SER A  1 314 ? 4.473   18.152  -2.681  1.00   23.05 ? 421 SER A N   1 
ATOM   2356  C  CA  . SER A  1 314 ? 4.685   18.707  -4.013  1.00   20.18 ? 421 SER A CA  1 
ATOM   2357  C  C   . SER A  1 314 ? 6.191   18.783  -4.248  1.00   19.08 ? 421 SER A C   1 
ATOM   2358  O  O   . SER A  1 314 ? 6.947   19.022  -3.311  1.00   17.72 ? 421 SER A O   1 
ATOM   2359  C  CB  . SER A  1 314 ? 4.080   20.114  -4.106  1.00   19.49 ? 421 SER A CB  1 
ATOM   2360  O  OG  . SER A  1 314 ? 4.555   20.800  -5.259  1.00   20.89 ? 421 SER A OG  1 
ATOM   2361  N  N   . HIS A  1 315 ? 6.630   18.583  -5.489  1.00   16.70 ? 422 HIS A N   1 
ATOM   2362  C  CA  . HIS A  1 315 ? 8.053   18.645  -5.769  1.00   17.92 ? 422 HIS A CA  1 
ATOM   2363  C  C   . HIS A  1 315 ? 8.527   20.100  -5.768  1.00   19.68 ? 422 HIS A C   1 
ATOM   2364  O  O   . HIS A  1 315 ? 9.728   20.379  -5.765  1.00   18.11 ? 422 HIS A O   1 
ATOM   2365  C  CB  . HIS A  1 315 ? 8.372   17.970  -7.112  1.00   17.41 ? 422 HIS A CB  1 
ATOM   2366  C  CG  . HIS A  1 315 ? 8.138   16.489  -7.115  1.00   20.59 ? 422 HIS A CG  1 
ATOM   2367  N  ND1 . HIS A  1 315 ? 6.879   15.933  -7.006  1.00   20.00 ? 422 HIS A ND1 1 
ATOM   2368  C  CD2 . HIS A  1 315 ? 9.004   15.447  -7.192  1.00   21.66 ? 422 HIS A CD2 1 
ATOM   2369  C  CE1 . HIS A  1 315 ? 6.979   14.616  -7.017  1.00   19.73 ? 422 HIS A CE1 1 
ATOM   2370  N  NE2 . HIS A  1 315 ? 8.256   14.294  -7.131  1.00   23.36 ? 422 HIS A NE2 1 
ATOM   2371  N  N   . SER A  1 316 ? 7.580   21.029  -5.761  1.00   18.41 ? 423 SER A N   1 
ATOM   2372  C  CA  . SER A  1 316 ? 7.934   22.441  -5.740  1.00   21.14 ? 423 SER A CA  1 
ATOM   2373  C  C   . SER A  1 316 ? 7.997   22.973  -4.324  1.00   19.91 ? 423 SER A C   1 
ATOM   2374  O  O   . SER A  1 316 ? 8.679   23.964  -4.062  1.00   20.87 ? 423 SER A O   1 
ATOM   2375  C  CB  . SER A  1 316 ? 6.900   23.288  -6.487  1.00   19.80 ? 423 SER A CB  1 
ATOM   2376  O  OG  . SER A  1 316 ? 7.016   23.150  -7.884  1.00   25.38 ? 423 SER A OG  1 
ATOM   2377  N  N   . TYR A  1 317 ? 7.312   22.299  -3.409  1.00   16.75 ? 424 TYR A N   1 
ATOM   2378  C  CA  . TYR A  1 317 ? 7.217   22.807  -2.045  1.00   18.91 ? 424 TYR A CA  1 
ATOM   2379  C  C   . TYR A  1 317 ? 7.545   21.844  -0.919  1.00   18.99 ? 424 TYR A C   1 
ATOM   2380  O  O   . TYR A  1 317 ? 7.607   22.258  0.244   1.00   20.90 ? 424 TYR A O   1 
ATOM   2381  C  CB  . TYR A  1 317 ? 5.787   23.309  -1.796  1.00   17.22 ? 424 TYR A CB  1 
ATOM   2382  C  CG  . TYR A  1 317 ? 5.235   24.339  -2.767  1.00   16.23 ? 424 TYR A CG  1 
ATOM   2383  C  CD1 . TYR A  1 317 ? 5.856   25.579  -2.924  1.00   19.24 ? 424 TYR A CD1 1 
ATOM   2384  C  CD2 . TYR A  1 317 ? 4.010   24.132  -3.417  1.00   17.73 ? 424 TYR A CD2 1 
ATOM   2385  C  CE1 . TYR A  1 317 ? 5.270   26.595  -3.682  1.00   17.60 ? 424 TYR A CE1 1 
ATOM   2386  C  CE2 . TYR A  1 317 ? 3.408   25.153  -4.188  1.00   16.77 ? 424 TYR A CE2 1 
ATOM   2387  C  CZ  . TYR A  1 317 ? 4.044   26.382  -4.303  1.00   17.85 ? 424 TYR A CZ  1 
ATOM   2388  O  OH  . TYR A  1 317 ? 3.446   27.437  -4.964  1.00   18.65 ? 424 TYR A OH  1 
ATOM   2389  N  N   . GLY A  1 318 ? 7.736   20.569  -1.241  1.00   18.89 ? 425 GLY A N   1 
ATOM   2390  C  CA  . GLY A  1 318 ? 7.986   19.614  -0.185  1.00   19.70 ? 425 GLY A CA  1 
ATOM   2391  C  C   . GLY A  1 318 ? 6.660   19.491  0.553   1.00   21.28 ? 425 GLY A C   1 
ATOM   2392  O  O   . GLY A  1 318 ? 5.624   19.357  -0.086  1.00   22.55 ? 425 GLY A O   1 
ATOM   2393  N  N   . TYR A  1 319 ? 6.667   19.569  1.879   1.00   20.45 ? 426 TYR A N   1 
ATOM   2394  C  CA  . TYR A  1 319 ? 5.432   19.445  2.632   1.00   18.53 ? 426 TYR A CA  1 
ATOM   2395  C  C   . TYR A  1 319 ? 4.676   20.740  2.781   1.00   21.53 ? 426 TYR A C   1 
ATOM   2396  O  O   . TYR A  1 319 ? 3.664   20.795  3.472   1.00   23.08 ? 426 TYR A O   1 
ATOM   2397  C  CB  . TYR A  1 319 ? 5.710   18.847  4.008   1.00   19.60 ? 426 TYR A CB  1 
ATOM   2398  C  CG  . TYR A  1 319 ? 5.993   17.376  3.913   1.00   21.45 ? 426 TYR A CG  1 
ATOM   2399  C  CD1 . TYR A  1 319 ? 7.261   16.919  3.596   1.00   18.54 ? 426 TYR A CD1 1 
ATOM   2400  C  CD2 . TYR A  1 319 ? 4.958   16.442  4.008   1.00   21.38 ? 426 TYR A CD2 1 
ATOM   2401  C  CE1 . TYR A  1 319 ? 7.496   15.572  3.362   1.00   23.60 ? 426 TYR A CE1 1 
ATOM   2402  C  CE2 . TYR A  1 319 ? 5.183   15.087  3.771   1.00   23.64 ? 426 TYR A CE2 1 
ATOM   2403  C  CZ  . TYR A  1 319 ? 6.455   14.661  3.443   1.00   21.30 ? 426 TYR A CZ  1 
ATOM   2404  O  OH  . TYR A  1 319 ? 6.689   13.343  3.148   1.00   20.51 ? 426 TYR A OH  1 
ATOM   2405  N  N   . GLY A  1 320 ? 5.163   21.792  2.138   1.00   22.08 ? 427 GLY A N   1 
ATOM   2406  C  CA  . GLY A  1 320 ? 4.471   23.065  2.230   1.00   20.63 ? 427 GLY A CA  1 
ATOM   2407  C  C   . GLY A  1 320 ? 5.184   24.151  3.018   1.00   21.03 ? 427 GLY A C   1 
ATOM   2408  O  O   . GLY A  1 320 ? 6.368   24.071  3.340   1.00   21.34 ? 427 GLY A O   1 
ATOM   2409  N  N   . LEU A  1 321 ? 4.420   25.182  3.334   1.00   22.67 ? 428 LEU A N   1 
ATOM   2410  C  CA  . LEU A  1 321 ? 4.888   26.353  4.067   1.00   22.27 ? 428 LEU A CA  1 
ATOM   2411  C  C   . LEU A  1 321 ? 5.197   26.052  5.520   1.00   22.80 ? 428 LEU A C   1 
ATOM   2412  O  O   . LEU A  1 321 ? 4.414   25.388  6.193   1.00   20.42 ? 428 LEU A O   1 
ATOM   2413  C  CB  . LEU A  1 321 ? 3.796   27.402  4.015   1.00   23.65 ? 428 LEU A CB  1 
ATOM   2414  C  CG  . LEU A  1 321 ? 4.044   28.834  3.599   1.00   28.19 ? 428 LEU A CG  1 
ATOM   2415  C  CD1 . LEU A  1 321 ? 5.014   28.917  2.439   1.00   24.62 ? 428 LEU A CD1 1 
ATOM   2416  C  CD2 . LEU A  1 321 ? 2.686   29.415  3.224   1.00   27.35 ? 428 LEU A CD2 1 
ATOM   2417  N  N   . LEU A  1 322 ? 6.338   26.542  6.000   1.00   20.43 ? 429 LEU A N   1 
ATOM   2418  C  CA  . LEU A  1 322 ? 6.707   26.354  7.398   1.00   19.82 ? 429 LEU A CA  1 
ATOM   2419  C  C   . LEU A  1 322 ? 5.712   27.131  8.266   1.00   19.04 ? 429 LEU A C   1 
ATOM   2420  O  O   . LEU A  1 322 ? 5.236   28.205  7.880   1.00   17.19 ? 429 LEU A O   1 
ATOM   2421  C  CB  . LEU A  1 322 ? 8.122   26.887  7.672   1.00   18.38 ? 429 LEU A CB  1 
ATOM   2422  C  CG  . LEU A  1 322 ? 9.311   26.134  7.095   1.00   17.47 ? 429 LEU A CG  1 
ATOM   2423  C  CD1 . LEU A  1 322 ? 10.620  26.775  7.589   1.00   18.04 ? 429 LEU A CD1 1 
ATOM   2424  C  CD2 . LEU A  1 322 ? 9.226   24.684  7.503   1.00   13.44 ? 429 LEU A CD2 1 
ATOM   2425  N  N   . ASP A  1 323 ? 5.428   26.597  9.446   1.00   17.70 ? 430 ASP A N   1 
ATOM   2426  C  CA  . ASP A  1 323 ? 4.490   27.223  10.371  1.00   17.03 ? 430 ASP A CA  1 
ATOM   2427  C  C   . ASP A  1 323 ? 5.199   27.352  11.720  1.00   17.51 ? 430 ASP A C   1 
ATOM   2428  O  O   . ASP A  1 323 ? 5.226   26.398  12.496  1.00   19.80 ? 430 ASP A O   1 
ATOM   2429  C  CB  . ASP A  1 323 ? 3.263   26.323  10.501  1.00   20.36 ? 430 ASP A CB  1 
ATOM   2430  C  CG  . ASP A  1 323 ? 2.200   26.916  11.383  1.00   23.56 ? 430 ASP A CG  1 
ATOM   2431  O  OD1 . ASP A  1 323 ? 2.555   27.647  12.339  1.00   21.82 ? 430 ASP A OD1 1 
ATOM   2432  O  OD2 . ASP A  1 323 ? 1.012   26.635  11.125  1.00   22.58 ? 430 ASP A OD2 1 
ATOM   2433  N  N   . ALA A  1 324 ? 5.770   28.524  11.996  1.00   14.83 ? 431 ALA A N   1 
ATOM   2434  C  CA  . ALA A  1 324 ? 6.513   28.737  13.235  1.00   15.49 ? 431 ALA A CA  1 
ATOM   2435  C  C   . ALA A  1 324 ? 5.729   28.419  14.507  1.00   15.36 ? 431 ALA A C   1 
ATOM   2436  O  O   . ALA A  1 324 ? 6.209   27.706  15.385  1.00   17.73 ? 431 ALA A O   1 
ATOM   2437  C  CB  . ALA A  1 324 ? 7.024   30.165  13.281  1.00   15.89 ? 431 ALA A CB  1 
ATOM   2438  N  N   . GLY A  1 325 ? 4.522   28.953  14.610  1.00   16.42 ? 432 GLY A N   1 
ATOM   2439  C  CA  . GLY A  1 325 ? 3.707   28.685  15.781  1.00   17.17 ? 432 GLY A CA  1 
ATOM   2440  C  C   . GLY A  1 325 ? 3.530   27.192  16.015  1.00   18.07 ? 432 GLY A C   1 
ATOM   2441  O  O   . GLY A  1 325 ? 3.676   26.707  17.151  1.00   19.29 ? 432 GLY A O   1 
ATOM   2442  N  N   . ALA A  1 326 ? 3.224   26.452  14.948  1.00   15.82 ? 433 ALA A N   1 
ATOM   2443  C  CA  . ALA A  1 326 ? 3.034   25.009  15.061  1.00   16.84 ? 433 ALA A CA  1 
ATOM   2444  C  C   . ALA A  1 326 ? 4.359   24.308  15.415  1.00   17.35 ? 433 ALA A C   1 
ATOM   2445  O  O   . ALA A  1 326 ? 4.384   23.379  16.206  1.00   19.85 ? 433 ALA A O   1 
ATOM   2446  C  CB  . ALA A  1 326 ? 2.468   24.464  13.756  1.00   10.77 ? 433 ALA A CB  1 
ATOM   2447  N  N   . MET A  1 327 ? 5.456   24.775  14.831  1.00   19.42 ? 434 MET A N   1 
ATOM   2448  C  CA  . MET A  1 327 ? 6.769   24.198  15.089  1.00   20.41 ? 434 MET A CA  1 
ATOM   2449  C  C   . MET A  1 327 ? 7.153   24.290  16.569  1.00   18.09 ? 434 MET A C   1 
ATOM   2450  O  O   . MET A  1 327 ? 7.575   23.301  17.178  1.00   17.48 ? 434 MET A O   1 
ATOM   2451  C  CB  . MET A  1 327 ? 7.840   24.908  14.243  1.00   19.75 ? 434 MET A CB  1 
ATOM   2452  C  CG  . MET A  1 327 ? 7.901   24.496  12.768  1.00   17.80 ? 434 MET A CG  1 
ATOM   2453  S  SD  . MET A  1 327 ? 8.709   22.891  12.522  1.00   19.80 ? 434 MET A SD  1 
ATOM   2454  C  CE  . MET A  1 327 ? 10.466  23.308  12.735  1.00   16.75 ? 434 MET A CE  1 
ATOM   2455  N  N   . VAL A  1 328 ? 7.006   25.471  17.150  1.00   15.21 ? 435 VAL A N   1 
ATOM   2456  C  CA  . VAL A  1 328 ? 7.374   25.643  18.550  1.00   16.39 ? 435 VAL A CA  1 
ATOM   2457  C  C   . VAL A  1 328 ? 6.418   24.910  19.471  1.00   19.77 ? 435 VAL A C   1 
ATOM   2458  O  O   . VAL A  1 328 ? 6.829   24.415  20.527  1.00   19.75 ? 435 VAL A O   1 
ATOM   2459  C  CB  . VAL A  1 328 ? 7.440   27.143  18.949  1.00   18.59 ? 435 VAL A CB  1 
ATOM   2460  C  CG1 . VAL A  1 328 ? 8.614   27.812  18.219  1.00   12.79 ? 435 VAL A CG1 1 
ATOM   2461  C  CG2 . VAL A  1 328 ? 6.123   27.847  18.616  1.00   16.68 ? 435 VAL A CG2 1 
ATOM   2462  N  N   . ALA A  1 329 ? 5.146   24.837  19.084  1.00   19.05 ? 436 ALA A N   1 
ATOM   2463  C  CA  . ALA A  1 329 ? 4.163   24.124  19.903  1.00   23.31 ? 436 ALA A CA  1 
ATOM   2464  C  C   . ALA A  1 329 ? 4.506   22.631  19.954  1.00   25.00 ? 436 ALA A C   1 
ATOM   2465  O  O   . ALA A  1 329 ? 4.635   22.044  21.036  1.00   25.61 ? 436 ALA A O   1 
ATOM   2466  C  CB  . ALA A  1 329 ? 2.749   24.311  19.337  1.00   18.08 ? 436 ALA A CB  1 
ATOM   2467  N  N   . LEU A  1 330 ? 4.665   22.015  18.783  1.00   24.11 ? 437 LEU A N   1 
ATOM   2468  C  CA  . LEU A  1 330 ? 4.978   20.589  18.736  1.00   23.86 ? 437 LEU A CA  1 
ATOM   2469  C  C   . LEU A  1 330 ? 6.326   20.258  19.382  1.00   23.79 ? 437 LEU A C   1 
ATOM   2470  O  O   . LEU A  1 330 ? 6.492   19.197  19.989  1.00   23.92 ? 437 LEU A O   1 
ATOM   2471  C  CB  . LEU A  1 330 ? 4.962   20.090  17.288  1.00   22.82 ? 437 LEU A CB  1 
ATOM   2472  C  CG  . LEU A  1 330 ? 5.089   18.571  17.103  1.00   28.50 ? 437 LEU A CG  1 
ATOM   2473  C  CD1 . LEU A  1 330 ? 3.990   17.872  17.901  1.00   25.67 ? 437 LEU A CD1 1 
ATOM   2474  C  CD2 . LEU A  1 330 ? 4.971   18.201  15.626  1.00   26.56 ? 437 LEU A CD2 1 
ATOM   2475  N  N   . ALA A  1 331 ? 7.287   21.166  19.255  1.00   21.00 ? 438 ALA A N   1 
ATOM   2476  C  CA  . ALA A  1 331 ? 8.604   20.942  19.826  1.00   20.90 ? 438 ALA A CA  1 
ATOM   2477  C  C   . ALA A  1 331 ? 8.566   20.651  21.322  1.00   22.56 ? 438 ALA A C   1 
ATOM   2478  O  O   . ALA A  1 331 ? 9.294   19.791  21.810  1.00   22.11 ? 438 ALA A O   1 
ATOM   2479  C  CB  . ALA A  1 331 ? 9.477   22.143  19.567  1.00   17.49 ? 438 ALA A CB  1 
ATOM   2480  N  N   . GLN A  1 332 ? 7.706   21.365  22.044  1.00   25.31 ? 439 GLN A N   1 
ATOM   2481  C  CA  . GLN A  1 332 ? 7.610   21.226  23.492  1.00   31.86 ? 439 GLN A CA  1 
ATOM   2482  C  C   . GLN A  1 332 ? 7.218   19.847  24.005  1.00   35.53 ? 439 GLN A C   1 
ATOM   2483  O  O   . GLN A  1 332 ? 7.721   19.396  25.031  1.00   38.20 ? 439 GLN A O   1 
ATOM   2484  C  CB  . GLN A  1 332 ? 6.660   22.290  24.031  1.00   32.60 ? 439 GLN A CB  1 
ATOM   2485  C  CG  . GLN A  1 332 ? 7.179   23.684  23.745  1.00   32.65 ? 439 GLN A CG  1 
ATOM   2486  C  CD  . GLN A  1 332 ? 6.205   24.762  24.139  1.00   33.92 ? 439 GLN A CD  1 
ATOM   2487  O  OE1 . GLN A  1 332 ? 5.959   24.985  25.326  1.00   35.27 ? 439 GLN A OE1 1 
ATOM   2488  N  NE2 . GLN A  1 332 ? 5.636   25.441  23.146  1.00   33.41 ? 439 GLN A NE2 1 
ATOM   2489  N  N   . ASN A  1 333 ? 6.331   19.171  23.290  1.00   37.58 ? 440 ASN A N   1 
ATOM   2490  C  CA  . ASN A  1 333 ? 5.909   17.840  23.700  1.00   41.06 ? 440 ASN A CA  1 
ATOM   2491  C  C   . ASN A  1 333 ? 6.647   16.733  22.941  1.00   39.62 ? 440 ASN A C   1 
ATOM   2492  O  O   . ASN A  1 333 ? 6.381   15.550  23.152  1.00   45.98 ? 440 ASN A O   1 
ATOM   2493  C  CB  . ASN A  1 333 ? 4.408   17.667  23.457  1.00   43.70 ? 440 ASN A CB  1 
ATOM   2494  C  CG  . ASN A  1 333 ? 3.563   18.477  24.408  1.00   46.69 ? 440 ASN A CG  1 
ATOM   2495  O  OD1 . ASN A  1 333 ? 2.432   18.840  24.093  0.0000 45.48 ? 440 ASN A OD1 1 
ATOM   2496  N  ND2 . ASN A  1 333 ? 4.100   18.749  25.593  0.0000 45.48 ? 440 ASN A ND2 1 
ATOM   2497  N  N   . TRP A  1 334 ? 7.592   17.096  22.082  1.00   34.90 ? 441 TRP A N   1 
ATOM   2498  C  CA  . TRP A  1 334 ? 8.288   16.092  21.279  1.00   29.41 ? 441 TRP A CA  1 
ATOM   2499  C  C   . TRP A  1 334 ? 9.211   15.107  21.982  1.00   27.22 ? 441 TRP A C   1 
ATOM   2500  O  O   . TRP A  1 334 ? 10.108  15.474  22.742  1.00   29.68 ? 441 TRP A O   1 
ATOM   2501  C  CB  . TRP A  1 334 ? 9.033   16.790  20.138  1.00   28.22 ? 441 TRP A CB  1 
ATOM   2502  C  CG  . TRP A  1 334 ? 9.551   15.863  19.083  1.00   26.03 ? 441 TRP A CG  1 
ATOM   2503  C  CD1 . TRP A  1 334 ? 10.826  15.370  18.982  1.00   27.97 ? 441 TRP A CD1 1 
ATOM   2504  C  CD2 . TRP A  1 334 ? 8.812   15.287  17.994  1.00   25.06 ? 441 TRP A CD2 1 
ATOM   2505  N  NE1 . TRP A  1 334 ? 10.923  14.524  17.899  1.00   25.44 ? 441 TRP A NE1 1 
ATOM   2506  C  CE2 . TRP A  1 334 ? 9.703   14.452  17.278  1.00   22.89 ? 441 TRP A CE2 1 
ATOM   2507  C  CE3 . TRP A  1 334 ? 7.483   15.390  17.554  1.00   24.86 ? 441 TRP A CE3 1 
ATOM   2508  C  CZ2 . TRP A  1 334 ? 9.310   13.722  16.149  1.00   22.33 ? 441 TRP A CZ2 1 
ATOM   2509  C  CZ3 . TRP A  1 334 ? 7.092   14.663  16.426  1.00   26.94 ? 441 TRP A CZ3 1 
ATOM   2510  C  CH2 . TRP A  1 334 ? 8.008   13.837  15.739  1.00   25.17 ? 441 TRP A CH2 1 
ATOM   2511  N  N   . THR A  1 335 ? 8.970   13.833  21.707  1.00   26.94 ? 442 THR A N   1 
ATOM   2512  C  CA  . THR A  1 335 ? 9.776   12.751  22.258  1.00   27.77 ? 442 THR A CA  1 
ATOM   2513  C  C   . THR A  1 335 ? 10.844  12.418  21.214  1.00   25.39 ? 442 THR A C   1 
ATOM   2514  O  O   . THR A  1 335 ? 10.520  12.104  20.080  1.00   24.79 ? 442 THR A O   1 
ATOM   2515  C  CB  . THR A  1 335 ? 8.900   11.494  22.529  1.00   31.10 ? 442 THR A CB  1 
ATOM   2516  O  OG1 . THR A  1 335 ? 7.951   11.786  23.564  1.00   33.36 ? 442 THR A OG1 1 
ATOM   2517  C  CG2 . THR A  1 335 ? 9.758   10.316  22.969  1.00   31.00 ? 442 THR A CG2 1 
ATOM   2518  N  N   . THR A  1 336 ? 12.109  12.506  21.594  1.00   25.17 ? 443 THR A N   1 
ATOM   2519  C  CA  . THR A  1 336 ? 13.196  12.209  20.670  1.00   30.48 ? 443 THR A CA  1 
ATOM   2520  C  C   . THR A  1 336 ? 12.962  10.897  19.938  1.00   28.60 ? 443 THR A C   1 
ATOM   2521  O  O   . THR A  1 336 ? 12.582  9.898   20.549  1.00   30.66 ? 443 THR A O   1 
ATOM   2522  C  CB  . THR A  1 336 ? 14.540  12.148  21.413  1.00   32.38 ? 443 THR A CB  1 
ATOM   2523  O  OG1 . THR A  1 336 ? 14.852  13.464  21.887  1.00   42.37 ? 443 THR A OG1 1 
ATOM   2524  C  CG2 . THR A  1 336 ? 15.652  11.670  20.485  1.00   29.92 ? 443 THR A CG2 1 
ATOM   2525  N  N   . VAL A  1 337 ? 13.186  10.903  18.629  1.00   26.53 ? 444 VAL A N   1 
ATOM   2526  C  CA  . VAL A  1 337 ? 12.971  9.699   17.835  1.00   26.75 ? 444 VAL A CA  1 
ATOM   2527  C  C   . VAL A  1 337 ? 14.008  8.631   18.122  1.00   24.93 ? 444 VAL A C   1 
ATOM   2528  O  O   . VAL A  1 337 ? 15.098  8.919   18.613  1.00   23.24 ? 444 VAL A O   1 
ATOM   2529  C  CB  . VAL A  1 337 ? 12.998  9.997   16.323  1.00   26.37 ? 444 VAL A CB  1 
ATOM   2530  C  CG1 . VAL A  1 337 ? 11.863  10.932  15.963  1.00   24.97 ? 444 VAL A CG1 1 
ATOM   2531  C  CG2 . VAL A  1 337 ? 14.335  10.604  15.939  1.00   27.79 ? 444 VAL A CG2 1 
ATOM   2532  N  N   . ALA A  1 338 ? 13.652  7.393   17.813  1.00   21.95 ? 445 ALA A N   1 
ATOM   2533  C  CA  . ALA A  1 338 ? 14.539  6.260   18.024  1.00   21.91 ? 445 ALA A CA  1 
ATOM   2534  C  C   . ALA A  1 338 ? 15.782  6.375   17.152  1.00   23.56 ? 445 ALA A C   1 
ATOM   2535  O  O   . ALA A  1 338 ? 15.811  7.148   16.183  1.00   22.79 ? 445 ALA A O   1 
ATOM   2536  C  CB  . ALA A  1 338 ? 13.806  4.965   17.702  1.00   17.40 ? 445 ALA A CB  1 
ATOM   2537  N  N   . PRO A  1 339 ? 16.832  5.606   17.484  1.00   22.88 ? 446 PRO A N   1 
ATOM   2538  C  CA  . PRO A  1 339 ? 18.078  5.628   16.712  1.00   24.92 ? 446 PRO A CA  1 
ATOM   2539  C  C   . PRO A  1 339 ? 17.834  5.378   15.227  1.00   25.09 ? 446 PRO A C   1 
ATOM   2540  O  O   . PRO A  1 339 ? 16.983  4.570   14.843  1.00   26.81 ? 446 PRO A O   1 
ATOM   2541  C  CB  . PRO A  1 339 ? 18.901  4.522   17.368  1.00   24.34 ? 446 PRO A CB  1 
ATOM   2542  C  CG  . PRO A  1 339 ? 18.511  4.688   18.821  1.00   22.99 ? 446 PRO A CG  1 
ATOM   2543  C  CD  . PRO A  1 339 ? 16.992  4.797   18.704  1.00   23.94 ? 446 PRO A CD  1 
ATOM   2544  N  N   . GLN A  1 340 ? 18.590  6.075   14.391  1.00   24.01 ? 447 GLN A N   1 
ATOM   2545  C  CA  . GLN A  1 340 ? 18.426  5.939   12.956  1.00   22.41 ? 447 GLN A CA  1 
ATOM   2546  C  C   . GLN A  1 340 ? 18.921  4.586   12.430  1.00   22.60 ? 447 GLN A C   1 
ATOM   2547  O  O   . GLN A  1 340 ? 20.057  4.187   12.693  1.00   21.57 ? 447 GLN A O   1 
ATOM   2548  C  CB  . GLN A  1 340 ? 19.172  7.072   12.241  1.00   17.25 ? 447 GLN A CB  1 
ATOM   2549  C  CG  . GLN A  1 340 ? 18.982  7.058   10.723  1.00   22.01 ? 447 GLN A CG  1 
ATOM   2550  C  CD  . GLN A  1 340 ? 20.126  7.715   9.980   1.00   26.50 ? 447 GLN A CD  1 
ATOM   2551  O  OE1 . GLN A  1 340 ? 21.268  7.249   10.048  1.00   31.85 ? 447 GLN A OE1 1 
ATOM   2552  N  NE2 . GLN A  1 340 ? 19.833  8.801   9.262   1.00   23.58 ? 447 GLN A NE2 1 
ATOM   2553  N  N   . ARG A  1 341 ? 18.069  3.884   11.687  1.00   23.60 ? 448 ARG A N   1 
ATOM   2554  C  CA  . ARG A  1 341 ? 18.459  2.608   11.083  1.00   23.94 ? 448 ARG A CA  1 
ATOM   2555  C  C   . ARG A  1 341 ? 18.666  2.840   9.596   1.00   22.86 ? 448 ARG A C   1 
ATOM   2556  O  O   . ARG A  1 341 ? 18.100  3.780   9.022   1.00   23.09 ? 448 ARG A O   1 
ATOM   2557  C  CB  . ARG A  1 341 ? 17.381  1.558   11.283  1.00   23.74 ? 448 ARG A CB  1 
ATOM   2558  C  CG  . ARG A  1 341 ? 17.088  1.284   12.718  1.00   24.48 ? 448 ARG A CG  1 
ATOM   2559  C  CD  . ARG A  1 341 ? 16.045  0.196   12.838  1.00   29.92 ? 448 ARG A CD  1 
ATOM   2560  N  NE  . ARG A  1 341 ? 15.720  -0.050  14.234  1.00   29.15 ? 448 ARG A NE  1 
ATOM   2561  C  CZ  . ARG A  1 341 ? 15.148  -1.160  14.683  1.00   34.25 ? 448 ARG A CZ  1 
ATOM   2562  N  NH1 . ARG A  1 341 ? 14.891  -1.289  15.978  1.00   34.41 ? 448 ARG A NH1 1 
ATOM   2563  N  NH2 . ARG A  1 341 ? 14.840  -2.144  13.847  1.00   31.51 ? 448 ARG A NH2 1 
ATOM   2564  N  N   . LYS A  1 342 ? 19.466  1.979   8.975   1.00   21.89 ? 449 LYS A N   1 
ATOM   2565  C  CA  . LYS A  1 342 ? 19.779  2.093   7.553   1.00   19.74 ? 449 LYS A CA  1 
ATOM   2566  C  C   . LYS A  1 342 ? 19.706  0.719   6.909   1.00   20.38 ? 449 LYS A C   1 
ATOM   2567  O  O   . LYS A  1 342 ? 20.444  -0.187  7.288   1.00   20.87 ? 449 LYS A O   1 
ATOM   2568  C  CB  . LYS A  1 342 ? 21.188  2.677   7.379   1.00   16.80 ? 449 LYS A CB  1 
ATOM   2569  C  CG  . LYS A  1 342 ? 21.582  3.001   5.938   1.00   16.89 ? 449 LYS A CG  1 
ATOM   2570  C  CD  . LYS A  1 342 ? 23.005  3.522   5.874   1.00   15.93 ? 449 LYS A CD  1 
ATOM   2571  C  CE  . LYS A  1 342 ? 23.395  4.016   4.476   1.00   19.05 ? 449 LYS A CE  1 
ATOM   2572  N  NZ  . LYS A  1 342 ? 24.823  4.519   4.436   1.00   16.18 ? 449 LYS A NZ  1 
ATOM   2573  N  N   . CYS A  1 343 ? 18.812  0.569   5.939   1.00   21.03 ? 450 CYS A N   1 
ATOM   2574  C  CA  . CYS A  1 343 ? 18.627  -0.708  5.258   1.00   23.33 ? 450 CYS A CA  1 
ATOM   2575  C  C   . CYS A  1 343 ? 19.022  -0.559  3.794   1.00   22.52 ? 450 CYS A C   1 
ATOM   2576  O  O   . CYS A  1 343 ? 18.425  0.223   3.057   1.00   23.01 ? 450 CYS A O   1 
ATOM   2577  C  CB  . CYS A  1 343 ? 17.159  -1.166  5.399   1.00   24.59 ? 450 CYS A CB  1 
ATOM   2578  S  SG  . CYS A  1 343 ? 16.754  -2.782  4.652   1.00   29.30 ? 450 CYS A SG  1 
ATOM   2579  N  N   . ILE A  1 344 ? 20.049  -1.303  3.392   1.00   23.68 ? 451 ILE A N   1 
ATOM   2580  C  CA  . ILE A  1 344 ? 20.577  -1.267  2.032   1.00   22.93 ? 451 ILE A CA  1 
ATOM   2581  C  C   . ILE A  1 344 ? 20.070  -2.449  1.221   1.00   24.95 ? 451 ILE A C   1 
ATOM   2582  O  O   . ILE A  1 344 ? 20.255  -3.602  1.624   1.00   24.39 ? 451 ILE A O   1 
ATOM   2583  C  CB  . ILE A  1 344 ? 22.120  -1.320  2.066   1.00   22.12 ? 451 ILE A CB  1 
ATOM   2584  C  CG1 . ILE A  1 344 ? 22.651  -0.153  2.909   1.00   21.38 ? 451 ILE A CG1 1 
ATOM   2585  C  CG2 . ILE A  1 344 ? 22.687  -1.309  0.658   1.00   17.53 ? 451 ILE A CG2 1 
ATOM   2586  C  CD1 . ILE A  1 344 ? 24.162  -0.156  3.101   1.00   23.87 ? 451 ILE A CD1 1 
ATOM   2587  N  N   . ILE A  1 345 ? 19.453  -2.164  0.077   1.00   25.23 ? 452 ILE A N   1 
ATOM   2588  C  CA  . ILE A  1 345 ? 18.915  -3.213  -0.788  1.00   25.36 ? 452 ILE A CA  1 
ATOM   2589  C  C   . ILE A  1 345 ? 19.402  -3.032  -2.220  1.00   26.53 ? 452 ILE A C   1 
ATOM   2590  O  O   . ILE A  1 345 ? 18.955  -2.125  -2.916  1.00   24.18 ? 452 ILE A O   1 
ATOM   2591  C  CB  . ILE A  1 345 ? 17.373  -3.173  -0.791  1.00   27.47 ? 452 ILE A CB  1 
ATOM   2592  C  CG1 . ILE A  1 345 ? 16.870  -3.145  0.657   1.00   26.30 ? 452 ILE A CG1 1 
ATOM   2593  C  CG2 . ILE A  1 345 ? 16.810  -4.378  -1.557  1.00   23.54 ? 452 ILE A CG2 1 
ATOM   2594  C  CD1 . ILE A  1 345 ? 15.535  -2.475  0.829   1.00   23.90 ? 452 ILE A CD1 1 
ATOM   2595  N  N   . ASP A  1 346 ? 20.329  -3.880  -2.660  1.00   28.51 ? 453 ASP A N   1 
ATOM   2596  C  CA  . ASP A  1 346 ? 20.825  -3.782  -4.028  1.00   32.89 ? 453 ASP A CA  1 
ATOM   2597  C  C   . ASP A  1 346 ? 19.790  -4.530  -4.875  1.00   34.58 ? 453 ASP A C   1 
ATOM   2598  O  O   . ASP A  1 346 ? 19.546  -5.714  -4.658  1.00   36.36 ? 453 ASP A O   1 
ATOM   2599  C  CB  . ASP A  1 346 ? 22.211  -4.420  -4.132  1.00   31.16 ? 453 ASP A CB  1 
ATOM   2600  C  CG  . ASP A  1 346 ? 23.152  -3.637  -5.054  1.00   37.33 ? 453 ASP A CG  1 
ATOM   2601  O  OD1 . ASP A  1 346 ? 22.767  -2.547  -5.545  1.00   33.26 ? 453 ASP A OD1 1 
ATOM   2602  O  OD2 . ASP A  1 346 ? 24.289  -4.109  -5.285  1.00   37.49 ? 453 ASP A OD2 1 
ATOM   2603  N  N   . ILE A  1 347 ? 19.182  -3.832  -5.829  1.00   36.34 ? 454 ILE A N   1 
ATOM   2604  C  CA  . ILE A  1 347 ? 18.118  -4.405  -6.657  1.00   38.48 ? 454 ILE A CA  1 
ATOM   2605  C  C   . ILE A  1 347 ? 18.469  -5.216  -7.916  1.00   38.34 ? 454 ILE A C   1 
ATOM   2606  O  O   . ILE A  1 347 ? 17.916  -6.290  -8.114  1.00   39.12 ? 454 ILE A O   1 
ATOM   2607  C  CB  . ILE A  1 347 ? 17.131  -3.302  -7.105  1.00   37.78 ? 454 ILE A CB  1 
ATOM   2608  C  CG1 . ILE A  1 347 ? 16.798  -2.347  -5.944  1.00   39.82 ? 454 ILE A CG1 1 
ATOM   2609  C  CG2 . ILE A  1 347 ? 15.890  -3.937  -7.651  1.00   38.46 ? 454 ILE A CG2 1 
ATOM   2610  C  CD1 . ILE A  1 347 ? 15.855  -2.905  -4.908  1.00   36.77 ? 454 ILE A CD1 1 
ATOM   2611  N  N   . LEU A  1 348 ? 19.362  -4.711  -8.766  1.00   38.82 ? 455 LEU A N   1 
ATOM   2612  C  CA  . LEU A  1 348 ? 19.698  -5.412  -10.008 1.00   40.01 ? 455 LEU A CA  1 
ATOM   2613  C  C   . LEU A  1 348 ? 20.507  -6.703  -9.937  1.00   42.89 ? 455 LEU A C   1 
ATOM   2614  O  O   . LEU A  1 348 ? 21.472  -6.806  -9.177  1.00   43.63 ? 455 LEU A O   1 
ATOM   2615  C  CB  . LEU A  1 348 ? 20.431  -4.475  -10.951 1.00   35.92 ? 455 LEU A CB  1 
ATOM   2616  C  CG  . LEU A  1 348 ? 19.686  -3.228  -11.383 1.00   36.34 ? 455 LEU A CG  1 
ATOM   2617  C  CD1 . LEU A  1 348 ? 20.524  -2.502  -12.427 1.00   33.03 ? 455 LEU A CD1 1 
ATOM   2618  C  CD2 . LEU A  1 348 ? 18.333  -3.624  -11.946 1.00   34.10 ? 455 LEU A CD2 1 
ATOM   2619  N  N   . THR A  1 349 ? 20.112  -7.680  -10.754 1.00   43.70 ? 456 THR A N   1 
ATOM   2620  C  CA  . THR A  1 349 ? 20.832  -8.947  -10.840 1.00   44.72 ? 456 THR A CA  1 
ATOM   2621  C  C   . THR A  1 349 ? 21.521  -8.990  -12.199 1.00   44.24 ? 456 THR A C   1 
ATOM   2622  O  O   . THR A  1 349 ? 22.217  -9.948  -12.522 1.00   44.66 ? 456 THR A O   1 
ATOM   2623  C  CB  . THR A  1 349 ? 19.901  -10.178 -10.721 1.00   45.95 ? 456 THR A CB  1 
ATOM   2624  O  OG1 . THR A  1 349 ? 18.835  -10.079 -11.678 1.00   50.05 ? 456 THR A OG1 1 
ATOM   2625  C  CG2 . THR A  1 349 ? 19.340  -10.281 -9.305  1.00   40.91 ? 456 THR A CG2 1 
ATOM   2626  N  N   . GLU A  1 350 ? 21.323  -7.937  -12.986 1.00   43.57 ? 457 GLU A N   1 
ATOM   2627  C  CA  . GLU A  1 350 ? 21.922  -7.831  -14.313 1.00   43.56 ? 457 GLU A CA  1 
ATOM   2628  C  C   . GLU A  1 350 ? 21.647  -6.451  -14.895 1.00   41.28 ? 457 GLU A C   1 
ATOM   2629  O  O   . GLU A  1 350 ? 20.662  -5.806  -14.551 1.00   40.91 ? 457 GLU A O   1 
ATOM   2630  C  CB  . GLU A  1 350 ? 21.337  -8.888  -15.256 1.00   47.21 ? 457 GLU A CB  1 
ATOM   2631  C  CG  . GLU A  1 350 ? 19.810  -9.014  -15.169 1.00   55.31 ? 457 GLU A CG  1 
ATOM   2632  C  CD  . GLU A  1 350 ? 19.165  -9.490  -16.463 1.00   59.28 ? 457 GLU A CD  1 
ATOM   2633  O  OE1 . GLU A  1 350 ? 19.762  -10.352 -17.140 1.00   61.92 ? 457 GLU A OE1 1 
ATOM   2634  O  OE2 . GLU A  1 350 ? 18.055  -9.008  -16.793 1.00   60.47 ? 457 GLU A OE2 1 
ATOM   2635  N  N   . PRO A  1 351 ? 22.516  -5.984  -15.793 1.00   39.34 ? 458 PRO A N   1 
ATOM   2636  C  CA  . PRO A  1 351 ? 22.319  -4.668  -16.404 1.00   39.36 ? 458 PRO A CA  1 
ATOM   2637  C  C   . PRO A  1 351 ? 20.973  -4.654  -17.119 1.00   40.54 ? 458 PRO A C   1 
ATOM   2638  O  O   . PRO A  1 351 ? 20.511  -5.691  -17.596 1.00   41.50 ? 458 PRO A O   1 
ATOM   2639  C  CB  . PRO A  1 351 ? 23.474  -4.562  -17.399 1.00   39.49 ? 458 PRO A CB  1 
ATOM   2640  C  CG  . PRO A  1 351 ? 24.506  -5.537  -16.871 1.00   42.04 ? 458 PRO A CG  1 
ATOM   2641  C  CD  . PRO A  1 351 ? 23.671  -6.682  -16.379 1.00   37.84 ? 458 PRO A CD  1 
ATOM   2642  N  N   . LYS A  1 352 ? 20.346  -3.486  -17.188 1.00   40.65 ? 459 LYS A N   1 
ATOM   2643  C  CA  . LYS A  1 352 ? 19.064  -3.351  -17.858 1.00   39.66 ? 459 LYS A CA  1 
ATOM   2644  C  C   . LYS A  1 352 ? 19.155  -2.288  -18.927 1.00   39.64 ? 459 LYS A C   1 
ATOM   2645  O  O   . LYS A  1 352 ? 19.644  -1.187  -18.683 1.00   40.23 ? 459 LYS A O   1 
ATOM   2646  C  CB  . LYS A  1 352 ? 17.978  -2.983  -16.853 1.00   41.34 ? 459 LYS A CB  1 
ATOM   2647  C  CG  . LYS A  1 352 ? 17.122  -4.158  -16.400 1.00   43.82 ? 459 LYS A CG  1 
ATOM   2648  C  CD  . LYS A  1 352 ? 17.961  -5.287  -15.846 1.00   46.38 ? 459 LYS A CD  1 
ATOM   2649  C  CE  . LYS A  1 352 ? 17.093  -6.482  -15.522 1.00   48.22 ? 459 LYS A CE  1 
ATOM   2650  N  NZ  . LYS A  1 352 ? 16.000  -6.066  -14.608 1.00   52.98 ? 459 LYS A NZ  1 
ATOM   2651  N  N   . ASP A  1 353 ? 18.695  -2.627  -20.120 1.00   39.15 ? 460 ASP A N   1 
ATOM   2652  C  CA  . ASP A  1 353 ? 18.719  -1.690  -21.226 1.00   39.22 ? 460 ASP A CA  1 
ATOM   2653  C  C   . ASP A  1 353 ? 17.585  -0.696  -20.994 1.00   36.08 ? 460 ASP A C   1 
ATOM   2654  O  O   . ASP A  1 353 ? 16.485  -1.079  -20.605 1.00   35.18 ? 460 ASP A O   1 
ATOM   2655  C  CB  . ASP A  1 353 ? 18.521  -2.442  -22.542 1.00   41.47 ? 460 ASP A CB  1 
ATOM   2656  C  CG  . ASP A  1 353 ? 18.548  -1.533  -23.733 1.00   45.15 ? 460 ASP A CG  1 
ATOM   2657  O  OD1 . ASP A  1 353 ? 19.622  -0.954  -24.013 1.00   46.69 ? 460 ASP A OD1 1 
ATOM   2658  O  OD2 . ASP A  1 353 ? 17.485  -1.394  -24.379 1.00   49.31 ? 460 ASP A OD2 1 
ATOM   2659  N  N   . ILE A  1 354 ? 17.849  0.579   -21.232 1.00   34.70 ? 461 ILE A N   1 
ATOM   2660  C  CA  . ILE A  1 354 ? 16.834  1.591   -21.003 1.00   36.31 ? 461 ILE A CA  1 
ATOM   2661  C  C   . ILE A  1 354 ? 15.887  1.782   -22.181 1.00   38.87 ? 461 ILE A C   1 
ATOM   2662  O  O   . ILE A  1 354 ? 14.665  1.697   -22.028 1.00   39.03 ? 461 ILE A O   1 
ATOM   2663  C  CB  . ILE A  1 354 ? 17.508  2.929   -20.612 1.00   33.36 ? 461 ILE A CB  1 
ATOM   2664  C  CG1 . ILE A  1 354 ? 18.316  2.711   -19.323 1.00   29.87 ? 461 ILE A CG1 1 
ATOM   2665  C  CG2 . ILE A  1 354 ? 16.460  4.019   -20.423 1.00   27.68 ? 461 ILE A CG2 1 
ATOM   2666  C  CD1 . ILE A  1 354 ? 19.183  3.874   -18.910 1.00   26.77 ? 461 ILE A CD1 1 
ATOM   2667  N  N   . GLY A  1 355 ? 16.443  2.026   -23.359 1.00   41.00 ? 462 GLY A N   1 
ATOM   2668  C  CA  . GLY A  1 355 ? 15.592  2.220   -24.511 1.00   43.35 ? 462 GLY A CA  1 
ATOM   2669  C  C   . GLY A  1 355 ? 14.623  3.372   -24.327 1.00   45.60 ? 462 GLY A C   1 
ATOM   2670  O  O   . GLY A  1 355 ? 15.005  4.452   -23.862 1.00   46.87 ? 462 GLY A O   1 
ATOM   2671  N  N   . LYS A  1 356 ? 13.366  3.140   -24.691 1.00   44.80 ? 463 LYS A N   1 
ATOM   2672  C  CA  . LYS A  1 356 ? 12.341  4.169   -24.599 1.00   46.30 ? 463 LYS A CA  1 
ATOM   2673  C  C   . LYS A  1 356 ? 11.811  4.291   -23.183 1.00   46.29 ? 463 LYS A C   1 
ATOM   2674  O  O   . LYS A  1 356 ? 11.500  5.386   -22.707 1.00   45.33 ? 463 LYS A O   1 
ATOM   2675  C  CB  . LYS A  1 356 ? 11.182  3.848   -25.545 1.00   48.00 ? 463 LYS A CB  1 
ATOM   2676  C  CG  . LYS A  1 356 ? 10.889  4.939   -26.560 1.00   50.67 ? 463 LYS A CG  1 
ATOM   2677  C  CD  . LYS A  1 356 ? 10.544  6.272   -25.898 1.00   50.84 ? 463 LYS A CD  1 
ATOM   2678  C  CE  . LYS A  1 356 ? 10.386  7.374   -26.948 1.00   52.49 ? 463 LYS A CE  1 
ATOM   2679  N  NZ  . LYS A  1 356 ? 10.121  8.720   -26.358 1.00   53.93 ? 463 LYS A NZ  1 
ATOM   2680  N  N   . ARG A  1 357 ? 11.686  3.153   -22.519 1.00   44.01 ? 464 ARG A N   1 
ATOM   2681  C  CA  . ARG A  1 357 ? 11.201  3.137   -21.159 1.00   42.50 ? 464 ARG A CA  1 
ATOM   2682  C  C   . ARG A  1 357 ? 11.653  1.868   -20.472 1.00   41.08 ? 464 ARG A C   1 
ATOM   2683  O  O   . ARG A  1 357 ? 11.730  0.805   -21.088 1.00   41.93 ? 464 ARG A O   1 
ATOM   2684  C  CB  . ARG A  1 357 ? 9.681   3.222   -21.118 1.00   44.55 ? 464 ARG A CB  1 
ATOM   2685  C  CG  . ARG A  1 357 ? 9.175   3.349   -19.708 1.00   49.61 ? 464 ARG A CG  1 
ATOM   2686  C  CD  . ARG A  1 357 ? 7.674   3.413   -19.644 1.00   54.35 ? 464 ARG A CD  1 
ATOM   2687  N  NE  . ARG A  1 357 ? 7.166   2.525   -18.600 1.00   59.92 ? 464 ARG A NE  1 
ATOM   2688  C  CZ  . ARG A  1 357 ? 6.832   2.900   -17.365 1.00   61.92 ? 464 ARG A CZ  1 
ATOM   2689  N  NH1 . ARG A  1 357 ? 6.937   4.173   -16.980 1.00   59.76 ? 464 ARG A NH1 1 
ATOM   2690  N  NH2 . ARG A  1 357 ? 6.395   1.985   -16.509 1.00   60.90 ? 464 ARG A NH2 1 
ATOM   2691  N  N   . LEU A  1 358 ? 11.970  1.992   -19.191 1.00   38.45 ? 465 LEU A N   1 
ATOM   2692  C  CA  . LEU A  1 358 ? 12.406  0.859   -18.391 1.00   34.27 ? 465 LEU A CA  1 
ATOM   2693  C  C   . LEU A  1 358 ? 11.677  0.915   -17.075 1.00   34.92 ? 465 LEU A C   1 
ATOM   2694  O  O   . LEU A  1 358 ? 11.528  1.984   -16.484 1.00   36.99 ? 465 LEU A O   1 
ATOM   2695  C  CB  . LEU A  1 358 ? 13.906  0.911   -18.133 1.00   32.89 ? 465 LEU A CB  1 
ATOM   2696  C  CG  . LEU A  1 358 ? 14.435  -0.050  -17.055 1.00   33.63 ? 465 LEU A CG  1 
ATOM   2697  C  CD1 . LEU A  1 358 ? 14.240  -1.504  -17.466 1.00   31.00 ? 465 LEU A CD1 1 
ATOM   2698  C  CD2 . LEU A  1 358 ? 15.911  0.227   -16.826 1.00   32.77 ? 465 LEU A CD2 1 
ATOM   2699  N  N   . GLU A  1 359 ? 11.212  -0.237  -16.625 1.00   33.33 ? 466 GLU A N   1 
ATOM   2700  C  CA  . GLU A  1 359 ? 10.495  -0.318  -15.374 1.00   36.38 ? 466 GLU A CA  1 
ATOM   2701  C  C   . GLU A  1 359 ? 11.102  -1.465  -14.585 1.00   36.24 ? 466 GLU A C   1 
ATOM   2702  O  O   . GLU A  1 359 ? 11.193  -2.587  -15.079 1.00   37.96 ? 466 GLU A O   1 
ATOM   2703  C  CB  . GLU A  1 359 ? 9.010   -0.590  -15.622 1.00   38.75 ? 466 GLU A CB  1 
ATOM   2704  C  CG  . GLU A  1 359 ? 8.121   -0.115  -14.501 1.00   43.32 ? 466 GLU A CG  1 
ATOM   2705  C  CD  . GLU A  1 359 ? 6.687   -0.577  -14.653 1.00   48.36 ? 466 GLU A CD  1 
ATOM   2706  O  OE1 . GLU A  1 359 ? 6.433   -1.789  -14.487 1.00   52.41 ? 466 GLU A OE1 1 
ATOM   2707  O  OE2 . GLU A  1 359 ? 5.809   0.267   -14.937 1.00   49.53 ? 466 GLU A OE2 1 
ATOM   2708  N  N   . VAL A  1 360 ? 11.530  -1.176  -13.364 1.00   33.34 ? 467 VAL A N   1 
ATOM   2709  C  CA  . VAL A  1 360 ? 12.125  -2.184  -12.508 1.00   31.93 ? 467 VAL A CA  1 
ATOM   2710  C  C   . VAL A  1 360 ? 11.297  -2.332  -11.239 1.00   32.78 ? 467 VAL A C   1 
ATOM   2711  O  O   . VAL A  1 360 ? 11.094  -1.365  -10.504 1.00   33.20 ? 467 VAL A O   1 
ATOM   2712  C  CB  . VAL A  1 360 ? 13.559  -1.805  -12.124 1.00   30.70 ? 467 VAL A CB  1 
ATOM   2713  C  CG1 . VAL A  1 360 ? 14.114  -2.821  -11.142 1.00   30.20 ? 467 VAL A CG1 1 
ATOM   2714  C  CG2 . VAL A  1 360 ? 14.426  -1.728  -13.366 1.00   27.44 ? 467 VAL A CG2 1 
ATOM   2715  N  N   . ARG A  1 361 ? 10.811  -3.543  -10.993 1.00   34.48 ? 468 ARG A N   1 
ATOM   2716  C  CA  . ARG A  1 361 ? 9.996   -3.818  -9.817  1.00   34.37 ? 468 ARG A CA  1 
ATOM   2717  C  C   . ARG A  1 361 ? 10.734  -4.706  -8.846  1.00   33.56 ? 468 ARG A C   1 
ATOM   2718  O  O   . ARG A  1 361 ? 11.507  -5.569  -9.237  1.00   33.25 ? 468 ARG A O   1 
ATOM   2719  C  CB  . ARG A  1 361 ? 8.686   -4.487  -10.223 1.00   36.33 ? 468 ARG A CB  1 
ATOM   2720  C  CG  . ARG A  1 361 ? 7.758   -3.547  -10.948 1.00   41.44 ? 468 ARG A CG  1 
ATOM   2721  C  CD  . ARG A  1 361 ? 6.548   -4.258  -11.513 1.00   47.91 ? 468 ARG A CD  1 
ATOM   2722  N  NE  . ARG A  1 361 ? 5.649   -3.305  -12.156 1.00   51.22 ? 468 ARG A NE  1 
ATOM   2723  C  CZ  . ARG A  1 361 ? 4.733   -2.593  -11.509 1.00   53.23 ? 468 ARG A CZ  1 
ATOM   2724  N  NH1 . ARG A  1 361 ? 3.964   -1.739  -12.177 1.00   54.82 ? 468 ARG A NH1 1 
ATOM   2725  N  NH2 . ARG A  1 361 ? 4.568   -2.754  -10.201 1.00   52.77 ? 468 ARG A NH2 1 
ATOM   2726  N  N   . LYS A  1 362 ? 10.483  -4.502  -7.564  1.00   34.55 ? 469 LYS A N   1 
ATOM   2727  C  CA  . LYS A  1 362 ? 11.152  -5.301  -6.563  1.00   31.85 ? 469 LYS A CA  1 
ATOM   2728  C  C   . LYS A  1 362 ? 10.415  -5.238  -5.243  1.00   31.09 ? 469 LYS A C   1 
ATOM   2729  O  O   . LYS A  1 362 ? 10.150  -4.163  -4.718  1.00   31.43 ? 469 LYS A O   1 
ATOM   2730  C  CB  . LYS A  1 362 ? 12.583  -4.804  -6.387  1.00   36.32 ? 469 LYS A CB  1 
ATOM   2731  C  CG  . LYS A  1 362 ? 13.346  -5.435  -5.226  1.00   40.64 ? 469 LYS A CG  1 
ATOM   2732  C  CD  . LYS A  1 362 ? 13.701  -6.880  -5.484  1.00   44.54 ? 469 LYS A CD  1 
ATOM   2733  C  CE  . LYS A  1 362 ? 14.688  -7.366  -4.433  1.00   48.01 ? 469 LYS A CE  1 
ATOM   2734  N  NZ  . LYS A  1 362 ? 15.217  -8.726  -4.724  1.00   49.62 ? 469 LYS A NZ  1 
ATOM   2735  N  N   . THR A  1 363 ? 10.068  -6.403  -4.714  1.00   27.85 ? 470 THR A N   1 
ATOM   2736  C  CA  . THR A  1 363 ? 9.388   -6.475  -3.440  1.00   26.95 ? 470 THR A CA  1 
ATOM   2737  C  C   . THR A  1 363 ? 10.473  -6.595  -2.384  1.00   26.36 ? 470 THR A C   1 
ATOM   2738  O  O   . THR A  1 363 ? 11.350  -7.450  -2.482  1.00   28.02 ? 470 THR A O   1 
ATOM   2739  C  CB  . THR A  1 363 ? 8.476   -7.692  -3.394  1.00   28.96 ? 470 THR A CB  1 
ATOM   2740  O  OG1 . THR A  1 363 ? 7.505   -7.582  -4.441  1.00   32.56 ? 470 THR A OG1 1 
ATOM   2741  C  CG2 . THR A  1 363 ? 7.773   -7.785  -2.048  1.00   25.63 ? 470 THR A CG2 1 
ATOM   2742  N  N   . VAL A  1 364 ? 10.425  -5.741  -1.373  1.00   25.61 ? 471 VAL A N   1 
ATOM   2743  C  CA  . VAL A  1 364 ? 11.449  -5.765  -0.339  1.00   23.66 ? 471 VAL A CA  1 
ATOM   2744  C  C   . VAL A  1 364 ? 10.828  -5.995  1.014   1.00   24.71 ? 471 VAL A C   1 
ATOM   2745  O  O   . VAL A  1 364 ? 9.641   -5.740  1.205   1.00   26.25 ? 471 VAL A O   1 
ATOM   2746  C  CB  . VAL A  1 364 ? 12.227  -4.418  -0.295  1.00   26.17 ? 471 VAL A CB  1 
ATOM   2747  C  CG1 . VAL A  1 364 ? 12.803  -4.092  -1.665  1.00   20.43 ? 471 VAL A CG1 1 
ATOM   2748  C  CG2 . VAL A  1 364 ? 11.303  -3.302  0.162   1.00   18.92 ? 471 VAL A CG2 1 
ATOM   2749  N  N   . THR A  1 365 ? 11.641  -6.454  1.959   1.00   24.78 ? 472 THR A N   1 
ATOM   2750  C  CA  . THR A  1 365 ? 11.165  -6.706  3.312   1.00   26.60 ? 472 THR A CA  1 
ATOM   2751  C  C   . THR A  1 365 ? 11.671  -5.642  4.263   1.00   25.95 ? 472 THR A C   1 
ATOM   2752  O  O   . THR A  1 365 ? 11.368  -5.674  5.452   1.00   27.55 ? 472 THR A O   1 
ATOM   2753  C  CB  . THR A  1 365 ? 11.660  -8.038  3.845   1.00   28.72 ? 472 THR A CB  1 
ATOM   2754  O  OG1 . THR A  1 365 ? 13.085  -7.989  3.985   1.00   31.51 ? 472 THR A OG1 1 
ATOM   2755  C  CG2 . THR A  1 365 ? 11.286  -9.145  2.904   1.00   31.02 ? 472 THR A CG2 1 
ATOM   2756  N  N   . ALA A  1 366 ? 12.463  -4.715  3.736   1.00   26.60 ? 473 ALA A N   1 
ATOM   2757  C  CA  . ALA A  1 366 ? 13.019  -3.622  4.529   1.00   23.60 ? 473 ALA A CA  1 
ATOM   2758  C  C   . ALA A  1 366 ? 13.785  -4.150  5.736   1.00   27.04 ? 473 ALA A C   1 
ATOM   2759  O  O   . ALA A  1 366 ? 13.592  -3.671  6.862   1.00   24.38 ? 473 ALA A O   1 
ATOM   2760  C  CB  . ALA A  1 366 ? 11.912  -2.690  4.985   1.00   19.71 ? 473 ALA A CB  1 
ATOM   2761  N  N   . CYS A  1 367 ? 14.626  -5.156  5.500   1.00   24.30 ? 474 CYS A N   1 
ATOM   2762  C  CA  . CYS A  1 367 ? 15.450  -5.721  6.553   1.00   27.38 ? 474 CYS A CA  1 
ATOM   2763  C  C   . CYS A  1 367 ? 14.687  -6.358  7.700   1.00   26.64 ? 474 CYS A C   1 
ATOM   2764  O  O   . CYS A  1 367 ? 15.123  -6.310  8.847   1.00   28.04 ? 474 CYS A O   1 
ATOM   2765  C  CB  . CYS A  1 367 ? 16.390  -4.628  7.090   1.00   27.82 ? 474 CYS A CB  1 
ATOM   2766  S  SG  . CYS A  1 367 ? 17.656  -4.142  5.875   1.00   29.09 ? 474 CYS A SG  1 
ATOM   2767  N  N   . LEU A  1 368 ? 13.543  -6.948  7.391   1.00   29.31 ? 475 LEU A N   1 
ATOM   2768  C  CA  . LEU A  1 368 ? 12.738  -7.610  8.407   1.00   30.18 ? 475 LEU A CA  1 
ATOM   2769  C  C   . LEU A  1 368 ? 13.580  -8.668  9.114   1.00   30.48 ? 475 LEU A C   1 
ATOM   2770  O  O   . LEU A  1 368 ? 14.356  -9.386  8.482   1.00   28.91 ? 475 LEU A O   1 
ATOM   2771  C  CB  . LEU A  1 368 ? 11.525  -8.279  7.765   1.00   30.34 ? 475 LEU A CB  1 
ATOM   2772  C  CG  . LEU A  1 368 ? 10.731  -9.199  8.698   1.00   31.10 ? 475 LEU A CG  1 
ATOM   2773  C  CD1 . LEU A  1 368 ? 10.103  -8.407  9.862   1.00   24.60 ? 475 LEU A CD1 1 
ATOM   2774  C  CD2 . LEU A  1 368 ? 9.667   -9.903  7.864   1.00   30.33 ? 475 LEU A CD2 1 
ATOM   2775  N  N   . GLY A  1 369 ? 13.430  -8.756  10.426  1.00   31.63 ? 476 GLY A N   1 
ATOM   2776  C  CA  . GLY A  1 369 ? 14.188  -9.738  11.174  1.00   37.73 ? 476 GLY A CA  1 
ATOM   2777  C  C   . GLY A  1 369 ? 15.622  -9.344  11.478  1.00   41.41 ? 476 GLY A C   1 
ATOM   2778  O  O   . GLY A  1 369 ? 16.344  -10.112 12.114  1.00   43.80 ? 476 GLY A O   1 
ATOM   2779  N  N   . GLU A  1 370 ? 16.050  -8.165  11.031  1.00   41.58 ? 477 GLU A N   1 
ATOM   2780  C  CA  . GLU A  1 370 ? 17.413  -7.716  11.303  1.00   40.87 ? 477 GLU A CA  1 
ATOM   2781  C  C   . GLU A  1 370 ? 17.380  -6.470  12.194  1.00   40.60 ? 477 GLU A C   1 
ATOM   2782  O  O   . GLU A  1 370 ? 16.316  -5.875  12.406  1.00   38.41 ? 477 GLU A O   1 
ATOM   2783  C  CB  . GLU A  1 370 ? 18.142  -7.372  10.010  1.00   43.93 ? 477 GLU A CB  1 
ATOM   2784  C  CG  . GLU A  1 370 ? 18.065  -8.388  8.886   1.00   49.95 ? 477 GLU A CG  1 
ATOM   2785  C  CD  . GLU A  1 370 ? 18.648  -7.819  7.578   1.00   56.25 ? 477 GLU A CD  1 
ATOM   2786  O  OE1 . GLU A  1 370 ? 18.353  -8.366  6.488   1.00   59.36 ? 477 GLU A OE1 1 
ATOM   2787  O  OE2 . GLU A  1 370 ? 19.410  -6.824  7.642   1.00   56.39 ? 477 GLU A OE2 1 
ATOM   2788  N  N   . PRO A  1 371 ? 18.551  -6.053  12.722  1.00   39.87 ? 478 PRO A N   1 
ATOM   2789  C  CA  . PRO A  1 371 ? 18.668  -4.876  13.593  1.00   37.17 ? 478 PRO A CA  1 
ATOM   2790  C  C   . PRO A  1 371 ? 18.280  -3.568  12.896  1.00   34.41 ? 478 PRO A C   1 
ATOM   2791  O  O   . PRO A  1 371 ? 17.896  -2.601  13.547  1.00   32.91 ? 478 PRO A O   1 
ATOM   2792  C  CB  . PRO A  1 371 ? 20.144  -4.879  13.996  1.00   38.34 ? 478 PRO A CB  1 
ATOM   2793  C  CG  . PRO A  1 371 ? 20.537  -6.315  13.884  1.00   41.79 ? 478 PRO A CG  1 
ATOM   2794  C  CD  . PRO A  1 371 ? 19.860  -6.719  12.594  1.00   42.00 ? 478 PRO A CD  1 
ATOM   2795  N  N   . ASN A  1 372 ? 18.387  -3.542  11.575  1.00   31.24 ? 479 ASN A N   1 
ATOM   2796  C  CA  . ASN A  1 372 ? 18.037  -2.362  10.803  1.00   35.16 ? 479 ASN A CA  1 
ATOM   2797  C  C   . ASN A  1 372 ? 16.680  -2.446  10.099  1.00   33.50 ? 479 ASN A C   1 
ATOM   2798  O  O   . ASN A  1 372 ? 16.450  -1.794  9.078   1.00   31.50 ? 479 ASN A O   1 
ATOM   2799  C  CB  . ASN A  1 372 ? 19.142  -2.051  9.786   1.00   40.14 ? 479 ASN A CB  1 
ATOM   2800  C  CG  . ASN A  1 372 ? 19.782  -3.305  9.193   1.00   50.08 ? 479 ASN A CG  1 
ATOM   2801  O  OD1 . ASN A  1 372 ? 20.769  -3.214  8.456   1.00   56.91 ? 479 ASN A OD1 1 
ATOM   2802  N  ND2 . ASN A  1 372 ? 19.229  -4.474  9.507   1.00   52.05 ? 479 ASN A ND2 1 
ATOM   2803  N  N   . HIS A  1 373 ? 15.784  -3.256  10.652  1.00   31.94 ? 480 HIS A N   1 
ATOM   2804  C  CA  . HIS A  1 373 ? 14.439  -3.412  10.105  1.00   29.03 ? 480 HIS A CA  1 
ATOM   2805  C  C   . HIS A  1 373 ? 13.725  -2.049  10.202  1.00   26.09 ? 480 HIS A C   1 
ATOM   2806  O  O   . HIS A  1 373 ? 13.718  -1.410  11.254  1.00   23.91 ? 480 HIS A O   1 
ATOM   2807  C  CB  . HIS A  1 373 ? 13.704  -4.485  10.914  1.00   28.81 ? 480 HIS A CB  1 
ATOM   2808  C  CG  . HIS A  1 373 ? 12.235  -4.572  10.632  1.00   31.94 ? 480 HIS A CG  1 
ATOM   2809  N  ND1 . HIS A  1 373 ? 11.721  -4.632  9.352   1.00   32.13 ? 480 HIS A ND1 1 
ATOM   2810  C  CD2 . HIS A  1 373 ? 11.175  -4.665  11.470  1.00   28.13 ? 480 HIS A CD2 1 
ATOM   2811  C  CE1 . HIS A  1 373 ? 10.408  -4.761  9.415   1.00   29.43 ? 480 HIS A CE1 1 
ATOM   2812  N  NE2 . HIS A  1 373 ? 10.052  -4.786  10.687  1.00   31.43 ? 480 HIS A NE2 1 
ATOM   2813  N  N   . ILE A  1 374 ? 13.135  -1.596  9.105   1.00   22.50 ? 481 ILE A N   1 
ATOM   2814  C  CA  . ILE A  1 374 ? 12.460  -0.308  9.114   1.00   21.02 ? 481 ILE A CA  1 
ATOM   2815  C  C   . ILE A  1 374 ? 10.978  -0.406  8.778   1.00   21.96 ? 481 ILE A C   1 
ATOM   2816  O  O   . ILE A  1 374 ? 10.594  -0.928  7.730   1.00   22.14 ? 481 ILE A O   1 
ATOM   2817  C  CB  . ILE A  1 374 ? 13.134  0.676   8.124   1.00   20.99 ? 481 ILE A CB  1 
ATOM   2818  C  CG1 . ILE A  1 374 ? 14.569  0.963   8.591   1.00   19.30 ? 481 ILE A CG1 1 
ATOM   2819  C  CG2 . ILE A  1 374 ? 12.308  1.974   8.015   1.00   16.79 ? 481 ILE A CG2 1 
ATOM   2820  C  CD1 . ILE A  1 374 ? 15.408  1.771   7.600   1.00   18.60 ? 481 ILE A CD1 1 
ATOM   2821  N  N   . THR A  1 375 ? 10.149  0.111   9.673   1.00   21.69 ? 482 THR A N   1 
ATOM   2822  C  CA  . THR A  1 375 ? 8.712   0.103   9.468   1.00   22.72 ? 482 THR A CA  1 
ATOM   2823  C  C   . THR A  1 375 ? 8.212   1.532   9.302   1.00   24.92 ? 482 THR A C   1 
ATOM   2824  O  O   . THR A  1 375 ? 7.100   1.780   8.827   1.00   23.27 ? 482 THR A O   1 
ATOM   2825  C  CB  . THR A  1 375 ? 8.011   -0.534  10.653  1.00   23.58 ? 482 THR A CB  1 
ATOM   2826  O  OG1 . THR A  1 375 ? 8.368   0.179   11.845  1.00   27.13 ? 482 THR A OG1 1 
ATOM   2827  C  CG2 . THR A  1 375 ? 8.436   -1.992  10.778  1.00   22.28 ? 482 THR A CG2 1 
ATOM   2828  N  N   . ARG A  1 376 ? 9.054   2.479   9.689   1.00   25.88 ? 483 ARG A N   1 
ATOM   2829  C  CA  . ARG A  1 376 ? 8.691   3.878   9.584   1.00   28.41 ? 483 ARG A CA  1 
ATOM   2830  C  C   . ARG A  1 376 ? 9.814   4.624   8.862   1.00   23.91 ? 483 ARG A C   1 
ATOM   2831  O  O   . ARG A  1 376 ? 10.831  4.971   9.448   1.00   24.64 ? 483 ARG A O   1 
ATOM   2832  C  CB  . ARG A  1 376 ? 8.468   4.439   10.980  1.00   32.15 ? 483 ARG A CB  1 
ATOM   2833  C  CG  . ARG A  1 376 ? 7.706   5.716   10.969  1.00   44.62 ? 483 ARG A CG  1 
ATOM   2834  C  CD  . ARG A  1 376 ? 7.762   6.379   12.309  1.00   53.12 ? 483 ARG A CD  1 
ATOM   2835  N  NE  . ARG A  1 376 ? 6.436   6.829   12.702  1.00   61.60 ? 483 ARG A NE  1 
ATOM   2836  C  CZ  . ARG A  1 376 ? 6.200   7.920   13.421  1.00   65.87 ? 483 ARG A CZ  1 
ATOM   2837  N  NH1 . ARG A  1 376 ? 4.949   8.237   13.728  1.00   70.16 ? 483 ARG A NH1 1 
ATOM   2838  N  NH2 . ARG A  1 376 ? 7.206   8.697   13.820  1.00   65.33 ? 483 ARG A NH2 1 
ATOM   2839  N  N   . LEU A  1 377 ? 9.616   4.868   7.579   1.00   21.86 ? 484 LEU A N   1 
ATOM   2840  C  CA  . LEU A  1 377 ? 10.623  5.525   6.755   1.00   22.96 ? 484 LEU A CA  1 
ATOM   2841  C  C   . LEU A  1 377 ? 10.865  7.011   7.014   1.00   22.91 ? 484 LEU A C   1 
ATOM   2842  O  O   . LEU A  1 377 ? 9.976   7.750   7.451   1.00   26.19 ? 484 LEU A O   1 
ATOM   2843  C  CB  . LEU A  1 377 ? 10.247  5.344   5.283   1.00   23.23 ? 484 LEU A CB  1 
ATOM   2844  C  CG  . LEU A  1 377 ? 11.220  5.716   4.168   1.00   24.12 ? 484 LEU A CG  1 
ATOM   2845  C  CD1 . LEU A  1 377 ? 12.380  4.714   4.118   1.00   19.66 ? 484 LEU A CD1 1 
ATOM   2846  C  CD2 . LEU A  1 377 ? 10.463  5.715   2.853   1.00   22.29 ? 484 LEU A CD2 1 
ATOM   2847  N  N   . GLU A  1 378 ? 12.091  7.438   6.747   1.00   20.77 ? 485 GLU A N   1 
ATOM   2848  C  CA  . GLU A  1 378 ? 12.457  8.838   6.856   1.00   19.76 ? 485 GLU A CA  1 
ATOM   2849  C  C   . GLU A  1 378 ? 12.897  9.159   5.441   1.00   18.65 ? 485 GLU A C   1 
ATOM   2850  O  O   . GLU A  1 378 ? 12.044  9.234   4.567   1.00   19.95 ? 485 GLU A O   1 
ATOM   2851  C  CB  . GLU A  1 378 ? 13.552  9.037   7.904   1.00   19.73 ? 485 GLU A CB  1 
ATOM   2852  C  CG  . GLU A  1 378 ? 12.949  8.989   9.298   1.00   18.98 ? 485 GLU A CG  1 
ATOM   2853  C  CD  . GLU A  1 378 ? 13.963  9.120   10.402  1.00   22.27 ? 485 GLU A CD  1 
ATOM   2854  O  OE1 . GLU A  1 378 ? 13.549  9.057   11.578  1.00   21.86 ? 485 GLU A OE1 1 
ATOM   2855  O  OE2 . GLU A  1 378 ? 15.167  9.289   10.107  1.00   22.72 ? 485 GLU A OE2 1 
ATOM   2856  N  N   . HIS A  1 379 ? 14.194  9.317   5.181   1.00   20.93 ? 486 HIS A N   1 
ATOM   2857  C  CA  . HIS A  1 379 ? 14.646  9.587   3.810   1.00   18.76 ? 486 HIS A CA  1 
ATOM   2858  C  C   . HIS A  1 379 ? 14.804  8.266   3.060   1.00   19.72 ? 486 HIS A C   1 
ATOM   2859  O  O   . HIS A  1 379 ? 14.975  7.209   3.669   1.00   15.91 ? 486 HIS A O   1 
ATOM   2860  C  CB  . HIS A  1 379 ? 16.033  10.261  3.780   1.00   17.99 ? 486 HIS A CB  1 
ATOM   2861  C  CG  . HIS A  1 379 ? 16.203  11.369  4.770   1.00   17.30 ? 486 HIS A CG  1 
ATOM   2862  N  ND1 . HIS A  1 379 ? 16.511  11.143  6.093   1.00   14.94 ? 486 HIS A ND1 1 
ATOM   2863  C  CD2 . HIS A  1 379 ? 16.080  12.713  4.635   1.00   16.06 ? 486 HIS A CD2 1 
ATOM   2864  C  CE1 . HIS A  1 379 ? 16.572  12.298  6.734   1.00   17.53 ? 486 HIS A CE1 1 
ATOM   2865  N  NE2 . HIS A  1 379 ? 16.312  13.265  5.872   1.00   16.53 ? 486 HIS A NE2 1 
ATOM   2866  N  N   . ALA A  1 380 ? 14.761  8.332   1.737   1.00   18.68 ? 487 ALA A N   1 
ATOM   2867  C  CA  . ALA A  1 380 ? 15.006  7.146   0.925   1.00   22.51 ? 487 ALA A CA  1 
ATOM   2868  C  C   . ALA A  1 380 ? 15.868  7.619   -0.231  1.00   22.56 ? 487 ALA A C   1 
ATOM   2869  O  O   . ALA A  1 380 ? 15.675  8.724   -0.733  1.00   25.14 ? 487 ALA A O   1 
ATOM   2870  C  CB  . ALA A  1 380 ? 13.706  6.551   0.394   1.00   21.19 ? 487 ALA A CB  1 
ATOM   2871  N  N   . GLN A  1 381 ? 16.835  6.804   -0.631  1.00   23.43 ? 488 GLN A N   1 
ATOM   2872  C  CA  . GLN A  1 381 ? 17.693  7.147   -1.758  1.00   21.46 ? 488 GLN A CA  1 
ATOM   2873  C  C   . GLN A  1 381 ? 17.655  6.020   -2.773  1.00   21.86 ? 488 GLN A C   1 
ATOM   2874  O  O   . GLN A  1 381 ? 17.546  4.843   -2.422  1.00   20.37 ? 488 GLN A O   1 
ATOM   2875  C  CB  . GLN A  1 381 ? 19.154  7.325   -1.331  1.00   20.76 ? 488 GLN A CB  1 
ATOM   2876  C  CG  . GLN A  1 381 ? 19.413  8.337   -0.237  1.00   18.85 ? 488 GLN A CG  1 
ATOM   2877  C  CD  . GLN A  1 381 ? 20.848  8.275   0.220   1.00   20.35 ? 488 GLN A CD  1 
ATOM   2878  O  OE1 . GLN A  1 381 ? 21.362  7.195   0.505   1.00   22.49 ? 488 GLN A OE1 1 
ATOM   2879  N  NE2 . GLN A  1 381 ? 21.508  9.425   0.289   1.00   19.23 ? 488 GLN A NE2 1 
ATOM   2880  N  N   . ALA A  1 382 ? 17.740  6.389   -4.040  1.00   23.25 ? 489 ALA A N   1 
ATOM   2881  C  CA  . ALA A  1 382 ? 17.789  5.411   -5.113  1.00   21.70 ? 489 ALA A CA  1 
ATOM   2882  C  C   . ALA A  1 382 ? 19.150  5.738   -5.723  1.00   24.80 ? 489 ALA A C   1 
ATOM   2883  O  O   . ALA A  1 382 ? 19.290  6.733   -6.449  1.00   23.83 ? 489 ALA A O   1 
ATOM   2884  C  CB  . ALA A  1 382 ? 16.681  5.661   -6.111  1.00   18.67 ? 489 ALA A CB  1 
ATOM   2885  N  N   . ARG A  1 383 ? 20.162  4.943   -5.383  1.00   22.51 ? 490 ARG A N   1 
ATOM   2886  C  CA  . ARG A  1 383 ? 21.499  5.191   -5.906  1.00   25.07 ? 490 ARG A CA  1 
ATOM   2887  C  C   . ARG A  1 383 ? 21.588  4.533   -7.278  1.00   26.85 ? 490 ARG A C   1 
ATOM   2888  O  O   . ARG A  1 383 ? 21.550  3.302   -7.402  1.00   25.88 ? 490 ARG A O   1 
ATOM   2889  C  CB  . ARG A  1 383 ? 22.565  4.623   -4.960  1.00   24.91 ? 490 ARG A CB  1 
ATOM   2890  C  CG  . ARG A  1 383 ? 22.455  5.096   -3.483  1.00   23.28 ? 490 ARG A CG  1 
ATOM   2891  C  CD  . ARG A  1 383 ? 23.702  4.681   -2.669  1.00   20.11 ? 490 ARG A CD  1 
ATOM   2892  N  NE  . ARG A  1 383 ? 24.865  5.446   -3.117  1.00   25.67 ? 490 ARG A NE  1 
ATOM   2893  C  CZ  . ARG A  1 383 ? 25.339  6.534   -2.507  1.00   26.61 ? 490 ARG A CZ  1 
ATOM   2894  N  NH1 . ARG A  1 383 ? 26.383  7.179   -3.019  1.00   24.06 ? 490 ARG A NH1 1 
ATOM   2895  N  NH2 . ARG A  1 383 ? 24.803  6.947   -1.360  1.00   24.07 ? 490 ARG A NH2 1 
ATOM   2896  N  N   . LEU A  1 384 ? 21.696  5.357   -8.312  1.00   26.82 ? 491 LEU A N   1 
ATOM   2897  C  CA  . LEU A  1 384 ? 21.745  4.841   -9.666  1.00   25.78 ? 491 LEU A CA  1 
ATOM   2898  C  C   . LEU A  1 384 ? 23.044  5.075   -10.404 1.00   27.86 ? 491 LEU A C   1 
ATOM   2899  O  O   . LEU A  1 384 ? 23.712  6.101   -10.234 1.00   26.92 ? 491 LEU A O   1 
ATOM   2900  C  CB  . LEU A  1 384 ? 20.612  5.446   -10.484 1.00   22.86 ? 491 LEU A CB  1 
ATOM   2901  C  CG  . LEU A  1 384 ? 19.266  5.472   -9.772  1.00   23.93 ? 491 LEU A CG  1 
ATOM   2902  C  CD1 . LEU A  1 384 ? 18.230  6.055   -10.702 1.00   21.38 ? 491 LEU A CD1 1 
ATOM   2903  C  CD2 . LEU A  1 384 ? 18.872  4.063   -9.330  1.00   22.52 ? 491 LEU A CD2 1 
ATOM   2904  N  N   . THR A  1 385 ? 23.390  4.096   -11.229 1.00   29.92 ? 492 THR A N   1 
ATOM   2905  C  CA  . THR A  1 385 ? 24.567  4.158   -12.080 1.00   28.99 ? 492 THR A CA  1 
ATOM   2906  C  C   . THR A  1 385 ? 24.041  3.740   -13.443 1.00   28.02 ? 492 THR A C   1 
ATOM   2907  O  O   . THR A  1 385 ? 23.499  2.648   -13.598 1.00   27.50 ? 492 THR A O   1 
ATOM   2908  C  CB  . THR A  1 385 ? 25.647  3.177   -11.622 1.00   29.39 ? 492 THR A CB  1 
ATOM   2909  O  OG1 . THR A  1 385 ? 26.059  3.525   -10.294 1.00   29.18 ? 492 THR A OG1 1 
ATOM   2910  C  CG2 . THR A  1 385 ? 26.856  3.229   -12.552 1.00   24.60 ? 492 THR A CG2 1 
ATOM   2911  N  N   . LEU A  1 386 ? 24.168  4.625   -14.420 1.00   29.99 ? 493 LEU A N   1 
ATOM   2912  C  CA  . LEU A  1 386 ? 23.675  4.330   -15.754 1.00   29.50 ? 493 LEU A CA  1 
ATOM   2913  C  C   . LEU A  1 386 ? 24.390  5.153   -16.801 1.00   30.73 ? 493 LEU A C   1 
ATOM   2914  O  O   . LEU A  1 386 ? 24.991  6.193   -16.492 1.00   32.60 ? 493 LEU A O   1 
ATOM   2915  C  CB  . LEU A  1 386 ? 22.175  4.617   -15.828 1.00   24.29 ? 493 LEU A CB  1 
ATOM   2916  C  CG  . LEU A  1 386 ? 21.778  6.073   -15.603 1.00   24.21 ? 493 LEU A CG  1 
ATOM   2917  C  CD1 . LEU A  1 386 ? 21.872  6.853   -16.914 1.00   23.40 ? 493 LEU A CD1 1 
ATOM   2918  C  CD2 . LEU A  1 386 ? 20.355  6.123   -15.081 1.00   22.15 ? 493 LEU A CD2 1 
ATOM   2919  N  N   . SER A  1 387 ? 24.310  4.674   -18.039 1.00   29.27 ? 494 SER A N   1 
ATOM   2920  C  CA  . SER A  1 387 ? 24.897  5.353   -19.180 1.00   29.24 ? 494 SER A CA  1 
ATOM   2921  C  C   . SER A  1 387 ? 23.730  5.789   -20.064 1.00   28.46 ? 494 SER A C   1 
ATOM   2922  O  O   . SER A  1 387 ? 22.682  5.142   -20.080 1.00   26.92 ? 494 SER A O   1 
ATOM   2923  C  CB  . SER A  1 387 ? 25.820  4.400   -19.949 1.00   28.40 ? 494 SER A CB  1 
ATOM   2924  O  OG  . SER A  1 387 ? 25.189  3.153   -20.185 1.00   31.07 ? 494 SER A OG  1 
ATOM   2925  N  N   . TYR A  1 388 ? 23.901  6.895   -20.779 1.00   27.09 ? 495 TYR A N   1 
ATOM   2926  C  CA  . TYR A  1 388 ? 22.855  7.378   -21.670 1.00   29.06 ? 495 TYR A CA  1 
ATOM   2927  C  C   . TYR A  1 388 ? 23.512  8.402   -22.580 1.00   30.61 ? 495 TYR A C   1 
ATOM   2928  O  O   . TYR A  1 388 ? 24.474  9.066   -22.186 1.00   31.34 ? 495 TYR A O   1 
ATOM   2929  C  CB  . TYR A  1 388 ? 21.707  8.023   -20.875 1.00   31.08 ? 495 TYR A CB  1 
ATOM   2930  C  CG  . TYR A  1 388 ? 20.353  7.918   -21.554 1.00   32.97 ? 495 TYR A CG  1 
ATOM   2931  C  CD1 . TYR A  1 388 ? 19.749  6.679   -21.745 1.00   34.59 ? 495 TYR A CD1 1 
ATOM   2932  C  CD2 . TYR A  1 388 ? 19.697  9.049   -22.042 1.00   35.47 ? 495 TYR A CD2 1 
ATOM   2933  C  CE1 . TYR A  1 388 ? 18.531  6.561   -22.408 1.00   35.50 ? 495 TYR A CE1 1 
ATOM   2934  C  CE2 . TYR A  1 388 ? 18.468  8.943   -22.715 1.00   35.99 ? 495 TYR A CE2 1 
ATOM   2935  C  CZ  . TYR A  1 388 ? 17.897  7.693   -22.894 1.00   37.88 ? 495 TYR A CZ  1 
ATOM   2936  O  OH  . TYR A  1 388 ? 16.703  7.555   -23.575 1.00   42.12 ? 495 TYR A OH  1 
ATOM   2937  N  N   . ASN A  1 389 ? 22.995  8.534   -23.795 1.00   30.13 ? 496 ASN A N   1 
ATOM   2938  C  CA  . ASN A  1 389 ? 23.572  9.457   -24.761 1.00   29.74 ? 496 ASN A CA  1 
ATOM   2939  C  C   . ASN A  1 389 ? 23.214  10.916  -24.525 1.00   30.25 ? 496 ASN A C   1 
ATOM   2940  O  O   . ASN A  1 389 ? 24.022  11.800  -24.815 1.00   32.66 ? 496 ASN A O   1 
ATOM   2941  C  CB  . ASN A  1 389 ? 23.139  9.049   -26.169 1.00   30.36 ? 496 ASN A CB  1 
ATOM   2942  C  CG  . ASN A  1 389 ? 21.621  9.104   -26.347 1.00   31.46 ? 496 ASN A CG  1 
ATOM   2943  O  OD1 . ASN A  1 389 ? 20.870  8.418   -25.642 1.00   31.34 ? 496 ASN A OD1 1 
ATOM   2944  N  ND2 . ASN A  1 389 ? 21.165  9.933   -27.283 1.00   28.81 ? 496 ASN A ND2 1 
ATOM   2945  N  N   . ARG A  1 390 ? 22.012  11.167  -24.005 1.00   29.97 ? 497 ARG A N   1 
ATOM   2946  C  CA  . ARG A  1 390 ? 21.541  12.529  -23.758 1.00   29.96 ? 497 ARG A CA  1 
ATOM   2947  C  C   . ARG A  1 390 ? 20.808  12.585  -22.410 1.00   30.94 ? 497 ARG A C   1 
ATOM   2948  O  O   . ARG A  1 390 ? 19.581  12.460  -22.332 1.00   29.69 ? 497 ARG A O   1 
ATOM   2949  C  CB  . ARG A  1 390 ? 20.616  12.946  -24.894 1.00   31.90 ? 497 ARG A CB  1 
ATOM   2950  C  CG  . ARG A  1 390 ? 20.850  14.345  -25.381 1.00   32.45 ? 497 ARG A CG  1 
ATOM   2951  C  CD  . ARG A  1 390 ? 19.765  15.253  -24.904 1.00   37.30 ? 497 ARG A CD  1 
ATOM   2952  N  NE  . ARG A  1 390 ? 20.058  16.630  -25.260 1.00   40.35 ? 497 ARG A NE  1 
ATOM   2953  C  CZ  . ARG A  1 390 ? 19.439  17.678  -24.730 1.00   40.60 ? 497 ARG A CZ  1 
ATOM   2954  N  NH1 . ARG A  1 390 ? 19.784  18.903  -25.116 1.00   42.64 ? 497 ARG A NH1 1 
ATOM   2955  N  NH2 . ARG A  1 390 ? 18.481  17.497  -23.820 1.00   36.03 ? 497 ARG A NH2 1 
ATOM   2956  N  N   . ARG A  1 391 ? 21.587  12.795  -21.353 1.00   31.18 ? 498 ARG A N   1 
ATOM   2957  C  CA  . ARG A  1 391 ? 21.087  12.812  -19.979 1.00   27.32 ? 498 ARG A CA  1 
ATOM   2958  C  C   . ARG A  1 391 ? 19.812  13.605  -19.684 1.00   25.59 ? 498 ARG A C   1 
ATOM   2959  O  O   . ARG A  1 391 ? 18.929  13.117  -18.980 1.00   24.44 ? 498 ARG A O   1 
ATOM   2960  C  CB  . ARG A  1 391 ? 22.209  13.261  -19.035 1.00   24.21 ? 498 ARG A CB  1 
ATOM   2961  C  CG  . ARG A  1 391 ? 21.969  12.856  -17.577 1.00   22.92 ? 498 ARG A CG  1 
ATOM   2962  C  CD  . ARG A  1 391 ? 23.218  13.031  -16.740 1.00   17.93 ? 498 ARG A CD  1 
ATOM   2963  N  NE  . ARG A  1 391 ? 23.672  14.410  -16.758 1.00   21.10 ? 498 ARG A NE  1 
ATOM   2964  C  CZ  . ARG A  1 391 ? 24.857  14.809  -16.311 1.00   24.28 ? 498 ARG A CZ  1 
ATOM   2965  N  NH1 . ARG A  1 391 ? 25.194  16.095  -16.370 1.00   22.39 ? 498 ARG A NH1 1 
ATOM   2966  N  NH2 . ARG A  1 391 ? 25.704  13.921  -15.801 1.00   23.77 ? 498 ARG A NH2 1 
ATOM   2967  N  N   . GLY A  1 392 ? 19.711  14.815  -20.218 1.00   24.49 ? 499 GLY A N   1 
ATOM   2968  C  CA  . GLY A  1 392 ? 18.539  15.633  -19.966 1.00   24.09 ? 499 GLY A CA  1 
ATOM   2969  C  C   . GLY A  1 392 ? 17.219  15.117  -20.509 1.00   26.26 ? 499 GLY A C   1 
ATOM   2970  O  O   . GLY A  1 392 ? 16.163  15.624  -20.133 1.00   27.49 ? 499 GLY A O   1 
ATOM   2971  N  N   . ASP A  1 393 ? 17.255  14.128  -21.395 1.00   25.75 ? 500 ASP A N   1 
ATOM   2972  C  CA  . ASP A  1 393 ? 16.009  13.602  -21.943 1.00   28.29 ? 500 ASP A CA  1 
ATOM   2973  C  C   . ASP A  1 393 ? 15.350  12.617  -20.986 1.00   29.23 ? 500 ASP A C   1 
ATOM   2974  O  O   . ASP A  1 393 ? 14.188  12.240  -21.160 1.00   30.94 ? 500 ASP A O   1 
ATOM   2975  C  CB  . ASP A  1 393 ? 16.245  12.905  -23.285 1.00   26.22 ? 500 ASP A CB  1 
ATOM   2976  C  CG  . ASP A  1 393 ? 16.589  13.870  -24.391 1.00   31.36 ? 500 ASP A CG  1 
ATOM   2977  O  OD1 . ASP A  1 393 ? 16.516  15.098  -24.167 1.00   31.00 ? 500 ASP A OD1 1 
ATOM   2978  O  OD2 . ASP A  1 393 ? 16.924  13.394  -25.492 1.00   31.48 ? 500 ASP A OD2 1 
ATOM   2979  N  N   . LEU A  1 394 ? 16.092  12.197  -19.970 1.00   27.56 ? 501 LEU A N   1 
ATOM   2980  C  CA  . LEU A  1 394 ? 15.566  11.237  -19.009 1.00   26.26 ? 501 LEU A CA  1 
ATOM   2981  C  C   . LEU A  1 394 ? 14.670  11.845  -17.933 1.00   25.72 ? 501 LEU A C   1 
ATOM   2982  O  O   . LEU A  1 394 ? 14.827  13.003  -17.532 1.00   26.66 ? 501 LEU A O   1 
ATOM   2983  C  CB  . LEU A  1 394 ? 16.710  10.523  -18.297 1.00   24.06 ? 501 LEU A CB  1 
ATOM   2984  C  CG  . LEU A  1 394 ? 17.732  9.690   -19.071 1.00   28.32 ? 501 LEU A CG  1 
ATOM   2985  C  CD1 . LEU A  1 394 ? 18.902  9.372   -18.139 1.00   25.70 ? 501 LEU A CD1 1 
ATOM   2986  C  CD2 . LEU A  1 394 ? 17.100  8.401   -19.584 1.00   23.72 ? 501 LEU A CD2 1 
ATOM   2987  N  N   . ALA A  1 395 ? 13.731  11.037  -17.472 1.00   21.21 ? 502 ALA A N   1 
ATOM   2988  C  CA  . ALA A  1 395 ? 12.842  11.401  -16.390 1.00   21.95 ? 502 ALA A CA  1 
ATOM   2989  C  C   . ALA A  1 395 ? 12.833  10.097  -15.591 1.00   23.69 ? 502 ALA A C   1 
ATOM   2990  O  O   . ALA A  1 395 ? 12.682  9.006   -16.160 1.00   23.81 ? 502 ALA A O   1 
ATOM   2991  C  CB  . ALA A  1 395 ? 11.453  11.739  -16.898 1.00   20.33 ? 502 ALA A CB  1 
ATOM   2992  N  N   . ILE A  1 396 ? 13.019  10.210  -14.281 1.00   20.27 ? 503 ILE A N   1 
ATOM   2993  C  CA  . ILE A  1 396 ? 13.082  9.049   -13.416 1.00   20.21 ? 503 ILE A CA  1 
ATOM   2994  C  C   . ILE A  1 396 ? 12.126  9.183   -12.250 1.00   21.92 ? 503 ILE A C   1 
ATOM   2995  O  O   . ILE A  1 396 ? 12.109  10.204  -11.559 1.00   21.82 ? 503 ILE A O   1 
ATOM   2996  C  CB  . ILE A  1 396 ? 14.516  8.874   -12.872 1.00   22.65 ? 503 ILE A CB  1 
ATOM   2997  C  CG1 . ILE A  1 396 ? 15.474  8.648   -14.040 1.00   22.47 ? 503 ILE A CG1 1 
ATOM   2998  C  CG2 . ILE A  1 396 ? 14.586  7.710   -11.899 1.00   21.38 ? 503 ILE A CG2 1 
ATOM   2999  C  CD1 . ILE A  1 396 ? 16.941  8.617   -13.646 1.00   25.52 ? 503 ILE A CD1 1 
ATOM   3000  N  N   . HIS A  1 397 ? 11.344  8.136   -12.021 1.00   20.59 ? 504 HIS A N   1 
ATOM   3001  C  CA  . HIS A  1 397 ? 10.371  8.143   -10.951 1.00   21.07 ? 504 HIS A CA  1 
ATOM   3002  C  C   . HIS A  1 397 ? 10.531  6.923   -10.076 1.00   19.90 ? 504 HIS A C   1 
ATOM   3003  O  O   . HIS A  1 397 ? 10.935  5.862   -10.540 1.00   23.57 ? 504 HIS A O   1 
ATOM   3004  C  CB  . HIS A  1 397 ? 8.972   8.168   -11.557 1.00   24.03 ? 504 HIS A CB  1 
ATOM   3005  C  CG  . HIS A  1 397 ? 8.807   9.202   -12.625 1.00   24.70 ? 504 HIS A CG  1 
ATOM   3006  N  ND1 . HIS A  1 397 ? 8.390   10.490  -12.357 1.00   26.47 ? 504 HIS A ND1 1 
ATOM   3007  C  CD2 . HIS A  1 397 ? 9.069   9.160   -13.953 1.00   24.22 ? 504 HIS A CD2 1 
ATOM   3008  C  CE1 . HIS A  1 397 ? 8.403   11.195  -13.472 1.00   22.50 ? 504 HIS A CE1 1 
ATOM   3009  N  NE2 . HIS A  1 397 ? 8.811   10.413  -14.455 1.00   24.81 ? 504 HIS A NE2 1 
ATOM   3010  N  N   . LEU A  1 398 ? 10.210  7.080   -8.803  1.00   19.00 ? 505 LEU A N   1 
ATOM   3011  C  CA  . LEU A  1 398 ? 10.298  5.988   -7.856  1.00   20.36 ? 505 LEU A CA  1 
ATOM   3012  C  C   . LEU A  1 398 ? 8.970   5.936   -7.115  1.00   22.91 ? 505 LEU A C   1 
ATOM   3013  O  O   . LEU A  1 398 ? 8.547   6.945   -6.534  1.00   21.71 ? 505 LEU A O   1 
ATOM   3014  C  CB  . LEU A  1 398 ? 11.427  6.234   -6.860  1.00   19.83 ? 505 LEU A CB  1 
ATOM   3015  C  CG  . LEU A  1 398 ? 11.528  5.205   -5.727  1.00   18.68 ? 505 LEU A CG  1 
ATOM   3016  C  CD1 . LEU A  1 398 ? 12.022  3.856   -6.284  1.00   19.56 ? 505 LEU A CD1 1 
ATOM   3017  C  CD2 . LEU A  1 398 ? 12.477  5.715   -4.679  1.00   13.38 ? 505 LEU A CD2 1 
ATOM   3018  N  N   . VAL A  1 399 ? 8.312   4.774   -7.160  1.00   22.17 ? 506 VAL A N   1 
ATOM   3019  C  CA  . VAL A  1 399 ? 7.024   4.583   -6.499  1.00   21.46 ? 506 VAL A CA  1 
ATOM   3020  C  C   . VAL A  1 399 ? 7.168   3.692   -5.276  1.00   23.01 ? 506 VAL A C   1 
ATOM   3021  O  O   . VAL A  1 399 ? 7.719   2.597   -5.352  1.00   25.38 ? 506 VAL A O   1 
ATOM   3022  C  CB  . VAL A  1 399 ? 6.017   3.937   -7.434  1.00   22.02 ? 506 VAL A CB  1 
ATOM   3023  C  CG1 . VAL A  1 399 ? 4.681   3.867   -6.755  1.00   21.14 ? 506 VAL A CG1 1 
ATOM   3024  C  CG2 . VAL A  1 399 ? 5.923   4.732   -8.719  1.00   24.33 ? 506 VAL A CG2 1 
ATOM   3025  N  N   . SER A  1 400 ? 6.673   4.157   -4.138  1.00   23.88 ? 507 SER A N   1 
ATOM   3026  C  CA  . SER A  1 400 ? 6.772   3.386   -2.903  1.00   23.92 ? 507 SER A CA  1 
ATOM   3027  C  C   . SER A  1 400 ? 5.678   2.337   -2.849  1.00   25.96 ? 507 SER A C   1 
ATOM   3028  O  O   . SER A  1 400 ? 4.682   2.432   -3.569  1.00   25.62 ? 507 SER A O   1 
ATOM   3029  C  CB  . SER A  1 400 ? 6.593   4.298   -1.696  1.00   23.40 ? 507 SER A CB  1 
ATOM   3030  O  OG  . SER A  1 400 ? 5.250   4.780   -1.658  1.00   20.80 ? 507 SER A OG  1 
ATOM   3031  N  N   . PRO A  1 401 ? 5.845   1.321   -1.984  1.00   26.33 ? 508 PRO A N   1 
ATOM   3032  C  CA  . PRO A  1 401 ? 4.820   0.284   -1.878  1.00   26.14 ? 508 PRO A CA  1 
ATOM   3033  C  C   . PRO A  1 401 ? 3.453   0.898   -1.598  1.00   27.48 ? 508 PRO A C   1 
ATOM   3034  O  O   . PRO A  1 401 ? 2.440   0.387   -2.062  1.00   28.63 ? 508 PRO A O   1 
ATOM   3035  C  CB  . PRO A  1 401 ? 5.325   -0.583  -0.725  1.00   25.28 ? 508 PRO A CB  1 
ATOM   3036  C  CG  . PRO A  1 401 ? 6.806   -0.548  -0.937  1.00   25.15 ? 508 PRO A CG  1 
ATOM   3037  C  CD  . PRO A  1 401 ? 7.050   0.936   -1.222  1.00   26.44 ? 508 PRO A CD  1 
ATOM   3038  N  N   . MET A  1 402 ? 3.419   2.002   -0.855  1.00   25.84 ? 509 MET A N   1 
ATOM   3039  C  CA  . MET A  1 402 ? 2.139   2.632   -0.544  1.00   27.10 ? 509 MET A CA  1 
ATOM   3040  C  C   . MET A  1 402 ? 1.590   3.544   -1.639  1.00   26.23 ? 509 MET A C   1 
ATOM   3041  O  O   . MET A  1 402 ? 0.623   4.270   -1.418  1.00   25.43 ? 509 MET A O   1 
ATOM   3042  C  CB  . MET A  1 402 ? 2.221   3.375   0.791   1.00   29.16 ? 509 MET A CB  1 
ATOM   3043  C  CG  . MET A  1 402 ? 2.356   2.415   1.947   1.00   31.45 ? 509 MET A CG  1 
ATOM   3044  S  SD  . MET A  1 402 ? 2.532   3.213   3.543   1.00   37.81 ? 509 MET A SD  1 
ATOM   3045  C  CE  . MET A  1 402 ? 0.851   3.153   4.154   1.00   38.36 ? 509 MET A CE  1 
ATOM   3046  N  N   . GLY A  1 403 ? 2.214   3.496   -2.813  1.00   25.84 ? 510 GLY A N   1 
ATOM   3047  C  CA  . GLY A  1 403 ? 1.756   4.275   -3.947  1.00   23.13 ? 510 GLY A CA  1 
ATOM   3048  C  C   . GLY A  1 403 ? 2.257   5.696   -4.113  1.00   26.88 ? 510 GLY A C   1 
ATOM   3049  O  O   . GLY A  1 403 ? 1.775   6.416   -4.996  1.00   27.95 ? 510 GLY A O   1 
ATOM   3050  N  N   . THR A  1 404 ? 3.206   6.124   -3.287  1.00   25.44 ? 511 THR A N   1 
ATOM   3051  C  CA  . THR A  1 404 ? 3.715   7.485   -3.428  1.00   26.09 ? 511 THR A CA  1 
ATOM   3052  C  C   . THR A  1 404 ? 4.733   7.564   -4.554  1.00   24.88 ? 511 THR A C   1 
ATOM   3053  O  O   . THR A  1 404 ? 5.742   6.871   -4.555  1.00   28.44 ? 511 THR A O   1 
ATOM   3054  C  CB  . THR A  1 404 ? 4.320   7.973   -2.130  1.00   24.30 ? 511 THR A CB  1 
ATOM   3055  O  OG1 . THR A  1 404 ? 3.308   7.927   -1.119  1.00   28.36 ? 511 THR A OG1 1 
ATOM   3056  C  CG2 . THR A  1 404 ? 4.805   9.405   -2.271  1.00   22.55 ? 511 THR A CG2 1 
ATOM   3057  N  N   . ARG A  1 405 ? 4.452   8.421   -5.519  1.00   22.91 ? 512 ARG A N   1 
ATOM   3058  C  CA  . ARG A  1 405 ? 5.309   8.572   -6.674  1.00   24.99 ? 512 ARG A CA  1 
ATOM   3059  C  C   . ARG A  1 405 ? 6.259   9.761   -6.569  1.00   25.36 ? 512 ARG A C   1 
ATOM   3060  O  O   . ARG A  1 405 ? 5.839   10.914  -6.705  1.00   23.26 ? 512 ARG A O   1 
ATOM   3061  C  CB  . ARG A  1 405 ? 4.416   8.725   -7.881  1.00   24.34 ? 512 ARG A CB  1 
ATOM   3062  C  CG  . ARG A  1 405 ? 5.046   8.476   -9.189  1.00   33.24 ? 512 ARG A CG  1 
ATOM   3063  C  CD  . ARG A  1 405 ? 3.984   8.681   -10.243 1.00   39.76 ? 512 ARG A CD  1 
ATOM   3064  N  NE  . ARG A  1 405 ? 4.555   8.558   -11.565 1.00   43.31 ? 512 ARG A NE  1 
ATOM   3065  C  CZ  . ARG A  1 405 ? 4.758   7.400   -12.170 1.00   46.86 ? 512 ARG A CZ  1 
ATOM   3066  N  NH1 . ARG A  1 405 ? 4.418   6.265   -11.559 1.00   45.00 ? 512 ARG A NH1 1 
ATOM   3067  N  NH2 . ARG A  1 405 ? 5.322   7.385   -13.377 1.00   46.76 ? 512 ARG A NH2 1 
ATOM   3068  N  N   . SER A  1 406 ? 7.536   9.479   -6.330  1.00   24.20 ? 513 SER A N   1 
ATOM   3069  C  CA  . SER A  1 406 ? 8.538   10.538  -6.236  1.00   23.15 ? 513 SER A CA  1 
ATOM   3070  C  C   . SER A  1 406 ? 9.266   10.664  -7.555  1.00   22.83 ? 513 SER A C   1 
ATOM   3071  O  O   . SER A  1 406 ? 9.777   9.676   -8.080  1.00   25.34 ? 513 SER A O   1 
ATOM   3072  C  CB  . SER A  1 406 ? 9.575   10.219  -5.151  1.00   21.96 ? 513 SER A CB  1 
ATOM   3073  O  OG  . SER A  1 406 ? 8.974   10.132  -3.880  1.00   19.81 ? 513 SER A OG  1 
ATOM   3074  N  N   . THR A  1 407 ? 9.307   11.869  -8.105  1.00   23.00 ? 514 THR A N   1 
ATOM   3075  C  CA  . THR A  1 407 ? 10.042  12.070  -9.346  1.00   23.55 ? 514 THR A CA  1 
ATOM   3076  C  C   . THR A  1 407 ? 11.471  12.437  -8.936  1.00   23.94 ? 514 THR A C   1 
ATOM   3077  O  O   . THR A  1 407 ? 11.727  13.527  -8.412  1.00   24.17 ? 514 THR A O   1 
ATOM   3078  C  CB  . THR A  1 407 ? 9.406   13.181  -10.207 1.00   25.34 ? 514 THR A CB  1 
ATOM   3079  O  OG1 . THR A  1 407 ? 8.145   12.714  -10.704 1.00   29.99 ? 514 THR A OG1 1 
ATOM   3080  C  CG2 . THR A  1 407 ? 10.274  13.511  -11.388 1.00   22.11 ? 514 THR A CG2 1 
ATOM   3081  N  N   . LEU A  1 408 ? 12.384  11.492  -9.148  1.00   20.71 ? 515 LEU A N   1 
ATOM   3082  C  CA  . LEU A  1 408 ? 13.781  11.666  -8.798  1.00   19.19 ? 515 LEU A CA  1 
ATOM   3083  C  C   . LEU A  1 408 ? 14.482  12.601  -9.752  1.00   20.09 ? 515 LEU A C   1 
ATOM   3084  O  O   . LEU A  1 408 ? 15.420  13.288  -9.367  1.00   21.05 ? 515 LEU A O   1 
ATOM   3085  C  CB  . LEU A  1 408 ? 14.493  10.308  -8.805  1.00   17.63 ? 515 LEU A CB  1 
ATOM   3086  C  CG  . LEU A  1 408 ? 13.846  9.253   -7.913  1.00   15.27 ? 515 LEU A CG  1 
ATOM   3087  C  CD1 . LEU A  1 408 ? 14.683  7.987   -7.885  1.00   15.08 ? 515 LEU A CD1 1 
ATOM   3088  C  CD2 . LEU A  1 408 ? 13.700  9.816   -6.508  1.00   18.61 ? 515 LEU A CD2 1 
ATOM   3089  N  N   . LEU A  1 409 ? 14.022  12.618  -11.001 1.00   20.48 ? 516 LEU A N   1 
ATOM   3090  C  CA  . LEU A  1 409 ? 14.608  13.461  -12.026 1.00   18.95 ? 516 LEU A CA  1 
ATOM   3091  C  C   . LEU A  1 409 ? 13.603  13.810  -13.119 1.00   23.51 ? 516 LEU A C   1 
ATOM   3092  O  O   . LEU A  1 409 ? 12.994  12.924  -13.726 1.00   24.51 ? 516 LEU A O   1 
ATOM   3093  C  CB  . LEU A  1 409 ? 15.789  12.739  -12.671 1.00   16.93 ? 516 LEU A CB  1 
ATOM   3094  C  CG  . LEU A  1 409 ? 16.540  13.477  -13.782 1.00   18.75 ? 516 LEU A CG  1 
ATOM   3095  C  CD1 . LEU A  1 409 ? 17.274  14.689  -13.180 1.00   16.41 ? 516 LEU A CD1 1 
ATOM   3096  C  CD2 . LEU A  1 409 ? 17.538  12.526  -14.451 1.00   16.70 ? 516 LEU A CD2 1 
ATOM   3097  N  N   . ALA A  1 410 ? 13.428  15.101  -13.369 1.00   21.71 ? 517 ALA A N   1 
ATOM   3098  C  CA  . ALA A  1 410 ? 12.539  15.531  -14.434 1.00   23.36 ? 517 ALA A CA  1 
ATOM   3099  C  C   . ALA A  1 410 ? 13.450  15.832  -15.622 1.00   22.53 ? 517 ALA A C   1 
ATOM   3100  O  O   . ALA A  1 410 ? 14.663  15.954  -15.465 1.00   24.72 ? 517 ALA A O   1 
ATOM   3101  C  CB  . ALA A  1 410 ? 11.771  16.791  -14.014 1.00   20.20 ? 517 ALA A CB  1 
ATOM   3102  N  N   . ALA A  1 411 ? 12.879  15.950  -16.809 1.00   23.39 ? 518 ALA A N   1 
ATOM   3103  C  CA  . ALA A  1 411 ? 13.681  16.254  -17.978 1.00   23.32 ? 518 ALA A CA  1 
ATOM   3104  C  C   . ALA A  1 411 ? 14.403  17.593  -17.798 1.00   22.23 ? 518 ALA A C   1 
ATOM   3105  O  O   . ALA A  1 411 ? 13.862  18.526  -17.205 1.00   24.03 ? 518 ALA A O   1 
ATOM   3106  C  CB  . ALA A  1 411 ? 12.789  16.296  -19.221 1.00   23.59 ? 518 ALA A CB  1 
ATOM   3107  N  N   . ARG A  1 412 ? 15.639  17.666  -18.281 1.00   21.90 ? 519 ARG A N   1 
ATOM   3108  C  CA  . ARG A  1 412 ? 16.429  18.890  -18.218 1.00   24.24 ? 519 ARG A CA  1 
ATOM   3109  C  C   . ARG A  1 412 ? 16.888  19.120  -19.648 1.00   27.02 ? 519 ARG A C   1 
ATOM   3110  O  O   . ARG A  1 412 ? 17.916  18.589  -20.075 1.00   26.68 ? 519 ARG A O   1 
ATOM   3111  C  CB  . ARG A  1 412 ? 17.644  18.727  -17.293 1.00   22.48 ? 519 ARG A CB  1 
ATOM   3112  C  CG  . ARG A  1 412 ? 17.277  18.524  -15.824 1.00   24.53 ? 519 ARG A CG  1 
ATOM   3113  C  CD  . ARG A  1 412 ? 18.416  18.948  -14.891 1.00   23.10 ? 519 ARG A CD  1 
ATOM   3114  N  NE  . ARG A  1 412 ? 19.604  18.120  -15.063 1.00   22.81 ? 519 ARG A NE  1 
ATOM   3115  C  CZ  . ARG A  1 412 ? 20.824  18.466  -14.665 1.00   22.03 ? 519 ARG A CZ  1 
ATOM   3116  N  NH1 . ARG A  1 412 ? 21.842  17.642  -14.864 1.00   23.93 ? 519 ARG A NH1 1 
ATOM   3117  N  NH2 . ARG A  1 412 ? 21.031  19.636  -14.082 1.00   18.83 ? 519 ARG A NH2 1 
ATOM   3118  N  N   . PRO A  1 413 ? 16.108  19.892  -20.419 1.00   27.64 ? 520 PRO A N   1 
ATOM   3119  C  CA  . PRO A  1 413 ? 16.433  20.186  -21.817 1.00   27.32 ? 520 PRO A CA  1 
ATOM   3120  C  C   . PRO A  1 413 ? 17.840  20.695  -22.127 1.00   28.07 ? 520 PRO A C   1 
ATOM   3121  O  O   . PRO A  1 413 ? 18.355  20.446  -23.212 1.00   25.56 ? 520 PRO A O   1 
ATOM   3122  C  CB  . PRO A  1 413 ? 15.332  21.170  -22.240 1.00   24.68 ? 520 PRO A CB  1 
ATOM   3123  C  CG  . PRO A  1 413 ? 14.745  21.651  -20.949 1.00   26.88 ? 520 PRO A CG  1 
ATOM   3124  C  CD  . PRO A  1 413 ? 14.796  20.452  -20.066 1.00   25.80 ? 520 PRO A CD  1 
ATOM   3125  N  N   . HIS A  1 414 ? 18.479  21.393  -21.195 1.00   27.77 ? 521 HIS A N   1 
ATOM   3126  C  CA  . HIS A  1 414 ? 19.818  21.893  -21.477 1.00   27.00 ? 521 HIS A CA  1 
ATOM   3127  C  C   . HIS A  1 414 ? 20.917  20.860  -21.176 1.00   27.83 ? 521 HIS A C   1 
ATOM   3128  O  O   . HIS A  1 414 ? 22.083  21.062  -21.513 1.00   28.20 ? 521 HIS A O   1 
ATOM   3129  C  CB  . HIS A  1 414 ? 20.086  23.170  -20.679 1.00   27.02 ? 521 HIS A CB  1 
ATOM   3130  C  CG  . HIS A  1 414 ? 19.163  24.302  -21.009 1.00   29.22 ? 521 HIS A CG  1 
ATOM   3131  N  ND1 . HIS A  1 414 ? 18.968  24.753  -22.295 1.00   30.31 ? 521 HIS A ND1 1 
ATOM   3132  C  CD2 . HIS A  1 414 ? 18.423  25.108  -20.212 1.00   30.57 ? 521 HIS A CD2 1 
ATOM   3133  C  CE1 . HIS A  1 414 ? 18.150  25.789  -22.277 1.00   32.93 ? 521 HIS A CE1 1 
ATOM   3134  N  NE2 . HIS A  1 414 ? 17.804  26.025  -21.025 1.00   34.25 ? 521 HIS A NE2 1 
ATOM   3135  N  N   . ASP A  1 415 ? 20.549  19.753  -20.546 1.00   26.12 ? 522 ASP A N   1 
ATOM   3136  C  CA  . ASP A  1 415 ? 21.526  18.727  -20.200 1.00   28.33 ? 522 ASP A CA  1 
ATOM   3137  C  C   . ASP A  1 415 ? 21.776  17.756  -21.352 1.00   29.34 ? 522 ASP A C   1 
ATOM   3138  O  O   . ASP A  1 415 ? 21.048  16.786  -21.535 1.00   30.14 ? 522 ASP A O   1 
ATOM   3139  C  CB  . ASP A  1 415 ? 21.064  17.956  -18.958 1.00   25.05 ? 522 ASP A CB  1 
ATOM   3140  C  CG  . ASP A  1 415 ? 22.112  16.981  -18.455 1.00   26.44 ? 522 ASP A CG  1 
ATOM   3141  O  OD1 . ASP A  1 415 ? 23.236  16.986  -19.008 1.00   25.99 ? 522 ASP A OD1 1 
ATOM   3142  O  OD2 . ASP A  1 415 ? 21.816  16.218  -17.508 1.00   25.51 ? 522 ASP A OD2 1 
ATOM   3143  N  N   . TYR A  1 416 ? 22.825  18.027  -22.114 1.00   33.13 ? 523 TYR A N   1 
ATOM   3144  C  CA  . TYR A  1 416 ? 23.195  17.212  -23.263 1.00   36.31 ? 523 TYR A CA  1 
ATOM   3145  C  C   . TYR A  1 416 ? 24.353  16.274  -22.926 1.00   34.08 ? 523 TYR A C   1 
ATOM   3146  O  O   . TYR A  1 416 ? 24.974  15.694  -23.814 1.00   32.54 ? 523 TYR A O   1 
ATOM   3147  C  CB  . TYR A  1 416 ? 23.605  18.136  -24.402 1.00   44.81 ? 523 TYR A CB  1 
ATOM   3148  C  CG  . TYR A  1 416 ? 24.740  19.072  -24.003 1.00   56.95 ? 523 TYR A CG  1 
ATOM   3149  C  CD1 . TYR A  1 416 ? 25.176  19.157  -22.674 1.00   63.25 ? 523 TYR A CD1 1 
ATOM   3150  C  CD2 . TYR A  1 416 ? 25.372  19.877  -24.941 1.00   62.05 ? 523 TYR A CD2 1 
ATOM   3151  C  CE1 . TYR A  1 416 ? 26.213  20.019  -22.295 1.00   67.86 ? 523 TYR A CE1 1 
ATOM   3152  C  CE2 . TYR A  1 416 ? 26.415  20.745  -24.574 1.00   67.45 ? 523 TYR A CE2 1 
ATOM   3153  C  CZ  . TYR A  1 416 ? 26.827  20.811  -23.249 1.00   68.04 ? 523 TYR A CZ  1 
ATOM   3154  O  OH  . TYR A  1 416 ? 27.845  21.668  -22.878 1.00   70.31 ? 523 TYR A OH  1 
ATOM   3155  N  N   . SER A  1 417 ? 24.644  16.128  -21.640 1.00   31.69 ? 524 SER A N   1 
ATOM   3156  C  CA  . SER A  1 417 ? 25.740  15.277  -21.203 1.00   28.12 ? 524 SER A CA  1 
ATOM   3157  C  C   . SER A  1 417 ? 25.581  13.824  -21.604 1.00   29.05 ? 524 SER A C   1 
ATOM   3158  O  O   . SER A  1 417 ? 24.472  13.274  -21.627 1.00   27.74 ? 524 SER A O   1 
ATOM   3159  C  CB  . SER A  1 417 ? 25.899  15.360  -19.686 1.00   28.53 ? 524 SER A CB  1 
ATOM   3160  O  OG  . SER A  1 417 ? 26.843  14.413  -19.222 1.00   26.85 ? 524 SER A OG  1 
ATOM   3161  N  N   . ALA A  1 418 ? 26.708  13.201  -21.915 1.00   29.16 ? 525 ALA A N   1 
ATOM   3162  C  CA  . ALA A  1 418 ? 26.728  11.800  -22.304 1.00   29.73 ? 525 ALA A CA  1 
ATOM   3163  C  C   . ALA A  1 418 ? 27.414  10.995  -21.210 1.00   30.88 ? 525 ALA A C   1 
ATOM   3164  O  O   . ALA A  1 418 ? 27.752  9.836   -21.414 1.00   30.80 ? 525 ALA A O   1 
ATOM   3165  C  CB  . ALA A  1 418 ? 27.483  11.644  -23.610 1.00   30.74 ? 525 ALA A CB  1 
ATOM   3166  N  N   . ASP A  1 419 ? 27.620  11.613  -20.048 1.00   31.09 ? 526 ASP A N   1 
ATOM   3167  C  CA  . ASP A  1 419 ? 28.284  10.937  -18.933 1.00   32.02 ? 526 ASP A CA  1 
ATOM   3168  C  C   . ASP A  1 419 ? 27.363  10.183  -17.987 1.00   29.83 ? 526 ASP A C   1 
ATOM   3169  O  O   . ASP A  1 419 ? 27.841  9.556   -17.048 1.00   31.04 ? 526 ASP A O   1 
ATOM   3170  C  CB  . ASP A  1 419 ? 29.102  11.927  -18.103 1.00   33.86 ? 526 ASP A CB  1 
ATOM   3171  C  CG  . ASP A  1 419 ? 30.164  12.635  -18.918 1.00   37.91 ? 526 ASP A CG  1 
ATOM   3172  O  OD1 . ASP A  1 419 ? 30.821  11.982  -19.757 1.00   39.74 ? 526 ASP A OD1 1 
ATOM   3173  O  OD2 . ASP A  1 419 ? 30.350  13.850  -18.711 1.00   40.94 ? 526 ASP A OD2 1 
ATOM   3174  N  N   . GLY A  1 420 ? 26.056  10.243  -18.217 1.00   27.82 ? 527 GLY A N   1 
ATOM   3175  C  CA  . GLY A  1 420 ? 25.124  9.542   -17.344 1.00   27.87 ? 527 GLY A CA  1 
ATOM   3176  C  C   . GLY A  1 420 ? 25.257  9.865   -15.854 1.00   28.10 ? 527 GLY A C   1 
ATOM   3177  O  O   . GLY A  1 420 ? 25.646  10.980  -15.480 1.00   25.12 ? 527 GLY A O   1 
ATOM   3178  N  N   . PHE A  1 421 ? 24.926  8.891   -15.006 1.00   25.10 ? 528 PHE A N   1 
ATOM   3179  C  CA  . PHE A  1 421 ? 25.014  9.055   -13.560 1.00   24.83 ? 528 PHE A CA  1 
ATOM   3180  C  C   . PHE A  1 421 ? 25.892  7.964   -12.977 1.00   28.61 ? 528 PHE A C   1 
ATOM   3181  O  O   . PHE A  1 421 ? 25.721  6.779   -13.276 1.00   28.75 ? 528 PHE A O   1 
ATOM   3182  C  CB  . PHE A  1 421 ? 23.635  8.975   -12.921 1.00   24.92 ? 528 PHE A CB  1 
ATOM   3183  C  CG  . PHE A  1 421 ? 22.780  10.172  -13.184 1.00   25.84 ? 528 PHE A CG  1 
ATOM   3184  C  CD1 . PHE A  1 421 ? 23.039  11.384  -12.540 1.00   25.88 ? 528 PHE A CD1 1 
ATOM   3185  C  CD2 . PHE A  1 421 ? 21.740  10.106  -14.101 1.00   24.30 ? 528 PHE A CD2 1 
ATOM   3186  C  CE1 . PHE A  1 421 ? 22.270  12.518  -12.808 1.00   24.35 ? 528 PHE A CE1 1 
ATOM   3187  C  CE2 . PHE A  1 421 ? 20.967  11.227  -14.377 1.00   24.56 ? 528 PHE A CE2 1 
ATOM   3188  C  CZ  . PHE A  1 421 ? 21.237  12.440  -13.725 1.00   24.98 ? 528 PHE A CZ  1 
ATOM   3189  N  N   . ASN A  1 422 ? 26.834  8.372   -12.136 1.00   29.34 ? 529 ASN A N   1 
ATOM   3190  C  CA  . ASN A  1 422 ? 27.754  7.439   -11.518 1.00   28.81 ? 529 ASN A CA  1 
ATOM   3191  C  C   . ASN A  1 422 ? 27.461  7.328   -10.023 1.00   27.45 ? 529 ASN A C   1 
ATOM   3192  O  O   . ASN A  1 422 ? 27.912  8.137   -9.216  1.00   29.01 ? 529 ASN A O   1 
ATOM   3193  C  CB  . ASN A  1 422 ? 29.179  7.916   -11.783 1.00   32.12 ? 529 ASN A CB  1 
ATOM   3194  C  CG  . ASN A  1 422 ? 30.227  6.961   -11.252 1.00   38.30 ? 529 ASN A CG  1 
ATOM   3195  O  OD1 . ASN A  1 422 ? 30.016  5.748   -11.198 1.00   41.77 ? 529 ASN A OD1 1 
ATOM   3196  N  ND2 . ASN A  1 422 ? 31.378  7.506   -10.869 1.00   39.28 ? 529 ASN A ND2 1 
ATOM   3197  N  N   . ASP A  1 423 ? 26.699  6.305   -9.665  1.00   26.62 ? 530 ASP A N   1 
ATOM   3198  C  CA  . ASP A  1 423 ? 26.290  6.067   -8.285  1.00   26.10 ? 530 ASP A CA  1 
ATOM   3199  C  C   . ASP A  1 423 ? 25.735  7.341   -7.651  1.00   25.68 ? 530 ASP A C   1 
ATOM   3200  O  O   . ASP A  1 423 ? 26.118  7.706   -6.543  1.00   28.60 ? 530 ASP A O   1 
ATOM   3201  C  CB  . ASP A  1 423 ? 27.459  5.519   -7.452  1.00   24.55 ? 530 ASP A CB  1 
ATOM   3202  C  CG  . ASP A  1 423 ? 27.031  5.081   -6.043  1.00   27.34 ? 530 ASP A CG  1 
ATOM   3203  O  OD1 . ASP A  1 423 ? 25.870  4.649   -5.872  1.00   25.31 ? 530 ASP A OD1 1 
ATOM   3204  O  OD2 . ASP A  1 423 ? 27.856  5.151   -5.100  1.00   29.82 ? 530 ASP A OD2 1 
ATOM   3205  N  N   . TRP A  1 424 ? 24.832  8.016   -8.360  1.00   24.90 ? 531 TRP A N   1 
ATOM   3206  C  CA  . TRP A  1 424 ? 24.234  9.239   -7.850  1.00   22.13 ? 531 TRP A CA  1 
ATOM   3207  C  C   . TRP A  1 424 ? 23.060  8.875   -6.947  1.00   23.03 ? 531 TRP A C   1 
ATOM   3208  O  O   . TRP A  1 424 ? 22.191  8.092   -7.332  1.00   21.19 ? 531 TRP A O   1 
ATOM   3209  C  CB  . TRP A  1 424 ? 23.772  10.131  -8.993  1.00   22.16 ? 531 TRP A CB  1 
ATOM   3210  C  CG  . TRP A  1 424 ? 23.320  11.448  -8.483  1.00   25.87 ? 531 TRP A CG  1 
ATOM   3211  C  CD1 . TRP A  1 424 ? 22.035  11.845  -8.281  1.00   27.36 ? 531 TRP A CD1 1 
ATOM   3212  C  CD2 . TRP A  1 424 ? 24.152  12.527  -8.028  1.00   23.59 ? 531 TRP A CD2 1 
ATOM   3213  N  NE1 . TRP A  1 424 ? 22.008  13.100  -7.727  1.00   27.19 ? 531 TRP A NE1 1 
ATOM   3214  C  CE2 . TRP A  1 424 ? 23.291  13.546  -7.559  1.00   24.39 ? 531 TRP A CE2 1 
ATOM   3215  C  CE3 . TRP A  1 424 ? 25.533  12.729  -7.968  1.00   22.37 ? 531 TRP A CE3 1 
ATOM   3216  C  CZ2 . TRP A  1 424 ? 23.766  14.758  -7.037  1.00   21.54 ? 531 TRP A CZ2 1 
ATOM   3217  C  CZ3 . TRP A  1 424 ? 26.012  13.937  -7.443  1.00   25.22 ? 531 TRP A CZ3 1 
ATOM   3218  C  CH2 . TRP A  1 424 ? 25.125  14.936  -6.986  1.00   24.21 ? 531 TRP A CH2 1 
ATOM   3219  N  N   . ALA A  1 425 ? 23.030  9.450   -5.745  1.00   22.60 ? 532 ALA A N   1 
ATOM   3220  C  CA  . ALA A  1 425 ? 21.986  9.123   -4.768  1.00   23.97 ? 532 ALA A CA  1 
ATOM   3221  C  C   . ALA A  1 425 ? 20.748  10.008  -4.742  1.00   23.58 ? 532 ALA A C   1 
ATOM   3222  O  O   . ALA A  1 425 ? 20.598  10.829  -3.833  1.00   25.47 ? 532 ALA A O   1 
ATOM   3223  C  CB  . ALA A  1 425 ? 22.596  9.077   -3.360  1.00   19.08 ? 532 ALA A CB  1 
ATOM   3224  N  N   . PHE A  1 426 ? 19.859  9.833   -5.715  1.00   21.11 ? 533 PHE A N   1 
ATOM   3225  C  CA  . PHE A  1 426 ? 18.623  10.604  -5.768  1.00   19.84 ? 533 PHE A CA  1 
ATOM   3226  C  C   . PHE A  1 426 ? 17.885  10.362  -4.452  1.00   20.20 ? 533 PHE A C   1 
ATOM   3227  O  O   . PHE A  1 426 ? 17.715  9.213   -4.026  1.00   21.52 ? 533 PHE A O   1 
ATOM   3228  C  CB  . PHE A  1 426 ? 17.764  10.137  -6.947  1.00   20.75 ? 533 PHE A CB  1 
ATOM   3229  C  CG  . PHE A  1 426 ? 18.405  10.367  -8.302  1.00   19.60 ? 533 PHE A CG  1 
ATOM   3230  C  CD1 . PHE A  1 426 ? 18.219  11.559  -8.981  1.00   20.17 ? 533 PHE A CD1 1 
ATOM   3231  C  CD2 . PHE A  1 426 ? 19.158  9.371   -8.908  1.00   17.45 ? 533 PHE A CD2 1 
ATOM   3232  C  CE1 . PHE A  1 426 ? 18.763  11.757  -10.249 1.00   20.41 ? 533 PHE A CE1 1 
ATOM   3233  C  CE2 . PHE A  1 426 ? 19.704  9.562   -10.165 1.00   20.17 ? 533 PHE A CE2 1 
ATOM   3234  C  CZ  . PHE A  1 426 ? 19.502  10.764  -10.842 1.00   19.85 ? 533 PHE A CZ  1 
ATOM   3235  N  N   . MET A  1 427 ? 17.438  11.436  -3.814  1.00   18.64 ? 534 MET A N   1 
ATOM   3236  C  CA  . MET A  1 427 ? 16.766  11.318  -2.531  1.00   17.46 ? 534 MET A CA  1 
ATOM   3237  C  C   . MET A  1 427 ? 15.356  11.875  -2.563  1.00   19.61 ? 534 MET A C   1 
ATOM   3238  O  O   . MET A  1 427 ? 15.075  12.836  -3.289  1.00   22.38 ? 534 MET A O   1 
ATOM   3239  C  CB  . MET A  1 427 ? 17.596  12.051  -1.464  1.00   16.85 ? 534 MET A CB  1 
ATOM   3240  C  CG  . MET A  1 427 ? 17.145  11.850  0.002   1.00   15.02 ? 534 MET A CG  1 
ATOM   3241  S  SD  . MET A  1 427 ? 15.794  12.959  0.515   1.00   19.83 ? 534 MET A SD  1 
ATOM   3242  C  CE  . MET A  1 427 ? 16.724  14.475  1.078   1.00   11.33 ? 534 MET A CE  1 
ATOM   3243  N  N   . THR A  1 428 ? 14.465  11.252  -1.796  1.00   18.46 ? 535 THR A N   1 
ATOM   3244  C  CA  . THR A  1 428 ? 13.087  11.721  -1.706  1.00   19.99 ? 535 THR A CA  1 
ATOM   3245  C  C   . THR A  1 428 ? 12.632  11.734  -0.257  1.00   20.48 ? 535 THR A C   1 
ATOM   3246  O  O   . THR A  1 428 ? 12.969  10.847  0.538   1.00   18.06 ? 535 THR A O   1 
ATOM   3247  C  CB  . THR A  1 428 ? 12.087  10.847  -2.499  1.00   21.42 ? 535 THR A CB  1 
ATOM   3248  O  OG1 . THR A  1 428 ? 10.766  11.359  -2.300  1.00   21.25 ? 535 THR A OG1 1 
ATOM   3249  C  CG2 . THR A  1 428 ? 12.109  9.408   -2.003  1.00   21.65 ? 535 THR A CG2 1 
ATOM   3250  N  N   . THR A  1 429 ? 11.864  12.760  0.077   1.00   21.00 ? 536 THR A N   1 
ATOM   3251  C  CA  . THR A  1 429 ? 11.333  12.920  1.426   1.00   18.84 ? 536 THR A CA  1 
ATOM   3252  C  C   . THR A  1 429 ? 9.835   12.642  1.402   1.00   18.91 ? 536 THR A C   1 
ATOM   3253  O  O   . THR A  1 429 ? 9.171   12.680  2.434   1.00   21.21 ? 536 THR A O   1 
ATOM   3254  C  CB  . THR A  1 429 ? 11.494  14.353  1.881   1.00   19.05 ? 536 THR A CB  1 
ATOM   3255  O  OG1 . THR A  1 429 ? 10.787  15.195  0.959   1.00   19.02 ? 536 THR A OG1 1 
ATOM   3256  C  CG2 . THR A  1 429 ? 12.979  14.757  1.919   1.00   19.64 ? 536 THR A CG2 1 
ATOM   3257  N  N   . HIS A  1 430 ? 9.306   12.364  0.218   1.00   18.52 ? 537 HIS A N   1 
ATOM   3258  C  CA  . HIS A  1 430 ? 7.873   12.162  0.057   1.00   21.47 ? 537 HIS A CA  1 
ATOM   3259  C  C   . HIS A  1 430 ? 7.221   10.946  0.710   1.00   22.25 ? 537 HIS A C   1 
ATOM   3260  O  O   . HIS A  1 430 ? 6.004   10.928  0.886   1.00   19.42 ? 537 HIS A O   1 
ATOM   3261  C  CB  . HIS A  1 430 ? 7.511   12.187  -1.435  1.00   22.14 ? 537 HIS A CB  1 
ATOM   3262  C  CG  . HIS A  1 430 ? 7.697   13.524  -2.084  1.00   20.97 ? 537 HIS A CG  1 
ATOM   3263  N  ND1 . HIS A  1 430 ? 6.927   13.945  -3.147  1.00   21.48 ? 537 HIS A ND1 1 
ATOM   3264  C  CD2 . HIS A  1 430 ? 8.567   14.531  -1.827  1.00   22.83 ? 537 HIS A CD2 1 
ATOM   3265  C  CE1 . HIS A  1 430 ? 7.315   15.153  -3.518  1.00   22.40 ? 537 HIS A CE1 1 
ATOM   3266  N  NE2 . HIS A  1 430 ? 8.310   15.531  -2.732  1.00   20.48 ? 537 HIS A NE2 1 
ATOM   3267  N  N   . SER A  1 431 ? 8.007   9.936   1.069   1.00   21.67 ? 538 SER A N   1 
ATOM   3268  C  CA  . SER A  1 431 ? 7.434   8.756   1.691   1.00   21.77 ? 538 SER A CA  1 
ATOM   3269  C  C   . SER A  1 431 ? 7.720   8.706   3.185   1.00   23.53 ? 538 SER A C   1 
ATOM   3270  O  O   . SER A  1 431 ? 7.630   7.656   3.820   1.00   25.01 ? 538 SER A O   1 
ATOM   3271  C  CB  . SER A  1 431 ? 7.950   7.497   1.001   1.00   24.21 ? 538 SER A CB  1 
ATOM   3272  O  OG  . SER A  1 431 ? 7.309   7.322   -0.258  1.00   25.92 ? 538 SER A OG  1 
ATOM   3273  N  N   . TRP A  1 432 ? 8.052   9.861   3.741   1.00   21.13 ? 539 TRP A N   1 
ATOM   3274  C  CA  . TRP A  1 432 ? 8.349   9.986   5.156   1.00   20.32 ? 539 TRP A CA  1 
ATOM   3275  C  C   . TRP A  1 432 ? 7.216   9.393   5.996   1.00   20.13 ? 539 TRP A C   1 
ATOM   3276  O  O   . TRP A  1 432 ? 6.057   9.741   5.811   1.00   19.04 ? 539 TRP A O   1 
ATOM   3277  C  CB  . TRP A  1 432 ? 8.526   11.470  5.465   1.00   18.99 ? 539 TRP A CB  1 
ATOM   3278  C  CG  . TRP A  1 432 ? 9.172   11.765  6.759   1.00   19.58 ? 539 TRP A CG  1 
ATOM   3279  C  CD1 . TRP A  1 432 ? 8.580   11.797  7.988   1.00   19.90 ? 539 TRP A CD1 1 
ATOM   3280  C  CD2 . TRP A  1 432 ? 10.544  12.127  6.959   1.00   21.11 ? 539 TRP A CD2 1 
ATOM   3281  N  NE1 . TRP A  1 432 ? 9.498   12.165  8.948   1.00   18.41 ? 539 TRP A NE1 1 
ATOM   3282  C  CE2 . TRP A  1 432 ? 10.713  12.376  8.344   1.00   19.40 ? 539 TRP A CE2 1 
ATOM   3283  C  CE3 . TRP A  1 432 ? 11.649  12.267  6.104   1.00   17.54 ? 539 TRP A CE3 1 
ATOM   3284  C  CZ2 . TRP A  1 432 ? 11.943  12.763  8.895   1.00   15.58 ? 539 TRP A CZ2 1 
ATOM   3285  C  CZ3 . TRP A  1 432 ? 12.874  12.649  6.653   1.00   17.24 ? 539 TRP A CZ3 1 
ATOM   3286  C  CH2 . TRP A  1 432 ? 13.008  12.894  8.036   1.00   15.21 ? 539 TRP A CH2 1 
ATOM   3287  N  N   . ASP A  1 433 ? 7.570   8.509   6.927   1.00   22.47 ? 540 ASP A N   1 
ATOM   3288  C  CA  . ASP A  1 433 ? 6.625   7.825   7.828   1.00   23.05 ? 540 ASP A CA  1 
ATOM   3289  C  C   . ASP A  1 433 ? 5.856   6.653   7.222   1.00   22.94 ? 540 ASP A C   1 
ATOM   3290  O  O   . ASP A  1 433 ? 5.106   5.988   7.922   1.00   24.11 ? 540 ASP A O   1 
ATOM   3291  C  CB  . ASP A  1 433 ? 5.625   8.798   8.465   1.00   20.64 ? 540 ASP A CB  1 
ATOM   3292  C  CG  . ASP A  1 433 ? 6.222   9.577   9.629   1.00   23.77 ? 540 ASP A CG  1 
ATOM   3293  O  OD1 . ASP A  1 433 ? 7.108   9.048   10.331  1.00   24.36 ? 540 ASP A OD1 1 
ATOM   3294  O  OD2 . ASP A  1 433 ? 5.794   10.720  9.865   1.00   21.09 ? 540 ASP A OD2 1 
ATOM   3295  N  N   . GLU A  1 434 ? 6.045   6.388   5.937   1.00   21.03 ? 541 GLU A N   1 
ATOM   3296  C  CA  . GLU A  1 434 ? 5.375   5.253   5.310   1.00   21.68 ? 541 GLU A CA  1 
ATOM   3297  C  C   . GLU A  1 434 ? 6.088   3.958   5.706   1.00   25.04 ? 541 GLU A C   1 
ATOM   3298  O  O   . GLU A  1 434 ? 7.245   3.974   6.149   1.00   27.20 ? 541 GLU A O   1 
ATOM   3299  C  CB  . GLU A  1 434 ? 5.431   5.359   3.784   1.00   21.00 ? 541 GLU A CB  1 
ATOM   3300  C  CG  . GLU A  1 434 ? 4.587   6.457   3.179   1.00   18.77 ? 541 GLU A CG  1 
ATOM   3301  C  CD  . GLU A  1 434 ? 4.660   6.486   1.654   1.00   24.27 ? 541 GLU A CD  1 
ATOM   3302  O  OE1 . GLU A  1 434 ? 5.336   5.620   1.037   1.00   21.76 ? 541 GLU A OE1 1 
ATOM   3303  O  OE2 . GLU A  1 434 ? 4.026   7.386   1.069   1.00   23.02 ? 541 GLU A OE2 1 
ATOM   3304  N  N   . ASP A  1 435 ? 5.396   2.832   5.553   1.00   26.39 ? 542 ASP A N   1 
ATOM   3305  C  CA  . ASP A  1 435 ? 6.014   1.545   5.817   1.00   23.54 ? 542 ASP A CA  1 
ATOM   3306  C  C   . ASP A  1 435 ? 6.649   1.243   4.472   1.00   22.98 ? 542 ASP A C   1 
ATOM   3307  O  O   . ASP A  1 435 ? 5.962   1.196   3.458   1.00   23.44 ? 542 ASP A O   1 
ATOM   3308  C  CB  . ASP A  1 435 ? 4.987   0.474   6.135   1.00   28.05 ? 542 ASP A CB  1 
ATOM   3309  C  CG  . ASP A  1 435 ? 5.644   -0.858  6.476   1.00   31.88 ? 542 ASP A CG  1 
ATOM   3310  O  OD1 . ASP A  1 435 ? 6.534   -1.294  5.705   1.00   31.29 ? 542 ASP A OD1 1 
ATOM   3311  O  OD2 . ASP A  1 435 ? 5.283   -1.456  7.508   1.00   33.33 ? 542 ASP A OD2 1 
ATOM   3312  N  N   . PRO A  1 436 ? 7.970   1.043   4.442   1.00   24.00 ? 543 PRO A N   1 
ATOM   3313  C  CA  . PRO A  1 436 ? 8.672   0.757   3.185   1.00   23.03 ? 543 PRO A CA  1 
ATOM   3314  C  C   . PRO A  1 436 ? 8.658   -0.677  2.655   1.00   24.93 ? 543 PRO A C   1 
ATOM   3315  O  O   . PRO A  1 436 ? 9.186   -0.940  1.575   1.00   25.24 ? 543 PRO A O   1 
ATOM   3316  C  CB  . PRO A  1 436 ? 10.084  1.236   3.478   1.00   23.53 ? 543 PRO A CB  1 
ATOM   3317  C  CG  . PRO A  1 436 ? 10.249  0.851   4.931   1.00   22.48 ? 543 PRO A CG  1 
ATOM   3318  C  CD  . PRO A  1 436 ? 8.918   1.257   5.552   1.00   24.55 ? 543 PRO A CD  1 
ATOM   3319  N  N   . SER A  1 437 ? 8.079   -1.613  3.393   1.00   25.62 ? 544 SER A N   1 
ATOM   3320  C  CA  . SER A  1 437 ? 8.068   -2.991  2.900   1.00   28.94 ? 544 SER A CA  1 
ATOM   3321  C  C   . SER A  1 437 ? 7.005   -3.164  1.825   1.00   28.84 ? 544 SER A C   1 
ATOM   3322  O  O   . SER A  1 437 ? 5.926   -2.568  1.891   1.00   28.45 ? 544 SER A O   1 
ATOM   3323  C  CB  . SER A  1 437 ? 7.845   -3.996  4.040   1.00   26.53 ? 544 SER A CB  1 
ATOM   3324  O  OG  . SER A  1 437 ? 6.658   -3.724  4.754   1.00   32.42 ? 544 SER A OG  1 
ATOM   3325  N  N   . GLY A  1 438 ? 7.327   -3.976  0.826   1.00   27.89 ? 545 GLY A N   1 
ATOM   3326  C  CA  . GLY A  1 438 ? 6.404   -4.189  -0.262  1.00   26.23 ? 545 GLY A CA  1 
ATOM   3327  C  C   . GLY A  1 438 ? 7.115   -3.940  -1.570  1.00   28.71 ? 545 GLY A C   1 
ATOM   3328  O  O   . GLY A  1 438 ? 8.349   -3.910  -1.620  1.00   28.92 ? 545 GLY A O   1 
ATOM   3329  N  N   . GLU A  1 439 ? 6.343   -3.738  -2.630  1.00   27.14 ? 546 GLU A N   1 
ATOM   3330  C  CA  . GLU A  1 439 ? 6.925   -3.519  -3.937  1.00   30.43 ? 546 GLU A CA  1 
ATOM   3331  C  C   . GLU A  1 439 ? 7.237   -2.059  -4.274  1.00   30.82 ? 546 GLU A C   1 
ATOM   3332  O  O   . GLU A  1 439 ? 6.376   -1.179  -4.174  1.00   30.41 ? 546 GLU A O   1 
ATOM   3333  C  CB  . GLU A  1 439 ? 6.005   -4.102  -5.015  1.00   31.98 ? 546 GLU A CB  1 
ATOM   3334  C  CG  . GLU A  1 439 ? 6.499   -3.843  -6.422  1.00   34.38 ? 546 GLU A CG  1 
ATOM   3335  C  CD  . GLU A  1 439 ? 5.605   -4.454  -7.484  1.00   37.78 ? 546 GLU A CD  1 
ATOM   3336  O  OE1 . GLU A  1 439 ? 6.019   -5.450  -8.114  1.00   36.12 ? 546 GLU A OE1 1 
ATOM   3337  O  OE2 . GLU A  1 439 ? 4.486   -3.934  -7.686  1.00   42.26 ? 546 GLU A OE2 1 
ATOM   3338  N  N   . TRP A  1 440 ? 8.486   -1.818  -4.665  1.00   29.65 ? 547 TRP A N   1 
ATOM   3339  C  CA  . TRP A  1 440 ? 8.937   -0.498  -5.084  1.00   27.48 ? 547 TRP A CA  1 
ATOM   3340  C  C   . TRP A  1 440 ? 9.076   -0.593  -6.596  1.00   26.64 ? 547 TRP A C   1 
ATOM   3341  O  O   . TRP A  1 440 ? 9.394   -1.662  -7.126  1.00   26.69 ? 547 TRP A O   1 
ATOM   3342  C  CB  . TRP A  1 440 ? 10.307  -0.146  -4.487  1.00   24.68 ? 547 TRP A CB  1 
ATOM   3343  C  CG  . TRP A  1 440 ? 10.283  0.243   -3.037  1.00   23.58 ? 547 TRP A CG  1 
ATOM   3344  C  CD1 . TRP A  1 440 ? 10.266  -0.596  -1.957  1.00   22.92 ? 547 TRP A CD1 1 
ATOM   3345  C  CD2 . TRP A  1 440 ? 10.273  1.571   -2.509  1.00   22.23 ? 547 TRP A CD2 1 
ATOM   3346  N  NE1 . TRP A  1 440 ? 10.249  0.128   -0.789  1.00   19.32 ? 547 TRP A NE1 1 
ATOM   3347  C  CE2 . TRP A  1 440 ? 10.252  1.461   -1.096  1.00   22.50 ? 547 TRP A CE2 1 
ATOM   3348  C  CE3 . TRP A  1 440 ? 10.283  2.848   -3.090  1.00   19.89 ? 547 TRP A CE3 1 
ATOM   3349  C  CZ2 . TRP A  1 440 ? 10.235  2.584   -0.252  1.00   21.71 ? 547 TRP A CZ2 1 
ATOM   3350  C  CZ3 . TRP A  1 440 ? 10.267  3.964   -2.250  1.00   21.28 ? 547 TRP A CZ3 1 
ATOM   3351  C  CH2 . TRP A  1 440 ? 10.244  3.821   -0.841  1.00   16.49 ? 547 TRP A CH2 1 
ATOM   3352  N  N   . VAL A  1 441 ? 8.840   0.515   -7.288  1.00   24.91 ? 548 VAL A N   1 
ATOM   3353  C  CA  . VAL A  1 441 ? 8.955   0.534   -8.740  1.00   25.24 ? 548 VAL A CA  1 
ATOM   3354  C  C   . VAL A  1 441 ? 9.785   1.734   -9.188  1.00   25.72 ? 548 VAL A C   1 
ATOM   3355  O  O   . VAL A  1 441 ? 9.524   2.871   -8.784  1.00   24.23 ? 548 VAL A O   1 
ATOM   3356  C  CB  . VAL A  1 441 ? 7.566   0.626   -9.426  1.00   22.41 ? 548 VAL A CB  1 
ATOM   3357  C  CG1 . VAL A  1 441 ? 7.719   0.534   -10.923 1.00   20.31 ? 548 VAL A CG1 1 
ATOM   3358  C  CG2 . VAL A  1 441 ? 6.654   -0.472  -8.915  1.00   21.00 ? 548 VAL A CG2 1 
ATOM   3359  N  N   . LEU A  1 442 ? 10.792  1.459   -10.011 1.00   24.51 ? 549 LEU A N   1 
ATOM   3360  C  CA  . LEU A  1 442 ? 11.650  2.499   -10.550 1.00   27.15 ? 549 LEU A CA  1 
ATOM   3361  C  C   . LEU A  1 442 ? 11.268  2.633   -12.018 1.00   25.76 ? 549 LEU A C   1 
ATOM   3362  O  O   . LEU A  1 442 ? 11.202  1.636   -12.735 1.00   26.98 ? 549 LEU A O   1 
ATOM   3363  C  CB  . LEU A  1 442 ? 13.124  2.092   -10.433 1.00   25.12 ? 549 LEU A CB  1 
ATOM   3364  C  CG  . LEU A  1 442 ? 14.129  3.135   -10.919 1.00   25.40 ? 549 LEU A CG  1 
ATOM   3365  C  CD1 . LEU A  1 442 ? 14.210  4.223   -9.875  1.00   26.87 ? 549 LEU A CD1 1 
ATOM   3366  C  CD2 . LEU A  1 442 ? 15.492  2.519   -11.154 1.00   24.18 ? 549 LEU A CD2 1 
ATOM   3367  N  N   . GLU A  1 443 ? 11.010  3.855   -12.461 1.00   26.26 ? 550 GLU A N   1 
ATOM   3368  C  CA  . GLU A  1 443 ? 10.635  4.081   -13.847 1.00   26.35 ? 550 GLU A CA  1 
ATOM   3369  C  C   . GLU A  1 443 ? 11.606  5.043   -14.483 1.00   26.87 ? 550 GLU A C   1 
ATOM   3370  O  O   . GLU A  1 443 ? 11.862  6.113   -13.935 1.00   27.71 ? 550 GLU A O   1 
ATOM   3371  C  CB  . GLU A  1 443 ? 9.234   4.677   -13.932 1.00   28.34 ? 550 GLU A CB  1 
ATOM   3372  C  CG  . GLU A  1 443 ? 8.202   3.964   -13.075 1.00   35.21 ? 550 GLU A CG  1 
ATOM   3373  C  CD  . GLU A  1 443 ? 6.832   4.622   -13.169 1.00   39.07 ? 550 GLU A CD  1 
ATOM   3374  O  OE1 . GLU A  1 443 ? 5.900   4.165   -12.469 1.00   36.89 ? 550 GLU A OE1 1 
ATOM   3375  O  OE2 . GLU A  1 443 ? 6.698   5.596   -13.948 1.00   39.84 ? 550 GLU A OE2 1 
ATOM   3376  N  N   . ILE A  1 444 ? 12.152  4.660   -15.633 1.00   26.37 ? 551 ILE A N   1 
ATOM   3377  C  CA  . ILE A  1 444 ? 13.075  5.523   -16.358 1.00   28.57 ? 551 ILE A CA  1 
ATOM   3378  C  C   . ILE A  1 444 ? 12.515  5.667   -17.761 1.00   30.54 ? 551 ILE A C   1 
ATOM   3379  O  O   . ILE A  1 444 ? 12.269  4.672   -18.437 1.00   33.12 ? 551 ILE A O   1 
ATOM   3380  C  CB  . ILE A  1 444 ? 14.476  4.912   -16.440 1.00   25.71 ? 551 ILE A CB  1 
ATOM   3381  C  CG1 . ILE A  1 444 ? 15.024  4.711   -15.026 1.00   27.00 ? 551 ILE A CG1 1 
ATOM   3382  C  CG2 . ILE A  1 444 ? 15.396  5.815   -17.254 1.00   25.07 ? 551 ILE A CG2 1 
ATOM   3383  C  CD1 . ILE A  1 444 ? 16.442  4.174   -14.977 1.00   25.49 ? 551 ILE A CD1 1 
ATOM   3384  N  N   . GLU A  1 445 ? 12.309  6.896   -18.207 1.00   29.65 ? 552 GLU A N   1 
ATOM   3385  C  CA  . GLU A  1 445 ? 11.744  7.082   -19.527 1.00   32.18 ? 552 GLU A CA  1 
ATOM   3386  C  C   . GLU A  1 445 ? 12.463  8.129   -20.342 1.00   33.25 ? 552 GLU A C   1 
ATOM   3387  O  O   . GLU A  1 445 ? 13.021  9.089   -19.803 1.00   34.68 ? 552 GLU A O   1 
ATOM   3388  C  CB  . GLU A  1 445 ? 10.266  7.467   -19.413 1.00   31.19 ? 552 GLU A CB  1 
ATOM   3389  C  CG  . GLU A  1 445 ? 10.037  8.769   -18.685 1.00   37.96 ? 552 GLU A CG  1 
ATOM   3390  C  CD  . GLU A  1 445 ? 8.564   9.188   -18.656 1.00   44.63 ? 552 GLU A CD  1 
ATOM   3391  O  OE1 . GLU A  1 445 ? 7.939   9.183   -19.742 1.00   48.70 ? 552 GLU A OE1 1 
ATOM   3392  O  OE2 . GLU A  1 445 ? 8.043   9.527   -17.562 1.00   41.38 ? 552 GLU A OE2 1 
ATOM   3393  N  N   . ASN A  1 446 ? 12.454  7.924   -21.650 1.00   32.57 ? 553 ASN A N   1 
ATOM   3394  C  CA  . ASN A  1 446 ? 13.038  8.866   -22.574 1.00   33.63 ? 553 ASN A CA  1 
ATOM   3395  C  C   . ASN A  1 446 ? 11.882  9.803   -22.894 1.00   35.00 ? 553 ASN A C   1 
ATOM   3396  O  O   . ASN A  1 446 ? 10.923  9.403   -23.553 1.00   36.76 ? 553 ASN A O   1 
ATOM   3397  C  CB  . ASN A  1 446 ? 13.503  8.150   -23.836 1.00   33.10 ? 553 ASN A CB  1 
ATOM   3398  C  CG  . ASN A  1 446 ? 13.982  9.104   -24.895 1.00   33.20 ? 553 ASN A CG  1 
ATOM   3399  O  OD1 . ASN A  1 446 ? 14.274  10.263  -24.615 1.00   35.54 ? 553 ASN A OD1 1 
ATOM   3400  N  ND2 . ASN A  1 446 ? 14.077  8.619   -26.124 1.00   36.88 ? 553 ASN A ND2 1 
ATOM   3401  N  N   . THR A  1 447 ? 11.967  11.039  -22.413 1.00   32.78 ? 554 THR A N   1 
ATOM   3402  C  CA  . THR A  1 447 ? 10.911  12.020  -22.626 1.00   33.10 ? 554 THR A CA  1 
ATOM   3403  C  C   . THR A  1 447 ? 10.961  12.668  -24.006 1.00   34.70 ? 554 THR A C   1 
ATOM   3404  O  O   . THR A  1 447 ? 10.089  13.455  -24.362 1.00   36.68 ? 554 THR A O   1 
ATOM   3405  C  CB  . THR A  1 447 ? 10.997  13.126  -21.573 1.00   31.09 ? 554 THR A CB  1 
ATOM   3406  O  OG1 . THR A  1 447 ? 12.192  13.886  -21.790 1.00   31.70 ? 554 THR A OG1 1 
ATOM   3407  C  CG2 . THR A  1 447 ? 11.056  12.520  -20.171 1.00   30.75 ? 554 THR A CG2 1 
ATOM   3408  N  N   . SER A  1 448 ? 11.988  12.344  -24.779 1.00   37.21 ? 555 SER A N   1 
ATOM   3409  C  CA  . SER A  1 448 ? 12.146  12.909  -26.115 1.00   40.70 ? 555 SER A CA  1 
ATOM   3410  C  C   . SER A  1 448 ? 11.736  11.922  -27.204 1.00   41.49 ? 555 SER A C   1 
ATOM   3411  O  O   . SER A  1 448 ? 11.582  10.726  -26.943 1.00   42.66 ? 555 SER A O   1 
ATOM   3412  C  CB  . SER A  1 448 ? 13.598  13.330  -26.317 1.00   41.90 ? 555 SER A CB  1 
ATOM   3413  O  OG  . SER A  1 448 ? 14.011  13.103  -27.646 1.00   47.96 ? 555 SER A OG  1 
ATOM   3414  N  N   . GLU A  1 449 ? 11.549  12.422  -28.423 1.00   41.07 ? 556 GLU A N   1 
ATOM   3415  C  CA  . GLU A  1 449 ? 11.168  11.555  -29.534 1.00   41.96 ? 556 GLU A CA  1 
ATOM   3416  C  C   . GLU A  1 449 ? 12.422  10.957  -30.167 1.00   41.66 ? 556 GLU A C   1 
ATOM   3417  O  O   . GLU A  1 449 ? 12.344  10.040  -30.981 1.00   43.53 ? 556 GLU A O   1 
ATOM   3418  C  CB  . GLU A  1 449 ? 10.377  12.335  -30.588 1.00   43.00 ? 556 GLU A CB  1 
ATOM   3419  C  CG  . GLU A  1 449 ? 8.968   12.750  -30.154 1.00   43.86 ? 556 GLU A CG  1 
ATOM   3420  C  CD  . GLU A  1 449 ? 8.047   11.568  -29.913 1.00   42.82 ? 556 GLU A CD  1 
ATOM   3421  O  OE1 . GLU A  1 449 ? 8.458   10.420  -30.184 0.0000 43.17 ? 556 GLU A OE1 1 
ATOM   3422  O  OE2 . GLU A  1 449 ? 6.904   11.791  -29.460 0.0000 43.17 ? 556 GLU A OE2 1 
ATOM   3423  N  N   . ALA A  1 450 ? 13.580  11.479  -29.783 1.00   40.03 ? 557 ALA A N   1 
ATOM   3424  C  CA  . ALA A  1 450 ? 14.850  11.001  -30.314 1.00   39.97 ? 557 ALA A CA  1 
ATOM   3425  C  C   . ALA A  1 450 ? 15.104  9.558   -29.933 1.00   40.42 ? 557 ALA A C   1 
ATOM   3426  O  O   . ALA A  1 450 ? 14.635  9.084   -28.904 1.00   41.84 ? 557 ALA A O   1 
ATOM   3427  C  CB  . ALA A  1 450 ? 15.991  11.863  -29.806 1.00   38.31 ? 557 ALA A CB  1 
ATOM   3428  N  N   . ASN A  1 451 ? 15.850  8.858   -30.777 1.00   42.01 ? 558 ASN A N   1 
ATOM   3429  C  CA  . ASN A  1 451 ? 16.183  7.466   -30.517 1.00   43.18 ? 558 ASN A CA  1 
ATOM   3430  C  C   . ASN A  1 451 ? 17.411  7.426   -29.607 1.00   44.52 ? 558 ASN A C   1 
ATOM   3431  O  O   . ASN A  1 451 ? 18.548  7.288   -30.075 1.00   43.62 ? 558 ASN A O   1 
ATOM   3432  C  CB  . ASN A  1 451 ? 16.462  6.732   -31.835 1.00   44.45 ? 558 ASN A CB  1 
ATOM   3433  C  CG  . ASN A  1 451 ? 15.192  6.226   -32.507 1.00   43.09 ? 558 ASN A CG  1 
ATOM   3434  O  OD1 . ASN A  1 451 ? 14.761  5.098   -32.269 0.0000 43.55 ? 558 ASN A OD1 1 
ATOM   3435  N  ND2 . ASN A  1 451 ? 14.585  7.065   -33.337 0.0000 43.55 ? 558 ASN A ND2 1 
ATOM   3436  N  N   . ASN A  1 452 ? 17.176  7.569   -28.303 1.00   43.53 ? 559 ASN A N   1 
ATOM   3437  C  CA  . ASN A  1 452 ? 18.265  7.552   -27.333 1.00   40.63 ? 559 ASN A CA  1 
ATOM   3438  C  C   . ASN A  1 452 ? 18.540  6.136   -26.849 1.00   40.10 ? 559 ASN A C   1 
ATOM   3439  O  O   . ASN A  1 452 ? 17.687  5.249   -26.943 1.00   40.45 ? 559 ASN A O   1 
ATOM   3440  C  CB  . ASN A  1 452 ? 17.942  8.450   -26.134 1.00   38.34 ? 559 ASN A CB  1 
ATOM   3441  C  CG  . ASN A  1 452 ? 17.807  9.908   -26.512 1.00   36.47 ? 559 ASN A CG  1 
ATOM   3442  O  OD1 . ASN A  1 452 ? 18.568  10.420  -27.340 1.00   34.25 ? 559 ASN A OD1 1 
ATOM   3443  N  ND2 . ASN A  1 452 ? 16.846  10.594  -25.898 1.00   32.17 ? 559 ASN A ND2 1 
ATOM   3444  N  N   . TYR A  1 453 ? 19.735  5.928   -26.314 1.00   37.72 ? 560 TYR A N   1 
ATOM   3445  C  CA  . TYR A  1 453 ? 20.119  4.612   -25.842 1.00   36.64 ? 560 TYR A CA  1 
ATOM   3446  C  C   . TYR A  1 453 ? 20.960  4.703   -24.582 1.00   37.14 ? 560 TYR A C   1 
ATOM   3447  O  O   . TYR A  1 453 ? 21.658  5.696   -24.354 1.00   37.93 ? 560 TYR A O   1 
ATOM   3448  C  CB  . TYR A  1 453 ? 20.923  3.895   -26.924 1.00   34.02 ? 560 TYR A CB  1 
ATOM   3449  C  CG  . TYR A  1 453 ? 22.106  4.712   -27.410 1.00   34.84 ? 560 TYR A CG  1 
ATOM   3450  C  CD1 . TYR A  1 453 ? 21.941  5.719   -28.358 1.00   32.89 ? 560 TYR A CD1 1 
ATOM   3451  C  CD2 . TYR A  1 453 ? 23.392  4.477   -26.918 1.00   35.92 ? 560 TYR A CD2 1 
ATOM   3452  C  CE1 . TYR A  1 453 ? 23.026  6.471   -28.809 1.00   35.69 ? 560 TYR A CE1 1 
ATOM   3453  C  CE2 . TYR A  1 453 ? 24.489  5.229   -27.366 1.00   35.52 ? 560 TYR A CE2 1 
ATOM   3454  C  CZ  . TYR A  1 453 ? 24.296  6.218   -28.308 1.00   37.39 ? 560 TYR A CZ  1 
ATOM   3455  O  OH  . TYR A  1 453 ? 25.372  6.952   -28.751 1.00   40.70 ? 560 TYR A OH  1 
ATOM   3456  N  N   . GLY A  1 454 ? 20.909  3.643   -23.780 1.00   35.05 ? 561 GLY A N   1 
ATOM   3457  C  CA  . GLY A  1 454 ? 21.682  3.604   -22.556 1.00   34.74 ? 561 GLY A CA  1 
ATOM   3458  C  C   . GLY A  1 454 ? 21.415  2.344   -21.755 1.00   33.90 ? 561 GLY A C   1 
ATOM   3459  O  O   . GLY A  1 454 ? 20.554  1.529   -22.106 1.00   31.65 ? 561 GLY A O   1 
ATOM   3460  N  N   . THR A  1 455 ? 22.146  2.195   -20.656 1.00   32.73 ? 562 THR A N   1 
ATOM   3461  C  CA  . THR A  1 455 ? 22.006  1.026   -19.803 1.00   31.22 ? 562 THR A CA  1 
ATOM   3462  C  C   . THR A  1 455 ? 22.060  1.377   -18.315 1.00   31.02 ? 562 THR A C   1 
ATOM   3463  O  O   . THR A  1 455 ? 22.898  2.167   -17.872 1.00   30.77 ? 562 THR A O   1 
ATOM   3464  C  CB  . THR A  1 455 ? 23.142  0.023   -20.081 1.00   32.21 ? 562 THR A CB  1 
ATOM   3465  O  OG1 . THR A  1 455 ? 23.187  -0.281  -21.479 1.00   34.07 ? 562 THR A OG1 1 
ATOM   3466  C  CG2 . THR A  1 455 ? 22.948  -1.254  -19.272 1.00   29.15 ? 562 THR A CG2 1 
ATOM   3467  N  N   . LEU A  1 456 ? 21.163  0.778   -17.547 1.00   29.39 ? 563 LEU A N   1 
ATOM   3468  C  CA  . LEU A  1 456 ? 21.138  0.982   -16.112 1.00   27.58 ? 563 LEU A CA  1 
ATOM   3469  C  C   . LEU A  1 456 ? 21.932  -0.183  -15.540 1.00   29.14 ? 563 LEU A C   1 
ATOM   3470  O  O   . LEU A  1 456 ? 21.493  -1.332  -15.642 1.00   28.61 ? 563 LEU A O   1 
ATOM   3471  C  CB  . LEU A  1 456 ? 19.713  0.917   -15.574 1.00   26.73 ? 563 LEU A CB  1 
ATOM   3472  C  CG  . LEU A  1 456 ? 19.668  0.933   -14.044 1.00   26.49 ? 563 LEU A CG  1 
ATOM   3473  C  CD1 . LEU A  1 456 ? 20.079  2.318   -13.529 1.00   26.19 ? 563 LEU A CD1 1 
ATOM   3474  C  CD2 . LEU A  1 456 ? 18.286  0.575   -13.566 1.00   25.70 ? 563 LEU A CD2 1 
ATOM   3475  N  N   . THR A  1 457 ? 23.088  0.099   -14.940 1.00   28.01 ? 564 THR A N   1 
ATOM   3476  C  CA  . THR A  1 457 ? 23.922  -0.960  -14.390 1.00   28.28 ? 564 THR A CA  1 
ATOM   3477  C  C   . THR A  1 457 ? 23.814  -1.144  -12.885 1.00   30.65 ? 564 THR A C   1 
ATOM   3478  O  O   . THR A  1 457 ? 24.244  -2.159  -12.356 1.00   29.87 ? 564 THR A O   1 
ATOM   3479  C  CB  . THR A  1 457 ? 25.392  -0.739  -14.740 1.00   30.57 ? 564 THR A CB  1 
ATOM   3480  O  OG1 . THR A  1 457 ? 25.799  0.562   -14.290 1.00   33.66 ? 564 THR A OG1 1 
ATOM   3481  C  CG2 . THR A  1 457 ? 25.594  -0.835  -16.243 1.00   28.01 ? 564 THR A CG2 1 
ATOM   3482  N  N   . LYS A  1 458 ? 23.247  -0.173  -12.180 1.00   31.74 ? 565 LYS A N   1 
ATOM   3483  C  CA  . LYS A  1 458 ? 23.103  -0.326  -10.736 1.00   28.79 ? 565 LYS A CA  1 
ATOM   3484  C  C   . LYS A  1 458 ? 21.954  0.483   -10.165 1.00   27.88 ? 565 LYS A C   1 
ATOM   3485  O  O   . LYS A  1 458 ? 21.744  1.645   -10.528 1.00   22.52 ? 565 LYS A O   1 
ATOM   3486  C  CB  . LYS A  1 458 ? 24.380  0.077   -10.004 1.00   32.48 ? 565 LYS A CB  1 
ATOM   3487  C  CG  . LYS A  1 458 ? 24.457  -0.493  -8.580  1.00   35.66 ? 565 LYS A CG  1 
ATOM   3488  C  CD  . LYS A  1 458 ? 25.599  0.121   -7.770  1.00   40.43 ? 565 LYS A CD  1 
ATOM   3489  C  CE  . LYS A  1 458 ? 25.195  1.481   -7.145  1.00   45.98 ? 565 LYS A CE  1 
ATOM   3490  N  NZ  . LYS A  1 458 ? 24.710  2.562   -8.099  1.00   43.37 ? 565 LYS A NZ  1 
ATOM   3491  N  N   . PHE A  1 459 ? 21.221  -0.155  -9.260  1.00   25.12 ? 566 PHE A N   1 
ATOM   3492  C  CA  . PHE A  1 459 ? 20.093  0.458   -8.595  1.00   25.04 ? 566 PHE A CA  1 
ATOM   3493  C  C   . PHE A  1 459 ? 20.074  -0.070  -7.172  1.00   26.30 ? 566 PHE A C   1 
ATOM   3494  O  O   . PHE A  1 459 ? 19.640  -1.193  -6.911  1.00   24.73 ? 566 PHE A O   1 
ATOM   3495  C  CB  . PHE A  1 459 ? 18.775  0.114   -9.297  1.00   23.04 ? 566 PHE A CB  1 
ATOM   3496  C  CG  . PHE A  1 459 ? 17.550  0.428   -8.478  1.00   25.83 ? 566 PHE A CG  1 
ATOM   3497  C  CD1 . PHE A  1 459 ? 17.575  1.426   -7.494  1.00   27.30 ? 566 PHE A CD1 1 
ATOM   3498  C  CD2 . PHE A  1 459 ? 16.357  -0.243  -8.706  1.00   24.11 ? 566 PHE A CD2 1 
ATOM   3499  C  CE1 . PHE A  1 459 ? 16.425  1.746   -6.749  1.00   23.66 ? 566 PHE A CE1 1 
ATOM   3500  C  CE2 . PHE A  1 459 ? 15.202  0.074   -7.969  1.00   27.32 ? 566 PHE A CE2 1 
ATOM   3501  C  CZ  . PHE A  1 459 ? 15.243  1.074   -6.987  1.00   24.02 ? 566 PHE A CZ  1 
ATOM   3502  N  N   . THR A  1 460 ? 20.554  0.753   -6.251  1.00   25.67 ? 567 THR A N   1 
ATOM   3503  C  CA  . THR A  1 460 ? 20.578  0.371   -4.848  1.00   24.18 ? 567 THR A CA  1 
ATOM   3504  C  C   . THR A  1 460 ? 19.577  1.243   -4.109  1.00   24.18 ? 567 THR A C   1 
ATOM   3505  O  O   . THR A  1 460 ? 19.641  2.479   -4.175  1.00   27.10 ? 567 THR A O   1 
ATOM   3506  C  CB  . THR A  1 460 ? 21.969  0.593   -4.195  1.00   21.83 ? 567 THR A CB  1 
ATOM   3507  O  OG1 . THR A  1 460 ? 22.999  0.002   -4.993  1.00   21.70 ? 567 THR A OG1 1 
ATOM   3508  C  CG2 . THR A  1 460 ? 21.999  -0.046  -2.801  1.00   16.72 ? 567 THR A CG2 1 
ATOM   3509  N  N   . LEU A  1 461 ? 18.651  0.597   -3.410  1.00   22.79 ? 568 LEU A N   1 
ATOM   3510  C  CA  . LEU A  1 461 ? 17.631  1.307   -2.651  1.00   22.50 ? 568 LEU A CA  1 
ATOM   3511  C  C   . LEU A  1 461 ? 18.146  1.409   -1.224  1.00   21.84 ? 568 LEU A C   1 
ATOM   3512  O  O   . LEU A  1 461 ? 18.485  0.393   -0.609  1.00   19.83 ? 568 LEU A O   1 
ATOM   3513  C  CB  . LEU A  1 461 ? 16.303  0.535   -2.674  1.00   21.97 ? 568 LEU A CB  1 
ATOM   3514  C  CG  . LEU A  1 461 ? 15.131  1.174   -1.918  1.00   22.19 ? 568 LEU A CG  1 
ATOM   3515  C  CD1 . LEU A  1 461 ? 14.823  2.513   -2.554  1.00   19.42 ? 568 LEU A CD1 1 
ATOM   3516  C  CD2 . LEU A  1 461 ? 13.894  0.272   -1.964  1.00   22.76 ? 568 LEU A CD2 1 
ATOM   3517  N  N   . VAL A  1 462 ? 18.233  2.633   -0.712  1.00   18.40 ? 569 VAL A N   1 
ATOM   3518  C  CA  . VAL A  1 462 ? 18.711  2.844   0.643   1.00   20.84 ? 569 VAL A CA  1 
ATOM   3519  C  C   . VAL A  1 462 ? 17.626  3.505   1.474   1.00   21.68 ? 569 VAL A C   1 
ATOM   3520  O  O   . VAL A  1 462 ? 17.190  4.625   1.185   1.00   20.94 ? 569 VAL A O   1 
ATOM   3521  C  CB  . VAL A  1 462 ? 19.983  3.728   0.675   1.00   23.16 ? 569 VAL A CB  1 
ATOM   3522  C  CG1 . VAL A  1 462 ? 20.502  3.838   2.101   1.00   16.99 ? 569 VAL A CG1 1 
ATOM   3523  C  CG2 . VAL A  1 462 ? 21.053  3.127   -0.218  1.00   24.01 ? 569 VAL A CG2 1 
ATOM   3524  N  N   . LEU A  1 463 ? 17.195  2.794   2.508   1.00   21.80 ? 570 LEU A N   1 
ATOM   3525  C  CA  . LEU A  1 463 ? 16.142  3.271   3.392   1.00   21.08 ? 570 LEU A CA  1 
ATOM   3526  C  C   . LEU A  1 463 ? 16.687  3.670   4.759   1.00   20.11 ? 570 LEU A C   1 
ATOM   3527  O  O   . LEU A  1 463 ? 17.477  2.944   5.359   1.00   23.94 ? 570 LEU A O   1 
ATOM   3528  C  CB  . LEU A  1 463 ? 15.099  2.169   3.588   1.00   19.68 ? 570 LEU A CB  1 
ATOM   3529  C  CG  . LEU A  1 463 ? 14.604  1.406   2.347   1.00   23.37 ? 570 LEU A CG  1 
ATOM   3530  C  CD1 . LEU A  1 463 ? 13.786  0.201   2.800   1.00   20.11 ? 570 LEU A CD1 1 
ATOM   3531  C  CD2 . LEU A  1 463 ? 13.770  2.310   1.449   1.00   17.29 ? 570 LEU A CD2 1 
ATOM   3532  N  N   . TYR A  1 464 ? 16.265  4.830   5.239   1.00   18.23 ? 571 TYR A N   1 
ATOM   3533  C  CA  . TYR A  1 464 ? 16.654  5.322   6.561   1.00   21.12 ? 571 TYR A CA  1 
ATOM   3534  C  C   . TYR A  1 464 ? 15.353  5.375   7.350   1.00   22.48 ? 571 TYR A C   1 
ATOM   3535  O  O   . TYR A  1 464 ? 14.289  5.647   6.774   1.00   22.24 ? 571 TYR A O   1 
ATOM   3536  C  CB  . TYR A  1 464 ? 17.248  6.741   6.481   1.00   18.30 ? 571 TYR A CB  1 
ATOM   3537  C  CG  . TYR A  1 464 ? 18.577  6.822   5.764   1.00   23.34 ? 571 TYR A CG  1 
ATOM   3538  C  CD1 . TYR A  1 464 ? 19.780  6.622   6.452   1.00   21.78 ? 571 TYR A CD1 1 
ATOM   3539  C  CD2 . TYR A  1 464 ? 18.635  7.101   4.396   1.00   21.64 ? 571 TYR A CD2 1 
ATOM   3540  C  CE1 . TYR A  1 464 ? 21.012  6.703   5.794   1.00   24.60 ? 571 TYR A CE1 1 
ATOM   3541  C  CE2 . TYR A  1 464 ? 19.860  7.183   3.727   1.00   25.20 ? 571 TYR A CE2 1 
ATOM   3542  C  CZ  . TYR A  1 464 ? 21.046  6.984   4.432   1.00   26.35 ? 571 TYR A CZ  1 
ATOM   3543  O  OH  . TYR A  1 464 ? 22.258  7.083   3.777   1.00   29.50 ? 571 TYR A OH  1 
ATOM   3544  N  N   . GLY A  1 465 ? 15.419  5.121   8.654   1.00   21.67 ? 572 GLY A N   1 
ATOM   3545  C  CA  . GLY A  1 465 ? 14.200  5.170   9.437   1.00   21.22 ? 572 GLY A CA  1 
ATOM   3546  C  C   . GLY A  1 465 ? 14.271  4.445   10.765  1.00   26.26 ? 572 GLY A C   1 
ATOM   3547  O  O   . GLY A  1 465 ? 15.359  4.147   11.278  1.00   28.22 ? 572 GLY A O   1 
ATOM   3548  N  N   . THR A  1 466 ? 13.095  4.146   11.310  1.00   27.01 ? 573 THR A N   1 
ATOM   3549  C  CA  . THR A  1 466 ? 12.981  3.476   12.597  1.00   27.80 ? 573 THR A CA  1 
ATOM   3550  C  C   . THR A  1 466 ? 11.944  2.350   12.578  1.00   28.50 ? 573 THR A C   1 
ATOM   3551  O  O   . THR A  1 466 ? 11.303  2.075   11.562  1.00   25.18 ? 573 THR A O   1 
ATOM   3552  C  CB  . THR A  1 466 ? 12.551  4.470   13.683  1.00   24.70 ? 573 THR A CB  1 
ATOM   3553  O  OG1 . THR A  1 466 ? 11.226  4.915   13.391  1.00   27.75 ? 573 THR A OG1 1 
ATOM   3554  C  CG2 . THR A  1 466 ? 13.474  5.684   13.718  1.00   23.79 ? 573 THR A CG2 1 
ATOM   3555  N  N   . ALA A  1 467 ? 11.785  1.721   13.738  1.00   32.35 ? 574 ALA A N   1 
ATOM   3556  C  CA  . ALA A  1 467 ? 10.841  0.632   13.921  1.00   36.93 ? 574 ALA A CA  1 
ATOM   3557  C  C   . ALA A  1 467 ? 10.003  0.912   15.170  1.00   39.49 ? 574 ALA A C   1 
ATOM   3558  O  O   . ALA A  1 467 ? 10.060  2.058   15.672  1.00   45.62 ? 574 ALA A O   1 
ATOM   3559  C  CB  . ALA A  1 467 ? 11.589  -0.685  14.056  1.00   35.39 ? 574 ALA A CB  1 
ATOM   3560  N  N   . TYR B  1 3   ? 47.852  -19.335 37.271  1.00   53.27 ? 110 TYR B N   1 
ATOM   3561  C  CA  . TYR B  1 3   ? 47.335  -19.508 35.876  1.00   52.65 ? 110 TYR B CA  1 
ATOM   3562  C  C   . TYR B  1 3   ? 47.829  -20.798 35.240  1.00   52.13 ? 110 TYR B C   1 
ATOM   3563  O  O   . TYR B  1 3   ? 49.026  -21.088 35.254  1.00   51.42 ? 110 TYR B O   1 
ATOM   3564  C  CB  . TYR B  1 3   ? 47.767  -18.344 34.963  1.00   51.85 ? 110 TYR B CB  1 
ATOM   3565  C  CG  . TYR B  1 3   ? 47.279  -18.526 33.538  1.00   48.79 ? 110 TYR B CG  1 
ATOM   3566  C  CD1 . TYR B  1 3   ? 45.916  -18.477 33.253  1.00   48.01 ? 110 TYR B CD1 1 
ATOM   3567  C  CD2 . TYR B  1 3   ? 48.160  -18.861 32.495  1.00   46.69 ? 110 TYR B CD2 1 
ATOM   3568  C  CE1 . TYR B  1 3   ? 45.428  -18.766 31.984  1.00   45.60 ? 110 TYR B CE1 1 
ATOM   3569  C  CE2 . TYR B  1 3   ? 47.679  -19.151 31.209  1.00   43.05 ? 110 TYR B CE2 1 
ATOM   3570  C  CZ  . TYR B  1 3   ? 46.302  -19.105 30.972  1.00   45.33 ? 110 TYR B CZ  1 
ATOM   3571  O  OH  . TYR B  1 3   ? 45.758  -19.426 29.748  1.00   43.21 ? 110 TYR B OH  1 
ATOM   3572  N  N   . GLN B  1 4   ? 46.907  -21.563 34.666  1.00   51.02 ? 111 GLN B N   1 
ATOM   3573  C  CA  . GLN B  1 4   ? 47.274  -22.807 34.003  1.00   51.12 ? 111 GLN B CA  1 
ATOM   3574  C  C   . GLN B  1 4   ? 47.129  -22.602 32.485  1.00   49.49 ? 111 GLN B C   1 
ATOM   3575  O  O   . GLN B  1 4   ? 46.037  -22.290 31.994  1.00   48.42 ? 111 GLN B O   1 
ATOM   3576  C  CB  . GLN B  1 4   ? 46.370  -23.950 34.491  1.00   52.85 ? 111 GLN B CB  1 
ATOM   3577  C  CG  . GLN B  1 4   ? 46.311  -24.092 36.002  0.0000 52.19 ? 111 GLN B CG  1 
ATOM   3578  C  CD  . GLN B  1 4   ? 45.385  -25.205 36.446  0.0000 52.32 ? 111 GLN B CD  1 
ATOM   3579  O  OE1 . GLN B  1 4   ? 44.202  -25.219 36.103  0.0000 52.25 ? 111 GLN B OE1 1 
ATOM   3580  N  NE2 . GLN B  1 4   ? 45.918  -26.147 37.216  0.0000 52.25 ? 111 GLN B NE2 1 
ATOM   3581  N  N   . GLU B  1 5   ? 48.228  -22.766 31.750  1.00   45.89 ? 112 GLU B N   1 
ATOM   3582  C  CA  . GLU B  1 5   ? 48.199  -22.588 30.300  1.00   45.31 ? 112 GLU B CA  1 
ATOM   3583  C  C   . GLU B  1 5   ? 47.461  -23.723 29.575  1.00   42.19 ? 112 GLU B C   1 
ATOM   3584  O  O   . GLU B  1 5   ? 47.399  -24.852 30.057  1.00   41.65 ? 112 GLU B O   1 
ATOM   3585  C  CB  . GLU B  1 5   ? 49.626  -22.450 29.755  1.00   47.20 ? 112 GLU B CB  1 
ATOM   3586  C  CG  . GLU B  1 5   ? 50.383  -23.750 29.626  1.00   47.67 ? 112 GLU B CG  1 
ATOM   3587  C  CD  . GLU B  1 5   ? 51.748  -23.564 28.997  1.00   48.89 ? 112 GLU B CD  1 
ATOM   3588  O  OE1 . GLU B  1 5   ? 52.323  -24.571 28.530  1.00   52.00 ? 112 GLU B OE1 1 
ATOM   3589  O  OE2 . GLU B  1 5   ? 52.247  -22.418 28.969  1.00   48.68 ? 112 GLU B OE2 1 
ATOM   3590  N  N   . PRO B  1 6   ? 46.889  -23.427 28.400  1.00   40.22 ? 113 PRO B N   1 
ATOM   3591  C  CA  . PRO B  1 6   ? 46.143  -24.399 27.593  1.00   38.45 ? 113 PRO B CA  1 
ATOM   3592  C  C   . PRO B  1 6   ? 46.767  -25.788 27.451  1.00   37.96 ? 113 PRO B C   1 
ATOM   3593  O  O   . PRO B  1 6   ? 47.977  -25.928 27.332  1.00   37.74 ? 113 PRO B O   1 
ATOM   3594  C  CB  . PRO B  1 6   ? 45.998  -23.684 26.261  1.00   37.81 ? 113 PRO B CB  1 
ATOM   3595  C  CG  . PRO B  1 6   ? 45.832  -22.244 26.705  1.00   35.59 ? 113 PRO B CG  1 
ATOM   3596  C  CD  . PRO B  1 6   ? 46.896  -22.100 27.754  1.00   36.17 ? 113 PRO B CD  1 
ATOM   3597  N  N   . THR B  1 7   ? 45.916  -26.808 27.450  1.00   36.25 ? 114 THR B N   1 
ATOM   3598  C  CA  . THR B  1 7   ? 46.357  -28.189 27.323  1.00   35.48 ? 114 THR B CA  1 
ATOM   3599  C  C   . THR B  1 7   ? 46.125  -28.714 25.912  1.00   36.57 ? 114 THR B C   1 
ATOM   3600  O  O   . THR B  1 7   ? 46.493  -29.846 25.598  1.00   37.62 ? 114 THR B O   1 
ATOM   3601  C  CB  . THR B  1 7   ? 45.588  -29.107 28.288  1.00   34.86 ? 114 THR B CB  1 
ATOM   3602  O  OG1 . THR B  1 7   ? 44.184  -29.016 28.012  1.00   31.84 ? 114 THR B OG1 1 
ATOM   3603  C  CG2 . THR B  1 7   ? 45.856  -28.716 29.731  1.00   30.94 ? 114 THR B CG2 1 
ATOM   3604  N  N   . ASP B  1 8   ? 45.507  -27.893 25.067  1.00   34.98 ? 115 ASP B N   1 
ATOM   3605  C  CA  . ASP B  1 8   ? 45.209  -28.286 23.693  1.00   31.94 ? 115 ASP B CA  1 
ATOM   3606  C  C   . ASP B  1 8   ? 46.436  -28.902 23.041  1.00   33.83 ? 115 ASP B C   1 
ATOM   3607  O  O   . ASP B  1 8   ? 47.556  -28.407 23.192  1.00   35.04 ? 115 ASP B O   1 
ATOM   3608  C  CB  . ASP B  1 8   ? 44.730  -27.076 22.892  1.00   30.69 ? 115 ASP B CB  1 
ATOM   3609  C  CG  . ASP B  1 8   ? 43.536  -26.403 23.528  1.00   30.20 ? 115 ASP B CG  1 
ATOM   3610  O  OD1 . ASP B  1 8   ? 43.701  -25.842 24.635  1.00   29.20 ? 115 ASP B OD1 1 
ATOM   3611  O  OD2 . ASP B  1 8   ? 42.437  -26.439 22.929  1.00   30.98 ? 115 ASP B OD2 1 
ATOM   3612  N  N   . PRO B  1 9   ? 46.233  -29.987 22.285  1.00   32.50 ? 116 PRO B N   1 
ATOM   3613  C  CA  . PRO B  1 9   ? 47.315  -30.700 21.602  1.00   32.36 ? 116 PRO B CA  1 
ATOM   3614  C  C   . PRO B  1 9   ? 48.270  -29.862 20.758  1.00   33.57 ? 116 PRO B C   1 
ATOM   3615  O  O   . PRO B  1 9   ? 49.473  -30.133 20.730  1.00   31.78 ? 116 PRO B O   1 
ATOM   3616  C  CB  . PRO B  1 9   ? 46.575  -31.755 20.783  1.00   31.35 ? 116 PRO B CB  1 
ATOM   3617  C  CG  . PRO B  1 9   ? 45.219  -31.124 20.547  1.00   34.47 ? 116 PRO B CG  1 
ATOM   3618  C  CD  . PRO B  1 9   ? 44.914  -30.501 21.878  1.00   31.83 ? 116 PRO B CD  1 
ATOM   3619  N  N   . LYS B  1 10  ? 47.748  -28.835 20.094  1.00   33.25 ? 117 LYS B N   1 
ATOM   3620  C  CA  . LYS B  1 10  ? 48.580  -27.992 19.235  1.00   33.64 ? 117 LYS B CA  1 
ATOM   3621  C  C   . LYS B  1 10  ? 49.080  -26.682 19.856  1.00   32.79 ? 117 LYS B C   1 
ATOM   3622  O  O   . LYS B  1 10  ? 49.804  -25.921 19.211  1.00   31.24 ? 117 LYS B O   1 
ATOM   3623  C  CB  . LYS B  1 10  ? 47.827  -27.672 17.945  1.00   33.78 ? 117 LYS B CB  1 
ATOM   3624  C  CG  . LYS B  1 10  ? 47.460  -28.892 17.126  1.00   40.30 ? 117 LYS B CG  1 
ATOM   3625  C  CD  . LYS B  1 10  ? 48.709  -29.642 16.698  1.00   47.20 ? 117 LYS B CD  1 
ATOM   3626  C  CE  . LYS B  1 10  ? 48.379  -30.799 15.764  1.00   52.07 ? 117 LYS B CE  1 
ATOM   3627  N  NZ  . LYS B  1 10  ? 49.615  -31.432 15.213  1.00   53.86 ? 117 LYS B NZ  1 
ATOM   3628  N  N   . PHE B  1 11  ? 48.710  -26.413 21.103  1.00   32.69 ? 118 PHE B N   1 
ATOM   3629  C  CA  . PHE B  1 11  ? 49.145  -25.178 21.746  1.00   31.59 ? 118 PHE B CA  1 
ATOM   3630  C  C   . PHE B  1 11  ? 50.666  -25.004 21.717  1.00   31.88 ? 118 PHE B C   1 
ATOM   3631  O  O   . PHE B  1 11  ? 51.162  -23.910 21.469  1.00   31.48 ? 118 PHE B O   1 
ATOM   3632  C  CB  . PHE B  1 11  ? 48.658  -25.119 23.190  1.00   29.80 ? 118 PHE B CB  1 
ATOM   3633  C  CG  . PHE B  1 11  ? 49.103  -23.889 23.922  1.00   30.01 ? 118 PHE B CG  1 
ATOM   3634  C  CD1 . PHE B  1 11  ? 48.587  -22.642 23.594  1.00   32.29 ? 118 PHE B CD1 1 
ATOM   3635  C  CD2 . PHE B  1 11  ? 50.056  -23.971 24.923  1.00   29.65 ? 118 PHE B CD2 1 
ATOM   3636  C  CE1 . PHE B  1 11  ? 49.018  -21.489 24.258  1.00   32.81 ? 118 PHE B CE1 1 
ATOM   3637  C  CE2 . PHE B  1 11  ? 50.494  -22.827 25.590  1.00   32.39 ? 118 PHE B CE2 1 
ATOM   3638  C  CZ  . PHE B  1 11  ? 49.973  -21.581 25.257  1.00   30.17 ? 118 PHE B CZ  1 
ATOM   3639  N  N   . PRO B  1 12  ? 51.427  -26.082 21.977  1.00   32.77 ? 119 PRO B N   1 
ATOM   3640  C  CA  . PRO B  1 12  ? 52.890  -25.977 21.964  1.00   32.09 ? 119 PRO B CA  1 
ATOM   3641  C  C   . PRO B  1 12  ? 53.454  -25.506 20.625  1.00   33.19 ? 119 PRO B C   1 
ATOM   3642  O  O   . PRO B  1 12  ? 54.568  -24.992 20.571  1.00   33.53 ? 119 PRO B O   1 
ATOM   3643  C  CB  . PRO B  1 12  ? 53.343  -27.393 22.315  1.00   32.01 ? 119 PRO B CB  1 
ATOM   3644  C  CG  . PRO B  1 12  ? 52.222  -27.873 23.213  1.00   32.09 ? 119 PRO B CG  1 
ATOM   3645  C  CD  . PRO B  1 12  ? 51.006  -27.413 22.455  1.00   31.91 ? 119 PRO B CD  1 
ATOM   3646  N  N   . GLN B  1 13  ? 52.701  -25.689 19.543  1.00   32.40 ? 120 GLN B N   1 
ATOM   3647  C  CA  . GLN B  1 13  ? 53.176  -25.240 18.243  1.00   32.15 ? 120 GLN B CA  1 
ATOM   3648  C  C   . GLN B  1 13  ? 52.772  -23.795 17.954  1.00   30.47 ? 120 GLN B C   1 
ATOM   3649  O  O   . GLN B  1 13  ? 53.211  -23.217 16.966  1.00   29.54 ? 120 GLN B O   1 
ATOM   3650  C  CB  . GLN B  1 13  ? 52.669  -26.148 17.125  1.00   36.56 ? 120 GLN B CB  1 
ATOM   3651  C  CG  . GLN B  1 13  ? 53.293  -27.520 17.132  1.00   44.03 ? 120 GLN B CG  1 
ATOM   3652  C  CD  . GLN B  1 13  ? 52.285  -28.584 17.502  1.00   51.29 ? 120 GLN B CD  1 
ATOM   3653  O  OE1 . GLN B  1 13  ? 51.431  -28.953 16.688  1.00   54.37 ? 120 GLN B OE1 1 
ATOM   3654  N  NE2 . GLN B  1 13  ? 52.360  -29.073 18.742  1.00   53.08 ? 120 GLN B NE2 1 
ATOM   3655  N  N   . GLN B  1 14  ? 51.941  -23.213 18.812  1.00   27.85 ? 121 GLN B N   1 
ATOM   3656  C  CA  . GLN B  1 14  ? 51.528  -21.828 18.616  1.00   27.07 ? 121 GLN B CA  1 
ATOM   3657  C  C   . GLN B  1 14  ? 52.593  -20.932 19.248  1.00   26.39 ? 121 GLN B C   1 
ATOM   3658  O  O   . GLN B  1 14  ? 52.366  -20.241 20.244  1.00   27.18 ? 121 GLN B O   1 
ATOM   3659  C  CB  . GLN B  1 14  ? 50.135  -21.602 19.214  1.00   25.61 ? 121 GLN B CB  1 
ATOM   3660  C  CG  . GLN B  1 14  ? 49.055  -22.355 18.425  1.00   29.13 ? 121 GLN B CG  1 
ATOM   3661  C  CD  . GLN B  1 14  ? 47.641  -22.190 18.969  1.00   30.40 ? 121 GLN B CD  1 
ATOM   3662  O  OE1 . GLN B  1 14  ? 47.329  -22.611 20.087  1.00   28.83 ? 121 GLN B OE1 1 
ATOM   3663  N  NE2 . GLN B  1 14  ? 46.770  -21.585 18.164  1.00   30.93 ? 121 GLN B NE2 1 
ATOM   3664  N  N   . TRP B  1 15  ? 53.774  -20.978 18.639  1.00   26.94 ? 122 TRP B N   1 
ATOM   3665  C  CA  . TRP B  1 15  ? 54.952  -20.229 19.065  1.00   26.53 ? 122 TRP B CA  1 
ATOM   3666  C  C   . TRP B  1 15  ? 54.738  -18.726 19.214  1.00   28.31 ? 122 TRP B C   1 
ATOM   3667  O  O   . TRP B  1 15  ? 55.394  -18.079 20.028  1.00   29.21 ? 122 TRP B O   1 
ATOM   3668  C  CB  . TRP B  1 15  ? 56.082  -20.453 18.063  1.00   24.39 ? 122 TRP B CB  1 
ATOM   3669  C  CG  . TRP B  1 15  ? 55.691  -20.102 16.642  1.00   25.36 ? 122 TRP B CG  1 
ATOM   3670  C  CD1 . TRP B  1 15  ? 55.037  -20.902 15.744  1.00   23.43 ? 122 TRP B CD1 1 
ATOM   3671  C  CD2 . TRP B  1 15  ? 55.901  -18.848 15.981  1.00   23.29 ? 122 TRP B CD2 1 
ATOM   3672  N  NE1 . TRP B  1 15  ? 54.828  -20.225 14.566  1.00   25.56 ? 122 TRP B NE1 1 
ATOM   3673  C  CE2 . TRP B  1 15  ? 55.345  -18.961 14.683  1.00   25.34 ? 122 TRP B CE2 1 
ATOM   3674  C  CE3 . TRP B  1 15  ? 56.502  -17.638 16.359  1.00   21.65 ? 122 TRP B CE3 1 
ATOM   3675  C  CZ2 . TRP B  1 15  ? 55.370  -17.903 13.758  1.00   23.16 ? 122 TRP B CZ2 1 
ATOM   3676  C  CZ3 . TRP B  1 15  ? 56.529  -16.584 15.438  1.00   21.31 ? 122 TRP B CZ3 1 
ATOM   3677  C  CH2 . TRP B  1 15  ? 55.964  -16.726 14.153  1.00   23.10 ? 122 TRP B CH2 1 
ATOM   3678  N  N   . TYR B  1 16  ? 53.843  -18.171 18.406  1.00   28.59 ? 123 TYR B N   1 
ATOM   3679  C  CA  . TYR B  1 16  ? 53.562  -16.741 18.437  1.00   30.63 ? 123 TYR B CA  1 
ATOM   3680  C  C   . TYR B  1 16  ? 52.750  -16.307 19.658  1.00   33.20 ? 123 TYR B C   1 
ATOM   3681  O  O   . TYR B  1 16  ? 52.723  -15.122 20.000  1.00   30.23 ? 123 TYR B O   1 
ATOM   3682  C  CB  . TYR B  1 16  ? 52.824  -16.326 17.158  1.00   26.97 ? 123 TYR B CB  1 
ATOM   3683  C  CG  . TYR B  1 16  ? 51.760  -17.311 16.736  1.00   26.08 ? 123 TYR B CG  1 
ATOM   3684  C  CD1 . TYR B  1 16  ? 52.084  -18.441 15.985  1.00   25.70 ? 123 TYR B CD1 1 
ATOM   3685  C  CD2 . TYR B  1 16  ? 50.440  -17.146 17.127  1.00   26.58 ? 123 TYR B CD2 1 
ATOM   3686  C  CE1 . TYR B  1 16  ? 51.115  -19.379 15.636  1.00   23.94 ? 123 TYR B CE1 1 
ATOM   3687  C  CE2 . TYR B  1 16  ? 49.459  -18.087 16.783  1.00   26.29 ? 123 TYR B CE2 1 
ATOM   3688  C  CZ  . TYR B  1 16  ? 49.804  -19.198 16.038  1.00   23.77 ? 123 TYR B CZ  1 
ATOM   3689  O  OH  . TYR B  1 16  ? 48.835  -20.113 15.689  1.00   19.16 ? 123 TYR B OH  1 
ATOM   3690  N  N   . LEU B  1 17  ? 52.079  -17.254 20.307  1.00   35.29 ? 124 LEU B N   1 
ATOM   3691  C  CA  . LEU B  1 17  ? 51.285  -16.927 21.485  1.00   38.80 ? 124 LEU B CA  1 
ATOM   3692  C  C   . LEU B  1 17  ? 52.163  -16.904 22.721  1.00   43.36 ? 124 LEU B C   1 
ATOM   3693  O  O   . LEU B  1 17  ? 52.102  -15.972 23.531  1.00   45.77 ? 124 LEU B O   1 
ATOM   3694  C  CB  . LEU B  1 17  ? 50.169  -17.950 21.685  1.00   34.65 ? 124 LEU B CB  1 
ATOM   3695  C  CG  . LEU B  1 17  ? 49.108  -18.029 20.592  1.00   35.65 ? 124 LEU B CG  1 
ATOM   3696  C  CD1 . LEU B  1 17  ? 48.102  -19.116 20.963  1.00   31.82 ? 124 LEU B CD1 1 
ATOM   3697  C  CD2 . LEU B  1 17  ? 48.414  -16.675 20.420  1.00   30.73 ? 124 LEU B CD2 1 
ATOM   3698  N  N   . SER B  1 18  ? 52.980  -17.940 22.861  1.00   48.82 ? 125 SER B N   1 
ATOM   3699  C  CA  . SER B  1 18  ? 53.881  -18.058 24.000  1.00   53.85 ? 125 SER B CA  1 
ATOM   3700  C  C   . SER B  1 18  ? 55.087  -18.884 23.598  1.00   56.53 ? 125 SER B C   1 
ATOM   3701  O  O   . SER B  1 18  ? 54.948  -19.950 22.997  1.00   56.70 ? 125 SER B O   1 
ATOM   3702  C  CB  . SER B  1 18  ? 53.170  -18.735 25.173  1.00   54.93 ? 125 SER B CB  1 
ATOM   3703  O  OG  . SER B  1 18  ? 54.056  -18.950 26.254  1.00   55.71 ? 125 SER B OG  1 
ATOM   3704  N  N   . GLY B  1 19  ? 56.272  -18.388 23.926  1.00   62.00 ? 126 GLY B N   1 
ATOM   3705  C  CA  . GLY B  1 19  ? 57.480  -19.110 23.574  1.00   68.86 ? 126 GLY B CA  1 
ATOM   3706  C  C   . GLY B  1 19  ? 58.596  -18.951 24.594  1.00   73.07 ? 126 GLY B C   1 
ATOM   3707  O  O   . GLY B  1 19  ? 58.583  -18.029 25.424  1.00   72.37 ? 126 GLY B O   1 
ATOM   3708  N  N   . VAL B  1 20  ? 59.567  -19.857 24.529  1.00   76.73 ? 127 VAL B N   1 
ATOM   3709  C  CA  . VAL B  1 20  ? 60.699  -19.811 25.435  1.00   80.19 ? 127 VAL B CA  1 
ATOM   3710  C  C   . VAL B  1 20  ? 61.853  -19.074 24.757  1.00   82.42 ? 127 VAL B C   1 
ATOM   3711  O  O   . VAL B  1 20  ? 63.017  -19.429 24.956  1.00   84.33 ? 127 VAL B O   1 
ATOM   3712  C  CB  . VAL B  1 20  ? 61.137  -21.240 25.825  1.00   80.24 ? 127 VAL B CB  1 
ATOM   3713  C  CG1 . VAL B  1 20  ? 60.005  -21.941 26.546  0.0000 80.85 ? 127 VAL B CG1 1 
ATOM   3714  C  CG2 . VAL B  1 20  ? 61.540  -22.017 24.577  0.0000 80.85 ? 127 VAL B CG2 1 
ATOM   3715  N  N   . THR B  1 21  ? 61.529  -18.054 23.959  1.00   82.03 ? 128 THR B N   1 
ATOM   3716  C  CA  . THR B  1 21  ? 62.565  -17.307 23.267  1.00   80.40 ? 128 THR B CA  1 
ATOM   3717  C  C   . THR B  1 21  ? 62.302  -15.808 23.300  1.00   80.03 ? 128 THR B C   1 
ATOM   3718  O  O   . THR B  1 21  ? 62.912  -15.049 22.532  1.00   81.40 ? 128 THR B O   1 
ATOM   3719  C  CB  . THR B  1 21  ? 62.692  -17.767 21.798  1.00   79.56 ? 128 THR B CB  1 
ATOM   3720  O  OG1 . THR B  1 21  ? 63.808  -17.103 21.191  0.0000 80.16 ? 128 THR B OG1 1 
ATOM   3721  C  CG2 . THR B  1 21  ? 61.423  -17.432 21.030  0.0000 80.16 ? 128 THR B CG2 1 
ATOM   3722  N  N   . GLN B  1 22  ? 61.396  -15.388 24.186  1.00   77.50 ? 129 GLN B N   1 
ATOM   3723  C  CA  . GLN B  1 22  ? 61.041  -13.977 24.317  1.00   73.69 ? 129 GLN B CA  1 
ATOM   3724  C  C   . GLN B  1 22  ? 60.700  -13.328 22.960  1.00   71.12 ? 129 GLN B C   1 
ATOM   3725  O  O   . GLN B  1 22  ? 60.731  -12.092 22.819  1.00   73.15 ? 129 GLN B O   1 
ATOM   3726  C  CB  . GLN B  1 22  ? 62.180  -13.198 24.993  1.00   74.16 ? 129 GLN B CB  1 
ATOM   3727  C  CG  . GLN B  1 22  ? 62.325  -13.464 26.489  0.0000 72.44 ? 129 GLN B CG  1 
ATOM   3728  C  CD  . GLN B  1 22  ? 62.948  -14.805 26.803  0.0000 72.01 ? 129 GLN B CD  1 
ATOM   3729  O  OE1 . GLN B  1 22  ? 62.427  -15.852 26.424  0.0000 71.25 ? 129 GLN B OE1 1 
ATOM   3730  N  NE2 . GLN B  1 22  ? 64.074  -14.779 27.506  0.0000 71.25 ? 129 GLN B NE2 1 
ATOM   3731  N  N   . ARG B  1 23  ? 60.363  -14.165 21.978  1.00   63.87 ? 130 ARG B N   1 
ATOM   3732  C  CA  . ARG B  1 23  ? 60.008  -13.701 20.642  1.00   55.29 ? 130 ARG B CA  1 
ATOM   3733  C  C   . ARG B  1 23  ? 58.563  -14.121 20.334  1.00   51.01 ? 130 ARG B C   1 
ATOM   3734  O  O   . ARG B  1 23  ? 58.335  -14.991 19.481  1.00   47.99 ? 130 ARG B O   1 
ATOM   3735  C  CB  . ARG B  1 23  ? 60.950  -14.317 19.602  1.00   52.88 ? 130 ARG B CB  1 
ATOM   3736  C  CG  . ARG B  1 23  ? 62.430  -14.015 19.806  0.0000 50.71 ? 130 ARG B CG  1 
ATOM   3737  C  CD  . ARG B  1 23  ? 62.746  -12.547 19.579  0.0000 48.97 ? 130 ARG B CD  1 
ATOM   3738  N  NE  . ARG B  1 23  ? 64.184  -12.289 19.591  0.0000 47.78 ? 130 ARG B NE  1 
ATOM   3739  C  CZ  . ARG B  1 23  ? 64.971  -12.463 20.649  0.0000 47.15 ? 130 ARG B CZ  1 
ATOM   3740  N  NH1 . ARG B  1 23  ? 64.464  -12.898 21.794  0.0000 46.93 ? 130 ARG B NH1 1 
ATOM   3741  N  NH2 . ARG B  1 23  ? 66.269  -12.207 20.559  0.0000 46.93 ? 130 ARG B NH2 1 
ATOM   3742  N  N   . ASP B  1 24  ? 57.602  -13.531 21.052  1.00   44.55 ? 131 ASP B N   1 
ATOM   3743  C  CA  . ASP B  1 24  ? 56.183  -13.845 20.857  1.00   39.50 ? 131 ASP B CA  1 
ATOM   3744  C  C   . ASP B  1 24  ? 55.305  -12.621 21.110  1.00   35.29 ? 131 ASP B C   1 
ATOM   3745  O  O   . ASP B  1 24  ? 55.817  -11.539 21.383  1.00   33.37 ? 131 ASP B O   1 
ATOM   3746  C  CB  . ASP B  1 24  ? 55.743  -15.018 21.761  1.00   39.93 ? 131 ASP B CB  1 
ATOM   3747  C  CG  . ASP B  1 24  ? 55.942  -14.737 23.250  1.00   38.57 ? 131 ASP B CG  1 
ATOM   3748  O  OD1 . ASP B  1 24  ? 55.433  -13.715 23.753  1.00   37.01 ? 131 ASP B OD1 1 
ATOM   3749  O  OD2 . ASP B  1 24  ? 56.606  -15.552 23.923  1.00   37.23 ? 131 ASP B OD2 1 
ATOM   3750  N  N   . LEU B  1 25  ? 53.987  -12.797 21.017  1.00   30.49 ? 132 LEU B N   1 
ATOM   3751  C  CA  . LEU B  1 25  ? 53.043  -11.694 21.208  1.00   28.46 ? 132 LEU B CA  1 
ATOM   3752  C  C   . LEU B  1 25  ? 52.675  -11.421 22.672  1.00   28.37 ? 132 LEU B C   1 
ATOM   3753  O  O   . LEU B  1 25  ? 51.817  -10.593 22.963  1.00   26.50 ? 132 LEU B O   1 
ATOM   3754  C  CB  . LEU B  1 25  ? 51.781  -11.954 20.384  1.00   24.36 ? 132 LEU B CB  1 
ATOM   3755  C  CG  . LEU B  1 25  ? 52.037  -11.992 18.871  1.00   22.33 ? 132 LEU B CG  1 
ATOM   3756  C  CD1 . LEU B  1 25  ? 50.774  -12.357 18.113  1.00   16.74 ? 132 LEU B CD1 1 
ATOM   3757  C  CD2 . LEU B  1 25  ? 52.534  -10.632 18.433  1.00   21.61 ? 132 LEU B CD2 1 
ATOM   3758  N  N   . ASN B  1 26  ? 53.322  -12.135 23.587  1.00   28.18 ? 133 ASN B N   1 
ATOM   3759  C  CA  . ASN B  1 26  ? 53.108  -11.946 25.013  1.00   24.59 ? 133 ASN B CA  1 
ATOM   3760  C  C   . ASN B  1 26  ? 51.656  -12.096 25.428  1.00   23.83 ? 133 ASN B C   1 
ATOM   3761  O  O   . ASN B  1 26  ? 51.169  -11.370 26.286  1.00   25.25 ? 133 ASN B O   1 
ATOM   3762  C  CB  . ASN B  1 26  ? 53.625  -10.566 25.403  1.00   23.21 ? 133 ASN B CB  1 
ATOM   3763  C  CG  . ASN B  1 26  ? 53.897  -10.438 26.874  1.00   25.05 ? 133 ASN B CG  1 
ATOM   3764  O  OD1 . ASN B  1 26  ? 54.292  -11.408 27.532  1.00   23.24 ? 133 ASN B OD1 1 
ATOM   3765  N  ND2 . ASN B  1 26  ? 53.714  -9.230  27.406  1.00   21.34 ? 133 ASN B ND2 1 
ATOM   3766  N  N   . VAL B  1 27  ? 50.973  -13.055 24.821  1.00   25.88 ? 134 VAL B N   1 
ATOM   3767  C  CA  . VAL B  1 27  ? 49.565  -13.308 25.109  1.00   27.19 ? 134 VAL B CA  1 
ATOM   3768  C  C   . VAL B  1 27  ? 49.334  -14.019 26.441  1.00   28.82 ? 134 VAL B C   1 
ATOM   3769  O  O   . VAL B  1 27  ? 48.359  -13.735 27.141  1.00   31.41 ? 134 VAL B O   1 
ATOM   3770  C  CB  . VAL B  1 27  ? 48.923  -14.154 23.983  1.00   26.02 ? 134 VAL B CB  1 
ATOM   3771  C  CG1 . VAL B  1 27  ? 47.506  -14.560 24.368  1.00   24.58 ? 134 VAL B CG1 1 
ATOM   3772  C  CG2 . VAL B  1 27  ? 48.911  -13.365 22.683  1.00   23.14 ? 134 VAL B CG2 1 
ATOM   3773  N  N   . LYS B  1 28  ? 50.220  -14.945 26.789  1.00   29.63 ? 135 LYS B N   1 
ATOM   3774  C  CA  . LYS B  1 28  ? 50.074  -15.676 28.039  1.00   31.11 ? 135 LYS B CA  1 
ATOM   3775  C  C   . LYS B  1 28  ? 50.051  -14.688 29.207  1.00   29.18 ? 135 LYS B C   1 
ATOM   3776  O  O   . LYS B  1 28  ? 49.280  -14.851 30.149  1.00   27.99 ? 135 LYS B O   1 
ATOM   3777  C  CB  . LYS B  1 28  ? 51.226  -16.679 28.190  1.00   36.21 ? 135 LYS B CB  1 
ATOM   3778  C  CG  . LYS B  1 28  ? 51.081  -17.647 29.364  1.00   43.70 ? 135 LYS B CG  1 
ATOM   3779  C  CD  . LYS B  1 28  ? 52.216  -18.674 29.394  1.00   49.47 ? 135 LYS B CD  1 
ATOM   3780  C  CE  . LYS B  1 28  ? 52.105  -19.592 30.616  1.00   54.04 ? 135 LYS B CE  1 
ATOM   3781  N  NZ  . LYS B  1 28  ? 53.191  -20.625 30.674  1.00   54.73 ? 135 LYS B NZ  1 
ATOM   3782  N  N   . ALA B  1 29  ? 50.886  -13.655 29.127  1.00   27.70 ? 136 ALA B N   1 
ATOM   3783  C  CA  . ALA B  1 29  ? 50.954  -12.632 30.166  1.00   27.82 ? 136 ALA B CA  1 
ATOM   3784  C  C   . ALA B  1 29  ? 49.603  -11.951 30.361  1.00   29.66 ? 136 ALA B C   1 
ATOM   3785  O  O   . ALA B  1 29  ? 49.281  -11.494 31.464  1.00   29.96 ? 136 ALA B O   1 
ATOM   3786  C  CB  . ALA B  1 29  ? 52.016  -11.588 29.821  1.00   24.10 ? 136 ALA B CB  1 
ATOM   3787  N  N   . ALA B  1 30  ? 48.818  -11.874 29.289  1.00   30.41 ? 137 ALA B N   1 
ATOM   3788  C  CA  . ALA B  1 30  ? 47.496  -11.261 29.371  1.00   30.49 ? 137 ALA B CA  1 
ATOM   3789  C  C   . ALA B  1 30  ? 46.530  -12.255 30.003  1.00   30.62 ? 137 ALA B C   1 
ATOM   3790  O  O   . ALA B  1 30  ? 45.720  -11.892 30.862  1.00   32.72 ? 137 ALA B O   1 
ATOM   3791  C  CB  . ALA B  1 30  ? 47.006  -10.854 27.985  1.00   27.48 ? 137 ALA B CB  1 
ATOM   3792  N  N   . TRP B  1 31  ? 46.608  -13.513 29.580  1.00   30.62 ? 138 TRP B N   1 
ATOM   3793  C  CA  . TRP B  1 31  ? 45.739  -14.541 30.156  1.00   32.37 ? 138 TRP B CA  1 
ATOM   3794  C  C   . TRP B  1 31  ? 45.990  -14.599 31.666  1.00   32.77 ? 138 TRP B C   1 
ATOM   3795  O  O   . TRP B  1 31  ? 45.053  -14.650 32.458  1.00   33.61 ? 138 TRP B O   1 
ATOM   3796  C  CB  . TRP B  1 31  ? 46.043  -15.922 29.555  1.00   33.26 ? 138 TRP B CB  1 
ATOM   3797  C  CG  . TRP B  1 31  ? 45.744  -16.066 28.087  1.00   30.21 ? 138 TRP B CG  1 
ATOM   3798  C  CD1 . TRP B  1 31  ? 44.826  -15.359 27.358  1.00   29.25 ? 138 TRP B CD1 1 
ATOM   3799  C  CD2 . TRP B  1 31  ? 46.315  -17.026 27.190  1.00   28.88 ? 138 TRP B CD2 1 
ATOM   3800  N  NE1 . TRP B  1 31  ? 44.790  -15.822 26.063  1.00   28.71 ? 138 TRP B NE1 1 
ATOM   3801  C  CE2 . TRP B  1 31  ? 45.694  -16.845 25.931  1.00   31.04 ? 138 TRP B CE2 1 
ATOM   3802  C  CE3 . TRP B  1 31  ? 47.290  -18.022 27.326  1.00   26.42 ? 138 TRP B CE3 1 
ATOM   3803  C  CZ2 . TRP B  1 31  ? 46.020  -17.626 24.811  1.00   28.60 ? 138 TRP B CZ2 1 
ATOM   3804  C  CZ3 . TRP B  1 31  ? 47.615  -18.796 26.219  1.00   28.88 ? 138 TRP B CZ3 1 
ATOM   3805  C  CH2 . TRP B  1 31  ? 46.979  -18.593 24.973  1.00   26.59 ? 138 TRP B CH2 1 
ATOM   3806  N  N   . ALA B  1 32  ? 47.267  -14.583 32.049  1.00   32.55 ? 139 ALA B N   1 
ATOM   3807  C  CA  . ALA B  1 32  ? 47.663  -14.634 33.452  1.00   33.48 ? 139 ALA B CA  1 
ATOM   3808  C  C   . ALA B  1 32  ? 47.068  -13.478 34.247  1.00   35.36 ? 139 ALA B C   1 
ATOM   3809  O  O   . ALA B  1 32  ? 46.783  -13.615 35.431  1.00   37.75 ? 139 ALA B O   1 
ATOM   3810  C  CB  . ALA B  1 32  ? 49.175  -14.614 33.562  1.00   32.68 ? 139 ALA B CB  1 
ATOM   3811  N  N   . GLN B  1 33  ? 46.894  -12.332 33.599  1.00   36.08 ? 140 GLN B N   1 
ATOM   3812  C  CA  . GLN B  1 33  ? 46.307  -11.178 34.270  1.00   33.42 ? 140 GLN B CA  1 
ATOM   3813  C  C   . GLN B  1 33  ? 44.793  -11.375 34.368  1.00   30.14 ? 140 GLN B C   1 
ATOM   3814  O  O   . GLN B  1 33  ? 44.082  -10.543 34.917  1.00   28.10 ? 140 GLN B O   1 
ATOM   3815  C  CB  . GLN B  1 33  ? 46.639  -9.892  33.504  1.00   32.84 ? 140 GLN B CB  1 
ATOM   3816  C  CG  . GLN B  1 33  ? 48.033  -9.340  33.799  1.00   37.24 ? 140 GLN B CG  1 
ATOM   3817  C  CD  . GLN B  1 33  ? 48.403  -8.126  32.938  1.00   40.46 ? 140 GLN B CD  1 
ATOM   3818  O  OE1 . GLN B  1 33  ? 49.067  -8.258  31.904  1.00   41.89 ? 140 GLN B OE1 1 
ATOM   3819  N  NE2 . GLN B  1 33  ? 47.967  -6.941  33.365  1.00   39.65 ? 140 GLN B NE2 1 
ATOM   3820  N  N   . GLY B  1 34  ? 44.314  -12.483 33.813  1.00   29.81 ? 141 GLY B N   1 
ATOM   3821  C  CA  . GLY B  1 34  ? 42.898  -12.794 33.863  1.00   29.09 ? 141 GLY B CA  1 
ATOM   3822  C  C   . GLY B  1 34  ? 42.048  -12.434 32.660  1.00   31.32 ? 141 GLY B C   1 
ATOM   3823  O  O   . GLY B  1 34  ? 40.818  -12.491 32.740  1.00   34.26 ? 141 GLY B O   1 
ATOM   3824  N  N   . TYR B  1 35  ? 42.666  -12.089 31.538  1.00   30.51 ? 142 TYR B N   1 
ATOM   3825  C  CA  . TYR B  1 35  ? 41.881  -11.695 30.365  1.00   29.64 ? 142 TYR B CA  1 
ATOM   3826  C  C   . TYR B  1 35  ? 41.907  -12.726 29.253  1.00   28.29 ? 142 TYR B C   1 
ATOM   3827  O  O   . TYR B  1 35  ? 42.971  -13.108 28.765  1.00   31.25 ? 142 TYR B O   1 
ATOM   3828  C  CB  . TYR B  1 35  ? 42.364  -10.324 29.878  1.00   28.53 ? 142 TYR B CB  1 
ATOM   3829  C  CG  . TYR B  1 35  ? 42.240  -9.271  30.963  1.00   27.01 ? 142 TYR B CG  1 
ATOM   3830  C  CD1 . TYR B  1 35  ? 40.987  -8.802  31.372  1.00   28.40 ? 142 TYR B CD1 1 
ATOM   3831  C  CD2 . TYR B  1 35  ? 43.365  -8.792  31.625  1.00   28.01 ? 142 TYR B CD2 1 
ATOM   3832  C  CE1 . TYR B  1 35  ? 40.861  -7.881  32.419  1.00   28.09 ? 142 TYR B CE1 1 
ATOM   3833  C  CE2 . TYR B  1 35  ? 43.252  -7.870  32.671  1.00   29.68 ? 142 TYR B CE2 1 
ATOM   3834  C  CZ  . TYR B  1 35  ? 42.001  -7.417  33.059  1.00   30.09 ? 142 TYR B CZ  1 
ATOM   3835  O  OH  . TYR B  1 35  ? 41.898  -6.461  34.051  1.00   31.62 ? 142 TYR B OH  1 
ATOM   3836  N  N   . THR B  1 36  ? 40.719  -13.170 28.859  1.00   27.30 ? 143 THR B N   1 
ATOM   3837  C  CA  . THR B  1 36  ? 40.582  -14.191 27.835  1.00   27.36 ? 143 THR B CA  1 
ATOM   3838  C  C   . THR B  1 36  ? 39.555  -13.836 26.756  1.00   28.24 ? 143 THR B C   1 
ATOM   3839  O  O   . THR B  1 36  ? 39.271  -14.651 25.862  1.00   26.59 ? 143 THR B O   1 
ATOM   3840  C  CB  . THR B  1 36  ? 40.184  -15.541 28.477  1.00   29.95 ? 143 THR B CB  1 
ATOM   3841  O  OG1 . THR B  1 36  ? 38.970  -15.377 29.228  1.00   29.01 ? 143 THR B OG1 1 
ATOM   3842  C  CG2 . THR B  1 36  ? 41.279  -16.032 29.398  1.00   24.99 ? 143 THR B CG2 1 
ATOM   3843  N  N   . GLY B  1 37  ? 38.993  -12.633 26.847  1.00   26.61 ? 144 GLY B N   1 
ATOM   3844  C  CA  . GLY B  1 37  ? 38.030  -12.193 25.849  1.00   28.83 ? 144 GLY B CA  1 
ATOM   3845  C  C   . GLY B  1 37  ? 36.584  -12.419 26.231  1.00   29.60 ? 144 GLY B C   1 
ATOM   3846  O  O   . GLY B  1 37  ? 35.669  -12.200 25.442  1.00   25.01 ? 144 GLY B O   1 
ATOM   3847  N  N   . HIS B  1 38  ? 36.372  -12.868 27.456  1.00   33.08 ? 145 HIS B N   1 
ATOM   3848  C  CA  . HIS B  1 38  ? 35.024  -13.115 27.926  1.00   34.88 ? 145 HIS B CA  1 
ATOM   3849  C  C   . HIS B  1 38  ? 34.164  -11.867 27.759  1.00   33.42 ? 145 HIS B C   1 
ATOM   3850  O  O   . HIS B  1 38  ? 34.554  -10.772 28.167  1.00   34.54 ? 145 HIS B O   1 
ATOM   3851  C  CB  . HIS B  1 38  ? 35.056  -13.509 29.397  1.00   44.64 ? 145 HIS B CB  1 
ATOM   3852  C  CG  . HIS B  1 38  ? 33.712  -13.843 29.956  1.00   53.84 ? 145 HIS B CG  1 
ATOM   3853  N  ND1 . HIS B  1 38  ? 33.019  -14.980 29.597  1.00   57.84 ? 145 HIS B ND1 1 
ATOM   3854  C  CD2 . HIS B  1 38  ? 32.919  -13.178 30.832  1.00   58.69 ? 145 HIS B CD2 1 
ATOM   3855  C  CE1 . HIS B  1 38  ? 31.856  -15.000 30.226  1.00   60.66 ? 145 HIS B CE1 1 
ATOM   3856  N  NE2 . HIS B  1 38  ? 31.771  -13.918 30.981  1.00   62.77 ? 145 HIS B NE2 1 
ATOM   3857  N  N   . GLY B  1 39  ? 32.995  -12.036 27.156  1.00   31.55 ? 146 GLY B N   1 
ATOM   3858  C  CA  . GLY B  1 39  ? 32.085  -10.917 26.970  1.00   29.55 ? 146 GLY B CA  1 
ATOM   3859  C  C   . GLY B  1 39  ? 32.296  -10.049 25.737  1.00   30.85 ? 146 GLY B C   1 
ATOM   3860  O  O   . GLY B  1 39  ? 31.493  -9.154  25.461  1.00   28.97 ? 146 GLY B O   1 
ATOM   3861  N  N   . ILE B  1 40  ? 33.365  -10.300 24.990  1.00   27.71 ? 147 ILE B N   1 
ATOM   3862  C  CA  . ILE B  1 40  ? 33.642  -9.523  23.792  1.00   25.06 ? 147 ILE B CA  1 
ATOM   3863  C  C   . ILE B  1 40  ? 33.181  -10.295 22.553  1.00   25.37 ? 147 ILE B C   1 
ATOM   3864  O  O   . ILE B  1 40  ? 33.298  -11.523 22.495  1.00   28.37 ? 147 ILE B O   1 
ATOM   3865  C  CB  . ILE B  1 40  ? 35.157  -9.197  23.703  1.00   25.53 ? 147 ILE B CB  1 
ATOM   3866  C  CG1 . ILE B  1 40  ? 35.602  -8.551  25.016  1.00   24.22 ? 147 ILE B CG1 1 
ATOM   3867  C  CG2 . ILE B  1 40  ? 35.448  -8.243  22.529  1.00   23.30 ? 147 ILE B CG2 1 
ATOM   3868  C  CD1 . ILE B  1 40  ? 34.813  -7.295  25.387  1.00   16.63 ? 147 ILE B CD1 1 
ATOM   3869  N  N   . VAL B  1 41  ? 32.651  -9.576  21.568  1.00   23.34 ? 148 VAL B N   1 
ATOM   3870  C  CA  . VAL B  1 41  ? 32.165  -10.205 20.343  1.00   22.77 ? 148 VAL B CA  1 
ATOM   3871  C  C   . VAL B  1 41  ? 32.987  -9.760  19.143  1.00   21.62 ? 148 VAL B C   1 
ATOM   3872  O  O   . VAL B  1 41  ? 33.154  -8.567  18.900  1.00   23.31 ? 148 VAL B O   1 
ATOM   3873  C  CB  . VAL B  1 41  ? 30.685  -9.851  20.078  1.00   24.92 ? 148 VAL B CB  1 
ATOM   3874  C  CG1 . VAL B  1 41  ? 30.234  -10.479 18.774  1.00   21.31 ? 148 VAL B CG1 1 
ATOM   3875  C  CG2 . VAL B  1 41  ? 29.808  -10.323 21.236  1.00   25.05 ? 148 VAL B CG2 1 
ATOM   3876  N  N   . VAL B  1 42  ? 33.481  -10.732 18.388  1.00   21.11 ? 149 VAL B N   1 
ATOM   3877  C  CA  . VAL B  1 42  ? 34.313  -10.480 17.221  1.00   20.21 ? 149 VAL B CA  1 
ATOM   3878  C  C   . VAL B  1 42  ? 33.703  -11.147 16.000  1.00   21.65 ? 149 VAL B C   1 
ATOM   3879  O  O   . VAL B  1 42  ? 33.249  -12.293 16.063  1.00   23.04 ? 149 VAL B O   1 
ATOM   3880  C  CB  . VAL B  1 42  ? 35.726  -11.075 17.425  1.00   20.24 ? 149 VAL B CB  1 
ATOM   3881  C  CG1 . VAL B  1 42  ? 36.654  -10.661 16.289  1.00   17.57 ? 149 VAL B CG1 1 
ATOM   3882  C  CG2 . VAL B  1 42  ? 36.273  -10.643 18.767  1.00   21.14 ? 149 VAL B CG2 1 
ATOM   3883  N  N   . SER B  1 43  ? 33.709  -10.441 14.883  1.00   19.36 ? 150 SER B N   1 
ATOM   3884  C  CA  . SER B  1 43  ? 33.158  -10.992 13.663  1.00   21.72 ? 150 SER B CA  1 
ATOM   3885  C  C   . SER B  1 43  ? 34.196  -10.988 12.548  1.00   22.26 ? 150 SER B C   1 
ATOM   3886  O  O   . SER B  1 43  ? 34.857  -9.976  12.299  1.00   22.64 ? 150 SER B O   1 
ATOM   3887  C  CB  . SER B  1 43  ? 31.925  -10.198 13.210  1.00   22.23 ? 150 SER B CB  1 
ATOM   3888  O  OG  . SER B  1 43  ? 31.340  -10.803 12.059  1.00   23.85 ? 150 SER B OG  1 
ATOM   3889  N  N   . ILE B  1 44  ? 34.330  -12.133 11.887  1.00   19.60 ? 151 ILE B N   1 
ATOM   3890  C  CA  . ILE B  1 44  ? 35.272  -12.310 10.794  1.00   18.31 ? 151 ILE B CA  1 
ATOM   3891  C  C   . ILE B  1 44  ? 34.549  -12.074 9.465   1.00   21.10 ? 151 ILE B C   1 
ATOM   3892  O  O   . ILE B  1 44  ? 33.703  -12.882 9.067   1.00   23.90 ? 151 ILE B O   1 
ATOM   3893  C  CB  . ILE B  1 44  ? 35.807  -13.747 10.784  1.00   17.60 ? 151 ILE B CB  1 
ATOM   3894  C  CG1 . ILE B  1 44  ? 36.380  -14.113 12.161  1.00   15.84 ? 151 ILE B CG1 1 
ATOM   3895  C  CG2 . ILE B  1 44  ? 36.786  -13.929 9.636   1.00   14.91 ? 151 ILE B CG2 1 
ATOM   3896  C  CD1 . ILE B  1 44  ? 37.524  -13.265 12.648  1.00   18.52 ? 151 ILE B CD1 1 
ATOM   3897  N  N   . LEU B  1 45  ? 34.855  -10.975 8.784   1.00   20.90 ? 152 LEU B N   1 
ATOM   3898  C  CA  . LEU B  1 45  ? 34.203  -10.692 7.502   1.00   22.79 ? 152 LEU B CA  1 
ATOM   3899  C  C   . LEU B  1 45  ? 35.065  -11.400 6.482   1.00   22.01 ? 152 LEU B C   1 
ATOM   3900  O  O   . LEU B  1 45  ? 36.155  -10.938 6.161   1.00   22.45 ? 152 LEU B O   1 
ATOM   3901  C  CB  . LEU B  1 45  ? 34.175  -9.185  7.211   1.00   22.25 ? 152 LEU B CB  1 
ATOM   3902  C  CG  . LEU B  1 45  ? 33.771  -8.221  8.341   1.00   28.42 ? 152 LEU B CG  1 
ATOM   3903  C  CD1 . LEU B  1 45  ? 33.360  -6.874  7.714   1.00   26.65 ? 152 LEU B CD1 1 
ATOM   3904  C  CD2 . LEU B  1 45  ? 32.624  -8.787  9.167   1.00   25.68 ? 152 LEU B CD2 1 
ATOM   3905  N  N   . ASP B  1 46  ? 34.574  -12.516 5.958   1.00   23.65 ? 153 ASP B N   1 
ATOM   3906  C  CA  . ASP B  1 46  ? 35.378  -13.302 5.034   1.00   23.98 ? 153 ASP B CA  1 
ATOM   3907  C  C   . ASP B  1 46  ? 34.529  -14.187 4.096   1.00   23.87 ? 153 ASP B C   1 
ATOM   3908  O  O   . ASP B  1 46  ? 33.472  -13.773 3.628   1.00   22.96 ? 153 ASP B O   1 
ATOM   3909  C  CB  . ASP B  1 46  ? 36.331  -14.153 5.891   1.00   23.18 ? 153 ASP B CB  1 
ATOM   3910  C  CG  . ASP B  1 46  ? 37.655  -14.455 5.211   1.00   26.49 ? 153 ASP B CG  1 
ATOM   3911  O  OD1 . ASP B  1 46  ? 37.719  -15.349 4.335   1.00   25.45 ? 153 ASP B OD1 1 
ATOM   3912  O  OD2 . ASP B  1 46  ? 38.645  -13.794 5.571   1.00   25.78 ? 153 ASP B OD2 1 
ATOM   3913  N  N   . ASP B  1 47  ? 35.004  -15.406 3.836   1.00   23.58 ? 154 ASP B N   1 
ATOM   3914  C  CA  . ASP B  1 47  ? 34.310  -16.328 2.948   1.00   23.63 ? 154 ASP B CA  1 
ATOM   3915  C  C   . ASP B  1 47  ? 33.422  -17.316 3.681   1.00   24.07 ? 154 ASP B C   1 
ATOM   3916  O  O   . ASP B  1 47  ? 33.004  -18.318 3.110   1.00   26.26 ? 154 ASP B O   1 
ATOM   3917  C  CB  . ASP B  1 47  ? 35.310  -17.091 2.039   1.00   22.35 ? 154 ASP B CB  1 
ATOM   3918  C  CG  . ASP B  1 47  ? 36.280  -17.996 2.814   1.00   20.59 ? 154 ASP B CG  1 
ATOM   3919  O  OD1 . ASP B  1 47  ? 36.034  -18.328 3.992   1.00   20.36 ? 154 ASP B OD1 1 
ATOM   3920  O  OD2 . ASP B  1 47  ? 37.301  -18.393 2.222   1.00   21.97 ? 154 ASP B OD2 1 
ATOM   3921  N  N   . GLY B  1 48  ? 33.135  -17.025 4.944   1.00   25.47 ? 155 GLY B N   1 
ATOM   3922  C  CA  . GLY B  1 48  ? 32.288  -17.894 5.732   1.00   25.74 ? 155 GLY B CA  1 
ATOM   3923  C  C   . GLY B  1 48  ? 32.994  -18.450 6.956   1.00   28.52 ? 155 GLY B C   1 
ATOM   3924  O  O   . GLY B  1 48  ? 34.206  -18.278 7.125   1.00   25.71 ? 155 GLY B O   1 
ATOM   3925  N  N   . ILE B  1 49  ? 32.233  -19.115 7.820   1.00   27.34 ? 156 ILE B N   1 
ATOM   3926  C  CA  . ILE B  1 49  ? 32.799  -19.700 9.020   1.00   30.93 ? 156 ILE B CA  1 
ATOM   3927  C  C   . ILE B  1 49  ? 32.110  -21.035 9.331   1.00   33.96 ? 156 ILE B C   1 
ATOM   3928  O  O   . ILE B  1 49  ? 30.883  -21.111 9.396   1.00   34.53 ? 156 ILE B O   1 
ATOM   3929  C  CB  . ILE B  1 49  ? 32.655  -18.739 10.221  1.00   30.07 ? 156 ILE B CB  1 
ATOM   3930  C  CG1 . ILE B  1 49  ? 33.362  -19.321 11.440  1.00   29.79 ? 156 ILE B CG1 1 
ATOM   3931  C  CG2 . ILE B  1 49  ? 31.181  -18.475 10.518  1.00   32.23 ? 156 ILE B CG2 1 
ATOM   3932  C  CD1 . ILE B  1 49  ? 33.336  -18.393 12.650  1.00   27.28 ? 156 ILE B CD1 1 
ATOM   3933  N  N   . GLU B  1 50  ? 32.906  -22.090 9.503   1.00   34.12 ? 157 GLU B N   1 
ATOM   3934  C  CA  . GLU B  1 50  ? 32.373  -23.412 9.813   1.00   31.15 ? 157 GLU B CA  1 
ATOM   3935  C  C   . GLU B  1 50  ? 31.969  -23.386 11.284  1.00   31.66 ? 157 GLU B C   1 
ATOM   3936  O  O   . GLU B  1 50  ? 32.738  -23.777 12.163  1.00   30.11 ? 157 GLU B O   1 
ATOM   3937  C  CB  . GLU B  1 50  ? 33.449  -24.467 9.567   1.00   31.57 ? 157 GLU B CB  1 
ATOM   3938  C  CG  . GLU B  1 50  ? 32.932  -25.893 9.479   1.00   33.46 ? 157 GLU B CG  1 
ATOM   3939  C  CD  . GLU B  1 50  ? 34.014  -26.861 9.017   1.00   35.85 ? 157 GLU B CD  1 
ATOM   3940  O  OE1 . GLU B  1 50  ? 34.837  -27.285 9.856   1.00   30.74 ? 157 GLU B OE1 1 
ATOM   3941  O  OE2 . GLU B  1 50  ? 34.054  -27.183 7.803   1.00   37.30 ? 157 GLU B OE2 1 
ATOM   3942  N  N   . LYS B  1 51  ? 30.752  -22.912 11.539  1.00   32.18 ? 158 LYS B N   1 
ATOM   3943  C  CA  . LYS B  1 51  ? 30.228  -22.775 12.897  1.00   32.55 ? 158 LYS B CA  1 
ATOM   3944  C  C   . LYS B  1 51  ? 30.168  -24.056 13.714  1.00   33.91 ? 158 LYS B C   1 
ATOM   3945  O  O   . LYS B  1 51  ? 30.158  -24.018 14.946  1.00   32.17 ? 158 LYS B O   1 
ATOM   3946  C  CB  . LYS B  1 51  ? 28.836  -22.131 12.849  1.00   33.31 ? 158 LYS B CB  1 
ATOM   3947  C  CG  . LYS B  1 51  ? 27.818  -22.856 11.966  1.00   35.57 ? 158 LYS B CG  1 
ATOM   3948  C  CD  . LYS B  1 51  ? 26.475  -22.116 11.940  1.00   37.59 ? 158 LYS B CD  1 
ATOM   3949  C  CE  . LYS B  1 51  ? 25.389  -22.957 11.283  1.00   39.12 ? 158 LYS B CE  1 
ATOM   3950  N  NZ  . LYS B  1 51  ? 25.795  -23.427 9.919   1.00   41.74 ? 158 LYS B NZ  1 
ATOM   3951  N  N   . ASN B  1 52  ? 30.126  -25.190 13.026  1.00   35.69 ? 159 ASN B N   1 
ATOM   3952  C  CA  . ASN B  1 52  ? 30.057  -26.477 13.694  1.00   36.34 ? 159 ASN B CA  1 
ATOM   3953  C  C   . ASN B  1 52  ? 31.442  -27.078 13.925  1.00   36.45 ? 159 ASN B C   1 
ATOM   3954  O  O   . ASN B  1 52  ? 31.550  -28.209 14.391  1.00   38.40 ? 159 ASN B O   1 
ATOM   3955  C  CB  . ASN B  1 52  ? 29.195  -27.432 12.871  1.00   35.84 ? 159 ASN B CB  1 
ATOM   3956  C  CG  . ASN B  1 52  ? 29.670  -27.557 11.447  1.00   40.55 ? 159 ASN B CG  1 
ATOM   3957  O  OD1 . ASN B  1 52  ? 29.871  -26.555 10.750  1.00   42.15 ? 159 ASN B OD1 1 
ATOM   3958  N  ND2 . ASN B  1 52  ? 29.850  -28.792 10.997  1.00   44.24 ? 159 ASN B ND2 1 
ATOM   3959  N  N   . HIS B  1 53  ? 32.498  -26.333 13.602  1.00   33.74 ? 160 HIS B N   1 
ATOM   3960  C  CA  . HIS B  1 53  ? 33.852  -26.847 13.805  1.00   31.46 ? 160 HIS B CA  1 
ATOM   3961  C  C   . HIS B  1 53  ? 34.009  -27.116 15.290  1.00   32.78 ? 160 HIS B C   1 
ATOM   3962  O  O   . HIS B  1 53  ? 33.628  -26.292 16.123  1.00   32.94 ? 160 HIS B O   1 
ATOM   3963  C  CB  . HIS B  1 53  ? 34.906  -25.835 13.343  1.00   30.31 ? 160 HIS B CB  1 
ATOM   3964  C  CG  . HIS B  1 53  ? 36.284  -26.413 13.208  1.00   28.32 ? 160 HIS B CG  1 
ATOM   3965  N  ND1 . HIS B  1 53  ? 37.045  -26.791 14.294  1.00   25.58 ? 160 HIS B ND1 1 
ATOM   3966  C  CD2 . HIS B  1 53  ? 37.038  -26.673 12.110  1.00   24.42 ? 160 HIS B CD2 1 
ATOM   3967  C  CE1 . HIS B  1 53  ? 38.207  -27.257 13.872  1.00   25.61 ? 160 HIS B CE1 1 
ATOM   3968  N  NE2 . HIS B  1 53  ? 38.230  -27.196 12.552  1.00   26.62 ? 160 HIS B NE2 1 
ATOM   3969  N  N   . PRO B  1 54  ? 34.566  -28.283 15.646  1.00   32.80 ? 161 PRO B N   1 
ATOM   3970  C  CA  . PRO B  1 54  ? 34.756  -28.644 17.054  1.00   31.06 ? 161 PRO B CA  1 
ATOM   3971  C  C   . PRO B  1 54  ? 35.535  -27.652 17.895  1.00   31.68 ? 161 PRO B C   1 
ATOM   3972  O  O   . PRO B  1 54  ? 35.354  -27.600 19.113  1.00   33.13 ? 161 PRO B O   1 
ATOM   3973  C  CB  . PRO B  1 54  ? 35.420  -30.027 16.984  1.00   31.82 ? 161 PRO B CB  1 
ATOM   3974  C  CG  . PRO B  1 54  ? 36.088  -30.038 15.631  1.00   33.87 ? 161 PRO B CG  1 
ATOM   3975  C  CD  . PRO B  1 54  ? 35.063  -29.348 14.756  1.00   33.30 ? 161 PRO B CD  1 
ATOM   3976  N  N   . ASP B  1 55  ? 36.389  -26.848 17.270  1.00   31.95 ? 162 ASP B N   1 
ATOM   3977  C  CA  . ASP B  1 55  ? 37.146  -25.872 18.046  1.00   31.59 ? 162 ASP B CA  1 
ATOM   3978  C  C   . ASP B  1 55  ? 36.532  -24.467 17.973  1.00   33.30 ? 162 ASP B C   1 
ATOM   3979  O  O   . ASP B  1 55  ? 37.107  -23.504 18.503  1.00   33.87 ? 162 ASP B O   1 
ATOM   3980  C  CB  . ASP B  1 55  ? 38.610  -25.849 17.588  1.00   30.72 ? 162 ASP B CB  1 
ATOM   3981  C  CG  . ASP B  1 55  ? 39.596  -25.757 18.759  1.00   30.57 ? 162 ASP B CG  1 
ATOM   3982  O  OD1 . ASP B  1 55  ? 39.213  -26.056 19.912  1.00   26.52 ? 162 ASP B OD1 1 
ATOM   3983  O  OD2 . ASP B  1 55  ? 40.771  -25.404 18.523  1.00   30.63 ? 162 ASP B OD2 1 
ATOM   3984  N  N   . LEU B  1 56  ? 35.367  -24.355 17.331  1.00   30.51 ? 163 LEU B N   1 
ATOM   3985  C  CA  . LEU B  1 56  ? 34.672  -23.070 17.199  1.00   30.79 ? 163 LEU B CA  1 
ATOM   3986  C  C   . LEU B  1 56  ? 33.251  -23.070 17.760  1.00   31.83 ? 163 LEU B C   1 
ATOM   3987  O  O   . LEU B  1 56  ? 32.796  -22.076 18.322  1.00   33.36 ? 163 LEU B O   1 
ATOM   3988  C  CB  . LEU B  1 56  ? 34.592  -22.644 15.736  1.00   27.21 ? 163 LEU B CB  1 
ATOM   3989  C  CG  . LEU B  1 56  ? 35.883  -22.282 15.016  1.00   25.88 ? 163 LEU B CG  1 
ATOM   3990  C  CD1 . LEU B  1 56  ? 35.535  -21.892 13.590  1.00   20.34 ? 163 LEU B CD1 1 
ATOM   3991  C  CD2 . LEU B  1 56  ? 36.600  -21.155 15.740  1.00   21.97 ? 163 LEU B CD2 1 
ATOM   3992  N  N   . ALA B  1 57  ? 32.546  -24.183 17.590  1.00   32.21 ? 164 ALA B N   1 
ATOM   3993  C  CA  . ALA B  1 57  ? 31.169  -24.303 18.053  1.00   30.29 ? 164 ALA B CA  1 
ATOM   3994  C  C   . ALA B  1 57  ? 30.927  -23.721 19.443  1.00   28.51 ? 164 ALA B C   1 
ATOM   3995  O  O   . ALA B  1 57  ? 29.976  -22.971 19.656  1.00   28.78 ? 164 ALA B O   1 
ATOM   3996  C  CB  . ALA B  1 57  ? 30.747  -25.765 18.021  1.00   29.34 ? 164 ALA B CB  1 
ATOM   3997  N  N   . GLY B  1 58  ? 31.792  -24.068 20.386  1.00   29.79 ? 165 GLY B N   1 
ATOM   3998  C  CA  . GLY B  1 58  ? 31.641  -23.586 21.745  1.00   29.54 ? 165 GLY B CA  1 
ATOM   3999  C  C   . GLY B  1 58  ? 31.616  -22.081 21.901  1.00   30.25 ? 165 GLY B C   1 
ATOM   4000  O  O   . GLY B  1 58  ? 31.047  -21.575 22.869  1.00   31.43 ? 165 GLY B O   1 
ATOM   4001  N  N   . ASN B  1 59  ? 32.232  -21.357 20.969  1.00   30.45 ? 166 ASN B N   1 
ATOM   4002  C  CA  . ASN B  1 59  ? 32.258  -19.900 21.049  1.00   30.33 ? 166 ASN B CA  1 
ATOM   4003  C  C   . ASN B  1 59  ? 31.439  -19.218 19.970  1.00   32.05 ? 166 ASN B C   1 
ATOM   4004  O  O   . ASN B  1 59  ? 31.267  -17.990 19.999  1.00   30.27 ? 166 ASN B O   1 
ATOM   4005  C  CB  . ASN B  1 59  ? 33.695  -19.381 20.992  1.00   26.70 ? 166 ASN B CB  1 
ATOM   4006  C  CG  . ASN B  1 59  ? 34.451  -19.644 22.274  1.00   27.60 ? 166 ASN B CG  1 
ATOM   4007  O  OD1 . ASN B  1 59  ? 33.861  -19.648 23.352  1.00   30.12 ? 166 ASN B OD1 1 
ATOM   4008  N  ND2 . ASN B  1 59  ? 35.763  -19.851 22.170  1.00   27.10 ? 166 ASN B ND2 1 
ATOM   4009  N  N   . TYR B  1 60  ? 30.921  -20.004 19.029  1.00   30.56 ? 167 TYR B N   1 
ATOM   4010  C  CA  . TYR B  1 60  ? 30.142  -19.437 17.930  1.00   31.69 ? 167 TYR B CA  1 
ATOM   4011  C  C   . TYR B  1 60  ? 28.979  -18.576 18.386  1.00   33.64 ? 167 TYR B C   1 
ATOM   4012  O  O   . TYR B  1 60  ? 28.265  -18.938 19.320  1.00   34.82 ? 167 TYR B O   1 
ATOM   4013  C  CB  . TYR B  1 60  ? 29.607  -20.529 17.023  1.00   32.16 ? 167 TYR B CB  1 
ATOM   4014  C  CG  . TYR B  1 60  ? 28.848  -19.963 15.850  1.00   33.57 ? 167 TYR B CG  1 
ATOM   4015  C  CD1 . TYR B  1 60  ? 29.504  -19.216 14.867  1.00   30.37 ? 167 TYR B CD1 1 
ATOM   4016  C  CD2 . TYR B  1 60  ? 27.472  -20.145 15.734  1.00   30.40 ? 167 TYR B CD2 1 
ATOM   4017  C  CE1 . TYR B  1 60  ? 28.803  -18.667 13.801  1.00   32.94 ? 167 TYR B CE1 1 
ATOM   4018  C  CE2 . TYR B  1 60  ? 26.764  -19.598 14.673  1.00   31.95 ? 167 TYR B CE2 1 
ATOM   4019  C  CZ  . TYR B  1 60  ? 27.432  -18.860 13.712  1.00   32.66 ? 167 TYR B CZ  1 
ATOM   4020  O  OH  . TYR B  1 60  ? 26.724  -18.305 12.669  1.00   38.44 ? 167 TYR B OH  1 
ATOM   4021  N  N   . ASP B  1 61  ? 28.796  -17.437 17.717  1.00   33.22 ? 168 ASP B N   1 
ATOM   4022  C  CA  . ASP B  1 61  ? 27.724  -16.502 18.048  1.00   33.53 ? 168 ASP B CA  1 
ATOM   4023  C  C   . ASP B  1 61  ? 26.957  -16.093 16.787  1.00   33.99 ? 168 ASP B C   1 
ATOM   4024  O  O   . ASP B  1 61  ? 27.452  -15.325 15.959  1.00   32.25 ? 168 ASP B O   1 
ATOM   4025  C  CB  . ASP B  1 61  ? 28.293  -15.253 18.726  1.00   33.72 ? 168 ASP B CB  1 
ATOM   4026  C  CG  . ASP B  1 61  ? 27.213  -14.233 19.075  1.00   39.82 ? 168 ASP B CG  1 
ATOM   4027  O  OD1 . ASP B  1 61  ? 26.095  -14.329 18.520  1.00   39.32 ? 168 ASP B OD1 1 
ATOM   4028  O  OD2 . ASP B  1 61  ? 27.481  -13.329 19.901  1.00   36.98 ? 168 ASP B OD2 1 
ATOM   4029  N  N   . PRO B  1 62  ? 25.723  -16.595 16.638  1.00   33.60 ? 169 PRO B N   1 
ATOM   4030  C  CA  . PRO B  1 62  ? 24.847  -16.314 15.491  1.00   33.64 ? 169 PRO B CA  1 
ATOM   4031  C  C   . PRO B  1 62  ? 24.552  -14.823 15.347  1.00   30.96 ? 169 PRO B C   1 
ATOM   4032  O  O   . PRO B  1 62  ? 24.319  -14.325 14.245  1.00   29.88 ? 169 PRO B O   1 
ATOM   4033  C  CB  . PRO B  1 62  ? 23.581  -17.106 15.815  1.00   34.51 ? 169 PRO B CB  1 
ATOM   4034  C  CG  . PRO B  1 62  ? 24.070  -18.190 16.759  1.00   36.50 ? 169 PRO B CG  1 
ATOM   4035  C  CD  . PRO B  1 62  ? 25.033  -17.439 17.625  1.00   34.19 ? 169 PRO B CD  1 
ATOM   4036  N  N   . GLY B  1 63  ? 24.554  -14.125 16.476  1.00   28.78 ? 170 GLY B N   1 
ATOM   4037  C  CA  . GLY B  1 63  ? 24.284  -12.699 16.477  1.00   28.55 ? 170 GLY B CA  1 
ATOM   4038  C  C   . GLY B  1 63  ? 25.399  -11.876 15.850  1.00   29.11 ? 170 GLY B C   1 
ATOM   4039  O  O   . GLY B  1 63  ? 25.203  -10.707 15.503  1.00   26.38 ? 170 GLY B O   1 
ATOM   4040  N  N   . ALA B  1 64  ? 26.573  -12.485 15.714  1.00   27.01 ? 171 ALA B N   1 
ATOM   4041  C  CA  . ALA B  1 64  ? 27.718  -11.817 15.117  1.00   26.61 ? 171 ALA B CA  1 
ATOM   4042  C  C   . ALA B  1 64  ? 27.947  -12.379 13.721  1.00   27.38 ? 171 ALA B C   1 
ATOM   4043  O  O   . ALA B  1 64  ? 29.012  -12.181 13.138  1.00   28.10 ? 171 ALA B O   1 
ATOM   4044  C  CB  . ALA B  1 64  ? 28.943  -12.052 15.959  1.00   23.87 ? 171 ALA B CB  1 
ATOM   4045  N  N   . SER B  1 65  ? 26.945  -13.072 13.185  1.00   25.28 ? 172 SER B N   1 
ATOM   4046  C  CA  . SER B  1 65  ? 27.097  -13.696 11.881  1.00   26.02 ? 172 SER B CA  1 
ATOM   4047  C  C   . SER B  1 65  ? 25.967  -13.422 10.907  1.00   26.28 ? 172 SER B C   1 
ATOM   4048  O  O   . SER B  1 65  ? 24.858  -13.054 11.299  1.00   28.93 ? 172 SER B O   1 
ATOM   4049  C  CB  . SER B  1 65  ? 27.217  -15.215 12.053  1.00   26.91 ? 172 SER B CB  1 
ATOM   4050  O  OG  . SER B  1 65  ? 28.250  -15.551 12.957  1.00   28.05 ? 172 SER B OG  1 
ATOM   4051  N  N   . PHE B  1 66  ? 26.262  -13.627 9.630   1.00   25.31 ? 173 PHE B N   1 
ATOM   4052  C  CA  . PHE B  1 66  ? 25.275  -13.456 8.582   1.00   25.88 ? 173 PHE B CA  1 
ATOM   4053  C  C   . PHE B  1 66  ? 25.866  -13.884 7.247   1.00   28.01 ? 173 PHE B C   1 
ATOM   4054  O  O   . PHE B  1 66  ? 27.092  -13.935 7.090   1.00   28.57 ? 173 PHE B O   1 
ATOM   4055  C  CB  . PHE B  1 66  ? 24.820  -12.003 8.502   1.00   26.97 ? 173 PHE B CB  1 
ATOM   4056  C  CG  . PHE B  1 66  ? 23.484  -11.836 7.844   1.00   27.72 ? 173 PHE B CG  1 
ATOM   4057  C  CD1 . PHE B  1 66  ? 22.314  -12.155 8.534   1.00   27.50 ? 173 PHE B CD1 1 
ATOM   4058  C  CD2 . PHE B  1 66  ? 23.395  -11.435 6.516   1.00   26.27 ? 173 PHE B CD2 1 
ATOM   4059  C  CE1 . PHE B  1 66  ? 21.070  -12.084 7.906   1.00   29.27 ? 173 PHE B CE1 1 
ATOM   4060  C  CE2 . PHE B  1 66  ? 22.160  -11.359 5.877   1.00   29.81 ? 173 PHE B CE2 1 
ATOM   4061  C  CZ  . PHE B  1 66  ? 20.991  -11.686 6.574   1.00   29.00 ? 173 PHE B CZ  1 
ATOM   4062  N  N   . ASP B  1 67  ? 25.002  -14.224 6.295   1.00   26.06 ? 174 ASP B N   1 
ATOM   4063  C  CA  . ASP B  1 67  ? 25.467  -14.617 4.969   1.00   28.79 ? 174 ASP B CA  1 
ATOM   4064  C  C   . ASP B  1 67  ? 24.983  -13.555 3.997   1.00   30.22 ? 174 ASP B C   1 
ATOM   4065  O  O   . ASP B  1 67  ? 23.835  -13.579 3.551   1.00   32.38 ? 174 ASP B O   1 
ATOM   4066  C  CB  . ASP B  1 67  ? 24.908  -15.985 4.548   1.00   28.36 ? 174 ASP B CB  1 
ATOM   4067  C  CG  . ASP B  1 67  ? 25.416  -16.421 3.166   1.00   30.05 ? 174 ASP B CG  1 
ATOM   4068  O  OD1 . ASP B  1 67  ? 25.899  -15.558 2.402   1.00   31.51 ? 174 ASP B OD1 1 
ATOM   4069  O  OD2 . ASP B  1 67  ? 25.329  -17.621 2.828   1.00   31.05 ? 174 ASP B OD2 1 
ATOM   4070  N  N   . VAL B  1 68  ? 25.856  -12.610 3.680   1.00   30.29 ? 175 VAL B N   1 
ATOM   4071  C  CA  . VAL B  1 68  ? 25.500  -11.537 2.766   1.00   30.26 ? 175 VAL B CA  1 
ATOM   4072  C  C   . VAL B  1 68  ? 25.519  -12.016 1.314   1.00   30.03 ? 175 VAL B C   1 
ATOM   4073  O  O   . VAL B  1 68  ? 24.803  -11.475 0.475   1.00   33.79 ? 175 VAL B O   1 
ATOM   4074  C  CB  . VAL B  1 68  ? 26.468  -10.323 2.936   1.00   28.22 ? 175 VAL B CB  1 
ATOM   4075  C  CG1 . VAL B  1 68  ? 26.248  -9.314  1.845   1.00   28.22 ? 175 VAL B CG1 1 
ATOM   4076  C  CG2 . VAL B  1 68  ? 26.254  -9.668  4.276   1.00   22.72 ? 175 VAL B CG2 1 
ATOM   4077  N  N   . ASN B  1 69  ? 26.330  -13.029 1.015   1.00   28.35 ? 176 ASN B N   1 
ATOM   4078  C  CA  . ASN B  1 69  ? 26.416  -13.540 -0.353  1.00   31.80 ? 176 ASN B CA  1 
ATOM   4079  C  C   . ASN B  1 69  ? 25.117  -14.208 -0.826  1.00   34.52 ? 176 ASN B C   1 
ATOM   4080  O  O   . ASN B  1 69  ? 24.689  -14.011 -1.962  1.00   35.41 ? 176 ASN B O   1 
ATOM   4081  C  CB  . ASN B  1 69  ? 27.575  -14.526 -0.476  1.00   29.98 ? 176 ASN B CB  1 
ATOM   4082  C  CG  . ASN B  1 69  ? 28.941  -13.846 -0.439  1.00   31.16 ? 176 ASN B CG  1 
ATOM   4083  O  OD1 . ASN B  1 69  ? 29.887  -14.375 0.152   1.00   28.40 ? 176 ASN B OD1 1 
ATOM   4084  N  ND2 . ASN B  1 69  ? 29.055  -12.681 -1.082  1.00   27.62 ? 176 ASN B ND2 1 
ATOM   4085  N  N   . ASP B  1 70  ? 24.495  -14.998 0.043   1.00   36.41 ? 177 ASP B N   1 
ATOM   4086  C  CA  . ASP B  1 70  ? 23.251  -15.678 -0.310  1.00   39.78 ? 177 ASP B CA  1 
ATOM   4087  C  C   . ASP B  1 70  ? 22.041  -15.091 0.403   1.00   39.54 ? 177 ASP B C   1 
ATOM   4088  O  O   . ASP B  1 70  ? 20.933  -15.605 0.273   1.00   44.70 ? 177 ASP B O   1 
ATOM   4089  C  CB  . ASP B  1 70  ? 23.331  -17.186 0.005   1.00   40.15 ? 177 ASP B CB  1 
ATOM   4090  C  CG  . ASP B  1 70  ? 24.198  -17.959 -0.985  1.00   40.83 ? 177 ASP B CG  1 
ATOM   4091  O  OD1 . ASP B  1 70  ? 24.423  -17.462 -2.105  1.00   42.24 ? 177 ASP B OD1 1 
ATOM   4092  O  OD2 . ASP B  1 70  ? 24.642  -19.079 -0.651  1.00   42.57 ? 177 ASP B OD2 1 
ATOM   4093  N  N   . GLN B  1 71  ? 22.253  -14.022 1.159   1.00   38.76 ? 178 GLN B N   1 
ATOM   4094  C  CA  . GLN B  1 71  ? 21.173  -13.367 1.887   1.00   37.80 ? 178 GLN B CA  1 
ATOM   4095  C  C   . GLN B  1 71  ? 20.418  -14.270 2.865   1.00   37.13 ? 178 GLN B C   1 
ATOM   4096  O  O   . GLN B  1 71  ? 19.211  -14.453 2.733   1.00   37.64 ? 178 GLN B O   1 
ATOM   4097  C  CB  . GLN B  1 71  ? 20.152  -12.756 0.920   1.00   39.51 ? 178 GLN B CB  1 
ATOM   4098  C  CG  . GLN B  1 71  ? 20.707  -11.896 -0.214  1.00   44.26 ? 178 GLN B CG  1 
ATOM   4099  C  CD  . GLN B  1 71  ? 21.527  -10.718 0.272   1.00   46.12 ? 178 GLN B CD  1 
ATOM   4100  O  OE1 . GLN B  1 71  ? 21.220  -10.114 1.298   0.0000 45.32 ? 178 GLN B OE1 1 
ATOM   4101  N  NE2 . GLN B  1 71  ? 22.569  -10.375 -0.477  0.0000 45.32 ? 178 GLN B NE2 1 
ATOM   4102  N  N   . ASP B  1 72  ? 21.125  -14.851 3.828   1.00   36.55 ? 179 ASP B N   1 
ATOM   4103  C  CA  . ASP B  1 72  ? 20.481  -15.664 4.860   1.00   36.81 ? 179 ASP B CA  1 
ATOM   4104  C  C   . ASP B  1 72  ? 21.358  -15.497 6.090   1.00   35.34 ? 179 ASP B C   1 
ATOM   4105  O  O   . ASP B  1 72  ? 22.466  -14.981 5.991   1.00   36.32 ? 179 ASP B O   1 
ATOM   4106  C  CB  . ASP B  1 72  ? 20.325  -17.143 4.447   1.00   34.76 ? 179 ASP B CB  1 
ATOM   4107  C  CG  . ASP B  1 72  ? 21.639  -17.840 4.239   1.00   37.27 ? 179 ASP B CG  1 
ATOM   4108  O  OD1 . ASP B  1 72  ? 22.409  -17.952 5.217   1.00   38.36 ? 179 ASP B OD1 1 
ATOM   4109  O  OD2 . ASP B  1 72  ? 21.893  -18.277 3.092   1.00   38.34 ? 179 ASP B OD2 1 
ATOM   4110  N  N   . PRO B  1 73  ? 20.873  -15.909 7.265   1.00   33.29 ? 180 PRO B N   1 
ATOM   4111  C  CA  . PRO B  1 73  ? 21.693  -15.742 8.463   1.00   33.14 ? 180 PRO B CA  1 
ATOM   4112  C  C   . PRO B  1 73  ? 22.735  -16.801 8.745   1.00   33.58 ? 180 PRO B C   1 
ATOM   4113  O  O   . PRO B  1 73  ? 23.456  -16.692 9.734   1.00   34.14 ? 180 PRO B O   1 
ATOM   4114  C  CB  . PRO B  1 73  ? 20.648  -15.657 9.574   1.00   32.42 ? 180 PRO B CB  1 
ATOM   4115  C  CG  . PRO B  1 73  ? 19.604  -16.591 9.095   1.00   31.71 ? 180 PRO B CG  1 
ATOM   4116  C  CD  . PRO B  1 73  ? 19.490  -16.273 7.620   1.00   33.63 ? 180 PRO B CD  1 
ATOM   4117  N  N   . ASP B  1 74  ? 22.826  -17.809 7.880   1.00   34.26 ? 181 ASP B N   1 
ATOM   4118  C  CA  . ASP B  1 74  ? 23.764  -18.911 8.080   1.00   32.31 ? 181 ASP B CA  1 
ATOM   4119  C  C   . ASP B  1 74  ? 25.038  -18.730 7.269   1.00   31.64 ? 181 ASP B C   1 
ATOM   4120  O  O   . ASP B  1 74  ? 25.038  -18.908 6.057   1.00   29.85 ? 181 ASP B O   1 
ATOM   4121  C  CB  . ASP B  1 74  ? 23.087  -20.228 7.703   1.00   34.78 ? 181 ASP B CB  1 
ATOM   4122  C  CG  . ASP B  1 74  ? 23.954  -21.435 7.986   1.00   36.21 ? 181 ASP B CG  1 
ATOM   4123  O  OD1 . ASP B  1 74  ? 25.158  -21.262 8.258   1.00   35.61 ? 181 ASP B OD1 1 
ATOM   4124  O  OD2 . ASP B  1 74  ? 23.427  -22.565 7.924   1.00   41.15 ? 181 ASP B OD2 1 
ATOM   4125  N  N   . PRO B  1 75  ? 26.154  -18.408 7.949   1.00   32.41 ? 182 PRO B N   1 
ATOM   4126  C  CA  . PRO B  1 75  ? 27.477  -18.182 7.357   1.00   33.23 ? 182 PRO B CA  1 
ATOM   4127  C  C   . PRO B  1 75  ? 28.293  -19.420 6.977   1.00   34.48 ? 182 PRO B C   1 
ATOM   4128  O  O   . PRO B  1 75  ? 29.465  -19.293 6.609   1.00   34.88 ? 182 PRO B O   1 
ATOM   4129  C  CB  . PRO B  1 75  ? 28.176  -17.361 8.423   1.00   32.15 ? 182 PRO B CB  1 
ATOM   4130  C  CG  . PRO B  1 75  ? 27.686  -18.028 9.678   1.00   31.04 ? 182 PRO B CG  1 
ATOM   4131  C  CD  . PRO B  1 75  ? 26.199  -18.200 9.411   1.00   30.64 ? 182 PRO B CD  1 
ATOM   4132  N  N   . GLN B  1 76  ? 27.690  -20.605 7.051   1.00   33.53 ? 183 GLN B N   1 
ATOM   4133  C  CA  . GLN B  1 76  ? 28.408  -21.837 6.715   1.00   31.74 ? 183 GLN B CA  1 
ATOM   4134  C  C   . GLN B  1 76  ? 29.106  -21.698 5.367   1.00   31.06 ? 183 GLN B C   1 
ATOM   4135  O  O   . GLN B  1 76  ? 28.522  -21.207 4.402   1.00   30.47 ? 183 GLN B O   1 
ATOM   4136  C  CB  . GLN B  1 76  ? 27.442  -23.021 6.664   1.00   35.42 ? 183 GLN B CB  1 
ATOM   4137  C  CG  . GLN B  1 76  ? 28.111  -24.398 6.651   1.00   35.51 ? 183 GLN B CG  1 
ATOM   4138  C  CD  . GLN B  1 76  ? 28.749  -24.760 7.989   1.00   35.36 ? 183 GLN B CD  1 
ATOM   4139  O  OE1 . GLN B  1 76  ? 28.290  -24.324 9.045   1.00   35.07 ? 183 GLN B OE1 1 
ATOM   4140  N  NE2 . GLN B  1 76  ? 29.798  -25.580 7.947   1.00   37.11 ? 183 GLN B NE2 1 
ATOM   4141  N  N   . PRO B  1 77  ? 30.370  -22.137 5.282   1.00   30.32 ? 184 PRO B N   1 
ATOM   4142  C  CA  . PRO B  1 77  ? 31.128  -22.043 4.029   1.00   30.41 ? 184 PRO B CA  1 
ATOM   4143  C  C   . PRO B  1 77  ? 30.541  -22.932 2.958   1.00   31.47 ? 184 PRO B C   1 
ATOM   4144  O  O   . PRO B  1 77  ? 29.834  -23.883 3.268   1.00   33.90 ? 184 PRO B O   1 
ATOM   4145  C  CB  . PRO B  1 77  ? 32.530  -22.513 4.426   1.00   28.04 ? 184 PRO B CB  1 
ATOM   4146  C  CG  . PRO B  1 77  ? 32.591  -22.269 5.908   1.00   30.37 ? 184 PRO B CG  1 
ATOM   4147  C  CD  . PRO B  1 77  ? 31.211  -22.668 6.367   1.00   30.94 ? 184 PRO B CD  1 
ATOM   4148  N  N   . ARG B  1 78  ? 30.833  -22.617 1.699   1.00   32.74 ? 185 ARG B N   1 
ATOM   4149  C  CA  . ARG B  1 78  ? 30.369  -23.430 0.578   1.00   32.17 ? 185 ARG B CA  1 
ATOM   4150  C  C   . ARG B  1 78  ? 31.497  -24.413 0.293   1.00   32.85 ? 185 ARG B C   1 
ATOM   4151  O  O   . ARG B  1 78  ? 32.603  -24.000 -0.071  1.00   34.14 ? 185 ARG B O   1 
ATOM   4152  C  CB  . ARG B  1 78  ? 30.112  -22.562 -0.661  1.00   32.68 ? 185 ARG B CB  1 
ATOM   4153  C  CG  . ARG B  1 78  ? 29.779  -23.353 -1.928  1.00   29.64 ? 185 ARG B CG  1 
ATOM   4154  C  CD  . ARG B  1 78  ? 29.454  -22.410 -3.071  1.00   30.92 ? 185 ARG B CD  1 
ATOM   4155  N  NE  . ARG B  1 78  ? 30.574  -21.516 -3.346  1.00   31.46 ? 185 ARG B NE  1 
ATOM   4156  C  CZ  . ARG B  1 78  ? 31.556  -21.780 -4.199  1.00   31.02 ? 185 ARG B CZ  1 
ATOM   4157  N  NH1 . ARG B  1 78  ? 32.544  -20.907 -4.375  1.00   25.03 ? 185 ARG B NH1 1 
ATOM   4158  N  NH2 . ARG B  1 78  ? 31.537  -22.910 -4.890  1.00   35.17 ? 185 ARG B NH2 1 
ATOM   4159  N  N   . TYR B  1 79  ? 31.229  -25.708 0.458   1.00   34.10 ? 186 TYR B N   1 
ATOM   4160  C  CA  . TYR B  1 79  ? 32.259  -26.722 0.233   1.00   32.97 ? 186 TYR B CA  1 
ATOM   4161  C  C   . TYR B  1 79  ? 32.553  -27.052 -1.225  1.00   35.88 ? 186 TYR B C   1 
ATOM   4162  O  O   . TYR B  1 79  ? 31.648  -27.231 -2.037  1.00   36.47 ? 186 TYR B O   1 
ATOM   4163  C  CB  . TYR B  1 79  ? 31.900  -27.996 0.986   1.00   31.84 ? 186 TYR B CB  1 
ATOM   4164  C  CG  . TYR B  1 79  ? 31.847  -27.794 2.481   1.00   30.04 ? 186 TYR B CG  1 
ATOM   4165  C  CD1 . TYR B  1 79  ? 30.708  -27.286 3.095   1.00   31.31 ? 186 TYR B CD1 1 
ATOM   4166  C  CD2 . TYR B  1 79  ? 32.957  -28.064 3.278   1.00   30.91 ? 186 TYR B CD2 1 
ATOM   4167  C  CE1 . TYR B  1 79  ? 30.676  -27.051 4.474   1.00   29.15 ? 186 TYR B CE1 1 
ATOM   4168  C  CE2 . TYR B  1 79  ? 32.934  -27.832 4.651   1.00   28.77 ? 186 TYR B CE2 1 
ATOM   4169  C  CZ  . TYR B  1 79  ? 31.795  -27.326 5.238   1.00   26.22 ? 186 TYR B CZ  1 
ATOM   4170  O  OH  . TYR B  1 79  ? 31.779  -27.082 6.590   1.00   29.99 ? 186 TYR B OH  1 
ATOM   4171  N  N   . THR B  1 80  ? 33.838  -27.114 -1.550  1.00   36.49 ? 187 THR B N   1 
ATOM   4172  C  CA  . THR B  1 80  ? 34.277  -27.436 -2.897  1.00   40.09 ? 187 THR B CA  1 
ATOM   4173  C  C   . THR B  1 80  ? 35.503  -28.333 -2.785  1.00   44.74 ? 187 THR B C   1 
ATOM   4174  O  O   . THR B  1 80  ? 36.192  -28.332 -1.760  1.00   45.76 ? 187 THR B O   1 
ATOM   4175  C  CB  . THR B  1 80  ? 34.653  -26.175 -3.692  1.00   39.70 ? 187 THR B CB  1 
ATOM   4176  O  OG1 . THR B  1 80  ? 35.897  -25.653 -3.212  1.00   37.49 ? 187 THR B OG1 1 
ATOM   4177  C  CG2 . THR B  1 80  ? 33.565  -25.123 -3.544  1.00   36.18 ? 187 THR B CG2 1 
ATOM   4178  N  N   . GLN B  1 81  ? 35.775  -29.097 -3.837  1.00   46.44 ? 188 GLN B N   1 
ATOM   4179  C  CA  . GLN B  1 81  ? 36.904  -30.011 -3.841  1.00   49.27 ? 188 GLN B CA  1 
ATOM   4180  C  C   . GLN B  1 81  ? 38.219  -29.299 -3.528  1.00   49.67 ? 188 GLN B C   1 
ATOM   4181  O  O   . GLN B  1 81  ? 39.073  -29.840 -2.830  1.00   51.86 ? 188 GLN B O   1 
ATOM   4182  C  CB  . GLN B  1 81  ? 36.991  -30.709 -5.194  1.00   50.83 ? 188 GLN B CB  1 
ATOM   4183  C  CG  . GLN B  1 81  ? 37.575  -32.097 -5.137  1.00   54.13 ? 188 GLN B CG  1 
ATOM   4184  C  CD  . GLN B  1 81  ? 37.553  -32.750 -6.494  1.00   56.27 ? 188 GLN B CD  1 
ATOM   4185  O  OE1 . GLN B  1 81  ? 37.486  -32.063 -7.514  1.00   59.38 ? 188 GLN B OE1 1 
ATOM   4186  N  NE2 . GLN B  1 81  ? 37.622  -34.077 -6.522  1.00   58.77 ? 188 GLN B NE2 1 
ATOM   4187  N  N   . MET B  1 82  ? 38.382  -28.086 -4.037  1.00   49.85 ? 189 MET B N   1 
ATOM   4188  C  CA  . MET B  1 82  ? 39.602  -27.324 -3.796  1.00   49.96 ? 189 MET B CA  1 
ATOM   4189  C  C   . MET B  1 82  ? 39.633  -26.633 -2.431  1.00   47.43 ? 189 MET B C   1 
ATOM   4190  O  O   . MET B  1 82  ? 40.640  -26.039 -2.060  1.00   46.28 ? 189 MET B O   1 
ATOM   4191  C  CB  . MET B  1 82  ? 39.792  -26.287 -4.904  1.00   55.83 ? 189 MET B CB  1 
ATOM   4192  C  CG  . MET B  1 82  ? 40.284  -26.883 -6.221  1.00   65.95 ? 189 MET B CG  1 
ATOM   4193  S  SD  . MET B  1 82  ? 39.994  -25.821 -7.673  1.00   77.60 ? 189 MET B SD  1 
ATOM   4194  C  CE  . MET B  1 82  ? 41.423  -24.700 -7.600  1.00   73.93 ? 189 MET B CE  1 
ATOM   4195  N  N   . ASN B  1 83  ? 38.536  -26.715 -1.686  1.00   44.74 ? 190 ASN B N   1 
ATOM   4196  C  CA  . ASN B  1 83  ? 38.447  -26.078 -0.373  1.00   43.11 ? 190 ASN B CA  1 
ATOM   4197  C  C   . ASN B  1 83  ? 38.720  -24.577 -0.446  1.00   42.76 ? 190 ASN B C   1 
ATOM   4198  O  O   . ASN B  1 83  ? 39.417  -24.016 0.403   1.00   41.49 ? 190 ASN B O   1 
ATOM   4199  C  CB  . ASN B  1 83  ? 39.433  -26.716 0.603   1.00   43.35 ? 190 ASN B CB  1 
ATOM   4200  C  CG  . ASN B  1 83  ? 39.076  -28.146 0.942   1.00   45.89 ? 190 ASN B CG  1 
ATOM   4201  O  OD1 . ASN B  1 83  ? 37.959  -28.439 1.382   1.00   44.87 ? 190 ASN B OD1 1 
ATOM   4202  N  ND2 . ASN B  1 83  ? 40.028  -29.048 0.743   1.00   42.81 ? 190 ASN B ND2 1 
ATOM   4203  N  N   . ASP B  1 84  ? 38.153  -23.932 -1.458  1.00   40.71 ? 191 ASP B N   1 
ATOM   4204  C  CA  . ASP B  1 84  ? 38.330  -22.503 -1.660  1.00   37.05 ? 191 ASP B CA  1 
ATOM   4205  C  C   . ASP B  1 84  ? 37.861  -21.639 -0.497  1.00   35.26 ? 191 ASP B C   1 
ATOM   4206  O  O   . ASP B  1 84  ? 38.457  -20.598 -0.226  1.00   35.55 ? 191 ASP B O   1 
ATOM   4207  C  CB  . ASP B  1 84  ? 37.592  -22.055 -2.923  1.00   40.12 ? 191 ASP B CB  1 
ATOM   4208  C  CG  . ASP B  1 84  ? 37.914  -22.926 -4.125  1.00   43.06 ? 191 ASP B CG  1 
ATOM   4209  O  OD1 . ASP B  1 84  ? 37.296  -24.003 -4.254  1.00   43.58 ? 191 ASP B OD1 1 
ATOM   4210  O  OD2 . ASP B  1 84  ? 38.795  -22.543 -4.930  1.00   45.89 ? 191 ASP B OD2 1 
ATOM   4211  N  N   . ASN B  1 85  ? 36.807  -22.067 0.193   1.00   29.74 ? 192 ASN B N   1 
ATOM   4212  C  CA  . ASN B  1 85  ? 36.257  -21.277 1.284   1.00   28.73 ? 192 ASN B CA  1 
ATOM   4213  C  C   . ASN B  1 85  ? 36.662  -21.672 2.695   1.00   29.65 ? 192 ASN B C   1 
ATOM   4214  O  O   . ASN B  1 85  ? 35.837  -21.688 3.607   1.00   26.85 ? 192 ASN B O   1 
ATOM   4215  C  CB  . ASN B  1 85  ? 34.738  -21.253 1.148   1.00   24.78 ? 192 ASN B CB  1 
ATOM   4216  C  CG  . ASN B  1 85  ? 34.312  -20.718 -0.191  1.00   26.69 ? 192 ASN B CG  1 
ATOM   4217  O  OD1 . ASN B  1 85  ? 34.756  -19.640 -0.598  1.00   27.16 ? 192 ASN B OD1 1 
ATOM   4218  N  ND2 . ASN B  1 85  ? 33.466  -21.461 -0.897  1.00   26.24 ? 192 ASN B ND2 1 
ATOM   4219  N  N   . ARG B  1 86  ? 37.950  -21.947 2.876   1.00   29.70 ? 193 ARG B N   1 
ATOM   4220  C  CA  . ARG B  1 86  ? 38.479  -22.349 4.179   1.00   28.88 ? 193 ARG B CA  1 
ATOM   4221  C  C   . ARG B  1 86  ? 39.110  -21.157 4.895   1.00   26.83 ? 193 ARG B C   1 
ATOM   4222  O  O   . ARG B  1 86  ? 39.368  -21.202 6.100   1.00   27.60 ? 193 ARG B O   1 
ATOM   4223  C  CB  . ARG B  1 86  ? 39.548  -23.416 3.982   1.00   26.77 ? 193 ARG B CB  1 
ATOM   4224  C  CG  . ARG B  1 86  ? 40.694  -22.893 3.179   1.00   29.69 ? 193 ARG B CG  1 
ATOM   4225  C  CD  . ARG B  1 86  ? 41.783  -23.893 2.998   1.00   27.46 ? 193 ARG B CD  1 
ATOM   4226  N  NE  . ARG B  1 86  ? 42.926  -23.247 2.383   1.00   29.80 ? 193 ARG B NE  1 
ATOM   4227  C  CZ  . ARG B  1 86  ? 44.050  -23.873 2.071   1.00   36.94 ? 193 ARG B CZ  1 
ATOM   4228  N  NH1 . ARG B  1 86  ? 44.166  -25.175 2.320   1.00   35.79 ? 193 ARG B NH1 1 
ATOM   4229  N  NH2 . ARG B  1 86  ? 45.058  -23.196 1.522   1.00   38.06 ? 193 ARG B NH2 1 
ATOM   4230  N  N   . HIS B  1 87  ? 39.342  -20.095 4.133   1.00   25.94 ? 194 HIS B N   1 
ATOM   4231  C  CA  . HIS B  1 87  ? 39.979  -18.884 4.623   1.00   23.50 ? 194 HIS B CA  1 
ATOM   4232  C  C   . HIS B  1 87  ? 39.377  -18.271 5.886   1.00   23.21 ? 194 HIS B C   1 
ATOM   4233  O  O   . HIS B  1 87  ? 40.096  -18.071 6.877   1.00   23.18 ? 194 HIS B O   1 
ATOM   4234  C  CB  . HIS B  1 87  ? 40.028  -17.863 3.485   1.00   25.45 ? 194 HIS B CB  1 
ATOM   4235  C  CG  . HIS B  1 87  ? 40.904  -16.678 3.756   1.00   24.93 ? 194 HIS B CG  1 
ATOM   4236  N  ND1 . HIS B  1 87  ? 40.404  -15.462 4.168   1.00   25.76 ? 194 HIS B ND1 1 
ATOM   4237  C  CD2 . HIS B  1 87  ? 42.239  -16.504 3.610   1.00   25.91 ? 194 HIS B CD2 1 
ATOM   4238  C  CE1 . HIS B  1 87  ? 41.391  -14.587 4.255   1.00   24.20 ? 194 HIS B CE1 1 
ATOM   4239  N  NE2 . HIS B  1 87  ? 42.516  -15.194 3.922   1.00   25.51 ? 194 HIS B NE2 1 
ATOM   4240  N  N   . GLY B  1 88  ? 38.076  -17.986 5.863   1.00   21.18 ? 195 GLY B N   1 
ATOM   4241  C  CA  . GLY B  1 88  ? 37.435  -17.386 7.018   1.00   19.17 ? 195 GLY B CA  1 
ATOM   4242  C  C   . GLY B  1 88  ? 37.514  -18.241 8.266   1.00   21.34 ? 195 GLY B C   1 
ATOM   4243  O  O   . GLY B  1 88  ? 37.676  -17.730 9.378   1.00   23.10 ? 195 GLY B O   1 
ATOM   4244  N  N   . THR B  1 89  ? 37.393  -19.549 8.088   1.00   20.74 ? 196 THR B N   1 
ATOM   4245  C  CA  . THR B  1 89  ? 37.446  -20.466 9.209   1.00   20.16 ? 196 THR B CA  1 
ATOM   4246  C  C   . THR B  1 89  ? 38.825  -20.441 9.851   1.00   22.00 ? 196 THR B C   1 
ATOM   4247  O  O   . THR B  1 89  ? 38.959  -20.490 11.080  1.00   21.02 ? 196 THR B O   1 
ATOM   4248  C  CB  . THR B  1 89  ? 37.069  -21.897 8.750   1.00   20.85 ? 196 THR B CB  1 
ATOM   4249  O  OG1 . THR B  1 89  ? 35.670  -21.923 8.417   1.00   24.29 ? 196 THR B OG1 1 
ATOM   4250  C  CG2 . THR B  1 89  ? 37.343  -22.916 9.848   1.00   21.57 ? 196 THR B CG2 1 
ATOM   4251  N  N   . ARG B  1 90  ? 39.855  -20.356 9.019   1.00   22.66 ? 197 ARG B N   1 
ATOM   4252  C  CA  . ARG B  1 90  ? 41.206  -20.307 9.541   1.00   23.22 ? 197 ARG B CA  1 
ATOM   4253  C  C   . ARG B  1 90  ? 41.383  -19.031 10.354  1.00   26.24 ? 197 ARG B C   1 
ATOM   4254  O  O   . ARG B  1 90  ? 41.933  -19.071 11.453  1.00   27.75 ? 197 ARG B O   1 
ATOM   4255  C  CB  . ARG B  1 90  ? 42.220  -20.384 8.398   1.00   22.28 ? 197 ARG B CB  1 
ATOM   4256  C  CG  . ARG B  1 90  ? 42.294  -21.786 7.803   1.00   23.67 ? 197 ARG B CG  1 
ATOM   4257  C  CD  . ARG B  1 90  ? 43.307  -21.908 6.676   1.00   26.99 ? 197 ARG B CD  1 
ATOM   4258  N  NE  . ARG B  1 90  ? 43.451  -23.294 6.234   1.00   27.94 ? 197 ARG B NE  1 
ATOM   4259  C  CZ  . ARG B  1 90  ? 44.507  -23.770 5.578   1.00   29.34 ? 197 ARG B CZ  1 
ATOM   4260  N  NH1 . ARG B  1 90  ? 44.539  -25.049 5.228   1.00   28.85 ? 197 ARG B NH1 1 
ATOM   4261  N  NH2 . ARG B  1 90  ? 45.527  -22.973 5.270   1.00   26.11 ? 197 ARG B NH2 1 
ATOM   4262  N  N   . CYS B  1 91  ? 40.892  -17.907 9.830   1.00   22.78 ? 198 CYS B N   1 
ATOM   4263  C  CA  . CYS B  1 91  ? 41.004  -16.645 10.545  1.00   21.41 ? 198 CYS B CA  1 
ATOM   4264  C  C   . CYS B  1 91  ? 40.222  -16.655 11.854  1.00   20.10 ? 198 CYS B C   1 
ATOM   4265  O  O   . CYS B  1 91  ? 40.700  -16.148 12.869  1.00   21.33 ? 198 CYS B O   1 
ATOM   4266  C  CB  . CYS B  1 91  ? 40.549  -15.486 9.654   1.00   18.62 ? 198 CYS B CB  1 
ATOM   4267  S  SG  . CYS B  1 91  ? 41.664  -15.201 8.236   1.00   24.81 ? 198 CYS B SG  1 
ATOM   4268  N  N   . ALA B  1 92  ? 39.034  -17.249 11.847  1.00   20.10 ? 199 ALA B N   1 
ATOM   4269  C  CA  . ALA B  1 92  ? 38.208  -17.300 13.057  1.00   21.52 ? 199 ALA B CA  1 
ATOM   4270  C  C   . ALA B  1 92  ? 38.911  -18.032 14.199  1.00   22.91 ? 199 ALA B C   1 
ATOM   4271  O  O   . ALA B  1 92  ? 38.870  -17.584 15.349  1.00   24.11 ? 199 ALA B O   1 
ATOM   4272  C  CB  . ALA B  1 92  ? 36.870  -17.972 12.754  1.00   21.33 ? 199 ALA B CB  1 
ATOM   4273  N  N   . GLY B  1 93  ? 39.556  -19.152 13.876  1.00   22.80 ? 200 GLY B N   1 
ATOM   4274  C  CA  . GLY B  1 93  ? 40.253  -19.921 14.894  1.00   24.91 ? 200 GLY B CA  1 
ATOM   4275  C  C   . GLY B  1 93  ? 41.365  -19.169 15.602  1.00   25.44 ? 200 GLY B C   1 
ATOM   4276  O  O   . GLY B  1 93  ? 41.584  -19.359 16.803  1.00   24.08 ? 200 GLY B O   1 
ATOM   4277  N  N   . GLU B  1 94  ? 42.072  -18.314 14.865  1.00   24.78 ? 201 GLU B N   1 
ATOM   4278  C  CA  . GLU B  1 94  ? 43.164  -17.549 15.448  1.00   25.04 ? 201 GLU B CA  1 
ATOM   4279  C  C   . GLU B  1 94  ? 42.636  -16.656 16.561  1.00   26.98 ? 201 GLU B C   1 
ATOM   4280  O  O   . GLU B  1 94  ? 43.311  -16.405 17.565  1.00   24.90 ? 201 GLU B O   1 
ATOM   4281  C  CB  . GLU B  1 94  ? 43.815  -16.654 14.403  1.00   24.00 ? 201 GLU B CB  1 
ATOM   4282  C  CG  . GLU B  1 94  ? 44.505  -17.348 13.259  1.00   21.41 ? 201 GLU B CG  1 
ATOM   4283  C  CD  . GLU B  1 94  ? 45.092  -16.329 12.290  1.00   22.75 ? 201 GLU B CD  1 
ATOM   4284  O  OE1 . GLU B  1 94  ? 44.441  -16.018 11.273  1.00   20.58 ? 201 GLU B OE1 1 
ATOM   4285  O  OE2 . GLU B  1 94  ? 46.192  -15.817 12.568  1.00   24.31 ? 201 GLU B OE2 1 
ATOM   4286  N  N   . VAL B  1 95  ? 41.420  -16.170 16.368  1.00   26.27 ? 202 VAL B N   1 
ATOM   4287  C  CA  . VAL B  1 95  ? 40.828  -15.281 17.337  1.00   26.53 ? 202 VAL B CA  1 
ATOM   4288  C  C   . VAL B  1 95  ? 40.240  -15.998 18.533  1.00   29.49 ? 202 VAL B C   1 
ATOM   4289  O  O   . VAL B  1 95  ? 40.610  -15.718 19.681  1.00   29.01 ? 202 VAL B O   1 
ATOM   4290  C  CB  . VAL B  1 95  ? 39.706  -14.444 16.696  1.00   27.23 ? 202 VAL B CB  1 
ATOM   4291  C  CG1 . VAL B  1 95  ? 39.143  -13.472 17.711  1.00   25.77 ? 202 VAL B CG1 1 
ATOM   4292  C  CG2 . VAL B  1 95  ? 40.232  -13.713 15.486  1.00   22.13 ? 202 VAL B CG2 1 
ATOM   4293  N  N   . ALA B  1 96  ? 39.340  -16.942 18.273  1.00   29.28 ? 203 ALA B N   1 
ATOM   4294  C  CA  . ALA B  1 96  ? 38.672  -17.594 19.381  1.00   28.45 ? 203 ALA B CA  1 
ATOM   4295  C  C   . ALA B  1 96  ? 38.509  -19.105 19.385  1.00   28.92 ? 203 ALA B C   1 
ATOM   4296  O  O   . ALA B  1 96  ? 37.465  -19.596 19.809  1.00   29.66 ? 203 ALA B O   1 
ATOM   4297  C  CB  . ALA B  1 96  ? 37.313  -16.937 19.567  1.00   29.17 ? 203 ALA B CB  1 
ATOM   4298  N  N   . ALA B  1 97  ? 39.511  -19.847 18.925  1.00   29.19 ? 204 ALA B N   1 
ATOM   4299  C  CA  . ALA B  1 97  ? 39.410  -21.305 18.965  1.00   31.67 ? 204 ALA B CA  1 
ATOM   4300  C  C   . ALA B  1 97  ? 39.260  -21.677 20.450  1.00   32.03 ? 204 ALA B C   1 
ATOM   4301  O  O   . ALA B  1 97  ? 39.884  -21.054 21.324  1.00   30.58 ? 204 ALA B O   1 
ATOM   4302  C  CB  . ALA B  1 97  ? 40.666  -21.946 18.379  1.00   28.10 ? 204 ALA B CB  1 
ATOM   4303  N  N   . VAL B  1 98  ? 38.426  -22.676 20.733  1.00   31.45 ? 205 VAL B N   1 
ATOM   4304  C  CA  . VAL B  1 98  ? 38.181  -23.108 22.102  1.00   29.52 ? 205 VAL B CA  1 
ATOM   4305  C  C   . VAL B  1 98  ? 39.422  -23.668 22.782  1.00   27.82 ? 205 VAL B C   1 
ATOM   4306  O  O   . VAL B  1 98  ? 40.221  -24.377 22.169  1.00   28.02 ? 205 VAL B O   1 
ATOM   4307  C  CB  . VAL B  1 98  ? 37.064  -24.157 22.139  1.00   33.45 ? 205 VAL B CB  1 
ATOM   4308  C  CG1 . VAL B  1 98  ? 36.886  -24.691 23.562  1.00   31.27 ? 205 VAL B CG1 1 
ATOM   4309  C  CG2 . VAL B  1 98  ? 35.771  -23.524 21.629  1.00   35.62 ? 205 VAL B CG2 1 
ATOM   4310  N  N   . ALA B  1 99  ? 39.579  -23.344 24.058  1.00   26.02 ? 206 ALA B N   1 
ATOM   4311  C  CA  . ALA B  1 99  ? 40.731  -23.807 24.829  1.00   31.63 ? 206 ALA B CA  1 
ATOM   4312  C  C   . ALA B  1 99  ? 40.426  -25.032 25.697  1.00   32.17 ? 206 ALA B C   1 
ATOM   4313  O  O   . ALA B  1 99  ? 39.274  -25.281 26.067  1.00   32.89 ? 206 ALA B O   1 
ATOM   4314  C  CB  . ALA B  1 99  ? 41.263  -22.665 25.722  1.00   28.55 ? 206 ALA B CB  1 
ATOM   4315  N  N   . ASN B  1 100 ? 41.478  -25.780 26.014  1.00   31.94 ? 207 ASN B N   1 
ATOM   4316  C  CA  . ASN B  1 100 ? 41.398  -26.963 26.865  1.00   32.50 ? 207 ASN B CA  1 
ATOM   4317  C  C   . ASN B  1 100 ? 40.284  -27.923 26.494  1.00   33.35 ? 207 ASN B C   1 
ATOM   4318  O  O   . ASN B  1 100 ? 39.539  -28.373 27.365  1.00   32.11 ? 207 ASN B O   1 
ATOM   4319  C  CB  . ASN B  1 100 ? 41.210  -26.542 28.323  1.00   30.75 ? 207 ASN B CB  1 
ATOM   4320  C  CG  . ASN B  1 100 ? 42.232  -25.543 28.769  1.00   33.09 ? 207 ASN B CG  1 
ATOM   4321  O  OD1 . ASN B  1 100 ? 43.432  -25.838 28.807  1.00   35.94 ? 207 ASN B OD1 1 
ATOM   4322  N  ND2 . ASN B  1 100 ? 41.773  -24.344 29.107  1.00   28.88 ? 207 ASN B ND2 1 
ATOM   4323  N  N   . ASN B  1 101 ? 40.175  -28.255 25.215  1.00   32.84 ? 208 ASN B N   1 
ATOM   4324  C  CA  . ASN B  1 101 ? 39.129  -29.167 24.782  1.00   32.25 ? 208 ASN B CA  1 
ATOM   4325  C  C   . ASN B  1 101 ? 39.726  -30.300 23.952  1.00   33.99 ? 208 ASN B C   1 
ATOM   4326  O  O   . ASN B  1 101 ? 39.029  -30.960 23.180  1.00   33.47 ? 208 ASN B O   1 
ATOM   4327  C  CB  . ASN B  1 101 ? 38.073  -28.400 23.970  1.00   35.46 ? 208 ASN B CB  1 
ATOM   4328  C  CG  . ASN B  1 101 ? 38.600  -27.908 22.614  1.00   36.20 ? 208 ASN B CG  1 
ATOM   4329  O  OD1 . ASN B  1 101 ? 39.802  -27.684 22.441  1.00   38.08 ? 208 ASN B OD1 1 
ATOM   4330  N  ND2 . ASN B  1 101 ? 37.691  -27.727 21.655  1.00   31.89 ? 208 ASN B ND2 1 
ATOM   4331  N  N   . GLY B  1 102 ? 41.029  -30.507 24.108  1.00   33.59 ? 209 GLY B N   1 
ATOM   4332  C  CA  . GLY B  1 102 ? 41.706  -31.567 23.382  1.00   34.46 ? 209 GLY B CA  1 
ATOM   4333  C  C   . GLY B  1 102 ? 41.644  -31.464 21.874  1.00   35.68 ? 209 GLY B C   1 
ATOM   4334  O  O   . GLY B  1 102 ? 41.901  -32.441 21.174  1.00   36.84 ? 209 GLY B O   1 
ATOM   4335  N  N   . VAL B  1 103 ? 41.309  -30.286 21.359  1.00   37.47 ? 210 VAL B N   1 
ATOM   4336  C  CA  . VAL B  1 103 ? 41.230  -30.105 19.917  1.00   35.72 ? 210 VAL B CA  1 
ATOM   4337  C  C   . VAL B  1 103 ? 42.120  -28.980 19.413  1.00   37.75 ? 210 VAL B C   1 
ATOM   4338  O  O   . VAL B  1 103 ? 42.094  -27.862 19.937  1.00   38.31 ? 210 VAL B O   1 
ATOM   4339  C  CB  . VAL B  1 103 ? 39.792  -29.794 19.459  1.00   36.33 ? 210 VAL B CB  1 
ATOM   4340  C  CG1 . VAL B  1 103 ? 39.779  -29.464 17.974  1.00   33.98 ? 210 VAL B CG1 1 
ATOM   4341  C  CG2 . VAL B  1 103 ? 38.888  -30.978 19.734  1.00   33.61 ? 210 VAL B CG2 1 
ATOM   4342  N  N   . CYS B  1 104 ? 42.914  -29.298 18.395  1.00   35.88 ? 211 CYS B N   1 
ATOM   4343  C  CA  . CYS B  1 104 ? 43.785  -28.337 17.753  1.00   35.29 ? 211 CYS B CA  1 
ATOM   4344  C  C   . CYS B  1 104 ? 44.511  -27.443 18.767  1.00   35.35 ? 211 CYS B C   1 
ATOM   4345  O  O   . CYS B  1 104 ? 45.126  -27.951 19.708  1.00   34.78 ? 211 CYS B O   1 
ATOM   4346  C  CB  . CYS B  1 104 ? 42.927  -27.519 16.790  1.00   37.05 ? 211 CYS B CB  1 
ATOM   4347  S  SG  . CYS B  1 104 ? 43.778  -26.736 15.396  1.00   43.83 ? 211 CYS B SG  1 
ATOM   4348  N  N   . GLY B  1 105 ? 44.444  -26.124 18.576  1.00   33.70 ? 212 GLY B N   1 
ATOM   4349  C  CA  . GLY B  1 105 ? 45.100  -25.199 19.492  1.00   30.32 ? 212 GLY B CA  1 
ATOM   4350  C  C   . GLY B  1 105 ? 44.114  -24.304 20.222  1.00   30.96 ? 212 GLY B C   1 
ATOM   4351  O  O   . GLY B  1 105 ? 43.044  -24.765 20.620  1.00   31.15 ? 212 GLY B O   1 
ATOM   4352  N  N   . VAL B  1 106 ? 44.472  -23.032 20.415  1.00   29.06 ? 213 VAL B N   1 
ATOM   4353  C  CA  . VAL B  1 106 ? 43.583  -22.077 21.078  1.00   27.64 ? 213 VAL B CA  1 
ATOM   4354  C  C   . VAL B  1 106 ? 43.613  -20.717 20.396  1.00   26.96 ? 213 VAL B C   1 
ATOM   4355  O  O   . VAL B  1 106 ? 44.579  -20.371 19.708  1.00   25.65 ? 213 VAL B O   1 
ATOM   4356  C  CB  . VAL B  1 106 ? 43.965  -21.841 22.547  1.00   27.71 ? 213 VAL B CB  1 
ATOM   4357  C  CG1 . VAL B  1 106 ? 44.004  -23.170 23.289  1.00   28.87 ? 213 VAL B CG1 1 
ATOM   4358  C  CG2 . VAL B  1 106 ? 45.297  -21.106 22.625  1.00   22.26 ? 213 VAL B CG2 1 
ATOM   4359  N  N   . GLY B  1 107 ? 42.550  -19.943 20.587  1.00   26.40 ? 214 GLY B N   1 
ATOM   4360  C  CA  . GLY B  1 107 ? 42.504  -18.615 20.007  1.00   25.78 ? 214 GLY B CA  1 
ATOM   4361  C  C   . GLY B  1 107 ? 43.137  -17.641 20.983  1.00   26.94 ? 214 GLY B C   1 
ATOM   4362  O  O   . GLY B  1 107 ? 43.282  -17.957 22.172  1.00   25.57 ? 214 GLY B O   1 
ATOM   4363  N  N   . VAL B  1 108 ? 43.528  -16.463 20.500  1.00   26.99 ? 215 VAL B N   1 
ATOM   4364  C  CA  . VAL B  1 108 ? 44.129  -15.460 21.374  1.00   23.61 ? 215 VAL B CA  1 
ATOM   4365  C  C   . VAL B  1 108 ? 43.123  -15.104 22.464  1.00   24.56 ? 215 VAL B C   1 
ATOM   4366  O  O   . VAL B  1 108 ? 43.479  -14.947 23.628  1.00   24.59 ? 215 VAL B O   1 
ATOM   4367  C  CB  . VAL B  1 108 ? 44.496  -14.181 20.597  1.00   24.05 ? 215 VAL B CB  1 
ATOM   4368  C  CG1 . VAL B  1 108 ? 44.875  -13.074 21.560  1.00   19.58 ? 215 VAL B CG1 1 
ATOM   4369  C  CG2 . VAL B  1 108 ? 45.660  -14.453 19.662  1.00   21.60 ? 215 VAL B CG2 1 
ATOM   4370  N  N   . ALA B  1 109 ? 41.857  -14.986 22.073  1.00   25.65 ? 216 ALA B N   1 
ATOM   4371  C  CA  . ALA B  1 109 ? 40.785  -14.657 23.005  1.00   25.86 ? 216 ALA B CA  1 
ATOM   4372  C  C   . ALA B  1 109 ? 39.859  -15.864 23.048  1.00   25.29 ? 216 ALA B C   1 
ATOM   4373  O  O   . ALA B  1 109 ? 38.725  -15.805 22.573  1.00   26.26 ? 216 ALA B O   1 
ATOM   4374  C  CB  . ALA B  1 109 ? 40.039  -13.429 22.510  1.00   23.77 ? 216 ALA B CB  1 
ATOM   4375  N  N   . TYR B  1 110 ? 40.337  -16.954 23.640  1.00   25.55 ? 217 TYR B N   1 
ATOM   4376  C  CA  . TYR B  1 110 ? 39.566  -18.187 23.658  1.00   27.17 ? 217 TYR B CA  1 
ATOM   4377  C  C   . TYR B  1 110 ? 38.245  -18.204 24.391  1.00   28.37 ? 217 TYR B C   1 
ATOM   4378  O  O   . TYR B  1 110 ? 37.543  -19.215 24.345  1.00   28.00 ? 217 TYR B O   1 
ATOM   4379  C  CB  . TYR B  1 110 ? 40.439  -19.367 24.115  1.00   28.32 ? 217 TYR B CB  1 
ATOM   4380  C  CG  . TYR B  1 110 ? 41.080  -19.212 25.465  1.00   27.16 ? 217 TYR B CG  1 
ATOM   4381  C  CD1 . TYR B  1 110 ? 40.327  -19.307 26.639  1.00   27.05 ? 217 TYR B CD1 1 
ATOM   4382  C  CD2 . TYR B  1 110 ? 42.452  -19.019 25.574  1.00   28.00 ? 217 TYR B CD2 1 
ATOM   4383  C  CE1 . TYR B  1 110 ? 40.941  -19.223 27.892  1.00   29.74 ? 217 TYR B CE1 1 
ATOM   4384  C  CE2 . TYR B  1 110 ? 43.073  -18.930 26.810  1.00   29.44 ? 217 TYR B CE2 1 
ATOM   4385  C  CZ  . TYR B  1 110 ? 42.319  -19.035 27.966  1.00   30.94 ? 217 TYR B CZ  1 
ATOM   4386  O  OH  . TYR B  1 110 ? 42.958  -18.960 29.184  1.00   33.30 ? 217 TYR B OH  1 
ATOM   4387  N  N   . ASN B  1 111 ? 37.889  -17.109 25.056  1.00   28.76 ? 218 ASN B N   1 
ATOM   4388  C  CA  . ASN B  1 111 ? 36.592  -17.060 25.732  1.00   32.67 ? 218 ASN B CA  1 
ATOM   4389  C  C   . ASN B  1 111 ? 35.682  -16.015 25.113  1.00   34.18 ? 218 ASN B C   1 
ATOM   4390  O  O   . ASN B  1 111 ? 34.613  -15.715 25.646  1.00   35.93 ? 218 ASN B O   1 
ATOM   4391  C  CB  . ASN B  1 111 ? 36.734  -16.777 27.230  1.00   33.68 ? 218 ASN B CB  1 
ATOM   4392  C  CG  . ASN B  1 111 ? 37.096  -18.019 28.024  1.00   33.39 ? 218 ASN B CG  1 
ATOM   4393  O  OD1 . ASN B  1 111 ? 36.596  -19.118 27.747  1.00   29.47 ? 218 ASN B OD1 1 
ATOM   4394  N  ND2 . ASN B  1 111 ? 37.960  -17.851 29.022  1.00   32.67 ? 218 ASN B ND2 1 
ATOM   4395  N  N   . ALA B  1 112 ? 36.111  -15.453 23.990  1.00   34.04 ? 219 ALA B N   1 
ATOM   4396  C  CA  . ALA B  1 112 ? 35.308  -14.454 23.297  1.00   31.87 ? 219 ALA B CA  1 
ATOM   4397  C  C   . ALA B  1 112 ? 34.272  -15.169 22.436  1.00   31.65 ? 219 ALA B C   1 
ATOM   4398  O  O   . ALA B  1 112 ? 34.398  -16.369 22.153  1.00   30.21 ? 219 ALA B O   1 
ATOM   4399  C  CB  . ALA B  1 112 ? 36.198  -13.594 22.417  1.00   31.96 ? 219 ALA B CB  1 
ATOM   4400  N  N   . ARG B  1 113 ? 33.241  -14.441 22.030  1.00   29.21 ? 220 ARG B N   1 
ATOM   4401  C  CA  . ARG B  1 113 ? 32.232  -15.019 21.165  1.00   31.30 ? 220 ARG B CA  1 
ATOM   4402  C  C   . ARG B  1 113 ? 32.691  -14.672 19.757  1.00   29.76 ? 220 ARG B C   1 
ATOM   4403  O  O   . ARG B  1 113 ? 33.139  -13.557 19.490  1.00   27.99 ? 220 ARG B O   1 
ATOM   4404  C  CB  . ARG B  1 113 ? 30.856  -14.438 21.488  1.00   37.60 ? 220 ARG B CB  1 
ATOM   4405  C  CG  . ARG B  1 113 ? 30.311  -14.993 22.795  1.00   40.95 ? 220 ARG B CG  1 
ATOM   4406  C  CD  . ARG B  1 113 ? 29.400  -14.005 23.467  1.00   49.65 ? 220 ARG B CD  1 
ATOM   4407  N  NE  . ARG B  1 113 ? 28.105  -13.908 22.800  1.00   54.47 ? 220 ARG B NE  1 
ATOM   4408  C  CZ  . ARG B  1 113 ? 27.200  -12.971 23.070  1.00   56.53 ? 220 ARG B CZ  1 
ATOM   4409  N  NH1 . ARG B  1 113 ? 26.043  -12.964 22.419  1.00   58.34 ? 220 ARG B NH1 1 
ATOM   4410  N  NH2 . ARG B  1 113 ? 27.461  -12.032 23.979  1.00   56.01 ? 220 ARG B NH2 1 
ATOM   4411  N  N   . ILE B  1 114 ? 32.607  -15.641 18.862  1.00   29.05 ? 221 ILE B N   1 
ATOM   4412  C  CA  . ILE B  1 114 ? 33.077  -15.439 17.510  1.00   28.83 ? 221 ILE B CA  1 
ATOM   4413  C  C   . ILE B  1 114 ? 31.974  -15.632 16.479  1.00   30.86 ? 221 ILE B C   1 
ATOM   4414  O  O   . ILE B  1 114 ? 31.192  -16.583 16.551  1.00   30.67 ? 221 ILE B O   1 
ATOM   4415  C  CB  . ILE B  1 114 ? 34.251  -16.411 17.214  1.00   31.18 ? 221 ILE B CB  1 
ATOM   4416  C  CG1 . ILE B  1 114 ? 34.766  -16.211 15.786  1.00   31.19 ? 221 ILE B CG1 1 
ATOM   4417  C  CG2 . ILE B  1 114 ? 33.802  -17.859 17.440  1.00   30.01 ? 221 ILE B CG2 1 
ATOM   4418  C  CD1 . ILE B  1 114 ? 35.559  -14.938 15.611  1.00   32.62 ? 221 ILE B CD1 1 
ATOM   4419  N  N   . GLY B  1 115 ? 31.922  -14.716 15.519  1.00   29.82 ? 222 GLY B N   1 
ATOM   4420  C  CA  . GLY B  1 115 ? 30.927  -14.796 14.470  1.00   28.87 ? 222 GLY B CA  1 
ATOM   4421  C  C   . GLY B  1 115 ? 31.595  -14.664 13.115  1.00   29.63 ? 222 GLY B C   1 
ATOM   4422  O  O   . GLY B  1 115 ? 32.794  -14.383 13.023  1.00   29.48 ? 222 GLY B O   1 
ATOM   4423  N  N   . GLY B  1 116 ? 30.826  -14.867 12.053  1.00   28.15 ? 223 GLY B N   1 
ATOM   4424  C  CA  . GLY B  1 116 ? 31.394  -14.755 10.728  1.00   25.01 ? 223 GLY B CA  1 
ATOM   4425  C  C   . GLY B  1 116 ? 30.387  -14.224 9.742   1.00   25.16 ? 223 GLY B C   1 
ATOM   4426  O  O   . GLY B  1 116 ? 29.211  -14.561 9.817   1.00   27.01 ? 223 GLY B O   1 
ATOM   4427  N  N   . VAL B  1 117 ? 30.837  -13.358 8.844   1.00   22.76 ? 224 VAL B N   1 
ATOM   4428  C  CA  . VAL B  1 117 ? 29.958  -12.834 7.815   1.00   23.60 ? 224 VAL B CA  1 
ATOM   4429  C  C   . VAL B  1 117 ? 30.488  -13.401 6.519   1.00   25.11 ? 224 VAL B C   1 
ATOM   4430  O  O   . VAL B  1 117 ? 31.637  -13.163 6.146   1.00   25.60 ? 224 VAL B O   1 
ATOM   4431  C  CB  . VAL B  1 117 ? 29.980  -11.298 7.693   1.00   22.42 ? 224 VAL B CB  1 
ATOM   4432  C  CG1 . VAL B  1 117 ? 29.255  -10.892 6.400   1.00   18.42 ? 224 VAL B CG1 1 
ATOM   4433  C  CG2 . VAL B  1 117 ? 29.302  -10.661 8.898   1.00   23.00 ? 224 VAL B CG2 1 
ATOM   4434  N  N   . ARG B  1 118 ? 29.655  -14.177 5.843   1.00   26.50 ? 225 ARG B N   1 
ATOM   4435  C  CA  . ARG B  1 118 ? 30.055  -14.764 4.579   1.00   25.24 ? 225 ARG B CA  1 
ATOM   4436  C  C   . ARG B  1 118 ? 29.799  -13.673 3.549   1.00   22.89 ? 225 ARG B C   1 
ATOM   4437  O  O   . ARG B  1 118 ? 28.649  -13.368 3.236   1.00   21.26 ? 225 ARG B O   1 
ATOM   4438  C  CB  . ARG B  1 118 ? 29.212  -16.015 4.295   1.00   25.41 ? 225 ARG B CB  1 
ATOM   4439  C  CG  . ARG B  1 118 ? 29.555  -16.731 3.007   1.00   26.43 ? 225 ARG B CG  1 
ATOM   4440  C  CD  . ARG B  1 118 ? 28.854  -18.099 2.911   1.00   28.22 ? 225 ARG B CD  1 
ATOM   4441  N  NE  . ARG B  1 118 ? 29.108  -18.711 1.609   1.00   30.86 ? 225 ARG B NE  1 
ATOM   4442  C  CZ  . ARG B  1 118 ? 28.249  -18.712 0.594   1.00   28.87 ? 225 ARG B CZ  1 
ATOM   4443  N  NH1 . ARG B  1 118 ? 28.588  -19.275 -0.556  1.00   29.03 ? 225 ARG B NH1 1 
ATOM   4444  N  NH2 . ARG B  1 118 ? 27.044  -18.183 0.739   1.00   27.36 ? 225 ARG B NH2 1 
ATOM   4445  N  N   . MET B  1 119 ? 30.868  -13.060 3.049   1.00   22.06 ? 226 MET B N   1 
ATOM   4446  C  CA  . MET B  1 119 ? 30.714  -11.995 2.060   1.00   22.70 ? 226 MET B CA  1 
ATOM   4447  C  C   . MET B  1 119 ? 31.742  -11.968 0.939   1.00   22.83 ? 226 MET B C   1 
ATOM   4448  O  O   . MET B  1 119 ? 31.630  -11.149 0.025   1.00   21.25 ? 226 MET B O   1 
ATOM   4449  C  CB  . MET B  1 119 ? 30.648  -10.621 2.747   1.00   22.74 ? 226 MET B CB  1 
ATOM   4450  C  CG  . MET B  1 119 ? 31.659  -10.364 3.854   1.00   22.57 ? 226 MET B CG  1 
ATOM   4451  S  SD  . MET B  1 119 ? 33.340  -10.037 3.315   1.00   27.14 ? 226 MET B SD  1 
ATOM   4452  C  CE  . MET B  1 119 ? 33.181  -8.623  2.235   1.00   21.83 ? 226 MET B CE  1 
ATOM   4453  N  N   . LEU B  1 120 ? 32.731  -12.858 0.985   1.00   21.09 ? 227 LEU B N   1 
ATOM   4454  C  CA  . LEU B  1 120 ? 33.725  -12.891 -0.092  1.00   25.23 ? 227 LEU B CA  1 
ATOM   4455  C  C   . LEU B  1 120 ? 33.409  -13.938 -1.170  1.00   26.53 ? 227 LEU B C   1 
ATOM   4456  O  O   . LEU B  1 120 ? 33.955  -13.880 -2.280  1.00   26.24 ? 227 LEU B O   1 
ATOM   4457  C  CB  . LEU B  1 120 ? 35.128  -13.176 0.450   1.00   24.33 ? 227 LEU B CB  1 
ATOM   4458  C  CG  . LEU B  1 120 ? 35.827  -12.132 1.327   1.00   27.85 ? 227 LEU B CG  1 
ATOM   4459  C  CD1 . LEU B  1 120 ? 37.202  -12.662 1.720   1.00   20.68 ? 227 LEU B CD1 1 
ATOM   4460  C  CD2 . LEU B  1 120 ? 35.948  -10.795 0.586   1.00   23.05 ? 227 LEU B CD2 1 
ATOM   4461  N  N   . ASP B  1 121 ? 32.529  -14.886 -0.852  1.00   25.90 ? 228 ASP B N   1 
ATOM   4462  C  CA  . ASP B  1 121 ? 32.188  -15.949 -1.796  1.00   24.75 ? 228 ASP B CA  1 
ATOM   4463  C  C   . ASP B  1 121 ? 31.041  -15.539 -2.704  1.00   25.28 ? 228 ASP B C   1 
ATOM   4464  O  O   . ASP B  1 121 ? 29.919  -16.016 -2.558  1.00   26.58 ? 228 ASP B O   1 
ATOM   4465  C  CB  . ASP B  1 121 ? 31.837  -17.212 -1.019  1.00   25.95 ? 228 ASP B CB  1 
ATOM   4466  C  CG  . ASP B  1 121 ? 31.830  -18.466 -1.886  1.00   27.40 ? 228 ASP B CG  1 
ATOM   4467  O  OD1 . ASP B  1 121 ? 32.357  -18.435 -3.015  1.00   26.44 ? 228 ASP B OD1 1 
ATOM   4468  O  OD2 . ASP B  1 121 ? 31.307  -19.496 -1.415  1.00   26.96 ? 228 ASP B OD2 1 
ATOM   4469  N  N   . GLY B  1 122 ? 31.346  -14.647 -3.642  1.00   25.89 ? 229 GLY B N   1 
ATOM   4470  C  CA  . GLY B  1 122 ? 30.365  -14.129 -4.579  1.00   27.07 ? 229 GLY B CA  1 
ATOM   4471  C  C   . GLY B  1 122 ? 30.822  -12.758 -5.055  1.00   30.13 ? 229 GLY B C   1 
ATOM   4472  O  O   . GLY B  1 122 ? 31.973  -12.391 -4.842  1.00   33.77 ? 229 GLY B O   1 
ATOM   4473  N  N   . GLU B  1 123 ? 29.944  -11.998 -5.701  1.00   32.23 ? 230 GLU B N   1 
ATOM   4474  C  CA  . GLU B  1 123 ? 30.308  -10.667 -6.176  1.00   33.34 ? 230 GLU B CA  1 
ATOM   4475  C  C   . GLU B  1 123 ? 30.443  -9.744  -4.952  1.00   31.69 ? 230 GLU B C   1 
ATOM   4476  O  O   . GLU B  1 123 ? 29.481  -9.539  -4.209  1.00   30.70 ? 230 GLU B O   1 
ATOM   4477  C  CB  . GLU B  1 123 ? 29.222  -10.129 -7.119  1.00   37.08 ? 230 GLU B CB  1 
ATOM   4478  C  CG  . GLU B  1 123 ? 29.761  -9.305  -8.300  1.00   41.31 ? 230 GLU B CG  1 
ATOM   4479  C  CD  . GLU B  1 123 ? 28.680  -8.487  -9.004  1.00   41.98 ? 230 GLU B CD  1 
ATOM   4480  O  OE1 . GLU B  1 123 ? 27.579  -9.028  -9.241  0.0000 41.71 ? 230 GLU B OE1 1 
ATOM   4481  O  OE2 . GLU B  1 123 ? 28.942  -7.308  -9.325  0.0000 41.71 ? 230 GLU B OE2 1 
ATOM   4482  N  N   . VAL B  1 124 ? 31.633  -9.200  -4.733  1.00   29.77 ? 231 VAL B N   1 
ATOM   4483  C  CA  . VAL B  1 124 ? 31.848  -8.309  -3.594  1.00   28.80 ? 231 VAL B CA  1 
ATOM   4484  C  C   . VAL B  1 124 ? 31.624  -6.853  -3.999  1.00   26.32 ? 231 VAL B C   1 
ATOM   4485  O  O   . VAL B  1 124 ? 32.533  -6.177  -4.485  1.00   27.01 ? 231 VAL B O   1 
ATOM   4486  C  CB  . VAL B  1 124 ? 33.269  -8.468  -3.030  1.00   29.02 ? 231 VAL B CB  1 
ATOM   4487  C  CG1 . VAL B  1 124 ? 33.419  -7.667  -1.752  1.00   28.84 ? 231 VAL B CG1 1 
ATOM   4488  C  CG2 . VAL B  1 124 ? 33.551  -9.941  -2.765  1.00   30.41 ? 231 VAL B CG2 1 
ATOM   4489  N  N   . THR B  1 125 ? 30.400  -6.382  -3.797  1.00   22.12 ? 232 THR B N   1 
ATOM   4490  C  CA  . THR B  1 125 ? 30.015  -5.017  -4.143  1.00   21.49 ? 232 THR B CA  1 
ATOM   4491  C  C   . THR B  1 125 ? 30.099  -4.066  -2.950  1.00   22.15 ? 232 THR B C   1 
ATOM   4492  O  O   . THR B  1 125 ? 30.309  -4.483  -1.804  1.00   23.60 ? 232 THR B O   1 
ATOM   4493  C  CB  . THR B  1 125 ? 28.571  -4.982  -4.615  1.00   20.76 ? 232 THR B CB  1 
ATOM   4494  O  OG1 . THR B  1 125 ? 27.749  -5.508  -3.567  1.00   18.55 ? 232 THR B OG1 1 
ATOM   4495  C  CG2 . THR B  1 125 ? 28.389  -5.833  -5.874  1.00   21.50 ? 232 THR B CG2 1 
ATOM   4496  N  N   . ASP B  1 126 ? 29.899  -2.784  -3.229  1.00   21.09 ? 233 ASP B N   1 
ATOM   4497  C  CA  . ASP B  1 126 ? 29.921  -1.769  -2.191  1.00   20.95 ? 233 ASP B CA  1 
ATOM   4498  C  C   . ASP B  1 126 ? 28.833  -2.127  -1.173  1.00   21.74 ? 233 ASP B C   1 
ATOM   4499  O  O   . ASP B  1 126 ? 29.069  -2.115  0.038   1.00   22.79 ? 233 ASP B O   1 
ATOM   4500  C  CB  . ASP B  1 126 ? 29.679  -0.394  -2.827  1.00   21.60 ? 233 ASP B CB  1 
ATOM   4501  C  CG  . ASP B  1 126 ? 29.803  0.761   -1.832  1.00   26.63 ? 233 ASP B CG  1 
ATOM   4502  O  OD1 . ASP B  1 126 ? 30.522  0.639   -0.810  1.00   25.64 ? 233 ASP B OD1 1 
ATOM   4503  O  OD2 . ASP B  1 126 ? 29.184  1.810   -2.100  1.00   27.43 ? 233 ASP B OD2 1 
ATOM   4504  N  N   . ALA B  1 127 ? 27.647  -2.481  -1.668  1.00   20.67 ? 234 ALA B N   1 
ATOM   4505  C  CA  . ALA B  1 127 ? 26.531  -2.846  -0.794  1.00   18.47 ? 234 ALA B CA  1 
ATOM   4506  C  C   . ALA B  1 127 ? 26.888  -4.051  0.081   1.00   20.45 ? 234 ALA B C   1 
ATOM   4507  O  O   . ALA B  1 127 ? 26.569  -4.089  1.274   1.00   21.26 ? 234 ALA B O   1 
ATOM   4508  C  CB  . ALA B  1 127 ? 25.309  -3.154  -1.625  1.00   19.84 ? 234 ALA B CB  1 
ATOM   4509  N  N   . VAL B  1 128 ? 27.544  -5.038  -0.518  1.00   18.14 ? 235 VAL B N   1 
ATOM   4510  C  CA  . VAL B  1 128 ? 27.958  -6.221  0.219   1.00   20.32 ? 235 VAL B CA  1 
ATOM   4511  C  C   . VAL B  1 128 ? 28.897  -5.800  1.354   1.00   21.71 ? 235 VAL B C   1 
ATOM   4512  O  O   . VAL B  1 128 ? 28.736  -6.207  2.505   1.00   21.59 ? 235 VAL B O   1 
ATOM   4513  C  CB  . VAL B  1 128 ? 28.693  -7.224  -0.719  1.00   20.88 ? 235 VAL B CB  1 
ATOM   4514  C  CG1 . VAL B  1 128 ? 29.387  -8.310  0.090   1.00   16.44 ? 235 VAL B CG1 1 
ATOM   4515  C  CG2 . VAL B  1 128 ? 27.691  -7.865  -1.681  1.00   19.71 ? 235 VAL B CG2 1 
ATOM   4516  N  N   . GLU B  1 129 ? 29.881  -4.972  1.028   1.00   23.57 ? 236 GLU B N   1 
ATOM   4517  C  CA  . GLU B  1 129 ? 30.833  -4.520  2.037   1.00   23.52 ? 236 GLU B CA  1 
ATOM   4518  C  C   . GLU B  1 129 ? 30.135  -3.723  3.143   1.00   24.55 ? 236 GLU B C   1 
ATOM   4519  O  O   . GLU B  1 129 ? 30.351  -3.969  4.327   1.00   24.54 ? 236 GLU B O   1 
ATOM   4520  C  CB  . GLU B  1 129 ? 31.925  -3.659  1.389   1.00   21.15 ? 236 GLU B CB  1 
ATOM   4521  C  CG  . GLU B  1 129 ? 32.851  -4.412  0.446   1.00   19.61 ? 236 GLU B CG  1 
ATOM   4522  C  CD  . GLU B  1 129 ? 33.917  -3.517  -0.199  1.00   23.30 ? 236 GLU B CD  1 
ATOM   4523  O  OE1 . GLU B  1 129 ? 34.160  -2.397  0.304   1.00   22.95 ? 236 GLU B OE1 1 
ATOM   4524  O  OE2 . GLU B  1 129 ? 34.536  -3.936  -1.205  1.00   22.88 ? 236 GLU B OE2 1 
ATOM   4525  N  N   . ALA B  1 130 ? 29.299  -2.767  2.750   1.00   24.17 ? 237 ALA B N   1 
ATOM   4526  C  CA  . ALA B  1 130 ? 28.604  -1.939  3.723   1.00   22.80 ? 237 ALA B CA  1 
ATOM   4527  C  C   . ALA B  1 130 ? 27.752  -2.761  4.682   1.00   22.13 ? 237 ALA B C   1 
ATOM   4528  O  O   . ALA B  1 130 ? 27.766  -2.524  5.886   1.00   19.95 ? 237 ALA B O   1 
ATOM   4529  C  CB  . ALA B  1 130 ? 27.747  -0.907  3.009   1.00   23.13 ? 237 ALA B CB  1 
ATOM   4530  N  N   . ARG B  1 131 ? 27.019  -3.734  4.157   1.00   23.70 ? 238 ARG B N   1 
ATOM   4531  C  CA  . ARG B  1 131 ? 26.169  -4.551  5.015   1.00   26.20 ? 238 ARG B CA  1 
ATOM   4532  C  C   . ARG B  1 131 ? 26.996  -5.387  5.982   1.00   24.92 ? 238 ARG B C   1 
ATOM   4533  O  O   . ARG B  1 131 ? 26.554  -5.674  7.095   1.00   24.23 ? 238 ARG B O   1 
ATOM   4534  C  CB  . ARG B  1 131 ? 25.265  -5.450  4.174   1.00   29.06 ? 238 ARG B CB  1 
ATOM   4535  C  CG  . ARG B  1 131 ? 24.366  -4.673  3.206   1.00   36.66 ? 238 ARG B CG  1 
ATOM   4536  C  CD  . ARG B  1 131 ? 23.386  -5.596  2.519   1.00   41.80 ? 238 ARG B CD  1 
ATOM   4537  N  NE  . ARG B  1 131 ? 22.515  -6.234  3.499   1.00   49.87 ? 238 ARG B NE  1 
ATOM   4538  C  CZ  . ARG B  1 131 ? 22.092  -7.492  3.415   1.00   55.26 ? 238 ARG B CZ  1 
ATOM   4539  N  NH1 . ARG B  1 131 ? 21.295  -7.987  4.361   1.00   56.84 ? 238 ARG B NH1 1 
ATOM   4540  N  NH2 . ARG B  1 131 ? 22.471  -8.257  2.391   1.00   55.40 ? 238 ARG B NH2 1 
ATOM   4541  N  N   . SER B  1 132 ? 28.200  -5.765  5.563   1.00   19.87 ? 239 SER B N   1 
ATOM   4542  C  CA  . SER B  1 132 ? 29.073  -6.551  6.417   1.00   20.03 ? 239 SER B CA  1 
ATOM   4543  C  C   . SER B  1 132 ? 29.698  -5.688  7.508   1.00   22.46 ? 239 SER B C   1 
ATOM   4544  O  O   . SER B  1 132 ? 29.642  -6.025  8.691   1.00   23.43 ? 239 SER B O   1 
ATOM   4545  C  CB  . SER B  1 132 ? 30.172  -7.196  5.584   1.00   20.32 ? 239 SER B CB  1 
ATOM   4546  O  OG  . SER B  1 132 ? 29.613  -7.988  4.549   1.00   24.30 ? 239 SER B OG  1 
ATOM   4547  N  N   . LEU B  1 133 ? 30.286  -4.566  7.103   1.00   22.53 ? 240 LEU B N   1 
ATOM   4548  C  CA  . LEU B  1 133 ? 30.920  -3.657  8.042   1.00   21.47 ? 240 LEU B CA  1 
ATOM   4549  C  C   . LEU B  1 133 ? 29.902  -3.080  9.024   1.00   20.99 ? 240 LEU B C   1 
ATOM   4550  O  O   . LEU B  1 133 ? 30.241  -2.749  10.152  1.00   22.06 ? 240 LEU B O   1 
ATOM   4551  C  CB  . LEU B  1 133 ? 31.616  -2.524  7.270   1.00   19.17 ? 240 LEU B CB  1 
ATOM   4552  C  CG  . LEU B  1 133 ? 32.821  -2.960  6.415   1.00   17.48 ? 240 LEU B CG  1 
ATOM   4553  C  CD1 . LEU B  1 133 ? 33.248  -1.846  5.478   1.00   17.22 ? 240 LEU B CD1 1 
ATOM   4554  C  CD2 . LEU B  1 133 ? 33.965  -3.327  7.317   1.00   14.03 ? 240 LEU B CD2 1 
ATOM   4555  N  N   . GLY B  1 134 ? 28.654  -2.977  8.589   1.00   20.95 ? 241 GLY B N   1 
ATOM   4556  C  CA  . GLY B  1 134 ? 27.621  -2.423  9.443   1.00   24.23 ? 241 GLY B CA  1 
ATOM   4557  C  C   . GLY B  1 134 ? 26.731  -3.448  10.123  1.00   26.60 ? 241 GLY B C   1 
ATOM   4558  O  O   . GLY B  1 134 ? 25.676  -3.105  10.657  1.00   28.14 ? 241 GLY B O   1 
ATOM   4559  N  N   . LEU B  1 135 ? 27.133  -4.710  10.113  1.00   24.45 ? 242 LEU B N   1 
ATOM   4560  C  CA  . LEU B  1 135 ? 26.319  -5.727  10.763  1.00   24.79 ? 242 LEU B CA  1 
ATOM   4561  C  C   . LEU B  1 135 ? 26.261  -5.576  12.285  1.00   25.87 ? 242 LEU B C   1 
ATOM   4562  O  O   . LEU B  1 135 ? 27.294  -5.536  12.953  1.00   27.83 ? 242 LEU B O   1 
ATOM   4563  C  CB  . LEU B  1 135 ? 26.864  -7.117  10.451  1.00   24.34 ? 242 LEU B CB  1 
ATOM   4564  C  CG  . LEU B  1 135 ? 26.042  -8.228  11.092  1.00   24.34 ? 242 LEU B CG  1 
ATOM   4565  C  CD1 . LEU B  1 135 ? 24.704  -8.338  10.358  1.00   24.75 ? 242 LEU B CD1 1 
ATOM   4566  C  CD2 . LEU B  1 135 ? 26.795  -9.541  11.036  1.00   24.75 ? 242 LEU B CD2 1 
ATOM   4567  N  N   . ASN B  1 136 ? 25.054  -5.491  12.831  1.00   26.24 ? 243 ASN B N   1 
ATOM   4568  C  CA  . ASN B  1 136 ? 24.874  -5.425  14.280  1.00   27.78 ? 243 ASN B CA  1 
ATOM   4569  C  C   . ASN B  1 136 ? 25.931  -4.647  15.044  1.00   25.61 ? 243 ASN B C   1 
ATOM   4570  O  O   . ASN B  1 136 ? 26.568  -5.199  15.941  1.00   23.83 ? 243 ASN B O   1 
ATOM   4571  C  CB  . ASN B  1 136 ? 24.862  -6.843  14.809  1.00   33.16 ? 243 ASN B CB  1 
ATOM   4572  C  CG  . ASN B  1 136 ? 23.662  -7.133  15.649  1.00   37.88 ? 243 ASN B CG  1 
ATOM   4573  O  OD1 . ASN B  1 136 ? 23.267  -8.288  15.794  1.00   46.11 ? 243 ASN B OD1 1 
ATOM   4574  N  ND2 . ASN B  1 136 ? 23.070  -6.090  16.229  1.00   39.43 ? 243 ASN B ND2 1 
ATOM   4575  N  N   . PRO B  1 137 ? 26.103  -3.354  14.726  1.00   24.07 ? 244 PRO B N   1 
ATOM   4576  C  CA  . PRO B  1 137 ? 27.092  -2.478  15.364  1.00   25.33 ? 244 PRO B CA  1 
ATOM   4577  C  C   . PRO B  1 137 ? 26.987  -2.351  16.879  1.00   25.11 ? 244 PRO B C   1 
ATOM   4578  O  O   . PRO B  1 137 ? 27.938  -1.927  17.525  1.00   23.07 ? 244 PRO B O   1 
ATOM   4579  C  CB  . PRO B  1 137 ? 26.876  -1.146  14.664  1.00   26.91 ? 244 PRO B CB  1 
ATOM   4580  C  CG  . PRO B  1 137 ? 26.308  -1.556  13.332  1.00   26.48 ? 244 PRO B CG  1 
ATOM   4581  C  CD  . PRO B  1 137 ? 25.334  -2.619  13.717  1.00   22.73 ? 244 PRO B CD  1 
ATOM   4582  N  N   . ASN B  1 138 ? 25.839  -2.703  17.449  1.00   27.30 ? 245 ASN B N   1 
ATOM   4583  C  CA  . ASN B  1 138 ? 25.709  -2.607  18.898  1.00   31.14 ? 245 ASN B CA  1 
ATOM   4584  C  C   . ASN B  1 138 ? 25.856  -3.937  19.601  1.00   29.98 ? 245 ASN B C   1 
ATOM   4585  O  O   . ASN B  1 138 ? 25.742  -4.012  20.823  1.00   30.51 ? 245 ASN B O   1 
ATOM   4586  C  CB  . ASN B  1 138 ? 24.401  -1.929  19.281  1.00   33.16 ? 245 ASN B CB  1 
ATOM   4587  C  CG  . ASN B  1 138 ? 24.424  -0.454  18.961  1.00   39.99 ? 245 ASN B CG  1 
ATOM   4588  O  OD1 . ASN B  1 138 ? 25.288  0.282   19.456  1.00   41.78 ? 245 ASN B OD1 1 
ATOM   4589  N  ND2 . ASN B  1 138 ? 23.497  -0.010  18.115  1.00   40.82 ? 245 ASN B ND2 1 
ATOM   4590  N  N   . HIS B  1 139 ? 26.122  -4.983  18.824  1.00   28.11 ? 246 HIS B N   1 
ATOM   4591  C  CA  . HIS B  1 139 ? 26.339  -6.294  19.398  1.00   26.65 ? 246 HIS B CA  1 
ATOM   4592  C  C   . HIS B  1 139 ? 27.815  -6.678  19.193  1.00   28.95 ? 246 HIS B C   1 
ATOM   4593  O  O   . HIS B  1 139 ? 28.515  -7.064  20.147  1.00   28.17 ? 246 HIS B O   1 
ATOM   4594  C  CB  . HIS B  1 139 ? 25.423  -7.315  18.741  1.00   25.30 ? 246 HIS B CB  1 
ATOM   4595  C  CG  . HIS B  1 139 ? 25.657  -8.711  19.212  1.00   28.00 ? 246 HIS B CG  1 
ATOM   4596  N  ND1 . HIS B  1 139 ? 25.491  -9.086  20.527  1.00   27.60 ? 246 HIS B ND1 1 
ATOM   4597  C  CD2 . HIS B  1 139 ? 26.092  -9.814  18.556  1.00   28.17 ? 246 HIS B CD2 1 
ATOM   4598  C  CE1 . HIS B  1 139 ? 25.816  -10.361 20.662  1.00   27.12 ? 246 HIS B CE1 1 
ATOM   4599  N  NE2 . HIS B  1 139 ? 26.185  -10.825 19.481  1.00   27.69 ? 246 HIS B NE2 1 
ATOM   4600  N  N   . ILE B  1 140 ? 28.280  -6.552  17.948  1.00   27.33 ? 247 ILE B N   1 
ATOM   4601  C  CA  . ILE B  1 140 ? 29.661  -6.860  17.583  1.00   24.48 ? 247 ILE B CA  1 
ATOM   4602  C  C   . ILE B  1 140 ? 30.600  -5.735  18.029  1.00   25.35 ? 247 ILE B C   1 
ATOM   4603  O  O   . ILE B  1 140 ? 30.330  -4.562  17.788  1.00   24.62 ? 247 ILE B O   1 
ATOM   4604  C  CB  . ILE B  1 140 ? 29.806  -7.017  16.061  1.00   22.66 ? 247 ILE B CB  1 
ATOM   4605  C  CG1 . ILE B  1 140 ? 28.954  -8.187  15.567  1.00   24.97 ? 247 ILE B CG1 1 
ATOM   4606  C  CG2 . ILE B  1 140 ? 31.263  -7.251  15.700  1.00   20.68 ? 247 ILE B CG2 1 
ATOM   4607  C  CD1 . ILE B  1 140 ? 28.788  -8.248  14.061  1.00   16.69 ? 247 ILE B CD1 1 
ATOM   4608  N  N   . HIS B  1 141 ? 31.708  -6.086  18.674  1.00   24.12 ? 248 HIS B N   1 
ATOM   4609  C  CA  . HIS B  1 141 ? 32.650  -5.064  19.119  1.00   23.03 ? 248 HIS B CA  1 
ATOM   4610  C  C   . HIS B  1 141 ? 33.781  -4.857  18.117  1.00   22.57 ? 248 HIS B C   1 
ATOM   4611  O  O   . HIS B  1 141 ? 34.186  -3.727  17.841  1.00   21.51 ? 248 HIS B O   1 
ATOM   4612  C  CB  . HIS B  1 141 ? 33.282  -5.444  20.464  1.00   25.31 ? 248 HIS B CB  1 
ATOM   4613  C  CG  . HIS B  1 141 ? 32.291  -5.667  21.562  1.00   29.73 ? 248 HIS B CG  1 
ATOM   4614  N  ND1 . HIS B  1 141 ? 31.945  -6.925  22.007  1.00   31.49 ? 248 HIS B ND1 1 
ATOM   4615  C  CD2 . HIS B  1 141 ? 31.530  -4.797  22.268  1.00   31.62 ? 248 HIS B CD2 1 
ATOM   4616  C  CE1 . HIS B  1 141 ? 31.011  -6.821  22.936  1.00   29.06 ? 248 HIS B CE1 1 
ATOM   4617  N  NE2 . HIS B  1 141 ? 30.741  -5.541  23.110  1.00   31.38 ? 248 HIS B NE2 1 
ATOM   4618  N  N   . ILE B  1 142 ? 34.277  -5.960  17.574  1.00   21.83 ? 249 ILE B N   1 
ATOM   4619  C  CA  . ILE B  1 142 ? 35.413  -5.937  16.673  1.00   20.60 ? 249 ILE B CA  1 
ATOM   4620  C  C   . ILE B  1 142 ? 35.149  -6.654  15.362  1.00   21.55 ? 249 ILE B C   1 
ATOM   4621  O  O   . ILE B  1 142 ? 34.623  -7.762  15.354  1.00   22.89 ? 249 ILE B O   1 
ATOM   4622  C  CB  . ILE B  1 142 ? 36.607  -6.636  17.360  1.00   18.80 ? 249 ILE B CB  1 
ATOM   4623  C  CG1 . ILE B  1 142 ? 36.863  -5.991  18.715  1.00   17.10 ? 249 ILE B CG1 1 
ATOM   4624  C  CG2 . ILE B  1 142 ? 37.842  -6.626  16.469  1.00   14.85 ? 249 ILE B CG2 1 
ATOM   4625  C  CD1 . ILE B  1 142 ? 37.851  -6.775  19.587  1.00   13.11 ? 249 ILE B CD1 1 
ATOM   4626  N  N   . TYR B  1 143 ? 35.535  -6.020  14.262  1.00   19.65 ? 250 TYR B N   1 
ATOM   4627  C  CA  . TYR B  1 143 ? 35.394  -6.615  12.942  1.00   18.95 ? 250 TYR B CA  1 
ATOM   4628  C  C   . TYR B  1 143 ? 36.810  -6.894  12.433  1.00   18.85 ? 250 TYR B C   1 
ATOM   4629  O  O   . TYR B  1 143 ? 37.691  -6.044  12.540  1.00   20.78 ? 250 TYR B O   1 
ATOM   4630  C  CB  . TYR B  1 143 ? 34.696  -5.648  11.977  1.00   19.14 ? 250 TYR B CB  1 
ATOM   4631  C  CG  . TYR B  1 143 ? 33.304  -5.248  12.403  1.00   24.39 ? 250 TYR B CG  1 
ATOM   4632  C  CD1 . TYR B  1 143 ? 33.108  -4.335  13.434  1.00   22.80 ? 250 TYR B CD1 1 
ATOM   4633  C  CD2 . TYR B  1 143 ? 32.176  -5.788  11.774  1.00   23.39 ? 250 TYR B CD2 1 
ATOM   4634  C  CE1 . TYR B  1 143 ? 31.826  -3.959  13.833  1.00   25.47 ? 250 TYR B CE1 1 
ATOM   4635  C  CE2 . TYR B  1 143 ? 30.888  -5.421  12.167  1.00   23.80 ? 250 TYR B CE2 1 
ATOM   4636  C  CZ  . TYR B  1 143 ? 30.722  -4.500  13.197  1.00   25.10 ? 250 TYR B CZ  1 
ATOM   4637  O  OH  . TYR B  1 143 ? 29.463  -4.091  13.576  1.00   21.80 ? 250 TYR B OH  1 
ATOM   4638  N  N   . SER B  1 144 ? 37.031  -8.078  11.884  1.00   17.33 ? 251 SER B N   1 
ATOM   4639  C  CA  . SER B  1 144 ? 38.341  -8.424  11.362  1.00   18.60 ? 251 SER B CA  1 
ATOM   4640  C  C   . SER B  1 144 ? 38.220  -8.682  9.867   1.00   19.62 ? 251 SER B C   1 
ATOM   4641  O  O   . SER B  1 144 ? 37.391  -9.486  9.441   1.00   19.07 ? 251 SER B O   1 
ATOM   4642  C  CB  . SER B  1 144 ? 38.878  -9.670  12.062  1.00   18.48 ? 251 SER B CB  1 
ATOM   4643  O  OG  . SER B  1 144 ? 40.206  -9.954  11.638  1.00   17.98 ? 251 SER B OG  1 
ATOM   4644  N  N   . ALA B  1 145 ? 39.048  -8.005  9.077   1.00   17.58 ? 252 ALA B N   1 
ATOM   4645  C  CA  . ALA B  1 145 ? 39.004  -8.157  7.632   1.00   19.20 ? 252 ALA B CA  1 
ATOM   4646  C  C   . ALA B  1 145 ? 40.347  -8.516  7.008   1.00   19.29 ? 252 ALA B C   1 
ATOM   4647  O  O   . ALA B  1 145 ? 41.251  -7.675  6.919   1.00   21.21 ? 252 ALA B O   1 
ATOM   4648  C  CB  . ALA B  1 145 ? 38.466  -6.871  6.996   1.00   19.38 ? 252 ALA B CB  1 
ATOM   4649  N  N   . SER B  1 146 ? 40.471  -9.766  6.575   1.00   19.16 ? 253 SER B N   1 
ATOM   4650  C  CA  . SER B  1 146 ? 41.686  -10.242 5.919   1.00   20.30 ? 253 SER B CA  1 
ATOM   4651  C  C   . SER B  1 146 ? 41.452  -10.322 4.408   1.00   21.99 ? 253 SER B C   1 
ATOM   4652  O  O   . SER B  1 146 ? 41.594  -11.391 3.796   1.00   21.19 ? 253 SER B O   1 
ATOM   4653  C  CB  . SER B  1 146 ? 42.072  -11.623 6.451   1.00   22.44 ? 253 SER B CB  1 
ATOM   4654  O  OG  . SER B  1 146 ? 42.501  -11.545 7.800   1.00   20.97 ? 253 SER B OG  1 
ATOM   4655  N  N   . TRP B  1 147 ? 41.081  -9.183  3.820   1.00   22.02 ? 254 TRP B N   1 
ATOM   4656  C  CA  . TRP B  1 147 ? 40.811  -9.077  2.385   1.00   20.17 ? 254 TRP B CA  1 
ATOM   4657  C  C   . TRP B  1 147 ? 40.928  -7.630  1.958   1.00   20.91 ? 254 TRP B C   1 
ATOM   4658  O  O   . TRP B  1 147 ? 41.054  -6.740  2.790   1.00   20.76 ? 254 TRP B O   1 
ATOM   4659  C  CB  . TRP B  1 147 ? 39.401  -9.586  2.039   1.00   15.66 ? 254 TRP B CB  1 
ATOM   4660  C  CG  . TRP B  1 147 ? 38.297  -8.988  2.854   1.00   17.83 ? 254 TRP B CG  1 
ATOM   4661  C  CD1 . TRP B  1 147 ? 37.808  -9.464  4.033   1.00   21.08 ? 254 TRP B CD1 1 
ATOM   4662  C  CD2 . TRP B  1 147 ? 37.546  -7.797  2.561   1.00   17.53 ? 254 TRP B CD2 1 
ATOM   4663  N  NE1 . TRP B  1 147 ? 36.802  -8.651  4.496   1.00   21.23 ? 254 TRP B NE1 1 
ATOM   4664  C  CE2 . TRP B  1 147 ? 36.620  -7.620  3.611   1.00   19.33 ? 254 TRP B CE2 1 
ATOM   4665  C  CE3 . TRP B  1 147 ? 37.567  -6.864  1.515   1.00   17.96 ? 254 TRP B CE3 1 
ATOM   4666  C  CZ2 . TRP B  1 147 ? 35.722  -6.550  3.648   1.00   16.39 ? 254 TRP B CZ2 1 
ATOM   4667  C  CZ3 . TRP B  1 147 ? 36.676  -5.799  1.553   1.00   19.44 ? 254 TRP B CZ3 1 
ATOM   4668  C  CH2 . TRP B  1 147 ? 35.765  -5.652  2.616   1.00   18.60 ? 254 TRP B CH2 1 
ATOM   4669  N  N   . GLY B  1 148 ? 40.887  -7.396  0.654   1.00   23.20 ? 255 GLY B N   1 
ATOM   4670  C  CA  . GLY B  1 148 ? 40.978  -6.039  0.160   1.00   23.17 ? 255 GLY B CA  1 
ATOM   4671  C  C   . GLY B  1 148 ? 41.158  -6.039  -1.341  1.00   24.27 ? 255 GLY B C   1 
ATOM   4672  O  O   . GLY B  1 148 ? 41.003  -7.083  -1.984  1.00   23.88 ? 255 GLY B O   1 
ATOM   4673  N  N   . PRO B  1 149 ? 41.465  -4.872  -1.930  1.00   22.35 ? 256 PRO B N   1 
ATOM   4674  C  CA  . PRO B  1 149 ? 41.668  -4.762  -3.374  1.00   23.97 ? 256 PRO B CA  1 
ATOM   4675  C  C   . PRO B  1 149 ? 42.854  -5.631  -3.775  1.00   25.01 ? 256 PRO B C   1 
ATOM   4676  O  O   . PRO B  1 149 ? 43.737  -5.890  -2.967  1.00   24.76 ? 256 PRO B O   1 
ATOM   4677  C  CB  . PRO B  1 149 ? 41.950  -3.273  -3.575  1.00   22.83 ? 256 PRO B CB  1 
ATOM   4678  C  CG  . PRO B  1 149 ? 41.203  -2.625  -2.425  1.00   23.94 ? 256 PRO B CG  1 
ATOM   4679  C  CD  . PRO B  1 149 ? 41.539  -3.550  -1.284  1.00   20.52 ? 256 PRO B CD  1 
ATOM   4680  N  N   . GLU B  1 150 ? 42.868  -6.072  -5.025  1.00   27.15 ? 257 GLU B N   1 
ATOM   4681  C  CA  . GLU B  1 150 ? 43.937  -6.911  -5.535  1.00   29.26 ? 257 GLU B CA  1 
ATOM   4682  C  C   . GLU B  1 150 ? 45.295  -6.242  -5.315  1.00   29.10 ? 257 GLU B C   1 
ATOM   4683  O  O   . GLU B  1 150 ? 45.440  -5.028  -5.482  1.00   28.25 ? 257 GLU B O   1 
ATOM   4684  C  CB  . GLU B  1 150 ? 43.704  -7.174  -7.021  1.00   34.33 ? 257 GLU B CB  1 
ATOM   4685  C  CG  . GLU B  1 150 ? 44.689  -8.155  -7.629  1.00   44.16 ? 257 GLU B CG  1 
ATOM   4686  C  CD  . GLU B  1 150 ? 44.325  -8.535  -9.055  1.00   50.44 ? 257 GLU B CD  1 
ATOM   4687  O  OE1 . GLU B  1 150 ? 45.139  -9.240  -9.704  1.00   49.32 ? 257 GLU B OE1 1 
ATOM   4688  O  OE2 . GLU B  1 150 ? 43.224  -8.131  -9.517  1.00   52.94 ? 257 GLU B OE2 1 
ATOM   4689  N  N   . ASP B  1 151 ? 46.294  -7.029  -4.929  1.00   26.94 ? 258 ASP B N   1 
ATOM   4690  C  CA  . ASP B  1 151 ? 47.622  -6.480  -4.679  1.00   25.78 ? 258 ASP B CA  1 
ATOM   4691  C  C   . ASP B  1 151 ? 48.502  -6.573  -5.923  1.00   27.39 ? 258 ASP B C   1 
ATOM   4692  O  O   . ASP B  1 151 ? 49.592  -7.148  -5.865  1.00   26.19 ? 258 ASP B O   1 
ATOM   4693  C  CB  . ASP B  1 151 ? 48.321  -7.236  -3.542  1.00   26.04 ? 258 ASP B CB  1 
ATOM   4694  C  CG  . ASP B  1 151 ? 47.576  -7.166  -2.235  1.00   26.32 ? 258 ASP B CG  1 
ATOM   4695  O  OD1 . ASP B  1 151 ? 47.177  -6.052  -1.829  1.00   19.60 ? 258 ASP B OD1 1 
ATOM   4696  O  OD2 . ASP B  1 151 ? 47.414  -8.233  -1.601  1.00   25.52 ? 258 ASP B OD2 1 
ATOM   4697  N  N   . ASP B  1 152 ? 48.061  -6.012  -7.044  1.00   26.54 ? 259 ASP B N   1 
ATOM   4698  C  CA  . ASP B  1 152 ? 48.875  -6.110  -8.251  1.00   26.28 ? 259 ASP B CA  1 
ATOM   4699  C  C   . ASP B  1 152 ? 49.983  -5.067  -8.314  1.00   26.61 ? 259 ASP B C   1 
ATOM   4700  O  O   . ASP B  1 152 ? 50.813  -5.093  -9.220  1.00   26.72 ? 259 ASP B O   1 
ATOM   4701  C  CB  . ASP B  1 152 ? 48.002  -6.022  -9.513  1.00   26.23 ? 259 ASP B CB  1 
ATOM   4702  C  CG  . ASP B  1 152 ? 47.111  -4.789  -9.536  1.00   28.85 ? 259 ASP B CG  1 
ATOM   4703  O  OD1 . ASP B  1 152 ? 47.347  -3.839  -8.759  1.00   26.71 ? 259 ASP B OD1 1 
ATOM   4704  O  OD2 . ASP B  1 152 ? 46.171  -4.776  -10.359 1.00   33.39 ? 259 ASP B OD2 1 
ATOM   4705  N  N   . GLY B  1 153 ? 50.000  -4.149  -7.353  1.00   24.69 ? 260 GLY B N   1 
ATOM   4706  C  CA  . GLY B  1 153 ? 51.030  -3.135  -7.344  1.00   22.34 ? 260 GLY B CA  1 
ATOM   4707  C  C   . GLY B  1 153 ? 50.840  -2.080  -8.416  1.00   26.30 ? 260 GLY B C   1 
ATOM   4708  O  O   . GLY B  1 153 ? 51.772  -1.346  -8.742  1.00   25.78 ? 260 GLY B O   1 
ATOM   4709  N  N   . LYS B  1 154 ? 49.642  -1.984  -8.977  1.00   26.93 ? 261 LYS B N   1 
ATOM   4710  C  CA  . LYS B  1 154 ? 49.429  -0.978  -10.000 1.00   31.24 ? 261 LYS B CA  1 
ATOM   4711  C  C   . LYS B  1 154 ? 48.102  -0.271  -9.869  1.00   31.26 ? 261 LYS B C   1 
ATOM   4712  O  O   . LYS B  1 154 ? 47.830  0.694   -10.581 1.00   32.92 ? 261 LYS B O   1 
ATOM   4713  C  CB  . LYS B  1 154 ? 49.558  -1.588  -11.398 1.00   31.58 ? 261 LYS B CB  1 
ATOM   4714  C  CG  . LYS B  1 154 ? 48.695  -2.786  -11.665 1.00   34.20 ? 261 LYS B CG  1 
ATOM   4715  C  CD  . LYS B  1 154 ? 48.949  -3.281  -13.092 1.00   41.32 ? 261 LYS B CD  1 
ATOM   4716  C  CE  . LYS B  1 154 ? 48.200  -4.572  -13.402 1.00   44.26 ? 261 LYS B CE  1 
ATOM   4717  N  NZ  . LYS B  1 154 ? 48.410  -4.992  -14.810 0.0000 43.09 ? 261 LYS B NZ  1 
ATOM   4718  N  N   . THR B  1 155 ? 47.279  -0.728  -8.942  1.00   30.52 ? 262 THR B N   1 
ATOM   4719  C  CA  . THR B  1 155 ? 45.988  -0.104  -8.783  1.00   31.60 ? 262 THR B CA  1 
ATOM   4720  C  C   . THR B  1 155 ? 45.885  0.715   -7.511  1.00   29.60 ? 262 THR B C   1 
ATOM   4721  O  O   . THR B  1 155 ? 46.654  0.527   -6.566  1.00   28.67 ? 262 THR B O   1 
ATOM   4722  C  CB  . THR B  1 155 ? 44.867  -1.164  -8.821  1.00   32.88 ? 262 THR B CB  1 
ATOM   4723  O  OG1 . THR B  1 155 ? 45.117  -2.169  -7.831  1.00   37.90 ? 262 THR B OG1 1 
ATOM   4724  C  CG2 . THR B  1 155 ? 44.832  -1.838  -10.200 1.00   32.74 ? 262 THR B CG2 1 
ATOM   4725  N  N   . VAL B  1 156 ? 44.958  1.663   -7.526  1.00   25.83 ? 263 VAL B N   1 
ATOM   4726  C  CA  . VAL B  1 156 ? 44.685  2.501   -6.367  1.00   25.07 ? 263 VAL B CA  1 
ATOM   4727  C  C   . VAL B  1 156 ? 43.196  2.285   -6.196  1.00   23.69 ? 263 VAL B C   1 
ATOM   4728  O  O   . VAL B  1 156 ? 42.411  2.590   -7.092  1.00   22.81 ? 263 VAL B O   1 
ATOM   4729  C  CB  . VAL B  1 156 ? 44.979  3.984   -6.632  1.00   23.25 ? 263 VAL B CB  1 
ATOM   4730  C  CG1 . VAL B  1 156 ? 44.748  4.786   -5.360  1.00   22.35 ? 263 VAL B CG1 1 
ATOM   4731  C  CG2 . VAL B  1 156 ? 46.406  4.148   -7.087  1.00   21.66 ? 263 VAL B CG2 1 
ATOM   4732  N  N   . ASP B  1 157 ? 42.805  1.735   -5.053  1.00   24.51 ? 264 ASP B N   1 
ATOM   4733  C  CA  . ASP B  1 157 ? 41.400  1.428   -4.826  1.00   21.19 ? 264 ASP B CA  1 
ATOM   4734  C  C   . ASP B  1 157 ? 41.079  1.498   -3.345  1.00   22.36 ? 264 ASP B C   1 
ATOM   4735  O  O   . ASP B  1 157 ? 41.975  1.457   -2.495  1.00   21.19 ? 264 ASP B O   1 
ATOM   4736  C  CB  . ASP B  1 157 ? 41.111  0.027   -5.376  1.00   20.87 ? 264 ASP B CB  1 
ATOM   4737  C  CG  . ASP B  1 157 ? 39.635  -0.215  -5.644  1.00   24.19 ? 264 ASP B CG  1 
ATOM   4738  O  OD1 . ASP B  1 157 ? 38.807  0.713   -5.471  1.00   27.25 ? 264 ASP B OD1 1 
ATOM   4739  O  OD2 . ASP B  1 157 ? 39.305  -1.355  -6.036  1.00   26.75 ? 264 ASP B OD2 1 
ATOM   4740  N  N   . GLY B  1 158 ? 39.792  1.607   -3.039  1.00   22.54 ? 265 GLY B N   1 
ATOM   4741  C  CA  . GLY B  1 158 ? 39.363  1.703   -1.657  1.00   22.67 ? 265 GLY B CA  1 
ATOM   4742  C  C   . GLY B  1 158 ? 37.854  1.587   -1.570  1.00   22.92 ? 265 GLY B C   1 
ATOM   4743  O  O   . GLY B  1 158 ? 37.188  1.352   -2.579  1.00   22.92 ? 265 GLY B O   1 
ATOM   4744  N  N   . PRO B  1 159 ? 37.280  1.769   -0.377  1.00   21.85 ? 266 PRO B N   1 
ATOM   4745  C  CA  . PRO B  1 159 ? 35.830  1.666   -0.210  1.00   21.41 ? 266 PRO B CA  1 
ATOM   4746  C  C   . PRO B  1 159 ? 35.004  2.669   -1.004  1.00   21.09 ? 266 PRO B C   1 
ATOM   4747  O  O   . PRO B  1 159 ? 35.357  3.844   -1.091  1.00   19.65 ? 266 PRO B O   1 
ATOM   4748  C  CB  . PRO B  1 159 ? 35.643  1.848   1.295   1.00   21.93 ? 266 PRO B CB  1 
ATOM   4749  C  CG  . PRO B  1 159 ? 36.773  2.760   1.662   1.00   20.64 ? 266 PRO B CG  1 
ATOM   4750  C  CD  . PRO B  1 159 ? 37.932  2.186   0.878   1.00   20.85 ? 266 PRO B CD  1 
ATOM   4751  N  N   . ALA B  1 160 ? 33.908  2.196   -1.590  1.00   18.40 ? 267 ALA B N   1 
ATOM   4752  C  CA  . ALA B  1 160 ? 33.004  3.078   -2.311  1.00   18.71 ? 267 ALA B CA  1 
ATOM   4753  C  C   . ALA B  1 160 ? 32.122  3.750   -1.230  1.00   18.21 ? 267 ALA B C   1 
ATOM   4754  O  O   . ALA B  1 160 ? 32.295  3.484   -0.038  1.00   19.14 ? 267 ALA B O   1 
ATOM   4755  C  CB  . ALA B  1 160 ? 32.167  2.279   -3.302  1.00   19.80 ? 267 ALA B CB  1 
ATOM   4756  N  N   . ARG B  1 161 ? 31.168  4.586   -1.634  1.00   19.76 ? 268 ARG B N   1 
ATOM   4757  C  CA  . ARG B  1 161 ? 30.356  5.334   -0.675  1.00   20.61 ? 268 ARG B CA  1 
ATOM   4758  C  C   . ARG B  1 161 ? 29.659  4.630   0.469   1.00   20.83 ? 268 ARG B C   1 
ATOM   4759  O  O   . ARG B  1 161 ? 29.780  5.060   1.620   1.00   18.49 ? 268 ARG B O   1 
ATOM   4760  C  CB  . ARG B  1 161 ? 29.330  6.205   -1.399  1.00   24.59 ? 268 ARG B CB  1 
ATOM   4761  C  CG  . ARG B  1 161 ? 29.882  7.518   -1.938  1.00   32.76 ? 268 ARG B CG  1 
ATOM   4762  C  CD  . ARG B  1 161 ? 30.525  7.334   -3.311  1.00   39.33 ? 268 ARG B CD  1 
ATOM   4763  N  NE  . ARG B  1 161 ? 30.806  8.595   -3.990  0.0000 37.33 ? 268 ARG B NE  1 
ATOM   4764  C  CZ  . ARG B  1 161 ? 31.334  8.678   -5.207  0.0000 37.84 ? 268 ARG B CZ  1 
ATOM   4765  N  NH1 . ARG B  1 161 ? 31.639  7.574   -5.876  0.0000 37.66 ? 268 ARG B NH1 1 
ATOM   4766  N  NH2 . ARG B  1 161 ? 31.555  9.864   -5.758  0.0000 37.66 ? 268 ARG B NH2 1 
ATOM   4767  N  N   . LEU B  1 162 ? 28.916  3.568   0.181   1.00   19.78 ? 269 LEU B N   1 
ATOM   4768  C  CA  . LEU B  1 162 ? 28.218  2.884   1.250   1.00   20.50 ? 269 LEU B CA  1 
ATOM   4769  C  C   . LEU B  1 162 ? 29.186  2.332   2.277   1.00   21.37 ? 269 LEU B C   1 
ATOM   4770  O  O   . LEU B  1 162 ? 28.928  2.404   3.481   1.00   23.34 ? 269 LEU B O   1 
ATOM   4771  C  CB  . LEU B  1 162 ? 27.347  1.762   0.682   1.00   23.35 ? 269 LEU B CB  1 
ATOM   4772  C  CG  . LEU B  1 162 ? 26.255  2.287   -0.258  1.00   26.11 ? 269 LEU B CG  1 
ATOM   4773  C  CD1 . LEU B  1 162 ? 25.443  1.138   -0.804  1.00   25.84 ? 269 LEU B CD1 1 
ATOM   4774  C  CD2 . LEU B  1 162 ? 25.360  3.254   0.482   1.00   24.87 ? 269 LEU B CD2 1 
ATOM   4775  N  N   . ALA B  1 163 ? 30.305  1.787   1.809   1.00   21.50 ? 270 ALA B N   1 
ATOM   4776  C  CA  . ALA B  1 163 ? 31.290  1.216   2.722   1.00   21.40 ? 270 ALA B CA  1 
ATOM   4777  C  C   . ALA B  1 163 ? 31.890  2.329   3.576   1.00   22.49 ? 270 ALA B C   1 
ATOM   4778  O  O   . ALA B  1 163 ? 32.070  2.163   4.785   1.00   25.76 ? 270 ALA B O   1 
ATOM   4779  C  CB  . ALA B  1 163 ? 32.370  0.483   1.942   1.00   20.08 ? 270 ALA B CB  1 
ATOM   4780  N  N   . GLU B  1 164 ? 32.188  3.467   2.954   1.00   20.55 ? 271 GLU B N   1 
ATOM   4781  C  CA  . GLU B  1 164 ? 32.724  4.593   3.701   1.00   21.46 ? 271 GLU B CA  1 
ATOM   4782  C  C   . GLU B  1 164 ? 31.729  4.986   4.765   1.00   19.65 ? 271 GLU B C   1 
ATOM   4783  O  O   . GLU B  1 164 ? 32.094  5.197   5.920   1.00   21.72 ? 271 GLU B O   1 
ATOM   4784  C  CB  . GLU B  1 164 ? 32.956  5.810   2.811   1.00   22.88 ? 271 GLU B CB  1 
ATOM   4785  C  CG  . GLU B  1 164 ? 34.221  5.771   1.988   1.00   28.50 ? 271 GLU B CG  1 
ATOM   4786  C  CD  . GLU B  1 164 ? 34.491  7.094   1.304   1.00   32.54 ? 271 GLU B CD  1 
ATOM   4787  O  OE1 . GLU B  1 164 ? 35.609  7.632   1.495   1.00   35.30 ? 271 GLU B OE1 1 
ATOM   4788  O  OE2 . GLU B  1 164 ? 33.585  7.593   0.586   1.00   34.97 ? 271 GLU B OE2 1 
ATOM   4789  N  N   . GLU B  1 165 ? 30.467  5.090   4.372   1.00   17.73 ? 272 GLU B N   1 
ATOM   4790  C  CA  . GLU B  1 165 ? 29.428  5.468   5.321   1.00   20.59 ? 272 GLU B CA  1 
ATOM   4791  C  C   . GLU B  1 165 ? 29.342  4.454   6.448   1.00   19.38 ? 272 GLU B C   1 
ATOM   4792  O  O   . GLU B  1 165 ? 29.146  4.826   7.603   1.00   19.79 ? 272 GLU B O   1 
ATOM   4793  C  CB  . GLU B  1 165 ? 28.089  5.625   4.590   1.00   18.69 ? 272 GLU B CB  1 
ATOM   4794  C  CG  . GLU B  1 165 ? 28.122  6.870   3.697   1.00   18.66 ? 272 GLU B CG  1 
ATOM   4795  C  CD  . GLU B  1 165 ? 26.870  7.106   2.876   1.00   22.64 ? 272 GLU B CD  1 
ATOM   4796  O  OE1 . GLU B  1 165 ? 26.686  8.259   2.430   1.00   23.63 ? 272 GLU B OE1 1 
ATOM   4797  O  OE2 . GLU B  1 165 ? 26.080  6.158   2.658   1.00   24.41 ? 272 GLU B OE2 1 
ATOM   4798  N  N   . ALA B  1 166 ? 29.530  3.177   6.125   1.00   17.58 ? 273 ALA B N   1 
ATOM   4799  C  CA  . ALA B  1 166 ? 29.469  2.145   7.159   1.00   18.92 ? 273 ALA B CA  1 
ATOM   4800  C  C   . ALA B  1 166 ? 30.618  2.353   8.153   1.00   19.05 ? 273 ALA B C   1 
ATOM   4801  O  O   . ALA B  1 166 ? 30.443  2.228   9.368   1.00   18.00 ? 273 ALA B O   1 
ATOM   4802  C  CB  . ALA B  1 166 ? 29.547  0.742   6.524   1.00   18.76 ? 273 ALA B CB  1 
ATOM   4803  N  N   . PHE B  1 167 ? 31.798  2.673   7.635   1.00   19.72 ? 274 PHE B N   1 
ATOM   4804  C  CA  . PHE B  1 167 ? 32.946  2.901   8.509   1.00   19.66 ? 274 PHE B CA  1 
ATOM   4805  C  C   . PHE B  1 167 ? 32.649  4.071   9.437   1.00   18.22 ? 274 PHE B C   1 
ATOM   4806  O  O   . PHE B  1 167 ? 32.895  4.002   10.643  1.00   18.88 ? 274 PHE B O   1 
ATOM   4807  C  CB  . PHE B  1 167 ? 34.203  3.239   7.694   1.00   16.17 ? 274 PHE B CB  1 
ATOM   4808  C  CG  . PHE B  1 167 ? 34.960  2.037   7.204   1.00   17.54 ? 274 PHE B CG  1 
ATOM   4809  C  CD1 . PHE B  1 167 ? 35.338  1.031   8.081   1.00   16.11 ? 274 PHE B CD1 1 
ATOM   4810  C  CD2 . PHE B  1 167 ? 35.353  1.945   5.872   1.00   16.64 ? 274 PHE B CD2 1 
ATOM   4811  C  CE1 . PHE B  1 167 ? 36.104  -0.051  7.640   1.00   20.65 ? 274 PHE B CE1 1 
ATOM   4812  C  CE2 . PHE B  1 167 ? 36.115  0.877   5.423   1.00   19.36 ? 274 PHE B CE2 1 
ATOM   4813  C  CZ  . PHE B  1 167 ? 36.494  -0.125  6.309   1.00   19.44 ? 274 PHE B CZ  1 
ATOM   4814  N  N   . PHE B  1 168 ? 32.114  5.145   8.864   1.00   18.11 ? 275 PHE B N   1 
ATOM   4815  C  CA  . PHE B  1 168 ? 31.826  6.340   9.643   1.00   19.26 ? 275 PHE B CA  1 
ATOM   4816  C  C   . PHE B  1 168 ? 30.735  6.115   10.678  1.00   16.67 ? 275 PHE B C   1 
ATOM   4817  O  O   . PHE B  1 168 ? 30.867  6.546   11.817  1.00   18.36 ? 275 PHE B O   1 
ATOM   4818  C  CB  . PHE B  1 168 ? 31.454  7.519   8.736   1.00   22.10 ? 275 PHE B CB  1 
ATOM   4819  C  CG  . PHE B  1 168 ? 31.796  8.858   9.342   1.00   34.04 ? 275 PHE B CG  1 
ATOM   4820  C  CD1 . PHE B  1 168 ? 31.123  9.326   10.477  1.00   37.12 ? 275 PHE B CD1 1 
ATOM   4821  C  CD2 . PHE B  1 168 ? 32.847  9.619   8.829   1.00   36.20 ? 275 PHE B CD2 1 
ATOM   4822  C  CE1 . PHE B  1 168 ? 31.501  10.530  11.096  1.00   38.68 ? 275 PHE B CE1 1 
ATOM   4823  C  CE2 . PHE B  1 168 ? 33.231  10.822  9.438   1.00   38.46 ? 275 PHE B CE2 1 
ATOM   4824  C  CZ  . PHE B  1 168 ? 32.560  11.275  10.574  1.00   37.76 ? 275 PHE B CZ  1 
ATOM   4825  N  N   . ARG B  1 169 ? 29.653  5.449   10.294  1.00   15.29 ? 276 ARG B N   1 
ATOM   4826  C  CA  . ARG B  1 169 ? 28.591  5.169   11.250  1.00   15.53 ? 276 ARG B CA  1 
ATOM   4827  C  C   . ARG B  1 169 ? 29.207  4.282   12.329  1.00   17.94 ? 276 ARG B C   1 
ATOM   4828  O  O   . ARG B  1 169 ? 28.927  4.439   13.514  1.00   21.21 ? 276 ARG B O   1 
ATOM   4829  C  CB  . ARG B  1 169 ? 27.436  4.415   10.580  1.00   16.08 ? 276 ARG B CB  1 
ATOM   4830  C  CG  . ARG B  1 169 ? 26.732  5.169   9.447   1.00   19.49 ? 276 ARG B CG  1 
ATOM   4831  C  CD  . ARG B  1 169 ? 25.685  4.292   8.762   1.00   20.96 ? 276 ARG B CD  1 
ATOM   4832  N  NE  . ARG B  1 169 ? 24.568  4.009   9.652   1.00   21.48 ? 276 ARG B NE  1 
ATOM   4833  C  CZ  . ARG B  1 169 ? 23.521  4.811   9.818   1.00   21.49 ? 276 ARG B CZ  1 
ATOM   4834  N  NH1 . ARG B  1 169 ? 22.564  4.475   10.664  1.00   21.74 ? 276 ARG B NH1 1 
ATOM   4835  N  NH2 . ARG B  1 169 ? 23.412  5.930   9.113   1.00   23.80 ? 276 ARG B NH2 1 
ATOM   4836  N  N   . GLY B  1 170 ? 30.068  3.356   11.909  1.00   16.26 ? 277 GLY B N   1 
ATOM   4837  C  CA  . GLY B  1 170 ? 30.698  2.450   12.855  1.00   16.86 ? 277 GLY B CA  1 
ATOM   4838  C  C   . GLY B  1 170 ? 31.488  3.120   13.973  1.00   19.53 ? 277 GLY B C   1 
ATOM   4839  O  O   . GLY B  1 170 ? 31.216  2.898   15.157  1.00   19.54 ? 277 GLY B O   1 
ATOM   4840  N  N   . VAL B  1 171 ? 32.472  3.942   13.618  1.00   18.01 ? 278 VAL B N   1 
ATOM   4841  C  CA  . VAL B  1 171 ? 33.266  4.599   14.647  1.00   17.69 ? 278 VAL B CA  1 
ATOM   4842  C  C   . VAL B  1 171 ? 32.472  5.648   15.422  1.00   17.07 ? 278 VAL B C   1 
ATOM   4843  O  O   . VAL B  1 171 ? 32.831  5.972   16.549  1.00   19.10 ? 278 VAL B O   1 
ATOM   4844  C  CB  . VAL B  1 171 ? 34.524  5.275   14.039  1.00   17.65 ? 278 VAL B CB  1 
ATOM   4845  C  CG1 . VAL B  1 171 ? 35.362  4.230   13.283  1.00   12.70 ? 278 VAL B CG1 1 
ATOM   4846  C  CG2 . VAL B  1 171 ? 34.100  6.397   13.091  1.00   17.30 ? 278 VAL B CG2 1 
ATOM   4847  N  N   . SER B  1 172 ? 31.399  6.173   14.826  1.00   18.39 ? 279 SER B N   1 
ATOM   4848  C  CA  . SER B  1 172 ? 30.583  7.208   15.475  1.00   20.57 ? 279 SER B CA  1 
ATOM   4849  C  C   . SER B  1 172 ? 29.532  6.647   16.412  1.00   21.99 ? 279 SER B C   1 
ATOM   4850  O  O   . SER B  1 172 ? 29.399  7.091   17.549  1.00   20.93 ? 279 SER B O   1 
ATOM   4851  C  CB  . SER B  1 172 ? 29.845  8.056   14.440  1.00   18.16 ? 279 SER B CB  1 
ATOM   4852  O  OG  . SER B  1 172 ? 30.732  8.618   13.505  1.00   28.76 ? 279 SER B OG  1 
ATOM   4853  N  N   . GLN B  1 173 ? 28.788  5.666   15.918  1.00   24.32 ? 280 GLN B N   1 
ATOM   4854  C  CA  . GLN B  1 173 ? 27.689  5.080   16.668  1.00   26.79 ? 280 GLN B CA  1 
ATOM   4855  C  C   . GLN B  1 173 ? 27.877  3.657   17.184  1.00   28.65 ? 280 GLN B C   1 
ATOM   4856  O  O   . GLN B  1 173 ? 27.235  3.271   18.162  1.00   32.10 ? 280 GLN B O   1 
ATOM   4857  C  CB  . GLN B  1 173 ? 26.425  5.168   15.809  1.00   28.60 ? 280 GLN B CB  1 
ATOM   4858  C  CG  . GLN B  1 173 ? 25.978  6.604   15.547  1.00   35.91 ? 280 GLN B CG  1 
ATOM   4859  C  CD  . GLN B  1 173 ? 25.564  6.873   14.103  1.00   42.87 ? 280 GLN B CD  1 
ATOM   4860  O  OE1 . GLN B  1 173 ? 24.713  6.173   13.533  1.00   43.66 ? 280 GLN B OE1 1 
ATOM   4861  N  NE2 . GLN B  1 173 ? 26.161  7.907   13.507  1.00   45.56 ? 280 GLN B NE2 1 
ATOM   4862  N  N   . GLY B  1 174 ? 28.750  2.878   16.548  1.00   26.66 ? 281 GLY B N   1 
ATOM   4863  C  CA  . GLY B  1 174 ? 28.981  1.518   16.998  1.00   24.02 ? 281 GLY B CA  1 
ATOM   4864  C  C   . GLY B  1 174 ? 29.340  1.422   18.473  1.00   24.51 ? 281 GLY B C   1 
ATOM   4865  O  O   . GLY B  1 174 ? 29.803  2.390   19.075  1.00   25.48 ? 281 GLY B O   1 
ATOM   4866  N  N   . ARG B  1 175 ? 29.129  0.246   19.060  1.00   25.58 ? 282 ARG B N   1 
ATOM   4867  C  CA  . ARG B  1 175 ? 29.432  0.008   20.481  1.00   26.26 ? 282 ARG B CA  1 
ATOM   4868  C  C   . ARG B  1 175 ? 28.906  1.115   21.378  1.00   26.71 ? 282 ARG B C   1 
ATOM   4869  O  O   . ARG B  1 175 ? 29.644  1.659   22.199  1.00   30.91 ? 282 ARG B O   1 
ATOM   4870  C  CB  . ARG B  1 175 ? 30.943  -0.120  20.718  1.00   23.65 ? 282 ARG B CB  1 
ATOM   4871  C  CG  . ARG B  1 175 ? 31.578  -1.448  20.348  1.00   24.82 ? 282 ARG B CG  1 
ATOM   4872  C  CD  . ARG B  1 175 ? 33.101  -1.279  20.292  1.00   26.48 ? 282 ARG B CD  1 
ATOM   4873  N  NE  . ARG B  1 175 ? 33.618  -1.011  21.621  1.00   27.45 ? 282 ARG B NE  1 
ATOM   4874  C  CZ  . ARG B  1 175 ? 34.576  -0.143  21.924  1.00   26.82 ? 282 ARG B CZ  1 
ATOM   4875  N  NH1 . ARG B  1 175 ? 35.170  0.596   20.992  1.00   24.19 ? 282 ARG B NH1 1 
ATOM   4876  N  NH2 . ARG B  1 175 ? 34.942  -0.026  23.189  1.00   26.58 ? 282 ARG B NH2 1 
ATOM   4877  N  N   . GLY B  1 176 ? 27.631  1.453   21.223  1.00   28.48 ? 283 GLY B N   1 
ATOM   4878  C  CA  . GLY B  1 176 ? 27.054  2.499   22.046  1.00   26.04 ? 283 GLY B CA  1 
ATOM   4879  C  C   . GLY B  1 176 ? 27.766  3.842   21.979  1.00   26.49 ? 283 GLY B C   1 
ATOM   4880  O  O   . GLY B  1 176 ? 27.812  4.564   22.979  1.00   28.84 ? 283 GLY B O   1 
ATOM   4881  N  N   . GLY B  1 177 ? 28.326  4.191   20.820  1.00   22.79 ? 284 GLY B N   1 
ATOM   4882  C  CA  . GLY B  1 177 ? 28.994  5.479   20.707  1.00   19.38 ? 284 GLY B CA  1 
ATOM   4883  C  C   . GLY B  1 177 ? 30.499  5.442   20.905  1.00   21.93 ? 284 GLY B C   1 
ATOM   4884  O  O   . GLY B  1 177 ? 31.181  6.409   20.577  1.00   23.68 ? 284 GLY B O   1 
ATOM   4885  N  N   . LEU B  1 178 ? 31.021  4.340   21.441  1.00   21.62 ? 285 LEU B N   1 
ATOM   4886  C  CA  . LEU B  1 178 ? 32.462  4.200   21.652  1.00   22.43 ? 285 LEU B CA  1 
ATOM   4887  C  C   . LEU B  1 178 ? 33.170  3.940   20.315  1.00   23.10 ? 285 LEU B C   1 
ATOM   4888  O  O   . LEU B  1 178 ? 34.362  4.201   20.185  1.00   24.43 ? 285 LEU B O   1 
ATOM   4889  C  CB  . LEU B  1 178 ? 32.751  3.056   22.632  1.00   21.36 ? 285 LEU B CB  1 
ATOM   4890  C  CG  . LEU B  1 178 ? 32.049  3.186   23.991  1.00   23.03 ? 285 LEU B CG  1 
ATOM   4891  C  CD1 . LEU B  1 178 ? 32.399  2.004   24.875  1.00   22.19 ? 285 LEU B CD1 1 
ATOM   4892  C  CD2 . LEU B  1 178 ? 32.463  4.478   24.660  1.00   19.57 ? 285 LEU B CD2 1 
ATOM   4893  N  N   . GLY B  1 179 ? 32.427  3.419   19.337  1.00   23.53 ? 286 GLY B N   1 
ATOM   4894  C  CA  . GLY B  1 179 ? 32.971  3.163   18.009  1.00   20.83 ? 286 GLY B CA  1 
ATOM   4895  C  C   . GLY B  1 179 ? 33.421  1.739   17.717  1.00   22.39 ? 286 GLY B C   1 
ATOM   4896  O  O   . GLY B  1 179 ? 34.161  1.140   18.501  1.00   20.38 ? 286 GLY B O   1 
ATOM   4897  N  N   . SER B  1 180 ? 32.960  1.193   16.592  1.00   19.23 ? 287 SER B N   1 
ATOM   4898  C  CA  . SER B  1 180 ? 33.339  -0.154  16.166  1.00   18.33 ? 287 SER B CA  1 
ATOM   4899  C  C   . SER B  1 180 ? 34.850  -0.196  15.960  1.00   18.16 ? 287 SER B C   1 
ATOM   4900  O  O   . SER B  1 180 ? 35.446  0.790   15.518  1.00   17.13 ? 287 SER B O   1 
ATOM   4901  C  CB  . SER B  1 180 ? 32.678  -0.509  14.825  1.00   18.76 ? 287 SER B CB  1 
ATOM   4902  O  OG  . SER B  1 180 ? 31.267  -0.564  14.901  1.00   20.33 ? 287 SER B OG  1 
ATOM   4903  N  N   . ILE B  1 181 ? 35.470  -1.326  16.286  1.00   18.62 ? 288 ILE B N   1 
ATOM   4904  C  CA  . ILE B  1 181 ? 36.910  -1.480  16.077  1.00   20.56 ? 288 ILE B CA  1 
ATOM   4905  C  C   . ILE B  1 181 ? 37.081  -2.263  14.771  1.00   21.31 ? 288 ILE B C   1 
ATOM   4906  O  O   . ILE B  1 181 ? 36.634  -3.414  14.684  1.00   22.32 ? 288 ILE B O   1 
ATOM   4907  C  CB  . ILE B  1 181 ? 37.592  -2.311  17.194  1.00   20.01 ? 288 ILE B CB  1 
ATOM   4908  C  CG1 . ILE B  1 181 ? 37.286  -1.740  18.578  1.00   18.24 ? 288 ILE B CG1 1 
ATOM   4909  C  CG2 . ILE B  1 181 ? 39.080  -2.352  16.949  1.00   17.23 ? 288 ILE B CG2 1 
ATOM   4910  C  CD1 . ILE B  1 181 ? 37.768  -0.336  18.784  1.00   23.82 ? 288 ILE B CD1 1 
ATOM   4911  N  N   . PHE B  1 182 ? 37.713  -1.649  13.772  1.00   17.34 ? 289 PHE B N   1 
ATOM   4912  C  CA  . PHE B  1 182 ? 37.937  -2.302  12.482  1.00   19.41 ? 289 PHE B CA  1 
ATOM   4913  C  C   . PHE B  1 182 ? 39.410  -2.673  12.294  1.00   20.04 ? 289 PHE B C   1 
ATOM   4914  O  O   . PHE B  1 182 ? 40.258  -1.793  12.118  1.00   20.97 ? 289 PHE B O   1 
ATOM   4915  C  CB  . PHE B  1 182 ? 37.525  -1.378  11.327  1.00   17.46 ? 289 PHE B CB  1 
ATOM   4916  C  CG  . PHE B  1 182 ? 36.051  -1.037  11.292  1.00   20.08 ? 289 PHE B CG  1 
ATOM   4917  C  CD1 . PHE B  1 182 ? 35.116  -1.974  10.868  1.00   13.71 ? 289 PHE B CD1 1 
ATOM   4918  C  CD2 . PHE B  1 182 ? 35.610  0.251   11.631  1.00   18.51 ? 289 PHE B CD2 1 
ATOM   4919  C  CE1 . PHE B  1 182 ? 33.766  -1.645  10.773  1.00   16.84 ? 289 PHE B CE1 1 
ATOM   4920  C  CE2 . PHE B  1 182 ? 34.260  0.589   11.539  1.00   21.00 ? 289 PHE B CE2 1 
ATOM   4921  C  CZ  . PHE B  1 182 ? 33.330  -0.375  11.103  1.00   18.50 ? 289 PHE B CZ  1 
ATOM   4922  N  N   . VAL B  1 183 ? 39.707  -3.972  12.302  1.00   21.17 ? 290 VAL B N   1 
ATOM   4923  C  CA  . VAL B  1 183 ? 41.075  -4.465  12.125  1.00   20.07 ? 290 VAL B CA  1 
ATOM   4924  C  C   . VAL B  1 183 ? 41.284  -4.937  10.688  1.00   21.90 ? 290 VAL B C   1 
ATOM   4925  O  O   . VAL B  1 183 ? 40.506  -5.737  10.172  1.00   20.64 ? 290 VAL B O   1 
ATOM   4926  C  CB  . VAL B  1 183 ? 41.356  -5.616  13.087  1.00   19.36 ? 290 VAL B CB  1 
ATOM   4927  C  CG1 . VAL B  1 183 ? 42.818  -6.032  13.000  1.00   20.73 ? 290 VAL B CG1 1 
ATOM   4928  C  CG2 . VAL B  1 183 ? 41.009  -5.177  14.496  1.00   16.91 ? 290 VAL B CG2 1 
ATOM   4929  N  N   . TRP B  1 184 ? 42.343  -4.454  10.043  1.00   21.64 ? 291 TRP B N   1 
ATOM   4930  C  CA  . TRP B  1 184 ? 42.588  -4.808  8.648   1.00   19.89 ? 291 TRP B CA  1 
ATOM   4931  C  C   . TRP B  1 184 ? 43.972  -5.394  8.369   1.00   20.13 ? 291 TRP B C   1 
ATOM   4932  O  O   . TRP B  1 184 ? 44.953  -4.985  8.985   1.00   20.33 ? 291 TRP B O   1 
ATOM   4933  C  CB  . TRP B  1 184 ? 42.388  -3.556  7.785   1.00   18.90 ? 291 TRP B CB  1 
ATOM   4934  C  CG  . TRP B  1 184 ? 41.613  -3.808  6.545   1.00   17.69 ? 291 TRP B CG  1 
ATOM   4935  C  CD1 . TRP B  1 184 ? 42.096  -4.258  5.350   1.00   18.24 ? 291 TRP B CD1 1 
ATOM   4936  C  CD2 . TRP B  1 184 ? 40.197  -3.701  6.393   1.00   18.04 ? 291 TRP B CD2 1 
ATOM   4937  N  NE1 . TRP B  1 184 ? 41.063  -4.441  4.460   1.00   17.89 ? 291 TRP B NE1 1 
ATOM   4938  C  CE2 . TRP B  1 184 ? 39.885  -4.110  5.074   1.00   19.20 ? 291 TRP B CE2 1 
ATOM   4939  C  CE3 . TRP B  1 184 ? 39.155  -3.305  7.246   1.00   15.11 ? 291 TRP B CE3 1 
ATOM   4940  C  CZ2 . TRP B  1 184 ? 38.567  -4.138  4.582   1.00   19.17 ? 291 TRP B CZ2 1 
ATOM   4941  C  CZ3 . TRP B  1 184 ? 37.838  -3.334  6.758   1.00   13.88 ? 291 TRP B CZ3 1 
ATOM   4942  C  CH2 . TRP B  1 184 ? 37.561  -3.749  5.437   1.00   16.30 ? 291 TRP B CH2 1 
ATOM   4943  N  N   . ALA B  1 185 ? 44.034  -6.359  7.450   1.00   16.86 ? 292 ALA B N   1 
ATOM   4944  C  CA  . ALA B  1 185 ? 45.296  -6.977  7.031   1.00   15.43 ? 292 ALA B CA  1 
ATOM   4945  C  C   . ALA B  1 185 ? 45.917  -5.995  6.012   1.00   15.01 ? 292 ALA B C   1 
ATOM   4946  O  O   . ALA B  1 185 ? 45.250  -5.614  5.041   1.00   14.26 ? 292 ALA B O   1 
ATOM   4947  C  CB  . ALA B  1 185 ? 45.015  -8.318  6.372   1.00   13.13 ? 292 ALA B CB  1 
ATOM   4948  N  N   . SER B  1 186 ? 47.176  -5.597  6.205   1.00   12.57 ? 293 SER B N   1 
ATOM   4949  C  CA  . SER B  1 186 ? 47.769  -4.602  5.304   1.00   16.68 ? 293 SER B CA  1 
ATOM   4950  C  C   . SER B  1 186 ? 48.025  -4.999  3.855   1.00   17.43 ? 293 SER B C   1 
ATOM   4951  O  O   . SER B  1 186 ? 48.228  -4.126  3.017   1.00   21.83 ? 293 SER B O   1 
ATOM   4952  C  CB  . SER B  1 186 ? 49.053  -4.008  5.910   1.00   16.17 ? 293 SER B CB  1 
ATOM   4953  O  OG  . SER B  1 186 ? 50.087  -4.972  6.023   1.00   15.83 ? 293 SER B OG  1 
ATOM   4954  N  N   . GLY B  1 187 ? 48.022  -6.293  3.545   1.00   18.95 ? 294 GLY B N   1 
ATOM   4955  C  CA  . GLY B  1 187 ? 48.228  -6.707  2.164   1.00   20.80 ? 294 GLY B CA  1 
ATOM   4956  C  C   . GLY B  1 187 ? 49.303  -7.747  1.871   1.00   24.02 ? 294 GLY B C   1 
ATOM   4957  O  O   . GLY B  1 187 ? 50.245  -7.929  2.654   1.00   23.09 ? 294 GLY B O   1 
ATOM   4958  N  N   . ASN B  1 188 ? 49.173  -8.425  0.726   1.00   21.63 ? 295 ASN B N   1 
ATOM   4959  C  CA  . ASN B  1 188 ? 50.143  -9.440  0.312   1.00   20.80 ? 295 ASN B CA  1 
ATOM   4960  C  C   . ASN B  1 188 ? 50.901  -9.054  -0.957  1.00   22.82 ? 295 ASN B C   1 
ATOM   4961  O  O   . ASN B  1 188 ? 51.488  -9.917  -1.611  1.00   22.76 ? 295 ASN B O   1 
ATOM   4962  C  CB  . ASN B  1 188 ? 49.462  -10.792 0.058   1.00   20.20 ? 295 ASN B CB  1 
ATOM   4963  C  CG  . ASN B  1 188 ? 49.187  -11.580 1.345   1.00   22.37 ? 295 ASN B CG  1 
ATOM   4964  O  OD1 . ASN B  1 188 ? 49.871  -11.411 2.356   1.00   20.14 ? 295 ASN B OD1 1 
ATOM   4965  N  ND2 . ASN B  1 188 ? 48.188  -12.464 1.295   1.00   18.82 ? 295 ASN B ND2 1 
ATOM   4966  N  N   . GLY B  1 189 ? 50.916  -7.768  -1.301  1.00   21.85 ? 296 GLY B N   1 
ATOM   4967  C  CA  . GLY B  1 189 ? 51.588  -7.341  -2.521  1.00   16.51 ? 296 GLY B CA  1 
ATOM   4968  C  C   . GLY B  1 189 ? 53.081  -7.093  -2.491  1.00   17.42 ? 296 GLY B C   1 
ATOM   4969  O  O   . GLY B  1 189 ? 53.600  -6.437  -3.390  1.00   18.27 ? 296 GLY B O   1 
ATOM   4970  N  N   . GLY B  1 190 ? 53.779  -7.609  -1.483  1.00   17.12 ? 297 GLY B N   1 
ATOM   4971  C  CA  . GLY B  1 190 ? 55.212  -7.395  -1.388  1.00   19.36 ? 297 GLY B CA  1 
ATOM   4972  C  C   . GLY B  1 190 ? 56.004  -7.740  -2.638  1.00   22.53 ? 297 GLY B C   1 
ATOM   4973  O  O   . GLY B  1 190 ? 56.889  -6.988  -3.050  1.00   20.88 ? 297 GLY B O   1 
ATOM   4974  N  N   . ARG B  1 191 ? 55.696  -8.881  -3.247  1.00   24.49 ? 298 ARG B N   1 
ATOM   4975  C  CA  . ARG B  1 191 ? 56.402  -9.297  -4.450  1.00   27.48 ? 298 ARG B CA  1 
ATOM   4976  C  C   . ARG B  1 191 ? 56.163  -8.353  -5.635  1.00   26.59 ? 298 ARG B C   1 
ATOM   4977  O  O   . ARG B  1 191 ? 57.034  -8.192  -6.489  1.00   23.64 ? 298 ARG B O   1 
ATOM   4978  C  CB  . ARG B  1 191 ? 56.004  -10.718 -4.842  1.00   30.29 ? 298 ARG B CB  1 
ATOM   4979  C  CG  . ARG B  1 191 ? 56.979  -11.349 -5.814  1.00   35.83 ? 298 ARG B CG  1 
ATOM   4980  C  CD  . ARG B  1 191 ? 56.252  -12.089 -6.901  1.00   42.85 ? 298 ARG B CD  1 
ATOM   4981  N  NE  . ARG B  1 191 ? 55.500  -13.217 -6.370  1.00   50.37 ? 298 ARG B NE  1 
ATOM   4982  C  CZ  . ARG B  1 191 ? 54.662  -13.951 -7.093  1.00   54.89 ? 298 ARG B CZ  1 
ATOM   4983  N  NH1 . ARG B  1 191 ? 54.014  -14.971 -6.539  1.00   55.37 ? 298 ARG B NH1 1 
ATOM   4984  N  NH2 . ARG B  1 191 ? 54.466  -13.657 -8.373  1.00   56.59 ? 298 ARG B NH2 1 
ATOM   4985  N  N   . GLU B  1 192 ? 54.989  -7.733  -5.689  1.00   25.57 ? 299 GLU B N   1 
ATOM   4986  C  CA  . GLU B  1 192 ? 54.682  -6.805  -6.778  1.00   29.16 ? 299 GLU B CA  1 
ATOM   4987  C  C   . GLU B  1 192 ? 55.041  -5.369  -6.376  1.00   30.48 ? 299 GLU B C   1 
ATOM   4988  O  O   . GLU B  1 192 ? 54.684  -4.416  -7.068  1.00   28.14 ? 299 GLU B O   1 
ATOM   4989  C  CB  . GLU B  1 192 ? 53.191  -6.859  -7.150  1.00   32.75 ? 299 GLU B CB  1 
ATOM   4990  C  CG  . GLU B  1 192 ? 52.545  -8.251  -7.169  1.00   38.61 ? 299 GLU B CG  1 
ATOM   4991  C  CD  . GLU B  1 192 ? 53.488  -9.364  -7.604  1.00   45.24 ? 299 GLU B CD  1 
ATOM   4992  O  OE1 . GLU B  1 192 ? 54.212  -9.204  -8.615  1.00   45.68 ? 299 GLU B OE1 1 
ATOM   4993  O  OE2 . GLU B  1 192 ? 53.494  -10.415 -6.928  1.00   48.90 ? 299 GLU B OE2 1 
ATOM   4994  N  N   . HIS B  1 193 ? 55.750  -5.216  -5.258  1.00   29.30 ? 300 HIS B N   1 
ATOM   4995  C  CA  . HIS B  1 193 ? 56.135  -3.891  -4.781  1.00   29.13 ? 300 HIS B CA  1 
ATOM   4996  C  C   . HIS B  1 193 ? 54.928  -3.012  -4.485  1.00   26.91 ? 300 HIS B C   1 
ATOM   4997  O  O   . HIS B  1 193 ? 54.985  -1.798  -4.666  1.00   26.24 ? 300 HIS B O   1 
ATOM   4998  C  CB  . HIS B  1 193 ? 57.009  -3.180  -5.819  1.00   32.87 ? 300 HIS B CB  1 
ATOM   4999  C  CG  . HIS B  1 193 ? 58.326  -3.840  -6.044  1.00   38.65 ? 300 HIS B CG  1 
ATOM   5000  N  ND1 . HIS B  1 193 ? 58.469  -4.977  -6.810  1.00   41.56 ? 300 HIS B ND1 1 
ATOM   5001  C  CD2 . HIS B  1 193 ? 59.553  -3.568  -5.537  1.00   39.94 ? 300 HIS B CD2 1 
ATOM   5002  C  CE1 . HIS B  1 193 ? 59.725  -5.380  -6.762  1.00   40.69 ? 300 HIS B CE1 1 
ATOM   5003  N  NE2 . HIS B  1 193 ? 60.404  -4.543  -5.995  1.00   41.71 ? 300 HIS B NE2 1 
ATOM   5004  N  N   . ASP B  1 194 ? 53.838  -3.618  -4.034  1.00   23.38 ? 301 ASP B N   1 
ATOM   5005  C  CA  . ASP B  1 194 ? 52.632  -2.855  -3.753  1.00   23.62 ? 301 ASP B CA  1 
ATOM   5006  C  C   . ASP B  1 194 ? 52.818  -1.970  -2.516  1.00   24.31 ? 301 ASP B C   1 
ATOM   5007  O  O   . ASP B  1 194 ? 53.697  -2.216  -1.694  1.00   25.70 ? 301 ASP B O   1 
ATOM   5008  C  CB  . ASP B  1 194 ? 51.448  -3.807  -3.558  1.00   17.37 ? 301 ASP B CB  1 
ATOM   5009  C  CG  . ASP B  1 194 ? 50.110  -3.144  -3.837  1.00   18.79 ? 301 ASP B CG  1 
ATOM   5010  O  OD1 . ASP B  1 194 ? 50.088  -1.984  -4.311  1.00   17.53 ? 301 ASP B OD1 1 
ATOM   5011  O  OD2 . ASP B  1 194 ? 49.072  -3.792  -3.587  1.00   13.95 ? 301 ASP B OD2 1 
ATOM   5012  N  N   . SER B  1 195 ? 52.003  -0.927  -2.406  1.00   24.51 ? 302 SER B N   1 
ATOM   5013  C  CA  . SER B  1 195 ? 52.052  -0.006  -1.267  1.00   24.92 ? 302 SER B CA  1 
ATOM   5014  C  C   . SER B  1 195 ? 50.704  -0.013  -0.575  1.00   23.14 ? 302 SER B C   1 
ATOM   5015  O  O   . SER B  1 195 ? 49.669  0.183   -1.213  1.00   23.65 ? 302 SER B O   1 
ATOM   5016  C  CB  . SER B  1 195 ? 52.349  1.427   -1.717  1.00   27.80 ? 302 SER B CB  1 
ATOM   5017  O  OG  . SER B  1 195 ? 51.991  2.353   -0.690  1.00   28.32 ? 302 SER B OG  1 
ATOM   5018  N  N   . CYS B  1 196 ? 50.693  -0.220  0.733   1.00   20.11 ? 303 CYS B N   1 
ATOM   5019  C  CA  . CYS B  1 196 ? 49.409  -0.240  1.402   1.00   20.33 ? 303 CYS B CA  1 
ATOM   5020  C  C   . CYS B  1 196 ? 48.775  1.138   1.582   1.00   20.31 ? 303 CYS B C   1 
ATOM   5021  O  O   . CYS B  1 196 ? 47.712  1.258   2.192   1.00   22.30 ? 303 CYS B O   1 
ATOM   5022  C  CB  . CYS B  1 196 ? 49.478  -1.013  2.730   1.00   20.56 ? 303 CYS B CB  1 
ATOM   5023  S  SG  . CYS B  1 196 ? 50.974  -0.839  3.749   1.00   24.43 ? 303 CYS B SG  1 
ATOM   5024  N  N   . ASN B  1 197 ? 49.406  2.180   1.046   1.00   18.13 ? 304 ASN B N   1 
ATOM   5025  C  CA  . ASN B  1 197 ? 48.797  3.505   1.121   1.00   19.37 ? 304 ASN B CA  1 
ATOM   5026  C  C   . ASN B  1 197 ? 47.940  3.685   -0.130  1.00   19.99 ? 304 ASN B C   1 
ATOM   5027  O  O   . ASN B  1 197 ? 47.216  4.674   -0.255  1.00   19.38 ? 304 ASN B O   1 
ATOM   5028  C  CB  . ASN B  1 197 ? 49.849  4.620   1.210   1.00   20.83 ? 304 ASN B CB  1 
ATOM   5029  C  CG  . ASN B  1 197 ? 50.255  4.947   2.658   1.00   25.42 ? 304 ASN B CG  1 
ATOM   5030  O  OD1 . ASN B  1 197 ? 49.919  4.226   3.605   1.00   25.23 ? 304 ASN B OD1 1 
ATOM   5031  N  ND2 . ASN B  1 197 ? 50.987  6.039   2.825   1.00   26.04 ? 304 ASN B ND2 1 
ATOM   5032  N  N   . CYS B  1 198 ? 48.012  2.716   -1.046  1.00   18.78 ? 305 CYS B N   1 
ATOM   5033  C  CA  . CYS B  1 198 ? 47.223  2.767   -2.283  1.00   18.94 ? 305 CYS B CA  1 
ATOM   5034  C  C   . CYS B  1 198 ? 46.001  1.891   -2.119  1.00   18.49 ? 305 CYS B C   1 
ATOM   5035  O  O   . CYS B  1 198 ? 45.342  1.522   -3.084  1.00   19.83 ? 305 CYS B O   1 
ATOM   5036  C  CB  . CYS B  1 198 ? 48.042  2.280   -3.480  1.00   18.61 ? 305 CYS B CB  1 
ATOM   5037  S  SG  . CYS B  1 198 ? 49.314  3.459   -3.984  1.00   18.18 ? 305 CYS B SG  1 
ATOM   5038  N  N   . ASP B  1 199 ? 45.714  1.575   -0.865  1.00   20.41 ? 306 ASP B N   1 
ATOM   5039  C  CA  . ASP B  1 199 ? 44.592  0.735   -0.462  1.00   17.71 ? 306 ASP B CA  1 
ATOM   5040  C  C   . ASP B  1 199 ? 43.794  1.601   0.511   1.00   17.62 ? 306 ASP B C   1 
ATOM   5041  O  O   . ASP B  1 199 ? 44.263  1.896   1.611   1.00   18.37 ? 306 ASP B O   1 
ATOM   5042  C  CB  . ASP B  1 199 ? 45.158  -0.491  0.253   1.00   18.51 ? 306 ASP B CB  1 
ATOM   5043  C  CG  . ASP B  1 199 ? 44.093  -1.402  0.816   1.00   18.42 ? 306 ASP B CG  1 
ATOM   5044  O  OD1 . ASP B  1 199 ? 42.970  -0.943  1.152   1.00   16.83 ? 306 ASP B OD1 1 
ATOM   5045  O  OD2 . ASP B  1 199 ? 44.416  -2.598  0.941   1.00   14.28 ? 306 ASP B OD2 1 
ATOM   5046  N  N   . GLY B  1 200 ? 42.596  2.011   0.109   1.00   18.70 ? 307 GLY B N   1 
ATOM   5047  C  CA  . GLY B  1 200 ? 41.786  2.876   0.957   1.00   15.19 ? 307 GLY B CA  1 
ATOM   5048  C  C   . GLY B  1 200 ? 41.241  2.278   2.234   1.00   16.87 ? 307 GLY B C   1 
ATOM   5049  O  O   . GLY B  1 200 ? 40.779  3.021   3.102   1.00   17.03 ? 307 GLY B O   1 
ATOM   5050  N  N   . TYR B  1 201 ? 41.263  0.949   2.349   1.00   16.47 ? 308 TYR B N   1 
ATOM   5051  C  CA  . TYR B  1 201 ? 40.779  0.293   3.562   1.00   17.79 ? 308 TYR B CA  1 
ATOM   5052  C  C   . TYR B  1 201 ? 41.856  0.369   4.646   1.00   18.07 ? 308 TYR B C   1 
ATOM   5053  O  O   . TYR B  1 201 ? 41.589  0.747   5.788   1.00   17.95 ? 308 TYR B O   1 
ATOM   5054  C  CB  . TYR B  1 201 ? 40.415  -1.173  3.287   1.00   16.32 ? 308 TYR B CB  1 
ATOM   5055  C  CG  . TYR B  1 201 ? 39.323  -1.338  2.250   1.00   21.83 ? 308 TYR B CG  1 
ATOM   5056  C  CD1 . TYR B  1 201 ? 39.625  -1.381  0.881   1.00   20.69 ? 308 TYR B CD1 1 
ATOM   5057  C  CD2 . TYR B  1 201 ? 37.978  -1.380  2.624   1.00   20.47 ? 308 TYR B CD2 1 
ATOM   5058  C  CE1 . TYR B  1 201 ? 38.612  -1.458  -0.088  1.00   17.80 ? 308 TYR B CE1 1 
ATOM   5059  C  CE2 . TYR B  1 201 ? 36.958  -1.452  1.655   1.00   21.53 ? 308 TYR B CE2 1 
ATOM   5060  C  CZ  . TYR B  1 201 ? 37.290  -1.486  0.307   1.00   19.82 ? 308 TYR B CZ  1 
ATOM   5061  O  OH  . TYR B  1 201 ? 36.303  -1.496  -0.646  1.00   21.22 ? 308 TYR B OH  1 
ATOM   5062  N  N   . THR B  1 202 ? 43.082  0.023   4.277   1.00   17.55 ? 309 THR B N   1 
ATOM   5063  C  CA  . THR B  1 202 ? 44.192  0.061   5.221   1.00   18.23 ? 309 THR B CA  1 
ATOM   5064  C  C   . THR B  1 202 ? 44.596  1.493   5.541   1.00   16.96 ? 309 THR B C   1 
ATOM   5065  O  O   . THR B  1 202 ? 44.917  1.820   6.678   1.00   16.18 ? 309 THR B O   1 
ATOM   5066  C  CB  . THR B  1 202 ? 45.410  -0.681  4.648   1.00   17.73 ? 309 THR B CB  1 
ATOM   5067  O  OG1 . THR B  1 202 ? 45.679  -0.194  3.328   1.00   18.36 ? 309 THR B OG1 1 
ATOM   5068  C  CG2 . THR B  1 202 ? 45.130  -2.166  4.577   1.00   13.75 ? 309 THR B CG2 1 
ATOM   5069  N  N   . ASN B  1 203 ? 44.562  2.337   4.520   1.00   18.42 ? 310 ASN B N   1 
ATOM   5070  C  CA  . ASN B  1 203 ? 44.940  3.744   4.613   1.00   20.95 ? 310 ASN B CA  1 
ATOM   5071  C  C   . ASN B  1 203 ? 43.946  4.595   5.427   1.00   21.87 ? 310 ASN B C   1 
ATOM   5072  O  O   . ASN B  1 203 ? 44.259  5.714   5.834   1.00   20.70 ? 310 ASN B O   1 
ATOM   5073  C  CB  . ASN B  1 203 ? 45.075  4.298   3.189   1.00   23.43 ? 310 ASN B CB  1 
ATOM   5074  C  CG  . ASN B  1 203 ? 45.794  5.619   3.139   1.00   26.76 ? 310 ASN B CG  1 
ATOM   5075  O  OD1 . ASN B  1 203 ? 46.986  5.724   3.480   1.00   28.25 ? 310 ASN B OD1 1 
ATOM   5076  N  ND2 . ASN B  1 203 ? 45.079  6.650   2.709   1.00   27.14 ? 310 ASN B ND2 1 
ATOM   5077  N  N   . SER B  1 204 ? 42.752  4.064   5.669   1.00   20.33 ? 311 SER B N   1 
ATOM   5078  C  CA  . SER B  1 204 ? 41.745  4.783   6.450   1.00   18.00 ? 311 SER B CA  1 
ATOM   5079  C  C   . SER B  1 204 ? 42.143  4.956   7.929   1.00   16.17 ? 311 SER B C   1 
ATOM   5080  O  O   . SER B  1 204 ? 42.778  4.086   8.518   1.00   17.38 ? 311 SER B O   1 
ATOM   5081  C  CB  . SER B  1 204 ? 40.415  4.031   6.393   1.00   13.81 ? 311 SER B CB  1 
ATOM   5082  O  OG  . SER B  1 204 ? 39.514  4.576   7.344   1.00   19.47 ? 311 SER B OG  1 
ATOM   5083  N  N   . ILE B  1 205 ? 41.754  6.065   8.539   1.00   15.01 ? 312 ILE B N   1 
ATOM   5084  C  CA  . ILE B  1 205 ? 42.079  6.267   9.947   1.00   15.90 ? 312 ILE B CA  1 
ATOM   5085  C  C   . ILE B  1 205 ? 41.146  5.426   10.816  1.00   14.19 ? 312 ILE B C   1 
ATOM   5086  O  O   . ILE B  1 205 ? 41.439  5.178   11.978  1.00   17.73 ? 312 ILE B O   1 
ATOM   5087  C  CB  . ILE B  1 205 ? 41.939  7.755   10.382  1.00   12.87 ? 312 ILE B CB  1 
ATOM   5088  C  CG1 . ILE B  1 205 ? 40.469  8.170   10.340  1.00   10.70 ? 312 ILE B CG1 1 
ATOM   5089  C  CG2 . ILE B  1 205 ? 42.789  8.657   9.465   1.00   14.38 ? 312 ILE B CG2 1 
ATOM   5090  C  CD1 . ILE B  1 205 ? 40.216  9.548   10.969  1.00   14.23 ? 312 ILE B CD1 1 
ATOM   5091  N  N   . TYR B  1 206 ? 40.026  4.990   10.252  1.00   14.16 ? 313 TYR B N   1 
ATOM   5092  C  CA  . TYR B  1 206 ? 39.046  4.193   10.995  1.00   14.53 ? 313 TYR B CA  1 
ATOM   5093  C  C   . TYR B  1 206 ? 39.449  2.725   11.175  1.00   16.27 ? 313 TYR B C   1 
ATOM   5094  O  O   . TYR B  1 206 ? 38.799  1.982   11.924  1.00   17.22 ? 313 TYR B O   1 
ATOM   5095  C  CB  . TYR B  1 206 ? 37.683  4.232   10.298  1.00   15.63 ? 313 TYR B CB  1 
ATOM   5096  C  CG  . TYR B  1 206 ? 37.216  5.601   9.853   1.00   15.97 ? 313 TYR B CG  1 
ATOM   5097  C  CD1 . TYR B  1 206 ? 37.265  6.706   10.711  1.00   18.78 ? 313 TYR B CD1 1 
ATOM   5098  C  CD2 . TYR B  1 206 ? 36.693  5.780   8.576   1.00   18.46 ? 313 TYR B CD2 1 
ATOM   5099  C  CE1 . TYR B  1 206 ? 36.801  7.966   10.293  1.00   21.41 ? 313 TYR B CE1 1 
ATOM   5100  C  CE2 . TYR B  1 206 ? 36.227  7.013   8.146   1.00   19.75 ? 313 TYR B CE2 1 
ATOM   5101  C  CZ  . TYR B  1 206 ? 36.282  8.112   9.000   1.00   25.43 ? 313 TYR B CZ  1 
ATOM   5102  O  OH  . TYR B  1 206 ? 35.843  9.344   8.528   1.00   22.13 ? 313 TYR B OH  1 
ATOM   5103  N  N   . THR B  1 207 ? 40.500  2.293   10.479  1.00   15.59 ? 314 THR B N   1 
ATOM   5104  C  CA  . THR B  1 207 ? 40.946  0.907   10.594  1.00   14.74 ? 314 THR B CA  1 
ATOM   5105  C  C   . THR B  1 207 ? 42.347  0.819   11.189  1.00   15.06 ? 314 THR B C   1 
ATOM   5106  O  O   . THR B  1 207 ? 43.184  1.688   10.952  1.00   13.78 ? 314 THR B O   1 
ATOM   5107  C  CB  . THR B  1 207 ? 41.017  0.182   9.209   1.00   14.33 ? 314 THR B CB  1 
ATOM   5108  O  OG1 . THR B  1 207 ? 42.092  0.733   8.428   1.00   10.29 ? 314 THR B OG1 1 
ATOM   5109  C  CG2 . THR B  1 207 ? 39.721  0.328   8.433   1.00   9.35  ? 314 THR B CG2 1 
ATOM   5110  N  N   . LEU B  1 208 ? 42.592  -0.226  11.972  1.00   16.37 ? 315 LEU B N   1 
ATOM   5111  C  CA  . LEU B  1 208 ? 43.923  -0.458  12.517  1.00   19.66 ? 315 LEU B CA  1 
ATOM   5112  C  C   . LEU B  1 208 ? 44.550  -1.406  11.505  1.00   19.97 ? 315 LEU B C   1 
ATOM   5113  O  O   . LEU B  1 208 ? 44.217  -2.594  11.491  1.00   21.17 ? 315 LEU B O   1 
ATOM   5114  C  CB  . LEU B  1 208 ? 43.863  -1.149  13.883  1.00   19.13 ? 315 LEU B CB  1 
ATOM   5115  C  CG  . LEU B  1 208 ? 43.120  -0.389  14.986  1.00   20.32 ? 315 LEU B CG  1 
ATOM   5116  C  CD1 . LEU B  1 208 ? 41.663  -0.821  15.007  1.00   21.15 ? 315 LEU B CD1 1 
ATOM   5117  C  CD2 . LEU B  1 208 ? 43.767  -0.682  16.334  1.00   18.01 ? 315 LEU B CD2 1 
ATOM   5118  N  N   . SER B  1 209 ? 45.421  -0.889  10.642  1.00   18.09 ? 316 SER B N   1 
ATOM   5119  C  CA  . SER B  1 209 ? 46.046  -1.734  9.637   1.00   17.18 ? 316 SER B CA  1 
ATOM   5120  C  C   . SER B  1 209 ? 47.213  -2.486  10.279  1.00   17.12 ? 316 SER B C   1 
ATOM   5121  O  O   . SER B  1 209 ? 48.083  -1.880  10.908  1.00   15.29 ? 316 SER B O   1 
ATOM   5122  C  CB  . SER B  1 209 ? 46.524  -0.888  8.460   1.00   15.42 ? 316 SER B CB  1 
ATOM   5123  O  OG  . SER B  1 209 ? 47.074  -1.738  7.470   1.00   18.35 ? 316 SER B OG  1 
ATOM   5124  N  N   . ILE B  1 210 ? 47.236  -3.800  10.088  1.00   17.20 ? 317 ILE B N   1 
ATOM   5125  C  CA  . ILE B  1 210 ? 48.248  -4.672  10.691  1.00   18.63 ? 317 ILE B CA  1 
ATOM   5126  C  C   . ILE B  1 210 ? 49.167  -5.390  9.695   1.00   20.84 ? 317 ILE B C   1 
ATOM   5127  O  O   . ILE B  1 210 ? 48.686  -6.053  8.775   1.00   18.50 ? 317 ILE B O   1 
ATOM   5128  C  CB  . ILE B  1 210 ? 47.540  -5.757  11.547  1.00   19.38 ? 317 ILE B CB  1 
ATOM   5129  C  CG1 . ILE B  1 210 ? 46.606  -5.085  12.547  1.00   16.37 ? 317 ILE B CG1 1 
ATOM   5130  C  CG2 . ILE B  1 210 ? 48.549  -6.628  12.273  1.00   19.41 ? 317 ILE B CG2 1 
ATOM   5131  C  CD1 . ILE B  1 210 ? 47.325  -4.172  13.469  1.00   15.56 ? 317 ILE B CD1 1 
ATOM   5132  N  N   . SER B  1 211 ? 50.482  -5.267  9.886   1.00   20.02 ? 318 SER B N   1 
ATOM   5133  C  CA  . SER B  1 211 ? 51.444  -5.948  9.016   1.00   18.66 ? 318 SER B CA  1 
ATOM   5134  C  C   . SER B  1 211 ? 51.963  -7.248  9.646   1.00   20.43 ? 318 SER B C   1 
ATOM   5135  O  O   . SER B  1 211 ? 51.561  -7.618  10.757  1.00   19.79 ? 318 SER B O   1 
ATOM   5136  C  CB  . SER B  1 211 ? 52.620  -5.036  8.681   1.00   16.32 ? 318 SER B CB  1 
ATOM   5137  O  OG  . SER B  1 211 ? 52.237  -4.043  7.751   1.00   18.19 ? 318 SER B OG  1 
ATOM   5138  N  N   . SER B  1 212 ? 52.862  -7.928  8.938   1.00   19.17 ? 319 SER B N   1 
ATOM   5139  C  CA  . SER B  1 212 ? 53.406  -9.206  9.395   1.00   18.74 ? 319 SER B CA  1 
ATOM   5140  C  C   . SER B  1 212 ? 54.914  -9.241  9.637   1.00   20.32 ? 319 SER B C   1 
ATOM   5141  O  O   . SER B  1 212 ? 55.681  -8.433  9.092   1.00   18.41 ? 319 SER B O   1 
ATOM   5142  C  CB  . SER B  1 212 ? 53.072  -10.294 8.378   1.00   15.35 ? 319 SER B CB  1 
ATOM   5143  O  OG  . SER B  1 212 ? 51.686  -10.339 8.115   1.00   17.81 ? 319 SER B OG  1 
ATOM   5144  N  N   . ALA B  1 213 ? 55.320  -10.198 10.464  1.00   18.22 ? 320 ALA B N   1 
ATOM   5145  C  CA  . ALA B  1 213 ? 56.728  -10.420 10.778  1.00   20.97 ? 320 ALA B CA  1 
ATOM   5146  C  C   . ALA B  1 213 ? 56.941  -11.938 10.774  1.00   20.96 ? 320 ALA B C   1 
ATOM   5147  O  O   . ALA B  1 213 ? 56.080  -12.682 11.250  1.00   21.63 ? 320 ALA B O   1 
ATOM   5148  C  CB  . ALA B  1 213 ? 57.064  -9.848  12.143  1.00   17.97 ? 320 ALA B CB  1 
ATOM   5149  N  N   . THR B  1 214 ? 58.059  -12.398 10.221  1.00   19.77 ? 321 THR B N   1 
ATOM   5150  C  CA  . THR B  1 214 ? 58.334  -13.836 10.185  1.00   19.91 ? 321 THR B CA  1 
ATOM   5151  C  C   . THR B  1 214 ? 58.842  -14.267 11.565  1.00   22.40 ? 321 THR B C   1 
ATOM   5152  O  O   . THR B  1 214 ? 59.204  -13.426 12.398  1.00   20.56 ? 321 THR B O   1 
ATOM   5153  C  CB  . THR B  1 214 ? 59.419  -14.194 9.152   1.00   15.49 ? 321 THR B CB  1 
ATOM   5154  O  OG1 . THR B  1 214 ? 60.673  -13.687 9.613   1.00   13.50 ? 321 THR B OG1 1 
ATOM   5155  C  CG2 . THR B  1 214 ? 59.089  -13.583 7.775   1.00   16.48 ? 321 THR B CG2 1 
ATOM   5156  N  N   . GLN B  1 215 ? 58.886  -15.576 11.793  1.00   21.39 ? 322 GLN B N   1 
ATOM   5157  C  CA  . GLN B  1 215 ? 59.328  -16.091 13.073  1.00   22.03 ? 322 GLN B CA  1 
ATOM   5158  C  C   . GLN B  1 215 ? 60.702  -15.592 13.497  1.00   21.63 ? 322 GLN B C   1 
ATOM   5159  O  O   . GLN B  1 215 ? 60.916  -15.334 14.678  1.00   21.56 ? 322 GLN B O   1 
ATOM   5160  C  CB  . GLN B  1 215 ? 59.314  -17.620 13.075  1.00   24.49 ? 322 GLN B CB  1 
ATOM   5161  C  CG  . GLN B  1 215 ? 60.061  -18.210 14.259  1.00   24.42 ? 322 GLN B CG  1 
ATOM   5162  C  CD  . GLN B  1 215 ? 59.835  -19.705 14.431  1.00   26.15 ? 322 GLN B CD  1 
ATOM   5163  O  OE1 . GLN B  1 215 ? 59.818  -20.460 13.463  1.00   24.29 ? 322 GLN B OE1 1 
ATOM   5164  N  NE2 . GLN B  1 215 ? 59.675  -20.136 15.676  1.00   27.24 ? 322 GLN B NE2 1 
ATOM   5165  N  N   . PHE B  1 216 ? 61.629  -15.451 12.554  1.00   19.79 ? 323 PHE B N   1 
ATOM   5166  C  CA  . PHE B  1 216 ? 62.966  -14.979 12.902  1.00   20.07 ? 323 PHE B CA  1 
ATOM   5167  C  C   . PHE B  1 216 ? 63.055  -13.447 12.974  1.00   19.65 ? 323 PHE B C   1 
ATOM   5168  O  O   . PHE B  1 216 ? 64.147  -12.891 13.101  1.00   22.15 ? 323 PHE B O   1 
ATOM   5169  C  CB  . PHE B  1 216 ? 64.009  -15.518 11.908  1.00   22.84 ? 323 PHE B CB  1 
ATOM   5170  C  CG  . PHE B  1 216 ? 64.051  -17.026 11.818  1.00   24.32 ? 323 PHE B CG  1 
ATOM   5171  C  CD1 . PHE B  1 216 ? 63.565  -17.823 12.857  1.00   23.24 ? 323 PHE B CD1 1 
ATOM   5172  C  CD2 . PHE B  1 216 ? 64.603  -17.650 10.698  1.00   25.42 ? 323 PHE B CD2 1 
ATOM   5173  C  CE1 . PHE B  1 216 ? 63.630  -19.219 12.777  1.00   24.83 ? 323 PHE B CE1 1 
ATOM   5174  C  CE2 . PHE B  1 216 ? 64.674  -19.048 10.606  1.00   25.49 ? 323 PHE B CE2 1 
ATOM   5175  C  CZ  . PHE B  1 216 ? 64.187  -19.832 11.648  1.00   28.33 ? 323 PHE B CZ  1 
ATOM   5176  N  N   . GLY B  1 217 ? 61.908  -12.779 12.883  1.00   18.53 ? 324 GLY B N   1 
ATOM   5177  C  CA  . GLY B  1 217 ? 61.876  -11.333 12.982  1.00   18.61 ? 324 GLY B CA  1 
ATOM   5178  C  C   . GLY B  1 217 ? 62.186  -10.548 11.723  1.00   19.44 ? 324 GLY B C   1 
ATOM   5179  O  O   . GLY B  1 217 ? 62.746  -9.448  11.792  1.00   20.26 ? 324 GLY B O   1 
ATOM   5180  N  N   . ASN B  1 218 ? 61.821  -11.092 10.573  1.00   18.80 ? 325 ASN B N   1 
ATOM   5181  C  CA  . ASN B  1 218 ? 62.092  -10.393 9.331   1.00   21.03 ? 325 ASN B CA  1 
ATOM   5182  C  C   . ASN B  1 218 ? 60.827  -9.964  8.606   1.00   19.59 ? 325 ASN B C   1 
ATOM   5183  O  O   . ASN B  1 218 ? 59.722  -10.417 8.922   1.00   20.52 ? 325 ASN B O   1 
ATOM   5184  C  CB  . ASN B  1 218 ? 62.944  -11.277 8.428   1.00   22.47 ? 325 ASN B CB  1 
ATOM   5185  C  CG  . ASN B  1 218 ? 64.343  -11.467 8.974   1.00   24.58 ? 325 ASN B CG  1 
ATOM   5186  O  OD1 . ASN B  1 218 ? 65.088  -10.503 9.164   1.00   26.07 ? 325 ASN B OD1 1 
ATOM   5187  N  ND2 . ASN B  1 218 ? 64.703  -12.712 9.241   1.00   24.04 ? 325 ASN B ND2 1 
ATOM   5188  N  N   . VAL B  1 219 ? 60.999  -9.075  7.640   1.00   15.56 ? 326 VAL B N   1 
ATOM   5189  C  CA  . VAL B  1 219 ? 59.894  -8.608  6.826   1.00   16.28 ? 326 VAL B CA  1 
ATOM   5190  C  C   . VAL B  1 219 ? 59.604  -9.696  5.794   1.00   16.90 ? 326 VAL B C   1 
ATOM   5191  O  O   . VAL B  1 219 ? 60.440  -9.989  4.950   1.00   18.30 ? 326 VAL B O   1 
ATOM   5192  C  CB  . VAL B  1 219 ? 60.281  -7.303  6.101   1.00   18.73 ? 326 VAL B CB  1 
ATOM   5193  C  CG1 . VAL B  1 219 ? 59.104  -6.781  5.273   1.00   14.56 ? 326 VAL B CG1 1 
ATOM   5194  C  CG2 . VAL B  1 219 ? 60.743  -6.268  7.144   1.00   11.51 ? 326 VAL B CG2 1 
ATOM   5195  N  N   . PRO B  1 220 ? 58.413  -10.309 5.855   1.00   18.18 ? 327 PRO B N   1 
ATOM   5196  C  CA  . PRO B  1 220 ? 58.024  -11.373 4.917   1.00   17.99 ? 327 PRO B CA  1 
ATOM   5197  C  C   . PRO B  1 220 ? 58.049  -10.912 3.462   1.00   18.69 ? 327 PRO B C   1 
ATOM   5198  O  O   . PRO B  1 220 ? 57.874  -9.726  3.167   1.00   19.33 ? 327 PRO B O   1 
ATOM   5199  C  CB  . PRO B  1 220 ? 56.607  -11.741 5.366   1.00   17.68 ? 327 PRO B CB  1 
ATOM   5200  C  CG  . PRO B  1 220 ? 56.578  -11.342 6.827   1.00   19.99 ? 327 PRO B CG  1 
ATOM   5201  C  CD  . PRO B  1 220 ? 57.313  -10.011 6.786   1.00   18.86 ? 327 PRO B CD  1 
ATOM   5202  N  N   . TRP B  1 221 ? 58.245  -11.858 2.553   1.00   18.17 ? 328 TRP B N   1 
ATOM   5203  C  CA  . TRP B  1 221 ? 58.291  -11.539 1.136   1.00   17.38 ? 328 TRP B CA  1 
ATOM   5204  C  C   . TRP B  1 221 ? 56.992  -10.887 0.641   1.00   18.11 ? 328 TRP B C   1 
ATOM   5205  O  O   . TRP B  1 221 ? 57.010  -10.076 -0.279  1.00   18.45 ? 328 TRP B O   1 
ATOM   5206  C  CB  . TRP B  1 221 ? 58.569  -12.810 0.327   1.00   16.69 ? 328 TRP B CB  1 
ATOM   5207  C  CG  . TRP B  1 221 ? 57.468  -13.827 0.400   1.00   17.81 ? 328 TRP B CG  1 
ATOM   5208  C  CD1 . TRP B  1 221 ? 57.309  -14.816 1.339   1.00   19.16 ? 328 TRP B CD1 1 
ATOM   5209  C  CD2 . TRP B  1 221 ? 56.345  -13.921 -0.477  1.00   17.22 ? 328 TRP B CD2 1 
ATOM   5210  N  NE1 . TRP B  1 221 ? 56.146  -15.516 1.092   1.00   21.61 ? 328 TRP B NE1 1 
ATOM   5211  C  CE2 . TRP B  1 221 ? 55.536  -14.984 -0.015  1.00   18.23 ? 328 TRP B CE2 1 
ATOM   5212  C  CE3 . TRP B  1 221 ? 55.939  -13.201 -1.612  1.00   21.51 ? 328 TRP B CE3 1 
ATOM   5213  C  CZ2 . TRP B  1 221 ? 54.343  -15.350 -0.648  1.00   20.17 ? 328 TRP B CZ2 1 
ATOM   5214  C  CZ3 . TRP B  1 221 ? 54.750  -13.560 -2.242  1.00   22.17 ? 328 TRP B CZ3 1 
ATOM   5215  C  CH2 . TRP B  1 221 ? 53.963  -14.631 -1.753  1.00   23.71 ? 328 TRP B CH2 1 
ATOM   5216  N  N   . TYR B  1 222 ? 55.865  -11.228 1.255   1.00   16.89 ? 329 TYR B N   1 
ATOM   5217  C  CA  . TYR B  1 222 ? 54.577  -10.678 0.821   1.00   18.70 ? 329 TYR B CA  1 
ATOM   5218  C  C   . TYR B  1 222 ? 54.221  -9.316  1.428   1.00   19.22 ? 329 TYR B C   1 
ATOM   5219  O  O   . TYR B  1 222 ? 53.255  -8.677  1.023   1.00   21.45 ? 329 TYR B O   1 
ATOM   5220  C  CB  . TYR B  1 222 ? 53.462  -11.683 1.137   1.00   13.16 ? 329 TYR B CB  1 
ATOM   5221  C  CG  . TYR B  1 222 ? 53.458  -12.126 2.579   1.00   15.98 ? 329 TYR B CG  1 
ATOM   5222  C  CD1 . TYR B  1 222 ? 52.859  -11.343 3.574   1.00   13.20 ? 329 TYR B CD1 1 
ATOM   5223  C  CD2 . TYR B  1 222 ? 54.101  -13.309 2.962   1.00   14.94 ? 329 TYR B CD2 1 
ATOM   5224  C  CE1 . TYR B  1 222 ? 52.908  -11.728 4.915   1.00   14.46 ? 329 TYR B CE1 1 
ATOM   5225  C  CE2 . TYR B  1 222 ? 54.157  -13.701 4.292   1.00   17.20 ? 329 TYR B CE2 1 
ATOM   5226  C  CZ  . TYR B  1 222 ? 53.562  -12.905 5.264   1.00   17.57 ? 329 TYR B CZ  1 
ATOM   5227  O  OH  . TYR B  1 222 ? 53.649  -13.283 6.576   1.00   14.85 ? 329 TYR B OH  1 
ATOM   5228  N  N   . SER B  1 223 ? 55.014  -8.869  2.385   1.00   18.80 ? 330 SER B N   1 
ATOM   5229  C  CA  . SER B  1 223 ? 54.753  -7.612  3.073   1.00   19.04 ? 330 SER B CA  1 
ATOM   5230  C  C   . SER B  1 223 ? 54.738  -6.337  2.220   1.00   18.77 ? 330 SER B C   1 
ATOM   5231  O  O   . SER B  1 223 ? 55.575  -6.145  1.339   1.00   14.63 ? 330 SER B O   1 
ATOM   5232  C  CB  . SER B  1 223 ? 55.771  -7.449  4.208   1.00   18.56 ? 330 SER B CB  1 
ATOM   5233  O  OG  . SER B  1 223 ? 55.674  -6.182  4.827   1.00   22.35 ? 330 SER B OG  1 
ATOM   5234  N  N   . GLU B  1 224 ? 53.788  -5.454  2.512   1.00   18.45 ? 331 GLU B N   1 
ATOM   5235  C  CA  . GLU B  1 224 ? 53.694  -4.167  1.819   1.00   19.51 ? 331 GLU B CA  1 
ATOM   5236  C  C   . GLU B  1 224 ? 54.069  -3.110  2.832   1.00   18.70 ? 331 GLU B C   1 
ATOM   5237  O  O   . GLU B  1 224 ? 53.587  -3.135  3.964   1.00   19.15 ? 331 GLU B O   1 
ATOM   5238  C  CB  . GLU B  1 224 ? 52.269  -3.868  1.326   1.00   15.83 ? 331 GLU B CB  1 
ATOM   5239  C  CG  . GLU B  1 224 ? 51.647  -4.964  0.452   1.00   19.28 ? 331 GLU B CG  1 
ATOM   5240  C  CD  . GLU B  1 224 ? 50.363  -4.523  -0.243  1.00   19.05 ? 331 GLU B CD  1 
ATOM   5241  O  OE1 . GLU B  1 224 ? 49.579  -5.414  -0.643  1.00   16.33 ? 331 GLU B OE1 1 
ATOM   5242  O  OE2 . GLU B  1 224 ? 50.139  -3.295  -0.399  1.00   16.36 ? 331 GLU B OE2 1 
ATOM   5243  N  N   . ALA B  1 225 ? 54.923  -2.182  2.427   1.00   17.43 ? 332 ALA B N   1 
ATOM   5244  C  CA  . ALA B  1 225 ? 55.339  -1.102  3.299   1.00   18.55 ? 332 ALA B CA  1 
ATOM   5245  C  C   . ALA B  1 225 ? 54.532  0.162   2.972   1.00   21.32 ? 332 ALA B C   1 
ATOM   5246  O  O   . ALA B  1 225 ? 54.169  0.400   1.816   1.00   18.36 ? 332 ALA B O   1 
ATOM   5247  C  CB  . ALA B  1 225 ? 56.835  -0.832  3.115   1.00   16.39 ? 332 ALA B CB  1 
ATOM   5248  N  N   . CYS B  1 226 ? 54.237  0.953   4.002   1.00   21.74 ? 333 CYS B N   1 
ATOM   5249  C  CA  . CYS B  1 226 ? 53.513  2.215   3.849   1.00   20.90 ? 333 CYS B CA  1 
ATOM   5250  C  C   . CYS B  1 226 ? 53.424  2.874   5.224   1.00   21.46 ? 333 CYS B C   1 
ATOM   5251  O  O   . CYS B  1 226 ? 53.603  2.212   6.254   1.00   20.34 ? 333 CYS B O   1 
ATOM   5252  C  CB  . CYS B  1 226 ? 52.107  2.002   3.244   1.00   19.19 ? 333 CYS B CB  1 
ATOM   5253  S  SG  . CYS B  1 226 ? 50.921  1.128   4.319   1.00   23.94 ? 333 CYS B SG  1 
ATOM   5254  N  N   . SER B  1 227 ? 53.160  4.177   5.236   1.00   18.23 ? 334 SER B N   1 
ATOM   5255  C  CA  . SER B  1 227 ? 53.075  4.933   6.473   1.00   19.08 ? 334 SER B CA  1 
ATOM   5256  C  C   . SER B  1 227 ? 51.765  4.779   7.225   1.00   20.64 ? 334 SER B C   1 
ATOM   5257  O  O   . SER B  1 227 ? 51.671  5.209   8.374   1.00   21.61 ? 334 SER B O   1 
ATOM   5258  C  CB  . SER B  1 227 ? 53.302  6.425   6.197   1.00   18.76 ? 334 SER B CB  1 
ATOM   5259  O  OG  . SER B  1 227 ? 52.267  6.949   5.380   1.00   17.24 ? 334 SER B OG  1 
ATOM   5260  N  N   . SER B  1 228 ? 50.753  4.183   6.595   1.00   21.65 ? 335 SER B N   1 
ATOM   5261  C  CA  . SER B  1 228 ? 49.452  4.041   7.260   1.00   23.55 ? 335 SER B CA  1 
ATOM   5262  C  C   . SER B  1 228 ? 49.364  2.845   8.221   1.00   23.34 ? 335 SER B C   1 
ATOM   5263  O  O   . SER B  1 228 ? 48.469  2.791   9.080   1.00   22.06 ? 335 SER B O   1 
ATOM   5264  C  CB  . SER B  1 228 ? 48.317  3.959   6.227   1.00   20.51 ? 335 SER B CB  1 
ATOM   5265  O  OG  . SER B  1 228 ? 48.421  2.794   5.431   1.00   21.73 ? 335 SER B OG  1 
ATOM   5266  N  N   . THR B  1 229 ? 50.277  1.887   8.070   1.00   19.94 ? 336 THR B N   1 
ATOM   5267  C  CA  . THR B  1 229 ? 50.289  0.720   8.949   1.00   19.17 ? 336 THR B CA  1 
ATOM   5268  C  C   . THR B  1 229 ? 50.507  1.174   10.394  1.00   19.62 ? 336 THR B C   1 
ATOM   5269  O  O   . THR B  1 229 ? 51.312  2.070   10.659  1.00   18.41 ? 336 THR B O   1 
ATOM   5270  C  CB  . THR B  1 229 ? 51.404  -0.262  8.546   1.00   17.28 ? 336 THR B CB  1 
ATOM   5271  O  OG1 . THR B  1 229 ? 51.105  -0.817  7.262   1.00   16.43 ? 336 THR B OG1 1 
ATOM   5272  C  CG2 . THR B  1 229 ? 51.526  -1.384  9.558   1.00   14.79 ? 336 THR B CG2 1 
ATOM   5273  N  N   . LEU B  1 230 ? 49.796  0.545   11.321  1.00   19.57 ? 337 LEU B N   1 
ATOM   5274  C  CA  . LEU B  1 230 ? 49.879  0.910   12.737  1.00   19.10 ? 337 LEU B CA  1 
ATOM   5275  C  C   . LEU B  1 230 ? 50.765  -0.016  13.572  1.00   18.20 ? 337 LEU B C   1 
ATOM   5276  O  O   . LEU B  1 230 ? 51.583  0.452   14.356  1.00   19.47 ? 337 LEU B O   1 
ATOM   5277  C  CB  . LEU B  1 230 ? 48.466  0.952   13.342  1.00   16.30 ? 337 LEU B CB  1 
ATOM   5278  C  CG  . LEU B  1 230 ? 48.319  1.626   14.707  1.00   20.74 ? 337 LEU B CG  1 
ATOM   5279  C  CD1 . LEU B  1 230 ? 48.585  3.104   14.544  1.00   18.48 ? 337 LEU B CD1 1 
ATOM   5280  C  CD2 . LEU B  1 230 ? 46.940  1.396   15.294  1.00   18.30 ? 337 LEU B CD2 1 
ATOM   5281  N  N   . ALA B  1 231 ? 50.607  -1.324  13.410  1.00   17.14 ? 338 ALA B N   1 
ATOM   5282  C  CA  . ALA B  1 231 ? 51.419  -2.281  14.161  1.00   15.69 ? 338 ALA B CA  1 
ATOM   5283  C  C   . ALA B  1 231 ? 51.593  -3.620  13.430  1.00   16.69 ? 338 ALA B C   1 
ATOM   5284  O  O   . ALA B  1 231 ? 51.119  -3.807  12.302  1.00   12.99 ? 338 ALA B O   1 
ATOM   5285  C  CB  . ALA B  1 231 ? 50.812  -2.507  15.537  1.00   16.14 ? 338 ALA B CB  1 
ATOM   5286  N  N   . THR B  1 232 ? 52.235  -4.566  14.104  1.00   18.86 ? 339 THR B N   1 
ATOM   5287  C  CA  . THR B  1 232 ? 52.535  -5.858  13.505  1.00   18.38 ? 339 THR B CA  1 
ATOM   5288  C  C   . THR B  1 232 ? 52.269  -7.072  14.396  1.00   20.70 ? 339 THR B C   1 
ATOM   5289  O  O   . THR B  1 232 ? 52.337  -6.984  15.629  1.00   21.09 ? 339 THR B O   1 
ATOM   5290  C  CB  . THR B  1 232 ? 54.035  -5.903  13.130  1.00   17.11 ? 339 THR B CB  1 
ATOM   5291  O  OG1 . THR B  1 232 ? 54.328  -4.856  12.200  1.00   17.64 ? 339 THR B OG1 1 
ATOM   5292  C  CG2 . THR B  1 232 ? 54.413  -7.254  12.532  1.00   14.56 ? 339 THR B CG2 1 
ATOM   5293  N  N   . THR B  1 233 ? 51.947  -8.199  13.767  1.00   19.00 ? 340 THR B N   1 
ATOM   5294  C  CA  . THR B  1 233 ? 51.799  -9.461  14.489  1.00   22.54 ? 340 THR B CA  1 
ATOM   5295  C  C   . THR B  1 233 ? 52.515  -10.491 13.620  1.00   24.55 ? 340 THR B C   1 
ATOM   5296  O  O   . THR B  1 233 ? 52.721  -10.285 12.417  1.00   24.77 ? 340 THR B O   1 
ATOM   5297  C  CB  . THR B  1 233 ? 50.343  -9.939  14.682  1.00   19.88 ? 340 THR B CB  1 
ATOM   5298  O  OG1 . THR B  1 233 ? 49.764  -10.201 13.407  1.00   24.06 ? 340 THR B OG1 1 
ATOM   5299  C  CG2 . THR B  1 233 ? 49.521  -8.910  15.460  1.00   19.16 ? 340 THR B CG2 1 
ATOM   5300  N  N   . TYR B  1 234 ? 52.909  -11.594 14.235  1.00   23.84 ? 341 TYR B N   1 
ATOM   5301  C  CA  . TYR B  1 234 ? 53.601  -12.654 13.524  1.00   22.39 ? 341 TYR B CA  1 
ATOM   5302  C  C   . TYR B  1 234 ? 52.752  -13.376 12.496  1.00   22.18 ? 341 TYR B C   1 
ATOM   5303  O  O   . TYR B  1 234 ? 51.525  -13.487 12.627  1.00   22.65 ? 341 TYR B O   1 
ATOM   5304  C  CB  . TYR B  1 234 ? 54.095  -13.694 14.516  1.00   22.30 ? 341 TYR B CB  1 
ATOM   5305  C  CG  . TYR B  1 234 ? 55.277  -13.259 15.331  1.00   21.42 ? 341 TYR B CG  1 
ATOM   5306  C  CD1 . TYR B  1 234 ? 56.505  -13.038 14.724  1.00   17.93 ? 341 TYR B CD1 1 
ATOM   5307  C  CD2 . TYR B  1 234 ? 55.177  -13.092 16.712  1.00   22.10 ? 341 TYR B CD2 1 
ATOM   5308  C  CE1 . TYR B  1 234 ? 57.603  -12.666 15.460  1.00   20.76 ? 341 TYR B CE1 1 
ATOM   5309  C  CE2 . TYR B  1 234 ? 56.279  -12.712 17.468  1.00   19.00 ? 341 TYR B CE2 1 
ATOM   5310  C  CZ  . TYR B  1 234 ? 57.489  -12.500 16.833  1.00   21.04 ? 341 TYR B CZ  1 
ATOM   5311  O  OH  . TYR B  1 234 ? 58.594  -12.096 17.547  1.00   20.89 ? 341 TYR B OH  1 
ATOM   5312  N  N   . SER B  1 235 ? 53.427  -13.864 11.464  1.00   25.08 ? 342 SER B N   1 
ATOM   5313  C  CA  . SER B  1 235 ? 52.789  -14.669 10.430  1.00   24.97 ? 342 SER B CA  1 
ATOM   5314  C  C   . SER B  1 235 ? 53.865  -15.586 9.831   1.00   24.19 ? 342 SER B C   1 
ATOM   5315  O  O   . SER B  1 235 ? 54.869  -15.864 10.487  1.00   23.00 ? 342 SER B O   1 
ATOM   5316  C  CB  . SER B  1 235 ? 52.150  -13.801 9.350   1.00   23.05 ? 342 SER B CB  1 
ATOM   5317  O  OG  . SER B  1 235 ? 51.237  -14.589 8.605   1.00   25.83 ? 342 SER B OG  1 
ATOM   5318  N  N   . SER B  1 236 ? 53.662  -16.045 8.596   1.00   24.62 ? 343 SER B N   1 
ATOM   5319  C  CA  . SER B  1 236 ? 54.609  -16.948 7.939   1.00   22.33 ? 343 SER B CA  1 
ATOM   5320  C  C   . SER B  1 236 ? 55.785  -16.256 7.244   1.00   20.38 ? 343 SER B C   1 
ATOM   5321  O  O   . SER B  1 236 ? 55.766  -15.050 6.998   1.00   18.00 ? 343 SER B O   1 
ATOM   5322  C  CB  . SER B  1 236 ? 53.865  -17.824 6.917   1.00   23.83 ? 343 SER B CB  1 
ATOM   5323  O  OG  . SER B  1 236 ? 53.306  -17.043 5.879   1.00   22.79 ? 343 SER B OG  1 
ATOM   5324  N  N   . GLY B  1 237 ? 56.801  -17.050 6.928   1.00   17.82 ? 344 GLY B N   1 
ATOM   5325  C  CA  . GLY B  1 237 ? 57.990  -16.556 6.252   1.00   20.40 ? 344 GLY B CA  1 
ATOM   5326  C  C   . GLY B  1 237 ? 58.542  -17.632 5.324   1.00   20.01 ? 344 GLY B C   1 
ATOM   5327  O  O   . GLY B  1 237 ? 57.808  -18.159 4.490   1.00   20.27 ? 344 GLY B O   1 
ATOM   5328  N  N   . ASN B  1 238 ? 59.822  -17.973 5.457   1.00   21.52 ? 345 ASN B N   1 
ATOM   5329  C  CA  . ASN B  1 238 ? 60.410  -19.011 4.610   1.00   20.81 ? 345 ASN B CA  1 
ATOM   5330  C  C   . ASN B  1 238 ? 60.084  -20.420 5.133   1.00   22.73 ? 345 ASN B C   1 
ATOM   5331  O  O   . ASN B  1 238 ? 59.409  -20.581 6.161   1.00   20.84 ? 345 ASN B O   1 
ATOM   5332  C  CB  . ASN B  1 238 ? 61.927  -18.810 4.481   1.00   23.24 ? 345 ASN B CB  1 
ATOM   5333  C  CG  . ASN B  1 238 ? 62.662  -18.949 5.806   1.00   23.79 ? 345 ASN B CG  1 
ATOM   5334  O  OD1 . ASN B  1 238 ? 62.373  -19.848 6.596   1.00   23.23 ? 345 ASN B OD1 1 
ATOM   5335  N  ND2 . ASN B  1 238 ? 63.636  -18.071 6.042   1.00   22.53 ? 345 ASN B ND2 1 
ATOM   5336  N  N   . GLN B  1 239 ? 60.567  -21.450 4.447   1.00   21.35 ? 346 GLN B N   1 
ATOM   5337  C  CA  . GLN B  1 239 ? 60.219  -22.792 4.881   1.00   23.01 ? 346 GLN B CA  1 
ATOM   5338  C  C   . GLN B  1 239 ? 60.919  -23.325 6.129   1.00   23.65 ? 346 GLN B C   1 
ATOM   5339  O  O   . GLN B  1 239 ? 60.604  -24.424 6.596   1.00   23.94 ? 346 GLN B O   1 
ATOM   5340  C  CB  . GLN B  1 239 ? 60.335  -23.762 3.706   1.00   19.10 ? 346 GLN B CB  1 
ATOM   5341  C  CG  . GLN B  1 239 ? 59.433  -23.351 2.540   1.00   22.95 ? 346 GLN B CG  1 
ATOM   5342  C  CD  . GLN B  1 239 ? 59.466  -24.326 1.365   1.00   21.43 ? 346 GLN B CD  1 
ATOM   5343  O  OE1 . GLN B  1 239 ? 59.310  -23.932 0.210   1.00   24.57 ? 346 GLN B OE1 1 
ATOM   5344  N  NE2 . GLN B  1 239 ? 59.652  -25.597 1.659   1.00   21.24 ? 346 GLN B NE2 1 
ATOM   5345  N  N   . ASN B  1 240 ? 61.847  -22.552 6.685   1.00   23.21 ? 347 ASN B N   1 
ATOM   5346  C  CA  . ASN B  1 240 ? 62.511  -22.970 7.926   1.00   24.16 ? 347 ASN B CA  1 
ATOM   5347  C  C   . ASN B  1 240 ? 61.781  -22.302 9.104   1.00   23.02 ? 347 ASN B C   1 
ATOM   5348  O  O   . ASN B  1 240 ? 62.029  -22.612 10.259  1.00   23.24 ? 347 ASN B O   1 
ATOM   5349  C  CB  . ASN B  1 240 ? 63.984  -22.547 7.956   1.00   24.48 ? 347 ASN B CB  1 
ATOM   5350  C  CG  . ASN B  1 240 ? 64.805  -23.142 6.815   1.00   28.57 ? 347 ASN B CG  1 
ATOM   5351  O  OD1 . ASN B  1 240 ? 64.980  -22.523 5.767   1.00   35.58 ? 347 ASN B OD1 1 
ATOM   5352  N  ND2 . ASN B  1 240 ? 65.312  -24.345 7.019   1.00   29.28 ? 347 ASN B ND2 1 
ATOM   5353  N  N   . GLU B  1 241 ? 60.882  -21.373 8.799   1.00   23.21 ? 348 GLU B N   1 
ATOM   5354  C  CA  . GLU B  1 241 ? 60.144  -20.668 9.838   1.00   22.25 ? 348 GLU B CA  1 
ATOM   5355  C  C   . GLU B  1 241 ? 58.764  -21.271 9.973   1.00   21.86 ? 348 GLU B C   1 
ATOM   5356  O  O   . GLU B  1 241 ? 58.164  -21.688 8.994   1.00   23.14 ? 348 GLU B O   1 
ATOM   5357  C  CB  . GLU B  1 241 ? 60.055  -19.178 9.493   1.00   18.92 ? 348 GLU B CB  1 
ATOM   5358  C  CG  . GLU B  1 241 ? 61.421  -18.488 9.512   1.00   19.28 ? 348 GLU B CG  1 
ATOM   5359  C  CD  . GLU B  1 241 ? 61.411  -17.094 8.897   1.00   23.47 ? 348 GLU B CD  1 
ATOM   5360  O  OE1 . GLU B  1 241 ? 61.892  -16.136 9.556   1.00   23.44 ? 348 GLU B OE1 1 
ATOM   5361  O  OE2 . GLU B  1 241 ? 60.932  -16.956 7.751   1.00   25.24 ? 348 GLU B OE2 1 
ATOM   5362  N  N   . LYS B  1 242 ? 58.267  -21.329 11.195  1.00   23.94 ? 349 LYS B N   1 
ATOM   5363  C  CA  . LYS B  1 242 ? 56.947  -21.892 11.443  1.00   25.63 ? 349 LYS B CA  1 
ATOM   5364  C  C   . LYS B  1 242 ? 55.827  -20.963 10.990  1.00   24.17 ? 349 LYS B C   1 
ATOM   5365  O  O   . LYS B  1 242 ? 56.059  -19.790 10.709  1.00   20.78 ? 349 LYS B O   1 
ATOM   5366  C  CB  . LYS B  1 242 ? 56.822  -22.244 12.925  1.00   29.24 ? 349 LYS B CB  1 
ATOM   5367  C  CG  . LYS B  1 242 ? 57.791  -23.363 13.329  1.00   29.87 ? 349 LYS B CG  1 
ATOM   5368  C  CD  . LYS B  1 242 ? 57.813  -23.592 14.830  1.00   36.80 ? 349 LYS B CD  1 
ATOM   5369  C  CE  . LYS B  1 242 ? 58.663  -24.814 15.184  1.00   42.02 ? 349 LYS B CE  1 
ATOM   5370  N  NZ  . LYS B  1 242 ? 58.827  -24.968 16.656  0.0000 40.01 ? 349 LYS B NZ  1 
ATOM   5371  N  N   . GLN B  1 243 ? 54.613  -21.497 10.904  1.00   24.04 ? 350 GLN B N   1 
ATOM   5372  C  CA  . GLN B  1 243 ? 53.477  -20.713 10.444  1.00   23.04 ? 350 GLN B CA  1 
ATOM   5373  C  C   . GLN B  1 243 ? 52.361  -20.658 11.475  1.00   23.90 ? 350 GLN B C   1 
ATOM   5374  O  O   . GLN B  1 243 ? 52.596  -20.932 12.647  1.00   23.01 ? 350 GLN B O   1 
ATOM   5375  C  CB  . GLN B  1 243 ? 52.998  -21.281 9.104   1.00   22.72 ? 350 GLN B CB  1 
ATOM   5376  C  CG  . GLN B  1 243 ? 54.193  -21.523 8.172   1.00   22.63 ? 350 GLN B CG  1 
ATOM   5377  C  CD  . GLN B  1 243 ? 53.819  -21.810 6.739   1.00   24.10 ? 350 GLN B CD  1 
ATOM   5378  O  OE1 . GLN B  1 243 ? 52.819  -22.471 6.464   1.00   25.70 ? 350 GLN B OE1 1 
ATOM   5379  N  NE2 . GLN B  1 243 ? 54.640  -21.331 5.811   1.00   22.44 ? 350 GLN B NE2 1 
ATOM   5380  N  N   . ILE B  1 244 ? 51.153  -20.301 11.050  1.00   24.33 ? 351 ILE B N   1 
ATOM   5381  C  CA  . ILE B  1 244 ? 50.047  -20.177 11.986  1.00   22.89 ? 351 ILE B CA  1 
ATOM   5382  C  C   . ILE B  1 244 ? 49.194  -21.428 12.092  1.00   23.71 ? 351 ILE B C   1 
ATOM   5383  O  O   . ILE B  1 244 ? 48.794  -22.020 11.088  1.00   22.93 ? 351 ILE B O   1 
ATOM   5384  C  CB  . ILE B  1 244 ? 49.176  -18.967 11.625  1.00   23.10 ? 351 ILE B CB  1 
ATOM   5385  C  CG1 . ILE B  1 244 ? 50.070  -17.730 11.538  1.00   23.85 ? 351 ILE B CG1 1 
ATOM   5386  C  CG2 . ILE B  1 244 ? 48.122  -18.724 12.696  1.00   24.45 ? 351 ILE B CG2 1 
ATOM   5387  C  CD1 . ILE B  1 244 ? 50.979  -17.552 12.744  1.00   25.92 ? 351 ILE B CD1 1 
ATOM   5388  N  N   . VAL B  1 245 ? 48.917  -21.810 13.335  1.00   23.04 ? 352 VAL B N   1 
ATOM   5389  C  CA  . VAL B  1 245 ? 48.137  -22.997 13.658  1.00   23.61 ? 352 VAL B CA  1 
ATOM   5390  C  C   . VAL B  1 245 ? 46.726  -22.593 14.018  1.00   24.98 ? 352 VAL B C   1 
ATOM   5391  O  O   . VAL B  1 245 ? 46.513  -21.835 14.962  1.00   28.81 ? 352 VAL B O   1 
ATOM   5392  C  CB  . VAL B  1 245 ? 48.783  -23.735 14.851  1.00   26.95 ? 352 VAL B CB  1 
ATOM   5393  C  CG1 . VAL B  1 245 ? 47.934  -24.931 15.277  1.00   25.93 ? 352 VAL B CG1 1 
ATOM   5394  C  CG2 . VAL B  1 245 ? 50.190  -24.182 14.462  1.00   22.53 ? 352 VAL B CG2 1 
ATOM   5395  N  N   . THR B  1 246 ? 45.756  -23.114 13.282  1.00   24.50 ? 353 THR B N   1 
ATOM   5396  C  CA  . THR B  1 246 ? 44.375  -22.747 13.531  1.00   24.53 ? 353 THR B CA  1 
ATOM   5397  C  C   . THR B  1 246 ? 43.393  -23.789 12.983  1.00   28.87 ? 353 THR B C   1 
ATOM   5398  O  O   . THR B  1 246 ? 43.793  -24.827 12.451  1.00   30.62 ? 353 THR B O   1 
ATOM   5399  C  CB  . THR B  1 246 ? 44.085  -21.352 12.891  1.00   22.64 ? 353 THR B CB  1 
ATOM   5400  O  OG1 . THR B  1 246 ? 42.725  -20.970 13.129  1.00   19.26 ? 353 THR B OG1 1 
ATOM   5401  C  CG2 . THR B  1 246 ? 44.357  -21.379 11.390  1.00   14.17 ? 353 THR B CG2 1 
ATOM   5402  N  N   . THR B  1 247 ? 42.108  -23.497 13.135  1.00   29.58 ? 354 THR B N   1 
ATOM   5403  C  CA  . THR B  1 247 ? 41.031  -24.354 12.677  1.00   31.15 ? 354 THR B CA  1 
ATOM   5404  C  C   . THR B  1 247 ? 40.906  -24.306 11.156  1.00   33.37 ? 354 THR B C   1 
ATOM   5405  O  O   . THR B  1 247 ? 40.982  -23.231 10.549  1.00   35.25 ? 354 THR B O   1 
ATOM   5406  C  CB  . THR B  1 247 ? 39.720  -23.890 13.296  1.00   32.88 ? 354 THR B CB  1 
ATOM   5407  O  OG1 . THR B  1 247 ? 39.581  -22.475 13.086  1.00   28.60 ? 354 THR B OG1 1 
ATOM   5408  C  CG2 . THR B  1 247 ? 39.719  -24.171 14.795  1.00   30.52 ? 354 THR B CG2 1 
ATOM   5409  N  N   . ASP B  1 248 ? 40.701  -25.467 10.542  1.00   31.75 ? 355 ASP B N   1 
ATOM   5410  C  CA  . ASP B  1 248 ? 40.576  -25.546 9.095   1.00   30.38 ? 355 ASP B CA  1 
ATOM   5411  C  C   . ASP B  1 248 ? 39.248  -26.160 8.676   1.00   30.68 ? 355 ASP B C   1 
ATOM   5412  O  O   . ASP B  1 248 ? 38.581  -26.840 9.462   1.00   28.32 ? 355 ASP B O   1 
ATOM   5413  C  CB  . ASP B  1 248 ? 41.723  -26.363 8.512   1.00   31.13 ? 355 ASP B CB  1 
ATOM   5414  C  CG  . ASP B  1 248 ? 41.981  -26.037 7.064   1.00   32.68 ? 355 ASP B CG  1 
ATOM   5415  O  OD1 . ASP B  1 248 ? 41.254  -25.187 6.508   1.00   33.91 ? 355 ASP B OD1 1 
ATOM   5416  O  OD2 . ASP B  1 248 ? 42.911  -26.627 6.479   1.00   34.85 ? 355 ASP B OD2 1 
ATOM   5417  N  N   . LEU B  1 249 ? 38.871  -25.913 7.428   1.00   31.21 ? 356 LEU B N   1 
ATOM   5418  C  CA  . LEU B  1 249 ? 37.621  -26.422 6.880   1.00   31.29 ? 356 LEU B CA  1 
ATOM   5419  C  C   . LEU B  1 249 ? 37.524  -27.942 7.033   1.00   34.21 ? 356 LEU B C   1 
ATOM   5420  O  O   . LEU B  1 249 ? 38.543  -28.645 7.089   1.00   33.03 ? 356 LEU B O   1 
ATOM   5421  C  CB  . LEU B  1 249 ? 37.524  -26.040 5.405   1.00   29.03 ? 356 LEU B CB  1 
ATOM   5422  C  CG  . LEU B  1 249 ? 36.152  -26.126 4.743   1.00   30.41 ? 356 LEU B CG  1 
ATOM   5423  C  CD1 . LEU B  1 249 ? 35.144  -25.264 5.486   1.00   28.31 ? 356 LEU B CD1 1 
ATOM   5424  C  CD2 . LEU B  1 249 ? 36.286  -25.667 3.311   1.00   27.47 ? 356 LEU B CD2 1 
ATOM   5425  N  N   . ARG B  1 250 ? 36.287  -28.432 7.090   1.00   35.47 ? 357 ARG B N   1 
ATOM   5426  C  CA  . ARG B  1 250 ? 35.993  -29.854 7.242   1.00   32.37 ? 357 ARG B CA  1 
ATOM   5427  C  C   . ARG B  1 250 ? 36.473  -30.360 8.593   1.00   32.68 ? 357 ARG B C   1 
ATOM   5428  O  O   . ARG B  1 250 ? 36.970  -31.474 8.720   1.00   32.82 ? 357 ARG B O   1 
ATOM   5429  C  CB  . ARG B  1 250 ? 36.611  -30.653 6.094   1.00   30.49 ? 357 ARG B CB  1 
ATOM   5430  C  CG  . ARG B  1 250 ? 36.097  -30.207 4.724   1.00   28.82 ? 357 ARG B CG  1 
ATOM   5431  C  CD  . ARG B  1 250 ? 36.745  -30.994 3.615   1.00   27.69 ? 357 ARG B CD  1 
ATOM   5432  N  NE  . ARG B  1 250 ? 36.481  -30.466 2.271   1.00   34.62 ? 357 ARG B NE  1 
ATOM   5433  C  CZ  . ARG B  1 250 ? 35.308  -30.517 1.634   1.00   36.82 ? 357 ARG B CZ  1 
ATOM   5434  N  NH1 . ARG B  1 250 ? 35.199  -30.004 0.416   1.00   35.04 ? 357 ARG B NH1 1 
ATOM   5435  N  NH2 . ARG B  1 250 ? 34.245  -31.073 2.203   1.00   37.48 ? 357 ARG B NH2 1 
ATOM   5436  N  N   . GLN B  1 251 ? 36.316  -29.505 9.597   1.00   31.43 ? 358 GLN B N   1 
ATOM   5437  C  CA  . GLN B  1 251 ? 36.670  -29.811 10.977  1.00   32.79 ? 358 GLN B CA  1 
ATOM   5438  C  C   . GLN B  1 251 ? 38.089  -30.285 11.209  1.00   33.08 ? 358 GLN B C   1 
ATOM   5439  O  O   . GLN B  1 251 ? 38.354  -31.108 12.079  1.00   33.32 ? 358 GLN B O   1 
ATOM   5440  C  CB  . GLN B  1 251 ? 35.682  -30.827 11.514  1.00   33.73 ? 358 GLN B CB  1 
ATOM   5441  C  CG  . GLN B  1 251 ? 34.283  -30.326 11.347  1.00   39.80 ? 358 GLN B CG  1 
ATOM   5442  C  CD  . GLN B  1 251 ? 33.265  -31.401 11.514  1.00   42.65 ? 358 GLN B CD  1 
ATOM   5443  O  OE1 . GLN B  1 251 ? 32.803  -31.671 12.621  1.00   41.59 ? 358 GLN B OE1 1 
ATOM   5444  N  NE2 . GLN B  1 251 ? 32.911  -32.044 10.407  1.00   47.21 ? 358 GLN B NE2 1 
ATOM   5445  N  N   . LYS B  1 252 ? 39.014  -29.738 10.442  1.00   34.54 ? 359 LYS B N   1 
ATOM   5446  C  CA  . LYS B  1 252 ? 40.399  -30.119 10.577  1.00   35.03 ? 359 LYS B CA  1 
ATOM   5447  C  C   . LYS B  1 252 ? 41.201  -29.040 11.292  1.00   35.12 ? 359 LYS B C   1 
ATOM   5448  O  O   . LYS B  1 252 ? 40.665  -28.001 11.686  1.00   30.40 ? 359 LYS B O   1 
ATOM   5449  C  CB  . LYS B  1 252 ? 40.979  -30.405 9.197   1.00   38.48 ? 359 LYS B CB  1 
ATOM   5450  C  CG  . LYS B  1 252 ? 40.266  -31.546 8.488   1.00   41.20 ? 359 LYS B CG  1 
ATOM   5451  C  CD  . LYS B  1 252 ? 40.805  -31.714 7.080   1.00   50.13 ? 359 LYS B CD  1 
ATOM   5452  C  CE  . LYS B  1 252 ? 40.103  -32.832 6.317   1.00   53.44 ? 359 LYS B CE  1 
ATOM   5453  N  NZ  . LYS B  1 252 ? 40.570  -32.879 4.892   1.00   55.34 ? 359 LYS B NZ  1 
ATOM   5454  N  N   . CYS B  1 253 ? 42.488  -29.314 11.458  1.00   35.73 ? 360 CYS B N   1 
ATOM   5455  C  CA  . CYS B  1 253 ? 43.411  -28.415 12.132  1.00   36.48 ? 360 CYS B CA  1 
ATOM   5456  C  C   . CYS B  1 253 ? 44.560  -28.212 11.149  1.00   35.37 ? 360 CYS B C   1 
ATOM   5457  O  O   . CYS B  1 253 ? 45.024  -29.171 10.528  1.00   38.92 ? 360 CYS B O   1 
ATOM   5458  C  CB  . CYS B  1 253 ? 43.882  -29.098 13.426  1.00   38.06 ? 360 CYS B CB  1 
ATOM   5459  S  SG  . CYS B  1 253 ? 44.965  -28.185 14.583  1.00   47.51 ? 360 CYS B SG  1 
ATOM   5460  N  N   . THR B  1 254 ? 44.997  -26.973 10.965  1.00   31.72 ? 361 THR B N   1 
ATOM   5461  C  CA  . THR B  1 254 ? 46.101  -26.717 10.050  1.00   31.22 ? 361 THR B CA  1 
ATOM   5462  C  C   . THR B  1 254 ? 47.234  -25.998 10.765  1.00   31.73 ? 361 THR B C   1 
ATOM   5463  O  O   . THR B  1 254 ? 47.017  -25.261 11.727  1.00   30.81 ? 361 THR B O   1 
ATOM   5464  C  CB  . THR B  1 254 ? 45.672  -25.856 8.840   1.00   32.10 ? 361 THR B CB  1 
ATOM   5465  O  OG1 . THR B  1 254 ? 46.775  -25.729 7.931   1.00   31.68 ? 361 THR B OG1 1 
ATOM   5466  C  CG2 . THR B  1 254 ? 45.261  -24.458 9.297   1.00   29.89 ? 361 THR B CG2 1 
ATOM   5467  N  N   . GLU B  1 255 ? 48.451  -26.222 10.292  1.00   32.46 ? 362 GLU B N   1 
ATOM   5468  C  CA  . GLU B  1 255 ? 49.624  -25.588 10.879  1.00   33.18 ? 362 GLU B CA  1 
ATOM   5469  C  C   . GLU B  1 255 ? 50.246  -24.708 9.814   1.00   30.02 ? 362 GLU B C   1 
ATOM   5470  O  O   . GLU B  1 255 ? 51.368  -24.218 9.973   1.00   31.01 ? 362 GLU B O   1 
ATOM   5471  C  CB  . GLU B  1 255 ? 50.636  -26.649 11.329  1.00   33.45 ? 362 GLU B CB  1 
ATOM   5472  C  CG  . GLU B  1 255 ? 50.137  -27.519 12.473  1.00   46.00 ? 362 GLU B CG  1 
ATOM   5473  C  CD  . GLU B  1 255 ? 51.083  -28.668 12.830  1.00   49.96 ? 362 GLU B CD  1 
ATOM   5474  O  OE1 . GLU B  1 255 ? 52.282  -28.407 13.075  1.00   52.09 ? 362 GLU B OE1 1 
ATOM   5475  O  OE2 . GLU B  1 255 ? 50.619  -29.833 12.877  1.00   52.00 ? 362 GLU B OE2 1 
ATOM   5476  N  N   . SER B  1 256 ? 49.511  -24.504 8.728   1.00   27.25 ? 363 SER B N   1 
ATOM   5477  C  CA  . SER B  1 256 ? 50.029  -23.703 7.638   1.00   28.62 ? 363 SER B CA  1 
ATOM   5478  C  C   . SER B  1 256 ? 49.146  -22.574 7.129   1.00   28.79 ? 363 SER B C   1 
ATOM   5479  O  O   . SER B  1 256 ? 48.960  -22.417 5.917   1.00   27.64 ? 363 SER B O   1 
ATOM   5480  C  CB  . SER B  1 256 ? 50.427  -24.614 6.477   1.00   29.89 ? 363 SER B CB  1 
ATOM   5481  O  OG  . SER B  1 256 ? 49.412  -25.563 6.215   1.00   33.92 ? 363 SER B OG  1 
ATOM   5482  N  N   . HIS B  1 257 ? 48.593  -21.797 8.057   1.00   27.53 ? 364 HIS B N   1 
ATOM   5483  C  CA  . HIS B  1 257 ? 47.807  -20.628 7.692   1.00   26.63 ? 364 HIS B CA  1 
ATOM   5484  C  C   . HIS B  1 257 ? 48.916  -19.589 7.477   1.00   27.92 ? 364 HIS B C   1 
ATOM   5485  O  O   . HIS B  1 257 ? 49.823  -19.471 8.307   1.00   25.27 ? 364 HIS B O   1 
ATOM   5486  C  CB  . HIS B  1 257 ? 46.880  -20.234 8.832   1.00   26.56 ? 364 HIS B CB  1 
ATOM   5487  C  CG  . HIS B  1 257 ? 45.974  -19.088 8.503   1.00   25.36 ? 364 HIS B CG  1 
ATOM   5488  N  ND1 . HIS B  1 257 ? 45.501  -18.855 7.231   1.00   25.40 ? 364 HIS B ND1 1 
ATOM   5489  C  CD2 . HIS B  1 257 ? 45.419  -18.136 9.290   1.00   23.58 ? 364 HIS B CD2 1 
ATOM   5490  C  CE1 . HIS B  1 257 ? 44.694  -17.809 7.245   1.00   23.83 ? 364 HIS B CE1 1 
ATOM   5491  N  NE2 . HIS B  1 257 ? 44.626  -17.353 8.483   1.00   27.65 ? 364 HIS B NE2 1 
ATOM   5492  N  N   . THR B  1 258 ? 48.852  -18.845 6.374   1.00   26.82 ? 365 THR B N   1 
ATOM   5493  C  CA  . THR B  1 258 ? 49.932  -17.916 6.038   1.00   23.50 ? 365 THR B CA  1 
ATOM   5494  C  C   . THR B  1 258 ? 49.555  -16.504 5.585   1.00   24.96 ? 365 THR B C   1 
ATOM   5495  O  O   . THR B  1 258 ? 48.383  -16.151 5.469   1.00   24.15 ? 365 THR B O   1 
ATOM   5496  C  CB  . THR B  1 258 ? 50.761  -18.503 4.891   1.00   24.62 ? 365 THR B CB  1 
ATOM   5497  O  OG1 . THR B  1 258 ? 49.937  -18.573 3.718   1.00   25.32 ? 365 THR B OG1 1 
ATOM   5498  C  CG2 . THR B  1 258 ? 51.234  -19.919 5.223   1.00   20.15 ? 365 THR B CG2 1 
ATOM   5499  N  N   . GLY B  1 259 ? 50.590  -15.711 5.313   1.00   22.57 ? 366 GLY B N   1 
ATOM   5500  C  CA  . GLY B  1 259 ? 50.410  -14.362 4.818   1.00   22.83 ? 366 GLY B CA  1 
ATOM   5501  C  C   . GLY B  1 259 ? 49.770  -13.325 5.718   1.00   24.75 ? 366 GLY B C   1 
ATOM   5502  O  O   . GLY B  1 259 ? 49.541  -13.534 6.919   1.00   21.96 ? 366 GLY B O   1 
ATOM   5503  N  N   . THR B  1 260 ? 49.490  -12.179 5.102   1.00   24.78 ? 367 THR B N   1 
ATOM   5504  C  CA  . THR B  1 260 ? 48.882  -11.048 5.778   1.00   21.90 ? 367 THR B CA  1 
ATOM   5505  C  C   . THR B  1 260 ? 47.557  -11.473 6.410   1.00   21.50 ? 367 THR B C   1 
ATOM   5506  O  O   . THR B  1 260 ? 47.159  -10.934 7.436   1.00   21.44 ? 367 THR B O   1 
ATOM   5507  C  CB  . THR B  1 260 ? 48.662  -9.874  4.765   1.00   24.02 ? 367 THR B CB  1 
ATOM   5508  O  OG1 . THR B  1 260 ? 48.211  -8.710  5.459   1.00   23.07 ? 367 THR B OG1 1 
ATOM   5509  C  CG2 . THR B  1 260 ? 47.634  -10.248 3.718   1.00   24.30 ? 367 THR B CG2 1 
ATOM   5510  N  N   . SER B  1 261 ? 46.888  -12.460 5.811   1.00   24.25 ? 368 SER B N   1 
ATOM   5511  C  CA  . SER B  1 261 ? 45.600  -12.942 6.330   1.00   22.90 ? 368 SER B CA  1 
ATOM   5512  C  C   . SER B  1 261 ? 45.654  -13.382 7.784   1.00   23.32 ? 368 SER B C   1 
ATOM   5513  O  O   . SER B  1 261 ? 44.679  -13.233 8.534   1.00   24.81 ? 368 SER B O   1 
ATOM   5514  C  CB  . SER B  1 261 ? 45.095  -14.133 5.520   1.00   21.46 ? 368 SER B CB  1 
ATOM   5515  O  OG  . SER B  1 261 ? 44.798  -13.781 4.193   1.00   27.02 ? 368 SER B OG  1 
ATOM   5516  N  N   . ALA B  1 262 ? 46.785  -13.945 8.181   1.00   21.46 ? 369 ALA B N   1 
ATOM   5517  C  CA  . ALA B  1 262 ? 46.920  -14.448 9.544   1.00   20.18 ? 369 ALA B CA  1 
ATOM   5518  C  C   . ALA B  1 262 ? 47.261  -13.395 10.585  1.00   20.42 ? 369 ALA B C   1 
ATOM   5519  O  O   . ALA B  1 262 ? 47.067  -13.624 11.764  1.00   20.66 ? 369 ALA B O   1 
ATOM   5520  C  CB  . ALA B  1 262 ? 47.959  -15.561 9.575   1.00   17.59 ? 369 ALA B CB  1 
ATOM   5521  N  N   . SER B  1 263 ? 47.759  -12.236 10.161  1.00   20.59 ? 370 SER B N   1 
ATOM   5522  C  CA  . SER B  1 263 ? 48.125  -11.211 11.123  1.00   20.01 ? 370 SER B CA  1 
ATOM   5523  C  C   . SER B  1 263 ? 46.971  -10.424 11.730  1.00   20.21 ? 370 SER B C   1 
ATOM   5524  O  O   . SER B  1 263 ? 46.918  -10.216 12.942  1.00   22.91 ? 370 SER B O   1 
ATOM   5525  C  CB  . SER B  1 263 ? 49.139  -10.251 10.507  1.00   19.18 ? 370 SER B CB  1 
ATOM   5526  O  OG  . SER B  1 263 ? 50.413  -10.865 10.407  1.00   18.56 ? 370 SER B OG  1 
ATOM   5527  N  N   . ALA B  1 264 ? 46.038  -9.983  10.907  1.00   20.00 ? 371 ALA B N   1 
ATOM   5528  C  CA  . ALA B  1 264 ? 44.926  -9.205  11.435  1.00   21.21 ? 371 ALA B CA  1 
ATOM   5529  C  C   . ALA B  1 264 ? 44.122  -9.926  12.530  1.00   20.58 ? 371 ALA B C   1 
ATOM   5530  O  O   . ALA B  1 264 ? 43.801  -9.331  13.559  1.00   21.19 ? 371 ALA B O   1 
ATOM   5531  C  CB  . ALA B  1 264 ? 43.992  -8.766  10.280  1.00   20.64 ? 371 ALA B CB  1 
ATOM   5532  N  N   . PRO B  1 265 ? 43.783  -11.208 12.321  1.00   18.73 ? 372 PRO B N   1 
ATOM   5533  C  CA  . PRO B  1 265 ? 43.008  -11.944 13.334  1.00   19.70 ? 372 PRO B CA  1 
ATOM   5534  C  C   . PRO B  1 265 ? 43.697  -11.991 14.700  1.00   19.98 ? 372 PRO B C   1 
ATOM   5535  O  O   . PRO B  1 265 ? 43.040  -11.895 15.742  1.00   19.89 ? 372 PRO B O   1 
ATOM   5536  C  CB  . PRO B  1 265 ? 42.845  -13.337 12.717  1.00   18.61 ? 372 PRO B CB  1 
ATOM   5537  C  CG  . PRO B  1 265 ? 42.947  -13.065 11.217  1.00   20.62 ? 372 PRO B CG  1 
ATOM   5538  C  CD  . PRO B  1 265 ? 44.062  -12.053 11.148  1.00   21.27 ? 372 PRO B CD  1 
ATOM   5539  N  N   . LEU B  1 266 ? 45.019  -12.152 14.702  1.00   17.37 ? 373 LEU B N   1 
ATOM   5540  C  CA  . LEU B  1 266 ? 45.744  -12.190 15.964  1.00   18.61 ? 373 LEU B CA  1 
ATOM   5541  C  C   . LEU B  1 266 ? 45.600  -10.825 16.637  1.00   20.44 ? 373 LEU B C   1 
ATOM   5542  O  O   . LEU B  1 266 ? 45.402  -10.743 17.852  1.00   21.23 ? 373 LEU B O   1 
ATOM   5543  C  CB  . LEU B  1 266 ? 47.217  -12.529 15.733  1.00   16.17 ? 373 LEU B CB  1 
ATOM   5544  C  CG  . LEU B  1 266 ? 47.496  -13.965 15.265  1.00   20.07 ? 373 LEU B CG  1 
ATOM   5545  C  CD1 . LEU B  1 266 ? 48.938  -14.055 14.825  1.00   18.17 ? 373 LEU B CD1 1 
ATOM   5546  C  CD2 . LEU B  1 266 ? 47.200  -14.987 16.379  1.00   14.90 ? 373 LEU B CD2 1 
ATOM   5547  N  N   . ALA B  1 267 ? 45.678  -9.760  15.843  1.00   18.20 ? 374 ALA B N   1 
ATOM   5548  C  CA  . ALA B  1 267 ? 45.525  -8.418  16.380  1.00   19.49 ? 374 ALA B CA  1 
ATOM   5549  C  C   . ALA B  1 267 ? 44.100  -8.257  16.921  1.00   19.81 ? 374 ALA B C   1 
ATOM   5550  O  O   . ALA B  1 267 ? 43.884  -7.679  17.992  1.00   17.38 ? 374 ALA B O   1 
ATOM   5551  C  CB  . ALA B  1 267 ? 45.799  -7.380  15.299  1.00   18.67 ? 374 ALA B CB  1 
ATOM   5552  N  N   . ALA B  1 268 ? 43.126  -8.778  16.187  1.00   19.57 ? 375 ALA B N   1 
ATOM   5553  C  CA  . ALA B  1 268 ? 41.738  -8.674  16.622  1.00   20.44 ? 375 ALA B CA  1 
ATOM   5554  C  C   . ALA B  1 268 ? 41.570  -9.353  17.974  1.00   22.06 ? 375 ALA B C   1 
ATOM   5555  O  O   . ALA B  1 268 ? 40.840  -8.858  18.850  1.00   22.69 ? 375 ALA B O   1 
ATOM   5556  C  CB  . ALA B  1 268 ? 40.816  -9.310  15.604  1.00   15.92 ? 375 ALA B CB  1 
ATOM   5557  N  N   . GLY B  1 269 ? 42.250  -10.486 18.142  1.00   22.50 ? 376 GLY B N   1 
ATOM   5558  C  CA  . GLY B  1 269 ? 42.165  -11.222 19.396  1.00   21.64 ? 376 GLY B CA  1 
ATOM   5559  C  C   . GLY B  1 269 ? 42.781  -10.444 20.548  1.00   22.57 ? 376 GLY B C   1 
ATOM   5560  O  O   . GLY B  1 269 ? 42.213  -10.359 21.649  1.00   20.58 ? 376 GLY B O   1 
ATOM   5561  N  N   . ILE B  1 270 ? 43.949  -9.861  20.304  1.00   19.08 ? 377 ILE B N   1 
ATOM   5562  C  CA  . ILE B  1 270 ? 44.619  -9.105  21.348  1.00   17.78 ? 377 ILE B CA  1 
ATOM   5563  C  C   . ILE B  1 270 ? 43.760  -7.912  21.754  1.00   21.08 ? 377 ILE B C   1 
ATOM   5564  O  O   . ILE B  1 270 ? 43.664  -7.574  22.936  1.00   23.90 ? 377 ILE B O   1 
ATOM   5565  C  CB  . ILE B  1 270 ? 45.997  -8.642  20.870  1.00   19.68 ? 377 ILE B CB  1 
ATOM   5566  C  CG1 . ILE B  1 270 ? 46.938  -9.847  20.811  1.00   19.95 ? 377 ILE B CG1 1 
ATOM   5567  C  CG2 . ILE B  1 270 ? 46.527  -7.545  21.774  1.00   16.59 ? 377 ILE B CG2 1 
ATOM   5568  C  CD1 . ILE B  1 270 ? 48.294  -9.544  20.219  1.00   23.54 ? 377 ILE B CD1 1 
ATOM   5569  N  N   . ILE B  1 271 ? 43.126  -7.286  20.770  1.00   18.90 ? 378 ILE B N   1 
ATOM   5570  C  CA  . ILE B  1 271 ? 42.260  -6.151  21.022  1.00   20.37 ? 378 ILE B CA  1 
ATOM   5571  C  C   . ILE B  1 271 ? 41.029  -6.612  21.812  1.00   20.99 ? 378 ILE B C   1 
ATOM   5572  O  O   . ILE B  1 271 ? 40.487  -5.866  22.623  1.00   21.65 ? 378 ILE B O   1 
ATOM   5573  C  CB  . ILE B  1 271 ? 41.842  -5.476  19.679  1.00   20.12 ? 378 ILE B CB  1 
ATOM   5574  C  CG1 . ILE B  1 271 ? 43.078  -4.819  19.048  1.00   19.60 ? 378 ILE B CG1 1 
ATOM   5575  C  CG2 . ILE B  1 271 ? 40.751  -4.418  19.911  1.00   16.39 ? 378 ILE B CG2 1 
ATOM   5576  C  CD1 . ILE B  1 271 ? 42.869  -4.310  17.602  1.00   19.95 ? 378 ILE B CD1 1 
ATOM   5577  N  N   . ALA B  1 272 ? 40.598  -7.847  21.590  1.00   22.70 ? 379 ALA B N   1 
ATOM   5578  C  CA  . ALA B  1 272 ? 39.449  -8.372  22.320  1.00   23.16 ? 379 ALA B CA  1 
ATOM   5579  C  C   . ALA B  1 272 ? 39.824  -8.508  23.804  1.00   24.01 ? 379 ALA B C   1 
ATOM   5580  O  O   . ALA B  1 272 ? 39.006  -8.239  24.692  1.00   24.30 ? 379 ALA B O   1 
ATOM   5581  C  CB  . ALA B  1 272 ? 39.036  -9.714  21.758  1.00   20.92 ? 379 ALA B CB  1 
ATOM   5582  N  N   . LEU B  1 273 ? 41.062  -8.910  24.071  1.00   21.59 ? 380 LEU B N   1 
ATOM   5583  C  CA  . LEU B  1 273 ? 41.501  -9.047  25.449  1.00   22.11 ? 380 LEU B CA  1 
ATOM   5584  C  C   . LEU B  1 273 ? 41.551  -7.667  26.072  1.00   23.28 ? 380 LEU B C   1 
ATOM   5585  O  O   . LEU B  1 273 ? 41.228  -7.481  27.244  1.00   25.54 ? 380 LEU B O   1 
ATOM   5586  C  CB  . LEU B  1 273 ? 42.888  -9.679  25.521  1.00   19.51 ? 380 LEU B CB  1 
ATOM   5587  C  CG  . LEU B  1 273 ? 43.035  -11.083 24.953  1.00   21.64 ? 380 LEU B CG  1 
ATOM   5588  C  CD1 . LEU B  1 273 ? 44.445  -11.577 25.205  1.00   24.83 ? 380 LEU B CD1 1 
ATOM   5589  C  CD2 . LEU B  1 273 ? 42.022  -12.019 25.598  1.00   19.53 ? 380 LEU B CD2 1 
ATOM   5590  N  N   . THR B  1 274 ? 41.959  -6.691  25.279  1.00   22.41 ? 381 THR B N   1 
ATOM   5591  C  CA  . THR B  1 274 ? 42.071  -5.336  25.768  1.00   21.51 ? 381 THR B CA  1 
ATOM   5592  C  C   . THR B  1 274 ? 40.707  -4.743  26.132  1.00   24.13 ? 381 THR B C   1 
ATOM   5593  O  O   . THR B  1 274 ? 40.561  -4.047  27.149  1.00   22.67 ? 381 THR B O   1 
ATOM   5594  C  CB  . THR B  1 274 ? 42.750  -4.468  24.728  1.00   21.41 ? 381 THR B CB  1 
ATOM   5595  O  OG1 . THR B  1 274 ? 43.990  -5.084  24.368  1.00   17.94 ? 381 THR B OG1 1 
ATOM   5596  C  CG2 . THR B  1 274 ? 42.992  -3.050  25.282  1.00   16.92 ? 381 THR B CG2 1 
ATOM   5597  N  N   . LEU B  1 275 ? 39.705  -5.010  25.307  1.00   22.32 ? 382 LEU B N   1 
ATOM   5598  C  CA  . LEU B  1 275 ? 38.373  -4.500  25.595  1.00   23.49 ? 382 LEU B CA  1 
ATOM   5599  C  C   . LEU B  1 275 ? 37.818  -5.131  26.860  1.00   26.36 ? 382 LEU B C   1 
ATOM   5600  O  O   . LEU B  1 275 ? 37.083  -4.485  27.597  1.00   27.39 ? 382 LEU B O   1 
ATOM   5601  C  CB  . LEU B  1 275 ? 37.411  -4.770  24.442  1.00   19.87 ? 382 LEU B CB  1 
ATOM   5602  C  CG  . LEU B  1 275 ? 37.401  -3.726  23.323  1.00   24.20 ? 382 LEU B CG  1 
ATOM   5603  C  CD1 . LEU B  1 275 ? 36.291  -4.051  22.336  1.00   22.43 ? 382 LEU B CD1 1 
ATOM   5604  C  CD2 . LEU B  1 275 ? 37.187  -2.323  23.922  1.00   22.32 ? 382 LEU B CD2 1 
ATOM   5605  N  N   . GLU B  1 276 ? 38.142  -6.397  27.110  1.00   27.79 ? 383 GLU B N   1 
ATOM   5606  C  CA  . GLU B  1 276 ? 37.655  -7.025  28.327  1.00   28.20 ? 383 GLU B CA  1 
ATOM   5607  C  C   . GLU B  1 276 ? 38.280  -6.291  29.514  1.00   28.29 ? 383 GLU B C   1 
ATOM   5608  O  O   . GLU B  1 276 ? 37.618  -6.057  30.525  1.00   30.30 ? 383 GLU B O   1 
ATOM   5609  C  CB  . GLU B  1 276 ? 38.021  -8.514  28.391  1.00   26.86 ? 383 GLU B CB  1 
ATOM   5610  C  CG  . GLU B  1 276 ? 37.633  -9.131  29.729  1.00   29.46 ? 383 GLU B CG  1 
ATOM   5611  C  CD  . GLU B  1 276 ? 37.890  -10.620 29.816  1.00   32.64 ? 383 GLU B CD  1 
ATOM   5612  O  OE1 . GLU B  1 276 ? 38.702  -11.152 29.032  1.00   31.09 ? 383 GLU B OE1 1 
ATOM   5613  O  OE2 . GLU B  1 276 ? 37.281  -11.260 30.694  1.00   35.15 ? 383 GLU B OE2 1 
ATOM   5614  N  N   . ALA B  1 277 ? 39.551  -5.921  29.383  1.00   26.90 ? 384 ALA B N   1 
ATOM   5615  C  CA  . ALA B  1 277 ? 40.253  -5.212  30.443  1.00   25.02 ? 384 ALA B CA  1 
ATOM   5616  C  C   . ALA B  1 277 ? 39.656  -3.820  30.654  1.00   27.85 ? 384 ALA B C   1 
ATOM   5617  O  O   . ALA B  1 277 ? 39.717  -3.277  31.757  1.00   32.34 ? 384 ALA B O   1 
ATOM   5618  C  CB  . ALA B  1 277 ? 41.729  -5.100  30.112  1.00   22.85 ? 384 ALA B CB  1 
ATOM   5619  N  N   . ASN B  1 278 ? 39.091  -3.235  29.604  1.00   25.04 ? 385 ASN B N   1 
ATOM   5620  C  CA  . ASN B  1 278 ? 38.478  -1.912  29.716  1.00   24.78 ? 385 ASN B CA  1 
ATOM   5621  C  C   . ASN B  1 278 ? 37.447  -1.731  28.604  1.00   27.02 ? 385 ASN B C   1 
ATOM   5622  O  O   . ASN B  1 278 ? 37.779  -1.307  27.494  1.00   26.34 ? 385 ASN B O   1 
ATOM   5623  C  CB  . ASN B  1 278 ? 39.532  -0.804  29.616  1.00   20.74 ? 385 ASN B CB  1 
ATOM   5624  C  CG  . ASN B  1 278 ? 38.963  0.574   29.948  1.00   23.74 ? 385 ASN B CG  1 
ATOM   5625  O  OD1 . ASN B  1 278 ? 37.746  0.796   29.876  1.00   20.20 ? 385 ASN B OD1 1 
ATOM   5626  N  ND2 . ASN B  1 278 ? 39.843  1.510   30.298  1.00   22.72 ? 385 ASN B ND2 1 
ATOM   5627  N  N   . LYS B  1 279 ? 36.197  -2.055  28.913  1.00   27.62 ? 386 LYS B N   1 
ATOM   5628  C  CA  . LYS B  1 279 ? 35.114  -1.960  27.951  1.00   29.31 ? 386 LYS B CA  1 
ATOM   5629  C  C   . LYS B  1 279 ? 34.747  -0.547  27.517  1.00   30.93 ? 386 LYS B C   1 
ATOM   5630  O  O   . LYS B  1 279 ? 33.989  -0.377  26.568  1.00   31.40 ? 386 LYS B O   1 
ATOM   5631  C  CB  . LYS B  1 279 ? 33.877  -2.656  28.513  1.00   31.44 ? 386 LYS B CB  1 
ATOM   5632  C  CG  . LYS B  1 279 ? 34.037  -4.163  28.632  1.00   38.01 ? 386 LYS B CG  1 
ATOM   5633  C  CD  . LYS B  1 279 ? 32.815  -4.818  29.273  1.00   45.56 ? 386 LYS B CD  1 
ATOM   5634  C  CE  . LYS B  1 279 ? 32.963  -6.346  29.364  1.00   48.52 ? 386 LYS B CE  1 
ATOM   5635  N  NZ  . LYS B  1 279 ? 32.997  -6.996  28.030  0.0000 47.36 ? 386 LYS B NZ  1 
ATOM   5636  N  N   . ASN B  1 280 ? 35.286  0.465   28.194  1.00   32.41 ? 387 ASN B N   1 
ATOM   5637  C  CA  . ASN B  1 280 ? 34.956  1.852   27.859  1.00   31.14 ? 387 ASN B CA  1 
ATOM   5638  C  C   . ASN B  1 280 ? 35.923  2.517   26.879  1.00   28.85 ? 387 ASN B C   1 
ATOM   5639  O  O   . ASN B  1 280 ? 35.799  3.699   26.584  1.00   25.11 ? 387 ASN B O   1 
ATOM   5640  C  CB  . ASN B  1 280 ? 34.865  2.685   29.143  1.00   33.98 ? 387 ASN B CB  1 
ATOM   5641  C  CG  . ASN B  1 280 ? 33.737  2.230   30.055  1.00   41.16 ? 387 ASN B CG  1 
ATOM   5642  O  OD1 . ASN B  1 280 ? 33.825  2.338   31.287  1.00   46.55 ? 387 ASN B OD1 1 
ATOM   5643  N  ND2 . ASN B  1 280 ? 32.666  1.720   29.456  1.00   43.19 ? 387 ASN B ND2 1 
ATOM   5644  N  N   . LEU B  1 281 ? 36.883  1.755   26.374  1.00   25.66 ? 388 LEU B N   1 
ATOM   5645  C  CA  . LEU B  1 281 ? 37.848  2.301   25.428  1.00   23.71 ? 388 LEU B CA  1 
ATOM   5646  C  C   . LEU B  1 281 ? 37.150  2.667   24.117  1.00   22.75 ? 388 LEU B C   1 
ATOM   5647  O  O   . LEU B  1 281 ? 36.359  1.889   23.605  1.00   21.78 ? 388 LEU B O   1 
ATOM   5648  C  CB  . LEU B  1 281 ? 38.936  1.261   25.143  1.00   19.11 ? 388 LEU B CB  1 
ATOM   5649  C  CG  . LEU B  1 281 ? 39.806  0.871   26.335  1.00   20.33 ? 388 LEU B CG  1 
ATOM   5650  C  CD1 . LEU B  1 281 ? 40.616  -0.376  26.007  1.00   17.06 ? 388 LEU B CD1 1 
ATOM   5651  C  CD2 . LEU B  1 281 ? 40.717  2.047   26.686  1.00   17.23 ? 388 LEU B CD2 1 
ATOM   5652  N  N   . THR B  1 282 ? 37.425  3.853   23.587  1.00   22.30 ? 389 THR B N   1 
ATOM   5653  C  CA  . THR B  1 282 ? 36.845  4.266   22.310  1.00   19.64 ? 389 THR B CA  1 
ATOM   5654  C  C   . THR B  1 282 ? 37.732  3.722   21.176  1.00   20.68 ? 389 THR B C   1 
ATOM   5655  O  O   . THR B  1 282 ? 38.830  3.206   21.436  1.00   17.91 ? 389 THR B O   1 
ATOM   5656  C  CB  . THR B  1 282 ? 36.819  5.792   22.182  1.00   19.77 ? 389 THR B CB  1 
ATOM   5657  O  OG1 . THR B  1 282 ? 38.162  6.278   22.058  1.00   19.37 ? 389 THR B OG1 1 
ATOM   5658  C  CG2 . THR B  1 282 ? 36.166  6.415   23.423  1.00   18.82 ? 389 THR B CG2 1 
ATOM   5659  N  N   . TRP B  1 283 ? 37.263  3.837   19.929  1.00   18.61 ? 390 TRP B N   1 
ATOM   5660  C  CA  . TRP B  1 283 ? 38.041  3.374   18.793  1.00   17.22 ? 390 TRP B CA  1 
ATOM   5661  C  C   . TRP B  1 283 ? 39.380  4.122   18.729  1.00   19.53 ? 390 TRP B C   1 
ATOM   5662  O  O   . TRP B  1 283 ? 40.385  3.559   18.292  1.00   20.42 ? 390 TRP B O   1 
ATOM   5663  C  CB  . TRP B  1 283 ? 37.267  3.551   17.481  1.00   17.94 ? 390 TRP B CB  1 
ATOM   5664  C  CG  . TRP B  1 283 ? 36.993  4.958   17.087  1.00   15.29 ? 390 TRP B CG  1 
ATOM   5665  C  CD1 . TRP B  1 283 ? 36.024  5.776   17.587  1.00   17.34 ? 390 TRP B CD1 1 
ATOM   5666  C  CD2 . TRP B  1 283 ? 37.711  5.729   16.115  1.00   17.57 ? 390 TRP B CD2 1 
ATOM   5667  N  NE1 . TRP B  1 283 ? 36.091  7.015   16.988  1.00   19.06 ? 390 TRP B NE1 1 
ATOM   5668  C  CE2 . TRP B  1 283 ? 37.116  7.014   16.078  1.00   14.89 ? 390 TRP B CE2 1 
ATOM   5669  C  CE3 . TRP B  1 283 ? 38.798  5.458   15.267  1.00   14.09 ? 390 TRP B CE3 1 
ATOM   5670  C  CZ2 . TRP B  1 283 ? 37.570  8.031   15.229  1.00   13.91 ? 390 TRP B CZ2 1 
ATOM   5671  C  CZ3 . TRP B  1 283 ? 39.251  6.472   14.419  1.00   18.38 ? 390 TRP B CZ3 1 
ATOM   5672  C  CH2 . TRP B  1 283 ? 38.635  7.744   14.408  1.00   15.51 ? 390 TRP B CH2 1 
ATOM   5673  N  N   . ARG B  1 284 ? 39.405  5.379   19.171  1.00   17.34 ? 391 ARG B N   1 
ATOM   5674  C  CA  . ARG B  1 284 ? 40.660  6.141   19.188  1.00   18.76 ? 391 ARG B CA  1 
ATOM   5675  C  C   . ARG B  1 284 ? 41.542  5.701   20.375  1.00   19.19 ? 391 ARG B C   1 
ATOM   5676  O  O   . ARG B  1 284 ? 42.766  5.586   20.238  1.00   17.13 ? 391 ARG B O   1 
ATOM   5677  C  CB  . ARG B  1 284 ? 40.381  7.658   19.244  1.00   19.44 ? 391 ARG B CB  1 
ATOM   5678  C  CG  . ARG B  1 284 ? 40.015  8.263   17.876  1.00   17.00 ? 391 ARG B CG  1 
ATOM   5679  C  CD  . ARG B  1 284 ? 39.397  9.646   18.008  1.00   18.03 ? 391 ARG B CD  1 
ATOM   5680  N  NE  . ARG B  1 284 ? 40.294  10.603  18.639  1.00   19.11 ? 391 ARG B NE  1 
ATOM   5681  C  CZ  . ARG B  1 284 ? 39.991  11.315  19.724  1.00   16.97 ? 391 ARG B CZ  1 
ATOM   5682  N  NH1 . ARG B  1 284 ? 38.809  11.179  20.305  1.00   15.31 ? 391 ARG B NH1 1 
ATOM   5683  N  NH2 . ARG B  1 284 ? 40.874  12.166  20.231  1.00   13.91 ? 391 ARG B NH2 1 
ATOM   5684  N  N   . ASP B  1 285 ? 40.928  5.445   21.533  1.00   20.08 ? 392 ASP B N   1 
ATOM   5685  C  CA  . ASP B  1 285 ? 41.694  4.977   22.693  1.00   21.24 ? 392 ASP B CA  1 
ATOM   5686  C  C   . ASP B  1 285 ? 42.482  3.731   22.278  1.00   20.83 ? 392 ASP B C   1 
ATOM   5687  O  O   . ASP B  1 285 ? 43.670  3.592   22.575  1.00   22.65 ? 392 ASP B O   1 
ATOM   5688  C  CB  . ASP B  1 285 ? 40.769  4.580   23.855  1.00   22.28 ? 392 ASP B CB  1 
ATOM   5689  C  CG  . ASP B  1 285 ? 40.189  5.776   24.595  1.00   20.48 ? 392 ASP B CG  1 
ATOM   5690  O  OD1 . ASP B  1 285 ? 40.906  6.785   24.767  1.00   22.41 ? 392 ASP B OD1 1 
ATOM   5691  O  OD2 . ASP B  1 285 ? 39.020  5.691   25.030  1.00   21.13 ? 392 ASP B OD2 1 
ATOM   5692  N  N   . MET B  1 286 ? 41.808  2.824   21.582  1.00   21.46 ? 393 MET B N   1 
ATOM   5693  C  CA  . MET B  1 286 ? 42.440  1.583   21.160  1.00   19.38 ? 393 MET B CA  1 
ATOM   5694  C  C   . MET B  1 286 ? 43.681  1.830   20.309  1.00   18.62 ? 393 MET B C   1 
ATOM   5695  O  O   . MET B  1 286 ? 44.701  1.178   20.506  1.00   18.55 ? 393 MET B O   1 
ATOM   5696  C  CB  . MET B  1 286 ? 41.445  0.711   20.395  1.00   16.90 ? 393 MET B CB  1 
ATOM   5697  C  CG  . MET B  1 286 ? 41.924  -0.731  20.197  1.00   19.72 ? 393 MET B CG  1 
ATOM   5698  S  SD  . MET B  1 286 ? 42.272  -1.599  21.783  1.00   21.25 ? 393 MET B SD  1 
ATOM   5699  C  CE  . MET B  1 286 ? 40.610  -1.819  22.442  1.00   20.92 ? 393 MET B CE  1 
ATOM   5700  N  N   . GLN B  1 287 ? 43.607  2.773   19.371  1.00   16.56 ? 394 GLN B N   1 
ATOM   5701  C  CA  . GLN B  1 287 ? 44.766  3.037   18.537  1.00   16.92 ? 394 GLN B CA  1 
ATOM   5702  C  C   . GLN B  1 287 ? 45.903  3.629   19.375  1.00   16.92 ? 394 GLN B C   1 
ATOM   5703  O  O   . GLN B  1 287 ? 47.078  3.325   19.144  1.00   16.07 ? 394 GLN B O   1 
ATOM   5704  C  CB  . GLN B  1 287 ? 44.373  3.932   17.352  1.00   14.77 ? 394 GLN B CB  1 
ATOM   5705  C  CG  . GLN B  1 287 ? 43.420  3.194   16.419  1.00   16.72 ? 394 GLN B CG  1 
ATOM   5706  C  CD  . GLN B  1 287 ? 43.227  3.849   15.067  1.00   19.43 ? 394 GLN B CD  1 
ATOM   5707  O  OE1 . GLN B  1 287 ? 44.150  4.449   14.510  1.00   15.87 ? 394 GLN B OE1 1 
ATOM   5708  N  NE2 . GLN B  1 287 ? 42.017  3.703   14.508  1.00   17.01 ? 394 GLN B NE2 1 
ATOM   5709  N  N   . HIS B  1 288 ? 45.555  4.454   20.365  1.00   15.08 ? 395 HIS B N   1 
ATOM   5710  C  CA  . HIS B  1 288 ? 46.568  5.024   21.253  1.00   16.60 ? 395 HIS B CA  1 
ATOM   5711  C  C   . HIS B  1 288 ? 47.315  3.897   21.989  1.00   16.40 ? 395 HIS B C   1 
ATOM   5712  O  O   . HIS B  1 288 ? 48.542  3.897   22.055  1.00   19.71 ? 395 HIS B O   1 
ATOM   5713  C  CB  . HIS B  1 288 ? 45.916  5.951   22.283  1.00   15.97 ? 395 HIS B CB  1 
ATOM   5714  C  CG  . HIS B  1 288 ? 45.688  7.340   21.784  1.00   22.51 ? 395 HIS B CG  1 
ATOM   5715  N  ND1 . HIS B  1 288 ? 46.693  8.284   21.734  1.00   21.85 ? 395 HIS B ND1 1 
ATOM   5716  C  CD2 . HIS B  1 288 ? 44.577  7.942   21.291  1.00   21.10 ? 395 HIS B CD2 1 
ATOM   5717  C  CE1 . HIS B  1 288 ? 46.210  9.408   21.232  1.00   24.60 ? 395 HIS B CE1 1 
ATOM   5718  N  NE2 . HIS B  1 288 ? 44.929  9.229   20.957  1.00   21.46 ? 395 HIS B NE2 1 
ATOM   5719  N  N   . LEU B  1 289 ? 46.565  2.945   22.537  1.00   15.16 ? 396 LEU B N   1 
ATOM   5720  C  CA  . LEU B  1 289 ? 47.166  1.846   23.277  1.00   18.81 ? 396 LEU B CA  1 
ATOM   5721  C  C   . LEU B  1 289 ? 48.160  1.087   22.407  1.00   19.68 ? 396 LEU B C   1 
ATOM   5722  O  O   . LEU B  1 289 ? 49.255  0.741   22.850  1.00   19.02 ? 396 LEU B O   1 
ATOM   5723  C  CB  . LEU B  1 289 ? 46.080  0.888   23.800  1.00   16.17 ? 396 LEU B CB  1 
ATOM   5724  C  CG  . LEU B  1 289 ? 45.112  1.419   24.868  1.00   19.27 ? 396 LEU B CG  1 
ATOM   5725  C  CD1 . LEU B  1 289 ? 44.158  0.312   25.263  1.00   17.43 ? 396 LEU B CD1 1 
ATOM   5726  C  CD2 . LEU B  1 289 ? 45.866  1.892   26.093  1.00   18.01 ? 396 LEU B CD2 1 
ATOM   5727  N  N   . VAL B  1 290 ? 47.778  0.836   21.162  1.00   20.15 ? 397 VAL B N   1 
ATOM   5728  C  CA  . VAL B  1 290 ? 48.647  0.123   20.245  1.00   16.96 ? 397 VAL B CA  1 
ATOM   5729  C  C   . VAL B  1 290 ? 49.947  0.879   20.010  1.00   16.84 ? 397 VAL B C   1 
ATOM   5730  O  O   . VAL B  1 290 ? 51.035  0.299   20.044  1.00   16.55 ? 397 VAL B O   1 
ATOM   5731  C  CB  . VAL B  1 290 ? 47.934  -0.106  18.891  1.00   16.01 ? 397 VAL B CB  1 
ATOM   5732  C  CG1 . VAL B  1 290 ? 48.919  -0.644  17.856  1.00   11.66 ? 397 VAL B CG1 1 
ATOM   5733  C  CG2 . VAL B  1 290 ? 46.771  -1.073  19.086  1.00   13.52 ? 397 VAL B CG2 1 
ATOM   5734  N  N   . VAL B  1 291 ? 49.830  2.177   19.764  1.00   17.85 ? 398 VAL B N   1 
ATOM   5735  C  CA  . VAL B  1 291 ? 51.005  2.995   19.502  1.00   17.49 ? 398 VAL B CA  1 
ATOM   5736  C  C   . VAL B  1 291 ? 51.942  2.979   20.693  1.00   20.44 ? 398 VAL B C   1 
ATOM   5737  O  O   . VAL B  1 291 ? 53.158  2.837   20.546  1.00   18.67 ? 398 VAL B O   1 
ATOM   5738  C  CB  . VAL B  1 291 ? 50.615  4.461   19.203  1.00   17.61 ? 398 VAL B CB  1 
ATOM   5739  C  CG1 . VAL B  1 291 ? 51.866  5.343   19.128  1.00   13.02 ? 398 VAL B CG1 1 
ATOM   5740  C  CG2 . VAL B  1 291 ? 49.849  4.527   17.905  1.00   13.88 ? 398 VAL B CG2 1 
ATOM   5741  N  N   . GLN B  1 292 ? 51.368  3.110   21.882  1.00   20.08 ? 399 GLN B N   1 
ATOM   5742  C  CA  . GLN B  1 292 ? 52.173  3.154   23.084  1.00   21.58 ? 399 GLN B CA  1 
ATOM   5743  C  C   . GLN B  1 292 ? 52.813  1.852   23.537  1.00   21.88 ? 399 GLN B C   1 
ATOM   5744  O  O   . GLN B  1 292 ? 53.938  1.857   24.021  1.00   23.99 ? 399 GLN B O   1 
ATOM   5745  C  CB  . GLN B  1 292 ? 51.351  3.738   24.231  1.00   22.93 ? 399 GLN B CB  1 
ATOM   5746  C  CG  . GLN B  1 292 ? 51.031  5.211   24.035  1.00   24.34 ? 399 GLN B CG  1 
ATOM   5747  C  CD  . GLN B  1 292 ? 50.683  5.915   25.334  1.00   27.58 ? 399 GLN B CD  1 
ATOM   5748  O  OE1 . GLN B  1 292 ? 50.959  5.408   26.419  1.00   30.34 ? 399 GLN B OE1 1 
ATOM   5749  N  NE2 . GLN B  1 292 ? 50.094  7.104   25.228  1.00   24.22 ? 399 GLN B NE2 1 
ATOM   5750  N  N   . THR B  1 293 ? 52.116  0.738   23.360  1.00   20.69 ? 400 THR B N   1 
ATOM   5751  C  CA  . THR B  1 293 ? 52.623  -0.536  23.823  1.00   20.12 ? 400 THR B CA  1 
ATOM   5752  C  C   . THR B  1 293 ? 53.354  -1.424  22.832  1.00   22.43 ? 400 THR B C   1 
ATOM   5753  O  O   . THR B  1 293 ? 54.010  -2.377  23.248  1.00   23.41 ? 400 THR B O   1 
ATOM   5754  C  CB  . THR B  1 293 ? 51.489  -1.363  24.450  1.00   20.96 ? 400 THR B CB  1 
ATOM   5755  O  OG1 . THR B  1 293 ? 50.534  -1.701  23.436  1.00   21.47 ? 400 THR B OG1 1 
ATOM   5756  C  CG2 . THR B  1 293 ? 50.784  -0.560  25.549  1.00   17.49 ? 400 THR B CG2 1 
ATOM   5757  N  N   . SER B  1 294 ? 53.271  -1.130  21.538  1.00   22.32 ? 401 SER B N   1 
ATOM   5758  C  CA  . SER B  1 294 ? 53.941  -1.997  20.566  1.00   22.01 ? 401 SER B CA  1 
ATOM   5759  C  C   . SER B  1 294 ? 55.458  -1.925  20.642  1.00   24.73 ? 401 SER B C   1 
ATOM   5760  O  O   . SER B  1 294 ? 56.037  -0.860  20.858  1.00   28.42 ? 401 SER B O   1 
ATOM   5761  C  CB  . SER B  1 294 ? 53.443  -1.711  19.157  1.00   18.87 ? 401 SER B CB  1 
ATOM   5762  O  OG  . SER B  1 294 ? 52.058  -2.000  19.091  1.00   15.55 ? 401 SER B OG  1 
ATOM   5763  N  N   . LYS B  1 295 ? 56.085  -3.091  20.484  1.00   24.93 ? 402 LYS B N   1 
ATOM   5764  C  CA  . LYS B  1 295 ? 57.531  -3.231  20.592  1.00   25.23 ? 402 LYS B CA  1 
ATOM   5765  C  C   . LYS B  1 295 ? 58.269  -3.461  19.282  1.00   25.49 ? 402 LYS B C   1 
ATOM   5766  O  O   . LYS B  1 295 ? 57.949  -4.378  18.524  1.00   22.58 ? 402 LYS B O   1 
ATOM   5767  C  CB  . LYS B  1 295 ? 57.865  -4.401  21.527  1.00   27.95 ? 402 LYS B CB  1 
ATOM   5768  C  CG  . LYS B  1 295 ? 57.167  -4.389  22.881  1.00   29.06 ? 402 LYS B CG  1 
ATOM   5769  C  CD  . LYS B  1 295 ? 57.642  -3.230  23.761  1.00   33.72 ? 402 LYS B CD  1 
ATOM   5770  C  CE  . LYS B  1 295 ? 57.077  -3.342  25.179  1.00   28.73 ? 402 LYS B CE  1 
ATOM   5771  N  NZ  . LYS B  1 295 ? 55.585  -3.391  25.214  1.00   25.93 ? 402 LYS B NZ  1 
ATOM   5772  N  N   . PRO B  1 296 ? 59.281  -2.631  19.006  1.00   26.32 ? 403 PRO B N   1 
ATOM   5773  C  CA  . PRO B  1 296 ? 60.069  -2.766  17.781  1.00   28.58 ? 403 PRO B CA  1 
ATOM   5774  C  C   . PRO B  1 296 ? 61.117  -3.860  17.979  1.00   32.85 ? 403 PRO B C   1 
ATOM   5775  O  O   . PRO B  1 296 ? 61.361  -4.671  17.091  1.00   34.56 ? 403 PRO B O   1 
ATOM   5776  C  CB  . PRO B  1 296 ? 60.730  -1.396  17.631  1.00   28.25 ? 403 PRO B CB  1 
ATOM   5777  C  CG  . PRO B  1 296 ? 59.866  -0.484  18.432  1.00   28.53 ? 403 PRO B CG  1 
ATOM   5778  C  CD  . PRO B  1 296 ? 59.511  -1.318  19.624  1.00   28.05 ? 403 PRO B CD  1 
ATOM   5779  N  N   . ALA B  1 297 ? 61.723  -3.873  19.162  1.00   36.09 ? 404 ALA B N   1 
ATOM   5780  C  CA  . ALA B  1 297 ? 62.774  -4.827  19.502  1.00   40.30 ? 404 ALA B CA  1 
ATOM   5781  C  C   . ALA B  1 297 ? 62.571  -6.214  18.914  1.00   39.94 ? 404 ALA B C   1 
ATOM   5782  O  O   . ALA B  1 297 ? 61.473  -6.774  18.972  1.00   42.85 ? 404 ALA B O   1 
ATOM   5783  C  CB  . ALA B  1 297 ? 62.920  -4.919  21.017  1.00   44.60 ? 404 ALA B CB  1 
ATOM   5784  N  N   . HIS B  1 298 ? 63.649  -6.747  18.347  1.00   38.30 ? 405 HIS B N   1 
ATOM   5785  C  CA  . HIS B  1 298 ? 63.675  -8.073  17.725  1.00   39.53 ? 405 HIS B CA  1 
ATOM   5786  C  C   . HIS B  1 298 ? 63.290  -8.082  16.247  1.00   37.70 ? 405 HIS B C   1 
ATOM   5787  O  O   . HIS B  1 298 ? 63.674  -8.990  15.512  1.00   41.33 ? 405 HIS B O   1 
ATOM   5788  C  CB  . HIS B  1 298 ? 62.780  -9.054  18.487  1.00   40.68 ? 405 HIS B CB  1 
ATOM   5789  C  CG  . HIS B  1 298 ? 63.111  -9.164  19.940  0.0000 40.33 ? 405 HIS B CG  1 
ATOM   5790  N  ND1 . HIS B  1 298 ? 64.387  -9.417  20.393  0.0000 40.53 ? 405 HIS B ND1 1 
ATOM   5791  C  CD2 . HIS B  1 298 ? 62.335  -9.046  21.043  0.0000 40.53 ? 405 HIS B CD2 1 
ATOM   5792  C  CE1 . HIS B  1 298 ? 64.384  -9.447  21.714  0.0000 40.51 ? 405 HIS B CE1 1 
ATOM   5793  N  NE2 . HIS B  1 298 ? 63.151  -9.226  22.133  0.0000 40.51 ? 405 HIS B NE2 1 
ATOM   5794  N  N   . LEU B  1 299 ? 62.541  -7.075  15.811  1.00   32.91 ? 406 LEU B N   1 
ATOM   5795  C  CA  . LEU B  1 299 ? 62.126  -6.978  14.416  1.00   28.40 ? 406 LEU B CA  1 
ATOM   5796  C  C   . LEU B  1 299 ? 63.210  -6.301  13.576  1.00   26.21 ? 406 LEU B C   1 
ATOM   5797  O  O   . LEU B  1 299 ? 63.692  -5.222  13.920  1.00   22.68 ? 406 LEU B O   1 
ATOM   5798  C  CB  . LEU B  1 299 ? 60.809  -6.202  14.319  1.00   28.27 ? 406 LEU B CB  1 
ATOM   5799  C  CG  . LEU B  1 299 ? 59.520  -7.038  14.302  1.00   31.04 ? 406 LEU B CG  1 
ATOM   5800  C  CD1 . LEU B  1 299 ? 59.611  -8.172  15.298  1.00   29.55 ? 406 LEU B CD1 1 
ATOM   5801  C  CD2 . LEU B  1 299 ? 58.323  -6.143  14.601  1.00   29.78 ? 406 LEU B CD2 1 
ATOM   5802  N  N   . ASN B  1 300 ? 63.594  -6.934  12.472  1.00   22.56 ? 407 ASN B N   1 
ATOM   5803  C  CA  . ASN B  1 300 ? 64.630  -6.372  11.627  1.00   23.35 ? 407 ASN B CA  1 
ATOM   5804  C  C   . ASN B  1 300 ? 64.003  -5.606  10.480  1.00   24.36 ? 407 ASN B C   1 
ATOM   5805  O  O   . ASN B  1 300 ? 63.075  -6.095  9.833   1.00   20.64 ? 407 ASN B O   1 
ATOM   5806  C  CB  . ASN B  1 300 ? 65.530  -7.487  11.098  1.00   25.88 ? 407 ASN B CB  1 
ATOM   5807  C  CG  . ASN B  1 300 ? 66.133  -8.329  12.231  1.00   33.39 ? 407 ASN B CG  1 
ATOM   5808  O  OD1 . ASN B  1 300 ? 66.936  -7.830  13.035  1.00   33.88 ? 407 ASN B OD1 1 
ATOM   5809  N  ND2 . ASN B  1 300 ? 65.735  -9.607  12.308  1.00   32.53 ? 407 ASN B ND2 1 
ATOM   5810  N  N   . ALA B  1 301 ? 64.509  -4.399  10.247  1.00   22.66 ? 408 ALA B N   1 
ATOM   5811  C  CA  . ALA B  1 301 ? 64.024  -3.558  9.165   1.00   24.23 ? 408 ALA B CA  1 
ATOM   5812  C  C   . ALA B  1 301 ? 65.107  -2.561  8.806   1.00   26.09 ? 408 ALA B C   1 
ATOM   5813  O  O   . ALA B  1 301 ? 65.898  -2.140  9.653   1.00   26.43 ? 408 ALA B O   1 
ATOM   5814  C  CB  . ALA B  1 301 ? 62.768  -2.831  9.580   1.00   20.05 ? 408 ALA B CB  1 
ATOM   5815  N  N   . ASN B  1 302 ? 65.125  -2.173  7.541   1.00   29.12 ? 409 ASN B N   1 
ATOM   5816  C  CA  . ASN B  1 302 ? 66.120  -1.242  7.040   1.00   29.82 ? 409 ASN B CA  1 
ATOM   5817  C  C   . ASN B  1 302 ? 65.729  0.208   7.324   1.00   28.95 ? 409 ASN B C   1 
ATOM   5818  O  O   . ASN B  1 302 ? 66.557  1.107   7.199   1.00   30.79 ? 409 ASN B O   1 
ATOM   5819  C  CB  . ASN B  1 302 ? 66.261  -1.452  5.530   1.00   35.41 ? 409 ASN B CB  1 
ATOM   5820  C  CG  . ASN B  1 302 ? 67.603  -1.005  4.996   1.00   39.32 ? 409 ASN B CG  1 
ATOM   5821  O  OD1 . ASN B  1 302 ? 68.044  0.116   5.249   0.0000 37.82 ? 409 ASN B OD1 1 
ATOM   5822  N  ND2 . ASN B  1 302 ? 68.253  -1.876  4.233   0.0000 37.82 ? 409 ASN B ND2 1 
ATOM   5823  N  N   . ASP B  1 303 ? 64.484  0.446   7.729   1.00   24.11 ? 410 ASP B N   1 
ATOM   5824  C  CA  . ASP B  1 303 ? 64.060  1.829   7.940   1.00   23.05 ? 410 ASP B CA  1 
ATOM   5825  C  C   . ASP B  1 303 ? 63.581  2.243   9.327   1.00   20.57 ? 410 ASP B C   1 
ATOM   5826  O  O   . ASP B  1 303 ? 62.775  3.153   9.436   1.00   21.19 ? 410 ASP B O   1 
ATOM   5827  C  CB  . ASP B  1 303 ? 62.976  2.170   6.915   1.00   20.75 ? 410 ASP B CB  1 
ATOM   5828  C  CG  . ASP B  1 303 ? 61.679  1.430   7.188   1.00   22.06 ? 410 ASP B CG  1 
ATOM   5829  O  OD1 . ASP B  1 303 ? 61.745  0.355   7.831   1.00   14.97 ? 410 ASP B OD1 1 
ATOM   5830  O  OD2 . ASP B  1 303 ? 60.603  1.924   6.764   1.00   17.86 ? 410 ASP B OD2 1 
ATOM   5831  N  N   . TRP B  1 304 ? 64.039  1.584   10.385  1.00   19.21 ? 411 TRP B N   1 
ATOM   5832  C  CA  . TRP B  1 304 ? 63.624  2.003   11.719  1.00   20.26 ? 411 TRP B CA  1 
ATOM   5833  C  C   . TRP B  1 304 ? 64.080  3.451   11.935  1.00   19.21 ? 411 TRP B C   1 
ATOM   5834  O  O   . TRP B  1 304 ? 65.229  3.787   11.703  1.00   19.05 ? 411 TRP B O   1 
ATOM   5835  C  CB  . TRP B  1 304 ? 64.261  1.122   12.803  1.00   18.42 ? 411 TRP B CB  1 
ATOM   5836  C  CG  . TRP B  1 304 ? 63.570  -0.179  13.031  1.00   19.17 ? 411 TRP B CG  1 
ATOM   5837  C  CD1 . TRP B  1 304 ? 64.101  -1.433  12.886  1.00   20.97 ? 411 TRP B CD1 1 
ATOM   5838  C  CD2 . TRP B  1 304 ? 62.225  -0.362  13.487  1.00   18.45 ? 411 TRP B CD2 1 
ATOM   5839  N  NE1 . TRP B  1 304 ? 63.162  -2.388  13.232  1.00   18.86 ? 411 TRP B NE1 1 
ATOM   5840  C  CE2 . TRP B  1 304 ? 62.005  -1.754  13.607  1.00   20.56 ? 411 TRP B CE2 1 
ATOM   5841  C  CE3 . TRP B  1 304 ? 61.181  0.518   13.810  1.00   20.85 ? 411 TRP B CE3 1 
ATOM   5842  C  CZ2 . TRP B  1 304 ? 60.781  -2.288  14.041  1.00   20.24 ? 411 TRP B CZ2 1 
ATOM   5843  C  CZ3 . TRP B  1 304 ? 59.962  -0.016  14.244  1.00   20.48 ? 411 TRP B CZ3 1 
ATOM   5844  C  CH2 . TRP B  1 304 ? 59.779  -1.404  14.355  1.00   19.18 ? 411 TRP B CH2 1 
ATOM   5845  N  N   . ALA B  1 305 ? 63.182  4.315   12.373  1.00   19.63 ? 412 ALA B N   1 
ATOM   5846  C  CA  . ALA B  1 305 ? 63.555  5.701   12.614  1.00   21.56 ? 412 ALA B CA  1 
ATOM   5847  C  C   . ALA B  1 305 ? 62.841  6.167   13.855  1.00   20.58 ? 412 ALA B C   1 
ATOM   5848  O  O   . ALA B  1 305 ? 61.746  5.693   14.151  1.00   24.65 ? 412 ALA B O   1 
ATOM   5849  C  CB  . ALA B  1 305 ? 63.163  6.576   11.420  1.00   19.34 ? 412 ALA B CB  1 
ATOM   5850  N  N   . THR B  1 306 ? 63.465  7.084   14.586  1.00   19.35 ? 413 THR B N   1 
ATOM   5851  C  CA  . THR B  1 306 ? 62.869  7.630   15.800  1.00   19.11 ? 413 THR B CA  1 
ATOM   5852  C  C   . THR B  1 306 ? 62.084  8.894   15.445  1.00   19.57 ? 413 THR B C   1 
ATOM   5853  O  O   . THR B  1 306 ? 62.617  9.809   14.819  1.00   23.08 ? 413 THR B O   1 
ATOM   5854  C  CB  . THR B  1 306 ? 63.953  7.985   16.821  1.00   18.06 ? 413 THR B CB  1 
ATOM   5855  O  OG1 . THR B  1 306 ? 64.795  6.846   17.011  1.00   19.43 ? 413 THR B OG1 1 
ATOM   5856  C  CG2 . THR B  1 306 ? 63.323  8.384   18.162  1.00   17.11 ? 413 THR B CG2 1 
ATOM   5857  N  N   . ASN B  1 307 ? 60.818  8.950   15.842  1.00   18.20 ? 414 ASN B N   1 
ATOM   5858  C  CA  . ASN B  1 307 ? 60.014  10.114  15.519  1.00   18.41 ? 414 ASN B CA  1 
ATOM   5859  C  C   . ASN B  1 307 ? 60.163  11.220  16.561  1.00   20.32 ? 414 ASN B C   1 
ATOM   5860  O  O   . ASN B  1 307 ? 60.954  11.098  17.505  1.00   17.98 ? 414 ASN B O   1 
ATOM   5861  C  CB  . ASN B  1 307 ? 58.539  9.721   15.350  1.00   17.52 ? 414 ASN B CB  1 
ATOM   5862  C  CG  . ASN B  1 307 ? 57.903  9.276   16.637  1.00   20.76 ? 414 ASN B CG  1 
ATOM   5863  O  OD1 . ASN B  1 307 ? 58.469  9.449   17.718  1.00   19.90 ? 414 ASN B OD1 1 
ATOM   5864  N  ND2 . ASN B  1 307 ? 56.700  8.709   16.536  1.00   19.18 ? 414 ASN B ND2 1 
ATOM   5865  N  N   . GLY B  1 308 ? 59.402  12.297  16.366  1.00   22.19 ? 415 GLY B N   1 
ATOM   5866  C  CA  . GLY B  1 308 ? 59.451  13.455  17.239  1.00   19.43 ? 415 GLY B CA  1 
ATOM   5867  C  C   . GLY B  1 308 ? 59.234  13.196  18.711  1.00   21.05 ? 415 GLY B C   1 
ATOM   5868  O  O   . GLY B  1 308 ? 59.621  14.015  19.537  1.00   21.13 ? 415 GLY B O   1 
ATOM   5869  N  N   . VAL B  1 309 ? 58.620  12.072  19.063  1.00   19.85 ? 416 VAL B N   1 
ATOM   5870  C  CA  . VAL B  1 309 ? 58.403  11.800  20.473  1.00   20.37 ? 416 VAL B CA  1 
ATOM   5871  C  C   . VAL B  1 309 ? 59.196  10.618  21.022  1.00   21.83 ? 416 VAL B C   1 
ATOM   5872  O  O   . VAL B  1 309 ? 58.861  10.080  22.072  1.00   23.78 ? 416 VAL B O   1 
ATOM   5873  C  CB  . VAL B  1 309 ? 56.904  11.623  20.785  1.00   20.12 ? 416 VAL B CB  1 
ATOM   5874  C  CG1 . VAL B  1 309 ? 56.177  12.944  20.526  1.00   17.05 ? 416 VAL B CG1 1 
ATOM   5875  C  CG2 . VAL B  1 309 ? 56.309  10.506  19.937  1.00   18.04 ? 416 VAL B CG2 1 
ATOM   5876  N  N   . GLY B  1 310 ? 60.248  10.216  20.311  1.00   20.59 ? 417 GLY B N   1 
ATOM   5877  C  CA  . GLY B  1 310 ? 61.090  9.133   20.789  1.00   19.69 ? 417 GLY B CA  1 
ATOM   5878  C  C   . GLY B  1 310 ? 60.653  7.704   20.519  1.00   21.71 ? 417 GLY B C   1 
ATOM   5879  O  O   . GLY B  1 310 ? 61.208  6.758   21.090  1.00   21.97 ? 417 GLY B O   1 
ATOM   5880  N  N   . ARG B  1 311 ? 59.660  7.517   19.663  1.00   19.74 ? 418 ARG B N   1 
ATOM   5881  C  CA  . ARG B  1 311 ? 59.223  6.162   19.373  1.00   20.96 ? 418 ARG B CA  1 
ATOM   5882  C  C   . ARG B  1 311 ? 59.790  5.720   18.035  1.00   20.21 ? 418 ARG B C   1 
ATOM   5883  O  O   . ARG B  1 311 ? 59.939  6.524   17.116  1.00   22.58 ? 418 ARG B O   1 
ATOM   5884  C  CB  . ARG B  1 311 ? 57.677  6.066   19.396  1.00   18.23 ? 418 ARG B CB  1 
ATOM   5885  C  CG  . ARG B  1 311 ? 57.099  6.153   20.821  1.00   24.91 ? 418 ARG B CG  1 
ATOM   5886  C  CD  . ARG B  1 311 ? 55.616  5.731   20.984  1.00   22.92 ? 418 ARG B CD  1 
ATOM   5887  N  NE  . ARG B  1 311 ? 54.705  6.825   20.686  1.00   30.05 ? 418 ARG B NE  1 
ATOM   5888  C  CZ  . ARG B  1 311 ? 53.928  7.455   21.572  1.00   29.53 ? 418 ARG B CZ  1 
ATOM   5889  N  NH1 . ARG B  1 311 ? 53.153  8.441   21.150  1.00   24.68 ? 418 ARG B NH1 1 
ATOM   5890  N  NH2 . ARG B  1 311 ? 53.905  7.114   22.859  1.00   21.21 ? 418 ARG B NH2 1 
ATOM   5891  N  N   . LYS B  1 312 ? 60.145  4.443   17.947  1.00   21.69 ? 419 LYS B N   1 
ATOM   5892  C  CA  . LYS B  1 312 ? 60.682  3.876   16.709  1.00   23.61 ? 419 LYS B CA  1 
ATOM   5893  C  C   . LYS B  1 312 ? 59.537  3.490   15.776  1.00   22.13 ? 419 LYS B C   1 
ATOM   5894  O  O   . LYS B  1 312 ? 58.551  2.895   16.209  1.00   21.28 ? 419 LYS B O   1 
ATOM   5895  C  CB  . LYS B  1 312 ? 61.490  2.607   16.993  1.00   23.63 ? 419 LYS B CB  1 
ATOM   5896  C  CG  . LYS B  1 312 ? 62.774  2.793   17.732  1.00   26.60 ? 419 LYS B CG  1 
ATOM   5897  C  CD  . LYS B  1 312 ? 63.850  3.351   16.837  1.00   29.89 ? 419 LYS B CD  1 
ATOM   5898  C  CE  . LYS B  1 312 ? 65.143  3.535   17.626  1.00   34.77 ? 419 LYS B CE  1 
ATOM   5899  N  NZ  . LYS B  1 312 ? 64.952  4.447   18.815  1.00   34.57 ? 419 LYS B NZ  1 
ATOM   5900  N  N   . VAL B  1 313 ? 59.664  3.826   14.500  1.00   22.56 ? 420 VAL B N   1 
ATOM   5901  C  CA  . VAL B  1 313 ? 58.644  3.462   13.525  1.00   22.57 ? 420 VAL B CA  1 
ATOM   5902  C  C   . VAL B  1 313 ? 59.289  2.963   12.241  1.00   22.87 ? 420 VAL B C   1 
ATOM   5903  O  O   . VAL B  1 313 ? 60.369  3.418   11.851  1.00   22.64 ? 420 VAL B O   1 
ATOM   5904  C  CB  . VAL B  1 313 ? 57.718  4.652   13.161  1.00   23.56 ? 420 VAL B CB  1 
ATOM   5905  C  CG1 . VAL B  1 313 ? 56.796  4.965   14.309  1.00   28.68 ? 420 VAL B CG1 1 
ATOM   5906  C  CG2 . VAL B  1 313 ? 58.551  5.888   12.800  1.00   27.46 ? 420 VAL B CG2 1 
ATOM   5907  N  N   . SER B  1 314 ? 58.612  2.023   11.596  1.00   19.14 ? 421 SER B N   1 
ATOM   5908  C  CA  . SER B  1 314 ? 59.063  1.454   10.339  1.00   18.64 ? 421 SER B CA  1 
ATOM   5909  C  C   . SER B  1 314 ? 57.860  1.363   9.399   1.00   17.75 ? 421 SER B C   1 
ATOM   5910  O  O   . SER B  1 314 ? 56.739  1.119   9.832   1.00   18.86 ? 421 SER B O   1 
ATOM   5911  C  CB  . SER B  1 314 ? 59.636  0.053   10.577  1.00   17.26 ? 421 SER B CB  1 
ATOM   5912  O  OG  . SER B  1 314 ? 59.872  -0.607  9.353   1.00   14.74 ? 421 SER B OG  1 
ATOM   5913  N  N   . HIS B  1 315 ? 58.086  1.561   8.109   1.00   20.51 ? 422 HIS B N   1 
ATOM   5914  C  CA  . HIS B  1 315 ? 56.998  1.468   7.146   1.00   18.12 ? 422 HIS B CA  1 
ATOM   5915  C  C   . HIS B  1 315 ? 56.586  0.009   6.934   1.00   17.33 ? 422 HIS B C   1 
ATOM   5916  O  O   . HIS B  1 315 ? 55.532  -0.273  6.348   1.00   19.44 ? 422 HIS B O   1 
ATOM   5917  C  CB  . HIS B  1 315 ? 57.415  2.119   5.829   1.00   16.90 ? 422 HIS B CB  1 
ATOM   5918  C  CG  . HIS B  1 315 ? 57.613  3.600   5.934   1.00   19.32 ? 422 HIS B CG  1 
ATOM   5919  N  ND1 . HIS B  1 315 ? 58.659  4.162   6.635   1.00   19.28 ? 422 HIS B ND1 1 
ATOM   5920  C  CD2 . HIS B  1 315 ? 56.867  4.636   5.473   1.00   19.92 ? 422 HIS B CD2 1 
ATOM   5921  C  CE1 . HIS B  1 315 ? 58.548  5.480   6.602   1.00   18.55 ? 422 HIS B CE1 1 
ATOM   5922  N  NE2 . HIS B  1 315 ? 57.470  5.795   5.905   1.00   18.59 ? 422 HIS B NE2 1 
ATOM   5923  N  N   . SER B  1 316 ? 57.407  -0.919  7.420   1.00   14.22 ? 423 SER B N   1 
ATOM   5924  C  CA  . SER B  1 316 ? 57.089  -2.343  7.298   1.00   17.58 ? 423 SER B CA  1 
ATOM   5925  C  C   . SER B  1 316 ? 56.329  -2.859  8.512   1.00   18.86 ? 423 SER B C   1 
ATOM   5926  O  O   . SER B  1 316 ? 55.579  -3.851  8.417   1.00   19.56 ? 423 SER B O   1 
ATOM   5927  C  CB  . SER B  1 316 ? 58.362  -3.195  7.170   1.00   14.51 ? 423 SER B CB  1 
ATOM   5928  O  OG  . SER B  1 316 ? 58.875  -3.170  5.853   1.00   19.56 ? 423 SER B OG  1 
ATOM   5929  N  N   . TYR B  1 317 ? 56.505  -2.182  9.644   1.00   16.05 ? 424 TYR B N   1 
ATOM   5930  C  CA  . TYR B  1 317 ? 55.902  -2.641  10.891  1.00   19.32 ? 424 TYR B CA  1 
ATOM   5931  C  C   . TYR B  1 317 ? 55.067  -1.649  11.695  1.00   19.41 ? 424 TYR B C   1 
ATOM   5932  O  O   . TYR B  1 317 ? 54.480  -2.017  12.712  1.00   22.76 ? 424 TYR B O   1 
ATOM   5933  C  CB  . TYR B  1 317 ? 57.009  -3.137  11.826  1.00   17.94 ? 424 TYR B CB  1 
ATOM   5934  C  CG  . TYR B  1 317 ? 57.956  -4.188  11.280  1.00   19.16 ? 424 TYR B CG  1 
ATOM   5935  C  CD1 . TYR B  1 317 ? 57.485  -5.431  10.857  1.00   19.09 ? 424 TYR B CD1 1 
ATOM   5936  C  CD2 . TYR B  1 317 ? 59.343  -3.992  11.325  1.00   18.53 ? 424 TYR B CD2 1 
ATOM   5937  C  CE1 . TYR B  1 317 ? 58.367  -6.464  10.506  1.00   19.94 ? 424 TYR B CE1 1 
ATOM   5938  C  CE2 . TYR B  1 317 ? 60.241  -5.028  10.980  1.00   17.55 ? 424 TYR B CE2 1 
ATOM   5939  C  CZ  . TYR B  1 317 ? 59.742  -6.261  10.578  1.00   17.21 ? 424 TYR B CZ  1 
ATOM   5940  O  OH  . TYR B  1 317 ? 60.603  -7.307  10.292  1.00   19.94 ? 424 TYR B OH  1 
ATOM   5941  N  N   . GLY B  1 318 ? 55.016  -0.396  11.276  1.00   21.05 ? 425 GLY B N   1 
ATOM   5942  C  CA  . GLY B  1 318 ? 54.297  0.566   12.084  1.00   19.37 ? 425 GLY B CA  1 
ATOM   5943  C  C   . GLY B  1 318 ? 55.105  0.740   13.370  1.00   21.33 ? 425 GLY B C   1 
ATOM   5944  O  O   . GLY B  1 318 ? 56.319  0.959   13.309  1.00   18.80 ? 425 GLY B O   1 
ATOM   5945  N  N   . TYR B  1 319 ? 54.461  0.624   14.531  1.00   19.42 ? 426 TYR B N   1 
ATOM   5946  C  CA  . TYR B  1 319 ? 55.168  0.773   15.803  1.00   16.27 ? 426 TYR B CA  1 
ATOM   5947  C  C   . TYR B  1 319 ? 55.765  -0.526  16.306  1.00   18.00 ? 426 TYR B C   1 
ATOM   5948  O  O   . TYR B  1 319 ? 56.350  -0.577  17.385  1.00   19.04 ? 426 TYR B O   1 
ATOM   5949  C  CB  . TYR B  1 319 ? 54.252  1.362   16.880  1.00   15.24 ? 426 TYR B CB  1 
ATOM   5950  C  CG  . TYR B  1 319 ? 54.025  2.821   16.652  1.00   16.68 ? 426 TYR B CG  1 
ATOM   5951  C  CD1 . TYR B  1 319 ? 53.003  3.262   15.801  1.00   13.31 ? 426 TYR B CD1 1 
ATOM   5952  C  CD2 . TYR B  1 319 ? 54.918  3.758   17.158  1.00   11.48 ? 426 TYR B CD2 1 
ATOM   5953  C  CE1 . TYR B  1 319 ? 52.890  4.601   15.453  1.00   15.18 ? 426 TYR B CE1 1 
ATOM   5954  C  CE2 . TYR B  1 319 ? 54.815  5.093   16.815  1.00   14.45 ? 426 TYR B CE2 1 
ATOM   5955  C  CZ  . TYR B  1 319 ? 53.802  5.513   15.956  1.00   15.42 ? 426 TYR B CZ  1 
ATOM   5956  O  OH  . TYR B  1 319 ? 53.737  6.833   15.557  1.00   14.51 ? 426 TYR B OH  1 
ATOM   5957  N  N   . GLY B  1 320 ? 55.623  -1.582  15.523  1.00   17.02 ? 427 GLY B N   1 
ATOM   5958  C  CA  . GLY B  1 320 ? 56.201  -2.841  15.942  1.00   19.91 ? 427 GLY B CA  1 
ATOM   5959  C  C   . GLY B  1 320 ? 55.210  -3.920  16.316  1.00   20.56 ? 427 GLY B C   1 
ATOM   5960  O  O   . GLY B  1 320 ? 54.004  -3.858  16.037  1.00   19.26 ? 427 GLY B O   1 
ATOM   5961  N  N   . LEU B  1 321 ? 55.747  -4.925  16.975  1.00   21.38 ? 428 LEU B N   1 
ATOM   5962  C  CA  . LEU B  1 321 ? 54.984  -6.084  17.406  1.00   22.16 ? 428 LEU B CA  1 
ATOM   5963  C  C   . LEU B  1 321 ? 54.022  -5.748  18.526  1.00   21.20 ? 428 LEU B C   1 
ATOM   5964  O  O   . LEU B  1 321 ? 54.391  -5.048  19.480  1.00   19.04 ? 428 LEU B O   1 
ATOM   5965  C  CB  . LEU B  1 321 ? 55.969  -7.137  17.896  1.00   26.05 ? 428 LEU B CB  1 
ATOM   5966  C  CG  . LEU B  1 321 ? 55.756  -8.603  17.554  1.00   32.48 ? 428 LEU B CG  1 
ATOM   5967  C  CD1 . LEU B  1 321 ? 55.499  -8.772  16.050  1.00   29.55 ? 428 LEU B CD1 1 
ATOM   5968  C  CD2 . LEU B  1 321 ? 57.009  -9.363  17.988  1.00   31.54 ? 428 LEU B CD2 1 
ATOM   5969  N  N   . LEU B  1 322 ? 52.796  -6.259  18.419  1.00   19.31 ? 429 LEU B N   1 
ATOM   5970  C  CA  . LEU B  1 322 ? 51.799  -6.048  19.460  1.00   19.65 ? 429 LEU B CA  1 
ATOM   5971  C  C   . LEU B  1 322 ? 52.252  -6.797  20.718  1.00   20.24 ? 429 LEU B C   1 
ATOM   5972  O  O   . LEU B  1 322 ? 52.865  -7.852  20.634  1.00   18.11 ? 429 LEU B O   1 
ATOM   5973  C  CB  . LEU B  1 322 ? 50.431  -6.580  19.026  1.00   16.40 ? 429 LEU B CB  1 
ATOM   5974  C  CG  . LEU B  1 322 ? 49.720  -5.802  17.923  1.00   21.77 ? 429 LEU B CG  1 
ATOM   5975  C  CD1 . LEU B  1 322 ? 48.345  -6.405  17.712  1.00   18.12 ? 429 LEU B CD1 1 
ATOM   5976  C  CD2 . LEU B  1 322 ? 49.608  -4.321  18.299  1.00   17.77 ? 429 LEU B CD2 1 
ATOM   5977  N  N   . ASP B  1 323 ? 51.926  -6.247  21.879  1.00   22.21 ? 430 ASP B N   1 
ATOM   5978  C  CA  . ASP B  1 323 ? 52.287  -6.838  23.166  1.00   21.26 ? 430 ASP B CA  1 
ATOM   5979  C  C   . ASP B  1 323 ? 50.994  -6.948  23.976  1.00   21.24 ? 430 ASP B C   1 
ATOM   5980  O  O   . ASP B  1 323 ? 50.566  -5.979  24.601  1.00   22.00 ? 430 ASP B O   1 
ATOM   5981  C  CB  . ASP B  1 323 ? 53.270  -5.900  23.869  1.00   22.50 ? 430 ASP B CB  1 
ATOM   5982  C  CG  . ASP B  1 323 ? 53.771  -6.444  25.195  1.00   25.19 ? 430 ASP B CG  1 
ATOM   5983  O  OD1 . ASP B  1 323 ? 53.044  -7.202  25.864  1.00   22.34 ? 430 ASP B OD1 1 
ATOM   5984  O  OD2 . ASP B  1 323 ? 54.906  -6.084  25.575  1.00   29.05 ? 430 ASP B OD2 1 
ATOM   5985  N  N   . ALA B  1 324 ? 50.369  -8.118  23.956  1.00   20.99 ? 431 ALA B N   1 
ATOM   5986  C  CA  . ALA B  1 324 ? 49.110  -8.321  24.672  1.00   19.48 ? 431 ALA B CA  1 
ATOM   5987  C  C   . ALA B  1 324 ? 49.193  -7.986  26.162  1.00   18.19 ? 431 ALA B C   1 
ATOM   5988  O  O   . ALA B  1 324 ? 48.330  -7.279  26.686  1.00   19.62 ? 431 ALA B O   1 
ATOM   5989  C  CB  . ALA B  1 324 ? 48.637  -9.743  24.485  1.00   17.00 ? 431 ALA B CB  1 
ATOM   5990  N  N   . GLY B  1 325 ? 50.217  -8.492  26.840  1.00   20.97 ? 432 GLY B N   1 
ATOM   5991  C  CA  . GLY B  1 325 ? 50.372  -8.214  28.260  1.00   21.67 ? 432 GLY B CA  1 
ATOM   5992  C  C   . GLY B  1 325 ? 50.384  -6.720  28.539  1.00   21.53 ? 432 GLY B C   1 
ATOM   5993  O  O   . GLY B  1 325 ? 49.699  -6.235  29.445  1.00   23.94 ? 432 GLY B O   1 
ATOM   5994  N  N   . ALA B  1 326 ? 51.157  -5.984  27.752  1.00   20.10 ? 433 ALA B N   1 
ATOM   5995  C  CA  . ALA B  1 326 ? 51.254  -4.538  27.916  1.00   20.83 ? 433 ALA B CA  1 
ATOM   5996  C  C   . ALA B  1 326 ? 49.941  -3.835  27.555  1.00   21.34 ? 433 ALA B C   1 
ATOM   5997  O  O   . ALA B  1 326 ? 49.547  -2.871  28.203  1.00   20.53 ? 433 ALA B O   1 
ATOM   5998  C  CB  . ALA B  1 326 ? 52.404  -3.997  27.055  1.00   18.77 ? 433 ALA B CB  1 
ATOM   5999  N  N   . MET B  1 327 ? 49.262  -4.325  26.521  1.00   20.75 ? 434 MET B N   1 
ATOM   6000  C  CA  . MET B  1 327 ? 47.993  -3.738  26.089  1.00   20.11 ? 434 MET B CA  1 
ATOM   6001  C  C   . MET B  1 327 ? 46.956  -3.800  27.212  1.00   22.59 ? 434 MET B C   1 
ATOM   6002  O  O   . MET B  1 327 ? 46.331  -2.793  27.552  1.00   21.83 ? 434 MET B O   1 
ATOM   6003  C  CB  . MET B  1 327 ? 47.448  -4.479  24.856  1.00   18.07 ? 434 MET B CB  1 
ATOM   6004  C  CG  . MET B  1 327 ? 48.099  -4.093  23.513  1.00   16.70 ? 434 MET B CG  1 
ATOM   6005  S  SD  . MET B  1 327 ? 47.527  -2.475  22.911  1.00   20.74 ? 434 MET B SD  1 
ATOM   6006  C  CE  . MET B  1 327 ? 45.928  -2.942  22.291  1.00   14.07 ? 434 MET B CE  1 
ATOM   6007  N  N   . VAL B  1 328 ? 46.778  -4.991  27.772  1.00   22.68 ? 435 VAL B N   1 
ATOM   6008  C  CA  . VAL B  1 328 ? 45.825  -5.222  28.842  1.00   25.98 ? 435 VAL B CA  1 
ATOM   6009  C  C   . VAL B  1 328 ? 46.184  -4.452  30.125  1.00   25.66 ? 435 VAL B C   1 
ATOM   6010  O  O   . VAL B  1 328 ? 45.312  -3.958  30.842  1.00   24.30 ? 435 VAL B O   1 
ATOM   6011  C  CB  . VAL B  1 328 ? 45.735  -6.759  29.073  1.00   27.81 ? 435 VAL B CB  1 
ATOM   6012  C  CG1 . VAL B  1 328 ? 45.850  -7.093  30.516  1.00   33.25 ? 435 VAL B CG1 1 
ATOM   6013  C  CG2 . VAL B  1 328 ? 44.478  -7.312  28.431  1.00   27.12 ? 435 VAL B CG2 1 
ATOM   6014  N  N   . ALA B  1 329 ? 47.476  -4.345  30.404  1.00   24.93 ? 436 ALA B N   1 
ATOM   6015  C  CA  . ALA B  1 329 ? 47.927  -3.623  31.580  1.00   25.19 ? 436 ALA B CA  1 
ATOM   6016  C  C   . ALA B  1 329 ? 47.607  -2.134  31.451  1.00   27.41 ? 436 ALA B C   1 
ATOM   6017  O  O   . ALA B  1 329 ? 46.987  -1.546  32.339  1.00   30.34 ? 436 ALA B O   1 
ATOM   6018  C  CB  . ALA B  1 329 ? 49.414  -3.808  31.766  1.00   23.75 ? 436 ALA B CB  1 
ATOM   6019  N  N   . LEU B  1 330 ? 48.018  -1.525  30.342  1.00   25.01 ? 437 LEU B N   1 
ATOM   6020  C  CA  . LEU B  1 330 ? 47.778  -0.103  30.129  1.00   27.42 ? 437 LEU B CA  1 
ATOM   6021  C  C   . LEU B  1 330 ? 46.287  0.225   30.034  1.00   28.52 ? 437 LEU B C   1 
ATOM   6022  O  O   . LEU B  1 330 ? 45.843  1.272   30.483  1.00   31.89 ? 437 LEU B O   1 
ATOM   6023  C  CB  . LEU B  1 330 ? 48.510  0.362   28.860  1.00   26.82 ? 437 LEU B CB  1 
ATOM   6024  C  CG  . LEU B  1 330 ? 48.517  1.865   28.584  1.00   26.98 ? 437 LEU B CG  1 
ATOM   6025  C  CD1 . LEU B  1 330 ? 49.194  2.576   29.739  1.00   26.49 ? 437 LEU B CD1 1 
ATOM   6026  C  CD2 . LEU B  1 330 ? 49.240  2.169   27.291  1.00   23.21 ? 437 LEU B CD2 1 
ATOM   6027  N  N   . ALA B  1 331 ? 45.509  -0.685  29.468  1.00   28.66 ? 438 ALA B N   1 
ATOM   6028  C  CA  . ALA B  1 331 ? 44.084  -0.452  29.315  1.00   28.92 ? 438 ALA B CA  1 
ATOM   6029  C  C   . ALA B  1 331 ? 43.374  -0.162  30.638  1.00   31.99 ? 438 ALA B C   1 
ATOM   6030  O  O   . ALA B  1 331 ? 42.484  0.690   30.700  1.00   29.66 ? 438 ALA B O   1 
ATOM   6031  C  CB  . ALA B  1 331 ? 43.439  -1.642  28.637  1.00   22.45 ? 438 ALA B CB  1 
ATOM   6032  N  N   . GLN B  1 332 ? 43.767  -0.873  31.688  1.00   33.62 ? 439 GLN B N   1 
ATOM   6033  C  CA  . GLN B  1 332 ? 43.148  -0.713  33.001  1.00   37.96 ? 439 GLN B CA  1 
ATOM   6034  C  C   . GLN B  1 332 ? 43.224  0.689   33.595  1.00   40.00 ? 439 GLN B C   1 
ATOM   6035  O  O   . GLN B  1 332 ? 42.265  1.155   34.199  1.00   39.96 ? 439 GLN B O   1 
ATOM   6036  C  CB  . GLN B  1 332 ? 43.745  -1.715  33.979  1.00   37.19 ? 439 GLN B CB  1 
ATOM   6037  C  CG  . GLN B  1 332 ? 43.351  -3.127  33.658  1.00   41.21 ? 439 GLN B CG  1 
ATOM   6038  C  CD  . GLN B  1 332 ? 44.037  -4.116  34.550  1.00   44.63 ? 439 GLN B CD  1 
ATOM   6039  O  OE1 . GLN B  1 332 ? 43.913  -4.043  35.774  1.00   46.28 ? 439 GLN B OE1 1 
ATOM   6040  N  NE2 . GLN B  1 332 ? 44.770  -5.053  33.950  1.00   44.29 ? 439 GLN B NE2 1 
ATOM   6041  N  N   . ASN B  1 333 ? 44.350  1.367   33.415  1.00   41.56 ? 440 ASN B N   1 
ATOM   6042  C  CA  . ASN B  1 333 ? 44.497  2.707   33.965  1.00   44.75 ? 440 ASN B CA  1 
ATOM   6043  C  C   . ASN B  1 333 ? 44.206  3.797   32.932  1.00   42.97 ? 440 ASN B C   1 
ATOM   6044  O  O   . ASN B  1 333 ? 44.325  4.981   33.229  1.00   47.28 ? 440 ASN B O   1 
ATOM   6045  C  CB  . ASN B  1 333 ? 45.925  2.880   34.504  1.00   48.34 ? 440 ASN B CB  1 
ATOM   6046  C  CG  . ASN B  1 333 ? 46.175  2.081   35.761  0.0000 47.13 ? 440 ASN B CG  1 
ATOM   6047  O  OD1 . ASN B  1 333 ? 47.311  1.715   36.062  0.0000 47.52 ? 440 ASN B OD1 1 
ATOM   6048  N  ND2 . ASN B  1 333 ? 45.115  1.818   36.514  0.0000 47.52 ? 440 ASN B ND2 1 
ATOM   6049  N  N   . TRP B  1 334 ? 43.784  3.407   31.736  1.00   39.54 ? 441 TRP B N   1 
ATOM   6050  C  CA  . TRP B  1 334 ? 43.563  4.378   30.669  1.00   33.44 ? 441 TRP B CA  1 
ATOM   6051  C  C   . TRP B  1 334 ? 42.443  5.404   30.813  1.00   32.05 ? 441 TRP B C   1 
ATOM   6052  O  O   . TRP B  1 334 ? 41.290  5.070   31.066  1.00   32.43 ? 441 TRP B O   1 
ATOM   6053  C  CB  . TRP B  1 334 ? 43.417  3.647   29.336  1.00   29.62 ? 441 TRP B CB  1 
ATOM   6054  C  CG  . TRP B  1 334 ? 43.501  4.560   28.177  1.00   25.34 ? 441 TRP B CG  1 
ATOM   6055  C  CD1 . TRP B  1 334 ? 42.467  5.064   27.460  1.00   23.48 ? 441 TRP B CD1 1 
ATOM   6056  C  CD2 . TRP B  1 334 ? 44.695  5.102   27.607  1.00   25.69 ? 441 TRP B CD2 1 
ATOM   6057  N  NE1 . TRP B  1 334 ? 42.936  5.888   26.471  1.00   25.98 ? 441 TRP B NE1 1 
ATOM   6058  C  CE2 . TRP B  1 334 ? 44.303  5.936   26.538  1.00   26.20 ? 441 TRP B CE2 1 
ATOM   6059  C  CE3 . TRP B  1 334 ? 46.062  4.971   27.900  1.00   22.64 ? 441 TRP B CE3 1 
ATOM   6060  C  CZ2 . TRP B  1 334 ? 45.230  6.635   25.746  1.00   26.49 ? 441 TRP B CZ2 1 
ATOM   6061  C  CZ3 . TRP B  1 334 ? 46.988  5.667   27.114  1.00   25.46 ? 441 TRP B CZ3 1 
ATOM   6062  C  CH2 . TRP B  1 334 ? 46.564  6.493   26.052  1.00   25.42 ? 441 TRP B CH2 1 
ATOM   6063  N  N   . THR B  1 335 ? 42.807  6.668   30.643  1.00   28.09 ? 442 THR B N   1 
ATOM   6064  C  CA  . THR B  1 335 ? 41.859  7.765   30.717  1.00   27.54 ? 442 THR B CA  1 
ATOM   6065  C  C   . THR B  1 335 ? 41.431  8.070   29.284  1.00   25.80 ? 442 THR B C   1 
ATOM   6066  O  O   . THR B  1 335 ? 42.272  8.374   28.449  1.00   26.22 ? 442 THR B O   1 
ATOM   6067  C  CB  . THR B  1 335 ? 42.524  9.030   31.305  1.00   28.84 ? 442 THR B CB  1 
ATOM   6068  O  OG1 . THR B  1 335 ? 42.993  8.754   32.626  1.00   31.18 ? 442 THR B OG1 1 
ATOM   6069  C  CG2 . THR B  1 335 ? 41.538  10.173  31.359  1.00   29.34 ? 442 THR B CG2 1 
ATOM   6070  N  N   . THR B  1 336 ? 40.137  7.978   28.998  1.00   24.45 ? 443 THR B N   1 
ATOM   6071  C  CA  . THR B  1 336 ? 39.631  8.244   27.656  1.00   25.82 ? 443 THR B CA  1 
ATOM   6072  C  C   . THR B  1 336 ? 40.199  9.545   27.109  1.00   25.79 ? 443 THR B C   1 
ATOM   6073  O  O   . THR B  1 336 ? 40.225  10.560  27.804  1.00   26.77 ? 443 THR B O   1 
ATOM   6074  C  CB  . THR B  1 336 ? 38.104  8.323   27.661  1.00   27.98 ? 443 THR B CB  1 
ATOM   6075  O  OG1 . THR B  1 336 ? 37.581  7.068   28.100  1.00   39.33 ? 443 THR B OG1 1 
ATOM   6076  C  CG2 . THR B  1 336 ? 37.570  8.615   26.270  1.00   29.00 ? 443 THR B CG2 1 
ATOM   6077  N  N   . VAL B  1 337 ? 40.659  9.516   25.864  1.00   25.52 ? 444 VAL B N   1 
ATOM   6078  C  CA  . VAL B  1 337 ? 41.235  10.708  25.253  1.00   25.10 ? 444 VAL B CA  1 
ATOM   6079  C  C   . VAL B  1 337 ? 40.189  11.776  24.991  1.00   25.74 ? 444 VAL B C   1 
ATOM   6080  O  O   . VAL B  1 337 ? 38.988  11.492  24.912  1.00   26.10 ? 444 VAL B O   1 
ATOM   6081  C  CB  . VAL B  1 337 ? 41.940  10.380  23.917  1.00   28.13 ? 444 VAL B CB  1 
ATOM   6082  C  CG1 . VAL B  1 337 ? 43.130  9.466   24.181  1.00   29.46 ? 444 VAL B CG1 1 
ATOM   6083  C  CG2 . VAL B  1 337 ? 40.956  9.704   22.941  1.00   26.23 ? 444 VAL B CG2 1 
ATOM   6084  N  N   . ALA B  1 338 ? 40.664  13.010  24.856  1.00   23.23 ? 445 ALA B N   1 
ATOM   6085  C  CA  . ALA B  1 338 ? 39.800  14.144  24.593  1.00   22.48 ? 445 ALA B CA  1 
ATOM   6086  C  C   . ALA B  1 338 ? 39.127  13.999  23.227  1.00   22.57 ? 445 ALA B C   1 
ATOM   6087  O  O   . ALA B  1 338 ? 39.541  13.193  22.392  1.00   22.75 ? 445 ALA B O   1 
ATOM   6088  C  CB  . ALA B  1 338 ? 40.606  15.437  24.656  1.00   14.11 ? 445 ALA B CB  1 
ATOM   6089  N  N   . PRO B  1 339 ? 38.067  14.783  22.989  1.00   22.34 ? 446 PRO B N   1 
ATOM   6090  C  CA  . PRO B  1 339 ? 37.346  14.726  21.717  1.00   22.79 ? 446 PRO B CA  1 
ATOM   6091  C  C   . PRO B  1 339 ? 38.278  14.947  20.538  1.00   22.16 ? 446 PRO B C   1 
ATOM   6092  O  O   . PRO B  1 339 ? 39.189  15.761  20.603  1.00   23.53 ? 446 PRO B O   1 
ATOM   6093  C  CB  . PRO B  1 339 ? 36.306  15.838  21.863  1.00   23.08 ? 446 PRO B CB  1 
ATOM   6094  C  CG  . PRO B  1 339 ? 36.030  15.821  23.365  1.00   22.37 ? 446 PRO B CG  1 
ATOM   6095  C  CD  . PRO B  1 339 ? 37.418  15.711  23.934  1.00   19.62 ? 446 PRO B CD  1 
ATOM   6096  N  N   . GLN B  1 340 ? 38.043  14.215  19.460  1.00   20.55 ? 447 GLN B N   1 
ATOM   6097  C  CA  . GLN B  1 340 ? 38.857  14.333  18.259  1.00   19.90 ? 447 GLN B CA  1 
ATOM   6098  C  C   . GLN B  1 340 ? 38.646  15.673  17.557  1.00   18.51 ? 447 GLN B C   1 
ATOM   6099  O  O   . GLN B  1 340 ? 37.516  16.055  17.290  1.00   24.00 ? 447 GLN B O   1 
ATOM   6100  C  CB  . GLN B  1 340 ? 38.509  13.197  17.284  1.00   18.54 ? 447 GLN B CB  1 
ATOM   6101  C  CG  . GLN B  1 340 ? 39.285  13.236  15.977  1.00   17.62 ? 447 GLN B CG  1 
ATOM   6102  C  CD  . GLN B  1 340 ? 38.555  12.557  14.836  1.00   21.23 ? 447 GLN B CD  1 
ATOM   6103  O  OE1 . GLN B  1 340 ? 37.479  12.992  14.430  1.00   26.28 ? 447 GLN B OE1 1 
ATOM   6104  N  NE2 . GLN B  1 340 ? 39.134  11.478  14.316  1.00   23.12 ? 447 GLN B NE2 1 
ATOM   6105  N  N   . ARG B  1 341 ? 39.733  16.378  17.260  1.00   19.82 ? 448 ARG B N   1 
ATOM   6106  C  CA  . ARG B  1 341 ? 39.674  17.655  16.550  1.00   18.10 ? 448 ARG B CA  1 
ATOM   6107  C  C   . ARG B  1 341 ? 40.215  17.383  15.154  1.00   21.86 ? 448 ARG B C   1 
ATOM   6108  O  O   . ARG B  1 341 ? 40.960  16.418  14.945  1.00   19.52 ? 448 ARG B O   1 
ATOM   6109  C  CB  . ARG B  1 341 ? 40.568  18.700  17.209  1.00   21.95 ? 448 ARG B CB  1 
ATOM   6110  C  CG  . ARG B  1 341 ? 40.339  18.873  18.681  1.00   22.27 ? 448 ARG B CG  1 
ATOM   6111  C  CD  . ARG B  1 341 ? 41.079  20.084  19.205  1.00   23.63 ? 448 ARG B CD  1 
ATOM   6112  N  NE  . ARG B  1 341 ? 40.594  20.404  20.542  1.00   24.93 ? 448 ARG B NE  1 
ATOM   6113  C  CZ  . ARG B  1 341 ? 40.904  21.499  21.224  1.00   27.59 ? 448 ARG B CZ  1 
ATOM   6114  N  NH1 . ARG B  1 341 ? 40.391  21.673  22.436  1.00   27.81 ? 448 ARG B NH1 1 
ATOM   6115  N  NH2 . ARG B  1 341 ? 41.713  22.417  20.703  1.00   22.36 ? 448 ARG B NH2 1 
ATOM   6116  N  N   . LYS B  1 342 ? 39.853  18.246  14.209  1.00   20.24 ? 449 LYS B N   1 
ATOM   6117  C  CA  . LYS B  1 342 ? 40.280  18.108  12.832  1.00   18.32 ? 449 LYS B CA  1 
ATOM   6118  C  C   . LYS B  1 342 ? 40.668  19.472  12.289  1.00   18.32 ? 449 LYS B C   1 
ATOM   6119  O  O   . LYS B  1 342 ? 39.853  20.376  12.254  1.00   23.33 ? 449 LYS B O   1 
ATOM   6120  C  CB  . LYS B  1 342 ? 39.141  17.503  12.009  1.00   16.40 ? 449 LYS B CB  1 
ATOM   6121  C  CG  . LYS B  1 342 ? 39.467  17.272  10.545  1.00   14.74 ? 449 LYS B CG  1 
ATOM   6122  C  CD  . LYS B  1 342 ? 38.304  16.577  9.852   1.00   19.56 ? 449 LYS B CD  1 
ATOM   6123  C  CE  . LYS B  1 342 ? 38.628  16.235  8.409   1.00   17.64 ? 449 LYS B CE  1 
ATOM   6124  N  NZ  . LYS B  1 342 ? 37.515  15.458  7.803   1.00   18.13 ? 449 LYS B NZ  1 
ATOM   6125  N  N   . CYS B  1 343 ? 41.918  19.624  11.874  1.00   19.91 ? 450 CYS B N   1 
ATOM   6126  C  CA  . CYS B  1 343 ? 42.389  20.900  11.342  1.00   18.90 ? 450 CYS B CA  1 
ATOM   6127  C  C   . CYS B  1 343 ? 42.767  20.726  9.869   1.00   20.29 ? 450 CYS B C   1 
ATOM   6128  O  O   . CYS B  1 343 ? 43.655  19.947  9.529   1.00   21.49 ? 450 CYS B O   1 
ATOM   6129  C  CB  . CYS B  1 343 ? 43.579  21.402  12.179  1.00   18.29 ? 450 CYS B CB  1 
ATOM   6130  S  SG  . CYS B  1 343 ? 44.325  22.991  11.666  1.00   24.71 ? 450 CYS B SG  1 
ATOM   6131  N  N   . ILE B  1 344 ? 42.068  21.456  9.006   1.00   19.54 ? 451 ILE B N   1 
ATOM   6132  C  CA  . ILE B  1 344 ? 42.274  21.393  7.566   1.00   19.19 ? 451 ILE B CA  1 
ATOM   6133  C  C   . ILE B  1 344 ? 43.105  22.563  7.064   1.00   23.33 ? 451 ILE B C   1 
ATOM   6134  O  O   . ILE B  1 344 ? 42.740  23.726  7.272   1.00   23.12 ? 451 ILE B O   1 
ATOM   6135  C  CB  . ILE B  1 344 ? 40.914  21.427  6.837   1.00   21.15 ? 451 ILE B CB  1 
ATOM   6136  C  CG1 . ILE B  1 344 ? 40.049  20.248  7.309   1.00   22.76 ? 451 ILE B CG1 1 
ATOM   6137  C  CG2 . ILE B  1 344 ? 41.118  21.421  5.330   1.00   15.76 ? 451 ILE B CG2 1 
ATOM   6138  C  CD1 . ILE B  1 344 ? 38.656  20.248  6.733   1.00   23.14 ? 451 ILE B CD1 1 
ATOM   6139  N  N   . ILE B  1 345 ? 44.206  22.264  6.379   1.00   22.71 ? 452 ILE B N   1 
ATOM   6140  C  CA  . ILE B  1 345 ? 45.076  23.309  5.859   1.00   22.36 ? 452 ILE B CA  1 
ATOM   6141  C  C   . ILE B  1 345 ? 45.350  23.084  4.379   1.00   23.52 ? 452 ILE B C   1 
ATOM   6142  O  O   . ILE B  1 345 ? 46.070  22.150  4.008   1.00   21.99 ? 452 ILE B O   1 
ATOM   6143  C  CB  . ILE B  1 345 ? 46.424  23.318  6.603   1.00   26.45 ? 452 ILE B CB  1 
ATOM   6144  C  CG1 . ILE B  1 345 ? 46.178  23.482  8.099   1.00   26.77 ? 452 ILE B CG1 1 
ATOM   6145  C  CG2 . ILE B  1 345 ? 47.319  24.450  6.061   1.00   21.84 ? 452 ILE B CG2 1 
ATOM   6146  C  CD1 . ILE B  1 345 ? 47.228  22.813  8.969   1.00   31.95 ? 452 ILE B CD1 1 
ATOM   6147  N  N   . ASP B  1 346 ? 44.774  23.926  3.528   1.00   22.70 ? 453 ASP B N   1 
ATOM   6148  C  CA  . ASP B  1 346 ? 45.004  23.780  2.093   1.00   27.03 ? 453 ASP B CA  1 
ATOM   6149  C  C   . ASP B  1 346 ? 46.312  24.524  1.835   1.00   28.20 ? 453 ASP B C   1 
ATOM   6150  O  O   . ASP B  1 346 ? 46.425  25.700  2.144   1.00   29.02 ? 453 ASP B O   1 
ATOM   6151  C  CB  . ASP B  1 346 ? 43.848  24.388  1.299   1.00   24.77 ? 453 ASP B CB  1 
ATOM   6152  C  CG  . ASP B  1 346 ? 43.611  23.675  -0.021  1.00   28.85 ? 453 ASP B CG  1 
ATOM   6153  O  OD1 . ASP B  1 346 ? 44.208  22.597  -0.237  1.00   20.40 ? 453 ASP B OD1 1 
ATOM   6154  O  OD2 . ASP B  1 346 ? 42.814  24.189  -0.845  1.00   32.91 ? 453 ASP B OD2 1 
ATOM   6155  N  N   . ILE B  1 347 ? 47.299  23.832  1.278   1.00   29.29 ? 454 ILE B N   1 
ATOM   6156  C  CA  . ILE B  1 347 ? 48.611  24.424  1.065   1.00   28.57 ? 454 ILE B CA  1 
ATOM   6157  C  C   . ILE B  1 347 ? 48.942  25.179  -0.221  1.00   29.28 ? 454 ILE B C   1 
ATOM   6158  O  O   . ILE B  1 347 ? 49.554  26.239  -0.157  1.00   29.59 ? 454 ILE B O   1 
ATOM   6159  C  CB  . ILE B  1 347 ? 49.690  23.364  1.297   1.00   27.29 ? 454 ILE B CB  1 
ATOM   6160  C  CG1 . ILE B  1 347 ? 49.627  22.943  2.762   1.00   26.09 ? 454 ILE B CG1 1 
ATOM   6161  C  CG2 . ILE B  1 347 ? 51.079  23.926  0.985   1.00   24.61 ? 454 ILE B CG2 1 
ATOM   6162  C  CD1 . ILE B  1 347 ? 49.360  21.503  2.948   1.00   31.30 ? 454 ILE B CD1 1 
ATOM   6163  N  N   . LEU B  1 348 ? 48.551  24.663  -1.380  1.00   31.11 ? 455 LEU B N   1 
ATOM   6164  C  CA  . LEU B  1 348 ? 48.893  25.338  -2.629  1.00   32.96 ? 455 LEU B CA  1 
ATOM   6165  C  C   . LEU B  1 348 ? 48.140  26.620  -2.973  1.00   36.76 ? 455 LEU B C   1 
ATOM   6166  O  O   . LEU B  1 348 ? 46.925  26.727  -2.772  1.00   37.97 ? 455 LEU B O   1 
ATOM   6167  C  CB  . LEU B  1 348 ? 48.742  24.377  -3.800  1.00   30.21 ? 455 LEU B CB  1 
ATOM   6168  C  CG  . LEU B  1 348 ? 49.551  23.086  -3.761  1.00   31.15 ? 455 LEU B CG  1 
ATOM   6169  C  CD1 . LEU B  1 348 ? 49.530  22.456  -5.144  1.00   28.09 ? 455 LEU B CD1 1 
ATOM   6170  C  CD2 . LEU B  1 348 ? 50.981  23.366  -3.330  1.00   30.08 ? 455 LEU B CD2 1 
ATOM   6171  N  N   . THR B  1 349 ? 48.879  27.592  -3.505  1.00   39.21 ? 456 THR B N   1 
ATOM   6172  C  CA  . THR B  1 349 ? 48.294  28.858  -3.951  1.00   40.91 ? 456 THR B CA  1 
ATOM   6173  C  C   . THR B  1 349 ? 48.336  28.866  -5.478  1.00   41.52 ? 456 THR B C   1 
ATOM   6174  O  O   . THR B  1 349 ? 47.853  29.793  -6.123  1.00   42.91 ? 456 THR B O   1 
ATOM   6175  C  CB  . THR B  1 349 ? 49.076  30.074  -3.437  1.00   40.73 ? 456 THR B CB  1 
ATOM   6176  O  OG1 . THR B  1 349 ? 50.462  29.910  -3.751  1.00   44.48 ? 456 THR B OG1 1 
ATOM   6177  C  CG2 . THR B  1 349 ? 48.914  30.219  -1.936  1.00   38.00 ? 456 THR B CG2 1 
ATOM   6178  N  N   . GLU B  1 350 ? 48.914  27.814  -6.048  1.00   41.55 ? 457 GLU B N   1 
ATOM   6179  C  CA  . GLU B  1 350 ? 49.022  27.677  -7.498  1.00   42.31 ? 457 GLU B CA  1 
ATOM   6180  C  C   . GLU B  1 350 ? 49.545  26.296  -7.862  1.00   37.54 ? 457 GLU B C   1 
ATOM   6181  O  O   . GLU B  1 350 ? 50.242  25.665  -7.079  1.00   34.16 ? 457 GLU B O   1 
ATOM   6182  C  CB  . GLU B  1 350 ? 49.980  28.730  -8.062  1.00   46.07 ? 457 GLU B CB  1 
ATOM   6183  C  CG  . GLU B  1 350 ? 51.278  28.850  -7.274  1.00   55.82 ? 457 GLU B CG  1 
ATOM   6184  C  CD  . GLU B  1 350 ? 52.433  29.370  -8.111  1.00   62.06 ? 457 GLU B CD  1 
ATOM   6185  O  OE1 . GLU B  1 350 ? 52.228  30.349  -8.863  1.00   66.60 ? 457 GLU B OE1 1 
ATOM   6186  O  OE2 . GLU B  1 350 ? 53.548  28.807  -8.012  1.00   63.76 ? 457 GLU B OE2 1 
ATOM   6187  N  N   . PRO B  1 351 ? 49.200  25.804  -9.055  1.00   35.26 ? 458 PRO B N   1 
ATOM   6188  C  CA  . PRO B  1 351 ? 49.689  24.484  -9.454  1.00   34.78 ? 458 PRO B CA  1 
ATOM   6189  C  C   . PRO B  1 351 ? 51.208  24.474  -9.456  1.00   33.96 ? 458 PRO B C   1 
ATOM   6190  O  O   . PRO B  1 351 ? 51.848  25.502  -9.672  1.00   33.61 ? 458 PRO B O   1 
ATOM   6191  C  CB  . PRO B  1 351 ? 49.099  24.287  -10.852 1.00   34.59 ? 458 PRO B CB  1 
ATOM   6192  C  CG  . PRO B  1 351 ? 48.764  25.678  -11.315 1.00   37.20 ? 458 PRO B CG  1 
ATOM   6193  C  CD  . PRO B  1 351 ? 48.270  26.346  -10.054 1.00   35.36 ? 458 PRO B CD  1 
ATOM   6194  N  N   . LYS B  1 352 ? 51.782  23.310  -9.199  1.00   34.52 ? 459 LYS B N   1 
ATOM   6195  C  CA  . LYS B  1 352 ? 53.226  23.181  -9.165  1.00   34.55 ? 459 LYS B CA  1 
ATOM   6196  C  C   . LYS B  1 352 ? 53.671  22.103  -10.122 1.00   33.72 ? 459 LYS B C   1 
ATOM   6197  O  O   . LYS B  1 352 ? 53.128  20.998  -10.131 1.00   34.08 ? 459 LYS B O   1 
ATOM   6198  C  CB  . LYS B  1 352 ? 53.685  22.848  -7.745  1.00   36.42 ? 459 LYS B CB  1 
ATOM   6199  C  CG  . LYS B  1 352 ? 54.287  24.029  -7.000  1.00   40.49 ? 459 LYS B CG  1 
ATOM   6200  C  CD  . LYS B  1 352 ? 53.380  25.238  -7.001  1.00   43.53 ? 459 LYS B CD  1 
ATOM   6201  C  CE  . LYS B  1 352 ? 54.048  26.421  -6.318  1.00   46.27 ? 459 LYS B CE  1 
ATOM   6202  N  NZ  . LYS B  1 352 ? 54.468  26.121  -4.915  1.00   49.42 ? 459 LYS B NZ  1 
ATOM   6203  N  N   . ASP B  1 353 ? 54.653  22.433  -10.948 1.00   34.00 ? 460 ASP B N   1 
ATOM   6204  C  CA  . ASP B  1 353 ? 55.170  21.468  -11.893 1.00   35.23 ? 460 ASP B CA  1 
ATOM   6205  C  C   . ASP B  1 353 ? 56.078  20.491  -11.138 1.00   33.77 ? 460 ASP B C   1 
ATOM   6206  O  O   . ASP B  1 353 ? 56.904  20.902  -10.325 1.00   32.31 ? 460 ASP B O   1 
ATOM   6207  C  CB  . ASP B  1 353 ? 55.950  22.168  -13.000 1.00   37.09 ? 460 ASP B CB  1 
ATOM   6208  C  CG  . ASP B  1 353 ? 56.400  21.200  -14.080 1.00   39.89 ? 460 ASP B CG  1 
ATOM   6209  O  OD1 . ASP B  1 353 ? 55.532  20.685  -14.824 1.00   42.44 ? 460 ASP B OD1 1 
ATOM   6210  O  OD2 . ASP B  1 353 ? 57.621  20.952  -14.164 1.00   39.39 ? 460 ASP B OD2 1 
ATOM   6211  N  N   . ILE B  1 354 ? 55.923  19.203  -11.415 1.00   33.77 ? 461 ILE B N   1 
ATOM   6212  C  CA  . ILE B  1 354 ? 56.700  18.185  -10.732 1.00   35.50 ? 461 ILE B CA  1 
ATOM   6213  C  C   . ILE B  1 354 ? 58.104  17.990  -11.301 1.00   38.18 ? 461 ILE B C   1 
ATOM   6214  O  O   . ILE B  1 354 ? 59.103  18.088  -10.569 1.00   39.43 ? 461 ILE B O   1 
ATOM   6215  C  CB  . ILE B  1 354 ? 55.925  16.851  -10.746 1.00   34.09 ? 461 ILE B CB  1 
ATOM   6216  C  CG1 . ILE B  1 354 ? 54.617  17.026  -9.972  1.00   33.84 ? 461 ILE B CG1 1 
ATOM   6217  C  CG2 . ILE B  1 354 ? 56.778  15.736  -10.178 1.00   34.16 ? 461 ILE B CG2 1 
ATOM   6218  C  CD1 . ILE B  1 354 ? 53.682  15.852  -10.033 1.00   32.30 ? 461 ILE B CD1 1 
ATOM   6219  N  N   . GLY B  1 355 ? 58.188  17.717  -12.598 1.00   36.15 ? 462 GLY B N   1 
ATOM   6220  C  CA  . GLY B  1 355 ? 59.494  17.524  -13.193 1.00   38.60 ? 462 GLY B CA  1 
ATOM   6221  C  C   . GLY B  1 355 ? 60.266  16.380  -12.544 1.00   41.83 ? 462 GLY B C   1 
ATOM   6222  O  O   . GLY B  1 355 ? 59.720  15.284  -12.321 1.00   41.27 ? 462 GLY B O   1 
ATOM   6223  N  N   . LYS B  1 356 ? 61.537  16.633  -12.238 1.00   39.66 ? 463 LYS B N   1 
ATOM   6224  C  CA  . LYS B  1 356 ? 62.404  15.621  -11.641 1.00   38.99 ? 463 LYS B CA  1 
ATOM   6225  C  C   . LYS B  1 356 ? 62.176  15.522  -10.139 1.00   36.79 ? 463 LYS B C   1 
ATOM   6226  O  O   . LYS B  1 356 ? 62.178  14.433  -9.562  1.00   33.32 ? 463 LYS B O   1 
ATOM   6227  C  CB  . LYS B  1 356 ? 63.875  15.966  -11.907 1.00   41.54 ? 463 LYS B CB  1 
ATOM   6228  C  CG  . LYS B  1 356 ? 64.791  14.765  -12.130 1.00   45.78 ? 463 LYS B CG  1 
ATOM   6229  C  CD  . LYS B  1 356 ? 64.665  13.733  -11.018 1.00   50.93 ? 463 LYS B CD  1 
ATOM   6230  C  CE  . LYS B  1 356 ? 64.475  12.318  -11.574 1.00   54.35 ? 463 LYS B CE  1 
ATOM   6231  N  NZ  . LYS B  1 356 ? 65.734  11.672  -12.062 1.00   55.59 ? 463 LYS B NZ  1 
ATOM   6232  N  N   . ARG B  1 357 ? 61.990  16.672  -9.510  1.00   34.76 ? 464 ARG B N   1 
ATOM   6233  C  CA  . ARG B  1 357 ? 61.755  16.712  -8.081  1.00   36.25 ? 464 ARG B CA  1 
ATOM   6234  C  C   . ARG B  1 357 ? 60.995  17.983  -7.718  1.00   35.90 ? 464 ARG B C   1 
ATOM   6235  O  O   . ARG B  1 357 ? 61.202  19.042  -8.307  1.00   34.84 ? 464 ARG B O   1 
ATOM   6236  C  CB  . ARG B  1 357 ? 63.083  16.670  -7.314  1.00   36.55 ? 464 ARG B CB  1 
ATOM   6237  C  CG  . ARG B  1 357 ? 62.929  16.412  -5.805  1.00   40.53 ? 464 ARG B CG  1 
ATOM   6238  C  CD  . ARG B  1 357 ? 64.225  16.690  -5.019  1.00   45.92 ? 464 ARG B CD  1 
ATOM   6239  N  NE  . ARG B  1 357 ? 64.252  16.044  -3.701  1.00   50.70 ? 464 ARG B NE  1 
ATOM   6240  C  CZ  . ARG B  1 357 ? 64.000  16.648  -2.537  1.00   54.66 ? 464 ARG B CZ  1 
ATOM   6241  N  NH1 . ARG B  1 357 ? 64.057  15.948  -1.409  1.00   53.37 ? 464 ARG B NH1 1 
ATOM   6242  N  NH2 . ARG B  1 357 ? 63.705  17.946  -2.487  1.00   54.63 ? 464 ARG B NH2 1 
ATOM   6243  N  N   . LEU B  1 358 ? 60.099  17.860  -6.750  1.00   32.74 ? 465 LEU B N   1 
ATOM   6244  C  CA  . LEU B  1 358 ? 59.326  18.993  -6.288  1.00   30.36 ? 465 LEU B CA  1 
ATOM   6245  C  C   . LEU B  1 358 ? 59.332  18.976  -4.777  1.00   29.71 ? 465 LEU B C   1 
ATOM   6246  O  O   . LEU B  1 358 ? 59.164  17.928  -4.154  1.00   29.72 ? 465 LEU B O   1 
ATOM   6247  C  CB  . LEU B  1 358 ? 57.884  18.918  -6.783  1.00   28.29 ? 465 LEU B CB  1 
ATOM   6248  C  CG  . LEU B  1 358 ? 56.953  19.998  -6.218  1.00   27.93 ? 465 LEU B CG  1 
ATOM   6249  C  CD1 . LEU B  1 358 ? 57.443  21.368  -6.629  1.00   25.74 ? 465 LEU B CD1 1 
ATOM   6250  C  CD2 . LEU B  1 358 ? 55.539  19.784  -6.730  1.00   24.58 ? 465 LEU B CD2 1 
ATOM   6251  N  N   . GLU B  1 359 ? 59.528  20.140  -4.188  1.00   27.66 ? 466 GLU B N   1 
ATOM   6252  C  CA  . GLU B  1 359 ? 59.540  20.244  -2.748  1.00   30.90 ? 466 GLU B CA  1 
ATOM   6253  C  C   . GLU B  1 359 ? 58.604  21.382  -2.388  1.00   30.78 ? 466 GLU B C   1 
ATOM   6254  O  O   . GLU B  1 359 ? 58.731  22.481  -2.917  1.00   31.72 ? 466 GLU B O   1 
ATOM   6255  C  CB  . GLU B  1 359 ? 60.948  20.561  -2.267  1.00   34.35 ? 466 GLU B CB  1 
ATOM   6256  C  CG  . GLU B  1 359 ? 61.241  20.146  -0.855  1.00   39.95 ? 466 GLU B CG  1 
ATOM   6257  C  CD  . GLU B  1 359 ? 62.621  20.583  -0.419  1.00   42.91 ? 466 GLU B CD  1 
ATOM   6258  O  OE1 . GLU B  1 359 ? 62.756  21.757  -0.002  1.00   41.28 ? 466 GLU B OE1 1 
ATOM   6259  O  OE2 . GLU B  1 359 ? 63.562  19.758  -0.514  1.00   41.67 ? 466 GLU B OE2 1 
ATOM   6260  N  N   . VAL B  1 360 ? 57.651  21.111  -1.506  1.00   29.34 ? 467 VAL B N   1 
ATOM   6261  C  CA  . VAL B  1 360 ? 56.711  22.132  -1.076  1.00   26.20 ? 467 VAL B CA  1 
ATOM   6262  C  C   . VAL B  1 360 ? 56.818  22.311  0.433   1.00   27.64 ? 467 VAL B C   1 
ATOM   6263  O  O   . VAL B  1 360 ? 56.622  21.367  1.190   1.00   28.50 ? 467 VAL B O   1 
ATOM   6264  C  CB  . VAL B  1 360 ? 55.268  21.739  -1.444  1.00   25.10 ? 467 VAL B CB  1 
ATOM   6265  C  CG1 . VAL B  1 360 ? 54.289  22.808  -0.956  1.00   19.91 ? 467 VAL B CG1 1 
ATOM   6266  C  CG2 . VAL B  1 360 ? 55.156  21.569  -2.956  1.00   20.46 ? 467 VAL B CG2 1 
ATOM   6267  N  N   . ARG B  1 361 ? 57.146  23.525  0.861   1.00   29.18 ? 468 ARG B N   1 
ATOM   6268  C  CA  . ARG B  1 361 ? 57.281  23.828  2.278   1.00   30.16 ? 468 ARG B CA  1 
ATOM   6269  C  C   . ARG B  1 361 ? 56.143  24.719  2.736   1.00   30.20 ? 468 ARG B C   1 
ATOM   6270  O  O   . ARG B  1 361 ? 55.651  25.558  1.978   1.00   30.16 ? 468 ARG B O   1 
ATOM   6271  C  CB  . ARG B  1 361 ? 58.611  24.533  2.549   1.00   33.01 ? 468 ARG B CB  1 
ATOM   6272  C  CG  . ARG B  1 361 ? 59.812  23.736  2.089   1.00   36.60 ? 468 ARG B CG  1 
ATOM   6273  C  CD  . ARG B  1 361 ? 61.129  24.353  2.523   1.00   33.62 ? 468 ARG B CD  1 
ATOM   6274  N  NE  . ARG B  1 361 ? 62.205  23.381  2.344   1.00   38.97 ? 468 ARG B NE  1 
ATOM   6275  C  CZ  . ARG B  1 361 ? 62.808  22.720  3.332   1.00   41.05 ? 468 ARG B CZ  1 
ATOM   6276  N  NH1 . ARG B  1 361 ? 63.770  21.844  3.056   1.00   42.45 ? 468 ARG B NH1 1 
ATOM   6277  N  NH2 . ARG B  1 361 ? 62.476  22.949  4.597   1.00   41.88 ? 468 ARG B NH2 1 
ATOM   6278  N  N   . LYS B  1 362 ? 55.737  24.548  3.986   1.00   27.83 ? 469 LYS B N   1 
ATOM   6279  C  CA  . LYS B  1 362 ? 54.655  25.341  4.524   1.00   27.89 ? 469 LYS B CA  1 
ATOM   6280  C  C   . LYS B  1 362 ? 54.667  25.327  6.041   1.00   25.52 ? 469 LYS B C   1 
ATOM   6281  O  O   . LYS B  1 362 ? 54.653  24.276  6.662   1.00   24.55 ? 469 LYS B O   1 
ATOM   6282  C  CB  . LYS B  1 362 ? 53.323  24.800  3.996   1.00   30.21 ? 469 LYS B CB  1 
ATOM   6283  C  CG  . LYS B  1 362 ? 52.076  25.406  4.628   1.00   35.20 ? 469 LYS B CG  1 
ATOM   6284  C  CD  . LYS B  1 362 ? 51.814  26.821  4.153   1.00   37.64 ? 469 LYS B CD  1 
ATOM   6285  C  CE  . LYS B  1 362 ? 50.505  27.325  4.731   1.00   40.50 ? 469 LYS B CE  1 
ATOM   6286  N  NZ  . LYS B  1 362 ? 50.167  28.668  4.212   1.00   45.15 ? 469 LYS B NZ  1 
ATOM   6287  N  N   . THR B  1 363 ? 54.711  26.506  6.637   1.00   23.57 ? 470 THR B N   1 
ATOM   6288  C  CA  . THR B  1 363 ? 54.692  26.599  8.081   1.00   26.00 ? 470 THR B CA  1 
ATOM   6289  C  C   . THR B  1 363 ? 53.228  26.723  8.476   1.00   27.50 ? 470 THR B C   1 
ATOM   6290  O  O   . THR B  1 363 ? 52.506  27.564  7.926   1.00   27.49 ? 470 THR B O   1 
ATOM   6291  C  CB  . THR B  1 363 ? 55.456  27.827  8.556   1.00   27.51 ? 470 THR B CB  1 
ATOM   6292  O  OG1 . THR B  1 363 ? 56.846  27.672  8.235   1.00   27.64 ? 470 THR B OG1 1 
ATOM   6293  C  CG2 . THR B  1 363 ? 55.289  28.000  10.054  1.00   27.66 ? 470 THR B CG2 1 
ATOM   6294  N  N   . VAL B  1 364 ? 52.783  25.882  9.409   1.00   24.15 ? 471 VAL B N   1 
ATOM   6295  C  CA  . VAL B  1 364 ? 51.390  25.904  9.839   1.00   21.44 ? 471 VAL B CA  1 
ATOM   6296  C  C   . VAL B  1 364 ? 51.266  26.159  11.332  1.00   24.38 ? 471 VAL B C   1 
ATOM   6297  O  O   . VAL B  1 364 ? 52.203  25.904  12.105  1.00   24.24 ? 471 VAL B O   1 
ATOM   6298  C  CB  . VAL B  1 364 ? 50.692  24.556  9.525   1.00   22.33 ? 471 VAL B CB  1 
ATOM   6299  C  CG1 . VAL B  1 364 ? 50.841  24.223  8.047   1.00   20.57 ? 471 VAL B CG1 1 
ATOM   6300  C  CG2 . VAL B  1 364 ? 51.287  23.445  10.389  1.00   16.90 ? 471 VAL B CG2 1 
ATOM   6301  N  N   . THR B  1 365 ? 50.104  26.652  11.746  1.00   22.21 ? 472 THR B N   1 
ATOM   6302  C  CA  . THR B  1 365 ? 49.884  26.907  13.161  1.00   19.63 ? 472 THR B CA  1 
ATOM   6303  C  C   . THR B  1 365 ? 48.988  25.839  13.758  1.00   18.85 ? 472 THR B C   1 
ATOM   6304  O  O   . THR B  1 365 ? 48.729  25.844  14.956  1.00   19.57 ? 472 THR B O   1 
ATOM   6305  C  CB  . THR B  1 365 ? 49.231  28.248  13.381  1.00   20.83 ? 472 THR B CB  1 
ATOM   6306  O  OG1 . THR B  1 365 ? 47.925  28.231  12.803  1.00   24.76 ? 472 THR B OG1 1 
ATOM   6307  C  CG2 . THR B  1 365 ? 50.062  29.342  12.739  1.00   18.95 ? 472 THR B CG2 1 
ATOM   6308  N  N   . ALA B  1 366 ? 48.516  24.920  12.917  1.00   19.66 ? 473 ALA B N   1 
ATOM   6309  C  CA  . ALA B  1 366 ? 47.645  23.838  13.365  1.00   19.84 ? 473 ALA B CA  1 
ATOM   6310  C  C   . ALA B  1 366 ? 46.385  24.376  14.052  1.00   20.85 ? 473 ALA B C   1 
ATOM   6311  O  O   . ALA B  1 366 ? 45.995  23.912  15.133  1.00   17.81 ? 473 ALA B O   1 
ATOM   6312  C  CB  . ALA B  1 366 ? 48.400  22.917  14.311  1.00   19.62 ? 473 ALA B CB  1 
ATOM   6313  N  N   . CYS B  1 367 ? 45.767  25.371  13.424  1.00   19.58 ? 474 CYS B N   1 
ATOM   6314  C  CA  . CYS B  1 367 ? 44.538  25.954  13.932  1.00   20.29 ? 474 CYS B CA  1 
ATOM   6315  C  C   . CYS B  1 367 ? 44.655  26.603  15.304  1.00   22.21 ? 474 CYS B C   1 
ATOM   6316  O  O   . CYS B  1 367 ? 43.719  26.573  16.107  1.00   24.09 ? 474 CYS B O   1 
ATOM   6317  C  CB  . CYS B  1 367 ? 43.443  24.890  13.928  1.00   19.23 ? 474 CYS B CB  1 
ATOM   6318  S  SG  . CYS B  1 367 ? 42.976  24.422  12.233  1.00   22.37 ? 474 CYS B SG  1 
ATOM   6319  N  N   . LEU B  1 368 ? 45.809  27.202  15.567  1.00   23.44 ? 475 LEU B N   1 
ATOM   6320  C  CA  . LEU B  1 368 ? 46.038  27.892  16.831  1.00   25.70 ? 475 LEU B CA  1 
ATOM   6321  C  C   . LEU B  1 368 ? 44.968  28.962  17.022  1.00   27.70 ? 475 LEU B C   1 
ATOM   6322  O  O   . LEU B  1 368 ? 44.634  29.684  16.083  1.00   27.24 ? 475 LEU B O   1 
ATOM   6323  C  CB  . LEU B  1 368 ? 47.411  28.560  16.817  1.00   26.18 ? 475 LEU B CB  1 
ATOM   6324  C  CG  . LEU B  1 368 ? 47.784  29.450  18.019  1.00   27.47 ? 475 LEU B CG  1 
ATOM   6325  C  CD1 . LEU B  1 368 ? 48.079  28.604  19.239  1.00   21.82 ? 475 LEU B CD1 1 
ATOM   6326  C  CD2 . LEU B  1 368 ? 48.996  30.295  17.666  1.00   22.89 ? 475 LEU B CD2 1 
ATOM   6327  N  N   . GLY B  1 369 ? 44.438  29.066  18.235  1.00   29.62 ? 476 GLY B N   1 
ATOM   6328  C  CA  . GLY B  1 369 ? 43.415  30.058  18.507  1.00   31.17 ? 476 GLY B CA  1 
ATOM   6329  C  C   . GLY B  1 369 ? 42.012  29.648  18.099  1.00   35.14 ? 476 GLY B C   1 
ATOM   6330  O  O   . GLY B  1 369 ? 41.077  30.429  18.269  1.00   39.36 ? 476 GLY B O   1 
ATOM   6331  N  N   . GLU B  1 370 ? 41.853  28.439  17.563  1.00   35.02 ? 477 GLU B N   1 
ATOM   6332  C  CA  . GLU B  1 370 ? 40.539  27.966  17.151  1.00   35.00 ? 477 GLU B CA  1 
ATOM   6333  C  C   . GLU B  1 370 ? 40.122  26.735  17.938  1.00   35.01 ? 477 GLU B C   1 
ATOM   6334  O  O   . GLU B  1 370 ? 40.930  26.137  18.655  1.00   33.14 ? 477 GLU B O   1 
ATOM   6335  C  CB  . GLU B  1 370 ? 40.531  27.681  15.651  1.00   38.05 ? 477 GLU B CB  1 
ATOM   6336  C  CG  . GLU B  1 370 ? 40.891  28.921  14.861  1.00   44.27 ? 477 GLU B CG  1 
ATOM   6337  C  CD  . GLU B  1 370 ? 40.094  30.165  15.307  1.00   51.16 ? 477 GLU B CD  1 
ATOM   6338  O  OE1 . GLU B  1 370 ? 40.690  31.265  15.342  1.00   54.26 ? 477 GLU B OE1 1 
ATOM   6339  O  OE2 . GLU B  1 370 ? 38.879  30.053  15.606  1.00   53.85 ? 477 GLU B OE2 1 
ATOM   6340  N  N   . PRO B  1 371 ? 38.844  26.342  17.821  1.00   34.40 ? 478 PRO B N   1 
ATOM   6341  C  CA  . PRO B  1 371 ? 38.314  25.176  18.533  1.00   31.36 ? 478 PRO B CA  1 
ATOM   6342  C  C   . PRO B  1 371 ? 39.000  23.870  18.139  1.00   26.53 ? 478 PRO B C   1 
ATOM   6343  O  O   . PRO B  1 371 ? 39.013  22.918  18.919  1.00   23.39 ? 478 PRO B O   1 
ATOM   6344  C  CB  . PRO B  1 371 ? 36.828  25.176  18.150  1.00   33.28 ? 478 PRO B CB  1 
ATOM   6345  C  CG  . PRO B  1 371 ? 36.563  26.603  17.743  1.00   36.46 ? 478 PRO B CG  1 
ATOM   6346  C  CD  . PRO B  1 371 ? 37.802  26.949  16.977  1.00   33.68 ? 478 PRO B CD  1 
ATOM   6347  N  N   . ASN B  1 372 ? 39.561  23.826  16.932  1.00   23.79 ? 479 ASN B N   1 
ATOM   6348  C  CA  . ASN B  1 372 ? 40.231  22.624  16.444  1.00   25.13 ? 479 ASN B CA  1 
ATOM   6349  C  C   . ASN B  1 372 ? 41.750  22.704  16.464  1.00   23.06 ? 479 ASN B C   1 
ATOM   6350  O  O   . ASN B  1 372 ? 42.434  22.054  15.671  1.00   21.67 ? 479 ASN B O   1 
ATOM   6351  C  CB  . ASN B  1 372 ? 39.746  22.300  15.037  1.00   31.07 ? 479 ASN B CB  1 
ATOM   6352  C  CG  . ASN B  1 372 ? 39.723  23.519  14.144  1.00   40.27 ? 479 ASN B CG  1 
ATOM   6353  O  OD1 . ASN B  1 372 ? 39.366  23.425  12.972  1.00   48.51 ? 479 ASN B OD1 1 
ATOM   6354  N  ND2 . ASN B  1 372 ? 40.101  24.675  14.691  1.00   37.56 ? 479 ASN B ND2 1 
ATOM   6355  N  N   . HIS B  1 373 ? 42.268  23.519  17.371  1.00   22.20 ? 480 HIS B N   1 
ATOM   6356  C  CA  . HIS B  1 373 ? 43.705  23.681  17.541  1.00   23.08 ? 480 HIS B CA  1 
ATOM   6357  C  C   . HIS B  1 373 ? 44.265  22.328  18.001  1.00   21.01 ? 480 HIS B C   1 
ATOM   6358  O  O   . HIS B  1 373 ? 43.752  21.715  18.932  1.00   19.13 ? 480 HIS B O   1 
ATOM   6359  C  CB  . HIS B  1 373 ? 43.960  24.768  18.590  1.00   21.89 ? 480 HIS B CB  1 
ATOM   6360  C  CG  . HIS B  1 373 ? 45.379  24.857  19.059  1.00   25.38 ? 480 HIS B CG  1 
ATOM   6361  N  ND1 . HIS B  1 373 ? 46.457  24.765  18.206  1.00   25.60 ? 480 HIS B ND1 1 
ATOM   6362  C  CD2 . HIS B  1 373 ? 45.894  25.093  20.291  1.00   25.20 ? 480 HIS B CD2 1 
ATOM   6363  C  CE1 . HIS B  1 373 ? 47.575  24.942  18.891  1.00   27.34 ? 480 HIS B CE1 1 
ATOM   6364  N  NE2 . HIS B  1 373 ? 47.260  25.145  20.158  1.00   24.19 ? 480 HIS B NE2 1 
ATOM   6365  N  N   . ILE B  1 374 ? 45.309  21.856  17.337  1.00   20.87 ? 481 ILE B N   1 
ATOM   6366  C  CA  . ILE B  1 374 ? 45.901  20.572  17.684  1.00   18.83 ? 481 ILE B CA  1 
ATOM   6367  C  C   . ILE B  1 374 ? 47.354  20.691  18.133  1.00   18.81 ? 481 ILE B C   1 
ATOM   6368  O  O   . ILE B  1 374 ? 48.197  21.223  17.413  1.00   19.89 ? 481 ILE B O   1 
ATOM   6369  C  CB  . ILE B  1 374 ? 45.819  19.607  16.478  1.00   18.83 ? 481 ILE B CB  1 
ATOM   6370  C  CG1 . ILE B  1 374 ? 44.354  19.233  16.222  1.00   18.08 ? 481 ILE B CG1 1 
ATOM   6371  C  CG2 . ILE B  1 374 ? 46.677  18.379  16.718  1.00   17.91 ? 481 ILE B CG2 1 
ATOM   6372  C  CD1 . ILE B  1 374 ? 44.118  18.529  14.898  1.00   16.05 ? 481 ILE B CD1 1 
ATOM   6373  N  N   . THR B  1 375 ? 47.644  20.199  19.328  1.00   16.93 ? 482 THR B N   1 
ATOM   6374  C  CA  . THR B  1 375 ? 49.013  20.224  19.842  1.00   19.95 ? 482 THR B CA  1 
ATOM   6375  C  C   . THR B  1 375 ? 49.545  18.797  19.968  1.00   20.81 ? 482 THR B C   1 
ATOM   6376  O  O   . THR B  1 375 ? 50.753  18.576  20.112  1.00   23.50 ? 482 THR B O   1 
ATOM   6377  C  CB  . THR B  1 375 ? 49.086  20.880  21.219  1.00   19.42 ? 482 THR B CB  1 
ATOM   6378  O  OG1 . THR B  1 375 ? 48.187  20.201  22.111  1.00   25.50 ? 482 THR B OG1 1 
ATOM   6379  C  CG2 . THR B  1 375 ? 48.708  22.360  21.129  1.00   19.28 ? 482 THR B CG2 1 
ATOM   6380  N  N   . ARG B  1 376 ? 48.636  17.831  19.911  1.00   18.10 ? 483 ARG B N   1 
ATOM   6381  C  CA  . ARG B  1 376 ? 48.991  16.428  20.020  1.00   20.62 ? 483 ARG B CA  1 
ATOM   6382  C  C   . ARG B  1 376 ? 48.336  15.668  18.845  1.00   20.49 ? 483 ARG B C   1 
ATOM   6383  O  O   . ARG B  1 376 ? 47.149  15.326  18.877  1.00   19.14 ? 483 ARG B O   1 
ATOM   6384  C  CB  . ARG B  1 376 ? 48.496  15.898  21.359  1.00   24.03 ? 483 ARG B CB  1 
ATOM   6385  C  CG  . ARG B  1 376 ? 49.458  14.988  22.076  1.00   32.26 ? 483 ARG B CG  1 
ATOM   6386  C  CD  . ARG B  1 376 ? 48.675  14.054  22.985  1.00   41.73 ? 483 ARG B CD  1 
ATOM   6387  N  NE  . ARG B  1 376 ? 49.471  13.560  24.100  1.00   46.24 ? 483 ARG B NE  1 
ATOM   6388  C  CZ  . ARG B  1 376 ? 49.251  12.406  24.723  1.00   48.76 ? 483 ARG B CZ  1 
ATOM   6389  N  NH1 . ARG B  1 376 ? 50.031  12.044  25.734  1.00   52.47 ? 483 ARG B NH1 1 
ATOM   6390  N  NH2 . ARG B  1 376 ? 48.267  11.605  24.330  1.00   46.42 ? 483 ARG B NH2 1 
ATOM   6391  N  N   . LEU B  1 377 ? 49.125  15.413  17.809  1.00   19.94 ? 484 LEU B N   1 
ATOM   6392  C  CA  . LEU B  1 377 ? 48.647  14.751  16.601  1.00   17.16 ? 484 LEU B CA  1 
ATOM   6393  C  C   . LEU B  1 377 ? 48.326  13.265  16.757  1.00   16.42 ? 484 LEU B C   1 
ATOM   6394  O  O   . LEU B  1 377 ? 48.904  12.562  17.580  1.00   15.85 ? 484 LEU B O   1 
ATOM   6395  C  CB  . LEU B  1 377 ? 49.692  14.929  15.485  1.00   15.16 ? 484 LEU B CB  1 
ATOM   6396  C  CG  . LEU B  1 377 ? 49.408  14.512  14.029  1.00   16.34 ? 484 LEU B CG  1 
ATOM   6397  C  CD1 . LEU B  1 377 ? 48.421  15.474  13.383  1.00   16.47 ? 484 LEU B CD1 1 
ATOM   6398  C  CD2 . LEU B  1 377 ? 50.706  14.528  13.214  1.00   16.30 ? 484 LEU B CD2 1 
ATOM   6399  N  N   . GLU B  1 378 ? 47.360  12.810  15.976  1.00   17.91 ? 485 GLU B N   1 
ATOM   6400  C  CA  . GLU B  1 378 ? 47.001  11.399  15.927  1.00   20.57 ? 485 GLU B CA  1 
ATOM   6401  C  C   . GLU B  1 378 ? 47.325  11.054  14.464  1.00   19.64 ? 485 GLU B C   1 
ATOM   6402  O  O   . GLU B  1 378 ? 48.513  10.970  14.128  1.00   19.10 ? 485 GLU B O   1 
ATOM   6403  C  CB  . GLU B  1 378 ? 45.527  11.196  16.304  1.00   20.89 ? 485 GLU B CB  1 
ATOM   6404  C  CG  . GLU B  1 378 ? 45.325  11.324  17.819  1.00   19.98 ? 485 GLU B CG  1 
ATOM   6405  C  CD  . GLU B  1 378 ? 43.867  11.265  18.291  1.00   23.37 ? 485 GLU B CD  1 
ATOM   6406  O  OE1 . GLU B  1 378 ? 43.662  11.343  19.522  1.00   21.04 ? 485 GLU B OE1 1 
ATOM   6407  O  OE2 . GLU B  1 378 ? 42.928  11.141  17.465  1.00   20.49 ? 485 GLU B OE2 1 
ATOM   6408  N  N   . HIS B  1 379 ? 46.325  10.880  13.597  1.00   17.36 ? 486 HIS B N   1 
ATOM   6409  C  CA  . HIS B  1 379 ? 46.610  10.600  12.182  1.00   13.77 ? 486 HIS B CA  1 
ATOM   6410  C  C   . HIS B  1 379 ? 46.810  11.905  11.431  1.00   15.59 ? 486 HIS B C   1 
ATOM   6411  O  O   . HIS B  1 379 ? 46.354  12.960  11.872  1.00   15.71 ? 486 HIS B O   1 
ATOM   6412  C  CB  . HIS B  1 379 ? 45.442  9.893   11.500  1.00   11.95 ? 486 HIS B CB  1 
ATOM   6413  C  CG  . HIS B  1 379 ? 44.789  8.848   12.342  1.00   15.73 ? 486 HIS B CG  1 
ATOM   6414  N  ND1 . HIS B  1 379 ? 43.789  9.140   13.246  1.00   11.73 ? 486 HIS B ND1 1 
ATOM   6415  C  CD2 . HIS B  1 379 ? 44.961  7.506   12.386  1.00   12.94 ? 486 HIS B CD2 1 
ATOM   6416  C  CE1 . HIS B  1 379 ? 43.367  8.018   13.801  1.00   12.41 ? 486 HIS B CE1 1 
ATOM   6417  N  NE2 . HIS B  1 379 ? 44.060  7.013   13.297  1.00   12.61 ? 486 HIS B NE2 1 
ATOM   6418  N  N   . ALA B  1 380 ? 47.484  11.830  10.290  1.00   15.32 ? 487 ALA B N   1 
ATOM   6419  C  CA  . ALA B  1 380 ? 47.653  12.999  9.436   1.00   18.24 ? 487 ALA B CA  1 
ATOM   6420  C  C   . ALA B  1 380 ? 47.457  12.505  8.012   1.00   17.04 ? 487 ALA B C   1 
ATOM   6421  O  O   . ALA B  1 380 ? 47.842  11.387  7.688   1.00   18.12 ? 487 ALA B O   1 
ATOM   6422  C  CB  . ALA B  1 380 ? 49.045  13.623  9.602   1.00   16.97 ? 487 ALA B CB  1 
ATOM   6423  N  N   . GLN B  1 381 ? 46.816  13.312  7.176   1.00   17.08 ? 488 GLN B N   1 
ATOM   6424  C  CA  . GLN B  1 381 ? 46.620  12.931  5.780   1.00   18.15 ? 488 GLN B CA  1 
ATOM   6425  C  C   . GLN B  1 381 ? 47.147  14.033  4.902   1.00   17.64 ? 488 GLN B C   1 
ATOM   6426  O  O   . GLN B  1 381 ? 47.092  15.209  5.265   1.00   16.45 ? 488 GLN B O   1 
ATOM   6427  C  CB  . GLN B  1 381 ? 45.145  12.755  5.425   1.00   16.74 ? 488 GLN B CB  1 
ATOM   6428  C  CG  . GLN B  1 381 ? 44.376  11.760  6.244   1.00   16.95 ? 488 GLN B CG  1 
ATOM   6429  C  CD  . GLN B  1 381 ? 42.910  11.821  5.888   1.00   22.64 ? 488 GLN B CD  1 
ATOM   6430  O  OE1 . GLN B  1 381 ? 42.332  12.912  5.812   1.00   23.94 ? 488 GLN B OE1 1 
ATOM   6431  N  NE2 . GLN B  1 381 ? 42.296  10.660  5.659   1.00   19.10 ? 488 GLN B NE2 1 
ATOM   6432  N  N   . ALA B  1 382 ? 47.676  13.647  3.753   1.00   16.88 ? 489 ALA B N   1 
ATOM   6433  C  CA  . ALA B  1 382 ? 48.143  14.616  2.779   1.00   17.37 ? 489 ALA B CA  1 
ATOM   6434  C  C   . ALA B  1 382 ? 47.268  14.250  1.590   1.00   20.28 ? 489 ALA B C   1 
ATOM   6435  O  O   . ALA B  1 382 ? 47.496  13.232  0.926   1.00   22.39 ? 489 ALA B O   1 
ATOM   6436  C  CB  . ALA B  1 382 ? 49.605  14.397  2.454   1.00   16.93 ? 489 ALA B CB  1 
ATOM   6437  N  N   . ARG B  1 383 ? 46.227  15.041  1.363   1.00   20.81 ? 490 ARG B N   1 
ATOM   6438  C  CA  . ARG B  1 383 ? 45.313  14.783  0.264   1.00   20.11 ? 490 ARG B CA  1 
ATOM   6439  C  C   . ARG B  1 383 ? 45.908  15.411  -0.982  1.00   20.70 ? 490 ARG B C   1 
ATOM   6440  O  O   . ARG B  1 383 ? 45.989  16.634  -1.103  1.00   19.78 ? 490 ARG B O   1 
ATOM   6441  C  CB  . ARG B  1 383 ? 43.941  15.391  0.550   1.00   20.10 ? 490 ARG B CB  1 
ATOM   6442  C  CG  . ARG B  1 383 ? 43.324  14.977  1.879   1.00   25.39 ? 490 ARG B CG  1 
ATOM   6443  C  CD  . ARG B  1 383 ? 41.861  15.414  1.941   1.00   26.55 ? 490 ARG B CD  1 
ATOM   6444  N  NE  . ARG B  1 383 ? 41.011  14.582  1.097   1.00   28.12 ? 490 ARG B NE  1 
ATOM   6445  C  CZ  . ARG B  1 383 ? 40.371  13.503  1.531   1.00   30.35 ? 490 ARG B CZ  1 
ATOM   6446  N  NH1 . ARG B  1 383 ? 39.627  12.796  0.693   1.00   33.06 ? 490 ARG B NH1 1 
ATOM   6447  N  NH2 . ARG B  1 383 ? 40.458  13.145  2.810   1.00   27.01 ? 490 ARG B NH2 1 
ATOM   6448  N  N   . LEU B  1 384 ? 46.314  14.568  -1.919  1.00   19.48 ? 491 LEU B N   1 
ATOM   6449  C  CA  . LEU B  1 384 ? 46.923  15.076  -3.128  1.00   21.80 ? 491 LEU B CA  1 
ATOM   6450  C  C   . LEU B  1 384 ? 46.141  14.831  -4.402  1.00   20.54 ? 491 LEU B C   1 
ATOM   6451  O  O   . LEU B  1 384 ? 45.469  13.806  -4.570  1.00   18.99 ? 491 LEU B O   1 
ATOM   6452  C  CB  . LEU B  1 384 ? 48.324  14.473  -3.295  1.00   19.51 ? 491 LEU B CB  1 
ATOM   6453  C  CG  . LEU B  1 384 ? 49.259  14.560  -2.079  1.00   21.81 ? 491 LEU B CG  1 
ATOM   6454  C  CD1 . LEU B  1 384 ? 50.551  13.792  -2.398  1.00   16.08 ? 491 LEU B CD1 1 
ATOM   6455  C  CD2 . LEU B  1 384 ? 49.548  16.027  -1.720  1.00   16.30 ? 491 LEU B CD2 1 
ATOM   6456  N  N   . THR B  1 385 ? 46.236  15.806  -5.293  1.00   21.12 ? 492 THR B N   1 
ATOM   6457  C  CA  . THR B  1 385 ? 45.635  15.708  -6.612  1.00   21.97 ? 492 THR B CA  1 
ATOM   6458  C  C   . THR B  1 385 ? 46.759  16.101  -7.565  1.00   21.20 ? 492 THR B C   1 
ATOM   6459  O  O   . THR B  1 385 ? 47.314  17.189  -7.464  1.00   21.51 ? 492 THR B O   1 
ATOM   6460  C  CB  . THR B  1 385 ? 44.470  16.665  -6.784  1.00   19.41 ? 492 THR B CB  1 
ATOM   6461  O  OG1 . THR B  1 385 ? 43.476  16.362  -5.802  1.00   25.16 ? 492 THR B OG1 1 
ATOM   6462  C  CG2 . THR B  1 385 ? 43.863  16.504  -8.183  1.00   17.89 ? 492 THR B CG2 1 
ATOM   6463  N  N   . LEU B  1 386 ? 47.103  15.206  -8.474  1.00   20.91 ? 493 LEU B N   1 
ATOM   6464  C  CA  . LEU B  1 386 ? 48.185  15.482  -9.406  1.00   23.29 ? 493 LEU B CA  1 
ATOM   6465  C  C   . LEU B  1 386 ? 48.086  14.626  -10.659 1.00   25.14 ? 493 LEU B C   1 
ATOM   6466  O  O   . LEU B  1 386 ? 47.450  13.562  -10.667 1.00   25.40 ? 493 LEU B O   1 
ATOM   6467  C  CB  . LEU B  1 386 ? 49.536  15.222  -8.726  1.00   22.30 ? 493 LEU B CB  1 
ATOM   6468  C  CG  . LEU B  1 386 ? 49.807  13.773  -8.298  1.00   18.82 ? 493 LEU B CG  1 
ATOM   6469  C  CD1 . LEU B  1 386 ? 50.241  12.942  -9.501  1.00   23.53 ? 493 LEU B CD1 1 
ATOM   6470  C  CD2 . LEU B  1 386 ? 50.900  13.743  -7.240  1.00   18.80 ? 493 LEU B CD2 1 
ATOM   6471  N  N   . SER B  1 387 ? 48.730  15.102  -11.716 1.00   25.88 ? 494 SER B N   1 
ATOM   6472  C  CA  . SER B  1 387 ? 48.766  14.392  -12.986 1.00   26.42 ? 494 SER B CA  1 
ATOM   6473  C  C   . SER B  1 387 ? 50.219  13.961  -13.185 1.00   26.74 ? 494 SER B C   1 
ATOM   6474  O  O   . SER B  1 387 ? 51.144  14.621  -12.696 1.00   27.05 ? 494 SER B O   1 
ATOM   6475  C  CB  . SER B  1 387 ? 48.324  15.329  -14.116 1.00   25.07 ? 494 SER B CB  1 
ATOM   6476  O  OG  . SER B  1 387 ? 48.992  16.580  -14.017 1.00   29.33 ? 494 SER B OG  1 
ATOM   6477  N  N   . TYR B  1 388 ? 50.423  12.848  -13.874 1.00   23.83 ? 495 TYR B N   1 
ATOM   6478  C  CA  . TYR B  1 388 ? 51.770  12.367  -14.122 1.00   25.03 ? 495 TYR B CA  1 
ATOM   6479  C  C   . TYR B  1 388 ? 51.635  11.324  -15.220 1.00   25.87 ? 495 TYR B C   1 
ATOM   6480  O  O   . TYR B  1 388 ? 50.590  10.684  -15.333 1.00   24.75 ? 495 TYR B O   1 
ATOM   6481  C  CB  . TYR B  1 388 ? 52.370  11.751  -12.850 1.00   23.49 ? 495 TYR B CB  1 
ATOM   6482  C  CG  . TYR B  1 388 ? 53.883  11.818  -12.808 1.00   26.35 ? 495 TYR B CG  1 
ATOM   6483  C  CD1 . TYR B  1 388 ? 54.542  13.050  -12.767 1.00   27.07 ? 495 TYR B CD1 1 
ATOM   6484  C  CD2 . TYR B  1 388 ? 54.661  10.654  -12.844 1.00   26.95 ? 495 TYR B CD2 1 
ATOM   6485  C  CE1 . TYR B  1 388 ? 55.944  13.128  -12.770 1.00   25.19 ? 495 TYR B CE1 1 
ATOM   6486  C  CE2 . TYR B  1 388 ? 56.062  10.722  -12.842 1.00   24.70 ? 495 TYR B CE2 1 
ATOM   6487  C  CZ  . TYR B  1 388 ? 56.689  11.958  -12.807 1.00   24.57 ? 495 TYR B CZ  1 
ATOM   6488  O  OH  . TYR B  1 388 ? 58.059  12.035  -12.811 1.00   32.05 ? 495 TYR B OH  1 
ATOM   6489  N  N   . ASN B  1 389 ? 52.678  11.162  -16.028 1.00   26.21 ? 496 ASN B N   1 
ATOM   6490  C  CA  . ASN B  1 389 ? 52.623  10.216  -17.133 1.00   28.62 ? 496 ASN B CA  1 
ATOM   6491  C  C   . ASN B  1 389 ? 52.856  8.762   -16.734 1.00   29.62 ? 496 ASN B C   1 
ATOM   6492  O  O   . ASN B  1 389 ? 52.322  7.854   -17.367 1.00   30.49 ? 496 ASN B O   1 
ATOM   6493  C  CB  . ASN B  1 389 ? 53.628  10.618  -18.206 1.00   29.40 ? 496 ASN B CB  1 
ATOM   6494  C  CG  . ASN B  1 389 ? 55.031  10.576  -17.704 1.00   31.98 ? 496 ASN B CG  1 
ATOM   6495  O  OD1 . ASN B  1 389 ? 55.421  11.381  -16.853 1.00   33.20 ? 496 ASN B OD1 1 
ATOM   6496  N  ND2 . ASN B  1 389 ? 55.810  9.618   -18.212 1.00   32.62 ? 496 ASN B ND2 1 
ATOM   6497  N  N   . ARG B  1 390 ? 53.636  8.538   -15.681 1.00   31.67 ? 497 ARG B N   1 
ATOM   6498  C  CA  . ARG B  1 390 ? 53.942  7.178   -15.231 1.00   31.79 ? 497 ARG B CA  1 
ATOM   6499  C  C   . ARG B  1 390 ? 53.906  7.159   -13.698 1.00   30.39 ? 497 ARG B C   1 
ATOM   6500  O  O   . ARG B  1 390 ? 54.935  7.319   -13.037 1.00   31.70 ? 497 ARG B O   1 
ATOM   6501  C  CB  . ARG B  1 390 ? 55.330  6.790   -15.744 1.00   34.37 ? 497 ARG B CB  1 
ATOM   6502  C  CG  . ARG B  1 390 ? 55.441  5.395   -16.296 1.00   38.32 ? 497 ARG B CG  1 
ATOM   6503  C  CD  . ARG B  1 390 ? 56.030  4.462   -15.279 1.00   42.05 ? 497 ARG B CD  1 
ATOM   6504  N  NE  . ARG B  1 390 ? 55.994  3.092   -15.767 1.00   46.42 ? 497 ARG B NE  1 
ATOM   6505  C  CZ  . ARG B  1 390 ? 56.339  2.031   -15.045 1.00   48.47 ? 497 ARG B CZ  1 
ATOM   6506  N  NH1 . ARG B  1 390 ? 56.259  0.821   -15.583 1.00   45.51 ? 497 ARG B NH1 1 
ATOM   6507  N  NH2 . ARG B  1 390 ? 56.768  2.184   -13.793 1.00   48.79 ? 497 ARG B NH2 1 
ATOM   6508  N  N   . ARG B  1 391 ? 52.713  6.941   -13.151 1.00   25.71 ? 498 ARG B N   1 
ATOM   6509  C  CA  . ARG B  1 391 ? 52.482  6.957   -11.710 1.00   23.58 ? 498 ARG B CA  1 
ATOM   6510  C  C   . ARG B  1 391 ? 53.453  6.184   -10.810 1.00   25.15 ? 498 ARG B C   1 
ATOM   6511  O  O   . ARG B  1 391 ? 53.891  6.705   -9.773  1.00   25.59 ? 498 ARG B O   1 
ATOM   6512  C  CB  . ARG B  1 391 ? 51.046  6.509   -11.433 1.00   21.77 ? 498 ARG B CB  1 
ATOM   6513  C  CG  . ARG B  1 391 ? 50.514  6.910   -10.075 1.00   20.59 ? 498 ARG B CG  1 
ATOM   6514  C  CD  . ARG B  1 391 ? 49.007  6.766   -10.030 1.00   17.41 ? 498 ARG B CD  1 
ATOM   6515  N  NE  . ARG B  1 391 ? 48.614  5.372   -10.202 1.00   18.88 ? 498 ARG B NE  1 
ATOM   6516  C  CZ  . ARG B  1 391 ? 47.358  4.968   -10.383 1.00   22.47 ? 498 ARG B CZ  1 
ATOM   6517  N  NH1 . ARG B  1 391 ? 47.078  3.669   -10.538 1.00   17.09 ? 498 ARG B NH1 1 
ATOM   6518  N  NH2 . ARG B  1 391 ? 46.381  5.866   -10.418 1.00   16.72 ? 498 ARG B NH2 1 
ATOM   6519  N  N   . GLY B  1 392 ? 53.788  4.955   -11.192 1.00   23.58 ? 499 GLY B N   1 
ATOM   6520  C  CA  . GLY B  1 392 ? 54.690  4.159   -10.384 1.00   22.23 ? 499 GLY B CA  1 
ATOM   6521  C  C   . GLY B  1 392 ? 56.113  4.672   -10.245 1.00   23.57 ? 499 GLY B C   1 
ATOM   6522  O  O   . GLY B  1 392 ? 56.859  4.164   -9.408  1.00   25.47 ? 499 GLY B O   1 
ATOM   6523  N  N   . ASP B  1 393 ? 56.510  5.656   -11.047 1.00   22.31 ? 500 ASP B N   1 
ATOM   6524  C  CA  . ASP B  1 393 ? 57.875  6.168   -10.936 1.00   25.22 ? 500 ASP B CA  1 
ATOM   6525  C  C   . ASP B  1 393 ? 57.996  7.211   -9.825  1.00   25.84 ? 500 ASP B C   1 
ATOM   6526  O  O   . ASP B  1 393 ? 59.098  7.637   -9.464  1.00   27.54 ? 500 ASP B O   1 
ATOM   6527  C  CB  . ASP B  1 393 ? 58.348  6.766   -12.267 1.00   25.83 ? 500 ASP B CB  1 
ATOM   6528  C  CG  . ASP B  1 393 ? 58.647  5.699   -13.311 1.00   26.84 ? 500 ASP B CG  1 
ATOM   6529  O  OD1 . ASP B  1 393 ? 58.747  4.511   -12.935 1.00   30.45 ? 500 ASP B OD1 1 
ATOM   6530  O  OD2 . ASP B  1 393 ? 58.796  6.041   -14.507 1.00   29.99 ? 500 ASP B OD2 1 
ATOM   6531  N  N   . LEU B  1 394 ? 56.861  7.610   -9.274  1.00   22.35 ? 501 LEU B N   1 
ATOM   6532  C  CA  . LEU B  1 394 ? 56.854  8.602   -8.202  1.00   23.85 ? 501 LEU B CA  1 
ATOM   6533  C  C   . LEU B  1 394 ? 57.099  8.023   -6.817  1.00   22.29 ? 501 LEU B C   1 
ATOM   6534  O  O   . LEU B  1 394 ? 56.720  6.888   -6.524  1.00   23.92 ? 501 LEU B O   1 
ATOM   6535  C  CB  . LEU B  1 394 ? 55.508  9.326   -8.153  1.00   22.10 ? 501 LEU B CB  1 
ATOM   6536  C  CG  . LEU B  1 394 ? 55.077  10.112  -9.397  1.00   24.92 ? 501 LEU B CG  1 
ATOM   6537  C  CD1 . LEU B  1 394 ? 53.592  10.387  -9.330  1.00   17.42 ? 501 LEU B CD1 1 
ATOM   6538  C  CD2 . LEU B  1 394 ? 55.867  11.408  -9.479  1.00   20.46 ? 501 LEU B CD2 1 
ATOM   6539  N  N   . ALA B  1 395 ? 57.741  8.825   -5.980  1.00   17.93 ? 502 ALA B N   1 
ATOM   6540  C  CA  . ALA B  1 395 ? 57.981  8.483   -4.593  1.00   18.25 ? 502 ALA B CA  1 
ATOM   6541  C  C   . ALA B  1 395 ? 57.599  9.803   -3.913  1.00   19.17 ? 502 ALA B C   1 
ATOM   6542  O  O   . ALA B  1 395 ? 58.010  10.882  -4.353  1.00   19.93 ? 502 ALA B O   1 
ATOM   6543  C  CB  . ALA B  1 395 ? 59.441  8.136   -4.350  1.00   12.65 ? 502 ALA B CB  1 
ATOM   6544  N  N   . ILE B  1 396 ? 56.792  9.713   -2.866  1.00   20.25 ? 503 ILE B N   1 
ATOM   6545  C  CA  . ILE B  1 396 ? 56.307  10.896  -2.160  1.00   19.18 ? 503 ILE B CA  1 
ATOM   6546  C  C   . ILE B  1 396 ? 56.575  10.784  -0.666  1.00   19.63 ? 503 ILE B C   1 
ATOM   6547  O  O   . ILE B  1 396 ? 56.233  9.784   -0.039  1.00   19.08 ? 503 ILE B O   1 
ATOM   6548  C  CB  . ILE B  1 396 ? 54.786  11.056  -2.389  1.00   16.61 ? 503 ILE B CB  1 
ATOM   6549  C  CG1 . ILE B  1 396 ? 54.512  11.125  -3.889  1.00   14.36 ? 503 ILE B CG1 1 
ATOM   6550  C  CG2 . ILE B  1 396 ? 54.262  12.307  -1.700  1.00   12.26 ? 503 ILE B CG2 1 
ATOM   6551  C  CD1 . ILE B  1 396 ? 53.043  11.234  -4.227  1.00   17.57 ? 503 ILE B CD1 1 
ATOM   6552  N  N   . HIS B  1 397 ? 57.181  11.820  -0.105  1.00   19.88 ? 504 HIS B N   1 
ATOM   6553  C  CA  . HIS B  1 397 ? 57.497  11.832  1.308   1.00   22.37 ? 504 HIS B CA  1 
ATOM   6554  C  C   . HIS B  1 397 ? 56.918  13.081  1.966   1.00   24.28 ? 504 HIS B C   1 
ATOM   6555  O  O   . HIS B  1 397 ? 56.772  14.131  1.327   1.00   25.56 ? 504 HIS B O   1 
ATOM   6556  C  CB  . HIS B  1 397 ? 59.013  11.812  1.487   1.00   21.68 ? 504 HIS B CB  1 
ATOM   6557  C  CG  . HIS B  1 397 ? 59.715  10.869  0.562   1.00   22.73 ? 504 HIS B CG  1 
ATOM   6558  N  ND1 . HIS B  1 397 ? 59.892  9.533   0.857   1.00   25.23 ? 504 HIS B ND1 1 
ATOM   6559  C  CD2 . HIS B  1 397 ? 60.230  11.055  -0.677  1.00   23.15 ? 504 HIS B CD2 1 
ATOM   6560  C  CE1 . HIS B  1 397 ? 60.480  8.937   -0.166  1.00   25.02 ? 504 HIS B CE1 1 
ATOM   6561  N  NE2 . HIS B  1 397 ? 60.695  9.838   -1.109  1.00   23.13 ? 504 HIS B NE2 1 
ATOM   6562  N  N   . LEU B  1 398 ? 56.589  12.954  3.247   1.00   22.59 ? 505 LEU B N   1 
ATOM   6563  C  CA  . LEU B  1 398 ? 56.054  14.061  4.020   1.00   19.61 ? 505 LEU B CA  1 
ATOM   6564  C  C   . LEU B  1 398 ? 56.870  14.139  5.311   1.00   19.40 ? 505 LEU B C   1 
ATOM   6565  O  O   . LEU B  1 398 ? 56.975  13.149  6.048   1.00   19.78 ? 505 LEU B O   1 
ATOM   6566  C  CB  . LEU B  1 398 ? 54.576  13.824  4.345   1.00   18.34 ? 505 LEU B CB  1 
ATOM   6567  C  CG  . LEU B  1 398 ? 53.934  14.972  5.130   1.00   19.74 ? 505 LEU B CG  1 
ATOM   6568  C  CD1 . LEU B  1 398 ? 53.847  16.207  4.247   1.00   16.49 ? 505 LEU B CD1 1 
ATOM   6569  C  CD2 . LEU B  1 398 ? 52.569  14.552  5.621   1.00   15.84 ? 505 LEU B CD2 1 
ATOM   6570  N  N   . VAL B  1 399 ? 57.468  15.299  5.567   1.00   18.75 ? 506 VAL B N   1 
ATOM   6571  C  CA  . VAL B  1 399 ? 58.279  15.495  6.762   1.00   17.86 ? 506 VAL B CA  1 
ATOM   6572  C  C   . VAL B  1 399 ? 57.562  16.410  7.739   1.00   19.48 ? 506 VAL B C   1 
ATOM   6573  O  O   . VAL B  1 399 ? 57.157  17.508  7.374   1.00   18.79 ? 506 VAL B O   1 
ATOM   6574  C  CB  . VAL B  1 399 ? 59.624  16.133  6.407   1.00   21.35 ? 506 VAL B CB  1 
ATOM   6575  C  CG1 . VAL B  1 399 ? 60.489  16.262  7.654   1.00   18.68 ? 506 VAL B CG1 1 
ATOM   6576  C  CG2 . VAL B  1 399 ? 60.323  15.297  5.351   1.00   17.73 ? 506 VAL B CG2 1 
ATOM   6577  N  N   . SER B  1 400 ? 57.406  15.961  8.979   1.00   20.01 ? 507 SER B N   1 
ATOM   6578  C  CA  . SER B  1 400 ? 56.726  16.763  9.983   1.00   18.43 ? 507 SER B CA  1 
ATOM   6579  C  C   . SER B  1 400 ? 57.675  17.813  10.542  1.00   18.46 ? 507 SER B C   1 
ATOM   6580  O  O   . SER B  1 400 ? 58.887  17.708  10.383  1.00   16.82 ? 507 SER B O   1 
ATOM   6581  C  CB  . SER B  1 400 ? 56.229  15.874  11.131  1.00   19.16 ? 507 SER B CB  1 
ATOM   6582  O  OG  . SER B  1 400 ? 57.311  15.387  11.914  1.00   19.62 ? 507 SER B OG  1 
ATOM   6583  N  N   . PRO B  1 401 ? 57.126  18.849  11.198  1.00   20.40 ? 508 PRO B N   1 
ATOM   6584  C  CA  . PRO B  1 401 ? 57.947  19.907  11.786  1.00   21.17 ? 508 PRO B CA  1 
ATOM   6585  C  C   . PRO B  1 401 ? 58.997  19.309  12.729  1.00   21.88 ? 508 PRO B C   1 
ATOM   6586  O  O   . PRO B  1 401 ? 60.098  19.830  12.852  1.00   21.28 ? 508 PRO B O   1 
ATOM   6587  C  CB  . PRO B  1 401 ? 56.915  20.761  12.523  1.00   22.55 ? 508 PRO B CB  1 
ATOM   6588  C  CG  . PRO B  1 401 ? 55.737  20.674  11.597  1.00   18.38 ? 508 PRO B CG  1 
ATOM   6589  C  CD  . PRO B  1 401 ? 55.696  19.206  11.256  1.00   20.04 ? 508 PRO B CD  1 
ATOM   6590  N  N   . MET B  1 402 ? 58.656  18.206  13.389  1.00   22.32 ? 509 MET B N   1 
ATOM   6591  C  CA  . MET B  1 402 ? 59.592  17.582  14.302  1.00   23.27 ? 509 MET B CA  1 
ATOM   6592  C  C   . MET B  1 402 ? 60.582  16.627  13.630  1.00   22.80 ? 509 MET B C   1 
ATOM   6593  O  O   . MET B  1 402 ? 61.262  15.854  14.294  1.00   25.93 ? 509 MET B O   1 
ATOM   6594  C  CB  . MET B  1 402 ? 58.828  16.897  15.426  1.00   23.72 ? 509 MET B CB  1 
ATOM   6595  C  CG  . MET B  1 402 ? 58.182  17.914  16.347  1.00   24.57 ? 509 MET B CG  1 
ATOM   6596  S  SD  . MET B  1 402 ? 57.260  17.208  17.720  1.00   27.75 ? 509 MET B SD  1 
ATOM   6597  C  CE  . MET B  1 402 ? 58.594  17.091  18.997  1.00   25.64 ? 509 MET B CE  1 
ATOM   6598  N  N   . GLY B  1 403 ? 60.647  16.688  12.307  1.00   21.36 ? 510 GLY B N   1 
ATOM   6599  C  CA  . GLY B  1 403 ? 61.603  15.885  11.564  1.00   22.39 ? 510 GLY B CA  1 
ATOM   6600  C  C   . GLY B  1 403 ? 61.273  14.458  11.189  1.00   22.75 ? 510 GLY B C   1 
ATOM   6601  O  O   . GLY B  1 403 ? 62.137  13.734  10.697  1.00   23.89 ? 510 GLY B O   1 
ATOM   6602  N  N   . THR B  1 404 ? 60.040  14.037  11.412  1.00   23.55 ? 511 THR B N   1 
ATOM   6603  C  CA  . THR B  1 404 ? 59.679  12.675  11.075  1.00   21.37 ? 511 THR B CA  1 
ATOM   6604  C  C   . THR B  1 404 ? 59.315  12.597  9.599   1.00   22.02 ? 511 THR B C   1 
ATOM   6605  O  O   . THR B  1 404 ? 58.431  13.302  9.105   1.00   21.31 ? 511 THR B O   1 
ATOM   6606  C  CB  . THR B  1 404 ? 58.518  12.191  11.939  1.00   22.40 ? 511 THR B CB  1 
ATOM   6607  O  OG1 . THR B  1 404 ? 58.884  12.311  13.318  1.00   20.60 ? 511 THR B OG1 1 
ATOM   6608  C  CG2 . THR B  1 404 ? 58.198  10.737  11.626  1.00   19.28 ? 511 THR B CG2 1 
ATOM   6609  N  N   . ARG B  1 405 ? 60.017  11.728  8.893   1.00   21.34 ? 512 ARG B N   1 
ATOM   6610  C  CA  . ARG B  1 405 ? 59.805  11.558  7.469   1.00   22.58 ? 512 ARG B CA  1 
ATOM   6611  C  C   . ARG B  1 405 ? 58.937  10.345  7.128   1.00   21.25 ? 512 ARG B C   1 
ATOM   6612  O  O   . ARG B  1 405 ? 59.370  9.198   7.247   1.00   17.78 ? 512 ARG B O   1 
ATOM   6613  C  CB  . ARG B  1 405 ? 61.160  11.439  6.779   1.00   24.50 ? 512 ARG B CB  1 
ATOM   6614  C  CG  . ARG B  1 405 ? 61.075  11.108  5.314   1.00   34.48 ? 512 ARG B CG  1 
ATOM   6615  C  CD  . ARG B  1 405 ? 62.472  10.969  4.748   1.00   43.26 ? 512 ARG B CD  1 
ATOM   6616  N  NE  . ARG B  1 405 ? 63.063  12.285  4.595   1.00   44.60 ? 512 ARG B NE  1 
ATOM   6617  C  CZ  . ARG B  1 405 ? 62.956  12.986  3.480   1.00   46.67 ? 512 ARG B CZ  1 
ATOM   6618  N  NH1 . ARG B  1 405 ? 63.498  14.195  3.396   1.00   46.95 ? 512 ARG B NH1 1 
ATOM   6619  N  NH2 . ARG B  1 405 ? 62.336  12.444  2.437   1.00   45.76 ? 512 ARG B NH2 1 
ATOM   6620  N  N   . SER B  1 406 ? 57.709  10.614  6.699   1.00   19.58 ? 513 SER B N   1 
ATOM   6621  C  CA  . SER B  1 406 ? 56.786  9.553   6.332   1.00   18.78 ? 513 SER B CA  1 
ATOM   6622  C  C   . SER B  1 406 ? 56.779  9.389   4.831   1.00   18.06 ? 513 SER B C   1 
ATOM   6623  O  O   . SER B  1 406 ? 56.579  10.352  4.094   1.00   22.15 ? 513 SER B O   1 
ATOM   6624  C  CB  . SER B  1 406 ? 55.364  9.883   6.795   1.00   19.04 ? 513 SER B CB  1 
ATOM   6625  O  OG  . SER B  1 406 ? 55.275  9.946   8.206   1.00   22.09 ? 513 SER B OG  1 
ATOM   6626  N  N   . THR B  1 407 ? 57.009  8.173   4.364   1.00   17.74 ? 514 THR B N   1 
ATOM   6627  C  CA  . THR B  1 407 ? 56.984  7.932   2.934   1.00   18.90 ? 514 THR B CA  1 
ATOM   6628  C  C   . THR B  1 407 ? 55.542  7.581   2.617   1.00   20.24 ? 514 THR B C   1 
ATOM   6629  O  O   . THR B  1 407 ? 55.062  6.513   2.989   1.00   18.84 ? 514 THR B O   1 
ATOM   6630  C  CB  . THR B  1 407 ? 57.901  6.756   2.527   1.00   19.12 ? 514 THR B CB  1 
ATOM   6631  O  OG1 . THR B  1 407 ? 59.261  7.150   2.684   1.00   19.01 ? 514 THR B OG1 1 
ATOM   6632  C  CG2 . THR B  1 407 ? 57.659  6.343   1.066   1.00   12.89 ? 514 THR B CG2 1 
ATOM   6633  N  N   . LEU B  1 408 ? 54.856  8.501   1.946   1.00   19.30 ? 515 LEU B N   1 
ATOM   6634  C  CA  . LEU B  1 408 ? 53.456  8.323   1.591   1.00   20.09 ? 515 LEU B CA  1 
ATOM   6635  C  C   . LEU B  1 408 ? 53.315  7.372   0.423   1.00   20.74 ? 515 LEU B C   1 
ATOM   6636  O  O   . LEU B  1 408 ? 52.319  6.663   0.304   1.00   25.35 ? 515 LEU B O   1 
ATOM   6637  C  CB  . LEU B  1 408 ? 52.839  9.675   1.241   1.00   18.96 ? 515 LEU B CB  1 
ATOM   6638  C  CG  . LEU B  1 408 ? 52.932  10.718  2.370   1.00   20.03 ? 515 LEU B CG  1 
ATOM   6639  C  CD1 . LEU B  1 408 ? 52.430  12.064  1.857   1.00   18.71 ? 515 LEU B CD1 1 
ATOM   6640  C  CD2 . LEU B  1 408 ? 52.093  10.278  3.579   1.00   17.38 ? 515 LEU B CD2 1 
ATOM   6641  N  N   . LEU B  1 409 ? 54.321  7.358   -0.439  1.00   20.77 ? 516 LEU B N   1 
ATOM   6642  C  CA  . LEU B  1 409 ? 54.304  6.489   -1.602  1.00   20.73 ? 516 LEU B CA  1 
ATOM   6643  C  C   . LEU B  1 409 ? 55.713  6.145   -2.067  1.00   21.74 ? 516 LEU B C   1 
ATOM   6644  O  O   . LEU B  1 409 ? 56.528  7.036   -2.323  1.00   21.73 ? 516 LEU B O   1 
ATOM   6645  C  CB  . LEU B  1 409 ? 53.550  7.159   -2.757  1.00   20.03 ? 516 LEU B CB  1 
ATOM   6646  C  CG  . LEU B  1 409 ? 53.488  6.365   -4.075  1.00   20.45 ? 516 LEU B CG  1 
ATOM   6647  C  CD1 . LEU B  1 409 ? 52.466  5.253   -3.910  1.00   18.59 ? 516 LEU B CD1 1 
ATOM   6648  C  CD2 . LEU B  1 409 ? 53.110  7.260   -5.263  1.00   15.04 ? 516 LEU B CD2 1 
ATOM   6649  N  N   . ALA B  1 410 ? 56.002  4.854   -2.157  1.00   19.59 ? 517 ALA B N   1 
ATOM   6650  C  CA  . ALA B  1 410 ? 57.293  4.399   -2.651  1.00   20.93 ? 517 ALA B CA  1 
ATOM   6651  C  C   . ALA B  1 410 ? 57.071  4.031   -4.119  1.00   21.13 ? 517 ALA B C   1 
ATOM   6652  O  O   . ALA B  1 410 ? 55.933  3.862   -4.564  1.00   18.47 ? 517 ALA B O   1 
ATOM   6653  C  CB  . ALA B  1 410 ? 57.756  3.179   -1.876  1.00   18.80 ? 517 ALA B CB  1 
ATOM   6654  N  N   . ALA B  1 411 ? 58.148  3.910   -4.874  1.00   19.94 ? 518 ALA B N   1 
ATOM   6655  C  CA  . ALA B  1 411 ? 58.019  3.560   -6.277  1.00   23.33 ? 518 ALA B CA  1 
ATOM   6656  C  C   . ALA B  1 411 ? 57.307  2.217   -6.443  1.00   23.53 ? 518 ALA B C   1 
ATOM   6657  O  O   . ALA B  1 411 ? 57.502  1.289   -5.656  1.00   21.95 ? 518 ALA B O   1 
ATOM   6658  C  CB  . ALA B  1 411 ? 59.396  3.501   -6.932  1.00   21.60 ? 518 ALA B CB  1 
ATOM   6659  N  N   . ARG B  1 412 ? 56.461  2.138   -7.461  1.00   21.15 ? 519 ARG B N   1 
ATOM   6660  C  CA  . ARG B  1 412 ? 55.729  0.921   -7.776  1.00   22.88 ? 519 ARG B CA  1 
ATOM   6661  C  C   . ARG B  1 412 ? 56.022  0.672   -9.258  1.00   23.62 ? 519 ARG B C   1 
ATOM   6662  O  O   . ARG B  1 412 ? 55.344  1.187   -10.145 1.00   24.72 ? 519 ARG B O   1 
ATOM   6663  C  CB  . ARG B  1 412 ? 54.226  1.103   -7.534  1.00   21.78 ? 519 ARG B CB  1 
ATOM   6664  C  CG  . ARG B  1 412 ? 53.846  1.283   -6.061  1.00   20.14 ? 519 ARG B CG  1 
ATOM   6665  C  CD  . ARG B  1 412 ? 52.378  0.899   -5.812  1.00   18.08 ? 519 ARG B CD  1 
ATOM   6666  N  NE  . ARG B  1 412 ? 51.450  1.655   -6.650  1.00   18.66 ? 519 ARG B NE  1 
ATOM   6667  C  CZ  . ARG B  1 412 ? 50.176  1.324   -6.860  1.00   19.00 ? 519 ARG B CZ  1 
ATOM   6668  N  NH1 . ARG B  1 412 ? 49.412  2.080   -7.647  1.00   20.99 ? 519 ARG B NH1 1 
ATOM   6669  N  NH2 . ARG B  1 412 ? 49.663  0.238   -6.294  1.00   11.53 ? 519 ARG B NH2 1 
ATOM   6670  N  N   . PRO B  1 413 ? 57.061  -0.117  -9.536  1.00   22.78 ? 520 PRO B N   1 
ATOM   6671  C  CA  . PRO B  1 413 ? 57.458  -0.424  -10.907 1.00   22.57 ? 520 PRO B CA  1 
ATOM   6672  C  C   . PRO B  1 413 ? 56.381  -0.950  -11.850 1.00   21.74 ? 520 PRO B C   1 
ATOM   6673  O  O   . PRO B  1 413 ? 56.453  -0.715  -13.046 1.00   22.34 ? 520 PRO B O   1 
ATOM   6674  C  CB  . PRO B  1 413 ? 58.633  -1.390  -10.723 1.00   22.02 ? 520 PRO B CB  1 
ATOM   6675  C  CG  . PRO B  1 413 ? 58.371  -2.019  -9.385  1.00   25.18 ? 520 PRO B CG  1 
ATOM   6676  C  CD  . PRO B  1 413 ? 57.895  -0.851  -8.564  1.00   24.04 ? 520 PRO B CD  1 
ATOM   6677  N  N   . HIS B  1 414 ? 55.378  -1.649  -11.340 1.00   21.70 ? 521 HIS B N   1 
ATOM   6678  C  CA  . HIS B  1 414 ? 54.329  -2.146  -12.230 1.00   23.04 ? 521 HIS B CA  1 
ATOM   6679  C  C   . HIS B  1 414 ? 53.215  -1.131  -12.516 1.00   24.80 ? 521 HIS B C   1 
ATOM   6680  O  O   . HIS B  1 414 ? 52.349  -1.385  -13.356 1.00   22.79 ? 521 HIS B O   1 
ATOM   6681  C  CB  . HIS B  1 414 ? 53.693  -3.415  -11.666 1.00   23.35 ? 521 HIS B CB  1 
ATOM   6682  C  CG  . HIS B  1 414 ? 54.663  -4.529  -11.452 1.00   28.60 ? 521 HIS B CG  1 
ATOM   6683  N  ND1 . HIS B  1 414 ? 55.565  -4.923  -12.416 1.00   29.10 ? 521 HIS B ND1 1 
ATOM   6684  C  CD2 . HIS B  1 414 ? 54.893  -5.314  -10.375 1.00   30.66 ? 521 HIS B CD2 1 
ATOM   6685  C  CE1 . HIS B  1 414 ? 56.312  -5.901  -11.937 1.00   34.24 ? 521 HIS B CE1 1 
ATOM   6686  N  NE2 . HIS B  1 414 ? 55.924  -6.158  -10.701 1.00   31.73 ? 521 HIS B NE2 1 
ATOM   6687  N  N   . ASP B  1 415 ? 53.233  0.008   -11.822 1.00   23.85 ? 522 ASP B N   1 
ATOM   6688  C  CA  . ASP B  1 415 ? 52.204  1.027   -12.000 1.00   26.95 ? 522 ASP B CA  1 
ATOM   6689  C  C   . ASP B  1 415 ? 52.548  1.982   -13.139 1.00   27.34 ? 522 ASP B C   1 
ATOM   6690  O  O   . ASP B  1 415 ? 53.277  2.963   -12.953 1.00   30.23 ? 522 ASP B O   1 
ATOM   6691  C  CB  . ASP B  1 415 ? 52.002  1.811   -10.694 1.00   27.13 ? 522 ASP B CB  1 
ATOM   6692  C  CG  . ASP B  1 415 ? 50.796  2.747   -10.749 1.00   29.13 ? 522 ASP B CG  1 
ATOM   6693  O  OD1 . ASP B  1 415 ? 49.981  2.615   -11.693 1.00   27.20 ? 522 ASP B OD1 1 
ATOM   6694  O  OD2 . ASP B  1 415 ? 50.655  3.606   -9.846  1.00   22.71 ? 522 ASP B OD2 1 
ATOM   6695  N  N   . TYR B  1 416 ? 52.003  1.693   -14.315 1.00   27.16 ? 523 TYR B N   1 
ATOM   6696  C  CA  . TYR B  1 416 ? 52.253  2.504   -15.501 1.00   29.05 ? 523 TYR B CA  1 
ATOM   6697  C  C   . TYR B  1 416 ? 51.077  3.428   -15.793 1.00   25.89 ? 523 TYR B C   1 
ATOM   6698  O  O   . TYR B  1 416 ? 50.980  4.001   -16.874 1.00   26.30 ? 523 TYR B O   1 
ATOM   6699  C  CB  . TYR B  1 416 ? 52.516  1.585   -16.706 1.00   31.05 ? 523 TYR B CB  1 
ATOM   6700  C  CG  . TYR B  1 416 ? 51.382  0.624   -16.954 1.00   37.40 ? 523 TYR B CG  1 
ATOM   6701  C  CD1 . TYR B  1 416 ? 50.201  1.047   -17.573 1.00   38.12 ? 523 TYR B CD1 1 
ATOM   6702  C  CD2 . TYR B  1 416 ? 51.451  -0.692  -16.488 1.00   39.83 ? 523 TYR B CD2 1 
ATOM   6703  C  CE1 . TYR B  1 416 ? 49.111  0.186   -17.714 1.00   40.73 ? 523 TYR B CE1 1 
ATOM   6704  C  CE2 . TYR B  1 416 ? 50.370  -1.564  -16.622 1.00   41.56 ? 523 TYR B CE2 1 
ATOM   6705  C  CZ  . TYR B  1 416 ? 49.202  -1.117  -17.231 1.00   44.13 ? 523 TYR B CZ  1 
ATOM   6706  O  OH  . TYR B  1 416 ? 48.123  -1.971  -17.328 1.00   45.98 ? 523 TYR B OH  1 
ATOM   6707  N  N   . SER B  1 417 ? 50.188  3.574   -14.821 1.00   25.98 ? 524 SER B N   1 
ATOM   6708  C  CA  . SER B  1 417 ? 49.013  4.417   -14.994 1.00   27.43 ? 524 SER B CA  1 
ATOM   6709  C  C   . SER B  1 417 ? 49.341  5.854   -15.308 1.00   26.69 ? 524 SER B C   1 
ATOM   6710  O  O   . SER B  1 417 ? 50.327  6.405   -14.821 1.00   29.61 ? 524 SER B O   1 
ATOM   6711  C  CB  . SER B  1 417 ? 48.131  4.387   -13.749 1.00   28.72 ? 524 SER B CB  1 
ATOM   6712  O  OG  . SER B  1 417 ? 47.083  5.343   -13.851 1.00   28.88 ? 524 SER B OG  1 
ATOM   6713  N  N   . ALA B  1 418 ? 48.493  6.459   -16.128 1.00   26.45 ? 525 ALA B N   1 
ATOM   6714  C  CA  . ALA B  1 418 ? 48.662  7.850   -16.504 1.00   29.96 ? 525 ALA B CA  1 
ATOM   6715  C  C   . ALA B  1 418 ? 47.540  8.694   -15.877 1.00   29.82 ? 525 ALA B C   1 
ATOM   6716  O  O   . ALA B  1 418 ? 47.375  9.875   -16.196 1.00   30.31 ? 525 ALA B O   1 
ATOM   6717  C  CB  . ALA B  1 418 ? 48.637  7.975   -18.025 1.00   28.65 ? 525 ALA B CB  1 
ATOM   6718  N  N   . ASP B  1 419 ? 46.787  8.087   -14.966 1.00   28.66 ? 526 ASP B N   1 
ATOM   6719  C  CA  . ASP B  1 419 ? 45.682  8.775   -14.312 1.00   29.21 ? 526 ASP B CA  1 
ATOM   6720  C  C   . ASP B  1 419 ? 46.039  9.586   -13.068 1.00   28.64 ? 526 ASP B C   1 
ATOM   6721  O  O   . ASP B  1 419 ? 45.175  10.246  -12.508 1.00   30.50 ? 526 ASP B O   1 
ATOM   6722  C  CB  . ASP B  1 419 ? 44.597  7.774   -13.919 1.00   31.50 ? 526 ASP B CB  1 
ATOM   6723  C  CG  . ASP B  1 419 ? 44.021  7.034   -15.104 1.00   36.52 ? 526 ASP B CG  1 
ATOM   6724  O  OD1 . ASP B  1 419 ? 43.780  7.674   -16.147 1.00   39.18 ? 526 ASP B OD1 1 
ATOM   6725  O  OD2 . ASP B  1 419 ? 43.795  5.811   -14.988 1.00   42.88 ? 526 ASP B OD2 1 
ATOM   6726  N  N   . GLY B  1 420 ? 47.289  9.537   -12.627 1.00   26.26 ? 527 GLY B N   1 
ATOM   6727  C  CA  . GLY B  1 420 ? 47.661  10.281  -11.437 1.00   25.45 ? 527 GLY B CA  1 
ATOM   6728  C  C   . GLY B  1 420 ? 46.836  9.950   -10.196 1.00   26.48 ? 527 GLY B C   1 
ATOM   6729  O  O   . GLY B  1 420 ? 46.324  8.830   -10.040 1.00   23.84 ? 527 GLY B O   1 
ATOM   6730  N  N   . PHE B  1 421 ? 46.727  10.929  -9.298  1.00   25.46 ? 528 PHE B N   1 
ATOM   6731  C  CA  . PHE B  1 421 ? 45.962  10.779  -8.057  1.00   24.58 ? 528 PHE B CA  1 
ATOM   6732  C  C   . PHE B  1 421 ? 44.900  11.866  -7.997  1.00   23.63 ? 528 PHE B C   1 
ATOM   6733  O  O   . PHE B  1 421 ? 45.177  13.041  -8.238  1.00   22.32 ? 528 PHE B O   1 
ATOM   6734  C  CB  . PHE B  1 421 ? 46.872  10.893  -6.830  1.00   23.30 ? 528 PHE B CB  1 
ATOM   6735  C  CG  . PHE B  1 421 ? 47.746  9.697   -6.615  1.00   18.78 ? 528 PHE B CG  1 
ATOM   6736  C  CD1 . PHE B  1 421 ? 47.227  8.535   -6.073  1.00   19.46 ? 528 PHE B CD1 1 
ATOM   6737  C  CD2 . PHE B  1 421 ? 49.080  9.723   -6.990  1.00   19.02 ? 528 PHE B CD2 1 
ATOM   6738  C  CE1 . PHE B  1 421 ? 48.025  7.395   -5.904  1.00   20.07 ? 528 PHE B CE1 1 
ATOM   6739  C  CE2 . PHE B  1 421 ? 49.894  8.598   -6.829  1.00   19.04 ? 528 PHE B CE2 1 
ATOM   6740  C  CZ  . PHE B  1 421 ? 49.368  7.428   -6.285  1.00   20.89 ? 528 PHE B CZ  1 
ATOM   6741  N  N   . ASN B  1 422 ? 43.678  11.458  -7.680  1.00   25.24 ? 529 ASN B N   1 
ATOM   6742  C  CA  . ASN B  1 422 ? 42.571  12.386  -7.604  1.00   24.20 ? 529 ASN B CA  1 
ATOM   6743  C  C   . ASN B  1 422 ? 42.089  12.518  -6.166  1.00   23.09 ? 529 ASN B C   1 
ATOM   6744  O  O   . ASN B  1 422 ? 41.296  11.708  -5.680  1.00   19.81 ? 529 ASN B O   1 
ATOM   6745  C  CB  . ASN B  1 422 ? 41.449  11.907  -8.511  1.00   28.11 ? 529 ASN B CB  1 
ATOM   6746  C  CG  . ASN B  1 422 ? 40.373  12.942  -8.665  1.00   38.86 ? 529 ASN B CG  1 
ATOM   6747  O  OD1 . ASN B  1 422 ? 40.637  14.143  -8.549  1.00   42.73 ? 529 ASN B OD1 1 
ATOM   6748  N  ND2 . ASN B  1 422 ? 39.149  12.497  -8.939  1.00   41.39 ? 529 ASN B ND2 1 
ATOM   6749  N  N   . ASP B  1 423 ? 42.586  13.556  -5.493  1.00   23.32 ? 530 ASP B N   1 
ATOM   6750  C  CA  . ASP B  1 423 ? 42.273  13.832  -4.097  1.00   22.74 ? 530 ASP B CA  1 
ATOM   6751  C  C   . ASP B  1 423 ? 42.440  12.571  -3.258  1.00   24.57 ? 530 ASP B C   1 
ATOM   6752  O  O   . ASP B  1 423 ? 41.550  12.211  -2.480  1.00   25.88 ? 530 ASP B O   1 
ATOM   6753  C  CB  . ASP B  1 423 ? 40.846  14.379  -3.940  1.00   22.87 ? 530 ASP B CB  1 
ATOM   6754  C  CG  . ASP B  1 423 ? 40.526  14.788  -2.496  1.00   25.04 ? 530 ASP B CG  1 
ATOM   6755  O  OD1 . ASP B  1 423 ? 41.404  15.355  -1.815  1.00   25.37 ? 530 ASP B OD1 1 
ATOM   6756  O  OD2 . ASP B  1 423 ? 39.394  14.558  -2.033  1.00   31.15 ? 530 ASP B OD2 1 
ATOM   6757  N  N   . TRP B  1 424 ? 43.581  11.905  -3.420  1.00   22.57 ? 531 TRP B N   1 
ATOM   6758  C  CA  . TRP B  1 424 ? 43.859  10.689  -2.675  1.00   21.34 ? 531 TRP B CA  1 
ATOM   6759  C  C   . TRP B  1 424 ? 44.460  11.074  -1.327  1.00   20.97 ? 531 TRP B C   1 
ATOM   6760  O  O   . TRP B  1 424 ? 45.429  11.832  -1.267  1.00   19.59 ? 531 TRP B O   1 
ATOM   6761  C  CB  . TRP B  1 424 ? 44.827  9.796   -3.443  1.00   21.62 ? 531 TRP B CB  1 
ATOM   6762  C  CG  . TRP B  1 424 ? 44.968  8.492   -2.782  1.00   17.55 ? 531 TRP B CG  1 
ATOM   6763  C  CD1 . TRP B  1 424 ? 46.030  8.052   -2.048  1.00   16.31 ? 531 TRP B CD1 1 
ATOM   6764  C  CD2 . TRP B  1 424 ? 43.990  7.454   -2.746  1.00   14.38 ? 531 TRP B CD2 1 
ATOM   6765  N  NE1 . TRP B  1 424 ? 45.773  6.798   -1.556  1.00   16.66 ? 531 TRP B NE1 1 
ATOM   6766  C  CE2 . TRP B  1 424 ? 44.527  6.403   -1.970  1.00   13.92 ? 531 TRP B CE2 1 
ATOM   6767  C  CE3 . TRP B  1 424 ? 42.710  7.308   -3.294  1.00   14.53 ? 531 TRP B CE3 1 
ATOM   6768  C  CZ2 . TRP B  1 424 ? 43.830  5.216   -1.728  1.00   15.66 ? 531 TRP B CZ2 1 
ATOM   6769  C  CZ3 . TRP B  1 424 ? 42.005  6.123   -3.052  1.00   16.49 ? 531 TRP B CZ3 1 
ATOM   6770  C  CH2 . TRP B  1 424 ? 42.573  5.092   -2.274  1.00   19.45 ? 531 TRP B CH2 1 
ATOM   6771  N  N   . ALA B  1 425 ? 43.892  10.542  -0.250  1.00   19.21 ? 532 ALA B N   1 
ATOM   6772  C  CA  . ALA B  1 425 ? 44.352  10.897  1.094   1.00   22.57 ? 532 ALA B CA  1 
ATOM   6773  C  C   . ALA B  1 425 ? 45.423  10.013  1.732   1.00   20.53 ? 532 ALA B C   1 
ATOM   6774  O  O   . ALA B  1 425 ? 45.111  9.219   2.619   1.00   24.54 ? 532 ALA B O   1 
ATOM   6775  C  CB  . ALA B  1 425 ? 43.139  10.991  2.046   1.00   19.68 ? 532 ALA B CB  1 
ATOM   6776  N  N   . PHE B  1 426 ? 46.674  10.168  1.312   1.00   15.65 ? 533 PHE B N   1 
ATOM   6777  C  CA  . PHE B  1 426 ? 47.773  9.388   1.885   1.00   17.08 ? 533 PHE B CA  1 
ATOM   6778  C  C   . PHE B  1 426 ? 47.772  9.640   3.384   1.00   17.08 ? 533 PHE B C   1 
ATOM   6779  O  O   . PHE B  1 426 ? 47.689  10.783  3.822   1.00   21.73 ? 533 PHE B O   1 
ATOM   6780  C  CB  . PHE B  1 426 ? 49.105  9.826   1.294   1.00   15.76 ? 533 PHE B CB  1 
ATOM   6781  C  CG  . PHE B  1 426 ? 49.211  9.581   -0.169  1.00   18.43 ? 533 PHE B CG  1 
ATOM   6782  C  CD1 . PHE B  1 426 ? 49.600  8.332   -0.653  1.00   16.04 ? 533 PHE B CD1 1 
ATOM   6783  C  CD2 . PHE B  1 426 ? 48.891  10.589  -1.072  1.00   16.55 ? 533 PHE B CD2 1 
ATOM   6784  C  CE1 . PHE B  1 426 ? 49.667  8.096   -2.020  1.00   19.52 ? 533 PHE B CE1 1 
ATOM   6785  C  CE2 . PHE B  1 426 ? 48.952  10.368  -2.444  1.00   19.82 ? 533 PHE B CE2 1 
ATOM   6786  C  CZ  . PHE B  1 426 ? 49.342  9.121   -2.924  1.00   21.64 ? 533 PHE B CZ  1 
ATOM   6787  N  N   . MET B  1 427 ? 47.872  8.578   4.168   1.00   15.18 ? 534 MET B N   1 
ATOM   6788  C  CA  . MET B  1 427 ? 47.827  8.724   5.612   1.00   15.60 ? 534 MET B CA  1 
ATOM   6789  C  C   . MET B  1 427 ? 49.079  8.207   6.310   1.00   15.66 ? 534 MET B C   1 
ATOM   6790  O  O   . MET B  1 427 ? 49.697  7.231   5.874   1.00   14.36 ? 534 MET B O   1 
ATOM   6791  C  CB  . MET B  1 427 ? 46.581  7.991   6.133   1.00   12.86 ? 534 MET B CB  1 
ATOM   6792  C  CG  . MET B  1 427 ? 46.210  8.251   7.590   1.00   16.11 ? 534 MET B CG  1 
ATOM   6793  S  SD  . MET B  1 427 ? 47.127  7.234   8.810   1.00   18.08 ? 534 MET B SD  1 
ATOM   6794  C  CE  . MET B  1 427 ? 46.144  5.634   8.773   1.00   12.39 ? 534 MET B CE  1 
ATOM   6795  N  N   . THR B  1 428 ? 49.476  8.879   7.382   1.00   15.14 ? 535 THR B N   1 
ATOM   6796  C  CA  . THR B  1 428 ? 50.623  8.412   8.137   1.00   17.93 ? 535 THR B CA  1 
ATOM   6797  C  C   . THR B  1 428 ? 50.318  8.402   9.621   1.00   18.16 ? 535 THR B C   1 
ATOM   6798  O  O   . THR B  1 428 ? 49.620  9.278   10.137  1.00   18.89 ? 535 THR B O   1 
ATOM   6799  C  CB  . THR B  1 428 ? 51.901  9.247   7.905   1.00   18.48 ? 535 THR B CB  1 
ATOM   6800  O  OG1 . THR B  1 428 ? 52.927  8.735   8.767   1.00   19.36 ? 535 THR B OG1 1 
ATOM   6801  C  CG2 . THR B  1 428 ? 51.677  10.740  8.206   1.00   15.35 ? 535 THR B CG2 1 
ATOM   6802  N  N   . THR B  1 429 ? 50.830  7.386   10.294  1.00   14.66 ? 536 THR B N   1 
ATOM   6803  C  CA  . THR B  1 429 ? 50.630  7.244   11.721  1.00   17.88 ? 536 THR B CA  1 
ATOM   6804  C  C   . THR B  1 429 ? 51.951  7.511   12.426  1.00   16.16 ? 536 THR B C   1 
ATOM   6805  O  O   . THR B  1 429 ? 52.027  7.439   13.646  1.00   20.28 ? 536 THR B O   1 
ATOM   6806  C  CB  . THR B  1 429 ? 50.217  5.802   12.074  1.00   18.55 ? 536 THR B CB  1 
ATOM   6807  O  OG1 . THR B  1 429 ? 51.274  4.922   11.698  1.00   15.13 ? 536 THR B OG1 1 
ATOM   6808  C  CG2 . THR B  1 429 ? 48.966  5.392   11.324  1.00   18.16 ? 536 THR B CG2 1 
ATOM   6809  N  N   . HIS B  1 430 ? 52.987  7.825   11.658  1.00   13.99 ? 537 HIS B N   1 
ATOM   6810  C  CA  . HIS B  1 430 ? 54.314  8.018   12.230  1.00   17.63 ? 537 HIS B CA  1 
ATOM   6811  C  C   . HIS B  1 430 ? 54.566  9.254   13.087  1.00   19.70 ? 537 HIS B C   1 
ATOM   6812  O  O   . HIS B  1 430 ? 55.545  9.303   13.831  1.00   19.27 ? 537 HIS B O   1 
ATOM   6813  C  CB  . HIS B  1 430 ? 55.374  7.926   11.119  1.00   18.30 ? 537 HIS B CB  1 
ATOM   6814  C  CG  . HIS B  1 430 ? 55.435  6.582   10.454  1.00   17.40 ? 537 HIS B CG  1 
ATOM   6815  N  ND1 . HIS B  1 430 ? 56.551  6.133   9.779   1.00   21.16 ? 537 HIS B ND1 1 
ATOM   6816  C  CD2 . HIS B  1 430 ? 54.516  5.589   10.357  1.00   19.64 ? 537 HIS B CD2 1 
ATOM   6817  C  CE1 . HIS B  1 430 ? 56.317  4.924   9.296   1.00   20.13 ? 537 HIS B CE1 1 
ATOM   6818  N  NE2 . HIS B  1 430 ? 55.089  4.572   9.632   1.00   19.22 ? 537 HIS B NE2 1 
ATOM   6819  N  N   . SER B  1 431 ? 53.698  10.253  13.004  1.00   20.61 ? 538 SER B N   1 
ATOM   6820  C  CA  . SER B  1 431 ? 53.910  11.452  13.801  1.00   19.73 ? 538 SER B CA  1 
ATOM   6821  C  C   . SER B  1 431 ? 52.943  11.516  14.975  1.00   19.66 ? 538 SER B C   1 
ATOM   6822  O  O   . SER B  1 431 ? 52.743  12.573  15.569  1.00   18.75 ? 538 SER B O   1 
ATOM   6823  C  CB  . SER B  1 431 ? 53.797  12.702  12.920  1.00   19.00 ? 538 SER B CB  1 
ATOM   6824  O  OG  . SER B  1 431 ? 54.960  12.858  12.111  1.00   18.54 ? 538 SER B OG  1 
ATOM   6825  N  N   . TRP B  1 432 ? 52.357  10.368  15.307  1.00   17.65 ? 539 TRP B N   1 
ATOM   6826  C  CA  . TRP B  1 432 ? 51.414  10.268  16.421  1.00   17.64 ? 539 TRP B CA  1 
ATOM   6827  C  C   . TRP B  1 432 ? 52.018  10.893  17.692  1.00   18.12 ? 539 TRP B C   1 
ATOM   6828  O  O   . TRP B  1 432 ? 53.144  10.572  18.070  1.00   16.59 ? 539 TRP B O   1 
ATOM   6829  C  CB  . TRP B  1 432 ? 51.092  8.796   16.666  1.00   16.81 ? 539 TRP B CB  1 
ATOM   6830  C  CG  . TRP B  1 432 ? 49.865  8.536   17.482  1.00   18.73 ? 539 TRP B CG  1 
ATOM   6831  C  CD1 . TRP B  1 432 ? 49.751  8.576   18.842  1.00   18.41 ? 539 TRP B CD1 1 
ATOM   6832  C  CD2 . TRP B  1 432 ? 48.581  8.128   16.980  1.00   18.77 ? 539 TRP B CD2 1 
ATOM   6833  N  NE1 . TRP B  1 432 ? 48.475  8.210   19.220  1.00   17.77 ? 539 TRP B NE1 1 
ATOM   6834  C  CE2 . TRP B  1 432 ? 47.739  7.929   18.096  1.00   15.81 ? 539 TRP B CE2 1 
ATOM   6835  C  CE3 . TRP B  1 432 ? 48.065  7.904   15.691  1.00   16.04 ? 539 TRP B CE3 1 
ATOM   6836  C  CZ2 . TRP B  1 432 ? 46.403  7.513   17.967  1.00   14.72 ? 539 TRP B CZ2 1 
ATOM   6837  C  CZ3 . TRP B  1 432 ? 46.739  7.489   15.560  1.00   17.96 ? 539 TRP B CZ3 1 
ATOM   6838  C  CH2 . TRP B  1 432 ? 45.923  7.297   16.693  1.00   15.32 ? 539 TRP B CH2 1 
ATOM   6839  N  N   . ASP B  1 433 ? 51.258  11.784  18.326  1.00   17.26 ? 540 ASP B N   1 
ATOM   6840  C  CA  . ASP B  1 433 ? 51.648  12.498  19.544  1.00   16.30 ? 540 ASP B CA  1 
ATOM   6841  C  C   . ASP B  1 433 ? 52.602  13.668  19.366  1.00   18.09 ? 540 ASP B C   1 
ATOM   6842  O  O   . ASP B  1 433 ? 52.938  14.348  20.330  1.00   18.78 ? 540 ASP B O   1 
ATOM   6843  C  CB  . ASP B  1 433 ? 52.196  11.535  20.594  1.00   18.27 ? 540 ASP B CB  1 
ATOM   6844  C  CG  . ASP B  1 433 ? 51.091  10.875  21.378  1.00   21.70 ? 540 ASP B CG  1 
ATOM   6845  O  OD1 . ASP B  1 433 ? 50.119  11.586  21.711  1.00   21.91 ? 540 ASP B OD1 1 
ATOM   6846  O  OD2 . ASP B  1 433 ? 51.180  9.666   21.661  1.00   20.59 ? 540 ASP B OD2 1 
ATOM   6847  N  N   . GLU B  1 434 ? 53.030  13.919  18.136  1.00   18.06 ? 541 GLU B N   1 
ATOM   6848  C  CA  . GLU B  1 434 ? 53.922  15.047  17.867  1.00   17.68 ? 541 GLU B CA  1 
ATOM   6849  C  C   . GLU B  1 434 ? 53.115  16.349  17.846  1.00   19.30 ? 541 GLU B C   1 
ATOM   6850  O  O   . GLU B  1 434 ? 51.884  16.336  17.687  1.00   17.31 ? 541 GLU B O   1 
ATOM   6851  C  CB  . GLU B  1 434 ? 54.611  14.886  16.504  1.00   16.20 ? 541 GLU B CB  1 
ATOM   6852  C  CG  . GLU B  1 434 ? 55.762  13.871  16.457  1.00   16.76 ? 541 GLU B CG  1 
ATOM   6853  C  CD  . GLU B  1 434 ? 56.368  13.729  15.045  1.00   20.78 ? 541 GLU B CD  1 
ATOM   6854  O  OE1 . GLU B  1 434 ? 56.167  14.631  14.200  1.00   16.22 ? 541 GLU B OE1 1 
ATOM   6855  O  OE2 . GLU B  1 434 ? 57.055  12.716  14.781  1.00   20.55 ? 541 GLU B OE2 1 
ATOM   6856  N  N   . ASP B  1 435 ? 53.804  17.472  18.032  1.00   17.42 ? 542 ASP B N   1 
ATOM   6857  C  CA  . ASP B  1 435 ? 53.154  18.768  17.964  1.00   17.87 ? 542 ASP B CA  1 
ATOM   6858  C  C   . ASP B  1 435 ? 53.239  19.022  16.467  1.00   17.91 ? 542 ASP B C   1 
ATOM   6859  O  O   . ASP B  1 435 ? 54.323  19.027  15.897  1.00   18.31 ? 542 ASP B O   1 
ATOM   6860  C  CB  . ASP B  1 435 ? 53.954  19.826  18.717  1.00   21.89 ? 542 ASP B CB  1 
ATOM   6861  C  CG  . ASP B  1 435 ? 53.331  21.213  18.621  1.00   25.30 ? 542 ASP B CG  1 
ATOM   6862  O  OD1 . ASP B  1 435 ? 52.842  21.585  17.534  1.00   27.54 ? 542 ASP B OD1 1 
ATOM   6863  O  OD2 . ASP B  1 435 ? 53.343  21.937  19.630  1.00   25.19 ? 542 ASP B OD2 1 
ATOM   6864  N  N   . PRO B  1 436 ? 52.100  19.231  15.808  1.00   15.32 ? 543 PRO B N   1 
ATOM   6865  C  CA  . PRO B  1 436 ? 52.122  19.464  14.366  1.00   15.96 ? 543 PRO B CA  1 
ATOM   6866  C  C   . PRO B  1 436 ? 52.379  20.894  13.878  1.00   19.59 ? 543 PRO B C   1 
ATOM   6867  O  O   . PRO B  1 436 ? 52.448  21.130  12.661  1.00   16.53 ? 543 PRO B O   1 
ATOM   6868  C  CB  . PRO B  1 436 ? 50.761  18.938  13.926  1.00   16.73 ? 543 PRO B CB  1 
ATOM   6869  C  CG  . PRO B  1 436 ? 49.884  19.363  15.080  1.00   21.30 ? 543 PRO B CG  1 
ATOM   6870  C  CD  . PRO B  1 436 ? 50.725  19.047  16.306  1.00   17.21 ? 543 PRO B CD  1 
ATOM   6871  N  N   . SER B  1 437 ? 52.522  21.851  14.790  1.00   18.29 ? 544 SER B N   1 
ATOM   6872  C  CA  . SER B  1 437 ? 52.765  23.215  14.336  1.00   20.97 ? 544 SER B CA  1 
ATOM   6873  C  C   . SER B  1 437 ? 54.215  23.361  13.888  1.00   19.84 ? 544 SER B C   1 
ATOM   6874  O  O   . SER B  1 437 ? 55.126  22.742  14.429  1.00   21.05 ? 544 SER B O   1 
ATOM   6875  C  CB  . SER B  1 437 ? 52.438  24.243  15.425  1.00   19.70 ? 544 SER B CB  1 
ATOM   6876  O  OG  . SER B  1 437 ? 53.263  24.064  16.546  1.00   25.18 ? 544 SER B OG  1 
ATOM   6877  N  N   . GLY B  1 438 ? 54.422  24.180  12.876  1.00   20.21 ? 545 GLY B N   1 
ATOM   6878  C  CA  . GLY B  1 438 ? 55.755  24.359  12.370  1.00   20.27 ? 545 GLY B CA  1 
ATOM   6879  C  C   . GLY B  1 438 ? 55.762  24.079  10.881  1.00   24.74 ? 545 GLY B C   1 
ATOM   6880  O  O   . GLY B  1 438 ? 54.703  23.991  10.247  1.00   26.97 ? 545 GLY B O   1 
ATOM   6881  N  N   . GLU B  1 439 ? 56.956  23.915  10.324  1.00   22.89 ? 546 GLU B N   1 
ATOM   6882  C  CA  . GLU B  1 439 ? 57.101  23.665  8.902   1.00   24.40 ? 546 GLU B CA  1 
ATOM   6883  C  C   . GLU B  1 439 ? 56.999  22.200  8.468   1.00   22.86 ? 546 GLU B C   1 
ATOM   6884  O  O   . GLU B  1 439 ? 57.720  21.339  8.963   1.00   24.26 ? 546 GLU B O   1 
ATOM   6885  C  CB  . GLU B  1 439 ? 58.432  24.249  8.425   1.00   24.79 ? 546 GLU B CB  1 
ATOM   6886  C  CG  . GLU B  1 439 ? 58.831  23.832  7.021   1.00   32.60 ? 546 GLU B CG  1 
ATOM   6887  C  CD  . GLU B  1 439 ? 60.159  24.434  6.587   1.00   35.72 ? 546 GLU B CD  1 
ATOM   6888  O  OE1 . GLU B  1 439 ? 60.156  25.429  5.829   1.00   32.59 ? 546 GLU B OE1 1 
ATOM   6889  O  OE2 . GLU B  1 439 ? 61.215  23.913  7.013   1.00   40.04 ? 546 GLU B OE2 1 
ATOM   6890  N  N   . TRP B  1 440 ? 56.085  21.933  7.543   1.00   19.78 ? 547 TRP B N   1 
ATOM   6891  C  CA  . TRP B  1 440 ? 55.910  20.605  6.995   1.00   19.96 ? 547 TRP B CA  1 
ATOM   6892  C  C   . TRP B  1 440 ? 56.518  20.672  5.607   1.00   22.23 ? 547 TRP B C   1 
ATOM   6893  O  O   . TRP B  1 440 ? 56.489  21.728  4.974   1.00   23.18 ? 547 TRP B O   1 
ATOM   6894  C  CB  . TRP B  1 440 ? 54.439  20.255  6.857   1.00   18.69 ? 547 TRP B CB  1 
ATOM   6895  C  CG  . TRP B  1 440 ? 53.803  19.869  8.115   1.00   18.09 ? 547 TRP B CG  1 
ATOM   6896  C  CD1 . TRP B  1 440 ? 53.366  20.695  9.098   1.00   17.66 ? 547 TRP B CD1 1 
ATOM   6897  C  CD2 . TRP B  1 440 ? 53.529  18.539  8.547   1.00   18.89 ? 547 TRP B CD2 1 
ATOM   6898  N  NE1 . TRP B  1 440 ? 52.829  19.962  10.122  1.00   15.54 ? 547 TRP B NE1 1 
ATOM   6899  C  CE2 . TRP B  1 440 ? 52.918  18.632  9.810   1.00   16.21 ? 547 TRP B CE2 1 
ATOM   6900  C  CE3 . TRP B  1 440 ? 53.746  17.270  7.987   1.00   17.36 ? 547 TRP B CE3 1 
ATOM   6901  C  CZ2 . TRP B  1 440 ? 52.514  17.506  10.531  1.00   17.82 ? 547 TRP B CZ2 1 
ATOM   6902  C  CZ3 . TRP B  1 440 ? 53.345  16.152  8.701   1.00   20.70 ? 547 TRP B CZ3 1 
ATOM   6903  C  CH2 . TRP B  1 440 ? 52.733  16.279  9.964   1.00   18.02 ? 547 TRP B CH2 1 
ATOM   6904  N  N   . VAL B  1 441 ? 57.061  19.558  5.127   1.00   21.71 ? 548 VAL B N   1 
ATOM   6905  C  CA  . VAL B  1 441 ? 57.656  19.524  3.797   1.00   18.92 ? 548 VAL B CA  1 
ATOM   6906  C  C   . VAL B  1 441 ? 57.149  18.310  3.025   1.00   21.78 ? 548 VAL B C   1 
ATOM   6907  O  O   . VAL B  1 441 ? 57.192  17.174  3.527   1.00   20.33 ? 548 VAL B O   1 
ATOM   6908  C  CB  . VAL B  1 441 ? 59.201  19.437  3.877   1.00   20.77 ? 548 VAL B CB  1 
ATOM   6909  C  CG1 . VAL B  1 441 ? 59.809  19.504  2.468   1.00   17.34 ? 548 VAL B CG1 1 
ATOM   6910  C  CG2 . VAL B  1 441 ? 59.755  20.577  4.744   1.00   19.54 ? 548 VAL B CG2 1 
ATOM   6911  N  N   . LEU B  1 442 ? 56.645  18.558  1.819   1.00   20.42 ? 549 LEU B N   1 
ATOM   6912  C  CA  . LEU B  1 442 ? 56.168  17.491  0.950   1.00   21.30 ? 549 LEU B CA  1 
ATOM   6913  C  C   . LEU B  1 442 ? 57.216  17.341  -0.141  1.00   23.25 ? 549 LEU B C   1 
ATOM   6914  O  O   . LEU B  1 442 ? 57.634  18.339  -0.752  1.00   23.27 ? 549 LEU B O   1 
ATOM   6915  C  CB  . LEU B  1 442 ? 54.836  17.860  0.301   1.00   21.61 ? 549 LEU B CB  1 
ATOM   6916  C  CG  . LEU B  1 442 ? 54.286  16.781  -0.645  1.00   21.62 ? 549 LEU B CG  1 
ATOM   6917  C  CD1 . LEU B  1 442 ? 53.813  15.577  0.176   1.00   20.74 ? 549 LEU B CD1 1 
ATOM   6918  C  CD2 . LEU B  1 442 ? 53.135  17.342  -1.468  1.00   19.82 ? 549 LEU B CD2 1 
ATOM   6919  N  N   . GLU B  1 443 ? 57.654  16.110  -0.372  1.00   21.26 ? 550 GLU B N   1 
ATOM   6920  C  CA  . GLU B  1 443 ? 58.649  15.851  -1.400  1.00   25.07 ? 550 GLU B CA  1 
ATOM   6921  C  C   . GLU B  1 443 ? 58.099  14.874  -2.423  1.00   24.81 ? 550 GLU B C   1 
ATOM   6922  O  O   . GLU B  1 443 ? 57.581  13.806  -2.074  1.00   25.15 ? 550 GLU B O   1 
ATOM   6923  C  CB  . GLU B  1 443 ? 59.917  15.247  -0.799  1.00   29.34 ? 550 GLU B CB  1 
ATOM   6924  C  CG  . GLU B  1 443 ? 60.587  16.067  0.284   1.00   36.52 ? 550 GLU B CG  1 
ATOM   6925  C  CD  . GLU B  1 443 ? 61.727  15.303  0.940   1.00   41.35 ? 550 GLU B CD  1 
ATOM   6926  O  OE1 . GLU B  1 443 ? 62.321  15.818  1.910   1.00   42.77 ? 550 GLU B OE1 1 
ATOM   6927  O  OE2 . GLU B  1 443 ? 62.028  14.180  0.477   1.00   45.45 ? 550 GLU B OE2 1 
ATOM   6928  N  N   . ILE B  1 444 ? 58.194  15.243  -3.689  1.00   23.63 ? 551 ILE B N   1 
ATOM   6929  C  CA  . ILE B  1 444 ? 57.741  14.366  -4.757  1.00   26.08 ? 551 ILE B CA  1 
ATOM   6930  C  C   . ILE B  1 444 ? 58.919  14.218  -5.709  1.00   27.56 ? 551 ILE B C   1 
ATOM   6931  O  O   . ILE B  1 444 ? 59.457  15.215  -6.196  1.00   26.59 ? 551 ILE B O   1 
ATOM   6932  C  CB  . ILE B  1 444 ? 56.570  14.967  -5.527  1.00   25.70 ? 551 ILE B CB  1 
ATOM   6933  C  CG1 . ILE B  1 444 ? 55.396  15.199  -4.581  1.00   28.18 ? 551 ILE B CG1 1 
ATOM   6934  C  CG2 . ILE B  1 444 ? 56.171  14.043  -6.673  1.00   26.03 ? 551 ILE B CG2 1 
ATOM   6935  C  CD1 . ILE B  1 444 ? 54.174  15.809  -5.250  1.00   23.38 ? 551 ILE B CD1 1 
ATOM   6936  N  N   . GLU B  1 445 ? 59.324  12.985  -5.979  1.00   27.11 ? 552 GLU B N   1 
ATOM   6937  C  CA  . GLU B  1 445 ? 60.459  12.778  -6.864  1.00   28.98 ? 552 GLU B CA  1 
ATOM   6938  C  C   . GLU B  1 445 ? 60.228  11.707  -7.911  1.00   27.51 ? 552 GLU B C   1 
ATOM   6939  O  O   . GLU B  1 445 ? 59.504  10.736  -7.684  1.00   26.49 ? 552 GLU B O   1 
ATOM   6940  C  CB  . GLU B  1 445 ? 61.688  12.387  -6.048  1.00   30.62 ? 552 GLU B CB  1 
ATOM   6941  C  CG  . GLU B  1 445 ? 61.568  10.995  -5.456  1.00   38.66 ? 552 GLU B CG  1 
ATOM   6942  C  CD  . GLU B  1 445 ? 62.733  10.628  -4.550  1.00   44.26 ? 552 GLU B CD  1 
ATOM   6943  O  OE1 . GLU B  1 445 ? 63.898  10.854  -4.963  1.00   46.59 ? 552 GLU B OE1 1 
ATOM   6944  O  OE2 . GLU B  1 445 ? 62.480  10.105  -3.436  1.00   44.45 ? 552 GLU B OE2 1 
ATOM   6945  N  N   . ASN B  1 446 ? 60.858  11.897  -9.062  1.00   27.56 ? 553 ASN B N   1 
ATOM   6946  C  CA  . ASN B  1 446 ? 60.794  10.925  -10.135 1.00   27.87 ? 553 ASN B CA  1 
ATOM   6947  C  C   . ASN B  1 446 ? 61.971  9.998   -9.841  1.00   28.79 ? 553 ASN B C   1 
ATOM   6948  O  O   . ASN B  1 446 ? 63.124  10.406  -9.938  1.00   30.09 ? 553 ASN B O   1 
ATOM   6949  C  CB  . ASN B  1 446 ? 60.989  11.605  -11.492 1.00   29.16 ? 553 ASN B CB  1 
ATOM   6950  C  CG  . ASN B  1 446 ? 61.078  10.599  -12.641 1.00   29.33 ? 553 ASN B CG  1 
ATOM   6951  O  OD1 . ASN B  1 446 ? 60.774  9.413   -12.477 1.00   26.56 ? 553 ASN B OD1 1 
ATOM   6952  N  ND2 . ASN B  1 446 ? 61.492  11.073  -13.806 1.00   26.21 ? 553 ASN B ND2 1 
ATOM   6953  N  N   . THR B  1 447 ? 61.671  8.763   -9.458  1.00   29.23 ? 554 THR B N   1 
ATOM   6954  C  CA  . THR B  1 447 ? 62.704  7.794   -9.119  1.00   29.10 ? 554 THR B CA  1 
ATOM   6955  C  C   . THR B  1 447 ? 63.327  7.107   -10.332 1.00   32.62 ? 554 THR B C   1 
ATOM   6956  O  O   . THR B  1 447 ? 64.276  6.343   -10.201 1.00   33.80 ? 554 THR B O   1 
ATOM   6957  C  CB  . THR B  1 447 ? 62.144  6.729   -8.180  1.00   25.84 ? 554 THR B CB  1 
ATOM   6958  O  OG1 . THR B  1 447 ? 61.142  5.972   -8.861  1.00   21.92 ? 554 THR B OG1 1 
ATOM   6959  C  CG2 . THR B  1 447 ? 61.512  7.394   -6.966  1.00   25.24 ? 554 THR B CG2 1 
ATOM   6960  N  N   . SER B  1 448 ? 62.792  7.387   -11.512 1.00   36.26 ? 555 SER B N   1 
ATOM   6961  C  CA  . SER B  1 448 ? 63.295  6.807   -12.749 1.00   39.45 ? 555 SER B CA  1 
ATOM   6962  C  C   . SER B  1 448 ? 64.196  7.796   -13.490 1.00   42.03 ? 555 SER B C   1 
ATOM   6963  O  O   . SER B  1 448 ? 64.225  8.991   -13.174 1.00   41.78 ? 555 SER B O   1 
ATOM   6964  C  CB  . SER B  1 448 ? 62.112  6.408   -13.639 1.00   41.06 ? 555 SER B CB  1 
ATOM   6965  O  OG  . SER B  1 448 ? 62.517  6.021   -14.943 1.00   44.22 ? 555 SER B OG  1 
ATOM   6966  N  N   . GLU B  1 449 ? 64.946  7.294   -14.466 1.00   42.66 ? 556 GLU B N   1 
ATOM   6967  C  CA  . GLU B  1 449 ? 65.825  8.151   -15.254 1.00   45.06 ? 556 GLU B CA  1 
ATOM   6968  C  C   . GLU B  1 449 ? 65.041  8.746   -16.410 1.00   44.75 ? 556 GLU B C   1 
ATOM   6969  O  O   . GLU B  1 449 ? 65.510  9.669   -17.075 1.00   47.25 ? 556 GLU B O   1 
ATOM   6970  C  CB  . GLU B  1 449 ? 67.010  7.352   -15.809 1.00   48.16 ? 556 GLU B CB  1 
ATOM   6971  C  CG  . GLU B  1 449 ? 68.026  6.915   -14.767 1.00   55.19 ? 556 GLU B CG  1 
ATOM   6972  C  CD  . GLU B  1 449 ? 68.733  8.092   -14.112 1.00   59.54 ? 556 GLU B CD  1 
ATOM   6973  O  OE1 . GLU B  1 449 ? 68.476  9.245   -14.529 1.00   60.82 ? 556 GLU B OE1 1 
ATOM   6974  O  OE2 . GLU B  1 449 ? 69.547  7.862   -13.186 1.00   62.56 ? 556 GLU B OE2 1 
ATOM   6975  N  N   . ALA B  1 450 ? 63.850  8.204   -16.649 1.00   43.07 ? 557 ALA B N   1 
ATOM   6976  C  CA  . ALA B  1 450 ? 62.980  8.663   -17.729 1.00   41.95 ? 557 ALA B CA  1 
ATOM   6977  C  C   . ALA B  1 450 ? 62.561  10.124  -17.560 1.00   42.04 ? 557 ALA B C   1 
ATOM   6978  O  O   . ALA B  1 450 ? 62.471  10.633  -16.442 1.00   43.33 ? 557 ALA B O   1 
ATOM   6979  C  CB  . ALA B  1 450 ? 61.741  7.773   -17.810 1.00   40.09 ? 557 ALA B CB  1 
ATOM   6980  N  N   . ASN B  1 451 ? 62.315  10.803  -18.674 1.00   40.36 ? 558 ASN B N   1 
ATOM   6981  C  CA  . ASN B  1 451 ? 61.905  12.200  -18.624 1.00   43.04 ? 558 ASN B CA  1 
ATOM   6982  C  C   . ASN B  1 451 ? 60.398  12.241  -18.417 1.00   44.11 ? 558 ASN B C   1 
ATOM   6983  O  O   . ASN B  1 451 ? 59.637  12.363  -19.375 1.00   46.04 ? 558 ASN B O   1 
ATOM   6984  C  CB  . ASN B  1 451 ? 62.282  12.917  -19.929 1.00   43.44 ? 558 ASN B CB  1 
ATOM   6985  C  CG  . ASN B  1 451 ? 63.702  13.461  -19.915 1.00   42.93 ? 558 ASN B CG  1 
ATOM   6986  O  OD1 . ASN B  1 451 ? 63.931  14.616  -19.559 0.0000 42.97 ? 558 ASN B OD1 1 
ATOM   6987  N  ND2 . ASN B  1 451 ? 64.661  12.624  -20.294 0.0000 42.97 ? 558 ASN B ND2 1 
ATOM   6988  N  N   . ASN B  1 452 ? 59.967  12.130  -17.164 1.00   42.38 ? 559 ASN B N   1 
ATOM   6989  C  CA  . ASN B  1 452 ? 58.546  12.147  -16.859 1.00   39.26 ? 559 ASN B CA  1 
ATOM   6990  C  C   . ASN B  1 452 ? 58.058  13.561  -16.598 1.00   38.21 ? 559 ASN B C   1 
ATOM   6991  O  O   . ASN B  1 452 ? 58.838  14.459  -16.282 1.00   38.88 ? 559 ASN B O   1 
ATOM   6992  C  CB  . ASN B  1 452 ? 58.253  11.265  -15.647 1.00   39.39 ? 559 ASN B CB  1 
ATOM   6993  C  CG  . ASN B  1 452 ? 58.593  9.804   -15.887 1.00   40.79 ? 559 ASN B CG  1 
ATOM   6994  O  OD1 . ASN B  1 452 ? 58.469  9.297   -17.005 1.00   40.93 ? 559 ASN B OD1 1 
ATOM   6995  N  ND2 . ASN B  1 452 ? 59.004  9.112   -14.828 1.00   39.32 ? 559 ASN B ND2 1 
ATOM   6996  N  N   . TYR B  1 453 ? 56.755  13.759  -16.720 1.00   35.91 ? 560 TYR B N   1 
ATOM   6997  C  CA  . TYR B  1 453 ? 56.184  15.083  -16.513 1.00   35.87 ? 560 TYR B CA  1 
ATOM   6998  C  C   . TYR B  1 453 ? 54.822  15.007  -15.828 1.00   33.28 ? 560 TYR B C   1 
ATOM   6999  O  O   . TYR B  1 453 ? 54.091  14.024  -15.963 1.00   31.62 ? 560 TYR B O   1 
ATOM   7000  C  CB  . TYR B  1 453 ? 56.025  15.790  -17.863 1.00   34.01 ? 560 TYR B CB  1 
ATOM   7001  C  CG  . TYR B  1 453 ? 55.255  14.949  -18.852 1.00   34.98 ? 560 TYR B CG  1 
ATOM   7002  C  CD1 . TYR B  1 453 ? 55.866  13.872  -19.500 1.00   37.78 ? 560 TYR B CD1 1 
ATOM   7003  C  CD2 . TYR B  1 453 ? 53.897  15.161  -19.069 1.00   33.89 ? 560 TYR B CD2 1 
ATOM   7004  C  CE1 . TYR B  1 453 ? 55.145  13.024  -20.330 1.00   37.39 ? 560 TYR B CE1 1 
ATOM   7005  C  CE2 . TYR B  1 453 ? 53.162  14.318  -19.896 1.00   35.88 ? 560 TYR B CE2 1 
ATOM   7006  C  CZ  . TYR B  1 453 ? 53.792  13.246  -20.520 1.00   40.21 ? 560 TYR B CZ  1 
ATOM   7007  O  OH  . TYR B  1 453 ? 53.059  12.371  -21.299 1.00   44.63 ? 560 TYR B OH  1 
ATOM   7008  N  N   . GLY B  1 454 ? 54.480  16.070  -15.113 1.00   31.76 ? 561 GLY B N   1 
ATOM   7009  C  CA  . GLY B  1 454 ? 53.210  16.110  -14.423 1.00   30.21 ? 561 GLY B CA  1 
ATOM   7010  C  C   . GLY B  1 454 ? 53.068  17.376  -13.609 1.00   29.31 ? 561 GLY B C   1 
ATOM   7011  O  O   . GLY B  1 454 ? 54.010  18.174  -13.504 1.00   24.76 ? 561 GLY B O   1 
ATOM   7012  N  N   . THR B  1 455 ? 51.893  17.542  -13.008 1.00   28.16 ? 562 THR B N   1 
ATOM   7013  C  CA  . THR B  1 455 ? 51.595  18.729  -12.214 1.00   28.63 ? 562 THR B CA  1 
ATOM   7014  C  C   . THR B  1 455 ? 50.825  18.405  -10.926 1.00   27.97 ? 562 THR B C   1 
ATOM   7015  O  O   . THR B  1 455 ? 49.866  17.625  -10.933 1.00   25.88 ? 562 THR B O   1 
ATOM   7016  C  CB  . THR B  1 455 ? 50.729  19.731  -13.036 1.00   29.54 ? 562 THR B CB  1 
ATOM   7017  O  OG1 . THR B  1 455 ? 51.412  20.104  -14.241 1.00   28.98 ? 562 THR B OG1 1 
ATOM   7018  C  CG2 . THR B  1 455 ? 50.425  20.987  -12.222 1.00   26.97 ? 562 THR B CG2 1 
ATOM   7019  N  N   . LEU B  1 456 ? 51.250  19.013  -9.825  1.00   25.94 ? 563 LEU B N   1 
ATOM   7020  C  CA  . LEU B  1 456 ? 50.572  18.836  -8.550  1.00   27.11 ? 563 LEU B CA  1 
ATOM   7021  C  C   . LEU B  1 456 ? 49.592  20.000  -8.461  1.00   28.95 ? 563 LEU B C   1 
ATOM   7022  O  O   . LEU B  1 456 ? 50.019  21.154  -8.385  1.00   30.96 ? 563 LEU B O   1 
ATOM   7023  C  CB  . LEU B  1 456 ? 51.557  18.930  -7.388  1.00   24.47 ? 563 LEU B CB  1 
ATOM   7024  C  CG  . LEU B  1 456 ? 50.889  18.852  -6.011  1.00   26.05 ? 563 LEU B CG  1 
ATOM   7025  C  CD1 . LEU B  1 456 ? 50.301  17.450  -5.801  1.00   22.60 ? 563 LEU B CD1 1 
ATOM   7026  C  CD2 . LEU B  1 456 ? 51.908  19.172  -4.929  1.00   17.06 ? 563 LEU B CD2 1 
ATOM   7027  N  N   . THR B  1 457 ? 48.291  19.711  -8.487  1.00   28.08 ? 564 THR B N   1 
ATOM   7028  C  CA  . THR B  1 457 ? 47.292  20.773  -8.421  1.00   29.21 ? 564 THR B CA  1 
ATOM   7029  C  C   . THR B  1 457 ? 46.671  20.979  -7.050  1.00   28.72 ? 564 THR B C   1 
ATOM   7030  O  O   . THR B  1 457 ? 46.051  22.007  -6.805  1.00   31.67 ? 564 THR B O   1 
ATOM   7031  C  CB  . THR B  1 457 ? 46.147  20.553  -9.443  1.00   30.55 ? 564 THR B CB  1 
ATOM   7032  O  OG1 . THR B  1 457 ? 45.502  19.292  -9.193  1.00   30.93 ? 564 THR B OG1 1 
ATOM   7033  C  CG2 . THR B  1 457 ? 46.699  20.595  -10.876 1.00   27.36 ? 564 THR B CG2 1 
ATOM   7034  N  N   . LYS B  1 458 ? 46.818  20.014  -6.150  1.00   27.82 ? 565 LYS B N   1 
ATOM   7035  C  CA  . LYS B  1 458 ? 46.257  20.194  -4.819  1.00   24.55 ? 565 LYS B CA  1 
ATOM   7036  C  C   . LYS B  1 458 ? 46.980  19.415  -3.761  1.00   21.65 ? 565 LYS B C   1 
ATOM   7037  O  O   . LYS B  1 458 ? 47.321  18.251  -3.958  1.00   21.54 ? 565 LYS B O   1 
ATOM   7038  C  CB  . LYS B  1 458 ? 44.781  19.805  -4.769  1.00   26.49 ? 565 LYS B CB  1 
ATOM   7039  C  CG  . LYS B  1 458 ? 44.121  20.252  -3.463  1.00   31.85 ? 565 LYS B CG  1 
ATOM   7040  C  CD  . LYS B  1 458 ? 42.670  19.786  -3.329  1.00   39.39 ? 565 LYS B CD  1 
ATOM   7041  C  CE  . LYS B  1 458 ? 42.563  18.480  -2.524  1.00   43.51 ? 565 LYS B CE  1 
ATOM   7042  N  NZ  . LYS B  1 458 ? 43.365  17.309  -3.067  1.00   42.90 ? 565 LYS B NZ  1 
ATOM   7043  N  N   . PHE B  1 459 ? 47.202  20.079  -2.632  1.00   20.74 ? 566 PHE B N   1 
ATOM   7044  C  CA  . PHE B  1 459 ? 47.864  19.493  -1.480  1.00   18.85 ? 566 PHE B CA  1 
ATOM   7045  C  C   . PHE B  1 459 ? 47.174  20.032  -0.230  1.00   20.24 ? 566 PHE B C   1 
ATOM   7046  O  O   . PHE B  1 459 ? 47.393  21.167  0.185   1.00   18.21 ? 566 PHE B O   1 
ATOM   7047  C  CB  . PHE B  1 459 ? 49.359  19.845  -1.478  1.00   15.88 ? 566 PHE B CB  1 
ATOM   7048  C  CG  . PHE B  1 459 ? 50.090  19.494  -0.188  1.00   17.72 ? 566 PHE B CG  1 
ATOM   7049  C  CD1 . PHE B  1 459 ? 49.601  18.519  0.685   1.00   16.15 ? 566 PHE B CD1 1 
ATOM   7050  C  CD2 . PHE B  1 459 ? 51.289  20.133  0.135   1.00   16.83 ? 566 PHE B CD2 1 
ATOM   7051  C  CE1 . PHE B  1 459 ? 50.291  18.191  1.857   1.00   14.93 ? 566 PHE B CE1 1 
ATOM   7052  C  CE2 . PHE B  1 459 ? 51.988  19.812  1.307   1.00   16.98 ? 566 PHE B CE2 1 
ATOM   7053  C  CZ  . PHE B  1 459 ? 51.483  18.838  2.170   1.00   15.40 ? 566 PHE B CZ  1 
ATOM   7054  N  N   . THR B  1 460 ? 46.310  19.213  0.354   1.00   19.18 ? 567 THR B N   1 
ATOM   7055  C  CA  . THR B  1 460 ? 45.616  19.617  1.559   1.00   18.49 ? 567 THR B CA  1 
ATOM   7056  C  C   . THR B  1 460 ? 46.114  18.754  2.712   1.00   18.73 ? 567 THR B C   1 
ATOM   7057  O  O   . THR B  1 460 ? 46.053  17.527  2.664   1.00   18.26 ? 567 THR B O   1 
ATOM   7058  C  CB  . THR B  1 460 ? 44.098  19.445  1.411   1.00   18.14 ? 567 THR B CB  1 
ATOM   7059  O  OG1 . THR B  1 460 ? 43.668  20.057  0.189   1.00   19.67 ? 567 THR B OG1 1 
ATOM   7060  C  CG2 . THR B  1 460 ? 43.381  20.116  2.560   1.00   17.38 ? 567 THR B CG2 1 
ATOM   7061  N  N   . LEU B  1 461 ? 46.634  19.411  3.736   1.00   18.87 ? 568 LEU B N   1 
ATOM   7062  C  CA  . LEU B  1 461 ? 47.138  18.723  4.910   1.00   20.19 ? 568 LEU B CA  1 
ATOM   7063  C  C   . LEU B  1 461 ? 45.986  18.651  5.917   1.00   19.48 ? 568 LEU B C   1 
ATOM   7064  O  O   . LEU B  1 461 ? 45.392  19.671  6.272   1.00   17.79 ? 568 LEU B O   1 
ATOM   7065  C  CB  . LEU B  1 461 ? 48.326  19.504  5.502   1.00   20.29 ? 568 LEU B CB  1 
ATOM   7066  C  CG  . LEU B  1 461 ? 49.047  18.837  6.684   1.00   20.84 ? 568 LEU B CG  1 
ATOM   7067  C  CD1 . LEU B  1 461 ? 49.683  17.534  6.246   1.00   18.94 ? 568 LEU B CD1 1 
ATOM   7068  C  CD2 . LEU B  1 461 ? 50.112  19.771  7.224   1.00   22.90 ? 568 LEU B CD2 1 
ATOM   7069  N  N   . VAL B  1 462 ? 45.656  17.443  6.355   1.00   17.47 ? 569 VAL B N   1 
ATOM   7070  C  CA  . VAL B  1 462 ? 44.575  17.262  7.305   1.00   16.20 ? 569 VAL B CA  1 
ATOM   7071  C  C   . VAL B  1 462 ? 45.116  16.646  8.579   1.00   17.14 ? 569 VAL B C   1 
ATOM   7072  O  O   . VAL B  1 462 ? 45.652  15.538  8.565   1.00   16.41 ? 569 VAL B O   1 
ATOM   7073  C  CB  . VAL B  1 462 ? 43.496  16.342  6.742   1.00   16.07 ? 569 VAL B CB  1 
ATOM   7074  C  CG1 . VAL B  1 462 ? 42.410  16.111  7.797   1.00   10.73 ? 569 VAL B CG1 1 
ATOM   7075  C  CG2 . VAL B  1 462 ? 42.940  16.951  5.458   1.00   13.10 ? 569 VAL B CG2 1 
ATOM   7076  N  N   . LEU B  1 463 ? 44.965  17.370  9.678   1.00   14.93 ? 570 LEU B N   1 
ATOM   7077  C  CA  . LEU B  1 463 ? 45.460  16.910  10.971  1.00   18.03 ? 570 LEU B CA  1 
ATOM   7078  C  C   . LEU B  1 463 ? 44.321  16.522  11.910  1.00   18.48 ? 570 LEU B C   1 
ATOM   7079  O  O   . LEU B  1 463 ? 43.333  17.260  12.042  1.00   19.29 ? 570 LEU B O   1 
ATOM   7080  C  CB  . LEU B  1 463 ? 46.290  18.018  11.629  1.00   16.83 ? 570 LEU B CB  1 
ATOM   7081  C  CG  . LEU B  1 463 ? 47.365  18.674  10.749  1.00   18.97 ? 570 LEU B CG  1 
ATOM   7082  C  CD1 . LEU B  1 463 ? 47.911  19.950  11.420  1.00   12.00 ? 570 LEU B CD1 1 
ATOM   7083  C  CD2 . LEU B  1 463 ? 48.484  17.684  10.494  1.00   16.81 ? 570 LEU B CD2 1 
ATOM   7084  N  N   . TYR B  1 464 ? 44.456  15.360  12.544  1.00   16.22 ? 571 TYR B N   1 
ATOM   7085  C  CA  . TYR B  1 464 ? 43.479  14.872  13.515  1.00   16.24 ? 571 TYR B CA  1 
ATOM   7086  C  C   . TYR B  1 464 ? 44.223  14.836  14.851  1.00   18.88 ? 571 TYR B C   1 
ATOM   7087  O  O   . TYR B  1 464 ? 45.424  14.547  14.887  1.00   20.00 ? 571 TYR B O   1 
ATOM   7088  C  CB  . TYR B  1 464 ? 43.002  13.454  13.163  1.00   16.77 ? 571 TYR B CB  1 
ATOM   7089  C  CG  . TYR B  1 464 ? 42.194  13.332  11.885  1.00   16.13 ? 571 TYR B CG  1 
ATOM   7090  C  CD1 . TYR B  1 464 ? 40.803  13.512  11.874  1.00   18.76 ? 571 TYR B CD1 1 
ATOM   7091  C  CD2 . TYR B  1 464 ? 42.820  13.032  10.682  1.00   19.05 ? 571 TYR B CD2 1 
ATOM   7092  C  CE1 . TYR B  1 464 ? 40.062  13.389  10.674  1.00   15.94 ? 571 TYR B CE1 1 
ATOM   7093  C  CE2 . TYR B  1 464 ? 42.096  12.911  9.490   1.00   19.59 ? 571 TYR B CE2 1 
ATOM   7094  C  CZ  . TYR B  1 464 ? 40.732  13.087  9.492   1.00   19.90 ? 571 TYR B CZ  1 
ATOM   7095  O  OH  . TYR B  1 464 ? 40.066  12.948  8.294   1.00   26.03 ? 571 TYR B OH  1 
ATOM   7096  N  N   . GLY B  1 465 ? 43.536  15.132  15.948  1.00   17.97 ? 572 GLY B N   1 
ATOM   7097  C  CA  . GLY B  1 465 ? 44.219  15.108  17.227  1.00   20.20 ? 572 GLY B CA  1 
ATOM   7098  C  C   . GLY B  1 465 ? 43.515  15.857  18.341  1.00   21.85 ? 572 GLY B C   1 
ATOM   7099  O  O   . GLY B  1 465 ? 42.326  16.148  18.249  1.00   23.24 ? 572 GLY B O   1 
ATOM   7100  N  N   . THR B  1 466 ? 44.266  16.180  19.387  1.00   20.03 ? 573 THR B N   1 
ATOM   7101  C  CA  . THR B  1 466 ? 43.737  16.879  20.552  1.00   21.95 ? 573 THR B CA  1 
ATOM   7102  C  C   . THR B  1 466 ? 44.714  17.976  20.989  1.00   24.53 ? 573 THR B C   1 
ATOM   7103  O  O   . THR B  1 466 ? 45.800  18.120  20.419  1.00   24.31 ? 573 THR B O   1 
ATOM   7104  C  CB  . THR B  1 466 ? 43.595  15.914  21.739  1.00   20.57 ? 573 THR B CB  1 
ATOM   7105  O  OG1 . THR B  1 466 ? 44.893  15.428  22.083  1.00   21.12 ? 573 THR B OG1 1 
ATOM   7106  C  CG2 . THR B  1 466 ? 42.711  14.724  21.389  1.00   19.79 ? 573 THR B CG2 1 
ATOM   7107  N  N   . ALA B  1 467 ? 44.328  18.736  22.009  1.00   25.66 ? 574 ALA B N   1 
ATOM   7108  C  CA  . ALA B  1 467 ? 45.185  19.794  22.543  1.00   31.20 ? 574 ALA B CA  1 
ATOM   7109  C  C   . ALA B  1 467 ? 45.485  19.534  24.021  1.00   34.30 ? 574 ALA B C   1 
ATOM   7110  O  O   . ALA B  1 467 ? 45.423  18.357  24.457  1.00   40.11 ? 574 ALA B O   1 
ATOM   7111  C  CB  . ALA B  1 467 ? 44.530  21.146  22.368  1.00   26.33 ? 574 ALA B CB  1 
ATOM   7112  N  N   . VAL C  1 2   ? -14.381 72.148  25.378  1.00   35.94 ? 109 VAL C N   1 
ATOM   7113  C  CA  . VAL C  1 2   ? -12.893 72.006  25.233  1.00   37.89 ? 109 VAL C CA  1 
ATOM   7114  C  C   . VAL C  1 2   ? -12.187 72.337  26.556  1.00   38.83 ? 109 VAL C C   1 
ATOM   7115  O  O   . VAL C  1 2   ? -12.437 73.384  27.165  1.00   39.21 ? 109 VAL C O   1 
ATOM   7116  C  CB  . VAL C  1 2   ? -12.323 72.936  24.114  1.00   36.96 ? 109 VAL C CB  1 
ATOM   7117  C  CG1 . VAL C  1 2   ? -10.796 72.943  24.154  1.00   36.56 ? 109 VAL C CG1 1 
ATOM   7118  C  CG2 . VAL C  1 2   ? -12.776 72.457  22.746  1.00   36.86 ? 109 VAL C CG2 1 
ATOM   7119  N  N   . TYR C  1 3   ? -11.314 71.436  27.001  1.00   34.95 ? 110 TYR C N   1 
ATOM   7120  C  CA  . TYR C  1 3   ? -10.586 71.647  28.248  1.00   32.68 ? 110 TYR C CA  1 
ATOM   7121  C  C   . TYR C  1 3   ? -9.626  72.828  28.119  1.00   31.26 ? 110 TYR C C   1 
ATOM   7122  O  O   . TYR C  1 3   ? -8.780  72.856  27.221  1.00   32.19 ? 110 TYR C O   1 
ATOM   7123  C  CB  . TYR C  1 3   ? -9.777  70.396  28.632  1.00   26.58 ? 110 TYR C CB  1 
ATOM   7124  C  CG  . TYR C  1 3   ? -8.882  70.625  29.837  1.00   23.97 ? 110 TYR C CG  1 
ATOM   7125  C  CD1 . TYR C  1 3   ? -9.425  70.743  31.124  1.00   24.51 ? 110 TYR C CD1 1 
ATOM   7126  C  CD2 . TYR C  1 3   ? -7.504  70.793  29.686  1.00   21.82 ? 110 TYR C CD2 1 
ATOM   7127  C  CE1 . TYR C  1 3   ? -8.624  71.029  32.224  1.00   24.39 ? 110 TYR C CE1 1 
ATOM   7128  C  CE2 . TYR C  1 3   ? -6.686  71.081  30.784  1.00   22.36 ? 110 TYR C CE2 1 
ATOM   7129  C  CZ  . TYR C  1 3   ? -7.258  71.200  32.047  1.00   24.98 ? 110 TYR C CZ  1 
ATOM   7130  O  OH  . TYR C  1 3   ? -6.478  71.509  33.127  1.00   24.36 ? 110 TYR C OH  1 
ATOM   7131  N  N   . GLN C  1 4   ? -9.750  73.796  29.018  1.00   30.11 ? 111 GLN C N   1 
ATOM   7132  C  CA  . GLN C  1 4   ? -8.855  74.949  28.996  1.00   30.58 ? 111 GLN C CA  1 
ATOM   7133  C  C   . GLN C  1 4   ? -7.725  74.683  29.995  1.00   28.57 ? 111 GLN C C   1 
ATOM   7134  O  O   . GLN C  1 4   ? -7.964  74.402  31.173  1.00   26.80 ? 111 GLN C O   1 
ATOM   7135  C  CB  . GLN C  1 4   ? -9.595  76.235  29.375  1.00   29.03 ? 111 GLN C CB  1 
ATOM   7136  C  CG  . GLN C  1 4   ? -8.687  77.457  29.307  1.00   30.66 ? 111 GLN C CG  1 
ATOM   7137  C  CD  . GLN C  1 4   ? -9.293  78.700  29.937  1.00   30.93 ? 111 GLN C CD  1 
ATOM   7138  O  OE1 . GLN C  1 4   ? -8.582  79.659  30.238  1.00   31.67 ? 111 GLN C OE1 1 
ATOM   7139  N  NE2 . GLN C  1 4   ? -10.603 78.693  30.133  1.00   28.50 ? 111 GLN C NE2 1 
ATOM   7140  N  N   . GLU C  1 5   ? -6.489  74.768  29.530  1.00   26.90 ? 112 GLU C N   1 
ATOM   7141  C  CA  . GLU C  1 5   ? -5.392  74.497  30.437  1.00   26.89 ? 112 GLU C CA  1 
ATOM   7142  C  C   . GLU C  1 5   ? -5.243  75.579  31.506  1.00   24.40 ? 112 GLU C C   1 
ATOM   7143  O  O   . GLU C  1 5   ? -5.756  76.690  31.375  1.00   24.56 ? 112 GLU C O   1 
ATOM   7144  C  CB  . GLU C  1 5   ? -4.084  74.285  29.654  1.00   28.87 ? 112 GLU C CB  1 
ATOM   7145  C  CG  . GLU C  1 5   ? -3.464  75.497  28.965  1.00   25.50 ? 112 GLU C CG  1 
ATOM   7146  C  CD  . GLU C  1 5   ? -2.227  75.101  28.147  1.00   27.00 ? 112 GLU C CD  1 
ATOM   7147  O  OE1 . GLU C  1 5   ? -1.264  75.889  28.062  1.00   27.29 ? 112 GLU C OE1 1 
ATOM   7148  O  OE2 . GLU C  1 5   ? -2.220  73.991  27.580  1.00   27.51 ? 112 GLU C OE2 1 
ATOM   7149  N  N   . PRO C  1 6   ? -4.565  75.246  32.604  1.00   23.10 ? 113 PRO C N   1 
ATOM   7150  C  CA  . PRO C  1 6   ? -4.346  76.178  33.707  1.00   22.04 ? 113 PRO C CA  1 
ATOM   7151  C  C   . PRO C  1 6   ? -3.903  77.563  33.251  1.00   24.02 ? 113 PRO C C   1 
ATOM   7152  O  O   . PRO C  1 6   ? -3.175  77.715  32.266  1.00   22.58 ? 113 PRO C O   1 
ATOM   7153  C  CB  . PRO C  1 6   ? -3.273  75.485  34.522  1.00   20.56 ? 113 PRO C CB  1 
ATOM   7154  C  CG  . PRO C  1 6   ? -3.591  74.039  34.320  1.00   23.28 ? 113 PRO C CG  1 
ATOM   7155  C  CD  . PRO C  1 6   ? -3.835  73.987  32.840  1.00   22.96 ? 113 PRO C CD  1 
ATOM   7156  N  N   . THR C  1 7   ? -4.340  78.575  33.988  1.00   21.64 ? 114 THR C N   1 
ATOM   7157  C  CA  . THR C  1 7   ? -3.984  79.954  33.680  1.00   21.95 ? 114 THR C CA  1 
ATOM   7158  C  C   . THR C  1 7   ? -2.856  80.447  34.586  1.00   22.43 ? 114 THR C C   1 
ATOM   7159  O  O   . THR C  1 7   ? -2.403  81.583  34.452  1.00   22.54 ? 114 THR C O   1 
ATOM   7160  C  CB  . THR C  1 7   ? -5.173  80.894  33.893  1.00   21.51 ? 114 THR C CB  1 
ATOM   7161  O  OG1 . THR C  1 7   ? -5.579  80.827  35.268  1.00   21.20 ? 114 THR C OG1 1 
ATOM   7162  C  CG2 . THR C  1 7   ? -6.343  80.508  32.993  1.00   17.98 ? 114 THR C CG2 1 
ATOM   7163  N  N   . ASP C  1 8   ? -2.409  79.594  35.503  1.00   20.21 ? 115 ASP C N   1 
ATOM   7164  C  CA  . ASP C  1 8   ? -1.354  79.956  36.438  1.00   20.79 ? 115 ASP C CA  1 
ATOM   7165  C  C   . ASP C  1 8   ? -0.142  80.569  35.735  1.00   21.22 ? 115 ASP C C   1 
ATOM   7166  O  O   . ASP C  1 8   ? 0.330   80.077  34.706  1.00   21.85 ? 115 ASP C O   1 
ATOM   7167  C  CB  . ASP C  1 8   ? -0.965  78.733  37.263  1.00   21.05 ? 115 ASP C CB  1 
ATOM   7168  C  CG  . ASP C  1 8   ? -2.157  78.126  37.961  1.00   20.57 ? 115 ASP C CG  1 
ATOM   7169  O  OD1 . ASP C  1 8   ? -3.052  77.600  37.264  1.00   22.44 ? 115 ASP C OD1 1 
ATOM   7170  O  OD2 . ASP C  1 8   ? -2.212  78.186  39.201  1.00   22.35 ? 115 ASP C OD2 1 
ATOM   7171  N  N   . PRO C  1 9   ? 0.407   81.645  36.315  1.00   20.89 ? 116 PRO C N   1 
ATOM   7172  C  CA  . PRO C  1 9   ? 1.561   82.321  35.712  1.00   19.44 ? 116 PRO C CA  1 
ATOM   7173  C  C   . PRO C  1 9   ? 2.735   81.457  35.289  1.00   21.90 ? 116 PRO C C   1 
ATOM   7174  O  O   . PRO C  1 9   ? 3.357   81.725  34.260  1.00   19.29 ? 116 PRO C O   1 
ATOM   7175  C  CB  . PRO C  1 9   ? 1.943   83.355  36.763  1.00   19.06 ? 116 PRO C CB  1 
ATOM   7176  C  CG  . PRO C  1 9   ? 1.557   82.668  38.068  1.00   21.56 ? 116 PRO C CG  1 
ATOM   7177  C  CD  . PRO C  1 9   ? 0.220   82.055  37.726  1.00   16.83 ? 116 PRO C CD  1 
ATOM   7178  N  N   . LYS C  1 10  ? 3.026   80.413  36.059  1.00   24.05 ? 117 LYS C N   1 
ATOM   7179  C  CA  . LYS C  1 10  ? 4.164   79.550  35.757  1.00   25.25 ? 117 LYS C CA  1 
ATOM   7180  C  C   . LYS C  1 10  ? 3.845   78.264  35.018  1.00   24.46 ? 117 LYS C C   1 
ATOM   7181  O  O   . LYS C  1 10  ? 4.752   77.493  34.695  1.00   27.12 ? 117 LYS C O   1 
ATOM   7182  C  CB  . LYS C  1 10  ? 4.908   79.207  37.045  1.00   29.19 ? 117 LYS C CB  1 
ATOM   7183  C  CG  . LYS C  1 10  ? 5.494   80.411  37.765  1.00   32.34 ? 117 LYS C CG  1 
ATOM   7184  C  CD  . LYS C  1 10  ? 6.563   81.067  36.931  1.00   38.83 ? 117 LYS C CD  1 
ATOM   7185  C  CE  . LYS C  1 10  ? 7.389   82.047  37.750  1.00   46.61 ? 117 LYS C CE  1 
ATOM   7186  N  NZ  . LYS C  1 10  ? 8.338   82.820  36.892  1.00   51.27 ? 117 LYS C NZ  1 
ATOM   7187  N  N   . PHE C  1 11  ? 2.572   78.021  34.738  1.00   20.83 ? 118 PHE C N   1 
ATOM   7188  C  CA  . PHE C  1 11  ? 2.227   76.805  34.033  1.00   19.46 ? 118 PHE C CA  1 
ATOM   7189  C  C   . PHE C  1 11  ? 3.025   76.617  32.731  1.00   20.09 ? 118 PHE C C   1 
ATOM   7190  O  O   . PHE C  1 11  ? 3.494   75.523  32.441  1.00   23.12 ? 118 PHE C O   1 
ATOM   7191  C  CB  . PHE C  1 11  ? 0.734   76.758  33.710  1.00   18.48 ? 118 PHE C CB  1 
ATOM   7192  C  CG  . PHE C  1 11  ? 0.355   75.558  32.908  1.00   20.60 ? 118 PHE C CG  1 
ATOM   7193  C  CD1 . PHE C  1 11  ? 0.478   74.278  33.455  1.00   19.34 ? 118 PHE C CD1 1 
ATOM   7194  C  CD2 . PHE C  1 11  ? -0.040  75.688  31.580  1.00   20.58 ? 118 PHE C CD2 1 
ATOM   7195  C  CE1 . PHE C  1 11  ? 0.215   73.144  32.684  1.00   20.18 ? 118 PHE C CE1 1 
ATOM   7196  C  CE2 . PHE C  1 11  ? -0.304  74.561  30.799  1.00   18.03 ? 118 PHE C CE2 1 
ATOM   7197  C  CZ  . PHE C  1 11  ? -0.174  73.288  31.353  1.00   16.94 ? 118 PHE C CZ  1 
ATOM   7198  N  N   . PRO C  1 12  ? 3.195   77.686  31.935  1.00   20.51 ? 119 PRO C N   1 
ATOM   7199  C  CA  . PRO C  1 12  ? 3.939   77.568  30.675  1.00   21.47 ? 119 PRO C CA  1 
ATOM   7200  C  C   . PRO C  1 12  ? 5.365   77.057  30.854  1.00   21.66 ? 119 PRO C C   1 
ATOM   7201  O  O   . PRO C  1 12  ? 5.979   76.575  29.909  1.00   23.81 ? 119 PRO C O   1 
ATOM   7202  C  CB  . PRO C  1 12  ? 3.922   78.996  30.119  1.00   17.97 ? 119 PRO C CB  1 
ATOM   7203  C  CG  . PRO C  1 12  ? 2.736   79.607  30.763  1.00   20.08 ? 119 PRO C CG  1 
ATOM   7204  C  CD  . PRO C  1 12  ? 2.817   79.091  32.165  1.00   20.43 ? 119 PRO C CD  1 
ATOM   7205  N  N   . GLN C  1 13  ? 5.911   77.185  32.055  1.00   23.01 ? 120 GLN C N   1 
ATOM   7206  C  CA  . GLN C  1 13  ? 7.262   76.694  32.293  1.00   22.39 ? 120 GLN C CA  1 
ATOM   7207  C  C   . GLN C  1 13  ? 7.265   75.246  32.784  1.00   21.62 ? 120 GLN C C   1 
ATOM   7208  O  O   . GLN C  1 13  ? 8.319   74.638  32.914  1.00   21.52 ? 120 GLN C O   1 
ATOM   7209  C  CB  . GLN C  1 13  ? 8.004   77.568  33.300  1.00   25.40 ? 120 GLN C CB  1 
ATOM   7210  C  CG  . GLN C  1 13  ? 8.403   78.905  32.747  1.00   35.36 ? 120 GLN C CG  1 
ATOM   7211  C  CD  . GLN C  1 13  ? 7.516   79.999  33.261  1.00   44.24 ? 120 GLN C CD  1 
ATOM   7212  O  OE1 . GLN C  1 13  ? 7.582   80.350  34.444  1.00   52.81 ? 120 GLN C OE1 1 
ATOM   7213  N  NE2 . GLN C  1 13  ? 6.669   80.549  32.389  1.00   44.78 ? 120 GLN C NE2 1 
ATOM   7214  N  N   . GLN C  1 14  ? 6.093   74.688  33.057  1.00   17.88 ? 121 GLN C N   1 
ATOM   7215  C  CA  . GLN C  1 14  ? 6.033   73.308  33.519  1.00   17.00 ? 121 GLN C CA  1 
ATOM   7216  C  C   . GLN C  1 14  ? 6.002   72.411  32.290  1.00   16.35 ? 121 GLN C C   1 
ATOM   7217  O  O   . GLN C  1 14  ? 5.020   71.732  32.009  1.00   15.19 ? 121 GLN C O   1 
ATOM   7218  C  CB  . GLN C  1 14  ? 4.810   73.119  34.407  1.00   12.73 ? 121 GLN C CB  1 
ATOM   7219  C  CG  . GLN C  1 14  ? 4.843   74.059  35.601  1.00   13.55 ? 121 GLN C CG  1 
ATOM   7220  C  CD  . GLN C  1 14  ? 3.731   73.801  36.586  1.00   19.78 ? 121 GLN C CD  1 
ATOM   7221  O  OE1 . GLN C  1 14  ? 2.563   74.127  36.336  1.00   24.95 ? 121 GLN C OE1 1 
ATOM   7222  N  NE2 . GLN C  1 14  ? 4.081   73.197  37.717  1.00   24.12 ? 121 GLN C NE2 1 
ATOM   7223  N  N   . TRP C  1 15  ? 7.110   72.453  31.557  1.00   16.65 ? 122 TRP C N   1 
ATOM   7224  C  CA  . TRP C  1 15  ? 7.318   71.710  30.319  1.00   17.30 ? 122 TRP C CA  1 
ATOM   7225  C  C   . TRP C  1 15  ? 7.054   70.224  30.420  1.00   18.30 ? 122 TRP C C   1 
ATOM   7226  O  O   . TRP C  1 15  ? 6.683   69.598  29.436  1.00   21.20 ? 122 TRP C O   1 
ATOM   7227  C  CB  . TRP C  1 15  ? 8.759   71.887  29.834  1.00   17.07 ? 122 TRP C CB  1 
ATOM   7228  C  CG  . TRP C  1 15  ? 9.793   71.524  30.895  1.00   18.02 ? 122 TRP C CG  1 
ATOM   7229  C  CD1 . TRP C  1 15  ? 10.232  72.322  31.918  1.00   18.59 ? 122 TRP C CD1 1 
ATOM   7230  C  CD2 . TRP C  1 15  ? 10.449  70.255  31.075  1.00   16.86 ? 122 TRP C CD2 1 
ATOM   7231  N  NE1 . TRP C  1 15  ? 11.114  71.630  32.723  1.00   16.90 ? 122 TRP C NE1 1 
ATOM   7232  C  CE2 . TRP C  1 15  ? 11.264  70.362  32.231  1.00   15.85 ? 122 TRP C CE2 1 
ATOM   7233  C  CE3 . TRP C  1 15  ? 10.424  69.034  30.377  1.00   18.45 ? 122 TRP C CE3 1 
ATOM   7234  C  CZ2 . TRP C  1 15  ? 12.045  69.289  32.710  1.00   15.14 ? 122 TRP C CZ2 1 
ATOM   7235  C  CZ3 . TRP C  1 15  ? 11.199  67.962  30.860  1.00   13.08 ? 122 TRP C CZ3 1 
ATOM   7236  C  CH2 . TRP C  1 15  ? 11.996  68.106  32.017  1.00   12.19 ? 122 TRP C CH2 1 
ATOM   7237  N  N   . TYR C  1 16  ? 7.272   69.658  31.598  1.00   19.18 ? 123 TYR C N   1 
ATOM   7238  C  CA  . TYR C  1 16  ? 7.070   68.226  31.808  1.00   19.59 ? 123 TYR C CA  1 
ATOM   7239  C  C   . TYR C  1 16  ? 5.596   67.827  31.889  1.00   19.06 ? 123 TYR C C   1 
ATOM   7240  O  O   . TYR C  1 16  ? 5.258   66.656  31.707  1.00   18.87 ? 123 TYR C O   1 
ATOM   7241  C  CB  . TYR C  1 16  ? 7.801   67.777  33.082  1.00   16.14 ? 123 TYR C CB  1 
ATOM   7242  C  CG  . TYR C  1 16  ? 7.635   68.749  34.230  1.00   14.48 ? 123 TYR C CG  1 
ATOM   7243  C  CD1 . TYR C  1 16  ? 8.404   69.912  34.291  1.00   14.17 ? 123 TYR C CD1 1 
ATOM   7244  C  CD2 . TYR C  1 16  ? 6.677   68.532  35.227  1.00   14.92 ? 123 TYR C CD2 1 
ATOM   7245  C  CE1 . TYR C  1 16  ? 8.229   70.844  35.311  1.00   14.62 ? 123 TYR C CE1 1 
ATOM   7246  C  CE2 . TYR C  1 16  ? 6.490   69.461  36.259  1.00   15.21 ? 123 TYR C CE2 1 
ATOM   7247  C  CZ  . TYR C  1 16  ? 7.270   70.615  36.290  1.00   14.88 ? 123 TYR C CZ  1 
ATOM   7248  O  OH  . TYR C  1 16  ? 7.086   71.559  37.275  1.00   17.13 ? 123 TYR C OH  1 
ATOM   7249  N  N   . LEU C  1 17  ? 4.724   68.792  32.164  1.00   20.91 ? 124 LEU C N   1 
ATOM   7250  C  CA  . LEU C  1 17  ? 3.299   68.500  32.260  1.00   24.07 ? 124 LEU C CA  1 
ATOM   7251  C  C   . LEU C  1 17  ? 2.667   68.488  30.886  1.00   27.14 ? 124 LEU C C   1 
ATOM   7252  O  O   . LEU C  1 17  ? 1.929   67.565  30.533  1.00   30.63 ? 124 LEU C O   1 
ATOM   7253  C  CB  . LEU C  1 17  ? 2.595   69.536  33.136  1.00   18.04 ? 124 LEU C CB  1 
ATOM   7254  C  CG  . LEU C  1 17  ? 3.055   69.572  34.595  1.00   19.75 ? 124 LEU C CG  1 
ATOM   7255  C  CD1 . LEU C  1 17  ? 2.157   70.530  35.394  1.00   19.48 ? 124 LEU C CD1 1 
ATOM   7256  C  CD2 . LEU C  1 17  ? 2.996   68.164  35.186  1.00   15.64 ? 124 LEU C CD2 1 
ATOM   7257  N  N   . SER C  1 18  ? 2.981   69.511  30.106  1.00   31.35 ? 125 SER C N   1 
ATOM   7258  C  CA  . SER C  1 18  ? 2.427   69.644  28.770  1.00   37.30 ? 125 SER C CA  1 
ATOM   7259  C  C   . SER C  1 18  ? 3.397   70.459  27.920  1.00   40.20 ? 125 SER C C   1 
ATOM   7260  O  O   . SER C  1 18  ? 3.880   71.508  28.347  1.00   40.60 ? 125 SER C O   1 
ATOM   7261  C  CB  . SER C  1 18  ? 1.073   70.349  28.861  1.00   37.30 ? 125 SER C CB  1 
ATOM   7262  O  OG  . SER C  1 18  ? 0.391   70.323  27.629  1.00   44.65 ? 125 SER C OG  1 
ATOM   7263  N  N   . GLY C  1 19  ? 3.690   69.966  26.723  1.00   45.45 ? 126 GLY C N   1 
ATOM   7264  C  CA  . GLY C  1 19  ? 4.610   70.670  25.852  1.00   49.68 ? 126 GLY C CA  1 
ATOM   7265  C  C   . GLY C  1 19  ? 4.280   70.529  24.380  1.00   53.20 ? 126 GLY C C   1 
ATOM   7266  O  O   . GLY C  1 19  ? 3.514   69.653  23.971  1.00   50.56 ? 126 GLY C O   1 
ATOM   7267  N  N   . VAL C  1 20  ? 4.860   71.411  23.576  1.00   57.98 ? 127 VAL C N   1 
ATOM   7268  C  CA  . VAL C  1 20  ? 4.635   71.378  22.143  1.00   62.36 ? 127 VAL C CA  1 
ATOM   7269  C  C   . VAL C  1 20  ? 5.778   70.622  21.480  1.00   65.92 ? 127 VAL C C   1 
ATOM   7270  O  O   . VAL C  1 20  ? 6.202   70.980  20.386  1.00   70.12 ? 127 VAL C O   1 
ATOM   7271  C  CB  . VAL C  1 20  ? 4.560   72.809  21.574  1.00   61.88 ? 127 VAL C CB  1 
ATOM   7272  C  CG1 . VAL C  1 20  ? 3.387   73.538  22.195  0.0000 62.59 ? 127 VAL C CG1 1 
ATOM   7273  C  CG2 . VAL C  1 20  ? 5.860   73.558  21.850  0.0000 62.59 ? 127 VAL C CG2 1 
ATOM   7274  N  N   . THR C  1 21  ? 6.281   69.583  22.141  1.00   67.96 ? 128 THR C N   1 
ATOM   7275  C  CA  . THR C  1 21  ? 7.385   68.824  21.582  1.00   68.32 ? 128 THR C CA  1 
ATOM   7276  C  C   . THR C  1 21  ? 7.181   67.335  21.791  1.00   69.67 ? 128 THR C C   1 
ATOM   7277  O  O   . THR C  1 21  ? 8.128   66.555  21.630  1.00   74.78 ? 128 THR C O   1 
ATOM   7278  C  CB  . THR C  1 21  ? 8.735   69.244  22.214  1.00   66.06 ? 128 THR C CB  1 
ATOM   7279  O  OG1 . THR C  1 21  ? 9.807   68.555  21.555  0.0000 67.80 ? 128 THR C OG1 1 
ATOM   7280  C  CG2 . THR C  1 21  ? 8.753   68.908  23.696  0.0000 67.80 ? 128 THR C CG2 1 
ATOM   7281  N  N   . GLN C  1 22  ? 5.954   66.943  22.145  1.00   67.88 ? 129 GLN C N   1 
ATOM   7282  C  CA  . GLN C  1 22  ? 5.630   65.532  22.381  1.00   66.44 ? 129 GLN C CA  1 
ATOM   7283  C  C   . GLN C  1 22  ? 6.617   64.854  23.357  1.00   64.57 ? 129 GLN C C   1 
ATOM   7284  O  O   . GLN C  1 22  ? 6.720   63.616  23.411  1.00   66.84 ? 129 GLN C O   1 
ATOM   7285  C  CB  . GLN C  1 22  ? 5.590   64.752  21.052  1.00   65.44 ? 129 GLN C CB  1 
ATOM   7286  C  CG  . GLN C  1 22  ? 4.378   65.063  20.178  0.0000 65.01 ? 129 GLN C CG  1 
ATOM   7287  C  CD  . GLN C  1 22  ? 4.470   66.404  19.484  0.0000 64.70 ? 129 GLN C CD  1 
ATOM   7288  O  OE1 . GLN C  1 22  ? 4.565   67.445  20.130  0.0000 64.11 ? 129 GLN C OE1 1 
ATOM   7289  N  NE2 . GLN C  1 22  ? 4.431   66.385  18.157  0.0000 64.11 ? 129 GLN C NE2 1 
ATOM   7290  N  N   . ARG C  1 23  ? 7.326   65.672  24.133  1.00   58.09 ? 130 ARG C N   1 
ATOM   7291  C  CA  . ARG C  1 23  ? 8.284   65.176  25.112  1.00   52.62 ? 130 ARG C CA  1 
ATOM   7292  C  C   . ARG C  1 23  ? 7.837   65.595  26.524  1.00   48.25 ? 130 ARG C C   1 
ATOM   7293  O  O   . ARG C  1 23  ? 8.488   66.443  27.168  1.00   46.07 ? 130 ARG C O   1 
ATOM   7294  C  CB  . ARG C  1 23  ? 9.678   65.753  24.821  1.00   52.85 ? 130 ARG C CB  1 
ATOM   7295  C  CG  . ARG C  1 23  ? 10.250  65.425  23.439  1.00   53.90 ? 130 ARG C CG  1 
ATOM   7296  C  CD  . ARG C  1 23  ? 10.574  63.953  23.288  0.0000 51.86 ? 130 ARG C CD  1 
ATOM   7297  N  NE  . ARG C  1 23  ? 11.277  63.682  22.037  0.0000 51.31 ? 130 ARG C NE  1 
ATOM   7298  C  CZ  . ARG C  1 23  ? 10.775  63.909  20.827  0.0000 50.78 ? 130 ARG C CZ  1 
ATOM   7299  N  NH1 . ARG C  1 23  ? 9.556   64.414  20.692  0.0000 50.55 ? 130 ARG C NH1 1 
ATOM   7300  N  NH2 . ARG C  1 23  ? 11.492  63.626  19.747  0.0000 50.55 ? 130 ARG C NH2 1 
ATOM   7301  N  N   . ASP C  1 24  ? 6.717   65.030  26.988  1.00   39.80 ? 131 ASP C N   1 
ATOM   7302  C  CA  . ASP C  1 24  ? 6.199   65.345  28.320  1.00   32.96 ? 131 ASP C CA  1 
ATOM   7303  C  C   . ASP C  1 24  ? 5.519   64.138  28.951  1.00   29.18 ? 131 ASP C C   1 
ATOM   7304  O  O   . ASP C  1 24  ? 5.510   63.056  28.364  1.00   27.63 ? 131 ASP C O   1 
ATOM   7305  C  CB  . ASP C  1 24  ? 5.236   66.543  28.259  1.00   31.71 ? 131 ASP C CB  1 
ATOM   7306  C  CG  . ASP C  1 24  ? 4.082   66.331  27.308  1.00   31.37 ? 131 ASP C CG  1 
ATOM   7307  O  OD1 . ASP C  1 24  ? 3.239   65.444  27.567  1.00   28.10 ? 131 ASP C OD1 1 
ATOM   7308  O  OD2 . ASP C  1 24  ? 4.009   67.072  26.300  1.00   36.67 ? 131 ASP C OD2 1 
ATOM   7309  N  N   . LEU C  1 25  ? 4.959   64.320  30.145  1.00   26.00 ? 132 LEU C N   1 
ATOM   7310  C  CA  . LEU C  1 25  ? 4.285   63.231  30.856  1.00   22.76 ? 132 LEU C CA  1 
ATOM   7311  C  C   . LEU C  1 25  ? 2.820   63.021  30.427  1.00   18.41 ? 132 LEU C C   1 
ATOM   7312  O  O   . LEU C  1 25  ? 2.107   62.197  31.003  1.00   16.56 ? 132 LEU C O   1 
ATOM   7313  C  CB  . LEU C  1 25  ? 4.373   63.463  32.367  1.00   22.84 ? 132 LEU C CB  1 
ATOM   7314  C  CG  . LEU C  1 25  ? 5.806   63.377  32.900  1.00   23.27 ? 132 LEU C CG  1 
ATOM   7315  C  CD1 . LEU C  1 25  ? 5.869   63.824  34.345  1.00   20.07 ? 132 LEU C CD1 1 
ATOM   7316  C  CD2 . LEU C  1 25  ? 6.301   61.954  32.766  1.00   25.07 ? 132 LEU C CD2 1 
ATOM   7317  N  N   . ASN C  1 26  ? 2.376   63.779  29.426  1.00   16.48 ? 133 ASN C N   1 
ATOM   7318  C  CA  . ASN C  1 26  ? 1.025   63.630  28.879  1.00   18.23 ? 133 ASN C CA  1 
ATOM   7319  C  C   . ASN C  1 26  ? -0.061  63.777  29.935  1.00   16.87 ? 133 ASN C C   1 
ATOM   7320  O  O   . ASN C  1 26  ? -1.056  63.044  29.938  1.00   20.54 ? 133 ASN C O   1 
ATOM   7321  C  CB  . ASN C  1 26  ? 0.921   62.254  28.191  1.00   15.17 ? 133 ASN C CB  1 
ATOM   7322  C  CG  . ASN C  1 26  ? -0.229  62.169  27.229  1.00   18.89 ? 133 ASN C CG  1 
ATOM   7323  O  OD1 . ASN C  1 26  ? -0.547  63.140  26.534  1.00   21.05 ? 133 ASN C OD1 1 
ATOM   7324  N  ND2 . ASN C  1 26  ? -0.859  61.001  27.166  1.00   17.77 ? 133 ASN C ND2 1 
ATOM   7325  N  N   . VAL C  1 27  ? 0.133   64.741  30.825  1.00   20.12 ? 134 VAL C N   1 
ATOM   7326  C  CA  . VAL C  1 27  ? -0.801  64.996  31.916  1.00   19.91 ? 134 VAL C CA  1 
ATOM   7327  C  C   . VAL C  1 27  ? -2.053  65.739  31.470  1.00   22.00 ? 134 VAL C C   1 
ATOM   7328  O  O   . VAL C  1 27  ? -3.138  65.527  32.004  1.00   24.79 ? 134 VAL C O   1 
ATOM   7329  C  CB  . VAL C  1 27  ? -0.116  65.830  33.012  1.00   20.79 ? 134 VAL C CB  1 
ATOM   7330  C  CG1 . VAL C  1 27  ? -1.087  66.131  34.121  1.00   18.67 ? 134 VAL C CG1 1 
ATOM   7331  C  CG2 . VAL C  1 27  ? 1.132   65.117  33.510  1.00   18.87 ? 134 VAL C CG2 1 
ATOM   7332  N  N   . LYS C  1 28  ? -1.900  66.627  30.500  1.00   23.91 ? 135 LYS C N   1 
ATOM   7333  C  CA  . LYS C  1 28  ? -3.034  67.402  30.015  1.00   27.30 ? 135 LYS C CA  1 
ATOM   7334  C  C   . LYS C  1 28  ? -4.077  66.454  29.419  1.00   25.47 ? 135 LYS C C   1 
ATOM   7335  O  O   . LYS C  1 28  ? -5.282  66.678  29.546  1.00   23.78 ? 135 LYS C O   1 
ATOM   7336  C  CB  . LYS C  1 28  ? -2.552  68.421  28.972  1.00   27.78 ? 135 LYS C CB  1 
ATOM   7337  C  CG  . LYS C  1 28  ? -3.582  69.452  28.571  1.00   31.32 ? 135 LYS C CG  1 
ATOM   7338  C  CD  . LYS C  1 28  ? -3.036  70.390  27.484  1.00   33.12 ? 135 LYS C CD  1 
ATOM   7339  C  CE  . LYS C  1 28  ? -4.106  71.386  27.025  1.00   36.67 ? 135 LYS C CE  1 
ATOM   7340  N  NZ  . LYS C  1 28  ? -3.652  72.349  25.968  1.00   34.82 ? 135 LYS C NZ  1 
ATOM   7341  N  N   . ALA C  1 29  ? -3.608  65.383  28.784  1.00   23.43 ? 136 ALA C N   1 
ATOM   7342  C  CA  . ALA C  1 29  ? -4.517  64.407  28.188  1.00   24.66 ? 136 ALA C CA  1 
ATOM   7343  C  C   . ALA C  1 29  ? -5.375  63.762  29.265  1.00   26.99 ? 136 ALA C C   1 
ATOM   7344  O  O   . ALA C  1 29  ? -6.512  63.372  29.003  1.00   31.19 ? 136 ALA C O   1 
ATOM   7345  C  CB  . ALA C  1 29  ? -3.742  63.341  27.446  1.00   23.05 ? 136 ALA C CB  1 
ATOM   7346  N  N   . ALA C  1 30  ? -4.837  63.650  30.478  1.00   25.15 ? 137 ALA C N   1 
ATOM   7347  C  CA  . ALA C  1 30  ? -5.590  63.052  31.578  1.00   23.27 ? 137 ALA C CA  1 
ATOM   7348  C  C   . ALA C  1 30  ? -6.589  64.071  32.109  1.00   21.84 ? 137 ALA C C   1 
ATOM   7349  O  O   . ALA C  1 30  ? -7.727  63.730  32.433  1.00   22.59 ? 137 ALA C O   1 
ATOM   7350  C  CB  . ALA C  1 30  ? -4.651  62.615  32.693  1.00   20.93 ? 137 ALA C CB  1 
ATOM   7351  N  N   . TRP C  1 31  ? -6.159  65.322  32.213  1.00   20.65 ? 138 TRP C N   1 
ATOM   7352  C  CA  . TRP C  1 31  ? -7.046  66.374  32.700  1.00   22.21 ? 138 TRP C CA  1 
ATOM   7353  C  C   . TRP C  1 31  ? -8.227  66.471  31.741  1.00   24.92 ? 138 TRP C C   1 
ATOM   7354  O  O   . TRP C  1 31  ? -9.382  66.573  32.163  1.00   22.37 ? 138 TRP C O   1 
ATOM   7355  C  CB  . TRP C  1 31  ? -6.343  67.743  32.737  1.00   20.14 ? 138 TRP C CB  1 
ATOM   7356  C  CG  . TRP C  1 31  ? -5.230  67.868  33.730  1.00   19.79 ? 138 TRP C CG  1 
ATOM   7357  C  CD1 . TRP C  1 31  ? -5.061  67.138  34.880  1.00   17.70 ? 138 TRP C CD1 1 
ATOM   7358  C  CD2 . TRP C  1 31  ? -4.130  68.788  33.673  1.00   18.32 ? 138 TRP C CD2 1 
ATOM   7359  N  NE1 . TRP C  1 31  ? -3.922  67.548  35.535  1.00   16.87 ? 138 TRP C NE1 1 
ATOM   7360  C  CE2 . TRP C  1 31  ? -3.330  68.554  34.820  1.00   16.07 ? 138 TRP C CE2 1 
ATOM   7361  C  CE3 . TRP C  1 31  ? -3.741  69.787  32.764  1.00   19.17 ? 138 TRP C CE3 1 
ATOM   7362  C  CZ2 . TRP C  1 31  ? -2.162  69.281  35.081  1.00   16.55 ? 138 TRP C CZ2 1 
ATOM   7363  C  CZ3 . TRP C  1 31  ? -2.576  70.515  33.024  1.00   16.86 ? 138 TRP C CZ3 1 
ATOM   7364  C  CH2 . TRP C  1 31  ? -1.801  70.254  34.173  1.00   18.19 ? 138 TRP C CH2 1 
ATOM   7365  N  N   . ALA C  1 32  ? -7.922  66.449  30.446  1.00   26.44 ? 139 ALA C N   1 
ATOM   7366  C  CA  . ALA C  1 32  ? -8.944  66.538  29.412  1.00   27.98 ? 139 ALA C CA  1 
ATOM   7367  C  C   . ALA C  1 32  ? -9.948  65.387  29.516  1.00   29.66 ? 139 ALA C C   1 
ATOM   7368  O  O   . ALA C  1 32  ? -11.118 65.552  29.172  1.00   31.80 ? 139 ALA C O   1 
ATOM   7369  C  CB  . ALA C  1 32  ? -8.300  66.548  28.049  1.00   26.10 ? 139 ALA C CB  1 
ATOM   7370  N  N   . GLN C  1 33  ? -9.502  64.225  29.980  1.00   27.05 ? 140 GLN C N   1 
ATOM   7371  C  CA  . GLN C  1 33  ? -10.411 63.095  30.133  1.00   23.92 ? 140 GLN C CA  1 
ATOM   7372  C  C   . GLN C  1 33  ? -11.252 63.314  31.389  1.00   24.05 ? 140 GLN C C   1 
ATOM   7373  O  O   . GLN C  1 33  ? -12.126 62.518  31.707  1.00   28.13 ? 140 GLN C O   1 
ATOM   7374  C  CB  . GLN C  1 33  ? -9.624  61.781  30.239  1.00   23.84 ? 140 GLN C CB  1 
ATOM   7375  C  CG  . GLN C  1 33  ? -9.149  61.234  28.908  1.00   25.94 ? 140 GLN C CG  1 
ATOM   7376  C  CD  . GLN C  1 33  ? -8.203  60.041  29.060  1.00   31.03 ? 140 GLN C CD  1 
ATOM   7377  O  OE1 . GLN C  1 33  ? -6.984  60.185  28.960  1.00   31.97 ? 140 GLN C OE1 1 
ATOM   7378  N  NE2 . GLN C  1 33  ? -8.767  58.858  29.304  1.00   34.36 ? 140 GLN C NE2 1 
ATOM   7379  N  N   . GLY C  1 34  ? -10.967 64.392  32.114  1.00   24.77 ? 141 GLY C N   1 
ATOM   7380  C  CA  . GLY C  1 34  ? -11.724 64.714  33.315  1.00   20.42 ? 141 GLY C CA  1 
ATOM   7381  C  C   . GLY C  1 34  ? -11.111 64.336  34.656  1.00   22.64 ? 141 GLY C C   1 
ATOM   7382  O  O   . GLY C  1 34  ? -11.786 64.394  35.679  1.00   23.03 ? 141 GLY C O   1 
ATOM   7383  N  N   . TYR C  1 35  ? -9.837  63.969  34.678  1.00   22.33 ? 142 TYR C N   1 
ATOM   7384  C  CA  . TYR C  1 35  ? -9.217  63.559  35.931  1.00   22.39 ? 142 TYR C CA  1 
ATOM   7385  C  C   . TYR C  1 35  ? -8.223  64.569  36.464  1.00   22.83 ? 142 TYR C C   1 
ATOM   7386  O  O   . TYR C  1 35  ? -7.274  64.950  35.774  1.00   25.27 ? 142 TYR C O   1 
ATOM   7387  C  CB  . TYR C  1 35  ? -8.581  62.181  35.738  1.00   20.53 ? 142 TYR C CB  1 
ATOM   7388  C  CG  . TYR C  1 35  ? -9.617  61.155  35.308  1.00   22.63 ? 142 TYR C CG  1 
ATOM   7389  C  CD1 . TYR C  1 35  ? -10.604 60.716  36.196  1.00   20.81 ? 142 TYR C CD1 1 
ATOM   7390  C  CD2 . TYR C  1 35  ? -9.652  60.678  33.999  1.00   21.46 ? 142 TYR C CD2 1 
ATOM   7391  C  CE1 . TYR C  1 35  ? -11.607 59.823  35.779  1.00   22.70 ? 142 TYR C CE1 1 
ATOM   7392  C  CE2 . TYR C  1 35  ? -10.640 59.791  33.577  1.00   25.94 ? 142 TYR C CE2 1 
ATOM   7393  C  CZ  . TYR C  1 35  ? -11.612 59.367  34.472  1.00   24.19 ? 142 TYR C CZ  1 
ATOM   7394  O  OH  . TYR C  1 35  ? -12.566 58.471  34.061  1.00   27.14 ? 142 TYR C OH  1 
ATOM   7395  N  N   . THR C  1 36  ? -8.456  65.004  37.699  1.00   21.13 ? 143 THR C N   1 
ATOM   7396  C  CA  . THR C  1 36  ? -7.599  65.991  38.335  1.00   23.75 ? 143 THR C CA  1 
ATOM   7397  C  C   . THR C  1 36  ? -7.189  65.625  39.759  1.00   22.95 ? 143 THR C C   1 
ATOM   7398  O  O   . THR C  1 36  ? -6.530  66.408  40.441  1.00   24.25 ? 143 THR C O   1 
ATOM   7399  C  CB  . THR C  1 36  ? -8.275  67.367  38.341  1.00   23.49 ? 143 THR C CB  1 
ATOM   7400  O  OG1 . THR C  1 36  ? -9.503  67.302  39.069  1.00   29.55 ? 143 THR C OG1 1 
ATOM   7401  C  CG2 . THR C  1 36  ? -8.564  67.794  36.922  1.00   25.92 ? 143 THR C CG2 1 
ATOM   7402  N  N   . GLY C  1 37  ? -7.577  64.436  40.202  1.00   23.02 ? 144 GLY C N   1 
ATOM   7403  C  CA  . GLY C  1 37  ? -7.207  63.997  41.533  1.00   25.37 ? 144 GLY C CA  1 
ATOM   7404  C  C   . GLY C  1 37  ? -8.265  64.254  42.584  1.00   26.30 ? 144 GLY C C   1 
ATOM   7405  O  O   . GLY C  1 37  ? -8.029  64.067  43.782  1.00   28.14 ? 144 GLY C O   1 
ATOM   7406  N  N   . HIS C  1 38  ? -9.438  64.686  42.144  1.00   25.67 ? 145 HIS C N   1 
ATOM   7407  C  CA  . HIS C  1 38  ? -10.520 64.962  43.061  1.00   24.98 ? 145 HIS C CA  1 
ATOM   7408  C  C   . HIS C  1 38  ? -10.858 63.722  43.908  1.00   24.47 ? 145 HIS C C   1 
ATOM   7409  O  O   . HIS C  1 38  ? -11.080 62.633  43.373  1.00   19.26 ? 145 HIS C O   1 
ATOM   7410  C  CB  . HIS C  1 38  ? -11.747 65.406  42.281  1.00   31.94 ? 145 HIS C CB  1 
ATOM   7411  C  CG  . HIS C  1 38  ? -12.904 65.763  43.153  1.00   42.90 ? 145 HIS C CG  1 
ATOM   7412  N  ND1 . HIS C  1 38  ? -12.924 66.902  43.931  1.00   47.41 ? 145 HIS C ND1 1 
ATOM   7413  C  CD2 . HIS C  1 38  ? -14.040 65.084  43.449  1.00   46.71 ? 145 HIS C CD2 1 
ATOM   7414  C  CE1 . HIS C  1 38  ? -14.019 66.907  44.672  1.00   49.09 ? 145 HIS C CE1 1 
ATOM   7415  N  NE2 . HIS C  1 38  ? -14.713 65.814  44.400  1.00   48.43 ? 145 HIS C NE2 1 
ATOM   7416  N  N   . GLY C  1 39  ? -10.891 63.893  45.230  1.00   22.94 ? 146 GLY C N   1 
ATOM   7417  C  CA  . GLY C  1 39  ? -11.210 62.779  46.115  1.00   23.21 ? 146 GLY C CA  1 
ATOM   7418  C  C   . GLY C  1 39  ? -10.040 61.893  46.544  1.00   23.85 ? 146 GLY C C   1 
ATOM   7419  O  O   . GLY C  1 39  ? -10.208 61.017  47.388  1.00   23.71 ? 146 GLY C O   1 
ATOM   7420  N  N   . ILE C  1 40  ? -8.858  62.118  45.979  1.00   21.36 ? 147 ILE C N   1 
ATOM   7421  C  CA  . ILE C  1 40  ? -7.685  61.313  46.313  1.00   20.87 ? 147 ILE C CA  1 
ATOM   7422  C  C   . ILE C  1 40  ? -6.824  62.050  47.336  1.00   20.83 ? 147 ILE C C   1 
ATOM   7423  O  O   . ILE C  1 40  ? -6.669  63.270  47.264  1.00   20.85 ? 147 ILE C O   1 
ATOM   7424  C  CB  . ILE C  1 40  ? -6.858  61.007  45.030  1.00   21.47 ? 147 ILE C CB  1 
ATOM   7425  C  CG1 . ILE C  1 40  ? -7.753  60.319  43.989  1.00   20.45 ? 147 ILE C CG1 1 
ATOM   7426  C  CG2 . ILE C  1 40  ? -5.659  60.133  45.343  1.00   15.30 ? 147 ILE C CG2 1 
ATOM   7427  C  CD1 . ILE C  1 40  ? -8.406  59.026  44.440  1.00   21.49 ? 147 ILE C CD1 1 
ATOM   7428  N  N   . VAL C  1 41  ? -6.280  61.308  48.300  1.00   19.50 ? 148 VAL C N   1 
ATOM   7429  C  CA  . VAL C  1 41  ? -5.455  61.897  49.345  1.00   17.78 ? 148 VAL C CA  1 
ATOM   7430  C  C   . VAL C  1 41  ? -4.012  61.427  49.214  1.00   20.82 ? 148 VAL C C   1 
ATOM   7431  O  O   . VAL C  1 41  ? -3.749  60.222  49.187  1.00   20.33 ? 148 VAL C O   1 
ATOM   7432  C  CB  . VAL C  1 41  ? -5.984  61.510  50.752  1.00   21.05 ? 148 VAL C CB  1 
ATOM   7433  C  CG1 . VAL C  1 41  ? -5.154  62.194  51.847  1.00   17.95 ? 148 VAL C CG1 1 
ATOM   7434  C  CG2 . VAL C  1 41  ? -7.463  61.894  50.877  1.00   22.30 ? 148 VAL C CG2 1 
ATOM   7435  N  N   . VAL C  1 42  ? -3.089  62.389  49.137  1.00   19.44 ? 149 VAL C N   1 
ATOM   7436  C  CA  . VAL C  1 42  ? -1.662  62.116  49.010  1.00   18.76 ? 149 VAL C CA  1 
ATOM   7437  C  C   . VAL C  1 42  ? -0.896  62.751  50.170  1.00   21.67 ? 149 VAL C C   1 
ATOM   7438  O  O   . VAL C  1 42  ? -1.181  63.883  50.564  1.00   23.32 ? 149 VAL C O   1 
ATOM   7439  C  CB  . VAL C  1 42  ? -1.095  62.689  47.688  1.00   19.24 ? 149 VAL C CB  1 
ATOM   7440  C  CG1 . VAL C  1 42  ? 0.400   62.337  47.546  1.00   16.86 ? 149 VAL C CG1 1 
ATOM   7441  C  CG2 . VAL C  1 42  ? -1.866  62.136  46.509  1.00   16.52 ? 149 VAL C CG2 1 
ATOM   7442  N  N   . SER C  1 43  ? 0.072   62.023  50.717  1.00   17.93 ? 150 SER C N   1 
ATOM   7443  C  CA  . SER C  1 43  ? 0.856   62.539  51.822  1.00   19.89 ? 150 SER C CA  1 
ATOM   7444  C  C   . SER C  1 43  ? 2.338   62.499  51.474  1.00   21.09 ? 150 SER C C   1 
ATOM   7445  O  O   . SER C  1 43  ? 2.850   61.482  51.008  1.00   21.36 ? 150 SER C O   1 
ATOM   7446  C  CB  . SER C  1 43  ? 0.605   61.723  53.099  1.00   21.67 ? 150 SER C CB  1 
ATOM   7447  O  OG  . SER C  1 43  ? 1.161   62.383  54.230  1.00   21.00 ? 150 SER C OG  1 
ATOM   7448  N  N   . ILE C  1 44  ? 3.012   63.617  51.714  1.00   20.18 ? 151 ILE C N   1 
ATOM   7449  C  CA  . ILE C  1 44  ? 4.436   63.756  51.448  1.00   21.12 ? 151 ILE C CA  1 
ATOM   7450  C  C   . ILE C  1 44  ? 5.222   63.482  52.740  1.00   21.86 ? 151 ILE C C   1 
ATOM   7451  O  O   . ILE C  1 44  ? 5.171   64.285  53.666  1.00   24.20 ? 151 ILE C O   1 
ATOM   7452  C  CB  . ILE C  1 44  ? 4.741   65.197  50.968  1.00   20.88 ? 151 ILE C CB  1 
ATOM   7453  C  CG1 . ILE C  1 44  ? 3.841   65.552  49.774  1.00   24.40 ? 151 ILE C CG1 1 
ATOM   7454  C  CG2 . ILE C  1 44  ? 6.191   65.342  50.610  1.00   19.89 ? 151 ILE C CG2 1 
ATOM   7455  C  CD1 . ILE C  1 44  ? 4.003   64.646  48.568  1.00   25.80 ? 151 ILE C CD1 1 
ATOM   7456  N  N   . LEU C  1 45  ? 5.932   62.356  52.816  1.00   18.49 ? 152 LEU C N   1 
ATOM   7457  C  CA  . LEU C  1 45  ? 6.712   62.045  54.018  1.00   18.65 ? 152 LEU C CA  1 
ATOM   7458  C  C   . LEU C  1 45  ? 8.045   62.714  53.790  1.00   20.25 ? 152 LEU C C   1 
ATOM   7459  O  O   . LEU C  1 45  ? 8.853   62.216  53.016  1.00   17.11 ? 152 LEU C O   1 
ATOM   7460  C  CB  . LEU C  1 45  ? 6.905   60.537  54.180  1.00   15.29 ? 152 LEU C CB  1 
ATOM   7461  C  CG  . LEU C  1 45  ? 5.634   59.698  53.988  1.00   16.38 ? 152 LEU C CG  1 
ATOM   7462  C  CD1 . LEU C  1 45  ? 5.821   58.278  54.543  1.00   10.89 ? 152 LEU C CD1 1 
ATOM   7463  C  CD2 . LEU C  1 45  ? 4.474   60.369  54.670  1.00   13.65 ? 152 LEU C CD2 1 
ATOM   7464  N  N   . ASP C  1 46  ? 8.278   63.837  54.471  1.00   21.29 ? 153 ASP C N   1 
ATOM   7465  C  CA  . ASP C  1 46  ? 9.498   64.590  54.242  1.00   20.64 ? 153 ASP C CA  1 
ATOM   7466  C  C   . ASP C  1 46  ? 9.888   65.477  55.439  1.00   22.88 ? 153 ASP C C   1 
ATOM   7467  O  O   . ASP C  1 46  ? 9.721   65.080  56.594  1.00   21.72 ? 153 ASP C O   1 
ATOM   7468  C  CB  . ASP C  1 46  ? 9.285   65.430  52.975  1.00   18.94 ? 153 ASP C CB  1 
ATOM   7469  C  CG  . ASP C  1 46  ? 10.569  65.681  52.207  1.00   21.33 ? 153 ASP C CG  1 
ATOM   7470  O  OD1 . ASP C  1 46  ? 11.355  66.546  52.634  1.00   19.69 ? 153 ASP C OD1 1 
ATOM   7471  O  OD2 . ASP C  1 46  ? 10.795  65.019  51.166  1.00   21.05 ? 153 ASP C OD2 1 
ATOM   7472  N  N   . ASP C  1 47  ? 10.412  66.670  55.158  1.00   21.50 ? 154 ASP C N   1 
ATOM   7473  C  CA  . ASP C  1 47  ? 10.839  67.578  56.223  1.00   23.19 ? 154 ASP C CA  1 
ATOM   7474  C  C   . ASP C  1 47  ? 9.783   68.589  56.623  1.00   21.03 ? 154 ASP C C   1 
ATOM   7475  O  O   . ASP C  1 47  ? 10.101  69.594  57.252  1.00   22.28 ? 154 ASP C O   1 
ATOM   7476  C  CB  . ASP C  1 47  ? 12.130  68.316  55.829  1.00   23.42 ? 154 ASP C CB  1 
ATOM   7477  C  CG  . ASP C  1 47  ? 11.956  69.204  54.613  1.00   25.17 ? 154 ASP C CG  1 
ATOM   7478  O  OD1 . ASP C  1 47  ? 10.808  69.396  54.141  1.00   24.78 ? 154 ASP C OD1 1 
ATOM   7479  O  OD2 . ASP C  1 47  ? 12.983  69.722  54.129  1.00   27.39 ? 154 ASP C OD2 1 
ATOM   7480  N  N   . GLY C  1 48  ? 8.533   68.310  56.256  1.00   20.39 ? 155 GLY C N   1 
ATOM   7481  C  CA  . GLY C  1 48  ? 7.432   69.190  56.591  1.00   21.49 ? 155 GLY C CA  1 
ATOM   7482  C  C   . GLY C  1 48  ? 6.741   69.778  55.375  1.00   24.37 ? 155 GLY C C   1 
ATOM   7483  O  O   . GLY C  1 48  ? 7.183   69.604  54.240  1.00   24.57 ? 155 GLY C O   1 
ATOM   7484  N  N   . ILE C  1 49  ? 5.644   70.483  55.606  1.00   22.86 ? 156 ILE C N   1 
ATOM   7485  C  CA  . ILE C  1 49  ? 4.931   71.106  54.506  1.00   22.07 ? 156 ILE C CA  1 
ATOM   7486  C  C   . ILE C  1 49  ? 4.360   72.457  54.950  1.00   23.15 ? 156 ILE C C   1 
ATOM   7487  O  O   . ILE C  1 49  ? 3.703   72.547  55.992  1.00   25.04 ? 156 ILE C O   1 
ATOM   7488  C  CB  . ILE C  1 49  ? 3.801   70.182  53.988  1.00   18.82 ? 156 ILE C CB  1 
ATOM   7489  C  CG1 . ILE C  1 49  ? 3.085   70.844  52.802  1.00   20.45 ? 156 ILE C CG1 1 
ATOM   7490  C  CG2 . ILE C  1 49  ? 2.830   69.851  55.106  1.00   18.39 ? 156 ILE C CG2 1 
ATOM   7491  C  CD1 . ILE C  1 49  ? 1.928   70.015  52.226  1.00   17.28 ? 156 ILE C CD1 1 
ATOM   7492  N  N   . GLU C  1 50  ? 4.636   73.508  54.177  1.00   22.28 ? 157 GLU C N   1 
ATOM   7493  C  CA  . GLU C  1 50  ? 4.123   74.850  54.487  1.00   22.88 ? 157 GLU C CA  1 
ATOM   7494  C  C   . GLU C  1 50  ? 2.644   74.865  54.119  1.00   21.55 ? 157 GLU C C   1 
ATOM   7495  O  O   . GLU C  1 50  ? 2.284   75.257  53.026  1.00   25.27 ? 157 GLU C O   1 
ATOM   7496  C  CB  . GLU C  1 50  ? 4.884   75.894  53.674  1.00   22.30 ? 157 GLU C CB  1 
ATOM   7497  C  CG  . GLU C  1 50  ? 4.664   77.321  54.133  1.00   27.25 ? 157 GLU C CG  1 
ATOM   7498  C  CD  . GLU C  1 50  ? 5.650   78.272  53.502  1.00   27.89 ? 157 GLU C CD  1 
ATOM   7499  O  OE1 . GLU C  1 50  ? 5.469   78.611  52.316  1.00   30.33 ? 157 GLU C OE1 1 
ATOM   7500  O  OE2 . GLU C  1 50  ? 6.622   78.668  54.182  1.00   30.29 ? 157 GLU C OE2 1 
ATOM   7501  N  N   . LYS C  1 51  ? 1.796   74.422  55.041  1.00   22.98 ? 158 LYS C N   1 
ATOM   7502  C  CA  . LYS C  1 51  ? 0.354   74.322  54.810  1.00   24.03 ? 158 LYS C CA  1 
ATOM   7503  C  C   . LYS C  1 51  ? -0.352  75.628  54.461  1.00   27.45 ? 158 LYS C C   1 
ATOM   7504  O  O   . LYS C  1 51  ? -1.434  75.620  53.868  1.00   26.63 ? 158 LYS C O   1 
ATOM   7505  C  CB  . LYS C  1 51  ? -0.328  73.693  56.032  1.00   21.56 ? 158 LYS C CB  1 
ATOM   7506  C  CG  . LYS C  1 51  ? -0.278  74.531  57.312  1.00   21.16 ? 158 LYS C CG  1 
ATOM   7507  C  CD  . LYS C  1 51  ? -0.853  73.744  58.518  1.00   23.45 ? 158 LYS C CD  1 
ATOM   7508  C  CE  . LYS C  1 51  ? -0.663  74.494  59.848  1.00   24.05 ? 158 LYS C CE  1 
ATOM   7509  N  NZ  . LYS C  1 51  ? 0.758   74.980  60.042  1.00   20.95 ? 158 LYS C NZ  1 
ATOM   7510  N  N   . ASN C  1 52  ? 0.250   76.744  54.843  1.00   26.55 ? 159 ASN C N   1 
ATOM   7511  C  CA  . ASN C  1 52  ? -0.341  78.039  54.570  1.00   28.93 ? 159 ASN C CA  1 
ATOM   7512  C  C   . ASN C  1 52  ? 0.177   78.631  53.259  1.00   30.01 ? 159 ASN C C   1 
ATOM   7513  O  O   . ASN C  1 52  ? -0.128  79.774  52.930  1.00   33.36 ? 159 ASN C O   1 
ATOM   7514  C  CB  . ASN C  1 52  ? -0.047  78.986  55.731  1.00   27.34 ? 159 ASN C CB  1 
ATOM   7515  C  CG  . ASN C  1 52  ? 1.408   79.084  56.018  1.00   29.25 ? 159 ASN C CG  1 
ATOM   7516  O  OD1 . ASN C  1 52  ? 2.125   78.081  55.985  1.00   32.50 ? 159 ASN C OD1 1 
ATOM   7517  N  ND2 . ASN C  1 52  ? 1.871   80.289  56.313  1.00   34.38 ? 159 ASN C ND2 1 
ATOM   7518  N  N   . HIS C  1 53  ? 0.969   77.867  52.513  1.00   27.82 ? 160 HIS C N   1 
ATOM   7519  C  CA  . HIS C  1 53  ? 1.474   78.359  51.239  1.00   26.02 ? 160 HIS C CA  1 
ATOM   7520  C  C   . HIS C  1 53  ? 0.255   78.674  50.365  1.00   26.35 ? 160 HIS C C   1 
ATOM   7521  O  O   . HIS C  1 53  ? -0.693  77.893  50.297  1.00   28.65 ? 160 HIS C O   1 
ATOM   7522  C  CB  . HIS C  1 53  ? 2.365   77.304  50.567  1.00   23.61 ? 160 HIS C CB  1 
ATOM   7523  C  CG  . HIS C  1 53  ? 3.177   77.831  49.422  1.00   24.52 ? 160 HIS C CG  1 
ATOM   7524  N  ND1 . HIS C  1 53  ? 2.616   78.231  48.226  1.00   22.65 ? 160 HIS C ND1 1 
ATOM   7525  C  CD2 . HIS C  1 53  ? 4.509   78.053  49.303  1.00   23.01 ? 160 HIS C CD2 1 
ATOM   7526  C  CE1 . HIS C  1 53  ? 3.565   78.677  47.424  1.00   20.94 ? 160 HIS C CE1 1 
ATOM   7527  N  NE2 . HIS C  1 53  ? 4.722   78.581  48.052  1.00   22.43 ? 160 HIS C NE2 1 
ATOM   7528  N  N   . PRO C  1 54  ? 0.255   79.842  49.703  1.00   25.80 ? 161 PRO C N   1 
ATOM   7529  C  CA  . PRO C  1 54  ? -0.864  80.235  48.845  1.00   24.84 ? 161 PRO C CA  1 
ATOM   7530  C  C   . PRO C  1 54  ? -1.220  79.252  47.735  1.00   25.94 ? 161 PRO C C   1 
ATOM   7531  O  O   . PRO C  1 54  ? -2.354  79.233  47.262  1.00   27.07 ? 161 PRO C O   1 
ATOM   7532  C  CB  . PRO C  1 54  ? -0.444  81.622  48.314  1.00   23.31 ? 161 PRO C CB  1 
ATOM   7533  C  CG  . PRO C  1 54  ? 1.039   81.628  48.447  1.00   30.00 ? 161 PRO C CG  1 
ATOM   7534  C  CD  . PRO C  1 54  ? 1.276   80.903  49.750  1.00   27.16 ? 161 PRO C CD  1 
ATOM   7535  N  N   . ASP C  1 55  ? -0.272  78.424  47.314  1.00   26.22 ? 162 ASP C N   1 
ATOM   7536  C  CA  . ASP C  1 55  ? -0.596  77.466  46.266  1.00   25.57 ? 162 ASP C CA  1 
ATOM   7537  C  C   . ASP C  1 55  ? -0.881  76.076  46.833  1.00   28.03 ? 162 ASP C C   1 
ATOM   7538  O  O   . ASP C  1 55  ? -1.105  75.128  46.078  1.00   29.73 ? 162 ASP C O   1 
ATOM   7539  C  CB  . ASP C  1 55  ? 0.524   77.409  45.228  1.00   21.74 ? 162 ASP C CB  1 
ATOM   7540  C  CG  . ASP C  1 55  ? -0.009  77.428  43.794  1.00   22.24 ? 162 ASP C CG  1 
ATOM   7541  O  OD1 . ASP C  1 55  ? -1.138  77.915  43.584  1.00   21.83 ? 162 ASP C OD1 1 
ATOM   7542  O  OD2 . ASP C  1 55  ? 0.709   76.981  42.870  1.00   19.50 ? 162 ASP C OD2 1 
ATOM   7543  N  N   . LEU C  1 56  ? -0.898  75.962  48.163  1.00   27.04 ? 163 LEU C N   1 
ATOM   7544  C  CA  . LEU C  1 56  ? -1.162  74.678  48.815  1.00   24.98 ? 163 LEU C CA  1 
ATOM   7545  C  C   . LEU C  1 56  ? -2.353  74.705  49.771  1.00   24.57 ? 163 LEU C C   1 
ATOM   7546  O  O   . LEU C  1 56  ? -3.094  73.724  49.880  1.00   22.82 ? 163 LEU C O   1 
ATOM   7547  C  CB  . LEU C  1 56  ? 0.073   74.211  49.589  1.00   24.43 ? 163 LEU C CB  1 
ATOM   7548  C  CG  . LEU C  1 56  ? 1.289   73.777  48.777  1.00   23.51 ? 163 LEU C CG  1 
ATOM   7549  C  CD1 . LEU C  1 56  ? 2.427   73.358  49.726  1.00   18.21 ? 163 LEU C CD1 1 
ATOM   7550  C  CD2 . LEU C  1 56  ? 0.875   72.627  47.862  1.00   20.18 ? 163 LEU C CD2 1 
ATOM   7551  N  N   . ALA C  1 57  ? -2.534  75.822  50.465  1.00   21.79 ? 164 ALA C N   1 
ATOM   7552  C  CA  . ALA C  1 57  ? -3.631  75.953  51.425  1.00   23.30 ? 164 ALA C CA  1 
ATOM   7553  C  C   . ALA C  1 57  ? -4.963  75.414  50.929  1.00   21.77 ? 164 ALA C C   1 
ATOM   7554  O  O   . ALA C  1 57  ? -5.646  74.688  51.639  1.00   25.02 ? 164 ALA C O   1 
ATOM   7555  C  CB  . ALA C  1 57  ? -3.794  77.409  51.837  1.00   22.73 ? 164 ALA C CB  1 
ATOM   7556  N  N   . GLY C  1 58  ? -5.337  75.772  49.710  1.00   22.44 ? 165 GLY C N   1 
ATOM   7557  C  CA  . GLY C  1 58  ? -6.605  75.314  49.174  1.00   21.73 ? 165 GLY C CA  1 
ATOM   7558  C  C   . GLY C  1 58  ? -6.790  73.803  49.092  1.00   25.86 ? 165 GLY C C   1 
ATOM   7559  O  O   . GLY C  1 58  ? -7.929  73.321  49.080  1.00   27.07 ? 165 GLY C O   1 
ATOM   7560  N  N   . ASN C  1 59  ? -5.696  73.047  49.022  1.00   24.49 ? 166 ASN C N   1 
ATOM   7561  C  CA  . ASN C  1 59  ? -5.801  71.594  48.942  1.00   23.77 ? 166 ASN C CA  1 
ATOM   7562  C  C   . ASN C  1 59  ? -5.299  70.910  50.213  1.00   25.54 ? 166 ASN C C   1 
ATOM   7563  O  O   . ASN C  1 59  ? -5.463  69.695  50.368  1.00   26.58 ? 166 ASN C O   1 
ATOM   7564  C  CB  . ASN C  1 59  ? -4.995  71.041  47.755  1.00   22.04 ? 166 ASN C CB  1 
ATOM   7565  C  CG  . ASN C  1 59  ? -5.627  71.346  46.399  1.00   20.76 ? 166 ASN C CG  1 
ATOM   7566  O  OD1 . ASN C  1 59  ? -6.846  71.439  46.272  1.00   25.18 ? 166 ASN C OD1 1 
ATOM   7567  N  ND2 . ASN C  1 59  ? -4.794  71.473  45.374  1.00   14.88 ? 166 ASN C ND2 1 
ATOM   7568  N  N   . TYR C  1 60  ? -4.692  71.675  51.119  1.00   22.44 ? 167 TYR C N   1 
ATOM   7569  C  CA  . TYR C  1 60  ? -4.146  71.095  52.346  1.00   25.26 ? 167 TYR C CA  1 
ATOM   7570  C  C   . TYR C  1 60  ? -5.142  70.247  53.143  1.00   26.09 ? 167 TYR C C   1 
ATOM   7571  O  O   . TYR C  1 60  ? -6.292  70.635  53.334  1.00   27.70 ? 167 TYR C O   1 
ATOM   7572  C  CB  . TYR C  1 60  ? -3.583  72.182  53.250  1.00   23.19 ? 167 TYR C CB  1 
ATOM   7573  C  CG  . TYR C  1 60  ? -2.982  71.615  54.503  1.00   25.01 ? 167 TYR C CG  1 
ATOM   7574  C  CD1 . TYR C  1 60  ? -1.785  70.897  54.459  1.00   22.10 ? 167 TYR C CD1 1 
ATOM   7575  C  CD2 . TYR C  1 60  ? -3.620  71.769  55.738  1.00   24.88 ? 167 TYR C CD2 1 
ATOM   7576  C  CE1 . TYR C  1 60  ? -1.238  70.349  55.605  1.00   22.72 ? 167 TYR C CE1 1 
ATOM   7577  C  CE2 . TYR C  1 60  ? -3.082  71.225  56.897  1.00   24.49 ? 167 TYR C CE2 1 
ATOM   7578  C  CZ  . TYR C  1 60  ? -1.893  70.513  56.827  1.00   25.39 ? 167 TYR C CZ  1 
ATOM   7579  O  OH  . TYR C  1 60  ? -1.372  69.947  57.972  1.00   25.94 ? 167 TYR C OH  1 
ATOM   7580  N  N   . ASP C  1 61  ? -4.689  69.088  53.606  1.00   25.07 ? 168 ASP C N   1 
ATOM   7581  C  CA  . ASP C  1 61  ? -5.543  68.176  54.367  1.00   28.48 ? 168 ASP C CA  1 
ATOM   7582  C  C   . ASP C  1 61  ? -4.837  67.742  55.653  1.00   28.14 ? 168 ASP C C   1 
ATOM   7583  O  O   . ASP C  1 61  ? -3.897  66.946  55.613  1.00   27.64 ? 168 ASP C O   1 
ATOM   7584  C  CB  . ASP C  1 61  ? -5.891  66.946  53.521  1.00   28.08 ? 168 ASP C CB  1 
ATOM   7585  C  CG  . ASP C  1 61  ? -6.787  65.969  54.252  1.00   30.38 ? 168 ASP C CG  1 
ATOM   7586  O  OD1 . ASP C  1 61  ? -7.096  66.199  55.442  1.00   32.70 ? 168 ASP C OD1 1 
ATOM   7587  O  OD2 . ASP C  1 61  ? -7.186  64.961  53.642  1.00   28.57 ? 168 ASP C OD2 1 
ATOM   7588  N  N   . PRO C  1 62  ? -5.301  68.256  56.810  1.00   28.62 ? 169 PRO C N   1 
ATOM   7589  C  CA  . PRO C  1 62  ? -4.752  67.966  58.139  1.00   28.13 ? 169 PRO C CA  1 
ATOM   7590  C  C   . PRO C  1 62  ? -4.807  66.475  58.454  1.00   27.80 ? 169 PRO C C   1 
ATOM   7591  O  O   . PRO C  1 62  ? -3.959  65.957  59.172  1.00   29.80 ? 169 PRO C O   1 
ATOM   7592  C  CB  . PRO C  1 62  ? -5.656  68.767  59.081  1.00   30.61 ? 169 PRO C CB  1 
ATOM   7593  C  CG  . PRO C  1 62  ? -6.330  69.780  58.185  1.00   31.92 ? 169 PRO C CG  1 
ATOM   7594  C  CD  . PRO C  1 62  ? -6.567  68.997  56.934  1.00   29.39 ? 169 PRO C CD  1 
ATOM   7595  N  N   . GLY C  1 63  ? -5.814  65.800  57.910  1.00   27.61 ? 170 GLY C N   1 
ATOM   7596  C  CA  . GLY C  1 63  ? -5.977  64.375  58.136  1.00   29.98 ? 170 GLY C CA  1 
ATOM   7597  C  C   . GLY C  1 63  ? -4.906  63.518  57.481  1.00   31.65 ? 170 GLY C C   1 
ATOM   7598  O  O   . GLY C  1 63  ? -4.754  62.342  57.817  1.00   31.18 ? 170 GLY C O   1 
ATOM   7599  N  N   . ALA C  1 64  ? -4.166  64.104  56.547  1.00   28.69 ? 171 ALA C N   1 
ATOM   7600  C  CA  . ALA C  1 64  ? -3.108  63.387  55.854  1.00   26.94 ? 171 ALA C CA  1 
ATOM   7601  C  C   . ALA C  1 64  ? -1.772  63.918  56.336  1.00   26.16 ? 171 ALA C C   1 
ATOM   7602  O  O   . ALA C  1 64  ? -0.743  63.686  55.696  1.00   23.22 ? 171 ALA C O   1 
ATOM   7603  C  CB  . ALA C  1 64  ? -3.230  63.603  54.361  1.00   26.16 ? 171 ALA C CB  1 
ATOM   7604  N  N   . SER C  1 65  ? -1.795  64.629  57.463  1.00   23.53 ? 172 SER C N   1 
ATOM   7605  C  CA  . SER C  1 65  ? -0.578  65.235  57.995  1.00   24.46 ? 172 SER C CA  1 
ATOM   7606  C  C   . SER C  1 65  ? -0.312  64.946  59.466  1.00   24.52 ? 172 SER C C   1 
ATOM   7607  O  O   . SER C  1 65  ? -1.225  64.603  60.229  1.00   23.62 ? 172 SER C O   1 
ATOM   7608  C  CB  . SER C  1 65  ? -0.636  66.762  57.814  1.00   25.98 ? 172 SER C CB  1 
ATOM   7609  O  OG  . SER C  1 65  ? -0.987  67.132  56.490  1.00   23.93 ? 172 SER C OG  1 
ATOM   7610  N  N   . PHE C  1 66  ? 0.949   65.112  59.855  1.00   23.33 ? 173 PHE C N   1 
ATOM   7611  C  CA  . PHE C  1 66  ? 1.363   64.930  61.231  1.00   24.12 ? 173 PHE C CA  1 
ATOM   7612  C  C   . PHE C  1 66  ? 2.826   65.319  61.367  1.00   23.73 ? 173 PHE C C   1 
ATOM   7613  O  O   . PHE C  1 66  ? 3.553   65.330  60.374  1.00   24.21 ? 173 PHE C O   1 
ATOM   7614  C  CB  . PHE C  1 66  ? 1.172   63.475  61.660  1.00   28.32 ? 173 PHE C CB  1 
ATOM   7615  C  CG  . PHE C  1 66  ? 1.146   63.294  63.143  1.00   27.96 ? 173 PHE C CG  1 
ATOM   7616  C  CD1 . PHE C  1 66  ? -0.033  63.499  63.857  1.00   30.27 ? 173 PHE C CD1 1 
ATOM   7617  C  CD2 . PHE C  1 66  ? 2.309   62.989  63.837  1.00   29.04 ? 173 PHE C CD2 1 
ATOM   7618  C  CE1 . PHE C  1 66  ? -0.055  63.407  65.254  1.00   29.95 ? 173 PHE C CE1 1 
ATOM   7619  C  CE2 . PHE C  1 66  ? 2.302   62.895  65.231  1.00   33.59 ? 173 PHE C CE2 1 
ATOM   7620  C  CZ  . PHE C  1 66  ? 1.112   63.107  65.943  1.00   30.89 ? 173 PHE C CZ  1 
ATOM   7621  N  N   . ASP C  1 67  ? 3.252   65.662  62.584  1.00   22.41 ? 174 ASP C N   1 
ATOM   7622  C  CA  . ASP C  1 67  ? 4.650   66.022  62.829  1.00   23.10 ? 174 ASP C CA  1 
ATOM   7623  C  C   . ASP C  1 67  ? 5.216   64.949  63.751  1.00   25.74 ? 174 ASP C C   1 
ATOM   7624  O  O   . ASP C  1 67  ? 5.015   64.988  64.966  1.00   28.05 ? 174 ASP C O   1 
ATOM   7625  C  CB  . ASP C  1 67  ? 4.772   67.393  63.512  1.00   23.42 ? 174 ASP C CB  1 
ATOM   7626  C  CG  . ASP C  1 67  ? 6.228   67.804  63.726  1.00   26.33 ? 174 ASP C CG  1 
ATOM   7627  O  OD1 . ASP C  1 67  ? 7.107   66.914  63.684  1.00   27.34 ? 174 ASP C OD1 1 
ATOM   7628  O  OD2 . ASP C  1 67  ? 6.509   69.005  63.943  1.00   24.57 ? 174 ASP C OD2 1 
ATOM   7629  N  N   . VAL C  1 68  ? 5.917   63.987  63.169  1.00   24.23 ? 175 VAL C N   1 
ATOM   7630  C  CA  . VAL C  1 68  ? 6.479   62.899  63.942  1.00   24.94 ? 175 VAL C CA  1 
ATOM   7631  C  C   . VAL C  1 68  ? 7.747   63.312  64.658  1.00   26.32 ? 175 VAL C C   1 
ATOM   7632  O  O   . VAL C  1 68  ? 8.075   62.756  65.705  1.00   28.65 ? 175 VAL C O   1 
ATOM   7633  C  CB  . VAL C  1 68  ? 6.733   61.670  63.027  1.00   24.93 ? 175 VAL C CB  1 
ATOM   7634  C  CG1 . VAL C  1 68  ? 7.571   60.622  63.727  1.00   24.57 ? 175 VAL C CG1 1 
ATOM   7635  C  CG2 . VAL C  1 68  ? 5.407   61.076  62.652  1.00   21.01 ? 175 VAL C CG2 1 
ATOM   7636  N  N   . ASN C  1 69  ? 8.447   64.297  64.106  1.00   27.84 ? 176 ASN C N   1 
ATOM   7637  C  CA  . ASN C  1 69  ? 9.680   64.776  64.707  1.00   30.41 ? 176 ASN C CA  1 
ATOM   7638  C  C   . ASN C  1 69  ? 9.447   65.439  66.069  1.00   32.74 ? 176 ASN C C   1 
ATOM   7639  O  O   . ASN C  1 69  ? 10.209  65.204  67.008  1.00   34.95 ? 176 ASN C O   1 
ATOM   7640  C  CB  . ASN C  1 69  ? 10.377  65.756  63.762  1.00   30.93 ? 176 ASN C CB  1 
ATOM   7641  C  CG  . ASN C  1 69  ? 10.970  65.073  62.548  1.00   32.11 ? 176 ASN C CG  1 
ATOM   7642  O  OD1 . ASN C  1 69  ? 10.949  65.622  61.445  1.00   32.05 ? 176 ASN C OD1 1 
ATOM   7643  N  ND2 . ASN C  1 69  ? 11.521  63.877  62.745  1.00   29.87 ? 176 ASN C ND2 1 
ATOM   7644  N  N   . ASP C  1 70  ? 8.411   66.265  66.179  1.00   32.70 ? 177 ASP C N   1 
ATOM   7645  C  CA  . ASP C  1 70  ? 8.117   66.940  67.444  1.00   36.01 ? 177 ASP C CA  1 
ATOM   7646  C  C   . ASP C  1 70  ? 6.858   66.397  68.121  1.00   37.51 ? 177 ASP C C   1 
ATOM   7647  O  O   . ASP C  1 70  ? 6.395   66.930  69.128  1.00   38.50 ? 177 ASP C O   1 
ATOM   7648  C  CB  . ASP C  1 70  ? 7.974   68.458  67.239  1.00   36.10 ? 177 ASP C CB  1 
ATOM   7649  C  CG  . ASP C  1 70  ? 9.286   69.121  66.814  1.00   40.08 ? 177 ASP C CG  1 
ATOM   7650  O  OD1 . ASP C  1 70  ? 10.354  68.492  66.949  1.00   40.98 ? 177 ASP C OD1 1 
ATOM   7651  O  OD2 . ASP C  1 70  ? 9.253   70.279  66.348  1.00   41.61 ? 177 ASP C OD2 1 
ATOM   7652  N  N   . GLN C  1 71  ? 6.295   65.340  67.553  1.00   37.13 ? 178 GLN C N   1 
ATOM   7653  C  CA  . GLN C  1 71  ? 5.106   64.737  68.120  1.00   35.74 ? 178 GLN C CA  1 
ATOM   7654  C  C   . GLN C  1 71  ? 3.921   65.666  68.312  1.00   36.01 ? 178 GLN C C   1 
ATOM   7655  O  O   . GLN C  1 71  ? 3.467   65.877  69.428  1.00   39.67 ? 178 GLN C O   1 
ATOM   7656  C  CB  . GLN C  1 71  ? 5.430   64.068  69.462  1.00   37.55 ? 178 GLN C CB  1 
ATOM   7657  C  CG  . GLN C  1 71  ? 5.826   62.606  69.345  1.00   36.58 ? 178 GLN C CG  1 
ATOM   7658  C  CD  . GLN C  1 71  ? 7.295   62.409  69.050  1.00   37.14 ? 178 GLN C CD  1 
ATOM   7659  O  OE1 . GLN C  1 71  ? 7.702   61.353  68.563  0.0000 36.78 ? 178 GLN C OE1 1 
ATOM   7660  N  NE2 . GLN C  1 71  ? 8.106   63.413  69.362  0.0000 36.78 ? 178 GLN C NE2 1 
ATOM   7661  N  N   . ASP C  1 72  ? 3.427   66.232  67.224  1.00   36.74 ? 179 ASP C N   1 
ATOM   7662  C  CA  . ASP C  1 72  ? 2.243   67.074  67.267  1.00   34.20 ? 179 ASP C CA  1 
ATOM   7663  C  C   . ASP C  1 72  ? 1.619   66.927  65.886  1.00   36.78 ? 179 ASP C C   1 
ATOM   7664  O  O   . ASP C  1 72  ? 2.235   66.381  64.967  1.00   37.58 ? 179 ASP C O   1 
ATOM   7665  C  CB  . ASP C  1 72  ? 2.586   68.537  67.597  1.00   33.06 ? 179 ASP C CB  1 
ATOM   7666  C  CG  . ASP C  1 72  ? 3.452   69.193  66.551  1.00   32.65 ? 179 ASP C CG  1 
ATOM   7667  O  OD1 . ASP C  1 72  ? 2.924   69.558  65.477  1.00   32.92 ? 179 ASP C OD1 1 
ATOM   7668  O  OD2 . ASP C  1 72  ? 4.662   69.345  66.804  1.00   32.28 ? 179 ASP C OD2 1 
ATOM   7669  N  N   . PRO C  1 73  ? 0.383   67.386  65.721  1.00   36.10 ? 180 PRO C N   1 
ATOM   7670  C  CA  . PRO C  1 73  ? -0.258  67.253  64.413  1.00   35.73 ? 180 PRO C CA  1 
ATOM   7671  C  C   . PRO C  1 73  ? 0.036   68.324  63.365  1.00   34.15 ? 180 PRO C C   1 
ATOM   7672  O  O   . PRO C  1 73  ? -0.465  68.235  62.248  1.00   34.85 ? 180 PRO C O   1 
ATOM   7673  C  CB  . PRO C  1 73  ? -1.741  67.185  64.773  1.00   37.89 ? 180 PRO C CB  1 
ATOM   7674  C  CG  . PRO C  1 73  ? -1.823  68.101  65.972  1.00   36.35 ? 180 PRO C CG  1 
ATOM   7675  C  CD  . PRO C  1 73  ? -0.584  67.768  66.768  1.00   36.89 ? 180 PRO C CD  1 
ATOM   7676  N  N   . ASP C  1 74  ? 0.857   69.307  63.713  1.00   33.28 ? 181 ASP C N   1 
ATOM   7677  C  CA  . ASP C  1 74  ? 1.191   70.412  62.807  1.00   34.13 ? 181 ASP C CA  1 
ATOM   7678  C  C   . ASP C  1 74  ? 2.534   70.198  62.085  1.00   32.12 ? 181 ASP C C   1 
ATOM   7679  O  O   . ASP C  1 74  ? 3.597   70.365  62.673  1.00   31.51 ? 181 ASP C O   1 
ATOM   7680  C  CB  . ASP C  1 74  ? 1.229   71.712  63.617  1.00   35.91 ? 181 ASP C CB  1 
ATOM   7681  C  CG  . ASP C  1 74  ? 1.479   72.934  62.767  1.00   38.50 ? 181 ASP C CG  1 
ATOM   7682  O  OD1 . ASP C  1 74  ? 1.875   72.789  61.595  1.00   39.48 ? 181 ASP C OD1 1 
ATOM   7683  O  OD2 . ASP C  1 74  ? 1.285   74.052  63.289  1.00   43.98 ? 181 ASP C OD2 1 
ATOM   7684  N  N   . PRO C  1 75  ? 2.489   69.864  60.785  1.00   31.01 ? 182 PRO C N   1 
ATOM   7685  C  CA  . PRO C  1 75  ? 3.667   69.610  59.944  1.00   30.72 ? 182 PRO C CA  1 
ATOM   7686  C  C   . PRO C  1 75  ? 4.427   70.819  59.432  1.00   28.30 ? 182 PRO C C   1 
ATOM   7687  O  O   . PRO C  1 75  ? 5.318   70.672  58.597  1.00   27.22 ? 182 PRO C O   1 
ATOM   7688  C  CB  . PRO C  1 75  ? 3.086   68.790  58.799  1.00   27.55 ? 182 PRO C CB  1 
ATOM   7689  C  CG  . PRO C  1 75  ? 1.760   69.446  58.604  1.00   27.83 ? 182 PRO C CG  1 
ATOM   7690  C  CD  . PRO C  1 75  ? 1.248   69.629  60.023  1.00   27.82 ? 182 PRO C CD  1 
ATOM   7691  N  N   . GLN C  1 76  ? 4.082   72.006  59.919  1.00   29.21 ? 183 GLN C N   1 
ATOM   7692  C  CA  . GLN C  1 76  ? 4.751   73.229  59.474  1.00   27.99 ? 183 GLN C CA  1 
ATOM   7693  C  C   . GLN C  1 76  ? 6.267   73.059  59.537  1.00   25.52 ? 183 GLN C C   1 
ATOM   7694  O  O   . GLN C  1 76  ? 6.799   72.545  60.516  1.00   25.50 ? 183 GLN C O   1 
ATOM   7695  C  CB  . GLN C  1 76  ? 4.329   74.408  60.354  1.00   26.58 ? 183 GLN C CB  1 
ATOM   7696  C  CG  . GLN C  1 76  ? 4.659   75.776  59.782  1.00   27.59 ? 183 GLN C CG  1 
ATOM   7697  C  CD  . GLN C  1 76  ? 3.795   76.134  58.579  1.00   29.88 ? 183 GLN C CD  1 
ATOM   7698  O  OE1 . GLN C  1 76  ? 2.694   75.602  58.410  1.00   26.42 ? 183 GLN C OE1 1 
ATOM   7699  N  NE2 . GLN C  1 76  ? 4.283   77.055  57.751  1.00   28.91 ? 183 GLN C NE2 1 
ATOM   7700  N  N   . PRO C  1 77  ? 6.981   73.485  58.489  1.00   23.93 ? 184 PRO C N   1 
ATOM   7701  C  CA  . PRO C  1 77  ? 8.447   73.362  58.470  1.00   24.63 ? 184 PRO C CA  1 
ATOM   7702  C  C   . PRO C  1 77  ? 9.104   74.236  59.545  1.00   27.00 ? 184 PRO C C   1 
ATOM   7703  O  O   . PRO C  1 77  ? 8.503   75.185  60.043  1.00   27.02 ? 184 PRO C O   1 
ATOM   7704  C  CB  . PRO C  1 77  ? 8.828   73.841  57.060  1.00   21.72 ? 184 PRO C CB  1 
ATOM   7705  C  CG  . PRO C  1 77  ? 7.578   73.673  56.255  1.00   21.90 ? 184 PRO C CG  1 
ATOM   7706  C  CD  . PRO C  1 77  ? 6.472   74.028  57.219  1.00   23.75 ? 184 PRO C CD  1 
ATOM   7707  N  N   . ARG C  1 78  ? 10.339  73.904  59.898  1.00   28.40 ? 185 ARG C N   1 
ATOM   7708  C  CA  . ARG C  1 78  ? 11.098  74.678  60.873  1.00   28.87 ? 185 ARG C CA  1 
ATOM   7709  C  C   . ARG C  1 78  ? 11.940  75.639  60.028  1.00   29.96 ? 185 ARG C C   1 
ATOM   7710  O  O   . ARG C  1 78  ? 12.774  75.210  59.221  1.00   28.56 ? 185 ARG C O   1 
ATOM   7711  C  CB  . ARG C  1 78  ? 12.003  73.757  61.704  1.00   27.89 ? 185 ARG C CB  1 
ATOM   7712  C  CG  . ARG C  1 78  ? 12.940  74.467  62.667  1.00   27.44 ? 185 ARG C CG  1 
ATOM   7713  C  CD  . ARG C  1 78  ? 13.745  73.453  63.492  1.00   27.71 ? 185 ARG C CD  1 
ATOM   7714  N  NE  . ARG C  1 78  ? 14.548  72.559  62.654  1.00   26.84 ? 185 ARG C NE  1 
ATOM   7715  C  CZ  . ARG C  1 78  ? 15.793  72.806  62.245  1.00   26.75 ? 185 ARG C CZ  1 
ATOM   7716  N  NH1 . ARG C  1 78  ? 16.421  71.931  61.477  1.00   23.31 ? 185 ARG C NH1 1 
ATOM   7717  N  NH2 . ARG C  1 78  ? 16.426  73.914  62.613  1.00   25.23 ? 185 ARG C NH2 1 
ATOM   7718  N  N   . TYR C  1 79  ? 11.721  76.937  60.210  1.00   29.27 ? 186 TYR C N   1 
ATOM   7719  C  CA  . TYR C  1 79  ? 12.439  77.928  59.423  1.00   28.24 ? 186 TYR C CA  1 
ATOM   7720  C  C   . TYR C  1 79  ? 13.850  78.227  59.888  1.00   28.23 ? 186 TYR C C   1 
ATOM   7721  O  O   . TYR C  1 79  ? 14.107  78.391  61.079  1.00   29.94 ? 186 TYR C O   1 
ATOM   7722  C  CB  . TYR C  1 79  ? 11.617  79.214  59.353  1.00   27.94 ? 186 TYR C CB  1 
ATOM   7723  C  CG  . TYR C  1 79  ? 10.268  79.005  58.693  1.00   27.36 ? 186 TYR C CG  1 
ATOM   7724  C  CD1 . TYR C  1 79  ? 9.161   78.567  59.424  1.00   26.43 ? 186 TYR C CD1 1 
ATOM   7725  C  CD2 . TYR C  1 79  ? 10.111  79.197  57.317  1.00   28.35 ? 186 TYR C CD2 1 
ATOM   7726  C  CE1 . TYR C  1 79  ? 7.931   78.329  58.792  1.00   24.61 ? 186 TYR C CE1 1 
ATOM   7727  C  CE2 . TYR C  1 79  ? 8.896   78.955  56.683  1.00   22.06 ? 186 TYR C CE2 1 
ATOM   7728  C  CZ  . TYR C  1 79  ? 7.817   78.522  57.418  1.00   23.67 ? 186 TYR C CZ  1 
ATOM   7729  O  OH  . TYR C  1 79  ? 6.634   78.250  56.764  1.00   24.12 ? 186 TYR C OH  1 
ATOM   7730  N  N   . THR C  1 80  ? 14.769  78.278  58.933  1.00   28.72 ? 187 THR C N   1 
ATOM   7731  C  CA  . THR C  1 80  ? 16.164  78.572  59.219  1.00   32.22 ? 187 THR C CA  1 
ATOM   7732  C  C   . THR C  1 80  ? 16.701  79.469  58.111  1.00   35.60 ? 187 THR C C   1 
ATOM   7733  O  O   . THR C  1 80  ? 16.147  79.502  57.014  1.00   37.22 ? 187 THR C O   1 
ATOM   7734  C  CB  . THR C  1 80  ? 17.001  77.280  59.308  1.00   32.50 ? 187 THR C CB  1 
ATOM   7735  O  OG1 . THR C  1 80  ? 17.044  76.635  58.030  1.00   30.18 ? 187 THR C OG1 1 
ATOM   7736  C  CG2 . THR C  1 80  ? 16.374  76.328  60.333  1.00   28.06 ? 187 THR C CG2 1 
ATOM   7737  N  N   . GLN C  1 81  ? 17.772  80.199  58.399  1.00   39.27 ? 188 GLN C N   1 
ATOM   7738  C  CA  . GLN C  1 81  ? 18.359  81.112  57.424  1.00   42.20 ? 188 GLN C CA  1 
ATOM   7739  C  C   . GLN C  1 81  ? 18.738  80.396  56.131  1.00   43.69 ? 188 GLN C C   1 
ATOM   7740  O  O   . GLN C  1 81  ? 18.606  80.950  55.045  1.00   45.62 ? 188 GLN C O   1 
ATOM   7741  C  CB  . GLN C  1 81  ? 19.598  81.801  58.013  1.00   44.37 ? 188 GLN C CB  1 
ATOM   7742  C  CG  . GLN C  1 81  ? 19.660  83.306  57.759  1.00   44.90 ? 188 GLN C CG  1 
ATOM   7743  C  CD  . GLN C  1 81  ? 20.875  83.956  58.391  1.00   44.30 ? 188 GLN C CD  1 
ATOM   7744  O  OE1 . GLN C  1 81  ? 21.279  83.599  59.498  0.0000 44.48 ? 188 GLN C OE1 1 
ATOM   7745  N  NE2 . GLN C  1 81  ? 21.453  84.929  57.698  0.0000 44.48 ? 188 GLN C NE2 1 
ATOM   7746  N  N   . MET C  1 82  ? 19.210  79.164  56.243  1.00   44.90 ? 189 MET C N   1 
ATOM   7747  C  CA  . MET C  1 82  ? 19.599  78.404  55.062  1.00   45.27 ? 189 MET C CA  1 
ATOM   7748  C  C   . MET C  1 82  ? 18.411  77.741  54.363  1.00   42.59 ? 189 MET C C   1 
ATOM   7749  O  O   . MET C  1 82  ? 18.579  77.124  53.317  1.00   40.51 ? 189 MET C O   1 
ATOM   7750  C  CB  . MET C  1 82  ? 20.626  77.336  55.446  1.00   49.84 ? 189 MET C CB  1 
ATOM   7751  C  CG  . MET C  1 82  ? 22.003  77.897  55.759  1.00   58.76 ? 189 MET C CG  1 
ATOM   7752  S  SD  . MET C  1 82  ? 23.025  76.746  56.716  1.00   71.60 ? 189 MET C SD  1 
ATOM   7753  C  CE  . MET C  1 82  ? 23.612  75.597  55.426  1.00   67.58 ? 189 MET C CE  1 
ATOM   7754  N  N   . ASN C  1 83  ? 17.217  77.870  54.937  1.00   39.98 ? 190 ASN C N   1 
ATOM   7755  C  CA  . ASN C  1 83  ? 16.018  77.250  54.365  1.00   39.92 ? 190 ASN C CA  1 
ATOM   7756  C  C   . ASN C  1 83  ? 16.179  75.727  54.165  1.00   39.31 ? 190 ASN C C   1 
ATOM   7757  O  O   . ASN C  1 83  ? 15.794  75.180  53.128  1.00   39.26 ? 190 ASN C O   1 
ATOM   7758  C  CB  . ASN C  1 83  ? 15.683  77.891  53.020  1.00   38.52 ? 190 ASN C CB  1 
ATOM   7759  C  CG  . ASN C  1 83  ? 15.185  79.313  53.151  1.00   38.91 ? 190 ASN C CG  1 
ATOM   7760  O  OD1 . ASN C  1 83  ? 14.341  79.623  53.995  1.00   37.22 ? 190 ASN C OD1 1 
ATOM   7761  N  ND2 . ASN C  1 83  ? 15.691  80.184  52.292  1.00   35.78 ? 190 ASN C ND2 1 
ATOM   7762  N  N   . ASP C  1 84  ? 16.738  75.052  55.163  1.00   37.09 ? 191 ASP C N   1 
ATOM   7763  C  CA  . ASP C  1 84  ? 16.968  73.611  55.103  1.00   36.72 ? 191 ASP C CA  1 
ATOM   7764  C  C   . ASP C  1 84  ? 15.693  72.777  54.907  1.00   37.03 ? 191 ASP C C   1 
ATOM   7765  O  O   . ASP C  1 84  ? 15.709  71.742  54.229  1.00   37.06 ? 191 ASP C O   1 
ATOM   7766  C  CB  . ASP C  1 84  ? 17.651  73.128  56.390  1.00   39.02 ? 191 ASP C CB  1 
ATOM   7767  C  CG  . ASP C  1 84  ? 18.825  73.993  56.797  1.00   41.63 ? 191 ASP C CG  1 
ATOM   7768  O  OD1 . ASP C  1 84  ? 18.602  75.174  57.133  1.00   42.52 ? 191 ASP C OD1 1 
ATOM   7769  O  OD2 . ASP C  1 84  ? 19.969  73.493  56.788  1.00   44.56 ? 191 ASP C OD2 1 
ATOM   7770  N  N   . ASN C  1 85  ? 14.590  73.223  55.498  1.00   32.78 ? 192 ASN C N   1 
ATOM   7771  C  CA  . ASN C  1 85  ? 13.355  72.469  55.422  1.00   30.22 ? 192 ASN C CA  1 
ATOM   7772  C  C   . ASN C  1 85  ? 12.348  72.901  54.350  1.00   30.86 ? 192 ASN C C   1 
ATOM   7773  O  O   . ASN C  1 85  ? 11.137  72.932  54.589  1.00   31.14 ? 192 ASN C O   1 
ATOM   7774  C  CB  . ASN C  1 85  ? 12.709  72.461  56.810  1.00   31.63 ? 192 ASN C CB  1 
ATOM   7775  C  CG  . ASN C  1 85  ? 13.650  71.911  57.888  1.00   35.94 ? 192 ASN C CG  1 
ATOM   7776  O  OD1 . ASN C  1 85  ? 14.169  70.791  57.766  1.00   33.35 ? 192 ASN C OD1 1 
ATOM   7777  N  ND2 . ASN C  1 85  ? 13.877  72.699  58.945  1.00   34.64 ? 192 ASN C ND2 1 
ATOM   7778  N  N   . ARG C  1 86  ? 12.850  73.198  53.157  1.00   29.80 ? 193 ARG C N   1 
ATOM   7779  C  CA  . ARG C  1 86  ? 11.998  73.613  52.035  1.00   29.80 ? 193 ARG C CA  1 
ATOM   7780  C  C   . ARG C  1 86  ? 11.657  72.429  51.121  1.00   26.36 ? 193 ARG C C   1 
ATOM   7781  O  O   . ARG C  1 86  ? 10.754  72.512  50.286  1.00   27.94 ? 193 ARG C O   1 
ATOM   7782  C  CB  . ARG C  1 86  ? 12.734  74.650  51.200  1.00   27.33 ? 193 ARG C CB  1 
ATOM   7783  C  CG  . ARG C  1 86  ? 13.951  74.048  50.554  1.00   28.20 ? 193 ARG C CG  1 
ATOM   7784  C  CD  . ARG C  1 86  ? 14.723  75.049  49.755  1.00   28.60 ? 193 ARG C CD  1 
ATOM   7785  N  NE  . ARG C  1 86  ? 15.762  74.369  49.001  1.00   32.27 ? 193 ARG C NE  1 
ATOM   7786  C  CZ  . ARG C  1 86  ? 16.675  74.999  48.277  1.00   37.83 ? 193 ARG C CZ  1 
ATOM   7787  N  NH1 . ARG C  1 86  ? 16.666  76.333  48.230  1.00   38.80 ? 193 ARG C NH1 1 
ATOM   7788  N  NH2 . ARG C  1 86  ? 17.572  74.301  47.580  1.00   36.27 ? 193 ARG C NH2 1 
ATOM   7789  N  N   . HIS C  1 87  ? 12.393  71.336  51.294  1.00   24.91 ? 194 HIS C N   1 
ATOM   7790  C  CA  . HIS C  1 87  ? 12.257  70.135  50.476  1.00   21.76 ? 194 HIS C CA  1 
ATOM   7791  C  C   . HIS C  1 87  ? 10.854  69.542  50.383  1.00   21.88 ? 194 HIS C C   1 
ATOM   7792  O  O   . HIS C  1 87  ? 10.348  69.323  49.289  1.00   23.29 ? 194 HIS C O   1 
ATOM   7793  C  CB  . HIS C  1 87  ? 13.261  69.099  50.984  1.00   22.19 ? 194 HIS C CB  1 
ATOM   7794  C  CG  . HIS C  1 87  ? 13.423  67.902  50.099  1.00   19.66 ? 194 HIS C CG  1 
ATOM   7795  N  ND1 . HIS C  1 87  ? 12.874  66.672  50.404  1.00   18.31 ? 194 HIS C ND1 1 
ATOM   7796  C  CD2 . HIS C  1 87  ? 14.154  67.719  48.975  1.00   16.42 ? 194 HIS C CD2 1 
ATOM   7797  C  CE1 . HIS C  1 87  ? 13.268  65.785  49.508  1.00   19.13 ? 194 HIS C CE1 1 
ATOM   7798  N  NE2 . HIS C  1 87  ? 14.045  66.393  48.629  1.00   13.78 ? 194 HIS C NE2 1 
ATOM   7799  N  N   . GLY C  1 88  ? 10.218  69.284  51.517  1.00   20.95 ? 195 GLY C N   1 
ATOM   7800  C  CA  . GLY C  1 88  ? 8.891   68.708  51.479  1.00   20.16 ? 195 GLY C CA  1 
ATOM   7801  C  C   . GLY C  1 88  ? 7.870   69.594  50.784  1.00   23.02 ? 195 GLY C C   1 
ATOM   7802  O  O   . GLY C  1 88  ? 6.994   69.112  50.052  1.00   20.60 ? 195 GLY C O   1 
ATOM   7803  N  N   . THR C  1 89  ? 7.969   70.897  51.020  1.00   22.16 ? 196 THR C N   1 
ATOM   7804  C  CA  . THR C  1 89  ? 7.048   71.843  50.409  1.00   21.08 ? 196 THR C CA  1 
ATOM   7805  C  C   . THR C  1 89  ? 7.220   71.827  48.884  1.00   19.72 ? 196 THR C C   1 
ATOM   7806  O  O   . THR C  1 89  ? 6.241   71.915  48.137  1.00   17.87 ? 196 THR C O   1 
ATOM   7807  C  CB  . THR C  1 89  ? 7.286   73.263  50.979  1.00   23.46 ? 196 THR C CB  1 
ATOM   7808  O  OG1 . THR C  1 89  ? 6.979   73.249  52.381  1.00   21.99 ? 196 THR C OG1 1 
ATOM   7809  C  CG2 . THR C  1 89  ? 6.406   74.293  50.277  1.00   22.26 ? 196 THR C CG2 1 
ATOM   7810  N  N   . ARG C  1 90  ? 8.459   71.714  48.417  1.00   14.07 ? 197 ARG C N   1 
ATOM   7811  C  CA  . ARG C  1 90  ? 8.684   71.661  46.980  1.00   16.59 ? 197 ARG C CA  1 
ATOM   7812  C  C   . ARG C  1 90  ? 8.015   70.411  46.398  1.00   19.16 ? 197 ARG C C   1 
ATOM   7813  O  O   . ARG C  1 90  ? 7.336   70.487  45.364  1.00   17.55 ? 197 ARG C O   1 
ATOM   7814  C  CB  . ARG C  1 90  ? 10.190  71.666  46.670  1.00   16.46 ? 197 ARG C CB  1 
ATOM   7815  C  CG  . ARG C  1 90  ? 10.844  73.015  46.945  1.00   15.99 ? 197 ARG C CG  1 
ATOM   7816  C  CD  . ARG C  1 90  ? 12.311  73.066  46.546  1.00   18.52 ? 197 ARG C CD  1 
ATOM   7817  N  NE  . ARG C  1 90  ? 12.805  74.439  46.639  1.00   21.07 ? 197 ARG C NE  1 
ATOM   7818  C  CZ  . ARG C  1 90  ? 13.900  74.890  46.038  1.00   24.32 ? 197 ARG C CZ  1 
ATOM   7819  N  NH1 . ARG C  1 90  ? 14.252  76.169  46.175  1.00   23.29 ? 197 ARG C NH1 1 
ATOM   7820  N  NH2 . ARG C  1 90  ? 14.641  74.070  45.298  1.00   19.99 ? 197 ARG C NH2 1 
ATOM   7821  N  N   . CYS C  1 91  ? 8.195   69.271  47.069  1.00   16.57 ? 198 CYS C N   1 
ATOM   7822  C  CA  . CYS C  1 91  ? 7.598   68.020  46.615  1.00   18.86 ? 198 CYS C CA  1 
ATOM   7823  C  C   . CYS C  1 91  ? 6.071   68.072  46.644  1.00   18.98 ? 198 CYS C C   1 
ATOM   7824  O  O   . CYS C  1 91  ? 5.405   67.576  45.737  1.00   21.70 ? 198 CYS C O   1 
ATOM   7825  C  CB  . CYS C  1 91  ? 8.110   66.839  47.463  1.00   17.16 ? 198 CYS C CB  1 
ATOM   7826  S  SG  . CYS C  1 91  ? 9.873   66.435  47.170  1.00   19.50 ? 198 CYS C SG  1 
ATOM   7827  N  N   . ALA C  1 92  ? 5.512   68.675  47.683  1.00   19.73 ? 199 ALA C N   1 
ATOM   7828  C  CA  . ALA C  1 92  ? 4.063   68.782  47.786  1.00   19.67 ? 199 ALA C CA  1 
ATOM   7829  C  C   . ALA C  1 92  ? 3.445   69.533  46.590  1.00   21.27 ? 199 ALA C C   1 
ATOM   7830  O  O   . ALA C  1 92  ? 2.407   69.121  46.046  1.00   18.96 ? 199 ALA C O   1 
ATOM   7831  C  CB  . ALA C  1 92  ? 3.689   69.487  49.085  1.00   19.04 ? 199 ALA C CB  1 
ATOM   7832  N  N   . GLY C  1 93  ? 4.076   70.635  46.194  1.00   17.56 ? 200 GLY C N   1 
ATOM   7833  C  CA  . GLY C  1 93  ? 3.547   71.419  45.093  1.00   18.82 ? 200 GLY C CA  1 
ATOM   7834  C  C   . GLY C  1 93  ? 3.495   70.666  43.776  1.00   21.61 ? 200 GLY C C   1 
ATOM   7835  O  O   . GLY C  1 93  ? 2.600   70.880  42.958  1.00   18.24 ? 200 GLY C O   1 
ATOM   7836  N  N   . GLU C  1 94  ? 4.451   69.770  43.564  1.00   20.88 ? 201 GLU C N   1 
ATOM   7837  C  CA  . GLU C  1 94  ? 4.476   69.014  42.321  1.00   20.18 ? 201 GLU C CA  1 
ATOM   7838  C  C   . GLU C  1 94  ? 3.236   68.172  42.216  1.00   19.64 ? 201 GLU C C   1 
ATOM   7839  O  O   . GLU C  1 94  ? 2.708   67.934  41.130  1.00   19.58 ? 201 GLU C O   1 
ATOM   7840  C  CB  . GLU C  1 94  ? 5.663   68.074  42.285  1.00   19.81 ? 201 GLU C CB  1 
ATOM   7841  C  CG  . GLU C  1 94  ? 7.009   68.710  42.379  1.00   17.49 ? 201 GLU C CG  1 
ATOM   7842  C  CD  . GLU C  1 94  ? 8.086   67.661  42.229  1.00   21.51 ? 201 GLU C CD  1 
ATOM   7843  O  OE1 . GLU C  1 94  ? 8.751   67.328  43.234  1.00   17.85 ? 201 GLU C OE1 1 
ATOM   7844  O  OE2 . GLU C  1 94  ? 8.247   67.150  41.097  1.00   19.63 ? 201 GLU C OE2 1 
ATOM   7845  N  N   . VAL C  1 95  ? 2.780   67.701  43.362  1.00   19.93 ? 202 VAL C N   1 
ATOM   7846  C  CA  . VAL C  1 95  ? 1.614   66.842  43.390  1.00   17.51 ? 202 VAL C CA  1 
ATOM   7847  C  C   . VAL C  1 95  ? 0.295   67.586  43.307  1.00   19.01 ? 202 VAL C C   1 
ATOM   7848  O  O   . VAL C  1 95  ? -0.527  67.316  42.424  1.00   17.90 ? 202 VAL C O   1 
ATOM   7849  C  CB  . VAL C  1 95  ? 1.591   65.993  44.673  1.00   15.73 ? 202 VAL C CB  1 
ATOM   7850  C  CG1 . VAL C  1 95  ? 0.391   65.056  44.656  1.00   16.21 ? 202 VAL C CG1 1 
ATOM   7851  C  CG2 . VAL C  1 95  ? 2.886   65.208  44.795  1.00   14.88 ? 202 VAL C CG2 1 
ATOM   7852  N  N   . ALA C  1 96  ? 0.100   68.541  44.208  1.00   17.29 ? 203 ALA C N   1 
ATOM   7853  C  CA  . ALA C  1 96  ? -1.175  69.224  44.249  1.00   20.87 ? 203 ALA C CA  1 
ATOM   7854  C  C   . ALA C  1 96  ? -1.208  70.736  44.403  1.00   21.60 ? 203 ALA C C   1 
ATOM   7855  O  O   . ALA C  1 96  ? -2.066  71.253  45.120  1.00   20.54 ? 203 ALA C O   1 
ATOM   7856  C  CB  . ALA C  1 96  ? -2.042  68.584  45.349  1.00   20.25 ? 203 ALA C CB  1 
ATOM   7857  N  N   . ALA C  1 97  ? -0.295  71.452  43.754  1.00   20.82 ? 204 ALA C N   1 
ATOM   7858  C  CA  . ALA C  1 97  ? -0.343  72.910  43.837  1.00   21.10 ? 204 ALA C CA  1 
ATOM   7859  C  C   . ALA C  1 97  ? -1.700  73.321  43.225  1.00   20.22 ? 204 ALA C C   1 
ATOM   7860  O  O   . ALA C  1 97  ? -2.157  72.723  42.241  1.00   16.12 ? 204 ALA C O   1 
ATOM   7861  C  CB  . ALA C  1 97  ? 0.818   73.527  43.052  1.00   17.15 ? 204 ALA C CB  1 
ATOM   7862  N  N   . VAL C  1 98  ? -2.349  74.318  43.818  1.00   21.55 ? 205 VAL C N   1 
ATOM   7863  C  CA  . VAL C  1 98  ? -3.650  74.774  43.332  1.00   20.93 ? 205 VAL C CA  1 
ATOM   7864  C  C   . VAL C  1 98  ? -3.594  75.340  41.915  1.00   20.91 ? 205 VAL C C   1 
ATOM   7865  O  O   . VAL C  1 98  ? -2.635  76.025  41.533  1.00   19.63 ? 205 VAL C O   1 
ATOM   7866  C  CB  . VAL C  1 98  ? -4.251  75.829  44.291  1.00   25.16 ? 205 VAL C CB  1 
ATOM   7867  C  CG1 . VAL C  1 98  ? -5.547  76.401  43.705  1.00   19.35 ? 205 VAL C CG1 1 
ATOM   7868  C  CG2 . VAL C  1 98  ? -4.534  75.178  45.655  1.00   22.27 ? 205 VAL C CG2 1 
ATOM   7869  N  N   . ALA C  1 99  ? -4.626  75.046  41.130  1.00   22.48 ? 206 ALA C N   1 
ATOM   7870  C  CA  . ALA C  1 99  ? -4.690  75.520  39.744  1.00   24.25 ? 206 ALA C CA  1 
ATOM   7871  C  C   . ALA C  1 99  ? -5.573  76.751  39.573  1.00   24.97 ? 206 ALA C C   1 
ATOM   7872  O  O   . ALA C  1 99  ? -6.476  76.994  40.371  1.00   24.95 ? 206 ALA C O   1 
ATOM   7873  C  CB  . ALA C  1 99  ? -5.200  74.411  38.836  1.00   21.22 ? 206 ALA C CB  1 
ATOM   7874  N  N   . ASN C  1 100 ? -5.301  77.512  38.514  1.00   24.48 ? 207 ASN C N   1 
ATOM   7875  C  CA  . ASN C  1 100 ? -6.065  78.713  38.175  1.00   23.66 ? 207 ASN C CA  1 
ATOM   7876  C  C   . ASN C  1 100 ? -6.282  79.681  39.329  1.00   22.95 ? 207 ASN C C   1 
ATOM   7877  O  O   . ASN C  1 100 ? -7.393  80.143  39.549  1.00   23.93 ? 207 ASN C O   1 
ATOM   7878  C  CB  . ASN C  1 100 ? -7.418  78.300  37.599  1.00   21.42 ? 207 ASN C CB  1 
ATOM   7879  C  CG  . ASN C  1 100 ? -7.275  77.433  36.356  1.00   24.83 ? 207 ASN C CG  1 
ATOM   7880  O  OD1 . ASN C  1 100 ? -6.574  77.800  35.402  1.00   27.84 ? 207 ASN C OD1 1 
ATOM   7881  N  ND2 . ASN C  1 100 ? -7.931  76.276  36.359  1.00   21.91 ? 207 ASN C ND2 1 
ATOM   7882  N  N   . ASN C  1 101 ? -5.222  80.001  40.059  1.00   24.83 ? 208 ASN C N   1 
ATOM   7883  C  CA  . ASN C  1 101 ? -5.352  80.906  41.195  1.00   24.21 ? 208 ASN C CA  1 
ATOM   7884  C  C   . ASN C  1 101 ? -4.324  82.018  41.111  1.00   23.12 ? 208 ASN C C   1 
ATOM   7885  O  O   . ASN C  1 101 ? -4.035  82.690  42.096  1.00   25.25 ? 208 ASN C O   1 
ATOM   7886  C  CB  . ASN C  1 101 ? -5.225  80.120  42.516  1.00   22.11 ? 208 ASN C CB  1 
ATOM   7887  C  CG  . ASN C  1 101 ? -3.823  79.577  42.759  1.00   23.82 ? 208 ASN C CG  1 
ATOM   7888  O  OD1 . ASN C  1 101 ? -3.027  79.398  41.836  1.00   21.30 ? 208 ASN C OD1 1 
ATOM   7889  N  ND2 . ASN C  1 101 ? -3.523  79.305  44.023  1.00   27.65 ? 208 ASN C ND2 1 
ATOM   7890  N  N   . GLY C  1 102 ? -3.781  82.202  39.913  1.00   23.34 ? 209 GLY C N   1 
ATOM   7891  C  CA  . GLY C  1 102 ? -2.799  83.246  39.682  1.00   21.08 ? 209 GLY C CA  1 
ATOM   7892  C  C   . GLY C  1 102 ? -1.521  83.108  40.475  1.00   21.10 ? 209 GLY C C   1 
ATOM   7893  O  O   . GLY C  1 102 ? -0.760  84.070  40.589  1.00   19.73 ? 209 GLY C O   1 
ATOM   7894  N  N   . VAL C  1 103 ? -1.272  81.919  41.017  1.00   20.70 ? 210 VAL C N   1 
ATOM   7895  C  CA  . VAL C  1 103 ? -0.065  81.699  41.801  1.00   20.76 ? 210 VAL C CA  1 
ATOM   7896  C  C   . VAL C  1 103 ? 0.790   80.552  41.272  1.00   21.37 ? 210 VAL C C   1 
ATOM   7897  O  O   . VAL C  1 103 ? 0.287   79.457  40.993  1.00   17.23 ? 210 VAL C O   1 
ATOM   7898  C  CB  . VAL C  1 103 ? -0.409  81.387  43.269  1.00   23.33 ? 210 VAL C CB  1 
ATOM   7899  C  CG1 . VAL C  1 103 ? 0.870   81.097  44.057  1.00   21.22 ? 210 VAL C CG1 1 
ATOM   7900  C  CG2 . VAL C  1 103 ? -1.182  82.542  43.869  1.00   22.06 ? 210 VAL C CG2 1 
ATOM   7901  N  N   . CYS C  1 104 ? 2.078   80.835  41.120  1.00   20.49 ? 211 CYS C N   1 
ATOM   7902  C  CA  . CYS C  1 104 ? 3.059   79.852  40.686  1.00   25.49 ? 211 CYS C CA  1 
ATOM   7903  C  C   . CYS C  1 104 ? 2.533   78.981  39.529  1.00   25.69 ? 211 CYS C C   1 
ATOM   7904  O  O   . CYS C  1 104 ? 2.055   79.508  38.517  1.00   27.21 ? 211 CYS C O   1 
ATOM   7905  C  CB  . CYS C  1 104 ? 3.419   79.017  41.922  1.00   27.59 ? 211 CYS C CB  1 
ATOM   7906  S  SG  . CYS C  1 104 ? 5.025   78.175  42.009  1.00   36.06 ? 211 CYS C SG  1 
ATOM   7907  N  N   . GLY C  1 105 ? 2.616   77.659  39.680  1.00   23.80 ? 212 GLY C N   1 
ATOM   7908  C  CA  . GLY C  1 105 ? 2.142   76.755  38.643  1.00   20.90 ? 212 GLY C CA  1 
ATOM   7909  C  C   . GLY C  1 105 ? 0.997   75.897  39.137  1.00   21.76 ? 212 GLY C C   1 
ATOM   7910  O  O   . GLY C  1 105 ? 0.138   76.396  39.866  1.00   23.11 ? 212 GLY C O   1 
ATOM   7911  N  N   . VAL C  1 106 ? 0.978   74.622  38.739  1.00   19.31 ? 213 VAL C N   1 
ATOM   7912  C  CA  . VAL C  1 106 ? -0.075  73.692  39.166  1.00   18.63 ? 213 VAL C CA  1 
ATOM   7913  C  C   . VAL C  1 106 ? 0.477   72.304  39.471  1.00   19.10 ? 213 VAL C C   1 
ATOM   7914  O  O   . VAL C  1 106 ? 1.519   71.909  38.949  1.00   19.00 ? 213 VAL C O   1 
ATOM   7915  C  CB  . VAL C  1 106 ? -1.154  73.502  38.082  1.00   20.69 ? 213 VAL C CB  1 
ATOM   7916  C  CG1 . VAL C  1 106 ? -1.626  74.863  37.572  1.00   17.79 ? 213 VAL C CG1 1 
ATOM   7917  C  CG2 . VAL C  1 106 ? -0.602  72.623  36.951  1.00   15.83 ? 213 VAL C CG2 1 
ATOM   7918  N  N   . GLY C  1 107 ? -0.220  71.559  40.321  1.00   17.28 ? 214 GLY C N   1 
ATOM   7919  C  CA  . GLY C  1 107 ? 0.233   70.213  40.617  1.00   18.30 ? 214 GLY C CA  1 
ATOM   7920  C  C   . GLY C  1 107 ? -0.313  69.268  39.551  1.00   18.91 ? 214 GLY C C   1 
ATOM   7921  O  O   . GLY C  1 107 ? -1.219  69.633  38.798  1.00   17.11 ? 214 GLY C O   1 
ATOM   7922  N  N   . VAL C  1 108 ? 0.242   68.068  39.459  1.00   17.54 ? 215 VAL C N   1 
ATOM   7923  C  CA  . VAL C  1 108 ? -0.246  67.099  38.491  1.00   16.85 ? 215 VAL C CA  1 
ATOM   7924  C  C   . VAL C  1 108 ? -1.711  66.779  38.815  1.00   19.55 ? 215 VAL C C   1 
ATOM   7925  O  O   . VAL C  1 108 ? -2.554  66.683  37.925  1.00   19.78 ? 215 VAL C O   1 
ATOM   7926  C  CB  . VAL C  1 108 ? 0.576   65.815  38.553  1.00   19.20 ? 215 VAL C CB  1 
ATOM   7927  C  CG1 . VAL C  1 108 ? -0.085  64.730  37.712  1.00   16.11 ? 215 VAL C CG1 1 
ATOM   7928  C  CG2 . VAL C  1 108 ? 1.985   66.099  38.053  1.00   19.22 ? 215 VAL C CG2 1 
ATOM   7929  N  N   . ALA C  1 109 ? -2.007  66.623  40.099  1.00   18.72 ? 216 ALA C N   1 
ATOM   7930  C  CA  . ALA C  1 109 ? -3.363  66.336  40.556  1.00   18.43 ? 216 ALA C CA  1 
ATOM   7931  C  C   . ALA C  1 109 ? -3.824  67.566  41.353  1.00   19.75 ? 216 ALA C C   1 
ATOM   7932  O  O   . ALA C  1 109 ? -3.963  67.513  42.583  1.00   18.86 ? 216 ALA C O   1 
ATOM   7933  C  CB  . ALA C  1 109 ? -3.354  65.106  41.443  1.00   14.53 ? 216 ALA C CB  1 
ATOM   7934  N  N   . TYR C  1 110 ? -4.066  68.667  40.648  1.00   18.06 ? 217 TYR C N   1 
ATOM   7935  C  CA  . TYR C  1 110 ? -4.441  69.917  41.301  1.00   21.66 ? 217 TYR C CA  1 
ATOM   7936  C  C   . TYR C  1 110 ? -5.733  69.972  42.094  1.00   21.37 ? 217 TYR C C   1 
ATOM   7937  O  O   . TYR C  1 110 ? -6.026  70.992  42.734  1.00   21.28 ? 217 TYR C O   1 
ATOM   7938  C  CB  . TYR C  1 110 ? -4.372  71.094  40.303  1.00   22.38 ? 217 TYR C CB  1 
ATOM   7939  C  CG  . TYR C  1 110 ? -5.224  70.988  39.055  1.00   23.36 ? 217 TYR C CG  1 
ATOM   7940  C  CD1 . TYR C  1 110 ? -6.609  71.170  39.108  1.00   24.60 ? 217 TYR C CD1 1 
ATOM   7941  C  CD2 . TYR C  1 110 ? -4.634  70.776  37.805  1.00   23.63 ? 217 TYR C CD2 1 
ATOM   7942  C  CE1 . TYR C  1 110 ? -7.386  71.151  37.939  1.00   25.19 ? 217 TYR C CE1 1 
ATOM   7943  C  CE2 . TYR C  1 110 ? -5.394  70.759  36.636  1.00   22.94 ? 217 TYR C CE2 1 
ATOM   7944  C  CZ  . TYR C  1 110 ? -6.766  70.950  36.709  1.00   27.22 ? 217 TYR C CZ  1 
ATOM   7945  O  OH  . TYR C  1 110 ? -7.510  70.978  35.551  1.00   29.79 ? 217 TYR C OH  1 
ATOM   7946  N  N   . ASN C  1 111 ? -6.503  68.893  42.081  1.00   20.29 ? 218 ASN C N   1 
ATOM   7947  C  CA  . ASN C  1 111 ? -7.722  68.866  42.876  1.00   22.01 ? 218 ASN C CA  1 
ATOM   7948  C  C   . ASN C  1 111 ? -7.652  67.823  43.977  1.00   24.49 ? 218 ASN C C   1 
ATOM   7949  O  O   . ASN C  1 111 ? -8.641  67.570  44.672  1.00   27.52 ? 218 ASN C O   1 
ATOM   7950  C  CB  . ASN C  1 111 ? -8.942  68.620  42.000  1.00   22.02 ? 218 ASN C CB  1 
ATOM   7951  C  CG  . ASN C  1 111 ? -9.407  69.885  41.325  1.00   24.80 ? 218 ASN C CG  1 
ATOM   7952  O  OD1 . ASN C  1 111 ? -9.277  70.975  41.892  1.00   25.02 ? 218 ASN C OD1 1 
ATOM   7953  N  ND2 . ASN C  1 111 ? -9.956  69.760  40.124  1.00   23.31 ? 218 ASN C ND2 1 
ATOM   7954  N  N   . ALA C  1 112 ? -6.481  67.215  44.139  1.00   24.52 ? 219 ALA C N   1 
ATOM   7955  C  CA  . ALA C  1 112 ? -6.302  66.207  45.175  1.00   25.00 ? 219 ALA C CA  1 
ATOM   7956  C  C   . ALA C  1 112 ? -6.081  66.897  46.511  1.00   25.58 ? 219 ALA C C   1 
ATOM   7957  O  O   . ALA C  1 112 ? -5.780  68.090  46.566  1.00   25.06 ? 219 ALA C O   1 
ATOM   7958  C  CB  . ALA C  1 112 ? -5.105  65.323  44.841  1.00   19.72 ? 219 ALA C CB  1 
ATOM   7959  N  N   . ARG C  1 113 ? -6.252  66.151  47.594  1.00   25.72 ? 220 ARG C N   1 
ATOM   7960  C  CA  . ARG C  1 113 ? -6.004  66.712  48.905  1.00   27.25 ? 220 ARG C CA  1 
ATOM   7961  C  C   . ARG C  1 113 ? -4.567  66.333  49.195  1.00   26.33 ? 220 ARG C C   1 
ATOM   7962  O  O   . ARG C  1 113 ? -4.143  65.201  48.927  1.00   25.56 ? 220 ARG C O   1 
ATOM   7963  C  CB  . ARG C  1 113 ? -6.968  66.122  49.930  1.00   33.54 ? 220 ARG C CB  1 
ATOM   7964  C  CG  . ARG C  1 113 ? -8.375  66.630  49.709  1.00   42.02 ? 220 ARG C CG  1 
ATOM   7965  C  CD  . ARG C  1 113 ? -9.401  65.608  50.139  1.00   49.43 ? 220 ARG C CD  1 
ATOM   7966  N  NE  . ARG C  1 113 ? -9.567  65.575  51.588  1.00   52.15 ? 220 ARG C NE  1 
ATOM   7967  C  CZ  . ARG C  1 113 ? -10.338 64.702  52.224  1.00   51.60 ? 220 ARG C CZ  1 
ATOM   7968  N  NH1 . ARG C  1 113 ? -10.436 64.742  53.546  1.00   51.61 ? 220 ARG C NH1 1 
ATOM   7969  N  NH2 . ARG C  1 113 ? -11.001 63.779  51.535  1.00   53.28 ? 220 ARG C NH2 1 
ATOM   7970  N  N   . ILE C  1 114 ? -3.807  67.284  49.719  1.00   23.46 ? 221 ILE C N   1 
ATOM   7971  C  CA  . ILE C  1 114 ? -2.405  67.042  49.984  1.00   22.47 ? 221 ILE C CA  1 
ATOM   7972  C  C   . ILE C  1 114 ? -2.049  67.229  51.462  1.00   23.03 ? 221 ILE C C   1 
ATOM   7973  O  O   . ILE C  1 114 ? -2.476  68.176  52.106  1.00   23.81 ? 221 ILE C O   1 
ATOM   7974  C  CB  . ILE C  1 114 ? -1.539  67.979  49.087  1.00   21.73 ? 221 ILE C CB  1 
ATOM   7975  C  CG1 . ILE C  1 114 ? -0.058  67.625  49.199  1.00   15.96 ? 221 ILE C CG1 1 
ATOM   7976  C  CG2 . ILE C  1 114 ? -1.802  69.437  49.450  1.00   20.05 ? 221 ILE C CG2 1 
ATOM   7977  C  CD1 . ILE C  1 114 ? 0.340   66.368  48.458  1.00   13.96 ? 221 ILE C CD1 1 
ATOM   7978  N  N   . GLY C  1 115 ? -1.261  66.303  51.987  1.00   23.88 ? 222 GLY C N   1 
ATOM   7979  C  CA  . GLY C  1 115 ? -0.851  66.380  53.368  1.00   21.10 ? 222 GLY C CA  1 
ATOM   7980  C  C   . GLY C  1 115 ? 0.645   66.198  53.466  1.00   23.44 ? 222 GLY C C   1 
ATOM   7981  O  O   . GLY C  1 115 ? 1.325   65.896  52.479  1.00   24.27 ? 222 GLY C O   1 
ATOM   7982  N  N   . GLY C  1 116 ? 1.174   66.382  54.665  1.00   23.51 ? 223 GLY C N   1 
ATOM   7983  C  CA  . GLY C  1 116 ? 2.597   66.219  54.851  1.00   23.40 ? 223 GLY C CA  1 
ATOM   7984  C  C   . GLY C  1 116 ? 2.921   65.663  56.221  1.00   24.99 ? 223 GLY C C   1 
ATOM   7985  O  O   . GLY C  1 116 ? 2.259   65.992  57.207  1.00   28.01 ? 223 GLY C O   1 
ATOM   7986  N  N   . VAL C  1 117 ? 3.920   64.790  56.281  1.00   25.23 ? 224 VAL C N   1 
ATOM   7987  C  CA  . VAL C  1 117 ? 4.364   64.232  57.547  1.00   22.22 ? 224 VAL C CA  1 
ATOM   7988  C  C   . VAL C  1 117 ? 5.759   64.766  57.738  1.00   19.78 ? 224 VAL C C   1 
ATOM   7989  O  O   . VAL C  1 117 ? 6.647   64.510  56.922  1.00   21.00 ? 224 VAL C O   1 
ATOM   7990  C  CB  . VAL C  1 117 ? 4.412   62.676  57.530  1.00   21.94 ? 224 VAL C CB  1 
ATOM   7991  C  CG1 . VAL C  1 117 ? 4.985   62.137  58.844  1.00   20.89 ? 224 VAL C CG1 1 
ATOM   7992  C  CG2 . VAL C  1 117 ? 3.017   62.137  57.339  1.00   21.71 ? 224 VAL C CG2 1 
ATOM   7993  N  N   . ARG C  1 118 ? 5.941   65.550  58.793  1.00   19.83 ? 225 ARG C N   1 
ATOM   7994  C  CA  . ARG C  1 118 ? 7.255   66.102  59.102  1.00   19.51 ? 225 ARG C CA  1 
ATOM   7995  C  C   . ARG C  1 118 ? 8.003   64.984  59.830  1.00   19.25 ? 225 ARG C C   1 
ATOM   7996  O  O   . ARG C  1 118 ? 7.714   64.690  60.998  1.00   20.14 ? 225 ARG C O   1 
ATOM   7997  C  CB  . ARG C  1 118 ? 7.120   67.347  59.998  1.00   16.41 ? 225 ARG C CB  1 
ATOM   7998  C  CG  . ARG C  1 118 ? 8.456   67.946  60.438  1.00   16.66 ? 225 ARG C CG  1 
ATOM   7999  C  CD  . ARG C  1 118 ? 8.268   69.338  61.063  1.00   17.98 ? 225 ARG C CD  1 
ATOM   8000  N  NE  . ARG C  1 118 ? 9.558   69.924  61.412  1.00   24.58 ? 225 ARG C NE  1 
ATOM   8001  C  CZ  . ARG C  1 118 ? 10.045  69.986  62.649  1.00   24.92 ? 225 ARG C CZ  1 
ATOM   8002  N  NH1 . ARG C  1 118 ? 11.239  70.528  62.861  1.00   24.39 ? 225 ARG C NH1 1 
ATOM   8003  N  NH2 . ARG C  1 118 ? 9.325   69.535  63.673  1.00   21.04 ? 225 ARG C NH2 1 
ATOM   8004  N  N   . MET C  1 119 ? 8.948   64.346  59.142  1.00   17.50 ? 226 MET C N   1 
ATOM   8005  C  CA  . MET C  1 119 ? 9.691   63.272  59.767  1.00   17.53 ? 226 MET C CA  1 
ATOM   8006  C  C   . MET C  1 119 ? 11.176  63.210  59.441  1.00   19.47 ? 226 MET C C   1 
ATOM   8007  O  O   . MET C  1 119 ? 11.886  62.391  60.007  1.00   23.36 ? 226 MET C O   1 
ATOM   8008  C  CB  . MET C  1 119 ? 9.010   61.922  59.478  1.00   22.18 ? 226 MET C CB  1 
ATOM   8009  C  CG  . MET C  1 119 ? 8.572   61.665  58.034  1.00   24.62 ? 226 MET C CG  1 
ATOM   8010  S  SD  . MET C  1 119 ? 9.953   61.331  56.920  1.00   25.62 ? 226 MET C SD  1 
ATOM   8011  C  CE  . MET C  1 119 ? 10.334  59.646  57.351  1.00   22.40 ? 226 MET C CE  1 
ATOM   8012  N  N   . LEU C  1 120 ? 11.662  64.082  58.566  1.00   18.17 ? 227 LEU C N   1 
ATOM   8013  C  CA  . LEU C  1 120 ? 13.083  64.079  58.233  1.00   19.96 ? 227 LEU C CA  1 
ATOM   8014  C  C   . LEU C  1 120 ? 13.890  65.097  59.048  1.00   21.53 ? 227 LEU C C   1 
ATOM   8015  O  O   . LEU C  1 120 ? 15.122  65.014  59.120  1.00   20.12 ? 227 LEU C O   1 
ATOM   8016  C  CB  . LEU C  1 120 ? 13.288  64.386  56.748  1.00   20.61 ? 227 LEU C CB  1 
ATOM   8017  C  CG  . LEU C  1 120 ? 12.787  63.384  55.722  1.00   21.09 ? 227 LEU C CG  1 
ATOM   8018  C  CD1 . LEU C  1 120 ? 13.026  63.922  54.322  1.00   16.17 ? 227 LEU C CD1 1 
ATOM   8019  C  CD2 . LEU C  1 120 ? 13.518  62.065  55.925  1.00   20.06 ? 227 LEU C CD2 1 
ATOM   8020  N  N   . ASP C  1 121 ? 13.200  66.057  59.655  1.00   22.83 ? 228 ASP C N   1 
ATOM   8021  C  CA  . ASP C  1 121 ? 13.873  67.097  60.424  1.00   24.07 ? 228 ASP C CA  1 
ATOM   8022  C  C   . ASP C  1 121 ? 14.055  66.670  61.871  1.00   22.69 ? 228 ASP C C   1 
ATOM   8023  O  O   . ASP C  1 121 ? 13.385  67.165  62.767  1.00   25.14 ? 228 ASP C O   1 
ATOM   8024  C  CB  . ASP C  1 121 ? 13.064  68.399  60.341  1.00   26.82 ? 228 ASP C CB  1 
ATOM   8025  C  CG  . ASP C  1 121 ? 13.838  69.608  60.862  1.00   23.23 ? 228 ASP C CG  1 
ATOM   8026  O  OD1 . ASP C  1 121 ? 15.079  69.541  60.939  1.00   21.85 ? 228 ASP C OD1 1 
ATOM   8027  O  OD2 . ASP C  1 121 ? 13.195  70.620  61.174  1.00   23.15 ? 228 ASP C OD2 1 
ATOM   8028  N  N   . GLY C  1 122 ? 14.981  65.744  62.075  1.00   23.96 ? 229 GLY C N   1 
ATOM   8029  C  CA  . GLY C  1 122 ? 15.268  65.214  63.394  1.00   27.26 ? 229 GLY C CA  1 
ATOM   8030  C  C   . GLY C  1 122 ? 15.908  63.847  63.236  1.00   31.48 ? 229 GLY C C   1 
ATOM   8031  O  O   . GLY C  1 122 ? 16.331  63.483  62.131  1.00   33.15 ? 229 GLY C O   1 
ATOM   8032  N  N   . GLU C  1 123 ? 15.992  63.085  64.323  1.00   31.62 ? 230 GLU C N   1 
ATOM   8033  C  CA  . GLU C  1 123 ? 16.583  61.753  64.244  1.00   32.95 ? 230 GLU C CA  1 
ATOM   8034  C  C   . GLU C  1 123 ? 15.580  60.857  63.499  1.00   30.07 ? 230 GLU C C   1 
ATOM   8035  O  O   . GLU C  1 123 ? 14.441  60.696  63.942  1.00   27.87 ? 230 GLU C O   1 
ATOM   8036  C  CB  . GLU C  1 123 ? 16.833  61.199  65.650  1.00   36.91 ? 230 GLU C CB  1 
ATOM   8037  C  CG  . GLU C  1 123 ? 18.131  60.409  65.792  1.00   41.03 ? 230 GLU C CG  1 
ATOM   8038  C  CD  . GLU C  1 123 ? 18.006  59.255  66.767  0.0000 39.91 ? 230 GLU C CD  1 
ATOM   8039  O  OE1 . GLU C  1 123 ? 17.410  59.444  67.849  0.0000 40.33 ? 230 GLU C OE1 1 
ATOM   8040  O  OE2 . GLU C  1 123 ? 18.509  58.157  66.448  0.0000 40.33 ? 230 GLU C OE2 1 
ATOM   8041  N  N   . VAL C  1 124 ? 15.989  60.293  62.367  1.00   25.66 ? 231 VAL C N   1 
ATOM   8042  C  CA  . VAL C  1 124 ? 15.081  59.437  61.608  1.00   24.83 ? 231 VAL C CA  1 
ATOM   8043  C  C   . VAL C  1 124 ? 15.273  57.974  61.988  1.00   25.74 ? 231 VAL C C   1 
ATOM   8044  O  O   . VAL C  1 124 ? 16.117  57.272  61.424  1.00   25.78 ? 231 VAL C O   1 
ATOM   8045  C  CB  . VAL C  1 124 ? 15.286  59.600  60.093  1.00   22.94 ? 231 VAL C CB  1 
ATOM   8046  C  CG1 . VAL C  1 124 ? 14.203  58.840  59.351  1.00   23.80 ? 231 VAL C CG1 1 
ATOM   8047  C  CG2 . VAL C  1 124 ? 15.231  61.063  59.724  1.00   19.76 ? 231 VAL C CG2 1 
ATOM   8048  N  N   . THR C  1 125 ? 14.476  57.523  62.950  1.00   24.46 ? 232 THR C N   1 
ATOM   8049  C  CA  . THR C  1 125 ? 14.544  56.159  63.456  1.00   22.49 ? 232 THR C CA  1 
ATOM   8050  C  C   . THR C  1 125 ? 13.537  55.235  62.780  1.00   24.58 ? 232 THR C C   1 
ATOM   8051  O  O   . THR C  1 125 ? 12.655  55.682  62.042  1.00   24.00 ? 232 THR C O   1 
ATOM   8052  C  CB  . THR C  1 125 ? 14.210  56.120  64.945  1.00   21.66 ? 232 THR C CB  1 
ATOM   8053  O  OG1 . THR C  1 125 ? 12.820  56.435  65.107  1.00   22.73 ? 232 THR C OG1 1 
ATOM   8054  C  CG2 . THR C  1 125 ? 15.032  57.142  65.723  1.00   14.71 ? 232 THR C CG2 1 
ATOM   8055  N  N   . ASP C  1 126 ? 13.659  53.942  63.073  1.00   24.41 ? 233 ASP C N   1 
ATOM   8056  C  CA  . ASP C  1 126 ? 12.747  52.941  62.532  1.00   24.41 ? 233 ASP C CA  1 
ATOM   8057  C  C   . ASP C  1 126 ? 11.331  53.317  62.962  1.00   23.16 ? 233 ASP C C   1 
ATOM   8058  O  O   . ASP C  1 126 ? 10.403  53.284  62.160  1.00   24.96 ? 233 ASP C O   1 
ATOM   8059  C  CB  . ASP C  1 126 ? 13.129  51.539  63.055  1.00   22.14 ? 233 ASP C CB  1 
ATOM   8060  C  CG  . ASP C  1 126 ? 12.241  50.417  62.488  1.00   24.47 ? 233 ASP C CG  1 
ATOM   8061  O  OD1 . ASP C  1 126 ? 11.871  50.470  61.308  1.00   25.54 ? 233 ASP C OD1 1 
ATOM   8062  O  OD2 . ASP C  1 126 ? 11.921  49.456  63.215  1.00   26.35 ? 233 ASP C OD2 1 
ATOM   8063  N  N   . ALA C  1 127 ? 11.174  53.697  64.225  1.00   23.28 ? 234 ALA C N   1 
ATOM   8064  C  CA  . ALA C  1 127 ? 9.863   54.074  64.745  1.00   23.51 ? 234 ALA C CA  1 
ATOM   8065  C  C   . ALA C  1 127 ? 9.311   55.283  64.001  1.00   23.07 ? 234 ALA C C   1 
ATOM   8066  O  O   . ALA C  1 127 ? 8.125   55.336  63.668  1.00   23.78 ? 234 ALA C O   1 
ATOM   8067  C  CB  . ALA C  1 127 ? 9.958   54.377  66.230  1.00   25.28 ? 234 ALA C CB  1 
ATOM   8068  N  N   . VAL C  1 128 ? 10.172  56.259  63.752  1.00   23.67 ? 235 VAL C N   1 
ATOM   8069  C  CA  . VAL C  1 128 ? 9.757   57.459  63.043  1.00   24.14 ? 235 VAL C CA  1 
ATOM   8070  C  C   . VAL C  1 128 ? 9.222   57.069  61.666  1.00   24.08 ? 235 VAL C C   1 
ATOM   8071  O  O   . VAL C  1 128 ? 8.132   57.491  61.262  1.00   22.19 ? 235 VAL C O   1 
ATOM   8072  C  CB  . VAL C  1 128 ? 10.937  58.439  62.898  1.00   25.97 ? 235 VAL C CB  1 
ATOM   8073  C  CG1 . VAL C  1 128 ? 10.609  59.534  61.857  1.00   26.24 ? 235 VAL C CG1 1 
ATOM   8074  C  CG2 . VAL C  1 128 ? 11.224  59.057  64.261  1.00   25.27 ? 235 VAL C CG2 1 
ATOM   8075  N  N   . GLU C  1 129 ? 9.984   56.246  60.955  1.00   20.59 ? 236 GLU C N   1 
ATOM   8076  C  CA  . GLU C  1 129 ? 9.574   55.799  59.635  1.00   18.22 ? 236 GLU C CA  1 
ATOM   8077  C  C   . GLU C  1 129 ? 8.260   55.027  59.683  1.00   20.33 ? 236 GLU C C   1 
ATOM   8078  O  O   . GLU C  1 129 ? 7.341   55.284  58.892  1.00   20.16 ? 236 GLU C O   1 
ATOM   8079  C  CB  . GLU C  1 129 ? 10.655  54.909  59.029  1.00   18.53 ? 236 GLU C CB  1 
ATOM   8080  C  CG  . GLU C  1 129 ? 11.903  55.650  58.565  1.00   14.87 ? 236 GLU C CG  1 
ATOM   8081  C  CD  . GLU C  1 129 ? 12.987  54.698  58.105  1.00   18.83 ? 236 GLU C CD  1 
ATOM   8082  O  OE1 . GLU C  1 129 ? 12.651  53.580  57.655  1.00   23.19 ? 236 GLU C OE1 1 
ATOM   8083  O  OE2 . GLU C  1 129 ? 14.174  55.060  58.187  1.00   20.50 ? 236 GLU C OE2 1 
ATOM   8084  N  N   . ALA C  1 130 ? 8.152   54.088  60.619  1.00   18.96 ? 237 ALA C N   1 
ATOM   8085  C  CA  . ALA C  1 130 ? 6.941   53.277  60.705  1.00   18.33 ? 237 ALA C CA  1 
ATOM   8086  C  C   . ALA C  1 130 ? 5.707   54.107  60.989  1.00   18.41 ? 237 ALA C C   1 
ATOM   8087  O  O   . ALA C  1 130 ? 4.652   53.865  60.412  1.00   17.91 ? 237 ALA C O   1 
ATOM   8088  C  CB  . ALA C  1 130 ? 7.097   52.184  61.761  1.00   15.98 ? 237 ALA C CB  1 
ATOM   8089  N  N   . ARG C  1 131 ? 5.827   55.092  61.871  1.00   21.19 ? 238 ARG C N   1 
ATOM   8090  C  CA  . ARG C  1 131 ? 4.670   55.922  62.183  1.00   20.88 ? 238 ARG C CA  1 
ATOM   8091  C  C   . ARG C  1 131 ? 4.280   56.795  60.993  1.00   19.16 ? 238 ARG C C   1 
ATOM   8092  O  O   . ARG C  1 131 ? 3.120   57.148  60.839  1.00   19.74 ? 238 ARG C O   1 
ATOM   8093  C  CB  . ARG C  1 131 ? 4.947   56.776  63.419  1.00   22.12 ? 238 ARG C CB  1 
ATOM   8094  C  CG  . ARG C  1 131 ? 5.177   55.931  64.657  1.00   27.29 ? 238 ARG C CG  1 
ATOM   8095  C  CD  . ARG C  1 131 ? 5.288   56.778  65.901  1.00   30.25 ? 238 ARG C CD  1 
ATOM   8096  N  NE  . ARG C  1 131 ? 4.026   57.441  66.200  1.00   35.52 ? 238 ARG C NE  1 
ATOM   8097  C  CZ  . ARG C  1 131 ? 3.929   58.721  66.549  1.00   41.61 ? 238 ARG C CZ  1 
ATOM   8098  N  NH1 . ARG C  1 131 ? 2.732   59.245  66.805  1.00   41.11 ? 238 ARG C NH1 1 
ATOM   8099  N  NH2 . ARG C  1 131 ? 5.028   59.480  66.634  1.00   41.11 ? 238 ARG C NH2 1 
ATOM   8100  N  N   . SER C  1 132 ? 5.244   57.128  60.145  1.00   17.10 ? 239 SER C N   1 
ATOM   8101  C  CA  . SER C  1 132 ? 4.951   57.944  58.972  1.00   18.06 ? 239 SER C CA  1 
ATOM   8102  C  C   . SER C  1 132 ? 4.309   57.089  57.881  1.00   17.67 ? 239 SER C C   1 
ATOM   8103  O  O   . SER C  1 132 ? 3.261   57.433  57.347  1.00   17.76 ? 239 SER C O   1 
ATOM   8104  C  CB  . SER C  1 132 ? 6.235   58.579  58.453  1.00   15.93 ? 239 SER C CB  1 
ATOM   8105  O  OG  . SER C  1 132 ? 6.866   59.278  59.502  1.00   16.83 ? 239 SER C OG  1 
ATOM   8106  N  N   . LEU C  1 133 ? 4.944   55.967  57.558  1.00   19.43 ? 240 LEU C N   1 
ATOM   8107  C  CA  . LEU C  1 133 ? 4.437   55.055  56.536  1.00   19.33 ? 240 LEU C CA  1 
ATOM   8108  C  C   . LEU C  1 133 ? 3.064   54.521  56.924  1.00   21.87 ? 240 LEU C C   1 
ATOM   8109  O  O   . LEU C  1 133 ? 2.247   54.198  56.059  1.00   21.49 ? 240 LEU C O   1 
ATOM   8110  C  CB  . LEU C  1 133 ? 5.406   53.881  56.358  1.00   15.26 ? 240 LEU C CB  1 
ATOM   8111  C  CG  . LEU C  1 133 ? 6.728   54.234  55.682  1.00   17.85 ? 240 LEU C CG  1 
ATOM   8112  C  CD1 . LEU C  1 133 ? 7.744   53.118  55.843  1.00   17.63 ? 240 LEU C CD1 1 
ATOM   8113  C  CD2 . LEU C  1 133 ? 6.459   54.517  54.212  1.00   13.12 ? 240 LEU C CD2 1 
ATOM   8114  N  N   . GLY C  1 134 ? 2.813   54.436  58.230  1.00   24.53 ? 241 GLY C N   1 
ATOM   8115  C  CA  . GLY C  1 134 ? 1.537   53.913  58.700  1.00   25.82 ? 241 GLY C CA  1 
ATOM   8116  C  C   . GLY C  1 134 ? 0.510   54.956  59.117  1.00   27.36 ? 241 GLY C C   1 
ATOM   8117  O  O   . GLY C  1 134 ? -0.494  54.621  59.746  1.00   27.89 ? 241 GLY C O   1 
ATOM   8118  N  N   . LEU C  1 135 ? 0.740   56.218  58.776  1.00   25.88 ? 242 LEU C N   1 
ATOM   8119  C  CA  . LEU C  1 135 ? -0.207  57.257  59.154  1.00   25.91 ? 242 LEU C CA  1 
ATOM   8120  C  C   . LEU C  1 135 ? -1.546  57.108  58.451  1.00   25.34 ? 242 LEU C C   1 
ATOM   8121  O  O   . LEU C  1 135 ? -1.589  57.021  57.229  1.00   25.57 ? 242 LEU C O   1 
ATOM   8122  C  CB  . LEU C  1 135 ? 0.353   58.647  58.824  1.00   25.62 ? 242 LEU C CB  1 
ATOM   8123  C  CG  . LEU C  1 135 ? -0.564  59.833  59.176  1.00   26.23 ? 242 LEU C CG  1 
ATOM   8124  C  CD1 . LEU C  1 135 ? -0.606  59.962  60.686  1.00   24.56 ? 242 LEU C CD1 1 
ATOM   8125  C  CD2 . LEU C  1 135 ? -0.060  61.134  58.572  1.00   22.36 ? 242 LEU C CD2 1 
ATOM   8126  N  N   . ASN C  1 136 ? -2.637  57.077  59.217  1.00   26.75 ? 243 ASN C N   1 
ATOM   8127  C  CA  . ASN C  1 136 ? -3.993  57.020  58.637  1.00   29.44 ? 243 ASN C CA  1 
ATOM   8128  C  C   . ASN C  1 136 ? -4.143  56.234  57.341  1.00   28.52 ? 243 ASN C C   1 
ATOM   8129  O  O   . ASN C  1 136 ? -4.611  56.781  56.351  1.00   27.62 ? 243 ASN C O   1 
ATOM   8130  C  CB  . ASN C  1 136 ? -4.464  58.423  58.322  1.00   35.30 ? 243 ASN C CB  1 
ATOM   8131  C  CG  . ASN C  1 136 ? -4.935  59.151  59.519  1.00   44.48 ? 243 ASN C CG  1 
ATOM   8132  O  OD1 . ASN C  1 136 ? -4.147  59.760  60.251  1.00   46.90 ? 243 ASN C OD1 1 
ATOM   8133  N  ND2 . ASN C  1 136 ? -6.244  59.096  59.748  1.00   48.76 ? 243 ASN C ND2 1 
ATOM   8134  N  N   . PRO C  1 137 ? -3.800  54.940  57.340  1.00   28.22 ? 244 PRO C N   1 
ATOM   8135  C  CA  . PRO C  1 137 ? -3.891  54.103  56.143  1.00   27.02 ? 244 PRO C CA  1 
ATOM   8136  C  C   . PRO C  1 137 ? -5.255  54.032  55.491  1.00   28.02 ? 244 PRO C C   1 
ATOM   8137  O  O   . PRO C  1 137 ? -5.358  53.637  54.337  1.00   29.77 ? 244 PRO C O   1 
ATOM   8138  C  CB  . PRO C  1 137 ? -3.431  52.740  56.639  1.00   29.96 ? 244 PRO C CB  1 
ATOM   8139  C  CG  . PRO C  1 137 ? -2.576  53.067  57.816  1.00   29.10 ? 244 PRO C CG  1 
ATOM   8140  C  CD  . PRO C  1 137 ? -3.388  54.127  58.491  1.00   26.45 ? 244 PRO C CD  1 
ATOM   8141  N  N   . ASN C  1 138 ? -6.309  54.392  56.213  1.00   29.02 ? 245 ASN C N   1 
ATOM   8142  C  CA  . ASN C  1 138 ? -7.622  54.339  55.600  1.00   29.68 ? 245 ASN C CA  1 
ATOM   8143  C  C   . ASN C  1 138 ? -8.128  55.690  55.138  1.00   29.56 ? 245 ASN C C   1 
ATOM   8144  O  O   . ASN C  1 138 ? -9.256  55.825  54.648  1.00   30.23 ? 245 ASN C O   1 
ATOM   8145  C  CB  . ASN C  1 138 ? -8.623  53.667  56.525  1.00   32.23 ? 245 ASN C CB  1 
ATOM   8146  C  CG  . ASN C  1 138 ? -8.460  52.165  56.528  1.00   38.06 ? 245 ASN C CG  1 
ATOM   8147  O  OD1 . ASN C  1 138 ? -8.583  51.508  55.483  1.00   37.33 ? 245 ASN C OD1 1 
ATOM   8148  N  ND2 . ASN C  1 138 ? -8.155  51.608  57.697  1.00   38.97 ? 245 ASN C ND2 1 
ATOM   8149  N  N   . HIS C  1 139 ? -7.284  56.698  55.288  1.00   26.30 ? 246 HIS C N   1 
ATOM   8150  C  CA  . HIS C  1 139 ? -7.648  58.019  54.826  1.00   23.81 ? 246 HIS C CA  1 
ATOM   8151  C  C   . HIS C  1 139 ? -6.713  58.391  53.668  1.00   21.89 ? 246 HIS C C   1 
ATOM   8152  O  O   . HIS C  1 139 ? -7.157  58.799  52.601  1.00   21.96 ? 246 HIS C O   1 
ATOM   8153  C  CB  . HIS C  1 139 ? -7.520  59.040  55.943  1.00   22.22 ? 246 HIS C CB  1 
ATOM   8154  C  CG  . HIS C  1 139 ? -7.778  60.432  55.482  1.00   23.69 ? 246 HIS C CG  1 
ATOM   8155  N  ND1 . HIS C  1 139 ? -9.005  60.832  55.002  1.00   25.48 ? 246 HIS C ND1 1 
ATOM   8156  C  CD2 . HIS C  1 139 ? -6.948  61.493  55.338  1.00   25.52 ? 246 HIS C CD2 1 
ATOM   8157  C  CE1 . HIS C  1 139 ? -8.919  62.082  54.578  1.00   27.65 ? 246 HIS C CE1 1 
ATOM   8158  N  NE2 . HIS C  1 139 ? -7.682  62.506  54.770  1.00   24.85 ? 246 HIS C NE2 1 
ATOM   8159  N  N   . ILE C  1 140 ? -5.414  58.236  53.891  1.00   20.48 ? 247 ILE C N   1 
ATOM   8160  C  CA  . ILE C  1 140 ? -4.408  58.533  52.877  1.00   18.76 ? 247 ILE C CA  1 
ATOM   8161  C  C   . ILE C  1 140 ? -4.338  57.399  51.871  1.00   19.76 ? 247 ILE C C   1 
ATOM   8162  O  O   . ILE C  1 140 ? -4.264  56.227  52.261  1.00   22.07 ? 247 ILE C O   1 
ATOM   8163  C  CB  . ILE C  1 140 ? -3.027  58.683  53.513  1.00   18.23 ? 247 ILE C CB  1 
ATOM   8164  C  CG1 . ILE C  1 140 ? -3.038  59.862  54.476  1.00   17.16 ? 247 ILE C CG1 1 
ATOM   8165  C  CG2 . ILE C  1 140 ? -1.959  58.870  52.428  1.00   16.89 ? 247 ILE C CG2 1 
ATOM   8166  C  CD1 . ILE C  1 140 ? -1.769  59.955  55.309  1.00   20.91 ? 247 ILE C CD1 1 
ATOM   8167  N  N   . HIS C  1 141 ? -4.350  57.742  50.584  1.00   19.68 ? 248 HIS C N   1 
ATOM   8168  C  CA  . HIS C  1 141 ? -4.275  56.734  49.524  1.00   19.04 ? 248 HIS C CA  1 
ATOM   8169  C  C   . HIS C  1 141 ? -2.857  56.490  49.035  1.00   16.47 ? 248 HIS C C   1 
ATOM   8170  O  O   . HIS C  1 141 ? -2.452  55.353  48.807  1.00   16.45 ? 248 HIS C O   1 
ATOM   8171  C  CB  . HIS C  1 141 ? -5.096  57.148  48.302  1.00   18.70 ? 248 HIS C CB  1 
ATOM   8172  C  CG  . HIS C  1 141 ? -6.535  57.413  48.591  1.00   21.86 ? 248 HIS C CG  1 
ATOM   8173  N  ND1 . HIS C  1 141 ? -7.090  58.672  48.505  1.00   24.33 ? 248 HIS C ND1 1 
ATOM   8174  C  CD2 . HIS C  1 141 ? -7.543  56.581  48.938  1.00   26.52 ? 248 HIS C CD2 1 
ATOM   8175  C  CE1 . HIS C  1 141 ? -8.378  58.605  48.785  1.00   23.26 ? 248 HIS C CE1 1 
ATOM   8176  N  NE2 . HIS C  1 141 ? -8.679  57.347  49.052  1.00   28.73 ? 248 HIS C NE2 1 
ATOM   8177  N  N   . ILE C  1 142 ? -2.105  57.571  48.880  1.00   14.89 ? 249 ILE C N   1 
ATOM   8178  C  CA  . ILE C  1 142 ? -0.754  57.498  48.342  1.00   14.08 ? 249 ILE C CA  1 
ATOM   8179  C  C   . ILE C  1 142 ? 0.284   58.192  49.222  1.00   15.87 ? 249 ILE C C   1 
ATOM   8180  O  O   . ILE C  1 142 ? 0.074   59.317  49.687  1.00   18.56 ? 249 ILE C O   1 
ATOM   8181  C  CB  . ILE C  1 142 ? -0.753  58.164  46.939  1.00   14.34 ? 249 ILE C CB  1 
ATOM   8182  C  CG1 . ILE C  1 142 ? -1.756  57.440  46.037  1.00   16.62 ? 249 ILE C CG1 1 
ATOM   8183  C  CG2 . ILE C  1 142 ? 0.637   58.166  46.330  1.00   14.82 ? 249 ILE C CG2 1 
ATOM   8184  C  CD1 . ILE C  1 142 ? -2.309  58.310  44.860  1.00   13.69 ? 249 ILE C CD1 1 
ATOM   8185  N  N   . TYR C  1 143 ? 1.403   57.518  49.443  1.00   13.76 ? 250 TYR C N   1 
ATOM   8186  C  CA  . TYR C  1 143 ? 2.493   58.085  50.224  1.00   17.67 ? 250 TYR C CA  1 
ATOM   8187  C  C   . TYR C  1 143 ? 3.646   58.344  49.268  1.00   18.11 ? 250 TYR C C   1 
ATOM   8188  O  O   . TYR C  1 143 ? 3.975   57.487  48.439  1.00   18.50 ? 250 TYR C O   1 
ATOM   8189  C  CB  . TYR C  1 143 ? 2.972   57.106  51.295  1.00   17.64 ? 250 TYR C CB  1 
ATOM   8190  C  CG  . TYR C  1 143 ? 1.915   56.700  52.274  1.00   19.25 ? 250 TYR C CG  1 
ATOM   8191  C  CD1 . TYR C  1 143 ? 0.916   55.797  51.911  1.00   16.13 ? 250 TYR C CD1 1 
ATOM   8192  C  CD2 . TYR C  1 143 ? 1.897   57.232  53.567  1.00   16.77 ? 250 TYR C CD2 1 
ATOM   8193  C  CE1 . TYR C  1 143 ? -0.080  55.438  52.815  1.00   20.09 ? 250 TYR C CE1 1 
ATOM   8194  C  CE2 . TYR C  1 143 ? 0.901   56.877  54.478  1.00   17.75 ? 250 TYR C CE2 1 
ATOM   8195  C  CZ  . TYR C  1 143 ? -0.079  55.984  54.093  1.00   18.19 ? 250 TYR C CZ  1 
ATOM   8196  O  OH  . TYR C  1 143 ? -1.074  55.658  54.972  1.00   22.42 ? 250 TYR C OH  1 
ATOM   8197  N  N   . SER C  1 144 ? 4.266   59.512  49.380  1.00   18.68 ? 251 SER C N   1 
ATOM   8198  C  CA  . SER C  1 144 ? 5.388   59.846  48.506  1.00   19.41 ? 251 SER C CA  1 
ATOM   8199  C  C   . SER C  1 144 ? 6.639   60.072  49.354  1.00   19.71 ? 251 SER C C   1 
ATOM   8200  O  O   . SER C  1 144 ? 6.627   60.889  50.278  1.00   15.61 ? 251 SER C O   1 
ATOM   8201  C  CB  . SER C  1 144 ? 5.065   61.104  47.691  1.00   20.56 ? 251 SER C CB  1 
ATOM   8202  O  OG  . SER C  1 144 ? 6.051   61.317  46.705  1.00   22.98 ? 251 SER C OG  1 
ATOM   8203  N  N   . ALA C  1 145 ? 7.713   59.347  49.044  1.00   16.93 ? 252 ALA C N   1 
ATOM   8204  C  CA  . ALA C  1 145 ? 8.942   59.480  49.805  1.00   18.14 ? 252 ALA C CA  1 
ATOM   8205  C  C   . ALA C  1 145 ? 10.150  59.837  48.949  1.00   21.45 ? 252 ALA C C   1 
ATOM   8206  O  O   . ALA C  1 145 ? 10.646  59.005  48.175  1.00   22.67 ? 252 ALA C O   1 
ATOM   8207  C  CB  . ALA C  1 145 ? 9.220   58.186  50.571  1.00   15.94 ? 252 ALA C CB  1 
ATOM   8208  N  N   . SER C  1 146 ? 10.621  61.073  49.090  1.00   19.43 ? 253 SER C N   1 
ATOM   8209  C  CA  . SER C  1 146 ? 11.787  61.531  48.351  1.00   20.82 ? 253 SER C CA  1 
ATOM   8210  C  C   . SER C  1 146 ? 12.972  61.568  49.299  1.00   22.39 ? 253 SER C C   1 
ATOM   8211  O  O   . SER C  1 146 ? 13.594  62.615  49.488  1.00   25.84 ? 253 SER C O   1 
ATOM   8212  C  CB  . SER C  1 146 ? 11.549  62.923  47.768  1.00   18.44 ? 253 SER C CB  1 
ATOM   8213  O  OG  . SER C  1 146 ? 10.686  62.861  46.654  1.00   17.09 ? 253 SER C OG  1 
ATOM   8214  N  N   . TRP C  1 147 ? 13.264  60.421  49.907  1.00   21.13 ? 254 TRP C N   1 
ATOM   8215  C  CA  . TRP C  1 147 ? 14.375  60.286  50.846  1.00   21.57 ? 254 TRP C CA  1 
ATOM   8216  C  C   . TRP C  1 147 ? 14.781  58.823  50.946  1.00   23.04 ? 254 TRP C C   1 
ATOM   8217  O  O   . TRP C  1 147 ? 14.093  57.952  50.416  1.00   21.80 ? 254 TRP C O   1 
ATOM   8218  C  CB  . TRP C  1 147 ? 13.985  60.793  52.251  1.00   18.15 ? 254 TRP C CB  1 
ATOM   8219  C  CG  . TRP C  1 147 ? 12.687  60.254  52.784  1.00   18.19 ? 254 TRP C CG  1 
ATOM   8220  C  CD1 . TRP C  1 147 ? 11.454  60.819  52.640  1.00   15.82 ? 254 TRP C CD1 1 
ATOM   8221  C  CD2 . TRP C  1 147 ? 12.481  59.034  53.531  1.00   17.93 ? 254 TRP C CD2 1 
ATOM   8222  N  NE1 . TRP C  1 147 ? 10.497  60.039  53.242  1.00   15.09 ? 254 TRP C NE1 1 
ATOM   8223  C  CE2 . TRP C  1 147 ? 11.092  58.936  53.794  1.00   17.54 ? 254 TRP C CE2 1 
ATOM   8224  C  CE3 . TRP C  1 147 ? 13.331  58.021  54.000  1.00   19.27 ? 254 TRP C CE3 1 
ATOM   8225  C  CZ2 . TRP C  1 147 ? 10.526  57.855  54.504  1.00   16.05 ? 254 TRP C CZ2 1 
ATOM   8226  C  CZ3 . TRP C  1 147 ? 12.765  56.936  54.716  1.00   17.42 ? 254 TRP C CZ3 1 
ATOM   8227  C  CH2 . TRP C  1 147 ? 11.374  56.870  54.954  1.00   15.01 ? 254 TRP C CH2 1 
ATOM   8228  N  N   . GLY C  1 148 ? 15.893  58.562  51.630  1.00   21.45 ? 255 GLY C N   1 
ATOM   8229  C  CA  . GLY C  1 148 ? 16.347  57.200  51.809  1.00   22.21 ? 255 GLY C CA  1 
ATOM   8230  C  C   . GLY C  1 148 ? 17.747  57.138  52.393  1.00   23.20 ? 255 GLY C C   1 
ATOM   8231  O  O   . GLY C  1 148 ? 18.267  58.143  52.864  1.00   22.33 ? 255 GLY C O   1 
ATOM   8232  N  N   . PRO C  1 149 ? 18.373  55.951  52.405  1.00   22.84 ? 256 PRO C N   1 
ATOM   8233  C  CA  . PRO C  1 149 ? 19.723  55.808  52.940  1.00   23.42 ? 256 PRO C CA  1 
ATOM   8234  C  C   . PRO C  1 149 ? 20.687  56.643  52.106  1.00   25.20 ? 256 PRO C C   1 
ATOM   8235  O  O   . PRO C  1 149 ? 20.459  56.861  50.925  1.00   25.94 ? 256 PRO C O   1 
ATOM   8236  C  CB  . PRO C  1 149 ? 19.986  54.317  52.795  1.00   21.88 ? 256 PRO C CB  1 
ATOM   8237  C  CG  . PRO C  1 149 ? 18.626  53.728  52.959  1.00   22.26 ? 256 PRO C CG  1 
ATOM   8238  C  CD  . PRO C  1 149 ? 17.801  54.629  52.097  1.00   21.91 ? 256 PRO C CD  1 
ATOM   8239  N  N   . GLU C  1 150 ? 21.759  57.101  52.734  1.00   26.17 ? 257 GLU C N   1 
ATOM   8240  C  CA  . GLU C  1 150 ? 22.759  57.911  52.078  1.00   26.48 ? 257 GLU C CA  1 
ATOM   8241  C  C   . GLU C  1 150 ? 23.227  57.236  50.798  1.00   25.62 ? 257 GLU C C   1 
ATOM   8242  O  O   . GLU C  1 150 ? 23.422  56.020  50.772  1.00   25.68 ? 257 GLU C O   1 
ATOM   8243  C  CB  . GLU C  1 150 ? 23.936  58.116  53.033  1.00   34.02 ? 257 GLU C CB  1 
ATOM   8244  C  CG  . GLU C  1 150 ? 25.007  59.052  52.506  1.00   44.53 ? 257 GLU C CG  1 
ATOM   8245  C  CD  . GLU C  1 150 ? 26.136  59.265  53.497  1.00   48.67 ? 257 GLU C CD  1 
ATOM   8246  O  OE1 . GLU C  1 150 ? 27.124  59.939  53.129  1.00   50.95 ? 257 GLU C OE1 1 
ATOM   8247  O  OE2 . GLU C  1 150 ? 26.032  58.762  54.639  1.00   50.97 ? 257 GLU C OE2 1 
ATOM   8248  N  N   . ASP C  1 151 ? 23.407  58.024  49.737  1.00   23.35 ? 258 ASP C N   1 
ATOM   8249  C  CA  . ASP C  1 151 ? 23.851  57.480  48.456  1.00   24.13 ? 258 ASP C CA  1 
ATOM   8250  C  C   . ASP C  1 151 ? 25.376  57.529  48.306  1.00   24.80 ? 258 ASP C C   1 
ATOM   8251  O  O   . ASP C  1 151 ? 25.887  58.073  47.336  1.00   26.13 ? 258 ASP C O   1 
ATOM   8252  C  CB  . ASP C  1 151 ? 23.215  58.253  47.296  1.00   22.34 ? 258 ASP C CB  1 
ATOM   8253  C  CG  . ASP C  1 151 ? 21.694  58.166  47.280  1.00   23.96 ? 258 ASP C CG  1 
ATOM   8254  O  OD1 . ASP C  1 151 ? 21.125  57.079  47.527  1.00   19.09 ? 258 ASP C OD1 1 
ATOM   8255  O  OD2 . ASP C  1 151 ? 21.061  59.199  46.985  1.00   25.87 ? 258 ASP C OD2 1 
ATOM   8256  N  N   . ASP C  1 152 ? 26.110  56.946  49.242  1.00   26.84 ? 259 ASP C N   1 
ATOM   8257  C  CA  . ASP C  1 152 ? 27.562  57.006  49.145  1.00   28.16 ? 259 ASP C CA  1 
ATOM   8258  C  C   . ASP C  1 152 ? 28.138  55.962  48.204  1.00   28.23 ? 259 ASP C C   1 
ATOM   8259  O  O   . ASP C  1 152 ? 29.324  55.985  47.889  1.00   29.69 ? 259 ASP C O   1 
ATOM   8260  C  CB  . ASP C  1 152 ? 28.197  56.876  50.526  1.00   29.01 ? 259 ASP C CB  1 
ATOM   8261  C  CG  . ASP C  1 152 ? 27.781  55.623  51.230  1.00   30.96 ? 259 ASP C CG  1 
ATOM   8262  O  OD1 . ASP C  1 152 ? 27.282  54.703  50.548  1.00   30.11 ? 259 ASP C OD1 1 
ATOM   8263  O  OD2 . ASP C  1 152 ? 27.966  55.560  52.462  1.00   34.38 ? 259 ASP C OD2 1 
ATOM   8264  N  N   . GLY C  1 153 ? 27.301  55.046  47.743  1.00   29.55 ? 260 GLY C N   1 
ATOM   8265  C  CA  . GLY C  1 153 ? 27.788  54.036  46.827  1.00   26.03 ? 260 GLY C CA  1 
ATOM   8266  C  C   . GLY C  1 153 ? 28.607  52.961  47.510  1.00   26.36 ? 260 GLY C C   1 
ATOM   8267  O  O   . GLY C  1 153 ? 29.359  52.227  46.854  1.00   21.94 ? 260 GLY C O   1 
ATOM   8268  N  N   . LYS C  1 154 ? 28.480  52.857  48.828  1.00   25.78 ? 261 LYS C N   1 
ATOM   8269  C  CA  . LYS C  1 154 ? 29.219  51.827  49.527  1.00   27.78 ? 261 LYS C CA  1 
ATOM   8270  C  C   . LYS C  1 154 ? 28.417  51.142  50.600  1.00   28.06 ? 261 LYS C C   1 
ATOM   8271  O  O   . LYS C  1 154 ? 28.852  50.148  51.167  1.00   33.24 ? 261 LYS C O   1 
ATOM   8272  C  CB  . LYS C  1 154 ? 30.529  52.383  50.102  1.00   29.20 ? 261 LYS C CB  1 
ATOM   8273  C  CG  . LYS C  1 154 ? 30.435  53.623  50.978  1.00   31.82 ? 261 LYS C CG  1 
ATOM   8274  C  CD  . LYS C  1 154 ? 31.861  54.126  51.293  1.00   30.08 ? 261 LYS C CD  1 
ATOM   8275  C  CE  . LYS C  1 154 ? 31.876  55.220  52.351  1.00   33.66 ? 261 LYS C CE  1 
ATOM   8276  N  NZ  . LYS C  1 154 ? 33.259  55.625  52.711  0.0000 32.29 ? 261 LYS C NZ  1 
ATOM   8277  N  N   . THR C  1 155 ? 27.225  51.636  50.875  1.00   29.09 ? 262 THR C N   1 
ATOM   8278  C  CA  . THR C  1 155 ? 26.437  50.994  51.906  1.00   27.41 ? 262 THR C CA  1 
ATOM   8279  C  C   . THR C  1 155 ? 25.262  50.205  51.350  1.00   25.47 ? 262 THR C C   1 
ATOM   8280  O  O   . THR C  1 155 ? 24.826  50.405  50.211  1.00   24.14 ? 262 THR C O   1 
ATOM   8281  C  CB  . THR C  1 155 ? 25.915  52.022  52.941  1.00   30.47 ? 262 THR C CB  1 
ATOM   8282  O  OG1 . THR C  1 155 ? 25.056  52.969  52.299  1.00   32.72 ? 262 THR C OG1 1 
ATOM   8283  C  CG2 . THR C  1 155 ? 27.084  52.754  53.593  1.00   31.48 ? 262 THR C CG2 1 
ATOM   8284  N  N   . VAL C  1 156 ? 24.781  49.279  52.164  1.00   20.23 ? 263 VAL C N   1 
ATOM   8285  C  CA  . VAL C  1 156 ? 23.633  48.465  51.819  1.00   22.54 ? 263 VAL C CA  1 
ATOM   8286  C  C   . VAL C  1 156 ? 22.737  48.708  53.023  1.00   22.26 ? 263 VAL C C   1 
ATOM   8287  O  O   . VAL C  1 156 ? 23.100  48.390  54.156  1.00   23.93 ? 263 VAL C O   1 
ATOM   8288  C  CB  . VAL C  1 156 ? 23.998  46.982  51.714  1.00   21.68 ? 263 VAL C CB  1 
ATOM   8289  C  CG1 . VAL C  1 156 ? 22.787  46.207  51.241  1.00   22.35 ? 263 VAL C CG1 1 
ATOM   8290  C  CG2 . VAL C  1 156 ? 25.180  46.796  50.756  1.00   20.08 ? 263 VAL C CG2 1 
ATOM   8291  N  N   . ASP C  1 157 ? 21.574  49.298  52.789  1.00   23.22 ? 264 ASP C N   1 
ATOM   8292  C  CA  . ASP C  1 157 ? 20.691  49.634  53.894  1.00   21.49 ? 264 ASP C CA  1 
ATOM   8293  C  C   . ASP C  1 157 ? 19.246  49.567  53.418  1.00   22.74 ? 264 ASP C C   1 
ATOM   8294  O  O   . ASP C  1 157 ? 18.984  49.588  52.214  1.00   24.06 ? 264 ASP C O   1 
ATOM   8295  C  CB  . ASP C  1 157 ? 21.052  51.042  54.375  1.00   19.62 ? 264 ASP C CB  1 
ATOM   8296  C  CG  . ASP C  1 157 ? 20.512  51.373  55.759  1.00   24.60 ? 264 ASP C CG  1 
ATOM   8297  O  OD1 . ASP C  1 157 ? 19.880  50.519  56.417  1.00   24.63 ? 264 ASP C OD1 1 
ATOM   8298  O  OD2 . ASP C  1 157 ? 20.732  52.526  56.192  1.00   28.75 ? 264 ASP C OD2 1 
ATOM   8299  N  N   . GLY C  1 158 ? 18.322  49.476  54.373  1.00   21.84 ? 265 GLY C N   1 
ATOM   8300  C  CA  . GLY C  1 158 ? 16.908  49.395  54.063  1.00   20.44 ? 265 GLY C CA  1 
ATOM   8301  C  C   . GLY C  1 158 ? 16.066  49.556  55.316  1.00   20.23 ? 265 GLY C C   1 
ATOM   8302  O  O   . GLY C  1 158 ? 16.595  49.817  56.395  1.00   24.03 ? 265 GLY C O   1 
ATOM   8303  N  N   . PRO C  1 159 ? 14.747  49.389  55.219  1.00   18.20 ? 266 PRO C N   1 
ATOM   8304  C  CA  . PRO C  1 159 ? 13.891  49.543  56.401  1.00   17.56 ? 266 PRO C CA  1 
ATOM   8305  C  C   . PRO C  1 159 ? 14.152  48.523  57.506  1.00   18.56 ? 266 PRO C C   1 
ATOM   8306  O  O   . PRO C  1 159 ? 14.419  47.357  57.227  1.00   18.06 ? 266 PRO C O   1 
ATOM   8307  C  CB  . PRO C  1 159 ? 12.492  49.398  55.823  1.00   16.91 ? 266 PRO C CB  1 
ATOM   8308  C  CG  . PRO C  1 159 ? 12.709  48.378  54.710  1.00   17.25 ? 266 PRO C CG  1 
ATOM   8309  C  CD  . PRO C  1 159 ? 13.976  48.905  54.061  1.00   16.45 ? 266 PRO C CD  1 
ATOM   8310  N  N   . ALA C  1 160 ? 14.085  48.974  58.757  1.00   17.59 ? 267 ALA C N   1 
ATOM   8311  C  CA  . ALA C  1 160 ? 14.250  48.084  59.891  1.00   16.77 ? 267 ALA C CA  1 
ATOM   8312  C  C   . ALA C  1 160 ? 12.868  47.433  60.091  1.00   20.62 ? 267 ALA C C   1 
ATOM   8313  O  O   . ALA C  1 160 ? 11.933  47.696  59.320  1.00   19.21 ? 267 ALA C O   1 
ATOM   8314  C  CB  . ALA C  1 160 ? 14.673  48.864  61.108  1.00   16.02 ? 267 ALA C CB  1 
ATOM   8315  N  N   . ARG C  1 161 ? 12.723  46.608  61.125  1.00   22.00 ? 268 ARG C N   1 
ATOM   8316  C  CA  . ARG C  1 161 ? 11.476  45.875  61.354  1.00   23.00 ? 268 ARG C CA  1 
ATOM   8317  C  C   . ARG C  1 161 ? 10.137  46.614  61.405  1.00   23.98 ? 268 ARG C C   1 
ATOM   8318  O  O   . ARG C  1 161 ? 9.169   46.191  60.758  1.00   23.82 ? 268 ARG C O   1 
ATOM   8319  C  CB  . ARG C  1 161 ? 11.588  45.019  62.615  1.00   25.05 ? 268 ARG C CB  1 
ATOM   8320  C  CG  . ARG C  1 161 ? 12.389  43.745  62.464  1.00   30.98 ? 268 ARG C CG  1 
ATOM   8321  C  CD  . ARG C  1 161 ? 13.883  43.972  62.562  0.0000 29.14 ? 268 ARG C CD  1 
ATOM   8322  N  NE  . ARG C  1 161 ? 14.584  42.697  62.671  0.0000 29.72 ? 268 ARG C NE  1 
ATOM   8323  C  CZ  . ARG C  1 161 ? 15.900  42.564  62.787  0.0000 29.60 ? 268 ARG C CZ  1 
ATOM   8324  N  NH1 . ARG C  1 161 ? 16.679  43.636  62.810  0.0000 29.72 ? 268 ARG C NH1 1 
ATOM   8325  N  NH2 . ARG C  1 161 ? 16.438  41.356  62.882  0.0000 29.72 ? 268 ARG C NH2 1 
ATOM   8326  N  N   . LEU C  1 162 ? 10.046  47.683  62.186  1.00   20.97 ? 269 LEU C N   1 
ATOM   8327  C  CA  . LEU C  1 162 ? 8.774   48.390  62.259  1.00   21.66 ? 269 LEU C CA  1 
ATOM   8328  C  C   . LEU C  1 162 ? 8.383   48.959  60.900  1.00   22.60 ? 269 LEU C C   1 
ATOM   8329  O  O   . LEU C  1 162 ? 7.220   48.883  60.497  1.00   23.84 ? 269 LEU C O   1 
ATOM   8330  C  CB  . LEU C  1 162 ? 8.839   49.495  63.312  1.00   20.37 ? 269 LEU C CB  1 
ATOM   8331  C  CG  . LEU C  1 162 ? 8.853   48.927  64.732  1.00   22.90 ? 269 LEU C CG  1 
ATOM   8332  C  CD1 . LEU C  1 162 ? 9.012   50.069  65.702  1.00   21.42 ? 269 LEU C CD1 1 
ATOM   8333  C  CD2 . LEU C  1 162 ? 7.554   48.123  65.016  1.00   20.32 ? 269 LEU C CD2 1 
ATOM   8334  N  N   . ALA C  1 163 ? 9.357   49.513  60.185  1.00   23.14 ? 270 ALA C N   1 
ATOM   8335  C  CA  . ALA C  1 163 ? 9.085   50.076  58.872  1.00   22.54 ? 270 ALA C CA  1 
ATOM   8336  C  C   . ALA C  1 163 ? 8.618   48.969  57.925  1.00   22.75 ? 270 ALA C C   1 
ATOM   8337  O  O   . ALA C  1 163 ? 7.668   49.166  57.152  1.00   20.63 ? 270 ALA C O   1 
ATOM   8338  C  CB  . ALA C  1 163 ? 10.330  50.766  58.331  1.00   22.22 ? 270 ALA C CB  1 
ATOM   8339  N  N   . GLU C  1 164 ? 9.268   47.803  57.986  1.00   21.93 ? 271 GLU C N   1 
ATOM   8340  C  CA  . GLU C  1 164 ? 8.863   46.687  57.122  1.00   24.53 ? 271 GLU C CA  1 
ATOM   8341  C  C   . GLU C  1 164 ? 7.433   46.323  57.454  1.00   22.78 ? 271 GLU C C   1 
ATOM   8342  O  O   . GLU C  1 164 ? 6.609   46.132  56.567  1.00   23.57 ? 271 GLU C O   1 
ATOM   8343  C  CB  . GLU C  1 164 ? 9.726   45.441  57.341  1.00   28.64 ? 271 GLU C CB  1 
ATOM   8344  C  CG  . GLU C  1 164 ? 11.149  45.533  56.811  1.00   37.01 ? 271 GLU C CG  1 
ATOM   8345  C  CD  . GLU C  1 164 ? 11.909  44.210  56.928  1.00   40.08 ? 271 GLU C CD  1 
ATOM   8346  O  OE1 . GLU C  1 164 ? 11.726  43.324  56.063  1.00   44.21 ? 271 GLU C OE1 1 
ATOM   8347  O  OE2 . GLU C  1 164 ? 12.684  44.061  57.897  1.00   42.78 ? 271 GLU C OE2 1 
ATOM   8348  N  N   . GLU C  1 165 ? 7.142   46.218  58.743  1.00   20.59 ? 272 GLU C N   1 
ATOM   8349  C  CA  . GLU C  1 165 ? 5.794   45.875  59.162  1.00   21.57 ? 272 GLU C CA  1 
ATOM   8350  C  C   . GLU C  1 165 ? 4.801   46.927  58.681  1.00   21.42 ? 272 GLU C C   1 
ATOM   8351  O  O   . GLU C  1 165 ? 3.682   46.585  58.298  1.00   21.36 ? 272 GLU C O   1 
ATOM   8352  C  CB  . GLU C  1 165 ? 5.733   45.703  60.688  1.00   20.39 ? 272 GLU C CB  1 
ATOM   8353  C  CG  . GLU C  1 165 ? 6.353   44.366  61.141  1.00   20.63 ? 272 GLU C CG  1 
ATOM   8354  C  CD  . GLU C  1 165 ? 6.473   44.234  62.643  1.00   24.80 ? 272 GLU C CD  1 
ATOM   8355  O  OE1 . GLU C  1 165 ? 6.855   43.141  63.113  1.00   26.71 ? 272 GLU C OE1 1 
ATOM   8356  O  OE2 . GLU C  1 165 ? 6.192   45.223  63.355  1.00   27.28 ? 272 GLU C OE2 1 
ATOM   8357  N  N   . ALA C  1 166 ? 5.213   48.192  58.674  1.00   16.68 ? 273 ALA C N   1 
ATOM   8358  C  CA  . ALA C  1 166 ? 4.329   49.262  58.210  1.00   19.17 ? 273 ALA C CA  1 
ATOM   8359  C  C   . ALA C  1 166 ? 4.036   49.060  56.720  1.00   16.96 ? 273 ALA C C   1 
ATOM   8360  O  O   . ALA C  1 166 ? 2.888   49.196  56.277  1.00   16.57 ? 273 ALA C O   1 
ATOM   8361  C  CB  . ALA C  1 166 ? 4.976   50.651  58.454  1.00   12.45 ? 273 ALA C CB  1 
ATOM   8362  N  N   . PHE C  1 167 ? 5.069   48.736  55.946  1.00   16.20 ? 274 PHE C N   1 
ATOM   8363  C  CA  . PHE C  1 167 ? 4.881   48.508  54.510  1.00   15.74 ? 274 PHE C CA  1 
ATOM   8364  C  C   . PHE C  1 167 ? 3.908   47.353  54.298  1.00   17.14 ? 274 PHE C C   1 
ATOM   8365  O  O   . PHE C  1 167 ? 2.978   47.438  53.487  1.00   17.98 ? 274 PHE C O   1 
ATOM   8366  C  CB  . PHE C  1 167 ? 6.197   48.129  53.842  1.00   15.93 ? 274 PHE C CB  1 
ATOM   8367  C  CG  . PHE C  1 167 ? 7.034   49.291  53.429  1.00   19.32 ? 274 PHE C CG  1 
ATOM   8368  C  CD1 . PHE C  1 167 ? 6.517   50.269  52.583  1.00   23.13 ? 274 PHE C CD1 1 
ATOM   8369  C  CD2 . PHE C  1 167 ? 8.365   49.382  53.829  1.00   18.44 ? 274 PHE C CD2 1 
ATOM   8370  C  CE1 . PHE C  1 167 ? 7.317   51.324  52.135  1.00   23.00 ? 274 PHE C CE1 1 
ATOM   8371  C  CE2 . PHE C  1 167 ? 9.175   50.427  53.387  1.00   21.98 ? 274 PHE C CE2 1 
ATOM   8372  C  CZ  . PHE C  1 167 ? 8.649   51.406  52.534  1.00   22.58 ? 274 PHE C CZ  1 
ATOM   8373  N  N   . PHE C  1 168 ? 4.124   46.269  55.029  1.00   17.02 ? 275 PHE C N   1 
ATOM   8374  C  CA  . PHE C  1 168 ? 3.270   45.092  54.884  1.00   20.89 ? 275 PHE C CA  1 
ATOM   8375  C  C   . PHE C  1 168 ? 1.823   45.323  55.312  1.00   20.97 ? 275 PHE C C   1 
ATOM   8376  O  O   . PHE C  1 168 ? 0.887   44.889  54.618  1.00   18.07 ? 275 PHE C O   1 
ATOM   8377  C  CB  . PHE C  1 168 ? 3.860   43.902  55.649  1.00   27.12 ? 275 PHE C CB  1 
ATOM   8378  C  CG  . PHE C  1 168 ? 3.491   42.559  55.056  1.00   35.38 ? 275 PHE C CG  1 
ATOM   8379  C  CD1 . PHE C  1 168 ? 2.157   42.182  54.916  1.00   41.23 ? 275 PHE C CD1 1 
ATOM   8380  C  CD2 . PHE C  1 168 ? 4.474   41.676  54.621  1.00   38.73 ? 275 PHE C CD2 1 
ATOM   8381  C  CE1 . PHE C  1 168 ? 1.811   40.941  54.347  1.00   42.27 ? 275 PHE C CE1 1 
ATOM   8382  C  CE2 . PHE C  1 168 ? 4.136   40.442  54.055  1.00   36.79 ? 275 PHE C CE2 1 
ATOM   8383  C  CZ  . PHE C  1 168 ? 2.808   40.078  53.919  1.00   37.33 ? 275 PHE C CZ  1 
ATOM   8384  N  N   . ARG C  1 169 ? 1.621   45.993  56.447  1.00   19.24 ? 276 ARG C N   1 
ATOM   8385  C  CA  . ARG C  1 169 ? 0.260   46.282  56.896  1.00   17.83 ? 276 ARG C CA  1 
ATOM   8386  C  C   . ARG C  1 169 ? -0.357  47.199  55.840  1.00   17.40 ? 276 ARG C C   1 
ATOM   8387  O  O   . ARG C  1 169 ? -1.535  47.077  55.510  1.00   20.82 ? 276 ARG C O   1 
ATOM   8388  C  CB  . ARG C  1 169 ? 0.271   46.991  58.264  1.00   17.80 ? 276 ARG C CB  1 
ATOM   8389  C  CG  . ARG C  1 169 ? 0.913   46.164  59.382  1.00   18.25 ? 276 ARG C CG  1 
ATOM   8390  C  CD  . ARG C  1 169 ? 0.987   46.939  60.684  1.00   17.01 ? 276 ARG C CD  1 
ATOM   8391  N  NE  . ARG C  1 169 ? -0.333  47.179  61.266  1.00   20.09 ? 276 ARG C NE  1 
ATOM   8392  C  CZ  . ARG C  1 169 ? -1.016  46.293  61.996  1.00   21.98 ? 276 ARG C CZ  1 
ATOM   8393  N  NH1 . ARG C  1 169 ? -2.207  46.614  62.474  1.00   20.56 ? 276 ARG C NH1 1 
ATOM   8394  N  NH2 . ARG C  1 169 ? -0.511  45.089  62.263  1.00   23.70 ? 276 ARG C NH2 1 
ATOM   8395  N  N   . GLY C  1 170 ? 0.458   48.104  55.300  1.00   17.63 ? 277 GLY C N   1 
ATOM   8396  C  CA  . GLY C  1 170 ? -0.016  49.046  54.294  1.00   15.32 ? 277 GLY C CA  1 
ATOM   8397  C  C   . GLY C  1 170 ? -0.583  48.410  53.040  1.00   16.29 ? 277 GLY C C   1 
ATOM   8398  O  O   . GLY C  1 170 ? -1.712  48.698  52.650  1.00   17.11 ? 277 GLY C O   1 
ATOM   8399  N  N   . VAL C  1 171 ? 0.180   47.543  52.383  1.00   16.53 ? 278 VAL C N   1 
ATOM   8400  C  CA  . VAL C  1 171 ? -0.342  46.932  51.166  1.00   18.39 ? 278 VAL C CA  1 
ATOM   8401  C  C   . VAL C  1 171 ? -1.422  45.895  51.453  1.00   21.11 ? 278 VAL C C   1 
ATOM   8402  O  O   . VAL C  1 171 ? -2.213  45.568  50.572  1.00   21.84 ? 278 VAL C O   1 
ATOM   8403  C  CB  . VAL C  1 171 ? 0.771   46.264  50.324  1.00   18.08 ? 278 VAL C CB  1 
ATOM   8404  C  CG1 . VAL C  1 171 ? 1.798   47.310  49.912  1.00   13.14 ? 278 VAL C CG1 1 
ATOM   8405  C  CG2 . VAL C  1 171 ? 1.408   45.113  51.101  1.00   13.33 ? 278 VAL C CG2 1 
ATOM   8406  N  N   . SER C  1 172 ? -1.469  45.391  52.685  1.00   22.30 ? 279 SER C N   1 
ATOM   8407  C  CA  . SER C  1 172 ? -2.471  44.389  53.063  1.00   23.98 ? 279 SER C CA  1 
ATOM   8408  C  C   . SER C  1 172 ? -3.773  44.983  53.517  1.00   23.09 ? 279 SER C C   1 
ATOM   8409  O  O   . SER C  1 172 ? -4.838  44.568  53.073  1.00   25.88 ? 279 SER C O   1 
ATOM   8410  C  CB  . SER C  1 172 ? -1.977  43.498  54.212  1.00   22.20 ? 279 SER C CB  1 
ATOM   8411  O  OG  . SER C  1 172 ? -0.842  42.759  53.834  1.00   34.94 ? 279 SER C OG  1 
ATOM   8412  N  N   . GLN C  1 173 ? -3.685  45.952  54.415  1.00   24.79 ? 280 GLN C N   1 
ATOM   8413  C  CA  . GLN C  1 173 ? -4.878  46.561  54.988  1.00   26.24 ? 280 GLN C CA  1 
ATOM   8414  C  C   . GLN C  1 173 ? -5.200  47.990  54.587  1.00   24.18 ? 280 GLN C C   1 
ATOM   8415  O  O   . GLN C  1 173 ? -6.347  48.410  54.699  1.00   27.88 ? 280 GLN C O   1 
ATOM   8416  C  CB  . GLN C  1 173 ? -4.790  46.466  56.507  1.00   30.33 ? 280 GLN C CB  1 
ATOM   8417  C  CG  . GLN C  1 173 ? -4.779  45.034  56.998  1.00   37.84 ? 280 GLN C CG  1 
ATOM   8418  C  CD  . GLN C  1 173 ? -3.917  44.849  58.227  1.00   40.72 ? 280 GLN C CD  1 
ATOM   8419  O  OE1 . GLN C  1 173 ? -4.074  45.554  59.222  1.00   42.87 ? 280 GLN C OE1 1 
ATOM   8420  N  NE2 . GLN C  1 173 ? -2.999  43.891  58.165  1.00   45.04 ? 280 GLN C NE2 1 
ATOM   8421  N  N   . GLY C  1 174 ? -4.206  48.734  54.122  1.00   22.52 ? 281 GLY C N   1 
ATOM   8422  C  CA  . GLY C  1 174 ? -4.442  50.116  53.728  1.00   20.56 ? 281 GLY C CA  1 
ATOM   8423  C  C   . GLY C  1 174 ? -5.512  50.253  52.665  1.00   20.59 ? 281 GLY C C   1 
ATOM   8424  O  O   . GLY C  1 174 ? -5.777  49.315  51.919  1.00   21.87 ? 281 GLY C O   1 
ATOM   8425  N  N   . ARG C  1 175 ? -6.125  51.429  52.590  1.00   23.34 ? 282 ARG C N   1 
ATOM   8426  C  CA  . ARG C  1 175 ? -7.169  51.688  51.608  1.00   25.99 ? 282 ARG C CA  1 
ATOM   8427  C  C   . ARG C  1 175 ? -8.223  50.600  51.603  1.00   27.33 ? 282 ARG C C   1 
ATOM   8428  O  O   . ARG C  1 175 ? -8.579  50.071  50.543  1.00   27.82 ? 282 ARG C O   1 
ATOM   8429  C  CB  . ARG C  1 175 ? -6.588  51.808  50.198  1.00   26.68 ? 282 ARG C CB  1 
ATOM   8430  C  CG  . ARG C  1 175 ? -5.869  53.106  49.917  1.00   27.63 ? 282 ARG C CG  1 
ATOM   8431  C  CD  . ARG C  1 175 ? -5.094  53.008  48.606  1.00   28.46 ? 282 ARG C CD  1 
ATOM   8432  N  NE  . ARG C  1 175 ? -5.986  52.801  47.484  1.00   22.50 ? 282 ARG C NE  1 
ATOM   8433  C  CZ  . ARG C  1 175 ? -5.883  51.818  46.599  1.00   22.39 ? 282 ARG C CZ  1 
ATOM   8434  N  NH1 . ARG C  1 175 ? -4.920  50.918  46.683  1.00   18.22 ? 282 ARG C NH1 1 
ATOM   8435  N  NH2 . ARG C  1 175 ? -6.767  51.737  45.621  1.00   25.52 ? 282 ARG C NH2 1 
ATOM   8436  N  N   . GLY C  1 176 ? -8.714  50.261  52.790  1.00   26.85 ? 283 GLY C N   1 
ATOM   8437  C  CA  . GLY C  1 176 ? -9.749  49.255  52.892  1.00   23.88 ? 283 GLY C CA  1 
ATOM   8438  C  C   . GLY C  1 176 ? -9.381  47.912  52.294  1.00   24.41 ? 283 GLY C C   1 
ATOM   8439  O  O   . GLY C  1 176 ? -10.235 47.220  51.751  1.00   24.71 ? 283 GLY C O   1 
ATOM   8440  N  N   . GLY C  1 177 ? -8.114  47.532  52.384  1.00   22.62 ? 284 GLY C N   1 
ATOM   8441  C  CA  . GLY C  1 177 ? -7.715  46.250  51.837  1.00   21.58 ? 284 GLY C CA  1 
ATOM   8442  C  C   . GLY C  1 177 ? -7.152  46.291  50.428  1.00   23.29 ? 284 GLY C C   1 
ATOM   8443  O  O   . GLY C  1 177 ? -6.590  45.298  49.976  1.00   25.27 ? 284 GLY C O   1 
ATOM   8444  N  N   . LEU C  1 178 ? -7.293  47.416  49.731  1.00   22.34 ? 285 LEU C N   1 
ATOM   8445  C  CA  . LEU C  1 178 ? -6.768  47.537  48.371  1.00   22.57 ? 285 LEU C CA  1 
ATOM   8446  C  C   . LEU C  1 178 ? -5.250  47.737  48.430  1.00   24.37 ? 285 LEU C C   1 
ATOM   8447  O  O   . LEU C  1 178 ? -4.524  47.419  47.476  1.00   24.94 ? 285 LEU C O   1 
ATOM   8448  C  CB  . LEU C  1 178 ? -7.435  48.715  47.649  1.00   22.81 ? 285 LEU C CB  1 
ATOM   8449  C  CG  . LEU C  1 178 ? -8.950  48.568  47.439  1.00   25.91 ? 285 LEU C CG  1 
ATOM   8450  C  CD1 . LEU C  1 178 ? -9.537  49.851  46.878  1.00   24.54 ? 285 LEU C CD1 1 
ATOM   8451  C  CD2 . LEU C  1 178 ? -9.224  47.413  46.493  1.00   22.80 ? 285 LEU C CD2 1 
ATOM   8452  N  N   . GLY C  1 179 ? -4.778  48.269  49.556  1.00   21.80 ? 286 GLY C N   1 
ATOM   8453  C  CA  . GLY C  1 179 ? -3.356  48.467  49.747  1.00   20.20 ? 286 GLY C CA  1 
ATOM   8454  C  C   . GLY C  1 179 ? -2.834  49.872  49.511  1.00   21.17 ? 286 GLY C C   1 
ATOM   8455  O  O   . GLY C  1 179 ? -3.087  50.468  48.474  1.00   22.21 ? 286 GLY C O   1 
ATOM   8456  N  N   . SER C  1 180 ? -2.094  50.400  50.481  1.00   18.80 ? 287 SER C N   1 
ATOM   8457  C  CA  . SER C  1 180 ? -1.511  51.733  50.371  1.00   18.86 ? 287 SER C CA  1 
ATOM   8458  C  C   . SER C  1 180 ? -0.567  51.785  49.167  1.00   18.35 ? 287 SER C C   1 
ATOM   8459  O  O   . SER C  1 180 ? 0.107   50.805  48.872  1.00   18.34 ? 287 SER C O   1 
ATOM   8460  C  CB  . SER C  1 180 ? -0.703  52.051  51.642  1.00   18.26 ? 287 SER C CB  1 
ATOM   8461  O  OG  . SER C  1 180 ? -1.517  52.058  52.805  1.00   17.16 ? 287 SER C OG  1 
ATOM   8462  N  N   . ILE C  1 181 ? -0.514  52.915  48.470  1.00   20.34 ? 288 ILE C N   1 
ATOM   8463  C  CA  . ILE C  1 181 ? 0.410   53.045  47.339  1.00   21.86 ? 288 ILE C CA  1 
ATOM   8464  C  C   . ILE C  1 181 ? 1.653   53.793  47.845  1.00   22.69 ? 288 ILE C C   1 
ATOM   8465  O  O   . ILE C  1 181 ? 1.550   54.935  48.290  1.00   26.27 ? 288 ILE C O   1 
ATOM   8466  C  CB  . ILE C  1 181 ? -0.196  53.860  46.174  1.00   23.79 ? 288 ILE C CB  1 
ATOM   8467  C  CG1 . ILE C  1 181 ? -1.533  53.258  45.716  1.00   23.02 ? 288 ILE C CG1 1 
ATOM   8468  C  CG2 . ILE C  1 181 ? 0.777   53.871  45.008  1.00   23.29 ? 288 ILE C CG2 1 
ATOM   8469  C  CD1 . ILE C  1 181 ? -1.442  51.847  45.220  1.00   25.82 ? 288 ILE C CD1 1 
ATOM   8470  N  N   . PHE C  1 182 ? 2.816   53.150  47.797  1.00   20.69 ? 289 PHE C N   1 
ATOM   8471  C  CA  . PHE C  1 182 ? 4.052   53.775  48.260  1.00   19.31 ? 289 PHE C CA  1 
ATOM   8472  C  C   . PHE C  1 182 ? 4.956   54.117  47.068  1.00   20.58 ? 289 PHE C C   1 
ATOM   8473  O  O   . PHE C  1 182 ? 5.483   53.217  46.403  1.00   20.41 ? 289 PHE C O   1 
ATOM   8474  C  CB  . PHE C  1 182 ? 4.820   52.832  49.204  1.00   20.44 ? 289 PHE C CB  1 
ATOM   8475  C  CG  . PHE C  1 182 ? 4.085   52.480  50.473  1.00   18.58 ? 289 PHE C CG  1 
ATOM   8476  C  CD1 . PHE C  1 182 ? 3.914   53.420  51.484  1.00   20.17 ? 289 PHE C CD1 1 
ATOM   8477  C  CD2 . PHE C  1 182 ? 3.595   51.194  50.672  1.00   18.97 ? 289 PHE C CD2 1 
ATOM   8478  C  CE1 . PHE C  1 182 ? 3.270   53.084  52.678  1.00   16.67 ? 289 PHE C CE1 1 
ATOM   8479  C  CE2 . PHE C  1 182 ? 2.950   50.849  51.862  1.00   16.78 ? 289 PHE C CE2 1 
ATOM   8480  C  CZ  . PHE C  1 182 ? 2.791   51.799  52.863  1.00   16.96 ? 289 PHE C CZ  1 
ATOM   8481  N  N   . VAL C  1 183 ? 5.139   55.409  46.813  1.00   17.36 ? 290 VAL C N   1 
ATOM   8482  C  CA  . VAL C  1 183 ? 5.982   55.880  45.713  1.00   20.50 ? 290 VAL C CA  1 
ATOM   8483  C  C   . VAL C  1 183 ? 7.343   56.315  46.262  1.00   20.19 ? 290 VAL C C   1 
ATOM   8484  O  O   . VAL C  1 183 ? 7.416   57.102  47.198  1.00   22.93 ? 290 VAL C O   1 
ATOM   8485  C  CB  . VAL C  1 183 ? 5.332   57.082  44.994  1.00   19.11 ? 290 VAL C CB  1 
ATOM   8486  C  CG1 . VAL C  1 183 ? 6.199   57.511  43.819  1.00   16.15 ? 290 VAL C CG1 1 
ATOM   8487  C  CG2 . VAL C  1 183 ? 3.932   56.714  44.547  1.00   17.12 ? 290 VAL C CG2 1 
ATOM   8488  N  N   . TRP C  1 184 ? 8.421   55.816  45.671  1.00   21.49 ? 291 TRP C N   1 
ATOM   8489  C  CA  . TRP C  1 184 ? 9.761   56.130  46.157  1.00   18.93 ? 291 TRP C CA  1 
ATOM   8490  C  C   . TRP C  1 184 ? 10.706  56.700  45.084  1.00   20.89 ? 291 TRP C C   1 
ATOM   8491  O  O   . TRP C  1 184 ? 10.630  56.323  43.904  1.00   19.98 ? 291 TRP C O   1 
ATOM   8492  C  CB  . TRP C  1 184 ? 10.356  54.852  46.766  1.00   18.54 ? 291 TRP C CB  1 
ATOM   8493  C  CG  . TRP C  1 184 ? 11.055  55.076  48.067  1.00   18.54 ? 291 TRP C CG  1 
ATOM   8494  C  CD1 . TRP C  1 184 ? 12.328  55.538  48.240  1.00   14.82 ? 291 TRP C CD1 1 
ATOM   8495  C  CD2 . TRP C  1 184 ? 10.479  54.981  49.379  1.00   17.68 ? 291 TRP C CD2 1 
ATOM   8496  N  NE1 . TRP C  1 184 ? 12.578  55.748  49.573  1.00   17.49 ? 291 TRP C NE1 1 
ATOM   8497  C  CE2 . TRP C  1 184 ? 11.464  55.420  50.300  1.00   15.97 ? 291 TRP C CE2 1 
ATOM   8498  C  CE3 . TRP C  1 184 ? 9.226   54.576  49.868  1.00   12.95 ? 291 TRP C CE3 1 
ATOM   8499  C  CZ2 . TRP C  1 184 ? 11.239  55.471  51.687  1.00   13.71 ? 291 TRP C CZ2 1 
ATOM   8500  C  CZ3 . TRP C  1 184 ? 8.999   54.622  51.254  1.00   14.90 ? 291 TRP C CZ3 1 
ATOM   8501  C  CH2 . TRP C  1 184 ? 10.003  55.071  52.143  1.00   16.44 ? 291 TRP C CH2 1 
ATOM   8502  N  N   . ALA C  1 185 ? 11.576  57.625  45.497  1.00   19.46 ? 292 ALA C N   1 
ATOM   8503  C  CA  . ALA C  1 185 ? 12.563  58.225  44.598  1.00   17.79 ? 292 ALA C CA  1 
ATOM   8504  C  C   . ALA C  1 185 ? 13.706  57.219  44.576  1.00   19.11 ? 292 ALA C C   1 
ATOM   8505  O  O   . ALA C  1 185 ? 14.187  56.827  45.639  1.00   19.84 ? 292 ALA C O   1 
ATOM   8506  C  CB  . ALA C  1 185 ? 13.049  59.568  45.159  1.00   17.93 ? 292 ALA C CB  1 
ATOM   8507  N  N   . SER C  1 186 ? 14.156  56.806  43.393  1.00   17.28 ? 293 SER C N   1 
ATOM   8508  C  CA  . SER C  1 186 ? 15.221  55.801  43.329  1.00   19.26 ? 293 SER C CA  1 
ATOM   8509  C  C   . SER C  1 186 ? 16.616  56.173  43.855  1.00   18.48 ? 293 SER C C   1 
ATOM   8510  O  O   . SER C  1 186 ? 17.419  55.278  44.107  1.00   20.66 ? 293 SER C O   1 
ATOM   8511  C  CB  . SER C  1 186 ? 15.329  55.208  41.905  1.00   17.12 ? 293 SER C CB  1 
ATOM   8512  O  OG  . SER C  1 186 ? 15.676  56.174  40.932  1.00   23.18 ? 293 SER C OG  1 
ATOM   8513  N  N   . GLY C  1 187 ? 16.917  57.463  44.023  1.00   17.22 ? 294 GLY C N   1 
ATOM   8514  C  CA  . GLY C  1 187 ? 18.223  57.847  44.558  1.00   18.39 ? 294 GLY C CA  1 
ATOM   8515  C  C   . GLY C  1 187 ? 19.057  58.856  43.776  1.00   21.82 ? 294 GLY C C   1 
ATOM   8516  O  O   . GLY C  1 187 ? 18.873  59.029  42.575  1.00   23.17 ? 294 GLY C O   1 
ATOM   8517  N  N   . ASN C  1 188 ? 19.990  59.517  44.458  1.00   20.30 ? 295 ASN C N   1 
ATOM   8518  C  CA  . ASN C  1 188 ? 20.856  60.504  43.810  1.00   21.14 ? 295 ASN C CA  1 
ATOM   8519  C  C   . ASN C  1 188 ? 22.326  60.082  43.767  1.00   20.29 ? 295 ASN C C   1 
ATOM   8520  O  O   . ASN C  1 188 ? 23.192  60.924  43.574  1.00   21.02 ? 295 ASN C O   1 
ATOM   8521  C  CB  . ASN C  1 188 ? 20.787  61.868  44.527  1.00   19.34 ? 295 ASN C CB  1 
ATOM   8522  C  CG  . ASN C  1 188 ? 19.546  62.692  44.152  1.00   21.29 ? 295 ASN C CG  1 
ATOM   8523  O  OD1 . ASN C  1 188 ? 18.939  62.497  43.095  1.00   22.47 ? 295 ASN C OD1 1 
ATOM   8524  N  ND2 . ASN C  1 188 ? 19.186  63.639  45.018  1.00   19.20 ? 295 ASN C ND2 1 
ATOM   8525  N  N   . GLY C  1 189 ? 22.609  58.795  43.930  1.00   18.71 ? 296 GLY C N   1 
ATOM   8526  C  CA  . GLY C  1 189 ? 23.989  58.331  43.952  1.00   16.68 ? 296 GLY C CA  1 
ATOM   8527  C  C   . GLY C  1 189 ? 24.700  58.069  42.635  1.00   17.49 ? 296 GLY C C   1 
ATOM   8528  O  O   . GLY C  1 189 ? 25.713  57.373  42.618  1.00   17.22 ? 296 GLY C O   1 
ATOM   8529  N  N   . GLY C  1 190 ? 24.191  58.620  41.537  1.00   16.43 ? 297 GLY C N   1 
ATOM   8530  C  CA  . GLY C  1 190 ? 24.814  58.409  40.237  1.00   18.61 ? 297 GLY C CA  1 
ATOM   8531  C  C   . GLY C  1 190 ? 26.307  58.696  40.185  1.00   20.87 ? 297 GLY C C   1 
ATOM   8532  O  O   . GLY C  1 190 ? 27.089  57.907  39.657  1.00   17.39 ? 297 GLY C O   1 
ATOM   8533  N  N   . ARG C  1 191 ? 26.709  59.831  40.744  1.00   24.87 ? 298 ARG C N   1 
ATOM   8534  C  CA  . ARG C  1 191 ? 28.112  60.209  40.744  1.00   27.10 ? 298 ARG C CA  1 
ATOM   8535  C  C   . ARG C  1 191 ? 28.980  59.237  41.545  1.00   27.55 ? 298 ARG C C   1 
ATOM   8536  O  O   . ARG C  1 191 ? 30.142  59.039  41.221  1.00   28.46 ? 298 ARG C O   1 
ATOM   8537  C  CB  . ARG C  1 191 ? 28.286  61.620  41.298  1.00   30.00 ? 298 ARG C CB  1 
ATOM   8538  C  CG  . ARG C  1 191 ? 29.626  62.206  40.941  1.00   38.41 ? 298 ARG C CG  1 
ATOM   8539  C  CD  . ARG C  1 191 ? 30.244  62.938  42.103  1.00   46.61 ? 298 ARG C CD  1 
ATOM   8540  N  NE  . ARG C  1 191 ? 29.490  64.121  42.486  1.00   52.02 ? 298 ARG C NE  1 
ATOM   8541  C  CZ  . ARG C  1 191 ? 29.714  64.796  43.606  1.00   58.40 ? 298 ARG C CZ  1 
ATOM   8542  N  NH1 . ARG C  1 191 ? 28.993  65.873  43.906  1.00   60.03 ? 298 ARG C NH1 1 
ATOM   8543  N  NH2 . ARG C  1 191 ? 30.665  64.380  44.434  1.00   63.00 ? 298 ARG C NH2 1 
ATOM   8544  N  N   . GLU C  1 192 ? 28.418  58.628  42.584  1.00   28.10 ? 299 GLU C N   1 
ATOM   8545  C  CA  . GLU C  1 192 ? 29.174  57.681  43.394  1.00   27.33 ? 299 GLU C CA  1 
ATOM   8546  C  C   . GLU C  1 192 ? 28.979  56.262  42.876  1.00   27.08 ? 299 GLU C C   1 
ATOM   8547  O  O   . GLU C  1 192 ? 29.371  55.297  43.527  1.00   28.79 ? 299 GLU C O   1 
ATOM   8548  C  CB  . GLU C  1 192 ? 28.728  57.732  44.853  1.00   27.90 ? 299 GLU C CB  1 
ATOM   8549  C  CG  . GLU C  1 192 ? 28.249  59.082  45.346  1.00   35.95 ? 299 GLU C CG  1 
ATOM   8550  C  CD  . GLU C  1 192 ? 29.193  60.213  45.007  1.00   39.96 ? 299 GLU C CD  1 
ATOM   8551  O  OE1 . GLU C  1 192 ? 30.420  60.015  45.110  1.00   42.30 ? 299 GLU C OE1 1 
ATOM   8552  O  OE2 . GLU C  1 192 ? 28.699  61.304  44.650  1.00   41.88 ? 299 GLU C OE2 1 
ATOM   8553  N  N   . HIS C  1 193 ? 28.372  56.134  41.704  1.00   28.38 ? 300 HIS C N   1 
ATOM   8554  C  CA  . HIS C  1 193 ? 28.125  54.819  41.118  1.00   29.64 ? 300 HIS C CA  1 
ATOM   8555  C  C   . HIS C  1 193 ? 27.262  53.952  42.018  1.00   27.27 ? 300 HIS C C   1 
ATOM   8556  O  O   . HIS C  1 193 ? 27.427  52.735  42.055  1.00   26.14 ? 300 HIS C O   1 
ATOM   8557  C  CB  . HIS C  1 193 ? 29.436  54.088  40.870  1.00   32.64 ? 300 HIS C CB  1 
ATOM   8558  C  CG  . HIS C  1 193 ? 30.362  54.815  39.955  1.00   39.30 ? 300 HIS C CG  1 
ATOM   8559  N  ND1 . HIS C  1 193 ? 31.267  55.752  40.403  1.00   46.59 ? 300 HIS C ND1 1 
ATOM   8560  C  CD2 . HIS C  1 193 ? 30.511  54.757  38.611  1.00   43.51 ? 300 HIS C CD2 1 
ATOM   8561  C  CE1 . HIS C  1 193 ? 31.938  56.240  39.374  1.00   47.77 ? 300 HIS C CE1 1 
ATOM   8562  N  NE2 . HIS C  1 193 ? 31.499  55.652  38.274  1.00   47.04 ? 300 HIS C NE2 1 
ATOM   8563  N  N   . ASP C  1 194 ? 26.343  54.572  42.744  1.00   24.92 ? 301 ASP C N   1 
ATOM   8564  C  CA  . ASP C  1 194 ? 25.484  53.814  43.639  1.00   24.90 ? 301 ASP C CA  1 
ATOM   8565  C  C   . ASP C  1 194 ? 24.487  52.961  42.847  1.00   25.82 ? 301 ASP C C   1 
ATOM   8566  O  O   . ASP C  1 194 ? 24.204  53.241  41.686  1.00   26.57 ? 301 ASP C O   1 
ATOM   8567  C  CB  . ASP C  1 194 ? 24.736  54.772  44.562  1.00   22.40 ? 301 ASP C CB  1 
ATOM   8568  C  CG  . ASP C  1 194 ? 24.238  54.091  45.800  1.00   23.12 ? 301 ASP C CG  1 
ATOM   8569  O  OD1 . ASP C  1 194 ? 24.561  52.891  45.957  1.00   19.37 ? 301 ASP C OD1 1 
ATOM   8570  O  OD2 . ASP C  1 194 ? 23.541  54.749  46.604  1.00   17.95 ? 301 ASP C OD2 1 
ATOM   8571  N  N   . SER C  1 195 ? 23.976  51.910  43.475  1.00   26.15 ? 302 SER C N   1 
ATOM   8572  C  CA  . SER C  1 195 ? 22.985  51.037  42.846  1.00   23.53 ? 302 SER C CA  1 
ATOM   8573  C  C   . SER C  1 195 ? 21.710  51.076  43.686  1.00   23.98 ? 302 SER C C   1 
ATOM   8574  O  O   . SER C  1 195 ? 21.764  50.888  44.904  1.00   23.30 ? 302 SER C O   1 
ATOM   8575  C  CB  . SER C  1 195 ? 23.492  49.598  42.798  1.00   24.74 ? 302 SER C CB  1 
ATOM   8576  O  OG  . SER C  1 195 ? 22.396  48.712  42.696  1.00   24.06 ? 302 SER C OG  1 
ATOM   8577  N  N   . CYS C  1 196 ? 20.563  51.294  43.050  1.00   20.70 ? 303 CYS C N   1 
ATOM   8578  C  CA  . CYS C  1 196 ? 19.335  51.345  43.819  1.00   19.96 ? 303 CYS C CA  1 
ATOM   8579  C  C   . CYS C  1 196 ? 18.837  49.984  44.279  1.00   19.64 ? 303 CYS C C   1 
ATOM   8580  O  O   . CYS C  1 196 ? 17.771  49.887  44.881  1.00   23.37 ? 303 CYS C O   1 
ATOM   8581  C  CB  . CYS C  1 196 ? 18.230  52.116  43.069  1.00   16.17 ? 303 CYS C CB  1 
ATOM   8582  S  SG  . CYS C  1 196 ? 18.097  51.898  41.252  1.00   22.22 ? 303 CYS C SG  1 
ATOM   8583  N  N   . ASN C  1 197 ? 19.597  48.927  44.005  1.00   20.97 ? 304 ASN C N   1 
ATOM   8584  C  CA  . ASN C  1 197 ? 19.202  47.598  44.481  1.00   19.69 ? 304 ASN C CA  1 
ATOM   8585  C  C   . ASN C  1 197 ? 19.850  47.372  45.852  1.00   21.27 ? 304 ASN C C   1 
ATOM   8586  O  O   . ASN C  1 197 ? 19.562  46.374  46.531  1.00   18.50 ? 304 ASN C O   1 
ATOM   8587  C  CB  . ASN C  1 197 ? 19.617  46.495  43.499  1.00   20.87 ? 304 ASN C CB  1 
ATOM   8588  C  CG  . ASN C  1 197 ? 18.554  46.225  42.425  1.00   24.02 ? 304 ASN C CG  1 
ATOM   8589  O  OD1 . ASN C  1 197 ? 17.571  46.961  42.302  1.00   24.37 ? 304 ASN C OD1 1 
ATOM   8590  N  ND2 . ASN C  1 197 ? 18.761  45.170  41.636  1.00   22.38 ? 304 ASN C ND2 1 
ATOM   8591  N  N   . CYS C  1 198 ? 20.710  48.316  46.253  1.00   20.03 ? 305 CYS C N   1 
ATOM   8592  C  CA  . CYS C  1 198 ? 21.386  48.274  47.549  1.00   19.76 ? 305 CYS C CA  1 
ATOM   8593  C  C   . CYS C  1 198 ? 20.628  49.168  48.528  1.00   20.66 ? 305 CYS C C   1 
ATOM   8594  O  O   . CYS C  1 198 ? 21.147  49.535  49.584  1.00   20.00 ? 305 CYS C O   1 
ATOM   8595  C  CB  . CYS C  1 198 ? 22.831  48.770  47.427  1.00   20.22 ? 305 CYS C CB  1 
ATOM   8596  S  SG  . CYS C  1 198 ? 23.957  47.622  46.559  1.00   19.83 ? 305 CYS C SG  1 
ATOM   8597  N  N   . ASP C  1 199 ? 19.395  49.505  48.152  1.00   19.73 ? 306 ASP C N   1 
ATOM   8598  C  CA  . ASP C  1 199 ? 18.501  50.358  48.934  1.00   18.38 ? 306 ASP C CA  1 
ATOM   8599  C  C   . ASP C  1 199 ? 17.227  49.530  49.129  1.00   20.96 ? 306 ASP C C   1 
ATOM   8600  O  O   . ASP C  1 199 ? 16.488  49.272  48.177  1.00   20.75 ? 306 ASP C O   1 
ATOM   8601  C  CB  . ASP C  1 199 ? 18.200  51.627  48.134  1.00   19.03 ? 306 ASP C CB  1 
ATOM   8602  C  CG  . ASP C  1 199 ? 17.155  52.523  48.792  1.00   23.23 ? 306 ASP C CG  1 
ATOM   8603  O  OD1 . ASP C  1 199 ? 16.308  52.019  49.567  1.00   21.96 ? 306 ASP C OD1 1 
ATOM   8604  O  OD2 . ASP C  1 199 ? 17.171  53.745  48.505  1.00   20.57 ? 306 ASP C OD2 1 
ATOM   8605  N  N   . GLY C  1 200 ? 16.974  49.116  50.365  1.00   20.79 ? 307 GLY C N   1 
ATOM   8606  C  CA  . GLY C  1 200 ? 15.817  48.285  50.653  1.00   19.85 ? 307 GLY C CA  1 
ATOM   8607  C  C   . GLY C  1 200 ? 14.455  48.921  50.476  1.00   20.92 ? 307 GLY C C   1 
ATOM   8608  O  O   . GLY C  1 200 ? 13.441  48.211  50.418  1.00   16.71 ? 307 GLY C O   1 
ATOM   8609  N  N   . TYR C  1 201 ? 14.415  50.250  50.416  1.00   19.12 ? 308 TYR C N   1 
ATOM   8610  C  CA  . TYR C  1 201 ? 13.143  50.948  50.224  1.00   20.77 ? 308 TYR C CA  1 
ATOM   8611  C  C   . TYR C  1 201 ? 12.739  50.881  48.762  1.00   18.13 ? 308 TYR C C   1 
ATOM   8612  O  O   . TYR C  1 201 ? 11.610  50.520  48.432  1.00   19.17 ? 308 TYR C O   1 
ATOM   8613  C  CB  . TYR C  1 201 ? 13.244  52.418  50.663  1.00   17.89 ? 308 TYR C CB  1 
ATOM   8614  C  CG  . TYR C  1 201 ? 13.595  52.564  52.127  1.00   19.09 ? 308 TYR C CG  1 
ATOM   8615  C  CD1 . TYR C  1 201 ? 14.916  52.490  52.552  1.00   15.40 ? 308 TYR C CD1 1 
ATOM   8616  C  CD2 . TYR C  1 201 ? 12.597  52.704  53.094  1.00   17.52 ? 308 TYR C CD2 1 
ATOM   8617  C  CE1 . TYR C  1 201 ? 15.239  52.548  53.909  1.00   21.26 ? 308 TYR C CE1 1 
ATOM   8618  C  CE2 . TYR C  1 201 ? 12.908  52.760  54.450  1.00   20.18 ? 308 TYR C CE2 1 
ATOM   8619  C  CZ  . TYR C  1 201 ? 14.232  52.681  54.847  1.00   15.87 ? 308 TYR C CZ  1 
ATOM   8620  O  OH  . TYR C  1 201 ? 14.548  52.719  56.174  1.00   20.40 ? 308 TYR C OH  1 
ATOM   8621  N  N   . THR C  1 202 ? 13.673  51.232  47.888  1.00   16.17 ? 309 THR C N   1 
ATOM   8622  C  CA  . THR C  1 202 ? 13.408  51.201  46.459  1.00   18.49 ? 309 THR C CA  1 
ATOM   8623  C  C   . THR C  1 202 ? 13.296  49.760  45.942  1.00   17.77 ? 309 THR C C   1 
ATOM   8624  O  O   . THR C  1 202 ? 12.445  49.457  45.117  1.00   17.19 ? 309 THR C O   1 
ATOM   8625  C  CB  . THR C  1 202 ? 14.515  51.950  45.705  1.00   18.66 ? 309 THR C CB  1 
ATOM   8626  O  OG1 . THR C  1 202 ? 15.802  51.492  46.143  1.00   15.40 ? 309 THR C OG1 1 
ATOM   8627  C  CG2 . THR C  1 202 ? 14.402  53.426  45.983  1.00   12.62 ? 309 THR C CG2 1 
ATOM   8628  N  N   . ASN C  1 203 ? 14.133  48.881  46.488  1.00   17.41 ? 310 ASN C N   1 
ATOM   8629  C  CA  . ASN C  1 203 ? 14.202  47.471  46.111  1.00   18.66 ? 310 ASN C CA  1 
ATOM   8630  C  C   . ASN C  1 203 ? 12.973  46.650  46.547  1.00   18.56 ? 310 ASN C C   1 
ATOM   8631  O  O   . ASN C  1 203 ? 12.753  45.540  46.072  1.00   17.03 ? 310 ASN C O   1 
ATOM   8632  C  CB  . ASN C  1 203 ? 15.483  46.905  46.722  1.00   23.33 ? 310 ASN C CB  1 
ATOM   8633  C  CG  . ASN C  1 203 ? 15.835  45.540  46.212  1.00   28.15 ? 310 ASN C CG  1 
ATOM   8634  O  OD1 . ASN C  1 203 ? 16.063  45.340  45.015  1.00   29.37 ? 310 ASN C OD1 1 
ATOM   8635  N  ND2 . ASN C  1 203 ? 15.911  44.581  47.128  1.00   29.48 ? 310 ASN C ND2 1 
ATOM   8636  N  N   . SER C  1 204 ? 12.169  47.197  47.451  1.00   17.49 ? 311 SER C N   1 
ATOM   8637  C  CA  . SER C  1 204 ? 10.977  46.496  47.936  1.00   16.35 ? 311 SER C CA  1 
ATOM   8638  C  C   . SER C  1 204 ? 9.897   46.352  46.866  1.00   19.41 ? 311 SER C C   1 
ATOM   8639  O  O   . SER C  1 204 ? 9.714   47.252  46.030  1.00   19.97 ? 311 SER C O   1 
ATOM   8640  C  CB  . SER C  1 204 ? 10.374  47.253  49.126  1.00   14.70 ? 311 SER C CB  1 
ATOM   8641  O  OG  . SER C  1 204 ? 9.092   46.746  49.475  1.00   17.35 ? 311 SER C OG  1 
ATOM   8642  N  N   . ILE C  1 205 ? 9.166   45.238  46.886  1.00   16.78 ? 312 ILE C N   1 
ATOM   8643  C  CA  . ILE C  1 205 ? 8.090   45.067  45.905  1.00   18.63 ? 312 ILE C CA  1 
ATOM   8644  C  C   . ILE C  1 205 ? 6.891   45.965  46.290  1.00   20.83 ? 312 ILE C C   1 
ATOM   8645  O  O   . ILE C  1 205 ? 6.027   46.254  45.464  1.00   20.20 ? 312 ILE C O   1 
ATOM   8646  C  CB  . ILE C  1 205 ? 7.597   43.581  45.811  1.00   15.44 ? 312 ILE C CB  1 
ATOM   8647  C  CG1 . ILE C  1 205 ? 6.828   43.194  47.082  1.00   15.82 ? 312 ILE C CG1 1 
ATOM   8648  C  CG2 . ILE C  1 205 ? 8.790   42.632  45.600  1.00   13.47 ? 312 ILE C CG2 1 
ATOM   8649  C  CD1 . ILE C  1 205 ? 6.268   41.742  47.056  1.00   12.65 ? 312 ILE C CD1 1 
ATOM   8650  N  N   . TYR C  1 206 ? 6.852   46.410  47.546  1.00   19.68 ? 313 TYR C N   1 
ATOM   8651  C  CA  . TYR C  1 206 ? 5.747   47.250  48.023  1.00   19.38 ? 313 TYR C CA  1 
ATOM   8652  C  C   . TYR C  1 206 ? 5.813   48.706  47.579  1.00   18.93 ? 313 TYR C C   1 
ATOM   8653  O  O   . TYR C  1 206 ? 4.846   49.449  47.731  1.00   20.28 ? 313 TYR C O   1 
ATOM   8654  C  CB  . TYR C  1 206 ? 5.677   47.221  49.548  1.00   19.55 ? 313 TYR C CB  1 
ATOM   8655  C  CG  . TYR C  1 206 ? 5.795   45.837  50.162  1.00   22.69 ? 313 TYR C CG  1 
ATOM   8656  C  CD1 . TYR C  1 206 ? 5.010   44.772  49.708  1.00   20.77 ? 313 TYR C CD1 1 
ATOM   8657  C  CD2 . TYR C  1 206 ? 6.677   45.604  51.219  1.00   22.58 ? 313 TYR C CD2 1 
ATOM   8658  C  CE1 . TYR C  1 206 ? 5.101   43.513  50.295  1.00   19.78 ? 313 TYR C CE1 1 
ATOM   8659  C  CE2 . TYR C  1 206 ? 6.773   44.359  51.814  1.00   20.24 ? 313 TYR C CE2 1 
ATOM   8660  C  CZ  . TYR C  1 206 ? 5.982   43.317  51.348  1.00   24.39 ? 313 TYR C CZ  1 
ATOM   8661  O  OH  . TYR C  1 206 ? 6.068   42.087  51.952  1.00   24.15 ? 313 TYR C OH  1 
ATOM   8662  N  N   . THR C  1 207 ? 6.949   49.124  47.038  1.00   19.09 ? 314 THR C N   1 
ATOM   8663  C  CA  . THR C  1 207 ? 7.095   50.504  46.596  1.00   18.13 ? 314 THR C CA  1 
ATOM   8664  C  C   . THR C  1 207 ? 7.289   50.581  45.087  1.00   20.40 ? 314 THR C C   1 
ATOM   8665  O  O   . THR C  1 207 ? 7.895   49.681  44.489  1.00   17.96 ? 314 THR C O   1 
ATOM   8666  C  CB  . THR C  1 207 ? 8.340   51.171  47.221  1.00   17.80 ? 314 THR C CB  1 
ATOM   8667  O  OG1 . THR C  1 207 ? 9.521   50.537  46.704  1.00   20.09 ? 314 THR C OG1 1 
ATOM   8668  C  CG2 . THR C  1 207 ? 8.338   51.041  48.739  1.00   13.84 ? 314 THR C CG2 1 
ATOM   8669  N  N   . LEU C  1 208 ? 6.768   51.645  44.475  1.00   18.99 ? 315 LEU C N   1 
ATOM   8670  C  CA  . LEU C  1 208 ? 6.976   51.871  43.050  1.00   18.86 ? 315 LEU C CA  1 
ATOM   8671  C  C   . LEU C  1 208 ? 8.190   52.783  43.015  1.00   17.10 ? 315 LEU C C   1 
ATOM   8672  O  O   . LEU C  1 208 ? 8.098   53.964  43.339  1.00   17.48 ? 315 LEU C O   1 
ATOM   8673  C  CB  . LEU C  1 208 ? 5.800   52.595  42.395  1.00   19.56 ? 315 LEU C CB  1 
ATOM   8674  C  CG  . LEU C  1 208 ? 4.433   51.926  42.395  1.00   20.35 ? 315 LEU C CG  1 
ATOM   8675  C  CD1 . LEU C  1 208 ? 3.650   52.394  43.617  1.00   17.34 ? 315 LEU C CD1 1 
ATOM   8676  C  CD2 . LEU C  1 208 ? 3.691   52.288  41.119  1.00   17.00 ? 315 LEU C CD2 1 
ATOM   8677  N  N   . SER C  1 209 ? 9.337   52.237  42.648  1.00   18.40 ? 316 SER C N   1 
ATOM   8678  C  CA  . SER C  1 209 ? 10.541  53.045  42.612  1.00   18.52 ? 316 SER C CA  1 
ATOM   8679  C  C   . SER C  1 209 ? 10.590  53.802  41.282  1.00   18.51 ? 316 SER C C   1 
ATOM   8680  O  O   . SER C  1 209 ? 10.460  53.203  40.220  1.00   19.90 ? 316 SER C O   1 
ATOM   8681  C  CB  . SER C  1 209 ? 11.762  52.153  42.792  1.00   14.10 ? 316 SER C CB  1 
ATOM   8682  O  OG  . SER C  1 209 ? 12.905  52.971  42.895  1.00   21.93 ? 316 SER C OG  1 
ATOM   8683  N  N   . ILE C  1 210 ? 10.796  55.113  41.358  1.00   18.99 ? 317 ILE C N   1 
ATOM   8684  C  CA  . ILE C  1 210 ? 10.804  55.989  40.192  1.00   17.16 ? 317 ILE C CA  1 
ATOM   8685  C  C   . ILE C  1 210 ? 12.136  56.680  39.916  1.00   20.41 ? 317 ILE C C   1 
ATOM   8686  O  O   . ILE C  1 210 ? 12.685  57.333  40.804  1.00   20.55 ? 317 ILE C O   1 
ATOM   8687  C  CB  . ILE C  1 210 ? 9.750   57.111  40.376  1.00   17.72 ? 317 ILE C CB  1 
ATOM   8688  C  CG1 . ILE C  1 210 ? 8.393   56.489  40.706  1.00   11.56 ? 317 ILE C CG1 1 
ATOM   8689  C  CG2 . ILE C  1 210 ? 9.717   58.026  39.150  1.00   15.20 ? 317 ILE C CG2 1 
ATOM   8690  C  CD1 . ILE C  1 210 ? 7.827   55.606  39.633  1.00   12.48 ? 317 ILE C CD1 1 
ATOM   8691  N  N   . SER C  1 211 ? 12.628  56.569  38.678  1.00   18.36 ? 318 SER C N   1 
ATOM   8692  C  CA  . SER C  1 211 ? 13.871  57.212  38.284  1.00   17.09 ? 318 SER C CA  1 
ATOM   8693  C  C   . SER C  1 211 ? 13.619  58.527  37.531  1.00   19.83 ? 318 SER C C   1 
ATOM   8694  O  O   . SER C  1 211 ? 12.472  58.917  37.316  1.00   17.57 ? 318 SER C O   1 
ATOM   8695  C  CB  . SER C  1 211 ? 14.705  56.277  37.420  1.00   17.98 ? 318 SER C CB  1 
ATOM   8696  O  OG  . SER C  1 211 ? 15.245  55.223  38.200  1.00   19.63 ? 318 SER C OG  1 
ATOM   8697  N  N   . SER C  1 212 ? 14.700  59.186  37.113  1.00   18.12 ? 319 SER C N   1 
ATOM   8698  C  CA  . SER C  1 212 ? 14.614  60.466  36.431  1.00   18.85 ? 319 SER C CA  1 
ATOM   8699  C  C   . SER C  1 212 ? 15.171  60.501  35.005  1.00   19.13 ? 319 SER C C   1 
ATOM   8700  O  O   . SER C  1 212 ? 16.019  59.694  34.625  1.00   18.76 ? 319 SER C O   1 
ATOM   8701  C  CB  . SER C  1 212 ? 15.345  61.523  37.262  1.00   19.56 ? 319 SER C CB  1 
ATOM   8702  O  OG  . SER C  1 212 ? 14.824  61.593  38.580  1.00   18.09 ? 319 SER C OG  1 
ATOM   8703  N  N   . ALA C  1 213 ? 14.693  61.471  34.233  1.00   17.31 ? 320 ALA C N   1 
ATOM   8704  C  CA  . ALA C  1 213 ? 15.136  61.681  32.848  1.00   18.36 ? 320 ALA C CA  1 
ATOM   8705  C  C   . ALA C  1 213 ? 15.287  63.188  32.665  1.00   16.01 ? 320 ALA C C   1 
ATOM   8706  O  O   . ALA C  1 213 ? 14.483  63.957  33.182  1.00   19.19 ? 320 ALA C O   1 
ATOM   8707  C  CB  . ALA C  1 213 ? 14.108  61.130  31.869  1.00   14.51 ? 320 ALA C CB  1 
ATOM   8708  N  N   . THR C  1 214 ? 16.323  63.618  31.962  1.00   15.76 ? 321 THR C N   1 
ATOM   8709  C  CA  . THR C  1 214 ? 16.530  65.046  31.770  1.00   19.92 ? 321 THR C CA  1 
ATOM   8710  C  C   . THR C  1 214 ? 15.586  65.528  30.669  1.00   22.82 ? 321 THR C C   1 
ATOM   8711  O  O   . THR C  1 214 ? 14.970  64.716  29.972  1.00   21.66 ? 321 THR C O   1 
ATOM   8712  C  CB  . THR C  1 214 ? 17.994  65.365  31.366  1.00   19.24 ? 321 THR C CB  1 
ATOM   8713  O  OG1 . THR C  1 214 ? 18.248  64.873  30.046  1.00   18.99 ? 321 THR C OG1 1 
ATOM   8714  C  CG2 . THR C  1 214 ? 18.976  64.706  32.335  1.00   17.89 ? 321 THR C CG2 1 
ATOM   8715  N  N   . GLN C  1 215 ? 15.462  66.843  30.521  1.00   22.29 ? 322 GLN C N   1 
ATOM   8716  C  CA  . GLN C  1 215 ? 14.592  67.391  29.496  1.00   22.40 ? 322 GLN C CA  1 
ATOM   8717  C  C   . GLN C  1 215 ? 14.922  66.866  28.102  1.00   20.59 ? 322 GLN C C   1 
ATOM   8718  O  O   . GLN C  1 215 ? 14.019  66.579  27.326  1.00   21.97 ? 322 GLN C O   1 
ATOM   8719  C  CB  . GLN C  1 215 ? 14.646  68.922  29.500  1.00   21.74 ? 322 GLN C CB  1 
ATOM   8720  C  CG  . GLN C  1 215 ? 13.856  69.550  28.361  1.00   21.66 ? 322 GLN C CG  1 
ATOM   8721  C  CD  . GLN C  1 215 ? 13.832  71.072  28.410  1.00   25.69 ? 322 GLN C CD  1 
ATOM   8722  O  OE1 . GLN C  1 215 ? 14.783  71.710  28.872  1.00   22.33 ? 322 GLN C OE1 1 
ATOM   8723  N  NE2 . GLN C  1 215 ? 12.745  71.661  27.915  1.00   23.63 ? 322 GLN C NE2 1 
ATOM   8724  N  N   . PHE C  1 216 ? 16.200  66.710  27.779  1.00   20.91 ? 323 PHE C N   1 
ATOM   8725  C  CA  . PHE C  1 216 ? 16.555  66.220  26.444  1.00   20.59 ? 323 PHE C CA  1 
ATOM   8726  C  C   . PHE C  1 216 ? 16.491  64.694  26.322  1.00   23.18 ? 323 PHE C C   1 
ATOM   8727  O  O   . PHE C  1 216 ? 16.946  64.115  25.330  1.00   24.51 ? 323 PHE C O   1 
ATOM   8728  C  CB  . PHE C  1 216 ? 17.948  66.715  26.031  1.00   19.82 ? 323 PHE C CB  1 
ATOM   8729  C  CG  . PHE C  1 216 ? 18.087  68.222  26.017  1.00   21.42 ? 323 PHE C CG  1 
ATOM   8730  C  CD1 . PHE C  1 216 ? 16.968  69.044  25.871  1.00   19.60 ? 323 PHE C CD1 1 
ATOM   8731  C  CD2 . PHE C  1 216 ? 19.338  68.813  26.156  1.00   22.81 ? 323 PHE C CD2 1 
ATOM   8732  C  CE1 . PHE C  1 216 ? 17.099  70.431  25.870  1.00   23.77 ? 323 PHE C CE1 1 
ATOM   8733  C  CE2 . PHE C  1 216 ? 19.486  70.208  26.155  1.00   25.72 ? 323 PHE C CE2 1 
ATOM   8734  C  CZ  . PHE C  1 216 ? 18.368  71.021  26.013  1.00   22.41 ? 323 PHE C CZ  1 
ATOM   8735  N  N   . GLY C  1 217 ? 15.933  64.041  27.335  1.00   22.31 ? 324 GLY C N   1 
ATOM   8736  C  CA  . GLY C  1 217 ? 15.809  62.594  27.293  1.00   20.84 ? 324 GLY C CA  1 
ATOM   8737  C  C   . GLY C  1 217 ? 17.049  61.785  27.649  1.00   20.32 ? 324 GLY C C   1 
ATOM   8738  O  O   . GLY C  1 217 ? 17.247  60.681  27.135  1.00   21.07 ? 324 GLY C O   1 
ATOM   8739  N  N   . ASN C  1 218 ? 17.878  62.304  28.541  1.00   16.88 ? 325 ASN C N   1 
ATOM   8740  C  CA  . ASN C  1 218 ? 19.070  61.571  28.922  1.00   19.03 ? 325 ASN C CA  1 
ATOM   8741  C  C   . ASN C  1 218 ? 19.048  61.143  30.370  1.00   17.21 ? 325 ASN C C   1 
ATOM   8742  O  O   . ASN C  1 218 ? 18.230  61.628  31.159  1.00   20.66 ? 325 ASN C O   1 
ATOM   8743  C  CB  . ASN C  1 218 ? 20.316  62.416  28.632  1.00   17.09 ? 325 ASN C CB  1 
ATOM   8744  C  CG  . ASN C  1 218 ? 20.547  62.589  27.132  1.00   21.87 ? 325 ASN C CG  1 
ATOM   8745  O  OD1 . ASN C  1 218 ? 20.648  61.612  26.390  1.00   26.90 ? 325 ASN C OD1 1 
ATOM   8746  N  ND2 . ASN C  1 218 ? 20.613  63.823  26.684  1.00   24.99 ? 325 ASN C ND2 1 
ATOM   8747  N  N   . VAL C  1 219 ? 19.939  60.219  30.709  1.00   15.08 ? 326 VAL C N   1 
ATOM   8748  C  CA  . VAL C  1 219 ? 20.080  59.739  32.085  1.00   16.89 ? 326 VAL C CA  1 
ATOM   8749  C  C   . VAL C  1 219 ? 20.857  60.808  32.858  1.00   17.56 ? 326 VAL C C   1 
ATOM   8750  O  O   . VAL C  1 219 ? 22.024  61.063  32.582  1.00   19.10 ? 326 VAL C O   1 
ATOM   8751  C  CB  . VAL C  1 219 ? 20.889  58.410  32.146  1.00   19.03 ? 326 VAL C CB  1 
ATOM   8752  C  CG1 . VAL C  1 219 ? 20.965  57.915  33.576  1.00   11.87 ? 326 VAL C CG1 1 
ATOM   8753  C  CG2 . VAL C  1 219 ? 20.249  57.351  31.244  1.00   12.89 ? 326 VAL C CG2 1 
ATOM   8754  N  N   . PRO C  1 220 ? 20.212  61.445  33.838  1.00   21.33 ? 327 PRO C N   1 
ATOM   8755  C  CA  . PRO C  1 220 ? 20.846  62.496  34.651  1.00   18.51 ? 327 PRO C CA  1 
ATOM   8756  C  C   . PRO C  1 220 ? 22.108  61.996  35.338  1.00   19.22 ? 327 PRO C C   1 
ATOM   8757  O  O   . PRO C  1 220 ? 22.247  60.794  35.586  1.00   15.72 ? 327 PRO C O   1 
ATOM   8758  C  CB  . PRO C  1 220 ? 19.762  62.857  35.660  1.00   18.98 ? 327 PRO C CB  1 
ATOM   8759  C  CG  . PRO C  1 220 ? 18.455  62.453  34.952  1.00   22.23 ? 327 PRO C CG  1 
ATOM   8760  C  CD  . PRO C  1 220 ? 18.833  61.165  34.287  1.00   20.51 ? 327 PRO C CD  1 
ATOM   8761  N  N   . TRP C  1 221 ? 23.012  62.921  35.658  1.00   17.45 ? 328 TRP C N   1 
ATOM   8762  C  CA  . TRP C  1 221 ? 24.262  62.563  36.317  1.00   19.11 ? 328 TRP C CA  1 
ATOM   8763  C  C   . TRP C  1 221 ? 24.042  61.898  37.680  1.00   18.56 ? 328 TRP C C   1 
ATOM   8764  O  O   . TRP C  1 221 ? 24.840  61.070  38.095  1.00   22.13 ? 328 TRP C O   1 
ATOM   8765  C  CB  . TRP C  1 221 ? 25.150  63.803  36.508  1.00   18.34 ? 328 TRP C CB  1 
ATOM   8766  C  CG  . TRP C  1 221 ? 24.576  64.812  37.452  1.00   20.78 ? 328 TRP C CG  1 
ATOM   8767  C  CD1 . TRP C  1 221 ? 23.769  65.872  37.136  1.00   19.70 ? 328 TRP C CD1 1 
ATOM   8768  C  CD2 . TRP C  1 221 ? 24.746  64.847  38.873  1.00   20.93 ? 328 TRP C CD2 1 
ATOM   8769  N  NE1 . TRP C  1 221 ? 23.430  66.568  38.275  1.00   19.01 ? 328 TRP C NE1 1 
ATOM   8770  C  CE2 . TRP C  1 221 ? 24.015  65.960  39.356  1.00   21.22 ? 328 TRP C CE2 1 
ATOM   8771  C  CE3 . TRP C  1 221 ? 25.444  64.041  39.788  1.00   21.92 ? 328 TRP C CE3 1 
ATOM   8772  C  CZ2 . TRP C  1 221 ? 23.960  66.292  40.715  1.00   22.25 ? 328 TRP C CZ2 1 
ATOM   8773  C  CZ3 . TRP C  1 221 ? 25.391  64.367  41.140  1.00   26.35 ? 328 TRP C CZ3 1 
ATOM   8774  C  CH2 . TRP C  1 221 ? 24.650  65.490  41.591  1.00   26.17 ? 328 TRP C CH2 1 
ATOM   8775  N  N   . TYR C  1 222 ? 22.966  62.259  38.369  1.00   17.08 ? 329 TYR C N   1 
ATOM   8776  C  CA  . TYR C  1 222 ? 22.678  61.714  39.696  1.00   15.85 ? 329 TYR C CA  1 
ATOM   8777  C  C   . TYR C  1 222 ? 21.935  60.381  39.704  1.00   18.26 ? 329 TYR C C   1 
ATOM   8778  O  O   . TYR C  1 222 ? 21.760  59.757  40.749  1.00   17.83 ? 329 TYR C O   1 
ATOM   8779  C  CB  . TYR C  1 222 ? 21.865  62.739  40.480  1.00   15.49 ? 329 TYR C CB  1 
ATOM   8780  C  CG  . TYR C  1 222 ? 20.620  63.195  39.753  1.00   15.51 ? 329 TYR C CG  1 
ATOM   8781  C  CD1 . TYR C  1 222 ? 19.449  62.436  39.780  1.00   16.87 ? 329 TYR C CD1 1 
ATOM   8782  C  CD2 . TYR C  1 222 ? 20.617  64.385  39.024  1.00   17.02 ? 329 TYR C CD2 1 
ATOM   8783  C  CE1 . TYR C  1 222 ? 18.296  62.852  39.093  1.00   18.71 ? 329 TYR C CE1 1 
ATOM   8784  C  CE2 . TYR C  1 222 ? 19.477  64.814  38.335  1.00   18.98 ? 329 TYR C CE2 1 
ATOM   8785  C  CZ  . TYR C  1 222 ? 18.323  64.039  38.371  1.00   20.13 ? 329 TYR C CZ  1 
ATOM   8786  O  OH  . TYR C  1 222 ? 17.223  64.434  37.650  1.00   22.44 ? 329 TYR C OH  1 
ATOM   8787  N  N   . SER C  1 223 ? 21.498  59.946  38.534  1.00   18.51 ? 330 SER C N   1 
ATOM   8788  C  CA  . SER C  1 223 ? 20.732  58.715  38.416  1.00   19.51 ? 330 SER C CA  1 
ATOM   8789  C  C   . SER C  1 223 ? 21.425  57.428  38.842  1.00   19.04 ? 330 SER C C   1 
ATOM   8790  O  O   . SER C  1 223 ? 22.601  57.217  38.549  1.00   21.12 ? 330 SER C O   1 
ATOM   8791  C  CB  . SER C  1 223 ? 20.249  58.550  36.976  1.00   19.47 ? 330 SER C CB  1 
ATOM   8792  O  OG  . SER C  1 223 ? 19.579  57.313  36.804  1.00   22.94 ? 330 SER C OG  1 
ATOM   8793  N  N   . GLU C  1 224 ? 20.676  56.561  39.524  1.00   17.77 ? 331 GLU C N   1 
ATOM   8794  C  CA  . GLU C  1 224 ? 21.202  55.260  39.942  1.00   17.85 ? 331 GLU C CA  1 
ATOM   8795  C  C   . GLU C  1 224 ? 20.503  54.192  39.103  1.00   17.50 ? 331 GLU C C   1 
ATOM   8796  O  O   . GLU C  1 224 ? 19.289  54.219  38.926  1.00   16.46 ? 331 GLU C O   1 
ATOM   8797  C  CB  . GLU C  1 224 ? 20.933  54.987  41.425  1.00   17.08 ? 331 GLU C CB  1 
ATOM   8798  C  CG  . GLU C  1 224 ? 21.601  55.975  42.399  1.00   17.83 ? 331 GLU C CG  1 
ATOM   8799  C  CD  . GLU C  1 224 ? 21.411  55.560  43.868  1.00   19.15 ? 331 GLU C CD  1 
ATOM   8800  O  OE1 . GLU C  1 224 ? 21.318  56.462  44.720  1.00   14.95 ? 331 GLU C OE1 1 
ATOM   8801  O  OE2 . GLU C  1 224 ? 21.357  54.335  44.176  1.00   19.60 ? 331 GLU C OE2 1 
ATOM   8802  N  N   . ALA C  1 225 ? 21.266  53.252  38.576  1.00   18.46 ? 332 ALA C N   1 
ATOM   8803  C  CA  . ALA C  1 225 ? 20.674  52.194  37.772  1.00   19.26 ? 332 ALA C CA  1 
ATOM   8804  C  C   . ALA C  1 225 ? 20.518  50.935  38.610  1.00   18.34 ? 332 ALA C C   1 
ATOM   8805  O  O   . ALA C  1 225 ? 21.340  50.662  39.483  1.00   19.70 ? 332 ALA C O   1 
ATOM   8806  C  CB  . ALA C  1 225 ? 21.560  51.895  36.568  1.00   16.01 ? 332 ALA C CB  1 
ATOM   8807  N  N   . CYS C  1 226 ? 19.459  50.176  38.345  1.00   16.71 ? 333 CYS C N   1 
ATOM   8808  C  CA  . CYS C  1 226 ? 19.216  48.915  39.037  1.00   15.19 ? 333 CYS C CA  1 
ATOM   8809  C  C   . CYS C  1 226 ? 17.962  48.291  38.437  1.00   17.10 ? 333 CYS C C   1 
ATOM   8810  O  O   . CYS C  1 226 ? 17.176  48.974  37.756  1.00   14.97 ? 333 CYS C O   1 
ATOM   8811  C  CB  . CYS C  1 226 ? 19.064  49.113  40.557  1.00   18.77 ? 333 CYS C CB  1 
ATOM   8812  S  SG  . CYS C  1 226 ? 17.534  49.943  41.051  1.00   20.44 ? 333 CYS C SG  1 
ATOM   8813  N  N   . SER C  1 227 ? 17.778  46.996  38.679  1.00   12.35 ? 334 SER C N   1 
ATOM   8814  C  CA  . SER C  1 227 ? 16.641  46.280  38.126  1.00   16.34 ? 334 SER C CA  1 
ATOM   8815  C  C   . SER C  1 227 ? 15.331  46.449  38.886  1.00   16.82 ? 334 SER C C   1 
ATOM   8816  O  O   . SER C  1 227 ? 14.282  46.034  38.398  1.00   16.73 ? 334 SER C O   1 
ATOM   8817  C  CB  . SER C  1 227 ? 16.963  44.791  38.039  1.00   15.78 ? 334 SER C CB  1 
ATOM   8818  O  OG  . SER C  1 227 ? 17.231  44.266  39.323  1.00   18.70 ? 334 SER C OG  1 
ATOM   8819  N  N   . SER C  1 228 ? 15.383  47.040  40.078  1.00   16.60 ? 335 SER C N   1 
ATOM   8820  C  CA  . SER C  1 228 ? 14.168  47.205  40.874  1.00   17.41 ? 335 SER C CA  1 
ATOM   8821  C  C   . SER C  1 228 ? 13.322  48.412  40.472  1.00   17.61 ? 335 SER C C   1 
ATOM   8822  O  O   . SER C  1 228 ? 12.132  48.472  40.795  1.00   17.77 ? 335 SER C O   1 
ATOM   8823  C  CB  . SER C  1 228 ? 14.495  47.277  42.375  1.00   16.06 ? 335 SER C CB  1 
ATOM   8824  O  OG  . SER C  1 228 ? 15.348  48.361  42.700  1.00   18.63 ? 335 SER C OG  1 
ATOM   8825  N  N   . THR C  1 229 ? 13.926  49.364  39.773  1.00   16.63 ? 336 THR C N   1 
ATOM   8826  C  CA  . THR C  1 229 ? 13.198  50.547  39.333  1.00   17.47 ? 336 THR C CA  1 
ATOM   8827  C  C   . THR C  1 229 ? 12.052  50.138  38.400  1.00   20.97 ? 336 THR C C   1 
ATOM   8828  O  O   . THR C  1 229 ? 12.208  49.249  37.546  1.00   18.84 ? 336 THR C O   1 
ATOM   8829  C  CB  . THR C  1 229 ? 14.138  51.525  38.609  1.00   20.13 ? 336 THR C CB  1 
ATOM   8830  O  OG1 . THR C  1 229 ? 15.085  52.043  39.557  1.00   14.45 ? 336 THR C OG1 1 
ATOM   8831  C  CG2 . THR C  1 229 ? 13.351  52.672  37.976  1.00   15.00 ? 336 THR C CG2 1 
ATOM   8832  N  N   . LEU C  1 230 ? 10.904  50.789  38.570  1.00   18.88 ? 337 LEU C N   1 
ATOM   8833  C  CA  . LEU C  1 230 ? 9.732   50.473  37.773  1.00   20.04 ? 337 LEU C CA  1 
ATOM   8834  C  C   . LEU C  1 230 ? 9.470   51.418  36.592  1.00   18.84 ? 337 LEU C C   1 
ATOM   8835  O  O   . LEU C  1 230 ? 9.157   50.968  35.492  1.00   18.72 ? 337 LEU C O   1 
ATOM   8836  C  CB  . LEU C  1 230 ? 8.495   50.425  38.681  1.00   17.51 ? 337 LEU C CB  1 
ATOM   8837  C  CG  . LEU C  1 230 ? 7.284   49.729  38.068  1.00   18.64 ? 337 LEU C CG  1 
ATOM   8838  C  CD1 . LEU C  1 230 ? 7.639   48.281  37.745  1.00   11.69 ? 337 LEU C CD1 1 
ATOM   8839  C  CD2 . LEU C  1 230 ? 6.102   49.800  39.024  1.00   18.93 ? 337 LEU C CD2 1 
ATOM   8840  N  N   . ALA C  1 231 ? 9.586   52.723  36.810  1.00   18.93 ? 338 ALA C N   1 
ATOM   8841  C  CA  . ALA C  1 231 ? 9.334   53.669  35.725  1.00   15.47 ? 338 ALA C CA  1 
ATOM   8842  C  C   . ALA C  1 231 ? 10.074  54.983  35.942  1.00   16.21 ? 338 ALA C C   1 
ATOM   8843  O  O   . ALA C  1 231 ? 10.811  55.133  36.908  1.00   18.05 ? 338 ALA C O   1 
ATOM   8844  C  CB  . ALA C  1 231 ? 7.839   53.912  35.584  1.00   10.48 ? 338 ALA C CB  1 
ATOM   8845  N  N   . THR C  1 232 ? 9.835   55.950  35.067  1.00   14.71 ? 339 THR C N   1 
ATOM   8846  C  CA  . THR C  1 232 ? 10.548  57.217  35.120  1.00   15.72 ? 339 THR C CA  1 
ATOM   8847  C  C   . THR C  1 232 ? 9.681   58.461  34.904  1.00   19.77 ? 339 THR C C   1 
ATOM   8848  O  O   . THR C  1 232 ? 8.679   58.410  34.192  1.00   20.36 ? 339 THR C O   1 
ATOM   8849  C  CB  . THR C  1 232 ? 11.625  57.232  33.996  1.00   15.94 ? 339 THR C CB  1 
ATOM   8850  O  OG1 . THR C  1 232 ? 12.420  56.055  34.092  1.00   13.80 ? 339 THR C OG1 1 
ATOM   8851  C  CG2 . THR C  1 232 ? 12.502  58.465  34.066  1.00   13.29 ? 339 THR C CG2 1 
ATOM   8852  N  N   . THR C  1 233 ? 10.086  59.574  35.511  1.00   19.11 ? 340 THR C N   1 
ATOM   8853  C  CA  . THR C  1 233 ? 9.415   60.856  35.301  1.00   22.47 ? 340 THR C CA  1 
ATOM   8854  C  C   . THR C  1 233 ? 10.536  61.861  35.126  1.00   21.57 ? 340 THR C C   1 
ATOM   8855  O  O   . THR C  1 233 ? 11.657  61.635  35.579  1.00   25.23 ? 340 THR C O   1 
ATOM   8856  C  CB  . THR C  1 233 ? 8.541   61.302  36.484  1.00   21.85 ? 340 THR C CB  1 
ATOM   8857  O  OG1 . THR C  1 233 ? 9.347   61.427  37.659  1.00   20.86 ? 340 THR C OG1 1 
ATOM   8858  C  CG2 . THR C  1 233 ? 7.437   60.305  36.714  1.00   16.57 ? 340 THR C CG2 1 
ATOM   8859  N  N   . TYR C  1 234 ? 10.243  62.963  34.458  1.00   22.08 ? 341 TYR C N   1 
ATOM   8860  C  CA  . TYR C  1 234 ? 11.242  63.994  34.218  1.00   20.59 ? 341 TYR C CA  1 
ATOM   8861  C  C   . TYR C  1 234 ? 11.728  64.696  35.486  1.00   21.32 ? 341 TYR C C   1 
ATOM   8862  O  O   . TYR C  1 234 ? 11.007  64.785  36.489  1.00   16.00 ? 341 TYR C O   1 
ATOM   8863  C  CB  . TYR C  1 234 ? 10.675  65.063  33.281  1.00   21.53 ? 341 TYR C CB  1 
ATOM   8864  C  CG  . TYR C  1 234 ? 10.589  64.662  31.826  1.00   23.86 ? 341 TYR C CG  1 
ATOM   8865  C  CD1 . TYR C  1 234 ? 11.745  64.447  31.073  1.00   22.57 ? 341 TYR C CD1 1 
ATOM   8866  C  CD2 . TYR C  1 234 ? 9.351   64.508  31.196  1.00   24.47 ? 341 TYR C CD2 1 
ATOM   8867  C  CE1 . TYR C  1 234 ? 11.679  64.089  29.729  1.00   21.08 ? 341 TYR C CE1 1 
ATOM   8868  C  CE2 . TYR C  1 234 ? 9.269   64.146  29.847  1.00   22.96 ? 341 TYR C CE2 1 
ATOM   8869  C  CZ  . TYR C  1 234 ? 10.439  63.937  29.123  1.00   24.50 ? 341 TYR C CZ  1 
ATOM   8870  O  OH  . TYR C  1 234 ? 10.368  63.565  27.796  1.00   25.47 ? 341 TYR C OH  1 
ATOM   8871  N  N   . SER C  1 235 ? 12.965  65.180  35.420  1.00   19.70 ? 342 SER C N   1 
ATOM   8872  C  CA  . SER C  1 235 ? 13.556  65.971  36.486  1.00   19.80 ? 342 SER C CA  1 
ATOM   8873  C  C   . SER C  1 235 ? 14.646  66.827  35.850  1.00   22.33 ? 342 SER C C   1 
ATOM   8874  O  O   . SER C  1 235 ? 14.627  67.056  34.643  1.00   22.49 ? 342 SER C O   1 
ATOM   8875  C  CB  . SER C  1 235 ? 14.146  65.107  37.592  1.00   21.67 ? 342 SER C CB  1 
ATOM   8876  O  OG  . SER C  1 235 ? 14.510  65.934  38.686  1.00   16.90 ? 342 SER C OG  1 
ATOM   8877  N  N   . SER C  1 236 ? 15.607  67.279  36.649  1.00   23.70 ? 343 SER C N   1 
ATOM   8878  C  CA  . SER C  1 236 ? 16.678  68.147  36.154  1.00   22.17 ? 343 SER C CA  1 
ATOM   8879  C  C   . SER C  1 236 ? 17.827  67.435  35.445  1.00   21.65 ? 343 SER C C   1 
ATOM   8880  O  O   . SER C  1 236 ? 17.963  66.217  35.529  1.00   19.43 ? 343 SER C O   1 
ATOM   8881  C  CB  . SER C  1 236 ? 17.248  68.951  37.310  1.00   21.35 ? 343 SER C CB  1 
ATOM   8882  O  OG  . SER C  1 236 ? 17.860  68.075  38.240  1.00   23.68 ? 343 SER C OG  1 
ATOM   8883  N  N   . GLY C  1 237 ? 18.656  68.223  34.759  1.00   21.69 ? 344 GLY C N   1 
ATOM   8884  C  CA  . GLY C  1 237 ? 19.804  67.696  34.031  1.00   20.58 ? 344 GLY C CA  1 
ATOM   8885  C  C   . GLY C  1 237 ? 20.921  68.726  34.021  1.00   21.54 ? 344 GLY C C   1 
ATOM   8886  O  O   . GLY C  1 237 ? 21.309  69.216  35.085  1.00   22.95 ? 344 GLY C O   1 
ATOM   8887  N  N   . ASN C  1 238 ? 21.445  69.072  32.844  1.00   19.70 ? 345 ASN C N   1 
ATOM   8888  C  CA  . ASN C  1 238 ? 22.513  70.076  32.783  1.00   20.36 ? 345 ASN C CA  1 
ATOM   8889  C  C   . ASN C  1 238 ? 21.930  71.493  32.799  1.00   21.08 ? 345 ASN C C   1 
ATOM   8890  O  O   . ASN C  1 238 ? 20.716  71.662  32.850  1.00   19.37 ? 345 ASN C O   1 
ATOM   8891  C  CB  . ASN C  1 238 ? 23.398  69.875  31.551  1.00   17.30 ? 345 ASN C CB  1 
ATOM   8892  C  CG  . ASN C  1 238 ? 22.631  70.005  30.245  1.00   22.07 ? 345 ASN C CG  1 
ATOM   8893  O  OD1 . ASN C  1 238 ? 21.848  70.940  30.064  1.00   23.49 ? 345 ASN C OD1 1 
ATOM   8894  N  ND2 . ASN C  1 238 ? 22.865  69.073  29.321  1.00   19.56 ? 345 ASN C ND2 1 
ATOM   8895  N  N   . GLN C  1 239 ? 22.783  72.512  32.745  1.00   22.97 ? 346 GLN C N   1 
ATOM   8896  C  CA  . GLN C  1 239 ? 22.278  73.874  32.827  1.00   23.98 ? 346 GLN C CA  1 
ATOM   8897  C  C   . GLN C  1 239 ? 21.572  74.417  31.586  1.00   23.89 ? 346 GLN C C   1 
ATOM   8898  O  O   . GLN C  1 239 ? 21.079  75.543  31.602  1.00   26.37 ? 346 GLN C O   1 
ATOM   8899  C  CB  . GLN C  1 239 ? 23.396  74.815  33.297  1.00   20.85 ? 346 GLN C CB  1 
ATOM   8900  C  CG  . GLN C  1 239 ? 23.978  74.406  34.647  1.00   21.37 ? 346 GLN C CG  1 
ATOM   8901  C  CD  . GLN C  1 239 ? 24.995  75.399  35.221  1.00   27.27 ? 346 GLN C CD  1 
ATOM   8902  O  OE1 . GLN C  1 239 ? 25.801  75.043  36.085  1.00   30.00 ? 346 GLN C OE1 1 
ATOM   8903  N  NE2 . GLN C  1 239 ? 24.956  76.641  34.754  1.00   27.30 ? 346 GLN C NE2 1 
ATOM   8904  N  N   . ASN C  1 240 ? 21.510  73.627  30.518  1.00   22.73 ? 347 ASN C N   1 
ATOM   8905  C  CA  . ASN C  1 240 ? 20.800  74.068  29.320  1.00   23.23 ? 347 ASN C CA  1 
ATOM   8906  C  C   . ASN C  1 240 ? 19.402  73.440  29.346  1.00   24.53 ? 347 ASN C C   1 
ATOM   8907  O  O   . ASN C  1 240 ? 18.548  73.754  28.508  1.00   22.91 ? 347 ASN C O   1 
ATOM   8908  C  CB  . ASN C  1 240 ? 21.502  73.616  28.036  1.00   25.87 ? 347 ASN C CB  1 
ATOM   8909  C  CG  . ASN C  1 240 ? 22.971  74.029  27.969  1.00   31.80 ? 347 ASN C CG  1 
ATOM   8910  O  OD1 . ASN C  1 240 ? 23.836  73.409  28.586  1.00   35.83 ? 347 ASN C OD1 1 
ATOM   8911  N  ND2 . ASN C  1 240 ? 23.254  75.074  27.206  1.00   30.35 ? 347 ASN C ND2 1 
ATOM   8912  N  N   . GLU C  1 241 ? 19.187  72.530  30.297  1.00   20.76 ? 348 GLU C N   1 
ATOM   8913  C  CA  . GLU C  1 241 ? 17.908  71.848  30.432  1.00   20.53 ? 348 GLU C CA  1 
ATOM   8914  C  C   . GLU C  1 241 ? 17.113  72.457  31.577  1.00   20.82 ? 348 GLU C C   1 
ATOM   8915  O  O   . GLU C  1 241 ? 17.670  72.821  32.607  1.00   24.60 ? 348 GLU C O   1 
ATOM   8916  C  CB  . GLU C  1 241 ? 18.138  70.346  30.666  1.00   20.23 ? 348 GLU C CB  1 
ATOM   8917  C  CG  . GLU C  1 241 ? 18.774  69.630  29.470  1.00   16.23 ? 348 GLU C CG  1 
ATOM   8918  C  CD  . GLU C  1 241 ? 19.215  68.191  29.759  1.00   21.12 ? 348 GLU C CD  1 
ATOM   8919  O  OE1 . GLU C  1 241 ? 18.827  67.285  28.986  1.00   23.03 ? 348 GLU C OE1 1 
ATOM   8920  O  OE2 . GLU C  1 241 ? 19.959  67.952  30.739  1.00   22.20 ? 348 GLU C OE2 1 
ATOM   8921  N  N   . LYS C  1 242 ? 15.807  72.571  31.396  1.00   22.36 ? 349 LYS C N   1 
ATOM   8922  C  CA  . LYS C  1 242 ? 14.952  73.161  32.417  1.00   23.16 ? 349 LYS C CA  1 
ATOM   8923  C  C   . LYS C  1 242 ? 14.763  72.240  33.612  1.00   22.02 ? 349 LYS C C   1 
ATOM   8924  O  O   . LYS C  1 242 ? 15.083  71.052  33.552  1.00   20.58 ? 349 LYS C O   1 
ATOM   8925  C  CB  . LYS C  1 242 ? 13.606  73.553  31.792  1.00   24.12 ? 349 LYS C CB  1 
ATOM   8926  C  CG  . LYS C  1 242 ? 13.755  74.735  30.860  1.00   27.33 ? 349 LYS C CG  1 
ATOM   8927  C  CD  . LYS C  1 242 ? 12.533  74.951  30.010  1.00   37.28 ? 349 LYS C CD  1 
ATOM   8928  C  CE  . LYS C  1 242 ? 12.763  76.122  29.072  1.00   43.71 ? 349 LYS C CE  1 
ATOM   8929  N  NZ  . LYS C  1 242 ? 11.557  76.413  28.262  1.00   49.80 ? 349 LYS C NZ  1 
ATOM   8930  N  N   . GLN C  1 243 ? 14.251  72.794  34.706  1.00   19.97 ? 350 GLN C N   1 
ATOM   8931  C  CA  . GLN C  1 243 ? 14.043  72.006  35.913  1.00   19.29 ? 350 GLN C CA  1 
ATOM   8932  C  C   . GLN C  1 243 ? 12.584  71.989  36.365  1.00   18.59 ? 350 GLN C C   1 
ATOM   8933  O  O   . GLN C  1 243 ? 11.689  72.308  35.593  1.00   18.40 ? 350 GLN C O   1 
ATOM   8934  C  CB  . GLN C  1 243 ? 14.985  72.513  37.017  1.00   17.30 ? 350 GLN C CB  1 
ATOM   8935  C  CG  . GLN C  1 243 ? 16.441  72.655  36.505  1.00   19.73 ? 350 GLN C CG  1 
ATOM   8936  C  CD  . GLN C  1 243 ? 17.487  72.961  37.590  1.00   22.22 ? 350 GLN C CD  1 
ATOM   8937  O  OE1 . GLN C  1 243 ? 17.200  73.624  38.587  1.00   23.69 ? 350 GLN C OE1 1 
ATOM   8938  N  NE2 . GLN C  1 243 ? 18.713  72.495  37.374  1.00   20.85 ? 350 GLN C NE2 1 
ATOM   8939  N  N   . ILE C  1 244 ? 12.341  71.600  37.609  1.00   19.86 ? 351 ILE C N   1 
ATOM   8940  C  CA  . ILE C  1 244 ? 10.975  71.500  38.105  1.00   19.94 ? 351 ILE C CA  1 
ATOM   8941  C  C   . ILE C  1 244 ? 10.481  72.760  38.787  1.00   20.00 ? 351 ILE C C   1 
ATOM   8942  O  O   . ILE C  1 244 ? 11.168  73.321  39.651  1.00   17.89 ? 351 ILE C O   1 
ATOM   8943  C  CB  . ILE C  1 244 ? 10.828  70.307  39.076  1.00   17.61 ? 351 ILE C CB  1 
ATOM   8944  C  CG1 . ILE C  1 244 ? 11.373  69.038  38.416  1.00   18.91 ? 351 ILE C CG1 1 
ATOM   8945  C  CG2 . ILE C  1 244 ? 9.362   70.112  39.460  1.00   16.63 ? 351 ILE C CG2 1 
ATOM   8946  C  CD1 . ILE C  1 244 ? 10.725  68.693  37.116  1.00   17.57 ? 351 ILE C CD1 1 
ATOM   8947  N  N   . VAL C  1 245 ? 9.276   73.177  38.399  1.00   18.13 ? 352 VAL C N   1 
ATOM   8948  C  CA  . VAL C  1 245 ? 8.631   74.382  38.917  1.00   18.13 ? 352 VAL C CA  1 
ATOM   8949  C  C   . VAL C  1 245 ? 7.611   74.012  39.979  1.00   19.31 ? 352 VAL C C   1 
ATOM   8950  O  O   . VAL C  1 245 ? 6.652   73.282  39.707  1.00   22.86 ? 352 VAL C O   1 
ATOM   8951  C  CB  . VAL C  1 245 ? 7.927   75.118  37.774  1.00   20.40 ? 352 VAL C CB  1 
ATOM   8952  C  CG1 . VAL C  1 245 ? 7.193   76.332  38.297  1.00   21.47 ? 352 VAL C CG1 1 
ATOM   8953  C  CG2 . VAL C  1 245 ? 8.961   75.467  36.698  1.00   17.25 ? 352 VAL C CG2 1 
ATOM   8954  N  N   . THR C  1 246 ? 7.788   74.534  41.187  1.00   17.88 ? 353 THR C N   1 
ATOM   8955  C  CA  . THR C  1 246 ? 6.874   74.178  42.254  1.00   16.59 ? 353 THR C CA  1 
ATOM   8956  C  C   . THR C  1 246 ? 6.868   75.196  43.377  1.00   16.46 ? 353 THR C C   1 
ATOM   8957  O  O   . THR C  1 246 ? 7.561   76.209  43.311  1.00   18.34 ? 353 THR C O   1 
ATOM   8958  C  CB  . THR C  1 246 ? 7.259   72.763  42.811  1.00   16.20 ? 353 THR C CB  1 
ATOM   8959  O  OG1 . THR C  1 246 ? 6.276   72.307  43.746  1.00   17.93 ? 353 THR C OG1 1 
ATOM   8960  C  CG2 . THR C  1 246 ? 8.611   72.808  43.495  1.00   14.54 ? 353 THR C CG2 1 
ATOM   8961  N  N   . THR C  1 247 ? 6.072   74.918  44.407  1.00   16.67 ? 354 THR C N   1 
ATOM   8962  C  CA  . THR C  1 247 ? 5.972   75.782  45.579  1.00   18.62 ? 354 THR C CA  1 
ATOM   8963  C  C   . THR C  1 247 ? 7.240   75.708  46.443  1.00   22.14 ? 354 THR C C   1 
ATOM   8964  O  O   . THR C  1 247 ? 7.786   74.622  46.696  1.00   24.10 ? 354 THR C O   1 
ATOM   8965  C  CB  . THR C  1 247 ? 4.792   75.366  46.460  1.00   20.50 ? 354 THR C CB  1 
ATOM   8966  O  OG1 . THR C  1 247 ? 4.875   73.954  46.711  1.00   18.64 ? 354 THR C OG1 1 
ATOM   8967  C  CG2 . THR C  1 247 ? 3.472   75.698  45.790  1.00   20.05 ? 354 THR C CG2 1 
ATOM   8968  N  N   . ASP C  1 248 ? 7.689   76.859  46.921  1.00   21.58 ? 355 ASP C N   1 
ATOM   8969  C  CA  . ASP C  1 248 ? 8.886   76.919  47.743  1.00   25.91 ? 355 ASP C CA  1 
ATOM   8970  C  C   . ASP C  1 248 ? 8.577   77.513  49.123  1.00   26.03 ? 355 ASP C C   1 
ATOM   8971  O  O   . ASP C  1 248 ? 7.543   78.165  49.319  1.00   25.00 ? 355 ASP C O   1 
ATOM   8972  C  CB  . ASP C  1 248 ? 9.944   77.753  47.021  1.00   26.41 ? 355 ASP C CB  1 
ATOM   8973  C  CG  . ASP C  1 248 ? 11.355  77.412  47.444  1.00   28.56 ? 355 ASP C CG  1 
ATOM   8974  O  OD1 . ASP C  1 248 ? 11.528  76.613  48.381  1.00   27.75 ? 355 ASP C OD1 1 
ATOM   8975  O  OD2 . ASP C  1 248 ? 12.297  77.949  46.826  1.00   30.92 ? 355 ASP C OD2 1 
ATOM   8976  N  N   . LEU C  1 249 ? 9.474   77.267  50.073  1.00   24.89 ? 356 LEU C N   1 
ATOM   8977  C  CA  . LEU C  1 249 ? 9.326   77.752  51.440  1.00   25.35 ? 356 LEU C CA  1 
ATOM   8978  C  C   . LEU C  1 249 ? 9.189   79.277  51.480  1.00   24.93 ? 356 LEU C C   1 
ATOM   8979  O  O   . LEU C  1 249 ? 9.684   79.984  50.595  1.00   24.15 ? 356 LEU C O   1 
ATOM   8980  C  CB  . LEU C  1 249 ? 10.535  77.308  52.265  1.00   26.79 ? 356 LEU C CB  1 
ATOM   8981  C  CG  . LEU C  1 249 ? 10.396  77.287  53.790  1.00   31.45 ? 356 LEU C CG  1 
ATOM   8982  C  CD1 . LEU C  1 249 ? 9.241   76.384  54.213  1.00   25.56 ? 356 LEU C CD1 1 
ATOM   8983  C  CD2 . LEU C  1 249 ? 11.707  76.788  54.392  1.00   30.69 ? 356 LEU C CD2 1 
ATOM   8984  N  N   . ARG C  1 250 ? 8.516   79.771  52.513  1.00   24.36 ? 357 ARG C N   1 
ATOM   8985  C  CA  . ARG C  1 250 ? 8.285   81.205  52.691  1.00   25.15 ? 357 ARG C CA  1 
ATOM   8986  C  C   . ARG C  1 250 ? 7.369   81.741  51.605  1.00   26.16 ? 357 ARG C C   1 
ATOM   8987  O  O   . ARG C  1 250 ? 7.531   82.855  51.116  1.00   26.81 ? 357 ARG C O   1 
ATOM   8988  C  CB  . ARG C  1 250 ? 9.606   81.981  52.729  1.00   22.63 ? 357 ARG C CB  1 
ATOM   8989  C  CG  . ARG C  1 250 ? 10.514  81.545  53.885  1.00   25.88 ? 357 ARG C CG  1 
ATOM   8990  C  CD  . ARG C  1 250 ? 11.844  82.283  53.889  1.00   28.48 ? 357 ARG C CD  1 
ATOM   8991  N  NE  . ARG C  1 250 ? 12.821  81.727  54.832  1.00   32.27 ? 357 ARG C NE  1 
ATOM   8992  C  CZ  . ARG C  1 250 ? 12.722  81.770  56.164  1.00   36.11 ? 357 ARG C CZ  1 
ATOM   8993  N  NH1 . ARG C  1 250 ? 13.680  81.228  56.912  1.00   35.20 ? 357 ARG C NH1 1 
ATOM   8994  N  NH2 . ARG C  1 250 ? 11.678  82.347  56.756  1.00   34.94 ? 357 ARG C NH2 1 
ATOM   8995  N  N   . GLN C  1 251 ? 6.402   80.909  51.235  1.00   27.23 ? 358 GLN C N   1 
ATOM   8996  C  CA  . GLN C  1 251 ? 5.391   81.245  50.243  1.00   30.07 ? 358 GLN C CA  1 
ATOM   8997  C  C   . GLN C  1 251 ? 5.927   81.708  48.894  1.00   30.00 ? 358 GLN C C   1 
ATOM   8998  O  O   . GLN C  1 251 ? 5.339   82.561  48.241  1.00   30.79 ? 358 GLN C O   1 
ATOM   8999  C  CB  . GLN C  1 251 ? 4.457   82.293  50.854  1.00   31.91 ? 358 GLN C CB  1 
ATOM   9000  C  CG  . GLN C  1 251 ? 3.897   81.800  52.191  1.00   35.86 ? 358 GLN C CG  1 
ATOM   9001  C  CD  . GLN C  1 251 ? 2.998   82.797  52.902  1.00   37.09 ? 358 GLN C CD  1 
ATOM   9002  O  OE1 . GLN C  1 251 ? 1.832   82.978  52.550  1.00   36.89 ? 358 GLN C OE1 1 
ATOM   9003  N  NE2 . GLN C  1 251 ? 3.544   83.449  53.915  1.00   43.01 ? 358 GLN C NE2 1 
ATOM   9004  N  N   . LYS C  1 252 ? 7.038   81.123  48.472  1.00   29.62 ? 359 LYS C N   1 
ATOM   9005  C  CA  . LYS C  1 252 ? 7.635   81.485  47.202  1.00   30.87 ? 359 LYS C CA  1 
ATOM   9006  C  C   . LYS C  1 252 ? 7.397   80.431  46.140  1.00   30.45 ? 359 LYS C C   1 
ATOM   9007  O  O   . LYS C  1 252 ? 6.782   79.398  46.382  1.00   29.33 ? 359 LYS C O   1 
ATOM   9008  C  CB  . LYS C  1 252 ? 9.134   81.711  47.371  1.00   32.54 ? 359 LYS C CB  1 
ATOM   9009  C  CG  . LYS C  1 252 ? 9.441   82.784  48.385  1.00   36.38 ? 359 LYS C CG  1 
ATOM   9010  C  CD  . LYS C  1 252 ? 10.904  83.146  48.392  1.00   41.07 ? 359 LYS C CD  1 
ATOM   9011  C  CE  . LYS C  1 252 ? 11.134  84.355  49.282  1.00   44.98 ? 359 LYS C CE  1 
ATOM   9012  N  NZ  . LYS C  1 252 ? 12.503  84.923  49.109  1.00   50.11 ? 359 LYS C NZ  1 
ATOM   9013  N  N   . CYS C  1 253 ? 7.889   80.718  44.949  1.00   29.98 ? 360 CYS C N   1 
ATOM   9014  C  CA  . CYS C  1 253 ? 7.750   79.823  43.824  1.00   30.41 ? 360 CYS C CA  1 
ATOM   9015  C  C   . CYS C  1 253 ? 9.165   79.581  43.327  1.00   29.62 ? 360 CYS C C   1 
ATOM   9016  O  O   . CYS C  1 253 ? 9.961   80.515  43.257  1.00   31.68 ? 360 CYS C O   1 
ATOM   9017  C  CB  . CYS C  1 253 ? 6.895   80.512  42.760  1.00   31.70 ? 360 CYS C CB  1 
ATOM   9018  S  SG  . CYS C  1 253 ? 6.423   79.505  41.325  1.00   45.78 ? 360 CYS C SG  1 
ATOM   9019  N  N   . THR C  1 254 ? 9.506   78.334  43.029  1.00   26.13 ? 361 THR C N   1 
ATOM   9020  C  CA  . THR C  1 254 ? 10.843  78.050  42.522  1.00   23.26 ? 361 THR C CA  1 
ATOM   9021  C  C   . THR C  1 254 ? 10.764  77.351  41.173  1.00   23.87 ? 361 THR C C   1 
ATOM   9022  O  O   . THR C  1 254 ? 9.790   76.673  40.873  1.00   22.89 ? 361 THR C O   1 
ATOM   9023  C  CB  . THR C  1 254 ? 11.652  77.151  43.472  1.00   20.60 ? 361 THR C CB  1 
ATOM   9024  O  OG1 . THR C  1 254 ? 12.951  76.957  42.916  1.00   22.29 ? 361 THR C OG1 1 
ATOM   9025  C  CG2 . THR C  1 254 ? 10.991  75.778  43.643  1.00   18.34 ? 361 THR C CG2 1 
ATOM   9026  N  N   . GLU C  1 255 ? 11.798  77.525  40.364  1.00   22.90 ? 362 GLU C N   1 
ATOM   9027  C  CA  . GLU C  1 255 ? 11.853  76.905  39.056  1.00   23.90 ? 362 GLU C CA  1 
ATOM   9028  C  C   . GLU C  1 255 ? 13.065  76.003  39.027  1.00   23.31 ? 362 GLU C C   1 
ATOM   9029  O  O   . GLU C  1 255 ? 13.482  75.524  37.965  1.00   20.76 ? 362 GLU C O   1 
ATOM   9030  C  CB  . GLU C  1 255 ? 11.974  77.976  37.973  1.00   27.40 ? 362 GLU C CB  1 
ATOM   9031  C  CG  . GLU C  1 255 ? 10.720  78.816  37.848  1.00   34.68 ? 362 GLU C CG  1 
ATOM   9032  C  CD  . GLU C  1 255 ? 10.887  79.972  36.889  1.00   41.21 ? 362 GLU C CD  1 
ATOM   9033  O  OE1 . GLU C  1 255 ? 11.241  79.728  35.715  1.00   40.91 ? 362 GLU C OE1 1 
ATOM   9034  O  OE2 . GLU C  1 255 ? 10.658  81.126  37.315  1.00   47.70 ? 362 GLU C OE2 1 
ATOM   9035  N  N   . SER C  1 256 ? 13.635  75.767  40.203  1.00   20.36 ? 363 SER C N   1 
ATOM   9036  C  CA  . SER C  1 256 ? 14.813  74.931  40.266  1.00   22.15 ? 363 SER C CA  1 
ATOM   9037  C  C   . SER C  1 256 ? 14.772  73.800  41.285  1.00   22.81 ? 363 SER C C   1 
ATOM   9038  O  O   . SER C  1 256 ? 15.715  73.615  42.051  1.00   21.80 ? 363 SER C O   1 
ATOM   9039  C  CB  . SER C  1 256 ? 16.042  75.808  40.487  1.00   24.10 ? 363 SER C CB  1 
ATOM   9040  O  OG  . SER C  1 256 ? 15.747  76.814  41.424  1.00   28.47 ? 363 SER C OG  1 
ATOM   9041  N  N   . HIS C  1 257 ? 13.670  73.050  41.303  1.00   21.77 ? 364 HIS C N   1 
ATOM   9042  C  CA  . HIS C  1 257 ? 13.569  71.889  42.178  1.00   21.40 ? 364 HIS C CA  1 
ATOM   9043  C  C   . HIS C  1 257 ? 14.278  70.826  41.317  1.00   22.89 ? 364 HIS C C   1 
ATOM   9044  O  O   . HIS C  1 257 ? 14.020  70.728  40.112  1.00   23.17 ? 364 HIS C O   1 
ATOM   9045  C  CB  . HIS C  1 257 ? 12.105  71.557  42.450  1.00   21.95 ? 364 HIS C CB  1 
ATOM   9046  C  CG  . HIS C  1 257 ? 11.907  70.391  43.369  1.00   21.24 ? 364 HIS C CG  1 
ATOM   9047  N  ND1 . HIS C  1 257 ? 12.790  70.083  44.383  1.00   21.66 ? 364 HIS C ND1 1 
ATOM   9048  C  CD2 . HIS C  1 257 ? 10.931  69.453  43.421  1.00   20.63 ? 364 HIS C CD2 1 
ATOM   9049  C  CE1 . HIS C  1 257 ? 12.369  69.000  45.014  1.00   20.86 ? 364 HIS C CE1 1 
ATOM   9050  N  NE2 . HIS C  1 257 ? 11.244  68.598  44.452  1.00   20.41 ? 364 HIS C NE2 1 
ATOM   9051  N  N   . THR C  1 258 ? 15.169  70.041  41.922  1.00   22.12 ? 365 THR C N   1 
ATOM   9052  C  CA  . THR C  1 258 ? 15.989  69.103  41.155  1.00   20.48 ? 365 THR C CA  1 
ATOM   9053  C  C   . THR C  1 258 ? 16.150  67.690  41.689  1.00   21.02 ? 365 THR C C   1 
ATOM   9054  O  O   . THR C  1 258 ? 15.638  67.340  42.742  1.00   21.38 ? 365 THR C O   1 
ATOM   9055  C  CB  . THR C  1 258 ? 17.419  69.657  41.042  1.00   21.94 ? 365 THR C CB  1 
ATOM   9056  O  OG1 . THR C  1 258 ? 17.987  69.703  42.364  1.00   23.36 ? 365 THR C OG1 1 
ATOM   9057  C  CG2 . THR C  1 258 ? 17.421  71.090  40.472  1.00   17.52 ? 365 THR C CG2 1 
ATOM   9058  N  N   . GLY C  1 259 ? 16.907  66.894  40.938  1.00   20.21 ? 366 GLY C N   1 
ATOM   9059  C  CA  . GLY C  1 259 ? 17.217  65.530  41.323  1.00   20.81 ? 366 GLY C CA  1 
ATOM   9060  C  C   . GLY C  1 259 ? 16.095  64.517  41.420  1.00   23.85 ? 366 GLY C C   1 
ATOM   9061  O  O   . GLY C  1 259 ? 14.948  64.759  41.025  1.00   23.42 ? 366 GLY C O   1 
ATOM   9062  N  N   . THR C  1 260 ? 16.450  63.366  41.973  1.00   21.53 ? 367 THR C N   1 
ATOM   9063  C  CA  . THR C  1 260 ? 15.526  62.264  42.165  1.00   21.02 ? 367 THR C CA  1 
ATOM   9064  C  C   . THR C  1 260 ? 14.323  62.715  43.005  1.00   20.90 ? 367 THR C C   1 
ATOM   9065  O  O   . THR C  1 260 ? 13.210  62.226  42.832  1.00   20.49 ? 367 THR C O   1 
ATOM   9066  C  CB  . THR C  1 260 ? 16.261  61.054  42.855  1.00   22.49 ? 367 THR C CB  1 
ATOM   9067  O  OG1 . THR C  1 260 ? 15.387  59.929  42.902  1.00   23.53 ? 367 THR C OG1 1 
ATOM   9068  C  CG2 . THR C  1 260 ? 16.685  61.404  44.283  1.00   20.71 ? 367 THR C CG2 1 
ATOM   9069  N  N   . SER C  1 261 ? 14.541  63.668  43.903  1.00   20.63 ? 368 SER C N   1 
ATOM   9070  C  CA  . SER C  1 261 ? 13.460  64.162  44.752  1.00   20.45 ? 368 SER C CA  1 
ATOM   9071  C  C   . SER C  1 261 ? 12.247  64.651  43.986  1.00   19.76 ? 368 SER C C   1 
ATOM   9072  O  O   . SER C  1 261 ? 11.121  64.549  44.473  1.00   19.63 ? 368 SER C O   1 
ATOM   9073  C  CB  . SER C  1 261 ? 13.941  65.317  45.629  1.00   20.49 ? 368 SER C CB  1 
ATOM   9074  O  OG  . SER C  1 261 ? 14.918  64.904  46.556  1.00   24.05 ? 368 SER C OG  1 
ATOM   9075  N  N   . ALA C  1 262 ? 12.474  65.198  42.797  1.00   18.37 ? 369 ALA C N   1 
ATOM   9076  C  CA  . ALA C  1 262 ? 11.385  65.752  42.008  1.00   19.43 ? 369 ALA C CA  1 
ATOM   9077  C  C   . ALA C  1 262 ? 10.619  64.736  41.169  1.00   21.34 ? 369 ALA C C   1 
ATOM   9078  O  O   . ALA C  1 262 ? 9.510   65.012  40.721  1.00   20.74 ? 369 ALA C O   1 
ATOM   9079  C  CB  . ALA C  1 262 ? 11.921  66.868  41.112  1.00   17.72 ? 369 ALA C CB  1 
ATOM   9080  N  N   . SER C  1 263 ? 11.195  63.561  40.956  1.00   20.90 ? 370 SER C N   1 
ATOM   9081  C  CA  . SER C  1 263 ? 10.526  62.566  40.138  1.00   19.32 ? 370 SER C CA  1 
ATOM   9082  C  C   . SER C  1 263 ? 9.396   61.813  40.832  1.00   20.43 ? 370 SER C C   1 
ATOM   9083  O  O   . SER C  1 263 ? 8.314   61.658  40.265  1.00   21.27 ? 370 SER C O   1 
ATOM   9084  C  CB  . SER C  1 263 ? 11.553  61.578  39.579  1.00   20.03 ? 370 SER C CB  1 
ATOM   9085  O  OG  . SER C  1 263 ? 12.289  62.166  38.524  1.00   20.76 ? 370 SER C OG  1 
ATOM   9086  N  N   . ALA C  1 264 ? 9.628   61.354  42.055  1.00   21.23 ? 371 ALA C N   1 
ATOM   9087  C  CA  . ALA C  1 264 ? 8.600   60.605  42.785  1.00   19.64 ? 371 ALA C CA  1 
ATOM   9088  C  C   . ALA C  1 264 ? 7.274   61.346  42.941  1.00   17.66 ? 371 ALA C C   1 
ATOM   9089  O  O   . ALA C  1 264 ? 6.204   60.774  42.707  1.00   19.11 ? 371 ALA C O   1 
ATOM   9090  C  CB  . ALA C  1 264 ? 9.130   60.182  44.160  1.00   18.40 ? 371 ALA C CB  1 
ATOM   9091  N  N   . PRO C  1 265 ? 7.317   62.629  43.339  1.00   17.31 ? 372 PRO C N   1 
ATOM   9092  C  CA  . PRO C  1 265 ? 6.067   63.388  43.502  1.00   15.41 ? 372 PRO C CA  1 
ATOM   9093  C  C   . PRO C  1 265 ? 5.239   63.440  42.207  1.00   16.51 ? 372 PRO C C   1 
ATOM   9094  O  O   . PRO C  1 265 ? 4.010   63.335  42.238  1.00   16.44 ? 372 PRO C O   1 
ATOM   9095  C  CB  . PRO C  1 265 ? 6.554   64.773  43.926  1.00   16.87 ? 372 PRO C CB  1 
ATOM   9096  C  CG  . PRO C  1 265 ? 7.859   64.478  44.628  1.00   18.17 ? 372 PRO C CG  1 
ATOM   9097  C  CD  . PRO C  1 265 ? 8.484   63.450  43.709  1.00   15.14 ? 372 PRO C CD  1 
ATOM   9098  N  N   . LEU C  1 266 ? 5.906   63.606  41.067  1.00   16.62 ? 373 LEU C N   1 
ATOM   9099  C  CA  . LEU C  1 266 ? 5.192   63.650  39.789  1.00   16.36 ? 373 LEU C CA  1 
ATOM   9100  C  C   . LEU C  1 266 ? 4.524   62.310  39.547  1.00   15.73 ? 373 LEU C C   1 
ATOM   9101  O  O   . LEU C  1 266 ? 3.394   62.241  39.057  1.00   18.46 ? 373 LEU C O   1 
ATOM   9102  C  CB  . LEU C  1 266 ? 6.149   63.972  38.648  1.00   14.19 ? 373 LEU C CB  1 
ATOM   9103  C  CG  . LEU C  1 266 ? 6.724   65.386  38.755  1.00   12.73 ? 373 LEU C CG  1 
ATOM   9104  C  CD1 . LEU C  1 266 ? 7.788   65.582  37.689  1.00   5.74  ? 373 LEU C CD1 1 
ATOM   9105  C  CD2 . LEU C  1 266 ? 5.593   66.425  38.627  1.00   9.66  ? 373 LEU C CD2 1 
ATOM   9106  N  N   . ALA C  1 267 ? 5.214   61.238  39.914  1.00   14.13 ? 374 ALA C N   1 
ATOM   9107  C  CA  . ALA C  1 267 ? 4.636   59.910  39.751  1.00   14.11 ? 374 ALA C CA  1 
ATOM   9108  C  C   . ALA C  1 267 ? 3.455   59.766  40.713  1.00   14.55 ? 374 ALA C C   1 
ATOM   9109  O  O   . ALA C  1 267 ? 2.409   59.226  40.352  1.00   15.87 ? 374 ALA C O   1 
ATOM   9110  C  CB  . ALA C  1 267 ? 5.684   58.842  40.016  1.00   9.87  ? 374 ALA C CB  1 
ATOM   9111  N  N   . ALA C  1 268 ? 3.612   60.269  41.933  1.00   15.60 ? 375 ALA C N   1 
ATOM   9112  C  CA  . ALA C  1 268 ? 2.535   60.179  42.908  1.00   16.45 ? 375 ALA C CA  1 
ATOM   9113  C  C   . ALA C  1 268 ? 1.298   60.912  42.387  1.00   18.19 ? 375 ALA C C   1 
ATOM   9114  O  O   . ALA C  1 268 ? 0.158   60.459  42.581  1.00   19.89 ? 375 ALA C O   1 
ATOM   9115  C  CB  . ALA C  1 268 ? 2.975   60.769  44.231  1.00   14.03 ? 375 ALA C CB  1 
ATOM   9116  N  N   . GLY C  1 269 ? 1.517   62.048  41.729  1.00   17.61 ? 376 GLY C N   1 
ATOM   9117  C  CA  . GLY C  1 269 ? 0.391   62.802  41.196  1.00   18.93 ? 376 GLY C CA  1 
ATOM   9118  C  C   . GLY C  1 269 ? -0.321  62.063  40.073  1.00   19.01 ? 376 GLY C C   1 
ATOM   9119  O  O   . GLY C  1 269 ? -1.550  62.025  40.016  1.00   21.30 ? 376 GLY C O   1 
ATOM   9120  N  N   . ILE C  1 270 ? 0.450   61.467  39.171  1.00   17.36 ? 377 ILE C N   1 
ATOM   9121  C  CA  . ILE C  1 270 ? -0.141  60.735  38.067  1.00   16.58 ? 377 ILE C CA  1 
ATOM   9122  C  C   . ILE C  1 270 ? -0.939  59.554  38.609  1.00   18.50 ? 377 ILE C C   1 
ATOM   9123  O  O   . ILE C  1 270 ? -2.020  59.230  38.108  1.00   17.73 ? 377 ILE C O   1 
ATOM   9124  C  CB  . ILE C  1 270 ? 0.957   60.274  37.083  1.00   17.05 ? 377 ILE C CB  1 
ATOM   9125  C  CG1 . ILE C  1 270 ? 1.513   61.522  36.377  1.00   13.91 ? 377 ILE C CG1 1 
ATOM   9126  C  CG2 . ILE C  1 270 ? 0.400   59.237  36.086  1.00   12.01 ? 377 ILE C CG2 1 
ATOM   9127  C  CD1 . ILE C  1 270 ? 2.621   61.284  35.398  1.00   13.53 ? 377 ILE C CD1 1 
ATOM   9128  N  N   . ILE C  1 271 ? -0.410  58.919  39.647  1.00   18.59 ? 378 ILE C N   1 
ATOM   9129  C  CA  . ILE C  1 271 ? -1.091  57.789  40.257  1.00   20.37 ? 378 ILE C CA  1 
ATOM   9130  C  C   . ILE C  1 271 ? -2.381  58.270  40.926  1.00   21.66 ? 378 ILE C C   1 
ATOM   9131  O  O   . ILE C  1 271 ? -3.373  57.541  40.972  1.00   21.43 ? 378 ILE C O   1 
ATOM   9132  C  CB  . ILE C  1 271 ? -0.168  57.077  41.272  1.00   17.89 ? 378 ILE C CB  1 
ATOM   9133  C  CG1 . ILE C  1 271 ? 0.967   56.386  40.509  1.00   18.24 ? 378 ILE C CG1 1 
ATOM   9134  C  CG2 . ILE C  1 271 ? -0.954  56.063  42.080  1.00   15.83 ? 378 ILE C CG2 1 
ATOM   9135  C  CD1 . ILE C  1 271 ? 2.105   55.914  41.372  1.00   15.13 ? 378 ILE C CD1 1 
ATOM   9136  N  N   . ALA C  1 272 ? -2.371  59.506  41.422  1.00   20.84 ? 379 ALA C N   1 
ATOM   9137  C  CA  . ALA C  1 272 ? -3.562  60.073  42.050  1.00   20.49 ? 379 ALA C CA  1 
ATOM   9138  C  C   . ALA C  1 272 ? -4.650  60.241  40.980  1.00   21.88 ? 379 ALA C C   1 
ATOM   9139  O  O   . ALA C  1 272 ? -5.828  59.998  41.232  1.00   23.31 ? 379 ALA C O   1 
ATOM   9140  C  CB  . ALA C  1 272 ? -3.235  61.428  42.689  1.00   18.47 ? 379 ALA C CB  1 
ATOM   9141  N  N   . LEU C  1 273 ? -4.257  60.661  39.783  1.00   20.12 ? 380 LEU C N   1 
ATOM   9142  C  CA  . LEU C  1 273 ? -5.226  60.820  38.714  1.00   20.29 ? 380 LEU C CA  1 
ATOM   9143  C  C   . LEU C  1 273 ? -5.772  59.442  38.345  1.00   21.09 ? 380 LEU C C   1 
ATOM   9144  O  O   . LEU C  1 273 ? -6.957  59.288  38.031  1.00   21.40 ? 380 LEU C O   1 
ATOM   9145  C  CB  . LEU C  1 273 ? -4.574  61.441  37.477  1.00   15.81 ? 380 LEU C CB  1 
ATOM   9146  C  CG  . LEU C  1 273 ? -3.955  62.842  37.515  1.00   19.54 ? 380 LEU C CG  1 
ATOM   9147  C  CD1 . LEU C  1 273 ? -3.417  63.197  36.104  1.00   17.97 ? 380 LEU C CD1 1 
ATOM   9148  C  CD2 . LEU C  1 273 ? -4.987  63.867  37.971  1.00   16.60 ? 380 LEU C CD2 1 
ATOM   9149  N  N   . THR C  1 274 ? -4.900  58.438  38.393  1.00   19.68 ? 381 THR C N   1 
ATOM   9150  C  CA  . THR C  1 274 ? -5.292  57.085  38.030  1.00   17.56 ? 381 THR C CA  1 
ATOM   9151  C  C   . THR C  1 274 ? -6.290  56.502  39.014  1.00   17.88 ? 381 THR C C   1 
ATOM   9152  O  O   . THR C  1 274 ? -7.238  55.826  38.612  1.00   17.55 ? 381 THR C O   1 
ATOM   9153  C  CB  . THR C  1 274 ? -4.051  56.178  37.917  1.00   17.97 ? 381 THR C CB  1 
ATOM   9154  O  OG1 . THR C  1 274 ? -3.057  56.851  37.128  1.00   18.32 ? 381 THR C OG1 1 
ATOM   9155  C  CG2 . THR C  1 274 ? -4.399  54.865  37.224  1.00   15.24 ? 381 THR C CG2 1 
ATOM   9156  N  N   . LEU C  1 275 ? -6.088  56.763  40.301  1.00   18.50 ? 382 LEU C N   1 
ATOM   9157  C  CA  . LEU C  1 275 ? -7.015  56.260  41.307  1.00   19.85 ? 382 LEU C CA  1 
ATOM   9158  C  C   . LEU C  1 275 ? -8.375  56.932  41.152  1.00   20.88 ? 382 LEU C C   1 
ATOM   9159  O  O   . LEU C  1 275 ? -9.407  56.311  41.409  1.00   20.32 ? 382 LEU C O   1 
ATOM   9160  C  CB  . LEU C  1 275 ? -6.484  56.511  42.720  1.00   21.31 ? 382 LEU C CB  1 
ATOM   9161  C  CG  . LEU C  1 275 ? -5.560  55.446  43.312  1.00   25.51 ? 382 LEU C CG  1 
ATOM   9162  C  CD1 . LEU C  1 275 ? -5.241  55.799  44.761  1.00   23.26 ? 382 LEU C CD1 1 
ATOM   9163  C  CD2 . LEU C  1 275 ? -6.237  54.080  43.240  1.00   22.95 ? 382 LEU C CD2 1 
ATOM   9164  N  N   . GLU C  1 276 ? -8.389  58.201  40.742  1.00   20.59 ? 383 GLU C N   1 
ATOM   9165  C  CA  . GLU C  1 276 ? -9.677  58.875  40.569  1.00   22.57 ? 383 GLU C CA  1 
ATOM   9166  C  C   . GLU C  1 276 ? -10.419 58.191  39.428  1.00   21.81 ? 383 GLU C C   1 
ATOM   9167  O  O   . GLU C  1 276 ? -11.633 58.027  39.484  1.00   21.89 ? 383 GLU C O   1 
ATOM   9168  C  CB  . GLU C  1 276 ? -9.509  60.369  40.262  1.00   23.10 ? 383 GLU C CB  1 
ATOM   9169  C  CG  . GLU C  1 276 ? -10.821 61.031  39.832  1.00   24.75 ? 383 GLU C CG  1 
ATOM   9170  C  CD  . GLU C  1 276 ? -10.707 62.538  39.607  1.00   27.64 ? 383 GLU C CD  1 
ATOM   9171  O  OE1 . GLU C  1 276 ? -9.619  63.032  39.237  1.00   26.84 ? 383 GLU C OE1 1 
ATOM   9172  O  OE2 . GLU C  1 276 ? -11.730 63.227  39.786  1.00   29.25 ? 383 GLU C OE2 1 
ATOM   9173  N  N   . ALA C  1 277 ? -9.683  57.787  38.397  1.00   19.70 ? 384 ALA C N   1 
ATOM   9174  C  CA  . ALA C  1 277 ? -10.286 57.097  37.261  1.00   18.87 ? 384 ALA C CA  1 
ATOM   9175  C  C   . ALA C  1 277 ? -10.797 55.709  37.669  1.00   19.74 ? 384 ALA C C   1 
ATOM   9176  O  O   . ALA C  1 277 ? -11.695 55.178  37.034  1.00   20.28 ? 384 ALA C O   1 
ATOM   9177  C  CB  . ALA C  1 277 ? -9.279  56.956  36.139  1.00   15.18 ? 384 ALA C CB  1 
ATOM   9178  N  N   . ASN C  1 278 ? -10.213 55.118  38.708  1.00   18.05 ? 385 ASN C N   1 
ATOM   9179  C  CA  . ASN C  1 278 ? -10.637 53.798  39.174  1.00   18.27 ? 385 ASN C CA  1 
ATOM   9180  C  C   . ASN C  1 278 ? -10.173 53.606  40.610  1.00   20.13 ? 385 ASN C C   1 
ATOM   9181  O  O   . ASN C  1 278 ? -9.048  53.158  40.867  1.00   20.70 ? 385 ASN C O   1 
ATOM   9182  C  CB  . ASN C  1 278 ? -10.039 52.700  38.299  1.00   17.30 ? 385 ASN C CB  1 
ATOM   9183  C  CG  . ASN C  1 278 ? -10.589 51.323  38.630  1.00   21.49 ? 385 ASN C CG  1 
ATOM   9184  O  OD1 . ASN C  1 278 ? -11.128 51.078  39.721  1.00   19.91 ? 385 ASN C OD1 1 
ATOM   9185  N  ND2 . ASN C  1 278 ? -10.439 50.404  37.686  1.00   20.99 ? 385 ASN C ND2 1 
ATOM   9186  N  N   . LYS C  1 279 ? -11.055 53.934  41.542  1.00   20.17 ? 386 LYS C N   1 
ATOM   9187  C  CA  . LYS C  1 279 ? -10.756 53.827  42.956  1.00   21.30 ? 386 LYS C CA  1 
ATOM   9188  C  C   . LYS C  1 279 ? -10.612 52.413  43.483  1.00   22.68 ? 386 LYS C C   1 
ATOM   9189  O  O   . LYS C  1 279 ? -10.199 52.230  44.626  1.00   23.77 ? 386 LYS C O   1 
ATOM   9190  C  CB  . LYS C  1 279 ? -11.836 54.554  43.760  1.00   23.34 ? 386 LYS C CB  1 
ATOM   9191  C  CG  . LYS C  1 279 ? -11.833 56.066  43.559  1.00   25.43 ? 386 LYS C CG  1 
ATOM   9192  C  CD  . LYS C  1 279 ? -13.027 56.724  44.253  1.00   30.91 ? 386 LYS C CD  1 
ATOM   9193  C  CE  . LYS C  1 279 ? -13.049 58.229  44.050  0.0000 29.11 ? 386 LYS C CE  1 
ATOM   9194  N  NZ  . LYS C  1 279 ? -11.906 58.896  44.729  0.0000 29.84 ? 386 LYS C NZ  1 
ATOM   9195  N  N   . ASN C  1 280 ? -10.948 51.413  42.674  1.00   22.22 ? 387 ASN C N   1 
ATOM   9196  C  CA  . ASN C  1 280 ? -10.853 50.027  43.142  1.00   26.66 ? 387 ASN C CA  1 
ATOM   9197  C  C   . ASN C  1 280 ? -9.546  49.316  42.795  1.00   21.39 ? 387 ASN C C   1 
ATOM   9198  O  O   . ASN C  1 280 ? -9.400  48.122  43.053  1.00   19.71 ? 387 ASN C O   1 
ATOM   9199  C  CB  . ASN C  1 280 ? -12.038 49.212  42.611  1.00   33.54 ? 387 ASN C CB  1 
ATOM   9200  C  CG  . ASN C  1 280 ? -13.339 49.557  43.310  1.00   42.89 ? 387 ASN C CG  1 
ATOM   9201  O  OD1 . ASN C  1 280 ? -14.426 49.355  42.756  1.00   52.74 ? 387 ASN C OD1 1 
ATOM   9202  N  ND2 . ASN C  1 280 ? -13.242 50.064  44.542  1.00   44.66 ? 387 ASN C ND2 1 
ATOM   9203  N  N   . LEU C  1 281 ? -8.602  50.049  42.217  1.00   18.84 ? 388 LEU C N   1 
ATOM   9204  C  CA  . LEU C  1 281 ? -7.323  49.463  41.850  1.00   19.77 ? 388 LEU C CA  1 
ATOM   9205  C  C   . LEU C  1 281 ? -6.552  49.078  43.106  1.00   19.90 ? 388 LEU C C   1 
ATOM   9206  O  O   . LEU C  1 281 ? -6.496  49.848  44.066  1.00   18.64 ? 388 LEU C O   1 
ATOM   9207  C  CB  . LEU C  1 281 ? -6.493  50.462  41.030  1.00   17.58 ? 388 LEU C CB  1 
ATOM   9208  C  CG  . LEU C  1 281 ? -7.055  50.875  39.669  1.00   18.15 ? 388 LEU C CG  1 
ATOM   9209  C  CD1 . LEU C  1 281 ? -6.202  52.003  39.086  1.00   17.99 ? 388 LEU C CD1 1 
ATOM   9210  C  CD2 . LEU C  1 281 ? -7.085  49.671  38.739  1.00   16.71 ? 388 LEU C CD2 1 
ATOM   9211  N  N   . THR C  1 282 ? -5.961  47.889  43.107  1.00   18.46 ? 389 THR C N   1 
ATOM   9212  C  CA  . THR C  1 282 ? -5.165  47.449  44.256  1.00   17.63 ? 389 THR C CA  1 
ATOM   9213  C  C   . THR C  1 282 ? -3.735  47.956  44.062  1.00   17.55 ? 389 THR C C   1 
ATOM   9214  O  O   . THR C  1 282 ? -3.384  48.484  42.996  1.00   16.37 ? 389 THR C O   1 
ATOM   9215  C  CB  . THR C  1 282 ? -5.114  45.921  44.339  1.00   17.28 ? 389 THR C CB  1 
ATOM   9216  O  OG1 . THR C  1 282 ? -4.418  45.415  43.198  1.00   16.73 ? 389 THR C OG1 1 
ATOM   9217  C  CG2 . THR C  1 282 ? -6.528  45.348  44.333  1.00   16.23 ? 389 THR C CG2 1 
ATOM   9218  N  N   . TRP C  1 283 ? -2.905  47.799  45.086  1.00   16.01 ? 390 TRP C N   1 
ATOM   9219  C  CA  . TRP C  1 283 ? -1.523  48.245  44.981  1.00   15.44 ? 390 TRP C CA  1 
ATOM   9220  C  C   . TRP C  1 283 ? -0.816  47.491  43.856  1.00   14.88 ? 390 TRP C C   1 
ATOM   9221  O  O   . TRP C  1 283 ? 0.096   48.027  43.233  1.00   18.44 ? 390 TRP C O   1 
ATOM   9222  C  CB  . TRP C  1 283 ? -0.780  48.048  46.312  1.00   14.70 ? 390 TRP C CB  1 
ATOM   9223  C  CG  . TRP C  1 283 ? -0.581  46.611  46.707  1.00   15.69 ? 390 TRP C CG  1 
ATOM   9224  C  CD1 . TRP C  1 283 ? -1.507  45.772  47.263  1.00   19.58 ? 390 TRP C CD1 1 
ATOM   9225  C  CD2 . TRP C  1 283 ? 0.627   45.848  46.589  1.00   18.58 ? 390 TRP C CD2 1 
ATOM   9226  N  NE1 . TRP C  1 283 ? -0.949  44.537  47.508  1.00   17.59 ? 390 TRP C NE1 1 
ATOM   9227  C  CE2 . TRP C  1 283 ? 0.360   44.556  47.103  1.00   17.28 ? 390 TRP C CE2 1 
ATOM   9228  C  CE3 . TRP C  1 283 ? 1.909   46.127  46.096  1.00   14.14 ? 390 TRP C CE3 1 
ATOM   9229  C  CZ2 . TRP C  1 283 ? 1.328   43.552  47.140  1.00   17.73 ? 390 TRP C CZ2 1 
ATOM   9230  C  CZ3 . TRP C  1 283 ? 2.872   45.126  46.131  1.00   14.78 ? 390 TRP C CZ3 1 
ATOM   9231  C  CH2 . TRP C  1 283 ? 2.578   43.857  46.650  1.00   15.22 ? 390 TRP C CH2 1 
ATOM   9232  N  N   . ARG C  1 284 ? -1.227  46.251  43.590  1.00   16.67 ? 391 ARG C N   1 
ATOM   9233  C  CA  . ARG C  1 284 ? -0.607  45.486  42.503  1.00   17.34 ? 391 ARG C CA  1 
ATOM   9234  C  C   . ARG C  1 284 ? -1.170  45.946  41.152  1.00   19.65 ? 391 ARG C C   1 
ATOM   9235  O  O   . ARG C  1 284 ? -0.433  46.048  40.167  1.00   17.56 ? 391 ARG C O   1 
ATOM   9236  C  CB  . ARG C  1 284 ? -0.821  43.984  42.704  1.00   18.64 ? 391 ARG C CB  1 
ATOM   9237  C  CG  . ARG C  1 284 ? 0.262   43.346  43.583  1.00   17.59 ? 391 ARG C CG  1 
ATOM   9238  C  CD  . ARG C  1 284 ? -0.163  41.990  44.112  1.00   19.53 ? 391 ARG C CD  1 
ATOM   9239  N  NE  . ARG C  1 284 ? -0.289  41.003  43.046  1.00   21.20 ? 391 ARG C NE  1 
ATOM   9240  C  CZ  . ARG C  1 284 ? -1.405  40.333  42.760  1.00   22.70 ? 391 ARG C CZ  1 
ATOM   9241  N  NH1 . ARG C  1 284 ? -2.522  40.534  43.454  1.00   21.68 ? 391 ARG C NH1 1 
ATOM   9242  N  NH2 . ARG C  1 284 ? -1.396  39.436  41.786  1.00   21.01 ? 391 ARG C NH2 1 
ATOM   9243  N  N   . ASP C  1 285 ? -2.471  46.241  41.109  1.00   20.04 ? 392 ASP C N   1 
ATOM   9244  C  CA  . ASP C  1 285 ? -3.087  46.715  39.869  1.00   20.72 ? 392 ASP C CA  1 
ATOM   9245  C  C   . ASP C  1 285 ? -2.306  47.940  39.390  1.00   20.24 ? 392 ASP C C   1 
ATOM   9246  O  O   . ASP C  1 285 ? -1.980  48.063  38.206  1.00   19.23 ? 392 ASP C O   1 
ATOM   9247  C  CB  . ASP C  1 285 ? -4.553  47.145  40.079  1.00   19.16 ? 392 ASP C CB  1 
ATOM   9248  C  CG  . ASP C  1 285 ? -5.518  45.973  40.160  1.00   19.80 ? 392 ASP C CG  1 
ATOM   9249  O  OD1 . ASP C  1 285 ? -5.312  44.963  39.438  1.00   21.69 ? 392 ASP C OD1 1 
ATOM   9250  O  OD2 . ASP C  1 285 ? -6.496  46.076  40.933  1.00   21.29 ? 392 ASP C OD2 1 
ATOM   9251  N  N   . MET C  1 286 ? -1.999  48.829  40.330  1.00   17.06 ? 393 MET C N   1 
ATOM   9252  C  CA  . MET C  1 286 ? -1.298  50.060  40.009  1.00   17.75 ? 393 MET C CA  1 
ATOM   9253  C  C   . MET C  1 286 ? 0.046   49.794  39.347  1.00   16.93 ? 393 MET C C   1 
ATOM   9254  O  O   . MET C  1 286 ? 0.400   50.456  38.385  1.00   17.61 ? 393 MET C O   1 
ATOM   9255  C  CB  . MET C  1 286 ? -1.112  50.901  41.271  1.00   16.22 ? 393 MET C CB  1 
ATOM   9256  C  CG  . MET C  1 286 ? -0.686  52.335  41.025  1.00   15.51 ? 393 MET C CG  1 
ATOM   9257  S  SD  . MET C  1 286 ? -1.787  53.234  39.870  1.00   21.08 ? 393 MET C SD  1 
ATOM   9258  C  CE  . MET C  1 286 ? -3.300  53.464  40.845  1.00   14.00 ? 393 MET C CE  1 
ATOM   9259  N  N   . GLN C  1 287 ? 0.796   48.825  39.855  1.00   16.88 ? 394 GLN C N   1 
ATOM   9260  C  CA  . GLN C  1 287 ? 2.079   48.525  39.248  1.00   15.99 ? 394 GLN C CA  1 
ATOM   9261  C  C   . GLN C  1 287 ? 1.897   47.948  37.834  1.00   19.00 ? 394 GLN C C   1 
ATOM   9262  O  O   . GLN C  1 287 ? 2.671   48.264  36.914  1.00   14.76 ? 394 GLN C O   1 
ATOM   9263  C  CB  . GLN C  1 287 ? 2.882   47.593  40.160  1.00   18.21 ? 394 GLN C CB  1 
ATOM   9264  C  CG  . GLN C  1 287 ? 3.341   48.312  41.442  1.00   19.26 ? 394 GLN C CG  1 
ATOM   9265  C  CD  . GLN C  1 287 ? 4.382   47.536  42.232  1.00   20.15 ? 394 GLN C CD  1 
ATOM   9266  O  OE1 . GLN C  1 287 ? 5.245   46.864  41.656  1.00   16.89 ? 394 GLN C OE1 1 
ATOM   9267  N  NE2 . GLN C  1 287 ? 4.325   47.648  43.563  1.00   17.12 ? 394 GLN C NE2 1 
ATOM   9268  N  N   . HIS C  1 288 ? 0.863   47.124  37.652  1.00   16.11 ? 395 HIS C N   1 
ATOM   9269  C  CA  . HIS C  1 288 ? 0.580   46.556  36.343  1.00   15.92 ? 395 HIS C CA  1 
ATOM   9270  C  C   . HIS C  1 288 ? 0.328   47.699  35.344  1.00   15.56 ? 395 HIS C C   1 
ATOM   9271  O  O   . HIS C  1 288 ? 0.881   47.707  34.249  1.00   15.81 ? 395 HIS C O   1 
ATOM   9272  C  CB  . HIS C  1 288 ? -0.655  45.661  36.417  1.00   16.48 ? 395 HIS C CB  1 
ATOM   9273  C  CG  . HIS C  1 288 ? -0.380  44.270  36.904  1.00   20.90 ? 395 HIS C CG  1 
ATOM   9274  N  ND1 . HIS C  1 288 ? 0.092   43.273  36.077  1.00   20.06 ? 395 HIS C ND1 1 
ATOM   9275  C  CD2 . HIS C  1 288 ? -0.540  43.700  38.126  1.00   20.81 ? 395 HIS C CD2 1 
ATOM   9276  C  CE1 . HIS C  1 288 ? 0.204   42.147  36.763  1.00   19.79 ? 395 HIS C CE1 1 
ATOM   9277  N  NE2 . HIS C  1 288 ? -0.173  42.379  38.008  1.00   18.99 ? 395 HIS C NE2 1 
ATOM   9278  N  N   . LEU C  1 289 ? -0.504  48.665  35.730  1.00   15.74 ? 396 LEU C N   1 
ATOM   9279  C  CA  . LEU C  1 289 ? -0.807  49.804  34.863  1.00   19.54 ? 396 LEU C CA  1 
ATOM   9280  C  C   . LEU C  1 289 ? 0.459   50.550  34.439  1.00   19.60 ? 396 LEU C C   1 
ATOM   9281  O  O   . LEU C  1 289 ? 0.617   50.920  33.276  1.00   20.35 ? 396 LEU C O   1 
ATOM   9282  C  CB  . LEU C  1 289 ? -1.761  50.773  35.564  1.00   18.62 ? 396 LEU C CB  1 
ATOM   9283  C  CG  . LEU C  1 289 ? -3.185  50.270  35.822  1.00   21.83 ? 396 LEU C CG  1 
ATOM   9284  C  CD1 . LEU C  1 289 ? -4.047  51.410  36.380  1.00   22.93 ? 396 LEU C CD1 1 
ATOM   9285  C  CD2 . LEU C  1 289 ? -3.789  49.762  34.525  1.00   22.05 ? 396 LEU C CD2 1 
ATOM   9286  N  N   . VAL C  1 290 ? 1.364   50.763  35.391  1.00   19.25 ? 397 VAL C N   1 
ATOM   9287  C  CA  . VAL C  1 290 ? 2.609   51.446  35.100  1.00   17.26 ? 397 VAL C CA  1 
ATOM   9288  C  C   . VAL C  1 290 ? 3.436   50.683  34.074  1.00   15.74 ? 397 VAL C C   1 
ATOM   9289  O  O   . VAL C  1 290 ? 3.911   51.267  33.097  1.00   15.92 ? 397 VAL C O   1 
ATOM   9290  C  CB  . VAL C  1 290 ? 3.441   51.638  36.379  1.00   17.21 ? 397 VAL C CB  1 
ATOM   9291  C  CG1 . VAL C  1 290 ? 4.853   52.149  36.033  1.00   14.53 ? 397 VAL C CG1 1 
ATOM   9292  C  CG2 . VAL C  1 290 ? 2.741   52.620  37.284  1.00   16.97 ? 397 VAL C CG2 1 
ATOM   9293  N  N   . VAL C  1 291 ? 3.605   49.385  34.309  1.00   15.39 ? 398 VAL C N   1 
ATOM   9294  C  CA  . VAL C  1 291 ? 4.373   48.528  33.421  1.00   16.07 ? 398 VAL C CA  1 
ATOM   9295  C  C   . VAL C  1 291 ? 3.820   48.568  32.003  1.00   17.83 ? 398 VAL C C   1 
ATOM   9296  O  O   . VAL C  1 291 ? 4.569   48.694  31.037  1.00   14.53 ? 398 VAL C O   1 
ATOM   9297  C  CB  . VAL C  1 291 ? 4.351   47.052  33.916  1.00   16.89 ? 398 VAL C CB  1 
ATOM   9298  C  CG1 . VAL C  1 291 ? 4.862   46.114  32.822  1.00   13.09 ? 398 VAL C CG1 1 
ATOM   9299  C  CG2 . VAL C  1 291 ? 5.210   46.913  35.180  1.00   17.39 ? 398 VAL C CG2 1 
ATOM   9300  N  N   . GLN C  1 292 ? 2.500   48.468  31.889  1.00   19.86 ? 399 GLN C N   1 
ATOM   9301  C  CA  . GLN C  1 292 ? 1.846   48.445  30.582  1.00   19.40 ? 399 GLN C CA  1 
ATOM   9302  C  C   . GLN C  1 292 ? 1.802   49.745  29.811  1.00   20.81 ? 399 GLN C C   1 
ATOM   9303  O  O   . GLN C  1 292 ? 1.944   49.742  28.593  1.00   20.59 ? 399 GLN C O   1 
ATOM   9304  C  CB  . GLN C  1 292 ? 0.421   47.908  30.723  1.00   20.79 ? 399 GLN C CB  1 
ATOM   9305  C  CG  . GLN C  1 292 ? 0.369   46.407  31.058  1.00   22.40 ? 399 GLN C CG  1 
ATOM   9306  C  CD  . GLN C  1 292 ? -0.983  45.790  30.708  1.00   25.48 ? 399 GLN C CD  1 
ATOM   9307  O  OE1 . GLN C  1 292 ? -1.713  46.327  29.864  1.00   21.68 ? 399 GLN C OE1 1 
ATOM   9308  N  NE2 . GLN C  1 292 ? -1.320  44.656  31.345  1.00   18.75 ? 399 GLN C NE2 1 
ATOM   9309  N  N   . THR C  1 293 ? 1.642   50.861  30.515  1.00   19.01 ? 400 THR C N   1 
ATOM   9310  C  CA  . THR C  1 293 ? 1.525   52.144  29.848  1.00   16.77 ? 400 THR C CA  1 
ATOM   9311  C  C   . THR C  1 293 ? 2.751   53.004  29.725  1.00   17.71 ? 400 THR C C   1 
ATOM   9312  O  O   . THR C  1 293 ? 2.712   53.975  28.979  1.00   19.25 ? 400 THR C O   1 
ATOM   9313  C  CB  . THR C  1 293 ? 0.445   53.002  30.517  1.00   16.94 ? 400 THR C CB  1 
ATOM   9314  O  OG1 . THR C  1 293 ? 0.858   53.336  31.854  1.00   14.13 ? 400 THR C OG1 1 
ATOM   9315  C  CG2 . THR C  1 293 ? -0.874  52.234  30.571  1.00   13.81 ? 400 THR C CG2 1 
ATOM   9316  N  N   . SER C  1 294 ? 3.828   52.689  30.441  1.00   18.89 ? 401 SER C N   1 
ATOM   9317  C  CA  . SER C  1 294 ? 5.018   53.535  30.356  1.00   20.95 ? 401 SER C CA  1 
ATOM   9318  C  C   . SER C  1 294 ? 5.701   53.467  28.991  1.00   23.37 ? 401 SER C C   1 
ATOM   9319  O  O   . SER C  1 294 ? 5.736   52.414  28.345  1.00   25.22 ? 401 SER C O   1 
ATOM   9320  C  CB  . SER C  1 294 ? 5.984   53.197  31.483  1.00   19.89 ? 401 SER C CB  1 
ATOM   9321  O  OG  . SER C  1 294 ? 5.324   53.419  32.715  1.00   17.42 ? 401 SER C OG  1 
ATOM   9322  N  N   . LYS C  1 295 ? 6.217   54.615  28.550  1.00   22.05 ? 402 LYS C N   1 
ATOM   9323  C  CA  . LYS C  1 295 ? 6.845   54.738  27.240  1.00   24.12 ? 402 LYS C CA  1 
ATOM   9324  C  C   . LYS C  1 295 ? 8.353   54.934  27.244  1.00   23.96 ? 402 LYS C C   1 
ATOM   9325  O  O   . LYS C  1 295 ? 8.871   55.856  27.876  1.00   22.56 ? 402 LYS C O   1 
ATOM   9326  C  CB  . LYS C  1 295 ? 6.222   55.916  26.477  1.00   24.08 ? 402 LYS C CB  1 
ATOM   9327  C  CG  . LYS C  1 295 ? 4.695   55.930  26.405  1.00   23.66 ? 402 LYS C CG  1 
ATOM   9328  C  CD  . LYS C  1 295 ? 4.146   54.783  25.565  1.00   23.98 ? 402 LYS C CD  1 
ATOM   9329  C  CE  . LYS C  1 295 ? 2.651   54.982  25.281  1.00   23.30 ? 402 LYS C CE  1 
ATOM   9330  N  NZ  . LYS C  1 295 ? 1.818   55.032  26.518  1.00   20.16 ? 402 LYS C NZ  1 
ATOM   9331  N  N   . PRO C  1 296 ? 9.075   54.070  26.523  1.00   25.33 ? 403 PRO C N   1 
ATOM   9332  C  CA  . PRO C  1 296 ? 10.531  54.171  26.442  1.00   28.98 ? 403 PRO C CA  1 
ATOM   9333  C  C   . PRO C  1 296 ? 10.917  55.248  25.434  1.00   32.19 ? 403 PRO C C   1 
ATOM   9334  O  O   . PRO C  1 296 ? 11.842  56.021  25.662  1.00   32.78 ? 403 PRO C O   1 
ATOM   9335  C  CB  . PRO C  1 296 ? 10.955  52.788  25.960  1.00   28.91 ? 403 PRO C CB  1 
ATOM   9336  C  CG  . PRO C  1 296 ? 9.839   51.899  26.414  1.00   30.08 ? 403 PRO C CG  1 
ATOM   9337  C  CD  . PRO C  1 296 ? 8.629   52.733  26.101  1.00   27.00 ? 403 PRO C CD  1 
ATOM   9338  N  N   . ALA C  1 297 ? 10.188  55.292  24.321  1.00   38.03 ? 404 ALA C N   1 
ATOM   9339  C  CA  . ALA C  1 297 ? 10.448  56.244  23.240  1.00   41.11 ? 404 ALA C CA  1 
ATOM   9340  C  C   . ALA C  1 297 ? 10.890  57.622  23.717  1.00   42.35 ? 404 ALA C C   1 
ATOM   9341  O  O   . ALA C  1 297 ? 10.305  58.193  24.643  1.00   43.83 ? 404 ALA C O   1 
ATOM   9342  C  CB  . ALA C  1 297 ? 9.214   56.371  22.355  1.00   44.21 ? 404 ALA C CB  1 
ATOM   9343  N  N   . HIS C  1 298 ? 11.930  58.135  23.068  1.00   41.85 ? 405 HIS C N   1 
ATOM   9344  C  CA  . HIS C  1 298 ? 12.513  59.444  23.365  1.00   46.87 ? 405 HIS C CA  1 
ATOM   9345  C  C   . HIS C  1 298 ? 13.605  59.410  24.432  1.00   44.60 ? 405 HIS C C   1 
ATOM   9346  O  O   . HIS C  1 298 ? 14.456  60.301  24.475  1.00   50.02 ? 405 HIS C O   1 
ATOM   9347  C  CB  . HIS C  1 298 ? 11.442  60.451  23.798  1.00   51.38 ? 405 HIS C CB  1 
ATOM   9348  C  CG  . HIS C  1 298 ? 10.327  60.617  22.813  1.00   58.89 ? 405 HIS C CG  1 
ATOM   9349  N  ND1 . HIS C  1 298 ? 10.539  60.962  21.496  1.00   61.35 ? 405 HIS C ND1 1 
ATOM   9350  C  CD2 . HIS C  1 298 ? 8.986   60.508  22.963  1.00   59.49 ? 405 HIS C CD2 1 
ATOM   9351  C  CE1 . HIS C  1 298 ? 9.376   61.060  20.876  1.00   62.61 ? 405 HIS C CE1 1 
ATOM   9352  N  NE2 . HIS C  1 298 ? 8.418   60.789  21.744  1.00   62.70 ? 405 HIS C NE2 1 
ATOM   9353  N  N   . LEU C  1 299 ? 13.581  58.398  25.294  1.00   35.07 ? 406 LEU C N   1 
ATOM   9354  C  CA  . LEU C  1 299 ? 14.584  58.277  26.346  1.00   30.32 ? 406 LEU C CA  1 
ATOM   9355  C  C   . LEU C  1 299 ? 15.836  57.572  25.833  1.00   28.41 ? 406 LEU C C   1 
ATOM   9356  O  O   . LEU C  1 299 ? 15.748  56.495  25.257  1.00   28.04 ? 406 LEU C O   1 
ATOM   9357  C  CB  . LEU C  1 299 ? 13.999  57.511  27.535  1.00   28.16 ? 406 LEU C CB  1 
ATOM   9358  C  CG  . LEU C  1 299 ? 13.429  58.317  28.709  1.00   28.49 ? 406 LEU C CG  1 
ATOM   9359  C  CD1 . LEU C  1 299 ? 12.814  59.617  28.228  1.00   26.70 ? 406 LEU C CD1 1 
ATOM   9360  C  CD2 . LEU C  1 299 ? 12.406  57.466  29.445  1.00   23.41 ? 406 LEU C CD2 1 
ATOM   9361  N  N   . ASN C  1 300 ? 17.002  58.178  26.035  1.00   25.76 ? 407 ASN C N   1 
ATOM   9362  C  CA  . ASN C  1 300 ? 18.242  57.577  25.578  1.00   25.49 ? 407 ASN C CA  1 
ATOM   9363  C  C   . ASN C  1 300 ? 18.907  56.780  26.702  1.00   26.41 ? 407 ASN C C   1 
ATOM   9364  O  O   . ASN C  1 300 ? 19.035  57.244  27.840  1.00   22.27 ? 407 ASN C O   1 
ATOM   9365  C  CB  . ASN C  1 300 ? 19.193  58.654  25.058  1.00   27.53 ? 407 ASN C CB  1 
ATOM   9366  C  CG  . ASN C  1 300 ? 18.571  59.467  23.931  1.00   36.16 ? 407 ASN C CG  1 
ATOM   9367  O  OD1 . ASN C  1 300 ? 18.179  58.912  22.890  1.00   34.79 ? 407 ASN C OD1 1 
ATOM   9368  N  ND2 . ASN C  1 300 ? 18.461  60.787  24.133  1.00   33.78 ? 407 ASN C ND2 1 
ATOM   9369  N  N   . ALA C  1 301 ? 19.309  55.561  26.369  1.00   24.53 ? 408 ALA C N   1 
ATOM   9370  C  CA  . ALA C  1 301 ? 19.975  54.680  27.312  1.00   26.31 ? 408 ALA C CA  1 
ATOM   9371  C  C   . ALA C  1 301 ? 20.806  53.672  26.545  1.00   25.22 ? 408 ALA C C   1 
ATOM   9372  O  O   . ALA C  1 301 ? 20.458  53.272  25.438  1.00   26.22 ? 408 ALA C O   1 
ATOM   9373  C  CB  . ALA C  1 301 ? 18.962  53.954  28.191  1.00   22.58 ? 408 ALA C CB  1 
ATOM   9374  N  N   . ASN C  1 302 ? 21.898  53.252  27.161  1.00   25.99 ? 409 ASN C N   1 
ATOM   9375  C  CA  . ASN C  1 302 ? 22.810  52.307  26.550  1.00   26.46 ? 409 ASN C CA  1 
ATOM   9376  C  C   . ASN C  1 302 ? 22.331  50.867  26.732  1.00   25.17 ? 409 ASN C C   1 
ATOM   9377  O  O   . ASN C  1 302 ? 22.823  49.967  26.063  1.00   21.50 ? 409 ASN C O   1 
ATOM   9378  C  CB  . ASN C  1 302 ? 24.186  52.475  27.195  1.00   32.03 ? 409 ASN C CB  1 
ATOM   9379  C  CG  . ASN C  1 302 ? 25.309  51.962  26.328  1.00   36.16 ? 409 ASN C CG  1 
ATOM   9380  O  OD1 . ASN C  1 302 ? 25.266  50.834  25.837  0.0000 34.53 ? 409 ASN C OD1 1 
ATOM   9381  N  ND2 . ASN C  1 302 ? 26.335  52.785  26.143  0.0000 34.53 ? 409 ASN C ND2 1 
ATOM   9382  N  N   . ASP C  1 303 ? 21.357  50.646  27.612  1.00   19.72 ? 410 ASP C N   1 
ATOM   9383  C  CA  . ASP C  1 303 ? 20.918  49.280  27.874  1.00   21.97 ? 410 ASP C CA  1 
ATOM   9384  C  C   . ASP C  1 303 ? 19.472  48.896  27.581  1.00   22.30 ? 410 ASP C C   1 
ATOM   9385  O  O   . ASP C  1 303 ? 18.962  47.961  28.184  1.00   22.89 ? 410 ASP C O   1 
ATOM   9386  C  CB  . ASP C  1 303 ? 21.225  48.914  29.329  1.00   20.37 ? 410 ASP C CB  1 
ATOM   9387  C  CG  . ASP C  1 303 ? 20.358  49.687  30.316  1.00   22.93 ? 410 ASP C CG  1 
ATOM   9388  O  OD1 . ASP C  1 303 ? 19.853  50.749  29.923  1.00   20.53 ? 410 ASP C OD1 1 
ATOM   9389  O  OD2 . ASP C  1 303 ? 20.188  49.254  31.479  1.00   22.28 ? 410 ASP C OD2 1 
ATOM   9390  N  N   . TRP C  1 304 ? 18.793  49.593  26.681  1.00   22.83 ? 411 TRP C N   1 
ATOM   9391  C  CA  . TRP C  1 304 ? 17.420  49.204  26.381  1.00   23.19 ? 411 TRP C CA  1 
ATOM   9392  C  C   . TRP C  1 304 ? 17.443  47.783  25.856  1.00   25.41 ? 411 TRP C C   1 
ATOM   9393  O  O   . TRP C  1 304 ? 18.228  47.456  24.968  1.00   29.40 ? 411 TRP C O   1 
ATOM   9394  C  CB  . TRP C  1 304 ? 16.801  50.107  25.319  1.00   23.26 ? 411 TRP C CB  1 
ATOM   9395  C  CG  . TRP C  1 304 ? 16.315  51.394  25.851  1.00   21.60 ? 411 TRP C CG  1 
ATOM   9396  C  CD1 . TRP C  1 304 ? 16.774  52.641  25.531  1.00   24.13 ? 411 TRP C CD1 1 
ATOM   9397  C  CD2 . TRP C  1 304 ? 15.240  51.583  26.783  1.00   22.50 ? 411 TRP C CD2 1 
ATOM   9398  N  NE1 . TRP C  1 304 ? 16.045  53.600  26.204  1.00   24.51 ? 411 TRP C NE1 1 
ATOM   9399  C  CE2 . TRP C  1 304 ? 15.096  52.978  26.978  1.00   21.82 ? 411 TRP C CE2 1 
ATOM   9400  C  CE3 . TRP C  1 304 ? 14.382  50.709  27.472  1.00   15.20 ? 411 TRP C CE3 1 
ATOM   9401  C  CZ2 . TRP C  1 304 ? 14.128  53.519  27.830  1.00   21.73 ? 411 TRP C CZ2 1 
ATOM   9402  C  CZ3 . TRP C  1 304 ? 13.426  51.242  28.316  1.00   19.29 ? 411 TRP C CZ3 1 
ATOM   9403  C  CH2 . TRP C  1 304 ? 13.303  52.640  28.490  1.00   19.36 ? 411 TRP C CH2 1 
ATOM   9404  N  N   . ALA C  1 305 ? 16.598  46.929  26.419  1.00   24.42 ? 412 ALA C N   1 
ATOM   9405  C  CA  . ALA C  1 305 ? 16.518  45.543  25.988  1.00   21.27 ? 412 ALA C CA  1 
ATOM   9406  C  C   . ALA C  1 305 ? 15.067  45.084  25.988  1.00   22.33 ? 412 ALA C C   1 
ATOM   9407  O  O   . ALA C  1 305 ? 14.273  45.503  26.827  1.00   23.61 ? 412 ALA C O   1 
ATOM   9408  C  CB  . ALA C  1 305 ? 17.337  44.662  26.906  1.00   17.46 ? 412 ALA C CB  1 
ATOM   9409  N  N   . THR C  1 306 ? 14.717  44.220  25.044  1.00   23.24 ? 413 THR C N   1 
ATOM   9410  C  CA  . THR C  1 306 ? 13.354  43.705  24.940  1.00   21.73 ? 413 THR C CA  1 
ATOM   9411  C  C   . THR C  1 306 ? 13.222  42.448  25.800  1.00   25.25 ? 413 THR C C   1 
ATOM   9412  O  O   . THR C  1 306 ? 13.995  41.497  25.642  1.00   28.01 ? 413 THR C O   1 
ATOM   9413  C  CB  . THR C  1 306 ? 13.010  43.352  23.470  1.00   21.84 ? 413 THR C CB  1 
ATOM   9414  O  OG1 . THR C  1 306 ? 13.025  44.543  22.676  1.00   21.20 ? 413 THR C OG1 1 
ATOM   9415  C  CG2 . THR C  1 306 ? 11.635  42.691  23.363  1.00   18.90 ? 413 THR C CG2 1 
ATOM   9416  N  N   . ASN C  1 307 ? 12.245  42.437  26.709  1.00   23.43 ? 414 ASN C N   1 
ATOM   9417  C  CA  . ASN C  1 307 ? 12.060  41.274  27.566  1.00   21.67 ? 414 ASN C CA  1 
ATOM   9418  C  C   . ASN C  1 307 ? 11.199  40.186  26.926  1.00   22.37 ? 414 ASN C C   1 
ATOM   9419  O  O   . ASN C  1 307 ? 10.747  40.310  25.788  1.00   20.97 ? 414 ASN C O   1 
ATOM   9420  C  CB  . ASN C  1 307 ? 11.492  41.675  28.945  1.00   21.75 ? 414 ASN C CB  1 
ATOM   9421  C  CG  . ASN C  1 307 ? 10.021  42.130  28.898  1.00   21.10 ? 414 ASN C CG  1 
ATOM   9422  O  OD1 . ASN C  1 307 ? 9.353   42.042  27.866  1.00   22.35 ? 414 ASN C OD1 1 
ATOM   9423  N  ND2 . ASN C  1 307 ? 9.515   42.612  30.035  1.00   14.89 ? 414 ASN C ND2 1 
ATOM   9424  N  N   . GLY C  1 308 ? 10.983  39.113  27.673  1.00   23.94 ? 415 GLY C N   1 
ATOM   9425  C  CA  . GLY C  1 308 ? 10.233  37.984  27.170  1.00   22.67 ? 415 GLY C CA  1 
ATOM   9426  C  C   . GLY C  1 308 ? 8.859   38.280  26.618  1.00   24.80 ? 415 GLY C C   1 
ATOM   9427  O  O   . GLY C  1 308 ? 8.309   37.459  25.882  1.00   25.78 ? 415 GLY C O   1 
ATOM   9428  N  N   . VAL C  1 309 ? 8.273   39.420  26.975  1.00   21.19 ? 416 VAL C N   1 
ATOM   9429  C  CA  . VAL C  1 309 ? 6.949   39.725  26.456  1.00   21.18 ? 416 VAL C CA  1 
ATOM   9430  C  C   . VAL C  1 309 ? 6.927   40.895  25.482  1.00   21.37 ? 416 VAL C C   1 
ATOM   9431  O  O   . VAL C  1 309 ? 5.873   41.476  25.229  1.00   20.20 ? 416 VAL C O   1 
ATOM   9432  C  CB  . VAL C  1 309 ? 5.901   40.002  27.579  1.00   22.97 ? 416 VAL C CB  1 
ATOM   9433  C  CG1 . VAL C  1 309 ? 5.731   38.788  28.471  1.00   23.83 ? 416 VAL C CG1 1 
ATOM   9434  C  CG2 . VAL C  1 309 ? 6.307   41.208  28.395  1.00   27.26 ? 416 VAL C CG2 1 
ATOM   9435  N  N   . GLY C  1 310 ? 8.090   41.246  24.943  1.00   19.26 ? 417 GLY C N   1 
ATOM   9436  C  CA  . GLY C  1 310 ? 8.153   42.316  23.969  1.00   19.44 ? 417 GLY C CA  1 
ATOM   9437  C  C   . GLY C  1 310 ? 8.202   43.744  24.469  1.00   19.69 ? 417 GLY C C   1 
ATOM   9438  O  O   . GLY C  1 310 ? 8.020   44.673  23.678  1.00   15.18 ? 417 GLY C O   1 
ATOM   9439  N  N   . ARG C  1 311 ? 8.445   43.935  25.760  1.00   16.71 ? 418 ARG C N   1 
ATOM   9440  C  CA  . ARG C  1 311 ? 8.508   45.286  26.289  1.00   19.21 ? 418 ARG C CA  1 
ATOM   9441  C  C   . ARG C  1 311 ? 9.951   45.676  26.518  1.00   18.14 ? 418 ARG C C   1 
ATOM   9442  O  O   . ARG C  1 311 ? 10.763  44.849  26.917  1.00   18.00 ? 418 ARG C O   1 
ATOM   9443  C  CB  . ARG C  1 311 ? 7.683   45.394  27.583  1.00   19.96 ? 418 ARG C CB  1 
ATOM   9444  C  CG  . ARG C  1 311 ? 6.203   45.304  27.273  1.00   23.41 ? 418 ARG C CG  1 
ATOM   9445  C  CD  . ARG C  1 311 ? 5.302   45.788  28.398  1.00   28.00 ? 418 ARG C CD  1 
ATOM   9446  N  NE  . ARG C  1 311 ? 5.075   44.736  29.371  1.00   32.00 ? 418 ARG C NE  1 
ATOM   9447  C  CZ  . ARG C  1 311 ? 3.895   44.180  29.633  1.00   28.78 ? 418 ARG C CZ  1 
ATOM   9448  N  NH1 . ARG C  1 311 ? 3.817   43.220  30.543  1.00   25.80 ? 418 ARG C NH1 1 
ATOM   9449  N  NH2 . ARG C  1 311 ? 2.801   44.585  29.006  1.00   27.01 ? 418 ARG C NH2 1 
ATOM   9450  N  N   . LYS C  1 312 ? 10.267  46.930  26.226  1.00   19.34 ? 419 LYS C N   1 
ATOM   9451  C  CA  . LYS C  1 312 ? 11.616  47.430  26.411  1.00   22.22 ? 419 LYS C CA  1 
ATOM   9452  C  C   . LYS C  1 312 ? 11.841  47.841  27.853  1.00   22.43 ? 419 LYS C C   1 
ATOM   9453  O  O   . LYS C  1 312 ? 10.977  48.463  28.471  1.00   21.77 ? 419 LYS C O   1 
ATOM   9454  C  CB  . LYS C  1 312 ? 11.860  48.622  25.492  1.00   24.88 ? 419 LYS C CB  1 
ATOM   9455  C  CG  . LYS C  1 312 ? 11.924  48.200  24.040  1.00   29.24 ? 419 LYS C CG  1 
ATOM   9456  C  CD  . LYS C  1 312 ? 11.982  49.397  23.109  1.00   35.77 ? 419 LYS C CD  1 
ATOM   9457  C  CE  . LYS C  1 312 ? 13.329  50.077  23.174  1.00   37.30 ? 419 LYS C CE  1 
ATOM   9458  N  NZ  . LYS C  1 312 ? 13.406  51.178  22.182  1.00   42.00 ? 419 LYS C NZ  1 
ATOM   9459  N  N   . VAL C  1 313 ? 12.998  47.476  28.390  1.00   21.85 ? 420 VAL C N   1 
ATOM   9460  C  CA  . VAL C  1 313 ? 13.347  47.846  29.756  1.00   23.08 ? 420 VAL C CA  1 
ATOM   9461  C  C   . VAL C  1 313 ? 14.787  48.304  29.833  1.00   20.48 ? 420 VAL C C   1 
ATOM   9462  O  O   . VAL C  1 313 ? 15.636  47.834  29.071  1.00   19.34 ? 420 VAL C O   1 
ATOM   9463  C  CB  . VAL C  1 313 ? 13.163  46.676  30.750  1.00   24.62 ? 420 VAL C CB  1 
ATOM   9464  C  CG1 . VAL C  1 313 ? 11.731  46.572  31.158  1.00   25.96 ? 420 VAL C CG1 1 
ATOM   9465  C  CG2 . VAL C  1 313 ? 13.632  45.376  30.136  1.00   27.05 ? 420 VAL C CG2 1 
ATOM   9466  N  N   . SER C  1 314 ? 15.042  49.235  30.752  1.00   17.85 ? 421 SER C N   1 
ATOM   9467  C  CA  . SER C  1 314 ? 16.379  49.770  30.990  1.00   16.95 ? 421 SER C CA  1 
ATOM   9468  C  C   . SER C  1 314 ? 16.584  49.838  32.497  1.00   15.66 ? 421 SER C C   1 
ATOM   9469  O  O   . SER C  1 314 ? 15.636  50.052  33.240  1.00   14.13 ? 421 SER C O   1 
ATOM   9470  C  CB  . SER C  1 314 ? 16.521  51.167  30.392  1.00   16.79 ? 421 SER C CB  1 
ATOM   9471  O  OG  . SER C  1 314 ? 17.668  51.808  30.918  1.00   12.66 ? 421 SER C OG  1 
ATOM   9472  N  N   . HIS C  1 315 ? 17.817  49.653  32.951  1.00   15.88 ? 422 HIS C N   1 
ATOM   9473  C  CA  . HIS C  1 315 ? 18.082  49.708  34.373  1.00   17.25 ? 422 HIS C CA  1 
ATOM   9474  C  C   . HIS C  1 315 ? 18.066  51.162  34.851  1.00   18.99 ? 422 HIS C C   1 
ATOM   9475  O  O   . HIS C  1 315 ? 17.994  51.432  36.056  1.00   20.04 ? 422 HIS C O   1 
ATOM   9476  C  CB  . HIS C  1 315 ? 19.417  49.017  34.684  1.00   16.79 ? 422 HIS C CB  1 
ATOM   9477  C  CG  . HIS C  1 315 ? 19.385  47.530  34.474  1.00   20.34 ? 422 HIS C CG  1 
ATOM   9478  N  ND1 . HIS C  1 315 ? 19.385  46.948  33.220  1.00   20.02 ? 422 HIS C ND1 1 
ATOM   9479  C  CD2 . HIS C  1 315 ? 19.295  46.507  35.359  1.00   19.37 ? 422 HIS C CD2 1 
ATOM   9480  C  CE1 . HIS C  1 315 ? 19.295  45.634  33.342  1.00   17.54 ? 422 HIS C CE1 1 
ATOM   9481  N  NE2 . HIS C  1 315 ? 19.239  45.340  34.630  1.00   21.07 ? 422 HIS C NE2 1 
ATOM   9482  N  N   . SER C  1 316 ? 18.115  52.097  33.904  1.00   16.82 ? 423 SER C N   1 
ATOM   9483  C  CA  . SER C  1 316 ? 18.091  53.517  34.242  1.00   17.17 ? 423 SER C CA  1 
ATOM   9484  C  C   . SER C  1 316 ? 16.683  54.071  34.273  1.00   18.74 ? 423 SER C C   1 
ATOM   9485  O  O   . SER C  1 316 ? 16.426  55.069  34.947  1.00   19.49 ? 423 SER C O   1 
ATOM   9486  C  CB  . SER C  1 316 ? 18.877  54.333  33.217  1.00   16.39 ? 423 SER C CB  1 
ATOM   9487  O  OG  . SER C  1 316 ? 20.265  54.157  33.397  1.00   19.68 ? 423 SER C OG  1 
ATOM   9488  N  N   . TYR C  1 317 ? 15.764  53.414  33.568  1.00   17.90 ? 424 TYR C N   1 
ATOM   9489  C  CA  . TYR C  1 317 ? 14.400  53.928  33.473  1.00   17.35 ? 424 TYR C CA  1 
ATOM   9490  C  C   . TYR C  1 317 ? 13.260  52.964  33.793  1.00   18.20 ? 424 TYR C C   1 
ATOM   9491  O  O   . TYR C  1 317 ? 12.088  53.365  33.803  1.00   16.61 ? 424 TYR C O   1 
ATOM   9492  C  CB  . TYR C  1 317 ? 14.151  54.437  32.051  1.00   17.25 ? 424 TYR C CB  1 
ATOM   9493  C  CG  . TYR C  1 317 ? 15.138  55.448  31.503  1.00   21.07 ? 424 TYR C CG  1 
ATOM   9494  C  CD1 . TYR C  1 317 ? 15.301  56.704  32.112  1.00   16.85 ? 424 TYR C CD1 1 
ATOM   9495  C  CD2 . TYR C  1 317 ? 15.823  55.199  30.298  1.00   18.63 ? 424 TYR C CD2 1 
ATOM   9496  C  CE1 . TYR C  1 317 ? 16.102  57.684  31.531  1.00   17.17 ? 424 TYR C CE1 1 
ATOM   9497  C  CE2 . TYR C  1 317 ? 16.637  56.184  29.703  1.00   14.19 ? 424 TYR C CE2 1 
ATOM   9498  C  CZ  . TYR C  1 317 ? 16.762  57.422  30.325  1.00   18.84 ? 424 TYR C CZ  1 
ATOM   9499  O  OH  . TYR C  1 317 ? 17.500  58.426  29.735  1.00   22.75 ? 424 TYR C OH  1 
ATOM   9500  N  N   . GLY C  1 318 ? 13.572  51.698  34.037  1.00   16.33 ? 425 GLY C N   1 
ATOM   9501  C  CA  . GLY C  1 318 ? 12.490  50.763  34.258  1.00   15.77 ? 425 GLY C CA  1 
ATOM   9502  C  C   . GLY C  1 318 ? 11.775  50.626  32.916  1.00   17.29 ? 425 GLY C C   1 
ATOM   9503  O  O   . GLY C  1 318 ? 12.418  50.455  31.877  1.00   18.94 ? 425 GLY C O   1 
ATOM   9504  N  N   . TYR C  1 319 ? 10.454  50.719  32.913  1.00   18.20 ? 426 TYR C N   1 
ATOM   9505  C  CA  . TYR C  1 319 ? 9.702   50.601  31.665  1.00   19.20 ? 426 TYR C CA  1 
ATOM   9506  C  C   . TYR C  1 319 ? 9.582   51.910  30.879  1.00   18.89 ? 426 TYR C C   1 
ATOM   9507  O  O   . TYR C  1 319 ? 8.926   51.968  29.837  1.00   19.49 ? 426 TYR C O   1 
ATOM   9508  C  CB  . TYR C  1 319 ? 8.313   50.019  31.944  1.00   13.56 ? 426 TYR C CB  1 
ATOM   9509  C  CG  . TYR C  1 319 ? 8.385   48.540  32.225  1.00   16.75 ? 426 TYR C CG  1 
ATOM   9510  C  CD1 . TYR C  1 319 ? 8.612   48.062  33.524  1.00   16.47 ? 426 TYR C CD1 1 
ATOM   9511  C  CD2 . TYR C  1 319 ? 8.358   47.611  31.176  1.00   9.95  ? 426 TYR C CD2 1 
ATOM   9512  C  CE1 . TYR C  1 319 ? 8.824   46.693  33.762  1.00   13.41 ? 426 TYR C CE1 1 
ATOM   9513  C  CE2 . TYR C  1 319 ? 8.562   46.251  31.405  1.00   8.79  ? 426 TYR C CE2 1 
ATOM   9514  C  CZ  . TYR C  1 319 ? 8.797   45.795  32.692  1.00   14.18 ? 426 TYR C CZ  1 
ATOM   9515  O  OH  . TYR C  1 319 ? 9.029   44.450  32.909  1.00   12.77 ? 426 TYR C OH  1 
ATOM   9516  N  N   . GLY C  1 320 ? 10.230  52.957  31.371  1.00   17.37 ? 427 GLY C N   1 
ATOM   9517  C  CA  . GLY C  1 320 ? 10.173  54.221  30.671  1.00   13.15 ? 427 GLY C CA  1 
ATOM   9518  C  C   . GLY C  1 320 ? 9.378   55.308  31.364  1.00   17.30 ? 427 GLY C C   1 
ATOM   9519  O  O   . GLY C  1 320 ? 9.015   55.232  32.539  1.00   18.10 ? 427 GLY C O   1 
ATOM   9520  N  N   . LEU C  1 321 ? 9.087   56.330  30.586  1.00   19.10 ? 428 LEU C N   1 
ATOM   9521  C  CA  . LEU C  1 321 ? 8.376   57.495  31.045  1.00   20.79 ? 428 LEU C CA  1 
ATOM   9522  C  C   . LEU C  1 321 ? 6.922   57.207  31.322  1.00   20.27 ? 428 LEU C C   1 
ATOM   9523  O  O   . LEU C  1 321 ? 6.257   56.555  30.523  1.00   19.05 ? 428 LEU C O   1 
ATOM   9524  C  CB  . LEU C  1 321 ? 8.474   58.552  29.966  1.00   22.37 ? 428 LEU C CB  1 
ATOM   9525  C  CG  . LEU C  1 321 ? 8.623   60.011  30.331  1.00   31.02 ? 428 LEU C CG  1 
ATOM   9526  C  CD1 . LEU C  1 321 ? 9.722   60.226  31.397  1.00   25.54 ? 428 LEU C CD1 1 
ATOM   9527  C  CD2 . LEU C  1 321 ? 8.975   60.728  29.024  1.00   31.01 ? 428 LEU C CD2 1 
ATOM   9528  N  N   . LEU C  1 322 ? 6.426   57.701  32.453  1.00   19.79 ? 429 LEU C N   1 
ATOM   9529  C  CA  . LEU C  1 322 ? 5.014   57.533  32.795  1.00   18.60 ? 429 LEU C CA  1 
ATOM   9530  C  C   . LEU C  1 322 ? 4.183   58.320  31.779  1.00   18.71 ? 429 LEU C C   1 
ATOM   9531  O  O   . LEU C  1 322 ? 4.607   59.379  31.300  1.00   18.79 ? 429 LEU C O   1 
ATOM   9532  C  CB  . LEU C  1 322 ? 4.718   58.082  34.192  1.00   16.95 ? 429 LEU C CB  1 
ATOM   9533  C  CG  . LEU C  1 322 ? 5.318   57.355  35.395  1.00   17.82 ? 429 LEU C CG  1 
ATOM   9534  C  CD1 . LEU C  1 322 ? 4.826   58.031  36.683  1.00   13.20 ? 429 LEU C CD1 1 
ATOM   9535  C  CD2 . LEU C  1 322 ? 4.910   55.867  35.359  1.00   12.45 ? 429 LEU C CD2 1 
ATOM   9536  N  N   . ASP C  1 323 ? 2.999   57.808  31.473  1.00   17.09 ? 430 ASP C N   1 
ATOM   9537  C  CA  . ASP C  1 323 ? 2.086   58.443  30.521  1.00   17.99 ? 430 ASP C CA  1 
ATOM   9538  C  C   . ASP C  1 323 ? 0.723   58.597  31.212  1.00   16.51 ? 430 ASP C C   1 
ATOM   9539  O  O   . ASP C  1 323 ? -0.070  57.659  31.242  1.00   19.60 ? 430 ASP C O   1 
ATOM   9540  C  CB  . ASP C  1 323 ? 1.955   57.548  29.288  1.00   18.65 ? 430 ASP C CB  1 
ATOM   9541  C  CG  . ASP C  1 323 ? 1.062   58.143  28.222  1.00   22.32 ? 430 ASP C CG  1 
ATOM   9542  O  OD1 . ASP C  1 323 ? 0.162   58.943  28.575  1.00   19.02 ? 430 ASP C OD1 1 
ATOM   9543  O  OD2 . ASP C  1 323 ? 1.253   57.787  27.033  1.00   20.52 ? 430 ASP C OD2 1 
ATOM   9544  N  N   . ALA C  1 324 ? 0.455   59.775  31.765  1.00   16.25 ? 431 ALA C N   1 
ATOM   9545  C  CA  . ALA C  1 324 ? -0.791  60.010  32.486  1.00   20.06 ? 431 ALA C CA  1 
ATOM   9546  C  C   . ALA C  1 324 ? -2.062  59.706  31.683  1.00   21.00 ? 431 ALA C C   1 
ATOM   9547  O  O   . ALA C  1 324 ? -2.978  59.026  32.173  1.00   20.35 ? 431 ALA C O   1 
ATOM   9548  C  CB  . ALA C  1 324 ? -0.820  61.436  32.997  1.00   18.26 ? 431 ALA C CB  1 
ATOM   9549  N  N   . GLY C  1 325 ? -2.124  60.220  30.458  1.00   21.00 ? 432 GLY C N   1 
ATOM   9550  C  CA  . GLY C  1 325 ? -3.283  59.966  29.626  1.00   21.18 ? 432 GLY C CA  1 
ATOM   9551  C  C   . GLY C  1 325 ? -3.547  58.473  29.483  1.00   22.68 ? 432 GLY C C   1 
ATOM   9552  O  O   . GLY C  1 325 ? -4.690  58.009  29.642  1.00   22.24 ? 432 GLY C O   1 
ATOM   9553  N  N   . ALA C  1 326 ? -2.491  57.714  29.196  1.00   16.90 ? 433 ALA C N   1 
ATOM   9554  C  CA  . ALA C  1 326 ? -2.615  56.275  29.027  1.00   18.20 ? 433 ALA C CA  1 
ATOM   9555  C  C   . ALA C  1 326 ? -2.991  55.583  30.346  1.00   20.81 ? 433 ALA C C   1 
ATOM   9556  O  O   . ALA C  1 326 ? -3.783  54.636  30.360  1.00   23.03 ? 433 ALA C O   1 
ATOM   9557  C  CB  . ALA C  1 326 ? -1.302  55.709  28.486  1.00   15.42 ? 433 ALA C CB  1 
ATOM   9558  N  N   . MET C  1 327 ? -2.410  56.052  31.450  1.00   20.59 ? 434 MET C N   1 
ATOM   9559  C  CA  . MET C  1 327 ? -2.685  55.479  32.763  1.00   18.99 ? 434 MET C CA  1 
ATOM   9560  C  C   . MET C  1 327 ? -4.163  55.591  33.096  1.00   19.49 ? 434 MET C C   1 
ATOM   9561  O  O   . MET C  1 327 ? -4.789  54.599  33.462  1.00   20.36 ? 434 MET C O   1 
ATOM   9562  C  CB  . MET C  1 327 ? -1.872  56.190  33.854  1.00   20.32 ? 434 MET C CB  1 
ATOM   9563  C  CG  . MET C  1 327 ? -0.403  55.752  33.967  1.00   21.60 ? 434 MET C CG  1 
ATOM   9564  S  SD  . MET C  1 327 ? -0.174  54.108  34.727  1.00   23.38 ? 434 MET C SD  1 
ATOM   9565  C  CE  . MET C  1 327 ? -0.327  54.557  36.471  1.00   15.28 ? 434 MET C CE  1 
ATOM   9566  N  N   . VAL C  1 328 ? -4.727  56.791  32.966  1.00   19.53 ? 435 VAL C N   1 
ATOM   9567  C  CA  . VAL C  1 328 ? -6.140  56.975  33.284  1.00   22.83 ? 435 VAL C CA  1 
ATOM   9568  C  C   . VAL C  1 328 ? -7.072  56.237  32.313  1.00   22.83 ? 435 VAL C C   1 
ATOM   9569  O  O   . VAL C  1 328 ? -8.135  55.749  32.718  1.00   24.04 ? 435 VAL C O   1 
ATOM   9570  C  CB  . VAL C  1 328 ? -6.533  58.474  33.330  1.00   26.04 ? 435 VAL C CB  1 
ATOM   9571  C  CG1 . VAL C  1 328 ? -5.847  59.142  34.504  1.00   22.76 ? 435 VAL C CG1 1 
ATOM   9572  C  CG2 . VAL C  1 328 ? -6.201  59.163  32.011  1.00   28.59 ? 435 VAL C CG2 1 
ATOM   9573  N  N   . ALA C  1 329 ? -6.675  56.144  31.044  1.00   20.72 ? 436 ALA C N   1 
ATOM   9574  C  CA  . ALA C  1 329 ? -7.480  55.440  30.046  1.00   21.74 ? 436 ALA C CA  1 
ATOM   9575  C  C   . ALA C  1 329 ? -7.560  53.959  30.389  1.00   23.07 ? 436 ALA C C   1 
ATOM   9576  O  O   . ALA C  1 329 ? -8.647  53.410  30.497  1.00   25.79 ? 436 ALA C O   1 
ATOM   9577  C  CB  . ALA C  1 329 ? -6.879  55.605  28.662  1.00   17.45 ? 436 ALA C CB  1 
ATOM   9578  N  N   . LEU C  1 330 ? -6.407  53.317  30.568  1.00   21.86 ? 437 LEU C N   1 
ATOM   9579  C  CA  . LEU C  1 330 ? -6.378  51.893  30.889  1.00   21.00 ? 437 LEU C CA  1 
ATOM   9580  C  C   . LEU C  1 330 ? -7.032  51.579  32.238  1.00   22.49 ? 437 LEU C C   1 
ATOM   9581  O  O   . LEU C  1 330 ? -7.656  50.530  32.402  1.00   21.29 ? 437 LEU C O   1 
ATOM   9582  C  CB  . LEU C  1 330 ? -4.936  51.383  30.886  1.00   20.71 ? 437 LEU C CB  1 
ATOM   9583  C  CG  . LEU C  1 330 ? -4.712  49.888  31.119  1.00   21.69 ? 437 LEU C CG  1 
ATOM   9584  C  CD1 . LEU C  1 330 ? -5.486  49.070  30.086  1.00   20.55 ? 437 LEU C CD1 1 
ATOM   9585  C  CD2 . LEU C  1 330 ? -3.234  49.590  31.012  1.00   18.90 ? 437 LEU C CD2 1 
ATOM   9586  N  N   . ALA C  1 331 ? -6.906  52.488  33.200  1.00   21.46 ? 438 ALA C N   1 
ATOM   9587  C  CA  . ALA C  1 331 ? -7.490  52.272  34.518  1.00   23.48 ? 438 ALA C CA  1 
ATOM   9588  C  C   . ALA C  1 331 ? -8.989  52.009  34.463  1.00   24.65 ? 438 ALA C C   1 
ATOM   9589  O  O   . ALA C  1 331 ? -9.502  51.149  35.176  1.00   25.04 ? 438 ALA C O   1 
ATOM   9590  C  CB  . ALA C  1 331 ? -7.214  53.472  35.408  1.00   22.09 ? 438 ALA C CB  1 
ATOM   9591  N  N   . GLN C  1 332 ? -9.683  52.748  33.609  1.00   28.92 ? 439 GLN C N   1 
ATOM   9592  C  CA  . GLN C  1 332 ? -11.134 52.626  33.479  1.00   34.56 ? 439 GLN C CA  1 
ATOM   9593  C  C   . GLN C  1 332 ? -11.662 51.242  33.105  1.00   36.14 ? 439 GLN C C   1 
ATOM   9594  O  O   . GLN C  1 332 ? -12.692 50.819  33.612  1.00   40.53 ? 439 GLN C O   1 
ATOM   9595  C  CB  . GLN C  1 332 ? -11.641 53.670  32.477  1.00   34.50 ? 439 GLN C CB  1 
ATOM   9596  C  CG  . GLN C  1 332 ? -11.262 55.085  32.870  1.00   35.67 ? 439 GLN C CG  1 
ATOM   9597  C  CD  . GLN C  1 332 ? -11.781 56.126  31.912  1.00   36.74 ? 439 GLN C CD  1 
ATOM   9598  O  OE1 . GLN C  1 332 ? -12.985 56.242  31.704  1.00   36.49 ? 439 GLN C OE1 1 
ATOM   9599  N  NE2 . GLN C  1 332 ? -10.875 56.900  31.324  1.00   39.29 ? 439 GLN C NE2 1 
ATOM   9600  N  N   . ASN C  1 333 ? -10.961 50.535  32.229  1.00   38.37 ? 440 ASN C N   1 
ATOM   9601  C  CA  . ASN C  1 333 ? -11.400 49.205  31.812  1.00   41.09 ? 440 ASN C CA  1 
ATOM   9602  C  C   . ASN C  1 333 ? -10.678 48.088  32.579  1.00   38.57 ? 440 ASN C C   1 
ATOM   9603  O  O   . ASN C  1 333 ? -10.916 46.907  32.330  1.00   39.84 ? 440 ASN C O   1 
ATOM   9604  C  CB  . ASN C  1 333 ? -11.137 49.026  30.305  1.00   45.38 ? 440 ASN C CB  1 
ATOM   9605  C  CG  . ASN C  1 333 ? -12.075 49.852  29.440  1.00   49.89 ? 440 ASN C CG  1 
ATOM   9606  O  OD1 . ASN C  1 333 ? -11.722 50.255  28.331  0.0000 48.14 ? 440 ASN C OD1 1 
ATOM   9607  N  ND2 . ASN C  1 333 ? -13.282 50.092  29.939  0.0000 48.14 ? 440 ASN C ND2 1 
ATOM   9608  N  N   . TRP C  1 334 ? -9.824  48.453  33.527  1.00   34.20 ? 441 TRP C N   1 
ATOM   9609  C  CA  . TRP C  1 334 ? -9.035  47.458  34.240  1.00   29.93 ? 441 TRP C CA  1 
ATOM   9610  C  C   . TRP C  1 334 ? -9.756  46.448  35.120  1.00   28.60 ? 441 TRP C C   1 
ATOM   9611  O  O   . TRP C  1 334 ? -10.557 46.804  35.974  1.00   28.24 ? 441 TRP C O   1 
ATOM   9612  C  CB  . TRP C  1 334 ? -7.939  48.148  35.055  1.00   27.99 ? 441 TRP C CB  1 
ATOM   9613  C  CG  . TRP C  1 334 ? -6.926  47.192  35.605  1.00   24.57 ? 441 TRP C CG  1 
ATOM   9614  C  CD1 . TRP C  1 334 ? -6.864  46.692  36.877  1.00   21.47 ? 441 TRP C CD1 1 
ATOM   9615  C  CD2 . TRP C  1 334 ? -5.829  46.610  34.891  1.00   24.79 ? 441 TRP C CD2 1 
ATOM   9616  N  NE1 . TRP C  1 334 ? -5.790  45.840  36.997  1.00   20.69 ? 441 TRP C NE1 1 
ATOM   9617  C  CE2 . TRP C  1 334 ? -5.139  45.771  35.794  1.00   22.27 ? 441 TRP C CE2 1 
ATOM   9618  C  CE3 . TRP C  1 334 ? -5.361  46.718  33.575  1.00   24.56 ? 441 TRP C CE3 1 
ATOM   9619  C  CZ2 . TRP C  1 334 ? -4.012  45.041  35.422  1.00   23.33 ? 441 TRP C CZ2 1 
ATOM   9620  C  CZ3 . TRP C  1 334 ? -4.242  45.991  33.203  1.00   25.75 ? 441 TRP C CZ3 1 
ATOM   9621  C  CH2 . TRP C  1 334 ? -3.578  45.163  34.125  1.00   26.40 ? 441 TRP C CH2 1 
ATOM   9622  N  N   . THR C  1 335 ? -9.446  45.174  34.900  1.00   26.73 ? 442 THR C N   1 
ATOM   9623  C  CA  . THR C  1 335 ? -10.021 44.087  35.683  1.00   26.72 ? 442 THR C CA  1 
ATOM   9624  C  C   . THR C  1 335 ? -9.010  43.760  36.781  1.00   26.53 ? 442 THR C C   1 
ATOM   9625  O  O   . THR C  1 335 ? -7.869  43.415  36.489  1.00   24.76 ? 442 THR C O   1 
ATOM   9626  C  CB  . THR C  1 335 ? -10.215 42.821  34.824  1.00   27.36 ? 442 THR C CB  1 
ATOM   9627  O  OG1 . THR C  1 335 ? -11.122 43.094  33.750  1.00   31.83 ? 442 THR C OG1 1 
ATOM   9628  C  CG2 . THR C  1 335 ? -10.748 41.677  35.677  1.00   25.06 ? 442 THR C CG2 1 
ATOM   9629  N  N   . THR C  1 336 ? -9.422  43.859  38.039  1.00   27.54 ? 443 THR C N   1 
ATOM   9630  C  CA  . THR C  1 336 ? -8.506  43.576  39.137  1.00   28.73 ? 443 THR C CA  1 
ATOM   9631  C  C   . THR C  1 336 ? -7.773  42.253  38.931  1.00   28.05 ? 443 THR C C   1 
ATOM   9632  O  O   . THR C  1 336 ? -8.379  41.250  38.567  1.00   29.12 ? 443 THR C O   1 
ATOM   9633  C  CB  . THR C  1 336 ? -9.254  43.569  40.474  1.00   29.87 ? 443 THR C CB  1 
ATOM   9634  O  OG1 . THR C  1 336 ? -9.748  44.894  40.727  1.00   39.12 ? 443 THR C OG1 1 
ATOM   9635  C  CG2 . THR C  1 336 ? -8.312  43.193  41.609  1.00   33.31 ? 443 THR C CG2 1 
ATOM   9636  N  N   . VAL C  1 337 ? -6.461  42.257  39.148  1.00   25.26 ? 444 VAL C N   1 
ATOM   9637  C  CA  . VAL C  1 337 ? -5.675  41.044  38.963  1.00   25.12 ? 444 VAL C CA  1 
ATOM   9638  C  C   . VAL C  1 337 ? -6.000  39.971  40.000  1.00   25.28 ? 444 VAL C C   1 
ATOM   9639  O  O   . VAL C  1 337 ? -6.517  40.257  41.079  1.00   21.38 ? 444 VAL C O   1 
ATOM   9640  C  CB  . VAL C  1 337 ? -4.158  41.330  39.025  1.00   26.62 ? 444 VAL C CB  1 
ATOM   9641  C  CG1 . VAL C  1 337 ? -3.758  42.210  37.860  1.00   26.26 ? 444 VAL C CG1 1 
ATOM   9642  C  CG2 . VAL C  1 337 ? -3.798  42.010  40.357  1.00   23.45 ? 444 VAL C CG2 1 
ATOM   9643  N  N   . ALA C  1 338 ? -5.691  38.730  39.652  1.00   23.47 ? 445 ALA C N   1 
ATOM   9644  C  CA  . ALA C  1 338 ? -5.936  37.607  40.535  1.00   24.86 ? 445 ALA C CA  1 
ATOM   9645  C  C   . ALA C  1 338 ? -5.076  37.723  41.802  1.00   25.67 ? 445 ALA C C   1 
ATOM   9646  O  O   . ALA C  1 338 ? -4.119  38.500  41.860  1.00   24.54 ? 445 ALA C O   1 
ATOM   9647  C  CB  . ALA C  1 338 ? -5.625  36.305  39.804  1.00   19.95 ? 445 ALA C CB  1 
ATOM   9648  N  N   . PRO C  1 339 ? -5.421  36.953  42.844  1.00   26.83 ? 446 PRO C N   1 
ATOM   9649  C  CA  . PRO C  1 339 ? -4.669  36.978  44.108  1.00   24.61 ? 446 PRO C CA  1 
ATOM   9650  C  C   . PRO C  1 339 ? -3.178  36.701  43.883  1.00   21.75 ? 446 PRO C C   1 
ATOM   9651  O  O   . PRO C  1 339 ? -2.789  35.859  43.069  1.00   19.22 ? 446 PRO C O   1 
ATOM   9652  C  CB  . PRO C  1 339 ? -5.334  35.872  44.925  1.00   24.61 ? 446 PRO C CB  1 
ATOM   9653  C  CG  . PRO C  1 339 ? -6.772  35.890  44.407  1.00   23.71 ? 446 PRO C CG  1 
ATOM   9654  C  CD  . PRO C  1 339 ? -6.553  36.007  42.921  1.00   23.95 ? 446 PRO C CD  1 
ATOM   9655  N  N   . GLN C  1 340 ? -2.345  37.413  44.620  1.00   18.85 ? 447 GLN C N   1 
ATOM   9656  C  CA  . GLN C  1 340 ? -0.911  37.266  44.491  1.00   18.95 ? 447 GLN C CA  1 
ATOM   9657  C  C   . GLN C  1 340 ? -0.421  35.915  45.010  1.00   19.64 ? 447 GLN C C   1 
ATOM   9658  O  O   . GLN C  1 340 ? -0.740  35.535  46.128  1.00   21.68 ? 447 GLN C O   1 
ATOM   9659  C  CB  . GLN C  1 340 ? -0.222  38.390  45.260  1.00   13.94 ? 447 GLN C CB  1 
ATOM   9660  C  CG  . GLN C  1 340 ? 1.286   38.309  45.242  1.00   17.21 ? 447 GLN C CG  1 
ATOM   9661  C  CD  . GLN C  1 340 ? 1.900   38.996  46.430  1.00   19.63 ? 447 GLN C CD  1 
ATOM   9662  O  OE1 . GLN C  1 340 ? 1.638   38.612  47.575  1.00   22.25 ? 447 GLN C OE1 1 
ATOM   9663  N  NE2 . GLN C  1 340 ? 2.711   40.028  46.176  1.00   13.97 ? 447 GLN C NE2 1 
ATOM   9664  N  N   . ARG C  1 341 ? 0.353   35.202  44.196  1.00   18.64 ? 448 ARG C N   1 
ATOM   9665  C  CA  . ARG C  1 341 ? 0.926   33.915  44.591  1.00   18.04 ? 448 ARG C CA  1 
ATOM   9666  C  C   . ARG C  1 341 ? 2.399   34.146  44.825  1.00   18.33 ? 448 ARG C C   1 
ATOM   9667  O  O   . ARG C  1 341 ? 2.972   35.095  44.283  1.00   17.28 ? 448 ARG C O   1 
ATOM   9668  C  CB  . ARG C  1 341 ? 0.772   32.881  43.488  1.00   17.90 ? 448 ARG C CB  1 
ATOM   9669  C  CG  . ARG C  1 341 ? -0.641  32.664  43.102  1.00   23.82 ? 448 ARG C CG  1 
ATOM   9670  C  CD  . ARG C  1 341 ? -0.789  31.600  42.058  1.00   24.39 ? 448 ARG C CD  1 
ATOM   9671  N  NE  . ARG C  1 341 ? -2.204  31.317  41.893  1.00   24.86 ? 448 ARG C NE  1 
ATOM   9672  C  CZ  . ARG C  1 341 ? -2.695  30.230  41.313  1.00   27.58 ? 448 ARG C CZ  1 
ATOM   9673  N  NH1 . ARG C  1 341 ? -4.010  30.075  41.228  1.00   27.34 ? 448 ARG C NH1 1 
ATOM   9674  N  NH2 . ARG C  1 341 ? -1.883  29.302  40.828  1.00   23.36 ? 448 ARG C NH2 1 
ATOM   9675  N  N   . LYS C  1 342 ? 3.012   33.274  45.616  1.00   18.80 ? 449 LYS C N   1 
ATOM   9676  C  CA  . LYS C  1 342 ? 4.428   33.381  45.932  1.00   17.65 ? 449 LYS C CA  1 
ATOM   9677  C  C   . LYS C  1 342 ? 5.043   31.991  45.882  1.00   21.82 ? 449 LYS C C   1 
ATOM   9678  O  O   . LYS C  1 342 ? 4.632   31.095  46.630  1.00   23.78 ? 449 LYS C O   1 
ATOM   9679  C  CB  . LYS C  1 342 ? 4.595   33.975  47.336  1.00   17.88 ? 449 LYS C CB  1 
ATOM   9680  C  CG  . LYS C  1 342 ? 6.024   34.197  47.769  1.00   12.60 ? 449 LYS C CG  1 
ATOM   9681  C  CD  . LYS C  1 342 ? 6.053   34.746  49.186  1.00   15.26 ? 449 LYS C CD  1 
ATOM   9682  C  CE  . LYS C  1 342 ? 7.459   35.108  49.635  1.00   14.49 ? 449 LYS C CE  1 
ATOM   9683  N  NZ  . LYS C  1 342 ? 7.458   35.739  50.990  1.00   13.68 ? 449 LYS C NZ  1 
ATOM   9684  N  N   . CYS C  1 343 ? 6.031   31.814  45.010  1.00   21.47 ? 450 CYS C N   1 
ATOM   9685  C  CA  . CYS C  1 343 ? 6.697   30.532  44.864  1.00   20.31 ? 450 CYS C CA  1 
ATOM   9686  C  C   . CYS C  1 343 ? 8.171   30.665  45.261  1.00   21.28 ? 450 CYS C C   1 
ATOM   9687  O  O   . CYS C  1 343 ? 8.947   31.429  44.657  1.00   18.97 ? 450 CYS C O   1 
ATOM   9688  C  CB  . CYS C  1 343 ? 6.535   30.032  43.419  1.00   20.65 ? 450 CYS C CB  1 
ATOM   9689  S  SG  . CYS C  1 343 ? 7.342   28.437  43.052  1.00   23.10 ? 450 CYS C SG  1 
ATOM   9690  N  N   . ILE C  1 344 ? 8.542   29.925  46.306  1.00   21.71 ? 451 ILE C N   1 
ATOM   9691  C  CA  . ILE C  1 344 ? 9.903   29.948  46.840  1.00   20.28 ? 451 ILE C CA  1 
ATOM   9692  C  C   . ILE C  1 344 ? 10.712  28.758  46.355  1.00   20.54 ? 451 ILE C C   1 
ATOM   9693  O  O   . ILE C  1 344 ? 10.305  27.611  46.531  1.00   21.72 ? 451 ILE C O   1 
ATOM   9694  C  CB  . ILE C  1 344 ? 9.893   29.922  48.384  1.00   19.73 ? 451 ILE C CB  1 
ATOM   9695  C  CG1 . ILE C  1 344 ? 9.309   31.221  48.933  1.00   19.34 ? 451 ILE C CG1 1 
ATOM   9696  C  CG2 . ILE C  1 344 ? 11.287  29.692  48.905  1.00   13.06 ? 451 ILE C CG2 1 
ATOM   9697  C  CD1 . ILE C  1 344 ? 8.957   31.147  50.418  1.00   20.13 ? 451 ILE C CD1 1 
ATOM   9698  N  N   . ILE C  1 345 ? 11.866  29.031  45.760  1.00   20.52 ? 452 ILE C N   1 
ATOM   9699  C  CA  . ILE C  1 345 ? 12.725  27.968  45.248  1.00   22.34 ? 452 ILE C CA  1 
ATOM   9700  C  C   . ILE C  1 345 ? 14.155  28.137  45.745  1.00   23.99 ? 452 ILE C C   1 
ATOM   9701  O  O   . ILE C  1 345 ? 14.870  29.032  45.292  1.00   20.79 ? 452 ILE C O   1 
ATOM   9702  C  CB  . ILE C  1 345 ? 12.743  27.969  43.697  1.00   22.85 ? 452 ILE C CB  1 
ATOM   9703  C  CG1 . ILE C  1 345 ? 11.316  27.956  43.161  1.00   20.11 ? 452 ILE C CG1 1 
ATOM   9704  C  CG2 . ILE C  1 345 ? 13.458  26.728  43.185  1.00   23.94 ? 452 ILE C CG2 1 
ATOM   9705  C  CD1 . ILE C  1 345 ? 11.151  28.672  41.845  1.00   19.79 ? 452 ILE C CD1 1 
ATOM   9706  N  N   . ASP C  1 346 ? 14.574  27.294  46.687  1.00   25.74 ? 453 ASP C N   1 
ATOM   9707  C  CA  . ASP C  1 346 ? 15.937  27.385  47.186  1.00   27.82 ? 453 ASP C CA  1 
ATOM   9708  C  C   . ASP C  1 346 ? 16.795  26.620  46.175  1.00   30.36 ? 453 ASP C C   1 
ATOM   9709  O  O   . ASP C  1 346 ? 16.564  25.444  45.928  1.00   29.35 ? 453 ASP C O   1 
ATOM   9710  C  CB  . ASP C  1 346 ? 16.045  26.781  48.584  1.00   29.12 ? 453 ASP C CB  1 
ATOM   9711  C  CG  . ASP C  1 346 ? 17.212  27.354  49.361  1.00   31.47 ? 453 ASP C CG  1 
ATOM   9712  O  OD1 . ASP C  1 346 ? 17.715  28.437  48.962  1.00   27.70 ? 453 ASP C OD1 1 
ATOM   9713  O  OD2 . ASP C  1 346 ? 17.617  26.735  50.371  1.00   33.85 ? 453 ASP C OD2 1 
ATOM   9714  N  N   . ILE C  1 347 ? 17.779  27.300  45.589  1.00   31.79 ? 454 ILE C N   1 
ATOM   9715  C  CA  . ILE C  1 347 ? 18.626  26.717  44.541  1.00   30.50 ? 454 ILE C CA  1 
ATOM   9716  C  C   . ILE C  1 347 ? 19.873  25.904  44.914  1.00   31.71 ? 454 ILE C C   1 
ATOM   9717  O  O   . ILE C  1 347 ? 20.092  24.834  44.355  1.00   33.34 ? 454 ILE C O   1 
ATOM   9718  C  CB  . ILE C  1 347 ? 19.105  27.818  43.566  1.00   29.52 ? 454 ILE C CB  1 
ATOM   9719  C  CG1 . ILE C  1 347 ? 17.923  28.648  43.060  1.00   28.21 ? 454 ILE C CG1 1 
ATOM   9720  C  CG2 . ILE C  1 347 ? 19.901  27.200  42.430  1.00   26.42 ? 454 ILE C CG2 1 
ATOM   9721  C  CD1 . ILE C  1 347 ? 16.952  27.903  42.205  1.00   28.92 ? 454 ILE C CD1 1 
ATOM   9722  N  N   . LEU C  1 348 ? 20.698  26.399  45.829  1.00   32.16 ? 455 LEU C N   1 
ATOM   9723  C  CA  . LEU C  1 348 ? 21.928  25.689  46.180  1.00   34.28 ? 455 LEU C CA  1 
ATOM   9724  C  C   . LEU C  1 348 ? 21.821  24.408  47.008  1.00   37.83 ? 455 LEU C C   1 
ATOM   9725  O  O   . LEU C  1 348 ? 21.039  24.324  47.957  1.00   37.61 ? 455 LEU C O   1 
ATOM   9726  C  CB  . LEU C  1 348 ? 22.890  26.637  46.889  1.00   32.32 ? 455 LEU C CB  1 
ATOM   9727  C  CG  . LEU C  1 348 ? 23.352  27.882  46.120  1.00   34.02 ? 455 LEU C CG  1 
ATOM   9728  C  CD1 . LEU C  1 348 ? 24.421  28.589  46.940  1.00   31.35 ? 455 LEU C CD1 1 
ATOM   9729  C  CD2 . LEU C  1 348 ? 23.910  27.506  44.754  1.00   30.56 ? 455 LEU C CD2 1 
ATOM   9730  N  N   . THR C  1 349 ? 22.632  23.416  46.636  1.00   39.13 ? 456 THR C N   1 
ATOM   9731  C  CA  . THR C  1 349 ? 22.693  22.143  47.349  1.00   39.66 ? 456 THR C CA  1 
ATOM   9732  C  C   . THR C  1 349 ? 24.038  22.101  48.070  1.00   40.23 ? 456 THR C C   1 
ATOM   9733  O  O   . THR C  1 349 ? 24.348  21.154  48.784  1.00   41.94 ? 456 THR C O   1 
ATOM   9734  C  CB  . THR C  1 349 ? 22.613  20.943  46.386  1.00   40.22 ? 456 THR C CB  1 
ATOM   9735  O  OG1 . THR C  1 349 ? 23.618  21.070  45.373  1.00   43.13 ? 456 THR C OG1 1 
ATOM   9736  C  CG2 . THR C  1 349 ? 21.271  20.900  45.711  1.00   41.66 ? 456 THR C CG2 1 
ATOM   9737  N  N   . GLU C  1 350 ? 24.832  23.148  47.880  1.00   40.73 ? 457 GLU C N   1 
ATOM   9738  C  CA  . GLU C  1 350 ? 26.144  23.248  48.502  1.00   40.22 ? 457 GLU C CA  1 
ATOM   9739  C  C   . GLU C  1 350 ? 26.752  24.612  48.219  1.00   38.17 ? 457 GLU C C   1 
ATOM   9740  O  O   . GLU C  1 350 ? 26.447  25.240  47.210  1.00   36.60 ? 457 GLU C O   1 
ATOM   9741  C  CB  . GLU C  1 350 ? 27.078  22.176  47.940  1.00   42.27 ? 457 GLU C CB  1 
ATOM   9742  C  CG  . GLU C  1 350 ? 27.080  22.132  46.417  1.00   50.97 ? 457 GLU C CG  1 
ATOM   9743  C  CD  . GLU C  1 350 ? 28.350  21.525  45.833  1.00   57.63 ? 457 GLU C CD  1 
ATOM   9744  O  OE1 . GLU C  1 350 ? 28.801  20.476  46.352  1.00   59.18 ? 457 GLU C OE1 1 
ATOM   9745  O  OE2 . GLU C  1 350 ? 28.891  22.092  44.850  1.00   58.22 ? 457 GLU C OE2 1 
ATOM   9746  N  N   . PRO C  1 351 ? 27.628  25.090  49.109  1.00   36.60 ? 458 PRO C N   1 
ATOM   9747  C  CA  . PRO C  1 351 ? 28.269  26.388  48.911  1.00   36.30 ? 458 PRO C CA  1 
ATOM   9748  C  C   . PRO C  1 351 ? 29.014  26.388  47.586  1.00   36.26 ? 458 PRO C C   1 
ATOM   9749  O  O   . PRO C  1 351 ? 29.497  25.353  47.140  1.00   37.56 ? 458 PRO C O   1 
ATOM   9750  C  CB  . PRO C  1 351 ? 29.220  26.485  50.094  1.00   35.17 ? 458 PRO C CB  1 
ATOM   9751  C  CG  . PRO C  1 351 ? 28.469  25.779  51.158  1.00   38.24 ? 458 PRO C CG  1 
ATOM   9752  C  CD  . PRO C  1 351 ? 27.949  24.553  50.438  1.00   38.53 ? 458 PRO C CD  1 
ATOM   9753  N  N   . LYS C  1 352 ? 29.103  27.549  46.956  1.00   36.50 ? 459 LYS C N   1 
ATOM   9754  C  CA  . LYS C  1 352 ? 29.787  27.671  45.679  1.00   35.94 ? 459 LYS C CA  1 
ATOM   9755  C  C   . LYS C  1 352 ? 30.869  28.730  45.774  1.00   37.20 ? 459 LYS C C   1 
ATOM   9756  O  O   . LYS C  1 352 ? 30.638  29.845  46.253  1.00   37.48 ? 459 LYS C O   1 
ATOM   9757  C  CB  . LYS C  1 352 ? 28.792  28.046  44.577  1.00   36.64 ? 459 LYS C CB  1 
ATOM   9758  C  CG  . LYS C  1 352 ? 28.385  26.897  43.653  1.00   40.86 ? 459 LYS C CG  1 
ATOM   9759  C  CD  . LYS C  1 352 ? 27.730  25.759  44.413  1.00   47.29 ? 459 LYS C CD  1 
ATOM   9760  C  CE  . LYS C  1 352 ? 27.579  24.514  43.543  1.00   50.39 ? 459 LYS C CE  1 
ATOM   9761  N  NZ  . LYS C  1 352 ? 26.669  24.746  42.390  1.00   54.69 ? 459 LYS C NZ  1 
ATOM   9762  N  N   . ASP C  1 353 ? 32.059  28.372  45.322  1.00   37.25 ? 460 ASP C N   1 
ATOM   9763  C  CA  . ASP C  1 353 ? 33.165  29.293  45.352  1.00   37.68 ? 460 ASP C CA  1 
ATOM   9764  C  C   . ASP C  1 353 ? 32.984  30.289  44.211  1.00   37.15 ? 460 ASP C C   1 
ATOM   9765  O  O   . ASP C  1 353 ? 32.663  29.899  43.085  1.00   34.19 ? 460 ASP C O   1 
ATOM   9766  C  CB  . ASP C  1 353 ? 34.473  28.545  45.184  1.00   39.81 ? 460 ASP C CB  1 
ATOM   9767  C  CG  . ASP C  1 353 ? 35.649  29.425  45.426  1.00   45.78 ? 460 ASP C CG  1 
ATOM   9768  O  OD1 . ASP C  1 353 ? 35.792  29.870  46.588  1.00   47.46 ? 460 ASP C OD1 1 
ATOM   9769  O  OD2 . ASP C  1 353 ? 36.402  29.679  44.461  1.00   45.98 ? 460 ASP C OD2 1 
ATOM   9770  N  N   . ILE C  1 354 ? 33.188  31.571  44.498  1.00   33.40 ? 461 ILE C N   1 
ATOM   9771  C  CA  . ILE C  1 354 ? 33.005  32.590  43.480  1.00   33.77 ? 461 ILE C CA  1 
ATOM   9772  C  C   . ILE C  1 354 ? 34.210  32.767  42.561  1.00   36.60 ? 461 ILE C C   1 
ATOM   9773  O  O   . ILE C  1 354 ? 34.091  32.680  41.332  1.00   37.29 ? 461 ILE C O   1 
ATOM   9774  C  CB  . ILE C  1 354 ? 32.645  33.933  44.131  1.00   32.40 ? 461 ILE C CB  1 
ATOM   9775  C  CG1 . ILE C  1 354 ? 31.376  33.767  44.961  1.00   30.65 ? 461 ILE C CG1 1 
ATOM   9776  C  CG2 . ILE C  1 354 ? 32.404  34.985  43.058  1.00   32.35 ? 461 ILE C CG2 1 
ATOM   9777  C  CD1 . ILE C  1 354 ? 31.053  34.956  45.824  1.00   29.94 ? 461 ILE C CD1 1 
ATOM   9778  N  N   . GLY C  1 355 ? 35.375  33.018  43.144  1.00   36.71 ? 462 GLY C N   1 
ATOM   9779  C  CA  . GLY C  1 355 ? 36.547  33.190  42.318  1.00   38.27 ? 462 GLY C CA  1 
ATOM   9780  C  C   . GLY C  1 355 ? 36.399  34.331  41.329  1.00   40.11 ? 462 GLY C C   1 
ATOM   9781  O  O   . GLY C  1 355 ? 35.959  35.421  41.696  1.00   41.60 ? 462 GLY C O   1 
ATOM   9782  N  N   . LYS C  1 356 ? 36.767  34.082  40.075  1.00   40.24 ? 463 LYS C N   1 
ATOM   9783  C  CA  . LYS C  1 356 ? 36.710  35.108  39.043  1.00   38.36 ? 463 LYS C CA  1 
ATOM   9784  C  C   . LYS C  1 356 ? 35.317  35.238  38.472  1.00   37.12 ? 463 LYS C C   1 
ATOM   9785  O  O   . LYS C  1 356 ? 34.868  36.338  38.157  1.00   35.81 ? 463 LYS C O   1 
ATOM   9786  C  CB  . LYS C  1 356 ? 37.696  34.788  37.918  1.00   40.42 ? 463 LYS C CB  1 
ATOM   9787  C  CG  . LYS C  1 356 ? 38.239  36.032  37.213  1.00   44.54 ? 463 LYS C CG  1 
ATOM   9788  C  CD  . LYS C  1 356 ? 37.199  36.706  36.328  1.00   45.32 ? 463 LYS C CD  1 
ATOM   9789  C  CE  . LYS C  1 356 ? 37.328  38.210  36.382  0.0000 45.31 ? 463 LYS C CE  1 
ATOM   9790  N  NZ  . LYS C  1 356 ? 38.732  38.651  36.175  0.0000 45.47 ? 463 LYS C NZ  1 
ATOM   9791  N  N   . ARG C  1 357 ? 34.640  34.108  38.329  1.00   36.39 ? 464 ARG C N   1 
ATOM   9792  C  CA  . ARG C  1 357 ? 33.293  34.098  37.802  1.00   34.53 ? 464 ARG C CA  1 
ATOM   9793  C  C   . ARG C  1 357 ? 32.578  32.845  38.269  1.00   35.59 ? 464 ARG C C   1 
ATOM   9794  O  O   . ARG C  1 357 ? 33.179  31.777  38.361  1.00   37.94 ? 464 ARG C O   1 
ATOM   9795  C  CB  . ARG C  1 357 ? 33.316  34.140  36.275  1.00   34.78 ? 464 ARG C CB  1 
ATOM   9796  C  CG  . ARG C  1 357 ? 31.939  34.263  35.650  1.00   40.00 ? 464 ARG C CG  1 
ATOM   9797  C  CD  . ARG C  1 357 ? 32.005  34.409  34.138  1.00   46.37 ? 464 ARG C CD  1 
ATOM   9798  N  NE  . ARG C  1 357 ? 30.746  34.906  33.561  1.00   53.46 ? 464 ARG C NE  1 
ATOM   9799  C  CZ  . ARG C  1 357 ? 29.675  34.162  33.274  1.00   57.26 ? 464 ARG C CZ  1 
ATOM   9800  N  NH1 . ARG C  1 357 ? 28.594  34.741  32.758  1.00   58.24 ? 464 ARG C NH1 1 
ATOM   9801  N  NH2 . ARG C  1 357 ? 29.675  32.845  33.481  1.00   56.21 ? 464 ARG C NH2 1 
ATOM   9802  N  N   . LEU C  1 358 ? 31.295  32.988  38.579  1.00   32.78 ? 465 LEU C N   1 
ATOM   9803  C  CA  . LEU C  1 358 ? 30.481  31.870  39.015  1.00   29.43 ? 465 LEU C CA  1 
ATOM   9804  C  C   . LEU C  1 358 ? 29.172  31.924  38.248  1.00   30.23 ? 465 LEU C C   1 
ATOM   9805  O  O   . LEU C  1 358 ? 28.585  32.992  38.072  1.00   30.35 ? 465 LEU C O   1 
ATOM   9806  C  CB  . LEU C  1 358 ? 30.201  31.964  40.512  1.00   26.52 ? 465 LEU C CB  1 
ATOM   9807  C  CG  . LEU C  1 358 ? 29.178  30.949  41.028  1.00   23.28 ? 465 LEU C CG  1 
ATOM   9808  C  CD1 . LEU C  1 358 ? 29.690  29.552  40.767  1.00   21.44 ? 465 LEU C CD1 1 
ATOM   9809  C  CD2 . LEU C  1 358 ? 28.936  31.148  42.509  1.00   20.88 ? 465 LEU C CD2 1 
ATOM   9810  N  N   . GLU C  1 359 ? 28.726  30.772  37.776  1.00   31.38 ? 466 GLU C N   1 
ATOM   9811  C  CA  . GLU C  1 359 ? 27.478  30.692  37.042  1.00   32.82 ? 466 GLU C CA  1 
ATOM   9812  C  C   . GLU C  1 359 ? 26.678  29.561  37.662  1.00   31.59 ? 466 GLU C C   1 
ATOM   9813  O  O   . GLU C  1 359 ? 27.185  28.452  37.802  1.00   32.80 ? 466 GLU C O   1 
ATOM   9814  C  CB  . GLU C  1 359 ? 27.738  30.391  35.568  1.00   35.59 ? 466 GLU C CB  1 
ATOM   9815  C  CG  . GLU C  1 359 ? 26.633  30.878  34.651  1.00   42.34 ? 466 GLU C CG  1 
ATOM   9816  C  CD  . GLU C  1 359 ? 26.784  30.386  33.229  1.00   45.13 ? 466 GLU C CD  1 
ATOM   9817  O  OE1 . GLU C  1 359 ? 26.517  29.191  32.992  1.00   45.71 ? 466 GLU C OE1 1 
ATOM   9818  O  OE2 . GLU C  1 359 ? 27.171  31.192  32.353  1.00   48.69 ? 466 GLU C OE2 1 
ATOM   9819  N  N   . VAL C  1 360 ? 25.442  29.852  38.060  1.00   28.57 ? 467 VAL C N   1 
ATOM   9820  C  CA  . VAL C  1 360 ? 24.579  28.843  38.645  1.00   25.97 ? 467 VAL C CA  1 
ATOM   9821  C  C   . VAL C  1 360 ? 23.335  28.710  37.789  1.00   27.39 ? 467 VAL C C   1 
ATOM   9822  O  O   . VAL C  1 360 ? 22.639  29.696  37.538  1.00   29.52 ? 467 VAL C O   1 
ATOM   9823  C  CB  . VAL C  1 360 ? 24.157  29.203  40.074  1.00   24.18 ? 467 VAL C CB  1 
ATOM   9824  C  CG1 . VAL C  1 360 ? 23.235  28.141  40.591  1.00   24.92 ? 467 VAL C CG1 1 
ATOM   9825  C  CG2 . VAL C  1 360 ? 25.374  29.309  40.978  1.00   24.05 ? 467 VAL C CG2 1 
ATOM   9826  N  N   . ARG C  1 361 ? 23.071  27.495  37.323  1.00   27.01 ? 468 ARG C N   1 
ATOM   9827  C  CA  . ARG C  1 361 ? 21.911  27.243  36.482  1.00   29.58 ? 468 ARG C CA  1 
ATOM   9828  C  C   . ARG C  1 361 ? 20.925  26.378  37.219  1.00   29.55 ? 468 ARG C C   1 
ATOM   9829  O  O   . ARG C  1 361 ? 21.315  25.521  38.005  1.00   32.69 ? 468 ARG C O   1 
ATOM   9830  C  CB  . ARG C  1 361 ? 22.330  26.553  35.189  1.00   30.11 ? 468 ARG C CB  1 
ATOM   9831  C  CG  . ARG C  1 361 ? 23.147  27.441  34.309  1.00   34.27 ? 468 ARG C CG  1 
ATOM   9832  C  CD  . ARG C  1 361 ? 23.593  26.746  33.047  1.00   39.97 ? 468 ARG C CD  1 
ATOM   9833  N  NE  . ARG C  1 361 ? 24.250  27.711  32.178  1.00   43.38 ? 468 ARG C NE  1 
ATOM   9834  C  CZ  . ARG C  1 361 ? 23.626  28.394  31.223  1.00   46.68 ? 468 ARG C CZ  1 
ATOM   9835  N  NH1 . ARG C  1 361 ? 24.294  29.278  30.483  1.00   46.48 ? 468 ARG C NH1 1 
ATOM   9836  N  NH2 . ARG C  1 361 ? 22.340  28.165  30.984  1.00   45.36 ? 468 ARG C NH2 1 
ATOM   9837  N  N   . LYS C  1 362 ? 19.644  26.592  36.961  1.00   29.80 ? 469 LYS C N   1 
ATOM   9838  C  CA  . LYS C  1 362 ? 18.619  25.813  37.629  1.00   29.55 ? 469 LYS C CA  1 
ATOM   9839  C  C   . LYS C  1 362 ? 17.305  25.891  36.880  1.00   29.53 ? 469 LYS C C   1 
ATOM   9840  O  O   . LYS C  1 362 ? 16.791  26.975  36.628  1.00   26.96 ? 469 LYS C O   1 
ATOM   9841  C  CB  . LYS C  1 362 ? 18.439  26.337  39.054  1.00   31.76 ? 469 LYS C CB  1 
ATOM   9842  C  CG  . LYS C  1 362 ? 17.377  25.641  39.874  1.00   32.66 ? 469 LYS C CG  1 
ATOM   9843  C  CD  . LYS C  1 362 ? 17.768  24.237  40.226  1.00   36.42 ? 469 LYS C CD  1 
ATOM   9844  C  CE  . LYS C  1 362 ? 16.791  23.672  41.230  1.00   41.37 ? 469 LYS C CE  1 
ATOM   9845  N  NZ  . LYS C  1 362 ? 17.020  22.227  41.436  1.00   45.53 ? 469 LYS C NZ  1 
ATOM   9846  N  N   . THR C  1 363 ? 16.775  24.728  36.515  1.00   30.72 ? 470 THR C N   1 
ATOM   9847  C  CA  . THR C  1 363 ? 15.501  24.651  35.819  1.00   29.56 ? 470 THR C CA  1 
ATOM   9848  C  C   . THR C  1 363 ? 14.413  24.558  36.885  1.00   28.88 ? 470 THR C C   1 
ATOM   9849  O  O   . THR C  1 363 ? 14.475  23.698  37.762  1.00   30.19 ? 470 THR C O   1 
ATOM   9850  C  CB  . THR C  1 363 ? 15.442  23.404  34.911  1.00   30.56 ? 470 THR C CB  1 
ATOM   9851  O  OG1 . THR C  1 363 ? 16.424  23.522  33.872  1.00   29.11 ? 470 THR C OG1 1 
ATOM   9852  C  CG2 . THR C  1 363 ? 14.052  23.253  34.297  1.00   27.43 ? 470 THR C CG2 1 
ATOM   9853  N  N   . VAL C  1 364 ? 13.430  25.449  36.826  1.00   25.58 ? 471 VAL C N   1 
ATOM   9854  C  CA  . VAL C  1 364 ? 12.364  25.442  37.816  1.00   23.95 ? 471 VAL C CA  1 
ATOM   9855  C  C   . VAL C  1 364 ? 11.012  25.216  37.167  1.00   25.58 ? 471 VAL C C   1 
ATOM   9856  O  O   . VAL C  1 364 ? 10.847  25.458  35.970  1.00   27.13 ? 471 VAL C O   1 
ATOM   9857  C  CB  . VAL C  1 364 ? 12.338  26.780  38.630  1.00   25.65 ? 471 VAL C CB  1 
ATOM   9858  C  CG1 . VAL C  1 364 ? 13.742  27.077  39.163  1.00   23.83 ? 471 VAL C CG1 1 
ATOM   9859  C  CG2 . VAL C  1 364 ? 11.855  27.963  37.773  1.00   17.40 ? 471 VAL C CG2 1 
ATOM   9860  N  N   . THR C  1 365 ? 10.055  24.734  37.954  1.00   24.73 ? 472 THR C N   1 
ATOM   9861  C  CA  . THR C  1 365 ? 8.711   24.476  37.453  1.00   22.74 ? 472 THR C CA  1 
ATOM   9862  C  C   . THR C  1 365 ? 7.767   25.553  37.940  1.00   23.25 ? 472 THR C C   1 
ATOM   9863  O  O   . THR C  1 365 ? 6.580   25.529  37.617  1.00   22.25 ? 472 THR C O   1 
ATOM   9864  C  CB  . THR C  1 365 ? 8.158   23.151  37.963  1.00   23.50 ? 472 THR C CB  1 
ATOM   9865  O  OG1 . THR C  1 365 ? 8.094   23.199  39.388  1.00   24.77 ? 472 THR C OG1 1 
ATOM   9866  C  CG2 . THR C  1 365 ? 9.035   21.998  37.547  1.00   25.06 ? 472 THR C CG2 1 
ATOM   9867  N  N   . ALA C  1 366 ? 8.293   26.488  38.728  1.00   21.26 ? 473 ALA C N   1 
ATOM   9868  C  CA  . ALA C  1 366 ? 7.493   27.580  39.275  1.00   20.26 ? 473 ALA C CA  1 
ATOM   9869  C  C   . ALA C  1 366 ? 6.270   27.071  40.044  1.00   22.22 ? 473 ALA C C   1 
ATOM   9870  O  O   . ALA C  1 366 ? 5.147   27.575  39.870  1.00   22.52 ? 473 ALA C O   1 
ATOM   9871  C  CB  . ALA C  1 366 ? 7.054   28.531  38.151  1.00   15.26 ? 473 ALA C CB  1 
ATOM   9872  N  N   . CYS C  1 367 ? 6.487   26.055  40.874  1.00   21.23 ? 474 CYS C N   1 
ATOM   9873  C  CA  . CYS C  1 367 ? 5.418   25.505  41.686  1.00   22.52 ? 474 CYS C CA  1 
ATOM   9874  C  C   . CYS C  1 367 ? 4.265   24.887  40.894  1.00   23.30 ? 474 CYS C C   1 
ATOM   9875  O  O   . CYS C  1 367 ? 3.095   24.957  41.294  1.00   20.41 ? 474 CYS C O   1 
ATOM   9876  C  CB  . CYS C  1 367 ? 4.904   26.592  42.633  1.00   22.66 ? 474 CYS C CB  1 
ATOM   9877  S  SG  . CYS C  1 367 ? 6.130   27.030  43.905  1.00   25.79 ? 474 CYS C SG  1 
ATOM   9878  N  N   . LEU C  1 368 ? 4.600   24.276  39.765  1.00   24.88 ? 475 LEU C N   1 
ATOM   9879  C  CA  . LEU C  1 368 ? 3.599   23.616  38.943  1.00   26.14 ? 475 LEU C CA  1 
ATOM   9880  C  C   . LEU C  1 368 ? 2.859   22.575  39.790  1.00   29.39 ? 475 LEU C C   1 
ATOM   9881  O  O   . LEU C  1 368 ? 3.473   21.856  40.581  1.00   25.20 ? 475 LEU C O   1 
ATOM   9882  C  CB  . LEU C  1 368 ? 4.272   22.908  37.771  1.00   27.33 ? 475 LEU C CB  1 
ATOM   9883  C  CG  . LEU C  1 368 ? 3.366   22.042  36.886  1.00   26.54 ? 475 LEU C CG  1 
ATOM   9884  C  CD1 . LEU C  1 368 ? 2.384   22.921  36.120  1.00   24.55 ? 475 LEU C CD1 1 
ATOM   9885  C  CD2 . LEU C  1 368 ? 4.229   21.253  35.926  1.00   22.74 ? 475 LEU C CD2 1 
ATOM   9886  N  N   . GLY C  1 369 ? 1.542   22.507  39.626  1.00   30.40 ? 476 GLY C N   1 
ATOM   9887  C  CA  . GLY C  1 369 ? 0.762   21.544  40.376  1.00   34.02 ? 476 GLY C CA  1 
ATOM   9888  C  C   . GLY C  1 369 ? 0.441   21.946  41.803  1.00   37.58 ? 476 GLY C C   1 
ATOM   9889  O  O   . GLY C  1 369 ? -0.191  21.184  42.528  1.00   40.77 ? 476 GLY C O   1 
ATOM   9890  N  N   . GLU C  1 370 ? 0.879   23.128  42.220  1.00   38.99 ? 477 GLU C N   1 
ATOM   9891  C  CA  . GLU C  1 370 ? 0.598   23.590  43.572  1.00   39.39 ? 477 GLU C CA  1 
ATOM   9892  C  C   . GLU C  1 370 ? -0.273  24.846  43.529  1.00   38.56 ? 477 GLU C C   1 
ATOM   9893  O  O   . GLU C  1 370 ? -0.462  25.460  42.475  1.00   36.56 ? 477 GLU C O   1 
ATOM   9894  C  CB  . GLU C  1 370 ? 1.889   23.914  44.317  1.00   42.07 ? 477 GLU C CB  1 
ATOM   9895  C  CG  . GLU C  1 370 ? 2.996   22.882  44.199  1.00   49.66 ? 477 GLU C CG  1 
ATOM   9896  C  CD  . GLU C  1 370 ? 4.329   23.383  44.792  1.00   57.62 ? 477 GLU C CD  1 
ATOM   9897  O  OE1 . GLU C  1 370 ? 5.368   22.707  44.577  1.00   58.58 ? 477 GLU C OE1 1 
ATOM   9898  O  OE2 . GLU C  1 370 ? 4.338   24.449  45.474  1.00   57.25 ? 477 GLU C OE2 1 
ATOM   9899  N  N   . PRO C  1 371 ? -0.820  25.242  44.686  1.00   38.80 ? 478 PRO C N   1 
ATOM   9900  C  CA  . PRO C  1 371 ? -1.675  26.430  44.797  1.00   36.55 ? 478 PRO C CA  1 
ATOM   9901  C  C   . PRO C  1 371 ? -0.963  27.725  44.402  1.00   33.70 ? 478 PRO C C   1 
ATOM   9902  O  O   . PRO C  1 371 ? -1.611  28.698  44.027  1.00   35.23 ? 478 PRO C O   1 
ATOM   9903  C  CB  . PRO C  1 371 ? -2.069  26.436  46.272  1.00   37.32 ? 478 PRO C CB  1 
ATOM   9904  C  CG  . PRO C  1 371 ? -2.011  24.974  46.651  1.00   39.73 ? 478 PRO C CG  1 
ATOM   9905  C  CD  . PRO C  1 371 ? -0.763  24.510  45.965  1.00   38.65 ? 478 PRO C CD  1 
ATOM   9906  N  N   . ASN C  1 372 ? 0.366   27.737  44.483  1.00   30.25 ? 479 ASN C N   1 
ATOM   9907  C  CA  . ASN C  1 372 ? 1.123   28.935  44.148  1.00   30.37 ? 479 ASN C CA  1 
ATOM   9908  C  C   . ASN C  1 372 ? 1.878   28.843  42.838  1.00   27.96 ? 479 ASN C C   1 
ATOM   9909  O  O   . ASN C  1 372 ? 2.904   29.490  42.643  1.00   23.98 ? 479 ASN C O   1 
ATOM   9910  C  CB  . ASN C  1 372 ? 2.074   29.295  45.286  1.00   35.55 ? 479 ASN C CB  1 
ATOM   9911  C  CG  . ASN C  1 372 ? 2.856   28.124  45.768  1.00   43.16 ? 479 ASN C CG  1 
ATOM   9912  O  OD1 . ASN C  1 372 ? 2.527   26.974  45.466  1.00   47.10 ? 479 ASN C OD1 1 
ATOM   9913  N  ND2 . ASN C  1 372 ? 3.899   28.395  46.543  1.00   46.62 ? 479 ASN C ND2 1 
ATOM   9914  N  N   . HIS C  1 373 ? 1.343   28.032  41.938  1.00   25.55 ? 480 HIS C N   1 
ATOM   9915  C  CA  . HIS C  1 373 ? 1.904   27.860  40.613  1.00   24.30 ? 480 HIS C CA  1 
ATOM   9916  C  C   . HIS C  1 373 ? 1.829   29.230  39.919  1.00   23.88 ? 480 HIS C C   1 
ATOM   9917  O  O   . HIS C  1 373 ? 0.776   29.870  39.936  1.00   21.26 ? 480 HIS C O   1 
ATOM   9918  C  CB  . HIS C  1 373 ? 1.061   26.822  39.873  1.00   26.66 ? 480 HIS C CB  1 
ATOM   9919  C  CG  . HIS C  1 373 ? 1.387   26.683  38.422  1.00   28.59 ? 480 HIS C CG  1 
ATOM   9920  N  ND1 . HIS C  1 373 ? 2.681   26.649  37.946  1.00   32.86 ? 480 HIS C ND1 1 
ATOM   9921  C  CD2 . HIS C  1 373 ? 0.586   26.497  37.347  1.00   29.85 ? 480 HIS C CD2 1 
ATOM   9922  C  CE1 . HIS C  1 373 ? 2.663   26.447  36.640  1.00   30.07 ? 480 HIS C CE1 1 
ATOM   9923  N  NE2 . HIS C  1 373 ? 1.403   26.350  36.253  1.00   30.09 ? 480 HIS C NE2 1 
ATOM   9924  N  N   . ILE C  1 374 ? 2.938   29.688  39.337  1.00   18.62 ? 481 ILE C N   1 
ATOM   9925  C  CA  . ILE C  1 374 ? 2.965   30.982  38.662  1.00   18.45 ? 481 ILE C CA  1 
ATOM   9926  C  C   . ILE C  1 374 ? 3.325   30.870  37.186  1.00   21.34 ? 481 ILE C C   1 
ATOM   9927  O  O   . ILE C  1 374 ? 4.393   30.352  36.825  1.00   20.26 ? 481 ILE C O   1 
ATOM   9928  C  CB  . ILE C  1 374 ? 3.976   31.951  39.341  1.00   19.92 ? 481 ILE C CB  1 
ATOM   9929  C  CG1 . ILE C  1 374 ? 3.477   32.326  40.737  1.00   19.48 ? 481 ILE C CG1 1 
ATOM   9930  C  CG2 . ILE C  1 374 ? 4.136   33.239  38.520  1.00   19.14 ? 481 ILE C CG2 1 
ATOM   9931  C  CD1 . ILE C  1 374 ? 4.489   33.074  41.578  1.00   18.16 ? 481 ILE C CD1 1 
ATOM   9932  N  N   . THR C  1 375 ? 2.431   31.366  36.335  1.00   22.71 ? 482 THR C N   1 
ATOM   9933  C  CA  . THR C  1 375 ? 2.649   31.343  34.890  1.00   22.68 ? 482 THR C CA  1 
ATOM   9934  C  C   . THR C  1 375 ? 2.834   32.764  34.368  1.00   23.36 ? 482 THR C C   1 
ATOM   9935  O  O   . THR C  1 375 ? 3.303   32.980  33.257  1.00   21.82 ? 482 THR C O   1 
ATOM   9936  C  CB  . THR C  1 375 ? 1.468   30.677  34.158  1.00   22.57 ? 482 THR C CB  1 
ATOM   9937  O  OG1 . THR C  1 375 ? 0.245   31.374  34.448  1.00   18.53 ? 482 THR C OG1 1 
ATOM   9938  C  CG2 . THR C  1 375 ? 1.341   29.226  34.617  1.00   19.47 ? 482 THR C CG2 1 
ATOM   9939  N  N   . ARG C  1 376 ? 2.475   33.732  35.198  1.00   24.94 ? 483 ARG C N   1 
ATOM   9940  C  CA  . ARG C  1 376 ? 2.590   35.134  34.839  1.00   26.22 ? 483 ARG C CA  1 
ATOM   9941  C  C   . ARG C  1 376 ? 3.297   35.867  35.991  1.00   23.41 ? 483 ARG C C   1 
ATOM   9942  O  O   . ARG C  1 376 ? 2.698   36.206  37.009  1.00   23.32 ? 483 ARG C O   1 
ATOM   9943  C  CB  . ARG C  1 376 ? 1.192   35.686  34.594  1.00   28.20 ? 483 ARG C CB  1 
ATOM   9944  C  CG  . ARG C  1 376 ? 1.161   37.101  34.105  1.00   40.48 ? 483 ARG C CG  1 
ATOM   9945  C  CD  . ARG C  1 376 ? -0.199  37.385  33.537  1.00   49.89 ? 483 ARG C CD  1 
ATOM   9946  N  NE  . ARG C  1 376 ? -0.346  38.765  33.094  1.00   56.51 ? 483 ARG C NE  1 
ATOM   9947  C  CZ  . ARG C  1 376 ? -1.266  39.166  32.222  1.00   61.31 ? 483 ARG C CZ  1 
ATOM   9948  N  NH1 . ARG C  1 376 ? -1.336  40.447  31.873  1.00   63.83 ? 483 ARG C NH1 1 
ATOM   9949  N  NH2 . ARG C  1 376 ? -2.105  38.281  31.687  1.00   61.91 ? 483 ARG C NH2 1 
ATOM   9950  N  N   . LEU C  1 377 ? 4.588   36.096  35.815  1.00   19.68 ? 484 LEU C N   1 
ATOM   9951  C  CA  . LEU C  1 377 ? 5.412   36.744  36.829  1.00   18.61 ? 484 LEU C CA  1 
ATOM   9952  C  C   . LEU C  1 377 ? 5.129   38.230  37.061  1.00   19.55 ? 484 LEU C C   1 
ATOM   9953  O  O   . LEU C  1 377 ? 4.691   38.952  36.169  1.00   16.77 ? 484 LEU C O   1 
ATOM   9954  C  CB  . LEU C  1 377 ? 6.898   36.603  36.452  1.00   20.15 ? 484 LEU C CB  1 
ATOM   9955  C  CG  . LEU C  1 377 ? 8.033   36.239  37.401  1.00   23.18 ? 484 LEU C CG  1 
ATOM   9956  C  CD1 . LEU C  1 377 ? 9.319   36.918  36.930  1.00   19.56 ? 484 LEU C CD1 1 
ATOM   9957  C  CD2 . LEU C  1 377 ? 7.747   36.672  38.808  1.00   25.47 ? 484 LEU C CD2 1 
ATOM   9958  N  N   . GLU C  1 378 ? 5.399   38.678  38.281  1.00   18.58 ? 485 GLU C N   1 
ATOM   9959  C  CA  . GLU C  1 378 ? 5.289   40.084  38.633  1.00   17.75 ? 485 GLU C CA  1 
ATOM   9960  C  C   . GLU C  1 378 ? 6.715   40.379  39.113  1.00   18.61 ? 485 GLU C C   1 
ATOM   9961  O  O   . GLU C  1 378 ? 7.626   40.429  38.294  1.00   19.64 ? 485 GLU C O   1 
ATOM   9962  C  CB  . GLU C  1 378 ? 4.230   40.294  39.716  1.00   19.37 ? 485 GLU C CB  1 
ATOM   9963  C  CG  . GLU C  1 378 ? 2.810   40.220  39.135  1.00   19.19 ? 485 GLU C CG  1 
ATOM   9964  C  CD  . GLU C  1 378 ? 1.700   40.346  40.166  1.00   20.20 ? 485 GLU C CD  1 
ATOM   9965  O  OE1 . GLU C  1 378 ? 0.511   40.261  39.769  1.00   22.19 ? 485 GLU C OE1 1 
ATOM   9966  O  OE2 . GLU C  1 378 ? 1.999   40.528  41.364  1.00   16.30 ? 485 GLU C OE2 1 
ATOM   9967  N  N   . HIS C  1 379 ? 6.943   40.545  40.410  1.00   16.75 ? 486 HIS C N   1 
ATOM   9968  C  CA  . HIS C  1 379 ? 8.305   40.792  40.866  1.00   14.98 ? 486 HIS C CA  1 
ATOM   9969  C  C   . HIS C  1 379 ? 9.026   39.455  41.058  1.00   16.49 ? 486 HIS C C   1 
ATOM   9970  O  O   . HIS C  1 379 ? 8.405   38.418  41.220  1.00   16.69 ? 486 HIS C O   1 
ATOM   9971  C  CB  . HIS C  1 379 ? 8.346   41.496  42.230  1.00   14.51 ? 486 HIS C CB  1 
ATOM   9972  C  CG  . HIS C  1 379 ? 7.348   42.595  42.399  1.00   17.41 ? 486 HIS C CG  1 
ATOM   9973  N  ND1 . HIS C  1 379 ? 6.015   42.357  42.672  1.00   20.46 ? 486 HIS C ND1 1 
ATOM   9974  C  CD2 . HIS C  1 379 ? 7.491   43.940  42.362  1.00   15.73 ? 486 HIS C CD2 1 
ATOM   9975  C  CE1 . HIS C  1 379 ? 5.382   43.512  42.798  1.00   17.92 ? 486 HIS C CE1 1 
ATOM   9976  N  NE2 . HIS C  1 379 ? 6.255   44.487  42.614  1.00   17.22 ? 486 HIS C NE2 1 
ATOM   9977  N  N   . ALA C  1 380 ? 10.348  39.495  41.065  1.00   19.03 ? 487 ALA C N   1 
ATOM   9978  C  CA  . ALA C  1 380 ? 11.149  38.310  41.318  1.00   18.32 ? 487 ALA C CA  1 
ATOM   9979  C  C   . ALA C  1 380 ? 12.297  38.802  42.185  1.00   19.21 ? 487 ALA C C   1 
ATOM   9980  O  O   . ALA C  1 380 ? 12.802  39.918  41.992  1.00   17.32 ? 487 ALA C O   1 
ATOM   9981  C  CB  . ALA C  1 380 ? 11.685  37.709  40.012  1.00   19.46 ? 487 ALA C CB  1 
ATOM   9982  N  N   . GLN C  1 381 ? 12.677  37.994  43.165  1.00   17.86 ? 488 GLN C N   1 
ATOM   9983  C  CA  . GLN C  1 381 ? 13.795  38.344  44.022  1.00   18.31 ? 488 GLN C CA  1 
ATOM   9984  C  C   . GLN C  1 381 ? 14.800  37.202  43.989  1.00   18.47 ? 488 GLN C C   1 
ATOM   9985  O  O   . GLN C  1 381 ? 14.435  36.028  43.844  1.00   17.40 ? 488 GLN C O   1 
ATOM   9986  C  CB  . GLN C  1 381 ? 13.370  38.518  45.484  1.00   16.69 ? 488 GLN C CB  1 
ATOM   9987  C  CG  . GLN C  1 381 ? 12.424  39.644  45.805  1.00   19.55 ? 488 GLN C CG  1 
ATOM   9988  C  CD  . GLN C  1 381 ? 11.875  39.499  47.233  1.00   24.31 ? 488 GLN C CD  1 
ATOM   9989  O  OE1 . GLN C  1 381 ? 11.480  38.403  47.641  1.00   23.83 ? 488 GLN C OE1 1 
ATOM   9990  N  NE2 . GLN C  1 381 ? 11.849  40.597  47.990  1.00   20.40 ? 488 GLN C NE2 1 
ATOM   9991  N  N   . ALA C  1 382 ? 16.067  37.557  44.122  1.00   17.18 ? 489 ALA C N   1 
ATOM   9992  C  CA  . ALA C  1 382 ? 17.122  36.577  44.188  1.00   17.73 ? 489 ALA C CA  1 
ATOM   9993  C  C   . ALA C  1 382 ? 17.716  36.908  45.548  1.00   19.34 ? 489 ALA C C   1 
ATOM   9994  O  O   . ALA C  1 382 ? 18.431  37.900  45.697  1.00   19.47 ? 489 ALA C O   1 
ATOM   9995  C  CB  . ALA C  1 382 ? 18.125  36.800  43.092  1.00   19.02 ? 489 ALA C CB  1 
ATOM   9996  N  N   . ARG C  1 383 ? 17.370  36.114  46.558  1.00   18.03 ? 490 ARG C N   1 
ATOM   9997  C  CA  . ARG C  1 383 ? 17.888  36.358  47.900  1.00   19.40 ? 490 ARG C CA  1 
ATOM   9998  C  C   . ARG C  1 383 ? 19.250  35.687  47.998  1.00   20.73 ? 490 ARG C C   1 
ATOM   9999  O  O   . ARG C  1 383 ? 19.360  34.448  47.965  1.00   18.82 ? 490 ARG C O   1 
ATOM   10000 C  CB  . ARG C  1 383 ? 16.941  35.795  48.959  1.00   20.45 ? 490 ARG C CB  1 
ATOM   10001 C  CG  . ARG C  1 383 ? 15.468  36.208  48.796  1.00   19.62 ? 490 ARG C CG  1 
ATOM   10002 C  CD  . ARG C  1 383 ? 14.678  35.794  50.038  1.00   18.63 ? 490 ARG C CD  1 
ATOM   10003 N  NE  . ARG C  1 383 ? 15.147  36.556  51.184  1.00   18.45 ? 490 ARG C NE  1 
ATOM   10004 C  CZ  . ARG C  1 383 ? 14.577  37.673  51.619  1.00   23.07 ? 490 ARG C CZ  1 
ATOM   10005 N  NH1 . ARG C  1 383 ? 15.093  38.322  52.661  1.00   20.55 ? 490 ARG C NH1 1 
ATOM   10006 N  NH2 . ARG C  1 383 ? 13.467  38.118  51.036  1.00   23.45 ? 490 ARG C NH2 1 
ATOM   10007 N  N   . LEU C  1 384 ? 20.287  36.509  48.122  1.00   19.05 ? 491 LEU C N   1 
ATOM   10008 C  CA  . LEU C  1 384 ? 21.643  35.991  48.177  1.00   20.07 ? 491 LEU C CA  1 
ATOM   10009 C  C   . LEU C  1 384 ? 22.380  36.196  49.485  1.00   20.52 ? 491 LEU C C   1 
ATOM   10010 O  O   . LEU C  1 384 ? 22.241  37.224  50.149  1.00   20.83 ? 491 LEU C O   1 
ATOM   10011 C  CB  . LEU C  1 384 ? 22.484  36.618  47.065  1.00   18.25 ? 491 LEU C CB  1 
ATOM   10012 C  CG  . LEU C  1 384 ? 21.924  36.617  45.650  1.00   24.04 ? 491 LEU C CG  1 
ATOM   10013 C  CD1 . LEU C  1 384 ? 22.910  37.290  44.698  1.00   21.46 ? 491 LEU C CD1 1 
ATOM   10014 C  CD2 . LEU C  1 384 ? 21.659  35.187  45.228  1.00   19.39 ? 491 LEU C CD2 1 
ATOM   10015 N  N   . THR C  1 385 ? 23.170  35.193  49.845  1.00   21.33 ? 492 THR C N   1 
ATOM   10016 C  CA  . THR C  1 385 ? 24.011  35.250  51.025  1.00   21.34 ? 492 THR C CA  1 
ATOM   10017 C  C   . THR C  1 385 ? 25.380  34.821  50.536  1.00   21.34 ? 492 THR C C   1 
ATOM   10018 O  O   . THR C  1 385 ? 25.552  33.714  50.033  1.00   22.83 ? 492 THR C O   1 
ATOM   10019 C  CB  . THR C  1 385 ? 23.532  34.305  52.122  1.00   20.60 ? 492 THR C CB  1 
ATOM   10020 O  OG1 . THR C  1 385 ? 22.213  34.692  52.506  1.00   21.88 ? 492 THR C OG1 1 
ATOM   10021 C  CG2 . THR C  1 385 ? 24.452  34.401  53.355  1.00   17.51 ? 492 THR C CG2 1 
ATOM   10022 N  N   . LEU C  1 386 ? 26.351  35.713  50.662  1.00   22.57 ? 493 LEU C N   1 
ATOM   10023 C  CA  . LEU C  1 386 ? 27.694  35.416  50.196  1.00   24.29 ? 493 LEU C CA  1 
ATOM   10024 C  C   . LEU C  1 386 ? 28.755  36.225  50.927  1.00   27.50 ? 493 LEU C C   1 
ATOM   10025 O  O   . LEU C  1 386 ? 28.470  37.276  51.511  1.00   28.70 ? 493 LEU C O   1 
ATOM   10026 C  CB  . LEU C  1 386 ? 27.796  35.715  48.702  1.00   21.32 ? 493 LEU C CB  1 
ATOM   10027 C  CG  . LEU C  1 386 ? 27.602  37.193  48.309  1.00   19.06 ? 493 LEU C CG  1 
ATOM   10028 C  CD1 . LEU C  1 386 ? 28.913  37.938  48.402  1.00   14.25 ? 493 LEU C CD1 1 
ATOM   10029 C  CD2 . LEU C  1 386 ? 27.107  37.300  46.875  1.00   18.20 ? 493 LEU C CD2 1 
ATOM   10030 N  N   . SER C  1 387 ? 29.985  35.723  50.883  1.00   28.79 ? 494 SER C N   1 
ATOM   10031 C  CA  . SER C  1 387 ? 31.119  36.396  51.502  1.00   27.47 ? 494 SER C CA  1 
ATOM   10032 C  C   . SER C  1 387 ? 32.023  36.815  50.354  1.00   26.51 ? 494 SER C C   1 
ATOM   10033 O  O   . SER C  1 387 ? 32.049  36.167  49.311  1.00   27.65 ? 494 SER C O   1 
ATOM   10034 C  CB  . SER C  1 387 ? 31.874  35.446  52.442  1.00   26.17 ? 494 SER C CB  1 
ATOM   10035 O  OG  . SER C  1 387 ? 32.425  34.342  51.736  1.00   28.38 ? 494 SER C OG  1 
ATOM   10036 N  N   . TYR C  1 388 ? 32.743  37.910  50.532  1.00   26.96 ? 495 TYR C N   1 
ATOM   10037 C  CA  . TYR C  1 388 ? 33.651  38.388  49.499  1.00   26.78 ? 495 TYR C CA  1 
ATOM   10038 C  C   . TYR C  1 388 ? 34.570  39.396  50.149  1.00   26.59 ? 495 TYR C C   1 
ATOM   10039 O  O   . TYR C  1 388 ? 34.190  40.050  51.121  1.00   27.32 ? 495 TYR C O   1 
ATOM   10040 C  CB  . TYR C  1 388 ? 32.896  39.044  48.346  1.00   24.02 ? 495 TYR C CB  1 
ATOM   10041 C  CG  . TYR C  1 388 ? 33.630  38.919  47.031  1.00   27.54 ? 495 TYR C CG  1 
ATOM   10042 C  CD1 . TYR C  1 388 ? 33.813  37.664  46.433  1.00   29.46 ? 495 TYR C CD1 1 
ATOM   10043 C  CD2 . TYR C  1 388 ? 34.143  40.040  46.379  1.00   29.63 ? 495 TYR C CD2 1 
ATOM   10044 C  CE1 . TYR C  1 388 ? 34.486  37.527  45.224  1.00   30.74 ? 495 TYR C CE1 1 
ATOM   10045 C  CE2 . TYR C  1 388 ? 34.824  39.915  45.151  1.00   31.21 ? 495 TYR C CE2 1 
ATOM   10046 C  CZ  . TYR C  1 388 ? 34.990  38.654  44.581  1.00   31.83 ? 495 TYR C CZ  1 
ATOM   10047 O  OH  . TYR C  1 388 ? 35.647  38.507  43.371  1.00   34.18 ? 495 TYR C OH  1 
ATOM   10048 N  N   . ASN C  1 389 ? 35.779  39.519  49.619  1.00   27.27 ? 496 ASN C N   1 
ATOM   10049 C  CA  . ASN C  1 389 ? 36.756  40.425  50.201  1.00   30.63 ? 496 ASN C CA  1 
ATOM   10050 C  C   . ASN C  1 389 ? 36.566  41.886  49.824  1.00   32.02 ? 496 ASN C C   1 
ATOM   10051 O  O   . ASN C  1 389 ? 36.888  42.779  50.610  1.00   33.90 ? 496 ASN C O   1 
ATOM   10052 C  CB  . ASN C  1 389 ? 38.180  39.973  49.835  1.00   30.23 ? 496 ASN C CB  1 
ATOM   10053 C  CG  . ASN C  1 389 ? 38.447  39.993  48.321  1.00   28.78 ? 496 ASN C CG  1 
ATOM   10054 O  OD1 . ASN C  1 389 ? 37.819  39.265  47.551  1.00   28.16 ? 496 ASN C OD1 1 
ATOM   10055 N  ND2 . ASN C  1 389 ? 39.394  40.828  47.901  1.00   26.63 ? 496 ASN C ND2 1 
ATOM   10056 N  N   . ARG C  1 390 ? 36.035  42.133  48.630  1.00   33.69 ? 497 ARG C N   1 
ATOM   10057 C  CA  . ARG C  1 390 ? 35.826  43.504  48.159  1.00   34.59 ? 497 ARG C CA  1 
ATOM   10058 C  C   . ARG C  1 390 ? 34.486  43.569  47.435  1.00   33.87 ? 497 ARG C C   1 
ATOM   10059 O  O   . ARG C  1 390 ? 34.426  43.426  46.214  1.00   33.95 ? 497 ARG C O   1 
ATOM   10060 C  CB  . ARG C  1 390 ? 36.959  43.880  47.211  1.00   35.91 ? 497 ARG C CB  1 
ATOM   10061 C  CG  . ARG C  1 390 ? 37.465  45.279  47.389  1.00   40.49 ? 497 ARG C CG  1 
ATOM   10062 C  CD  . ARG C  1 390 ? 36.930  46.222  46.340  1.00   45.78 ? 497 ARG C CD  1 
ATOM   10063 N  NE  . ARG C  1 390 ? 37.319  47.592  46.661  1.00   50.34 ? 497 ARG C NE  1 
ATOM   10064 C  CZ  . ARG C  1 390 ? 36.878  48.671  46.024  1.00   51.06 ? 497 ARG C CZ  1 
ATOM   10065 N  NH1 . ARG C  1 390 ? 36.024  48.543  45.009  1.00   48.15 ? 497 ARG C NH1 1 
ATOM   10066 N  NH2 . ARG C  1 390 ? 37.269  49.879  46.428  1.00   49.35 ? 497 ARG C NH2 1 
ATOM   10067 N  N   . ARG C  1 391 ? 33.422  43.806  48.198  1.00   30.32 ? 498 ARG C N   1 
ATOM   10068 C  CA  . ARG C  1 391 ? 32.059  43.821  47.670  1.00   27.50 ? 498 ARG C CA  1 
ATOM   10069 C  C   . ARG C  1 391 ? 31.795  44.599  46.375  1.00   26.45 ? 498 ARG C C   1 
ATOM   10070 O  O   . ARG C  1 391 ? 31.142  44.083  45.467  1.00   22.42 ? 498 ARG C O   1 
ATOM   10071 C  CB  . ARG C  1 391 ? 31.093  44.294  48.758  1.00   24.55 ? 498 ARG C CB  1 
ATOM   10072 C  CG  . ARG C  1 391 ? 29.656  43.904  48.485  1.00   23.97 ? 498 ARG C CG  1 
ATOM   10073 C  CD  . ARG C  1 391 ? 28.816  44.108  49.723  1.00   23.01 ? 498 ARG C CD  1 
ATOM   10074 N  NE  . ARG C  1 391 ? 28.873  45.494  50.158  1.00   20.71 ? 498 ARG C NE  1 
ATOM   10075 C  CZ  . ARG C  1 391 ? 28.439  45.925  51.336  1.00   21.82 ? 498 ARG C CZ  1 
ATOM   10076 N  NH1 . ARG C  1 391 ? 28.533  47.217  51.637  1.00   18.81 ? 498 ARG C NH1 1 
ATOM   10077 N  NH2 . ARG C  1 391 ? 27.924  45.062  52.212  1.00   14.71 ? 498 ARG C NH2 1 
ATOM   10078 N  N   . GLY C  1 392 ? 32.302  45.826  46.292  1.00   25.13 ? 499 GLY C N   1 
ATOM   10079 C  CA  . GLY C  1 392 ? 32.089  46.643  45.112  1.00   22.26 ? 499 GLY C CA  1 
ATOM   10080 C  C   . GLY C  1 392 ? 32.673  46.127  43.807  1.00   25.66 ? 499 GLY C C   1 
ATOM   10081 O  O   . GLY C  1 392 ? 32.370  46.664  42.737  1.00   25.14 ? 499 GLY C O   1 
ATOM   10082 N  N   . ASP C  1 393 ? 33.520  45.104  43.871  1.00   23.82 ? 500 ASP C N   1 
ATOM   10083 C  CA  . ASP C  1 393 ? 34.104  44.568  42.645  1.00   24.63 ? 500 ASP C CA  1 
ATOM   10084 C  C   . ASP C  1 393 ? 33.157  43.580  41.965  1.00   22.89 ? 500 ASP C C   1 
ATOM   10085 O  O   . ASP C  1 393 ? 33.363  43.191  40.809  1.00   19.85 ? 500 ASP C O   1 
ATOM   10086 C  CB  . ASP C  1 393 ? 35.446  43.891  42.934  1.00   24.42 ? 500 ASP C CB  1 
ATOM   10087 C  CG  . ASP C  1 393 ? 36.565  44.897  43.194  1.00   30.36 ? 500 ASP C CG  1 
ATOM   10088 O  OD1 . ASP C  1 393 ? 36.403  46.079  42.826  1.00   32.99 ? 500 ASP C OD1 1 
ATOM   10089 O  OD2 . ASP C  1 393 ? 37.614  44.508  43.747  1.00   33.07 ? 500 ASP C OD2 1 
ATOM   10090 N  N   . LEU C  1 394 ? 32.108  43.191  42.681  1.00   21.33 ? 501 LEU C N   1 
ATOM   10091 C  CA  . LEU C  1 394 ? 31.135  42.247  42.139  1.00   21.98 ? 501 LEU C CA  1 
ATOM   10092 C  C   . LEU C  1 394 ? 30.080  42.857  41.219  1.00   20.65 ? 501 LEU C C   1 
ATOM   10093 O  O   . LEU C  1 394 ? 29.669  44.000  41.380  1.00