data_4OMD
# 
_entry.id   4OMD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OMD         
RCSB  RCSB084674   
WWPDB D_1000084674 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OMC 'X-ray structure of human furin in complex with meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine' 
unspecified 
PDB 1P8J 'Crystal structure of mouse furin'                                                                                      
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OMD 
_pdbx_database_status.recvd_initial_deposition_date   2014-01-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dahms, S.O.' 1 
'Than, M.E.'  2 
# 
_citation.id                        primary 
_citation.title                     'X-ray Structures of Human Furin in Complex with Competitive Inhibitors.' 
_citation.journal_abbrev            'Acs Chem.Biol.' 
_citation.journal_volume            9 
_citation.page_first                1113 
_citation.page_last                 1118 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1554-8929 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24666235 
_citation.pdbx_database_id_DOI      10.1021/cb500087x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dahms, S.O.'      1 
primary 'Hardes, K.'       2 
primary 'Becker, G.L.'     3 
primary 'Steinmetzer, T.'  4 
primary 'Brandstetter, H.' 5 
primary 'Than, M.E.'       6 
# 
_cell.entry_id           4OMD 
_cell.length_a           141.616 
_cell.length_b           152.612 
_cell.length_c           168.538 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OMD 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Furin                                               52388.602 6   3.4.21.75 ? 'UNP residues 108-574' ? 
2 polymer     syn 'phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine' 664.845   6   ?         ? ?                      ? 
3 non-polymer syn 'FORMIC ACID'                                       46.025    12  ?         ? ?                      ? 
4 non-polymer syn 'CALCIUM ION'                                       40.078    18  ?         ? ?                      ? 
5 non-polymer syn 'SODIUM ION'                                        22.990    6   ?         ? ?                      ? 
6 water       nat water                                               18.015    661 ?         ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dibasic-processing enzyme, Paired basic amino acid residue-cleaving enzyme, PACE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no yes '(HY1)RVR(00S)' XRVRX H,I,J,K,L,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   TYR n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   THR n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  PHE n 
1 12  PRO n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  TYR n 
1 17  LEU n 
1 18  SER n 
1 19  GLY n 
1 20  VAL n 
1 21  THR n 
1 22  GLN n 
1 23  ARG n 
1 24  ASP n 
1 25  LEU n 
1 26  ASN n 
1 27  VAL n 
1 28  LYS n 
1 29  ALA n 
1 30  ALA n 
1 31  TRP n 
1 32  ALA n 
1 33  GLN n 
1 34  GLY n 
1 35  TYR n 
1 36  THR n 
1 37  GLY n 
1 38  HIS n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  VAL n 
1 43  SER n 
1 44  ILE n 
1 45  LEU n 
1 46  ASP n 
1 47  ASP n 
1 48  GLY n 
1 49  ILE n 
1 50  GLU n 
1 51  LYS n 
1 52  ASN n 
1 53  HIS n 
1 54  PRO n 
1 55  ASP n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  ASN n 
1 60  TYR n 
1 61  ASP n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  SER n 
1 66  PHE n 
1 67  ASP n 
1 68  VAL n 
1 69  ASN n 
1 70  ASP n 
1 71  GLN n 
1 72  ASP n 
1 73  PRO n 
1 74  ASP n 
1 75  PRO n 
1 76  GLN n 
1 77  PRO n 
1 78  ARG n 
1 79  TYR n 
1 80  THR n 
1 81  GLN n 
1 82  MET n 
1 83  ASN n 
1 84  ASP n 
1 85  ASN n 
1 86  ARG n 
1 87  HIS n 
1 88  GLY n 
1 89  THR n 
1 90  ARG n 
1 91  CYS n 
1 92  ALA n 
1 93  GLY n 
1 94  GLU n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  VAL n 
1 99  ALA n 
1 100 ASN n 
1 101 ASN n 
1 102 GLY n 
1 103 VAL n 
1 104 CYS n 
1 105 GLY n 
1 106 VAL n 
1 107 GLY n 
1 108 VAL n 
1 109 ALA n 
1 110 TYR n 
1 111 ASN n 
1 112 ALA n 
1 113 ARG n 
1 114 ILE n 
1 115 GLY n 
1 116 GLY n 
1 117 VAL n 
1 118 ARG n 
1 119 MET n 
1 120 LEU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 VAL n 
1 125 THR n 
1 126 ASP n 
1 127 ALA n 
1 128 VAL n 
1 129 GLU n 
1 130 ALA n 
1 131 ARG n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 LEU n 
1 136 ASN n 
1 137 PRO n 
1 138 ASN n 
1 139 HIS n 
1 140 ILE n 
1 141 HIS n 
1 142 ILE n 
1 143 TYR n 
1 144 SER n 
1 145 ALA n 
1 146 SER n 
1 147 TRP n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 ASP n 
1 152 ASP n 
1 153 GLY n 
1 154 LYS n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 GLY n 
1 159 PRO n 
1 160 ALA n 
1 161 ARG n 
1 162 LEU n 
1 163 ALA n 
1 164 GLU n 
1 165 GLU n 
1 166 ALA n 
1 167 PHE n 
1 168 PHE n 
1 169 ARG n 
1 170 GLY n 
1 171 VAL n 
1 172 SER n 
1 173 GLN n 
1 174 GLY n 
1 175 ARG n 
1 176 GLY n 
1 177 GLY n 
1 178 LEU n 
1 179 GLY n 
1 180 SER n 
1 181 ILE n 
1 182 PHE n 
1 183 VAL n 
1 184 TRP n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 ASN n 
1 189 GLY n 
1 190 GLY n 
1 191 ARG n 
1 192 GLU n 
1 193 HIS n 
1 194 ASP n 
1 195 SER n 
1 196 CYS n 
1 197 ASN n 
1 198 CYS n 
1 199 ASP n 
1 200 GLY n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 SER n 
1 205 ILE n 
1 206 TYR n 
1 207 THR n 
1 208 LEU n 
1 209 SER n 
1 210 ILE n 
1 211 SER n 
1 212 SER n 
1 213 ALA n 
1 214 THR n 
1 215 GLN n 
1 216 PHE n 
1 217 GLY n 
1 218 ASN n 
1 219 VAL n 
1 220 PRO n 
1 221 TRP n 
1 222 TYR n 
1 223 SER n 
1 224 GLU n 
1 225 ALA n 
1 226 CYS n 
1 227 SER n 
1 228 SER n 
1 229 THR n 
1 230 LEU n 
1 231 ALA n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 SER n 
1 236 SER n 
1 237 GLY n 
1 238 ASN n 
1 239 GLN n 
1 240 ASN n 
1 241 GLU n 
1 242 LYS n 
1 243 GLN n 
1 244 ILE n 
1 245 VAL n 
1 246 THR n 
1 247 THR n 
1 248 ASP n 
1 249 LEU n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 CYS n 
1 254 THR n 
1 255 GLU n 
1 256 SER n 
1 257 HIS n 
1 258 THR n 
1 259 GLY n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 SER n 
1 264 ALA n 
1 265 PRO n 
1 266 LEU n 
1 267 ALA n 
1 268 ALA n 
1 269 GLY n 
1 270 ILE n 
1 271 ILE n 
1 272 ALA n 
1 273 LEU n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 THR n 
1 283 TRP n 
1 284 ARG n 
1 285 ASP n 
1 286 MET n 
1 287 GLN n 
1 288 HIS n 
1 289 LEU n 
1 290 VAL n 
1 291 VAL n 
1 292 GLN n 
1 293 THR n 
1 294 SER n 
1 295 LYS n 
1 296 PRO n 
1 297 ALA n 
1 298 HIS n 
1 299 LEU n 
1 300 ASN n 
1 301 ALA n 
1 302 ASN n 
1 303 ASP n 
1 304 TRP n 
1 305 ALA n 
1 306 THR n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 GLY n 
1 311 ARG n 
1 312 LYS n 
1 313 VAL n 
1 314 SER n 
1 315 HIS n 
1 316 SER n 
1 317 TYR n 
1 318 GLY n 
1 319 TYR n 
1 320 GLY n 
1 321 LEU n 
1 322 LEU n 
1 323 ASP n 
1 324 ALA n 
1 325 GLY n 
1 326 ALA n 
1 327 MET n 
1 328 VAL n 
1 329 ALA n 
1 330 LEU n 
1 331 ALA n 
1 332 GLN n 
1 333 ASN n 
1 334 TRP n 
1 335 THR n 
1 336 THR n 
1 337 VAL n 
1 338 ALA n 
1 339 PRO n 
1 340 GLN n 
1 341 ARG n 
1 342 LYS n 
1 343 CYS n 
1 344 ILE n 
1 345 ILE n 
1 346 ASP n 
1 347 ILE n 
1 348 LEU n 
1 349 THR n 
1 350 GLU n 
1 351 PRO n 
1 352 LYS n 
1 353 ASP n 
1 354 ILE n 
1 355 GLY n 
1 356 LYS n 
1 357 ARG n 
1 358 LEU n 
1 359 GLU n 
1 360 VAL n 
1 361 ARG n 
1 362 LYS n 
1 363 THR n 
1 364 VAL n 
1 365 THR n 
1 366 ALA n 
1 367 CYS n 
1 368 LEU n 
1 369 GLY n 
1 370 GLU n 
1 371 PRO n 
1 372 ASN n 
1 373 HIS n 
1 374 ILE n 
1 375 THR n 
1 376 ARG n 
1 377 LEU n 
1 378 GLU n 
1 379 HIS n 
1 380 ALA n 
1 381 GLN n 
1 382 ALA n 
1 383 ARG n 
1 384 LEU n 
1 385 THR n 
1 386 LEU n 
1 387 SER n 
1 388 TYR n 
1 389 ASN n 
1 390 ARG n 
1 391 ARG n 
1 392 GLY n 
1 393 ASP n 
1 394 LEU n 
1 395 ALA n 
1 396 ILE n 
1 397 HIS n 
1 398 LEU n 
1 399 VAL n 
1 400 SER n 
1 401 PRO n 
1 402 MET n 
1 403 GLY n 
1 404 THR n 
1 405 ARG n 
1 406 SER n 
1 407 THR n 
1 408 LEU n 
1 409 LEU n 
1 410 ALA n 
1 411 ALA n 
1 412 ARG n 
1 413 PRO n 
1 414 HIS n 
1 415 ASP n 
1 416 TYR n 
1 417 SER n 
1 418 ALA n 
1 419 ASP n 
1 420 GLY n 
1 421 PHE n 
1 422 ASN n 
1 423 ASP n 
1 424 TRP n 
1 425 ALA n 
1 426 PHE n 
1 427 MET n 
1 428 THR n 
1 429 THR n 
1 430 HIS n 
1 431 SER n 
1 432 TRP n 
1 433 ASP n 
1 434 GLU n 
1 435 ASP n 
1 436 PRO n 
1 437 SER n 
1 438 GLY n 
1 439 GLU n 
1 440 TRP n 
1 441 VAL n 
1 442 LEU n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 ASN n 
1 447 THR n 
1 448 SER n 
1 449 GLU n 
1 450 ALA n 
1 451 ASN n 
1 452 ASN n 
1 453 TYR n 
1 454 GLY n 
1 455 THR n 
1 456 LEU n 
1 457 THR n 
1 458 LYS n 
1 459 PHE n 
1 460 THR n 
1 461 LEU n 
1 462 VAL n 
1 463 LEU n 
1 464 TYR n 
1 465 GLY n 
1 466 THR n 
1 467 ALA n 
1 468 SER n 
1 469 GLY n 
1 470 SER n 
1 471 LEU n 
1 472 VAL n 
1 473 PRO n 
1 474 ARG n 
1 475 GLY n 
1 476 SER n 
1 477 HIS n 
1 478 HIS n 
1 479 HIS n 
1 480 HIS n 
1 481 HIS n 
1 482 HIS n 
2 1   HY1 n 
2 2   ARG n 
2 3   VAL n 
2 4   ARG n 
2 5   00S n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FURIN, FUR, PACE, PCSK3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 HEK293S 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHLsec 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FURIN_HUMAN P09958 1 
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
108 ? 
2 PDB 4OMD        4OMD   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4OMD A 1 ? 467 ? P09958 108 ? 574 ? 108 574 
2  1 4OMD B 1 ? 467 ? P09958 108 ? 574 ? 108 574 
3  1 4OMD C 1 ? 467 ? P09958 108 ? 574 ? 108 574 
4  1 4OMD D 1 ? 467 ? P09958 108 ? 574 ? 108 574 
5  1 4OMD E 1 ? 467 ? P09958 108 ? 574 ? 108 574 
6  1 4OMD F 1 ? 467 ? P09958 108 ? 574 ? 108 574 
7  2 4OMD H 1 ? 5   ? 4OMD   1   ? 5   ? 1   5   
8  2 4OMD I 1 ? 5   ? 4OMD   1   ? 5   ? 1   5   
9  2 4OMD J 1 ? 5   ? 4OMD   1   ? 5   ? 1   5   
10 2 4OMD K 1 ? 5   ? 4OMD   1   ? 5   ? 1   5   
11 2 4OMD L 1 ? 5   ? 4OMD   1   ? 5   ? 1   5   
12 2 4OMD N 1 ? 5   ? 4OMD   1   ? 5   ? 1   5   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4OMD SER A 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 1  
1 4OMD GLY A 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 2  
1 4OMD SER A 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 3  
1 4OMD LEU A 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 4  
1 4OMD VAL A 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 5  
1 4OMD PRO A 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 6  
1 4OMD ARG A 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 7  
1 4OMD GLY A 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 8  
1 4OMD SER A 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 9  
1 4OMD HIS A 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 10 
1 4OMD HIS A 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 11 
1 4OMD HIS A 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 12 
1 4OMD HIS A 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 13 
1 4OMD HIS A 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 14 
1 4OMD HIS A 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 15 
2 4OMD SER B 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 16 
2 4OMD GLY B 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 17 
2 4OMD SER B 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 18 
2 4OMD LEU B 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 19 
2 4OMD VAL B 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 20 
2 4OMD PRO B 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 21 
2 4OMD ARG B 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 22 
2 4OMD GLY B 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 23 
2 4OMD SER B 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 24 
2 4OMD HIS B 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 25 
2 4OMD HIS B 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 26 
2 4OMD HIS B 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 27 
2 4OMD HIS B 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 28 
2 4OMD HIS B 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 29 
2 4OMD HIS B 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 30 
3 4OMD SER C 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 31 
3 4OMD GLY C 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 32 
3 4OMD SER C 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 33 
3 4OMD LEU C 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 34 
3 4OMD VAL C 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 35 
3 4OMD PRO C 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 36 
3 4OMD ARG C 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 37 
3 4OMD GLY C 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 38 
3 4OMD SER C 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 39 
3 4OMD HIS C 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 40 
3 4OMD HIS C 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 41 
3 4OMD HIS C 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 42 
3 4OMD HIS C 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 43 
3 4OMD HIS C 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 44 
3 4OMD HIS C 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 45 
4 4OMD SER D 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 46 
4 4OMD GLY D 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 47 
4 4OMD SER D 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 48 
4 4OMD LEU D 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 49 
4 4OMD VAL D 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 50 
4 4OMD PRO D 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 51 
4 4OMD ARG D 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 52 
4 4OMD GLY D 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 53 
4 4OMD SER D 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 54 
4 4OMD HIS D 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 55 
4 4OMD HIS D 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 56 
4 4OMD HIS D 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 57 
4 4OMD HIS D 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 58 
4 4OMD HIS D 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 59 
4 4OMD HIS D 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 60 
5 4OMD SER E 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 61 
5 4OMD GLY E 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 62 
5 4OMD SER E 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 63 
5 4OMD LEU E 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 64 
5 4OMD VAL E 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 65 
5 4OMD PRO E 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 66 
5 4OMD ARG E 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 67 
5 4OMD GLY E 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 68 
5 4OMD SER E 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 69 
5 4OMD HIS E 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 70 
5 4OMD HIS E 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 71 
5 4OMD HIS E 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 72 
5 4OMD HIS E 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 73 
5 4OMD HIS E 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 74 
5 4OMD HIS E 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 75 
6 4OMD SER F 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 76 
6 4OMD GLY F 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 77 
6 4OMD SER F 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 78 
6 4OMD LEU F 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 79 
6 4OMD VAL F 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 80 
6 4OMD PRO F 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 81 
6 4OMD ARG F 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 82 
6 4OMD GLY F 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 83 
6 4OMD SER F 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 84 
6 4OMD HIS F 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 85 
6 4OMD HIS F 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 86 
6 4OMD HIS F 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 87 
6 4OMD HIS F 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 88 
6 4OMD HIS F 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 89 
6 4OMD HIS F 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 90 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
00S non-polymer         . '4-(aminomethyl)benzenecarboximidamide' ? 'C8 H11 N3'      149.193 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                           ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'                           ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'           18.015  
HY1 non-polymer         . PHENYLACETALDEHYDE                      ? 'C8 H8 O'        120.149 
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                            ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4OMD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_percent_sol   57.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'50mM Tris, 2.8M sodium formate, 0.015mM Cymal-7, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-05-29 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.918 
# 
_reflns.entry_id                     4OMD 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   100092 
_reflns.number_all                   100623 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.131 
_reflns.pdbx_netI_over_sigmaI        9.73 
_reflns.B_iso_Wilson_estimate        26.8 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.86 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.448 
_reflns_shell.meanI_over_sigI_obs    2.84 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      15879 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4OMD 
_refine.ls_number_reflns_obs                     100091 
_refine.ls_number_reflns_all                     100727 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1934 
_refine.ls_R_factor_R_free                       0.2180 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  5025 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            shells 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        21620 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             661 
_refine_hist.number_atoms_total               22341 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
c_bond_d     0.0068 ? ? ? ? 'X-RAY DIFFRACTION' 
c_mcangle_it 2.375  ? ? ? ? 'X-RAY DIFFRACTION' 
c_mcbond_it  1.512  ? ? ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2811 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3262 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             670 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                12220 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4OMD 
_struct.title                     'X-ray structure of human furin in complex with the competitive inhibitor Phac-RVR-Amba' 
_struct.pdbx_descriptor           'Furin (E.C.3.4.21.75), phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OMD 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'pro-protein convertase, serine protease, competitive inhibitor, protease-inhibitor complex, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 5 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 5 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 5 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 5 ? 
WA N N 6 ? 
XA N N 6 ? 
YA N N 6 ? 
ZA N N 6 ? 
AB N N 6 ? 
BB N N 6 ? 
CB N N 6 ? 
DB N N 6 ? 
EB N N 6 ? 
FB N N 6 ? 
GB N N 6 ? 
HB N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 10  ? GLN A 14  ? LYS A 117 GLN A 121 5 ? 5  
HELX_P HELX_P2  2  ASN A 26  ? GLN A 33  ? ASN A 133 GLN A 140 1 ? 8  
HELX_P HELX_P3  3  ASP A 61  ? SER A 65  ? ASP A 168 SER A 172 5 ? 5  
HELX_P HELX_P4  4  ASN A 83  ? ASN A 85  ? ASN A 190 ASN A 192 5 ? 3  
HELX_P HELX_P5  5  ARG A 86  ? ALA A 97  ? ARG A 193 ALA A 204 1 ? 12 
HELX_P HELX_P6  6  THR A 125 ? GLY A 134 ? THR A 232 GLY A 241 1 ? 10 
HELX_P HELX_P7  7  ALA A 160 ? GLY A 174 ? ALA A 267 GLY A 281 1 ? 15 
HELX_P HELX_P8  8  ARG A 175 ? LEU A 178 ? ARG A 282 LEU A 285 5 ? 4  
HELX_P HELX_P9  9  ASN A 188 ? HIS A 193 ? ASN A 295 HIS A 300 5 ? 6  
HELX_P HELX_P10 10 GLY A 259 ? ASN A 278 ? GLY A 366 ASN A 385 1 ? 20 
HELX_P HELX_P11 11 THR A 282 ? SER A 294 ? THR A 389 SER A 401 1 ? 13 
HELX_P HELX_P12 12 ASP A 323 ? TRP A 334 ? ASP A 430 TRP A 441 1 ? 12 
HELX_P HELX_P13 13 ARG A 390 ? GLY A 392 ? ARG A 497 GLY A 499 5 ? 3  
HELX_P HELX_P14 14 LYS B 10  ? GLN B 14  ? LYS B 117 GLN B 121 5 ? 5  
HELX_P HELX_P15 15 VAL B 27  ? GLN B 33  ? VAL B 134 GLN B 140 1 ? 7  
HELX_P HELX_P16 16 ASP B 61  ? SER B 65  ? ASP B 168 SER B 172 5 ? 5  
HELX_P HELX_P17 17 ASN B 83  ? ASN B 85  ? ASN B 190 ASN B 192 5 ? 3  
HELX_P HELX_P18 18 ARG B 86  ? ALA B 97  ? ARG B 193 ALA B 204 1 ? 12 
HELX_P HELX_P19 19 THR B 125 ? GLY B 134 ? THR B 232 GLY B 241 1 ? 10 
HELX_P HELX_P20 20 ALA B 160 ? GLY B 174 ? ALA B 267 GLY B 281 1 ? 15 
HELX_P HELX_P21 21 ARG B 175 ? LEU B 178 ? ARG B 282 LEU B 285 5 ? 4  
HELX_P HELX_P22 22 ASN B 188 ? HIS B 193 ? ASN B 295 HIS B 300 5 ? 6  
HELX_P HELX_P23 23 GLY B 259 ? ASN B 278 ? GLY B 366 ASN B 385 1 ? 20 
HELX_P HELX_P24 24 THR B 282 ? SER B 294 ? THR B 389 SER B 401 1 ? 13 
HELX_P HELX_P25 25 ASP B 323 ? TRP B 334 ? ASP B 430 TRP B 441 1 ? 12 
HELX_P HELX_P26 26 ARG B 390 ? GLY B 392 ? ARG B 497 GLY B 499 5 ? 3  
HELX_P HELX_P27 27 LYS C 10  ? GLN C 14  ? LYS C 117 GLN C 121 5 ? 5  
HELX_P HELX_P28 28 ASN C 26  ? GLN C 33  ? ASN C 133 GLN C 140 1 ? 8  
HELX_P HELX_P29 29 ASP C 61  ? SER C 65  ? ASP C 168 SER C 172 5 ? 5  
HELX_P HELX_P30 30 ASN C 83  ? ASN C 85  ? ASN C 190 ASN C 192 5 ? 3  
HELX_P HELX_P31 31 ARG C 86  ? ALA C 97  ? ARG C 193 ALA C 204 1 ? 12 
HELX_P HELX_P32 32 THR C 125 ? GLY C 134 ? THR C 232 GLY C 241 1 ? 10 
HELX_P HELX_P33 33 ALA C 160 ? GLY C 174 ? ALA C 267 GLY C 281 1 ? 15 
HELX_P HELX_P34 34 ARG C 175 ? LEU C 178 ? ARG C 282 LEU C 285 5 ? 4  
HELX_P HELX_P35 35 ASN C 188 ? HIS C 193 ? ASN C 295 HIS C 300 5 ? 6  
HELX_P HELX_P36 36 GLY C 259 ? ASN C 278 ? GLY C 366 ASN C 385 1 ? 20 
HELX_P HELX_P37 37 THR C 282 ? SER C 294 ? THR C 389 SER C 401 1 ? 13 
HELX_P HELX_P38 38 ASP C 323 ? TRP C 334 ? ASP C 430 TRP C 441 1 ? 12 
HELX_P HELX_P39 39 ARG C 390 ? GLY C 392 ? ARG C 497 GLY C 499 5 ? 3  
HELX_P HELX_P40 40 LYS D 10  ? GLN D 14  ? LYS D 117 GLN D 121 5 ? 5  
HELX_P HELX_P41 41 ASN D 26  ? GLN D 33  ? ASN D 133 GLN D 140 1 ? 8  
HELX_P HELX_P42 42 ASP D 61  ? SER D 65  ? ASP D 168 SER D 172 5 ? 5  
HELX_P HELX_P43 43 ASN D 83  ? ASN D 85  ? ASN D 190 ASN D 192 5 ? 3  
HELX_P HELX_P44 44 ARG D 86  ? ALA D 97  ? ARG D 193 ALA D 204 1 ? 12 
HELX_P HELX_P45 45 THR D 125 ? GLY D 134 ? THR D 232 GLY D 241 1 ? 10 
HELX_P HELX_P46 46 ALA D 160 ? GLY D 174 ? ALA D 267 GLY D 281 1 ? 15 
HELX_P HELX_P47 47 ARG D 175 ? LEU D 178 ? ARG D 282 LEU D 285 5 ? 4  
HELX_P HELX_P48 48 ASN D 188 ? HIS D 193 ? ASN D 295 HIS D 300 5 ? 6  
HELX_P HELX_P49 49 GLY D 259 ? ASN D 278 ? GLY D 366 ASN D 385 1 ? 20 
HELX_P HELX_P50 50 THR D 282 ? SER D 294 ? THR D 389 SER D 401 1 ? 13 
HELX_P HELX_P51 51 ASP D 323 ? TRP D 334 ? ASP D 430 TRP D 441 1 ? 12 
HELX_P HELX_P52 52 ARG D 390 ? GLY D 392 ? ARG D 497 GLY D 499 5 ? 3  
HELX_P HELX_P53 53 LYS E 10  ? GLN E 14  ? LYS E 117 GLN E 121 5 ? 5  
HELX_P HELX_P54 54 ASN E 26  ? GLN E 33  ? ASN E 133 GLN E 140 1 ? 8  
HELX_P HELX_P55 55 ASP E 61  ? SER E 65  ? ASP E 168 SER E 172 5 ? 5  
HELX_P HELX_P56 56 ASN E 83  ? ASN E 85  ? ASN E 190 ASN E 192 5 ? 3  
HELX_P HELX_P57 57 ARG E 86  ? ALA E 97  ? ARG E 193 ALA E 204 1 ? 12 
HELX_P HELX_P58 58 THR E 125 ? GLY E 134 ? THR E 232 GLY E 241 1 ? 10 
HELX_P HELX_P59 59 ALA E 160 ? GLY E 174 ? ALA E 267 GLY E 281 1 ? 15 
HELX_P HELX_P60 60 ARG E 175 ? LEU E 178 ? ARG E 282 LEU E 285 5 ? 4  
HELX_P HELX_P61 61 ASN E 188 ? HIS E 193 ? ASN E 295 HIS E 300 5 ? 6  
HELX_P HELX_P62 62 GLY E 259 ? ASN E 278 ? GLY E 366 ASN E 385 1 ? 20 
HELX_P HELX_P63 63 THR E 282 ? SER E 294 ? THR E 389 SER E 401 1 ? 13 
HELX_P HELX_P64 64 ASP E 323 ? TRP E 334 ? ASP E 430 TRP E 441 1 ? 12 
HELX_P HELX_P65 65 ARG E 390 ? GLY E 392 ? ARG E 497 GLY E 499 5 ? 3  
HELX_P HELX_P66 66 LYS F 10  ? GLN F 14  ? LYS F 117 GLN F 121 5 ? 5  
HELX_P HELX_P67 67 ASN F 26  ? GLN F 33  ? ASN F 133 GLN F 140 1 ? 8  
HELX_P HELX_P68 68 ASP F 61  ? SER F 65  ? ASP F 168 SER F 172 5 ? 5  
HELX_P HELX_P69 69 ASN F 83  ? ASN F 85  ? ASN F 190 ASN F 192 5 ? 3  
HELX_P HELX_P70 70 ARG F 86  ? ALA F 97  ? ARG F 193 ALA F 204 1 ? 12 
HELX_P HELX_P71 71 THR F 125 ? GLY F 134 ? THR F 232 GLY F 241 1 ? 10 
HELX_P HELX_P72 72 ALA F 160 ? GLY F 174 ? ALA F 267 GLY F 281 1 ? 15 
HELX_P HELX_P73 73 ARG F 175 ? LEU F 178 ? ARG F 282 LEU F 285 5 ? 4  
HELX_P HELX_P74 74 ASN F 188 ? HIS F 193 ? ASN F 295 HIS F 300 5 ? 6  
HELX_P HELX_P75 75 GLY F 259 ? ASN F 278 ? GLY F 366 ASN F 385 1 ? 20 
HELX_P HELX_P76 76 THR F 282 ? SER F 294 ? THR F 389 SER F 401 1 ? 13 
HELX_P HELX_P77 77 ASP F 323 ? TRP F 334 ? ASP F 430 TRP F 441 1 ? 12 
HELX_P HELX_P78 78 ARG F 390 ? GLY F 392 ? ARG F 497 GLY F 499 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? A  CYS 104 SG  ? ? ? 1_555 A  CYS 253 SG  ? ? A CYS 211 A CYS 360 1_555 ? ? ? ? ? ? ? 2.037 ?    
disulf2   disulf ? ? A  CYS 196 SG  ? ? ? 1_555 A  CYS 226 SG  ? ? A CYS 303 A CYS 333 1_555 ? ? ? ? ? ? ? 2.033 ?    
disulf3   disulf ? ? A  CYS 343 SG  ? ? ? 1_555 A  CYS 367 SG  ? ? A CYS 450 A CYS 474 1_555 ? ? ? ? ? ? ? 2.031 ?    
disulf4   disulf ? ? B  CYS 104 SG  ? ? ? 1_555 B  CYS 253 SG  ? ? B CYS 211 B CYS 360 1_555 ? ? ? ? ? ? ? 2.031 ?    
disulf5   disulf ? ? B  CYS 196 SG  ? ? ? 1_555 B  CYS 226 SG  ? ? B CYS 303 B CYS 333 1_555 ? ? ? ? ? ? ? 2.033 ?    
disulf6   disulf ? ? B  CYS 343 SG  ? ? ? 1_555 B  CYS 367 SG  ? ? B CYS 450 B CYS 474 1_555 ? ? ? ? ? ? ? 2.036 ?    
disulf7   disulf ? ? C  CYS 104 SG  ? ? ? 1_555 C  CYS 253 SG  ? ? C CYS 211 C CYS 360 1_555 ? ? ? ? ? ? ? 2.033 ?    
disulf8   disulf ? ? C  CYS 196 SG  ? ? ? 1_555 C  CYS 226 SG  ? ? C CYS 303 C CYS 333 1_555 ? ? ? ? ? ? ? 2.037 ?    
disulf9   disulf ? ? C  CYS 343 SG  ? ? ? 1_555 C  CYS 367 SG  ? ? C CYS 450 C CYS 474 1_555 ? ? ? ? ? ? ? 2.038 ?    
disulf10  disulf ? ? D  CYS 104 SG  ? ? ? 1_555 D  CYS 253 SG  ? ? D CYS 211 D CYS 360 1_555 ? ? ? ? ? ? ? 2.033 ?    
disulf11  disulf ? ? D  CYS 196 SG  ? ? ? 1_555 D  CYS 226 SG  ? ? D CYS 303 D CYS 333 1_555 ? ? ? ? ? ? ? 2.035 ?    
disulf12  disulf ? ? D  CYS 343 SG  ? ? ? 1_555 D  CYS 367 SG  ? ? D CYS 450 D CYS 474 1_555 ? ? ? ? ? ? ? 2.045 ?    
disulf13  disulf ? ? E  CYS 104 SG  ? ? ? 1_555 E  CYS 253 SG  ? ? E CYS 211 E CYS 360 1_555 ? ? ? ? ? ? ? 2.037 ?    
disulf14  disulf ? ? E  CYS 196 SG  ? ? ? 1_555 E  CYS 226 SG  ? ? E CYS 303 E CYS 333 1_555 ? ? ? ? ? ? ? 2.031 ?    
disulf15  disulf ? ? E  CYS 343 SG  ? ? ? 1_555 E  CYS 367 SG  ? ? E CYS 450 E CYS 474 1_555 ? ? ? ? ? ? ? 2.045 ?    
disulf16  disulf ? ? F  CYS 104 SG  ? ? ? 1_555 F  CYS 253 SG  ? ? F CYS 211 F CYS 360 1_555 ? ? ? ? ? ? ? 2.031 ?    
disulf17  disulf ? ? F  CYS 196 SG  ? ? ? 1_555 F  CYS 226 SG  ? ? F CYS 303 F CYS 333 1_555 ? ? ? ? ? ? ? 2.040 ?    
disulf18  disulf ? ? F  CYS 343 SG  ? ? ? 1_555 F  CYS 367 SG  ? ? F CYS 450 F CYS 474 1_555 ? ? ? ? ? ? ? 2.035 ?    
covale1   covale ? ? G  HY1 1   C   ? ? ? 1_555 G  ARG 2   N   ? ? H HY1 1   H ARG 2   1_555 ? ? ? ? ? ? ? 1.331 sing 
covale2   covale ? ? H  HY1 1   C   ? ? ? 1_555 H  ARG 2   N   ? ? I HY1 1   I ARG 2   1_555 ? ? ? ? ? ? ? 1.324 sing 
covale3   covale ? ? I  HY1 1   C   ? ? ? 1_555 I  ARG 2   N   ? ? J HY1 1   J ARG 2   1_555 ? ? ? ? ? ? ? 1.330 sing 
covale4   covale ? ? J  HY1 1   C   ? ? ? 1_555 J  ARG 2   N   ? ? K HY1 1   K ARG 2   1_555 ? ? ? ? ? ? ? 1.332 sing 
covale5   covale ? ? K  HY1 1   C   ? ? ? 1_555 K  ARG 2   N   ? ? L HY1 1   L ARG 2   1_555 ? ? ? ? ? ? ? 1.328 sing 
covale6   covale ? ? L  HY1 1   C   ? ? ? 1_555 L  ARG 2   N   ? ? N HY1 1   N ARG 2   1_555 ? ? ? ? ? ? ? 1.329 sing 
covale7   covale ? ? G  ARG 4   C   ? ? ? 1_555 G  00S 5   N23 ? ? H ARG 4   H 00S 5   1_555 ? ? ? ? ? ? ? 1.331 sing 
covale8   covale ? ? H  ARG 4   C   ? ? ? 1_555 H  00S 5   N23 ? ? I ARG 4   I 00S 5   1_555 ? ? ? ? ? ? ? 1.325 sing 
covale9   covale ? ? I  ARG 4   C   ? ? ? 1_555 I  00S 5   N23 ? ? J ARG 4   J 00S 5   1_555 ? ? ? ? ? ? ? 1.328 sing 
covale10  covale ? ? J  ARG 4   C   ? ? ? 1_555 J  00S 5   N23 ? ? K ARG 4   K 00S 5   1_555 ? ? ? ? ? ? ? 1.326 sing 
covale11  covale ? ? K  ARG 4   C   ? ? ? 1_555 K  00S 5   N23 ? ? L ARG 4   L 00S 5   1_555 ? ? ? ? ? ? ? 1.328 sing 
covale12  covale ? ? L  ARG 4   C   ? ? ? 1_555 L  00S 5   N23 ? ? N ARG 4   N 00S 5   1_555 ? ? ? ? ? ? ? 1.326 sing 
metalc1   metalc ? ? E  SER 204 O   ? ? ? 1_555 PA NA  .   NA  ? ? E SER 311 E NA  606 1_555 ? ? ? ? ? ? ? 2.110 ?    
metalc2   metalc ? ? A  SER 204 O   ? ? ? 1_555 R  NA  .   NA  ? ? A SER 311 A NA  606 1_555 ? ? ? ? ? ? ? 2.143 ?    
metalc3   metalc ? ? E  ASP 8   OD2 ? ? ? 1_555 MA CA  .   CA  ? ? E ASP 115 E CA  603 1_555 ? ? ? ? ? ? ? 2.171 ?    
metalc4   metalc ? ? A  ASP 151 OD1 ? ? ? 1_555 P  CA  .   CA  ? ? A ASP 258 A CA  604 1_555 ? ? ? ? ? ? ? 2.186 ?    
metalc5   metalc ? ? D  THR 207 O   ? ? ? 1_555 JA NA  .   NA  ? ? D THR 314 D NA  606 1_555 ? ? ? ? ? ? ? 2.187 ?    
metalc6   metalc ? ? P  CA  .   CA  ? ? ? 1_555 WA HOH .   O   ? ? A CA  604 A HOH 746 1_555 ? ? ? ? ? ? ? 2.190 ?    
metalc7   metalc ? ? C  ASP 194 OD2 ? ? ? 1_555 BA CA  .   CA  ? ? C ASP 301 C CA  604 1_555 ? ? ? ? ? ? ? 2.194 ?    
metalc8   metalc ? ? B  ASP 194 OD2 ? ? ? 1_555 V  CA  .   CA  ? ? B ASP 301 B CA  604 1_555 ? ? ? ? ? ? ? 2.199 ?    
metalc9   metalc ? ? C  ASP 8   OD2 ? ? ? 1_555 AA CA  .   CA  ? ? C ASP 115 C CA  603 1_555 ? ? ? ? ? ? ? 2.202 ?    
metalc10  metalc ? ? A  THR 202 O   ? ? ? 1_555 R  NA  .   NA  ? ? A THR 309 A NA  606 1_555 ? ? ? ? ? ? ? 2.219 ?    
metalc11  metalc ? ? B  ASP 8   OD2 ? ? ? 1_555 U  CA  .   CA  ? ? B ASP 115 B CA  603 1_555 ? ? ? ? ? ? ? 2.228 ?    
metalc12  metalc ? ? E  VAL 98  O   ? ? ? 1_555 MA CA  .   CA  ? ? E VAL 205 E CA  603 1_555 ? ? ? ? ? ? ? 2.230 ?    
metalc13  metalc ? ? B  THR 207 O   ? ? ? 1_555 X  NA  .   NA  ? ? B THR 314 B NA  606 1_555 ? ? ? ? ? ? ? 2.235 ?    
metalc14  metalc ? ? C  THR 207 OG1 ? ? ? 1_555 DA NA  .   NA  ? ? C THR 314 C NA  606 1_555 ? ? ? ? ? ? ? 2.236 ?    
metalc15  metalc ? ? D  ASP 8   OD2 ? ? ? 1_555 GA CA  .   CA  ? ? D ASP 115 D CA  603 1_555 ? ? ? ? ? ? ? 2.237 ?    
metalc16  metalc ? ? D  VAL 98  O   ? ? ? 1_555 GA CA  .   CA  ? ? D VAL 205 D CA  603 1_555 ? ? ? ? ? ? ? 2.245 ?    
metalc17  metalc ? ? B  GLY 105 O   ? ? ? 1_555 U  CA  .   CA  ? ? B GLY 212 B CA  603 1_555 ? ? ? ? ? ? ? 2.245 ?    
metalc18  metalc ? ? D  SER 204 O   ? ? ? 1_555 JA NA  .   NA  ? ? D SER 311 D NA  606 1_555 ? ? ? ? ? ? ? 2.246 ?    
metalc19  metalc ? ? F  ASP 151 OD1 ? ? ? 1_555 TA CA  .   CA  ? ? F ASP 258 F CA  604 1_555 ? ? ? ? ? ? ? 2.247 ?    
metalc20  metalc ? ? VA NA  .   NA  ? ? ? 1_555 BB HOH .   O   ? ? F NA  606 F HOH 715 1_555 ? ? ? ? ? ? ? 2.253 ?    
metalc21  metalc ? ? F  ASP 194 OD2 ? ? ? 1_555 TA CA  .   CA  ? ? F ASP 301 F CA  604 1_555 ? ? ? ? ? ? ? 2.256 ?    
metalc22  metalc ? ? C  SER 204 O   ? ? ? 1_555 DA NA  .   NA  ? ? C SER 311 C NA  606 1_555 ? ? ? ? ? ? ? 2.262 ?    
metalc23  metalc ? ? BA CA  .   CA  ? ? ? 1_555 YA HOH .   O   ? ? C CA  604 C HOH 742 1_555 ? ? ? ? ? ? ? 2.267 ?    
metalc24  metalc ? ? E  THR 202 O   ? ? ? 1_555 PA NA  .   NA  ? ? E THR 309 E NA  606 1_555 ? ? ? ? ? ? ? 2.269 ?    
metalc25  metalc ? ? F  THR 202 O   ? ? ? 1_555 VA NA  .   NA  ? ? F THR 309 F NA  606 1_555 ? ? ? ? ? ? ? 2.275 ?    
metalc26  metalc ? ? B  THR 202 O   ? ? ? 1_555 X  NA  .   NA  ? ? B THR 309 B NA  606 1_555 ? ? ? ? ? ? ? 2.277 ?    
metalc27  metalc ? ? A  ASP 194 OD2 ? ? ? 1_555 P  CA  .   CA  ? ? A ASP 301 A CA  604 1_555 ? ? ? ? ? ? ? 2.282 ?    
metalc28  metalc ? ? P  CA  .   CA  ? ? ? 1_555 WA HOH .   O   ? ? A CA  604 A HOH 796 1_555 ? ? ? ? ? ? ? 2.284 ?    
metalc29  metalc ? ? B  VAL 98  O   ? ? ? 1_555 U  CA  .   CA  ? ? B VAL 205 B CA  603 1_555 ? ? ? ? ? ? ? 2.285 ?    
metalc30  metalc ? ? A  VAL 103 O   ? ? ? 1_555 O  CA  .   CA  ? ? A VAL 210 A CA  603 1_555 ? ? ? ? ? ? ? 2.285 ?    
metalc31  metalc ? ? C  THR 207 O   ? ? ? 1_555 DA NA  .   NA  ? ? C THR 314 C NA  606 1_555 ? ? ? ? ? ? ? 2.291 ?    
metalc32  metalc ? ? F  THR 207 O   ? ? ? 1_555 VA NA  .   NA  ? ? F THR 314 F NA  606 1_555 ? ? ? ? ? ? ? 2.298 ?    
metalc33  metalc ? ? F  ASP 8   OD2 ? ? ? 1_555 SA CA  .   CA  ? ? F ASP 115 F CA  603 1_555 ? ? ? ? ? ? ? 2.302 ?    
metalc34  metalc ? ? C  VAL 103 O   ? ? ? 1_555 AA CA  .   CA  ? ? C VAL 210 C CA  603 1_555 ? ? ? ? ? ? ? 2.302 ?    
metalc35  metalc ? ? D  ASP 55  OD1 ? ? ? 1_555 GA CA  .   CA  ? ? D ASP 162 D CA  603 1_555 ? ? ? ? ? ? ? 2.308 ?    
metalc36  metalc ? ? C  THR 202 O   ? ? ? 1_555 DA NA  .   NA  ? ? C THR 309 C NA  606 1_555 ? ? ? ? ? ? ? 2.309 ?    
metalc37  metalc ? ? F  ASP 55  OD1 ? ? ? 1_555 SA CA  .   CA  ? ? F ASP 162 F CA  603 1_555 ? ? ? ? ? ? ? 2.311 ?    
metalc38  metalc ? ? D  ASP 194 OD2 ? ? ? 1_555 HA CA  .   CA  ? ? D ASP 301 D CA  604 1_555 ? ? ? ? ? ? ? 2.321 ?    
metalc39  metalc ? ? C  ASP 55  OD1 ? ? ? 1_555 AA CA  .   CA  ? ? C ASP 162 C CA  603 1_555 ? ? ? ? ? ? ? 2.323 ?    
metalc40  metalc ? ? D  ASP 67  OD2 ? ? ? 1_555 IA CA  .   CA  ? ? D ASP 174 D CA  605 1_555 ? ? ? ? ? ? ? 2.324 ?    
metalc41  metalc ? ? F  SER 204 O   ? ? ? 1_555 VA NA  .   NA  ? ? F SER 311 F NA  606 1_555 ? ? ? ? ? ? ? 2.325 ?    
metalc42  metalc ? ? F  VAL 103 O   ? ? ? 1_555 SA CA  .   CA  ? ? F VAL 210 F CA  603 1_555 ? ? ? ? ? ? ? 2.326 ?    
metalc43  metalc ? ? F  ASP 67  OD2 ? ? ? 1_555 UA CA  .   CA  ? ? F ASP 174 F CA  605 1_555 ? ? ? ? ? ? ? 2.327 ?    
metalc44  metalc ? ? F  VAL 98  O   ? ? ? 1_555 SA CA  .   CA  ? ? F VAL 205 F CA  603 1_555 ? ? ? ? ? ? ? 2.328 ?    
metalc45  metalc ? ? B  VAL 103 O   ? ? ? 1_555 U  CA  .   CA  ? ? B VAL 210 B CA  603 1_555 ? ? ? ? ? ? ? 2.332 ?    
metalc46  metalc ? ? E  GLY 105 O   ? ? ? 1_555 MA CA  .   CA  ? ? E GLY 212 E CA  603 1_555 ? ? ? ? ? ? ? 2.332 ?    
metalc47  metalc ? ? D  ASP 151 OD1 ? ? ? 1_555 HA CA  .   CA  ? ? D ASP 258 D CA  604 1_555 ? ? ? ? ? ? ? 2.334 ?    
metalc48  metalc ? ? F  GLY 105 O   ? ? ? 1_555 SA CA  .   CA  ? ? F GLY 212 F CA  603 1_555 ? ? ? ? ? ? ? 2.339 ?    
metalc49  metalc ? ? C  VAL 98  O   ? ? ? 1_555 AA CA  .   CA  ? ? C VAL 205 C CA  603 1_555 ? ? ? ? ? ? ? 2.339 ?    
metalc50  metalc ? ? HA CA  .   CA  ? ? ? 1_555 ZA HOH .   O   ? ? D CA  604 D HOH 797 1_555 ? ? ? ? ? ? ? 2.340 ?    
metalc51  metalc ? ? UA CA  .   CA  ? ? ? 1_555 BB HOH .   O   ? ? F CA  605 F HOH 776 1_555 ? ? ? ? ? ? ? 2.346 ?    
metalc52  metalc ? ? F  THR 207 OG1 ? ? ? 1_555 VA NA  .   NA  ? ? F THR 314 F NA  606 1_555 ? ? ? ? ? ? ? 2.348 ?    
metalc53  metalc ? ? Q  CA  .   CA  ? ? ? 1_555 WA HOH .   O   ? ? A CA  605 A HOH 727 1_555 ? ? ? ? ? ? ? 2.348 ?    
metalc54  metalc ? ? B  ASP 151 OD1 ? ? ? 1_555 V  CA  .   CA  ? ? B ASP 258 B CA  604 1_555 ? ? ? ? ? ? ? 2.352 ?    
metalc55  metalc ? ? A  VAL 98  O   ? ? ? 1_555 O  CA  .   CA  ? ? A VAL 205 A CA  603 1_555 ? ? ? ? ? ? ? 2.354 ?    
metalc56  metalc ? ? E  ASP 194 OD2 ? ? ? 1_555 NA CA  .   CA  ? ? E ASP 301 E CA  604 1_555 ? ? ? ? ? ? ? 2.358 ?    
metalc57  metalc ? ? A  ASP 8   OD2 ? ? ? 1_555 O  CA  .   CA  ? ? A ASP 115 A CA  603 1_555 ? ? ? ? ? ? ? 2.363 ?    
metalc58  metalc ? ? BA CA  .   CA  ? ? ? 1_555 YA HOH .   O   ? ? C CA  604 C HOH 769 1_555 ? ? ? ? ? ? ? 2.364 ?    
metalc59  metalc ? ? NA CA  .   CA  ? ? ? 1_555 AB HOH .   O   ? ? E CA  604 E HOH 788 1_555 ? ? ? ? ? ? ? 2.364 ?    
metalc60  metalc ? ? A  ASP 55  OD1 ? ? ? 1_555 O  CA  .   CA  ? ? A ASP 162 A CA  603 1_555 ? ? ? ? ? ? ? 2.365 ?    
metalc61  metalc ? ? A  GLY 105 O   ? ? ? 1_555 O  CA  .   CA  ? ? A GLY 212 A CA  603 1_555 ? ? ? ? ? ? ? 2.366 ?    
metalc62  metalc ? ? A  THR 207 O   ? ? ? 1_555 R  NA  .   NA  ? ? A THR 314 A NA  606 1_555 ? ? ? ? ? ? ? 2.369 ?    
metalc63  metalc ? ? E  THR 207 OG1 ? ? ? 1_555 PA NA  .   NA  ? ? E THR 314 E NA  606 1_555 ? ? ? ? ? ? ? 2.371 ?    
metalc64  metalc ? ? A  GLU 224 OE1 ? ? ? 1_555 P  CA  .   CA  ? ? A GLU 331 A CA  604 1_555 ? ? ? ? ? ? ? 2.375 ?    
metalc65  metalc ? ? C  GLU 224 OE1 ? ? ? 1_555 BA CA  .   CA  ? ? C GLU 331 C CA  604 1_555 ? ? ? ? ? ? ? 2.376 ?    
metalc66  metalc ? ? B  ASP 55  OD1 ? ? ? 1_555 U  CA  .   CA  ? ? B ASP 162 B CA  603 1_555 ? ? ? ? ? ? ? 2.377 ?    
metalc67  metalc ? ? D  GLU 224 OE1 ? ? ? 1_555 HA CA  .   CA  ? ? D GLU 331 D CA  604 1_555 ? ? ? ? ? ? ? 2.377 ?    
metalc68  metalc ? ? IA CA  .   CA  ? ? ? 1_555 ZA HOH .   O   ? ? D CA  605 D HOH 749 1_555 ? ? ? ? ? ? ? 2.386 ?    
metalc69  metalc ? ? NA CA  .   CA  ? ? ? 1_555 AB HOH .   O   ? ? E CA  604 E HOH 719 1_555 ? ? ? ? ? ? ? 2.392 ?    
metalc70  metalc ? ? D  THR 202 O   ? ? ? 1_555 JA NA  .   NA  ? ? D THR 309 D NA  606 1_555 ? ? ? ? ? ? ? 2.392 ?    
metalc71  metalc ? ? C  ASN 101 OD1 ? ? ? 1_555 AA CA  .   CA  ? ? C ASN 208 C CA  603 1_555 ? ? ? ? ? ? ? 2.395 ?    
metalc72  metalc ? ? R  NA  .   NA  ? ? ? 1_555 WA HOH .   O   ? ? A NA  606 A HOH 764 1_555 ? ? ? ? ? ? ? 2.396 ?    
metalc73  metalc ? ? D  VAL 103 O   ? ? ? 1_555 GA CA  .   CA  ? ? D VAL 210 D CA  603 1_555 ? ? ? ? ? ? ? 2.397 ?    
metalc74  metalc ? ? V  CA  .   CA  ? ? ? 1_555 XA HOH .   O   ? ? B CA  604 B HOH 735 1_555 ? ? ? ? ? ? ? 2.399 ?    
metalc75  metalc ? ? E  VAL 103 O   ? ? ? 1_555 MA CA  .   CA  ? ? E VAL 210 E CA  603 1_555 ? ? ? ? ? ? ? 2.402 ?    
metalc76  metalc ? ? F  GLU 224 OE1 ? ? ? 1_555 TA CA  .   CA  ? ? F GLU 331 F CA  604 1_555 ? ? ? ? ? ? ? 2.403 ?    
metalc77  metalc ? ? NA CA  .   CA  ? ? ? 1_555 AB HOH .   O   ? ? E CA  604 E HOH 718 1_555 ? ? ? ? ? ? ? 2.404 ?    
metalc78  metalc ? ? Q  CA  .   CA  ? ? ? 1_555 WA HOH .   O   ? ? A CA  605 A HOH 723 1_555 ? ? ? ? ? ? ? 2.404 ?    
metalc79  metalc ? ? A  ASP 74  O   ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 181 A CA  605 1_555 ? ? ? ? ? ? ? 2.408 ?    
metalc80  metalc ? ? E  THR 207 O   ? ? ? 1_555 PA NA  .   NA  ? ? E THR 314 E NA  606 1_555 ? ? ? ? ? ? ? 2.409 ?    
metalc81  metalc ? ? D  ASP 72  OD2 ? ? ? 1_555 IA CA  .   CA  ? ? D ASP 179 D CA  605 1_555 ? ? ? ? ? ? ? 2.412 ?    
metalc82  metalc ? ? E  ASP 55  OD1 ? ? ? 1_555 MA CA  .   CA  ? ? E ASP 162 E CA  603 1_555 ? ? ? ? ? ? ? 2.422 ?    
metalc83  metalc ? ? V  CA  .   CA  ? ? ? 1_555 XA HOH .   O   ? ? B CA  604 B HOH 711 1_555 ? ? ? ? ? ? ? 2.429 ?    
metalc84  metalc ? ? A  ASP 67  OD2 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 174 A CA  605 1_555 ? ? ? ? ? ? ? 2.432 ?    
metalc85  metalc ? ? E  ASP 151 OD1 ? ? ? 1_555 NA CA  .   CA  ? ? E ASP 258 E CA  604 1_555 ? ? ? ? ? ? ? 2.435 ?    
metalc86  metalc ? ? TA CA  .   CA  ? ? ? 1_555 BB HOH .   O   ? ? F CA  604 F HOH 704 1_555 ? ? ? ? ? ? ? 2.435 ?    
metalc87  metalc ? ? C  GLY 105 O   ? ? ? 1_555 AA CA  .   CA  ? ? C GLY 212 C CA  603 1_555 ? ? ? ? ? ? ? 2.440 ?    
metalc88  metalc ? ? IA CA  .   CA  ? ? ? 1_555 ZA HOH .   O   ? ? D CA  605 D HOH 798 1_555 ? ? ? ? ? ? ? 2.441 ?    
metalc89  metalc ? ? A  ASN 101 OD1 ? ? ? 1_555 O  CA  .   CA  ? ? A ASN 208 A CA  603 1_555 ? ? ? ? ? ? ? 2.444 ?    
metalc90  metalc ? ? E  ASP 67  OD2 ? ? ? 1_555 OA CA  .   CA  ? ? E ASP 174 E CA  605 1_555 ? ? ? ? ? ? ? 2.446 ?    
metalc91  metalc ? ? D  GLY 105 O   ? ? ? 1_555 GA CA  .   CA  ? ? D GLY 212 D CA  603 1_555 ? ? ? ? ? ? ? 2.446 ?    
metalc92  metalc ? ? DA NA  .   NA  ? ? ? 1_555 YA HOH .   O   ? ? C NA  606 C HOH 718 1_555 ? ? ? ? ? ? ? 2.451 ?    
metalc93  metalc ? ? B  SER 204 O   ? ? ? 1_555 X  NA  .   NA  ? ? B SER 311 B NA  606 1_555 ? ? ? ? ? ? ? 2.454 ?    
metalc94  metalc ? ? C  ASP 151 OD1 ? ? ? 1_555 BA CA  .   CA  ? ? C ASP 258 C CA  604 1_555 ? ? ? ? ? ? ? 2.466 ?    
metalc95  metalc ? ? W  CA  .   CA  ? ? ? 1_555 XA HOH .   O   ? ? B CA  605 B HOH 769 1_555 ? ? ? ? ? ? ? 2.466 ?    
metalc96  metalc ? ? E  ASP 74  O   ? ? ? 1_555 OA CA  .   CA  ? ? E ASP 181 E CA  605 1_555 ? ? ? ? ? ? ? 2.467 ?    
metalc97  metalc ? ? F  ASP 74  O   ? ? ? 1_555 UA CA  .   CA  ? ? F ASP 181 F CA  605 1_555 ? ? ? ? ? ? ? 2.469 ?    
metalc98  metalc ? ? D  ASN 101 OD1 ? ? ? 1_555 GA CA  .   CA  ? ? D ASN 208 D CA  603 1_555 ? ? ? ? ? ? ? 2.470 ?    
metalc99  metalc ? ? D  ASP 74  O   ? ? ? 1_555 IA CA  .   CA  ? ? D ASP 181 D CA  605 1_555 ? ? ? ? ? ? ? 2.474 ?    
metalc100 metalc ? ? C  ASP 72  OD1 ? ? ? 1_555 CA CA  .   CA  ? ? C ASP 179 C CA  605 1_555 ? ? ? ? ? ? ? 2.477 ?    
metalc101 metalc ? ? C  ASP 74  O   ? ? ? 1_555 CA CA  .   CA  ? ? C ASP 181 C CA  605 1_555 ? ? ? ? ? ? ? 2.478 ?    
metalc102 metalc ? ? B  THR 207 OG1 ? ? ? 1_555 X  NA  .   NA  ? ? B THR 314 B NA  606 1_555 ? ? ? ? ? ? ? 2.486 ?    
metalc103 metalc ? ? V  CA  .   CA  ? ? ? 1_555 XA HOH .   O   ? ? B CA  604 B HOH 782 1_555 ? ? ? ? ? ? ? 2.490 ?    
metalc104 metalc ? ? C  ASP 67  OD2 ? ? ? 1_555 CA CA  .   CA  ? ? C ASP 174 C CA  605 1_555 ? ? ? ? ? ? ? 2.496 ?    
metalc105 metalc ? ? A  THR 207 OG1 ? ? ? 1_555 R  NA  .   NA  ? ? A THR 314 A NA  606 1_555 ? ? ? ? ? ? ? 2.497 ?    
metalc106 metalc ? ? C  GLU 224 OE2 ? ? ? 1_555 BA CA  .   CA  ? ? C GLU 331 C CA  604 1_555 ? ? ? ? ? ? ? 2.498 ?    
metalc107 metalc ? ? UA CA  .   CA  ? ? ? 1_555 BB HOH .   O   ? ? F CA  605 F HOH 739 1_555 ? ? ? ? ? ? ? 2.507 ?    
metalc108 metalc ? ? E  GLU 224 OE1 ? ? ? 1_555 NA CA  .   CA  ? ? E GLU 331 E CA  604 1_555 ? ? ? ? ? ? ? 2.508 ?    
metalc109 metalc ? ? E  ASP 72  OD2 ? ? ? 1_555 OA CA  .   CA  ? ? E ASP 179 E CA  605 1_555 ? ? ? ? ? ? ? 2.510 ?    
metalc110 metalc ? ? Q  CA  .   CA  ? ? ? 1_555 WA HOH .   O   ? ? A CA  605 A HOH 809 1_555 ? ? ? ? ? ? ? 2.513 ?    
metalc111 metalc ? ? E  GLU 224 OE2 ? ? ? 1_555 NA CA  .   CA  ? ? E GLU 331 E CA  604 1_555 ? ? ? ? ? ? ? 2.517 ?    
metalc112 metalc ? ? F  ASP 72  OD2 ? ? ? 1_555 UA CA  .   CA  ? ? F ASP 179 F CA  605 1_555 ? ? ? ? ? ? ? 2.520 ?    
metalc113 metalc ? ? B  GLU 224 OE1 ? ? ? 1_555 V  CA  .   CA  ? ? B GLU 331 B CA  604 1_555 ? ? ? ? ? ? ? 2.528 ?    
metalc114 metalc ? ? D  THR 207 OG1 ? ? ? 1_555 JA NA  .   NA  ? ? D THR 314 D NA  606 1_555 ? ? ? ? ? ? ? 2.533 ?    
metalc115 metalc ? ? X  NA  .   NA  ? ? ? 1_555 XA HOH .   O   ? ? B NA  606 B HOH 703 1_555 ? ? ? ? ? ? ? 2.533 ?    
metalc116 metalc ? ? B  ASP 74  O   ? ? ? 1_555 W  CA  .   CA  ? ? B ASP 181 B CA  605 1_555 ? ? ? ? ? ? ? 2.536 ?    
metalc117 metalc ? ? F  ASN 101 OD1 ? ? ? 1_555 SA CA  .   CA  ? ? F ASN 208 F CA  603 1_555 ? ? ? ? ? ? ? 2.537 ?    
metalc118 metalc ? ? B  GLU 224 OE2 ? ? ? 1_555 V  CA  .   CA  ? ? B GLU 331 B CA  604 1_555 ? ? ? ? ? ? ? 2.539 ?    
metalc119 metalc ? ? OA CA  .   CA  ? ? ? 1_555 AB HOH .   O   ? ? E CA  605 E HOH 789 1_555 ? ? ? ? ? ? ? 2.544 ?    
metalc120 metalc ? ? HA CA  .   CA  ? ? ? 1_555 ZA HOH .   O   ? ? D CA  604 D HOH 725 1_555 ? ? ? ? ? ? ? 2.550 ?    
metalc121 metalc ? ? D  GLU 224 OE2 ? ? ? 1_555 HA CA  .   CA  ? ? D GLU 331 D CA  604 1_555 ? ? ? ? ? ? ? 2.553 ?    
metalc122 metalc ? ? BA CA  .   CA  ? ? ? 1_555 YA HOH .   O   ? ? C CA  604 C HOH 725 1_555 ? ? ? ? ? ? ? 2.565 ?    
metalc123 metalc ? ? UA CA  .   CA  ? ? ? 1_555 BB HOH .   O   ? ? F CA  605 F HOH 757 1_555 ? ? ? ? ? ? ? 2.569 ?    
metalc124 metalc ? ? JA NA  .   NA  ? ? ? 1_555 ZA HOH .   O   ? ? D NA  606 D HOH 721 1_555 ? ? ? ? ? ? ? 2.569 ?    
metalc125 metalc ? ? B  ASP 67  OD2 ? ? ? 1_555 W  CA  .   CA  ? ? B ASP 174 B CA  605 1_555 ? ? ? ? ? ? ? 2.585 ?    
metalc126 metalc ? ? F  ASP 55  OD2 ? ? ? 1_555 SA CA  .   CA  ? ? F ASP 162 F CA  603 1_555 ? ? ? ? ? ? ? 2.603 ?    
metalc127 metalc ? ? CA CA  .   CA  ? ? ? 1_555 YA HOH .   O   ? ? C CA  605 C HOH 773 1_555 ? ? ? ? ? ? ? 2.620 ?    
metalc128 metalc ? ? HA CA  .   CA  ? ? ? 1_555 ZA HOH .   O   ? ? D CA  604 D HOH 710 1_555 ? ? ? ? ? ? ? 2.625 ?    
metalc129 metalc ? ? B  ASN 101 OD1 ? ? ? 1_555 U  CA  .   CA  ? ? B ASN 208 B CA  603 1_555 ? ? ? ? ? ? ? 2.637 ?    
metalc130 metalc ? ? A  GLU 224 OE2 ? ? ? 1_555 P  CA  .   CA  ? ? A GLU 331 A CA  604 1_555 ? ? ? ? ? ? ? 2.639 ?    
metalc131 metalc ? ? E  ASN 101 OD1 ? ? ? 1_555 MA CA  .   CA  ? ? E ASN 208 E CA  603 1_555 ? ? ? ? ? ? ? 2.641 ?    
metalc132 metalc ? ? C  ASP 55  OD2 ? ? ? 1_555 AA CA  .   CA  ? ? C ASP 162 C CA  603 1_555 ? ? ? ? ? ? ? 2.643 ?    
metalc133 metalc ? ? D  ASP 72  OD1 ? ? ? 1_555 IA CA  .   CA  ? ? D ASP 179 D CA  605 1_555 ? ? ? ? ? ? ? 2.647 ?    
metalc134 metalc ? ? A  ASP 72  OD1 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 179 A CA  605 1_555 ? ? ? ? ? ? ? 2.662 ?    
metalc135 metalc ? ? B  ASP 72  OD1 ? ? ? 1_555 W  CA  .   CA  ? ? B ASP 179 B CA  605 1_555 ? ? ? ? ? ? ? 2.671 ?    
metalc136 metalc ? ? A  ASP 55  OD2 ? ? ? 1_555 O  CA  .   CA  ? ? A ASP 162 A CA  603 1_555 ? ? ? ? ? ? ? 2.673 ?    
metalc137 metalc ? ? F  GLU 224 OE2 ? ? ? 1_555 TA CA  .   CA  ? ? F GLU 331 F CA  604 1_555 ? ? ? ? ? ? ? 2.699 ?    
metalc138 metalc ? ? D  ASP 55  OD2 ? ? ? 1_555 GA CA  .   CA  ? ? D ASP 162 D CA  603 1_555 ? ? ? ? ? ? ? 2.700 ?    
metalc139 metalc ? ? A  ASP 72  OD2 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 179 A CA  605 1_555 ? ? ? ? ? ? ? 2.702 ?    
metalc140 metalc ? ? B  ASP 55  OD2 ? ? ? 1_555 U  CA  .   CA  ? ? B ASP 162 B CA  603 1_555 ? ? ? ? ? ? ? 2.705 ?    
metalc141 metalc ? ? P  CA  .   CA  ? ? ? 1_555 WA HOH .   O   ? ? A CA  604 A HOH 758 1_555 ? ? ? ? ? ? ? 2.713 ?    
metalc142 metalc ? ? B  ASP 72  OD2 ? ? ? 1_555 W  CA  .   CA  ? ? B ASP 179 B CA  605 1_555 ? ? ? ? ? ? ? 2.714 ?    
metalc143 metalc ? ? E  ASP 72  OD1 ? ? ? 1_555 OA CA  .   CA  ? ? E ASP 179 E CA  605 1_555 ? ? ? ? ? ? ? 2.728 ?    
metalc144 metalc ? ? PA NA  .   NA  ? ? ? 1_555 AB HOH .   O   ? ? E NA  606 E HOH 704 1_555 ? ? ? ? ? ? ? 2.735 ?    
metalc145 metalc ? ? C  ASP 72  OD2 ? ? ? 1_555 CA CA  .   CA  ? ? C ASP 179 C CA  605 1_555 ? ? ? ? ? ? ? 2.740 ?    
metalc146 metalc ? ? F  ASP 72  OD1 ? ? ? 1_555 UA CA  .   CA  ? ? F ASP 179 F CA  605 1_555 ? ? ? ? ? ? ? 2.745 ?    
metalc147 metalc ? ? E  ASP 55  OD2 ? ? ? 1_555 MA CA  .   CA  ? ? E ASP 162 E CA  603 1_555 ? ? ? ? ? ? ? 2.774 ?    
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 3 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 7 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 2 ? 
L  ? 3 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 7 ? 
P  ? 2 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 3 ? 
T  ? 4 ? 
U  ? 4 ? 
V  ? 7 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 3 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 7 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 3 ? 
AH ? 4 ? 
AI ? 4 ? 
AJ ? 7 ? 
AK ? 2 ? 
AL ? 2 ? 
AM ? 2 ? 
AN ? 3 ? 
AO ? 4 ? 
AP ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
A  5 6 ? parallel      
A  6 7 ? parallel      
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? parallel      
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
H  6 7 ? parallel      
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? parallel      
O  2 3 ? parallel      
O  3 4 ? parallel      
O  4 5 ? parallel      
O  5 6 ? parallel      
O  6 7 ? parallel      
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? parallel      
V  2 3 ? parallel      
V  3 4 ? parallel      
V  4 5 ? parallel      
V  5 6 ? parallel      
V  6 7 ? parallel      
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
AC 6 7 ? parallel      
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? parallel      
AJ 2 3 ? parallel      
AJ 3 4 ? parallel      
AJ 4 5 ? parallel      
AJ 5 6 ? parallel      
AJ 6 7 ? parallel      
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE A 66  ? ASP A 67  ? PHE A 173 ASP A 174 
A  2 ARG A 113 ? ARG A 118 ? ARG A 220 ARG A 225 
A  3 VAL A 41  ? ASP A 46  ? VAL A 148 ASP A 153 
A  4 ILE A 142 ? ALA A 145 ? ILE A 249 ALA A 252 
A  5 ILE A 181 ? ALA A 185 ? ILE A 288 ALA A 292 
A  6 THR A 207 ? ALA A 213 ? THR A 314 ALA A 320 
A  7 ALA A 231 ? TYR A 234 ? ALA A 338 TYR A 341 
B  1 GLY A 148 ? PRO A 149 ? GLY A 255 PRO A 256 
B  2 ARG G 2   ? VAL G 3   ? ARG H 2   VAL H 3   
C  1 ILE A 244 ? ASP A 248 ? ILE A 351 ASP A 355 
C  2 LYS A 252 ? HIS A 257 ? LYS A 359 HIS A 364 
D  1 ALA A 305 ? THR A 306 ? ALA A 412 THR A 413 
D  2 LYS A 312 ? VAL A 313 ? LYS A 419 VAL A 420 
E  1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
E  2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
E  3 LYS A 352 ? ASP A 353 ? LYS A 459 ASP A 460 
F  1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
F  2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
F  3 ARG A 376 ? TYR A 388 ? ARG A 483 TYR A 495 
F  4 PHE A 421 ? THR A 428 ? PHE A 528 THR A 535 
G  1 ARG A 357 ? VAL A 364 ? ARG A 464 VAL A 471 
G  2 GLY A 438 ? ASN A 446 ? GLY A 545 ASN A 553 
G  3 LEU A 394 ? VAL A 399 ? LEU A 501 VAL A 506 
G  4 ARG A 405 ? LEU A 409 ? ARG A 512 LEU A 516 
H  1 PHE B 66  ? ASP B 67  ? PHE B 173 ASP B 174 
H  2 ARG B 113 ? ARG B 118 ? ARG B 220 ARG B 225 
H  3 VAL B 41  ? ASP B 46  ? VAL B 148 ASP B 153 
H  4 ILE B 142 ? ALA B 145 ? ILE B 249 ALA B 252 
H  5 ILE B 181 ? ALA B 185 ? ILE B 288 ALA B 292 
H  6 THR B 207 ? ALA B 213 ? THR B 314 ALA B 320 
H  7 ALA B 231 ? TYR B 234 ? ALA B 338 TYR B 341 
I  1 GLY B 148 ? PRO B 149 ? GLY B 255 PRO B 256 
I  2 ARG H 2   ? VAL H 3   ? ARG I 2   VAL I 3   
J  1 ILE B 244 ? ASP B 248 ? ILE B 351 ASP B 355 
J  2 LYS B 252 ? HIS B 257 ? LYS B 359 HIS B 364 
K  1 ALA B 305 ? THR B 306 ? ALA B 412 THR B 413 
K  2 LYS B 312 ? VAL B 313 ? LYS B 419 VAL B 420 
L  1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
L  2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
L  3 LYS B 352 ? ASP B 353 ? LYS B 459 ASP B 460 
M  1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
M  2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
M  3 ARG B 376 ? TYR B 388 ? ARG B 483 TYR B 495 
M  4 PHE B 421 ? THR B 428 ? PHE B 528 THR B 535 
N  1 ARG B 357 ? VAL B 364 ? ARG B 464 VAL B 471 
N  2 GLY B 438 ? ASN B 446 ? GLY B 545 ASN B 553 
N  3 LEU B 394 ? VAL B 399 ? LEU B 501 VAL B 506 
N  4 ARG B 405 ? LEU B 409 ? ARG B 512 LEU B 516 
O  1 PHE C 66  ? ASP C 67  ? PHE C 173 ASP C 174 
O  2 ARG C 113 ? ARG C 118 ? ARG C 220 ARG C 225 
O  3 VAL C 41  ? ASP C 46  ? VAL C 148 ASP C 153 
O  4 ILE C 142 ? ALA C 145 ? ILE C 249 ALA C 252 
O  5 ILE C 181 ? ALA C 185 ? ILE C 288 ALA C 292 
O  6 THR C 207 ? ALA C 213 ? THR C 314 ALA C 320 
O  7 ALA C 231 ? TYR C 234 ? ALA C 338 TYR C 341 
P  1 GLY C 148 ? PRO C 149 ? GLY C 255 PRO C 256 
P  2 ARG I 2   ? VAL I 3   ? ARG J 2   VAL J 3   
Q  1 ILE C 244 ? ASP C 248 ? ILE C 351 ASP C 355 
Q  2 LYS C 252 ? HIS C 257 ? LYS C 359 HIS C 364 
R  1 ALA C 305 ? THR C 306 ? ALA C 412 THR C 413 
R  2 LYS C 312 ? VAL C 313 ? LYS C 419 VAL C 420 
S  1 ARG C 341 ? ASP C 346 ? ARG C 448 ASP C 453 
S  2 GLY C 454 ? THR C 466 ? GLY C 561 THR C 573 
S  3 LYS C 352 ? ASP C 353 ? LYS C 459 ASP C 460 
T  1 ARG C 341 ? ASP C 346 ? ARG C 448 ASP C 453 
T  2 GLY C 454 ? THR C 466 ? GLY C 561 THR C 573 
T  3 ARG C 376 ? TYR C 388 ? ARG C 483 TYR C 495 
T  4 PHE C 421 ? THR C 428 ? PHE C 528 THR C 535 
U  1 ARG C 357 ? VAL C 364 ? ARG C 464 VAL C 471 
U  2 GLY C 438 ? ASN C 446 ? GLY C 545 ASN C 553 
U  3 LEU C 394 ? VAL C 399 ? LEU C 501 VAL C 506 
U  4 ARG C 405 ? LEU C 409 ? ARG C 512 LEU C 516 
V  1 PHE D 66  ? ASP D 67  ? PHE D 173 ASP D 174 
V  2 ARG D 113 ? ARG D 118 ? ARG D 220 ARG D 225 
V  3 VAL D 41  ? ASP D 46  ? VAL D 148 ASP D 153 
V  4 ILE D 142 ? ALA D 145 ? ILE D 249 ALA D 252 
V  5 ILE D 181 ? ALA D 185 ? ILE D 288 ALA D 292 
V  6 THR D 207 ? ALA D 213 ? THR D 314 ALA D 320 
V  7 ALA D 231 ? TYR D 234 ? ALA D 338 TYR D 341 
W  1 GLY D 148 ? PRO D 149 ? GLY D 255 PRO D 256 
W  2 ARG J 2   ? VAL J 3   ? ARG K 2   VAL K 3   
X  1 ILE D 244 ? ASP D 248 ? ILE D 351 ASP D 355 
X  2 LYS D 252 ? HIS D 257 ? LYS D 359 HIS D 364 
Y  1 ALA D 305 ? THR D 306 ? ALA D 412 THR D 413 
Y  2 LYS D 312 ? VAL D 313 ? LYS D 419 VAL D 420 
Z  1 ARG D 341 ? ASP D 346 ? ARG D 448 ASP D 453 
Z  2 GLY D 454 ? THR D 466 ? GLY D 561 THR D 573 
Z  3 LYS D 352 ? ASP D 353 ? LYS D 459 ASP D 460 
AA 1 ARG D 341 ? ASP D 346 ? ARG D 448 ASP D 453 
AA 2 GLY D 454 ? THR D 466 ? GLY D 561 THR D 573 
AA 3 ARG D 376 ? TYR D 388 ? ARG D 483 TYR D 495 
AA 4 PHE D 421 ? THR D 428 ? PHE D 528 THR D 535 
AB 1 ARG D 357 ? VAL D 364 ? ARG D 464 VAL D 471 
AB 2 GLY D 438 ? ASN D 446 ? GLY D 545 ASN D 553 
AB 3 LEU D 394 ? VAL D 399 ? LEU D 501 VAL D 506 
AB 4 ARG D 405 ? LEU D 409 ? ARG D 512 LEU D 516 
AC 1 PHE E 66  ? ASP E 67  ? PHE E 173 ASP E 174 
AC 2 ARG E 113 ? ARG E 118 ? ARG E 220 ARG E 225 
AC 3 VAL E 41  ? ASP E 46  ? VAL E 148 ASP E 153 
AC 4 ILE E 142 ? ALA E 145 ? ILE E 249 ALA E 252 
AC 5 ILE E 181 ? ALA E 185 ? ILE E 288 ALA E 292 
AC 6 THR E 207 ? ALA E 213 ? THR E 314 ALA E 320 
AC 7 ALA E 231 ? TYR E 234 ? ALA E 338 TYR E 341 
AD 1 GLY E 148 ? PRO E 149 ? GLY E 255 PRO E 256 
AD 2 ARG K 2   ? VAL K 3   ? ARG L 2   VAL L 3   
AE 1 ILE E 244 ? ASP E 248 ? ILE E 351 ASP E 355 
AE 2 LYS E 252 ? HIS E 257 ? LYS E 359 HIS E 364 
AF 1 ALA E 305 ? THR E 306 ? ALA E 412 THR E 413 
AF 2 LYS E 312 ? VAL E 313 ? LYS E 419 VAL E 420 
AG 1 ARG E 341 ? ASP E 346 ? ARG E 448 ASP E 453 
AG 2 GLY E 454 ? THR E 466 ? GLY E 561 THR E 573 
AG 3 LYS E 352 ? ASP E 353 ? LYS E 459 ASP E 460 
AH 1 ARG E 341 ? ASP E 346 ? ARG E 448 ASP E 453 
AH 2 GLY E 454 ? THR E 466 ? GLY E 561 THR E 573 
AH 3 ARG E 376 ? TYR E 388 ? ARG E 483 TYR E 495 
AH 4 PHE E 421 ? THR E 428 ? PHE E 528 THR E 535 
AI 1 ARG E 357 ? VAL E 364 ? ARG E 464 VAL E 471 
AI 2 GLY E 438 ? ASN E 446 ? GLY E 545 ASN E 553 
AI 3 LEU E 394 ? VAL E 399 ? LEU E 501 VAL E 506 
AI 4 ARG E 405 ? LEU E 409 ? ARG E 512 LEU E 516 
AJ 1 PHE F 66  ? ASP F 67  ? PHE F 173 ASP F 174 
AJ 2 ARG F 113 ? ARG F 118 ? ARG F 220 ARG F 225 
AJ 3 VAL F 41  ? ASP F 46  ? VAL F 148 ASP F 153 
AJ 4 ILE F 142 ? ALA F 145 ? ILE F 249 ALA F 252 
AJ 5 ILE F 181 ? ALA F 185 ? ILE F 288 ALA F 292 
AJ 6 THR F 207 ? ALA F 213 ? THR F 314 ALA F 320 
AJ 7 ALA F 231 ? TYR F 234 ? ALA F 338 TYR F 341 
AK 1 GLY F 148 ? PRO F 149 ? GLY F 255 PRO F 256 
AK 2 ARG L 2   ? VAL L 3   ? ARG N 2   VAL N 3   
AL 1 ILE F 244 ? ASP F 248 ? ILE F 351 ASP F 355 
AL 2 LYS F 252 ? HIS F 257 ? LYS F 359 HIS F 364 
AM 1 ALA F 305 ? THR F 306 ? ALA F 412 THR F 413 
AM 2 LYS F 312 ? VAL F 313 ? LYS F 419 VAL F 420 
AN 1 ARG F 341 ? ASP F 346 ? ARG F 448 ASP F 453 
AN 2 GLY F 454 ? THR F 466 ? GLY F 561 THR F 573 
AN 3 LYS F 352 ? ASP F 353 ? LYS F 459 ASP F 460 
AO 1 ARG F 341 ? ASP F 346 ? ARG F 448 ASP F 453 
AO 2 GLY F 454 ? THR F 466 ? GLY F 561 THR F 573 
AO 3 ARG F 376 ? TYR F 388 ? ARG F 483 TYR F 495 
AO 4 PHE F 421 ? THR F 428 ? PHE F 528 THR F 535 
AP 1 ARG F 357 ? VAL F 364 ? ARG F 464 VAL F 471 
AP 2 GLY F 438 ? ASN F 446 ? GLY F 545 ASN F 553 
AP 3 LEU F 394 ? VAL F 399 ? LEU F 501 VAL F 506 
AP 4 ARG F 405 ? LEU F 409 ? ARG F 512 LEU F 516 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N PHE A 66  ? N PHE A 173 O ARG A 118 ? O ARG A 225 
A  2 3 O ARG A 113 ? O ARG A 220 N VAL A 42  ? N VAL A 149 
A  3 4 N SER A 43  ? N SER A 150 O ILE A 142 ? O ILE A 249 
A  4 5 N TYR A 143 ? N TYR A 250 O ILE A 181 ? O ILE A 288 
A  5 6 N TRP A 184 ? N TRP A 291 O ILE A 210 ? O ILE A 317 
A  6 7 N SER A 211 ? N SER A 318 O ALA A 231 ? O ALA A 338 
B  1 2 N GLY A 148 ? N GLY A 255 O VAL G 3   ? O VAL H 3   
C  1 2 N ASP A 248 ? N ASP A 355 O LYS A 252 ? O LYS A 359 
D  1 2 N ALA A 305 ? N ALA A 412 O VAL A 313 ? O VAL A 420 
E  1 2 N CYS A 343 ? N CYS A 450 O LEU A 463 ? O LEU A 570 
E  2 3 O LEU A 456 ? O LEU A 563 N LYS A 352 ? N LYS A 459 
F  1 2 N CYS A 343 ? N CYS A 450 O LEU A 463 ? O LEU A 570 
F  2 3 O THR A 460 ? O THR A 567 N ARG A 383 ? N ARG A 490 
F  3 4 N ALA A 382 ? N ALA A 489 O PHE A 426 ? O PHE A 533 
G  1 2 N LYS A 362 ? N LYS A 469 O TRP A 440 ? O TRP A 547 
G  2 3 O GLU A 443 ? O GLU A 550 N HIS A 397 ? N HIS A 504 
G  3 4 N LEU A 398 ? N LEU A 505 O SER A 406 ? O SER A 513 
H  1 2 N PHE B 66  ? N PHE B 173 O ARG B 118 ? O ARG B 225 
H  2 3 O GLY B 115 ? O GLY B 222 N VAL B 42  ? N VAL B 149 
H  3 4 N SER B 43  ? N SER B 150 O ILE B 142 ? O ILE B 249 
H  4 5 N TYR B 143 ? N TYR B 250 O ILE B 181 ? O ILE B 288 
H  5 6 N TRP B 184 ? N TRP B 291 O ILE B 210 ? O ILE B 317 
H  6 7 N SER B 211 ? N SER B 318 O ALA B 231 ? O ALA B 338 
I  1 2 N GLY B 148 ? N GLY B 255 O VAL H 3   ? O VAL I 3   
J  1 2 N THR B 246 ? N THR B 353 O THR B 254 ? O THR B 361 
K  1 2 N ALA B 305 ? N ALA B 412 O VAL B 313 ? O VAL B 420 
L  1 2 N CYS B 343 ? N CYS B 450 O LEU B 463 ? O LEU B 570 
L  2 3 O LEU B 456 ? O LEU B 563 N LYS B 352 ? N LYS B 459 
M  1 2 N CYS B 343 ? N CYS B 450 O LEU B 463 ? O LEU B 570 
M  2 3 O THR B 466 ? O THR B 573 N ARG B 376 ? N ARG B 483 
M  3 4 N ALA B 382 ? N ALA B 489 O PHE B 426 ? O PHE B 533 
N  1 2 N LEU B 358 ? N LEU B 465 O ILE B 444 ? O ILE B 551 
N  2 3 O GLU B 443 ? O GLU B 550 N HIS B 397 ? N HIS B 504 
N  3 4 N LEU B 398 ? N LEU B 505 O SER B 406 ? O SER B 513 
O  1 2 N PHE C 66  ? N PHE C 173 O ARG C 118 ? O ARG C 225 
O  2 3 O ARG C 113 ? O ARG C 220 N VAL C 42  ? N VAL C 149 
O  3 4 N SER C 43  ? N SER C 150 O ILE C 142 ? O ILE C 249 
O  4 5 N TYR C 143 ? N TYR C 250 O ILE C 181 ? O ILE C 288 
O  5 6 N TRP C 184 ? N TRP C 291 O ILE C 210 ? O ILE C 317 
O  6 7 N SER C 211 ? N SER C 318 O ALA C 231 ? O ALA C 338 
P  1 2 N GLY C 148 ? N GLY C 255 O VAL I 3   ? O VAL J 3   
Q  1 2 N ASP C 248 ? N ASP C 355 O LYS C 252 ? O LYS C 359 
R  1 2 N ALA C 305 ? N ALA C 412 O VAL C 313 ? O VAL C 420 
S  1 2 N CYS C 343 ? N CYS C 450 O LEU C 463 ? O LEU C 570 
S  2 3 O LEU C 456 ? O LEU C 563 N LYS C 352 ? N LYS C 459 
T  1 2 N CYS C 343 ? N CYS C 450 O LEU C 463 ? O LEU C 570 
T  2 3 O VAL C 462 ? O VAL C 569 N GLN C 381 ? N GLN C 488 
T  3 4 N ALA C 382 ? N ALA C 489 O PHE C 426 ? O PHE C 533 
U  1 2 N LEU C 358 ? N LEU C 465 O ILE C 444 ? O ILE C 551 
U  2 3 O GLU C 443 ? O GLU C 550 N HIS C 397 ? N HIS C 504 
U  3 4 N LEU C 398 ? N LEU C 505 O SER C 406 ? O SER C 513 
V  1 2 N PHE D 66  ? N PHE D 173 O ARG D 118 ? O ARG D 225 
V  2 3 O ARG D 113 ? O ARG D 220 N VAL D 42  ? N VAL D 149 
V  3 4 N SER D 43  ? N SER D 150 O ILE D 142 ? O ILE D 249 
V  4 5 N TYR D 143 ? N TYR D 250 O ILE D 181 ? O ILE D 288 
V  5 6 N TRP D 184 ? N TRP D 291 O ILE D 210 ? O ILE D 317 
V  6 7 N SER D 211 ? N SER D 318 O ALA D 231 ? O ALA D 338 
W  1 2 N GLY D 148 ? N GLY D 255 O VAL J 3   ? O VAL K 3   
X  1 2 N ASP D 248 ? N ASP D 355 O LYS D 252 ? O LYS D 359 
Y  1 2 N ALA D 305 ? N ALA D 412 O VAL D 313 ? O VAL D 420 
Z  1 2 N CYS D 343 ? N CYS D 450 O LEU D 463 ? O LEU D 570 
Z  2 3 O LEU D 456 ? O LEU D 563 N LYS D 352 ? N LYS D 459 
AA 1 2 N CYS D 343 ? N CYS D 450 O LEU D 463 ? O LEU D 570 
AA 2 3 O THR D 460 ? O THR D 567 N ARG D 383 ? N ARG D 490 
AA 3 4 N ALA D 382 ? N ALA D 489 O PHE D 426 ? O PHE D 533 
AB 1 2 N LYS D 362 ? N LYS D 469 O TRP D 440 ? O TRP D 547 
AB 2 3 O GLU D 443 ? O GLU D 550 N HIS D 397 ? N HIS D 504 
AB 3 4 N LEU D 398 ? N LEU D 505 O SER D 406 ? O SER D 513 
AC 1 2 N PHE E 66  ? N PHE E 173 O ARG E 118 ? O ARG E 225 
AC 2 3 O GLY E 115 ? O GLY E 222 N VAL E 42  ? N VAL E 149 
AC 3 4 N SER E 43  ? N SER E 150 O ILE E 142 ? O ILE E 249 
AC 4 5 N TYR E 143 ? N TYR E 250 O ILE E 181 ? O ILE E 288 
AC 5 6 N TRP E 184 ? N TRP E 291 O ILE E 210 ? O ILE E 317 
AC 6 7 N SER E 211 ? N SER E 318 O ALA E 231 ? O ALA E 338 
AD 1 2 N GLY E 148 ? N GLY E 255 O VAL K 3   ? O VAL L 3   
AE 1 2 N ASP E 248 ? N ASP E 355 O LYS E 252 ? O LYS E 359 
AF 1 2 N ALA E 305 ? N ALA E 412 O VAL E 313 ? O VAL E 420 
AG 1 2 N ILE E 345 ? N ILE E 452 O LEU E 461 ? O LEU E 568 
AG 2 3 O LEU E 456 ? O LEU E 563 N LYS E 352 ? N LYS E 459 
AH 1 2 N ILE E 345 ? N ILE E 452 O LEU E 461 ? O LEU E 568 
AH 2 3 O THR E 460 ? O THR E 567 N ARG E 383 ? N ARG E 490 
AH 3 4 N ALA E 382 ? N ALA E 489 O PHE E 426 ? O PHE E 533 
AI 1 2 N LEU E 358 ? N LEU E 465 O ILE E 444 ? O ILE E 551 
AI 2 3 O GLU E 443 ? O GLU E 550 N HIS E 397 ? N HIS E 504 
AI 3 4 N LEU E 398 ? N LEU E 505 O SER E 406 ? O SER E 513 
AJ 1 2 N PHE F 66  ? N PHE F 173 O ARG F 118 ? O ARG F 225 
AJ 2 3 O GLY F 115 ? O GLY F 222 N VAL F 42  ? N VAL F 149 
AJ 3 4 N SER F 43  ? N SER F 150 O ILE F 142 ? O ILE F 249 
AJ 4 5 N TYR F 143 ? N TYR F 250 O ILE F 181 ? O ILE F 288 
AJ 5 6 N TRP F 184 ? N TRP F 291 O ILE F 210 ? O ILE F 317 
AJ 6 7 N SER F 211 ? N SER F 318 O ALA F 231 ? O ALA F 338 
AK 1 2 N GLY F 148 ? N GLY F 255 O VAL L 3   ? O VAL N 3   
AL 1 2 N ASP F 248 ? N ASP F 355 O LYS F 252 ? O LYS F 359 
AM 1 2 N ALA F 305 ? N ALA F 412 O VAL F 313 ? O VAL F 420 
AN 1 2 N CYS F 343 ? N CYS F 450 O LEU F 463 ? O LEU F 570 
AN 2 3 O LEU F 456 ? O LEU F 563 N LYS F 352 ? N LYS F 459 
AO 1 2 N CYS F 343 ? N CYS F 450 O LEU F 463 ? O LEU F 570 
AO 2 3 O THR F 460 ? O THR F 567 N ARG F 383 ? N ARG F 490 
AO 3 4 N ALA F 382 ? N ALA F 489 O PHE F 426 ? O PHE F 533 
AP 1 2 N LEU F 358 ? N LEU F 465 O ILE F 444 ? O ILE F 551 
AP 2 3 O GLU F 443 ? O GLU F 550 N HIS F 397 ? N HIS F 504 
AP 3 4 N LEU F 398 ? N LEU F 505 O SER F 406 ? O SER F 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT A 601'                                            
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT A 602'                                            
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 603'                                             
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 604'                                             
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 605'                                             
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 606'                                             
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT B 601'                                            
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT B 602'                                            
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 603'                                             
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 604'                                             
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA B 605'                                             
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA B 606'                                             
BC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE FMT C 601'                                            
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT C 602'                                            
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 603'                                             
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 604'                                             
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA C 605'                                             
BC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA C 606'                                             
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT D 601'                                            
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT D 602'                                            
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 603'                                             
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 604'                                             
CC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA D 605'                                             
CC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA D 606'                                             
CC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT E 601'                                            
CC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT E 602'                                            
CC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 603'                                             
DC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 604'                                             
DC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA E 605'                                             
DC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA E 606'                                             
DC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT F 601'                                            
DC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT F 602'                                            
DC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 603'                                             
DC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA F 604'                                             
DC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 605'                                             
DC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA F 606'                                             
EC1 Software ? ? ? ? 22 'BINDING SITE FOR CHAIN H OF PHENYLACETYL-ARG-VAL-ARG-(AMIDOMETHYL)BENZAMIDINE' 
EC2 Software ? ? ? ? 24 'BINDING SITE FOR CHAIN I OF PHENYLACETYL-ARG-VAL-ARG-(AMIDOMETHYL)BENZAMIDINE' 
EC3 Software ? ? ? ? 24 'BINDING SITE FOR CHAIN J OF PHENYLACETYL-ARG-VAL-ARG-(AMIDOMETHYL)BENZAMIDINE' 
EC4 Software ? ? ? ? 23 'BINDING SITE FOR CHAIN K OF PHENYLACETYL-ARG-VAL-ARG-(AMIDOMETHYL)BENZAMIDINE' 
EC5 Software ? ? ? ? 23 'BINDING SITE FOR CHAIN L OF PHENYLACETYL-ARG-VAL-ARG-(AMIDOMETHYL)BENZAMIDINE' 
EC6 Software ? ? ? ? 26 'BINDING SITE FOR CHAIN N OF PHENYLACETYL-ARG-VAL-ARG-(AMIDOMETHYL)BENZAMIDINE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  TYR A  206 ? TYR A 313 . ? 1_555 ? 
2   AC1 4  GLN A  340 ? GLN A 447 . ? 1_555 ? 
3   AC1 4  FMT N  .   ? FMT A 602 . ? 1_555 ? 
4   AC1 4  GLN B  173 ? GLN B 280 . ? 1_555 ? 
5   AC2 6  PHE A  168 ? PHE A 275 . ? 1_555 ? 
6   AC2 6  TYR A  206 ? TYR A 313 . ? 1_555 ? 
7   AC2 6  LYS A  342 ? LYS A 449 . ? 1_555 ? 
8   AC2 6  TYR A  464 ? TYR A 571 . ? 1_555 ? 
9   AC2 6  FMT M  .   ? FMT A 601 . ? 1_555 ? 
10  AC2 6  ARG B  169 ? ARG B 276 . ? 1_555 ? 
11  AC3 6  ASP A  8   ? ASP A 115 . ? 1_555 ? 
12  AC3 6  ASP A  55  ? ASP A 162 . ? 1_555 ? 
13  AC3 6  VAL A  98  ? VAL A 205 . ? 1_555 ? 
14  AC3 6  ASN A  101 ? ASN A 208 . ? 1_555 ? 
15  AC3 6  VAL A  103 ? VAL A 210 . ? 1_555 ? 
16  AC3 6  GLY A  105 ? GLY A 212 . ? 1_555 ? 
17  AC4 6  ASP A  151 ? ASP A 258 . ? 1_555 ? 
18  AC4 6  ASP A  194 ? ASP A 301 . ? 1_555 ? 
19  AC4 6  GLU A  224 ? GLU A 331 . ? 1_555 ? 
20  AC4 6  HOH WA .   ? HOH A 746 . ? 1_555 ? 
21  AC4 6  HOH WA .   ? HOH A 758 . ? 1_555 ? 
22  AC4 6  HOH WA .   ? HOH A 796 . ? 1_555 ? 
23  AC5 6  ASP A  67  ? ASP A 174 . ? 1_555 ? 
24  AC5 6  ASP A  72  ? ASP A 179 . ? 1_555 ? 
25  AC5 6  ASP A  74  ? ASP A 181 . ? 1_555 ? 
26  AC5 6  HOH WA .   ? HOH A 723 . ? 1_555 ? 
27  AC5 6  HOH WA .   ? HOH A 727 . ? 1_555 ? 
28  AC5 6  HOH WA .   ? HOH A 809 . ? 1_555 ? 
29  AC6 4  THR A  202 ? THR A 309 . ? 1_555 ? 
30  AC6 4  SER A  204 ? SER A 311 . ? 1_555 ? 
31  AC6 4  THR A  207 ? THR A 314 . ? 1_555 ? 
32  AC6 4  HOH WA .   ? HOH A 764 . ? 1_555 ? 
33  AC7 6  ARG A  169 ? ARG A 276 . ? 1_555 ? 
34  AC7 6  GLN A  173 ? GLN A 280 . ? 1_555 ? 
35  AC7 6  TYR B  206 ? TYR B 313 . ? 1_555 ? 
36  AC7 6  GLN B  340 ? GLN B 447 . ? 1_555 ? 
37  AC7 6  FMT T  .   ? FMT B 602 . ? 1_555 ? 
38  AC7 6  HOH XA .   ? HOH B 742 . ? 1_555 ? 
39  AC8 6  ARG A  169 ? ARG A 276 . ? 1_555 ? 
40  AC8 6  PHE B  168 ? PHE B 275 . ? 1_555 ? 
41  AC8 6  TYR B  206 ? TYR B 313 . ? 1_555 ? 
42  AC8 6  LYS B  342 ? LYS B 449 . ? 1_555 ? 
43  AC8 6  TYR B  464 ? TYR B 571 . ? 1_555 ? 
44  AC8 6  FMT S  .   ? FMT B 601 . ? 1_555 ? 
45  AC9 6  ASP B  8   ? ASP B 115 . ? 1_555 ? 
46  AC9 6  ASP B  55  ? ASP B 162 . ? 1_555 ? 
47  AC9 6  VAL B  98  ? VAL B 205 . ? 1_555 ? 
48  AC9 6  ASN B  101 ? ASN B 208 . ? 1_555 ? 
49  AC9 6  VAL B  103 ? VAL B 210 . ? 1_555 ? 
50  AC9 6  GLY B  105 ? GLY B 212 . ? 1_555 ? 
51  BC1 6  ASP B  151 ? ASP B 258 . ? 1_555 ? 
52  BC1 6  ASP B  194 ? ASP B 301 . ? 1_555 ? 
53  BC1 6  GLU B  224 ? GLU B 331 . ? 1_555 ? 
54  BC1 6  HOH XA .   ? HOH B 711 . ? 1_555 ? 
55  BC1 6  HOH XA .   ? HOH B 735 . ? 1_555 ? 
56  BC1 6  HOH XA .   ? HOH B 782 . ? 1_555 ? 
57  BC2 4  ASP B  67  ? ASP B 174 . ? 1_555 ? 
58  BC2 4  ASP B  72  ? ASP B 179 . ? 1_555 ? 
59  BC2 4  ASP B  74  ? ASP B 181 . ? 1_555 ? 
60  BC2 4  HOH XA .   ? HOH B 769 . ? 1_555 ? 
61  BC3 5  THR B  202 ? THR B 309 . ? 1_555 ? 
62  BC3 5  SER B  204 ? SER B 311 . ? 1_555 ? 
63  BC3 5  THR B  207 ? THR B 314 . ? 1_555 ? 
64  BC3 5  SER B  209 ? SER B 316 . ? 1_555 ? 
65  BC3 5  HOH XA .   ? HOH B 703 . ? 1_555 ? 
66  BC4 3  TYR C  206 ? TYR C 313 . ? 1_555 ? 
67  BC4 3  GLN C  340 ? GLN C 447 . ? 1_555 ? 
68  BC4 3  FMT Z  .   ? FMT C 602 . ? 1_555 ? 
69  BC5 6  PHE C  168 ? PHE C 275 . ? 1_555 ? 
70  BC5 6  TYR C  206 ? TYR C 313 . ? 1_555 ? 
71  BC5 6  LYS C  342 ? LYS C 449 . ? 1_555 ? 
72  BC5 6  TYR C  464 ? TYR C 571 . ? 1_555 ? 
73  BC5 6  FMT Y  .   ? FMT C 601 . ? 1_555 ? 
74  BC5 6  ARG D  169 ? ARG D 276 . ? 1_555 ? 
75  BC6 6  ASP C  8   ? ASP C 115 . ? 1_555 ? 
76  BC6 6  ASP C  55  ? ASP C 162 . ? 1_555 ? 
77  BC6 6  VAL C  98  ? VAL C 205 . ? 1_555 ? 
78  BC6 6  ASN C  101 ? ASN C 208 . ? 1_555 ? 
79  BC6 6  VAL C  103 ? VAL C 210 . ? 1_555 ? 
80  BC6 6  GLY C  105 ? GLY C 212 . ? 1_555 ? 
81  BC7 6  ASP C  151 ? ASP C 258 . ? 1_555 ? 
82  BC7 6  ASP C  194 ? ASP C 301 . ? 1_555 ? 
83  BC7 6  GLU C  224 ? GLU C 331 . ? 1_555 ? 
84  BC7 6  HOH YA .   ? HOH C 725 . ? 1_555 ? 
85  BC7 6  HOH YA .   ? HOH C 742 . ? 1_555 ? 
86  BC7 6  HOH YA .   ? HOH C 769 . ? 1_555 ? 
87  BC8 4  ASP C  67  ? ASP C 174 . ? 1_555 ? 
88  BC8 4  ASP C  72  ? ASP C 179 . ? 1_555 ? 
89  BC8 4  ASP C  74  ? ASP C 181 . ? 1_555 ? 
90  BC8 4  HOH YA .   ? HOH C 773 . ? 1_555 ? 
91  BC9 4  THR C  202 ? THR C 309 . ? 1_555 ? 
92  BC9 4  SER C  204 ? SER C 311 . ? 1_555 ? 
93  BC9 4  THR C  207 ? THR C 314 . ? 1_555 ? 
94  BC9 4  HOH YA .   ? HOH C 718 . ? 1_555 ? 
95  CC1 6  ARG C  169 ? ARG C 276 . ? 1_555 ? 
96  CC1 6  GLN C  173 ? GLN C 280 . ? 1_555 ? 
97  CC1 6  TYR D  206 ? TYR D 313 . ? 1_555 ? 
98  CC1 6  GLN D  340 ? GLN D 447 . ? 1_555 ? 
99  CC1 6  FMT FA .   ? FMT D 602 . ? 1_555 ? 
100 CC1 6  HOH ZA .   ? HOH D 760 . ? 1_555 ? 
101 CC2 6  ARG C  169 ? ARG C 276 . ? 1_555 ? 
102 CC2 6  PHE D  168 ? PHE D 275 . ? 1_555 ? 
103 CC2 6  TYR D  206 ? TYR D 313 . ? 1_555 ? 
104 CC2 6  LYS D  342 ? LYS D 449 . ? 1_555 ? 
105 CC2 6  TYR D  464 ? TYR D 571 . ? 1_555 ? 
106 CC2 6  FMT EA .   ? FMT D 601 . ? 1_555 ? 
107 CC3 6  ASP D  8   ? ASP D 115 . ? 1_555 ? 
108 CC3 6  ASP D  55  ? ASP D 162 . ? 1_555 ? 
109 CC3 6  VAL D  98  ? VAL D 205 . ? 1_555 ? 
110 CC3 6  ASN D  101 ? ASN D 208 . ? 1_555 ? 
111 CC3 6  VAL D  103 ? VAL D 210 . ? 1_555 ? 
112 CC3 6  GLY D  105 ? GLY D 212 . ? 1_555 ? 
113 CC4 6  ASP D  151 ? ASP D 258 . ? 1_555 ? 
114 CC4 6  ASP D  194 ? ASP D 301 . ? 1_555 ? 
115 CC4 6  GLU D  224 ? GLU D 331 . ? 1_555 ? 
116 CC4 6  HOH ZA .   ? HOH D 710 . ? 1_555 ? 
117 CC4 6  HOH ZA .   ? HOH D 725 . ? 1_555 ? 
118 CC4 6  HOH ZA .   ? HOH D 797 . ? 1_555 ? 
119 CC5 5  ASP D  67  ? ASP D 174 . ? 1_555 ? 
120 CC5 5  ASP D  72  ? ASP D 179 . ? 1_555 ? 
121 CC5 5  ASP D  74  ? ASP D 181 . ? 1_555 ? 
122 CC5 5  HOH ZA .   ? HOH D 749 . ? 1_555 ? 
123 CC5 5  HOH ZA .   ? HOH D 798 . ? 1_555 ? 
124 CC6 4  THR D  202 ? THR D 309 . ? 1_555 ? 
125 CC6 4  SER D  204 ? SER D 311 . ? 1_555 ? 
126 CC6 4  THR D  207 ? THR D 314 . ? 1_555 ? 
127 CC6 4  HOH ZA .   ? HOH D 721 . ? 1_555 ? 
128 CC7 5  TYR E  206 ? TYR E 313 . ? 1_555 ? 
129 CC7 5  GLN E  340 ? GLN E 447 . ? 1_555 ? 
130 CC7 5  FMT LA .   ? FMT E 602 . ? 1_555 ? 
131 CC7 5  HOH AB .   ? HOH E 740 . ? 1_555 ? 
132 CC7 5  ARG F  169 ? ARG F 276 . ? 1_555 ? 
133 CC8 6  PHE E  168 ? PHE E 275 . ? 1_555 ? 
134 CC8 6  TYR E  206 ? TYR E 313 . ? 1_555 ? 
135 CC8 6  LYS E  342 ? LYS E 449 . ? 1_555 ? 
136 CC8 6  TYR E  464 ? TYR E 571 . ? 1_555 ? 
137 CC8 6  FMT KA .   ? FMT E 601 . ? 1_555 ? 
138 CC8 6  ARG F  169 ? ARG F 276 . ? 1_555 ? 
139 CC9 6  ASP E  8   ? ASP E 115 . ? 1_555 ? 
140 CC9 6  ASP E  55  ? ASP E 162 . ? 1_555 ? 
141 CC9 6  VAL E  98  ? VAL E 205 . ? 1_555 ? 
142 CC9 6  ASN E  101 ? ASN E 208 . ? 1_555 ? 
143 CC9 6  VAL E  103 ? VAL E 210 . ? 1_555 ? 
144 CC9 6  GLY E  105 ? GLY E 212 . ? 1_555 ? 
145 DC1 6  ASP E  151 ? ASP E 258 . ? 1_555 ? 
146 DC1 6  ASP E  194 ? ASP E 301 . ? 1_555 ? 
147 DC1 6  GLU E  224 ? GLU E 331 . ? 1_555 ? 
148 DC1 6  HOH AB .   ? HOH E 718 . ? 1_555 ? 
149 DC1 6  HOH AB .   ? HOH E 719 . ? 1_555 ? 
150 DC1 6  HOH AB .   ? HOH E 788 . ? 1_555 ? 
151 DC2 4  ASP E  67  ? ASP E 174 . ? 1_555 ? 
152 DC2 4  ASP E  72  ? ASP E 179 . ? 1_555 ? 
153 DC2 4  ASP E  74  ? ASP E 181 . ? 1_555 ? 
154 DC2 4  HOH AB .   ? HOH E 789 . ? 1_555 ? 
155 DC3 4  THR E  202 ? THR E 309 . ? 1_555 ? 
156 DC3 4  SER E  204 ? SER E 311 . ? 1_555 ? 
157 DC3 4  THR E  207 ? THR E 314 . ? 1_555 ? 
158 DC3 4  HOH AB .   ? HOH E 704 . ? 1_555 ? 
159 DC4 4  ARG E  169 ? ARG E 276 . ? 1_555 ? 
160 DC4 4  TYR F  206 ? TYR F 313 . ? 1_555 ? 
161 DC4 4  GLN F  340 ? GLN F 447 . ? 1_555 ? 
162 DC4 4  FMT RA .   ? FMT F 602 . ? 1_555 ? 
163 DC5 6  ARG E  169 ? ARG E 276 . ? 1_555 ? 
164 DC5 6  PHE F  168 ? PHE F 275 . ? 1_555 ? 
165 DC5 6  TYR F  206 ? TYR F 313 . ? 1_555 ? 
166 DC5 6  LYS F  342 ? LYS F 449 . ? 1_555 ? 
167 DC5 6  TYR F  464 ? TYR F 571 . ? 1_555 ? 
168 DC5 6  FMT QA .   ? FMT F 601 . ? 1_555 ? 
169 DC6 6  ASP F  8   ? ASP F 115 . ? 1_555 ? 
170 DC6 6  ASP F  55  ? ASP F 162 . ? 1_555 ? 
171 DC6 6  VAL F  98  ? VAL F 205 . ? 1_555 ? 
172 DC6 6  ASN F  101 ? ASN F 208 . ? 1_555 ? 
173 DC6 6  VAL F  103 ? VAL F 210 . ? 1_555 ? 
174 DC6 6  GLY F  105 ? GLY F 212 . ? 1_555 ? 
175 DC7 4  ASP F  151 ? ASP F 258 . ? 1_555 ? 
176 DC7 4  ASP F  194 ? ASP F 301 . ? 1_555 ? 
177 DC7 4  GLU F  224 ? GLU F 331 . ? 1_555 ? 
178 DC7 4  HOH BB .   ? HOH F 704 . ? 1_555 ? 
179 DC8 6  ASP F  67  ? ASP F 174 . ? 1_555 ? 
180 DC8 6  ASP F  72  ? ASP F 179 . ? 1_555 ? 
181 DC8 6  ASP F  74  ? ASP F 181 . ? 1_555 ? 
182 DC8 6  HOH BB .   ? HOH F 739 . ? 1_555 ? 
183 DC8 6  HOH BB .   ? HOH F 757 . ? 1_555 ? 
184 DC8 6  HOH BB .   ? HOH F 776 . ? 1_555 ? 
185 DC9 4  THR F  202 ? THR F 309 . ? 1_555 ? 
186 DC9 4  SER F  204 ? SER F 311 . ? 1_555 ? 
187 DC9 4  THR F  207 ? THR F 314 . ? 1_555 ? 
188 DC9 4  HOH BB .   ? HOH F 715 . ? 1_555 ? 
189 EC1 22 ASP A  47  ? ASP A 154 . ? 1_555 ? 
190 EC1 22 ASP A  84  ? ASP A 191 . ? 1_555 ? 
191 EC1 22 ASN A  85  ? ASN A 192 . ? 1_555 ? 
192 EC1 22 HIS A  87  ? HIS A 194 . ? 1_555 ? 
193 EC1 22 VAL A  124 ? VAL A 231 . ? 1_555 ? 
194 EC1 22 GLU A  129 ? GLU A 236 . ? 1_555 ? 
195 EC1 22 SER A  146 ? SER A 253 . ? 1_555 ? 
196 EC1 22 TRP A  147 ? TRP A 254 . ? 1_555 ? 
197 EC1 22 GLY A  148 ? GLY A 255 . ? 1_555 ? 
198 EC1 22 PRO A  149 ? PRO A 256 . ? 1_555 ? 
199 EC1 22 ASP A  151 ? ASP A 258 . ? 1_555 ? 
200 EC1 22 ASP A  157 ? ASP A 264 . ? 1_555 ? 
201 EC1 22 GLY A  158 ? GLY A 265 . ? 1_555 ? 
202 EC1 22 ALA A  185 ? ALA A 292 . ? 1_555 ? 
203 EC1 22 SER A  186 ? SER A 293 . ? 1_555 ? 
204 EC1 22 ASN A  188 ? ASN A 295 . ? 1_555 ? 
205 EC1 22 ASP A  199 ? ASP A 306 . ? 1_555 ? 
206 EC1 22 TYR A  201 ? TYR A 308 . ? 1_555 ? 
207 EC1 22 THR A  260 ? THR A 367 . ? 1_555 ? 
208 EC1 22 SER A  261 ? SER A 368 . ? 1_555 ? 
209 EC1 22 HOH CB .   ? HOH H 101 . ? 1_555 ? 
210 EC1 22 HOH CB .   ? HOH H 102 . ? 1_555 ? 
211 EC2 24 ASP B  47  ? ASP B 154 . ? 1_555 ? 
212 EC2 24 ASP B  84  ? ASP B 191 . ? 1_555 ? 
213 EC2 24 ASN B  85  ? ASN B 192 . ? 1_555 ? 
214 EC2 24 HIS B  87  ? HIS B 194 . ? 1_555 ? 
215 EC2 24 VAL B  124 ? VAL B 231 . ? 1_555 ? 
216 EC2 24 GLU B  129 ? GLU B 236 . ? 1_555 ? 
217 EC2 24 SER B  146 ? SER B 253 . ? 1_555 ? 
218 EC2 24 TRP B  147 ? TRP B 254 . ? 1_555 ? 
219 EC2 24 GLY B  148 ? GLY B 255 . ? 1_555 ? 
220 EC2 24 PRO B  149 ? PRO B 256 . ? 1_555 ? 
221 EC2 24 ASP B  151 ? ASP B 258 . ? 1_555 ? 
222 EC2 24 ASP B  157 ? ASP B 264 . ? 1_555 ? 
223 EC2 24 GLY B  158 ? GLY B 265 . ? 1_555 ? 
224 EC2 24 ALA B  185 ? ALA B 292 . ? 1_555 ? 
225 EC2 24 SER B  186 ? SER B 293 . ? 1_555 ? 
226 EC2 24 GLY B  187 ? GLY B 294 . ? 1_555 ? 
227 EC2 24 ASN B  188 ? ASN B 295 . ? 1_555 ? 
228 EC2 24 ASP B  199 ? ASP B 306 . ? 1_555 ? 
229 EC2 24 TYR B  201 ? TYR B 308 . ? 1_555 ? 
230 EC2 24 THR B  202 ? THR B 309 . ? 1_555 ? 
231 EC2 24 THR B  260 ? THR B 367 . ? 1_555 ? 
232 EC2 24 SER B  261 ? SER B 368 . ? 1_555 ? 
233 EC2 24 HOH DB .   ? HOH I 101 . ? 1_555 ? 
234 EC2 24 HOH DB .   ? HOH I 102 . ? 1_555 ? 
235 EC3 24 ASP C  47  ? ASP C 154 . ? 1_555 ? 
236 EC3 24 ASP C  84  ? ASP C 191 . ? 1_555 ? 
237 EC3 24 ASN C  85  ? ASN C 192 . ? 1_555 ? 
238 EC3 24 HIS C  87  ? HIS C 194 . ? 1_555 ? 
239 EC3 24 VAL C  124 ? VAL C 231 . ? 1_555 ? 
240 EC3 24 GLU C  129 ? GLU C 236 . ? 1_555 ? 
241 EC3 24 SER C  146 ? SER C 253 . ? 1_555 ? 
242 EC3 24 TRP C  147 ? TRP C 254 . ? 1_555 ? 
243 EC3 24 GLY C  148 ? GLY C 255 . ? 1_555 ? 
244 EC3 24 PRO C  149 ? PRO C 256 . ? 1_555 ? 
245 EC3 24 ASP C  151 ? ASP C 258 . ? 1_555 ? 
246 EC3 24 ASP C  157 ? ASP C 264 . ? 1_555 ? 
247 EC3 24 GLY C  158 ? GLY C 265 . ? 1_555 ? 
248 EC3 24 ALA C  185 ? ALA C 292 . ? 1_555 ? 
249 EC3 24 SER C  186 ? SER C 293 . ? 1_555 ? 
250 EC3 24 ASN C  188 ? ASN C 295 . ? 1_555 ? 
251 EC3 24 ASP C  199 ? ASP C 306 . ? 1_555 ? 
252 EC3 24 TYR C  201 ? TYR C 308 . ? 1_555 ? 
253 EC3 24 THR C  202 ? THR C 309 . ? 1_555 ? 
254 EC3 24 THR C  260 ? THR C 367 . ? 1_555 ? 
255 EC3 24 SER C  261 ? SER C 368 . ? 1_555 ? 
256 EC3 24 HOH EB .   ? HOH J 101 . ? 1_555 ? 
257 EC3 24 HOH EB .   ? HOH J 102 . ? 1_555 ? 
258 EC3 24 HOH EB .   ? HOH J 103 . ? 1_555 ? 
259 EC4 23 ASP D  47  ? ASP D 154 . ? 1_555 ? 
260 EC4 23 ASP D  84  ? ASP D 191 . ? 1_555 ? 
261 EC4 23 ASN D  85  ? ASN D 192 . ? 1_555 ? 
262 EC4 23 HIS D  87  ? HIS D 194 . ? 1_555 ? 
263 EC4 23 VAL D  124 ? VAL D 231 . ? 1_555 ? 
264 EC4 23 GLU D  129 ? GLU D 236 . ? 1_555 ? 
265 EC4 23 SER D  146 ? SER D 253 . ? 1_555 ? 
266 EC4 23 TRP D  147 ? TRP D 254 . ? 1_555 ? 
267 EC4 23 GLY D  148 ? GLY D 255 . ? 1_555 ? 
268 EC4 23 PRO D  149 ? PRO D 256 . ? 1_555 ? 
269 EC4 23 ASP D  151 ? ASP D 258 . ? 1_555 ? 
270 EC4 23 ASP D  157 ? ASP D 264 . ? 1_555 ? 
271 EC4 23 GLY D  158 ? GLY D 265 . ? 1_555 ? 
272 EC4 23 ALA D  185 ? ALA D 292 . ? 1_555 ? 
273 EC4 23 ASN D  188 ? ASN D 295 . ? 1_555 ? 
274 EC4 23 ASP D  199 ? ASP D 306 . ? 1_555 ? 
275 EC4 23 TYR D  201 ? TYR D 308 . ? 1_555 ? 
276 EC4 23 THR D  202 ? THR D 309 . ? 1_555 ? 
277 EC4 23 THR D  260 ? THR D 367 . ? 1_555 ? 
278 EC4 23 SER D  261 ? SER D 368 . ? 1_555 ? 
279 EC4 23 HOH ZA .   ? HOH D 799 . ? 1_555 ? 
280 EC4 23 HOH FB .   ? HOH K 101 . ? 1_555 ? 
281 EC4 23 HOH FB .   ? HOH K 102 . ? 1_555 ? 
282 EC5 23 ASP E  47  ? ASP E 154 . ? 1_555 ? 
283 EC5 23 ASP E  84  ? ASP E 191 . ? 1_555 ? 
284 EC5 23 ASN E  85  ? ASN E 192 . ? 1_555 ? 
285 EC5 23 HIS E  87  ? HIS E 194 . ? 1_555 ? 
286 EC5 23 VAL E  124 ? VAL E 231 . ? 1_555 ? 
287 EC5 23 GLU E  129 ? GLU E 236 . ? 1_555 ? 
288 EC5 23 SER E  146 ? SER E 253 . ? 1_555 ? 
289 EC5 23 TRP E  147 ? TRP E 254 . ? 1_555 ? 
290 EC5 23 GLY E  148 ? GLY E 255 . ? 1_555 ? 
291 EC5 23 PRO E  149 ? PRO E 256 . ? 1_555 ? 
292 EC5 23 ASP E  151 ? ASP E 258 . ? 1_555 ? 
293 EC5 23 ASP E  157 ? ASP E 264 . ? 1_555 ? 
294 EC5 23 GLY E  158 ? GLY E 265 . ? 1_555 ? 
295 EC5 23 ALA E  185 ? ALA E 292 . ? 1_555 ? 
296 EC5 23 ASN E  188 ? ASN E 295 . ? 1_555 ? 
297 EC5 23 ASP E  199 ? ASP E 306 . ? 1_555 ? 
298 EC5 23 TYR E  201 ? TYR E 308 . ? 1_555 ? 
299 EC5 23 THR E  202 ? THR E 309 . ? 1_555 ? 
300 EC5 23 THR E  260 ? THR E 367 . ? 1_555 ? 
301 EC5 23 SER E  261 ? SER E 368 . ? 1_555 ? 
302 EC5 23 HOH GB .   ? HOH L 101 . ? 1_555 ? 
303 EC5 23 HOH GB .   ? HOH L 102 . ? 1_555 ? 
304 EC5 23 HOH GB .   ? HOH L 103 . ? 1_555 ? 
305 EC6 26 ASP F  47  ? ASP F 154 . ? 1_555 ? 
306 EC6 26 ASP F  84  ? ASP F 191 . ? 1_555 ? 
307 EC6 26 ASN F  85  ? ASN F 192 . ? 1_555 ? 
308 EC6 26 HIS F  87  ? HIS F 194 . ? 1_555 ? 
309 EC6 26 VAL F  124 ? VAL F 231 . ? 1_555 ? 
310 EC6 26 GLU F  129 ? GLU F 236 . ? 1_555 ? 
311 EC6 26 SER F  146 ? SER F 253 . ? 1_555 ? 
312 EC6 26 TRP F  147 ? TRP F 254 . ? 1_555 ? 
313 EC6 26 GLY F  148 ? GLY F 255 . ? 1_555 ? 
314 EC6 26 PRO F  149 ? PRO F 256 . ? 1_555 ? 
315 EC6 26 ASP F  151 ? ASP F 258 . ? 1_555 ? 
316 EC6 26 ASP F  157 ? ASP F 264 . ? 1_555 ? 
317 EC6 26 GLY F  158 ? GLY F 265 . ? 1_555 ? 
318 EC6 26 ALA F  185 ? ALA F 292 . ? 1_555 ? 
319 EC6 26 SER F  186 ? SER F 293 . ? 1_555 ? 
320 EC6 26 GLY F  187 ? GLY F 294 . ? 1_555 ? 
321 EC6 26 ASN F  188 ? ASN F 295 . ? 1_555 ? 
322 EC6 26 ASP F  199 ? ASP F 306 . ? 1_555 ? 
323 EC6 26 TYR F  201 ? TYR F 308 . ? 1_555 ? 
324 EC6 26 THR F  202 ? THR F 309 . ? 1_555 ? 
325 EC6 26 THR F  260 ? THR F 367 . ? 1_555 ? 
326 EC6 26 SER F  261 ? SER F 368 . ? 1_555 ? 
327 EC6 26 HOH BB .   ? HOH F 704 . ? 1_555 ? 
328 EC6 26 HOH BB .   ? HOH F 770 . ? 1_555 ? 
329 EC6 26 HOH HB .   ? HOH N 101 . ? 1_555 ? 
330 EC6 26 HOH HB .   ? HOH N 102 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OMD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OMD 
_atom_sites.fract_transf_matrix[1][1]   0.007061 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006553 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005933 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . VAL A  1 2   ? -0.900  39.128  25.840  1.00   28.80 ? 109 VAL A N     1 
ATOM   2     C  CA    . VAL A  1 2   ? 0.019   39.962  26.665  1.00   30.25 ? 109 VAL A CA    1 
ATOM   3     C  C     . VAL A  1 2   ? 1.295   40.376  25.904  1.00   30.77 ? 109 VAL A C     1 
ATOM   4     O  O     . VAL A  1 2   ? 1.913   41.395  26.230  1.00   32.83 ? 109 VAL A O     1 
ATOM   5     C  CB    . VAL A  1 2   ? 0.413   39.215  27.956  1.00   31.19 ? 109 VAL A CB    1 
ATOM   6     C  CG1   . VAL A  1 2   ? 1.242   37.990  27.611  1.00   31.83 ? 109 VAL A CG1   1 
ATOM   7     C  CG2   . VAL A  1 2   ? 1.167   40.151  28.898  1.00   30.35 ? 109 VAL A CG2   1 
ATOM   8     N  N     . TYR A  1 3   ? 1.667   39.597  24.887  1.00   27.95 ? 110 TYR A N     1 
ATOM   9     C  CA    . TYR A  1 3   ? 2.857   39.858  24.070  1.00   25.13 ? 110 TYR A CA    1 
ATOM   10    C  C     . TYR A  1 3   ? 2.798   41.122  23.191  1.00   24.24 ? 110 TYR A C     1 
ATOM   11    O  O     . TYR A  1 3   ? 1.810   41.364  22.498  1.00   24.17 ? 110 TYR A O     1 
ATOM   12    C  CB    . TYR A  1 3   ? 3.126   38.648  23.169  1.00   22.29 ? 110 TYR A CB    1 
ATOM   13    C  CG    . TYR A  1 3   ? 4.211   38.875  22.138  1.00   23.76 ? 110 TYR A CG    1 
ATOM   14    C  CD1   . TYR A  1 3   ? 5.553   38.963  22.510  1.00   22.44 ? 110 TYR A CD1   1 
ATOM   15    C  CD2   . TYR A  1 3   ? 3.890   39.057  20.793  1.00   25.40 ? 110 TYR A CD2   1 
ATOM   16    C  CE1   . TYR A  1 3   ? 6.544   39.231  21.573  1.00   22.04 ? 110 TYR A CE1   1 
ATOM   17    C  CE2   . TYR A  1 3   ? 4.880   39.327  19.845  1.00   25.16 ? 110 TYR A CE2   1 
ATOM   18    C  CZ    . TYR A  1 3   ? 6.202   39.416  20.244  1.00   23.30 ? 110 TYR A CZ    1 
ATOM   19    O  OH    . TYR A  1 3   ? 7.181   39.704  19.321  1.00   23.54 ? 110 TYR A OH    1 
ATOM   20    N  N     . GLN A  1 4   ? 3.869   41.915  23.212  1.00   24.03 ? 111 GLN A N     1 
ATOM   21    C  CA    . GLN A  1 4   ? 3.949   43.128  22.397  1.00   24.81 ? 111 GLN A CA    1 
ATOM   22    C  C     . GLN A  1 4   ? 4.852   42.877  21.181  1.00   24.06 ? 111 GLN A C     1 
ATOM   23    O  O     . GLN A  1 4   ? 6.026   42.560  21.341  1.00   24.20 ? 111 GLN A O     1 
ATOM   24    C  CB    . GLN A  1 4   ? 4.532   44.305  23.197  1.00   27.37 ? 111 GLN A CB    1 
ATOM   25    C  CG    . GLN A  1 4   ? 3.816   44.661  24.491  1.00   31.75 ? 111 GLN A CG    1 
ATOM   26    C  CD    . GLN A  1 4   ? 2.317   44.760  24.322  1.00   35.65 ? 111 GLN A CD    1 
ATOM   27    O  OE1   . GLN A  1 4   ? 1.567   43.957  24.886  1.00   38.06 ? 111 GLN A OE1   1 
ATOM   28    N  NE2   . GLN A  1 4   ? 1.866   45.740  23.537  1.00   33.08 ? 111 GLN A NE2   1 
ATOM   29    N  N     . GLU A  1 5   ? 4.314   43.043  19.973  1.00   25.29 ? 112 GLU A N     1 
ATOM   30    C  CA    . GLU A  1 5   ? 5.072   42.821  18.739  1.00   23.84 ? 112 GLU A CA    1 
ATOM   31    C  C     . GLU A  1 5   ? 6.088   43.922  18.419  1.00   26.97 ? 112 GLU A C     1 
ATOM   32    O  O     . GLU A  1 5   ? 6.080   44.999  19.025  1.00   26.97 ? 112 GLU A O     1 
ATOM   33    C  CB    . GLU A  1 5   ? 4.114   42.655  17.557  1.00   22.67 ? 112 GLU A CB    1 
ATOM   34    C  CG    . GLU A  1 5   ? 3.393   43.929  17.126  1.00   20.63 ? 112 GLU A CG    1 
ATOM   35    C  CD    . GLU A  1 5   ? 2.424   43.693  15.968  1.00   21.92 ? 112 GLU A CD    1 
ATOM   36    O  OE1   . GLU A  1 5   ? 1.985   44.680  15.331  1.00   21.81 ? 112 GLU A OE1   1 
ATOM   37    O  OE2   . GLU A  1 5   ? 2.094   42.517  15.694  1.00   21.61 ? 112 GLU A OE2   1 
ATOM   38    N  N     . PRO A  1 6   ? 6.978   43.664  17.446  1.00   27.33 ? 113 PRO A N     1 
ATOM   39    C  CA    . PRO A  1 6   ? 8.005   44.630  17.048  1.00   27.19 ? 113 PRO A CA    1 
ATOM   40    C  C     . PRO A  1 6   ? 7.507   46.003  16.607  1.00   27.17 ? 113 PRO A C     1 
ATOM   41    O  O     . PRO A  1 6   ? 6.490   46.131  15.924  1.00   28.82 ? 113 PRO A O     1 
ATOM   42    C  CB    . PRO A  1 6   ? 8.752   43.892  15.942  1.00   28.00 ? 113 PRO A CB    1 
ATOM   43    C  CG    . PRO A  1 6   ? 8.715   42.485  16.434  1.00   27.01 ? 113 PRO A CG    1 
ATOM   44    C  CD    . PRO A  1 6   ? 7.269   42.338  16.873  1.00   27.70 ? 113 PRO A CD    1 
ATOM   45    N  N     . THR A  1 7   ? 8.253   47.028  17.001  1.00   24.60 ? 114 THR A N     1 
ATOM   46    C  CA    . THR A  1 7   ? 7.915   48.400  16.670  1.00   22.89 ? 114 THR A CA    1 
ATOM   47    C  C     . THR A  1 7   ? 8.820   48.929  15.561  1.00   23.30 ? 114 THR A C     1 
ATOM   48    O  O     . THR A  1 7   ? 8.721   50.098  15.183  1.00   22.97 ? 114 THR A O     1 
ATOM   49    C  CB    . THR A  1 7   ? 8.079   49.298  17.899  1.00   22.58 ? 114 THR A CB    1 
ATOM   50    O  OG1   . THR A  1 7   ? 9.431   49.218  18.365  1.00   25.12 ? 114 THR A OG1   1 
ATOM   51    C  CG2   . THR A  1 7   ? 7.163   48.842  19.010  1.00   19.21 ? 114 THR A CG2   1 
ATOM   52    N  N     . ASP A  1 8   ? 9.696   48.070  15.041  1.00   20.24 ? 115 ASP A N     1 
ATOM   53    C  CA    . ASP A  1 8   ? 10.622  48.485  13.995  1.00   19.63 ? 115 ASP A CA    1 
ATOM   54    C  C     . ASP A  1 8   ? 9.882   49.128  12.819  1.00   19.19 ? 115 ASP A C     1 
ATOM   55    O  O     . ASP A  1 8   ? 8.802   48.687  12.427  1.00   18.05 ? 115 ASP A O     1 
ATOM   56    C  CB    . ASP A  1 8   ? 11.465  47.291  13.538  1.00   20.51 ? 115 ASP A CB    1 
ATOM   57    C  CG    . ASP A  1 8   ? 12.234  46.635  14.690  1.00   19.35 ? 115 ASP A CG    1 
ATOM   58    O  OD1   . ASP A  1 8   ? 11.604  45.965  15.534  1.00   17.54 ? 115 ASP A OD1   1 
ATOM   59    O  OD2   . ASP A  1 8   ? 13.473  46.791  14.758  1.00   17.93 ? 115 ASP A OD2   1 
ATOM   60    N  N     . PRO A  1 9   ? 10.469  50.184  12.237  1.00   20.20 ? 116 PRO A N     1 
ATOM   61    C  CA    . PRO A  1 9   ? 9.831   50.874  11.117  1.00   20.11 ? 116 PRO A CA    1 
ATOM   62    C  C     . PRO A  1 9   ? 9.392   50.004  9.951   1.00   21.34 ? 116 PRO A C     1 
ATOM   63    O  O     . PRO A  1 9   ? 8.322   50.230  9.382   1.00   22.76 ? 116 PRO A O     1 
ATOM   64    C  CB    . PRO A  1 9   ? 10.872  51.931  10.723  1.00   16.83 ? 116 PRO A CB    1 
ATOM   65    C  CG    . PRO A  1 9   ? 12.184  51.312  11.142  1.00   16.71 ? 116 PRO A CG    1 
ATOM   66    C  CD    . PRO A  1 9   ? 11.826  50.712  12.480  1.00   19.14 ? 116 PRO A CD    1 
ATOM   67    N  N     . LYS A  1 10  ? 10.194  48.999  9.615   1.00   22.54 ? 117 LYS A N     1 
ATOM   68    C  CA    . LYS A  1 10  ? 9.890   48.133  8.479   1.00   24.00 ? 117 LYS A CA    1 
ATOM   69    C  C     . LYS A  1 10  ? 9.130   46.844  8.784   1.00   23.77 ? 117 LYS A C     1 
ATOM   70    O  O     . LYS A  1 10  ? 8.787   46.101  7.864   1.00   26.84 ? 117 LYS A O     1 
ATOM   71    C  CB    . LYS A  1 10  ? 11.187  47.793  7.728   1.00   25.38 ? 117 LYS A CB    1 
ATOM   72    C  CG    . LYS A  1 10  ? 11.877  48.994  7.095   1.00   25.43 ? 117 LYS A CG    1 
ATOM   73    C  CD    . LYS A  1 10  ? 10.978  49.618  6.056   1.00   31.23 ? 117 LYS A CD    1 
ATOM   74    C  CE    . LYS A  1 10  ? 11.671  50.738  5.311   1.00   34.43 ? 117 LYS A CE    1 
ATOM   75    N  NZ    . LYS A  1 10  ? 10.716  51.381  4.365   1.00   39.46 ? 117 LYS A NZ    1 
ATOM   76    N  N     . PHE A  1 11  ? 8.857   46.575  10.056  1.00   23.08 ? 118 PHE A N     1 
ATOM   77    C  CA    . PHE A  1 11  ? 8.140   45.356  10.422  1.00   20.93 ? 118 PHE A CA    1 
ATOM   78    C  C     . PHE A  1 11  ? 6.824   45.207  9.666   1.00   21.67 ? 118 PHE A C     1 
ATOM   79    O  O     . PHE A  1 11  ? 6.495   44.125  9.170   1.00   21.67 ? 118 PHE A O     1 
ATOM   80    C  CB    . PHE A  1 11  ? 7.855   45.326  11.921  1.00   19.45 ? 118 PHE A CB    1 
ATOM   81    C  CG    . PHE A  1 11  ? 7.107   44.103  12.364  1.00   19.91 ? 118 PHE A CG    1 
ATOM   82    C  CD1   . PHE A  1 11  ? 7.636   42.831  12.142  1.00   20.11 ? 118 PHE A CD1   1 
ATOM   83    C  CD2   . PHE A  1 11  ? 5.856   44.211  12.966  1.00   18.87 ? 118 PHE A CD2   1 
ATOM   84    C  CE1   . PHE A  1 11  ? 6.930   41.678  12.511  1.00   19.34 ? 118 PHE A CE1   1 
ATOM   85    C  CE2   . PHE A  1 11  ? 5.140   43.063  13.340  1.00   17.46 ? 118 PHE A CE2   1 
ATOM   86    C  CZ    . PHE A  1 11  ? 5.682   41.795  13.108  1.00   18.33 ? 118 PHE A CZ    1 
ATOM   87    N  N     . PRO A  1 12  ? 6.042   46.294  9.577   1.00   22.32 ? 119 PRO A N     1 
ATOM   88    C  CA    . PRO A  1 12  ? 4.762   46.230  8.863   1.00   20.94 ? 119 PRO A CA    1 
ATOM   89    C  C     . PRO A  1 12  ? 4.891   45.741  7.419   1.00   22.02 ? 119 PRO A C     1 
ATOM   90    O  O     . PRO A  1 12  ? 3.924   45.235  6.847   1.00   21.39 ? 119 PRO A O     1 
ATOM   91    C  CB    . PRO A  1 12  ? 4.256   47.665  8.949   1.00   18.80 ? 119 PRO A CB    1 
ATOM   92    C  CG    . PRO A  1 12  ? 4.765   48.101  10.284  1.00   17.56 ? 119 PRO A CG    1 
ATOM   93    C  CD    . PRO A  1 12  ? 6.194   47.593  10.257  1.00   19.81 ? 119 PRO A CD    1 
ATOM   94    N  N     . GLN A  1 13  ? 6.079   45.885  6.833   1.00   22.33 ? 120 GLN A N     1 
ATOM   95    C  CA    . GLN A  1 13  ? 6.296   45.457  5.458   1.00   24.16 ? 120 GLN A CA    1 
ATOM   96    C  C     . GLN A  1 13  ? 6.798   44.022  5.371   1.00   23.84 ? 120 GLN A C     1 
ATOM   97    O  O     . GLN A  1 13  ? 6.978   43.470  4.279   1.00   25.65 ? 120 GLN A O     1 
ATOM   98    C  CB    . GLN A  1 13  ? 7.257   46.416  4.740   1.00   26.45 ? 120 GLN A CB    1 
ATOM   99    C  CG    . GLN A  1 13  ? 6.613   47.759  4.389   1.00   33.27 ? 120 GLN A CG    1 
ATOM   100   C  CD    . GLN A  1 13  ? 6.855   48.820  5.447   1.00   40.63 ? 120 GLN A CD    1 
ATOM   101   O  OE1   . GLN A  1 13  ? 7.931   49.419  5.499   1.00   47.72 ? 120 GLN A OE1   1 
ATOM   102   N  NE2   . GLN A  1 13  ? 5.861   49.052  6.306   1.00   39.71 ? 120 GLN A NE2   1 
ATOM   103   N  N     . GLN A  1 14  ? 7.010   43.407  6.524   1.00   20.93 ? 121 GLN A N     1 
ATOM   104   C  CA    . GLN A  1 14  ? 7.477   42.034  6.546   1.00   21.36 ? 121 GLN A CA    1 
ATOM   105   C  C     . GLN A  1 14  ? 6.268   41.107  6.572   1.00   21.31 ? 121 GLN A C     1 
ATOM   106   O  O     . GLN A  1 14  ? 6.040   40.355  7.527   1.00   19.71 ? 121 GLN A O     1 
ATOM   107   C  CB    . GLN A  1 14  ? 8.392   41.816  7.752   1.00   19.85 ? 121 GLN A CB    1 
ATOM   108   C  CG    . GLN A  1 14  ? 9.591   42.737  7.708   1.00   21.63 ? 121 GLN A CG    1 
ATOM   109   C  CD    . GLN A  1 14  ? 10.633  42.423  8.754   1.00   23.97 ? 121 GLN A CD    1 
ATOM   110   O  OE1   . GLN A  1 14  ? 10.430  42.648  9.946   1.00   23.78 ? 121 GLN A OE1   1 
ATOM   111   N  NE2   . GLN A  1 14  ? 11.770  41.895  8.307   1.00   25.67 ? 121 GLN A NE2   1 
ATOM   112   N  N     . TRP A  1 15  ? 5.502   41.180  5.488   1.00   21.43 ? 122 TRP A N     1 
ATOM   113   C  CA    . TRP A  1 15  ? 4.282   40.396  5.295   1.00   20.36 ? 122 TRP A CA    1 
ATOM   114   C  C     . TRP A  1 15  ? 4.402   38.912  5.592   1.00   20.87 ? 122 TRP A C     1 
ATOM   115   O  O     . TRP A  1 15  ? 3.453   38.305  6.064   1.00   22.96 ? 122 TRP A O     1 
ATOM   116   C  CB    . TRP A  1 15  ? 3.795   40.558  3.860   1.00   18.42 ? 122 TRP A CB    1 
ATOM   117   C  CG    . TRP A  1 15  ? 4.825   40.200  2.861   1.00   17.64 ? 122 TRP A CG    1 
ATOM   118   C  CD1   . TRP A  1 15  ? 5.835   40.996  2.401   1.00   17.21 ? 122 TRP A CD1   1 
ATOM   119   C  CD2   . TRP A  1 15  ? 4.967   38.940  2.202   1.00   19.36 ? 122 TRP A CD2   1 
ATOM   120   N  NE1   . TRP A  1 15  ? 6.599   40.310  1.484   1.00   18.59 ? 122 TRP A NE1   1 
ATOM   121   C  CE2   . TRP A  1 15  ? 6.090   39.042  1.342   1.00   21.01 ? 122 TRP A CE2   1 
ATOM   122   C  CE3   . TRP A  1 15  ? 4.257   37.730  2.252   1.00   15.75 ? 122 TRP A CE3   1 
ATOM   123   C  CZ2   . TRP A  1 15  ? 6.521   37.977  0.534   1.00   19.00 ? 122 TRP A CZ2   1 
ATOM   124   C  CZ3   . TRP A  1 15  ? 4.682   36.673  1.451   1.00   20.02 ? 122 TRP A CZ3   1 
ATOM   125   C  CH2   . TRP A  1 15  ? 5.807   36.805  0.602   1.00   19.92 ? 122 TRP A CH2   1 
ATOM   126   N  N     . TYR A  1 16  ? 5.562   38.332  5.299   1.00   22.20 ? 123 TYR A N     1 
ATOM   127   C  CA    . TYR A  1 16  ? 5.804   36.909  5.512   1.00   21.13 ? 123 TYR A CA    1 
ATOM   128   C  C     . TYR A  1 16  ? 5.908   36.484  6.979   1.00   23.08 ? 123 TYR A C     1 
ATOM   129   O  O     . TYR A  1 16  ? 5.706   35.309  7.301   1.00   24.47 ? 123 TYR A O     1 
ATOM   130   C  CB    . TYR A  1 16  ? 7.077   36.489  4.773   1.00   20.09 ? 123 TYR A CB    1 
ATOM   131   C  CG    . TYR A  1 16  ? 8.226   37.456  4.963   1.00   21.78 ? 123 TYR A CG    1 
ATOM   132   C  CD1   . TYR A  1 16  ? 8.325   38.618  4.190   1.00   21.57 ? 123 TYR A CD1   1 
ATOM   133   C  CD2   . TYR A  1 16  ? 9.194   37.239  5.952   1.00   22.54 ? 123 TYR A CD2   1 
ATOM   134   C  CE1   . TYR A  1 16  ? 9.364   39.545  4.401   1.00   22.15 ? 123 TYR A CE1   1 
ATOM   135   C  CE2   . TYR A  1 16  ? 10.232  38.158  6.171   1.00   21.29 ? 123 TYR A CE2   1 
ATOM   136   C  CZ    . TYR A  1 16  ? 10.308  39.307  5.392   1.00   22.54 ? 123 TYR A CZ    1 
ATOM   137   O  OH    . TYR A  1 16  ? 11.317  40.222  5.604   1.00   24.44 ? 123 TYR A OH    1 
ATOM   138   N  N     . LEU A  1 17  ? 6.227   37.423  7.867   1.00   23.00 ? 124 LEU A N     1 
ATOM   139   C  CA    . LEU A  1 17  ? 6.350   37.104  9.288   1.00   23.27 ? 124 LEU A CA    1 
ATOM   140   C  C     . LEU A  1 17  ? 4.999   37.112  9.985   1.00   26.13 ? 124 LEU A C     1 
ATOM   141   O  O     . LEU A  1 17  ? 4.668   36.194  10.741  1.00   23.67 ? 124 LEU A O     1 
ATOM   142   C  CB    . LEU A  1 17  ? 7.268   38.106  9.985   1.00   21.92 ? 124 LEU A CB    1 
ATOM   143   C  CG    . LEU A  1 17  ? 8.725   38.072  9.537   1.00   23.50 ? 124 LEU A CG    1 
ATOM   144   C  CD1   . LEU A  1 17  ? 9.516   39.122  10.303  1.00   21.90 ? 124 LEU A CD1   1 
ATOM   145   C  CD2   . LEU A  1 17  ? 9.292   36.673  9.771   1.00   23.92 ? 124 LEU A CD2   1 
ATOM   146   N  N     . SER A  1 18  ? 4.221   38.157  9.723   1.00   30.34 ? 125 SER A N     1 
ATOM   147   C  CA    . SER A  1 18  ? 2.915   38.314  10.339  1.00   33.91 ? 125 SER A CA    1 
ATOM   148   C  C     . SER A  1 18  ? 2.022   39.124  9.409   1.00   36.91 ? 125 SER A C     1 
ATOM   149   O  O     . SER A  1 18  ? 2.448   40.150  8.865   1.00   38.83 ? 125 SER A O     1 
ATOM   150   C  CB    . SER A  1 18  ? 3.083   39.035  11.676  1.00   33.32 ? 125 SER A CB    1 
ATOM   151   O  OG    . SER A  1 18  ? 1.948   38.894  12.502  1.00   39.05 ? 125 SER A OG    1 
ATOM   152   N  N     . GLY A  1 19  ? 0.788   38.665  9.227   1.00   39.07 ? 126 GLY A N     1 
ATOM   153   C  CA    . GLY A  1 19  ? -0.126  39.377  8.352   1.00   44.41 ? 126 GLY A CA    1 
ATOM   154   C  C     . GLY A  1 19  ? -1.587  39.017  8.577   1.00   47.77 ? 126 GLY A C     1 
ATOM   155   O  O     . GLY A  1 19  ? -1.914  37.865  8.917   1.00   48.80 ? 126 GLY A O     1 
ATOM   156   N  N     . VAL A  1 20  ? -2.466  40.003  8.390   1.00   49.66 ? 127 VAL A N     1 
ATOM   157   C  CA    . VAL A  1 20  ? -3.898  39.793  8.555   1.00   49.98 ? 127 VAL A CA    1 
ATOM   158   C  C     . VAL A  1 20  ? -4.325  38.662  7.612   1.00   50.80 ? 127 VAL A C     1 
ATOM   159   O  O     . VAL A  1 20  ? -5.027  37.729  8.026   1.00   51.25 ? 127 VAL A O     1 
ATOM   160   C  CB    . VAL A  1 20  ? -4.700  41.085  8.220   1.00   48.30 ? 127 VAL A CB    1 
ATOM   161   C  CG1   . VAL A  1 20  ? -4.387  42.173  9.240   0.0000 48.05 ? 127 VAL A CG1   1 
ATOM   162   C  CG2   . VAL A  1 20  ? -4.352  41.565  6.822   0.0000 48.05 ? 127 VAL A CG2   1 
ATOM   163   N  N     . THR A  1 21  ? -3.860  38.749  6.362   1.00   50.54 ? 128 THR A N     1 
ATOM   164   C  CA    . THR A  1 21  ? -4.169  37.793  5.302   1.00   49.39 ? 128 THR A CA    1 
ATOM   165   C  C     . THR A  1 21  ? -3.964  36.314  5.640   1.00   50.66 ? 128 THR A C     1 
ATOM   166   O  O     . THR A  1 21  ? -4.245  35.450  4.796   1.00   52.15 ? 128 THR A O     1 
ATOM   167   C  CB    . THR A  1 21  ? -3.366  38.112  4.027   1.00   48.24 ? 128 THR A CB    1 
ATOM   168   O  OG1   . THR A  1 21  ? -3.718  37.183  2.994   0.0000 47.80 ? 128 THR A OG1   1 
ATOM   169   C  CG2   . THR A  1 21  ? -1.877  38.017  4.302   0.0000 47.80 ? 128 THR A CG2   1 
ATOM   170   N  N     . GLN A  1 22  ? -3.468  36.018  6.845   1.00   49.55 ? 129 GLN A N     1 
ATOM   171   C  CA    . GLN A  1 22  ? -3.258  34.630  7.277   1.00   48.94 ? 129 GLN A CA    1 
ATOM   172   C  C     . GLN A  1 22  ? -2.434  33.803  6.268   1.00   49.55 ? 129 GLN A C     1 
ATOM   173   O  O     . GLN A  1 22  ? -2.466  32.559  6.283   1.00   50.51 ? 129 GLN A O     1 
ATOM   174   C  CB    . GLN A  1 22  ? -4.615  33.949  7.515   1.00   46.19 ? 129 GLN A CB    1 
ATOM   175   C  CG    . GLN A  1 22  ? -4.553  32.644  8.290   0.0000 41.14 ? 129 GLN A CG    1 
ATOM   176   C  CD    . GLN A  1 22  ? -4.231  32.849  9.756   0.0000 38.78 ? 129 GLN A CD    1 
ATOM   177   O  OE1   . GLN A  1 22  ? -4.113  31.887  10.514  0.0000 37.21 ? 129 GLN A OE1   1 
ATOM   178   N  NE2   . GLN A  1 22  ? -4.091  34.105  10.165  0.0000 37.21 ? 129 GLN A NE2   1 
ATOM   179   N  N     . ARG A  1 23  ? -1.706  34.502  5.394   1.00   47.36 ? 130 ARG A N     1 
ATOM   180   C  CA    . ARG A  1 23  ? -0.850  33.865  4.395   1.00   41.89 ? 130 ARG A CA    1 
ATOM   181   C  C     . ARG A  1 23  ? 0.589   34.267  4.760   1.00   40.45 ? 130 ARG A C     1 
ATOM   182   O  O     . ARG A  1 23  ? 1.218   35.078  4.062   1.00   39.18 ? 130 ARG A O     1 
ATOM   183   C  CB    . ARG A  1 23  ? -1.196  34.373  2.991   1.00   40.90 ? 130 ARG A CB    1 
ATOM   184   C  CG    . ARG A  1 23  ? -2.634  34.100  2.530   1.00   36.52 ? 130 ARG A CG    1 
ATOM   185   C  CD    . ARG A  1 23  ? -2.944  32.624  2.399   0.0000 33.81 ? 130 ARG A CD    1 
ATOM   186   N  NE    . ARG A  1 23  ? -4.233  32.404  1.745   0.0000 30.67 ? 130 ARG A NE    1 
ATOM   187   C  CZ    . ARG A  1 23  ? -5.398  32.847  2.209   0.0000 29.09 ? 130 ARG A CZ    1 
ATOM   188   N  NH1   . ARG A  1 23  ? -5.448  33.539  3.339   0.0000 27.98 ? 130 ARG A NH1   1 
ATOM   189   N  NH2   . ARG A  1 23  ? -6.516  32.597  1.543   0.0000 27.98 ? 130 ARG A NH2   1 
ATOM   190   N  N     . ASP A  1 24  ? 1.089   33.707  5.864   1.00   36.24 ? 131 ASP A N     1 
ATOM   191   C  CA    . ASP A  1 24  ? 2.431   34.003  6.363   1.00   31.83 ? 131 ASP A CA    1 
ATOM   192   C  C     . ASP A  1 24  ? 3.068   32.774  7.018   1.00   28.48 ? 131 ASP A C     1 
ATOM   193   O  O     . ASP A  1 24  ? 2.480   31.695  7.026   1.00   25.50 ? 131 ASP A O     1 
ATOM   194   C  CB    . ASP A  1 24  ? 2.353   35.138  7.373   1.00   32.19 ? 131 ASP A CB    1 
ATOM   195   C  CG    . ASP A  1 24  ? 1.402   34.829  8.504   1.00   36.77 ? 131 ASP A CG    1 
ATOM   196   O  OD1   . ASP A  1 24  ? 1.687   33.881  9.271   1.00   40.70 ? 131 ASP A OD1   1 
ATOM   197   O  OD2   . ASP A  1 24  ? 0.365   35.517  8.618   1.00   39.98 ? 131 ASP A OD2   1 
ATOM   198   N  N     . LEU A  1 25  ? 4.265   32.942  7.574   1.00   24.95 ? 132 LEU A N     1 
ATOM   199   C  CA    . LEU A  1 25  ? 4.974   31.831  8.209   1.00   21.81 ? 132 LEU A CA    1 
ATOM   200   C  C     . LEU A  1 25  ? 4.580   31.623  9.673   1.00   20.48 ? 132 LEU A C     1 
ATOM   201   O  O     . LEU A  1 25  ? 5.172   30.812  10.384  1.00   20.50 ? 132 LEU A O     1 
ATOM   202   C  CB    . LEU A  1 25  ? 6.483   32.040  8.073   1.00   21.06 ? 132 LEU A CB    1 
ATOM   203   C  CG    . LEU A  1 25  ? 6.951   32.086  6.615   1.00   18.46 ? 132 LEU A CG    1 
ATOM   204   C  CD1   . LEU A  1 25  ? 8.421   32.375  6.551   1.00   19.36 ? 132 LEU A CD1   1 
ATOM   205   C  CD2   . LEU A  1 25  ? 6.653   30.770  5.933   1.00   19.36 ? 132 LEU A CD2   1 
ATOM   206   N  N     . ASN A  1 26  ? 3.564   32.358  10.110  1.00   18.45 ? 133 ASN A N     1 
ATOM   207   C  CA    . ASN A  1 26  ? 3.053   32.252  11.468  1.00   17.02 ? 133 ASN A CA    1 
ATOM   208   C  C     . ASN A  1 26  ? 4.148   32.359  12.535  1.00   18.42 ? 133 ASN A C     1 
ATOM   209   O  O     . ASN A  1 26  ? 4.184   31.592  13.503  1.00   16.25 ? 133 ASN A O     1 
ATOM   210   C  CB    . ASN A  1 26  ? 2.293   30.939  11.614  1.00   14.89 ? 133 ASN A CB    1 
ATOM   211   C  CG    . ASN A  1 26  ? 1.391   30.934  12.819  1.00   16.48 ? 133 ASN A CG    1 
ATOM   212   O  OD1   . ASN A  1 26  ? 0.842   31.968  13.195  1.00   15.50 ? 133 ASN A OD1   1 
ATOM   213   N  ND2   . ASN A  1 26  ? 1.218   29.764  13.430  1.00   14.83 ? 133 ASN A ND2   1 
ATOM   214   N  N     . VAL A  1 27  ? 5.029   33.337  12.356  1.00   17.67 ? 134 VAL A N     1 
ATOM   215   C  CA    . VAL A  1 27  ? 6.135   33.561  13.274  1.00   16.85 ? 134 VAL A CA    1 
ATOM   216   C  C     . VAL A  1 27  ? 5.706   34.285  14.542  1.00   17.63 ? 134 VAL A C     1 
ATOM   217   O  O     . VAL A  1 27  ? 6.204   33.990  15.627  1.00   17.93 ? 134 VAL A O     1 
ATOM   218   C  CB    . VAL A  1 27  ? 7.252   34.374  12.585  1.00   18.12 ? 134 VAL A CB    1 
ATOM   219   C  CG1   . VAL A  1 27  ? 8.374   34.679  13.574  1.00   14.26 ? 134 VAL A CG1   1 
ATOM   220   C  CG2   . VAL A  1 27  ? 7.781   33.600  11.389  1.00   15.22 ? 134 VAL A CG2   1 
ATOM   221   N  N     . LYS A  1 28  ? 4.787   35.235  14.411  1.00   17.44 ? 135 LYS A N     1 
ATOM   222   C  CA    . LYS A  1 28  ? 4.324   35.972  15.577  1.00   16.94 ? 135 LYS A CA    1 
ATOM   223   C  C     . LYS A  1 28  ? 3.738   35.008  16.606  1.00   16.68 ? 135 LYS A C     1 
ATOM   224   O  O     . LYS A  1 28  ? 3.910   35.199  17.806  1.00   14.89 ? 135 LYS A O     1 
ATOM   225   C  CB    . LYS A  1 28  ? 3.280   37.016  15.169  1.00   18.62 ? 135 LYS A CB    1 
ATOM   226   C  CG    . LYS A  1 28  ? 2.855   37.910  16.324  1.00   19.87 ? 135 LYS A CG    1 
ATOM   227   C  CD    . LYS A  1 28  ? 1.815   38.922  15.919  1.00   21.92 ? 135 LYS A CD    1 
ATOM   228   C  CE    . LYS A  1 28  ? 1.375   39.717  17.134  1.00   24.03 ? 135 LYS A CE    1 
ATOM   229   N  NZ    . LYS A  1 28  ? 0.366   40.758  16.806  1.00   26.57 ? 135 LYS A NZ    1 
ATOM   230   N  N     . ALA A  1 29  ? 3.057   33.970  16.123  1.00   18.20 ? 136 ALA A N     1 
ATOM   231   C  CA    . ALA A  1 29  ? 2.449   32.969  16.992  1.00   19.45 ? 136 ALA A CA    1 
ATOM   232   C  C     . ALA A  1 29  ? 3.520   32.311  17.867  1.00   21.74 ? 136 ALA A C     1 
ATOM   233   O  O     . ALA A  1 29  ? 3.272   31.976  19.027  1.00   23.72 ? 136 ALA A O     1 
ATOM   234   C  CB    . ALA A  1 29  ? 1.720   31.918  16.144  1.00   16.79 ? 136 ALA A CB    1 
ATOM   235   N  N     . ALA A  1 30  ? 4.714   32.137  17.308  1.00   21.10 ? 137 ALA A N     1 
ATOM   236   C  CA    . ALA A  1 30  ? 5.814   31.535  18.047  1.00   22.18 ? 137 ALA A CA    1 
ATOM   237   C  C     . ALA A  1 30  ? 6.375   32.534  19.063  1.00   22.96 ? 137 ALA A C     1 
ATOM   238   O  O     . ALA A  1 30  ? 6.703   32.165  20.198  1.00   24.07 ? 137 ALA A O     1 
ATOM   239   C  CB    . ALA A  1 30  ? 6.908   31.084  17.087  1.00   21.30 ? 137 ALA A CB    1 
ATOM   240   N  N     . TRP A  1 31  ? 6.500   33.795  18.659  1.00   20.98 ? 138 TRP A N     1 
ATOM   241   C  CA    . TRP A  1 31  ? 6.997   34.810  19.575  1.00   21.57 ? 138 TRP A CA    1 
ATOM   242   C  C     . TRP A  1 31  ? 6.065   34.893  20.784  1.00   23.05 ? 138 TRP A C     1 
ATOM   243   O  O     . TRP A  1 31  ? 6.520   34.979  21.927  1.00   23.54 ? 138 TRP A O     1 
ATOM   244   C  CB    . TRP A  1 31  ? 7.032   36.183  18.914  1.00   19.93 ? 138 TRP A CB    1 
ATOM   245   C  CG    . TRP A  1 31  ? 7.976   36.334  17.778  1.00   15.76 ? 138 TRP A CG    1 
ATOM   246   C  CD1   . TRP A  1 31  ? 9.136   35.638  17.563  1.00   14.32 ? 138 TRP A CD1   1 
ATOM   247   C  CD2   . TRP A  1 31  ? 7.902   37.323  16.742  1.00   14.27 ? 138 TRP A CD2   1 
ATOM   248   N  NE1   . TRP A  1 31  ? 9.790   36.142  16.460  1.00   11.59 ? 138 TRP A NE1   1 
ATOM   249   C  CE2   . TRP A  1 31  ? 9.055   37.176  15.938  1.00   11.59 ? 138 TRP A CE2   1 
ATOM   250   C  CE3   . TRP A  1 31  ? 6.972   38.323  16.417  1.00   10.78 ? 138 TRP A CE3   1 
ATOM   251   C  CZ2   . TRP A  1 31  ? 9.303   37.992  14.829  1.00   8.32  ? 138 TRP A CZ2   1 
ATOM   252   C  CZ3   . TRP A  1 31  ? 7.221   39.139  15.309  1.00   8.17  ? 138 TRP A CZ3   1 
ATOM   253   C  CH2   . TRP A  1 31  ? 8.378   38.964  14.532  1.00   9.37  ? 138 TRP A CH2   1 
ATOM   254   N  N     . ALA A  1 32  ? 4.761   34.882  20.513  1.00   23.33 ? 139 ALA A N     1 
ATOM   255   C  CA    . ALA A  1 32  ? 3.747   34.949  21.556  1.00   22.58 ? 139 ALA A CA    1 
ATOM   256   C  C     . ALA A  1 32  ? 3.900   33.795  22.543  1.00   23.40 ? 139 ALA A C     1 
ATOM   257   O  O     . ALA A  1 32  ? 3.635   33.967  23.733  1.00   25.44 ? 139 ALA A O     1 
ATOM   258   C  CB    . ALA A  1 32  ? 2.363   34.933  20.941  1.00   19.97 ? 139 ALA A CB    1 
ATOM   259   N  N     . GLN A  1 33  ? 4.317   32.624  22.058  1.00   21.67 ? 140 GLN A N     1 
ATOM   260   C  CA    . GLN A  1 33  ? 4.523   31.476  22.939  1.00   21.19 ? 140 GLN A CA    1 
ATOM   261   C  C     . GLN A  1 33  ? 5.807   31.659  23.749  1.00   22.16 ? 140 GLN A C     1 
ATOM   262   O  O     . GLN A  1 33  ? 6.161   30.817  24.573  1.00   22.83 ? 140 GLN A O     1 
ATOM   263   C  CB    . GLN A  1 33  ? 4.593   30.185  22.126  1.00   20.89 ? 140 GLN A CB    1 
ATOM   264   C  CG    . GLN A  1 33  ? 3.284   29.835  21.422  1.00   19.56 ? 140 GLN A CG    1 
ATOM   265   C  CD    . GLN A  1 33  ? 3.351   28.535  20.623  1.00   21.20 ? 140 GLN A CD    1 
ATOM   266   O  OE1   . GLN A  1 33  ? 3.642   27.461  21.165  1.00   25.95 ? 140 GLN A OE1   1 
ATOM   267   N  NE2   . GLN A  1 33  ? 3.077   28.628  19.331  1.00   19.61 ? 140 GLN A NE2   1 
ATOM   268   N  N     . GLY A  1 34  ? 6.507   32.763  23.493  1.00   23.85 ? 141 GLY A N     1 
ATOM   269   C  CA    . GLY A  1 34  ? 7.727   33.067  24.218  1.00   24.07 ? 141 GLY A CA    1 
ATOM   270   C  C     . GLY A  1 34  ? 9.045   32.661  23.578  1.00   23.35 ? 141 GLY A C     1 
ATOM   271   O  O     . GLY A  1 34  ? 10.076  32.585  24.259  1.00   23.69 ? 141 GLY A O     1 
ATOM   272   N  N     . TYR A  1 35  ? 9.044   32.412  22.276  1.00   21.52 ? 142 TYR A N     1 
ATOM   273   C  CA    . TYR A  1 35  ? 10.284  32.005  21.624  1.00   21.84 ? 142 TYR A CA    1 
ATOM   274   C  C     . TYR A  1 35  ? 10.797  33.016  20.621  1.00   22.15 ? 142 TYR A C     1 
ATOM   275   O  O     . TYR A  1 35  ? 10.095  33.381  19.680  1.00   23.21 ? 142 TYR A O     1 
ATOM   276   C  CB    . TYR A  1 35  ? 10.086  30.653  20.949  1.00   20.01 ? 142 TYR A CB    1 
ATOM   277   C  CG    . TYR A  1 35  ? 9.658   29.601  21.924  1.00   17.82 ? 142 TYR A CG    1 
ATOM   278   C  CD1   . TYR A  1 35  ? 10.500  29.209  22.961  1.00   17.27 ? 142 TYR A CD1   1 
ATOM   279   C  CD2   . TYR A  1 35  ? 8.381   29.060  21.868  1.00   20.34 ? 142 TYR A CD2   1 
ATOM   280   C  CE1   . TYR A  1 35  ? 10.083  28.319  23.917  1.00   17.77 ? 142 TYR A CE1   1 
ATOM   281   C  CE2   . TYR A  1 35  ? 7.952   28.162  22.826  1.00   21.53 ? 142 TYR A CE2   1 
ATOM   282   C  CZ    . TYR A  1 35  ? 8.810   27.798  23.848  1.00   19.81 ? 142 TYR A CZ    1 
ATOM   283   O  OH    . TYR A  1 35  ? 8.400   26.911  24.806  1.00   26.20 ? 142 TYR A OH    1 
ATOM   284   N  N     . THR A  1 36  ? 12.034  33.464  20.826  1.00   23.18 ? 143 THR A N     1 
ATOM   285   C  CA    . THR A  1 36  ? 12.645  34.460  19.950  1.00   23.40 ? 143 THR A CA    1 
ATOM   286   C  C     . THR A  1 36  ? 14.068  34.105  19.545  1.00   23.22 ? 143 THR A C     1 
ATOM   287   O  O     . THR A  1 36  ? 14.773  34.917  18.938  1.00   22.20 ? 143 THR A O     1 
ATOM   288   C  CB    . THR A  1 36  ? 12.678  35.831  20.624  1.00   21.89 ? 143 THR A CB    1 
ATOM   289   O  OG1   . THR A  1 36  ? 13.398  35.722  21.855  1.00   25.45 ? 143 THR A OG1   1 
ATOM   290   C  CG2   . THR A  1 36  ? 11.276  36.332  20.887  1.00   22.62 ? 143 THR A CG2   1 
ATOM   291   N  N     . GLY A  1 37  ? 14.490  32.896  19.898  1.00   23.28 ? 144 GLY A N     1 
ATOM   292   C  CA    . GLY A  1 37  ? 15.823  32.443  19.544  1.00   23.04 ? 144 GLY A CA    1 
ATOM   293   C  C     . GLY A  1 37  ? 16.883  32.665  20.606  1.00   24.32 ? 144 GLY A C     1 
ATOM   294   O  O     . GLY A  1 37  ? 18.073  32.436  20.358  1.00   24.20 ? 144 GLY A O     1 
ATOM   295   N  N     . HIS A  1 38  ? 16.465  33.104  21.789  1.00   22.56 ? 145 HIS A N     1 
ATOM   296   C  CA    . HIS A  1 38  ? 17.420  33.350  22.847  1.00   22.55 ? 145 HIS A CA    1 
ATOM   297   C  C     . HIS A  1 38  ? 18.271  32.114  23.091  1.00   21.43 ? 145 HIS A C     1 
ATOM   298   O  O     . HIS A  1 38  ? 17.752  31.006  23.174  1.00   20.58 ? 145 HIS A O     1 
ATOM   299   C  CB    . HIS A  1 38  ? 16.722  33.723  24.147  1.00   25.78 ? 145 HIS A CB    1 
ATOM   300   C  CG    . HIS A  1 38  ? 17.669  33.874  25.292  1.00   30.47 ? 145 HIS A CG    1 
ATOM   301   N  ND1   . HIS A  1 38  ? 18.342  35.052  25.544  1.00   34.67 ? 145 HIS A ND1   1 
ATOM   302   C  CD2   . HIS A  1 38  ? 18.156  32.966  26.174  1.00   28.11 ? 145 HIS A CD2   1 
ATOM   303   C  CE1   . HIS A  1 38  ? 19.204  34.863  26.528  1.00   36.03 ? 145 HIS A CE1   1 
ATOM   304   N  NE2   . HIS A  1 38  ? 19.112  33.604  26.926  1.00   32.07 ? 145 HIS A NE2   1 
ATOM   305   N  N     . GLY A  1 39  ? 19.580  32.305  23.198  1.00   21.48 ? 146 GLY A N     1 
ATOM   306   C  CA    . GLY A  1 39  ? 20.467  31.185  23.463  1.00   19.63 ? 146 GLY A CA    1 
ATOM   307   C  C     . GLY A  1 39  ? 20.873  30.318  22.284  1.00   21.24 ? 146 GLY A C     1 
ATOM   308   O  O     . GLY A  1 39  ? 21.650  29.377  22.449  1.00   20.83 ? 146 GLY A O     1 
ATOM   309   N  N     . ILE A  1 40  ? 20.356  30.616  21.095  1.00   20.82 ? 147 ILE A N     1 
ATOM   310   C  CA    . ILE A  1 40  ? 20.687  29.829  19.910  1.00   19.29 ? 147 ILE A CA    1 
ATOM   311   C  C     . ILE A  1 40  ? 21.674  30.563  19.014  1.00   17.20 ? 147 ILE A C     1 
ATOM   312   O  O     . ILE A  1 40  ? 21.566  31.764  18.820  1.00   19.73 ? 147 ILE A O     1 
ATOM   313   C  CB    . ILE A  1 40  ? 19.422  29.486  19.085  1.00   20.09 ? 147 ILE A CB    1 
ATOM   314   C  CG1   . ILE A  1 40  ? 18.399  28.776  19.971  1.00   17.19 ? 147 ILE A CG1   1 
ATOM   315   C  CG2   . ILE A  1 40  ? 19.805  28.588  17.901  1.00   16.87 ? 147 ILE A CG2   1 
ATOM   316   C  CD1   . ILE A  1 40  ? 18.904  27.474  20.558  1.00   16.20 ? 147 ILE A CD1   1 
ATOM   317   N  N     . VAL A  1 41  ? 22.631  29.827  18.465  1.00   17.06 ? 148 VAL A N     1 
ATOM   318   C  CA    . VAL A  1 41  ? 23.652  30.410  17.604  1.00   17.00 ? 148 VAL A CA    1 
ATOM   319   C  C     . VAL A  1 41  ? 23.476  29.963  16.157  1.00   16.34 ? 148 VAL A C     1 
ATOM   320   O  O     . VAL A  1 41  ? 23.452  28.773  15.873  1.00   16.08 ? 148 VAL A O     1 
ATOM   321   C  CB    . VAL A  1 41  ? 25.079  30.007  18.075  1.00   18.02 ? 148 VAL A CB    1 
ATOM   322   C  CG1   . VAL A  1 41  ? 26.130  30.659  17.181  1.00   15.73 ? 148 VAL A CG1   1 
ATOM   323   C  CG2   . VAL A  1 41  ? 25.293  30.416  19.519  1.00   13.52 ? 148 VAL A CG2   1 
ATOM   324   N  N     . VAL A  1 42  ? 23.358  30.925  15.250  1.00   15.21 ? 149 VAL A N     1 
ATOM   325   C  CA    . VAL A  1 42  ? 23.189  30.642  13.829  1.00   14.84 ? 149 VAL A CA    1 
ATOM   326   C  C     . VAL A  1 42  ? 24.318  31.286  13.048  1.00   17.65 ? 149 VAL A C     1 
ATOM   327   O  O     . VAL A  1 42  ? 24.675  32.444  13.294  1.00   18.25 ? 149 VAL A O     1 
ATOM   328   C  CB    . VAL A  1 42  ? 21.870  31.226  13.282  1.00   14.23 ? 149 VAL A CB    1 
ATOM   329   C  CG1   . VAL A  1 42  ? 21.790  31.010  11.781  1.00   10.56 ? 149 VAL A CG1   1 
ATOM   330   C  CG2   . VAL A  1 42  ? 20.693  30.593  13.985  1.00   14.89 ? 149 VAL A CG2   1 
ATOM   331   N  N     . SER A  1 43  ? 24.876  30.548  12.097  1.00   16.22 ? 150 SER A N     1 
ATOM   332   C  CA    . SER A  1 43  ? 25.964  31.080  11.285  1.00   16.83 ? 150 SER A CA    1 
ATOM   333   C  C     . SER A  1 43  ? 25.587  31.089  9.815   1.00   16.98 ? 150 SER A C     1 
ATOM   334   O  O     . SER A  1 43  ? 25.064  30.100  9.289   1.00   18.96 ? 150 SER A O     1 
ATOM   335   C  CB    . SER A  1 43  ? 27.233  30.247  11.478  1.00   19.65 ? 150 SER A CB    1 
ATOM   336   O  OG    . SER A  1 43  ? 28.295  30.746  10.677  1.00   20.82 ? 150 SER A OG    1 
ATOM   337   N  N     . ILE A  1 44  ? 25.856  32.211  9.157   1.00   14.99 ? 151 ILE A N     1 
ATOM   338   C  CA    . ILE A  1 44  ? 25.567  32.361  7.737   1.00   14.36 ? 151 ILE A CA    1 
ATOM   339   C  C     . ILE A  1 44  ? 26.839  32.108  6.906   1.00   17.30 ? 151 ILE A C     1 
ATOM   340   O  O     . ILE A  1 44  ? 27.785  32.889  6.952   1.00   17.18 ? 151 ILE A O     1 
ATOM   341   C  CB    . ILE A  1 44  ? 25.054  33.789  7.413   1.00   12.89 ? 151 ILE A CB    1 
ATOM   342   C  CG1   . ILE A  1 44  ? 23.812  34.125  8.259   1.00   14.78 ? 151 ILE A CG1   1 
ATOM   343   C  CG2   . ILE A  1 44  ? 24.794  33.909  5.916   1.00   7.33  ? 151 ILE A CG2   1 
ATOM   344   C  CD1   . ILE A  1 44  ? 22.615  33.218  8.039   1.00   13.09 ? 151 ILE A CD1   1 
ATOM   345   N  N     . LEU A  1 45  ? 26.865  31.009  6.159   1.00   18.46 ? 152 LEU A N     1 
ATOM   346   C  CA    . LEU A  1 45  ? 28.014  30.695  5.321   1.00   18.45 ? 152 LEU A CA    1 
ATOM   347   C  C     . LEU A  1 45  ? 27.746  31.393  3.998   1.00   19.41 ? 152 LEU A C     1 
ATOM   348   O  O     . LEU A  1 45  ? 26.960  30.912  3.178   1.00   20.79 ? 152 LEU A O     1 
ATOM   349   C  CB    . LEU A  1 45  ? 28.125  29.181  5.101   1.00   17.47 ? 152 LEU A CB    1 
ATOM   350   C  CG    . LEU A  1 45  ? 28.047  28.298  6.352   1.00   17.38 ? 152 LEU A CG    1 
ATOM   351   C  CD1   . LEU A  1 45  ? 28.390  26.870  5.955   1.00   15.95 ? 152 LEU A CD1   1 
ATOM   352   C  CD2   . LEU A  1 45  ? 29.004  28.803  7.434   1.00   13.72 ? 152 LEU A CD2   1 
ATOM   353   N  N     . ASP A  1 46  ? 28.397  32.528  3.778   1.00   19.20 ? 153 ASP A N     1 
ATOM   354   C  CA    . ASP A  1 46  ? 28.156  33.283  2.550   1.00   18.78 ? 153 ASP A CA    1 
ATOM   355   C  C     . ASP A  1 46  ? 29.371  34.120  2.132   1.00   19.93 ? 153 ASP A C     1 
ATOM   356   O  O     . ASP A  1 46  ? 30.514  33.681  2.272   1.00   21.73 ? 153 ASP A O     1 
ATOM   357   C  CB    . ASP A  1 46  ? 26.938  34.181  2.775   1.00   18.49 ? 153 ASP A CB    1 
ATOM   358   C  CG    . ASP A  1 46  ? 26.056  34.297  1.561   1.00   19.55 ? 153 ASP A CG    1 
ATOM   359   O  OD1   . ASP A  1 46  ? 26.300  35.166  0.699   1.00   18.24 ? 153 ASP A OD1   1 
ATOM   360   O  OD2   . ASP A  1 46  ? 25.104  33.506  1.473   1.00   24.55 ? 153 ASP A OD2   1 
ATOM   361   N  N     . ASP A  1 47  ? 29.119  35.325  1.622   1.00   19.97 ? 154 ASP A N     1 
ATOM   362   C  CA    . ASP A  1 47  ? 30.191  36.213  1.183   1.00   20.28 ? 154 ASP A CA    1 
ATOM   363   C  C     . ASP A  1 47  ? 30.587  37.217  2.249   1.00   19.65 ? 154 ASP A C     1 
ATOM   364   O  O     . ASP A  1 47  ? 31.202  38.241  1.951   1.00   18.88 ? 154 ASP A O     1 
ATOM   365   C  CB    . ASP A  1 47  ? 29.798  36.960  -0.102  1.00   21.43 ? 154 ASP A CB    1 
ATOM   366   C  CG    . ASP A  1 47  ? 28.575  37.853  0.073   1.00   23.56 ? 154 ASP A CG    1 
ATOM   367   O  OD1   . ASP A  1 47  ? 28.178  38.135  1.227   1.00   21.60 ? 154 ASP A OD1   1 
ATOM   368   O  OD2   . ASP A  1 47  ? 28.020  38.287  -0.963  1.00   23.08 ? 154 ASP A OD2   1 
ATOM   369   N  N     . GLY A  1 48  ? 30.232  36.918  3.492   1.00   21.15 ? 155 GLY A N     1 
ATOM   370   C  CA    . GLY A  1 48  ? 30.564  37.814  4.587   1.00   23.50 ? 155 GLY A CA    1 
ATOM   371   C  C     . GLY A  1 48  ? 29.360  38.363  5.339   1.00   24.81 ? 155 GLY A C     1 
ATOM   372   O  O     . GLY A  1 48  ? 28.204  38.144  4.960   1.00   25.19 ? 155 GLY A O     1 
ATOM   373   N  N     . ILE A  1 49  ? 29.634  39.086  6.418   1.00   22.56 ? 156 ILE A N     1 
ATOM   374   C  CA    . ILE A  1 49  ? 28.578  39.672  7.226   1.00   22.22 ? 156 ILE A CA    1 
ATOM   375   C  C     . ILE A  1 49  ? 29.047  41.015  7.774   1.00   22.51 ? 156 ILE A C     1 
ATOM   376   O  O     . ILE A  1 49  ? 30.141  41.123  8.328   1.00   23.00 ? 156 ILE A O     1 
ATOM   377   C  CB    . ILE A  1 49  ? 28.198  38.740  8.395   1.00   20.34 ? 156 ILE A CB    1 
ATOM   378   C  CG1   . ILE A  1 49  ? 27.079  39.364  9.226   1.00   20.26 ? 156 ILE A CG1   1 
ATOM   379   C  CG2   . ILE A  1 49  ? 29.426  38.471  9.262   1.00   19.38 ? 156 ILE A CG2   1 
ATOM   380   C  CD1   . ILE A  1 49  ? 26.501  38.438  10.296  1.00   20.26 ? 156 ILE A CD1   1 
ATOM   381   N  N     . GLU A  1 50  ? 28.226  42.044  7.593   1.00   21.25 ? 157 GLU A N     1 
ATOM   382   C  CA    . GLU A  1 50  ? 28.561  43.373  8.079   1.00   21.05 ? 157 GLU A CA    1 
ATOM   383   C  C     . GLU A  1 50  ? 28.240  43.396  9.573   1.00   20.44 ? 157 GLU A C     1 
ATOM   384   O  O     . GLU A  1 50  ? 27.184  43.869  9.985   1.00   19.63 ? 157 GLU A O     1 
ATOM   385   C  CB    . GLU A  1 50  ? 27.739  44.416  7.325   1.00   21.47 ? 157 GLU A CB    1 
ATOM   386   C  CG    . GLU A  1 50  ? 28.226  45.845  7.509   1.00   23.99 ? 157 GLU A CG    1 
ATOM   387   C  CD    . GLU A  1 50  ? 27.520  46.820  6.585   1.00   26.59 ? 157 GLU A CD    1 
ATOM   388   O  OE1   . GLU A  1 50  ? 26.294  47.026  6.743   1.00   26.83 ? 157 GLU A OE1   1 
ATOM   389   O  OE2   . GLU A  1 50  ? 28.196  47.372  5.693   1.00   27.26 ? 157 GLU A OE2   1 
ATOM   390   N  N     . LYS A  1 51  ? 29.161  42.875  10.379  1.00   21.10 ? 158 LYS A N     1 
ATOM   391   C  CA    . LYS A  1 51  ? 28.966  42.790  11.827  1.00   22.03 ? 158 LYS A CA    1 
ATOM   392   C  C     . LYS A  1 51  ? 28.661  44.108  12.542  1.00   22.48 ? 158 LYS A C     1 
ATOM   393   O  O     . LYS A  1 51  ? 28.086  44.109  13.636  1.00   23.50 ? 158 LYS A O     1 
ATOM   394   C  CB    . LYS A  1 51  ? 30.181  42.117  12.475  1.00   19.66 ? 158 LYS A CB    1 
ATOM   395   C  CG    . LYS A  1 51  ? 31.490  42.878  12.349  1.00   20.10 ? 158 LYS A CG    1 
ATOM   396   C  CD    . LYS A  1 51  ? 32.614  42.110  13.032  1.00   16.67 ? 158 LYS A CD    1 
ATOM   397   C  CE    . LYS A  1 51  ? 33.891  42.910  13.072  1.00   16.28 ? 158 LYS A CE    1 
ATOM   398   N  NZ    . LYS A  1 51  ? 34.423  43.178  11.720  1.00   21.59 ? 158 LYS A NZ    1 
ATOM   399   N  N     . ASN A  1 52  ? 29.030  45.225  11.927  1.00   21.52 ? 159 ASN A N     1 
ATOM   400   C  CA    . ASN A  1 52  ? 28.791  46.521  12.537  1.00   20.88 ? 159 ASN A CA    1 
ATOM   401   C  C     . ASN A  1 52  ? 27.488  47.164  12.045  1.00   22.11 ? 159 ASN A C     1 
ATOM   402   O  O     . ASN A  1 52  ? 27.190  48.316  12.371  1.00   24.45 ? 159 ASN A O     1 
ATOM   403   C  CB    . ASN A  1 52  ? 29.989  47.439  12.270  1.00   18.51 ? 159 ASN A CB    1 
ATOM   404   C  CG    . ASN A  1 52  ? 30.232  47.670  10.787  1.00   20.82 ? 159 ASN A CG    1 
ATOM   405   O  OD1   . ASN A  1 52  ? 30.350  46.723  9.997   1.00   20.86 ? 159 ASN A OD1   1 
ATOM   406   N  ND2   . ASN A  1 52  ? 30.311  48.934  10.400  1.00   21.66 ? 159 ASN A ND2   1 
ATOM   407   N  N     . HIS A  1 53  ? 26.707  46.428  11.258  1.00   21.19 ? 160 HIS A N     1 
ATOM   408   C  CA    . HIS A  1 53  ? 25.438  46.964  10.769  1.00   20.86 ? 160 HIS A CA    1 
ATOM   409   C  C     . HIS A  1 53  ? 24.555  47.285  11.989  1.00   22.50 ? 160 HIS A C     1 
ATOM   410   O  O     . HIS A  1 53  ? 24.441  46.470  12.912  1.00   23.24 ? 160 HIS A O     1 
ATOM   411   C  CB    . HIS A  1 53  ? 24.735  45.940  9.880   1.00   17.97 ? 160 HIS A CB    1 
ATOM   412   C  CG    . HIS A  1 53  ? 23.511  46.475  9.207   1.00   20.19 ? 160 HIS A CG    1 
ATOM   413   N  ND1   . HIS A  1 53  ? 22.430  46.968  9.907   1.00   19.33 ? 160 HIS A ND1   1 
ATOM   414   C  CD2   . HIS A  1 53  ? 23.217  46.640  7.895   1.00   20.00 ? 160 HIS A CD2   1 
ATOM   415   C  CE1   . HIS A  1 53  ? 21.524  47.416  9.055   1.00   19.20 ? 160 HIS A CE1   1 
ATOM   416   N  NE2   . HIS A  1 53  ? 21.978  47.229  7.828   1.00   20.78 ? 160 HIS A NE2   1 
ATOM   417   N  N     . PRO A  1 54  ? 23.934  48.481  12.019  1.00   20.96 ? 161 PRO A N     1 
ATOM   418   C  CA    . PRO A  1 54  ? 23.077  48.853  13.154  1.00   18.90 ? 161 PRO A CA    1 
ATOM   419   C  C     . PRO A  1 54  ? 21.973  47.864  13.526  1.00   18.12 ? 161 PRO A C     1 
ATOM   420   O  O     . PRO A  1 54  ? 21.508  47.856  14.663  1.00   15.12 ? 161 PRO A O     1 
ATOM   421   C  CB    . PRO A  1 54  ? 22.537  50.230  12.756  1.00   18.05 ? 161 PRO A CB    1 
ATOM   422   C  CG    . PRO A  1 54  ? 22.751  50.299  11.255  1.00   22.05 ? 161 PRO A CG    1 
ATOM   423   C  CD    . PRO A  1 54  ? 24.062  49.598  11.068  1.00   18.52 ? 161 PRO A CD    1 
ATOM   424   N  N     . ASP A  1 55  ? 21.557  47.015  12.592  1.00   17.95 ? 162 ASP A N     1 
ATOM   425   C  CA    . ASP A  1 55  ? 20.520  46.043  12.918  1.00   19.67 ? 162 ASP A CA    1 
ATOM   426   C  C     . ASP A  1 55  ? 21.071  44.626  13.151  1.00   18.83 ? 162 ASP A C     1 
ATOM   427   O  O     . ASP A  1 55  ? 20.305  43.675  13.314  1.00   20.58 ? 162 ASP A O     1 
ATOM   428   C  CB    . ASP A  1 55  ? 19.439  46.036  11.832  1.00   22.18 ? 162 ASP A CB    1 
ATOM   429   C  CG    . ASP A  1 55  ? 18.040  45.918  12.414  1.00   24.22 ? 162 ASP A CG    1 
ATOM   430   O  OD1   . ASP A  1 55  ? 17.856  46.302  13.593  1.00   22.51 ? 162 ASP A OD1   1 
ATOM   431   O  OD2   . ASP A  1 55  ? 17.129  45.456  11.693  1.00   29.09 ? 162 ASP A OD2   1 
ATOM   432   N  N     . LEU A  1 56  ? 22.398  44.498  13.191  1.00   15.44 ? 163 LEU A N     1 
ATOM   433   C  CA    . LEU A  1 56  ? 23.047  43.205  13.423  1.00   15.57 ? 163 LEU A CA    1 
ATOM   434   C  C     . LEU A  1 56  ? 24.033  43.195  14.600  1.00   17.10 ? 163 LEU A C     1 
ATOM   435   O  O     . LEU A  1 56  ? 24.156  42.195  15.313  1.00   14.86 ? 163 LEU A O     1 
ATOM   436   C  CB    . LEU A  1 56  ? 23.792  42.743  12.174  1.00   13.13 ? 163 LEU A CB    1 
ATOM   437   C  CG    . LEU A  1 56  ? 22.967  42.352  10.945  1.00   16.28 ? 163 LEU A CG    1 
ATOM   438   C  CD1   . LEU A  1 56  ? 23.920  41.958  9.826   1.00   15.43 ? 163 LEU A CD1   1 
ATOM   439   C  CD2   . LEU A  1 56  ? 22.019  41.200  11.278  1.00   14.80 ? 163 LEU A CD2   1 
ATOM   440   N  N     . ALA A  1 57  ? 24.735  44.306  14.804  1.00   18.05 ? 164 ALA A N     1 
ATOM   441   C  CA    . ALA A  1 57  ? 25.734  44.398  15.871  1.00   17.07 ? 164 ALA A CA    1 
ATOM   442   C  C     . ALA A  1 57  ? 25.258  43.849  17.214  1.00   16.39 ? 164 ALA A C     1 
ATOM   443   O  O     . ALA A  1 57  ? 25.986  43.110  17.887  1.00   16.55 ? 164 ALA A O     1 
ATOM   444   C  CB    . ALA A  1 57  ? 26.201  45.851  16.029  1.00   12.64 ? 164 ALA A CB    1 
ATOM   445   N  N     . GLY A  1 58  ? 24.036  44.203  17.589  1.00   13.98 ? 165 GLY A N     1 
ATOM   446   C  CA    . GLY A  1 58  ? 23.497  43.752  18.854  1.00   12.76 ? 165 GLY A CA    1 
ATOM   447   C  C     . GLY A  1 58  ? 23.461  42.250  19.025  1.00   15.10 ? 165 GLY A C     1 
ATOM   448   O  O     . GLY A  1 58  ? 23.517  41.758  20.153  1.00   16.22 ? 165 GLY A O     1 
ATOM   449   N  N     . ASN A  1 59  ? 23.358  41.517  17.919  1.00   15.12 ? 166 ASN A N     1 
ATOM   450   C  CA    . ASN A  1 59  ? 23.312  40.056  17.982  1.00   15.06 ? 166 ASN A CA    1 
ATOM   451   C  C     . ASN A  1 59  ? 24.548  39.369  17.403  1.00   15.10 ? 166 ASN A C     1 
ATOM   452   O  O     . ASN A  1 59  ? 24.680  38.146  17.496  1.00   11.21 ? 166 ASN A O     1 
ATOM   453   C  CB    . ASN A  1 59  ? 22.081  39.522  17.252  1.00   14.12 ? 166 ASN A CB    1 
ATOM   454   C  CG    . ASN A  1 59  ? 20.811  39.794  17.997  1.00   18.07 ? 166 ASN A CG    1 
ATOM   455   O  OD1   . ASN A  1 59  ? 20.806  39.813  19.223  1.00   19.58 ? 166 ASN A OD1   1 
ATOM   456   N  ND2   . ASN A  1 59  ? 19.714  39.984  17.269  1.00   17.88 ? 166 ASN A ND2   1 
ATOM   457   N  N     . TYR A  1 60  ? 25.449  40.142  16.803  1.00   14.40 ? 167 TYR A N     1 
ATOM   458   C  CA    . TYR A  1 60  ? 26.634  39.558  16.205  1.00   15.09 ? 167 TYR A CA    1 
ATOM   459   C  C     . TYR A  1 60  ? 27.427  38.712  17.195  1.00   17.22 ? 167 TYR A C     1 
ATOM   460   O  O     . TYR A  1 60  ? 27.638  39.111  18.341  1.00   16.60 ? 167 TYR A O     1 
ATOM   461   C  CB    . TYR A  1 60  ? 27.533  40.648  15.635  1.00   15.29 ? 167 TYR A CB    1 
ATOM   462   C  CG    . TYR A  1 60  ? 28.805  40.082  15.035  1.00   18.21 ? 167 TYR A CG    1 
ATOM   463   C  CD1   . TYR A  1 60  ? 28.770  39.321  13.860  1.00   13.30 ? 167 TYR A CD1   1 
ATOM   464   C  CD2   . TYR A  1 60  ? 30.042  40.273  15.664  1.00   15.99 ? 167 TYR A CD2   1 
ATOM   465   C  CE1   . TYR A  1 60  ? 29.934  38.768  13.325  1.00   16.44 ? 167 TYR A CE1   1 
ATOM   466   C  CE2   . TYR A  1 60  ? 31.215  39.719  15.138  1.00   18.45 ? 167 TYR A CE2   1 
ATOM   467   C  CZ    . TYR A  1 60  ? 31.157  38.969  13.970  1.00   19.48 ? 167 TYR A CZ    1 
ATOM   468   O  OH    . TYR A  1 60  ? 32.323  38.431  13.459  1.00   17.14 ? 167 TYR A OH    1 
ATOM   469   N  N     . ASP A  1 61  ? 27.870  37.543  16.737  1.00   18.25 ? 168 ASP A N     1 
ATOM   470   C  CA    . ASP A  1 61  ? 28.643  36.620  17.568  1.00   21.08 ? 168 ASP A CA    1 
ATOM   471   C  C     . ASP A  1 61  ? 29.955  36.248  16.884  1.00   23.23 ? 168 ASP A C     1 
ATOM   472   O  O     . ASP A  1 61  ? 29.964  35.506  15.901  1.00   23.82 ? 168 ASP A O     1 
ATOM   473   C  CB    . ASP A  1 61  ? 27.843  35.336  17.833  1.00   18.53 ? 168 ASP A CB    1 
ATOM   474   C  CG    . ASP A  1 61  ? 28.603  34.334  18.693  1.00   19.69 ? 168 ASP A CG    1 
ATOM   475   O  OD1   . ASP A  1 61  ? 29.792  34.567  19.003  1.00   19.52 ? 168 ASP A OD1   1 
ATOM   476   O  OD2   . ASP A  1 61  ? 28.011  33.302  19.067  1.00   21.07 ? 168 ASP A OD2   1 
ATOM   477   N  N     . PRO A  1 62  ? 31.087  36.747  17.410  1.00   24.92 ? 169 PRO A N     1 
ATOM   478   C  CA    . PRO A  1 62  ? 32.410  36.456  16.841  1.00   23.09 ? 169 PRO A CA    1 
ATOM   479   C  C     . PRO A  1 62  ? 32.692  34.953  16.842  1.00   21.62 ? 169 PRO A C     1 
ATOM   480   O  O     . PRO A  1 62  ? 33.333  34.427  15.939  1.00   25.09 ? 169 PRO A O     1 
ATOM   481   C  CB    . PRO A  1 62  ? 33.368  37.185  17.781  1.00   21.08 ? 169 PRO A CB    1 
ATOM   482   C  CG    . PRO A  1 62  ? 32.522  38.232  18.436  1.00   22.37 ? 169 PRO A CG    1 
ATOM   483   C  CD    . PRO A  1 62  ? 31.212  37.536  18.647  1.00   22.52 ? 169 PRO A CD    1 
ATOM   484   N  N     . GLY A  1 63  ? 32.205  34.270  17.872  1.00   21.33 ? 170 GLY A N     1 
ATOM   485   C  CA    . GLY A  1 63  ? 32.429  32.840  17.989  1.00   20.09 ? 170 GLY A CA    1 
ATOM   486   C  C     . GLY A  1 63  ? 31.775  32.015  16.907  1.00   20.50 ? 170 GLY A C     1 
ATOM   487   O  O     . GLY A  1 63  ? 32.104  30.845  16.739  1.00   23.68 ? 170 GLY A O     1 
ATOM   488   N  N     . ALA A  1 64  ? 30.839  32.618  16.182  1.00   20.59 ? 171 ALA A N     1 
ATOM   489   C  CA    . ALA A  1 64  ? 30.139  31.931  15.107  1.00   20.82 ? 171 ALA A CA    1 
ATOM   490   C  C     . ALA A  1 64  ? 30.582  32.481  13.754  1.00   21.36 ? 171 ALA A C     1 
ATOM   491   O  O     . ALA A  1 64  ? 29.954  32.215  12.729  1.00   19.73 ? 171 ALA A O     1 
ATOM   492   C  CB    . ALA A  1 64  ? 28.644  32.111  15.270  1.00   19.62 ? 171 ALA A CB    1 
ATOM   493   N  N     . SER A  1 65  ? 31.671  33.244  13.756  1.00   20.86 ? 172 SER A N     1 
ATOM   494   C  CA    . SER A  1 65  ? 32.172  33.847  12.527  1.00   22.23 ? 172 SER A CA    1 
ATOM   495   C  C     . SER A  1 65  ? 33.625  33.509  12.217  1.00   24.12 ? 172 SER A C     1 
ATOM   496   O  O     . SER A  1 65  ? 34.373  33.032  13.077  1.00   24.36 ? 172 SER A O     1 
ATOM   497   C  CB    . SER A  1 65  ? 32.041  35.367  12.598  1.00   19.21 ? 172 SER A CB    1 
ATOM   498   O  OG    . SER A  1 65  ? 30.724  35.759  12.913  1.00   19.73 ? 172 SER A OG    1 
ATOM   499   N  N     . PHE A  1 66  ? 34.007  33.772  10.971  1.00   23.15 ? 173 PHE A N     1 
ATOM   500   C  CA    . PHE A  1 66  ? 35.364  33.543  10.509  1.00   23.16 ? 173 PHE A CA    1 
ATOM   501   C  C     . PHE A  1 66  ? 35.487  33.900  9.033   1.00   22.59 ? 173 PHE A C     1 
ATOM   502   O  O     . PHE A  1 66  ? 34.498  33.897  8.298   1.00   21.24 ? 173 PHE A O     1 
ATOM   503   C  CB    . PHE A  1 66  ? 35.773  32.086  10.702  1.00   26.58 ? 173 PHE A CB    1 
ATOM   504   C  CG    . PHE A  1 66  ? 37.253  31.886  10.727  1.00   27.42 ? 173 PHE A CG    1 
ATOM   505   C  CD1   . PHE A  1 66  ? 37.976  32.148  11.888  1.00   25.53 ? 173 PHE A CD1   1 
ATOM   506   C  CD2   . PHE A  1 66  ? 37.934  31.477  9.583   1.00   28.20 ? 173 PHE A CD2   1 
ATOM   507   C  CE1   . PHE A  1 66  ? 39.356  32.009  11.913  1.00   26.38 ? 173 PHE A CE1   1 
ATOM   508   C  CE2   . PHE A  1 66  ? 39.319  31.336  9.599   1.00   30.39 ? 173 PHE A CE2   1 
ATOM   509   C  CZ    . PHE A  1 66  ? 40.031  31.604  10.772  1.00   28.65 ? 173 PHE A CZ    1 
ATOM   510   N  N     . ASP A  1 67  ? 36.704  34.206  8.601   1.00   21.20 ? 174 ASP A N     1 
ATOM   511   C  CA    . ASP A  1 67  ? 36.956  34.560  7.213   1.00   20.96 ? 174 ASP A CA    1 
ATOM   512   C  C     . ASP A  1 67  ? 37.845  33.485  6.612   1.00   21.67 ? 174 ASP A C     1 
ATOM   513   O  O     . ASP A  1 67  ? 39.064  33.532  6.749   1.00   23.03 ? 174 ASP A O     1 
ATOM   514   C  CB    . ASP A  1 67  ? 37.655  35.917  7.139   1.00   21.44 ? 174 ASP A CB    1 
ATOM   515   C  CG    . ASP A  1 67  ? 37.873  36.394  5.713   1.00   21.54 ? 174 ASP A CG    1 
ATOM   516   O  OD1   . ASP A  1 67  ? 37.729  35.588  4.776   1.00   19.73 ? 174 ASP A OD1   1 
ATOM   517   O  OD2   . ASP A  1 67  ? 38.205  37.585  5.533   1.00   22.38 ? 174 ASP A OD2   1 
ATOM   518   N  N     . VAL A  1 68  ? 37.230  32.515  5.949   1.00   21.00 ? 175 VAL A N     1 
ATOM   519   C  CA    . VAL A  1 68  ? 37.982  31.435  5.336   1.00   24.29 ? 175 VAL A CA    1 
ATOM   520   C  C     . VAL A  1 68  ? 38.680  31.886  4.055   1.00   25.84 ? 175 VAL A C     1 
ATOM   521   O  O     . VAL A  1 68  ? 39.730  31.358  3.690   1.00   29.09 ? 175 VAL A O     1 
ATOM   522   C  CB    . VAL A  1 68  ? 37.075  30.236  5.015   1.00   24.15 ? 175 VAL A CB    1 
ATOM   523   C  CG1   . VAL A  1 68  ? 37.884  29.149  4.334   1.00   24.71 ? 175 VAL A CG1   1 
ATOM   524   C  CG2   . VAL A  1 68  ? 36.455  29.697  6.290   1.00   22.70 ? 175 VAL A CG2   1 
ATOM   525   N  N     . ASN A  1 69  ? 38.095  32.863  3.375   1.00   24.81 ? 176 ASN A N     1 
ATOM   526   C  CA    . ASN A  1 69  ? 38.673  33.382  2.143   1.00   25.37 ? 176 ASN A CA    1 
ATOM   527   C  C     . ASN A  1 69  ? 40.043  34.038  2.372   1.00   27.81 ? 176 ASN A C     1 
ATOM   528   O  O     . ASN A  1 69  ? 40.974  33.798  1.607   1.00   27.97 ? 176 ASN A O     1 
ATOM   529   C  CB    . ASN A  1 69  ? 37.708  34.387  1.494   1.00   24.66 ? 176 ASN A CB    1 
ATOM   530   C  CG    . ASN A  1 69  ? 36.493  33.711  0.834   1.00   24.96 ? 176 ASN A CG    1 
ATOM   531   O  OD1   . ASN A  1 69  ? 35.444  34.331  0.644   1.00   23.60 ? 176 ASN A OD1   1 
ATOM   532   N  ND2   . ASN A  1 69  ? 36.644  32.442  0.473   1.00   23.89 ? 176 ASN A ND2   1 
ATOM   533   N  N     . ASP A  1 70  ? 40.169  34.863  3.413   1.00   29.22 ? 177 ASP A N     1 
ATOM   534   C  CA    . ASP A  1 70  ? 41.441  35.526  3.702   1.00   30.44 ? 177 ASP A CA    1 
ATOM   535   C  C     . ASP A  1 70  ? 42.126  35.008  4.959   1.00   32.14 ? 177 ASP A C     1 
ATOM   536   O  O     . ASP A  1 70  ? 43.085  35.611  5.448   1.00   34.24 ? 177 ASP A O     1 
ATOM   537   C  CB    . ASP A  1 70  ? 41.258  37.044  3.812   1.00   31.61 ? 177 ASP A CB    1 
ATOM   538   C  CG    . ASP A  1 70  ? 40.952  37.695  2.468   1.00   35.46 ? 177 ASP A CG    1 
ATOM   539   O  OD1   . ASP A  1 70  ? 41.268  37.091  1.412   1.00   36.71 ? 177 ASP A OD1   1 
ATOM   540   O  OD2   . ASP A  1 70  ? 40.403  38.818  2.466   1.00   35.84 ? 177 ASP A OD2   1 
ATOM   541   N  N     . GLN A  1 71  ? 41.633  33.890  5.483   1.00   31.82 ? 178 GLN A N     1 
ATOM   542   C  CA    . GLN A  1 71  ? 42.220  33.285  6.673   1.00   30.67 ? 178 GLN A CA    1 
ATOM   543   C  C     . GLN A  1 71  ? 42.393  34.200  7.886   1.00   30.19 ? 178 GLN A C     1 
ATOM   544   O  O     . GLN A  1 71  ? 43.512  34.380  8.360   1.00   31.73 ? 178 GLN A O     1 
ATOM   545   C  CB    . GLN A  1 71  ? 43.581  32.674  6.331   1.00   27.86 ? 178 GLN A CB    1 
ATOM   546   C  CG    . GLN A  1 71  ? 43.583  31.148  6.197   1.00   29.97 ? 178 GLN A CG    1 
ATOM   547   C  CD    . GLN A  1 71  ? 42.694  30.640  5.082   1.00   25.09 ? 178 GLN A CD    1 
ATOM   548   O  OE1   . GLN A  1 71  ? 41.476  30.575  5.230   0.0000 26.58 ? 178 GLN A OE1   1 
ATOM   549   N  NE2   . GLN A  1 71  ? 43.302  30.286  3.956   0.0000 26.58 ? 178 GLN A NE2   1 
ATOM   550   N  N     . ASP A  1 72  ? 41.303  34.792  8.368   1.00   28.19 ? 179 ASP A N     1 
ATOM   551   C  CA    . ASP A  1 72  ? 41.340  35.620  9.570   1.00   27.58 ? 179 ASP A CA    1 
ATOM   552   C  C     . ASP A  1 72  ? 39.979  35.501  10.237  1.00   30.04 ? 179 ASP A C     1 
ATOM   553   O  O     . ASP A  1 72  ? 39.023  35.020  9.630   1.00   31.80 ? 179 ASP A O     1 
ATOM   554   C  CB    . ASP A  1 72  ? 41.715  37.082  9.270   1.00   24.33 ? 179 ASP A CB    1 
ATOM   555   C  CG    . ASP A  1 72  ? 40.674  37.820  8.467   1.00   26.14 ? 179 ASP A CG    1 
ATOM   556   O  OD1   . ASP A  1 72  ? 39.553  38.018  8.974   1.00   24.15 ? 179 ASP A OD1   1 
ATOM   557   O  OD2   . ASP A  1 72  ? 40.988  38.224  7.325   1.00   29.12 ? 179 ASP A OD2   1 
ATOM   558   N  N     . PRO A  1 73  ? 39.872  35.911  11.504  1.00   31.40 ? 180 PRO A N     1 
ATOM   559   C  CA    . PRO A  1 73  ? 38.572  35.795  12.171  1.00   31.21 ? 180 PRO A CA    1 
ATOM   560   C  C     . PRO A  1 73  ? 37.532  36.866  11.875  1.00   30.20 ? 180 PRO A C     1 
ATOM   561   O  O     . PRO A  1 73  ? 36.407  36.762  12.361  1.00   32.46 ? 180 PRO A O     1 
ATOM   562   C  CB    . PRO A  1 73  ? 38.955  35.758  13.647  1.00   31.18 ? 180 PRO A CB    1 
ATOM   563   C  CG    . PRO A  1 73  ? 40.119  36.695  13.690  1.00   31.24 ? 180 PRO A CG    1 
ATOM   564   C  CD    . PRO A  1 73  ? 40.924  36.311  12.455  1.00   30.95 ? 180 PRO A CD    1 
ATOM   565   N  N     . ASP A  1 74  ? 37.892  37.876  11.085  1.00   28.86 ? 181 ASP A N     1 
ATOM   566   C  CA    . ASP A  1 74  ? 36.970  38.958  10.760  1.00   29.31 ? 181 ASP A CA    1 
ATOM   567   C  C     . ASP A  1 74  ? 36.223  38.707  9.445   1.00   28.86 ? 181 ASP A C     1 
ATOM   568   O  O     . ASP A  1 74  ? 36.816  38.771  8.363   1.00   30.10 ? 181 ASP A O     1 
ATOM   569   C  CB    . ASP A  1 74  ? 37.735  40.271  10.661  1.00   31.79 ? 181 ASP A CB    1 
ATOM   570   C  CG    . ASP A  1 74  ? 36.823  41.466  10.544  1.00   34.67 ? 181 ASP A CG    1 
ATOM   571   O  OD1   . ASP A  1 74  ? 35.632  41.292  10.187  1.00   37.26 ? 181 ASP A OD1   1 
ATOM   572   O  OD2   . ASP A  1 74  ? 37.303  42.588  10.801  1.00   35.48 ? 181 ASP A OD2   1 
ATOM   573   N  N     . PRO A  1 75  ? 34.902  38.450  9.523   1.00   27.26 ? 182 PRO A N     1 
ATOM   574   C  CA    . PRO A  1 75  ? 34.055  38.183  8.355   1.00   25.74 ? 182 PRO A CA    1 
ATOM   575   C  C     . PRO A  1 75  ? 33.498  39.414  7.645   1.00   24.78 ? 182 PRO A C     1 
ATOM   576   O  O     . PRO A  1 75  ? 32.574  39.293  6.845   1.00   25.02 ? 182 PRO A O     1 
ATOM   577   C  CB    . PRO A  1 75  ? 32.945  37.324  8.939   1.00   23.14 ? 182 PRO A CB    1 
ATOM   578   C  CG    . PRO A  1 75  ? 32.708  38.014  10.239  1.00   26.74 ? 182 PRO A CG    1 
ATOM   579   C  CD    . PRO A  1 75  ? 34.124  38.282  10.765  1.00   25.54 ? 182 PRO A CD    1 
ATOM   580   N  N     . GLN A  1 76  ? 34.046  40.591  7.930   1.00   24.74 ? 183 GLN A N     1 
ATOM   581   C  CA    . GLN A  1 76  ? 33.571  41.819  7.288   1.00   24.16 ? 183 GLN A CA    1 
ATOM   582   C  C     . GLN A  1 76  ? 33.617  41.669  5.765   1.00   22.40 ? 183 GLN A C     1 
ATOM   583   O  O     . GLN A  1 76  ? 34.585  41.155  5.207   1.00   23.07 ? 183 GLN A O     1 
ATOM   584   C  CB    . GLN A  1 76  ? 34.432  43.011  7.712   1.00   21.55 ? 183 GLN A CB    1 
ATOM   585   C  CG    . GLN A  1 76  ? 33.844  44.368  7.349   1.00   20.44 ? 183 GLN A CG    1 
ATOM   586   C  CD    . GLN A  1 76  ? 32.681  44.774  8.254   1.00   21.62 ? 183 GLN A CD    1 
ATOM   587   O  OE1   . GLN A  1 76  ? 32.662  44.447  9.438   1.00   20.69 ? 183 GLN A OE1   1 
ATOM   588   N  NE2   . GLN A  1 76  ? 31.722  45.509  7.702   1.00   19.37 ? 183 GLN A NE2   1 
ATOM   589   N  N     . PRO A  1 77  ? 32.562  42.116  5.071   1.00   21.87 ? 184 PRO A N     1 
ATOM   590   C  CA    . PRO A  1 77  ? 32.521  42.008  3.607   1.00   21.04 ? 184 PRO A CA    1 
ATOM   591   C  C     . PRO A  1 77  ? 33.543  42.905  2.920   1.00   18.90 ? 184 PRO A C     1 
ATOM   592   O  O     . PRO A  1 77  ? 34.020  43.874  3.506   1.00   20.04 ? 184 PRO A O     1 
ATOM   593   C  CB    . PRO A  1 77  ? 31.090  42.427  3.269   1.00   18.97 ? 184 PRO A CB    1 
ATOM   594   C  CG    . PRO A  1 77  ? 30.327  42.086  4.500   1.00   20.41 ? 184 PRO A CG    1 
ATOM   595   C  CD    . PRO A  1 77  ? 31.258  42.552  5.594   1.00   20.03 ? 184 PRO A CD    1 
ATOM   596   N  N     . ARG A  1 78  ? 33.881  42.570  1.680   1.00   17.65 ? 185 ARG A N     1 
ATOM   597   C  CA    . ARG A  1 78  ? 34.820  43.368  0.901   1.00   17.93 ? 185 ARG A CA    1 
ATOM   598   C  C     . ARG A  1 78  ? 33.985  44.330  0.085   1.00   19.61 ? 185 ARG A C     1 
ATOM   599   O  O     . ARG A  1 78  ? 33.244  43.903  -0.799  1.00   19.94 ? 185 ARG A O     1 
ATOM   600   C  CB    . ARG A  1 78  ? 35.630  42.483  -0.037  1.00   18.06 ? 185 ARG A CB    1 
ATOM   601   C  CG    . ARG A  1 78  ? 36.529  43.262  -0.986  1.00   17.64 ? 185 ARG A CG    1 
ATOM   602   C  CD    . ARG A  1 78  ? 37.414  42.308  -1.766  1.00   14.86 ? 185 ARG A CD    1 
ATOM   603   N  NE    . ARG A  1 78  ? 36.606  41.395  -2.562  1.00   14.40 ? 185 ARG A NE    1 
ATOM   604   C  CZ    . ARG A  1 78  ? 36.169  41.663  -3.786  1.00   16.34 ? 185 ARG A CZ    1 
ATOM   605   N  NH1   . ARG A  1 78  ? 35.425  40.775  -4.430  1.00   11.60 ? 185 ARG A NH1   1 
ATOM   606   N  NH2   . ARG A  1 78  ? 36.495  42.810  -4.373  1.00   15.18 ? 185 ARG A NH2   1 
ATOM   607   N  N     . TYR A  1 79  ? 34.102  45.624  0.381   1.00   21.00 ? 186 TYR A N     1 
ATOM   608   C  CA    . TYR A  1 79  ? 33.316  46.640  -0.318  1.00   22.56 ? 186 TYR A CA    1 
ATOM   609   C  C     . TYR A  1 79  ? 33.782  46.948  -1.732  1.00   21.91 ? 186 TYR A C     1 
ATOM   610   O  O     . TYR A  1 79  ? 34.975  47.046  -1.996  1.00   21.84 ? 186 TYR A O     1 
ATOM   611   C  CB    . TYR A  1 79  ? 33.271  47.935  0.498   1.00   20.79 ? 186 TYR A CB    1 
ATOM   612   C  CG    . TYR A  1 79  ? 32.617  47.756  1.837   1.00   20.35 ? 186 TYR A CG    1 
ATOM   613   C  CD1   . TYR A  1 79  ? 33.371  47.419  2.965   1.00   19.12 ? 186 TYR A CD1   1 
ATOM   614   C  CD2   . TYR A  1 79  ? 31.230  47.848  1.967   1.00   20.29 ? 186 TYR A CD2   1 
ATOM   615   C  CE1   . TYR A  1 79  ? 32.752  47.172  4.195   1.00   19.39 ? 186 TYR A CE1   1 
ATOM   616   C  CE2   . TYR A  1 79  ? 30.599  47.602  3.193   1.00   19.88 ? 186 TYR A CE2   1 
ATOM   617   C  CZ    . TYR A  1 79  ? 31.366  47.264  4.298   1.00   19.37 ? 186 TYR A CZ    1 
ATOM   618   O  OH    . TYR A  1 79  ? 30.745  47.011  5.493   1.00   20.77 ? 186 TYR A OH    1 
ATOM   619   N  N     . THR A  1 80  ? 32.819  47.094  -2.634  1.00   21.60 ? 187 THR A N     1 
ATOM   620   C  CA    . THR A  1 80  ? 33.101  47.403  -4.031  1.00   25.25 ? 187 THR A CA    1 
ATOM   621   C  C     . THR A  1 80  ? 31.953  48.266  -4.568  1.00   29.25 ? 187 THR A C     1 
ATOM   622   O  O     . THR A  1 80  ? 30.859  48.266  -3.992  1.00   30.18 ? 187 THR A O     1 
ATOM   623   C  CB    . THR A  1 80  ? 33.225  46.120  -4.873  1.00   22.81 ? 187 THR A CB    1 
ATOM   624   O  OG1   . THR A  1 80  ? 31.937  45.516  -5.044  1.00   22.71 ? 187 THR A OG1   1 
ATOM   625   C  CG2   . THR A  1 80  ? 34.118  45.133  -4.164  1.00   18.85 ? 187 THR A CG2   1 
ATOM   626   N  N     . GLN A  1 81  ? 32.199  49.001  -5.654  1.00   31.39 ? 188 GLN A N     1 
ATOM   627   C  CA    . GLN A  1 81  ? 31.174  49.865  -6.238  1.00   33.11 ? 188 GLN A CA    1 
ATOM   628   C  C     . GLN A  1 81  ? 29.881  49.118  -6.551  1.00   33.59 ? 188 GLN A C     1 
ATOM   629   O  O     . GLN A  1 81  ? 28.785  49.638  -6.337  1.00   34.95 ? 188 GLN A O     1 
ATOM   630   C  CB    . GLN A  1 81  ? 31.682  50.530  -7.526  1.00   32.74 ? 188 GLN A CB    1 
ATOM   631   C  CG    . GLN A  1 81  ? 32.229  51.949  -7.343  1.00   32.97 ? 188 GLN A CG    1 
ATOM   632   C  CD    . GLN A  1 81  ? 32.454  52.678  -8.668  1.00   30.97 ? 188 GLN A CD    1 
ATOM   633   O  OE1   . GLN A  1 81  ? 33.173  52.195  -9.542  0.0000 31.16 ? 188 GLN A OE1   1 
ATOM   634   N  NE2   . GLN A  1 81  ? 31.839  53.845  -8.811  0.0000 31.16 ? 188 GLN A NE2   1 
ATOM   635   N  N     . MET A  1 82  ? 30.012  47.902  -7.065  1.00   33.35 ? 189 MET A N     1 
ATOM   636   C  CA    . MET A  1 82  ? 28.846  47.105  -7.418  1.00   35.06 ? 189 MET A CA    1 
ATOM   637   C  C     . MET A  1 82  ? 28.146  46.454  -6.223  1.00   32.71 ? 189 MET A C     1 
ATOM   638   O  O     . MET A  1 82  ? 27.054  45.916  -6.375  1.00   29.87 ? 189 MET A O     1 
ATOM   639   C  CB    . MET A  1 82  ? 29.238  46.038  -8.448  1.00   38.69 ? 189 MET A CB    1 
ATOM   640   C  CG    . MET A  1 82  ? 29.500  46.624  -9.827  1.00   44.02 ? 189 MET A CG    1 
ATOM   641   S  SD    . MET A  1 82  ? 30.145  45.429  -11.018 1.00   54.99 ? 189 MET A SD    1 
ATOM   642   C  CE    . MET A  1 82  ? 28.704  44.463  -11.436 1.00   49.76 ? 189 MET A CE    1 
ATOM   643   N  N     . ASN A  1 83  ? 28.768  46.518  -5.043  1.00   30.35 ? 190 ASN A N     1 
ATOM   644   C  CA    . ASN A  1 83  ? 28.212  45.914  -3.827  1.00   28.66 ? 190 ASN A CA    1 
ATOM   645   C  C     . ASN A  1 83  ? 27.994  44.406  -3.981  1.00   28.31 ? 190 ASN A C     1 
ATOM   646   O  O     . ASN A  1 83  ? 26.960  43.866  -3.575  1.00   23.60 ? 190 ASN A O     1 
ATOM   647   C  CB    . ASN A  1 83  ? 26.885  46.575  -3.458  1.00   26.23 ? 190 ASN A CB    1 
ATOM   648   C  CG    . ASN A  1 83  ? 27.065  47.963  -2.889  1.00   25.34 ? 190 ASN A CG    1 
ATOM   649   O  OD1   . ASN A  1 83  ? 27.878  48.180  -1.985  1.00   24.09 ? 190 ASN A OD1   1 
ATOM   650   N  ND2   . ASN A  1 83  ? 26.296  48.912  -3.402  1.00   22.91 ? 190 ASN A ND2   1 
ATOM   651   N  N     . ASP A  1 84  ? 28.982  43.731  -4.554  1.00   29.49 ? 191 ASP A N     1 
ATOM   652   C  CA    . ASP A  1 84  ? 28.898  42.296  -4.788  1.00   31.16 ? 191 ASP A CA    1 
ATOM   653   C  C     . ASP A  1 84  ? 28.695  41.477  -3.527  1.00   30.52 ? 191 ASP A C     1 
ATOM   654   O  O     . ASP A  1 84  ? 27.932  40.503  -3.522  1.00   31.45 ? 191 ASP A O     1 
ATOM   655   C  CB    . ASP A  1 84  ? 30.171  41.797  -5.469  1.00   33.65 ? 191 ASP A CB    1 
ATOM   656   C  CG    . ASP A  1 84  ? 30.539  42.621  -6.676  1.00   36.95 ? 191 ASP A CG    1 
ATOM   657   O  OD1   . ASP A  1 84  ? 30.971  43.780  -6.491  1.00   37.95 ? 191 ASP A OD1   1 
ATOM   658   O  OD2   . ASP A  1 84  ? 30.380  42.109  -7.805  1.00   38.77 ? 191 ASP A OD2   1 
ATOM   659   N  N     . ASN A  1 85  ? 29.387  41.875  -2.466  1.00   26.52 ? 192 ASN A N     1 
ATOM   660   C  CA    . ASN A  1 85  ? 29.338  41.143  -1.218  1.00   25.02 ? 192 ASN A CA    1 
ATOM   661   C  C     . ASN A  1 85  ? 28.295  41.601  -0.212  1.00   25.01 ? 192 ASN A C     1 
ATOM   662   O  O     . ASN A  1 85  ? 28.580  41.727  0.976   1.00   25.27 ? 192 ASN A O     1 
ATOM   663   C  CB    . ASN A  1 85  ? 30.729  41.162  -0.592  1.00   25.10 ? 192 ASN A CB    1 
ATOM   664   C  CG    . ASN A  1 85  ? 31.791  40.603  -1.526  1.00   24.85 ? 192 ASN A CG    1 
ATOM   665   O  OD1   . ASN A  1 85  ? 31.714  39.444  -1.947  1.00   23.46 ? 192 ASN A OD1   1 
ATOM   666   N  ND2   . ASN A  1 85  ? 32.791  41.425  -1.855  1.00   21.50 ? 192 ASN A ND2   1 
ATOM   667   N  N     . ARG A  1 86  ? 27.078  41.834  -0.688  1.00   24.26 ? 193 ARG A N     1 
ATOM   668   C  CA    . ARG A  1 86  ? 25.979  42.266  0.178   1.00   23.57 ? 193 ARG A CA    1 
ATOM   669   C  C     . ARG A  1 86  ? 25.084  41.080  0.518   1.00   22.62 ? 193 ARG A C     1 
ATOM   670   O  O     . ARG A  1 86  ? 24.305  41.125  1.468   1.00   21.94 ? 193 ARG A O     1 
ATOM   671   C  CB    . ARG A  1 86  ? 25.129  43.302  -0.537  1.00   23.82 ? 193 ARG A CB    1 
ATOM   672   C  CG    . ARG A  1 86  ? 24.353  42.693  -1.681  1.00   24.52 ? 193 ARG A CG    1 
ATOM   673   C  CD    . ARG A  1 86  ? 23.629  43.733  -2.482  1.00   29.06 ? 193 ARG A CD    1 
ATOM   674   N  NE    . ARG A  1 86  ? 22.823  43.125  -3.535  1.00   31.65 ? 193 ARG A NE    1 
ATOM   675   C  CZ    . ARG A  1 86  ? 22.071  43.812  -4.390  1.00   34.10 ? 193 ARG A CZ    1 
ATOM   676   N  NH1   . ARG A  1 86  ? 22.028  45.142  -4.320  1.00   37.30 ? 193 ARG A NH1   1 
ATOM   677   N  NH2   . ARG A  1 86  ? 21.345  43.173  -5.302  1.00   32.31 ? 193 ARG A NH2   1 
ATOM   678   N  N     . HIS A  1 87  ? 25.206  40.023  -0.277  1.00   21.96 ? 194 HIS A N     1 
ATOM   679   C  CA    . HIS A  1 87  ? 24.405  38.812  -0.134  1.00   18.66 ? 194 HIS A CA    1 
ATOM   680   C  C     . HIS A  1 87  ? 24.363  38.203  1.260   1.00   18.45 ? 194 HIS A C     1 
ATOM   681   O  O     . HIS A  1 87  ? 23.286  37.936  1.783   1.00   20.56 ? 194 HIS A O     1 
ATOM   682   C  CB    . HIS A  1 87  ? 24.900  37.781  -1.141  1.00   17.71 ? 194 HIS A CB    1 
ATOM   683   C  CG    . HIS A  1 87  ? 23.982  36.617  -1.326  1.00   14.91 ? 194 HIS A CG    1 
ATOM   684   N  ND1   . HIS A  1 87  ? 24.225  35.383  -0.768  1.00   16.02 ? 194 HIS A ND1   1 
ATOM   685   C  CD2   . HIS A  1 87  ? 22.868  36.476  -2.081  1.00   13.35 ? 194 HIS A CD2   1 
ATOM   686   C  CE1   . HIS A  1 87  ? 23.307  34.526  -1.182  1.00   14.59 ? 194 HIS A CE1   1 
ATOM   687   N  NE2   . HIS A  1 87  ? 22.474  35.165  -1.981  1.00   12.41 ? 194 HIS A NE2   1 
ATOM   688   N  N     . GLY A  1 88  ? 25.526  37.985  1.862   1.00   16.82 ? 195 GLY A N     1 
ATOM   689   C  CA    . GLY A  1 88  ? 25.555  37.387  3.186   1.00   16.47 ? 195 GLY A CA    1 
ATOM   690   C  C     . GLY A  1 88  ? 24.878  38.234  4.246   1.00   16.34 ? 195 GLY A C     1 
ATOM   691   O  O     . GLY A  1 88  ? 24.219  37.720  5.154   1.00   14.64 ? 195 GLY A O     1 
ATOM   692   N  N     . THR A  1 89  ? 25.040  39.546  4.129   1.00   16.41 ? 196 THR A N     1 
ATOM   693   C  CA    . THR A  1 89  ? 24.458  40.471  5.084   1.00   15.31 ? 196 THR A CA    1 
ATOM   694   C  C     . THR A  1 89  ? 22.939  40.467  5.009   1.00   17.23 ? 196 THR A C     1 
ATOM   695   O  O     . THR A  1 89  ? 22.250  40.583  6.025   1.00   16.41 ? 196 THR A O     1 
ATOM   696   C  CB    . THR A  1 89  ? 24.989  41.882  4.844   1.00   15.03 ? 196 THR A CB    1 
ATOM   697   O  OG1   . THR A  1 89  ? 26.389  41.897  5.159   1.00   15.67 ? 196 THR A OG1   1 
ATOM   698   C  CG2   . THR A  1 89  ? 24.241  42.908  5.706   1.00   11.84 ? 196 THR A CG2   1 
ATOM   699   N  N     . ARG A  1 90  ? 22.413  40.326  3.802   1.00   17.33 ? 197 ARG A N     1 
ATOM   700   C  CA    . ARG A  1 90  ? 20.972  40.288  3.632   1.00   18.67 ? 197 ARG A CA    1 
ATOM   701   C  C     . ARG A  1 90  ? 20.406  39.026  4.278   1.00   18.51 ? 197 ARG A C     1 
ATOM   702   O  O     . ARG A  1 90  ? 19.394  39.073  4.978   1.00   20.37 ? 197 ARG A O     1 
ATOM   703   C  CB    . ARG A  1 90  ? 20.618  40.346  2.145   1.00   18.12 ? 197 ARG A CB    1 
ATOM   704   C  CG    . ARG A  1 90  ? 20.936  41.702  1.528   1.00   17.75 ? 197 ARG A CG    1 
ATOM   705   C  CD    . ARG A  1 90  ? 20.515  41.791  0.085   1.00   16.15 ? 197 ARG A CD    1 
ATOM   706   N  NE    . ARG A  1 90  ? 20.613  43.161  -0.402  1.00   16.57 ? 197 ARG A NE    1 
ATOM   707   C  CZ    . ARG A  1 90  ? 19.961  43.619  -1.468  1.00   18.88 ? 197 ARG A CZ    1 
ATOM   708   N  NH1   . ARG A  1 90  ? 20.099  44.880  -1.846  1.00   17.88 ? 197 ARG A NH1   1 
ATOM   709   N  NH2   . ARG A  1 90  ? 19.161  42.817  -2.156  1.00   22.21 ? 197 ARG A NH2   1 
ATOM   710   N  N     . CYS A  1 91  ? 21.068  37.899  4.060   1.00   15.66 ? 198 CYS A N     1 
ATOM   711   C  CA    . CYS A  1 91  ? 20.613  36.651  4.640   1.00   17.14 ? 198 CYS A CA    1 
ATOM   712   C  C     . CYS A  1 91  ? 20.661  36.699  6.170   1.00   17.86 ? 198 CYS A C     1 
ATOM   713   O  O     . CYS A  1 91  ? 19.733  36.256  6.847   1.00   17.68 ? 198 CYS A O     1 
ATOM   714   C  CB    . CYS A  1 91  ? 21.467  35.495  4.113   1.00   17.65 ? 198 CYS A CB    1 
ATOM   715   S  SG    . CYS A  1 91  ? 21.272  35.214  2.339   1.00   21.06 ? 198 CYS A SG    1 
ATOM   716   N  N     . ALA A  1 92  ? 21.740  37.246  6.715   1.00   18.86 ? 199 ALA A N     1 
ATOM   717   C  CA    . ALA A  1 92  ? 21.890  37.344  8.162   1.00   19.85 ? 199 ALA A CA    1 
ATOM   718   C  C     . ALA A  1 92  ? 20.725  38.103  8.809   1.00   21.05 ? 199 ALA A C     1 
ATOM   719   O  O     . ALA A  1 92  ? 20.165  37.659  9.815   1.00   24.51 ? 199 ALA A O     1 
ATOM   720   C  CB    . ALA A  1 92  ? 23.209  38.028  8.499   1.00   16.17 ? 199 ALA A CB    1 
ATOM   721   N  N     . GLY A  1 93  ? 20.364  39.242  8.221   1.00   20.60 ? 200 GLY A N     1 
ATOM   722   C  CA    . GLY A  1 93  ? 19.274  40.056  8.740   1.00   19.24 ? 200 GLY A CA    1 
ATOM   723   C  C     . GLY A  1 93  ? 17.941  39.335  8.821   1.00   20.93 ? 200 GLY A C     1 
ATOM   724   O  O     . GLY A  1 93  ? 17.145  39.605  9.715   1.00   22.11 ? 200 GLY A O     1 
ATOM   725   N  N     . GLU A  1 94  ? 17.689  38.423  7.885   1.00   21.31 ? 201 GLU A N     1 
ATOM   726   C  CA    . GLU A  1 94  ? 16.446  37.652  7.869   1.00   19.98 ? 201 GLU A CA    1 
ATOM   727   C  C     . GLU A  1 94  ? 16.339  36.796  9.114   1.00   19.35 ? 201 GLU A C     1 
ATOM   728   O  O     . GLU A  1 94  ? 15.260  36.631  9.678   1.00   19.98 ? 201 GLU A O     1 
ATOM   729   C  CB    . GLU A  1 94  ? 16.405  36.717  6.658   1.00   21.60 ? 201 GLU A CB    1 
ATOM   730   C  CG    . GLU A  1 94  ? 16.358  37.411  5.303   1.00   21.95 ? 201 GLU A CG    1 
ATOM   731   C  CD    . GLU A  1 94  ? 16.280  36.420  4.174   1.00   20.78 ? 201 GLU A CD    1 
ATOM   732   O  OE1   . GLU A  1 94  ? 17.315  36.184  3.514   1.00   19.97 ? 201 GLU A OE1   1 
ATOM   733   O  OE2   . GLU A  1 94  ? 15.181  35.862  3.964   1.00   19.59 ? 201 GLU A OE2   1 
ATOM   734   N  N     . VAL A  1 95  ? 17.474  36.251  9.531   1.00   18.37 ? 202 VAL A N     1 
ATOM   735   C  CA    . VAL A  1 95  ? 17.528  35.372  10.685  1.00   19.21 ? 202 VAL A CA    1 
ATOM   736   C  C     . VAL A  1 95  ? 17.496  36.087  12.013  1.00   20.65 ? 202 VAL A C     1 
ATOM   737   O  O     . VAL A  1 95  ? 16.660  35.776  12.866  1.00   22.09 ? 202 VAL A O     1 
ATOM   738   C  CB    . VAL A  1 95  ? 18.805  34.492  10.658  1.00   19.48 ? 202 VAL A CB    1 
ATOM   739   C  CG1   . VAL A  1 95  ? 18.845  33.576  11.867  1.00   17.43 ? 202 VAL A CG1   1 
ATOM   740   C  CG2   . VAL A  1 95  ? 18.860  33.694  9.369   1.00   16.86 ? 202 VAL A CG2   1 
ATOM   741   N  N     . ALA A  1 96  ? 18.388  37.057  12.190  1.00   21.26 ? 203 ALA A N     1 
ATOM   742   C  CA    . ALA A  1 96  ? 18.456  37.740  13.475  1.00   21.70 ? 203 ALA A CA    1 
ATOM   743   C  C     . ALA A  1 96  ? 18.619  39.265  13.522  1.00   21.83 ? 203 ALA A C     1 
ATOM   744   O  O     . ALA A  1 96  ? 19.392  39.772  14.338  1.00   20.23 ? 203 ALA A O     1 
ATOM   745   C  CB    . ALA A  1 96  ? 19.551  37.085  14.316  1.00   20.80 ? 203 ALA A CB    1 
ATOM   746   N  N     . ALA A  1 97  ? 17.908  40.000  12.668  1.00   21.48 ? 204 ALA A N     1 
ATOM   747   C  CA    . ALA A  1 97  ? 17.993  41.458  12.720  1.00   19.06 ? 204 ALA A CA    1 
ATOM   748   C  C     . ALA A  1 97  ? 17.412  41.878  14.083  1.00   19.00 ? 204 ALA A C     1 
ATOM   749   O  O     . ALA A  1 97  ? 16.391  41.343  14.529  1.00   17.58 ? 204 ALA A O     1 
ATOM   750   C  CB    . ALA A  1 97  ? 17.191  42.077  11.587  1.00   18.29 ? 204 ALA A CB    1 
ATOM   751   N  N     . VAL A  1 98  ? 18.068  42.820  14.749  1.00   17.06 ? 205 VAL A N     1 
ATOM   752   C  CA    . VAL A  1 98  ? 17.615  43.278  16.054  1.00   15.80 ? 205 VAL A CA    1 
ATOM   753   C  C     . VAL A  1 98  ? 16.186  43.830  16.036  1.00   16.36 ? 205 VAL A C     1 
ATOM   754   O  O     . VAL A  1 98  ? 15.751  44.450  15.058  1.00   14.56 ? 205 VAL A O     1 
ATOM   755   C  CB    . VAL A  1 98  ? 18.577  44.356  16.611  1.00   18.21 ? 205 VAL A CB    1 
ATOM   756   C  CG1   . VAL A  1 98  ? 18.109  44.825  18.011  1.00   11.33 ? 205 VAL A CG1   1 
ATOM   757   C  CG2   . VAL A  1 98  ? 20.007  43.786  16.662  1.00   15.04 ? 205 VAL A CG2   1 
ATOM   758   N  N     . ALA A  1 99  ? 15.460  43.611  17.129  1.00   15.82 ? 206 ALA A N     1 
ATOM   759   C  CA    . ALA A  1 99  ? 14.086  44.078  17.233  1.00   17.96 ? 206 ALA A CA    1 
ATOM   760   C  C     . ALA A  1 99  ? 13.904  45.294  18.144  1.00   19.76 ? 206 ALA A C     1 
ATOM   761   O  O     . ALA A  1 99  ? 14.676  45.515  19.088  1.00   19.60 ? 206 ALA A O     1 
ATOM   762   C  CB    . ALA A  1 99  ? 13.197  42.939  17.715  1.00   17.15 ? 206 ALA A CB    1 
ATOM   763   N  N     . ASN A  1 100 ? 12.872  46.081  17.845  1.00   19.82 ? 207 ASN A N     1 
ATOM   764   C  CA    . ASN A  1 100 ? 12.537  47.265  18.636  1.00   17.48 ? 207 ASN A CA    1 
ATOM   765   C  C     . ASN A  1 100 ? 13.699  48.230  18.812  1.00   18.59 ? 207 ASN A C     1 
ATOM   766   O  O     . ASN A  1 100 ? 13.944  48.722  19.913  1.00   15.44 ? 207 ASN A O     1 
ATOM   767   C  CB    . ASN A  1 100 ? 12.036  46.834  20.007  1.00   15.48 ? 207 ASN A CB    1 
ATOM   768   C  CG    . ASN A  1 100 ? 10.985  45.772  19.915  1.00   15.57 ? 207 ASN A CG    1 
ATOM   769   O  OD1   . ASN A  1 100 ? 10.033  45.898  19.147  1.00   19.41 ? 207 ASN A OD1   1 
ATOM   770   N  ND2   . ASN A  1 100 ? 11.141  44.716  20.697  1.00   13.94 ? 207 ASN A ND2   1 
ATOM   771   N  N     . ASN A  1 101 ? 14.414  48.505  17.727  1.00   19.59 ? 208 ASN A N     1 
ATOM   772   C  CA    . ASN A  1 101 ? 15.540  49.414  17.803  1.00   17.02 ? 208 ASN A CA    1 
ATOM   773   C  C     . ASN A  1 101 ? 15.418  50.523  16.775  1.00   17.38 ? 208 ASN A C     1 
ATOM   774   O  O     . ASN A  1 101 ? 16.407  51.140  16.394  1.00   20.04 ? 208 ASN A O     1 
ATOM   775   C  CB    . ASN A  1 101 ? 16.853  48.638  17.632  1.00   17.83 ? 208 ASN A CB    1 
ATOM   776   C  CG    . ASN A  1 101 ? 17.072  48.116  16.217  1.00   20.34 ? 208 ASN A CG    1 
ATOM   777   O  OD1   . ASN A  1 101 ? 16.141  47.686  15.536  1.00   23.04 ? 208 ASN A OD1   1 
ATOM   778   N  ND2   . ASN A  1 101 ? 18.324  48.123  15.783  1.00   18.28 ? 208 ASN A ND2   1 
ATOM   779   N  N     . GLY A  1 102 ? 14.189  50.776  16.338  1.00   17.48 ? 209 GLY A N     1 
ATOM   780   C  CA    . GLY A  1 102 ? 13.935  51.824  15.362  1.00   16.27 ? 209 GLY A CA    1 
ATOM   781   C  C     . GLY A  1 102 ? 14.692  51.700  14.054  1.00   17.33 ? 209 GLY A C     1 
ATOM   782   O  O     . GLY A  1 102 ? 14.756  52.652  13.276  1.00   15.85 ? 209 GLY A O     1 
ATOM   783   N  N     . VAL A  1 103 ? 15.262  50.527  13.796  1.00   16.61 ? 210 VAL A N     1 
ATOM   784   C  CA    . VAL A  1 103 ? 16.008  50.323  12.566  1.00   17.42 ? 210 VAL A CA    1 
ATOM   785   C  C     . VAL A  1 103 ? 15.481  49.182  11.704  1.00   20.07 ? 210 VAL A C     1 
ATOM   786   O  O     . VAL A  1 103 ? 15.320  48.059  12.178  1.00   21.36 ? 210 VAL A O     1 
ATOM   787   C  CB    . VAL A  1 103 ? 17.490  50.053  12.866  1.00   17.08 ? 210 VAL A CB    1 
ATOM   788   C  CG1   . VAL A  1 103 ? 18.267  49.878  11.566  1.00   15.36 ? 210 VAL A CG1   1 
ATOM   789   C  CG2   . VAL A  1 103 ? 18.052  51.186  13.689  1.00   11.55 ? 210 VAL A CG2   1 
ATOM   790   N  N     . CYS A  1 104 ? 15.207  49.492  10.438  1.00   21.08 ? 211 CYS A N     1 
ATOM   791   C  CA    . CYS A  1 104 ? 14.744  48.509  9.460   1.00   22.66 ? 211 CYS A CA    1 
ATOM   792   C  C     . CYS A  1 104 ? 13.633  47.591  10.025  1.00   23.13 ? 211 CYS A C     1 
ATOM   793   O  O     . CYS A  1 104 ? 12.660  48.079  10.615  1.00   20.69 ? 211 CYS A O     1 
ATOM   794   C  CB    . CYS A  1 104 ? 15.968  47.703  9.010   1.00   24.15 ? 211 CYS A CB    1 
ATOM   795   S  SG    . CYS A  1 104 ? 15.950  46.858  7.397   1.00   31.03 ? 211 CYS A SG    1 
ATOM   796   N  N     . GLY A  1 105 ? 13.782  46.277  9.840   1.00   22.89 ? 212 GLY A N     1 
ATOM   797   C  CA    . GLY A  1 105 ? 12.792  45.332  10.340  1.00   20.47 ? 212 GLY A CA    1 
ATOM   798   C  C     . GLY A  1 105 ? 13.325  44.458  11.464  1.00   20.34 ? 212 GLY A C     1 
ATOM   799   O  O     . GLY A  1 105 ? 14.113  44.921  12.291  1.00   19.10 ? 212 GLY A O     1 
ATOM   800   N  N     . VAL A  1 106 ? 12.894  43.200  11.509  1.00   19.81 ? 213 VAL A N     1 
ATOM   801   C  CA    . VAL A  1 106 ? 13.360  42.265  12.538  1.00   20.36 ? 213 VAL A CA    1 
ATOM   802   C  C     . VAL A  1 106 ? 13.616  40.882  11.965  1.00   20.68 ? 213 VAL A C     1 
ATOM   803   O  O     . VAL A  1 106 ? 13.040  40.503  10.945  1.00   22.71 ? 213 VAL A O     1 
ATOM   804   C  CB    . VAL A  1 106 ? 12.332  42.086  13.687  1.00   20.89 ? 213 VAL A CB    1 
ATOM   805   C  CG1   . VAL A  1 106 ? 12.021  43.425  14.316  1.00   21.86 ? 213 VAL A CG1   1 
ATOM   806   C  CG2   . VAL A  1 106 ? 11.068  41.398  13.173  1.00   17.87 ? 213 VAL A CG2   1 
ATOM   807   N  N     . GLY A  1 107 ? 14.477  40.122  12.631  1.00   19.69 ? 214 GLY A N     1 
ATOM   808   C  CA    . GLY A  1 107 ? 14.749  38.775  12.173  1.00   20.49 ? 214 GLY A CA    1 
ATOM   809   C  C     . GLY A  1 107 ? 13.726  37.811  12.754  1.00   20.53 ? 214 GLY A C     1 
ATOM   810   O  O     . GLY A  1 107 ? 13.041  38.149  13.729  1.00   18.72 ? 214 GLY A O     1 
ATOM   811   N  N     . VAL A  1 108 ? 13.606  36.620  12.166  1.00   18.98 ? 215 VAL A N     1 
ATOM   812   C  CA    . VAL A  1 108 ? 12.663  35.619  12.669  1.00   18.39 ? 215 VAL A CA    1 
ATOM   813   C  C     . VAL A  1 108 ? 13.021  35.292  14.124  1.00   18.92 ? 215 VAL A C     1 
ATOM   814   O  O     . VAL A  1 108 ? 12.144  35.205  14.982  1.00   18.79 ? 215 VAL A O     1 
ATOM   815   C  CB    . VAL A  1 108 ? 12.716  34.333  11.815  1.00   16.68 ? 215 VAL A CB    1 
ATOM   816   C  CG1   . VAL A  1 108 ? 11.986  33.214  12.506  1.00   17.56 ? 215 VAL A CG1   1 
ATOM   817   C  CG2   . VAL A  1 108 ? 12.088  34.589  10.463  1.00   15.50 ? 215 VAL A CG2   1 
ATOM   818   N  N     . ALA A  1 109 ? 14.314  35.110  14.381  1.00   17.89 ? 216 ALA A N     1 
ATOM   819   C  CA    . ALA A  1 109 ? 14.822  34.825  15.718  1.00   15.71 ? 216 ALA A CA    1 
ATOM   820   C  C     . ALA A  1 109 ? 15.622  36.064  16.142  1.00   17.29 ? 216 ALA A C     1 
ATOM   821   O  O     . ALA A  1 109 ? 16.852  36.032  16.198  1.00   18.33 ? 216 ALA A O     1 
ATOM   822   C  CB    . ALA A  1 109 ? 15.723  33.607  15.674  1.00   11.80 ? 216 ALA A CB    1 
ATOM   823   N  N     . TYR A  1 110 ? 14.917  37.153  16.440  1.00   16.85 ? 217 TYR A N     1 
ATOM   824   C  CA    . TYR A  1 110 ? 15.567  38.405  16.803  1.00   19.02 ? 217 TYR A CA    1 
ATOM   825   C  C     . TYR A  1 110 ? 16.347  38.442  18.111  1.00   19.98 ? 217 TYR A C     1 
ATOM   826   O  O     . TYR A  1 110 ? 16.912  39.476  18.470  1.00   21.51 ? 217 TYR A O     1 
ATOM   827   C  CB    . TYR A  1 110 ? 14.561  39.567  16.750  1.00   19.43 ? 217 TYR A CB    1 
ATOM   828   C  CG    . TYR A  1 110 ? 13.355  39.462  17.679  1.00   19.15 ? 217 TYR A CG    1 
ATOM   829   C  CD1   . TYR A  1 110 ? 13.487  39.608  19.068  1.00   17.49 ? 217 TYR A CD1   1 
ATOM   830   C  CD2   . TYR A  1 110 ? 12.072  39.315  17.157  1.00   17.73 ? 217 TYR A CD2   1 
ATOM   831   C  CE1   . TYR A  1 110 ? 12.366  39.624  19.907  1.00   15.51 ? 217 TYR A CE1   1 
ATOM   832   C  CE2   . TYR A  1 110 ? 10.946  39.331  17.985  1.00   18.08 ? 217 TYR A CE2   1 
ATOM   833   C  CZ    . TYR A  1 110 ? 11.095  39.491  19.355  1.00   18.28 ? 217 TYR A CZ    1 
ATOM   834   O  OH    . TYR A  1 110 ? 9.968   39.558  20.156  1.00   13.67 ? 217 TYR A OH    1 
ATOM   835   N  N     . ASN A  1 111 ? 16.384  37.326  18.829  1.00   20.66 ? 218 ASN A N     1 
ATOM   836   C  CA    . ASN A  1 111 ? 17.158  37.272  20.069  1.00   22.48 ? 218 ASN A CA    1 
ATOM   837   C  C     . ASN A  1 111 ? 18.272  36.239  19.960  1.00   20.92 ? 218 ASN A C     1 
ATOM   838   O  O     . ASN A  1 111 ? 18.997  36.000  20.930  1.00   20.65 ? 218 ASN A O     1 
ATOM   839   C  CB    . ASN A  1 111 ? 16.280  36.932  21.274  1.00   23.19 ? 218 ASN A CB    1 
ATOM   840   C  CG    . ASN A  1 111 ? 15.712  38.159  21.941  1.00   24.45 ? 218 ASN A CG    1 
ATOM   841   O  OD1   . ASN A  1 111 ? 16.430  39.132  22.188  1.00   23.44 ? 218 ASN A OD1   1 
ATOM   842   N  ND2   . ASN A  1 111 ? 14.415  38.122  22.248  1.00   22.28 ? 218 ASN A ND2   1 
ATOM   843   N  N     . ALA A  1 112 ? 18.397  35.630  18.781  1.00   18.27 ? 219 ALA A N     1 
ATOM   844   C  CA    . ALA A  1 112 ? 19.430  34.629  18.534  1.00   18.66 ? 219 ALA A CA    1 
ATOM   845   C  C     . ALA A  1 112 ? 20.764  35.327  18.247  1.00   18.58 ? 219 ALA A C     1 
ATOM   846   O  O     . ALA A  1 112 ? 20.796  36.509  17.894  1.00   16.28 ? 219 ALA A O     1 
ATOM   847   C  CB    . ALA A  1 112 ? 19.039  33.747  17.341  1.00   15.27 ? 219 ALA A CB    1 
ATOM   848   N  N     . ARG A  1 113 ? 21.864  34.603  18.416  1.00   14.93 ? 220 ARG A N     1 
ATOM   849   C  CA    . ARG A  1 113 ? 23.160  35.171  18.125  1.00   18.06 ? 220 ARG A CA    1 
ATOM   850   C  C     . ARG A  1 113 ? 23.464  34.793  16.687  1.00   17.40 ? 220 ARG A C     1 
ATOM   851   O  O     . ARG A  1 113 ? 23.298  33.643  16.293  1.00   13.55 ? 220 ARG A O     1 
ATOM   852   C  CB    . ARG A  1 113 ? 24.214  34.627  19.080  1.00   21.85 ? 220 ARG A CB    1 
ATOM   853   C  CG    . ARG A  1 113 ? 24.199  35.318  20.427  1.00   26.93 ? 220 ARG A CG    1 
ATOM   854   C  CD    . ARG A  1 113 ? 24.711  34.383  21.493  1.00   35.00 ? 220 ARG A CD    1 
ATOM   855   N  NE    . ARG A  1 113 ? 26.170  34.339  21.580  1.00   38.38 ? 220 ARG A NE    1 
ATOM   856   C  CZ    . ARG A  1 113 ? 26.840  33.370  22.202  1.00   39.64 ? 220 ARG A CZ    1 
ATOM   857   N  NH1   . ARG A  1 113 ? 28.166  33.401  22.251  1.00   40.42 ? 220 ARG A NH1   1 
ATOM   858   N  NH2   . ARG A  1 113 ? 26.182  32.353  22.756  1.00   38.07 ? 220 ARG A NH2   1 
ATOM   859   N  N     . ILE A  1 114 ? 23.891  35.777  15.905  1.00   18.12 ? 221 ILE A N     1 
ATOM   860   C  CA    . ILE A  1 114 ? 24.164  35.566  14.499  1.00   19.26 ? 221 ILE A CA    1 
ATOM   861   C  C     . ILE A  1 114 ? 25.627  35.762  14.171  1.00   19.85 ? 221 ILE A C     1 
ATOM   862   O  O     . ILE A  1 114 ? 26.258  36.718  14.606  1.00   20.55 ? 221 ILE A O     1 
ATOM   863   C  CB    . ILE A  1 114 ? 23.322  36.540  13.636  1.00   20.56 ? 221 ILE A CB    1 
ATOM   864   C  CG1   . ILE A  1 114 ? 23.503  36.224  12.153  1.00   19.39 ? 221 ILE A CG1   1 
ATOM   865   C  CG2   . ILE A  1 114 ? 23.722  37.982  13.942  1.00   20.84 ? 221 ILE A CG2   1 
ATOM   866   C  CD1   . ILE A  1 114 ? 22.719  35.033  11.691  1.00   21.37 ? 221 ILE A CD1   1 
ATOM   867   N  N     . GLY A  1 115 ? 26.165  34.832  13.400  1.00   22.65 ? 222 GLY A N     1 
ATOM   868   C  CA    . GLY A  1 115 ? 27.552  34.911  12.995  1.00   22.12 ? 222 GLY A CA    1 
ATOM   869   C  C     . GLY A  1 115 ? 27.629  34.747  11.491  1.00   21.87 ? 222 GLY A C     1 
ATOM   870   O  O     . GLY A  1 115 ? 26.626  34.452  10.835  1.00   22.83 ? 222 GLY A O     1 
ATOM   871   N  N     . GLY A  1 116 ? 28.817  34.941  10.938  1.00   20.62 ? 223 GLY A N     1 
ATOM   872   C  CA    . GLY A  1 116 ? 28.975  34.792  9.507   1.00   19.22 ? 223 GLY A CA    1 
ATOM   873   C  C     . GLY A  1 116 ? 30.336  34.254  9.114   1.00   18.04 ? 223 GLY A C     1 
ATOM   874   O  O     . GLY A  1 116 ? 31.343  34.597  9.732   1.00   18.36 ? 223 GLY A O     1 
ATOM   875   N  N     . VAL A  1 117 ? 30.365  33.388  8.106   1.00   13.94 ? 224 VAL A N     1 
ATOM   876   C  CA    . VAL A  1 117 ? 31.616  32.838  7.614   1.00   12.76 ? 224 VAL A CA    1 
ATOM   877   C  C     . VAL A  1 117 ? 31.821  33.360  6.203   1.00   16.12 ? 224 VAL A C     1 
ATOM   878   O  O     . VAL A  1 117 ? 31.055  33.037  5.296   1.00   17.81 ? 224 VAL A O     1 
ATOM   879   C  CB    . VAL A  1 117 ? 31.618  31.281  7.535   1.00   12.56 ? 224 VAL A CB    1 
ATOM   880   C  CG1   . VAL A  1 117 ? 32.935  30.805  6.909   1.00   5.39  ? 224 VAL A CG1   1 
ATOM   881   C  CG2   . VAL A  1 117 ? 31.430  30.662  8.915   1.00   6.72  ? 224 VAL A CG2   1 
ATOM   882   N  N     . ARG A  1 118 ? 32.844  34.185  6.020   1.00   17.57 ? 225 ARG A N     1 
ATOM   883   C  CA    . ARG A  1 118 ? 33.138  34.727  4.701   1.00   16.83 ? 225 ARG A CA    1 
ATOM   884   C  C     . ARG A  1 118 ? 33.847  33.614  3.933   1.00   17.74 ? 225 ARG A C     1 
ATOM   885   O  O     . ARG A  1 118 ? 35.004  33.303  4.213   1.00   18.95 ? 225 ARG A O     1 
ATOM   886   C  CB    . ARG A  1 118 ? 34.036  35.970  4.830   1.00   15.94 ? 225 ARG A CB    1 
ATOM   887   C  CG    . ARG A  1 118 ? 34.439  36.626  3.503   1.00   14.63 ? 225 ARG A CG    1 
ATOM   888   C  CD    . ARG A  1 118 ? 35.026  38.013  3.743   1.00   16.96 ? 225 ARG A CD    1 
ATOM   889   N  NE    . ARG A  1 118 ? 35.499  38.647  2.513   1.00   20.78 ? 225 ARG A NE    1 
ATOM   890   C  CZ    . ARG A  1 118 ? 36.752  38.585  2.068   1.00   21.12 ? 225 ARG A CZ    1 
ATOM   891   N  NH1   . ARG A  1 118 ? 37.094  39.188  0.938   1.00   18.73 ? 225 ARG A NH1   1 
ATOM   892   N  NH2   . ARG A  1 118 ? 37.667  37.928  2.764   1.00   20.96 ? 225 ARG A NH2   1 
ATOM   893   N  N     . MET A  1 119 ? 33.146  32.994  2.987   1.00   17.36 ? 226 MET A N     1 
ATOM   894   C  CA    . MET A  1 119 ? 33.744  31.920  2.205   1.00   17.11 ? 226 MET A CA    1 
ATOM   895   C  C     . MET A  1 119 ? 33.352  31.852  0.733   1.00   17.34 ? 226 MET A C     1 
ATOM   896   O  O     . MET A  1 119 ? 33.823  30.981  0.013   1.00   18.93 ? 226 MET A O     1 
ATOM   897   C  CB    . MET A  1 119 ? 33.491  30.567  2.882   1.00   17.48 ? 226 MET A CB    1 
ATOM   898   C  CG    . MET A  1 119 ? 32.066  30.321  3.357   1.00   20.88 ? 226 MET A CG    1 
ATOM   899   S  SD    . MET A  1 119 ? 30.894  29.944  2.041   1.00   21.29 ? 226 MET A SD    1 
ATOM   900   C  CE    . MET A  1 119 ? 31.434  28.366  1.528   1.00   20.84 ? 226 MET A CE    1 
ATOM   901   N  N     . LEU A  1 120 ? 32.505  32.767  0.271   1.00   17.71 ? 227 LEU A N     1 
ATOM   902   C  CA    . LEU A  1 120 ? 32.103  32.771  -1.141  1.00   18.48 ? 227 LEU A CA    1 
ATOM   903   C  C     . LEU A  1 120 ? 32.912  33.765  -1.967  1.00   19.39 ? 227 LEU A C     1 
ATOM   904   O  O     . LEU A  1 120 ? 32.934  33.680  -3.196  1.00   17.17 ? 227 LEU A O     1 
ATOM   905   C  CB    . LEU A  1 120 ? 30.616  33.118  -1.301  1.00   16.01 ? 227 LEU A CB    1 
ATOM   906   C  CG    . LEU A  1 120 ? 29.550  32.104  -0.890  1.00   17.28 ? 227 LEU A CG    1 
ATOM   907   C  CD1   . LEU A  1 120 ? 28.183  32.638  -1.256  1.00   15.61 ? 227 LEU A CD1   1 
ATOM   908   C  CD2   . LEU A  1 120 ? 29.805  30.768  -1.580  1.00   18.13 ? 227 LEU A CD2   1 
ATOM   909   N  N     . ASP A  1 121 ? 33.569  34.705  -1.287  1.00   20.65 ? 228 ASP A N     1 
ATOM   910   C  CA    . ASP A  1 121 ? 34.352  35.750  -1.946  1.00   20.31 ? 228 ASP A CA    1 
ATOM   911   C  C     . ASP A  1 121 ? 35.799  35.323  -2.148  1.00   21.99 ? 228 ASP A C     1 
ATOM   912   O  O     . ASP A  1 121 ? 36.712  35.828  -1.500  1.00   24.66 ? 228 ASP A O     1 
ATOM   913   C  CB    . ASP A  1 121 ? 34.284  37.033  -1.113  1.00   19.19 ? 228 ASP A CB    1 
ATOM   914   C  CG    . ASP A  1 121 ? 34.749  38.249  -1.874  1.00   20.55 ? 228 ASP A CG    1 
ATOM   915   O  OD1   . ASP A  1 121 ? 34.716  38.221  -3.121  1.00   20.97 ? 228 ASP A OD1   1 
ATOM   916   O  OD2   . ASP A  1 121 ? 35.127  39.244  -1.229  1.00   22.76 ? 228 ASP A OD2   1 
ATOM   917   N  N     . GLY A  1 122 ? 35.994  34.391  -3.068  1.00   21.75 ? 229 GLY A N     1 
ATOM   918   C  CA    . GLY A  1 122 ? 37.316  33.873  -3.361  1.00   21.83 ? 229 GLY A CA    1 
ATOM   919   C  C     . GLY A  1 122 ? 37.135  32.519  -4.019  1.00   23.25 ? 229 GLY A C     1 
ATOM   920   O  O     . GLY A  1 122 ? 36.028  32.182  -4.452  1.00   22.99 ? 229 GLY A O     1 
ATOM   921   N  N     . GLU A  1 123 ? 38.199  31.731  -4.112  1.00   24.65 ? 230 GLU A N     1 
ATOM   922   C  CA    . GLU A  1 123 ? 38.064  30.419  -4.726  1.00   26.47 ? 230 GLU A CA    1 
ATOM   923   C  C     . GLU A  1 123 ? 37.391  29.520  -3.694  1.00   27.76 ? 230 GLU A C     1 
ATOM   924   O  O     . GLU A  1 123 ? 37.912  29.345  -2.591  1.00   29.48 ? 230 GLU A O     1 
ATOM   925   C  CB    . GLU A  1 123 ? 39.424  29.845  -5.108  1.00   26.96 ? 230 GLU A CB    1 
ATOM   926   C  CG    . GLU A  1 123 ? 39.392  29.106  -6.440  1.00   35.41 ? 230 GLU A CG    1 
ATOM   927   C  CD    . GLU A  1 123 ? 40.465  28.015  -6.554  1.00   42.29 ? 230 GLU A CD    1 
ATOM   928   O  OE1   . GLU A  1 123 ? 41.656  28.285  -6.242  1.00   42.34 ? 230 GLU A OE1   1 
ATOM   929   O  OE2   . GLU A  1 123 ? 40.108  26.881  -6.962  1.00   40.68 ? 230 GLU A OE2   1 
ATOM   930   N  N     . VAL A  1 124 ? 36.226  28.978  -4.042  1.00   27.26 ? 231 VAL A N     1 
ATOM   931   C  CA    . VAL A  1 124 ? 35.484  28.097  -3.141  1.00   25.34 ? 231 VAL A CA    1 
ATOM   932   C  C     . VAL A  1 124 ? 35.919  26.646  -3.358  1.00   24.80 ? 231 VAL A C     1 
ATOM   933   O  O     . VAL A  1 124 ? 35.334  25.924  -4.170  1.00   21.78 ? 231 VAL A O     1 
ATOM   934   C  CB    . VAL A  1 124 ? 33.956  28.197  -3.395  1.00   24.95 ? 231 VAL A CB    1 
ATOM   935   C  CG1   . VAL A  1 124 ? 33.207  27.301  -2.431  1.00   20.93 ? 231 VAL A CG1   1 
ATOM   936   C  CG2   . VAL A  1 124 ? 33.501  29.647  -3.268  1.00   21.77 ? 231 VAL A CG2   1 
ATOM   937   N  N     . THR A  1 125 ? 36.947  26.223  -2.628  1.00   24.09 ? 232 THR A N     1 
ATOM   938   C  CA    . THR A  1 125 ? 37.457  24.868  -2.753  1.00   22.72 ? 232 THR A CA    1 
ATOM   939   C  C     . THR A  1 125 ? 36.786  23.937  -1.749  1.00   23.17 ? 232 THR A C     1 
ATOM   940   O  O     . THR A  1 125 ? 35.988  24.370  -0.914  1.00   22.55 ? 232 THR A O     1 
ATOM   941   C  CB    . THR A  1 125 ? 38.982  24.842  -2.524  1.00   24.32 ? 232 THR A CB    1 
ATOM   942   O  OG1   . THR A  1 125 ? 39.282  25.253  -1.186  1.00   27.19 ? 232 THR A OG1   1 
ATOM   943   C  CG2   . THR A  1 125 ? 39.661  25.810  -3.464  1.00   22.03 ? 232 THR A CG2   1 
ATOM   944   N  N     . ASP A  1 126 ? 37.118  22.655  -1.837  1.00   23.47 ? 233 ASP A N     1 
ATOM   945   C  CA    . ASP A  1 126 ? 36.566  21.658  -0.939  1.00   20.84 ? 233 ASP A CA    1 
ATOM   946   C  C     . ASP A  1 126 ? 36.987  22.005  0.487   1.00   20.61 ? 233 ASP A C     1 
ATOM   947   O  O     . ASP A  1 126 ? 36.172  21.998  1.410   1.00   22.12 ? 233 ASP A O     1 
ATOM   948   C  CB    . ASP A  1 126 ? 37.067  20.274  -1.344  1.00   18.83 ? 233 ASP A CB    1 
ATOM   949   C  CG    . ASP A  1 126 ? 36.469  19.172  -0.501  1.00   22.41 ? 233 ASP A CG    1 
ATOM   950   O  OD1   . ASP A  1 126 ? 35.269  19.276  -0.158  1.00   23.65 ? 233 ASP A OD1   1 
ATOM   951   O  OD2   . ASP A  1 126 ? 37.191  18.195  -0.193  1.00   23.64 ? 233 ASP A OD2   1 
ATOM   952   N  N     . ALA A  1 127 ? 38.259  22.338  0.662   1.00   20.02 ? 234 ALA A N     1 
ATOM   953   C  CA    . ALA A  1 127 ? 38.763  22.697  1.981   1.00   20.20 ? 234 ALA A CA    1 
ATOM   954   C  C     . ALA A  1 127 ? 38.031  23.915  2.506   1.00   19.73 ? 234 ALA A C     1 
ATOM   955   O  O     . ALA A  1 127 ? 37.745  24.002  3.700   1.00   20.07 ? 234 ALA A O     1 
ATOM   956   C  CB    . ALA A  1 127 ? 40.263  22.979  1.922   1.00   17.33 ? 234 ALA A CB    1 
ATOM   957   N  N     . VAL A  1 128 ? 37.724  24.856  1.616   1.00   17.79 ? 235 VAL A N     1 
ATOM   958   C  CA    . VAL A  1 128 ? 37.017  26.057  2.029   1.00   17.39 ? 235 VAL A CA    1 
ATOM   959   C  C     . VAL A  1 128 ? 35.641  25.694  2.561   1.00   19.22 ? 235 VAL A C     1 
ATOM   960   O  O     . VAL A  1 128 ? 35.256  26.121  3.648   1.00   22.64 ? 235 VAL A O     1 
ATOM   961   C  CB    . VAL A  1 128 ? 36.867  27.059  0.868   1.00   18.74 ? 235 VAL A CB    1 
ATOM   962   C  CG1   . VAL A  1 128 ? 35.926  28.190  1.270   1.00   16.12 ? 235 VAL A CG1   1 
ATOM   963   C  CG2   . VAL A  1 128 ? 38.221  27.637  0.519   1.00   18.16 ? 235 VAL A CG2   1 
ATOM   964   N  N     . GLU A  1 129 ? 34.900  24.898  1.803   1.00   18.42 ? 236 GLU A N     1 
ATOM   965   C  CA    . GLU A  1 129 ? 33.573  24.492  2.235   1.00   17.72 ? 236 GLU A CA    1 
ATOM   966   C  C     . GLU A  1 129 ? 33.655  23.721  3.555   1.00   18.81 ? 236 GLU A C     1 
ATOM   967   O  O     . GLU A  1 129 ? 32.895  23.981  4.489   1.00   16.86 ? 236 GLU A O     1 
ATOM   968   C  CB    . GLU A  1 129 ? 32.916  23.618  1.163   1.00   15.72 ? 236 GLU A CB    1 
ATOM   969   C  CG    . GLU A  1 129 ? 32.348  24.404  -0.016  1.00   17.02 ? 236 GLU A CG    1 
ATOM   970   C  CD    . GLU A  1 129 ? 31.996  23.527  -1.210  1.00   17.82 ? 236 GLU A CD    1 
ATOM   971   O  OE1   . GLU A  1 129 ? 31.746  22.311  -1.009  1.00   13.33 ? 236 GLU A OE1   1 
ATOM   972   O  OE2   . GLU A  1 129 ? 31.956  24.057  -2.345  1.00   18.41 ? 236 GLU A OE2   1 
ATOM   973   N  N     . ALA A  1 130 ? 34.594  22.783  3.631   1.00   18.34 ? 237 ALA A N     1 
ATOM   974   C  CA    . ALA A  1 130 ? 34.756  21.951  4.815   1.00   16.11 ? 237 ALA A CA    1 
ATOM   975   C  C     . ALA A  1 130 ? 35.026  22.736  6.089   1.00   15.91 ? 237 ALA A C     1 
ATOM   976   O  O     . ALA A  1 130 ? 34.468  22.435  7.142   1.00   12.88 ? 237 ALA A O     1 
ATOM   977   C  CB    . ALA A  1 130 ? 35.857  20.945  4.582   1.00   14.19 ? 237 ALA A CB    1 
ATOM   978   N  N     . ARG A  1 131 ? 35.882  23.745  6.004   1.00   17.14 ? 238 ARG A N     1 
ATOM   979   C  CA    . ARG A  1 131 ? 36.188  24.538  7.187   1.00   18.35 ? 238 ARG A CA    1 
ATOM   980   C  C     . ARG A  1 131 ? 34.983  25.388  7.605   1.00   17.46 ? 238 ARG A C     1 
ATOM   981   O  O     . ARG A  1 131 ? 34.772  25.647  8.788   1.00   20.64 ? 238 ARG A O     1 
ATOM   982   C  CB    . ARG A  1 131 ? 37.415  25.423  6.930   1.00   19.44 ? 238 ARG A CB    1 
ATOM   983   C  CG    . ARG A  1 131 ? 38.698  24.650  6.637   1.00   23.69 ? 238 ARG A CG    1 
ATOM   984   C  CD    . ARG A  1 131 ? 39.884  25.580  6.576   1.00   25.31 ? 238 ARG A CD    1 
ATOM   985   N  NE    . ARG A  1 131 ? 40.168  26.107  7.904   1.00   34.45 ? 238 ARG A NE    1 
ATOM   986   C  CZ    . ARG A  1 131 ? 40.574  27.354  8.151   1.00   40.16 ? 238 ARG A CZ    1 
ATOM   987   N  NH1   . ARG A  1 131 ? 40.806  27.730  9.408   1.00   40.60 ? 238 ARG A NH1   1 
ATOM   988   N  NH2   . ARG A  1 131 ? 40.741  28.231  7.152   1.00   38.43 ? 238 ARG A NH2   1 
ATOM   989   N  N     . SER A  1 132 ? 34.189  25.816  6.632   1.00   14.94 ? 239 SER A N     1 
ATOM   990   C  CA    . SER A  1 132 ? 33.009  26.618  6.918   1.00   14.38 ? 239 SER A CA    1 
ATOM   991   C  C     . SER A  1 132 ? 31.924  25.751  7.553   1.00   15.17 ? 239 SER A C     1 
ATOM   992   O  O     . SER A  1 132 ? 31.382  26.096  8.594   1.00   14.53 ? 239 SER A O     1 
ATOM   993   C  CB    . SER A  1 132 ? 32.473  27.245  5.630   1.00   15.89 ? 239 SER A CB    1 
ATOM   994   O  OG    . SER A  1 132 ? 33.455  28.044  4.984   1.00   16.22 ? 239 SER A OG    1 
ATOM   995   N  N     . LEU A  1 133 ? 31.617  24.622  6.922   1.00   15.94 ? 240 LEU A N     1 
ATOM   996   C  CA    . LEU A  1 133 ? 30.593  23.708  7.429   1.00   17.26 ? 240 LEU A CA    1 
ATOM   997   C  C     . LEU A  1 133 ? 30.977  23.126  8.781   1.00   18.70 ? 240 LEU A C     1 
ATOM   998   O  O     . LEU A  1 133 ? 30.104  22.802  9.598   1.00   20.41 ? 240 LEU A O     1 
ATOM   999   C  CB    . LEU A  1 133 ? 30.357  22.564  6.429   1.00   14.44 ? 240 LEU A CB    1 
ATOM   1000  C  CG    . LEU A  1 133 ? 29.773  22.978  5.069   1.00   12.34 ? 240 LEU A CG    1 
ATOM   1001  C  CD1   . LEU A  1 133 ? 29.875  21.838  4.082   1.00   8.33  ? 240 LEU A CD1   1 
ATOM   1002  C  CD2   . LEU A  1 133 ? 28.327  23.421  5.238   1.00   11.06 ? 240 LEU A CD2   1 
ATOM   1003  N  N     . GLY A  1 134 ? 32.280  23.007  9.022   1.00   19.73 ? 241 GLY A N     1 
ATOM   1004  C  CA    . GLY A  1 134 ? 32.742  22.438  10.274  1.00   19.10 ? 241 GLY A CA    1 
ATOM   1005  C  C     . GLY A  1 134 ? 33.256  23.434  11.292  1.00   18.71 ? 241 GLY A C     1 
ATOM   1006  O  O     . GLY A  1 134 ? 33.981  23.059  12.207  1.00   19.78 ? 241 GLY A O     1 
ATOM   1007  N  N     . LEU A  1 135 ? 32.884  24.698  11.143  1.00   17.52 ? 242 LEU A N     1 
ATOM   1008  C  CA    . LEU A  1 135 ? 33.318  25.735  12.072  1.00   19.05 ? 242 LEU A CA    1 
ATOM   1009  C  C     . LEU A  1 135 ? 32.591  25.631  13.408  1.00   19.70 ? 242 LEU A C     1 
ATOM   1010  O  O     . LEU A  1 135 ? 31.366  25.666  13.440  1.00   22.49 ? 242 LEU A O     1 
ATOM   1011  C  CB    . LEU A  1 135 ? 33.046  27.112  11.463  1.00   16.53 ? 242 LEU A CB    1 
ATOM   1012  C  CG    . LEU A  1 135 ? 33.345  28.322  12.344  1.00   16.11 ? 242 LEU A CG    1 
ATOM   1013  C  CD1   . LEU A  1 135 ? 34.840  28.426  12.557  1.00   17.07 ? 242 LEU A CD1   1 
ATOM   1014  C  CD2   . LEU A  1 135 ? 32.809  29.577  11.699  1.00   16.00 ? 242 LEU A CD2   1 
ATOM   1015  N  N     . ASN A  1 136 ? 33.339  25.505  14.503  1.00   19.84 ? 243 ASN A N     1 
ATOM   1016  C  CA    . ASN A  1 136 ? 32.741  25.432  15.840  1.00   22.24 ? 243 ASN A CA    1 
ATOM   1017  C  C     . ASN A  1 136 ? 31.472  24.614  15.989  1.00   22.40 ? 243 ASN A C     1 
ATOM   1018  O  O     . ASN A  1 136 ? 30.447  25.138  16.441  1.00   22.74 ? 243 ASN A O     1 
ATOM   1019  C  CB    . ASN A  1 136 ? 32.411  26.824  16.349  1.00   26.76 ? 243 ASN A CB    1 
ATOM   1020  C  CG    . ASN A  1 136 ? 33.537  27.432  17.096  1.00   29.17 ? 243 ASN A CG    1 
ATOM   1021  O  OD1   . ASN A  1 136 ? 34.353  28.159  16.529  1.00   35.04 ? 243 ASN A OD1   1 
ATOM   1022  N  ND2   . ASN A  1 136 ? 33.614  27.125  18.383  1.00   27.96 ? 243 ASN A ND2   1 
ATOM   1023  N  N     . PRO A  1 137 ? 31.520  23.324  15.644  1.00   19.74 ? 244 PRO A N     1 
ATOM   1024  C  CA    . PRO A  1 137 ? 30.348  22.452  15.751  1.00   20.19 ? 244 PRO A CA    1 
ATOM   1025  C  C     . PRO A  1 137 ? 29.702  22.442  17.140  1.00   18.96 ? 244 PRO A C     1 
ATOM   1026  O  O     . PRO A  1 137 ? 28.527  22.124  17.273  1.00   20.58 ? 244 PRO A O     1 
ATOM   1027  C  CB    . PRO A  1 137 ? 30.904  21.086  15.378  1.00   21.28 ? 244 PRO A CB    1 
ATOM   1028  C  CG    . PRO A  1 137 ? 32.059  21.430  14.487  1.00   20.32 ? 244 PRO A CG    1 
ATOM   1029  C  CD    . PRO A  1 137 ? 32.696  22.558  15.222  1.00   17.55 ? 244 PRO A CD    1 
ATOM   1030  N  N     . ASN A  1 138 ? 30.459  22.795  18.174  1.00   17.16 ? 245 ASN A N     1 
ATOM   1031  C  CA    . ASN A  1 138 ? 29.899  22.790  19.515  1.00   20.14 ? 245 ASN A CA    1 
ATOM   1032  C  C     . ASN A  1 138 ? 29.474  24.144  20.037  1.00   20.03 ? 245 ASN A C     1 
ATOM   1033  O  O     . ASN A  1 138 ? 29.054  24.263  21.189  1.00   20.32 ? 245 ASN A O     1 
ATOM   1034  C  CB    . ASN A  1 138 ? 30.857  22.124  20.497  1.00   21.61 ? 245 ASN A CB    1 
ATOM   1035  C  CG    . ASN A  1 138 ? 31.054  20.649  20.196  1.00   27.92 ? 245 ASN A CG    1 
ATOM   1036  O  OD1   . ASN A  1 138 ? 30.087  19.869  20.158  1.00   28.94 ? 245 ASN A OD1   1 
ATOM   1037  N  ND2   . ASN A  1 138 ? 32.305  20.255  19.973  1.00   28.97 ? 245 ASN A ND2   1 
ATOM   1038  N  N     . HIS A  1 139 ? 29.577  25.165  19.196  1.00   18.29 ? 246 HIS A N     1 
ATOM   1039  C  CA    . HIS A  1 139 ? 29.136  26.491  19.591  1.00   15.90 ? 246 HIS A CA    1 
ATOM   1040  C  C     . HIS A  1 139 ? 27.947  26.887  18.712  1.00   18.20 ? 246 HIS A C     1 
ATOM   1041  O  O     . HIS A  1 139 ? 26.924  27.364  19.210  1.00   16.55 ? 246 HIS A O     1 
ATOM   1042  C  CB    . HIS A  1 139 ? 30.251  27.506  19.419  1.00   13.31 ? 246 HIS A CB    1 
ATOM   1043  C  CG    . HIS A  1 139 ? 29.829  28.899  19.743  1.00   14.39 ? 246 HIS A CG    1 
ATOM   1044  N  ND1   . HIS A  1 139 ? 29.436  29.277  21.009  1.00   15.55 ? 246 HIS A ND1   1 
ATOM   1045  C  CD2   . HIS A  1 139 ? 29.689  29.995  18.962  1.00   16.25 ? 246 HIS A CD2   1 
ATOM   1046  C  CE1   . HIS A  1 139 ? 29.072  30.546  20.995  1.00   16.71 ? 246 HIS A CE1   1 
ATOM   1047  N  NE2   . HIS A  1 139 ? 29.216  31.006  19.765  1.00   18.99 ? 246 HIS A NE2   1 
ATOM   1048  N  N     . ILE A  1 140 ? 28.103  26.671  17.404  1.00   18.21 ? 247 ILE A N     1 
ATOM   1049  C  CA    . ILE A  1 140 ? 27.090  26.987  16.400  1.00   17.04 ? 247 ILE A CA    1 
ATOM   1050  C  C     . ILE A  1 140 ? 26.063  25.872  16.337  1.00   17.29 ? 247 ILE A C     1 
ATOM   1051  O  O     . ILE A  1 140 ? 26.431  24.706  16.241  1.00   18.74 ? 247 ILE A O     1 
ATOM   1052  C  CB    . ILE A  1 140 ? 27.739  27.118  14.990  1.00   16.12 ? 247 ILE A CB    1 
ATOM   1053  C  CG1   . ILE A  1 140 ? 28.775  28.246  15.000  1.00   16.12 ? 247 ILE A CG1   1 
ATOM   1054  C  CG2   . ILE A  1 140 ? 26.678  27.345  13.919  1.00   12.57 ? 247 ILE A CG2   1 
ATOM   1055  C  CD1   . ILE A  1 140 ? 29.406  28.528  13.654  1.00   13.14 ? 247 ILE A CD1   1 
ATOM   1056  N  N     . HIS A  1 141 ? 24.781  26.222  16.385  1.00   17.41 ? 248 HIS A N     1 
ATOM   1057  C  CA    . HIS A  1 141 ? 23.728  25.215  16.318  1.00   18.29 ? 248 HIS A CA    1 
ATOM   1058  C  C     . HIS A  1 141 ? 23.234  25.007  14.897  1.00   18.69 ? 248 HIS A C     1 
ATOM   1059  O  O     . HIS A  1 141 ? 23.099  23.878  14.435  1.00   19.47 ? 248 HIS A O     1 
ATOM   1060  C  CB    . HIS A  1 141 ? 22.518  25.617  17.172  1.00   19.47 ? 248 HIS A CB    1 
ATOM   1061  C  CG    . HIS A  1 141 ? 22.856  25.909  18.596  1.00   23.10 ? 248 HIS A CG    1 
ATOM   1062  N  ND1   . HIS A  1 141 ? 22.973  27.191  19.083  1.00   24.55 ? 248 HIS A ND1   1 
ATOM   1063  C  CD2   . HIS A  1 141 ? 23.124  25.084  19.635  1.00   22.05 ? 248 HIS A CD2   1 
ATOM   1064  C  CE1   . HIS A  1 141 ? 23.298  27.143  20.362  1.00   23.66 ? 248 HIS A CE1   1 
ATOM   1065  N  NE2   . HIS A  1 141 ? 23.397  25.877  20.720  1.00   20.12 ? 248 HIS A NE2   1 
ATOM   1066  N  N     . ILE A  1 142 ? 22.974  26.112  14.209  1.00   17.69 ? 249 ILE A N     1 
ATOM   1067  C  CA    . ILE A  1 142 ? 22.426  26.081  12.869  1.00   17.21 ? 249 ILE A CA    1 
ATOM   1068  C  C     . ILE A  1 142 ? 23.298  26.766  11.829  1.00   18.10 ? 249 ILE A C     1 
ATOM   1069  O  O     . ILE A  1 142 ? 23.785  27.874  12.051  1.00   21.74 ? 249 ILE A O     1 
ATOM   1070  C  CB    . ILE A  1 142 ? 21.044  26.764  12.880  1.00   19.69 ? 249 ILE A CB    1 
ATOM   1071  C  CG1   . ILE A  1 142 ? 20.104  25.987  13.802  1.00   19.49 ? 249 ILE A CG1   1 
ATOM   1072  C  CG2   . ILE A  1 142 ? 20.490  26.888  11.466  1.00   17.53 ? 249 ILE A CG2   1 
ATOM   1073  C  CD1   . ILE A  1 142 ? 18.933  26.805  14.294  1.00   21.93 ? 249 ILE A CD1   1 
ATOM   1074  N  N     . TYR A  1 143 ? 23.487  26.100  10.693  1.00   16.88 ? 250 TYR A N     1 
ATOM   1075  C  CA    . TYR A  1 143 ? 24.270  26.648  9.594   1.00   16.07 ? 250 TYR A CA    1 
ATOM   1076  C  C     . TYR A  1 143 ? 23.307  26.929  8.457   1.00   19.05 ? 250 TYR A C     1 
ATOM   1077  O  O     . TYR A  1 143 ? 22.457  26.092  8.145   1.00   21.08 ? 250 TYR A O     1 
ATOM   1078  C  CB    . TYR A  1 143 ? 25.318  25.649  9.100   1.00   12.89 ? 250 TYR A CB    1 
ATOM   1079  C  CG    . TYR A  1 143 ? 26.355  25.276  10.123  1.00   13.39 ? 250 TYR A CG    1 
ATOM   1080  C  CD1   . TYR A  1 143 ? 26.019  24.482  11.210  1.00   13.02 ? 250 TYR A CD1   1 
ATOM   1081  C  CD2   . TYR A  1 143 ? 27.670  25.747  10.027  1.00   13.78 ? 250 TYR A CD2   1 
ATOM   1082  C  CE1   . TYR A  1 143 ? 26.958  24.165  12.185  1.00   17.29 ? 250 TYR A CE1   1 
ATOM   1083  C  CE2   . TYR A  1 143 ? 28.623  25.435  11.000  1.00   13.51 ? 250 TYR A CE2   1 
ATOM   1084  C  CZ    . TYR A  1 143 ? 28.257  24.639  12.080  1.00   17.58 ? 250 TYR A CZ    1 
ATOM   1085  O  OH    . TYR A  1 143 ? 29.172  24.295  13.059  1.00   20.04 ? 250 TYR A OH    1 
ATOM   1086  N  N     . SER A  1 144 ? 23.431  28.098  7.837   1.00   17.78 ? 251 SER A N     1 
ATOM   1087  C  CA    . SER A  1 144 ? 22.550  28.450  6.728   1.00   17.34 ? 251 SER A CA    1 
ATOM   1088  C  C     . SER A  1 144 ? 23.365  28.710  5.464   1.00   17.36 ? 251 SER A C     1 
ATOM   1089  O  O     . SER A  1 144 ? 24.293  29.516  5.470   1.00   18.29 ? 251 SER A O     1 
ATOM   1090  C  CB    . SER A  1 144 ? 21.731  29.695  7.083   1.00   17.56 ? 251 SER A CB    1 
ATOM   1091  O  OG    . SER A  1 144 ? 20.798  30.000  6.060   1.00   14.01 ? 251 SER A OG    1 
ATOM   1092  N  N     . ALA A  1 145 ? 23.013  28.038  4.376   1.00   15.80 ? 252 ALA A N     1 
ATOM   1093  C  CA    . ALA A  1 145 ? 23.749  28.208  3.130   1.00   15.17 ? 252 ALA A CA    1 
ATOM   1094  C  C     . ALA A  1 145 ? 22.863  28.542  1.952   1.00   17.16 ? 252 ALA A C     1 
ATOM   1095  O  O     . ALA A  1 145 ? 22.094  27.700  1.481   1.00   18.15 ? 252 ALA A O     1 
ATOM   1096  C  CB    . ALA A  1 145 ? 24.541  26.950  2.816   1.00   15.52 ? 252 ALA A CB    1 
ATOM   1097  N  N     . SER A  1 146 ? 22.984  29.773  1.475   1.00   16.40 ? 253 SER A N     1 
ATOM   1098  C  CA    . SER A  1 146 ? 22.219  30.227  0.324   1.00   18.46 ? 253 SER A CA    1 
ATOM   1099  C  C     . SER A  1 146 ? 23.128  30.289  -0.912  1.00   17.18 ? 253 SER A C     1 
ATOM   1100  O  O     . SER A  1 146 ? 23.241  31.326  -1.575  1.00   17.45 ? 253 SER A O     1 
ATOM   1101  C  CB    . SER A  1 146 ? 21.604  31.597  0.612   1.00   19.98 ? 253 SER A CB    1 
ATOM   1102  O  OG    . SER A  1 146 ? 20.714  31.495  1.707   1.00   22.72 ? 253 SER A OG    1 
ATOM   1103  N  N     . TRP A  1 147 ? 23.776  29.165  -1.204  1.00   14.97 ? 254 TRP A N     1 
ATOM   1104  C  CA    . TRP A  1 147 ? 24.673  29.056  -2.348  1.00   14.36 ? 254 TRP A CA    1 
ATOM   1105  C  C     . TRP A  1 147 ? 24.773  27.596  -2.746  1.00   15.00 ? 254 TRP A C     1 
ATOM   1106  O  O     . TRP A  1 147 ? 24.209  26.731  -2.077  1.00   16.42 ? 254 TRP A O     1 
ATOM   1107  C  CB    . TRP A  1 147 ? 26.071  29.599  -2.003  1.00   14.15 ? 254 TRP A CB    1 
ATOM   1108  C  CG    . TRP A  1 147 ? 26.660  29.035  -0.739  1.00   13.59 ? 254 TRP A CG    1 
ATOM   1109  C  CD1   . TRP A  1 147 ? 26.525  29.542  0.522   1.00   11.29 ? 254 TRP A CD1   1 
ATOM   1110  C  CD2   . TRP A  1 147 ? 27.421  27.819  -0.607  1.00   11.25 ? 254 TRP A CD2   1 
ATOM   1111  N  NE1   . TRP A  1 147 ? 27.151  28.719  1.429   1.00   12.65 ? 254 TRP A NE1   1 
ATOM   1112  C  CE2   . TRP A  1 147 ? 27.705  27.654  0.767   1.00   10.61 ? 254 TRP A CE2   1 
ATOM   1113  C  CE3   . TRP A  1 147 ? 27.883  26.856  -1.516  1.00   9.08  ? 254 TRP A CE3   1 
ATOM   1114  C  CZ2   . TRP A  1 147 ? 28.433  26.559  1.258   1.00   7.36  ? 254 TRP A CZ2   1 
ATOM   1115  C  CZ3   . TRP A  1 147 ? 28.611  25.766  -1.022  1.00   11.51 ? 254 TRP A CZ3   1 
ATOM   1116  C  CH2   . TRP A  1 147 ? 28.874  25.630  0.351   1.00   8.73  ? 254 TRP A CH2   1 
ATOM   1117  N  N     . GLY A  1 148 ? 25.486  27.319  -3.832  1.00   15.69 ? 255 GLY A N     1 
ATOM   1118  C  CA    . GLY A  1 148 ? 25.640  25.945  -4.277  1.00   16.76 ? 255 GLY A CA    1 
ATOM   1119  C  C     . GLY A  1 148 ? 26.111  25.868  -5.709  1.00   17.82 ? 255 GLY A C     1 
ATOM   1120  O  O     . GLY A  1 148 ? 26.475  26.890  -6.287  1.00   19.44 ? 255 GLY A O     1 
ATOM   1121  N  N     . PRO A  1 149 ? 26.125  24.666  -6.306  1.00   17.34 ? 256 PRO A N     1 
ATOM   1122  C  CA    . PRO A  1 149 ? 26.556  24.463  -7.688  1.00   19.42 ? 256 PRO A CA    1 
ATOM   1123  C  C     . PRO A  1 149 ? 25.803  25.379  -8.643  1.00   20.65 ? 256 PRO A C     1 
ATOM   1124  O  O     . PRO A  1 149 ? 24.680  25.783  -8.367  1.00   19.98 ? 256 PRO A O     1 
ATOM   1125  C  CB    . PRO A  1 149 ? 26.231  22.990  -7.934  1.00   17.22 ? 256 PRO A CB    1 
ATOM   1126  C  CG    . PRO A  1 149 ? 26.451  22.391  -6.607  1.00   17.54 ? 256 PRO A CG    1 
ATOM   1127  C  CD    . PRO A  1 149 ? 25.788  23.378  -5.680  1.00   18.39 ? 256 PRO A CD    1 
ATOM   1128  N  N     . GLU A  1 150 ? 26.423  25.700  -9.770  1.00   24.25 ? 257 GLU A N     1 
ATOM   1129  C  CA    . GLU A  1 150 ? 25.797  26.571  -10.752 1.00   27.26 ? 257 GLU A CA    1 
ATOM   1130  C  C     . GLU A  1 150 ? 24.467  25.983  -11.221 1.00   25.75 ? 257 GLU A C     1 
ATOM   1131  O  O     . GLU A  1 150 ? 24.343  24.770  -11.377 1.00   26.47 ? 257 GLU A O     1 
ATOM   1132  C  CB    . GLU A  1 150 ? 26.745  26.759  -11.928 1.00   31.42 ? 257 GLU A CB    1 
ATOM   1133  C  CG    . GLU A  1 150 ? 26.218  27.656  -13.018 1.00   40.01 ? 257 GLU A CG    1 
ATOM   1134  C  CD    . GLU A  1 150 ? 27.332  28.135  -13.934 1.00   43.40 ? 257 GLU A CD    1 
ATOM   1135  O  OE1   . GLU A  1 150 ? 27.039  28.890  -14.890 1.00   44.77 ? 257 GLU A OE1   1 
ATOM   1136  O  OE2   . GLU A  1 150 ? 28.501  27.759  -13.683 1.00   44.57 ? 257 GLU A OE2   1 
ATOM   1137  N  N     . ASP A  1 151 ? 23.472  26.842  -11.431 1.00   22.71 ? 258 ASP A N     1 
ATOM   1138  C  CA    . ASP A  1 151 ? 22.156  26.391  -11.871 1.00   22.03 ? 258 ASP A CA    1 
ATOM   1139  C  C     . ASP A  1 151 ? 21.948  26.476  -13.380 1.00   21.50 ? 258 ASP A C     1 
ATOM   1140  O  O     . ASP A  1 151 ? 20.927  27.004  -13.846 1.00   16.99 ? 258 ASP A O     1 
ATOM   1141  C  CB    . ASP A  1 151 ? 21.070  27.209  -11.183 1.00   22.41 ? 258 ASP A CB    1 
ATOM   1142  C  CG    . ASP A  1 151 ? 21.029  26.976  -9.706  1.00   22.59 ? 258 ASP A CG    1 
ATOM   1143  O  OD1   . ASP A  1 151 ? 21.026  25.797  -9.290  1.00   22.19 ? 258 ASP A OD1   1 
ATOM   1144  O  OD2   . ASP A  1 151 ? 20.986  27.974  -8.963  1.00   22.30 ? 258 ASP A OD2   1 
ATOM   1145  N  N     . ASP A  1 152 ? 22.902  25.957  -14.149 1.00   22.52 ? 259 ASP A N     1 
ATOM   1146  C  CA    . ASP A  1 152 ? 22.792  26.022  -15.605 1.00   22.73 ? 259 ASP A CA    1 
ATOM   1147  C  C     . ASP A  1 152 ? 21.826  24.982  -16.149 1.00   23.49 ? 259 ASP A C     1 
ATOM   1148  O  O     . ASP A  1 152 ? 21.490  25.004  -17.330 1.00   22.33 ? 259 ASP A O     1 
ATOM   1149  C  CB    . ASP A  1 152 ? 24.167  25.875  -16.263 1.00   23.51 ? 259 ASP A CB    1 
ATOM   1150  C  CG    . ASP A  1 152 ? 24.880  24.584  -15.881 1.00   28.46 ? 259 ASP A CG    1 
ATOM   1151  O  OD1   . ASP A  1 152 ? 24.322  23.775  -15.106 1.00   28.61 ? 259 ASP A OD1   1 
ATOM   1152  O  OD2   . ASP A  1 152 ? 26.013  24.380  -16.370 1.00   30.96 ? 259 ASP A OD2   1 
ATOM   1153  N  N     . GLY A  1 153 ? 21.373  24.087  -15.272 1.00   22.63 ? 260 GLY A N     1 
ATOM   1154  C  CA    . GLY A  1 153 ? 20.432  23.060  -15.673 1.00   23.20 ? 260 GLY A CA    1 
ATOM   1155  C  C     . GLY A  1 153 ? 21.074  21.954  -16.488 1.00   24.61 ? 260 GLY A C     1 
ATOM   1156  O  O     . GLY A  1 153 ? 20.393  21.199  -17.179 1.00   25.39 ? 260 GLY A O     1 
ATOM   1157  N  N     . LYS A  1 154 ? 22.395  21.854  -16.419 1.00   25.80 ? 261 LYS A N     1 
ATOM   1158  C  CA    . LYS A  1 154 ? 23.094  20.822  -17.162 1.00   25.47 ? 261 LYS A CA    1 
ATOM   1159  C  C     . LYS A  1 154 ? 24.225  20.197  -16.367 1.00   26.00 ? 261 LYS A C     1 
ATOM   1160  O  O     . LYS A  1 154 ? 24.901  19.298  -16.855 1.00   27.90 ? 261 LYS A O     1 
ATOM   1161  C  CB    . LYS A  1 154 ? 23.615  21.370  -18.491 1.00   23.12 ? 261 LYS A CB    1 
ATOM   1162  C  CG    . LYS A  1 154 ? 24.530  22.559  -18.367 1.00   25.17 ? 261 LYS A CG    1 
ATOM   1163  C  CD    . LYS A  1 154 ? 24.949  23.062  -19.746 1.00   29.40 ? 261 LYS A CD    1 
ATOM   1164  C  CE    . LYS A  1 154 ? 25.946  24.218  -19.655 1.00   28.65 ? 261 LYS A CE    1 
ATOM   1165  N  NZ    . LYS A  1 154 ? 26.421  24.651  -20.995 0.0000 28.66 ? 261 LYS A NZ    1 
ATOM   1166  N  N     . THR A  1 155 ? 24.431  20.649  -15.135 1.00   25.49 ? 262 THR A N     1 
ATOM   1167  C  CA    . THR A  1 155 ? 25.484  20.046  -14.333 1.00   26.30 ? 262 THR A CA    1 
ATOM   1168  C  C     . THR A  1 155 ? 24.953  19.209  -13.169 1.00   24.59 ? 262 THR A C     1 
ATOM   1169  O  O     . THR A  1 155 ? 23.852  19.420  -12.665 1.00   22.28 ? 262 THR A O     1 
ATOM   1170  C  CB    . THR A  1 155 ? 26.498  21.103  -13.788 1.00   26.82 ? 262 THR A CB    1 
ATOM   1171  O  OG1   . THR A  1 155 ? 25.901  21.888  -12.755 1.00   24.73 ? 262 THR A OG1   1 
ATOM   1172  C  CG2   . THR A  1 155 ? 26.952  22.027  -14.905 1.00   30.26 ? 262 THR A CG2   1 
ATOM   1173  N  N     . VAL A  1 156 ? 25.755  18.225  -12.787 1.00   24.95 ? 263 VAL A N     1 
ATOM   1174  C  CA    . VAL A  1 156 ? 25.472  17.338  -11.671 1.00   23.57 ? 263 VAL A CA    1 
ATOM   1175  C  C     . VAL A  1 156 ? 26.696  17.529  -10.779 1.00   24.94 ? 263 VAL A C     1 
ATOM   1176  O  O     . VAL A  1 156 ? 27.818  17.165  -11.151 1.00   26.96 ? 263 VAL A O     1 
ATOM   1177  C  CB    . VAL A  1 156 ? 25.402  15.876  -12.108 1.00   21.77 ? 263 VAL A CB    1 
ATOM   1178  C  CG1   . VAL A  1 156 ? 25.036  15.005  -10.909 1.00   20.68 ? 263 VAL A CG1   1 
ATOM   1179  C  CG2   . VAL A  1 156 ? 24.398  15.717  -13.246 1.00   20.36 ? 263 VAL A CG2   1 
ATOM   1180  N  N     . ASP A  1 157 ? 26.495  18.115  -9.608  1.00   24.63 ? 264 ASP A N     1 
ATOM   1181  C  CA    . ASP A  1 157 ? 27.615  18.391  -8.723  1.00   22.22 ? 264 ASP A CA    1 
ATOM   1182  C  C     . ASP A  1 157 ? 27.188  18.342  -7.258  1.00   20.85 ? 264 ASP A C     1 
ATOM   1183  O  O     . ASP A  1 157 ? 26.035  18.602  -6.922  1.00   18.82 ? 264 ASP A O     1 
ATOM   1184  C  CB    . ASP A  1 157 ? 28.193  19.771  -9.079  1.00   21.16 ? 264 ASP A CB    1 
ATOM   1185  C  CG    . ASP A  1 157 ? 29.546  20.035  -8.441  1.00   22.41 ? 264 ASP A CG    1 
ATOM   1186  O  OD1   . ASP A  1 157 ? 30.081  19.130  -7.769  1.00   27.53 ? 264 ASP A OD1   1 
ATOM   1187  O  OD2   . ASP A  1 157 ? 30.083  21.155  -8.618  1.00   21.73 ? 264 ASP A OD2   1 
ATOM   1188  N  N     . GLY A  1 158 ? 28.132  17.996  -6.396  1.00   20.76 ? 265 GLY A N     1 
ATOM   1189  C  CA    . GLY A  1 158 ? 27.860  17.910  -4.979  1.00   22.17 ? 265 GLY A CA    1 
ATOM   1190  C  C     . GLY A  1 158 ? 29.130  18.139  -4.181  1.00   23.43 ? 265 GLY A C     1 
ATOM   1191  O  O     . GLY A  1 158 ? 30.183  18.432  -4.758  1.00   24.96 ? 265 GLY A O     1 
ATOM   1192  N  N     . PRO A  1 159 ? 29.063  18.021  -2.845  1.00   22.17 ? 266 PRO A N     1 
ATOM   1193  C  CA    . PRO A  1 159 ? 30.246  18.228  -2.011  1.00   20.06 ? 266 PRO A CA    1 
ATOM   1194  C  C     . PRO A  1 159 ? 31.338  17.200  -2.280  1.00   18.86 ? 266 PRO A C     1 
ATOM   1195  O  O     . PRO A  1 159 ? 31.045  16.061  -2.645  1.00   16.00 ? 266 PRO A O     1 
ATOM   1196  C  CB    . PRO A  1 159 ? 29.684  18.117  -0.593  1.00   17.79 ? 266 PRO A CB    1 
ATOM   1197  C  CG    . PRO A  1 159 ? 28.578  17.141  -0.750  1.00   16.12 ? 266 PRO A CG    1 
ATOM   1198  C  CD    . PRO A  1 159 ? 27.906  17.638  -2.015  1.00   20.14 ? 266 PRO A CD    1 
ATOM   1199  N  N     . ALA A  1 160 ? 32.592  17.616  -2.109  1.00   16.92 ? 267 ALA A N     1 
ATOM   1200  C  CA    . ALA A  1 160 ? 33.730  16.724  -2.290  1.00   17.39 ? 267 ALA A CA    1 
ATOM   1201  C  C     . ALA A  1 160 ? 34.017  16.044  -0.950  1.00   19.12 ? 267 ALA A C     1 
ATOM   1202  O  O     . ALA A  1 160 ? 33.324  16.292  0.033   1.00   19.63 ? 267 ALA A O     1 
ATOM   1203  C  CB    . ALA A  1 160 ? 34.942  17.501  -2.754  1.00   13.96 ? 267 ALA A CB    1 
ATOM   1204  N  N     . ARG A  1 161 ? 35.042  15.198  -0.914  1.00   22.39 ? 268 ARG A N     1 
ATOM   1205  C  CA    . ARG A  1 161 ? 35.408  14.444  0.283   1.00   25.01 ? 268 ARG A CA    1 
ATOM   1206  C  C     . ARG A  1 161 ? 35.376  15.214  1.604   1.00   25.67 ? 268 ARG A C     1 
ATOM   1207  O  O     . ARG A  1 161 ? 34.624  14.859  2.519   1.00   24.79 ? 268 ARG A O     1 
ATOM   1208  C  CB    . ARG A  1 161 ? 36.798  13.834  0.105   1.00   31.50 ? 268 ARG A CB    1 
ATOM   1209  C  CG    . ARG A  1 161 ? 36.848  12.354  -0.216  1.00   39.89 ? 268 ARG A CG    1 
ATOM   1210  C  CD    . ARG A  1 161 ? 36.324  12.025  -1.599  1.00   44.84 ? 268 ARG A CD    1 
ATOM   1211  N  NE    . ARG A  1 161 ? 36.595  10.626  -1.919  1.00   49.63 ? 268 ARG A NE    1 
ATOM   1212  C  CZ    . ARG A  1 161 ? 35.983  9.936   -2.877  1.00   52.54 ? 268 ARG A CZ    1 
ATOM   1213  N  NH1   . ARG A  1 161 ? 35.043  10.511  -3.628  1.00   56.03 ? 268 ARG A NH1   1 
ATOM   1214  N  NH2   . ARG A  1 161 ? 36.310  8.663   -3.084  1.00   53.00 ? 268 ARG A NH2   1 
ATOM   1215  N  N     . LEU A  1 162 ? 36.197  16.257  1.713   1.00   23.96 ? 269 LEU A N     1 
ATOM   1216  C  CA    . LEU A  1 162 ? 36.259  17.038  2.950   1.00   21.51 ? 269 LEU A CA    1 
ATOM   1217  C  C     . LEU A  1 162 ? 34.902  17.585  3.355   1.00   21.51 ? 269 LEU A C     1 
ATOM   1218  O  O     . LEU A  1 162 ? 34.509  17.479  4.514   1.00   22.63 ? 269 LEU A O     1 
ATOM   1219  C  CB    . LEU A  1 162 ? 37.278  18.177  2.823   1.00   19.69 ? 269 LEU A CB    1 
ATOM   1220  C  CG    . LEU A  1 162 ? 38.759  17.783  2.657   1.00   18.33 ? 269 LEU A CG    1 
ATOM   1221  C  CD1   . LEU A  1 162 ? 39.604  19.037  2.539   1.00   15.13 ? 269 LEU A CD1   1 
ATOM   1222  C  CD2   . LEU A  1 162 ? 39.228  16.938  3.844   1.00   16.97 ? 269 LEU A CD2   1 
ATOM   1223  N  N     . ALA A  1 163 ? 34.176  18.157  2.403   1.00   21.92 ? 270 ALA A N     1 
ATOM   1224  C  CA    . ALA A  1 163 ? 32.854  18.698  2.698   1.00   22.35 ? 270 ALA A CA    1 
ATOM   1225  C  C     . ALA A  1 163 ? 31.920  17.607  3.213   1.00   22.94 ? 270 ALA A C     1 
ATOM   1226  O  O     . ALA A  1 163 ? 31.172  17.829  4.163   1.00   23.49 ? 270 ALA A O     1 
ATOM   1227  C  CB    . ALA A  1 163 ? 32.262  19.342  1.455   1.00   22.53 ? 270 ALA A CB    1 
ATOM   1228  N  N     . GLU A  1 164 ? 31.952  16.431  2.588   1.00   22.49 ? 271 GLU A N     1 
ATOM   1229  C  CA    . GLU A  1 164 ? 31.088  15.343  3.027   1.00   22.15 ? 271 GLU A CA    1 
ATOM   1230  C  C     . GLU A  1 164 ? 31.466  14.973  4.437   1.00   19.85 ? 271 GLU A C     1 
ATOM   1231  O  O     . GLU A  1 164 ? 30.604  14.809  5.291   1.00   20.66 ? 271 GLU A O     1 
ATOM   1232  C  CB    . GLU A  1 164 ? 31.254  14.106  2.159   1.00   25.67 ? 271 GLU A CB    1 
ATOM   1233  C  CG    . GLU A  1 164 ? 30.925  14.285  0.718   1.00   30.71 ? 271 GLU A CG    1 
ATOM   1234  C  CD    . GLU A  1 164 ? 30.815  12.951  0.026   1.00   34.43 ? 271 GLU A CD    1 
ATOM   1235  O  OE1   . GLU A  1 164 ? 29.725  12.338  0.090   1.00   38.27 ? 271 GLU A OE1   1 
ATOM   1236  O  OE2   . GLU A  1 164 ? 31.827  12.507  -0.562  1.00   37.76 ? 271 GLU A OE2   1 
ATOM   1237  N  N     . GLU A  1 165 ? 32.763  14.823  4.674   1.00   17.83 ? 272 GLU A N     1 
ATOM   1238  C  CA    . GLU A  1 165 ? 33.235  14.470  5.999   1.00   16.42 ? 272 GLU A CA    1 
ATOM   1239  C  C     . GLU A  1 165 ? 32.794  15.513  7.019   1.00   16.87 ? 272 GLU A C     1 
ATOM   1240  O  O     . GLU A  1 165 ? 32.529  15.187  8.178   1.00   15.52 ? 272 GLU A O     1 
ATOM   1241  C  CB    . GLU A  1 165 ? 34.750  14.327  5.995   1.00   15.93 ? 272 GLU A CB    1 
ATOM   1242  C  CG    . GLU A  1 165 ? 35.218  13.012  5.419   1.00   17.46 ? 272 GLU A CG    1 
ATOM   1243  C  CD    . GLU A  1 165 ? 36.723  12.927  5.308   1.00   19.44 ? 272 GLU A CD    1 
ATOM   1244  O  OE1   . GLU A  1 165 ? 37.243  11.817  5.046   1.00   19.35 ? 272 GLU A OE1   1 
ATOM   1245  O  OE2   . GLU A  1 165 ? 37.379  13.974  5.481   1.00   18.86 ? 272 GLU A OE2   1 
ATOM   1246  N  N     . ALA A  1 166 ? 32.697  16.767  6.584   1.00   16.68 ? 273 ALA A N     1 
ATOM   1247  C  CA    . ALA A  1 166 ? 32.268  17.843  7.475   1.00   15.50 ? 273 ALA A CA    1 
ATOM   1248  C  C     . ALA A  1 166 ? 30.793  17.668  7.806   1.00   16.78 ? 273 ALA A C     1 
ATOM   1249  O  O     . ALA A  1 166 ? 30.383  17.846  8.959   1.00   15.83 ? 273 ALA A O     1 
ATOM   1250  C  CB    . ALA A  1 166 ? 32.507  19.202  6.824   1.00   13.59 ? 273 ALA A CB    1 
ATOM   1251  N  N     . PHE A  1 167 ? 29.998  17.313  6.796   1.00   16.23 ? 274 PHE A N     1 
ATOM   1252  C  CA    . PHE A  1 167 ? 28.569  17.100  6.994   1.00   16.82 ? 274 PHE A CA    1 
ATOM   1253  C  C     . PHE A  1 167 ? 28.360  15.954  7.969   1.00   16.60 ? 274 PHE A C     1 
ATOM   1254  O  O     . PHE A  1 167 ? 27.556  16.052  8.902   1.00   16.07 ? 274 PHE A O     1 
ATOM   1255  C  CB    . PHE A  1 167 ? 27.875  16.757  5.667   1.00   14.78 ? 274 PHE A CB    1 
ATOM   1256  C  CG    . PHE A  1 167 ? 27.466  17.961  4.858   1.00   15.70 ? 274 PHE A CG    1 
ATOM   1257  C  CD1   . PHE A  1 167 ? 26.684  18.969  5.428   1.00   16.04 ? 274 PHE A CD1   1 
ATOM   1258  C  CD2   . PHE A  1 167 ? 27.804  18.062  3.505   1.00   14.98 ? 274 PHE A CD2   1 
ATOM   1259  C  CE1   . PHE A  1 167 ? 26.236  20.057  4.661   1.00   13.59 ? 274 PHE A CE1   1 
ATOM   1260  C  CE2   . PHE A  1 167 ? 27.363  19.139  2.729   1.00   11.83 ? 274 PHE A CE2   1 
ATOM   1261  C  CZ    . PHE A  1 167 ? 26.577  20.138  3.308   1.00   13.47 ? 274 PHE A CZ    1 
ATOM   1262  N  N     . PHE A  1 168 ? 29.095  14.868  7.747   1.00   17.43 ? 275 PHE A N     1 
ATOM   1263  C  CA    . PHE A  1 168 ? 28.974  13.691  8.591   1.00   21.36 ? 275 PHE A CA    1 
ATOM   1264  C  C     . PHE A  1 168 ? 29.433  13.928  10.035  1.00   20.80 ? 275 PHE A C     1 
ATOM   1265  O  O     . PHE A  1 168 ? 28.769  13.496  10.982  1.00   16.33 ? 275 PHE A O     1 
ATOM   1266  C  CB    . PHE A  1 168 ? 29.745  12.520  7.975   1.00   26.54 ? 275 PHE A CB    1 
ATOM   1267  C  CG    . PHE A  1 168 ? 29.145  11.185  8.291   1.00   34.22 ? 275 PHE A CG    1 
ATOM   1268  C  CD1   . PHE A  1 168 ? 29.000  10.775  9.612   1.00   36.00 ? 275 PHE A CD1   1 
ATOM   1269  C  CD2   . PHE A  1 168 ? 28.657  10.368  7.276   1.00   36.84 ? 275 PHE A CD2   1 
ATOM   1270  C  CE1   . PHE A  1 168 ? 28.379  9.573   9.922   1.00   38.45 ? 275 PHE A CE1   1 
ATOM   1271  C  CE2   . PHE A  1 168 ? 28.031  9.159   7.574   1.00   40.39 ? 275 PHE A CE2   1 
ATOM   1272  C  CZ    . PHE A  1 168 ? 27.889  8.763   8.902   1.00   39.47 ? 275 PHE A CZ    1 
ATOM   1273  N  N     . ARG A  1 169 ? 30.564  14.607  10.206  1.00   19.67 ? 276 ARG A N     1 
ATOM   1274  C  CA    . ARG A  1 169 ? 31.050  14.895  11.550  1.00   20.78 ? 276 ARG A CA    1 
ATOM   1275  C  C     . ARG A  1 169 ? 30.012  15.793  12.218  1.00   21.48 ? 276 ARG A C     1 
ATOM   1276  O  O     . ARG A  1 169 ? 29.715  15.641  13.401  1.00   23.01 ? 276 ARG A O     1 
ATOM   1277  C  CB    . ARG A  1 169 ? 32.394  15.641  11.512  1.00   18.21 ? 276 ARG A CB    1 
ATOM   1278  C  CG    . ARG A  1 169 ? 33.589  14.881  10.988  1.00   15.53 ? 276 ARG A CG    1 
ATOM   1279  C  CD    . ARG A  1 169 ? 34.782  15.815  10.856  1.00   11.49 ? 276 ARG A CD    1 
ATOM   1280  N  NE    . ARG A  1 169 ? 35.390  16.138  12.144  1.00   14.24 ? 276 ARG A NE    1 
ATOM   1281  C  CZ    . ARG A  1 169 ? 36.157  15.309  12.853  1.00   15.26 ? 276 ARG A CZ    1 
ATOM   1282  N  NH1   . ARG A  1 169 ? 36.656  15.709  14.014  1.00   12.12 ? 276 ARG A NH1   1 
ATOM   1283  N  NH2   . ARG A  1 169 ? 36.436  14.085  12.410  1.00   15.00 ? 276 ARG A NH2   1 
ATOM   1284  N  N     . GLY A  1 170 ? 29.468  16.728  11.443  1.00   19.11 ? 277 GLY A N     1 
ATOM   1285  C  CA    . GLY A  1 170 ? 28.472  17.646  11.965  1.00   21.04 ? 277 GLY A CA    1 
ATOM   1286  C  C     . GLY A  1 170 ? 27.211  17.013  12.538  1.00   22.70 ? 277 GLY A C     1 
ATOM   1287  O  O     . GLY A  1 170 ? 26.808  17.345  13.649  1.00   24.68 ? 277 GLY A O     1 
ATOM   1288  N  N     . VAL A  1 171 ? 26.575  16.112  11.796  1.00   20.71 ? 278 VAL A N     1 
ATOM   1289  C  CA    . VAL A  1 171 ? 25.353  15.481  12.282  1.00   19.26 ? 278 VAL A CA    1 
ATOM   1290  C  C     . VAL A  1 171 ? 25.631  14.426  13.338  1.00   19.19 ? 278 VAL A C     1 
ATOM   1291  O  O     . VAL A  1 171 ? 24.736  14.059  14.095  1.00   21.44 ? 278 VAL A O     1 
ATOM   1292  C  CB    . VAL A  1 171 ? 24.539  14.845  11.125  1.00   19.35 ? 278 VAL A CB    1 
ATOM   1293  C  CG1   . VAL A  1 171 ? 24.179  15.922  10.103  1.00   18.55 ? 278 VAL A CG1   1 
ATOM   1294  C  CG2   . VAL A  1 171 ? 25.326  13.727  10.464  1.00   17.89 ? 278 VAL A CG2   1 
ATOM   1295  N  N     . SER A  1 172 ? 26.875  13.955  13.394  1.00   17.54 ? 279 SER A N     1 
ATOM   1296  C  CA    . SER A  1 172 ? 27.275  12.939  14.365  1.00   17.00 ? 279 SER A CA    1 
ATOM   1297  C  C     . SER A  1 172 ? 27.715  13.534  15.685  1.00   17.30 ? 279 SER A C     1 
ATOM   1298  O  O     . SER A  1 172 ? 27.223  13.145  16.740  1.00   17.00 ? 279 SER A O     1 
ATOM   1299  C  CB    . SER A  1 172 ? 28.440  12.110  13.833  1.00   16.81 ? 279 SER A CB    1 
ATOM   1300  O  OG    . SER A  1 172 ? 28.114  11.507  12.604  1.00   24.71 ? 279 SER A OG    1 
ATOM   1301  N  N     . GLN A  1 173 ? 28.644  14.485  15.604  1.00   19.32 ? 280 GLN A N     1 
ATOM   1302  C  CA    . GLN A  1 173 ? 29.228  15.119  16.773  1.00   17.80 ? 280 GLN A CA    1 
ATOM   1303  C  C     . GLN A  1 173 ? 28.812  16.546  17.089  1.00   17.30 ? 280 GLN A C     1 
ATOM   1304  O  O     . GLN A  1 173 ? 28.946  16.976  18.231  1.00   18.21 ? 280 GLN A O     1 
ATOM   1305  C  CB    . GLN A  1 173 ? 30.748  15.047  16.657  1.00   20.22 ? 280 GLN A CB    1 
ATOM   1306  C  CG    . GLN A  1 173 ? 31.292  13.634  16.697  1.00   28.83 ? 280 GLN A CG    1 
ATOM   1307  C  CD    . GLN A  1 173 ? 32.229  13.312  15.537  1.00   33.74 ? 280 GLN A CD    1 
ATOM   1308  O  OE1   . GLN A  1 173 ? 33.232  14.005  15.314  1.00   34.00 ? 280 GLN A OE1   1 
ATOM   1309  N  NE2   . GLN A  1 173 ? 31.908  12.247  14.798  1.00   33.83 ? 280 GLN A NE2   1 
ATOM   1310  N  N     . GLY A  1 174 ? 28.317  17.287  16.102  1.00   14.86 ? 281 GLY A N     1 
ATOM   1311  C  CA    . GLY A  1 174 ? 27.907  18.664  16.367  1.00   18.72 ? 281 GLY A CA    1 
ATOM   1312  C  C     . GLY A  1 174 ? 26.885  18.792  17.497  1.00   20.06 ? 281 GLY A C     1 
ATOM   1313  O  O     . GLY A  1 174 ? 26.183  17.827  17.824  1.00   22.13 ? 281 GLY A O     1 
ATOM   1314  N  N     . ARG A  1 175 ? 26.784  19.979  18.090  1.00   18.68 ? 282 ARG A N     1 
ATOM   1315  C  CA    . ARG A  1 175 ? 25.841  20.211  19.180  1.00   18.84 ? 282 ARG A CA    1 
ATOM   1316  C  C     . ARG A  1 175 ? 25.890  19.079  20.203  1.00   20.66 ? 282 ARG A C     1 
ATOM   1317  O  O     . ARG A  1 175 ? 24.862  18.510  20.576  1.00   20.28 ? 282 ARG A O     1 
ATOM   1318  C  CB    . ARG A  1 175 ? 24.411  20.337  18.648  1.00   18.23 ? 282 ARG A CB    1 
ATOM   1319  C  CG    . ARG A  1 175 ? 24.096  21.635  17.918  1.00   20.81 ? 282 ARG A CG    1 
ATOM   1320  C  CD    . ARG A  1 175 ? 22.753  21.534  17.182  1.00   18.34 ? 282 ARG A CD    1 
ATOM   1321  N  NE    . ARG A  1 175 ? 21.650  21.288  18.103  1.00   21.21 ? 282 ARG A NE    1 
ATOM   1322  C  CZ    . ARG A  1 175 ? 20.651  20.426  17.897  1.00   22.84 ? 282 ARG A CZ    1 
ATOM   1323  N  NH1   . ARG A  1 175 ? 20.580  19.689  16.792  1.00   17.05 ? 282 ARG A NH1   1 
ATOM   1324  N  NH2   . ARG A  1 175 ? 19.707  20.304  18.815  1.00   24.87 ? 282 ARG A NH2   1 
ATOM   1325  N  N     . GLY A  1 176 ? 27.093  18.744  20.645  1.00   20.97 ? 283 GLY A N     1 
ATOM   1326  C  CA    . GLY A  1 176 ? 27.229  17.693  21.628  1.00   19.08 ? 283 GLY A CA    1 
ATOM   1327  C  C     . GLY A  1 176 ? 26.580  16.366  21.279  1.00   17.63 ? 283 GLY A C     1 
ATOM   1328  O  O     . GLY A  1 176 ? 26.085  15.681  22.164  1.00   17.93 ? 283 GLY A O     1 
ATOM   1329  N  N     . GLY A  1 177 ? 26.575  15.990  20.003  1.00   16.82 ? 284 GLY A N     1 
ATOM   1330  C  CA    . GLY A  1 177 ? 25.991  14.713  19.633  1.00   14.07 ? 284 GLY A CA    1 
ATOM   1331  C  C     . GLY A  1 177 ? 24.607  14.778  19.029  1.00   14.51 ? 284 GLY A C     1 
ATOM   1332  O  O     . GLY A  1 177 ? 24.179  13.848  18.347  1.00   15.75 ? 284 GLY A O     1 
ATOM   1333  N  N     . LEU A  1 178 ? 23.893  15.868  19.268  1.00   14.33 ? 285 LEU A N     1 
ATOM   1334  C  CA    . LEU A  1 178 ? 22.554  16.011  18.708  1.00   14.61 ? 285 LEU A CA    1 
ATOM   1335  C  C     . LEU A  1 178 ? 22.612  16.258  17.199  1.00   15.63 ? 285 LEU A C     1 
ATOM   1336  O  O     . LEU A  1 178 ? 21.639  16.002  16.485  1.00   13.31 ? 285 LEU A O     1 
ATOM   1337  C  CB    . LEU A  1 178 ? 21.821  17.158  19.402  1.00   16.69 ? 285 LEU A CB    1 
ATOM   1338  C  CG    . LEU A  1 178 ? 21.673  16.964  20.914  1.00   16.95 ? 285 LEU A CG    1 
ATOM   1339  C  CD1   . LEU A  1 178 ? 21.034  18.194  21.561  1.00   13.61 ? 285 LEU A CD1   1 
ATOM   1340  C  CD2   . LEU A  1 178 ? 20.837  15.725  21.158  1.00   14.41 ? 285 LEU A CD2   1 
ATOM   1341  N  N     . GLY A  1 179 ? 23.756  16.754  16.718  1.00   16.37 ? 286 GLY A N     1 
ATOM   1342  C  CA    . GLY A  1 179 ? 23.923  17.013  15.290  1.00   16.72 ? 286 GLY A CA    1 
ATOM   1343  C  C     . GLY A  1 179 ? 23.683  18.438  14.808  1.00   16.08 ? 286 GLY A C     1 
ATOM   1344  O  O     . GLY A  1 179 ? 22.680  19.064  15.148  1.00   16.22 ? 286 GLY A O     1 
ATOM   1345  N  N     . SER A  1 180 ? 24.603  18.954  14.001  1.00   15.52 ? 287 SER A N     1 
ATOM   1346  C  CA    . SER A  1 180 ? 24.469  20.307  13.457  1.00   16.26 ? 287 SER A CA    1 
ATOM   1347  C  C     . SER A  1 180 ? 23.263  20.362  12.514  1.00   15.01 ? 287 SER A C     1 
ATOM   1348  O  O     . SER A  1 180 ? 22.970  19.394  11.820  1.00   16.15 ? 287 SER A O     1 
ATOM   1349  C  CB    . SER A  1 180 ? 25.734  20.695  12.676  1.00   15.14 ? 287 SER A CB    1 
ATOM   1350  O  OG    . SER A  1 180 ? 26.907  20.619  13.481  1.00   17.81 ? 287 SER A OG    1 
ATOM   1351  N  N     . ILE A  1 181 ? 22.548  21.481  12.505  1.00   14.57 ? 288 ILE A N     1 
ATOM   1352  C  CA    . ILE A  1 181 ? 21.405  21.636  11.611  1.00   13.08 ? 288 ILE A CA    1 
ATOM   1353  C  C     . ILE A  1 181 ? 21.916  22.393  10.388  1.00   14.58 ? 288 ILE A C     1 
ATOM   1354  O  O     . ILE A  1 181 ? 22.406  23.516  10.512  1.00   15.77 ? 288 ILE A O     1 
ATOM   1355  C  CB    . ILE A  1 181 ? 20.276  22.473  12.250  1.00   14.61 ? 288 ILE A CB    1 
ATOM   1356  C  CG1   . ILE A  1 181 ? 19.856  21.864  13.598  1.00   12.22 ? 288 ILE A CG1   1 
ATOM   1357  C  CG2   . ILE A  1 181 ? 19.093  22.557  11.278  1.00   9.29  ? 288 ILE A CG2   1 
ATOM   1358  C  CD1   . ILE A  1 181 ? 19.227  20.499  13.489  1.00   14.85 ? 288 ILE A CD1   1 
ATOM   1359  N  N     . PHE A  1 182 ? 21.820  21.775  9.214   1.00   13.94 ? 289 PHE A N     1 
ATOM   1360  C  CA    . PHE A  1 182 ? 22.276  22.401  7.969   1.00   14.19 ? 289 PHE A CA    1 
ATOM   1361  C  C     . PHE A  1 182 ? 21.087  22.775  7.081   1.00   13.95 ? 289 PHE A C     1 
ATOM   1362  O  O     . PHE A  1 182 ? 20.454  21.898  6.498   1.00   15.43 ? 289 PHE A O     1 
ATOM   1363  C  CB    . PHE A  1 182 ? 23.189  21.440  7.184   1.00   16.28 ? 289 PHE A CB    1 
ATOM   1364  C  CG    . PHE A  1 182 ? 24.495  21.114  7.871   1.00   16.30 ? 289 PHE A CG    1 
ATOM   1365  C  CD1   . PHE A  1 182 ? 25.490  22.087  8.013   1.00   15.71 ? 289 PHE A CD1   1 
ATOM   1366  C  CD2   . PHE A  1 182 ? 24.734  19.830  8.360   1.00   13.24 ? 289 PHE A CD2   1 
ATOM   1367  C  CE1   . PHE A  1 182 ? 26.710  21.793  8.634   1.00   13.86 ? 289 PHE A CE1   1 
ATOM   1368  C  CE2   . PHE A  1 182 ? 25.954  19.520  8.983   1.00   16.16 ? 289 PHE A CE2   1 
ATOM   1369  C  CZ    . PHE A  1 182 ? 26.947  20.510  9.120   1.00   15.56 ? 289 PHE A CZ    1 
ATOM   1370  N  N     . VAL A  1 183 ? 20.799  24.070  6.975   1.00   12.37 ? 290 VAL A N     1 
ATOM   1371  C  CA    . VAL A  1 183 ? 19.691  24.562  6.158   1.00   11.76 ? 290 VAL A CA    1 
ATOM   1372  C  C     . VAL A  1 183 ? 20.223  25.011  4.801   1.00   12.20 ? 290 VAL A C     1 
ATOM   1373  O  O     . VAL A  1 183 ? 21.148  25.815  4.727   1.00   13.74 ? 290 VAL A O     1 
ATOM   1374  C  CB    . VAL A  1 183 ? 18.982  25.743  6.851   1.00   10.47 ? 290 VAL A CB    1 
ATOM   1375  C  CG1   . VAL A  1 183 ? 17.845  26.254  5.988   1.00   9.93  ? 290 VAL A CG1   1 
ATOM   1376  C  CG2   . VAL A  1 183 ? 18.453  25.296  8.194   1.00   9.28  ? 290 VAL A CG2   1 
ATOM   1377  N  N     . TRP A  1 184 ? 19.628  24.501  3.729   1.00   13.56 ? 291 TRP A N     1 
ATOM   1378  C  CA    . TRP A  1 184 ? 20.082  24.827  2.376   1.00   15.33 ? 291 TRP A CA    1 
ATOM   1379  C  C     . TRP A  1 184 ? 19.008  25.414  1.457   1.00   17.73 ? 291 TRP A C     1 
ATOM   1380  O  O     . TRP A  1 184 ? 17.832  25.058  1.558   1.00   20.78 ? 291 TRP A O     1 
ATOM   1381  C  CB    . TRP A  1 184 ? 20.654  23.560  1.721   1.00   12.84 ? 291 TRP A CB    1 
ATOM   1382  C  CG    . TRP A  1 184 ? 21.923  23.792  0.975   1.00   12.66 ? 291 TRP A CG    1 
ATOM   1383  C  CD1   . TRP A  1 184 ? 22.051  24.276  -0.292  1.00   13.58 ? 291 TRP A CD1   1 
ATOM   1384  C  CD2   . TRP A  1 184 ? 23.254  23.686  1.503   1.00   11.47 ? 291 TRP A CD2   1 
ATOM   1385  N  NE1   . TRP A  1 184 ? 23.377  24.493  -0.585  1.00   14.46 ? 291 TRP A NE1   1 
ATOM   1386  C  CE2   . TRP A  1 184 ? 24.140  24.141  0.497   1.00   14.29 ? 291 TRP A CE2   1 
ATOM   1387  C  CE3   . TRP A  1 184 ? 23.782  23.258  2.728   1.00   9.30  ? 291 TRP A CE3   1 
ATOM   1388  C  CZ2   . TRP A  1 184 ? 25.539  24.186  0.681   1.00   13.28 ? 291 TRP A CZ2   1 
ATOM   1389  C  CZ3   . TRP A  1 184 ? 25.177  23.301  2.913   1.00   13.88 ? 291 TRP A CZ3   1 
ATOM   1390  C  CH2   . TRP A  1 184 ? 26.033  23.763  1.893   1.00   14.00 ? 291 TRP A CH2   1 
ATOM   1391  N  N     . ALA A  1 185 ? 19.419  26.315  0.563   1.00   17.91 ? 292 ALA A N     1 
ATOM   1392  C  CA    . ALA A  1 185 ? 18.500  26.910  -0.413  1.00   19.01 ? 292 ALA A CA    1 
ATOM   1393  C  C     . ALA A  1 185 ? 18.483  25.948  -1.614  1.00   18.93 ? 292 ALA A C     1 
ATOM   1394  O  O     . ALA A  1 185 ? 19.543  25.601  -2.143  1.00   18.57 ? 292 ALA A O     1 
ATOM   1395  C  CB    . ALA A  1 185 ? 18.996  28.287  -0.840  1.00   15.54 ? 292 ALA A CB    1 
ATOM   1396  N  N     . SER A  1 186 ? 17.295  25.520  -2.045  1.00   16.87 ? 293 SER A N     1 
ATOM   1397  C  CA    . SER A  1 186 ? 17.207  24.561  -3.139  1.00   18.95 ? 293 SER A CA    1 
ATOM   1398  C  C     . SER A  1 186 ? 17.705  24.994  -4.513  1.00   19.83 ? 293 SER A C     1 
ATOM   1399  O  O     . SER A  1 186 ? 18.013  24.140  -5.339  1.00   24.65 ? 293 SER A O     1 
ATOM   1400  C  CB    . SER A  1 186 ? 15.788  23.985  -3.244  1.00   18.21 ? 293 SER A CB    1 
ATOM   1401  O  OG    . SER A  1 186 ? 14.813  24.994  -3.384  1.00   21.79 ? 293 SER A OG    1 
ATOM   1402  N  N     . GLY A  1 187 ? 17.788  26.291  -4.781  1.00   17.77 ? 294 GLY A N     1 
ATOM   1403  C  CA    . GLY A  1 187 ? 18.316  26.708  -6.071  1.00   17.77 ? 294 GLY A CA    1 
ATOM   1404  C  C     . GLY A  1 187 ? 17.498  27.676  -6.897  1.00   17.41 ? 294 GLY A C     1 
ATOM   1405  O  O     . GLY A  1 187 ? 16.298  27.775  -6.699  1.00   18.12 ? 294 GLY A O     1 
ATOM   1406  N  N     . ASN A  1 188 ? 18.152  28.382  -7.824  1.00   13.63 ? 295 ASN A N     1 
ATOM   1407  C  CA    . ASN A  1 188 ? 17.484  29.342  -8.697  1.00   14.30 ? 295 ASN A CA    1 
ATOM   1408  C  C     . ASN A  1 188 ? 17.428  28.892  -10.157 1.00   15.41 ? 295 ASN A C     1 
ATOM   1409  O  O     . ASN A  1 188 ? 17.139  29.693  -11.038 1.00   16.58 ? 295 ASN A O     1 
ATOM   1410  C  CB    . ASN A  1 188 ? 18.185  30.702  -8.660  1.00   15.85 ? 295 ASN A CB    1 
ATOM   1411  C  CG    . ASN A  1 188 ? 17.929  31.471  -7.383  1.00   18.01 ? 295 ASN A CG    1 
ATOM   1412  O  OD1   . ASN A  1 188 ? 16.871  31.358  -6.770  1.00   20.09 ? 295 ASN A OD1   1 
ATOM   1413  N  ND2   . ASN A  1 188 ? 18.896  32.288  -6.989  1.00   17.40 ? 295 ASN A ND2   1 
ATOM   1414  N  N     . GLY A  1 189 ? 17.690  27.621  -10.426 1.00   15.25 ? 296 GLY A N     1 
ATOM   1415  C  CA    . GLY A  1 189 ? 17.675  27.160  -11.803 1.00   14.90 ? 296 GLY A CA    1 
ATOM   1416  C  C     . GLY A  1 189 ? 16.327  26.919  -12.462 1.00   17.14 ? 296 GLY A C     1 
ATOM   1417  O  O     . GLY A  1 189 ? 16.257  26.249  -13.493 1.00   18.99 ? 296 GLY A O     1 
ATOM   1418  N  N     . GLY A  1 190 ? 15.254  27.457  -11.893 1.00   17.82 ? 297 GLY A N     1 
ATOM   1419  C  CA    . GLY A  1 190 ? 13.936  27.256  -12.480 1.00   18.84 ? 297 GLY A CA    1 
ATOM   1420  C  C     . GLY A  1 190 ? 13.807  27.579  -13.966 1.00   20.14 ? 297 GLY A C     1 
ATOM   1421  O  O     . GLY A  1 190 ? 13.195  26.825  -14.723 1.00   16.70 ? 297 GLY A O     1 
ATOM   1422  N  N     . ARG A  1 191 ? 14.392  28.691  -14.395 1.00   22.20 ? 298 ARG A N     1 
ATOM   1423  C  CA    . ARG A  1 191 ? 14.301  29.087  -15.794 1.00   24.37 ? 298 ARG A CA    1 
ATOM   1424  C  C     . ARG A  1 191 ? 15.075  28.160  -16.739 1.00   25.87 ? 298 ARG A C     1 
ATOM   1425  O  O     . ARG A  1 191 ? 14.765  28.075  -17.929 1.00   24.13 ? 298 ARG A O     1 
ATOM   1426  C  CB    . ARG A  1 191 ? 14.791  30.520  -15.968 1.00   26.23 ? 298 ARG A CB    1 
ATOM   1427  C  CG    . ARG A  1 191 ? 14.393  31.108  -17.296 1.00   29.91 ? 298 ARG A CG    1 
ATOM   1428  C  CD    . ARG A  1 191 ? 15.527  31.874  -17.897 1.00   37.19 ? 298 ARG A CD    1 
ATOM   1429  N  NE    . ARG A  1 191 ? 15.868  33.041  -17.099 1.00   43.13 ? 298 ARG A NE    1 
ATOM   1430  C  CZ    . ARG A  1 191 ? 17.036  33.664  -17.184 1.00   47.45 ? 298 ARG A CZ    1 
ATOM   1431  N  NH1   . ARG A  1 191 ? 17.283  34.726  -16.430 1.00   50.41 ? 298 ARG A NH1   1 
ATOM   1432  N  NH2   . ARG A  1 191 ? 17.966  33.207  -18.019 1.00   50.42 ? 298 ARG A NH2   1 
ATOM   1433  N  N     . GLU A  1 192 ? 16.081  27.468  -16.211 1.00   26.73 ? 299 GLU A N     1 
ATOM   1434  C  CA    . GLU A  1 192 ? 16.878  26.552  -17.015 1.00   28.71 ? 299 GLU A CA    1 
ATOM   1435  C  C     . GLU A  1 192 ? 16.371  25.111  -16.849 1.00   30.25 ? 299 GLU A C     1 
ATOM   1436  O  O     . GLU A  1 192 ? 17.016  24.153  -17.307 1.00   27.68 ? 299 GLU A O     1 
ATOM   1437  C  CB    . GLU A  1 192 ? 18.356  26.621  -16.608 1.00   30.15 ? 299 GLU A CB    1 
ATOM   1438  C  CG    . GLU A  1 192 ? 18.906  28.019  -16.321 1.00   38.71 ? 299 GLU A CG    1 
ATOM   1439  C  CD    . GLU A  1 192 ? 18.494  29.077  -17.351 1.00   43.38 ? 299 GLU A CD    1 
ATOM   1440  O  OE1   . GLU A  1 192 ? 18.655  28.847  -18.574 1.00   45.91 ? 299 GLU A OE1   1 
ATOM   1441  O  OE2   . GLU A  1 192 ? 18.017  30.152  -16.924 1.00   45.26 ? 299 GLU A OE2   1 
ATOM   1442  N  N     . HIS A  1 193 ? 15.212  24.970  -16.204 1.00   29.52 ? 300 HIS A N     1 
ATOM   1443  C  CA    . HIS A  1 193 ? 14.601  23.668  -15.955 1.00   29.49 ? 300 HIS A CA    1 
ATOM   1444  C  C     . HIS A  1 193 ? 15.509  22.790  -15.114 1.00   28.01 ? 300 HIS A C     1 
ATOM   1445  O  O     . HIS A  1 193 ? 15.532  21.567  -15.279 1.00   25.30 ? 300 HIS A O     1 
ATOM   1446  C  CB    . HIS A  1 193 ? 14.298  22.943  -17.264 1.00   33.19 ? 300 HIS A CB    1 
ATOM   1447  C  CG    . HIS A  1 193 ? 13.368  23.686  -18.163 1.00   38.97 ? 300 HIS A CG    1 
ATOM   1448  N  ND1   . HIS A  1 193 ? 13.809  24.531  -19.160 1.00   40.35 ? 300 HIS A ND1   1 
ATOM   1449  C  CD2   . HIS A  1 193 ? 12.016  23.744  -18.191 1.00   40.41 ? 300 HIS A CD2   1 
ATOM   1450  C  CE1   . HIS A  1 193 ? 12.769  25.079  -19.762 1.00   41.93 ? 300 HIS A CE1   1 
ATOM   1451  N  NE2   . HIS A  1 193 ? 11.669  24.619  -19.192 1.00   41.30 ? 300 HIS A NE2   1 
ATOM   1452  N  N     . ASP A  1 194 ? 16.250  23.412  -14.208 1.00   24.73 ? 301 ASP A N     1 
ATOM   1453  C  CA    . ASP A  1 194 ? 17.161  22.668  -13.362 1.00   25.57 ? 301 ASP A CA    1 
ATOM   1454  C  C     . ASP A  1 194 ? 16.410  21.799  -12.350 1.00   25.50 ? 301 ASP A C     1 
ATOM   1455  O  O     . ASP A  1 194 ? 15.259  22.081  -12.008 1.00   25.66 ? 301 ASP A O     1 
ATOM   1456  C  CB    . ASP A  1 194 ? 18.098  23.642  -12.646 1.00   24.56 ? 301 ASP A CB    1 
ATOM   1457  C  CG    . ASP A  1 194 ? 19.353  22.967  -12.126 1.00   23.53 ? 301 ASP A CG    1 
ATOM   1458  O  OD1   . ASP A  1 194 ? 19.631  21.820  -12.542 1.00   20.10 ? 301 ASP A OD1   1 
ATOM   1459  O  OD2   . ASP A  1 194 ? 20.069  23.590  -11.313 1.00   25.66 ? 301 ASP A OD2   1 
ATOM   1460  N  N     . SER A  1 195 ? 17.069  20.734  -11.894 1.00   24.52 ? 302 SER A N     1 
ATOM   1461  C  CA    . SER A  1 195 ? 16.505  19.809  -10.916 1.00   24.69 ? 302 SER A CA    1 
ATOM   1462  C  C     . SER A  1 195 ? 17.376  19.845  -9.665  1.00   27.33 ? 302 SER A C     1 
ATOM   1463  O  O     . SER A  1 195 ? 18.587  19.615  -9.739  1.00   28.69 ? 302 SER A O     1 
ATOM   1464  C  CB    . SER A  1 195 ? 16.495  18.388  -11.477 1.00   23.97 ? 302 SER A CB    1 
ATOM   1465  O  OG    . SER A  1 195 ? 15.836  17.490  -10.593 1.00   24.43 ? 302 SER A OG    1 
ATOM   1466  N  N     . CYS A  1 196 ? 16.778  20.122  -8.512  1.00   28.04 ? 303 CYS A N     1 
ATOM   1467  C  CA    . CYS A  1 196 ? 17.572  20.169  -7.302  1.00   25.06 ? 303 CYS A CA    1 
ATOM   1468  C  C     . CYS A  1 196 ? 18.030  18.813  -6.779  1.00   24.82 ? 303 CYS A C     1 
ATOM   1469  O  O     . CYS A  1 196 ? 18.612  18.730  -5.699  1.00   25.90 ? 303 CYS A O     1 
ATOM   1470  C  CB    . CYS A  1 196 ? 16.858  20.956  -6.198  1.00   25.43 ? 303 CYS A CB    1 
ATOM   1471  S  SG    . CYS A  1 196 ? 15.053  20.772  -6.026  1.00   25.41 ? 303 CYS A SG    1 
ATOM   1472  N  N     . ASN A  1 197 ? 17.776  17.752  -7.541  1.00   25.23 ? 304 ASN A N     1 
ATOM   1473  C  CA    . ASN A  1 197 ? 18.240  16.420  -7.155  1.00   24.19 ? 304 ASN A CA    1 
ATOM   1474  C  C     . ASN A  1 197 ? 19.604  16.196  -7.825  1.00   22.56 ? 304 ASN A C     1 
ATOM   1475  O  O     . ASN A  1 197 ? 20.276  15.193  -7.593  1.00   20.50 ? 304 ASN A O     1 
ATOM   1476  C  CB    . ASN A  1 197 ? 17.245  15.344  -7.593  1.00   25.63 ? 304 ASN A CB    1 
ATOM   1477  C  CG    . ASN A  1 197 ? 16.150  15.098  -6.560  1.00   28.99 ? 304 ASN A CG    1 
ATOM   1478  O  OD1   . ASN A  1 197 ? 16.050  15.803  -5.551  1.00   28.41 ? 304 ASN A OD1   1 
ATOM   1479  N  ND2   . ASN A  1 197 ? 15.319  14.091  -6.814  1.00   30.11 ? 304 ASN A ND2   1 
ATOM   1480  N  N     . CYS A  1 198 ? 19.994  17.149  -8.665  1.00   21.20 ? 305 CYS A N     1 
ATOM   1481  C  CA    . CYS A  1 198 ? 21.269  17.107  -9.358  1.00   20.55 ? 305 CYS A CA    1 
ATOM   1482  C  C     . CYS A  1 198 ? 22.236  18.011  -8.617  1.00   20.03 ? 305 CYS A C     1 
ATOM   1483  O  O     . CYS A  1 198 ? 23.284  18.394  -9.135  1.00   19.13 ? 305 CYS A O     1 
ATOM   1484  C  CB    . CYS A  1 198 ? 21.107  17.588  -10.798 1.00   22.36 ? 305 CYS A CB    1 
ATOM   1485  S  SG    . CYS A  1 198 ? 20.222  16.413  -11.846 1.00   23.27 ? 305 CYS A SG    1 
ATOM   1486  N  N     . ASP A  1 199 ? 21.854  18.349  -7.393  1.00   20.39 ? 306 ASP A N     1 
ATOM   1487  C  CA    . ASP A  1 199 ? 22.635  19.206  -6.512  1.00   19.42 ? 306 ASP A CA    1 
ATOM   1488  C  C     . ASP A  1 199 ? 22.909  18.385  -5.258  1.00   19.62 ? 306 ASP A C     1 
ATOM   1489  O  O     . ASP A  1 199 ? 22.017  18.179  -4.450  1.00   22.25 ? 306 ASP A O     1 
ATOM   1490  C  CB    . ASP A  1 199 ? 21.806  20.434  -6.154  1.00   19.57 ? 306 ASP A CB    1 
ATOM   1491  C  CG    . ASP A  1 199 ? 22.502  21.337  -5.186  1.00   22.73 ? 306 ASP A CG    1 
ATOM   1492  O  OD1   . ASP A  1 199 ? 23.183  20.817  -4.274  1.00   23.73 ? 306 ASP A OD1   1 
ATOM   1493  O  OD2   . ASP A  1 199 ? 22.356  22.564  -5.330  1.00   25.18 ? 306 ASP A OD2   1 
ATOM   1494  N  N     . GLY A  1 200 ? 24.138  17.919  -5.095  1.00   20.93 ? 307 GLY A N     1 
ATOM   1495  C  CA    . GLY A  1 200 ? 24.469  17.098  -3.942  1.00   19.35 ? 307 GLY A CA    1 
ATOM   1496  C  C     . GLY A  1 200 ? 24.314  17.706  -2.560  1.00   18.44 ? 307 GLY A C     1 
ATOM   1497  O  O     . GLY A  1 200 ? 24.295  16.978  -1.569  1.00   17.94 ? 307 GLY A O     1 
ATOM   1498  N  N     . TYR A  1 201 ? 24.210  19.028  -2.474  1.00   17.35 ? 308 TYR A N     1 
ATOM   1499  C  CA    . TYR A  1 201 ? 24.065  19.672  -1.176  1.00   17.99 ? 308 TYR A CA    1 
ATOM   1500  C  C     . TYR A  1 201 ? 22.625  19.637  -0.716  1.00   17.99 ? 308 TYR A C     1 
ATOM   1501  O  O     . TYR A  1 201 ? 22.334  19.286  0.423   1.00   19.86 ? 308 TYR A O     1 
ATOM   1502  C  CB    . TYR A  1 201 ? 24.563  21.120  -1.229  1.00   16.12 ? 308 TYR A CB    1 
ATOM   1503  C  CG    . TYR A  1 201 ? 26.015  21.211  -1.619  1.00   16.00 ? 308 TYR A CG    1 
ATOM   1504  C  CD1   . TYR A  1 201 ? 26.406  21.121  -2.959  1.00   15.74 ? 308 TYR A CD1   1 
ATOM   1505  C  CD2   . TYR A  1 201 ? 27.006  21.344  -0.651  1.00   14.12 ? 308 TYR A CD2   1 
ATOM   1506  C  CE1   . TYR A  1 201 ? 27.744  21.165  -3.323  1.00   15.57 ? 308 TYR A CE1   1 
ATOM   1507  C  CE2   . TYR A  1 201 ? 28.349  21.389  -1.002  1.00   17.02 ? 308 TYR A CE2   1 
ATOM   1508  C  CZ    . TYR A  1 201 ? 28.717  21.298  -2.342  1.00   17.74 ? 308 TYR A CZ    1 
ATOM   1509  O  OH    . TYR A  1 201 ? 30.056  21.338  -2.695  1.00   17.49 ? 308 TYR A OH    1 
ATOM   1510  N  N     . THR A  1 202 ? 21.721  19.998  -1.611  1.00   17.89 ? 309 THR A N     1 
ATOM   1511  C  CA    . THR A  1 202 ? 20.302  19.995  -1.302  1.00   18.56 ? 309 THR A CA    1 
ATOM   1512  C  C     . THR A  1 202 ? 19.817  18.548  -1.218  1.00   20.91 ? 309 THR A C     1 
ATOM   1513  O  O     . THR A  1 202 ? 19.012  18.182  -0.367  1.00   22.76 ? 309 THR A O     1 
ATOM   1514  C  CB    . THR A  1 202 ? 19.506  20.718  -2.405  1.00   18.54 ? 309 THR A CB    1 
ATOM   1515  O  OG1   . THR A  1 202 ? 19.924  20.241  -3.689  1.00   16.82 ? 309 THR A OG1   1 
ATOM   1516  C  CG2   . THR A  1 202 ? 19.721  22.220  -2.337  1.00   18.30 ? 309 THR A CG2   1 
ATOM   1517  N  N     . ASN A  1 203 ? 20.344  17.728  -2.114  1.00   21.24 ? 310 ASN A N     1 
ATOM   1518  C  CA    . ASN A  1 203 ? 19.988  16.323  -2.223  1.00   19.80 ? 310 ASN A CA    1 
ATOM   1519  C  C     . ASN A  1 203 ? 20.439  15.466  -1.037  1.00   20.89 ? 310 ASN A C     1 
ATOM   1520  O  O     . ASN A  1 203 ? 19.970  14.337  -0.865  1.00   18.65 ? 310 ASN A O     1 
ATOM   1521  C  CB    . ASN A  1 203 ? 20.586  15.793  -3.517  1.00   20.71 ? 310 ASN A CB    1 
ATOM   1522  C  CG    . ASN A  1 203 ? 20.033  14.458  -3.915  1.00   24.63 ? 310 ASN A CG    1 
ATOM   1523  O  OD1   . ASN A  1 203 ? 18.838  14.309  -4.163  1.00   27.57 ? 310 ASN A OD1   1 
ATOM   1524  N  ND2   . ASN A  1 203 ? 20.910  13.466  -3.993  1.00   28.74 ? 310 ASN A ND2   1 
ATOM   1525  N  N     . SER A  1 204 ? 21.346  16.003  -0.222  1.00   20.66 ? 311 SER A N     1 
ATOM   1526  C  CA    . SER A  1 204 ? 21.861  15.280  0.940   1.00   19.04 ? 311 SER A CA    1 
ATOM   1527  C  C     . SER A  1 204 ? 20.816  15.127  2.043   1.00   18.78 ? 311 SER A C     1 
ATOM   1528  O  O     . SER A  1 204 ? 19.980  15.999  2.237   1.00   17.73 ? 311 SER A O     1 
ATOM   1529  C  CB    . SER A  1 204 ? 23.080  16.002  1.502   1.00   20.63 ? 311 SER A CB    1 
ATOM   1530  O  OG    . SER A  1 204 ? 23.533  15.368  2.687   1.00   23.89 ? 311 SER A OG    1 
ATOM   1531  N  N     . ILE A  1 205 ? 20.858  14.018  2.769   1.00   17.05 ? 312 ILE A N     1 
ATOM   1532  C  CA    . ILE A  1 205 ? 19.896  13.821  3.844   1.00   15.75 ? 312 ILE A CA    1 
ATOM   1533  C  C     . ILE A  1 205 ? 20.306  14.618  5.080   1.00   18.10 ? 312 ILE A C     1 
ATOM   1534  O  O     . ILE A  1 205 ? 19.519  14.769  6.010   1.00   20.09 ? 312 ILE A O     1 
ATOM   1535  C  CB    . ILE A  1 205 ? 19.758  12.335  4.249   1.00   12.23 ? 312 ILE A CB    1 
ATOM   1536  C  CG1   . ILE A  1 205 ? 21.007  11.866  4.994   1.00   10.86 ? 312 ILE A CG1   1 
ATOM   1537  C  CG2   . ILE A  1 205 ? 19.534  11.488  3.023   1.00   10.16 ? 312 ILE A CG2   1 
ATOM   1538  C  CD1   . ILE A  1 205 ? 20.876  10.479  5.598   1.00   7.55  ? 312 ILE A CD1   1 
ATOM   1539  N  N     . TYR A  1 206 ? 21.534  15.132  5.089   1.00   18.86 ? 313 TYR A N     1 
ATOM   1540  C  CA    . TYR A  1 206 ? 22.018  15.905  6.226   1.00   17.26 ? 313 TYR A CA    1 
ATOM   1541  C  C     . TYR A  1 206 ? 21.567  17.366  6.177   1.00   17.94 ? 313 TYR A C     1 
ATOM   1542  O  O     . TYR A  1 206 ? 21.734  18.109  7.142   1.00   20.72 ? 313 TYR A O     1 
ATOM   1543  C  CB    . TYR A  1 206 ? 23.541  15.858  6.289   1.00   17.52 ? 313 TYR A CB    1 
ATOM   1544  C  CG    . TYR A  1 206 ? 24.120  14.475  6.157   1.00   18.08 ? 313 TYR A CG    1 
ATOM   1545  C  CD1   . TYR A  1 206 ? 23.629  13.408  6.916   1.00   15.99 ? 313 TYR A CD1   1 
ATOM   1546  C  CD2   . TYR A  1 206 ? 25.190  14.243  5.301   1.00   17.58 ? 313 TYR A CD2   1 
ATOM   1547  C  CE1   . TYR A  1 206 ? 24.203  12.148  6.818   1.00   18.08 ? 313 TYR A CE1   1 
ATOM   1548  C  CE2   . TYR A  1 206 ? 25.768  12.997  5.196   1.00   16.71 ? 313 TYR A CE2   1 
ATOM   1549  C  CZ    . TYR A  1 206 ? 25.280  11.954  5.949   1.00   20.45 ? 313 TYR A CZ    1 
ATOM   1550  O  OH    . TYR A  1 206 ? 25.886  10.730  5.817   1.00   24.05 ? 313 TYR A OH    1 
ATOM   1551  N  N     . THR A  1 207 ? 20.997  17.788  5.057   1.00   16.18 ? 314 THR A N     1 
ATOM   1552  C  CA    . THR A  1 207 ? 20.553  19.169  4.936   1.00   15.26 ? 314 THR A CA    1 
ATOM   1553  C  C     . THR A  1 207 ? 19.048  19.269  4.702   1.00   14.84 ? 314 THR A C     1 
ATOM   1554  O  O     . THR A  1 207 ? 18.451  18.404  4.067   1.00   13.90 ? 314 THR A O     1 
ATOM   1555  C  CB    . THR A  1 207 ? 21.254  19.903  3.762   1.00   15.10 ? 314 THR A CB    1 
ATOM   1556  O  OG1   . THR A  1 207 ? 20.719  19.439  2.520   1.00   13.14 ? 314 THR A OG1   1 
ATOM   1557  C  CG2   . THR A  1 207 ? 22.748  19.641  3.762   1.00   17.48 ? 314 THR A CG2   1 
ATOM   1558  N  N     . LEU A  1 208 ? 18.440  20.326  5.243   1.00   13.54 ? 315 LEU A N     1 
ATOM   1559  C  CA    . LEU A  1 208 ? 17.022  20.578  5.049   1.00   11.29 ? 315 LEU A CA    1 
ATOM   1560  C  C     . LEU A  1 208 ? 16.966  21.525  3.864   1.00   12.86 ? 315 LEU A C     1 
ATOM   1561  O  O     . LEU A  1 208 ? 17.263  22.709  4.002   1.00   11.56 ? 315 LEU A O     1 
ATOM   1562  C  CB    . LEU A  1 208 ? 16.383  21.267  6.252   1.00   9.16  ? 315 LEU A CB    1 
ATOM   1563  C  CG    . LEU A  1 208 ? 16.374  20.559  7.595   1.00   12.41 ? 315 LEU A CG    1 
ATOM   1564  C  CD1   . LEU A  1 208 ? 17.705  20.823  8.278   1.00   14.82 ? 315 LEU A CD1   1 
ATOM   1565  C  CD2   . LEU A  1 208 ? 15.218  21.078  8.449   1.00   11.40 ? 315 LEU A CD2   1 
ATOM   1566  N  N     . SER A  1 209 ? 16.617  20.997  2.694   1.00   12.29 ? 316 SER A N     1 
ATOM   1567  C  CA    . SER A  1 209 ? 16.534  21.807  1.487   1.00   12.70 ? 316 SER A CA    1 
ATOM   1568  C  C     . SER A  1 209 ? 15.226  22.582  1.523   1.00   13.64 ? 316 SER A C     1 
ATOM   1569  O  O     . SER A  1 209 ? 14.157  22.004  1.702   1.00   16.56 ? 316 SER A O     1 
ATOM   1570  C  CB    . SER A  1 209 ? 16.594  20.909  0.249   1.00   14.20 ? 316 SER A CB    1 
ATOM   1571  O  OG    . SER A  1 209 ? 16.874  21.679  -0.913  1.00   14.58 ? 316 SER A OG    1 
ATOM   1572  N  N     . ILE A  1 210 ? 15.314  23.893  1.339   1.00   13.43 ? 317 ILE A N     1 
ATOM   1573  C  CA    . ILE A  1 210 ? 14.139  24.757  1.401   1.00   12.33 ? 317 ILE A CA    1 
ATOM   1574  C  C     . ILE A  1 210 ? 13.810  25.480  0.102   1.00   12.61 ? 317 ILE A C     1 
ATOM   1575  O  O     . ILE A  1 210 ? 14.646  26.192  -0.444  1.00   14.60 ? 317 ILE A O     1 
ATOM   1576  C  CB    . ILE A  1 210 ? 14.330  25.826  2.499   1.00   12.88 ? 317 ILE A CB    1 
ATOM   1577  C  CG1   . ILE A  1 210 ? 14.706  25.146  3.836   1.00   13.08 ? 317 ILE A CG1   1 
ATOM   1578  C  CG2   . ILE A  1 210 ? 13.085  26.694  2.595   1.00   11.10 ? 317 ILE A CG2   1 
ATOM   1579  C  CD1   . ILE A  1 210 ? 13.650  24.168  4.382   1.00   5.92  ? 317 ILE A CD1   1 
ATOM   1580  N  N     . SER A  1 211 ? 12.585  25.313  -0.383  1.00   14.78 ? 318 SER A N     1 
ATOM   1581  C  CA    . SER A  1 211 ? 12.148  25.967  -1.616  1.00   15.11 ? 318 SER A CA    1 
ATOM   1582  C  C     . SER A  1 211 ? 11.373  27.256  -1.340  1.00   15.88 ? 318 SER A C     1 
ATOM   1583  O  O     . SER A  1 211 ? 11.143  27.620  -0.186  1.00   12.43 ? 318 SER A O     1 
ATOM   1584  C  CB    . SER A  1 211 ? 11.291  25.019  -2.461  1.00   15.24 ? 318 SER A CB    1 
ATOM   1585  O  OG    . SER A  1 211 ? 12.102  24.038  -3.084  1.00   12.87 ? 318 SER A OG    1 
ATOM   1586  N  N     . SER A  1 212 ? 10.953  27.928  -2.415  1.00   17.46 ? 319 SER A N     1 
ATOM   1587  C  CA    . SER A  1 212 ? 10.251  29.205  -2.311  1.00   17.80 ? 319 SER A CA    1 
ATOM   1588  C  C     . SER A  1 212 ? 8.808   29.240  -2.815  1.00   19.64 ? 319 SER A C     1 
ATOM   1589  O  O     . SER A  1 212 ? 8.393   28.423  -3.637  1.00   20.07 ? 319 SER A O     1 
ATOM   1590  C  CB    . SER A  1 212 ? 11.048  30.281  -3.063  1.00   17.50 ? 319 SER A CB    1 
ATOM   1591  O  OG    . SER A  1 212 ? 12.375  30.407  -2.581  1.00   16.70 ? 319 SER A OG    1 
ATOM   1592  N  N     . ALA A  1 213 ? 8.060   30.220  -2.317  1.00   20.25 ? 320 ALA A N     1 
ATOM   1593  C  CA    . ALA A  1 213 ? 6.667   30.447  -2.705  1.00   19.81 ? 320 ALA A CA    1 
ATOM   1594  C  C     . ALA A  1 213 ? 6.484   31.961  -2.801  1.00   21.52 ? 320 ALA A C     1 
ATOM   1595  O  O     . ALA A  1 213 ? 7.016   32.708  -1.973  1.00   23.60 ? 320 ALA A O     1 
ATOM   1596  C  CB    . ALA A  1 213 ? 5.726   29.874  -1.662  1.00   16.55 ? 320 ALA A CB    1 
ATOM   1597  N  N     . THR A  1 214 ? 5.758   32.419  -3.816  1.00   20.85 ? 321 THR A N     1 
ATOM   1598  C  CA    . THR A  1 214 ? 5.536   33.854  -3.985  1.00   19.64 ? 321 THR A CA    1 
ATOM   1599  C  C     . THR A  1 214 ? 4.456   34.305  -3.012  1.00   20.44 ? 321 THR A C     1 
ATOM   1600  O  O     . THR A  1 214 ? 3.749   33.476  -2.430  1.00   21.16 ? 321 THR A O     1 
ATOM   1601  C  CB    . THR A  1 214 ? 5.075   34.205  -5.414  1.00   19.90 ? 321 THR A CB    1 
ATOM   1602  O  OG1   . THR A  1 214 ? 3.756   33.685  -5.640  1.00   18.39 ? 321 THR A OG1   1 
ATOM   1603  C  CG2   . THR A  1 214 ? 6.022   33.610  -6.438  1.00   20.54 ? 321 THR A CG2   1 
ATOM   1604  N  N     . GLN A  1 215 ? 4.322   35.616  -2.843  1.00   17.20 ? 322 GLN A N     1 
ATOM   1605  C  CA    . GLN A  1 215 ? 3.325   36.148  -1.931  1.00   17.07 ? 322 GLN A CA    1 
ATOM   1606  C  C     . GLN A  1 215 ? 1.910   35.634  -2.218  1.00   16.93 ? 322 GLN A C     1 
ATOM   1607  O  O     . GLN A  1 215 ? 1.159   35.346  -1.287  1.00   17.98 ? 322 GLN A O     1 
ATOM   1608  C  CB    . GLN A  1 215 ? 3.353   37.678  -1.954  1.00   19.00 ? 322 GLN A CB    1 
ATOM   1609  C  CG    . GLN A  1 215 ? 2.193   38.315  -1.218  1.00   21.43 ? 322 GLN A CG    1 
ATOM   1610  C  CD    . GLN A  1 215 ? 2.321   39.823  -1.093  1.00   24.45 ? 322 GLN A CD    1 
ATOM   1611  O  OE1   . GLN A  1 215 ? 2.768   40.503  -2.019  1.00   23.90 ? 322 GLN A OE1   1 
ATOM   1612  N  NE2   . GLN A  1 215 ? 1.908   40.357  0.056   1.00   25.00 ? 322 GLN A NE2   1 
ATOM   1613  N  N     . PHE A  1 216 ? 1.540   35.508  -3.490  1.00   16.39 ? 323 PHE A N     1 
ATOM   1614  C  CA    . PHE A  1 216 ? 0.205   35.026  -3.833  1.00   13.19 ? 323 PHE A CA    1 
ATOM   1615  C  C     . PHE A  1 216 ? 0.127   33.501  -3.835  1.00   17.15 ? 323 PHE A C     1 
ATOM   1616  O  O     . PHE A  1 216 ? -0.853  32.921  -4.306  1.00   18.79 ? 323 PHE A O     1 
ATOM   1617  C  CB    . PHE A  1 216 ? -0.249  35.564  -5.195  1.00   9.72  ? 323 PHE A CB    1 
ATOM   1618  C  CG    . PHE A  1 216 ? -0.251  37.067  -5.290  1.00   13.57 ? 323 PHE A CG    1 
ATOM   1619  C  CD1   . PHE A  1 216 ? -0.324  37.860  -4.131  1.00   12.54 ? 323 PHE A CD1   1 
ATOM   1620  C  CD2   . PHE A  1 216 ? -0.149  37.700  -6.538  1.00   11.79 ? 323 PHE A CD2   1 
ATOM   1621  C  CE1   . PHE A  1 216 ? -0.294  39.265  -4.206  1.00   8.70  ? 323 PHE A CE1   1 
ATOM   1622  C  CE2   . PHE A  1 216 ? -0.118  39.106  -6.633  1.00   11.21 ? 323 PHE A CE2   1 
ATOM   1623  C  CZ    . PHE A  1 216 ? -0.188  39.891  -5.462  1.00   10.50 ? 323 PHE A CZ    1 
ATOM   1624  N  N     . GLY A  1 217 ? 1.165   32.851  -3.318  1.00   17.90 ? 324 GLY A N     1 
ATOM   1625  C  CA    . GLY A  1 217 ? 1.162   31.397  -3.246  1.00   19.56 ? 324 GLY A CA    1 
ATOM   1626  C  C     . GLY A  1 217 ? 1.455   30.599  -4.506  1.00   21.40 ? 324 GLY A C     1 
ATOM   1627  O  O     . GLY A  1 217 ? 0.903   29.523  -4.700  1.00   21.42 ? 324 GLY A O     1 
ATOM   1628  N  N     . ASN A  1 218 ? 2.341   31.104  -5.354  1.00   22.62 ? 325 ASN A N     1 
ATOM   1629  C  CA    . ASN A  1 218 ? 2.687   30.397  -6.575  1.00   21.66 ? 325 ASN A CA    1 
ATOM   1630  C  C     . ASN A  1 218 ? 4.149   29.979  -6.604  1.00   21.01 ? 325 ASN A C     1 
ATOM   1631  O  O     . ASN A  1 218 ? 4.951   30.459  -5.803  1.00   22.69 ? 325 ASN A O     1 
ATOM   1632  C  CB    . ASN A  1 218 ? 2.370   31.274  -7.782  1.00   22.18 ? 325 ASN A CB    1 
ATOM   1633  C  CG    . ASN A  1 218 ? 0.891   31.527  -7.921  1.00   22.76 ? 325 ASN A CG    1 
ATOM   1634  O  OD1   . ASN A  1 218 ? 0.109   30.587  -8.049  1.00   25.45 ? 325 ASN A OD1   1 
ATOM   1635  N  ND2   . ASN A  1 218 ? 0.492   32.790  -7.884  1.00   23.14 ? 325 ASN A ND2   1 
ATOM   1636  N  N     . VAL A  1 219 ? 4.478   29.066  -7.515  1.00   17.56 ? 326 VAL A N     1 
ATOM   1637  C  CA    . VAL A  1 219 ? 5.845   28.593  -7.679  1.00   16.27 ? 326 VAL A CA    1 
ATOM   1638  C  C     . VAL A  1 219 ? 6.607   29.660  -8.452  1.00   17.16 ? 326 VAL A C     1 
ATOM   1639  O  O     . VAL A  1 219 ? 6.303   29.919  -9.621  1.00   17.27 ? 326 VAL A O     1 
ATOM   1640  C  CB    . VAL A  1 219 ? 5.887   27.273  -8.484  1.00   17.12 ? 326 VAL A CB    1 
ATOM   1641  C  CG1   . VAL A  1 219 ? 7.336   26.807  -8.648  1.00   10.94 ? 326 VAL A CG1   1 
ATOM   1642  C  CG2   . VAL A  1 219 ? 5.041   26.217  -7.786  1.00   11.27 ? 326 VAL A CG2   1 
ATOM   1643  N  N     . PRO A  1 220 ? 7.605   30.298  -7.814  1.00   17.89 ? 327 PRO A N     1 
ATOM   1644  C  CA    . PRO A  1 220 ? 8.406   31.348  -8.458  1.00   19.09 ? 327 PRO A CA    1 
ATOM   1645  C  C     . PRO A  1 220 ? 9.065   30.886  -9.752  1.00   20.27 ? 327 PRO A C     1 
ATOM   1646  O  O     . PRO A  1 220 ? 9.278   29.695  -9.966  1.00   19.80 ? 327 PRO A O     1 
ATOM   1647  C  CB    . PRO A  1 220 ? 9.437   31.707  -7.386  1.00   17.21 ? 327 PRO A CB    1 
ATOM   1648  C  CG    . PRO A  1 220 ? 8.733   31.410  -6.121  1.00   20.72 ? 327 PRO A CG    1 
ATOM   1649  C  CD    . PRO A  1 220 ? 8.044   30.095  -6.424  1.00   18.11 ? 327 PRO A CD    1 
ATOM   1650  N  N     . TRP A  1 221 ? 9.389   31.841  -10.616 1.00   21.22 ? 328 TRP A N     1 
ATOM   1651  C  CA    . TRP A  1 221 ? 10.027  31.521  -11.882 1.00   21.42 ? 328 TRP A CA    1 
ATOM   1652  C  C     . TRP A  1 221 ? 11.378  30.843  -11.682 1.00   21.66 ? 328 TRP A C     1 
ATOM   1653  O  O     . TRP A  1 221 ? 11.781  29.996  -12.479 1.00   23.70 ? 328 TRP A O     1 
ATOM   1654  C  CB    . TRP A  1 221 ? 10.235  32.790  -12.703 1.00   21.40 ? 328 TRP A CB    1 
ATOM   1655  C  CG    . TRP A  1 221 ? 11.171  33.767  -12.070 1.00   20.96 ? 328 TRP A CG    1 
ATOM   1656  C  CD1   . TRP A  1 221 ? 10.858  34.760  -11.187 1.00   22.98 ? 328 TRP A CD1   1 
ATOM   1657  C  CD2   . TRP A  1 221 ? 12.581  33.851  -12.284 1.00   20.26 ? 328 TRP A CD2   1 
ATOM   1658  N  NE1   . TRP A  1 221 ? 11.989  35.464  -10.842 1.00   21.02 ? 328 TRP A NE1   1 
ATOM   1659  C  CE2   . TRP A  1 221 ? 13.061  34.925  -11.500 1.00   18.96 ? 328 TRP A CE2   1 
ATOM   1660  C  CE3   . TRP A  1 221 ? 13.488  33.121  -13.064 1.00   20.15 ? 328 TRP A CE3   1 
ATOM   1661  C  CZ2   . TRP A  1 221 ? 14.402  35.288  -11.476 1.00   19.86 ? 328 TRP A CZ2   1 
ATOM   1662  C  CZ3   . TRP A  1 221 ? 14.819  33.480  -13.043 1.00   19.90 ? 328 TRP A CZ3   1 
ATOM   1663  C  CH2   . TRP A  1 221 ? 15.266  34.556  -12.252 1.00   22.34 ? 328 TRP A CH2   1 
ATOM   1664  N  N     . TYR A  1 222 ? 12.070  31.214  -10.613 1.00   19.27 ? 329 TYR A N     1 
ATOM   1665  C  CA    . TYR A  1 222 ? 13.387  30.658  -10.327 1.00   19.62 ? 329 TYR A CA    1 
ATOM   1666  C  C     . TYR A  1 222 ? 13.389  29.303  -9.619  1.00   18.91 ? 329 TYR A C     1 
ATOM   1667  O  O     . TYR A  1 222 ? 14.424  28.644  -9.552  1.00   18.65 ? 329 TYR A O     1 
ATOM   1668  C  CB    . TYR A  1 222 ? 14.186  31.671  -9.504  1.00   17.43 ? 329 TYR A CB    1 
ATOM   1669  C  CG    . TYR A  1 222 ? 13.459  32.167  -8.267  1.00   14.31 ? 329 TYR A CG    1 
ATOM   1670  C  CD1   . TYR A  1 222 ? 13.377  31.382  -7.119  1.00   14.15 ? 329 TYR A CD1   1 
ATOM   1671  C  CD2   . TYR A  1 222 ? 12.848  33.418  -8.248  1.00   11.84 ? 329 TYR A CD2   1 
ATOM   1672  C  CE1   . TYR A  1 222 ? 12.701  31.828  -5.983  1.00   14.70 ? 329 TYR A CE1   1 
ATOM   1673  C  CE2   . TYR A  1 222 ? 12.169  33.873  -7.113  1.00   13.41 ? 329 TYR A CE2   1 
ATOM   1674  C  CZ    . TYR A  1 222 ? 12.099  33.066  -5.989  1.00   13.04 ? 329 TYR A CZ    1 
ATOM   1675  O  OH    . TYR A  1 222 ? 11.392  33.466  -4.882  1.00   14.27 ? 329 TYR A OH    1 
ATOM   1676  N  N     . SER A  1 223 ? 12.232  28.886  -9.112  1.00   18.71 ? 330 SER A N     1 
ATOM   1677  C  CA    . SER A  1 223 ? 12.108  27.621  -8.382  1.00   18.78 ? 330 SER A CA    1 
ATOM   1678  C  C     . SER A  1 223 ? 12.503  26.350  -9.138  1.00   17.48 ? 330 SER A C     1 
ATOM   1679  O  O     . SER A  1 223 ? 12.196  26.201  -10.324 1.00   16.43 ? 330 SER A O     1 
ATOM   1680  C  CB    . SER A  1 223 ? 10.676  27.464  -7.871  1.00   19.37 ? 330 SER A CB    1 
ATOM   1681  O  OG    . SER A  1 223 ? 10.507  26.208  -7.242  1.00   20.02 ? 330 SER A OG    1 
ATOM   1682  N  N     . GLU A  1 224 ? 13.193  25.445  -8.438  1.00   17.37 ? 331 GLU A N     1 
ATOM   1683  C  CA    . GLU A  1 224 ? 13.598  24.153  -9.002  1.00   17.67 ? 331 GLU A CA    1 
ATOM   1684  C  C     . GLU A  1 224 ? 12.766  23.085  -8.314  1.00   17.56 ? 331 GLU A C     1 
ATOM   1685  O  O     . GLU A  1 224 ? 12.520  23.162  -7.110  1.00   19.54 ? 331 GLU A O     1 
ATOM   1686  C  CB    . GLU A  1 224 ? 15.074  23.850  -8.736  1.00   15.93 ? 331 GLU A CB    1 
ATOM   1687  C  CG    . GLU A  1 224 ? 16.042  24.873  -9.282  1.00   18.67 ? 331 GLU A CG    1 
ATOM   1688  C  CD    . GLU A  1 224 ? 17.471  24.393  -9.213  1.00   17.06 ? 331 GLU A CD    1 
ATOM   1689  O  OE1   . GLU A  1 224 ? 18.385  25.240  -9.186  1.00   17.42 ? 331 GLU A OE1   1 
ATOM   1690  O  OE2   . GLU A  1 224 ? 17.681  23.163  -9.192  1.00   20.61 ? 331 GLU A OE2   1 
ATOM   1691  N  N     . ALA A  1 225 ? 12.326  22.085  -9.064  1.00   16.31 ? 332 ALA A N     1 
ATOM   1692  C  CA    . ALA A  1 225 ? 11.534  21.028  -8.464  1.00   15.81 ? 332 ALA A CA    1 
ATOM   1693  C  C     . ALA A  1 225 ? 12.374  19.758  -8.361  1.00   18.39 ? 332 ALA A C     1 
ATOM   1694  O  O     . ALA A  1 225 ? 13.217  19.492  -9.226  1.00   20.44 ? 332 ALA A O     1 
ATOM   1695  C  CB    . ALA A  1 225 ? 10.291  20.778  -9.300  1.00   12.96 ? 332 ALA A CB    1 
ATOM   1696  N  N     . CYS A  1 226 ? 12.151  18.995  -7.290  1.00   17.78 ? 333 CYS A N     1 
ATOM   1697  C  CA    . CYS A  1 226 ? 12.844  17.729  -7.056  1.00   21.01 ? 333 CYS A CA    1 
ATOM   1698  C  C     . CYS A  1 226 ? 12.229  17.098  -5.812  1.00   20.91 ? 333 CYS A C     1 
ATOM   1699  O  O     . CYS A  1 226 ? 11.546  17.776  -5.047  1.00   21.58 ? 333 CYS A O     1 
ATOM   1700  C  CB    . CYS A  1 226 ? 14.356  17.941  -6.858  1.00   23.57 ? 333 CYS A CB    1 
ATOM   1701  S  SG    . CYS A  1 226 ? 14.760  18.875  -5.357  1.00   28.28 ? 333 CYS A SG    1 
ATOM   1702  N  N     . SER A  1 227 ? 12.470  15.806  -5.612  1.00   20.41 ? 334 SER A N     1 
ATOM   1703  C  CA    . SER A  1 227 ? 11.924  15.091  -4.463  1.00   21.79 ? 334 SER A CA    1 
ATOM   1704  C  C     . SER A  1 227 ? 12.739  15.222  -3.167  1.00   21.76 ? 334 SER A C     1 
ATOM   1705  O  O     . SER A  1 227 ? 12.308  14.750  -2.114  1.00   23.88 ? 334 SER A O     1 
ATOM   1706  C  CB    . SER A  1 227 ? 11.763  13.604  -4.804  1.00   23.39 ? 334 SER A CB    1 
ATOM   1707  O  OG    . SER A  1 227 ? 12.996  13.025  -5.198  1.00   25.79 ? 334 SER A OG    1 
ATOM   1708  N  N     . SER A  1 228 ? 13.904  15.857  -3.230  1.00   19.87 ? 335 SER A N     1 
ATOM   1709  C  CA    . SER A  1 228 ? 14.727  16.004  -2.037  1.00   16.49 ? 335 SER A CA    1 
ATOM   1710  C  C     . SER A  1 228 ? 14.347  17.209  -1.188  1.00   14.61 ? 335 SER A C     1 
ATOM   1711  O  O     . SER A  1 228 ? 14.712  17.282  -0.019  1.00   14.66 ? 335 SER A O     1 
ATOM   1712  C  CB    . SER A  1 228 ? 16.219  16.077  -2.404  1.00   17.19 ? 335 SER A CB    1 
ATOM   1713  O  OG    . SER A  1 228 ? 16.563  17.280  -3.067  1.00   14.90 ? 335 SER A OG    1 
ATOM   1714  N  N     . THR A  1 229 ? 13.623  18.159  -1.767  1.00   14.59 ? 336 THR A N     1 
ATOM   1715  C  CA    . THR A  1 229 ? 13.200  19.339  -1.008  1.00   14.12 ? 336 THR A CA    1 
ATOM   1716  C  C     . THR A  1 229 ? 12.290  18.906  0.140   1.00   14.88 ? 336 THR A C     1 
ATOM   1717  O  O     . THR A  1 229 ? 11.421  18.049  -0.040  1.00   16.70 ? 336 THR A O     1 
ATOM   1718  C  CB    . THR A  1 229 ? 12.430  20.331  -1.892  1.00   10.58 ? 336 THR A CB    1 
ATOM   1719  O  OG1   . THR A  1 229 ? 13.299  20.821  -2.916  1.00   7.98  ? 336 THR A OG1   1 
ATOM   1720  C  CG2   . THR A  1 229 ? 11.902  21.490  -1.054  1.00   8.37  ? 336 THR A CG2   1 
ATOM   1721  N  N     . LEU A  1 230 ? 12.481  19.505  1.310   1.00   14.13 ? 337 LEU A N     1 
ATOM   1722  C  CA    . LEU A  1 230 ? 11.694  19.154  2.493   1.00   13.72 ? 337 LEU A CA    1 
ATOM   1723  C  C     . LEU A  1 230 ? 10.525  20.096  2.806   1.00   15.67 ? 337 LEU A C     1 
ATOM   1724  O  O     . LEU A  1 230 ? 9.437   19.638  3.146   1.00   15.79 ? 337 LEU A O     1 
ATOM   1725  C  CB    . LEU A  1 230 ? 12.613  19.076  3.709   1.00   12.92 ? 337 LEU A CB    1 
ATOM   1726  C  CG    . LEU A  1 230 ? 12.085  18.284  4.897   1.00   13.28 ? 337 LEU A CG    1 
ATOM   1727  C  CD1   . LEU A  1 230 ? 11.872  16.817  4.512   1.00   12.12 ? 337 LEU A CD1   1 
ATOM   1728  C  CD2   . LEU A  1 230 ? 13.084  18.397  6.025   1.00   14.11 ? 337 LEU A CD2   1 
ATOM   1729  N  N     . ALA A  1 231 ? 10.745  21.405  2.703   1.00   15.21 ? 338 ALA A N     1 
ATOM   1730  C  CA    . ALA A  1 231 ? 9.685   22.369  2.984   1.00   14.91 ? 338 ALA A CA    1 
ATOM   1731  C  C     . ALA A  1 231 ? 9.887   23.688  2.232   1.00   17.43 ? 338 ALA A C     1 
ATOM   1732  O  O     . ALA A  1 231 ? 10.833  23.835  1.452   1.00   16.79 ? 338 ALA A O     1 
ATOM   1733  C  CB    . ALA A  1 231 ? 9.590   22.623  4.488   1.00   15.32 ? 338 ALA A CB    1 
ATOM   1734  N  N     . THR A  1 232 ? 9.012   24.656  2.497   1.00   16.73 ? 339 THR A N     1 
ATOM   1735  C  CA    . THR A  1 232 ? 9.047   25.940  1.802   1.00   16.73 ? 339 THR A CA    1 
ATOM   1736  C  C     . THR A  1 232 ? 8.836   27.157  2.700   1.00   18.25 ? 339 THR A C     1 
ATOM   1737  O  O     . THR A  1 232 ? 8.179   27.071  3.743   1.00   20.31 ? 339 THR A O     1 
ATOM   1738  C  CB    . THR A  1 232 ? 7.917   25.977  0.710   1.00   17.70 ? 339 THR A CB    1 
ATOM   1739  O  OG1   . THR A  1 232 ? 8.114   24.912  -0.235  1.00   12.90 ? 339 THR A OG1   1 
ATOM   1740  C  CG2   . THR A  1 232 ? 7.876   27.339  -0.007  1.00   14.08 ? 339 THR A CG2   1 
ATOM   1741  N  N     . THR A  1 233 ? 9.392   28.291  2.278   1.00   16.53 ? 340 THR A N     1 
ATOM   1742  C  CA    . THR A  1 233 ? 9.209   29.565  2.977   1.00   15.85 ? 340 THR A CA    1 
ATOM   1743  C  C     . THR A  1 233 ? 9.000   30.601  1.878   1.00   16.40 ? 340 THR A C     1 
ATOM   1744  O  O     . THR A  1 233 ? 9.418   30.399  0.730   1.00   15.93 ? 340 THR A O     1 
ATOM   1745  C  CB    . THR A  1 233 ? 10.431  30.000  3.797   1.00   14.92 ? 340 THR A CB    1 
ATOM   1746  O  OG1   . THR A  1 233 ? 11.526  30.242  2.909   1.00   14.86 ? 340 THR A OG1   1 
ATOM   1747  C  CG2   . THR A  1 233 ? 10.796  28.953  4.837   1.00   15.57 ? 340 THR A CG2   1 
ATOM   1748  N  N     . TYR A  1 234 ? 8.355   31.707  2.223   1.00   14.97 ? 341 TYR A N     1 
ATOM   1749  C  CA    . TYR A  1 234 ? 8.086   32.758  1.247   1.00   16.72 ? 341 TYR A CA    1 
ATOM   1750  C  C     . TYR A  1 234 ? 9.330   33.452  0.715   1.00   17.66 ? 341 TYR A C     1 
ATOM   1751  O  O     . TYR A  1 234 ? 10.377  33.465  1.355   1.00   19.92 ? 341 TYR A O     1 
ATOM   1752  C  CB    . TYR A  1 234 ? 7.166   33.823  1.849   1.00   13.57 ? 341 TYR A CB    1 
ATOM   1753  C  CG    . TYR A  1 234 ? 5.734   33.394  1.944   1.00   16.03 ? 341 TYR A CG    1 
ATOM   1754  C  CD1   . TYR A  1 234 ? 4.965   33.236  0.793   1.00   17.24 ? 341 TYR A CD1   1 
ATOM   1755  C  CD2   . TYR A  1 234 ? 5.146   33.115  3.183   1.00   13.55 ? 341 TYR A CD2   1 
ATOM   1756  C  CE1   . TYR A  1 234 ? 3.638   32.805  0.866   1.00   16.62 ? 341 TYR A CE1   1 
ATOM   1757  C  CE2   . TYR A  1 234 ? 3.829   32.687  3.269   1.00   14.07 ? 341 TYR A CE2   1 
ATOM   1758  C  CZ    . TYR A  1 234 ? 3.079   32.531  2.102   1.00   16.06 ? 341 TYR A CZ    1 
ATOM   1759  O  OH    . TYR A  1 234 ? 1.783   32.078  2.153   1.00   17.27 ? 341 TYR A OH    1 
ATOM   1760  N  N     . SER A  1 235 ? 9.194   34.024  -0.475  1.00   17.06 ? 342 SER A N     1 
ATOM   1761  C  CA    . SER A  1 235 ? 10.260  34.783  -1.110  1.00   17.18 ? 342 SER A CA    1 
ATOM   1762  C  C     . SER A  1 235 ? 9.655   35.680  -2.199  1.00   19.30 ? 342 SER A C     1 
ATOM   1763  O  O     . SER A  1 235 ? 8.456   35.961  -2.187  1.00   18.77 ? 342 SER A O     1 
ATOM   1764  C  CB    . SER A  1 235 ? 11.313  33.861  -1.714  1.00   16.24 ? 342 SER A CB    1 
ATOM   1765  O  OG    . SER A  1 235 ? 12.440  34.628  -2.109  1.00   17.69 ? 342 SER A OG    1 
ATOM   1766  N  N     . SER A  1 236 ? 10.473  36.131  -3.143  1.00   19.08 ? 343 SER A N     1 
ATOM   1767  C  CA    . SER A  1 236 ? 9.984   37.009  -4.202  1.00   18.41 ? 343 SER A CA    1 
ATOM   1768  C  C     . SER A  1 236 ? 9.258   36.284  -5.333  1.00   18.17 ? 343 SER A C     1 
ATOM   1769  O  O     . SER A  1 236 ? 9.386   35.069  -5.481  1.00   19.84 ? 343 SER A O     1 
ATOM   1770  C  CB    . SER A  1 236 ? 11.147  37.816  -4.786  1.00   18.64 ? 343 SER A CB    1 
ATOM   1771  O  OG    . SER A  1 236 ? 12.166  36.964  -5.287  1.00   17.69 ? 343 SER A OG    1 
ATOM   1772  N  N     . GLY A  1 237 ? 8.495   37.050  -6.116  1.00   15.42 ? 344 GLY A N     1 
ATOM   1773  C  CA    . GLY A  1 237 ? 7.763   36.521  -7.256  1.00   14.57 ? 344 GLY A CA    1 
ATOM   1774  C  C     . GLY A  1 237 ? 7.747   37.580  -8.352  1.00   18.19 ? 344 GLY A C     1 
ATOM   1775  O  O     . GLY A  1 237 ? 8.802   38.049  -8.786  1.00   18.93 ? 344 GLY A O     1 
ATOM   1776  N  N     . ASN A  1 238 ? 6.560   37.977  -8.805  1.00   20.01 ? 345 ASN A N     1 
ATOM   1777  C  CA    . ASN A  1 238 ? 6.469   38.999  -9.837  1.00   18.75 ? 345 ASN A CA    1 
ATOM   1778  C  C     . ASN A  1 238 ? 6.527   40.396  -9.213  1.00   18.33 ? 345 ASN A C     1 
ATOM   1779  O  O     . ASN A  1 238 ? 6.632   40.535  -8.000  1.00   16.02 ? 345 ASN A O     1 
ATOM   1780  C  CB    . ASN A  1 238 ? 5.190   38.830  -10.679 1.00   19.90 ? 345 ASN A CB    1 
ATOM   1781  C  CG    . ASN A  1 238 ? 3.893   38.995  -9.863  1.00   23.90 ? 345 ASN A CG    1 
ATOM   1782  O  OD1   . ASN A  1 238 ? 3.731   39.954  -9.098  1.00   20.64 ? 345 ASN A OD1   1 
ATOM   1783  N  ND2   . ASN A  1 238 ? 2.955   38.064  -10.053 1.00   22.25 ? 345 ASN A ND2   1 
ATOM   1784  N  N     . GLN A  1 239 ? 6.448   41.433  -10.041 1.00   19.06 ? 346 GLN A N     1 
ATOM   1785  C  CA    . GLN A  1 239 ? 6.544   42.796  -9.539  1.00   17.93 ? 346 GLN A CA    1 
ATOM   1786  C  C     . GLN A  1 239 ? 5.307   43.343  -8.839  1.00   20.87 ? 346 GLN A C     1 
ATOM   1787  O  O     . GLN A  1 239 ? 5.292   44.505  -8.437  1.00   21.70 ? 346 GLN A O     1 
ATOM   1788  C  CB    . GLN A  1 239 ? 6.982   43.743  -10.663 1.00   13.91 ? 346 GLN A CB    1 
ATOM   1789  C  CG    . GLN A  1 239 ? 8.340   43.374  -11.255 1.00   16.80 ? 346 GLN A CG    1 
ATOM   1790  C  CD    . GLN A  1 239 ? 8.914   44.429  -12.185 1.00   16.29 ? 346 GLN A CD    1 
ATOM   1791  O  OE1   . GLN A  1 239 ? 9.574   44.106  -13.167 1.00   22.90 ? 346 GLN A OE1   1 
ATOM   1792  N  NE2   . GLN A  1 239 ? 8.687   45.688  -11.869 1.00   18.71 ? 346 GLN A NE2   1 
ATOM   1793  N  N     . ASN A  1 240 ? 4.271   42.523  -8.688  1.00   21.76 ? 347 ASN A N     1 
ATOM   1794  C  CA    . ASN A  1 240 ? 3.065   42.956  -7.989  1.00   20.10 ? 347 ASN A CA    1 
ATOM   1795  C  C     . ASN A  1 240 ? 3.103   42.315  -6.613  1.00   21.62 ? 347 ASN A C     1 
ATOM   1796  O  O     . ASN A  1 240 ? 2.315   42.651  -5.733  1.00   21.24 ? 347 ASN A O     1 
ATOM   1797  C  CB    . ASN A  1 240 ? 1.789   42.487  -8.691  1.00   21.43 ? 347 ASN A CB    1 
ATOM   1798  C  CG    . ASN A  1 240 ? 1.609   43.085  -10.065 1.00   26.01 ? 347 ASN A CG    1 
ATOM   1799  O  OD1   . ASN A  1 240 ? 2.265   42.684  -11.021 1.00   30.90 ? 347 ASN A OD1   1 
ATOM   1800  N  ND2   . ASN A  1 240 ? 0.704   44.052  -10.175 1.00   27.43 ? 347 ASN A ND2   1 
ATOM   1801  N  N     . GLU A  1 241 ? 4.017   41.365  -6.443  1.00   22.82 ? 348 GLU A N     1 
ATOM   1802  C  CA    . GLU A  1 241 ? 4.180   40.658  -5.177  1.00   22.05 ? 348 GLU A CA    1 
ATOM   1803  C  C     . GLU A  1 241 ? 5.340   41.263  -4.399  1.00   21.46 ? 348 GLU A C     1 
ATOM   1804  O  O     . GLU A  1 241 ? 6.368   41.620  -4.970  1.00   21.99 ? 348 GLU A O     1 
ATOM   1805  C  CB    . GLU A  1 241 ? 4.421   39.166  -5.437  1.00   21.39 ? 348 GLU A CB    1 
ATOM   1806  C  CG    . GLU A  1 241 ? 3.202   38.459  -6.041  1.00   21.77 ? 348 GLU A CG    1 
ATOM   1807  C  CD    . GLU A  1 241 ? 3.503   37.055  -6.540  1.00   23.57 ? 348 GLU A CD    1 
ATOM   1808  O  OE1   . GLU A  1 241 ? 2.770   36.116  -6.135  1.00   18.24 ? 348 GLU A OE1   1 
ATOM   1809  O  OE2   . GLU A  1 241 ? 4.460   36.899  -7.341  1.00   18.57 ? 348 GLU A OE2   1 
ATOM   1810  N  N     . LYS A  1 242 ? 5.167   41.389  -3.092  1.00   21.69 ? 349 LYS A N     1 
ATOM   1811  C  CA    . LYS A  1 242 ? 6.200   41.968  -2.261  1.00   23.27 ? 349 LYS A CA    1 
ATOM   1812  C  C     . LYS A  1 242 ? 7.383   41.030  -2.112  1.00   23.91 ? 349 LYS A C     1 
ATOM   1813  O  O     . LYS A  1 242 ? 7.290   39.842  -2.420  1.00   25.39 ? 349 LYS A O     1 
ATOM   1814  C  CB    . LYS A  1 242 ? 5.623   42.343  -0.900  1.00   26.15 ? 349 LYS A CB    1 
ATOM   1815  C  CG    . LYS A  1 242 ? 4.632   43.482  -0.985  1.00   32.85 ? 349 LYS A CG    1 
ATOM   1816  C  CD    . LYS A  1 242 ? 4.027   43.777  0.362   1.00   40.80 ? 349 LYS A CD    1 
ATOM   1817  C  CE    . LYS A  1 242 ? 2.897   44.781  0.229   1.00   45.48 ? 349 LYS A CE    1 
ATOM   1818  N  NZ    . LYS A  1 242 ? 2.167   44.911  1.520   1.00   48.80 ? 349 LYS A NZ    1 
ATOM   1819  N  N     . GLN A  1 243 ? 8.505   41.569  -1.649  1.00   23.68 ? 350 GLN A N     1 
ATOM   1820  C  CA    . GLN A  1 243 ? 9.701   40.759  -1.491  1.00   24.30 ? 350 GLN A CA    1 
ATOM   1821  C  C     . GLN A  1 243 ? 10.185  40.696  -0.047  1.00   23.21 ? 350 GLN A C     1 
ATOM   1822  O  O     . GLN A  1 243 ? 9.407   40.937  0.877   1.00   21.67 ? 350 GLN A O     1 
ATOM   1823  C  CB    . GLN A  1 243 ? 10.778  41.276  -2.438  1.00   23.80 ? 350 GLN A CB    1 
ATOM   1824  C  CG    . GLN A  1 243 ? 10.190  41.445  -3.820  1.00   21.10 ? 350 GLN A CG    1 
ATOM   1825  C  CD    . GLN A  1 243 ? 11.211  41.770  -4.864  1.00   21.15 ? 350 GLN A CD    1 
ATOM   1826  O  OE1   . GLN A  1 243 ? 12.121  42.559  -4.631  1.00   23.96 ? 350 GLN A OE1   1 
ATOM   1827  N  NE2   . GLN A  1 243 ? 11.059  41.172  -6.042  1.00   18.53 ? 350 GLN A NE2   1 
ATOM   1828  N  N     . ILE A  1 244 ? 11.457  40.363  0.151   1.00   20.08 ? 351 ILE A N     1 
ATOM   1829  C  CA    . ILE A  1 244 ? 11.980  40.235  1.503   1.00   18.55 ? 351 ILE A CA    1 
ATOM   1830  C  C     . ILE A  1 244 ? 12.696  41.475  2.010   1.00   16.97 ? 351 ILE A C     1 
ATOM   1831  O  O     . ILE A  1 244 ? 13.563  42.015  1.340   1.00   17.92 ? 351 ILE A O     1 
ATOM   1832  C  CB    . ILE A  1 244 ? 12.907  39.008  1.599   1.00   16.88 ? 351 ILE A CB    1 
ATOM   1833  C  CG1   . ILE A  1 244 ? 12.156  37.769  1.097   1.00   17.28 ? 351 ILE A CG1   1 
ATOM   1834  C  CG2   . ILE A  1 244 ? 13.357  38.789  3.033   1.00   17.15 ? 351 ILE A CG2   1 
ATOM   1835  C  CD1   . ILE A  1 244 ? 10.786  37.554  1.723   1.00   11.75 ? 351 ILE A CD1   1 
ATOM   1836  N  N     . VAL A  1 245 ? 12.305  41.916  3.204   1.00   15.45 ? 352 VAL A N     1 
ATOM   1837  C  CA    . VAL A  1 245 ? 12.871  43.097  3.851   1.00   14.63 ? 352 VAL A CA    1 
ATOM   1838  C  C     . VAL A  1 245 ? 13.950  42.668  4.827   1.00   16.10 ? 352 VAL A C     1 
ATOM   1839  O  O     . VAL A  1 245 ? 13.691  41.865  5.719   1.00   17.32 ? 352 VAL A O     1 
ATOM   1840  C  CB    . VAL A  1 245 ? 11.789  43.870  4.625   1.00   14.27 ? 352 VAL A CB    1 
ATOM   1841  C  CG1   . VAL A  1 245 ? 12.403  45.040  5.384   1.00   10.37 ? 352 VAL A CG1   1 
ATOM   1842  C  CG2   . VAL A  1 245 ? 10.718  44.344  3.661   1.00   12.95 ? 352 VAL A CG2   1 
ATOM   1843  N  N     . THR A  1 246 ? 15.154  43.213  4.669   1.00   15.85 ? 353 THR A N     1 
ATOM   1844  C  CA    . THR A  1 246 ? 16.265  42.842  5.536   1.00   16.11 ? 353 THR A CA    1 
ATOM   1845  C  C     . THR A  1 246 ? 17.409  43.867  5.516   1.00   17.42 ? 353 THR A C     1 
ATOM   1846  O  O     . THR A  1 246 ? 17.338  44.889  4.828   1.00   17.10 ? 353 THR A O     1 
ATOM   1847  C  CB    . THR A  1 246 ? 16.825  41.445  5.123   1.00   16.64 ? 353 THR A CB    1 
ATOM   1848  O  OG1   . THR A  1 246 ? 17.848  41.042  6.042   1.00   18.10 ? 353 THR A OG1   1 
ATOM   1849  C  CG2   . THR A  1 246 ? 17.417  41.492  3.704   1.00   11.61 ? 353 THR A CG2   1 
ATOM   1850  N  N     . THR A  1 247 ? 18.463  43.573  6.274   1.00   17.01 ? 354 THR A N     1 
ATOM   1851  C  CA    . THR A  1 247 ? 19.637  44.435  6.359   1.00   17.26 ? 354 THR A CA    1 
ATOM   1852  C  C     . THR A  1 247 ? 20.463  44.377  5.073   1.00   17.29 ? 354 THR A C     1 
ATOM   1853  O  O     . THR A  1 247 ? 20.667  43.305  4.502   1.00   18.23 ? 354 THR A O     1 
ATOM   1854  C  CB    . THR A  1 247 ? 20.525  43.992  7.510   1.00   16.39 ? 354 THR A CB    1 
ATOM   1855  O  OG1   . THR A  1 247 ? 20.813  42.600  7.343   1.00   17.73 ? 354 THR A OG1   1 
ATOM   1856  C  CG2   . THR A  1 247 ? 19.827  44.213  8.857   1.00   16.13 ? 354 THR A CG2   1 
ATOM   1857  N  N     . ASP A  1 248 ? 20.939  45.533  4.618   1.00   18.94 ? 355 ASP A N     1 
ATOM   1858  C  CA    . ASP A  1 248 ? 21.744  45.591  3.403   1.00   19.79 ? 355 ASP A CA    1 
ATOM   1859  C  C     . ASP A  1 248 ? 23.123  46.167  3.686   1.00   20.54 ? 355 ASP A C     1 
ATOM   1860  O  O     . ASP A  1 248 ? 23.326  46.856  4.679   1.00   23.15 ? 355 ASP A O     1 
ATOM   1861  C  CB    . ASP A  1 248 ? 21.052  46.439  2.330   1.00   18.81 ? 355 ASP A CB    1 
ATOM   1862  C  CG    . ASP A  1 248 ? 21.516  46.092  0.915   1.00   19.01 ? 355 ASP A CG    1 
ATOM   1863  O  OD1   . ASP A  1 248 ? 22.445  45.272  0.765   1.00   18.86 ? 355 ASP A OD1   1 
ATOM   1864  O  OD2   . ASP A  1 248 ? 20.949  46.637  -0.055  1.00   18.21 ? 355 ASP A OD2   1 
ATOM   1865  N  N     . LEU A  1 249 ? 24.066  45.866  2.801   1.00   20.75 ? 356 LEU A N     1 
ATOM   1866  C  CA    . LEU A  1 249 ? 25.437  46.333  2.917   1.00   18.65 ? 356 LEU A CA    1 
ATOM   1867  C  C     . LEU A  1 249 ? 25.456  47.845  3.079   1.00   20.52 ? 356 LEU A C     1 
ATOM   1868  O  O     . LEU A  1 249 ? 24.538  48.545  2.641   1.00   20.82 ? 356 LEU A O     1 
ATOM   1869  C  CB    . LEU A  1 249 ? 26.223  45.935  1.668   1.00   19.78 ? 356 LEU A CB    1 
ATOM   1870  C  CG    . LEU A  1 249 ? 27.753  45.931  1.715   1.00   19.55 ? 356 LEU A CG    1 
ATOM   1871  C  CD1   . LEU A  1 249 ? 28.252  44.946  2.769   1.00   15.59 ? 356 LEU A CD1   1 
ATOM   1872  C  CD2   . LEU A  1 249 ? 28.277  45.552  0.333   1.00   17.38 ? 356 LEU A CD2   1 
ATOM   1873  N  N     . ARG A  1 250 ? 26.516  48.338  3.712   1.00   21.26 ? 357 ARG A N     1 
ATOM   1874  C  CA    . ARG A  1 250 ? 26.702  49.760  3.969   1.00   18.42 ? 357 ARG A CA    1 
ATOM   1875  C  C     . ARG A  1 250 ? 25.642  50.307  4.915   1.00   20.96 ? 357 ARG A C     1 
ATOM   1876  O  O     . ARG A  1 250 ? 25.167  51.431  4.766   1.00   21.56 ? 357 ARG A O     1 
ATOM   1877  C  CB    . ARG A  1 250 ? 26.723  50.539  2.657   1.00   17.50 ? 357 ARG A CB    1 
ATOM   1878  C  CG    . ARG A  1 250 ? 27.896  50.165  1.753   1.00   15.75 ? 357 ARG A CG    1 
ATOM   1879  C  CD    . ARG A  1 250 ? 27.737  50.790  0.373   1.00   19.07 ? 357 ARG A CD    1 
ATOM   1880  N  NE    . ARG A  1 250 ? 28.701  50.271  -0.595  1.00   20.63 ? 357 ARG A NE    1 
ATOM   1881  C  CZ    . ARG A  1 250 ? 30.015  50.492  -0.549  1.00   22.45 ? 357 ARG A CZ    1 
ATOM   1882  N  NH1   . ARG A  1 250 ? 30.810  49.976  -1.480  1.00   22.63 ? 357 ARG A NH1   1 
ATOM   1883  N  NH2   . ARG A  1 250 ? 30.537  51.234  0.421   1.00   21.35 ? 357 ARG A NH2   1 
ATOM   1884  N  N     . GLN A  1 251 ? 25.273  49.479  5.886   1.00   23.62 ? 358 GLN A N     1 
ATOM   1885  C  CA    . GLN A  1 251 ? 24.315  49.841  6.922   1.00   24.78 ? 358 GLN A CA    1 
ATOM   1886  C  C     . GLN A  1 251 ? 22.973  50.343  6.433   1.00   25.19 ? 358 GLN A C     1 
ATOM   1887  O  O     . GLN A  1 251 ? 22.343  51.176  7.072   1.00   25.34 ? 358 GLN A O     1 
ATOM   1888  C  CB    . GLN A  1 251 ? 24.962  50.868  7.835   1.00   22.45 ? 358 GLN A CB    1 
ATOM   1889  C  CG    . GLN A  1 251 ? 26.280  50.354  8.332   1.00   26.68 ? 358 GLN A CG    1 
ATOM   1890  C  CD    . GLN A  1 251 ? 27.030  51.352  9.142   1.00   29.29 ? 358 GLN A CD    1 
ATOM   1891  O  OE1   . GLN A  1 251 ? 26.572  51.783  10.200  1.00   32.67 ? 358 GLN A OE1   1 
ATOM   1892  N  NE2   . GLN A  1 251 ? 28.201  51.737  8.657   1.00   33.53 ? 358 GLN A NE2   1 
ATOM   1893  N  N     . LYS A  1 252 ? 22.530  49.818  5.302   1.00   26.69 ? 359 LYS A N     1 
ATOM   1894  C  CA    . LYS A  1 252 ? 21.251  50.210  4.741   1.00   25.06 ? 359 LYS A CA    1 
ATOM   1895  C  C     . LYS A  1 252 ? 20.192  49.144  4.994   1.00   24.43 ? 359 LYS A C     1 
ATOM   1896  O  O     . LYS A  1 252 ? 20.457  48.098  5.594   1.00   21.65 ? 359 LYS A O     1 
ATOM   1897  C  CB    . LYS A  1 252 ? 21.395  50.464  3.244   1.00   28.57 ? 359 LYS A CB    1 
ATOM   1898  C  CG    . LYS A  1 252 ? 22.247  51.678  2.926   1.00   31.08 ? 359 LYS A CG    1 
ATOM   1899  C  CD    . LYS A  1 252 ? 22.452  51.827  1.434   1.00   35.09 ? 359 LYS A CD    1 
ATOM   1900  C  CE    . LYS A  1 252 ? 23.490  52.905  1.168   1.00   41.07 ? 359 LYS A CE    1 
ATOM   1901  N  NZ    . LYS A  1 252 ? 23.981  52.911  -0.245  1.00   41.83 ? 359 LYS A NZ    1 
ATOM   1902  N  N     . CYS A  1 253 ? 18.986  49.423  4.529   1.00   23.29 ? 360 CYS A N     1 
ATOM   1903  C  CA    . CYS A  1 253 ? 17.868  48.521  4.711   1.00   25.40 ? 360 CYS A CA    1 
ATOM   1904  C  C     . CYS A  1 253 ? 17.276  48.271  3.338   1.00   25.32 ? 360 CYS A C     1 
ATOM   1905  O  O     . CYS A  1 253 ? 16.969  49.213  2.627   1.00   30.55 ? 360 CYS A O     1 
ATOM   1906  C  CB    . CYS A  1 253 ? 16.855  49.198  5.629   1.00   25.19 ? 360 CYS A CB    1 
ATOM   1907  S  SG    . CYS A  1 253 ? 15.343  48.274  6.064   1.00   39.00 ? 360 CYS A SG    1 
ATOM   1908  N  N     . THR A  1 254 ? 17.131  47.015  2.946   1.00   23.72 ? 361 THR A N     1 
ATOM   1909  C  CA    . THR A  1 254 ? 16.569  46.728  1.642   1.00   23.25 ? 361 THR A CA    1 
ATOM   1910  C  C     . THR A  1 254 ? 15.207  46.058  1.742   1.00   25.46 ? 361 THR A C     1 
ATOM   1911  O  O     . THR A  1 254 ? 14.922  45.331  2.696   1.00   25.12 ? 361 THR A O     1 
ATOM   1912  C  CB    . THR A  1 254 ? 17.504  45.824  0.822   1.00   23.40 ? 361 THR A CB    1 
ATOM   1913  O  OG1   . THR A  1 254 ? 16.872  45.488  -0.418  1.00   25.44 ? 361 THR A OG1   1 
ATOM   1914  C  CG2   . THR A  1 254 ? 17.819  44.550  1.589   1.00   20.49 ? 361 THR A CG2   1 
ATOM   1915  N  N     . GLU A  1 255 ? 14.362  46.308  0.751   1.00   28.30 ? 362 GLU A N     1 
ATOM   1916  C  CA    . GLU A  1 255 ? 13.036  45.706  0.715   1.00   30.05 ? 362 GLU A CA    1 
ATOM   1917  C  C     . GLU A  1 255 ? 12.968  44.791  -0.495  1.00   29.43 ? 362 GLU A C     1 
ATOM   1918  O  O     . GLU A  1 255 ? 11.895  44.299  -0.859  1.00   32.44 ? 362 GLU A O     1 
ATOM   1919  C  CB    . GLU A  1 255 ? 11.956  46.790  0.617   1.00   31.35 ? 362 GLU A CB    1 
ATOM   1920  C  CG    . GLU A  1 255 ? 11.770  47.564  1.906   1.00   35.56 ? 362 GLU A CG    1 
ATOM   1921  C  CD    . GLU A  1 255 ? 10.810  48.727  1.757   1.00   38.21 ? 362 GLU A CD    1 
ATOM   1922  O  OE1   . GLU A  1 255 ? 9.689   48.507  1.262   1.00   40.07 ? 362 GLU A OE1   1 
ATOM   1923  O  OE2   . GLU A  1 255 ? 11.178  49.859  2.139   1.00   38.93 ? 362 GLU A OE2   1 
ATOM   1924  N  N     . SER A  1 256 ? 14.117  44.557  -1.118  1.00   26.37 ? 363 SER A N     1 
ATOM   1925  C  CA    . SER A  1 256 ? 14.136  43.714  -2.296  1.00   26.77 ? 363 SER A CA    1 
ATOM   1926  C  C     . SER A  1 256 ? 15.153  42.577  -2.312  1.00   25.10 ? 363 SER A C     1 
ATOM   1927  O  O     . SER A  1 256 ? 15.937  42.449  -3.255  1.00   26.61 ? 363 SER A O     1 
ATOM   1928  C  CB    . SER A  1 256 ? 14.301  44.592  -3.540  1.00   28.18 ? 363 SER A CB    1 
ATOM   1929  O  OG    . SER A  1 256 ? 15.317  45.554  -3.353  1.00   32.18 ? 363 SER A OG    1 
ATOM   1930  N  N     . HIS A  1 257 ? 15.155  41.765  -1.258  1.00   21.92 ? 364 HIS A N     1 
ATOM   1931  C  CA    . HIS A  1 257 ? 16.038  40.610  -1.202  1.00   19.72 ? 364 HIS A CA    1 
ATOM   1932  C  C     . HIS A  1 257 ? 15.176  39.548  -1.895  1.00   20.62 ? 364 HIS A C     1 
ATOM   1933  O  O     . HIS A  1 257 ? 14.007  39.361  -1.543  1.00   18.22 ? 364 HIS A O     1 
ATOM   1934  C  CB    . HIS A  1 257 ? 16.329  40.240  0.244   1.00   18.85 ? 364 HIS A CB    1 
ATOM   1935  C  CG    . HIS A  1 257 ? 17.305  39.120  0.390   1.00   20.26 ? 364 HIS A CG    1 
ATOM   1936  N  ND1   . HIS A  1 257 ? 18.292  38.870  -0.539  1.00   20.61 ? 364 HIS A ND1   1 
ATOM   1937  C  CD2   . HIS A  1 257 ? 17.473  38.204  1.373   1.00   21.64 ? 364 HIS A CD2   1 
ATOM   1938  C  CE1   . HIS A  1 257 ? 19.026  37.848  -0.136  1.00   21.44 ? 364 HIS A CE1   1 
ATOM   1939  N  NE2   . HIS A  1 257 ? 18.551  37.425  1.023   1.00   22.14 ? 364 HIS A NE2   1 
ATOM   1940  N  N     . THR A  1 258 ? 15.738  38.863  -2.885  1.00   18.88 ? 365 THR A N     1 
ATOM   1941  C  CA    . THR A  1 258 ? 14.956  37.905  -3.660  1.00   16.69 ? 365 THR A CA    1 
ATOM   1942  C  C     . THR A  1 258 ? 15.531  36.507  -3.876  1.00   17.21 ? 365 THR A C     1 
ATOM   1943  O  O     . THR A  1 258 ? 16.622  36.173  -3.414  1.00   17.88 ? 365 THR A O     1 
ATOM   1944  C  CB    . THR A  1 258 ? 14.706  38.469  -5.061  1.00   15.41 ? 365 THR A CB    1 
ATOM   1945  O  OG1   . THR A  1 258 ? 15.958  38.498  -5.760  1.00   11.93 ? 365 THR A OG1   1 
ATOM   1946  C  CG2   . THR A  1 258 ? 14.143  39.889  -4.996  1.00   10.16 ? 365 THR A CG2   1 
ATOM   1947  N  N     . GLY A  1 259 ? 14.758  35.701  -4.600  1.00   17.52 ? 366 GLY A N     1 
ATOM   1948  C  CA    . GLY A  1 259 ? 15.165  34.356  -4.953  1.00   16.55 ? 366 GLY A CA    1 
ATOM   1949  C  C     . GLY A  1 259 ? 15.275  33.344  -3.838  1.00   19.76 ? 366 GLY A C     1 
ATOM   1950  O  O     . GLY A  1 259 ? 14.943  33.611  -2.681  1.00   19.60 ? 366 GLY A O     1 
ATOM   1951  N  N     . THR A  1 260 ? 15.762  32.164  -4.208  1.00   20.65 ? 367 THR A N     1 
ATOM   1952  C  CA    . THR A  1 260 ? 15.932  31.060  -3.281  1.00   19.68 ? 367 THR A CA    1 
ATOM   1953  C  C     . THR A  1 260 ? 16.786  31.472  -2.080  1.00   18.97 ? 367 THR A C     1 
ATOM   1954  O  O     . THR A  1 260 ? 16.640  30.929  -0.983  1.00   18.80 ? 367 THR A O     1 
ATOM   1955  C  CB    . THR A  1 260 ? 16.576  29.850  -3.999  1.00   18.88 ? 367 THR A CB    1 
ATOM   1956  O  OG1   . THR A  1 260 ? 16.583  28.720  -3.121  1.00   20.06 ? 367 THR A OG1   1 
ATOM   1957  C  CG2   . THR A  1 260 ? 17.997  30.170  -4.428  1.00   18.48 ? 367 THR A CG2   1 
ATOM   1958  N  N     . SER A  1 261 ? 17.662  32.448  -2.290  1.00   17.94 ? 368 SER A N     1 
ATOM   1959  C  CA    . SER A  1 261 ? 18.552  32.929  -1.232  1.00   21.16 ? 368 SER A CA    1 
ATOM   1960  C  C     . SER A  1 261 ? 17.832  33.402  0.018   1.00   20.85 ? 368 SER A C     1 
ATOM   1961  O  O     . SER A  1 261 ? 18.335  33.238  1.130   1.00   21.88 ? 368 SER A O     1 
ATOM   1962  C  CB    . SER A  1 261 ? 19.425  34.082  -1.745  1.00   22.01 ? 368 SER A CB    1 
ATOM   1963  O  OG    . SER A  1 261 ? 20.355  33.651  -2.723  1.00   21.05 ? 368 SER A OG    1 
ATOM   1964  N  N     . ALA A  1 262 ? 16.664  34.006  -0.167  1.00   20.23 ? 369 ALA A N     1 
ATOM   1965  C  CA    . ALA A  1 262 ? 15.894  34.521  0.958   1.00   20.21 ? 369 ALA A CA    1 
ATOM   1966  C  C     . ALA A  1 262 ? 15.106  33.464  1.729   1.00   19.31 ? 369 ALA A C     1 
ATOM   1967  O  O     . ALA A  1 262 ? 14.746  33.682  2.884   1.00   19.93 ? 369 ALA A O     1 
ATOM   1968  C  CB    . ALA A  1 262 ? 14.948  35.613  0.468   1.00   19.81 ? 369 ALA A CB    1 
ATOM   1969  N  N     . SER A  1 263 ? 14.846  32.317  1.110   1.00   18.37 ? 370 SER A N     1 
ATOM   1970  C  CA    . SER A  1 263 ? 14.069  31.286  1.786   1.00   16.53 ? 370 SER A CA    1 
ATOM   1971  C  C     . SER A  1 263 ? 14.805  30.534  2.870   1.00   15.16 ? 370 SER A C     1 
ATOM   1972  O  O     . SER A  1 263 ? 14.275  30.376  3.969   1.00   16.00 ? 370 SER A O     1 
ATOM   1973  C  CB    . SER A  1 263 ? 13.487  30.301  0.770   1.00   16.98 ? 370 SER A CB    1 
ATOM   1974  O  OG    . SER A  1 263 ? 12.423  30.903  0.046   1.00   16.01 ? 370 SER A OG    1 
ATOM   1975  N  N     . ALA A  1 264 ? 16.023  30.083  2.585   1.00   12.81 ? 371 ALA A N     1 
ATOM   1976  C  CA    . ALA A  1 264 ? 16.782  29.328  3.585   1.00   14.67 ? 371 ALA A CA    1 
ATOM   1977  C  C     . ALA A  1 264 ? 16.945  30.058  4.931   1.00   14.43 ? 371 ALA A C     1 
ATOM   1978  O  O     . ALA A  1 264 ? 16.722  29.477  6.003   1.00   14.22 ? 371 ALA A O     1 
ATOM   1979  C  CB    . ALA A  1 264 ? 18.155  28.944  3.026   1.00   10.89 ? 371 ALA A CB    1 
ATOM   1980  N  N     . PRO A  1 265 ? 17.331  31.341  4.891   1.00   12.86 ? 372 PRO A N     1 
ATOM   1981  C  CA    . PRO A  1 265 ? 17.513  32.094  6.129   1.00   12.87 ? 372 PRO A CA    1 
ATOM   1982  C  C     . PRO A  1 265 ? 16.274  32.116  7.009   1.00   15.09 ? 372 PRO A C     1 
ATOM   1983  O  O     . PRO A  1 265 ? 16.380  32.036  8.235   1.00   17.16 ? 372 PRO A O     1 
ATOM   1984  C  CB    . PRO A  1 265 ? 17.909  33.481  5.629   1.00   14.23 ? 372 PRO A CB    1 
ATOM   1985  C  CG    . PRO A  1 265 ? 18.623  33.190  4.328   1.00   12.19 ? 372 PRO A CG    1 
ATOM   1986  C  CD    . PRO A  1 265 ? 17.718  32.147  3.716   1.00   13.09 ? 372 PRO A CD    1 
ATOM   1987  N  N     . LEU A  1 266 ? 15.100  32.223  6.394   1.00   15.96 ? 373 LEU A N     1 
ATOM   1988  C  CA    . LEU A  1 266 ? 13.855  32.249  7.157   1.00   13.92 ? 373 LEU A CA    1 
ATOM   1989  C  C     . LEU A  1 266 ? 13.656  30.903  7.830   1.00   13.77 ? 373 LEU A C     1 
ATOM   1990  O  O     . LEU A  1 266 ? 13.230  30.830  8.979   1.00   14.22 ? 373 LEU A O     1 
ATOM   1991  C  CB    . LEU A  1 266 ? 12.674  32.568  6.237   1.00   16.17 ? 373 LEU A CB    1 
ATOM   1992  C  CG    . LEU A  1 266 ? 12.704  33.976  5.620   1.00   16.29 ? 373 LEU A CG    1 
ATOM   1993  C  CD1   . LEU A  1 266 ? 11.545  34.177  4.654   1.00   13.47 ? 373 LEU A CD1   1 
ATOM   1994  C  CD2   . LEU A  1 266 ? 12.640  34.994  6.731   1.00   15.22 ? 373 LEU A CD2   1 
ATOM   1995  N  N     . ALA A  1 267 ? 13.981  29.837  7.109   1.00   14.51 ? 374 ALA A N     1 
ATOM   1996  C  CA    . ALA A  1 267 ? 13.849  28.498  7.647   1.00   14.05 ? 374 ALA A CA    1 
ATOM   1997  C  C     . ALA A  1 267 ? 14.815  28.367  8.820   1.00   13.96 ? 374 ALA A C     1 
ATOM   1998  O  O     . ALA A  1 267 ? 14.473  27.821  9.869   1.00   14.10 ? 374 ALA A O     1 
ATOM   1999  C  CB    . ALA A  1 267 ? 14.166  27.466  6.560   1.00   13.98 ? 374 ALA A CB    1 
ATOM   2000  N  N     . ALA A  1 268 ? 16.018  28.896  8.647   1.00   14.54 ? 375 ALA A N     1 
ATOM   2001  C  CA    . ALA A  1 268 ? 17.015  28.821  9.702   1.00   17.02 ? 375 ALA A CA    1 
ATOM   2002  C  C     . ALA A  1 268 ? 16.507  29.539  10.948  1.00   18.62 ? 375 ALA A C     1 
ATOM   2003  O  O     . ALA A  1 268 ? 16.699  29.077  12.077  1.00   20.08 ? 375 ALA A O     1 
ATOM   2004  C  CB    . ALA A  1 268 ? 18.314  29.440  9.227   1.00   15.91 ? 375 ALA A CB    1 
ATOM   2005  N  N     . GLY A  1 269 ? 15.850  30.671  10.734  1.00   18.57 ? 376 GLY A N     1 
ATOM   2006  C  CA    . GLY A  1 269 ? 15.328  31.431  11.853  1.00   20.42 ? 376 GLY A CA    1 
ATOM   2007  C  C     . GLY A  1 269 ? 14.255  30.669  12.599  1.00   20.12 ? 376 GLY A C     1 
ATOM   2008  O  O     . GLY A  1 269 ? 14.262  30.609  13.826  1.00   20.46 ? 376 GLY A O     1 
ATOM   2009  N  N     . ILE A  1 270 ? 13.326  30.084  11.851  1.00   18.30 ? 377 ILE A N     1 
ATOM   2010  C  CA    . ILE A  1 270 ? 12.248  29.318  12.446  1.00   18.10 ? 377 ILE A CA    1 
ATOM   2011  C  C     . ILE A  1 270 ? 12.803  28.108  13.199  1.00   19.10 ? 377 ILE A C     1 
ATOM   2012  O  O     . ILE A  1 270 ? 12.327  27.757  14.278  1.00   17.91 ? 377 ILE A O     1 
ATOM   2013  C  CB    . ILE A  1 270 ? 11.246  28.873  11.355  1.00   17.28 ? 377 ILE A CB    1 
ATOM   2014  C  CG1   . ILE A  1 270 ? 10.527  30.111  10.823  1.00   17.97 ? 377 ILE A CG1   1 
ATOM   2015  C  CG2   . ILE A  1 270 ? 10.249  27.847  11.913  1.00   16.04 ? 377 ILE A CG2   1 
ATOM   2016  C  CD1   . ILE A  1 270 ? 9.533   29.841  9.727   1.00   17.20 ? 377 ILE A CD1   1 
ATOM   2017  N  N     . ILE A  1 271 ? 13.824  27.476  12.630  1.00   18.46 ? 378 ILE A N     1 
ATOM   2018  C  CA    . ILE A  1 271 ? 14.430  26.322  13.272  1.00   17.76 ? 378 ILE A CA    1 
ATOM   2019  C  C     . ILE A  1 271 ? 15.123  26.767  14.562  1.00   18.38 ? 378 ILE A C     1 
ATOM   2020  O  O     . ILE A  1 271 ? 15.215  26.003  15.526  1.00   19.60 ? 378 ILE A O     1 
ATOM   2021  C  CB    . ILE A  1 271 ? 15.426  25.630  12.313  1.00   18.67 ? 378 ILE A CB    1 
ATOM   2022  C  CG1   . ILE A  1 271 ? 14.641  24.977  11.166  1.00   17.91 ? 378 ILE A CG1   1 
ATOM   2023  C  CG2   . ILE A  1 271 ? 16.251  24.588  13.058  1.00   17.06 ? 378 ILE A CG2   1 
ATOM   2024  C  CD1   . ILE A  1 271 ? 15.496  24.360  10.079  1.00   17.83 ? 378 ILE A CD1   1 
ATOM   2025  N  N     . ALA A  1 272 ? 15.592  28.013  14.581  1.00   16.50 ? 379 ALA A N     1 
ATOM   2026  C  CA    . ALA A  1 272 ? 16.248  28.558  15.761  1.00   14.17 ? 379 ALA A CA    1 
ATOM   2027  C  C     . ALA A  1 272 ? 15.208  28.685  16.880  1.00   15.94 ? 379 ALA A C     1 
ATOM   2028  O  O     . ALA A  1 272 ? 15.480  28.360  18.035  1.00   16.26 ? 379 ALA A O     1 
ATOM   2029  C  CB    . ALA A  1 272 ? 16.852  29.909  15.441  1.00   12.12 ? 379 ALA A CB    1 
ATOM   2030  N  N     . LEU A  1 273 ? 14.012  29.154  16.535  1.00   14.85 ? 380 LEU A N     1 
ATOM   2031  C  CA    . LEU A  1 273 ? 12.961  29.291  17.527  1.00   15.03 ? 380 LEU A CA    1 
ATOM   2032  C  C     . LEU A  1 273 ? 12.608  27.909  18.056  1.00   15.81 ? 380 LEU A C     1 
ATOM   2033  O  O     . LEU A  1 273 ? 12.375  27.735  19.250  1.00   15.50 ? 380 LEU A O     1 
ATOM   2034  C  CB    . LEU A  1 273 ? 11.708  29.927  16.919  1.00   14.13 ? 380 LEU A CB    1 
ATOM   2035  C  CG    . LEU A  1 273 ? 11.838  31.266  16.184  1.00   14.57 ? 380 LEU A CG    1 
ATOM   2036  C  CD1   . LEU A  1 273 ? 10.452  31.723  15.753  1.00   9.46  ? 380 LEU A CD1   1 
ATOM   2037  C  CD2   . LEU A  1 273 ? 12.493  32.317  17.079  1.00   14.47 ? 380 LEU A CD2   1 
ATOM   2038  N  N     . THR A  1 274 ? 12.584  26.924  17.165  1.00   15.54 ? 381 THR A N     1 
ATOM   2039  C  CA    . THR A  1 274 ? 12.247  25.570  17.568  1.00   18.25 ? 381 THR A CA    1 
ATOM   2040  C  C     . THR A  1 274 ? 13.280  24.997  18.536  1.00   19.90 ? 381 THR A C     1 
ATOM   2041  O  O     . THR A  1 274 ? 12.917  24.308  19.491  1.00   20.31 ? 381 THR A O     1 
ATOM   2042  C  CB    . THR A  1 274 ? 12.104  24.651  16.342  1.00   18.42 ? 381 THR A CB    1 
ATOM   2043  O  OG1   . THR A  1 274 ? 11.118  25.194  15.457  1.00   18.27 ? 381 THR A OG1   1 
ATOM   2044  C  CG2   . THR A  1 274 ? 11.647  23.268  16.762  1.00   18.79 ? 381 THR A CG2   1 
ATOM   2045  N  N     . LEU A  1 275 ? 14.561  25.284  18.305  1.00   21.43 ? 382 LEU A N     1 
ATOM   2046  C  CA    . LEU A  1 275 ? 15.602  24.782  19.200  1.00   21.42 ? 382 LEU A CA    1 
ATOM   2047  C  C     . LEU A  1 275 ? 15.492  25.408  20.583  1.00   20.74 ? 382 LEU A C     1 
ATOM   2048  O  O     . LEU A  1 275 ? 15.798  24.762  21.584  1.00   18.39 ? 382 LEU A O     1 
ATOM   2049  C  CB    . LEU A  1 275 ? 17.000  25.032  18.630  1.00   21.06 ? 382 LEU A CB    1 
ATOM   2050  C  CG    . LEU A  1 275 ? 17.438  24.000  17.587  1.00   20.78 ? 382 LEU A CG    1 
ATOM   2051  C  CD1   . LEU A  1 275 ? 18.881  24.276  17.160  1.00   22.49 ? 382 LEU A CD1   1 
ATOM   2052  C  CD2   . LEU A  1 275 ? 17.317  22.601  18.174  1.00   21.77 ? 382 LEU A CD2   1 
ATOM   2053  N  N     . GLU A  1 276 ? 15.065  26.667  20.645  1.00   20.75 ? 383 GLU A N     1 
ATOM   2054  C  CA    . GLU A  1 276 ? 14.905  27.307  21.943  1.00   20.07 ? 383 GLU A CA    1 
ATOM   2055  C  C     . GLU A  1 276 ? 13.763  26.592  22.676  1.00   18.75 ? 383 GLU A C     1 
ATOM   2056  O  O     . GLU A  1 276 ? 13.837  26.364  23.877  1.00   15.79 ? 383 GLU A O     1 
ATOM   2057  C  CB    . GLU A  1 276 ? 14.598  28.806  21.797  1.00   20.31 ? 383 GLU A CB    1 
ATOM   2058  C  CG    . GLU A  1 276 ? 14.066  29.429  23.088  1.00   25.72 ? 383 GLU A CG    1 
ATOM   2059  C  CD    . GLU A  1 276 ? 14.033  30.955  23.094  1.00   27.83 ? 383 GLU A CD    1 
ATOM   2060  O  OE1   . GLU A  1 276 ? 13.720  31.576  22.055  1.00   29.90 ? 383 GLU A OE1   1 
ATOM   2061  O  OE2   . GLU A  1 276 ? 14.303  31.534  24.166  1.00   30.56 ? 383 GLU A OE2   1 
ATOM   2062  N  N     . ALA A  1 277 ? 12.718  26.221  21.940  1.00   17.88 ? 384 ALA A N     1 
ATOM   2063  C  CA    . ALA A  1 277 ? 11.579  25.534  22.529  1.00   18.33 ? 384 ALA A CA    1 
ATOM   2064  C  C     . ALA A  1 277 ? 11.962  24.133  23.014  1.00   19.86 ? 384 ALA A C     1 
ATOM   2065  O  O     . ALA A  1 277 ? 11.296  23.572  23.880  1.00   20.07 ? 384 ALA A O     1 
ATOM   2066  C  CB    . ALA A  1 277 ? 10.435  25.455  21.528  1.00   17.71 ? 384 ALA A CB    1 
ATOM   2067  N  N     . ASN A  1 278 ? 13.034  23.570  22.459  1.00   20.48 ? 385 ASN A N     1 
ATOM   2068  C  CA    . ASN A  1 278 ? 13.514  22.238  22.865  1.00   20.98 ? 385 ASN A CA    1 
ATOM   2069  C  C     . ASN A  1 278 ? 14.959  22.040  22.401  1.00   22.53 ? 385 ASN A C     1 
ATOM   2070  O  O     . ASN A  1 278 ? 15.203  21.580  21.284  1.00   21.87 ? 385 ASN A O     1 
ATOM   2071  C  CB    . ASN A  1 278 ? 12.633  21.133  22.271  1.00   18.09 ? 385 ASN A CB    1 
ATOM   2072  C  CG    . ASN A  1 278 ? 13.013  19.747  22.781  1.00   15.44 ? 385 ASN A CG    1 
ATOM   2073  O  OD1   . ASN A  1 278 ? 14.121  19.539  23.264  1.00   15.02 ? 385 ASN A OD1   1 
ATOM   2074  N  ND2   . ASN A  1 278 ? 12.103  18.795  22.657  1.00   10.72 ? 385 ASN A ND2   1 
ATOM   2075  N  N     . LYS A  1 279 ? 15.911  22.370  23.273  1.00   23.30 ? 386 LYS A N     1 
ATOM   2076  C  CA    . LYS A  1 279 ? 17.329  22.269  22.951  1.00   23.13 ? 386 LYS A CA    1 
ATOM   2077  C  C     . LYS A  1 279 ? 17.844  20.849  22.765  1.00   23.80 ? 386 LYS A C     1 
ATOM   2078  O  O     . LYS A  1 279 ? 18.952  20.657  22.279  1.00   25.49 ? 386 LYS A O     1 
ATOM   2079  C  CB    . LYS A  1 279 ? 18.163  22.981  24.028  1.00   23.93 ? 386 LYS A CB    1 
ATOM   2080  C  CG    . LYS A  1 279 ? 17.886  24.482  24.160  1.00   26.51 ? 386 LYS A CG    1 
ATOM   2081  C  CD    . LYS A  1 279 ? 18.873  25.170  25.087  0.0000 25.27 ? 386 LYS A CD    1 
ATOM   2082  C  CE    . LYS A  1 279 ? 18.628  26.671  25.125  0.0000 25.38 ? 386 LYS A CE    1 
ATOM   2083  N  NZ    . LYS A  1 279 ? 18.742  27.292  23.774  0.0000 25.16 ? 386 LYS A NZ    1 
ATOM   2084  N  N     . ASN A  1 280 ? 17.046  19.855  23.133  1.00   24.37 ? 387 ASN A N     1 
ATOM   2085  C  CA    . ASN A  1 280 ? 17.472  18.463  23.017  1.00   25.16 ? 387 ASN A CA    1 
ATOM   2086  C  C     . ASN A  1 280 ? 17.025  17.765  21.726  1.00   24.54 ? 387 ASN A C     1 
ATOM   2087  O  O     . ASN A  1 280 ? 17.101  16.538  21.612  1.00   23.07 ? 387 ASN A O     1 
ATOM   2088  C  CB    . ASN A  1 280 ? 16.998  17.664  24.243  1.00   29.44 ? 387 ASN A CB    1 
ATOM   2089  C  CG    . ASN A  1 280 ? 17.936  17.813  25.452  1.00   36.78 ? 387 ASN A CG    1 
ATOM   2090  O  OD1   . ASN A  1 280 ? 17.651  17.307  26.556  1.00   41.73 ? 387 ASN A OD1   1 
ATOM   2091  N  ND2   . ASN A  1 280 ? 19.064  18.501  25.247  1.00   37.31 ? 387 ASN A ND2   1 
ATOM   2092  N  N     . LEU A  1 281 ? 16.564  18.545  20.755  1.00   22.06 ? 388 LEU A N     1 
ATOM   2093  C  CA    . LEU A  1 281 ? 16.144  17.987  19.478  1.00   20.30 ? 388 LEU A CA    1 
ATOM   2094  C  C     . LEU A  1 281 ? 17.362  17.562  18.650  1.00   19.36 ? 388 LEU A C     1 
ATOM   2095  O  O     . LEU A  1 281 ? 18.350  18.288  18.576  1.00   20.98 ? 388 LEU A O     1 
ATOM   2096  C  CB    . LEU A  1 281 ? 15.342  19.024  18.697  1.00   21.12 ? 388 LEU A CB    1 
ATOM   2097  C  CG    . LEU A  1 281 ? 13.961  19.436  19.235  1.00   21.82 ? 388 LEU A CG    1 
ATOM   2098  C  CD1   . LEU A  1 281 ? 13.404  20.606  18.415  1.00   19.62 ? 388 LEU A CD1   1 
ATOM   2099  C  CD2   . LEU A  1 281 ? 13.013  18.249  19.157  1.00   20.34 ? 388 LEU A CD2   1 
ATOM   2100  N  N     . THR A  1 282 ? 17.301  16.389  18.029  1.00   16.69 ? 389 THR A N     1 
ATOM   2101  C  CA    . THR A  1 282 ? 18.422  15.932  17.210  1.00   17.18 ? 389 THR A CA    1 
ATOM   2102  C  C     . THR A  1 282 ? 18.230  16.456  15.792  1.00   17.45 ? 389 THR A C     1 
ATOM   2103  O  O     . THR A  1 282 ? 17.168  16.982  15.462  1.00   18.08 ? 389 THR A O     1 
ATOM   2104  C  CB    . THR A  1 282 ? 18.492  14.405  17.144  1.00   15.64 ? 389 THR A CB    1 
ATOM   2105  O  OG1   . THR A  1 282 ? 17.395  13.916  16.359  1.00   16.34 ? 389 THR A OG1   1 
ATOM   2106  C  CG2   . THR A  1 282 ? 18.441  13.808  18.539  1.00   11.34 ? 389 THR A CG2   1 
ATOM   2107  N  N     . TRP A  1 283 ? 19.250  16.317  14.953  1.00   17.45 ? 390 TRP A N     1 
ATOM   2108  C  CA    . TRP A  1 283 ? 19.142  16.791  13.583  1.00   14.18 ? 390 TRP A CA    1 
ATOM   2109  C  C     . TRP A  1 283 ? 17.996  16.060  12.872  1.00   14.95 ? 390 TRP A C     1 
ATOM   2110  O  O     . TRP A  1 283 ? 17.358  16.621  11.985  1.00   13.62 ? 390 TRP A O     1 
ATOM   2111  C  CB    . TRP A  1 283 ? 20.464  16.589  12.836  1.00   14.15 ? 390 TRP A CB    1 
ATOM   2112  C  CG    . TRP A  1 283 ? 20.841  15.167  12.598  1.00   15.60 ? 390 TRP A CG    1 
ATOM   2113  C  CD1   . TRP A  1 283 ? 21.487  14.326  13.462  1.00   17.02 ? 390 TRP A CD1   1 
ATOM   2114  C  CD2   . TRP A  1 283 ? 20.617  14.419  11.397  1.00   15.93 ? 390 TRP A CD2   1 
ATOM   2115  N  NE1   . TRP A  1 283 ? 21.685  13.100  12.866  1.00   15.83 ? 390 TRP A NE1   1 
ATOM   2116  C  CE2   . TRP A  1 283 ? 21.160  13.128  11.600  1.00   14.64 ? 390 TRP A CE2   1 
ATOM   2117  C  CE3   . TRP A  1 283 ? 20.007  14.714  10.168  1.00   13.72 ? 390 TRP A CE3   1 
ATOM   2118  C  CZ2   . TRP A  1 283 ? 21.116  12.133  10.620  1.00   11.58 ? 390 TRP A CZ2   1 
ATOM   2119  C  CZ3   . TRP A  1 283 ? 19.961  13.727  9.197   1.00   15.02 ? 390 TRP A CZ3   1 
ATOM   2120  C  CH2   . TRP A  1 283 ? 20.514  12.450  9.429   1.00   15.50 ? 390 TRP A CH2   1 
ATOM   2121  N  N     . ARG A  1 284 ? 17.724  14.816  13.262  1.00   14.21 ? 391 ARG A N     1 
ATOM   2122  C  CA    . ARG A  1 284 ? 16.625  14.078  12.648  1.00   14.42 ? 391 ARG A CA    1 
ATOM   2123  C  C     . ARG A  1 284 ? 15.295  14.511  13.260  1.00   16.37 ? 391 ARG A C     1 
ATOM   2124  O  O     . ARG A  1 284 ? 14.291  14.601  12.558  1.00   16.64 ? 391 ARG A O     1 
ATOM   2125  C  CB    . ARG A  1 284 ? 16.808  12.567  12.810  1.00   14.38 ? 391 ARG A CB    1 
ATOM   2126  C  CG    . ARG A  1 284 ? 17.849  11.972  11.872  1.00   16.14 ? 391 ARG A CG    1 
ATOM   2127  C  CD    . ARG A  1 284 ? 18.377  10.615  12.330  1.00   14.29 ? 391 ARG A CD    1 
ATOM   2128  N  NE    . ARG A  1 284 ? 17.367  9.561   12.351  1.00   15.16 ? 391 ARG A NE    1 
ATOM   2129  C  CZ    . ARG A  1 284 ? 16.881  8.998   13.462  1.00   15.10 ? 391 ARG A CZ    1 
ATOM   2130  N  NH1   . ARG A  1 284 ? 15.954  8.042   13.383  1.00   14.14 ? 391 ARG A NH1   1 
ATOM   2131  N  NH2   . ARG A  1 284 ? 17.315  9.382   14.665  1.00   17.48 ? 391 ARG A NH2   1 
ATOM   2132  N  N     . ASP A  1 285 ? 15.278  14.783  14.563  1.00   17.05 ? 392 ASP A N     1 
ATOM   2133  C  CA    . ASP A  1 285 ? 14.043  15.227  15.203  1.00   17.53 ? 392 ASP A CA    1 
ATOM   2134  C  C     . ASP A  1 285 ? 13.562  16.466  14.464  1.00   17.01 ? 392 ASP A C     1 
ATOM   2135  O  O     . ASP A  1 285 ? 12.379  16.617  14.167  1.00   17.48 ? 392 ASP A O     1 
ATOM   2136  C  CB    . ASP A  1 285 ? 14.264  15.600  16.677  1.00   20.35 ? 392 ASP A CB    1 
ATOM   2137  C  CG    . ASP A  1 285 ? 14.331  14.390  17.588  1.00   24.18 ? 392 ASP A CG    1 
ATOM   2138  O  OD1   . ASP A  1 285 ? 13.677  13.368  17.275  1.00   25.56 ? 392 ASP A OD1   1 
ATOM   2139  O  OD2   . ASP A  1 285 ? 15.026  14.470  18.629  1.00   24.38 ? 392 ASP A OD2   1 
ATOM   2140  N  N     . MET A  1 286 ? 14.498  17.359  14.169  1.00   17.41 ? 393 MET A N     1 
ATOM   2141  C  CA    . MET A  1 286 ? 14.180  18.607  13.481  1.00   16.84 ? 393 MET A CA    1 
ATOM   2142  C  C     . MET A  1 286 ? 13.504  18.371  12.135  1.00   16.97 ? 393 MET A C     1 
ATOM   2143  O  O     . MET A  1 286 ? 12.556  19.074  11.789  1.00   16.49 ? 393 MET A O     1 
ATOM   2144  C  CB    . MET A  1 286 ? 15.447  19.440  13.292  1.00   13.79 ? 393 MET A CB    1 
ATOM   2145  C  CG    . MET A  1 286 ? 15.186  20.847  12.786  1.00   15.07 ? 393 MET A CG    1 
ATOM   2146  S  SD    . MET A  1 286 ? 14.084  21.798  13.855  1.00   16.17 ? 393 MET A SD    1 
ATOM   2147  C  CE    . MET A  1 286 ? 15.041  21.955  15.353  1.00   12.82 ? 393 MET A CE    1 
ATOM   2148  N  N     . GLN A  1 287 ? 13.984  17.391  11.375  1.00   14.73 ? 394 GLN A N     1 
ATOM   2149  C  CA    . GLN A  1 287 ? 13.369  17.115  10.088  1.00   14.10 ? 394 GLN A CA    1 
ATOM   2150  C  C     . GLN A  1 287 ? 11.970  16.528  10.265  1.00   14.99 ? 394 GLN A C     1 
ATOM   2151  O  O     . GLN A  1 287 ? 11.075  16.792  9.460   1.00   13.70 ? 394 GLN A O     1 
ATOM   2152  C  CB    . GLN A  1 287 ? 14.263  16.199  9.253   1.00   10.55 ? 394 GLN A CB    1 
ATOM   2153  C  CG    . GLN A  1 287 ? 15.411  16.953  8.624   1.00   12.16 ? 394 GLN A CG    1 
ATOM   2154  C  CD    . GLN A  1 287 ? 16.218  16.124  7.651   1.00   14.27 ? 394 GLN A CD    1 
ATOM   2155  O  OE1   . GLN A  1 287 ? 15.668  15.428  6.804   1.00   12.90 ? 394 GLN A OE1   1 
ATOM   2156  N  NE2   . GLN A  1 287 ? 17.541  16.213  7.756   1.00   17.38 ? 394 GLN A NE2   1 
ATOM   2157  N  N     . HIS A  1 288 ? 11.778  15.755  11.332  1.00   15.90 ? 395 HIS A N     1 
ATOM   2158  C  CA    . HIS A  1 288 ? 10.469  15.169  11.626  1.00   16.47 ? 395 HIS A CA    1 
ATOM   2159  C  C     . HIS A  1 288 ? 9.474   16.287  11.899  1.00   17.07 ? 395 HIS A C     1 
ATOM   2160  O  O     . HIS A  1 288 ? 8.349   16.264  11.386  1.00   15.63 ? 395 HIS A O     1 
ATOM   2161  C  CB    . HIS A  1 288 ? 10.537  14.266  12.857  1.00   15.40 ? 395 HIS A CB    1 
ATOM   2162  C  CG    . HIS A  1 288 ? 10.949  12.863  12.557  1.00   18.17 ? 395 HIS A CG    1 
ATOM   2163  N  ND1   . HIS A  1 288 ? 10.063  11.911  12.102  1.00   17.12 ? 395 HIS A ND1   1 
ATOM   2164  C  CD2   . HIS A  1 288 ? 12.158  12.252  12.629  1.00   16.98 ? 395 HIS A CD2   1 
ATOM   2165  C  CE1   . HIS A  1 288 ? 10.709  10.773  11.906  1.00   18.53 ? 395 HIS A CE1   1 
ATOM   2166  N  NE2   . HIS A  1 288 ? 11.982  10.956  12.218  1.00   16.94 ? 395 HIS A NE2   1 
ATOM   2167  N  N     . LEU A  1 289 ? 9.890   17.260  12.710  1.00   16.39 ? 396 LEU A N     1 
ATOM   2168  C  CA    . LEU A  1 289 ? 9.022   18.382  13.054  1.00   17.26 ? 396 LEU A CA    1 
ATOM   2169  C  C     . LEU A  1 289 ? 8.557   19.141  11.813  1.00   19.02 ? 396 LEU A C     1 
ATOM   2170  O  O     . LEU A  1 289 ? 7.391   19.523  11.708  1.00   20.16 ? 396 LEU A O     1 
ATOM   2171  C  CB    . LEU A  1 289 ? 9.736   19.335  14.015  1.00   17.78 ? 396 LEU A CB    1 
ATOM   2172  C  CG    . LEU A  1 289 ? 9.947   18.816  15.440  1.00   21.29 ? 396 LEU A CG    1 
ATOM   2173  C  CD1   . LEU A  1 289 ? 10.645  19.869  16.277  1.00   20.28 ? 396 LEU A CD1   1 
ATOM   2174  C  CD2   . LEU A  1 289 ? 8.607   18.466  16.058  1.00   22.29 ? 396 LEU A CD2   1 
ATOM   2175  N  N     . VAL A  1 290 ? 9.467   19.353  10.867  1.00   18.99 ? 397 VAL A N     1 
ATOM   2176  C  CA    . VAL A  1 290 ? 9.130   20.063  9.642   1.00   18.09 ? 397 VAL A CA    1 
ATOM   2177  C  C     . VAL A  1 290 ? 8.121   19.288  8.800   1.00   20.89 ? 397 VAL A C     1 
ATOM   2178  O  O     . VAL A  1 290 ? 7.172   19.868  8.268   1.00   20.19 ? 397 VAL A O     1 
ATOM   2179  C  CB    . VAL A  1 290 ? 10.390  20.336  8.776   1.00   19.39 ? 397 VAL A CB    1 
ATOM   2180  C  CG1   . VAL A  1 290 ? 9.979   20.936  7.406   1.00   12.41 ? 397 VAL A CG1   1 
ATOM   2181  C  CG2   . VAL A  1 290 ? 11.334  21.282  9.529   1.00   18.65 ? 397 VAL A CG2   1 
ATOM   2182  N  N     . VAL A  1 291 ? 8.325   17.979  8.680   1.00   19.52 ? 398 VAL A N     1 
ATOM   2183  C  CA    . VAL A  1 291 ? 7.431   17.159  7.882   1.00   18.08 ? 398 VAL A CA    1 
ATOM   2184  C  C     . VAL A  1 291 ? 6.036   17.185  8.459   1.00   18.68 ? 398 VAL A C     1 
ATOM   2185  O  O     . VAL A  1 291 ? 5.063   17.337  7.726   1.00   20.42 ? 398 VAL A O     1 
ATOM   2186  C  CB    . VAL A  1 291 ? 7.913   15.685  7.805   1.00   18.35 ? 398 VAL A CB    1 
ATOM   2187  C  CG1   . VAL A  1 291 ? 6.880   14.842  7.060   1.00   13.22 ? 398 VAL A CG1   1 
ATOM   2188  C  CG2   . VAL A  1 291 ? 9.243   15.609  7.072   1.00   17.75 ? 398 VAL A CG2   1 
ATOM   2189  N  N     . GLN A  1 292 ? 5.946   17.059  9.778   1.00   19.95 ? 399 GLN A N     1 
ATOM   2190  C  CA    . GLN A  1 292 ? 4.657   17.030  10.455  1.00   19.17 ? 399 GLN A CA    1 
ATOM   2191  C  C     . GLN A  1 292 ? 3.894   18.336  10.543  1.00   19.59 ? 399 GLN A C     1 
ATOM   2192  O  O     . GLN A  1 292 ? 2.672   18.322  10.488  1.00   22.20 ? 399 GLN A O     1 
ATOM   2193  C  CB    . GLN A  1 292 ? 4.818   16.453  11.860  1.00   16.42 ? 399 GLN A CB    1 
ATOM   2194  C  CG    . GLN A  1 292 ? 4.937   14.944  11.863  1.00   20.71 ? 399 GLN A CG    1 
ATOM   2195  C  CD    . GLN A  1 292 ? 4.936   14.369  13.256  1.00   22.20 ? 399 GLN A CD    1 
ATOM   2196  O  OE1   . GLN A  1 292 ? 4.166   14.798  14.107  1.00   25.94 ? 399 GLN A OE1   1 
ATOM   2197  N  NE2   . GLN A  1 292 ? 5.796   13.384  13.498  1.00   23.16 ? 399 GLN A NE2   1 
ATOM   2198  N  N     . THR A  1 293 ? 4.600   19.457  10.649  1.00   18.41 ? 400 THR A N     1 
ATOM   2199  C  CA    . THR A  1 293 ? 3.944   20.745  10.814  1.00   16.98 ? 400 THR A CA    1 
ATOM   2200  C  C     . THR A  1 293 ? 3.779   21.629  9.582   1.00   19.19 ? 400 THR A C     1 
ATOM   2201  O  O     . THR A  1 293 ? 3.004   22.593  9.606   1.00   18.83 ? 400 THR A O     1 
ATOM   2202  C  CB    . THR A  1 293 ? 4.672   21.565  11.888  1.00   15.92 ? 400 THR A CB    1 
ATOM   2203  O  OG1   . THR A  1 293 ? 6.051   21.687  11.517  1.00   14.89 ? 400 THR A OG1   1 
ATOM   2204  C  CG2   . THR A  1 293 ? 4.576   20.884  13.245  1.00   10.38 ? 400 THR A CG2   1 
ATOM   2205  N  N     . SER A  1 294 ? 4.493   21.322  8.507   1.00   20.30 ? 401 SER A N     1 
ATOM   2206  C  CA    . SER A  1 294 ? 4.386   22.139  7.302   1.00   21.21 ? 401 SER A CA    1 
ATOM   2207  C  C     . SER A  1 294 ? 2.996   22.073  6.665   1.00   22.50 ? 401 SER A C     1 
ATOM   2208  O  O     . SER A  1 294 ? 2.386   21.011  6.552   1.00   22.25 ? 401 SER A O     1 
ATOM   2209  C  CB    . SER A  1 294 ? 5.460   21.737  6.297   1.00   20.64 ? 401 SER A CB    1 
ATOM   2210  O  OG    . SER A  1 294 ? 6.744   21.961  6.843   1.00   21.57 ? 401 SER A OG    1 
ATOM   2211  N  N     . LYS A  1 295 ? 2.511   23.234  6.238   1.00   26.38 ? 402 LYS A N     1 
ATOM   2212  C  CA    . LYS A  1 295 ? 1.187   23.366  5.647   1.00   24.43 ? 402 LYS A CA    1 
ATOM   2213  C  C     . LYS A  1 295 ? 1.156   23.539  4.127   1.00   25.44 ? 402 LYS A C     1 
ATOM   2214  O  O     . LYS A  1 295 ? 1.808   24.429  3.588   1.00   25.04 ? 402 LYS A O     1 
ATOM   2215  C  CB    . LYS A  1 295 ? 0.481   24.570  6.262   1.00   22.02 ? 402 LYS A CB    1 
ATOM   2216  C  CG    . LYS A  1 295 ? 0.501   24.634  7.770   1.00   25.89 ? 402 LYS A CG    1 
ATOM   2217  C  CD    . LYS A  1 295 ? -0.367  23.556  8.415   1.00   27.17 ? 402 LYS A CD    1 
ATOM   2218  C  CE    . LYS A  1 295 ? -0.543  23.832  9.907   1.00   23.65 ? 402 LYS A CE    1 
ATOM   2219  N  NZ    . LYS A  1 295 ? 0.770   23.942  10.605  1.00   25.90 ? 402 LYS A NZ    1 
ATOM   2220  N  N     . PRO A  1 296 ? 0.396   22.682  3.420   1.00   25.93 ? 403 PRO A N     1 
ATOM   2221  C  CA    . PRO A  1 296 ? 0.303   22.802  1.964   1.00   26.26 ? 403 PRO A CA    1 
ATOM   2222  C  C     . PRO A  1 296 ? -0.647  23.953  1.660   1.00   27.21 ? 403 PRO A C     1 
ATOM   2223  O  O     . PRO A  1 296 ? -0.303  24.882  0.933   1.00   29.88 ? 403 PRO A O     1 
ATOM   2224  C  CB    . PRO A  1 296 ? -0.299  21.463  1.536   1.00   23.54 ? 403 PRO A CB    1 
ATOM   2225  C  CG    . PRO A  1 296 ? 0.161   20.535  2.594   1.00   26.84 ? 403 PRO A CG    1 
ATOM   2226  C  CD    . PRO A  1 296 ? -0.059  21.352  3.847   1.00   23.77 ? 403 PRO A CD    1 
ATOM   2227  N  N     . ALA A  1 297 ? -1.835  23.878  2.261   1.00   29.44 ? 404 ALA A N     1 
ATOM   2228  C  CA    . ALA A  1 297 ? -2.907  24.853  2.072   1.00   30.72 ? 404 ALA A CA    1 
ATOM   2229  C  C     . ALA A  1 297 ? -2.428  26.255  1.772   1.00   30.79 ? 404 ALA A C     1 
ATOM   2230  O  O     . ALA A  1 297 ? -1.561  26.787  2.464   1.00   33.05 ? 404 ALA A O     1 
ATOM   2231  C  CB    . ALA A  1 297 ? -3.818  24.867  3.285   1.00   33.29 ? 404 ALA A CB    1 
ATOM   2232  N  N     . HIS A  1 298 ? -3.010  26.835  0.726   1.00   28.99 ? 405 HIS A N     1 
ATOM   2233  C  CA    . HIS A  1 298 ? -2.704  28.184  0.259   1.00   30.59 ? 405 HIS A CA    1 
ATOM   2234  C  C     . HIS A  1 298 ? -1.687  28.185  -0.874  1.00   31.56 ? 405 HIS A C     1 
ATOM   2235  O  O     . HIS A  1 298 ? -1.700  29.094  -1.707  1.00   34.58 ? 405 HIS A O     1 
ATOM   2236  C  CB    . HIS A  1 298 ? -2.211  29.079  1.406   1.00   29.36 ? 405 HIS A CB    1 
ATOM   2237  C  CG    . HIS A  1 298 ? -3.229  29.293  2.481   0.0000 28.12 ? 405 HIS A CG    1 
ATOM   2238  N  ND1   . HIS A  1 298 ? -4.515  29.713  2.214   0.0000 27.62 ? 405 HIS A ND1   1 
ATOM   2239  C  CD2   . HIS A  1 298 ? -3.150  29.156  3.826   0.0000 27.62 ? 405 HIS A CD2   1 
ATOM   2240  C  CE1   . HIS A  1 298 ? -5.182  29.825  3.347   0.0000 27.33 ? 405 HIS A CE1   1 
ATOM   2241  N  NE2   . HIS A  1 298 ? -4.377  29.494  4.341   0.0000 27.33 ? 405 HIS A NE2   1 
ATOM   2242  N  N     . LEU A  1 299 ? -0.826  27.167  -0.911  1.00   29.09 ? 406 LEU A N     1 
ATOM   2243  C  CA    . LEU A  1 299 ? 0.202   27.044  -1.948  1.00   26.83 ? 406 LEU A CA    1 
ATOM   2244  C  C     . LEU A  1 299 ? -0.324  26.333  -3.196  1.00   25.64 ? 406 LEU A C     1 
ATOM   2245  O  O     . LEU A  1 299 ? -0.812  25.209  -3.111  1.00   27.06 ? 406 LEU A O     1 
ATOM   2246  C  CB    . LEU A  1 299 ? 1.408   26.281  -1.387  1.00   24.51 ? 406 LEU A CB    1 
ATOM   2247  C  CG    . LEU A  1 299 ? 2.644   27.072  -0.954  1.00   25.38 ? 406 LEU A CG    1 
ATOM   2248  C  CD1   . LEU A  1 299 ? 2.244   28.378  -0.309  1.00   27.16 ? 406 LEU A CD1   1 
ATOM   2249  C  CD2   . LEU A  1 299 ? 3.464   26.236  0.001   1.00   23.42 ? 406 LEU A CD2   1 
ATOM   2250  N  N     . ASN A  1 300 ? -0.212  26.979  -4.353  1.00   24.44 ? 407 ASN A N     1 
ATOM   2251  C  CA    . ASN A  1 300 ? -0.695  26.394  -5.603  1.00   24.09 ? 407 ASN A CA    1 
ATOM   2252  C  C     . ASN A  1 300 ? 0.382   25.626  -6.346  1.00   23.15 ? 407 ASN A C     1 
ATOM   2253  O  O     . ASN A  1 300 ? 1.471   26.130  -6.572  1.00   26.61 ? 407 ASN A O     1 
ATOM   2254  C  CB    . ASN A  1 300 ? -1.262  27.491  -6.511  1.00   25.48 ? 407 ASN A CB    1 
ATOM   2255  C  CG    . ASN A  1 300 ? -2.313  28.348  -5.804  1.00   27.49 ? 407 ASN A CG    1 
ATOM   2256  O  OD1   . ASN A  1 300 ? -3.338  27.840  -5.334  1.00   30.96 ? 407 ASN A OD1   1 
ATOM   2257  N  ND2   . ASN A  1 300 ? -2.057  29.647  -5.718  1.00   26.94 ? 407 ASN A ND2   1 
ATOM   2258  N  N     . ALA A  1 301 ? 0.071   24.396  -6.725  1.00   23.19 ? 408 ALA A N     1 
ATOM   2259  C  CA    . ALA A  1 301 ? 1.014   23.563  -7.456  1.00   24.65 ? 408 ALA A CA    1 
ATOM   2260  C  C     . ALA A  1 301 ? 0.236   22.549  -8.277  1.00   26.73 ? 408 ALA A C     1 
ATOM   2261  O  O     . ALA A  1 301 ? -0.827  22.089  -7.870  1.00   29.64 ? 408 ALA A O     1 
ATOM   2262  C  CB    . ALA A  1 301 ? 1.954   22.852  -6.493  1.00   23.99 ? 408 ALA A CB    1 
ATOM   2263  N  N     . ASN A  1 302 ? 0.775   22.190  -9.432  1.00   28.23 ? 409 ASN A N     1 
ATOM   2264  C  CA    . ASN A  1 302 ? 0.115   21.246  -10.314 1.00   27.66 ? 409 ASN A CA    1 
ATOM   2265  C  C     . ASN A  1 302 ? 0.388   19.792  -9.919  1.00   26.36 ? 409 ASN A C     1 
ATOM   2266  O  O     . ASN A  1 302 ? -0.190  18.877  -10.500 1.00   28.06 ? 409 ASN A O     1 
ATOM   2267  C  CB    . ASN A  1 302 ? 0.588   21.515  -11.753 1.00   31.39 ? 409 ASN A CB    1 
ATOM   2268  C  CG    . ASN A  1 302 ? -0.144  20.686  -12.788 1.00   34.35 ? 409 ASN A CG    1 
ATOM   2269  O  OD1   . ASN A  1 302 ? -0.029  19.462  -12.821 0.0000 32.95 ? 409 ASN A OD1   1 
ATOM   2270  N  ND2   . ASN A  1 302 ? -0.902  21.357  -13.648 0.0000 32.95 ? 409 ASN A ND2   1 
ATOM   2271  N  N     . ASP A  1 303 ? 1.233   19.570  -8.914  1.00   25.53 ? 410 ASP A N     1 
ATOM   2272  C  CA    . ASP A  1 303 ? 1.575   18.201  -8.533  1.00   22.16 ? 410 ASP A CA    1 
ATOM   2273  C  C     . ASP A  1 303 ? 1.345   17.765  -7.086  1.00   20.87 ? 410 ASP A C     1 
ATOM   2274  O  O     . ASP A  1 303 ? 2.008   16.842  -6.611  1.00   20.35 ? 410 ASP A O     1 
ATOM   2275  C  CB    . ASP A  1 303 ? 3.035   17.935  -8.886  1.00   22.13 ? 410 ASP A CB    1 
ATOM   2276  C  CG    . ASP A  1 303 ? 3.984   18.733  -8.018  1.00   25.32 ? 410 ASP A CG    1 
ATOM   2277  O  OD1   . ASP A  1 303 ? 3.645   19.895  -7.689  1.00   27.69 ? 410 ASP A OD1   1 
ATOM   2278  O  OD2   . ASP A  1 303 ? 5.063   18.208  -7.669  1.00   25.52 ? 410 ASP A OD2   1 
ATOM   2279  N  N     . TRP A  1 304 ? 0.423   18.401  -6.378  1.00   19.10 ? 411 TRP A N     1 
ATOM   2280  C  CA    . TRP A  1 304 ? 0.166   17.975  -5.008  1.00   18.72 ? 411 TRP A CA    1 
ATOM   2281  C  C     . TRP A  1 304 ? -0.356  16.542  -5.040  1.00   20.66 ? 411 TRP A C     1 
ATOM   2282  O  O     . TRP A  1 304 ? -1.265  16.219  -5.805  1.00   22.37 ? 411 TRP A O     1 
ATOM   2283  C  CB    . TRP A  1 304 ? -0.873  18.869  -4.335  1.00   16.34 ? 411 TRP A CB    1 
ATOM   2284  C  CG    . TRP A  1 304 ? -0.336  20.202  -3.873  1.00   17.16 ? 411 TRP A CG    1 
ATOM   2285  C  CD1   . TRP A  1 304 ? -0.666  21.444  -4.358  1.00   14.13 ? 411 TRP A CD1   1 
ATOM   2286  C  CD2   . TRP A  1 304 ? 0.609   20.421  -2.823  1.00   15.32 ? 411 TRP A CD2   1 
ATOM   2287  N  NE1   . TRP A  1 304 ? 0.017   22.417  -3.669  1.00   13.39 ? 411 TRP A NE1   1 
ATOM   2288  C  CE2   . TRP A  1 304 ? 0.808   21.819  -2.723  1.00   16.42 ? 411 TRP A CE2   1 
ATOM   2289  C  CE3   . TRP A  1 304 ? 1.306   19.572  -1.958  1.00   15.49 ? 411 TRP A CE3   1 
ATOM   2290  C  CZ2   . TRP A  1 304 ? 1.681   22.384  -1.784  1.00   16.66 ? 411 TRP A CZ2   1 
ATOM   2291  C  CZ3   . TRP A  1 304 ? 2.174   20.133  -1.022  1.00   16.49 ? 411 TRP A CZ3   1 
ATOM   2292  C  CH2   . TRP A  1 304 ? 2.354   21.527  -0.945  1.00   15.99 ? 411 TRP A CH2   1 
ATOM   2293  N  N     . ALA A  1 305 ? 0.221   15.676  -4.218  1.00   19.80 ? 412 ALA A N     1 
ATOM   2294  C  CA    . ALA A  1 305 ? -0.210  14.289  -4.174  1.00   17.38 ? 412 ALA A CA    1 
ATOM   2295  C  C     . ALA A  1 305 ? -0.170  13.837  -2.732  1.00   19.65 ? 412 ALA A C     1 
ATOM   2296  O  O     . ALA A  1 305 ? 0.645   14.331  -1.944  1.00   23.00 ? 412 ALA A O     1 
ATOM   2297  C  CB    . ALA A  1 305 ? 0.708   13.435  -5.014  1.00   13.16 ? 412 ALA A CB    1 
ATOM   2298  N  N     . THR A  1 306 ? -1.047  12.903  -2.380  1.00   18.08 ? 413 THR A N     1 
ATOM   2299  C  CA    . THR A  1 306 ? -1.084  12.400  -1.015  1.00   19.70 ? 413 THR A CA    1 
ATOM   2300  C  C     . THR A  1 306 ? -0.242  11.132  -0.886  1.00   20.56 ? 413 THR A C     1 
ATOM   2301  O  O     . THR A  1 306 ? -0.478  10.151  -1.590  1.00   21.78 ? 413 THR A O     1 
ATOM   2302  C  CB    . THR A  1 306 ? -2.515  12.089  -0.574  1.00   17.92 ? 413 THR A CB    1 
ATOM   2303  O  OG1   . THR A  1 306 ? -3.340  13.238  -0.787  1.00   19.21 ? 413 THR A OG1   1 
ATOM   2304  C  CG2   . THR A  1 306 ? -2.529  11.727  0.905   1.00   18.17 ? 413 THR A CG2   1 
ATOM   2305  N  N     . ASN A  1 307 ? 0.744   11.150  0.009   1.00   21.23 ? 414 ASN A N     1 
ATOM   2306  C  CA    . ASN A  1 307 ? 1.589   9.974   0.189   1.00   21.81 ? 414 ASN A CA    1 
ATOM   2307  C  C     . ASN A  1 307 ? 0.908   8.887   1.018   1.00   22.47 ? 414 ASN A C     1 
ATOM   2308  O  O     . ASN A  1 307 ? -0.231  9.044   1.458   1.00   22.70 ? 414 ASN A O     1 
ATOM   2309  C  CB    . ASN A  1 307 ? 2.936   10.345  0.825   1.00   18.57 ? 414 ASN A CB    1 
ATOM   2310  C  CG    . ASN A  1 307 ? 2.794   10.924  2.213   1.00   17.24 ? 414 ASN A CG    1 
ATOM   2311  O  OD1   . ASN A  1 307 ? 1.716   10.893  2.813   1.00   17.22 ? 414 ASN A OD1   1 
ATOM   2312  N  ND2   . ASN A  1 307 ? 3.894   11.447  2.739   1.00   15.26 ? 414 ASN A ND2   1 
ATOM   2313  N  N     . GLY A  1 308 ? 1.626   7.790   1.228   1.00   22.67 ? 415 GLY A N     1 
ATOM   2314  C  CA    . GLY A  1 308 ? 1.090   6.670   1.978   1.00   24.22 ? 415 GLY A CA    1 
ATOM   2315  C  C     . GLY A  1 308 ? 0.583   6.944   3.381   1.00   24.06 ? 415 GLY A C     1 
ATOM   2316  O  O     . GLY A  1 308 ? -0.159  6.132   3.920   1.00   25.45 ? 415 GLY A O     1 
ATOM   2317  N  N     . VAL A  1 309 ? 0.972   8.063   3.983   1.00   23.66 ? 416 VAL A N     1 
ATOM   2318  C  CA    . VAL A  1 309 ? 0.516   8.362   5.336   1.00   20.84 ? 416 VAL A CA    1 
ATOM   2319  C  C     . VAL A  1 309 ? -0.466  9.520   5.397   1.00   19.22 ? 416 VAL A C     1 
ATOM   2320  O  O     . VAL A  1 309 ? -0.718  10.077  6.462   1.00   18.32 ? 416 VAL A O     1 
ATOM   2321  C  CB    . VAL A  1 309 ? 1.706   8.636   6.299   1.00   21.28 ? 416 VAL A CB    1 
ATOM   2322  C  CG1   . VAL A  1 309 ? 2.534   7.376   6.457   1.00   20.42 ? 416 VAL A CG1   1 
ATOM   2323  C  CG2   . VAL A  1 309 ? 2.573   9.771   5.771   1.00   22.52 ? 416 VAL A CG2   1 
ATOM   2324  N  N     . GLY A  1 310 ? -1.014  9.888   4.246   1.00   19.93 ? 417 GLY A N     1 
ATOM   2325  C  CA    . GLY A  1 310 ? -2.001  10.956  4.206   1.00   19.24 ? 417 GLY A CA    1 
ATOM   2326  C  C     . GLY A  1 310 ? -1.523  12.393  4.143   1.00   18.91 ? 417 GLY A C     1 
ATOM   2327  O  O     . GLY A  1 310 ? -2.312  13.316  4.319   1.00   19.81 ? 417 GLY A O     1 
ATOM   2328  N  N     . ARG A  1 311 ? -0.240  12.601  3.896   1.00   18.19 ? 418 ARG A N     1 
ATOM   2329  C  CA    . ARG A  1 311 ? 0.266   13.954  3.816   1.00   17.65 ? 418 ARG A CA    1 
ATOM   2330  C  C     . ARG A  1 311 ? 0.420   14.382  2.365   1.00   20.81 ? 418 ARG A C     1 
ATOM   2331  O  O     . ARG A  1 311 ? 0.730   13.562  1.498   1.00   21.86 ? 418 ARG A O     1 
ATOM   2332  C  CB    . ARG A  1 311 ? 1.584   14.062  4.575   1.00   15.84 ? 418 ARG A CB    1 
ATOM   2333  C  CG    . ARG A  1 311 ? 1.373   13.923  6.074   1.00   16.78 ? 418 ARG A CG    1 
ATOM   2334  C  CD    . ARG A  1 311 ? 2.575   14.364  6.891   1.00   19.13 ? 418 ARG A CD    1 
ATOM   2335  N  NE    . ARG A  1 311 ? 3.374   13.218  7.310   1.00   20.73 ? 418 ARG A NE    1 
ATOM   2336  C  CZ    . ARG A  1 311 ? 3.607   12.893  8.577   1.00   17.32 ? 418 ARG A CZ    1 
ATOM   2337  N  NH1   . ARG A  1 311 ? 4.339   11.823  8.862   1.00   15.62 ? 418 ARG A NH1   1 
ATOM   2338  N  NH2   . ARG A  1 311 ? 3.114   13.637  9.558   1.00   17.49 ? 418 ARG A NH2   1 
ATOM   2339  N  N     . LYS A  1 312 ? 0.163   15.661  2.101   1.00   21.27 ? 419 LYS A N     1 
ATOM   2340  C  CA    . LYS A  1 312 ? 0.276   16.216  0.755   1.00   22.41 ? 419 LYS A CA    1 
ATOM   2341  C  C     . LYS A  1 312 ? 1.706   16.654  0.497   1.00   20.68 ? 419 LYS A C     1 
ATOM   2342  O  O     . LYS A  1 312 ? 2.302   17.338  1.321   1.00   21.92 ? 419 LYS A O     1 
ATOM   2343  C  CB    . LYS A  1 312 ? -0.627  17.439  0.601   1.00   25.69 ? 419 LYS A CB    1 
ATOM   2344  C  CG    . LYS A  1 312 ? -2.051  17.233  1.065   1.00   29.78 ? 419 LYS A CG    1 
ATOM   2345  C  CD    . LYS A  1 312 ? -2.881  16.462  0.057   1.00   33.41 ? 419 LYS A CD    1 
ATOM   2346  C  CE    . LYS A  1 312 ? -3.227  17.333  -1.120  1.00   36.86 ? 419 LYS A CE    1 
ATOM   2347  N  NZ    . LYS A  1 312 ? -3.843  18.612  -0.645  1.00   41.31 ? 419 LYS A NZ    1 
ATOM   2348  N  N     . VAL A  1 313 ? 2.256   16.266  -0.644  1.00   19.52 ? 420 VAL A N     1 
ATOM   2349  C  CA    . VAL A  1 313 ? 3.619   16.661  -0.993  1.00   21.76 ? 420 VAL A CA    1 
ATOM   2350  C  C     . VAL A  1 313 ? 3.692   17.125  -2.441  1.00   19.55 ? 420 VAL A C     1 
ATOM   2351  O  O     . VAL A  1 313 ? 2.952   16.653  -3.298  1.00   20.45 ? 420 VAL A O     1 
ATOM   2352  C  CB    . VAL A  1 313 ? 4.649   15.501  -0.786  1.00   20.38 ? 420 VAL A CB    1 
ATOM   2353  C  CG1   . VAL A  1 313 ? 4.779   15.175  0.676   1.00   21.52 ? 420 VAL A CG1   1 
ATOM   2354  C  CG2   . VAL A  1 313 ? 4.219   14.260  -1.549  1.00   24.67 ? 420 VAL A CG2   1 
ATOM   2355  N  N     . SER A  1 314 ? 4.581   18.073  -2.692  1.00   18.67 ? 421 SER A N     1 
ATOM   2356  C  CA    . SER A  1 314 ? 4.800   18.607  -4.031  1.00   18.99 ? 421 SER A CA    1 
ATOM   2357  C  C     . SER A  1 314 ? 6.311   18.715  -4.259  1.00   17.82 ? 421 SER A C     1 
ATOM   2358  O  O     . SER A  1 314 ? 7.060   18.999  -3.326  1.00   20.64 ? 421 SER A O     1 
ATOM   2359  C  CB    . SER A  1 314 ? 4.147   19.986  -4.164  1.00   18.63 ? 421 SER A CB    1 
ATOM   2360  O  OG    . SER A  1 314 ? 4.666   20.689  -5.280  1.00   17.34 ? 421 SER A OG    1 
ATOM   2361  N  N     . HIS A  1 315 ? 6.756   18.480  -5.485  1.00   14.37 ? 422 HIS A N     1 
ATOM   2362  C  CA    . HIS A  1 315 ? 8.173   18.568  -5.793  1.00   16.17 ? 422 HIS A CA    1 
ATOM   2363  C  C     . HIS A  1 315 ? 8.649   20.023  -5.807  1.00   17.40 ? 422 HIS A C     1 
ATOM   2364  O  O     . HIS A  1 315 ? 9.844   20.304  -5.881  1.00   19.25 ? 422 HIS A O     1 
ATOM   2365  C  CB    . HIS A  1 315 ? 8.452   17.903  -7.144  1.00   15.76 ? 422 HIS A CB    1 
ATOM   2366  C  CG    . HIS A  1 315 ? 8.216   16.422  -7.144  1.00   20.44 ? 422 HIS A CG    1 
ATOM   2367  N  ND1   . HIS A  1 315 ? 6.998   15.859  -6.827  1.00   19.58 ? 422 HIS A ND1   1 
ATOM   2368  C  CD2   . HIS A  1 315 ? 9.059   15.387  -7.376  1.00   20.59 ? 422 HIS A CD2   1 
ATOM   2369  C  CE1   . HIS A  1 315 ? 7.103   14.542  -6.859  1.00   22.27 ? 422 HIS A CE1   1 
ATOM   2370  N  NE2   . HIS A  1 315 ? 8.343   14.230  -7.189  1.00   19.37 ? 422 HIS A NE2   1 
ATOM   2371  N  N     . SER A  1 316 ? 7.708   20.950  -5.732  1.00   16.60 ? 423 SER A N     1 
ATOM   2372  C  CA    . SER A  1 316 ? 8.046   22.356  -5.743  1.00   18.51 ? 423 SER A CA    1 
ATOM   2373  C  C     . SER A  1 316 ? 8.077   22.939  -4.350  1.00   19.63 ? 423 SER A C     1 
ATOM   2374  O  O     . SER A  1 316 ? 8.729   23.958  -4.121  1.00   20.29 ? 423 SER A O     1 
ATOM   2375  C  CB    . SER A  1 316 ? 7.026   23.147  -6.566  1.00   19.48 ? 423 SER A CB    1 
ATOM   2376  O  OG    . SER A  1 316 ? 7.380   23.176  -7.931  1.00   21.95 ? 423 SER A OG    1 
ATOM   2377  N  N     . TYR A  1 317 ? 7.382   22.287  -3.421  1.00   20.06 ? 424 TYR A N     1 
ATOM   2378  C  CA    . TYR A  1 317 ? 7.267   22.788  -2.056  1.00   17.56 ? 424 TYR A CA    1 
ATOM   2379  C  C     . TYR A  1 317 ? 7.614   21.820  -0.940  1.00   18.31 ? 424 TYR A C     1 
ATOM   2380  O  O     . TYR A  1 317 ? 7.726   22.228  0.223   1.00   18.60 ? 424 TYR A O     1 
ATOM   2381  C  CB    . TYR A  1 317 ? 5.837   23.260  -1.813  1.00   15.92 ? 424 TYR A CB    1 
ATOM   2382  C  CG    . TYR A  1 317 ? 5.310   24.295  -2.777  1.00   10.57 ? 424 TYR A CG    1 
ATOM   2383  C  CD1   . TYR A  1 317 ? 5.966   25.508  -2.949  1.00   11.49 ? 424 TYR A CD1   1 
ATOM   2384  C  CD2   . TYR A  1 317 ? 4.083   24.111  -3.417  1.00   11.97 ? 424 TYR A CD2   1 
ATOM   2385  C  CE1   . TYR A  1 317 ? 5.409   26.528  -3.719  1.00   13.84 ? 424 TYR A CE1   1 
ATOM   2386  C  CE2   . TYR A  1 317 ? 3.510   25.124  -4.193  1.00   13.95 ? 424 TYR A CE2   1 
ATOM   2387  C  CZ    . TYR A  1 317 ? 4.180   26.332  -4.336  1.00   14.79 ? 424 TYR A CZ    1 
ATOM   2388  O  OH    . TYR A  1 317 ? 3.620   27.354  -5.060  1.00   15.80 ? 424 TYR A OH    1 
ATOM   2389  N  N     . GLY A  1 318 ? 7.774   20.545  -1.275  1.00   16.76 ? 425 GLY A N     1 
ATOM   2390  C  CA    . GLY A  1 318 ? 8.063   19.574  -0.240  1.00   16.82 ? 425 GLY A CA    1 
ATOM   2391  C  C     . GLY A  1 318 ? 6.768   19.373  0.527   1.00   17.27 ? 425 GLY A C     1 
ATOM   2392  O  O     . GLY A  1 318 ? 5.727   19.173  -0.085  1.00   19.67 ? 425 GLY A O     1 
ATOM   2393  N  N     . TYR A  1 319 ? 6.803   19.441  1.851   1.00   16.25 ? 426 TYR A N     1 
ATOM   2394  C  CA    . TYR A  1 319 ? 5.578   19.251  2.621   1.00   17.32 ? 426 TYR A CA    1 
ATOM   2395  C  C     . TYR A  1 319 ? 4.764   20.523  2.795   1.00   17.40 ? 426 TYR A C     1 
ATOM   2396  O  O     . TYR A  1 319 ? 3.732   20.518  3.465   1.00   19.12 ? 426 TYR A O     1 
ATOM   2397  C  CB    . TYR A  1 319 ? 5.894   18.629  3.986   1.00   16.90 ? 426 TYR A CB    1 
ATOM   2398  C  CG    . TYR A  1 319 ? 6.195   17.155  3.866   1.00   18.27 ? 426 TYR A CG    1 
ATOM   2399  C  CD1   . TYR A  1 319 ? 7.452   16.713  3.483   1.00   17.73 ? 426 TYR A CD1   1 
ATOM   2400  C  CD2   . TYR A  1 319 ? 5.191   16.205  4.036   1.00   19.96 ? 426 TYR A CD2   1 
ATOM   2401  C  CE1   . TYR A  1 319 ? 7.706   15.358  3.263   1.00   19.53 ? 426 TYR A CE1   1 
ATOM   2402  C  CE2   . TYR A  1 319 ? 5.428   14.847  3.817   1.00   18.51 ? 426 TYR A CE2   1 
ATOM   2403  C  CZ    . TYR A  1 319 ? 6.687   14.429  3.427   1.00   19.45 ? 426 TYR A CZ    1 
ATOM   2404  O  OH    . TYR A  1 319 ? 6.917   13.089  3.187   1.00   17.57 ? 426 TYR A OH    1 
ATOM   2405  N  N     . GLY A  1 320 ? 5.217   21.607  2.174   1.00   16.99 ? 427 GLY A N     1 
ATOM   2406  C  CA    . GLY A  1 320 ? 4.503   22.866  2.286   1.00   16.48 ? 427 GLY A CA    1 
ATOM   2407  C  C     . GLY A  1 320 ? 5.234   24.000  2.991   1.00   17.26 ? 427 GLY A C     1 
ATOM   2408  O  O     . GLY A  1 320 ? 6.451   23.968  3.188   1.00   19.04 ? 427 GLY A O     1 
ATOM   2409  N  N     . LEU A  1 321 ? 4.462   25.012  3.370   1.00   17.18 ? 428 LEU A N     1 
ATOM   2410  C  CA    . LEU A  1 321 ? 4.962   26.206  4.044   1.00   17.21 ? 428 LEU A CA    1 
ATOM   2411  C  C     . LEU A  1 321 ? 5.274   25.910  5.510   1.00   17.43 ? 428 LEU A C     1 
ATOM   2412  O  O     . LEU A  1 321 ? 4.515   25.203  6.170   1.00   17.48 ? 428 LEU A O     1 
ATOM   2413  C  CB    . LEU A  1 321 ? 3.888   27.286  3.960   1.00   17.81 ? 428 LEU A CB    1 
ATOM   2414  C  CG    . LEU A  1 321 ? 4.248   28.745  3.729   1.00   19.33 ? 428 LEU A CG    1 
ATOM   2415  C  CD1   . LEU A  1 321 ? 5.045   28.872  2.450   1.00   21.55 ? 428 LEU A CD1   1 
ATOM   2416  C  CD2   . LEU A  1 321 ? 2.962   29.560  3.641   1.00   19.44 ? 428 LEU A CD2   1 
ATOM   2417  N  N     . LEU A  1 322 ? 6.388   26.436  6.017   1.00   14.35 ? 429 LEU A N     1 
ATOM   2418  C  CA    . LEU A  1 322 ? 6.739   26.214  7.416   1.00   13.80 ? 429 LEU A CA    1 
ATOM   2419  C  C     . LEU A  1 322 ? 5.761   26.985  8.291   1.00   16.53 ? 429 LEU A C     1 
ATOM   2420  O  O     . LEU A  1 322 ? 5.266   28.052  7.902   1.00   19.25 ? 429 LEU A O     1 
ATOM   2421  C  CB    . LEU A  1 322 ? 8.160   26.696  7.711   1.00   11.99 ? 429 LEU A CB    1 
ATOM   2422  C  CG    . LEU A  1 322 ? 9.351   25.962  7.101   1.00   11.40 ? 429 LEU A CG    1 
ATOM   2423  C  CD1   . LEU A  1 322 ? 10.629  26.664  7.553   1.00   12.78 ? 429 LEU A CD1   1 
ATOM   2424  C  CD2   . LEU A  1 322 ? 9.352   24.491  7.531   1.00   11.49 ? 429 LEU A CD2   1 
ATOM   2425  N  N     . ASP A  1 323 ? 5.489   26.437  9.470   1.00   15.05 ? 430 ASP A N     1 
ATOM   2426  C  CA    . ASP A  1 323 ? 4.577   27.042  10.434  1.00   16.41 ? 430 ASP A CA    1 
ATOM   2427  C  C     . ASP A  1 323 ? 5.346   27.209  11.752  1.00   17.89 ? 430 ASP A C     1 
ATOM   2428  O  O     . ASP A  1 323 ? 5.424   26.272  12.547  1.00   20.26 ? 430 ASP A O     1 
ATOM   2429  C  CB    . ASP A  1 323 ? 3.381   26.113  10.636  1.00   19.12 ? 430 ASP A CB    1 
ATOM   2430  C  CG    . ASP A  1 323 ? 2.254   26.765  11.399  1.00   22.22 ? 430 ASP A CG    1 
ATOM   2431  O  OD1   . ASP A  1 323 ? 2.535   27.503  12.371  1.00   22.39 ? 430 ASP A OD1   1 
ATOM   2432  O  OD2   . ASP A  1 323 ? 1.082   26.525  11.027  1.00   22.05 ? 430 ASP A OD2   1 
ATOM   2433  N  N     . ALA A  1 324 ? 5.921   28.385  11.985  1.00   15.09 ? 431 ALA A N     1 
ATOM   2434  C  CA    . ALA A  1 324 ? 6.687   28.609  13.207  1.00   15.80 ? 431 ALA A CA    1 
ATOM   2435  C  C     . ALA A  1 324 ? 5.894   28.274  14.469  1.00   16.55 ? 431 ALA A C     1 
ATOM   2436  O  O     . ALA A  1 324 ? 6.395   27.593  15.366  1.00   17.92 ? 431 ALA A O     1 
ATOM   2437  C  CB    . ALA A  1 324 ? 7.168   30.045  13.264  1.00   18.46 ? 431 ALA A CB    1 
ATOM   2438  N  N     . GLY A  1 325 ? 4.660   28.760  14.542  1.00   15.83 ? 432 GLY A N     1 
ATOM   2439  C  CA    . GLY A  1 325 ? 3.829   28.483  15.698  1.00   14.86 ? 432 GLY A CA    1 
ATOM   2440  C  C     . GLY A  1 325 ? 3.685   26.988  15.932  1.00   15.06 ? 432 GLY A C     1 
ATOM   2441  O  O     . GLY A  1 325 ? 3.871   26.495  17.052  1.00   15.21 ? 432 GLY A O     1 
ATOM   2442  N  N     . ALA A  1 326 ? 3.361   26.260  14.869  1.00   13.01 ? 433 ALA A N     1 
ATOM   2443  C  CA    . ALA A  1 326 ? 3.192   24.814  14.962  1.00   15.59 ? 433 ALA A CA    1 
ATOM   2444  C  C     . ALA A  1 326 ? 4.506   24.117  15.341  1.00   17.56 ? 433 ALA A C     1 
ATOM   2445  O  O     . ALA A  1 326 ? 4.507   23.159  16.112  1.00   18.95 ? 433 ALA A O     1 
ATOM   2446  C  CB    . ALA A  1 326 ? 2.661   24.273  13.645  1.00   10.76 ? 433 ALA A CB    1 
ATOM   2447  N  N     . MET A  1 327 ? 5.618   24.613  14.803  1.00   18.88 ? 434 MET A N     1 
ATOM   2448  C  CA    . MET A  1 327 ? 6.938   24.054  15.085  1.00   17.50 ? 434 MET A CA    1 
ATOM   2449  C  C     . MET A  1 327 ? 7.293   24.122  16.571  1.00   17.46 ? 434 MET A C     1 
ATOM   2450  O  O     . MET A  1 327 ? 7.619   23.098  17.182  1.00   16.72 ? 434 MET A O     1 
ATOM   2451  C  CB    . MET A  1 327 ? 8.025   24.800  14.295  1.00   19.40 ? 434 MET A CB    1 
ATOM   2452  C  CG    . MET A  1 327 ? 8.122   24.481  12.811  1.00   17.88 ? 434 MET A CG    1 
ATOM   2453  S  SD    . MET A  1 327 ? 8.852   22.877  12.446  1.00   16.87 ? 434 MET A SD    1 
ATOM   2454  C  CE    . MET A  1 327 ? 10.582  23.200  12.671  1.00   16.62 ? 434 MET A CE    1 
ATOM   2455  N  N     . VAL A  1 328 ? 7.239   25.321  17.151  1.00   13.88 ? 435 VAL A N     1 
ATOM   2456  C  CA    . VAL A  1 328 ? 7.589   25.479  18.560  1.00   14.12 ? 435 VAL A CA    1 
ATOM   2457  C  C     . VAL A  1 328 ? 6.602   24.740  19.452  1.00   15.63 ? 435 VAL A C     1 
ATOM   2458  O  O     . VAL A  1 328 ? 6.967   24.254  20.521  1.00   15.76 ? 435 VAL A O     1 
ATOM   2459  C  CB    . VAL A  1 328 ? 7.650   26.982  18.978  1.00   14.76 ? 435 VAL A CB    1 
ATOM   2460  C  CG1   . VAL A  1 328 ? 8.726   27.712  18.177  1.00   7.33  ? 435 VAL A CG1   1 
ATOM   2461  C  CG2   . VAL A  1 328 ? 6.296   27.653  18.761  1.00   13.51 ? 435 VAL A CG2   1 
ATOM   2462  N  N     . ALA A  1 329 ? 5.354   24.648  19.005  1.00   17.05 ? 436 ALA A N     1 
ATOM   2463  C  CA    . ALA A  1 329 ? 4.328   23.950  19.771  1.00   19.72 ? 436 ALA A CA    1 
ATOM   2464  C  C     . ALA A  1 329 ? 4.638   22.458  19.870  1.00   21.99 ? 436 ALA A C     1 
ATOM   2465  O  O     . ALA A  1 329 ? 4.705   21.901  20.963  1.00   24.93 ? 436 ALA A O     1 
ATOM   2466  C  CB    . ALA A  1 329 ? 2.974   24.144  19.122  1.00   18.60 ? 436 ALA A CB    1 
ATOM   2467  N  N     . LEU A  1 330 ? 4.824   21.815  18.722  1.00   22.17 ? 437 LEU A N     1 
ATOM   2468  C  CA    . LEU A  1 330 ? 5.110   20.391  18.693  1.00   22.60 ? 437 LEU A CA    1 
ATOM   2469  C  C     . LEU A  1 330 ? 6.457   20.076  19.332  1.00   23.20 ? 437 LEU A C     1 
ATOM   2470  O  O     . LEU A  1 330 ? 6.627   19.030  19.964  1.00   22.47 ? 437 LEU A O     1 
ATOM   2471  C  CB    . LEU A  1 330 ? 5.094   19.881  17.250  1.00   23.60 ? 437 LEU A CB    1 
ATOM   2472  C  CG    . LEU A  1 330 ? 5.141   18.356  17.125  1.00   22.94 ? 437 LEU A CG    1 
ATOM   2473  C  CD1   . LEU A  1 330 ? 3.915   17.780  17.799  1.00   18.32 ? 437 LEU A CD1   1 
ATOM   2474  C  CD2   . LEU A  1 330 ? 5.194   17.940  15.669  1.00   22.76 ? 437 LEU A CD2   1 
ATOM   2475  N  N     . ALA A  1 331 ? 7.409   20.988  19.178  1.00   23.23 ? 438 ALA A N     1 
ATOM   2476  C  CA    . ALA A  1 331 ? 8.747   20.790  19.722  1.00   24.91 ? 438 ALA A CA    1 
ATOM   2477  C  C     . ALA A  1 331 ? 8.765   20.506  21.216  1.00   25.52 ? 438 ALA A C     1 
ATOM   2478  O  O     . ALA A  1 331 ? 9.515   19.655  21.684  1.00   23.44 ? 438 ALA A O     1 
ATOM   2479  C  CB    . ALA A  1 331 ? 9.606   22.003  19.426  1.00   22.03 ? 438 ALA A CB    1 
ATOM   2480  N  N     . GLN A  1 332 ? 7.929   21.219  21.958  1.00   29.12 ? 439 GLN A N     1 
ATOM   2481  C  CA    . GLN A  1 332 ? 7.867   21.081  23.404  1.00   30.93 ? 439 GLN A CA    1 
ATOM   2482  C  C     . GLN A  1 332 ? 7.516   19.705  23.942  1.00   33.95 ? 439 GLN A C     1 
ATOM   2483  O  O     . GLN A  1 332 ? 8.111   19.255  24.920  1.00   36.66 ? 439 GLN A O     1 
ATOM   2484  C  CB    . GLN A  1 332 ? 6.903   22.110  23.964  1.00   30.65 ? 439 GLN A CB    1 
ATOM   2485  C  CG    . GLN A  1 332 ? 7.371   23.520  23.704  1.00   32.97 ? 439 GLN A CG    1 
ATOM   2486  C  CD    . GLN A  1 332 ? 6.402   24.553  24.205  1.00   36.08 ? 439 GLN A CD    1 
ATOM   2487  O  OE1   . GLN A  1 332 ? 6.108   24.619  25.406  1.00   38.28 ? 439 GLN A OE1   1 
ATOM   2488  N  NE2   . GLN A  1 332 ? 5.888   25.374  23.287  1.00   37.19 ? 439 GLN A NE2   1 
ATOM   2489  N  N     . ASN A  1 333 ? 6.558   19.031  23.317  1.00   34.75 ? 440 ASN A N     1 
ATOM   2490  C  CA    . ASN A  1 333 ? 6.178   17.702  23.783  1.00   36.34 ? 440 ASN A CA    1 
ATOM   2491  C  C     . ASN A  1 333 ? 6.845   16.582  22.982  1.00   35.00 ? 440 ASN A C     1 
ATOM   2492  O  O     . ASN A  1 333 ? 6.537   15.407  23.175  1.00   40.00 ? 440 ASN A O     1 
ATOM   2493  C  CB    . ASN A  1 333 ? 4.658   17.532  23.717  1.00   37.64 ? 440 ASN A CB    1 
ATOM   2494  C  CG    . ASN A  1 333 ? 3.927   18.357  24.760  1.00   40.31 ? 440 ASN A CG    1 
ATOM   2495  O  OD1   . ASN A  1 333 ? 2.702   18.324  24.840  0.0000 39.05 ? 440 ASN A OD1   1 
ATOM   2496  N  ND2   . ASN A  1 333 ? 4.679   19.100  25.567  0.0000 39.05 ? 440 ASN A ND2   1 
ATOM   2497  N  N     . TRP A  1 334 ? 7.775   16.937  22.103  1.00   31.08 ? 441 TRP A N     1 
ATOM   2498  C  CA    . TRP A  1 334 ? 8.440   15.945  21.266  1.00   23.81 ? 441 TRP A CA    1 
ATOM   2499  C  C     . TRP A  1 334 ? 9.371   14.965  21.960  1.00   22.86 ? 441 TRP A C     1 
ATOM   2500  O  O     . TRP A  1 334 ? 10.246  15.349  22.738  1.00   24.64 ? 441 TRP A O     1 
ATOM   2501  C  CB    . TRP A  1 334 ? 9.193   16.650  20.149  1.00   22.05 ? 441 TRP A CB    1 
ATOM   2502  C  CG    . TRP A  1 334 ? 9.750   15.732  19.104  1.00   20.83 ? 441 TRP A CG    1 
ATOM   2503  C  CD1   . TRP A  1 334 ? 11.044  15.300  18.997  1.00   21.32 ? 441 TRP A CD1   1 
ATOM   2504  C  CD2   . TRP A  1 334 ? 9.040   15.144  18.004  1.00   18.59 ? 441 TRP A CD2   1 
ATOM   2505  N  NE1   . TRP A  1 334 ? 11.180  14.482  17.898  1.00   21.27 ? 441 TRP A NE1   1 
ATOM   2506  C  CE2   . TRP A  1 334 ? 9.966   14.370  17.273  1.00   18.47 ? 441 TRP A CE2   1 
ATOM   2507  C  CE3   . TRP A  1 334 ? 7.710   15.198  17.565  1.00   17.46 ? 441 TRP A CE3   1 
ATOM   2508  C  CZ2   . TRP A  1 334 ? 9.603   13.650  16.124  1.00   18.28 ? 441 TRP A CZ2   1 
ATOM   2509  C  CZ3   . TRP A  1 334 ? 7.349   14.475  16.414  1.00   15.64 ? 441 TRP A CZ3   1 
ATOM   2510  C  CH2   . TRP A  1 334 ? 8.294   13.716  15.713  1.00   15.23 ? 441 TRP A CH2   1 
ATOM   2511  N  N     . THR A  1 335 ? 9.168   13.688  21.653  1.00   21.76 ? 442 THR A N     1 
ATOM   2512  C  CA    . THR A  1 335 ? 9.980   12.600  22.190  1.00   23.12 ? 442 THR A CA    1 
ATOM   2513  C  C     . THR A  1 335 ? 11.036  12.221  21.150  1.00   21.22 ? 442 THR A C     1 
ATOM   2514  O  O     . THR A  1 335 ? 10.698  11.829  20.037  1.00   21.63 ? 442 THR A O     1 
ATOM   2515  C  CB    . THR A  1 335 ? 9.093   11.368  22.527  1.00   23.31 ? 442 THR A CB    1 
ATOM   2516  O  OG1   . THR A  1 335 ? 8.353   11.634  23.727  1.00   22.76 ? 442 THR A OG1   1 
ATOM   2517  C  CG2   . THR A  1 335 ? 9.938   10.127  22.743  1.00   22.28 ? 442 THR A CG2   1 
ATOM   2518  N  N     . THR A  1 336 ? 12.311  12.345  21.510  1.00   19.94 ? 443 THR A N     1 
ATOM   2519  C  CA    . THR A  1 336 ? 13.394  12.027  20.580  1.00   21.19 ? 443 THR A CA    1 
ATOM   2520  C  C     . THR A  1 336 ? 13.183  10.707  19.854  1.00   21.02 ? 443 THR A C     1 
ATOM   2521  O  O     . THR A  1 336 ? 12.892  9.685   20.477  1.00   19.52 ? 443 THR A O     1 
ATOM   2522  C  CB    . THR A  1 336 ? 14.765  12.002  21.288  1.00   20.75 ? 443 THR A CB    1 
ATOM   2523  O  OG1   . THR A  1 336 ? 15.235  13.348  21.445  1.00   26.91 ? 443 THR A OG1   1 
ATOM   2524  C  CG2   . THR A  1 336 ? 15.786  11.236  20.453  1.00   18.93 ? 443 THR A CG2   1 
ATOM   2525  N  N     . VAL A  1 337 ? 13.338  10.731  18.533  1.00   18.71 ? 444 VAL A N     1 
ATOM   2526  C  CA    . VAL A  1 337 ? 13.142  9.524   17.739  1.00   19.08 ? 444 VAL A CA    1 
ATOM   2527  C  C     . VAL A  1 337 ? 14.197  8.468   18.037  1.00   20.18 ? 444 VAL A C     1 
ATOM   2528  O  O     . VAL A  1 337 ? 15.263  8.775   18.575  1.00   21.79 ? 444 VAL A O     1 
ATOM   2529  C  CB    . VAL A  1 337 ? 13.147  9.833   16.216  1.00   18.21 ? 444 VAL A CB    1 
ATOM   2530  C  CG1   . VAL A  1 337 ? 12.013  10.779  15.877  1.00   14.82 ? 444 VAL A CG1   1 
ATOM   2531  C  CG2   . VAL A  1 337 ? 14.478  10.436  15.799  1.00   20.42 ? 444 VAL A CG2   1 
ATOM   2532  N  N     . ALA A  1 338 ? 13.883  7.221   17.690  1.00   19.85 ? 445 ALA A N     1 
ATOM   2533  C  CA    . ALA A  1 338 ? 14.788  6.096   17.912  1.00   18.06 ? 445 ALA A CA    1 
ATOM   2534  C  C     . ALA A  1 338 ? 16.027  6.216   17.044  1.00   18.01 ? 445 ALA A C     1 
ATOM   2535  O  O     . ALA A  1 338 ? 16.045  6.966   16.074  1.00   18.56 ? 445 ALA A O     1 
ATOM   2536  C  CB    . ALA A  1 338 ? 14.078  4.793   17.605  1.00   14.09 ? 445 ALA A CB    1 
ATOM   2537  N  N     . PRO A  1 339 ? 17.089  5.478   17.392  1.00   19.96 ? 446 PRO A N     1 
ATOM   2538  C  CA    . PRO A  1 339 ? 18.336  5.513   16.620  1.00   20.14 ? 446 PRO A CA    1 
ATOM   2539  C  C     . PRO A  1 339 ? 18.086  5.251   15.140  1.00   20.33 ? 446 PRO A C     1 
ATOM   2540  O  O     . PRO A  1 339 ? 17.251  4.423   14.774  1.00   21.35 ? 446 PRO A O     1 
ATOM   2541  C  CB    . PRO A  1 339 ? 19.169  4.425   17.279  1.00   18.21 ? 446 PRO A CB    1 
ATOM   2542  C  CG    . PRO A  1 339 ? 18.768  4.568   18.722  1.00   19.16 ? 446 PRO A CG    1 
ATOM   2543  C  CD    . PRO A  1 339 ? 17.259  4.688   18.625  1.00   19.50 ? 446 PRO A CD    1 
ATOM   2544  N  N     . GLN A  1 340 ? 18.809  5.967   14.291  1.00   20.06 ? 447 GLN A N     1 
ATOM   2545  C  CA    . GLN A  1 340 ? 18.655  5.830   12.850  1.00   19.60 ? 447 GLN A CA    1 
ATOM   2546  C  C     . GLN A  1 340 ? 19.158  4.493   12.301  1.00   20.59 ? 447 GLN A C     1 
ATOM   2547  O  O     . GLN A  1 340 ? 20.305  4.107   12.532  1.00   20.20 ? 447 GLN A O     1 
ATOM   2548  C  CB    . GLN A  1 340 ? 19.402  6.964   12.151  1.00   17.39 ? 447 GLN A CB    1 
ATOM   2549  C  CG    . GLN A  1 340 ? 19.252  6.960   10.644  1.00   21.39 ? 447 GLN A CG    1 
ATOM   2550  C  CD    . GLN A  1 340 ? 20.415  7.631   9.924   1.00   24.66 ? 447 GLN A CD    1 
ATOM   2551  O  OE1   . GLN A  1 340 ? 21.562  7.170   9.998   1.00   24.59 ? 447 GLN A OE1   1 
ATOM   2552  N  NE2   . GLN A  1 340 ? 20.125  8.717   9.215   1.00   23.82 ? 447 GLN A NE2   1 
ATOM   2553  N  N     . ARG A  1 341 ? 18.298  3.792   11.570  1.00   19.04 ? 448 ARG A N     1 
ATOM   2554  C  CA    . ARG A  1 341 ? 18.683  2.526   10.965  1.00   19.06 ? 448 ARG A CA    1 
ATOM   2555  C  C     . ARG A  1 341 ? 18.865  2.765   9.475   1.00   18.46 ? 448 ARG A C     1 
ATOM   2556  O  O     . ARG A  1 341 ? 18.242  3.657   8.902   1.00   18.91 ? 448 ARG A O     1 
ATOM   2557  C  CB    . ARG A  1 341 ? 17.602  1.470   11.179  1.00   21.79 ? 448 ARG A CB    1 
ATOM   2558  C  CG    . ARG A  1 341 ? 17.287  1.196   12.625  1.00   24.19 ? 448 ARG A CG    1 
ATOM   2559  C  CD    . ARG A  1 341 ? 16.222  0.134   12.743  1.00   28.15 ? 448 ARG A CD    1 
ATOM   2560  N  NE    . ARG A  1 341 ? 16.024  -0.235  14.137  1.00   32.28 ? 448 ARG A NE    1 
ATOM   2561  C  CZ    . ARG A  1 341 ? 15.496  -1.384  14.534  1.00   33.06 ? 448 ARG A CZ    1 
ATOM   2562  N  NH1   . ARG A  1 341 ? 15.366  -1.633  15.829  1.00   34.35 ? 448 ARG A NH1   1 
ATOM   2563  N  NH2   . ARG A  1 341 ? 15.101  -2.281  13.639  1.00   34.98 ? 448 ARG A NH2   1 
ATOM   2564  N  N     . LYS A  1 342 ? 19.711  1.956   8.850   1.00   19.60 ? 449 LYS A N     1 
ATOM   2565  C  CA    . LYS A  1 342 ? 19.993  2.074   7.423   1.00   16.49 ? 449 LYS A CA    1 
ATOM   2566  C  C     . LYS A  1 342 ? 19.898  0.696   6.782   1.00   16.72 ? 449 LYS A C     1 
ATOM   2567  O  O     . LYS A  1 342 ? 20.567  -0.245  7.209   1.00   17.94 ? 449 LYS A O     1 
ATOM   2568  C  CB    . LYS A  1 342 ? 21.399  2.649   7.222   1.00   12.57 ? 449 LYS A CB    1 
ATOM   2569  C  CG    . LYS A  1 342 ? 21.766  2.944   5.783   1.00   11.68 ? 449 LYS A CG    1 
ATOM   2570  C  CD    . LYS A  1 342 ? 23.164  3.525   5.696   1.00   12.94 ? 449 LYS A CD    1 
ATOM   2571  C  CE    . LYS A  1 342 ? 23.559  3.886   4.270   1.00   10.15 ? 449 LYS A CE    1 
ATOM   2572  N  NZ    . LYS A  1 342 ? 24.926  4.479   4.239   1.00   12.15 ? 449 LYS A NZ    1 
ATOM   2573  N  N     . CYS A  1 343 ? 19.054  0.567   5.768   1.00   15.95 ? 450 CYS A N     1 
ATOM   2574  C  CA    . CYS A  1 343 ? 18.897  -0.714  5.099   1.00   17.79 ? 450 CYS A CA    1 
ATOM   2575  C  C     . CYS A  1 343 ? 19.283  -0.596  3.630   1.00   17.84 ? 450 CYS A C     1 
ATOM   2576  O  O     . CYS A  1 343 ? 18.642  0.124   2.868   1.00   17.74 ? 450 CYS A O     1 
ATOM   2577  C  CB    . CYS A  1 343 ? 17.450  -1.205  5.245   1.00   18.28 ? 450 CYS A CB    1 
ATOM   2578  S  SG    . CYS A  1 343 ? 17.114  -2.812  4.448   1.00   22.91 ? 450 CYS A SG    1 
ATOM   2579  N  N     . ILE A  1 344 ? 20.340  -1.306  3.241   1.00   17.56 ? 451 ILE A N     1 
ATOM   2580  C  CA    . ILE A  1 344 ? 20.822  -1.274  1.865   1.00   18.44 ? 451 ILE A CA    1 
ATOM   2581  C  C     . ILE A  1 344 ? 20.305  -2.458  1.051   1.00   19.88 ? 451 ILE A C     1 
ATOM   2582  O  O     . ILE A  1 344 ? 20.432  -3.601  1.468   1.00   20.18 ? 451 ILE A O     1 
ATOM   2583  C  CB    . ILE A  1 344 ? 22.354  -1.294  1.826   1.00   15.68 ? 451 ILE A CB    1 
ATOM   2584  C  CG1   . ILE A  1 344 ? 22.907  -0.153  2.669   1.00   11.63 ? 451 ILE A CG1   1 
ATOM   2585  C  CG2   . ILE A  1 344 ? 22.844  -1.154  0.394   1.00   13.71 ? 451 ILE A CG2   1 
ATOM   2586  C  CD1   . ILE A  1 344 ? 24.410  -0.145  2.738   1.00   12.63 ? 451 ILE A CD1   1 
ATOM   2587  N  N     . ILE A  1 345 ? 19.738  -2.174  -0.118  1.00   21.88 ? 452 ILE A N     1 
ATOM   2588  C  CA    . ILE A  1 345 ? 19.196  -3.217  -0.985  1.00   23.57 ? 452 ILE A CA    1 
ATOM   2589  C  C     . ILE A  1 345 ? 19.637  -3.038  -2.434  1.00   25.13 ? 452 ILE A C     1 
ATOM   2590  O  O     . ILE A  1 345 ? 19.127  -2.164  -3.129  1.00   25.11 ? 452 ILE A O     1 
ATOM   2591  C  CB    . ILE A  1 345 ? 17.657  -3.203  -0.981  1.00   22.92 ? 452 ILE A CB    1 
ATOM   2592  C  CG1   . ILE A  1 345 ? 17.127  -3.232  0.451   1.00   21.32 ? 452 ILE A CG1   1 
ATOM   2593  C  CG2   . ILE A  1 345 ? 17.137  -4.379  -1.768  1.00   17.56 ? 452 ILE A CG2   1 
ATOM   2594  C  CD1   . ILE A  1 345 ? 15.746  -2.630  0.585   1.00   20.80 ? 452 ILE A CD1   1 
ATOM   2595  N  N     . ASP A  1 346 ? 20.581  -3.860  -2.885  1.00   27.16 ? 453 ASP A N     1 
ATOM   2596  C  CA    . ASP A  1 346 ? 21.043  -3.788  -4.267  1.00   31.71 ? 453 ASP A CA    1 
ATOM   2597  C  C     . ASP A  1 346 ? 19.977  -4.519  -5.095  1.00   32.74 ? 453 ASP A C     1 
ATOM   2598  O  O     . ASP A  1 346 ? 19.693  -5.688  -4.839  1.00   35.10 ? 453 ASP A O     1 
ATOM   2599  C  CB    . ASP A  1 346 ? 22.403  -4.476  -4.399  1.00   30.63 ? 453 ASP A CB    1 
ATOM   2600  C  CG    . ASP A  1 346 ? 23.423  -3.620  -5.133  1.00   34.08 ? 453 ASP A CG    1 
ATOM   2601  O  OD1   . ASP A  1 346 ? 23.060  -2.502  -5.563  1.00   33.37 ? 453 ASP A OD1   1 
ATOM   2602  O  OD2   . ASP A  1 346 ? 24.587  -4.065  -5.282  1.00   34.45 ? 453 ASP A OD2   1 
ATOM   2603  N  N     . ILE A  1 347 ? 19.387  -3.840  -6.077  1.00   32.60 ? 454 ILE A N     1 
ATOM   2604  C  CA    . ILE A  1 347 ? 18.321  -4.445  -6.869  1.00   32.97 ? 454 ILE A CA    1 
ATOM   2605  C  C     . ILE A  1 347 ? 18.690  -5.260  -8.110  1.00   33.24 ? 454 ILE A C     1 
ATOM   2606  O  O     . ILE A  1 347 ? 18.179  -6.361  -8.292  1.00   34.14 ? 454 ILE A O     1 
ATOM   2607  C  CB    . ILE A  1 347 ? 17.300  -3.383  -7.315  1.00   33.86 ? 454 ILE A CB    1 
ATOM   2608  C  CG1   . ILE A  1 347 ? 16.885  -2.500  -6.130  1.00   33.33 ? 454 ILE A CG1   1 
ATOM   2609  C  CG2   . ILE A  1 347 ? 16.084  -4.076  -7.892  1.00   32.77 ? 454 ILE A CG2   1 
ATOM   2610  C  CD1   . ILE A  1 347 ? 16.071  -3.210  -5.077  1.00   34.14 ? 454 ILE A CD1   1 
ATOM   2611  N  N     . LEU A  1 348 ? 19.566  -4.731  -8.960  1.00   33.06 ? 455 LEU A N     1 
ATOM   2612  C  CA    . LEU A  1 348 ? 19.924  -5.422  -10.197 1.00   32.04 ? 455 LEU A CA    1 
ATOM   2613  C  C     . LEU A  1 348 ? 20.772  -6.686  -10.117 1.00   33.21 ? 455 LEU A C     1 
ATOM   2614  O  O     . LEU A  1 348 ? 21.759  -6.742  -9.390  1.00   33.94 ? 455 LEU A O     1 
ATOM   2615  C  CB    . LEU A  1 348 ? 20.618  -4.454  -11.141 1.00   28.29 ? 455 LEU A CB    1 
ATOM   2616  C  CG    . LEU A  1 348 ? 19.892  -3.159  -11.444 1.00   25.87 ? 455 LEU A CG    1 
ATOM   2617  C  CD1   . LEU A  1 348 ? 20.633  -2.479  -12.578 1.00   25.31 ? 455 LEU A CD1   1 
ATOM   2618  C  CD2   . LEU A  1 348 ? 18.451  -3.432  -11.838 1.00   25.31 ? 455 LEU A CD2   1 
ATOM   2619  N  N     . THR A  1 349 ? 20.385  -7.695  -10.898 1.00   35.81 ? 456 THR A N     1 
ATOM   2620  C  CA    . THR A  1 349 ? 21.133  -8.952  -10.963 1.00   35.44 ? 456 THR A CA    1 
ATOM   2621  C  C     . THR A  1 349 ? 21.810  -8.992  -12.328 1.00   34.53 ? 456 THR A C     1 
ATOM   2622  O  O     . THR A  1 349 ? 22.529  -9.931  -12.641 1.00   35.24 ? 456 THR A O     1 
ATOM   2623  C  CB    . THR A  1 349 ? 20.224  -10.208 -10.831 1.00   34.76 ? 456 THR A CB    1 
ATOM   2624  O  OG1   . THR A  1 349 ? 19.280  -10.244 -11.908 1.00   37.19 ? 456 THR A OG1   1 
ATOM   2625  C  CG2   . THR A  1 349 ? 19.485  -10.196 -9.492  1.00   31.31 ? 456 THR A CG2   1 
ATOM   2626  N  N     . GLU A  1 350 ? 21.576  -7.955  -13.129 1.00   35.36 ? 457 GLU A N     1 
ATOM   2627  C  CA    . GLU A  1 350 ? 22.148  -7.849  -14.469 1.00   36.27 ? 457 GLU A CA    1 
ATOM   2628  C  C     . GLU A  1 350 ? 21.847  -6.467  -15.050 1.00   34.96 ? 457 GLU A C     1 
ATOM   2629  O  O     . GLU A  1 350 ? 20.848  -5.840  -14.695 1.00   35.64 ? 457 GLU A O     1 
ATOM   2630  C  CB    . GLU A  1 350 ? 21.549  -8.915  -15.396 1.00   39.53 ? 457 GLU A CB    1 
ATOM   2631  C  CG    . GLU A  1 350 ? 20.026  -8.978  -15.345 1.00   47.06 ? 457 GLU A CG    1 
ATOM   2632  C  CD    . GLU A  1 350 ? 19.411  -9.464  -16.654 1.00   51.18 ? 457 GLU A CD    1 
ATOM   2633  O  OE1   . GLU A  1 350 ? 19.870  -10.504 -17.180 1.00   53.62 ? 457 GLU A OE1   1 
ATOM   2634  O  OE2   . GLU A  1 350 ? 18.465  -8.803  -17.151 1.00   51.68 ? 457 GLU A OE2   1 
ATOM   2635  N  N     . PRO A  1 351 ? 22.707  -5.975  -15.954 1.00   33.91 ? 458 PRO A N     1 
ATOM   2636  C  CA    . PRO A  1 351 ? 22.480  -4.657  -16.560 1.00   34.71 ? 458 PRO A CA    1 
ATOM   2637  C  C     . PRO A  1 351 ? 21.115  -4.651  -17.241 1.00   35.76 ? 458 PRO A C     1 
ATOM   2638  O  O     . PRO A  1 351 ? 20.591  -5.705  -17.590 1.00   38.83 ? 458 PRO A O     1 
ATOM   2639  C  CB    . PRO A  1 351 ? 23.615  -4.536  -17.574 1.00   34.82 ? 458 PRO A CB    1 
ATOM   2640  C  CG    . PRO A  1 351 ? 24.698  -5.393  -16.995 1.00   35.34 ? 458 PRO A CG    1 
ATOM   2641  C  CD    . PRO A  1 351 ? 23.937  -6.594  -16.474 1.00   33.09 ? 458 PRO A CD    1 
ATOM   2642  N  N     . LYS A  1 352 ? 20.538  -3.471  -17.427 1.00   36.33 ? 459 LYS A N     1 
ATOM   2643  C  CA    . LYS A  1 352 ? 19.235  -3.351  -18.073 1.00   35.07 ? 459 LYS A CA    1 
ATOM   2644  C  C     . LYS A  1 352 ? 19.317  -2.303  -19.165 1.00   35.80 ? 459 LYS A C     1 
ATOM   2645  O  O     . LYS A  1 352 ? 19.881  -1.236  -18.961 1.00   38.48 ? 459 LYS A O     1 
ATOM   2646  C  CB    . LYS A  1 352 ? 18.174  -2.926  -17.060 1.00   35.52 ? 459 LYS A CB    1 
ATOM   2647  C  CG    . LYS A  1 352 ? 17.248  -4.038  -16.590 1.00   36.98 ? 459 LYS A CG    1 
ATOM   2648  C  CD    . LYS A  1 352 ? 18.013  -5.174  -15.941 1.00   39.49 ? 459 LYS A CD    1 
ATOM   2649  C  CE    . LYS A  1 352 ? 17.099  -6.355  -15.658 1.00   39.05 ? 459 LYS A CE    1 
ATOM   2650  N  NZ    . LYS A  1 352 ? 16.037  -5.983  -14.697 1.00   41.85 ? 459 LYS A NZ    1 
ATOM   2651  N  N     . ASP A  1 353 ? 18.758  -2.603  -20.327 1.00   37.30 ? 460 ASP A N     1 
ATOM   2652  C  CA    . ASP A  1 353 ? 18.779  -1.658  -21.431 1.00   36.23 ? 460 ASP A CA    1 
ATOM   2653  C  C     . ASP A  1 353 ? 17.681  -0.628  -21.178 1.00   34.25 ? 460 ASP A C     1 
ATOM   2654  O  O     . ASP A  1 353 ? 16.569  -0.981  -20.797 1.00   36.09 ? 460 ASP A O     1 
ATOM   2655  C  CB    . ASP A  1 353 ? 18.529  -2.397  -22.741 1.00   37.01 ? 460 ASP A CB    1 
ATOM   2656  C  CG    . ASP A  1 353 ? 18.886  -1.569  -23.944 1.00   41.97 ? 460 ASP A CG    1 
ATOM   2657  O  OD1   . ASP A  1 353 ? 20.087  -1.245  -24.102 1.00   42.01 ? 460 ASP A OD1   1 
ATOM   2658  O  OD2   . ASP A  1 353 ? 17.961  -1.238  -24.723 1.00   44.29 ? 460 ASP A OD2   1 
ATOM   2659  N  N     . ILE A  1 354 ? 17.988  0.645   -21.377 1.00   32.27 ? 461 ILE A N     1 
ATOM   2660  C  CA    . ILE A  1 354 ? 16.999  1.682   -21.136 1.00   31.40 ? 461 ILE A CA    1 
ATOM   2661  C  C     . ILE A  1 354 ? 16.030  1.868   -22.304 1.00   32.26 ? 461 ILE A C     1 
ATOM   2662  O  O     . ILE A  1 354 ? 14.809  1.819   -22.123 1.00   30.53 ? 461 ILE A O     1 
ATOM   2663  C  CB    . ILE A  1 354 ? 17.696  3.021   -20.781 1.00   29.63 ? 461 ILE A CB    1 
ATOM   2664  C  CG1   . ILE A  1 354 ? 18.439  2.859   -19.448 1.00   28.27 ? 461 ILE A CG1   1 
ATOM   2665  C  CG2   . ILE A  1 354 ? 16.677  4.147   -20.661 1.00   27.54 ? 461 ILE A CG2   1 
ATOM   2666  C  CD1   . ILE A  1 354 ? 19.299  4.044   -19.053 1.00   25.50 ? 461 ILE A CD1   1 
ATOM   2667  N  N     . GLY A  1 355 ? 16.563  2.066   -23.503 1.00   32.39 ? 462 GLY A N     1 
ATOM   2668  C  CA    . GLY A  1 355 ? 15.687  2.246   -24.644 1.00   36.25 ? 462 GLY A CA    1 
ATOM   2669  C  C     . GLY A  1 355 ? 14.708  3.401   -24.477 1.00   38.41 ? 462 GLY A C     1 
ATOM   2670  O  O     . GLY A  1 355 ? 15.085  4.481   -24.000 1.00   39.51 ? 462 GLY A O     1 
ATOM   2671  N  N     . LYS A  1 356 ? 13.454  3.179   -24.867 1.00   38.07 ? 463 LYS A N     1 
ATOM   2672  C  CA    . LYS A  1 356 ? 12.435  4.219   -24.778 1.00   39.52 ? 463 LYS A CA    1 
ATOM   2673  C  C     . LYS A  1 356 ? 11.918  4.311   -23.355 1.00   38.88 ? 463 LYS A C     1 
ATOM   2674  O  O     . LYS A  1 356 ? 11.587  5.397   -22.871 1.00   39.24 ? 463 LYS A O     1 
ATOM   2675  C  CB    . LYS A  1 356 ? 11.267  3.919   -25.724 1.00   40.54 ? 463 LYS A CB    1 
ATOM   2676  C  CG    . LYS A  1 356 ? 10.883  5.080   -26.649 1.00   44.66 ? 463 LYS A CG    1 
ATOM   2677  C  CD    . LYS A  1 356 ? 10.422  6.331   -25.876 1.00   47.22 ? 463 LYS A CD    1 
ATOM   2678  C  CE    . LYS A  1 356 ? 10.225  7.514   -26.830 1.00   48.52 ? 463 LYS A CE    1 
ATOM   2679  N  NZ    . LYS A  1 356 ? 9.912   8.799   -26.137 1.00   47.68 ? 463 LYS A NZ    1 
ATOM   2680  N  N     . ARG A  1 357 ? 11.830  3.165   -22.692 1.00   36.40 ? 464 ARG A N     1 
ATOM   2681  C  CA    . ARG A  1 357 ? 11.358  3.133   -21.319 1.00   34.12 ? 464 ARG A CA    1 
ATOM   2682  C  C     . ARG A  1 357 ? 11.819  1.859   -20.635 1.00   32.88 ? 464 ARG A C     1 
ATOM   2683  O  O     . ARG A  1 357 ? 11.881  0.790   -21.251 1.00   32.01 ? 464 ARG A O     1 
ATOM   2684  C  CB    . ARG A  1 357 ? 9.832   3.226   -21.252 1.00   33.49 ? 464 ARG A CB    1 
ATOM   2685  C  CG    . ARG A  1 357 ? 9.345   3.411   -19.832 1.00   37.40 ? 464 ARG A CG    1 
ATOM   2686  C  CD    . ARG A  1 357 ? 7.852   3.617   -19.733 1.00   41.45 ? 464 ARG A CD    1 
ATOM   2687  N  NE    . ARG A  1 357 ? 7.279   2.682   -18.758 1.00   47.65 ? 464 ARG A NE    1 
ATOM   2688  C  CZ    . ARG A  1 357 ? 6.848   3.026   -17.542 1.00   49.37 ? 464 ARG A CZ    1 
ATOM   2689  N  NH1   . ARG A  1 357 ? 6.913   4.300   -17.130 1.00   46.82 ? 464 ARG A NH1   1 
ATOM   2690  N  NH2   . ARG A  1 357 ? 6.353   2.097   -16.732 1.00   49.30 ? 464 ARG A NH2   1 
ATOM   2691  N  N     . LEU A  1 358 ? 12.161  1.986   -19.357 1.00   30.69 ? 465 LEU A N     1 
ATOM   2692  C  CA    . LEU A  1 358 ? 12.611  0.854   -18.562 1.00   27.40 ? 465 LEU A CA    1 
ATOM   2693  C  C     . LEU A  1 358 ? 11.867  0.853   -17.245 1.00   26.80 ? 465 LEU A C     1 
ATOM   2694  O  O     . LEU A  1 358 ? 11.649  1.904   -16.642 1.00   29.61 ? 465 LEU A O     1 
ATOM   2695  C  CB    . LEU A  1 358 ? 14.111  0.940   -18.292 1.00   26.00 ? 465 LEU A CB    1 
ATOM   2696  C  CG    . LEU A  1 358 ? 14.613  0.001   -17.196 1.00   23.52 ? 465 LEU A CG    1 
ATOM   2697  C  CD1   . LEU A  1 358 ? 14.434  -1.423  -17.630 1.00   22.47 ? 465 LEU A CD1   1 
ATOM   2698  C  CD2   . LEU A  1 358 ? 16.069  0.280   -16.903 1.00   24.81 ? 465 LEU A CD2   1 
ATOM   2699  N  N     . GLU A  1 359 ? 11.460  -0.325  -16.804 1.00   26.66 ? 466 GLU A N     1 
ATOM   2700  C  CA    . GLU A  1 359 ? 10.753  -0.426  -15.547 1.00   27.98 ? 466 GLU A CA    1 
ATOM   2701  C  C     . GLU A  1 359 ? 11.390  -1.544  -14.751 1.00   27.97 ? 466 GLU A C     1 
ATOM   2702  O  O     . GLU A  1 359 ? 11.613  -2.633  -15.275 1.00   30.46 ? 466 GLU A O     1 
ATOM   2703  C  CB    . GLU A  1 359 ? 9.279   -0.732  -15.771 1.00   30.01 ? 466 GLU A CB    1 
ATOM   2704  C  CG    . GLU A  1 359 ? 8.409   -0.265  -14.616 1.00   35.39 ? 466 GLU A CG    1 
ATOM   2705  C  CD    . GLU A  1 359 ? 6.955   -0.655  -14.772 1.00   38.83 ? 466 GLU A CD    1 
ATOM   2706  O  OE1   . GLU A  1 359 ? 6.632   -1.834  -14.505 1.00   40.10 ? 466 GLU A OE1   1 
ATOM   2707  O  OE2   . GLU A  1 359 ? 6.141   0.213   -15.170 1.00   38.23 ? 466 GLU A OE2   1 
ATOM   2708  N  N     . VAL A  1 360 ? 11.700  -1.269  -13.489 1.00   26.57 ? 467 VAL A N     1 
ATOM   2709  C  CA    . VAL A  1 360 ? 12.316  -2.261  -12.621 1.00   23.59 ? 467 VAL A CA    1 
ATOM   2710  C  C     . VAL A  1 360 ? 11.498  -2.402  -11.350 1.00   26.71 ? 467 VAL A C     1 
ATOM   2711  O  O     . VAL A  1 360 ? 11.338  -1.440  -10.590 1.00   28.17 ? 467 VAL A O     1 
ATOM   2712  C  CB    . VAL A  1 360 ? 13.752  -1.862  -12.237 1.00   20.87 ? 467 VAL A CB    1 
ATOM   2713  C  CG1   . VAL A  1 360 ? 14.348  -2.894  -11.260 1.00   15.82 ? 467 VAL A CG1   1 
ATOM   2714  C  CG2   . VAL A  1 360 ? 14.597  -1.737  -13.483 1.00   13.77 ? 467 VAL A CG2   1 
ATOM   2715  N  N     . ARG A  1 361 ? 10.972  -3.603  -11.131 1.00   26.73 ? 468 ARG A N     1 
ATOM   2716  C  CA    . ARG A  1 361 ? 10.168  -3.883  -9.954  1.00   26.98 ? 468 ARG A CA    1 
ATOM   2717  C  C     . ARG A  1 361 ? 10.949  -4.735  -8.979  1.00   28.20 ? 468 ARG A C     1 
ATOM   2718  O  O     . ARG A  1 361 ? 11.832  -5.499  -9.367  1.00   30.15 ? 468 ARG A O     1 
ATOM   2719  C  CB    . ARG A  1 361 ? 8.883   -4.595  -10.352 1.00   26.77 ? 468 ARG A CB    1 
ATOM   2720  C  CG    . ARG A  1 361 ? 7.954   -3.695  -11.111 1.00   30.94 ? 468 ARG A CG    1 
ATOM   2721  C  CD    . ARG A  1 361 ? 6.792   -4.449  -11.726 1.00   36.26 ? 468 ARG A CD    1 
ATOM   2722  N  NE    . ARG A  1 361 ? 5.816   -3.525  -12.297 1.00   38.45 ? 468 ARG A NE    1 
ATOM   2723  C  CZ    . ARG A  1 361 ? 4.917   -2.855  -11.582 1.00   39.42 ? 468 ARG A CZ    1 
ATOM   2724  N  NH1   . ARG A  1 361 ? 4.069   -2.024  -12.185 1.00   40.09 ? 468 ARG A NH1   1 
ATOM   2725  N  NH2   . ARG A  1 361 ? 4.847   -3.031  -10.264 1.00   36.89 ? 468 ARG A NH2   1 
ATOM   2726  N  N     . LYS A  1 362 ? 10.627  -4.604  -7.704  1.00   28.57 ? 469 LYS A N     1 
ATOM   2727  C  CA    . LYS A  1 362 ? 11.323  -5.377  -6.706  1.00   28.34 ? 469 LYS A CA    1 
ATOM   2728  C  C     . LYS A  1 362 ? 10.590  -5.317  -5.389  1.00   28.08 ? 469 LYS A C     1 
ATOM   2729  O  O     . LYS A  1 362 ? 10.275  -4.242  -4.892  1.00   27.94 ? 469 LYS A O     1 
ATOM   2730  C  CB    . LYS A  1 362 ? 12.738  -4.845  -6.527  1.00   29.19 ? 469 LYS A CB    1 
ATOM   2731  C  CG    . LYS A  1 362 ? 13.498  -5.467  -5.362  1.00   33.28 ? 469 LYS A CG    1 
ATOM   2732  C  CD    . LYS A  1 362 ? 13.872  -6.908  -5.622  1.00   35.60 ? 469 LYS A CD    1 
ATOM   2733  C  CE    . LYS A  1 362 ? 14.791  -7.399  -4.516  1.00   39.50 ? 469 LYS A CE    1 
ATOM   2734  N  NZ    . LYS A  1 362 ? 15.404  -8.724  -4.828  1.00   41.60 ? 469 LYS A NZ    1 
ATOM   2735  N  N     . THR A  1 363 ? 10.302  -6.486  -4.835  1.00   28.24 ? 470 THR A N     1 
ATOM   2736  C  CA    . THR A  1 363 ? 9.638   -6.558  -3.550  1.00   26.80 ? 470 THR A CA    1 
ATOM   2737  C  C     . THR A  1 363 ? 10.739  -6.687  -2.512  1.00   25.40 ? 470 THR A C     1 
ATOM   2738  O  O     . THR A  1 363 ? 11.588  -7.574  -2.605  1.00   25.10 ? 470 THR A O     1 
ATOM   2739  C  CB    . THR A  1 363 ? 8.708   -7.764  -3.471  1.00   26.24 ? 470 THR A CB    1 
ATOM   2740  O  OG1   . THR A  1 363 ? 7.659   -7.601  -4.432  1.00   27.55 ? 470 THR A OG1   1 
ATOM   2741  C  CG2   . THR A  1 363 ? 8.115   -7.891  -2.065  1.00   23.61 ? 470 THR A CG2   1 
ATOM   2742  N  N     . VAL A  1 364 ? 10.739  -5.787  -1.538  1.00   23.87 ? 471 VAL A N     1 
ATOM   2743  C  CA    . VAL A  1 364 ? 11.764  -5.803  -0.509  1.00   21.36 ? 471 VAL A CA    1 
ATOM   2744  C  C     . VAL A  1 364 ? 11.121  -6.063  0.837   1.00   20.17 ? 471 VAL A C     1 
ATOM   2745  O  O     . VAL A  1 364 ? 9.928   -5.820  1.019   1.00   19.40 ? 471 VAL A O     1 
ATOM   2746  C  CB    . VAL A  1 364 ? 12.537  -4.444  -0.469  1.00   20.61 ? 471 VAL A CB    1 
ATOM   2747  C  CG1   . VAL A  1 364 ? 13.029  -4.085  -1.861  1.00   16.78 ? 471 VAL A CG1   1 
ATOM   2748  C  CG2   . VAL A  1 364 ? 11.646  -3.331  0.061   1.00   19.72 ? 471 VAL A CG2   1 
ATOM   2749  N  N     . THR A  1 365 ? 11.914  -6.560  1.779   1.00   19.15 ? 472 THR A N     1 
ATOM   2750  C  CA    . THR A  1 365 ? 11.410  -6.835  3.116   1.00   21.45 ? 472 THR A CA    1 
ATOM   2751  C  C     . THR A  1 365 ? 11.909  -5.778  4.078   1.00   21.56 ? 472 THR A C     1 
ATOM   2752  O  O     . THR A  1 365 ? 11.645  -5.840  5.274   1.00   22.08 ? 472 THR A O     1 
ATOM   2753  C  CB    . THR A  1 365 ? 11.867  -8.216  3.629   1.00   21.99 ? 472 THR A CB    1 
ATOM   2754  O  OG1   . THR A  1 365 ? 13.298  -8.262  3.693   1.00   22.10 ? 472 THR A OG1   1 
ATOM   2755  C  CG2   . THR A  1 365 ? 11.375  -9.312  2.703   1.00   22.22 ? 472 THR A CG2   1 
ATOM   2756  N  N     . ALA A  1 366 ? 12.635  -4.806  3.537   1.00   23.85 ? 473 ALA A N     1 
ATOM   2757  C  CA    . ALA A  1 366 ? 13.203  -3.712  4.322   1.00   23.67 ? 473 ALA A CA    1 
ATOM   2758  C  C     . ALA A  1 366 ? 13.992  -4.232  5.526   1.00   23.92 ? 473 ALA A C     1 
ATOM   2759  O  O     . ALA A  1 366 ? 13.806  -3.772  6.653   1.00   24.82 ? 473 ALA A O     1 
ATOM   2760  C  CB    . ALA A  1 366 ? 12.096  -2.762  4.783   1.00   20.84 ? 473 ALA A CB    1 
ATOM   2761  N  N     . CYS A  1 367 ? 14.855  -5.211  5.283   1.00   22.81 ? 474 CYS A N     1 
ATOM   2762  C  CA    . CYS A  1 367 ? 15.689  -5.763  6.336   1.00   24.18 ? 474 CYS A CA    1 
ATOM   2763  C  C     . CYS A  1 367 ? 14.927  -6.438  7.473   1.00   26.74 ? 474 CYS A C     1 
ATOM   2764  O  O     . CYS A  1 367 ? 15.330  -6.350  8.640   1.00   28.04 ? 474 CYS A O     1 
ATOM   2765  C  CB    . CYS A  1 367 ? 16.584  -4.652  6.889   1.00   21.60 ? 474 CYS A CB    1 
ATOM   2766  S  SG    . CYS A  1 367 ? 17.911  -4.158  5.743   1.00   25.24 ? 474 CYS A SG    1 
ATOM   2767  N  N     . LEU A  1 368 ? 13.833  -7.115  7.136   1.00   27.86 ? 475 LEU A N     1 
ATOM   2768  C  CA    . LEU A  1 368 ? 13.047  -7.805  8.149   1.00   27.79 ? 475 LEU A CA    1 
ATOM   2769  C  C     . LEU A  1 368 ? 13.933  -8.813  8.869   1.00   27.86 ? 475 LEU A C     1 
ATOM   2770  O  O     . LEU A  1 368 ? 14.764  -9.476  8.251   1.00   26.89 ? 475 LEU A O     1 
ATOM   2771  C  CB    . LEU A  1 368 ? 11.868  -8.541  7.512   1.00   28.23 ? 475 LEU A CB    1 
ATOM   2772  C  CG    . LEU A  1 368 ? 10.956  -9.290  8.500   1.00   26.05 ? 475 LEU A CG    1 
ATOM   2773  C  CD1   . LEU A  1 368 ? 10.395  -8.318  9.537   1.00   23.00 ? 475 LEU A CD1   1 
ATOM   2774  C  CD2   . LEU A  1 368 ? 9.826   -9.954  7.747   1.00   20.57 ? 475 LEU A CD2   1 
ATOM   2775  N  N     . GLY A  1 369 ? 13.768  -8.918  10.177  1.00   28.96 ? 476 GLY A N     1 
ATOM   2776  C  CA    . GLY A  1 369 ? 14.558  -9.875  10.919  1.00   32.43 ? 476 GLY A CA    1 
ATOM   2777  C  C     . GLY A  1 369 ? 15.978  -9.447  11.229  1.00   34.82 ? 476 GLY A C     1 
ATOM   2778  O  O     . GLY A  1 369 ? 16.677  -10.155 11.948  1.00   39.52 ? 476 GLY A O     1 
ATOM   2779  N  N     . GLU A  1 370 ? 16.418  -8.309  10.702  1.00   35.99 ? 477 GLU A N     1 
ATOM   2780  C  CA    . GLU A  1 370 ? 17.770  -7.825  10.977  1.00   35.48 ? 477 GLU A CA    1 
ATOM   2781  C  C     . GLU A  1 370 ? 17.704  -6.626  11.933  1.00   35.56 ? 477 GLU A C     1 
ATOM   2782  O  O     . GLU A  1 370 ? 16.630  -6.059  12.162  1.00   34.85 ? 477 GLU A O     1 
ATOM   2783  C  CB    . GLU A  1 370 ? 18.451  -7.397  9.685   1.00   37.81 ? 477 GLU A CB    1 
ATOM   2784  C  CG    . GLU A  1 370 ? 18.474  -8.438  8.596   1.00   43.03 ? 477 GLU A CG    1 
ATOM   2785  C  CD    . GLU A  1 370 ? 18.903  -7.838  7.245   1.00   47.89 ? 477 GLU A CD    1 
ATOM   2786  O  OE1   . GLU A  1 370 ? 18.723  -8.518  6.207   1.00   49.97 ? 477 GLU A OE1   1 
ATOM   2787  O  OE2   . GLU A  1 370 ? 19.420  -6.689  7.225   1.00   47.87 ? 477 GLU A OE2   1 
ATOM   2788  N  N     . PRO A  1 371 ? 18.855  -6.223  12.501  1.00   34.95 ? 478 PRO A N     1 
ATOM   2789  C  CA    . PRO A  1 371 ? 18.937  -5.091  13.433  1.00   34.14 ? 478 PRO A CA    1 
ATOM   2790  C  C     . PRO A  1 371 ? 18.566  -3.759  12.791  1.00   32.78 ? 478 PRO A C     1 
ATOM   2791  O  O     . PRO A  1 371 ? 18.193  -2.811  13.483  1.00   31.43 ? 478 PRO A O     1 
ATOM   2792  C  CB    . PRO A  1 371 ? 20.395  -5.110  13.881  1.00   34.69 ? 478 PRO A CB    1 
ATOM   2793  C  CG    . PRO A  1 371 ? 20.763  -6.536  13.757  1.00   37.41 ? 478 PRO A CG    1 
ATOM   2794  C  CD    . PRO A  1 371 ? 20.151  -6.913  12.429  1.00   36.92 ? 478 PRO A CD    1 
ATOM   2795  N  N     . ASN A  1 372 ? 18.678  -3.686  11.471  1.00   31.16 ? 479 ASN A N     1 
ATOM   2796  C  CA    . ASN A  1 372 ? 18.337  -2.461  10.760  1.00   34.92 ? 479 ASN A CA    1 
ATOM   2797  C  C     . ASN A  1 372 ? 17.019  -2.567  9.991   1.00   34.62 ? 479 ASN A C     1 
ATOM   2798  O  O     . ASN A  1 372 ? 16.850  -1.955  8.930   1.00   33.86 ? 479 ASN A O     1 
ATOM   2799  C  CB    . ASN A  1 372 ? 19.471  -2.044  9.810   1.00   36.68 ? 479 ASN A CB    1 
ATOM   2800  C  CG    . ASN A  1 372 ? 19.970  -3.187  8.944   1.00   43.07 ? 479 ASN A CG    1 
ATOM   2801  O  OD1   . ASN A  1 372 ? 20.780  -2.977  8.040   1.00   46.78 ? 479 ASN A OD1   1 
ATOM   2802  N  ND2   . ASN A  1 372 ? 19.502  -4.404  9.219   1.00   44.35 ? 479 ASN A ND2   1 
ATOM   2803  N  N     . HIS A  1 373 ? 16.094  -3.352  10.534  1.00   33.48 ? 480 HIS A N     1 
ATOM   2804  C  CA    . HIS A  1 373 ? 14.773  -3.533  9.941   1.00   30.40 ? 480 HIS A CA    1 
ATOM   2805  C  C     . HIS A  1 373 ? 14.075  -2.171  10.043  1.00   29.10 ? 480 HIS A C     1 
ATOM   2806  O  O     . HIS A  1 373 ? 14.162  -1.505  11.081  1.00   30.53 ? 480 HIS A O     1 
ATOM   2807  C  CB    . HIS A  1 373 ? 14.021  -4.618  10.731  1.00   28.83 ? 480 HIS A CB    1 
ATOM   2808  C  CG    . HIS A  1 373 ? 12.549  -4.685  10.454  1.00   30.03 ? 480 HIS A CG    1 
ATOM   2809  N  ND1   . HIS A  1 373 ? 12.028  -4.751  9.179   1.00   30.93 ? 480 HIS A ND1   1 
ATOM   2810  C  CD2   . HIS A  1 373 ? 11.492  -4.741  11.297  1.00   28.30 ? 480 HIS A CD2   1 
ATOM   2811  C  CE1   . HIS A  1 373 ? 10.711  -4.843  9.248   1.00   28.14 ? 480 HIS A CE1   1 
ATOM   2812  N  NE2   . HIS A  1 373 ? 10.361  -4.840  10.521  1.00   28.28 ? 480 HIS A NE2   1 
ATOM   2813  N  N     . ILE A  1 374 ? 13.412  -1.743  8.969   1.00   25.24 ? 481 ILE A N     1 
ATOM   2814  C  CA    . ILE A  1 374 ? 12.722  -0.455  8.970   1.00   23.24 ? 481 ILE A CA    1 
ATOM   2815  C  C     . ILE A  1 374 ? 11.232  -0.566  8.685   1.00   22.98 ? 481 ILE A C     1 
ATOM   2816  O  O     . ILE A  1 374 ? 10.822  -1.166  7.699   1.00   25.47 ? 481 ILE A O     1 
ATOM   2817  C  CB    . ILE A  1 374 ? 13.355  0.517   7.938   1.00   21.73 ? 481 ILE A CB    1 
ATOM   2818  C  CG1   . ILE A  1 374 ? 14.764  0.907   8.395   1.00   21.33 ? 481 ILE A CG1   1 
ATOM   2819  C  CG2   . ILE A  1 374 ? 12.498  1.776   7.795   1.00   18.05 ? 481 ILE A CG2   1 
ATOM   2820  C  CD1   . ILE A  1 374 ? 15.553  1.685   7.374   1.00   19.46 ? 481 ILE A CD1   1 
ATOM   2821  N  N     . THR A  1 375 ? 10.419  0.025   9.550   1.00   22.51 ? 482 THR A N     1 
ATOM   2822  C  CA    . THR A  1 375 ? 8.975   -0.007  9.356   1.00   24.46 ? 482 THR A CA    1 
ATOM   2823  C  C     . THR A  1 375 ? 8.462   1.418   9.192   1.00   24.74 ? 482 THR A C     1 
ATOM   2824  O  O     . THR A  1 375 ? 7.367   1.641   8.670   1.00   28.52 ? 482 THR A O     1 
ATOM   2825  C  CB    . THR A  1 375 ? 8.238   -0.654  10.552  1.00   22.23 ? 482 THR A CB    1 
ATOM   2826  O  OG1   . THR A  1 375 ? 8.436   0.142   11.725  1.00   23.18 ? 482 THR A OG1   1 
ATOM   2827  C  CG2   . THR A  1 375 ? 8.741   -2.058  10.796  1.00   21.37 ? 482 THR A CG2   1 
ATOM   2828  N  N     . ARG A  1 376 ? 9.259   2.376   9.645   1.00   24.10 ? 483 ARG A N     1 
ATOM   2829  C  CA    . ARG A  1 376 ? 8.905   3.783   9.555   1.00   24.59 ? 483 ARG A CA    1 
ATOM   2830  C  C     . ARG A  1 376 ? 10.025  4.447   8.767   1.00   22.28 ? 483 ARG A C     1 
ATOM   2831  O  O     . ARG A  1 376 ? 11.114  4.671   9.291   1.00   23.75 ? 483 ARG A O     1 
ATOM   2832  C  CB    . ARG A  1 376 ? 8.825   4.384   10.958  1.00   28.91 ? 483 ARG A CB    1 
ATOM   2833  C  CG    . ARG A  1 376 ? 7.574   5.174   11.248  1.00   32.39 ? 483 ARG A CG    1 
ATOM   2834  C  CD    . ARG A  1 376 ? 7.775   6.030   12.483  1.00   40.99 ? 483 ARG A CD    1 
ATOM   2835  N  NE    . ARG A  1 376 ? 6.597   6.841   12.760  1.00   49.01 ? 483 ARG A NE    1 
ATOM   2836  C  CZ    . ARG A  1 376 ? 6.615   8.011   13.399  1.00   50.55 ? 483 ARG A CZ    1 
ATOM   2837  N  NH1   . ARG A  1 376 ? 5.476   8.675   13.597  1.00   53.38 ? 483 ARG A NH1   1 
ATOM   2838  N  NH2   . ARG A  1 376 ? 7.764   8.529   13.837  1.00   48.61 ? 483 ARG A NH2   1 
ATOM   2839  N  N     . LEU A  1 377 ? 9.763   4.766   7.510   1.00   20.53 ? 484 LEU A N     1 
ATOM   2840  C  CA    . LEU A  1 377 ? 10.788  5.367   6.666   1.00   20.83 ? 484 LEU A CA    1 
ATOM   2841  C  C     . LEU A  1 377 ? 11.049  6.842   6.908   1.00   21.25 ? 484 LEU A C     1 
ATOM   2842  O  O     . LEU A  1 377 ? 10.175  7.571   7.364   1.00   24.75 ? 484 LEU A O     1 
ATOM   2843  C  CB    . LEU A  1 377 ? 10.416  5.185   5.193   1.00   19.47 ? 484 LEU A CB    1 
ATOM   2844  C  CG    . LEU A  1 377 ? 11.489  5.570   4.172   1.00   16.82 ? 484 LEU A CG    1 
ATOM   2845  C  CD1   . LEU A  1 377 ? 12.594  4.534   4.211   1.00   18.35 ? 484 LEU A CD1   1 
ATOM   2846  C  CD2   . LEU A  1 377 ? 10.907  5.624   2.781   1.00   15.31 ? 484 LEU A CD2   1 
ATOM   2847  N  N     . GLU A  1 378 ? 12.268  7.274   6.604   1.00   20.92 ? 485 GLU A N     1 
ATOM   2848  C  CA    . GLU A  1 378 ? 12.646  8.684   6.706   1.00   21.32 ? 485 GLU A CA    1 
ATOM   2849  C  C     . GLU A  1 378 ? 13.115  9.050   5.303   1.00   19.89 ? 485 GLU A C     1 
ATOM   2850  O  O     . GLU A  1 378 ? 12.289  9.179   4.410   1.00   21.27 ? 485 GLU A O     1 
ATOM   2851  C  CB    . GLU A  1 378 ? 13.744  8.899   7.755   1.00   19.86 ? 485 GLU A CB    1 
ATOM   2852  C  CG    . GLU A  1 378 ? 13.166  8.936   9.151   1.00   21.72 ? 485 GLU A CG    1 
ATOM   2853  C  CD    . GLU A  1 378 ? 14.208  8.996   10.240  1.00   24.64 ? 485 GLU A CD    1 
ATOM   2854  O  OE1   . GLU A  1 378 ? 13.809  8.919   11.423  1.00   26.91 ? 485 GLU A OE1   1 
ATOM   2855  O  OE2   . GLU A  1 378 ? 15.413  9.119   9.922   1.00   25.90 ? 485 GLU A OE2   1 
ATOM   2856  N  N     . HIS A  1 379 ? 14.417  9.203   5.086   1.00   19.48 ? 486 HIS A N     1 
ATOM   2857  C  CA    . HIS A  1 379 ? 14.885  9.507   3.741   1.00   16.95 ? 486 HIS A CA    1 
ATOM   2858  C  C     . HIS A  1 379 ? 15.003  8.197   2.979   1.00   17.15 ? 486 HIS A C     1 
ATOM   2859  O  O     . HIS A  1 379 ? 15.098  7.131   3.578   1.00   18.67 ? 486 HIS A O     1 
ATOM   2860  C  CB    . HIS A  1 379 ? 16.270  10.154  3.759   1.00   16.43 ? 486 HIS A CB    1 
ATOM   2861  C  CG    . HIS A  1 379 ? 16.398  11.301  4.705   1.00   16.46 ? 486 HIS A CG    1 
ATOM   2862  N  ND1   . HIS A  1 379 ? 16.653  11.131  6.046   1.00   16.68 ? 486 HIS A ND1   1 
ATOM   2863  C  CD2   . HIS A  1 379 ? 16.298  12.638  4.504   1.00   15.40 ? 486 HIS A CD2   1 
ATOM   2864  C  CE1   . HIS A  1 379 ? 16.705  12.314  6.632   1.00   19.02 ? 486 HIS A CE1   1 
ATOM   2865  N  NE2   . HIS A  1 379 ? 16.492  13.244  5.717   1.00   16.90 ? 486 HIS A NE2   1 
ATOM   2866  N  N     . ALA A  1 380 ? 14.988  8.281   1.656   1.00   16.41 ? 487 ALA A N     1 
ATOM   2867  C  CA    . ALA A  1 380 ? 15.178  7.104   0.817   1.00   17.28 ? 487 ALA A CA    1 
ATOM   2868  C  C     . ALA A  1 380 ? 16.035  7.541   -0.361  1.00   19.39 ? 487 ALA A C     1 
ATOM   2869  O  O     . ALA A  1 380 ? 15.799  8.600   -0.949  1.00   19.13 ? 487 ALA A O     1 
ATOM   2870  C  CB    . ALA A  1 380 ? 13.861  6.565   0.327   1.00   13.75 ? 487 ALA A CB    1 
ATOM   2871  N  N     . GLN A  1 381 ? 17.045  6.744   -0.691  1.00   19.62 ? 488 GLN A N     1 
ATOM   2872  C  CA    . GLN A  1 381 ? 17.912  7.063   -1.817  1.00   20.50 ? 488 GLN A CA    1 
ATOM   2873  C  C     . GLN A  1 381 ? 17.849  5.966   -2.850  1.00   19.24 ? 488 GLN A C     1 
ATOM   2874  O  O     . GLN A  1 381 ? 17.711  4.789   -2.521  1.00   19.67 ? 488 GLN A O     1 
ATOM   2875  C  CB    . GLN A  1 381 ? 19.370  7.199   -1.381  1.00   22.76 ? 488 GLN A CB    1 
ATOM   2876  C  CG    . GLN A  1 381 ? 19.612  8.232   -0.328  1.00   24.69 ? 488 GLN A CG    1 
ATOM   2877  C  CD    . GLN A  1 381 ? 21.044  8.232   0.094   1.00   25.89 ? 488 GLN A CD    1 
ATOM   2878  O  OE1   . GLN A  1 381 ? 21.598  7.183   0.440   1.00   29.65 ? 488 GLN A OE1   1 
ATOM   2879  N  NE2   . GLN A  1 381 ? 21.668  9.401   0.069   1.00   26.90 ? 488 GLN A NE2   1 
ATOM   2880  N  N     . ALA A  1 382 ? 17.939  6.368   -4.107  1.00   18.39 ? 489 ALA A N     1 
ATOM   2881  C  CA    . ALA A  1 382 ? 17.962  5.425   -5.210  1.00   17.68 ? 489 ALA A CA    1 
ATOM   2882  C  C     . ALA A  1 382 ? 19.305  5.737   -5.873  1.00   18.53 ? 489 ALA A C     1 
ATOM   2883  O  O     . ALA A  1 382 ? 19.426  6.689   -6.653  1.00   17.34 ? 489 ALA A O     1 
ATOM   2884  C  CB    . ALA A  1 382 ? 16.801  5.687   -6.162  1.00   10.08 ? 489 ALA A CB    1 
ATOM   2885  N  N     . ARG A  1 383 ? 20.328  4.966   -5.519  1.00   18.35 ? 490 ARG A N     1 
ATOM   2886  C  CA    . ARG A  1 383 ? 21.653  5.191   -6.088  1.00   21.73 ? 490 ARG A CA    1 
ATOM   2887  C  C     . ARG A  1 383 ? 21.702  4.535   -7.459  1.00   23.54 ? 490 ARG A C     1 
ATOM   2888  O  O     . ARG A  1 383 ? 21.671  3.312   -7.569  1.00   24.76 ? 490 ARG A O     1 
ATOM   2889  C  CB    . ARG A  1 383 ? 22.738  4.596   -5.184  1.00   21.42 ? 490 ARG A CB    1 
ATOM   2890  C  CG    . ARG A  1 383 ? 22.636  4.997   -3.710  1.00   18.18 ? 490 ARG A CG    1 
ATOM   2891  C  CD    . ARG A  1 383 ? 23.858  4.512   -2.950  1.00   20.88 ? 490 ARG A CD    1 
ATOM   2892  N  NE    . ARG A  1 383 ? 25.029  5.277   -3.348  1.00   25.78 ? 490 ARG A NE    1 
ATOM   2893  C  CZ    . ARG A  1 383 ? 25.447  6.373   -2.718  1.00   28.12 ? 490 ARG A CZ    1 
ATOM   2894  N  NH1   . ARG A  1 383 ? 26.516  7.033   -3.160  1.00   26.53 ? 490 ARG A NH1   1 
ATOM   2895  N  NH2   . ARG A  1 383 ? 24.817  6.789   -1.620  1.00   26.84 ? 490 ARG A NH2   1 
ATOM   2896  N  N     . LEU A  1 384 ? 21.779  5.352   -8.505  1.00   25.56 ? 491 LEU A N     1 
ATOM   2897  C  CA    . LEU A  1 384 ? 21.799  4.830   -9.865  1.00   24.97 ? 491 LEU A CA    1 
ATOM   2898  C  C     . LEU A  1 384 ? 23.112  5.071   -10.595 1.00   25.18 ? 491 LEU A C     1 
ATOM   2899  O  O     . LEU A  1 384 ? 23.787  6.080   -10.393 1.00   24.59 ? 491 LEU A O     1 
ATOM   2900  C  CB    . LEU A  1 384 ? 20.666  5.458   -10.682 1.00   23.66 ? 491 LEU A CB    1 
ATOM   2901  C  CG    . LEU A  1 384 ? 19.283  5.548   -10.023 1.00   25.54 ? 491 LEU A CG    1 
ATOM   2902  C  CD1   . LEU A  1 384 ? 18.291  6.201   -10.990 1.00   25.28 ? 491 LEU A CD1   1 
ATOM   2903  C  CD2   . LEU A  1 384 ? 18.799  4.164   -9.624  1.00   24.84 ? 491 LEU A CD2   1 
ATOM   2904  N  N     . THR A  1 385 ? 23.468  4.120   -11.445 1.00   27.49 ? 492 THR A N     1 
ATOM   2905  C  CA    . THR A  1 385 ? 24.667  4.217   -12.262 1.00   26.29 ? 492 THR A CA    1 
ATOM   2906  C  C     . THR A  1 385 ? 24.188  3.810   -13.643 1.00   25.74 ? 492 THR A C     1 
ATOM   2907  O  O     . THR A  1 385 ? 23.778  2.667   -13.851 1.00   26.13 ? 492 THR A O     1 
ATOM   2908  C  CB    . THR A  1 385 ? 25.752  3.252   -11.789 1.00   25.70 ? 492 THR A CB    1 
ATOM   2909  O  OG1   . THR A  1 385 ? 26.068  3.538   -10.426 1.00   29.10 ? 492 THR A OG1   1 
ATOM   2910  C  CG2   . THR A  1 385 ? 27.000  3.421   -12.608 1.00   24.63 ? 492 THR A CG2   1 
ATOM   2911  N  N     . LEU A  1 386 ? 24.209  4.751   -14.578 1.00   24.17 ? 493 LEU A N     1 
ATOM   2912  C  CA    . LEU A  1 386 ? 23.738  4.460   -15.922 1.00   23.72 ? 493 LEU A CA    1 
ATOM   2913  C  C     . LEU A  1 386 ? 24.468  5.266   -16.972 1.00   24.48 ? 493 LEU A C     1 
ATOM   2914  O  O     . LEU A  1 386 ? 25.106  6.285   -16.671 1.00   24.84 ? 493 LEU A O     1 
ATOM   2915  C  CB    . LEU A  1 386 ? 22.242  4.752   -16.005 1.00   21.02 ? 493 LEU A CB    1 
ATOM   2916  C  CG    . LEU A  1 386 ? 21.847  6.210   -15.763 1.00   18.35 ? 493 LEU A CG    1 
ATOM   2917  C  CD1   . LEU A  1 386 ? 22.067  7.014   -17.036 1.00   16.17 ? 493 LEU A CD1   1 
ATOM   2918  C  CD2   . LEU A  1 386 ? 20.388  6.285   -15.350 1.00   17.31 ? 493 LEU A CD2   1 
ATOM   2919  N  N     . SER A  1 387 ? 24.368  4.803   -18.211 1.00   22.82 ? 494 SER A N     1 
ATOM   2920  C  CA    . SER A  1 387 ? 24.999  5.485   -19.327 1.00   24.34 ? 494 SER A CA    1 
ATOM   2921  C  C     . SER A  1 387 ? 23.878  5.899   -20.263 1.00   24.08 ? 494 SER A C     1 
ATOM   2922  O  O     . SER A  1 387 ? 22.870  5.197   -20.381 1.00   20.67 ? 494 SER A O     1 
ATOM   2923  C  CB    . SER A  1 387 ? 26.000  4.546   -20.031 1.00   24.42 ? 494 SER A CB    1 
ATOM   2924  O  OG    . SER A  1 387 ? 25.415  3.309   -20.413 1.00   28.29 ? 494 SER A OG    1 
ATOM   2925  N  N     . TYR A  1 388 ? 24.037  7.046   -20.910 1.00   25.03 ? 495 TYR A N     1 
ATOM   2926  C  CA    . TYR A  1 388 ? 23.019  7.527   -21.838 1.00   28.37 ? 495 TYR A CA    1 
ATOM   2927  C  C     . TYR A  1 388 ? 23.655  8.563   -22.761 1.00   28.44 ? 495 TYR A C     1 
ATOM   2928  O  O     . TYR A  1 388 ? 24.582  9.270   -22.362 1.00   28.86 ? 495 TYR A O     1 
ATOM   2929  C  CB    . TYR A  1 388 ? 21.849  8.145   -21.068 1.00   29.96 ? 495 TYR A CB    1 
ATOM   2930  C  CG    . TYR A  1 388 ? 20.509  7.969   -21.744 1.00   32.68 ? 495 TYR A CG    1 
ATOM   2931  C  CD1   . TYR A  1 388 ? 19.982  6.697   -21.963 1.00   34.29 ? 495 TYR A CD1   1 
ATOM   2932  C  CD2   . TYR A  1 388 ? 19.764  9.072   -22.165 1.00   34.19 ? 495 TYR A CD2   1 
ATOM   2933  C  CE1   . TYR A  1 388 ? 18.748  6.527   -22.588 1.00   36.88 ? 495 TYR A CE1   1 
ATOM   2934  C  CE2   . TYR A  1 388 ? 18.528  8.912   -22.790 1.00   35.05 ? 495 TYR A CE2   1 
ATOM   2935  C  CZ    . TYR A  1 388 ? 18.027  7.638   -22.999 1.00   36.13 ? 495 TYR A CZ    1 
ATOM   2936  O  OH    . TYR A  1 388 ? 16.819  7.468   -23.632 1.00   37.28 ? 495 TYR A OH    1 
ATOM   2937  N  N     . ASN A  1 389 ? 23.157  8.649   -23.991 1.00   28.49 ? 496 ASN A N     1 
ATOM   2938  C  CA    . ASN A  1 389 ? 23.701  9.580   -24.973 1.00   29.20 ? 496 ASN A CA    1 
ATOM   2939  C  C     . ASN A  1 389 ? 23.307  11.035  -24.704 1.00   30.68 ? 496 ASN A C     1 
ATOM   2940  O  O     . ASN A  1 389 ? 24.070  11.960  -25.005 1.00   31.94 ? 496 ASN A O     1 
ATOM   2941  C  CB    . ASN A  1 389 ? 23.248  9.169   -26.374 1.00   28.94 ? 496 ASN A CB    1 
ATOM   2942  C  CG    . ASN A  1 389 ? 21.737  9.118   -26.495 1.00   32.67 ? 496 ASN A CG    1 
ATOM   2943  O  OD1   . ASN A  1 389 ? 21.064  8.373   -25.767 1.00   33.83 ? 496 ASN A OD1   1 
ATOM   2944  N  ND2   . ASN A  1 389 ? 21.190  9.921   -27.404 1.00   29.53 ? 496 ASN A ND2   1 
ATOM   2945  N  N     . ARG A  1 390 ? 22.118  11.241  -24.145 1.00   29.63 ? 497 ARG A N     1 
ATOM   2946  C  CA    . ARG A  1 390 ? 21.658  12.589  -23.845 1.00   29.39 ? 497 ARG A CA    1 
ATOM   2947  C  C     . ARG A  1 390 ? 20.929  12.573  -22.507 1.00   29.14 ? 497 ARG A C     1 
ATOM   2948  O  O     . ARG A  1 390 ? 19.717  12.357  -22.442 1.00   26.61 ? 497 ARG A O     1 
ATOM   2949  C  CB    . ARG A  1 390 ? 20.732  13.079  -24.947 1.00   31.76 ? 497 ARG A CB    1 
ATOM   2950  C  CG    . ARG A  1 390 ? 21.029  14.484  -25.392 1.00   30.93 ? 497 ARG A CG    1 
ATOM   2951  C  CD    . ARG A  1 390 ? 19.803  15.343  -25.277 1.00   31.89 ? 497 ARG A CD    1 
ATOM   2952  N  NE    . ARG A  1 390 ? 20.139  16.727  -25.552 1.00   32.54 ? 497 ARG A NE    1 
ATOM   2953  C  CZ    . ARG A  1 390 ? 19.552  17.756  -24.958 1.00   36.89 ? 497 ARG A CZ    1 
ATOM   2954  N  NH1   . ARG A  1 390 ? 19.929  18.996  -25.269 1.00   39.49 ? 497 ARG A NH1   1 
ATOM   2955  N  NH2   . ARG A  1 390 ? 18.595  17.543  -24.051 1.00   34.64 ? 497 ARG A NH2   1 
ATOM   2956  N  N     . ARG A  1 391 ? 21.688  12.806  -21.441 1.00   28.76 ? 498 ARG A N     1 
ATOM   2957  C  CA    . ARG A  1 391 ? 21.163  12.787  -20.081 1.00   27.94 ? 498 ARG A CA    1 
ATOM   2958  C  C     . ARG A  1 391 ? 19.886  13.602  -19.829 1.00   27.24 ? 498 ARG A C     1 
ATOM   2959  O  O     . ARG A  1 391 ? 18.948  13.117  -19.192 1.00   26.99 ? 498 ARG A O     1 
ATOM   2960  C  CB    . ARG A  1 391 ? 22.260  13.231  -19.119 1.00   24.45 ? 498 ARG A CB    1 
ATOM   2961  C  CG    . ARG A  1 391 ? 21.964  12.894  -17.681 1.00   23.12 ? 498 ARG A CG    1 
ATOM   2962  C  CD    . ARG A  1 391 ? 23.200  13.059  -16.853 1.00   21.66 ? 498 ARG A CD    1 
ATOM   2963  N  NE    . ARG A  1 391 ? 23.728  14.411  -16.965 1.00   21.89 ? 498 ARG A NE    1 
ATOM   2964  C  CZ    . ARG A  1 391 ? 24.891  14.793  -16.454 1.00   21.43 ? 498 ARG A CZ    1 
ATOM   2965  N  NH1   . ARG A  1 391 ? 25.307  16.046  -16.594 1.00   21.59 ? 498 ARG A NH1   1 
ATOM   2966  N  NH2   . ARG A  1 391 ? 25.640  13.915  -15.802 1.00   20.18 ? 498 ARG A NH2   1 
ATOM   2967  N  N     . GLY A  1 392 ? 19.857  14.832  -20.329 1.00   25.84 ? 499 GLY A N     1 
ATOM   2968  C  CA    . GLY A  1 392 ? 18.702  15.686  -20.131 1.00   26.09 ? 499 GLY A CA    1 
ATOM   2969  C  C     . GLY A  1 392 ? 17.370  15.160  -20.633 1.00   25.19 ? 499 GLY A C     1 
ATOM   2970  O  O     . GLY A  1 392 ? 16.322  15.641  -20.208 1.00   25.38 ? 499 GLY A O     1 
ATOM   2971  N  N     . ASP A  1 393 ? 17.394  14.183  -21.532 1.00   25.64 ? 500 ASP A N     1 
ATOM   2972  C  CA    . ASP A  1 393 ? 16.155  13.630  -22.064 1.00   25.27 ? 500 ASP A CA    1 
ATOM   2973  C  C     . ASP A  1 393 ? 15.520  12.619  -21.115 1.00   25.71 ? 500 ASP A C     1 
ATOM   2974  O  O     . ASP A  1 393 ? 14.353  12.246  -21.273 1.00   26.50 ? 500 ASP A O     1 
ATOM   2975  C  CB    . ASP A  1 393 ? 16.403  12.957  -23.415 1.00   25.73 ? 500 ASP A CB    1 
ATOM   2976  C  CG    . ASP A  1 393 ? 16.691  13.947  -24.528 1.00   27.14 ? 500 ASP A CG    1 
ATOM   2977  O  OD1   . ASP A  1 393 ? 16.564  15.175  -24.309 1.00   27.00 ? 500 ASP A OD1   1 
ATOM   2978  O  OD2   . ASP A  1 393 ? 17.035  13.480  -25.632 1.00   27.15 ? 500 ASP A OD2   1 
ATOM   2979  N  N     . LEU A  1 394 ? 16.289  12.175  -20.128 1.00   24.83 ? 501 LEU A N     1 
ATOM   2980  C  CA    . LEU A  1 394 ? 15.799  11.191  -19.174 1.00   23.34 ? 501 LEU A CA    1 
ATOM   2981  C  C     . LEU A  1 394 ? 14.848  11.758  -18.129 1.00   24.15 ? 501 LEU A C     1 
ATOM   2982  O  O     . LEU A  1 394 ? 14.884  12.945  -17.807 1.00   26.47 ? 501 LEU A O     1 
ATOM   2983  C  CB    . LEU A  1 394 ? 16.970  10.535  -18.449 1.00   21.45 ? 501 LEU A CB    1 
ATOM   2984  C  CG    . LEU A  1 394 ? 17.905  9.612   -19.219 1.00   24.09 ? 501 LEU A CG    1 
ATOM   2985  C  CD1   . LEU A  1 394 ? 19.064  9.236   -18.304 1.00   24.28 ? 501 LEU A CD1   1 
ATOM   2986  C  CD2   . LEU A  1 394 ? 17.161  8.368   -19.700 1.00   20.56 ? 501 LEU A CD2   1 
ATOM   2987  N  N     . ALA A  1 395 ? 13.990  10.889  -17.610 1.00   21.67 ? 502 ALA A N     1 
ATOM   2988  C  CA    . ALA A  1 395 ? 13.050  11.241  -16.555 1.00   21.28 ? 502 ALA A CA    1 
ATOM   2989  C  C     . ALA A  1 395 ? 13.006  9.980   -15.703 1.00   21.27 ? 502 ALA A C     1 
ATOM   2990  O  O     . ALA A  1 395 ? 12.764  8.886   -16.212 1.00   19.38 ? 502 ALA A O     1 
ATOM   2991  C  CB    . ALA A  1 395 ? 11.679  11.550  -17.127 1.00   23.11 ? 502 ALA A CB    1 
ATOM   2992  N  N     . ILE A  1 396 ? 13.258  10.132  -14.409 1.00   19.51 ? 503 ILE A N     1 
ATOM   2993  C  CA    . ILE A  1 396 ? 13.283  8.991   -13.518 1.00   16.74 ? 503 ILE A CA    1 
ATOM   2994  C  C     . ILE A  1 396 ? 12.265  9.123   -12.398 1.00   17.93 ? 503 ILE A C     1 
ATOM   2995  O  O     . ILE A  1 396 ? 12.122  10.184  -11.801 1.00   19.16 ? 503 ILE A O     1 
ATOM   2996  C  CB    . ILE A  1 396 ? 14.698  8.816   -12.935 1.00   15.26 ? 503 ILE A CB    1 
ATOM   2997  C  CG1   . ILE A  1 396 ? 15.705  8.768   -14.091 1.00   14.94 ? 503 ILE A CG1   1 
ATOM   2998  C  CG2   . ILE A  1 396 ? 14.781  7.545   -12.088 1.00   13.69 ? 503 ILE A CG2   1 
ATOM   2999  C  CD1   . ILE A  1 396 ? 17.160  8.684   -13.669 1.00   13.26 ? 503 ILE A CD1   1 
ATOM   3000  N  N     . HIS A  1 397 ? 11.563  8.030   -12.117 1.00   17.39 ? 504 HIS A N     1 
ATOM   3001  C  CA    . HIS A  1 397 ? 10.544  8.013   -11.082 1.00   18.05 ? 504 HIS A CA    1 
ATOM   3002  C  C     . HIS A  1 397 ? 10.699  6.820   -10.167 1.00   20.29 ? 504 HIS A C     1 
ATOM   3003  O  O     . HIS A  1 397 ? 11.126  5.752   -10.597 1.00   23.04 ? 504 HIS A O     1 
ATOM   3004  C  CB    . HIS A  1 397 ? 9.178   7.966   -11.736 1.00   18.43 ? 504 HIS A CB    1 
ATOM   3005  C  CG    . HIS A  1 397 ? 8.969   9.059   -12.730 1.00   19.06 ? 504 HIS A CG    1 
ATOM   3006  N  ND1   . HIS A  1 397 ? 8.699   10.357  -12.356 1.00   18.48 ? 504 HIS A ND1   1 
ATOM   3007  C  CD2   . HIS A  1 397 ? 9.052   9.060   -14.081 1.00   16.63 ? 504 HIS A CD2   1 
ATOM   3008  C  CE1   . HIS A  1 397 ? 8.625   11.114  -13.436 1.00   18.61 ? 504 HIS A CE1   1 
ATOM   3009  N  NE2   . HIS A  1 397 ? 8.836   10.350  -14.494 1.00   19.29 ? 504 HIS A NE2   1 
ATOM   3010  N  N     . LEU A  1 398 ? 10.350  7.010   -8.900  1.00   19.36 ? 505 LEU A N     1 
ATOM   3011  C  CA    . LEU A  1 398 ? 10.435  5.945   -7.917  1.00   19.06 ? 505 LEU A CA    1 
ATOM   3012  C  C     . LEU A  1 398 ? 9.092   5.855   -7.218  1.00   21.00 ? 505 LEU A C     1 
ATOM   3013  O  O     . LEU A  1 398 ? 8.627   6.842   -6.645  1.00   18.92 ? 505 LEU A O     1 
ATOM   3014  C  CB    . LEU A  1 398 ? 11.523  6.253   -6.891  1.00   18.62 ? 505 LEU A CB    1 
ATOM   3015  C  CG    . LEU A  1 398 ? 11.716  5.216   -5.775  1.00   17.75 ? 505 LEU A CG    1 
ATOM   3016  C  CD1   . LEU A  1 398 ? 12.211  3.903   -6.382  1.00   16.69 ? 505 LEU A CD1   1 
ATOM   3017  C  CD2   . LEU A  1 398 ? 12.704  5.734   -4.739  1.00   11.31 ? 505 LEU A CD2   1 
ATOM   3018  N  N     . VAL A  1 399 ? 8.471   4.677   -7.265  1.00   20.34 ? 506 VAL A N     1 
ATOM   3019  C  CA    . VAL A  1 399 ? 7.177   4.484   -6.633  1.00   18.69 ? 506 VAL A CA    1 
ATOM   3020  C  C     . VAL A  1 399 ? 7.308   3.575   -5.431  1.00   21.26 ? 506 VAL A C     1 
ATOM   3021  O  O     . VAL A  1 399 ? 7.777   2.446   -5.552  1.00   24.64 ? 506 VAL A O     1 
ATOM   3022  C  CB    . VAL A  1 399 ? 6.178   3.869   -7.600  1.00   17.31 ? 506 VAL A CB    1 
ATOM   3023  C  CG1   . VAL A  1 399 ? 4.816   3.846   -6.966  1.00   18.04 ? 506 VAL A CG1   1 
ATOM   3024  C  CG2   . VAL A  1 399 ? 6.169   4.654   -8.890  1.00   19.04 ? 506 VAL A CG2   1 
ATOM   3025  N  N     . SER A  1 400 ? 6.888   4.069   -4.269  1.00   21.63 ? 507 SER A N     1 
ATOM   3026  C  CA    . SER A  1 400 ? 6.977   3.293   -3.039  1.00   22.56 ? 507 SER A CA    1 
ATOM   3027  C  C     . SER A  1 400 ? 5.869   2.260   -2.971  1.00   23.94 ? 507 SER A C     1 
ATOM   3028  O  O     . SER A  1 400 ? 4.865   2.369   -3.671  1.00   25.64 ? 507 SER A O     1 
ATOM   3029  C  CB    . SER A  1 400 ? 6.863   4.205   -1.815  1.00   24.23 ? 507 SER A CB    1 
ATOM   3030  O  OG    . SER A  1 400 ? 5.516   4.614   -1.603  1.00   22.62 ? 507 SER A OG    1 
ATOM   3031  N  N     . PRO A  1 401 ? 6.044   1.230   -2.128  1.00   25.19 ? 508 PRO A N     1 
ATOM   3032  C  CA    . PRO A  1 401 ? 5.018   0.195   -1.996  1.00   23.56 ? 508 PRO A CA    1 
ATOM   3033  C  C     . PRO A  1 401 ? 3.638   0.796   -1.727  1.00   23.65 ? 508 PRO A C     1 
ATOM   3034  O  O     . PRO A  1 401 ? 2.630   0.278   -2.205  1.00   26.01 ? 508 PRO A O     1 
ATOM   3035  C  CB    . PRO A  1 401 ? 5.533   -0.647  -0.830  1.00   20.54 ? 508 PRO A CB    1 
ATOM   3036  C  CG    . PRO A  1 401 ? 7.002   -0.618  -1.056  1.00   22.66 ? 508 PRO A CG    1 
ATOM   3037  C  CD    . PRO A  1 401 ? 7.260   0.852   -1.383  1.00   24.86 ? 508 PRO A CD    1 
ATOM   3038  N  N     . MET A  1 402 ? 3.594   1.892   -0.976  1.00   22.26 ? 509 MET A N     1 
ATOM   3039  C  CA    . MET A  1 402 ? 2.320   2.522   -0.666  1.00   23.65 ? 509 MET A CA    1 
ATOM   3040  C  C     . MET A  1 402 ? 1.813   3.458   -1.761  1.00   23.23 ? 509 MET A C     1 
ATOM   3041  O  O     . MET A  1 402 ? 0.916   4.271   -1.529  1.00   24.51 ? 509 MET A O     1 
ATOM   3042  C  CB    . MET A  1 402 ? 2.404   3.251   0.675   1.00   24.68 ? 509 MET A CB    1 
ATOM   3043  C  CG    . MET A  1 402 ? 2.631   2.297   1.814   1.00   28.63 ? 509 MET A CG    1 
ATOM   3044  S  SD    . MET A  1 402 ? 2.667   3.120   3.387   1.00   34.84 ? 509 MET A SD    1 
ATOM   3045  C  CE    . MET A  1 402 ? 0.942   2.905   3.915   1.00   32.83 ? 509 MET A CE    1 
ATOM   3046  N  N     . GLY A  1 403 ? 2.400   3.344   -2.948  1.00   21.18 ? 510 GLY A N     1 
ATOM   3047  C  CA    . GLY A  1 403 ? 1.963   4.141   -4.078  1.00   19.73 ? 510 GLY A CA    1 
ATOM   3048  C  C     . GLY A  1 403 ? 2.457   5.559   -4.243  1.00   22.27 ? 510 GLY A C     1 
ATOM   3049  O  O     . GLY A  1 403 ? 1.998   6.261   -5.146  1.00   23.79 ? 510 GLY A O     1 
ATOM   3050  N  N     . THR A  1 404 ? 3.376   6.004   -3.395  1.00   23.82 ? 511 THR A N     1 
ATOM   3051  C  CA    . THR A  1 404 ? 3.880   7.371   -3.523  1.00   22.22 ? 511 THR A CA    1 
ATOM   3052  C  C     . THR A  1 404 ? 4.898   7.431   -4.648  1.00   22.12 ? 511 THR A C     1 
ATOM   3053  O  O     . THR A  1 404 ? 5.897   6.728   -4.648  1.00   23.35 ? 511 THR A O     1 
ATOM   3054  C  CB    . THR A  1 404 ? 4.506   7.854   -2.229  1.00   21.02 ? 511 THR A CB    1 
ATOM   3055  O  OG1   . THR A  1 404 ? 3.528   7.775   -1.185  1.00   23.74 ? 511 THR A OG1   1 
ATOM   3056  C  CG2   . THR A  1 404 ? 4.967   9.291   -2.376  1.00   21.88 ? 511 THR A CG2   1 
ATOM   3057  N  N     . ARG A  1 405 ? 4.629   8.302   -5.600  1.00   22.85 ? 512 ARG A N     1 
ATOM   3058  C  CA    . ARG A  1 405 ? 5.449   8.451   -6.781  1.00   22.78 ? 512 ARG A CA    1 
ATOM   3059  C  C     . ARG A  1 405 ? 6.407   9.644   -6.715  1.00   22.04 ? 512 ARG A C     1 
ATOM   3060  O  O     . ARG A  1 405 ? 6.001   10.791  -6.924  1.00   22.79 ? 512 ARG A O     1 
ATOM   3061  C  CB    . ARG A  1 405 ? 4.492   8.584   -7.950  1.00   21.27 ? 512 ARG A CB    1 
ATOM   3062  C  CG    . ARG A  1 405 ? 5.003   8.196   -9.263  1.00   27.00 ? 512 ARG A CG    1 
ATOM   3063  C  CD    . ARG A  1 405 ? 3.878   8.361   -10.262 1.00   29.42 ? 512 ARG A CD    1 
ATOM   3064  N  NE    . ARG A  1 405 ? 4.454   8.373   -11.600 1.00   34.07 ? 512 ARG A NE    1 
ATOM   3065  C  CZ    . ARG A  1 405 ? 4.956   7.286   -12.170 1.00   38.62 ? 512 ARG A CZ    1 
ATOM   3066  N  NH1   . ARG A  1 405 ? 4.922   6.125   -11.504 1.00   36.49 ? 512 ARG A NH1   1 
ATOM   3067  N  NH2   . ARG A  1 405 ? 5.505   7.358   -13.376 1.00   41.42 ? 512 ARG A NH2   1 
ATOM   3068  N  N     . SER A  1 406 ? 7.677   9.369   -6.426  1.00   21.70 ? 513 SER A N     1 
ATOM   3069  C  CA    . SER A  1 406 ? 8.693   10.416  -6.341  1.00   19.31 ? 513 SER A CA    1 
ATOM   3070  C  C     . SER A  1 406 ? 9.428   10.571  -7.662  1.00   18.13 ? 513 SER A C     1 
ATOM   3071  O  O     . SER A  1 406 ? 9.957   9.599   -8.210  1.00   19.17 ? 513 SER A O     1 
ATOM   3072  C  CB    . SER A  1 406 ? 9.713   10.079  -5.246  1.00   18.14 ? 513 SER A CB    1 
ATOM   3073  O  OG    . SER A  1 406 ? 9.090   9.968   -3.982  1.00   16.98 ? 513 SER A OG    1 
ATOM   3074  N  N     . THR A  1 407 ? 9.453   11.787  -8.190  1.00   17.61 ? 514 THR A N     1 
ATOM   3075  C  CA    . THR A  1 407 ? 10.189  12.016  -9.427  1.00   18.30 ? 514 THR A CA    1 
ATOM   3076  C  C     . THR A  1 407 ? 11.621  12.382  -9.035  1.00   17.89 ? 514 THR A C     1 
ATOM   3077  O  O     . THR A  1 407 ? 11.902  13.495  -8.592  1.00   17.29 ? 514 THR A O     1 
ATOM   3078  C  CB    . THR A  1 407 ? 9.558   13.138  -10.275 1.00   17.05 ? 514 THR A CB    1 
ATOM   3079  O  OG1   . THR A  1 407 ? 8.265   12.715  -10.721 1.00   18.23 ? 514 THR A OG1   1 
ATOM   3080  C  CG2   . THR A  1 407 ? 10.416  13.441  -11.491 1.00   15.71 ? 514 THR A CG2   1 
ATOM   3081  N  N     . LEU A  1 408 ? 12.515  11.410  -9.178  1.00   18.30 ? 515 LEU A N     1 
ATOM   3082  C  CA    . LEU A  1 408 ? 13.919  11.593  -8.841  1.00   18.08 ? 515 LEU A CA    1 
ATOM   3083  C  C     . LEU A  1 408 ? 14.597  12.557  -9.807  1.00   18.70 ? 515 LEU A C     1 
ATOM   3084  O  O     . LEU A  1 408 ? 15.473  13.324  -9.416  1.00   17.76 ? 515 LEU A O     1 
ATOM   3085  C  CB    . LEU A  1 408 ? 14.638  10.242  -8.870  1.00   14.38 ? 515 LEU A CB    1 
ATOM   3086  C  CG    . LEU A  1 408 ? 14.005  9.114   -8.038  1.00   12.98 ? 515 LEU A CG    1 
ATOM   3087  C  CD1   . LEU A  1 408 ? 14.899  7.887   -8.087  1.00   11.81 ? 515 LEU A CD1   1 
ATOM   3088  C  CD2   . LEU A  1 408 ? 13.811  9.566   -6.598  1.00   13.11 ? 515 LEU A CD2   1 
ATOM   3089  N  N     . LEU A  1 409 ? 14.182  12.520  -11.068 1.00   19.60 ? 516 LEU A N     1 
ATOM   3090  C  CA    . LEU A  1 409 ? 14.764  13.392  -12.075 1.00   21.48 ? 516 LEU A CA    1 
ATOM   3091  C  C     . LEU A  1 409 ? 13.786  13.726  -13.190 1.00   23.26 ? 516 LEU A C     1 
ATOM   3092  O  O     . LEU A  1 409 ? 13.240  12.829  -13.839 1.00   25.90 ? 516 LEU A O     1 
ATOM   3093  C  CB    . LEU A  1 409 ? 15.999  12.734  -12.696 1.00   19.43 ? 516 LEU A CB    1 
ATOM   3094  C  CG    . LEU A  1 409 ? 16.672  13.500  -13.847 1.00   20.72 ? 516 LEU A CG    1 
ATOM   3095  C  CD1   . LEU A  1 409 ? 17.482  14.660  -13.283 1.00   19.01 ? 516 LEU A CD1   1 
ATOM   3096  C  CD2   . LEU A  1 409 ? 17.576  12.563  -14.643 1.00   17.65 ? 516 LEU A CD2   1 
ATOM   3097  N  N     . ALA A  1 410 ? 13.567  15.018  -13.416 1.00   22.91 ? 517 ALA A N     1 
ATOM   3098  C  CA    . ALA A  1 410 ? 12.687  15.454  -14.493 1.00   20.00 ? 517 ALA A CA    1 
ATOM   3099  C  C     . ALA A  1 410 ? 13.576  15.817  -15.674 1.00   18.78 ? 517 ALA A C     1 
ATOM   3100  O  O     . ALA A  1 410 ? 14.781  16.013  -15.520 1.00   20.76 ? 517 ALA A O     1 
ATOM   3101  C  CB    . ALA A  1 410 ? 11.878  16.660  -14.061 1.00   15.55 ? 517 ALA A CB    1 
ATOM   3102  N  N     . ALA A  1 411 ? 12.994  15.904  -16.857 1.00   17.63 ? 518 ALA A N     1 
ATOM   3103  C  CA    . ALA A  1 411 ? 13.776  16.252  -18.030 1.00   17.55 ? 518 ALA A CA    1 
ATOM   3104  C  C     . ALA A  1 411 ? 14.468  17.612  -17.867 1.00   20.06 ? 518 ALA A C     1 
ATOM   3105  O  O     . ALA A  1 411 ? 13.896  18.566  -17.318 1.00   21.98 ? 518 ALA A O     1 
ATOM   3106  C  CB    . ALA A  1 411 ? 12.886  16.258  -19.266 1.00   12.03 ? 518 ALA A CB    1 
ATOM   3107  N  N     . ARG A  1 412 ? 15.714  17.681  -18.327 1.00   19.23 ? 519 ARG A N     1 
ATOM   3108  C  CA    . ARG A  1 412 ? 16.492  18.912  -18.282 1.00   19.23 ? 519 ARG A CA    1 
ATOM   3109  C  C     . ARG A  1 412 ? 16.954  19.150  -19.707 1.00   20.26 ? 519 ARG A C     1 
ATOM   3110  O  O     . ARG A  1 412 ? 18.006  18.672  -20.121 1.00   21.96 ? 519 ARG A O     1 
ATOM   3111  C  CB    . ARG A  1 412 ? 17.696  18.769  -17.349 1.00   18.75 ? 519 ARG A CB    1 
ATOM   3112  C  CG    . ARG A  1 412 ? 17.310  18.584  -15.885 1.00   20.85 ? 519 ARG A CG    1 
ATOM   3113  C  CD    . ARG A  1 412 ? 18.421  19.016  -14.952 1.00   17.60 ? 519 ARG A CD    1 
ATOM   3114  N  NE    . ARG A  1 412 ? 19.628  18.223  -15.141 1.00   20.88 ? 519 ARG A NE    1 
ATOM   3115  C  CZ    . ARG A  1 412 ? 20.820  18.556  -14.660 1.00   20.56 ? 519 ARG A CZ    1 
ATOM   3116  N  NH1   . ARG A  1 412 ? 21.866  17.779  -14.877 1.00   19.22 ? 519 ARG A NH1   1 
ATOM   3117  N  NH2   . ARG A  1 412 ? 20.967  19.676  -13.968 1.00   22.25 ? 519 ARG A NH2   1 
ATOM   3118  N  N     . PRO A  1 413 ? 16.153  19.884  -20.485 1.00   20.46 ? 520 PRO A N     1 
ATOM   3119  C  CA    . PRO A  1 413 ? 16.457  20.193  -21.883 1.00   20.74 ? 520 PRO A CA    1 
ATOM   3120  C  C     . PRO A  1 413 ? 17.861  20.697  -22.195 1.00   21.19 ? 520 PRO A C     1 
ATOM   3121  O  O     . PRO A  1 413 ? 18.374  20.439  -23.274 1.00   22.36 ? 520 PRO A O     1 
ATOM   3122  C  CB    . PRO A  1 413 ? 15.365  21.194  -22.263 1.00   20.18 ? 520 PRO A CB    1 
ATOM   3123  C  CG    . PRO A  1 413 ? 14.932  21.765  -20.940 1.00   22.37 ? 520 PRO A CG    1 
ATOM   3124  C  CD    . PRO A  1 413 ? 14.922  20.563  -20.057 1.00   19.40 ? 520 PRO A CD    1 
ATOM   3125  N  N     . HIS A  1 414 ? 18.493  21.399  -21.263 1.00   19.57 ? 521 HIS A N     1 
ATOM   3126  C  CA    . HIS A  1 414 ? 19.833  21.909  -21.520 1.00   20.77 ? 521 HIS A CA    1 
ATOM   3127  C  C     . HIS A  1 414 ? 20.946  20.892  -21.246 1.00   22.38 ? 521 HIS A C     1 
ATOM   3128  O  O     . HIS A  1 414 ? 22.094  21.083  -21.653 1.00   21.66 ? 521 HIS A O     1 
ATOM   3129  C  CB    . HIS A  1 414 ? 20.085  23.174  -20.694 1.00   21.55 ? 521 HIS A CB    1 
ATOM   3130  C  CG    . HIS A  1 414 ? 19.199  24.327  -21.057 1.00   23.87 ? 521 HIS A CG    1 
ATOM   3131  N  ND1   . HIS A  1 414 ? 19.066  24.788  -22.349 1.00   23.77 ? 521 HIS A ND1   1 
ATOM   3132  C  CD2   . HIS A  1 414 ? 18.419  25.126  -20.291 1.00   25.23 ? 521 HIS A CD2   1 
ATOM   3133  C  CE1   . HIS A  1 414 ? 18.240  25.820  -22.364 1.00   25.60 ? 521 HIS A CE1   1 
ATOM   3134  N  NE2   . HIS A  1 414 ? 17.834  26.046  -21.128 1.00   27.52 ? 521 HIS A NE2   1 
ATOM   3135  N  N     . ASP A  1 415 ? 20.614  19.809  -20.557 1.00   21.58 ? 522 ASP A N     1 
ATOM   3136  C  CA    . ASP A  1 415 ? 21.620  18.805  -20.238 1.00   24.35 ? 522 ASP A CA    1 
ATOM   3137  C  C     . ASP A  1 415 ? 21.864  17.878  -21.426 1.00   26.30 ? 522 ASP A C     1 
ATOM   3138  O  O     . ASP A  1 415 ? 21.100  16.945  -21.668 1.00   26.72 ? 522 ASP A O     1 
ATOM   3139  C  CB    . ASP A  1 415 ? 21.182  18.003  -19.001 1.00   23.71 ? 522 ASP A CB    1 
ATOM   3140  C  CG    . ASP A  1 415 ? 22.237  16.987  -18.535 1.00   23.70 ? 522 ASP A CG    1 
ATOM   3141  O  OD1   . ASP A  1 415 ? 23.319  16.877  -19.165 1.00   20.00 ? 522 ASP A OD1   1 
ATOM   3142  O  OD2   . ASP A  1 415 ? 21.971  16.295  -17.523 1.00   20.94 ? 522 ASP A OD2   1 
ATOM   3143  N  N     . TYR A  1 416 ? 22.940  18.144  -22.163 1.00   27.43 ? 523 TYR A N     1 
ATOM   3144  C  CA    . TYR A  1 416 ? 23.300  17.347  -23.331 1.00   26.57 ? 523 TYR A CA    1 
ATOM   3145  C  C     . TYR A  1 416 ? 24.469  16.417  -23.033 1.00   24.74 ? 523 TYR A C     1 
ATOM   3146  O  O     . TYR A  1 416 ? 25.069  15.848  -23.941 1.00   25.51 ? 523 TYR A O     1 
ATOM   3147  C  CB    . TYR A  1 416 ? 23.661  18.277  -24.486 1.00   30.86 ? 523 TYR A CB    1 
ATOM   3148  C  CG    . TYR A  1 416 ? 24.807  19.214  -24.169 1.00   36.04 ? 523 TYR A CG    1 
ATOM   3149  C  CD1   . TYR A  1 416 ? 26.137  18.825  -24.367 1.00   36.88 ? 523 TYR A CD1   1 
ATOM   3150  C  CD2   . TYR A  1 416 ? 24.565  20.474  -23.627 1.00   39.72 ? 523 TYR A CD2   1 
ATOM   3151  C  CE1   . TYR A  1 416 ? 27.194  19.667  -24.029 1.00   37.29 ? 523 TYR A CE1   1 
ATOM   3152  C  CE2   . TYR A  1 416 ? 25.616  21.325  -23.282 1.00   41.32 ? 523 TYR A CE2   1 
ATOM   3153  C  CZ    . TYR A  1 416 ? 26.926  20.916  -23.483 1.00   41.56 ? 523 TYR A CZ    1 
ATOM   3154  O  OH    . TYR A  1 416 ? 27.954  21.756  -23.112 1.00   44.64 ? 523 TYR A OH    1 
ATOM   3155  N  N     . SER A  1 417 ? 24.784  16.261  -21.753 1.00   23.50 ? 524 SER A N     1 
ATOM   3156  C  CA    . SER A  1 417 ? 25.887  15.404  -21.328 1.00   21.09 ? 524 SER A CA    1 
ATOM   3157  C  C     . SER A  1 417 ? 25.720  13.965  -21.765 1.00   20.80 ? 524 SER A C     1 
ATOM   3158  O  O     . SER A  1 417 ? 24.607  13.454  -21.868 1.00   22.57 ? 524 SER A O     1 
ATOM   3159  C  CB    . SER A  1 417 ? 26.042  15.436  -19.804 1.00   19.73 ? 524 SER A CB    1 
ATOM   3160  O  OG    . SER A  1 417 ? 26.995  14.471  -19.380 1.00   18.77 ? 524 SER A OG    1 
ATOM   3161  N  N     . ALA A  1 418 ? 26.842  13.312  -22.019 1.00   21.70 ? 525 ALA A N     1 
ATOM   3162  C  CA    . ALA A  1 418 ? 26.835  11.924  -22.434 1.00   21.62 ? 525 ALA A CA    1 
ATOM   3163  C  C     . ALA A  1 418 ? 27.512  11.099  -21.348 1.00   21.93 ? 525 ALA A C     1 
ATOM   3164  O  O     . ALA A  1 418 ? 27.803  9.928   -21.542 1.00   20.59 ? 525 ALA A O     1 
ATOM   3165  C  CB    . ALA A  1 418 ? 27.582  11.782  -23.740 1.00   19.07 ? 525 ALA A CB    1 
ATOM   3166  N  N     . ASP A  1 419 ? 27.750  11.718  -20.194 1.00   24.76 ? 526 ASP A N     1 
ATOM   3167  C  CA    . ASP A  1 419 ? 28.422  11.036  -19.090 1.00   26.17 ? 526 ASP A CA    1 
ATOM   3168  C  C     . ASP A  1 419 ? 27.497  10.292  -18.138 1.00   25.61 ? 526 ASP A C     1 
ATOM   3169  O  O     . ASP A  1 419 ? 27.963  9.701   -17.166 1.00   25.44 ? 526 ASP A O     1 
ATOM   3170  C  CB    . ASP A  1 419 ? 29.259  12.016  -18.268 1.00   27.24 ? 526 ASP A CB    1 
ATOM   3171  C  CG    . ASP A  1 419 ? 30.181  12.862  -19.117 1.00   31.63 ? 526 ASP A CG    1 
ATOM   3172  O  OD1   . ASP A  1 419 ? 30.756  12.346  -20.102 1.00   32.87 ? 526 ASP A OD1   1 
ATOM   3173  O  OD2   . ASP A  1 419 ? 30.335  14.054  -18.782 1.00   35.41 ? 526 ASP A OD2   1 
ATOM   3174  N  N     . GLY A  1 420 ? 26.195  10.333  -18.402 1.00   24.43 ? 527 GLY A N     1 
ATOM   3175  C  CA    . GLY A  1 420 ? 25.243  9.634   -17.551 1.00   24.49 ? 527 GLY A CA    1 
ATOM   3176  C  C     . GLY A  1 420 ? 25.362  9.945   -16.067 1.00   24.80 ? 527 GLY A C     1 
ATOM   3177  O  O     . GLY A  1 420 ? 25.687  11.068  -15.687 1.00   24.33 ? 527 GLY A O     1 
ATOM   3178  N  N     . PHE A  1 421 ? 25.082  8.946   -15.232 1.00   22.94 ? 528 PHE A N     1 
ATOM   3179  C  CA    . PHE A  1 421 ? 25.161  9.084   -13.783 1.00   20.64 ? 528 PHE A CA    1 
ATOM   3180  C  C     . PHE A  1 421 ? 26.045  7.981   -13.211 1.00   24.04 ? 528 PHE A C     1 
ATOM   3181  O  O     . PHE A  1 421 ? 25.834  6.793   -13.486 1.00   24.20 ? 528 PHE A O     1 
ATOM   3182  C  CB    . PHE A  1 421 ? 23.773  8.978   -13.157 1.00   19.25 ? 528 PHE A CB    1 
ATOM   3183  C  CG    . PHE A  1 421 ? 22.931  10.191  -13.356 1.00   22.10 ? 528 PHE A CG    1 
ATOM   3184  C  CD1   . PHE A  1 421 ? 23.198  11.368  -12.648 1.00   21.96 ? 528 PHE A CD1   1 
ATOM   3185  C  CD2   . PHE A  1 421 ? 21.888  10.184  -14.275 1.00   19.68 ? 528 PHE A CD2   1 
ATOM   3186  C  CE1   . PHE A  1 421 ? 22.432  12.523  -12.856 1.00   18.10 ? 528 PHE A CE1   1 
ATOM   3187  C  CE2   . PHE A  1 421 ? 21.123  11.326  -14.488 1.00   19.75 ? 528 PHE A CE2   1 
ATOM   3188  C  CZ    . PHE A  1 421 ? 21.398  12.500  -13.776 1.00   19.00 ? 528 PHE A CZ    1 
ATOM   3189  N  N     . ASN A  1 422 ? 27.039  8.378   -12.421 1.00   24.51 ? 529 ASN A N     1 
ATOM   3190  C  CA    . ASN A  1 422 ? 27.948  7.429   -11.795 1.00   25.32 ? 529 ASN A CA    1 
ATOM   3191  C  C     . ASN A  1 422 ? 27.675  7.330   -10.291 1.00   24.31 ? 529 ASN A C     1 
ATOM   3192  O  O     . ASN A  1 422 ? 28.201  8.099   -9.485  1.00   21.27 ? 529 ASN A O     1 
ATOM   3193  C  CB    . ASN A  1 422 ? 29.396  7.842   -12.066 1.00   28.26 ? 529 ASN A CB    1 
ATOM   3194  C  CG    . ASN A  1 422 ? 30.401  6.901   -11.426 1.00   34.02 ? 529 ASN A CG    1 
ATOM   3195  O  OD1   . ASN A  1 422 ? 30.190  5.679   -11.367 1.00   35.69 ? 529 ASN A OD1   1 
ATOM   3196  N  ND2   . ASN A  1 422 ? 31.511  7.461   -10.955 1.00   36.39 ? 529 ASN A ND2   1 
ATOM   3197  N  N     . ASP A  1 423 ? 26.847  6.357   -9.932  1.00   23.29 ? 530 ASP A N     1 
ATOM   3198  C  CA    . ASP A  1 423 ? 26.446  6.131   -8.550  1.00   24.04 ? 530 ASP A CA    1 
ATOM   3199  C  C     . ASP A  1 423 ? 25.912  7.402   -7.893  1.00   22.57 ? 530 ASP A C     1 
ATOM   3200  O  O     . ASP A  1 423 ? 26.333  7.770   -6.794  1.00   21.83 ? 530 ASP A O     1 
ATOM   3201  C  CB    . ASP A  1 423 ? 27.602  5.560   -7.721  1.00   22.44 ? 530 ASP A CB    1 
ATOM   3202  C  CG    . ASP A  1 423 ? 27.150  5.119   -6.329  1.00   24.37 ? 530 ASP A CG    1 
ATOM   3203  O  OD1   . ASP A  1 423 ? 26.076  4.484   -6.238  1.00   23.74 ? 530 ASP A OD1   1 
ATOM   3204  O  OD2   . ASP A  1 423 ? 27.853  5.398   -5.331  1.00   25.44 ? 530 ASP A OD2   1 
ATOM   3205  N  N     . TRP A  1 424 ? 24.982  8.071   -8.573  1.00   21.68 ? 531 TRP A N     1 
ATOM   3206  C  CA    . TRP A  1 424 ? 24.381  9.289   -8.037  1.00   21.57 ? 531 TRP A CA    1 
ATOM   3207  C  C     . TRP A  1 424 ? 23.216  8.904   -7.122  1.00   21.32 ? 531 TRP A C     1 
ATOM   3208  O  O     . TRP A  1 424 ? 22.352  8.110   -7.502  1.00   23.07 ? 531 TRP A O     1 
ATOM   3209  C  CB    . TRP A  1 424 ? 23.890  10.182  -9.170  1.00   21.89 ? 531 TRP A CB    1 
ATOM   3210  C  CG    . TRP A  1 424 ? 23.431  11.509  -8.678  1.00   23.50 ? 531 TRP A CG    1 
ATOM   3211  C  CD1   . TRP A  1 424 ? 22.139  11.931  -8.544  1.00   23.19 ? 531 TRP A CD1   1 
ATOM   3212  C  CD2   . TRP A  1 424 ? 24.258  12.577  -8.191  1.00   22.48 ? 531 TRP A CD2   1 
ATOM   3213  N  NE1   . TRP A  1 424 ? 22.109  13.196  -7.999  1.00   25.19 ? 531 TRP A NE1   1 
ATOM   3214  C  CE2   . TRP A  1 424 ? 23.394  13.616  -7.771  1.00   22.29 ? 531 TRP A CE2   1 
ATOM   3215  C  CE3   . TRP A  1 424 ? 25.641  12.754  -8.062  1.00   20.22 ? 531 TRP A CE3   1 
ATOM   3216  C  CZ2   . TRP A  1 424 ? 23.869  14.817  -7.231  1.00   19.57 ? 531 TRP A CZ2   1 
ATOM   3217  C  CZ3   . TRP A  1 424 ? 26.114  13.944  -7.524  1.00   18.04 ? 531 TRP A CZ3   1 
ATOM   3218  C  CH2   . TRP A  1 424 ? 25.227  14.962  -7.114  1.00   21.70 ? 531 TRP A CH2   1 
ATOM   3219  N  N     . ALA A  1 425 ? 23.189  9.472   -5.919  1.00   20.70 ? 532 ALA A N     1 
ATOM   3220  C  CA    . ALA A  1 425 ? 22.153  9.132   -4.940  1.00   22.56 ? 532 ALA A CA    1 
ATOM   3221  C  C     . ALA A  1 425 ? 20.901  10.006  -4.921  1.00   22.89 ? 532 ALA A C     1 
ATOM   3222  O  O     . ALA A  1 425 ? 20.752  10.860  -4.046  1.00   21.27 ? 532 ALA A O     1 
ATOM   3223  C  CB    . ALA A  1 425 ? 22.761  9.103   -3.543  1.00   20.31 ? 532 ALA A CB    1 
ATOM   3224  N  N     . PHE A  1 426 ? 19.997  9.783   -5.870  1.00   23.42 ? 533 PHE A N     1 
ATOM   3225  C  CA    . PHE A  1 426 ? 18.755  10.546  -5.925  1.00   20.70 ? 533 PHE A CA    1 
ATOM   3226  C  C     . PHE A  1 426 ? 18.018  10.308  -4.608  1.00   20.13 ? 533 PHE A C     1 
ATOM   3227  O  O     . PHE A  1 426 ? 17.817  9.162   -4.200  1.00   19.93 ? 533 PHE A O     1 
ATOM   3228  C  CB    . PHE A  1 426 ? 17.922  10.067  -7.109  1.00   17.89 ? 533 PHE A CB    1 
ATOM   3229  C  CG    . PHE A  1 426 ? 18.565  10.333  -8.440  1.00   15.34 ? 533 PHE A CG    1 
ATOM   3230  C  CD1   . PHE A  1 426 ? 18.325  11.524  -9.113  1.00   15.42 ? 533 PHE A CD1   1 
ATOM   3231  C  CD2   . PHE A  1 426 ? 19.385  9.382   -9.036  1.00   12.87 ? 533 PHE A CD2   1 
ATOM   3232  C  CE1   . PHE A  1 426 ? 18.882  11.767  -10.368 1.00   17.12 ? 533 PHE A CE1   1 
ATOM   3233  C  CE2   . PHE A  1 426 ? 19.944  9.613   -10.286 1.00   15.87 ? 533 PHE A CE2   1 
ATOM   3234  C  CZ    . PHE A  1 426 ? 19.692  10.814  -10.957 1.00   15.45 ? 533 PHE A CZ    1 
ATOM   3235  N  N     . MET A  1 427 ? 17.628  11.388  -3.940  1.00   19.60 ? 534 MET A N     1 
ATOM   3236  C  CA    . MET A  1 427 ? 16.956  11.274  -2.654  1.00   18.63 ? 534 MET A CA    1 
ATOM   3237  C  C     . MET A  1 427 ? 15.534  11.812  -2.674  1.00   18.91 ? 534 MET A C     1 
ATOM   3238  O  O     . MET A  1 427 ? 15.233  12.776  -3.374  1.00   20.32 ? 534 MET A O     1 
ATOM   3239  C  CB    . MET A  1 427 ? 17.788  12.003  -1.593  1.00   18.32 ? 534 MET A CB    1 
ATOM   3240  C  CG    . MET A  1 427 ? 17.351  11.771  -0.148  1.00   19.75 ? 534 MET A CG    1 
ATOM   3241  S  SD    . MET A  1 427 ? 16.023  12.863  0.393   1.00   22.12 ? 534 MET A SD    1 
ATOM   3242  C  CE    . MET A  1 427 ? 16.964  14.322  0.957   1.00   16.42 ? 534 MET A CE    1 
ATOM   3243  N  N     . THR A  1 428 ? 14.655  11.174  -1.909  1.00   19.00 ? 535 THR A N     1 
ATOM   3244  C  CA    . THR A  1 428 ? 13.266  11.614  -1.825  1.00   19.09 ? 535 THR A CA    1 
ATOM   3245  C  C     . THR A  1 428 ? 12.794  11.633  -0.384  1.00   21.04 ? 535 THR A C     1 
ATOM   3246  O  O     . THR A  1 428 ? 13.128  10.745  0.411   1.00   22.85 ? 535 THR A O     1 
ATOM   3247  C  CB    . THR A  1 428 ? 12.302  10.711  -2.637  1.00   18.60 ? 535 THR A CB    1 
ATOM   3248  O  OG1   . THR A  1 428 ? 10.979  11.247  -2.554  1.00   14.70 ? 535 THR A OG1   1 
ATOM   3249  C  CG2   . THR A  1 428 ? 12.291  9.279   -2.099  1.00   18.34 ? 535 THR A CG2   1 
ATOM   3250  N  N     . THR A  1 429 ? 12.013  12.653  -0.054  1.00   20.86 ? 536 THR A N     1 
ATOM   3251  C  CA    . THR A  1 429 ? 11.482  12.814  1.290   1.00   20.30 ? 536 THR A CA    1 
ATOM   3252  C  C     . THR A  1 429 ? 9.982   12.581  1.282   1.00   22.06 ? 536 THR A C     1 
ATOM   3253  O  O     . THR A  1 429 ? 9.326   12.700  2.321   1.00   23.58 ? 536 THR A O     1 
ATOM   3254  C  CB    . THR A  1 429 ? 11.692  14.235  1.798   1.00   20.37 ? 536 THR A CB    1 
ATOM   3255  O  OG1   . THR A  1 429 ? 10.909  15.131  0.998   1.00   16.47 ? 536 THR A OG1   1 
ATOM   3256  C  CG2   . THR A  1 429 ? 13.150  14.627  1.716   1.00   21.03 ? 536 THR A CG2   1 
ATOM   3257  N  N     . HIS A  1 430 ? 9.441   12.241  0.115   1.00   22.01 ? 537 HIS A N     1 
ATOM   3258  C  CA    . HIS A  1 430 ? 8.002   12.048  -0.030  1.00   21.82 ? 537 HIS A CA    1 
ATOM   3259  C  C     . HIS A  1 430 ? 7.377   10.814  0.611   1.00   21.41 ? 537 HIS A C     1 
ATOM   3260  O  O     . HIS A  1 430 ? 6.171   10.790  0.852   1.00   19.52 ? 537 HIS A O     1 
ATOM   3261  C  CB    . HIS A  1 430 ? 7.614   12.110  -1.512  1.00   22.49 ? 537 HIS A CB    1 
ATOM   3262  C  CG    . HIS A  1 430 ? 7.886   13.436  -2.152  1.00   23.41 ? 537 HIS A CG    1 
ATOM   3263  N  ND1   . HIS A  1 430 ? 7.173   13.902  -3.237  1.00   23.02 ? 537 HIS A ND1   1 
ATOM   3264  C  CD2   . HIS A  1 430 ? 8.820   14.382  -1.885  1.00   24.83 ? 537 HIS A CD2   1 
ATOM   3265  C  CE1   . HIS A  1 430 ? 7.656   15.073  -3.611  1.00   24.63 ? 537 HIS A CE1   1 
ATOM   3266  N  NE2   . HIS A  1 430 ? 8.657   15.387  -2.807  1.00   25.09 ? 537 HIS A NE2   1 
ATOM   3267  N  N     . SER A  1 431 ? 8.175   9.792   0.897   1.00   20.23 ? 538 SER A N     1 
ATOM   3268  C  CA    . SER A  1 431 ? 7.618   8.596   1.518   1.00   21.26 ? 538 SER A CA    1 
ATOM   3269  C  C     . SER A  1 431 ? 7.934   8.545   3.000   1.00   20.55 ? 538 SER A C     1 
ATOM   3270  O  O     . SER A  1 431 ? 7.912   7.487   3.622   1.00   21.02 ? 538 SER A O     1 
ATOM   3271  C  CB    . SER A  1 431 ? 8.134   7.333   0.821   1.00   22.27 ? 538 SER A CB    1 
ATOM   3272  O  OG    . SER A  1 431 ? 7.537   7.183   -0.458  1.00   22.29 ? 538 SER A OG    1 
ATOM   3273  N  N     . TRP A  1 432 ? 8.223   9.713   3.556   1.00   20.35 ? 539 TRP A N     1 
ATOM   3274  C  CA    . TRP A  1 432 ? 8.544   9.857   4.968   1.00   17.51 ? 539 TRP A CA    1 
ATOM   3275  C  C     . TRP A  1 432 ? 7.421   9.273   5.834   1.00   17.88 ? 539 TRP A C     1 
ATOM   3276  O  O     . TRP A  1 432 ? 6.255   9.606   5.657   1.00   17.39 ? 539 TRP A O     1 
ATOM   3277  C  CB    . TRP A  1 432 ? 8.740   11.338  5.266   1.00   16.45 ? 539 TRP A CB    1 
ATOM   3278  C  CG    . TRP A  1 432 ? 9.380   11.620  6.574   1.00   16.16 ? 539 TRP A CG    1 
ATOM   3279  C  CD1   . TRP A  1 432 ? 8.784   11.605  7.799   1.00   17.05 ? 539 TRP A CD1   1 
ATOM   3280  C  CD2   . TRP A  1 432 ? 10.744  11.999  6.792   1.00   15.41 ? 539 TRP A CD2   1 
ATOM   3281  N  NE1   . TRP A  1 432 ? 9.692   11.959  8.769   1.00   17.48 ? 539 TRP A NE1   1 
ATOM   3282  C  CE2   . TRP A  1 432 ? 10.903  12.206  8.179   1.00   14.74 ? 539 TRP A CE2   1 
ATOM   3283  C  CE3   . TRP A  1 432 ? 11.850  12.185  5.947   1.00   13.74 ? 539 TRP A CE3   1 
ATOM   3284  C  CZ2   . TRP A  1 432 ? 12.125  12.593  8.747   1.00   14.42 ? 539 TRP A CZ2   1 
ATOM   3285  C  CZ3   . TRP A  1 432 ? 13.069  12.569  6.512   1.00   13.34 ? 539 TRP A CZ3   1 
ATOM   3286  C  CH2   . TRP A  1 432 ? 13.194  12.769  7.900   1.00   12.66 ? 539 TRP A CH2   1 
ATOM   3287  N  N     . ASP A  1 433 ? 7.794   8.403   6.769   1.00   18.30 ? 540 ASP A N     1 
ATOM   3288  C  CA    . ASP A  1 433 ? 6.864   7.725   7.682   1.00   18.15 ? 540 ASP A CA    1 
ATOM   3289  C  C     . ASP A  1 433 ? 6.091   6.539   7.112   1.00   16.97 ? 540 ASP A C     1 
ATOM   3290  O  O     . ASP A  1 433 ? 5.335   5.894   7.820   1.00   14.92 ? 540 ASP A O     1 
ATOM   3291  C  CB    . ASP A  1 433 ? 5.891   8.716   8.323   1.00   18.66 ? 540 ASP A CB    1 
ATOM   3292  C  CG    . ASP A  1 433 ? 6.478   9.382   9.554   1.00   21.67 ? 540 ASP A CG    1 
ATOM   3293  O  OD1   . ASP A  1 433 ? 7.106   8.662   10.363  1.00   23.21 ? 540 ASP A OD1   1 
ATOM   3294  O  OD2   . ASP A  1 433 ? 6.307   10.607  9.725   1.00   19.30 ? 540 ASP A OD2   1 
ATOM   3295  N  N     . GLU A  1 434 ? 6.293   6.238   5.838   1.00   18.51 ? 541 GLU A N     1 
ATOM   3296  C  CA    . GLU A  1 434 ? 5.630   5.094   5.220   1.00   20.69 ? 541 GLU A CA    1 
ATOM   3297  C  C     . GLU A  1 434 ? 6.332   3.797   5.611   1.00   22.37 ? 541 GLU A C     1 
ATOM   3298  O  O     . GLU A  1 434 ? 7.455   3.821   6.111   1.00   21.05 ? 541 GLU A O     1 
ATOM   3299  C  CB    . GLU A  1 434 ? 5.684   5.205   3.701   1.00   19.76 ? 541 GLU A CB    1 
ATOM   3300  C  CG    . GLU A  1 434 ? 4.843   6.306   3.134   1.00   20.09 ? 541 GLU A CG    1 
ATOM   3301  C  CD    . GLU A  1 434 ? 4.886   6.328   1.623   1.00   21.67 ? 541 GLU A CD    1 
ATOM   3302  O  OE1   . GLU A  1 434 ? 5.400   5.365   1.008   1.00   21.18 ? 541 GLU A OE1   1 
ATOM   3303  O  OE2   . GLU A  1 434 ? 4.392   7.312   1.048   1.00   21.33 ? 541 GLU A OE2   1 
ATOM   3304  N  N     . ASP A  1 435 ? 5.660   2.669   5.390   1.00   24.23 ? 542 ASP A N     1 
ATOM   3305  C  CA    . ASP A  1 435 ? 6.260   1.367   5.654   1.00   24.96 ? 542 ASP A CA    1 
ATOM   3306  C  C     . ASP A  1 435 ? 6.949   1.072   4.328   1.00   24.51 ? 542 ASP A C     1 
ATOM   3307  O  O     . ASP A  1 435 ? 6.295   0.974   3.288   1.00   24.17 ? 542 ASP A O     1 
ATOM   3308  C  CB    . ASP A  1 435 ? 5.210   0.299   5.928   1.00   26.78 ? 542 ASP A CB    1 
ATOM   3309  C  CG    . ASP A  1 435 ? 5.832   -1.048  6.254   1.00   30.21 ? 542 ASP A CG    1 
ATOM   3310  O  OD1   . ASP A  1 435 ? 6.702   -1.511  5.480   1.00   32.75 ? 542 ASP A OD1   1 
ATOM   3311  O  OD2   . ASP A  1 435 ? 5.458   -1.646  7.283   1.00   31.84 ? 542 ASP A OD2   1 
ATOM   3312  N  N     . PRO A  1 436 ? 8.279   0.927   4.347   1.00   23.30 ? 543 PRO A N     1 
ATOM   3313  C  CA    . PRO A  1 436 ? 9.034   0.660   3.122   1.00   23.42 ? 543 PRO A CA    1 
ATOM   3314  C  C     . PRO A  1 436 ? 8.972   -0.740  2.521   1.00   23.28 ? 543 PRO A C     1 
ATOM   3315  O  O     . PRO A  1 436 ? 9.409   -0.936  1.392   1.00   22.50 ? 543 PRO A O     1 
ATOM   3316  C  CB    . PRO A  1 436 ? 10.451  1.065   3.514   1.00   23.87 ? 543 PRO A CB    1 
ATOM   3317  C  CG    . PRO A  1 436 ? 10.516  0.613   4.945   1.00   22.11 ? 543 PRO A CG    1 
ATOM   3318  C  CD    . PRO A  1 436 ? 9.176   1.038   5.513   1.00   20.57 ? 543 PRO A CD    1 
ATOM   3319  N  N     . SER A  1 437 ? 8.438   -1.717  3.248   1.00   25.15 ? 544 SER A N     1 
ATOM   3320  C  CA    . SER A  1 437 ? 8.389   -3.078  2.699   1.00   27.18 ? 544 SER A CA    1 
ATOM   3321  C  C     . SER A  1 437 ? 7.311   -3.202  1.635   1.00   25.93 ? 544 SER A C     1 
ATOM   3322  O  O     . SER A  1 437 ? 6.269   -2.540  1.709   1.00   26.86 ? 544 SER A O     1 
ATOM   3323  C  CB    . SER A  1 437 ? 8.147   -4.119  3.794   1.00   24.42 ? 544 SER A CB    1 
ATOM   3324  O  OG    . SER A  1 437 ? 6.837   -4.021  4.295   1.00   29.05 ? 544 SER A OG    1 
ATOM   3325  N  N     . GLY A  1 438 ? 7.573   -4.051  0.647   1.00   24.83 ? 545 GLY A N     1 
ATOM   3326  C  CA    . GLY A  1 438 ? 6.638   -4.237  -0.439  1.00   23.21 ? 545 GLY A CA    1 
ATOM   3327  C  C     . GLY A  1 438 ? 7.335   -4.045  -1.771  1.00   26.39 ? 545 GLY A C     1 
ATOM   3328  O  O     . GLY A  1 438 ? 8.567   -4.119  -1.857  1.00   26.98 ? 545 GLY A O     1 
ATOM   3329  N  N     . GLU A  1 439 ? 6.554   -3.785  -2.813  1.00   25.04 ? 546 GLU A N     1 
ATOM   3330  C  CA    . GLU A  1 439 ? 7.116   -3.601  -4.138  1.00   26.73 ? 546 GLU A CA    1 
ATOM   3331  C  C     . GLU A  1 439 ? 7.470   -2.152  -4.472  1.00   26.27 ? 546 GLU A C     1 
ATOM   3332  O  O     . GLU A  1 439 ? 6.620   -1.261  -4.426  1.00   25.81 ? 546 GLU A O     1 
ATOM   3333  C  CB    . GLU A  1 439 ? 6.149   -4.123  -5.196  1.00   28.65 ? 546 GLU A CB    1 
ATOM   3334  C  CG    . GLU A  1 439 ? 6.796   -4.311  -6.547  1.00   33.71 ? 546 GLU A CG    1 
ATOM   3335  C  CD    . GLU A  1 439 ? 5.785   -4.532  -7.649  1.00   37.74 ? 546 GLU A CD    1 
ATOM   3336  O  OE1   . GLU A  1 439 ? 6.133   -5.224  -8.634  1.00   37.25 ? 546 GLU A OE1   1 
ATOM   3337  O  OE2   . GLU A  1 439 ? 4.652   -4.005  -7.532  1.00   41.00 ? 546 GLU A OE2   1 
ATOM   3338  N  N     . TRP A  1 440 ? 8.736   -1.932  -4.810  1.00   25.84 ? 547 TRP A N     1 
ATOM   3339  C  CA    . TRP A  1 440 ? 9.229   -0.619  -5.201  1.00   22.57 ? 547 TRP A CA    1 
ATOM   3340  C  C     . TRP A  1 440 ? 9.367   -0.683  -6.714  1.00   22.01 ? 547 TRP A C     1 
ATOM   3341  O  O     . TRP A  1 440 ? 9.732   -1.726  -7.259  1.00   21.09 ? 547 TRP A O     1 
ATOM   3342  C  CB    . TRP A  1 440 ? 10.607  -0.338  -4.597  1.00   21.63 ? 547 TRP A CB    1 
ATOM   3343  C  CG    . TRP A  1 440 ? 10.592  0.098   -3.188  1.00   19.96 ? 547 TRP A CG    1 
ATOM   3344  C  CD1   . TRP A  1 440 ? 10.627  -0.693  -2.081  1.00   19.49 ? 547 TRP A CD1   1 
ATOM   3345  C  CD2   . TRP A  1 440 ? 10.544  1.448   -2.721  1.00   20.67 ? 547 TRP A CD2   1 
ATOM   3346  N  NE1   . TRP A  1 440 ? 10.609  0.081   -0.943  1.00   18.74 ? 547 TRP A NE1   1 
ATOM   3347  C  CE2   . TRP A  1 440 ? 10.556  1.401   -1.306  1.00   20.71 ? 547 TRP A CE2   1 
ATOM   3348  C  CE3   . TRP A  1 440 ? 10.493  2.695   -3.358  1.00   16.16 ? 547 TRP A CE3   1 
ATOM   3349  C  CZ2   . TRP A  1 440 ? 10.518  2.559   -0.512  1.00   21.16 ? 547 TRP A CZ2   1 
ATOM   3350  C  CZ3   . TRP A  1 440 ? 10.456  3.845   -2.571  1.00   20.57 ? 547 TRP A CZ3   1 
ATOM   3351  C  CH2   . TRP A  1 440 ? 10.469  3.768   -1.159  1.00   18.96 ? 547 TRP A CH2   1 
ATOM   3352  N  N     . VAL A  1 441 ? 9.092   0.426   -7.389  1.00   20.47 ? 548 VAL A N     1 
ATOM   3353  C  CA    . VAL A  1 441 ? 9.187   0.461   -8.842  1.00   20.43 ? 548 VAL A CA    1 
ATOM   3354  C  C     . VAL A  1 441 ? 10.006  1.656   -9.323  1.00   22.75 ? 548 VAL A C     1 
ATOM   3355  O  O     . VAL A  1 441 ? 9.734   2.803   -8.951  1.00   23.00 ? 548 VAL A O     1 
ATOM   3356  C  CB    . VAL A  1 441 ? 7.780   0.537   -9.487  1.00   18.81 ? 548 VAL A CB    1 
ATOM   3357  C  CG1   . VAL A  1 441 ? 7.898   0.533   -11.004 1.00   19.49 ? 548 VAL A CG1   1 
ATOM   3358  C  CG2   . VAL A  1 441 ? 6.928   -0.619  -9.008  1.00   13.87 ? 548 VAL A CG2   1 
ATOM   3359  N  N     . LEU A  1 442 ? 11.009  1.385   -10.152 1.00   22.91 ? 549 LEU A N     1 
ATOM   3360  C  CA    . LEU A  1 442 ? 11.851  2.445   -10.688 1.00   23.66 ? 549 LEU A CA    1 
ATOM   3361  C  C     . LEU A  1 442 ? 11.468  2.618   -12.143 1.00   23.87 ? 549 LEU A C     1 
ATOM   3362  O  O     . LEU A  1 442 ? 11.355  1.635   -12.871 1.00   25.04 ? 549 LEU A O     1 
ATOM   3363  C  CB    . LEU A  1 442 ? 13.331  2.071   -10.583 1.00   23.16 ? 549 LEU A CB    1 
ATOM   3364  C  CG    . LEU A  1 442 ? 14.291  3.135   -11.119 1.00   22.34 ? 549 LEU A CG    1 
ATOM   3365  C  CD1   . LEU A  1 442 ? 14.304  4.307   -10.170 1.00   25.95 ? 549 LEU A CD1   1 
ATOM   3366  C  CD2   . LEU A  1 442 ? 15.686  2.571   -11.253 1.00   26.92 ? 549 LEU A CD2   1 
ATOM   3367  N  N     . GLU A  1 443 ? 11.259  3.858   -12.567 1.00   24.29 ? 550 GLU A N     1 
ATOM   3368  C  CA    . GLU A  1 443 ? 10.872  4.110   -13.945 1.00   26.37 ? 550 GLU A CA    1 
ATOM   3369  C  C     . GLU A  1 443 ? 11.827  5.064   -14.615 1.00   26.67 ? 550 GLU A C     1 
ATOM   3370  O  O     . GLU A  1 443 ? 12.044  6.171   -14.129 1.00   29.83 ? 550 GLU A O     1 
ATOM   3371  C  CB    . GLU A  1 443 ? 9.470   4.705   -14.010 1.00   28.26 ? 550 GLU A CB    1 
ATOM   3372  C  CG    . GLU A  1 443 ? 8.426   3.937   -13.238 1.00   32.80 ? 550 GLU A CG    1 
ATOM   3373  C  CD    . GLU A  1 443 ? 7.053   4.569   -13.351 1.00   35.87 ? 550 GLU A CD    1 
ATOM   3374  O  OE1   . GLU A  1 443 ? 6.128   4.069   -12.679 1.00   36.22 ? 550 GLU A OE1   1 
ATOM   3375  O  OE2   . GLU A  1 443 ? 6.900   5.557   -14.116 1.00   36.04 ? 550 GLU A OE2   1 
ATOM   3376  N  N     . ILE A  1 444 ? 12.409  4.630   -15.726 1.00   24.97 ? 551 ILE A N     1 
ATOM   3377  C  CA    . ILE A  1 444 ? 13.312  5.482   -16.480 1.00   27.00 ? 551 ILE A CA    1 
ATOM   3378  C  C     . ILE A  1 444 ? 12.713  5.592   -17.872 1.00   27.76 ? 551 ILE A C     1 
ATOM   3379  O  O     . ILE A  1 444 ? 12.438  4.580   -18.513 1.00   28.64 ? 551 ILE A O     1 
ATOM   3380  C  CB    . ILE A  1 444 ? 14.716  4.884   -16.554 1.00   26.81 ? 551 ILE A CB    1 
ATOM   3381  C  CG1   . ILE A  1 444 ? 15.234  4.635   -15.136 1.00   25.48 ? 551 ILE A CG1   1 
ATOM   3382  C  CG2   . ILE A  1 444 ? 15.654  5.851   -17.270 1.00   25.82 ? 551 ILE A CG2   1 
ATOM   3383  C  CD1   . ILE A  1 444 ? 16.604  3.993   -15.079 1.00   25.15 ? 551 ILE A CD1   1 
ATOM   3384  N  N     . GLU A  1 445 ? 12.495  6.816   -18.336 1.00   28.17 ? 552 GLU A N     1 
ATOM   3385  C  CA    . GLU A  1 445 ? 11.883  7.008   -19.638 1.00   29.33 ? 552 GLU A CA    1 
ATOM   3386  C  C     . GLU A  1 445 ? 12.562  8.088   -20.463 1.00   29.64 ? 552 GLU A C     1 
ATOM   3387  O  O     . GLU A  1 445 ? 13.122  9.044   -19.927 1.00   31.64 ? 552 GLU A O     1 
ATOM   3388  C  CB    . GLU A  1 445 ? 10.408  7.367   -19.466 1.00   30.21 ? 552 GLU A CB    1 
ATOM   3389  C  CG    . GLU A  1 445 ? 10.184  8.747   -18.863 1.00   36.00 ? 552 GLU A CG    1 
ATOM   3390  C  CD    . GLU A  1 445 ? 8.705   9.107   -18.728 1.00   40.31 ? 552 GLU A CD    1 
ATOM   3391  O  OE1   . GLU A  1 445 ? 7.911   8.692   -19.609 1.00   42.29 ? 552 GLU A OE1   1 
ATOM   3392  O  OE2   . GLU A  1 445 ? 8.345   9.815   -17.752 1.00   37.70 ? 552 GLU A OE2   1 
ATOM   3393  N  N     . ASN A  1 446 ? 12.511  7.915   -21.778 1.00   29.24 ? 553 ASN A N     1 
ATOM   3394  C  CA    . ASN A  1 446 ? 13.076  8.866   -22.717 1.00   29.15 ? 553 ASN A CA    1 
ATOM   3395  C  C     . ASN A  1 446 ? 11.928  9.824   -23.029 1.00   29.83 ? 553 ASN A C     1 
ATOM   3396  O  O     . ASN A  1 446 ? 10.981  9.456   -23.725 1.00   30.70 ? 553 ASN A O     1 
ATOM   3397  C  CB    . ASN A  1 446 ? 13.524  8.125   -23.976 1.00   28.54 ? 553 ASN A CB    1 
ATOM   3398  C  CG    . ASN A  1 446 ? 13.966  9.048   -25.078 1.00   31.18 ? 553 ASN A CG    1 
ATOM   3399  O  OD1   . ASN A  1 446 ? 13.887  10.271  -24.956 1.00   32.71 ? 553 ASN A OD1   1 
ATOM   3400  N  ND2   . ASN A  1 446 ? 14.442  8.462   -26.177 1.00   33.83 ? 553 ASN A ND2   1 
ATOM   3401  N  N     . THR A  1 447 ? 12.001  11.042  -22.501 1.00   29.01 ? 554 THR A N     1 
ATOM   3402  C  CA    . THR A  1 447 ? 10.946  12.027  -22.716 1.00   30.28 ? 554 THR A CA    1 
ATOM   3403  C  C     . THR A  1 447 ? 11.022  12.712  -24.077 1.00   30.88 ? 554 THR A C     1 
ATOM   3404  O  O     . THR A  1 447 ? 10.248  13.624  -24.361 1.00   33.53 ? 554 THR A O     1 
ATOM   3405  C  CB    . THR A  1 447 ? 10.977  13.109  -21.620 1.00   29.09 ? 554 THR A CB    1 
ATOM   3406  O  OG1   . THR A  1 447 ? 12.173  13.890  -21.736 1.00   31.18 ? 554 THR A OG1   1 
ATOM   3407  C  CG2   . THR A  1 447 ? 10.953  12.460  -20.253 1.00   27.44 ? 554 THR A CG2   1 
ATOM   3408  N  N     . SER A  1 448 ? 11.948  12.264  -24.914 1.00   30.51 ? 555 SER A N     1 
ATOM   3409  C  CA    . SER A  1 448 ? 12.134  12.844  -26.235 1.00   32.49 ? 555 SER A CA    1 
ATOM   3410  C  C     . SER A  1 448 ? 11.744  11.887  -27.370 1.00   32.97 ? 555 SER A C     1 
ATOM   3411  O  O     . SER A  1 448 ? 11.598  10.677  -27.161 1.00   33.92 ? 555 SER A O     1 
ATOM   3412  C  CB    . SER A  1 448 ? 13.596  13.271  -26.384 1.00   33.55 ? 555 SER A CB    1 
ATOM   3413  O  OG    . SER A  1 448 ? 14.012  13.277  -27.737 1.00   38.16 ? 555 SER A OG    1 
ATOM   3414  N  N     . GLU A  1 449 ? 11.565  12.434  -28.571 1.00   33.37 ? 556 GLU A N     1 
ATOM   3415  C  CA    . GLU A  1 449 ? 11.213  11.618  -29.726 1.00   33.14 ? 556 GLU A CA    1 
ATOM   3416  C  C     . GLU A  1 449 ? 12.493  11.054  -30.346 1.00   33.01 ? 556 GLU A C     1 
ATOM   3417  O  O     . GLU A  1 449 ? 12.452  10.144  -31.177 1.00   33.75 ? 556 GLU A O     1 
ATOM   3418  C  CB    . GLU A  1 449 ? 10.460  12.443  -30.772 1.00   32.09 ? 556 GLU A CB    1 
ATOM   3419  C  CG    . GLU A  1 449 ? 9.058   12.878  -30.368 1.00   32.60 ? 556 GLU A CG    1 
ATOM   3420  C  CD    . GLU A  1 449 ? 8.136   11.718  -30.058 1.00   30.89 ? 556 GLU A CD    1 
ATOM   3421  O  OE1   . GLU A  1 449 ? 8.122   10.737  -30.832 0.0000 30.65 ? 556 GLU A OE1   1 
ATOM   3422  O  OE2   . GLU A  1 449 ? 7.410   11.796  -29.044 0.0000 30.65 ? 556 GLU A OE2   1 
ATOM   3423  N  N     . ALA A  1 450 ? 13.630  11.604  -29.934 1.00   32.54 ? 557 ALA A N     1 
ATOM   3424  C  CA    . ALA A  1 450 ? 14.927  11.168  -30.436 1.00   33.17 ? 557 ALA A CA    1 
ATOM   3425  C  C     . ALA A  1 450 ? 15.192  9.717   -30.060 1.00   34.01 ? 557 ALA A C     1 
ATOM   3426  O  O     . ALA A  1 450 ? 14.733  9.243   -29.018 1.00   36.05 ? 557 ALA A O     1 
ATOM   3427  C  CB    . ALA A  1 450 ? 16.022  12.055  -29.880 1.00   32.39 ? 557 ALA A CB    1 
ATOM   3428  N  N     . ASN A  1 451 ? 15.926  9.010   -30.915 1.00   34.33 ? 558 ASN A N     1 
ATOM   3429  C  CA    . ASN A  1 451 ? 16.247  7.613   -30.653 1.00   35.97 ? 558 ASN A CA    1 
ATOM   3430  C  C     . ASN A  1 451 ? 17.489  7.539   -29.764 1.00   37.60 ? 558 ASN A C     1 
ATOM   3431  O  O     . ASN A  1 451 ? 18.606  7.334   -30.253 1.00   35.66 ? 558 ASN A O     1 
ATOM   3432  C  CB    . ASN A  1 451 ? 16.485  6.852   -31.966 1.00   34.30 ? 558 ASN A CB    1 
ATOM   3433  C  CG    . ASN A  1 451 ? 15.202  6.644   -32.767 1.00   30.17 ? 558 ASN A CG    1 
ATOM   3434  O  OD1   . ASN A  1 451 ? 14.320  5.886   -32.365 0.0000 31.15 ? 558 ASN A OD1   1 
ATOM   3435  N  ND2   . ASN A  1 451 ? 15.095  7.331   -33.899 0.0000 31.15 ? 558 ASN A ND2   1 
ATOM   3436  N  N     . ASN A  1 452 ? 17.283  7.724   -28.457 1.00   38.93 ? 559 ASN A N     1 
ATOM   3437  C  CA    . ASN A  1 452 ? 18.377  7.678   -27.490 1.00   37.70 ? 559 ASN A CA    1 
ATOM   3438  C  C     . ASN A  1 452 ? 18.645  6.240   -27.049 1.00   37.61 ? 559 ASN A C     1 
ATOM   3439  O  O     . ASN A  1 452 ? 17.799  5.349   -27.218 1.00   39.93 ? 559 ASN A O     1 
ATOM   3440  C  CB    . ASN A  1 452 ? 18.061  8.536   -26.260 1.00   36.12 ? 559 ASN A CB    1 
ATOM   3441  C  CG    . ASN A  1 452 ? 17.870  9.998   -26.598 1.00   35.93 ? 559 ASN A CG    1 
ATOM   3442  O  OD1   . ASN A  1 452 ? 18.604  10.563  -27.417 1.00   33.79 ? 559 ASN A OD1   1 
ATOM   3443  N  ND2   . ASN A  1 452 ? 16.887  10.628  -25.958 1.00   36.71 ? 559 ASN A ND2   1 
ATOM   3444  N  N     . TYR A  1 453 ? 19.813  6.024   -26.456 1.00   35.44 ? 560 TYR A N     1 
ATOM   3445  C  CA    . TYR A  1 453 ? 20.204  4.696   -26.015 1.00   33.24 ? 560 TYR A CA    1 
ATOM   3446  C  C     . TYR A  1 453 ? 21.073  4.747   -24.763 1.00   33.24 ? 560 TYR A C     1 
ATOM   3447  O  O     . TYR A  1 453 ? 21.823  5.704   -24.549 1.00   32.64 ? 560 TYR A O     1 
ATOM   3448  C  CB    . TYR A  1 453 ? 20.978  4.008   -27.135 1.00   31.02 ? 560 TYR A CB    1 
ATOM   3449  C  CG    . TYR A  1 453 ? 22.154  4.831   -27.625 1.00   28.81 ? 560 TYR A CG    1 
ATOM   3450  C  CD1   . TYR A  1 453 ? 21.978  5.866   -28.547 1.00   28.27 ? 560 TYR A CD1   1 
ATOM   3451  C  CD2   . TYR A  1 453 ? 23.441  4.581   -27.157 1.00   28.60 ? 560 TYR A CD2   1 
ATOM   3452  C  CE1   . TYR A  1 453 ? 23.059  6.630   -28.988 1.00   27.47 ? 560 TYR A CE1   1 
ATOM   3453  C  CE2   . TYR A  1 453 ? 24.526  5.337   -27.591 1.00   29.24 ? 560 TYR A CE2   1 
ATOM   3454  C  CZ    . TYR A  1 453 ? 24.331  6.358   -28.506 1.00   29.89 ? 560 TYR A CZ    1 
ATOM   3455  O  OH    . TYR A  1 453 ? 25.417  7.094   -28.926 1.00   30.69 ? 560 TYR A OH    1 
ATOM   3456  N  N     . GLY A  1 454 ? 20.983  3.698   -23.948 1.00   33.09 ? 561 GLY A N     1 
ATOM   3457  C  CA    . GLY A  1 454 ? 21.772  3.636   -22.731 1.00   32.22 ? 561 GLY A CA    1 
ATOM   3458  C  C     . GLY A  1 454 ? 21.534  2.376   -21.921 1.00   31.46 ? 561 GLY A C     1 
ATOM   3459  O  O     . GLY A  1 454 ? 20.664  1.567   -22.249 1.00   30.23 ? 561 GLY A O     1 
ATOM   3460  N  N     . THR A  1 455 ? 22.300  2.218   -20.846 1.00   32.17 ? 562 THR A N     1 
ATOM   3461  C  CA    . THR A  1 455 ? 22.188  1.043   -19.992 1.00   31.92 ? 562 THR A CA    1 
ATOM   3462  C  C     . THR A  1 455 ? 22.225  1.398   -18.503 1.00   33.02 ? 562 THR A C     1 
ATOM   3463  O  O     . THR A  1 455 ? 23.064  2.191   -18.058 1.00   33.65 ? 562 THR A O     1 
ATOM   3464  C  CB    . THR A  1 455 ? 23.361  0.059   -20.247 1.00   32.04 ? 562 THR A CB    1 
ATOM   3465  O  OG1   . THR A  1 455 ? 23.429  -0.271  -21.637 1.00   33.45 ? 562 THR A OG1   1 
ATOM   3466  C  CG2   . THR A  1 455 ? 23.189  -1.218  -19.432 1.00   28.49 ? 562 THR A CG2   1 
ATOM   3467  N  N     . LEU A  1 456 ? 21.314  0.804   -17.738 1.00   31.93 ? 563 LEU A N     1 
ATOM   3468  C  CA    . LEU A  1 456 ? 21.267  1.002   -16.292 1.00   28.72 ? 563 LEU A CA    1 
ATOM   3469  C  C     . LEU A  1 456 ? 22.082  -0.160  -15.737 1.00   27.91 ? 563 LEU A C     1 
ATOM   3470  O  O     . LEU A  1 456 ? 21.684  -1.312  -15.896 1.00   27.64 ? 563 LEU A O     1 
ATOM   3471  C  CB    . LEU A  1 456 ? 19.829  0.899   -15.769 1.00   26.24 ? 563 LEU A CB    1 
ATOM   3472  C  CG    . LEU A  1 456 ? 19.677  0.878   -14.241 1.00   24.68 ? 563 LEU A CG    1 
ATOM   3473  C  CD1   . LEU A  1 456 ? 20.096  2.222   -13.664 1.00   26.33 ? 563 LEU A CD1   1 
ATOM   3474  C  CD2   . LEU A  1 456 ? 18.247  0.573   -13.856 1.00   26.02 ? 563 LEU A CD2   1 
ATOM   3475  N  N     . THR A  1 457 ? 23.208  0.127   -15.086 1.00   26.60 ? 564 THR A N     1 
ATOM   3476  C  CA    . THR A  1 457 ? 24.045  -0.942  -14.554 1.00   25.80 ? 564 THR A CA    1 
ATOM   3477  C  C     . THR A  1 457 ? 23.965  -1.117  -13.045 1.00   26.87 ? 564 THR A C     1 
ATOM   3478  O  O     . THR A  1 457 ? 24.393  -2.141  -12.510 1.00   28.22 ? 564 THR A O     1 
ATOM   3479  C  CB    . THR A  1 457 ? 25.518  -0.743  -14.943 1.00   25.48 ? 564 THR A CB    1 
ATOM   3480  O  OG1   . THR A  1 457 ? 26.027  0.434   -14.310 1.00   27.03 ? 564 THR A OG1   1 
ATOM   3481  C  CG2   . THR A  1 457 ? 25.646  -0.583  -16.440 1.00   26.45 ? 564 THR A CG2   1 
ATOM   3482  N  N     . LYS A  1 458 ? 23.434  -0.124  -12.345 1.00   26.97 ? 565 LYS A N     1 
ATOM   3483  C  CA    . LYS A  1 458 ? 23.308  -0.248  -10.899 1.00   26.59 ? 565 LYS A CA    1 
ATOM   3484  C  C     . LYS A  1 458 ? 22.144  0.546   -10.345 1.00   27.16 ? 565 LYS A C     1 
ATOM   3485  O  O     . LYS A  1 458 ? 21.923  1.700   -10.720 1.00   28.32 ? 565 LYS A O     1 
ATOM   3486  C  CB    . LYS A  1 458 ? 24.581  0.197   -10.193 1.00   26.37 ? 565 LYS A CB    1 
ATOM   3487  C  CG    . LYS A  1 458 ? 24.646  -0.263  -8.744  1.00   27.55 ? 565 LYS A CG    1 
ATOM   3488  C  CD    . LYS A  1 458 ? 25.890  0.272   -8.050  1.00   30.02 ? 565 LYS A CD    1 
ATOM   3489  C  CE    . LYS A  1 458 ? 25.601  1.586   -7.319  1.00   36.22 ? 565 LYS A CE    1 
ATOM   3490  N  NZ    . LYS A  1 458 ? 24.865  2.602   -8.152  1.00   36.33 ? 565 LYS A NZ    1 
ATOM   3491  N  N     . PHE A  1 459 ? 21.399  -0.094  -9.452  1.00   25.44 ? 566 PHE A N     1 
ATOM   3492  C  CA    . PHE A  1 459 ? 20.260  0.519   -8.799  1.00   23.95 ? 566 PHE A CA    1 
ATOM   3493  C  C     . PHE A  1 459 ? 20.221  -0.011  -7.380  1.00   25.12 ? 566 PHE A C     1 
ATOM   3494  O  O     . PHE A  1 459 ? 19.720  -1.104  -7.123  1.00   27.11 ? 566 PHE A O     1 
ATOM   3495  C  CB    . PHE A  1 459 ? 18.950  0.185   -9.527  1.00   24.36 ? 566 PHE A CB    1 
ATOM   3496  C  CG    . PHE A  1 459 ? 17.705  0.471   -8.710  1.00   25.35 ? 566 PHE A CG    1 
ATOM   3497  C  CD1   . PHE A  1 459 ? 17.650  1.557   -7.824  1.00   25.38 ? 566 PHE A CD1   1 
ATOM   3498  C  CD2   . PHE A  1 459 ? 16.584  -0.342  -8.826  1.00   26.36 ? 566 PHE A CD2   1 
ATOM   3499  C  CE1   . PHE A  1 459 ? 16.504  1.818   -7.067  1.00   22.43 ? 566 PHE A CE1   1 
ATOM   3500  C  CE2   . PHE A  1 459 ? 15.434  -0.084  -8.070  1.00   27.21 ? 566 PHE A CE2   1 
ATOM   3501  C  CZ    . PHE A  1 459 ? 15.400  1.001   -7.191  1.00   23.91 ? 566 PHE A CZ    1 
ATOM   3502  N  N     . THR A  1 460 ? 20.775  0.768   -6.461  1.00   23.63 ? 567 THR A N     1 
ATOM   3503  C  CA    . THR A  1 460 ? 20.792  0.395   -5.054  1.00   23.25 ? 567 THR A CA    1 
ATOM   3504  C  C     . THR A  1 460 ? 19.787  1.253   -4.294  1.00   22.24 ? 567 THR A C     1 
ATOM   3505  O  O     . THR A  1 460 ? 19.824  2.485   -4.371  1.00   24.08 ? 567 THR A O     1 
ATOM   3506  C  CB    . THR A  1 460 ? 22.171  0.628   -4.408  1.00   21.44 ? 567 THR A CB    1 
ATOM   3507  O  OG1   . THR A  1 460 ? 23.182  -0.053  -5.148  1.00   23.39 ? 567 THR A OG1   1 
ATOM   3508  C  CG2   . THR A  1 460 ? 22.173  0.103   -2.984  1.00   21.38 ? 567 THR A CG2   1 
ATOM   3509  N  N     . LEU A  1 461 ? 18.891  0.599   -3.568  1.00   20.95 ? 568 LEU A N     1 
ATOM   3510  C  CA    . LEU A  1 461 ? 17.886  1.300   -2.782  1.00   21.78 ? 568 LEU A CA    1 
ATOM   3511  C  C     . LEU A  1 461 ? 18.407  1.403   -1.355  1.00   21.82 ? 568 LEU A C     1 
ATOM   3512  O  O     . LEU A  1 461 ? 18.783  0.392   -0.757  1.00   22.75 ? 568 LEU A O     1 
ATOM   3513  C  CB    . LEU A  1 461 ? 16.568  0.523   -2.794  1.00   20.85 ? 568 LEU A CB    1 
ATOM   3514  C  CG    . LEU A  1 461 ? 15.357  1.203   -2.167  1.00   19.31 ? 568 LEU A CG    1 
ATOM   3515  C  CD1   . LEU A  1 461 ? 15.080  2.479   -2.914  1.00   19.04 ? 568 LEU A CD1   1 
ATOM   3516  C  CD2   . LEU A  1 461 ? 14.159  0.286   -2.238  1.00   17.67 ? 568 LEU A CD2   1 
ATOM   3517  N  N     . VAL A  1 462 ? 18.452  2.617   -0.815  1.00   19.69 ? 569 VAL A N     1 
ATOM   3518  C  CA    . VAL A  1 462 ? 18.932  2.801   0.543   1.00   19.50 ? 569 VAL A CA    1 
ATOM   3519  C  C     . VAL A  1 462 ? 17.832  3.419   1.383   1.00   20.94 ? 569 VAL A C     1 
ATOM   3520  O  O     . VAL A  1 462 ? 17.369  4.527   1.107   1.00   21.44 ? 569 VAL A O     1 
ATOM   3521  C  CB    . VAL A  1 462 ? 20.187  3.697   0.587   1.00   17.42 ? 569 VAL A CB    1 
ATOM   3522  C  CG1   . VAL A  1 462 ? 20.706  3.793   2.011   1.00   14.38 ? 569 VAL A CG1   1 
ATOM   3523  C  CG2   . VAL A  1 462 ? 21.259  3.118   -0.318  1.00   14.03 ? 569 VAL A CG2   1 
ATOM   3524  N  N     . LEU A  1 463 ? 17.414  2.686   2.409   1.00   21.15 ? 570 LEU A N     1 
ATOM   3525  C  CA    . LEU A  1 463 ? 16.350  3.138   3.291   1.00   22.32 ? 570 LEU A CA    1 
ATOM   3526  C  C     . LEU A  1 463 ? 16.879  3.566   4.661   1.00   22.88 ? 570 LEU A C     1 
ATOM   3527  O  O     . LEU A  1 463 ? 17.660  2.851   5.294   1.00   24.14 ? 570 LEU A O     1 
ATOM   3528  C  CB    . LEU A  1 463 ? 15.324  2.013   3.469   1.00   21.63 ? 570 LEU A CB    1 
ATOM   3529  C  CG    . LEU A  1 463 ? 14.796  1.300   2.212   1.00   20.40 ? 570 LEU A CG    1 
ATOM   3530  C  CD1   . LEU A  1 463 ? 13.936  0.124   2.633   1.00   18.54 ? 570 LEU A CD1   1 
ATOM   3531  C  CD2   . LEU A  1 463 ? 13.997  2.247   1.340   1.00   18.01 ? 570 LEU A CD2   1 
ATOM   3532  N  N     . TYR A  1 464 ? 16.452  4.741   5.109   1.00   22.70 ? 571 TYR A N     1 
ATOM   3533  C  CA    . TYR A  1 464 ? 16.834  5.258   6.423   1.00   24.43 ? 571 TYR A CA    1 
ATOM   3534  C  C     . TYR A  1 464 ? 15.545  5.288   7.247   1.00   25.07 ? 571 TYR A C     1 
ATOM   3535  O  O     . TYR A  1 464 ? 14.457  5.495   6.694   1.00   25.62 ? 571 TYR A O     1 
ATOM   3536  C  CB    . TYR A  1 464 ? 17.387  6.685   6.309   1.00   22.57 ? 571 TYR A CB    1 
ATOM   3537  C  CG    . TYR A  1 464 ? 18.730  6.785   5.629   1.00   21.74 ? 571 TYR A CG    1 
ATOM   3538  C  CD1   . TYR A  1 464 ? 19.911  6.569   6.341   1.00   21.49 ? 571 TYR A CD1   1 
ATOM   3539  C  CD2   . TYR A  1 464 ? 18.822  7.081   4.268   1.00   20.52 ? 571 TYR A CD2   1 
ATOM   3540  C  CE1   . TYR A  1 464 ? 21.150  6.644   5.719   1.00   21.92 ? 571 TYR A CE1   1 
ATOM   3541  C  CE2   . TYR A  1 464 ? 20.059  7.161   3.631   1.00   22.07 ? 571 TYR A CE2   1 
ATOM   3542  C  CZ    . TYR A  1 464 ? 21.223  6.940   4.362   1.00   24.36 ? 571 TYR A CZ    1 
ATOM   3543  O  OH    . TYR A  1 464 ? 22.456  7.012   3.740   1.00   25.27 ? 571 TYR A OH    1 
ATOM   3544  N  N     . GLY A  1 465 ? 15.645  5.071   8.552   1.00   22.92 ? 572 GLY A N     1 
ATOM   3545  C  CA    . GLY A  1 465 ? 14.438  5.114   9.349   1.00   22.07 ? 572 GLY A CA    1 
ATOM   3546  C  C     . GLY A  1 465 ? 14.484  4.369   10.664  1.00   23.62 ? 572 GLY A C     1 
ATOM   3547  O  O     . GLY A  1 465 ? 15.561  4.006   11.159  1.00   23.31 ? 572 GLY A O     1 
ATOM   3548  N  N     . THR A  1 466 ? 13.295  4.136   11.225  1.00   23.07 ? 573 THR A N     1 
ATOM   3549  C  CA    . THR A  1 466 ? 13.146  3.445   12.502  1.00   21.50 ? 573 THR A CA    1 
ATOM   3550  C  C     . THR A  1 466 ? 12.162  2.277   12.467  1.00   23.08 ? 573 THR A C     1 
ATOM   3551  O  O     . THR A  1 466 ? 11.515  2.002   11.451  1.00   19.91 ? 573 THR A O     1 
ATOM   3552  C  CB    . THR A  1 466 ? 12.645  4.396   13.564  1.00   18.20 ? 573 THR A CB    1 
ATOM   3553  O  OG1   . THR A  1 466 ? 11.360  4.874   13.163  1.00   19.90 ? 573 THR A OG1   1 
ATOM   3554  C  CG2   . THR A  1 466 ? 13.613  5.570   13.750  1.00   15.86 ? 573 THR A CG2   1 
ATOM   3555  N  N     . ALA A  1 467 ? 12.056  1.610   13.614  1.00   26.07 ? 574 ALA A N     1 
ATOM   3556  C  CA    . ALA A  1 467 ? 11.175  0.463   13.800  1.00   28.27 ? 574 ALA A CA    1 
ATOM   3557  C  C     . ALA A  1 467 ? 10.311  0.665   15.058  1.00   32.55 ? 574 ALA A C     1 
ATOM   3558  O  O     . ALA A  1 467 ? 10.047  1.838   15.419  1.00   34.10 ? 574 ALA A O     1 
ATOM   3559  C  CB    . ALA A  1 467 ? 12.005  -0.802  13.931  1.00   26.27 ? 574 ALA A CB    1 
ATOM   3560  N  N     . TYR B  1 3   ? 48.196  -19.714 37.152  1.00   41.74 ? 110 TYR B N     1 
ATOM   3561  C  CA    . TYR B  1 3   ? 47.591  -19.820 35.787  1.00   41.50 ? 110 TYR B CA    1 
ATOM   3562  C  C     . TYR B  1 3   ? 48.137  -21.030 35.046  1.00   41.45 ? 110 TYR B C     1 
ATOM   3563  O  O     . TYR B  1 3   ? 49.352  -21.157 34.856  1.00   40.41 ? 110 TYR B O     1 
ATOM   3564  C  CB    . TYR B  1 3   ? 47.890  -18.570 34.936  1.00   40.06 ? 110 TYR B CB    1 
ATOM   3565  C  CG    . TYR B  1 3   ? 47.443  -18.711 33.488  1.00   38.52 ? 110 TYR B CG    1 
ATOM   3566  C  CD1   . TYR B  1 3   ? 46.086  -18.701 33.158  1.00   36.30 ? 110 TYR B CD1   1 
ATOM   3567  C  CD2   . TYR B  1 3   ? 48.370  -18.969 32.465  1.00   35.30 ? 110 TYR B CD2   1 
ATOM   3568  C  CE1   . TYR B  1 3   ? 45.658  -18.954 31.856  1.00   35.26 ? 110 TYR B CE1   1 
ATOM   3569  C  CE2   . TYR B  1 3   ? 47.951  -19.226 31.160  1.00   33.83 ? 110 TYR B CE2   1 
ATOM   3570  C  CZ    . TYR B  1 3   ? 46.591  -19.223 30.864  1.00   35.68 ? 110 TYR B CZ    1 
ATOM   3571  O  OH    . TYR B  1 3   ? 46.156  -19.522 29.591  1.00   36.55 ? 110 TYR B OH    1 
ATOM   3572  N  N     . GLN B  1 4   ? 47.239  -21.906 34.610  1.00   40.76 ? 111 GLN B N     1 
ATOM   3573  C  CA    . GLN B  1 4   ? 47.648  -23.095 33.874  1.00   40.73 ? 111 GLN B CA    1 
ATOM   3574  C  C     . GLN B  1 4   ? 47.428  -22.823 32.376  1.00   40.29 ? 111 GLN B C     1 
ATOM   3575  O  O     . GLN B  1 4   ? 46.315  -22.475 31.960  1.00   40.80 ? 111 GLN B O     1 
ATOM   3576  C  CB    . GLN B  1 4   ? 46.829  -24.306 34.343  1.00   38.74 ? 111 GLN B CB    1 
ATOM   3577  C  CG    . GLN B  1 4   ? 46.946  -24.595 35.830  0.0000 35.34 ? 111 GLN B CG    1 
ATOM   3578  C  CD    . GLN B  1 4   ? 46.090  -25.769 36.269  0.0000 33.64 ? 111 GLN B CD    1 
ATOM   3579  O  OE1   . GLN B  1 4   ? 44.868  -25.753 36.118  0.0000 32.51 ? 111 GLN B OE1   1 
ATOM   3580  N  NE2   . GLN B  1 4   ? 46.731  -26.797 36.815  0.0000 32.51 ? 111 GLN B NE2   1 
ATOM   3581  N  N     . GLU B  1 5   ? 48.480  -22.977 31.570  1.00   37.79 ? 112 GLU B N     1 
ATOM   3582  C  CA    . GLU B  1 5   ? 48.379  -22.723 30.132  1.00   36.22 ? 112 GLU B CA    1 
ATOM   3583  C  C     . GLU B  1 5   ? 47.629  -23.825 29.377  1.00   34.51 ? 112 GLU B C     1 
ATOM   3584  O  O     . GLU B  1 5   ? 47.554  -24.970 29.826  1.00   33.68 ? 112 GLU B O     1 
ATOM   3585  C  CB    . GLU B  1 5   ? 49.775  -22.522 29.528  1.00   37.11 ? 112 GLU B CB    1 
ATOM   3586  C  CG    . GLU B  1 5   ? 50.599  -23.787 29.371  1.00   36.41 ? 112 GLU B CG    1 
ATOM   3587  C  CD    . GLU B  1 5   ? 51.996  -23.490 28.856  1.00   38.23 ? 112 GLU B CD    1 
ATOM   3588  O  OE1   . GLU B  1 5   ? 52.771  -24.449 28.638  1.00   40.15 ? 112 GLU B OE1   1 
ATOM   3589  O  OE2   . GLU B  1 5   ? 52.317  -22.293 28.671  1.00   36.26 ? 112 GLU B OE2   1 
ATOM   3590  N  N     . PRO B  1 6   ? 47.059  -23.482 28.212  1.00   34.01 ? 113 PRO B N     1 
ATOM   3591  C  CA    . PRO B  1 6   ? 46.305  -24.427 27.384  1.00   33.05 ? 113 PRO B CA    1 
ATOM   3592  C  C     . PRO B  1 6   ? 46.925  -25.812 27.242  1.00   31.64 ? 113 PRO B C     1 
ATOM   3593  O  O     . PRO B  1 6   ? 48.135  -25.956 27.117  1.00   33.33 ? 113 PRO B O     1 
ATOM   3594  C  CB    . PRO B  1 6   ? 46.199  -23.694 26.055  1.00   32.05 ? 113 PRO B CB    1 
ATOM   3595  C  CG    . PRO B  1 6   ? 46.037  -22.276 26.509  1.00   31.10 ? 113 PRO B CG    1 
ATOM   3596  C  CD    . PRO B  1 6   ? 47.089  -22.149 27.584  1.00   31.58 ? 113 PRO B CD    1 
ATOM   3597  N  N     . THR B  1 7   ? 46.076  -26.833 27.256  1.00   30.22 ? 114 THR B N     1 
ATOM   3598  C  CA    . THR B  1 7   ? 46.542  -28.207 27.125  1.00   27.53 ? 114 THR B CA    1 
ATOM   3599  C  C     . THR B  1 7   ? 46.309  -28.753 25.724  1.00   27.85 ? 114 THR B C     1 
ATOM   3600  O  O     . THR B  1 7   ? 46.613  -29.911 25.458  1.00   27.02 ? 114 THR B O     1 
ATOM   3601  C  CB    . THR B  1 7   ? 45.828  -29.139 28.114  1.00   24.36 ? 114 THR B CB    1 
ATOM   3602  O  OG1   . THR B  1 7   ? 44.411  -29.068 27.907  1.00   21.37 ? 114 THR B OG1   1 
ATOM   3603  C  CG2   . THR B  1 7   ? 46.160  -28.753 29.533  1.00   20.12 ? 114 THR B CG2   1 
ATOM   3604  N  N     . ASP B  1 8   ? 45.766  -27.921 24.836  1.00   28.55 ? 115 ASP B N     1 
ATOM   3605  C  CA    . ASP B  1 8   ? 45.481  -28.339 23.468  1.00   28.79 ? 115 ASP B CA    1 
ATOM   3606  C  C     . ASP B  1 8   ? 46.702  -28.968 22.831  1.00   28.54 ? 115 ASP B C     1 
ATOM   3607  O  O     . ASP B  1 8   ? 47.826  -28.523 23.054  1.00   31.78 ? 115 ASP B O     1 
ATOM   3608  C  CB    . ASP B  1 8   ? 45.000  -27.153 22.641  1.00   29.88 ? 115 ASP B CB    1 
ATOM   3609  C  CG    . ASP B  1 8   ? 43.741  -26.544 23.204  1.00   29.93 ? 115 ASP B CG    1 
ATOM   3610  O  OD1   . ASP B  1 8   ? 43.814  -25.966 24.304  1.00   29.99 ? 115 ASP B OD1   1 
ATOM   3611  O  OD2   . ASP B  1 8   ? 42.675  -26.659 22.564  1.00   30.89 ? 115 ASP B OD2   1 
ATOM   3612  N  N     . PRO B  1 9   ? 46.494  -30.016 22.022  1.00   27.68 ? 116 PRO B N     1 
ATOM   3613  C  CA    . PRO B  1 9   ? 47.588  -30.724 21.350  1.00   27.62 ? 116 PRO B CA    1 
ATOM   3614  C  C     . PRO B  1 9   ? 48.535  -29.869 20.520  1.00   27.37 ? 116 PRO B C     1 
ATOM   3615  O  O     . PRO B  1 9   ? 49.744  -30.124 20.504  1.00   23.83 ? 116 PRO B O     1 
ATOM   3616  C  CB    . PRO B  1 9   ? 46.860  -31.777 20.513  1.00   27.30 ? 116 PRO B CB    1 
ATOM   3617  C  CG    . PRO B  1 9   ? 45.519  -31.150 20.257  1.00   29.24 ? 116 PRO B CG    1 
ATOM   3618  C  CD    . PRO B  1 9   ? 45.185  -30.541 21.594  1.00   29.22 ? 116 PRO B CD    1 
ATOM   3619  N  N     . LYS B  1 10  ? 47.996  -28.852 19.851  1.00   27.04 ? 117 LYS B N     1 
ATOM   3620  C  CA    . LYS B  1 10  ? 48.817  -27.994 19.004  1.00   27.74 ? 117 LYS B CA    1 
ATOM   3621  C  C     . LYS B  1 10  ? 49.330  -26.697 19.624  1.00   26.40 ? 117 LYS B C     1 
ATOM   3622  O  O     . LYS B  1 10  ? 50.085  -25.966 18.982  1.00   23.81 ? 117 LYS B O     1 
ATOM   3623  C  CB    . LYS B  1 10  ? 48.070  -27.666 17.712  1.00   28.78 ? 117 LYS B CB    1 
ATOM   3624  C  CG    . LYS B  1 10  ? 47.830  -28.881 16.836  1.00   32.69 ? 117 LYS B CG    1 
ATOM   3625  C  CD    . LYS B  1 10  ? 49.143  -29.563 16.501  1.00   36.35 ? 117 LYS B CD    1 
ATOM   3626  C  CE    . LYS B  1 10  ? 48.947  -30.710 15.528  1.00   41.60 ? 117 LYS B CE    1 
ATOM   3627  N  NZ    . LYS B  1 10  ? 50.260  -31.332 15.178  1.00   43.71 ? 117 LYS B NZ    1 
ATOM   3628  N  N     . PHE B  1 11  ? 48.936  -26.410 20.862  1.00   26.64 ? 118 PHE B N     1 
ATOM   3629  C  CA    . PHE B  1 11  ? 49.384  -25.191 21.530  1.00   27.45 ? 118 PHE B CA    1 
ATOM   3630  C  C     . PHE B  1 11  ? 50.915  -25.056 21.522  1.00   28.85 ? 118 PHE B C     1 
ATOM   3631  O  O     . PHE B  1 11  ? 51.453  -23.979 21.264  1.00   29.83 ? 118 PHE B O     1 
ATOM   3632  C  CB    . PHE B  1 11  ? 48.879  -25.149 22.976  1.00   25.49 ? 118 PHE B CB    1 
ATOM   3633  C  CG    . PHE B  1 11  ? 49.300  -23.921 23.720  1.00   25.04 ? 118 PHE B CG    1 
ATOM   3634  C  CD1   . PHE B  1 11  ? 48.802  -22.670 23.367  1.00   27.45 ? 118 PHE B CD1   1 
ATOM   3635  C  CD2   . PHE B  1 11  ? 50.236  -24.000 24.741  1.00   25.33 ? 118 PHE B CD2   1 
ATOM   3636  C  CE1   . PHE B  1 11  ? 49.234  -21.513 24.024  1.00   25.01 ? 118 PHE B CE1   1 
ATOM   3637  C  CE2   . PHE B  1 11  ? 50.674  -22.851 25.401  1.00   24.94 ? 118 PHE B CE2   1 
ATOM   3638  C  CZ    . PHE B  1 11  ? 50.172  -21.610 25.039  1.00   24.23 ? 118 PHE B CZ    1 
ATOM   3639  N  N     . PRO B  1 12  ? 51.638  -26.145 21.824  1.00   29.75 ? 119 PRO B N     1 
ATOM   3640  C  CA    . PRO B  1 12  ? 53.101  -26.074 21.828  1.00   30.36 ? 119 PRO B CA    1 
ATOM   3641  C  C     . PRO B  1 12  ? 53.695  -25.605 20.498  1.00   31.77 ? 119 PRO B C     1 
ATOM   3642  O  O     . PRO B  1 12  ? 54.822  -25.114 20.467  1.00   32.32 ? 119 PRO B O     1 
ATOM   3643  C  CB    . PRO B  1 12  ? 53.507  -27.500 22.171  1.00   29.74 ? 119 PRO B CB    1 
ATOM   3644  C  CG    . PRO B  1 12  ? 52.405  -27.917 23.086  1.00   29.68 ? 119 PRO B CG    1 
ATOM   3645  C  CD    . PRO B  1 12  ? 51.184  -27.440 22.353  1.00   28.45 ? 119 PRO B CD    1 
ATOM   3646  N  N     . GLN B  1 13  ? 52.949  -25.757 19.405  1.00   31.61 ? 120 GLN B N     1 
ATOM   3647  C  CA    . GLN B  1 13  ? 53.448  -25.331 18.100  1.00   32.20 ? 120 GLN B CA    1 
ATOM   3648  C  C     . GLN B  1 13  ? 53.052  -23.893 17.761  1.00   30.88 ? 120 GLN B C     1 
ATOM   3649  O  O     . GLN B  1 13  ? 53.434  -23.359 16.713  1.00   27.64 ? 120 GLN B O     1 
ATOM   3650  C  CB    . GLN B  1 13  ? 52.964  -26.279 16.999  1.00   36.81 ? 120 GLN B CB    1 
ATOM   3651  C  CG    . GLN B  1 13  ? 53.610  -27.646 17.054  1.00   44.09 ? 120 GLN B CG    1 
ATOM   3652  C  CD    . GLN B  1 13  ? 52.738  -28.664 17.763  1.00   51.48 ? 120 GLN B CD    1 
ATOM   3653  O  OE1   . GLN B  1 13  ? 51.796  -29.207 17.176  1.00   55.01 ? 120 GLN B OE1   1 
ATOM   3654  N  NE2   . GLN B  1 13  ? 53.037  -28.922 19.040  1.00   53.13 ? 120 GLN B NE2   1 
ATOM   3655  N  N     . GLN B  1 14  ? 52.283  -23.269 18.648  1.00   28.03 ? 121 GLN B N     1 
ATOM   3656  C  CA    . GLN B  1 14  ? 51.858  -21.898 18.434  1.00   25.72 ? 121 GLN B CA    1 
ATOM   3657  C  C     . GLN B  1 14  ? 52.900  -20.965 19.045  1.00   26.59 ? 121 GLN B C     1 
ATOM   3658  O  O     . GLN B  1 14  ? 52.638  -20.207 19.980  1.00   26.67 ? 121 GLN B O     1 
ATOM   3659  C  CB    . GLN B  1 14  ? 50.467  -21.688 19.029  1.00   24.64 ? 121 GLN B CB    1 
ATOM   3660  C  CG    . GLN B  1 14  ? 49.417  -22.529 18.311  1.00   27.20 ? 121 GLN B CG    1 
ATOM   3661  C  CD    . GLN B  1 14  ? 47.987  -22.262 18.759  1.00   29.52 ? 121 GLN B CD    1 
ATOM   3662  O  OE1   . GLN B  1 14  ? 47.602  -22.557 19.896  1.00   30.46 ? 121 GLN B OE1   1 
ATOM   3663  N  NE2   . GLN B  1 14  ? 47.189  -21.711 17.857  1.00   28.73 ? 121 GLN B NE2   1 
ATOM   3664  N  N     . TRP B  1 15  ? 54.098  -21.043 18.479  1.00   27.27 ? 122 TRP B N     1 
ATOM   3665  C  CA    . TRP B  1 15  ? 55.254  -20.261 18.899  1.00   26.22 ? 122 TRP B CA    1 
ATOM   3666  C  C     . TRP B  1 15  ? 54.998  -18.776 19.094  1.00   26.75 ? 122 TRP B C     1 
ATOM   3667  O  O     . TRP B  1 15  ? 55.600  -18.149 19.960  1.00   31.31 ? 122 TRP B O     1 
ATOM   3668  C  CB    . TRP B  1 15  ? 56.381  -20.421 17.876  1.00   24.94 ? 122 TRP B CB    1 
ATOM   3669  C  CG    . TRP B  1 15  ? 55.965  -20.063 16.483  1.00   23.82 ? 122 TRP B CG    1 
ATOM   3670  C  CD1   . TRP B  1 15  ? 55.266  -20.842 15.611  1.00   23.56 ? 122 TRP B CD1   1 
ATOM   3671  C  CD2   . TRP B  1 15  ? 56.178  -18.815 15.821  1.00   23.68 ? 122 TRP B CD2   1 
ATOM   3672  N  NE1   . TRP B  1 15  ? 55.027  -20.160 14.446  1.00   23.30 ? 122 TRP B NE1   1 
ATOM   3673  C  CE2   . TRP B  1 15  ? 55.576  -18.911 14.547  1.00   25.55 ? 122 TRP B CE2   1 
ATOM   3674  C  CE3   . TRP B  1 15  ? 56.819  -17.624 16.177  1.00   22.81 ? 122 TRP B CE3   1 
ATOM   3675  C  CZ2   . TRP B  1 15  ? 55.596  -17.858 13.625  1.00   26.26 ? 122 TRP B CZ2   1 
ATOM   3676  C  CZ3   . TRP B  1 15  ? 56.842  -16.576 15.261  1.00   26.32 ? 122 TRP B CZ3   1 
ATOM   3677  C  CH2   . TRP B  1 15  ? 56.233  -16.702 13.998  1.00   24.31 ? 122 TRP B CH2   1 
ATOM   3678  N  N     . TYR B  1 16  ? 54.131  -18.210 18.267  1.00   27.56 ? 123 TYR B N     1 
ATOM   3679  C  CA    . TYR B  1 16  ? 53.820  -16.786 18.330  1.00   26.50 ? 123 TYR B CA    1 
ATOM   3680  C  C     . TYR B  1 16  ? 53.015  -16.361 19.554  1.00   28.69 ? 123 TYR B C     1 
ATOM   3681  O  O     . TYR B  1 16  ? 53.040  -15.192 19.929  1.00   29.79 ? 123 TYR B O     1 
ATOM   3682  C  CB    . TYR B  1 16  ? 53.072  -16.361 17.060  1.00   25.86 ? 123 TYR B CB    1 
ATOM   3683  C  CG    . TYR B  1 16  ? 51.961  -17.312 16.650  1.00   23.32 ? 123 TYR B CG    1 
ATOM   3684  C  CD1   . TYR B  1 16  ? 52.235  -18.457 15.901  1.00   23.12 ? 123 TYR B CD1   1 
ATOM   3685  C  CD2   . TYR B  1 16  ? 50.649  -17.093 17.049  1.00   23.11 ? 123 TYR B CD2   1 
ATOM   3686  C  CE1   . TYR B  1 16  ? 51.226  -19.358 15.563  1.00   23.27 ? 123 TYR B CE1   1 
ATOM   3687  C  CE2   . TYR B  1 16  ? 49.633  -17.993 16.719  1.00   24.02 ? 123 TYR B CE2   1 
ATOM   3688  C  CZ    . TYR B  1 16  ? 49.929  -19.119 15.976  1.00   21.10 ? 123 TYR B CZ    1 
ATOM   3689  O  OH    . TYR B  1 16  ? 48.920  -19.992 15.636  1.00   18.30 ? 123 TYR B OH    1 
ATOM   3690  N  N     . LEU B  1 17  ? 52.293  -17.294 20.168  1.00   31.41 ? 124 LEU B N     1 
ATOM   3691  C  CA    . LEU B  1 17  ? 51.489  -16.975 21.346  1.00   33.29 ? 124 LEU B CA    1 
ATOM   3692  C  C     . LEU B  1 17  ? 52.339  -16.968 22.609  1.00   38.10 ? 124 LEU B C     1 
ATOM   3693  O  O     . LEU B  1 17  ? 52.271  -16.030 23.415  1.00   39.11 ? 124 LEU B O     1 
ATOM   3694  C  CB    . LEU B  1 17  ? 50.362  -17.989 21.514  1.00   29.20 ? 124 LEU B CB    1 
ATOM   3695  C  CG    . LEU B  1 17  ? 49.305  -17.998 20.419  1.00   28.57 ? 124 LEU B CG    1 
ATOM   3696  C  CD1   . LEU B  1 17  ? 48.268  -19.069 20.714  1.00   26.37 ? 124 LEU B CD1   1 
ATOM   3697  C  CD2   . LEU B  1 17  ? 48.651  -16.632 20.338  1.00   27.93 ? 124 LEU B CD2   1 
ATOM   3698  N  N     . SER B  1 18  ? 53.139  -18.019 22.777  1.00   41.93 ? 125 SER B N     1 
ATOM   3699  C  CA    . SER B  1 18  ? 54.007  -18.151 23.941  1.00   45.00 ? 125 SER B CA    1 
ATOM   3700  C  C     . SER B  1 18  ? 55.233  -18.968 23.575  1.00   46.90 ? 125 SER B C     1 
ATOM   3701  O  O     . SER B  1 18  ? 55.122  -20.000 22.907  1.00   47.13 ? 125 SER B O     1 
ATOM   3702  C  CB    . SER B  1 18  ? 53.264  -18.843 25.085  1.00   46.73 ? 125 SER B CB    1 
ATOM   3703  O  OG    . SER B  1 18  ? 54.126  -19.061 26.188  1.00   48.36 ? 125 SER B OG    1 
ATOM   3704  N  N     . GLY B  1 19  ? 56.399  -18.507 24.013  1.00   49.76 ? 126 GLY B N     1 
ATOM   3705  C  CA    . GLY B  1 19  ? 57.624  -19.221 23.710  1.00   52.44 ? 126 GLY B CA    1 
ATOM   3706  C  C     . GLY B  1 19  ? 58.788  -18.844 24.613  1.00   53.70 ? 126 GLY B C     1 
ATOM   3707  O  O     . GLY B  1 19  ? 58.905  -17.689 25.058  1.00   53.78 ? 126 GLY B O     1 
ATOM   3708  N  N     . VAL B  1 20  ? 59.648  -19.825 24.891  1.00   54.55 ? 127 VAL B N     1 
ATOM   3709  C  CA    . VAL B  1 20  ? 60.819  -19.604 25.732  1.00   53.41 ? 127 VAL B CA    1 
ATOM   3710  C  C     . VAL B  1 20  ? 61.655  -18.485 25.102  1.00   53.87 ? 127 VAL B C     1 
ATOM   3711  O  O     . VAL B  1 20  ? 62.073  -17.547 25.790  1.00   53.27 ? 127 VAL B O     1 
ATOM   3712  C  CB    . VAL B  1 20  ? 61.675  -20.895 25.859  1.00   50.74 ? 127 VAL B CB    1 
ATOM   3713  C  CG1   . VAL B  1 20  ? 60.890  -21.965 26.601  0.0000 50.38 ? 127 VAL B CG1   1 
ATOM   3714  C  CG2   . VAL B  1 20  ? 62.076  -21.395 24.479  0.0000 50.38 ? 127 VAL B CG2   1 
ATOM   3715  N  N     . THR B  1 21  ? 61.852  -18.584 23.785  1.00   53.64 ? 128 THR B N     1 
ATOM   3716  C  CA    . THR B  1 21  ? 62.638  -17.630 23.004  1.00   52.89 ? 128 THR B CA    1 
ATOM   3717  C  C     . THR B  1 21  ? 62.291  -16.146 23.188  1.00   53.42 ? 128 THR B C     1 
ATOM   3718  O  O     . THR B  1 21  ? 62.936  -15.281 22.575  1.00   55.89 ? 128 THR B O     1 
ATOM   3719  C  CB    . THR B  1 21  ? 62.564  -17.965 21.495  1.00   52.01 ? 128 THR B CB    1 
ATOM   3720  O  OG1   . THR B  1 21  ? 63.373  -17.043 20.755  0.0000 51.12 ? 128 THR B OG1   1 
ATOM   3721  C  CG2   . THR B  1 21  ? 61.128  -17.883 21.001  0.0000 51.12 ? 128 THR B CG2   1 
ATOM   3722  N  N     . GLN B  1 22  ? 61.277  -15.849 24.003  1.00   51.85 ? 129 GLN B N     1 
ATOM   3723  C  CA    . GLN B  1 22  ? 60.877  -14.463 24.266  1.00   50.24 ? 129 GLN B CA    1 
ATOM   3724  C  C     . GLN B  1 22  ? 60.656  -13.649 22.969  1.00   50.77 ? 129 GLN B C     1 
ATOM   3725  O  O     . GLN B  1 22  ? 60.693  -12.404 22.978  1.00   52.04 ? 129 GLN B O     1 
ATOM   3726  C  CB    . GLN B  1 22  ? 61.936  -13.778 25.145  1.00   46.24 ? 129 GLN B CB    1 
ATOM   3727  C  CG    . GLN B  1 22  ? 61.502  -12.464 25.770  0.0000 41.19 ? 129 GLN B CG    1 
ATOM   3728  C  CD    . GLN B  1 22  ? 60.505  -12.650 26.897  0.0000 38.53 ? 129 GLN B CD    1 
ATOM   3729  O  OE1   . GLN B  1 22  ? 60.036  -11.678 27.489  0.0000 36.85 ? 129 GLN B OE1   1 
ATOM   3730  N  NE2   . GLN B  1 22  ? 60.179  -13.900 27.201  0.0000 36.85 ? 129 GLN B NE2   1 
ATOM   3731  N  N     . ARG B  1 23  ? 60.435  -14.359 21.862  1.00   47.98 ? 130 ARG B N     1 
ATOM   3732  C  CA    . ARG B  1 23  ? 60.180  -13.732 20.566  1.00   42.48 ? 130 ARG B CA    1 
ATOM   3733  C  C     . ARG B  1 23  ? 58.744  -14.129 20.197  1.00   40.85 ? 130 ARG B C     1 
ATOM   3734  O  O     . ARG B  1 23  ? 58.528  -14.959 19.306  1.00   39.73 ? 130 ARG B O     1 
ATOM   3735  C  CB    . ARG B  1 23  ? 61.155  -14.268 19.518  1.00   39.89 ? 130 ARG B CB    1 
ATOM   3736  C  CG    . ARG B  1 23  ? 62.622  -14.031 19.821  0.0000 36.33 ? 130 ARG B CG    1 
ATOM   3737  C  CD    . ARG B  1 23  ? 62.960  -12.550 19.831  0.0000 32.94 ? 130 ARG B CD    1 
ATOM   3738  N  NE    . ARG B  1 23  ? 64.401  -12.312 19.877  0.0000 29.55 ? 130 ARG B NE    1 
ATOM   3739  C  CZ    . ARG B  1 23  ? 65.201  -12.720 20.857  0.0000 27.76 ? 130 ARG B CZ    1 
ATOM   3740  N  NH1   . ARG B  1 23  ? 64.707  -13.392 21.888  0.0000 26.51 ? 130 ARG B NH1   1 
ATOM   3741  N  NH2   . ARG B  1 23  ? 66.499  -12.453 20.807  0.0000 26.51 ? 130 ARG B NH2   1 
ATOM   3742  N  N     . ASP B  1 24  ? 57.776  -13.553 20.915  1.00   37.55 ? 131 ASP B N     1 
ATOM   3743  C  CA    . ASP B  1 24  ? 56.356  -13.844 20.704  1.00   33.53 ? 131 ASP B CA    1 
ATOM   3744  C  C     . ASP B  1 24  ? 55.477  -12.608 20.952  1.00   31.18 ? 131 ASP B C     1 
ATOM   3745  O  O     . ASP B  1 24  ? 55.984  -11.520 21.231  1.00   27.32 ? 131 ASP B O     1 
ATOM   3746  C  CB    . ASP B  1 24  ? 55.914  -14.989 21.625  1.00   33.28 ? 131 ASP B CB    1 
ATOM   3747  C  CG    . ASP B  1 24  ? 56.161  -14.684 23.093  1.00   33.24 ? 131 ASP B CG    1 
ATOM   3748  O  OD1   . ASP B  1 24  ? 55.550  -13.722 23.616  1.00   32.17 ? 131 ASP B OD1   1 
ATOM   3749  O  OD2   . ASP B  1 24  ? 56.970  -15.401 23.719  1.00   32.82 ? 131 ASP B OD2   1 
ATOM   3750  N  N     . LEU B  1 25  ? 54.160  -12.783 20.852  1.00   28.86 ? 132 LEU B N     1 
ATOM   3751  C  CA    . LEU B  1 25  ? 53.221  -11.682 21.045  1.00   26.02 ? 132 LEU B CA    1 
ATOM   3752  C  C     . LEU B  1 25  ? 52.870  -11.458 22.513  1.00   25.98 ? 132 LEU B C     1 
ATOM   3753  O  O     . LEU B  1 25  ? 52.008  -10.638 22.844  1.00   25.02 ? 132 LEU B O     1 
ATOM   3754  C  CB    . LEU B  1 25  ? 51.954  -11.927 20.222  1.00   23.30 ? 132 LEU B CB    1 
ATOM   3755  C  CG    . LEU B  1 25  ? 52.215  -11.981 18.720  1.00   18.71 ? 132 LEU B CG    1 
ATOM   3756  C  CD1   . LEU B  1 25  ? 50.941  -12.260 17.988  1.00   17.00 ? 132 LEU B CD1   1 
ATOM   3757  C  CD2   . LEU B  1 25  ? 52.801  -10.663 18.264  1.00   18.38 ? 132 LEU B CD2   1 
ATOM   3758  N  N     . ASN B  1 26  ? 53.542  -12.196 23.390  1.00   24.63 ? 133 ASN B N     1 
ATOM   3759  C  CA    . ASN B  1 26  ? 53.336  -12.066 24.831  1.00   22.33 ? 133 ASN B CA    1 
ATOM   3760  C  C     . ASN B  1 26  ? 51.863  -12.168 25.221  1.00   21.01 ? 133 ASN B C     1 
ATOM   3761  O  O     . ASN B  1 26  ? 51.363  -11.378 26.017  1.00   18.45 ? 133 ASN B O     1 
ATOM   3762  C  CB    . ASN B  1 26  ? 53.915  -10.728 25.290  1.00   20.96 ? 133 ASN B CB    1 
ATOM   3763  C  CG    . ASN B  1 26  ? 54.109  -10.649 26.780  1.00   19.92 ? 133 ASN B CG    1 
ATOM   3764  O  OD1   . ASN B  1 26  ? 54.614  -11.583 27.411  1.00   19.49 ? 133 ASN B OD1   1 
ATOM   3765  N  ND2   . ASN B  1 26  ? 53.736  -9.515  27.353  1.00   15.57 ? 133 ASN B ND2   1 
ATOM   3766  N  N     . VAL B  1 27  ? 51.183  -13.162 24.662  1.00   22.57 ? 134 VAL B N     1 
ATOM   3767  C  CA    . VAL B  1 27  ? 49.765  -13.383 24.923  1.00   24.85 ? 134 VAL B CA    1 
ATOM   3768  C  C     . VAL B  1 27  ? 49.512  -14.090 26.255  1.00   26.89 ? 134 VAL B C     1 
ATOM   3769  O  O     . VAL B  1 27  ? 48.547  -13.779 26.961  1.00   26.73 ? 134 VAL B O     1 
ATOM   3770  C  CB    . VAL B  1 27  ? 49.125  -14.206 23.788  1.00   23.63 ? 134 VAL B CB    1 
ATOM   3771  C  CG1   . VAL B  1 27  ? 47.688  -14.520 24.126  1.00   23.36 ? 134 VAL B CG1   1 
ATOM   3772  C  CG2   . VAL B  1 27  ? 49.212  -13.434 22.480  1.00   22.86 ? 134 VAL B CG2   1 
ATOM   3773  N  N     . LYS B  1 28  ? 50.379  -15.037 26.597  1.00   27.28 ? 135 LYS B N     1 
ATOM   3774  C  CA    . LYS B  1 28  ? 50.234  -15.762 27.845  1.00   26.72 ? 135 LYS B CA    1 
ATOM   3775  C  C     . LYS B  1 28  ? 50.247  -14.782 29.026  1.00   26.93 ? 135 LYS B C     1 
ATOM   3776  O  O     . LYS B  1 28  ? 49.516  -14.960 30.005  1.00   25.60 ? 135 LYS B O     1 
ATOM   3777  C  CB    . LYS B  1 28  ? 51.360  -16.787 27.979  1.00   30.08 ? 135 LYS B CB    1 
ATOM   3778  C  CG    . LYS B  1 28  ? 51.237  -17.675 29.202  1.00   34.37 ? 135 LYS B CG    1 
ATOM   3779  C  CD    . LYS B  1 28  ? 52.303  -18.749 29.218  1.00   36.35 ? 135 LYS B CD    1 
ATOM   3780  C  CE    . LYS B  1 28  ? 52.178  -19.589 30.472  1.00   39.18 ? 135 LYS B CE    1 
ATOM   3781  N  NZ    . LYS B  1 28  ? 53.222  -20.650 30.537  1.00   40.61 ? 135 LYS B NZ    1 
ATOM   3782  N  N     . ALA B  1 29  ? 51.071  -13.740 28.924  1.00   26.63 ? 136 ALA B N     1 
ATOM   3783  C  CA    . ALA B  1 29  ? 51.164  -12.725 29.968  1.00   24.38 ? 136 ALA B CA    1 
ATOM   3784  C  C     . ALA B  1 29  ? 49.805  -12.053 30.182  1.00   26.70 ? 136 ALA B C     1 
ATOM   3785  O  O     . ALA B  1 29  ? 49.472  -11.642 31.297  1.00   27.56 ? 136 ALA B O     1 
ATOM   3786  C  CB    . ALA B  1 29  ? 52.200  -11.691 29.595  1.00   19.64 ? 136 ALA B CB    1 
ATOM   3787  N  N     . ALA B  1 30  ? 49.020  -11.941 29.113  1.00   26.98 ? 137 ALA B N     1 
ATOM   3788  C  CA    . ALA B  1 30  ? 47.704  -11.327 29.212  1.00   29.08 ? 137 ALA B CA    1 
ATOM   3789  C  C     . ALA B  1 30  ? 46.724  -12.315 29.834  1.00   30.01 ? 137 ALA B C     1 
ATOM   3790  O  O     . ALA B  1 30  ? 45.880  -11.934 30.649  1.00   32.33 ? 137 ALA B O     1 
ATOM   3791  C  CB    . ALA B  1 30  ? 47.209  -10.889 27.840  1.00   27.12 ? 137 ALA B CB    1 
ATOM   3792  N  N     . TRP B  1 31  ? 46.824  -13.581 29.446  1.00   29.94 ? 138 TRP B N     1 
ATOM   3793  C  CA    . TRP B  1 31  ? 45.940  -14.600 30.009  1.00   31.28 ? 138 TRP B CA    1 
ATOM   3794  C  C     . TRP B  1 31  ? 46.161  -14.655 31.523  1.00   30.91 ? 138 TRP B C     1 
ATOM   3795  O  O     . TRP B  1 31  ? 45.206  -14.717 32.302  1.00   29.55 ? 138 TRP B O     1 
ATOM   3796  C  CB    . TRP B  1 31  ? 46.237  -15.985 29.421  1.00   29.72 ? 138 TRP B CB    1 
ATOM   3797  C  CG    . TRP B  1 31  ? 45.951  -16.121 27.968  1.00   29.61 ? 138 TRP B CG    1 
ATOM   3798  C  CD1   . TRP B  1 31  ? 45.040  -15.412 27.243  1.00   28.88 ? 138 TRP B CD1   1 
ATOM   3799  C  CD2   . TRP B  1 31  ? 46.525  -17.079 27.067  1.00   30.97 ? 138 TRP B CD2   1 
ATOM   3800  N  NE1   . TRP B  1 31  ? 45.006  -15.868 25.949  1.00   29.34 ? 138 TRP B NE1   1 
ATOM   3801  C  CE2   . TRP B  1 31  ? 45.906  -16.890 25.809  1.00   30.72 ? 138 TRP B CE2   1 
ATOM   3802  C  CE3   . TRP B  1 31  ? 47.501  -18.078 27.199  1.00   30.18 ? 138 TRP B CE3   1 
ATOM   3803  C  CZ2   . TRP B  1 31  ? 46.227  -17.670 24.684  1.00   29.24 ? 138 TRP B CZ2   1 
ATOM   3804  C  CZ3   . TRP B  1 31  ? 47.823  -18.858 26.076  1.00   30.33 ? 138 TRP B CZ3   1 
ATOM   3805  C  CH2   . TRP B  1 31  ? 47.185  -18.645 24.836  1.00   28.91 ? 138 TRP B CH2   1 
ATOM   3806  N  N     . ALA B  1 32  ? 47.432  -14.639 31.925  1.00   29.95 ? 139 ALA B N     1 
ATOM   3807  C  CA    . ALA B  1 32  ? 47.809  -14.683 33.337  1.00   28.40 ? 139 ALA B CA    1 
ATOM   3808  C  C     . ALA B  1 32  ? 47.185  -13.533 34.119  1.00   27.59 ? 139 ALA B C     1 
ATOM   3809  O  O     . ALA B  1 32  ? 46.832  -13.693 35.283  1.00   28.14 ? 139 ALA B O     1 
ATOM   3810  C  CB    . ALA B  1 32  ? 49.309  -14.635 33.472  1.00   26.78 ? 139 ALA B CB    1 
ATOM   3811  N  N     . GLN B  1 33  ? 47.061  -12.370 33.487  1.00   26.08 ? 140 GLN B N     1 
ATOM   3812  C  CA    . GLN B  1 33  ? 46.445  -11.219 34.142  1.00   25.08 ? 140 GLN B CA    1 
ATOM   3813  C  C     . GLN B  1 33  ? 44.927  -11.413 34.224  1.00   23.07 ? 140 GLN B C     1 
ATOM   3814  O  O     . GLN B  1 33  ? 44.221  -10.563 34.761  1.00   21.38 ? 140 GLN B O     1 
ATOM   3815  C  CB    . GLN B  1 33  ? 46.780  -9.923  33.386  1.00   24.96 ? 140 GLN B CB    1 
ATOM   3816  C  CG    . GLN B  1 33  ? 48.263  -9.549  33.425  1.00   26.53 ? 140 GLN B CG    1 
ATOM   3817  C  CD    . GLN B  1 33  ? 48.580  -8.226  32.725  1.00   30.16 ? 140 GLN B CD    1 
ATOM   3818  O  OE1   . GLN B  1 33  ? 48.075  -7.161  33.110  1.00   29.19 ? 140 GLN B OE1   1 
ATOM   3819  N  NE2   . GLN B  1 33  ? 49.426  -8.290  31.694  1.00   29.59 ? 140 GLN B NE2   1 
ATOM   3820  N  N     . GLY B  1 34  ? 44.439  -12.529 33.678  1.00   21.52 ? 141 GLY B N     1 
ATOM   3821  C  CA    . GLY B  1 34  ? 43.019  -12.832 33.724  1.00   20.76 ? 141 GLY B CA    1 
ATOM   3822  C  C     . GLY B  1 34  ? 42.179  -12.461 32.519  1.00   23.91 ? 141 GLY B C     1 
ATOM   3823  O  O     . GLY B  1 34  ? 40.951  -12.438 32.608  1.00   26.85 ? 141 GLY B O     1 
ATOM   3824  N  N     . TYR B  1 35  ? 42.810  -12.191 31.381  1.00   25.25 ? 142 TYR B N     1 
ATOM   3825  C  CA    . TYR B  1 35  ? 42.049  -11.801 30.195  1.00   24.47 ? 142 TYR B CA    1 
ATOM   3826  C  C     . TYR B  1 35  ? 42.104  -12.838 29.088  1.00   24.37 ? 142 TYR B C     1 
ATOM   3827  O  O     . TYR B  1 35  ? 43.181  -13.243 28.642  1.00   23.88 ? 142 TYR B O     1 
ATOM   3828  C  CB    . TYR B  1 35  ? 42.548  -10.443 29.695  1.00   24.11 ? 142 TYR B CB    1 
ATOM   3829  C  CG    . TYR B  1 35  ? 42.445  -9.373  30.762  1.00   26.20 ? 142 TYR B CG    1 
ATOM   3830  C  CD1   . TYR B  1 35  ? 41.201  -8.862  31.150  1.00   25.99 ? 142 TYR B CD1   1 
ATOM   3831  C  CD2   . TYR B  1 35  ? 43.579  -8.937  31.452  1.00   25.40 ? 142 TYR B CD2   1 
ATOM   3832  C  CE1   . TYR B  1 35  ? 41.093  -7.950  32.204  1.00   26.33 ? 142 TYR B CE1   1 
ATOM   3833  C  CE2   . TYR B  1 35  ? 43.481  -8.029  32.501  1.00   24.43 ? 142 TYR B CE2   1 
ATOM   3834  C  CZ    . TYR B  1 35  ? 42.236  -7.540  32.875  1.00   27.29 ? 142 TYR B CZ    1 
ATOM   3835  O  OH    . TYR B  1 35  ? 42.126  -6.642  33.915  1.00   29.98 ? 142 TYR B OH    1 
ATOM   3836  N  N     . THR B  1 36  ? 40.925  -13.267 28.652  1.00   26.08 ? 143 THR B N     1 
ATOM   3837  C  CA    . THR B  1 36  ? 40.813  -14.278 27.606  1.00   27.29 ? 143 THR B CA    1 
ATOM   3838  C  C     . THR B  1 36  ? 39.757  -13.937 26.555  1.00   29.03 ? 143 THR B C     1 
ATOM   3839  O  O     . THR B  1 36  ? 39.431  -14.769 25.698  1.00   28.88 ? 143 THR B O     1 
ATOM   3840  C  CB    . THR B  1 36  ? 40.481  -15.657 28.216  1.00   27.36 ? 143 THR B CB    1 
ATOM   3841  O  OG1   . THR B  1 36  ? 39.327  -15.547 29.061  1.00   24.85 ? 143 THR B OG1   1 
ATOM   3842  C  CG2   . THR B  1 36  ? 41.654  -16.175 29.035  1.00   25.27 ? 143 THR B CG2   1 
ATOM   3843  N  N     . GLY B  1 37  ? 39.215  -12.722 26.637  1.00   29.12 ? 144 GLY B N     1 
ATOM   3844  C  CA    . GLY B  1 37  ? 38.218  -12.287 25.675  1.00   31.25 ? 144 GLY B CA    1 
ATOM   3845  C  C     . GLY B  1 37  ? 36.773  -12.510 26.076  1.00   30.85 ? 144 GLY B C     1 
ATOM   3846  O  O     . GLY B  1 37  ? 35.852  -12.287 25.290  1.00   31.66 ? 144 GLY B O     1 
ATOM   3847  N  N     . HIS B  1 38  ? 36.562  -12.947 27.304  1.00   31.79 ? 145 HIS B N     1 
ATOM   3848  C  CA    . HIS B  1 38  ? 35.211  -13.188 27.760  1.00   33.20 ? 145 HIS B CA    1 
ATOM   3849  C  C     . HIS B  1 38  ? 34.336  -11.948 27.572  1.00   30.61 ? 145 HIS B C     1 
ATOM   3850  O  O     . HIS B  1 38  ? 34.714  -10.838 27.950  1.00   31.99 ? 145 HIS B O     1 
ATOM   3851  C  CB    . HIS B  1 38  ? 35.213  -13.592 29.234  1.00   39.26 ? 145 HIS B CB    1 
ATOM   3852  C  CG    . HIS B  1 38  ? 33.859  -13.956 29.758  1.00   46.07 ? 145 HIS B CG    1 
ATOM   3853  N  ND1   . HIS B  1 38  ? 33.278  -15.189 29.534  1.00   48.41 ? 145 HIS B ND1   1 
ATOM   3854  C  CD2   . HIS B  1 38  ? 32.947  -13.230 30.445  1.00   49.04 ? 145 HIS B CD2   1 
ATOM   3855  C  CE1   . HIS B  1 38  ? 32.065  -15.202 30.057  1.00   49.91 ? 145 HIS B CE1   1 
ATOM   3856  N  NE2   . HIS B  1 38  ? 31.838  -14.025 30.616  1.00   52.35 ? 145 HIS B NE2   1 
ATOM   3857  N  N     . GLY B  1 39  ? 33.168  -12.143 26.972  1.00   29.04 ? 146 GLY B N     1 
ATOM   3858  C  CA    . GLY B  1 39  ? 32.246  -11.041 26.769  1.00   26.71 ? 146 GLY B CA    1 
ATOM   3859  C  C     . GLY B  1 39  ? 32.484  -10.161 25.560  1.00   26.71 ? 146 GLY B C     1 
ATOM   3860  O  O     . GLY B  1 39  ? 31.737  -9.210  25.326  1.00   25.70 ? 146 GLY B O     1 
ATOM   3861  N  N     . ILE B  1 40  ? 33.521  -10.459 24.786  1.00   26.03 ? 147 ILE B N     1 
ATOM   3862  C  CA    . ILE B  1 40  ? 33.821  -9.663  23.605  1.00   25.41 ? 147 ILE B CA    1 
ATOM   3863  C  C     . ILE B  1 40  ? 33.387  -10.400 22.340  1.00   25.37 ? 147 ILE B C     1 
ATOM   3864  O  O     . ILE B  1 40  ? 33.570  -11.618 22.229  1.00   27.76 ? 147 ILE B O     1 
ATOM   3865  C  CB    . ILE B  1 40  ? 35.327  -9.348  23.532  1.00   25.58 ? 147 ILE B CB    1 
ATOM   3866  C  CG1   . ILE B  1 40  ? 35.780  -8.718  24.848  1.00   23.63 ? 147 ILE B CG1   1 
ATOM   3867  C  CG2   . ILE B  1 40  ? 35.615  -8.409  22.368  1.00   24.56 ? 147 ILE B CG2   1 
ATOM   3868  C  CD1   . ILE B  1 40  ? 34.987  -7.515  25.251  1.00   22.62 ? 147 ILE B CD1   1 
ATOM   3869  N  N     . VAL B  1 41  ? 32.805  -9.663  21.397  1.00   22.35 ? 148 VAL B N     1 
ATOM   3870  C  CA    . VAL B  1 41  ? 32.341  -10.257 20.146  1.00   20.46 ? 148 VAL B CA    1 
ATOM   3871  C  C     . VAL B  1 41  ? 33.206  -9.840  18.958  1.00   18.15 ? 148 VAL B C     1 
ATOM   3872  O  O     . VAL B  1 41  ? 33.393  -8.650  18.712  1.00   19.54 ? 148 VAL B O     1 
ATOM   3873  C  CB    . VAL B  1 41  ? 30.879  -9.855  19.862  1.00   20.23 ? 148 VAL B CB    1 
ATOM   3874  C  CG1   . VAL B  1 41  ? 30.407  -10.459 18.548  1.00   16.36 ? 148 VAL B CG1   1 
ATOM   3875  C  CG2   . VAL B  1 41  ? 29.992  -10.297 21.018  1.00   19.90 ? 148 VAL B CG2   1 
ATOM   3876  N  N     . VAL B  1 42  ? 33.737  -10.821 18.233  1.00   15.24 ? 149 VAL B N     1 
ATOM   3877  C  CA    . VAL B  1 42  ? 34.577  -10.551 17.067  1.00   15.63 ? 149 VAL B CA    1 
ATOM   3878  C  C     . VAL B  1 42  ? 33.972  -11.200 15.832  1.00   15.79 ? 149 VAL B C     1 
ATOM   3879  O  O     . VAL B  1 42  ? 33.548  -12.353 15.864  1.00   15.07 ? 149 VAL B O     1 
ATOM   3880  C  CB    . VAL B  1 42  ? 36.009  -11.132 17.224  1.00   14.65 ? 149 VAL B CB    1 
ATOM   3881  C  CG1   . VAL B  1 42  ? 36.850  -10.768 16.006  1.00   13.46 ? 149 VAL B CG1   1 
ATOM   3882  C  CG2   . VAL B  1 42  ? 36.656  -10.619 18.481  1.00   13.94 ? 149 VAL B CG2   1 
ATOM   3883  N  N     . SER B  1 43  ? 33.945  -10.466 14.732  1.00   17.41 ? 150 SER B N     1 
ATOM   3884  C  CA    . SER B  1 43  ? 33.396  -11.003 13.499  1.00   17.36 ? 150 SER B CA    1 
ATOM   3885  C  C     . SER B  1 43  ? 34.450  -11.005 12.402  1.00   19.17 ? 150 SER B C     1 
ATOM   3886  O  O     . SER B  1 43  ? 35.147  -10.008 12.196  1.00   20.99 ? 150 SER B O     1 
ATOM   3887  C  CB    . SER B  1 43  ? 32.195  -10.171 13.048  1.00   19.13 ? 150 SER B CB    1 
ATOM   3888  O  OG    . SER B  1 43  ? 31.568  -10.756 11.918  1.00   20.26 ? 150 SER B OG    1 
ATOM   3889  N  N     . ILE B  1 44  ? 34.565  -12.134 11.707  1.00   19.93 ? 151 ILE B N     1 
ATOM   3890  C  CA    . ILE B  1 44  ? 35.519  -12.290 10.613  1.00   17.71 ? 151 ILE B CA    1 
ATOM   3891  C  C     . ILE B  1 44  ? 34.802  -12.058 9.281   1.00   19.49 ? 151 ILE B C     1 
ATOM   3892  O  O     . ILE B  1 44  ? 33.941  -12.853 8.906   1.00   20.33 ? 151 ILE B O     1 
ATOM   3893  C  CB    . ILE B  1 44  ? 36.108  -13.711 10.601  1.00   14.74 ? 151 ILE B CB    1 
ATOM   3894  C  CG1   . ILE B  1 44  ? 36.752  -14.028 11.954  1.00   17.22 ? 151 ILE B CG1   1 
ATOM   3895  C  CG2   . ILE B  1 44  ? 37.119  -13.844 9.482   1.00   14.45 ? 151 ILE B CG2   1 
ATOM   3896  C  CD1   . ILE B  1 44  ? 37.958  -13.173 12.303  1.00   18.95 ? 151 ILE B CD1   1 
ATOM   3897  N  N     . LEU B  1 45  ? 35.139  -10.966 8.586   1.00   21.08 ? 152 LEU B N     1 
ATOM   3898  C  CA    . LEU B  1 45  ? 34.534  -10.651 7.287   1.00   22.19 ? 152 LEU B CA    1 
ATOM   3899  C  C     . LEU B  1 45  ? 35.400  -11.346 6.253   1.00   22.91 ? 152 LEU B C     1 
ATOM   3900  O  O     . LEU B  1 45  ? 36.469  -10.848 5.903   1.00   23.60 ? 152 LEU B O     1 
ATOM   3901  C  CB    . LEU B  1 45  ? 34.529  -9.137  7.035   1.00   21.72 ? 152 LEU B CB    1 
ATOM   3902  C  CG    . LEU B  1 45  ? 34.011  -8.224  8.158   1.00   25.91 ? 152 LEU B CG    1 
ATOM   3903  C  CD1   . LEU B  1 45  ? 33.866  -6.799  7.617   1.00   22.79 ? 152 LEU B CD1   1 
ATOM   3904  C  CD2   . LEU B  1 45  ? 32.665  -8.727  8.700   1.00   25.15 ? 152 LEU B CD2   1 
ATOM   3905  N  N     . ASP B  1 46  ? 34.939  -12.491 5.760   1.00   22.70 ? 153 ASP B N     1 
ATOM   3906  C  CA    . ASP B  1 46  ? 35.736  -13.259 4.812   1.00   23.21 ? 153 ASP B CA    1 
ATOM   3907  C  C     . ASP B  1 46  ? 34.882  -14.097 3.849   1.00   23.17 ? 153 ASP B C     1 
ATOM   3908  O  O     . ASP B  1 46  ? 33.828  -13.647 3.384   1.00   22.57 ? 153 ASP B O     1 
ATOM   3909  C  CB    . ASP B  1 46  ? 36.682  -14.161 5.620   1.00   22.75 ? 153 ASP B CB    1 
ATOM   3910  C  CG    . ASP B  1 46  ? 38.024  -14.350 4.963   1.00   22.01 ? 153 ASP B CG    1 
ATOM   3911  O  OD1   . ASP B  1 46  ? 38.108  -15.083 3.964   1.00   25.16 ? 153 ASP B OD1   1 
ATOM   3912  O  OD2   . ASP B  1 46  ? 39.005  -13.764 5.449   1.00   23.88 ? 153 ASP B OD2   1 
ATOM   3913  N  N     . ASP B  1 47  ? 35.349  -15.309 3.549   1.00   22.53 ? 154 ASP B N     1 
ATOM   3914  C  CA    . ASP B  1 47  ? 34.638  -16.214 2.649   1.00   21.41 ? 154 ASP B CA    1 
ATOM   3915  C  C     . ASP B  1 47  ? 33.778  -17.219 3.404   1.00   21.76 ? 154 ASP B C     1 
ATOM   3916  O  O     . ASP B  1 47  ? 33.402  -18.255 2.864   1.00   23.65 ? 154 ASP B O     1 
ATOM   3917  C  CB    . ASP B  1 47  ? 35.625  -16.972 1.755   1.00   21.07 ? 154 ASP B CB    1 
ATOM   3918  C  CG    . ASP B  1 47  ? 36.579  -17.849 2.549   1.00   22.90 ? 154 ASP B CG    1 
ATOM   3919  O  OD1   . ASP B  1 47  ? 36.357  -18.041 3.769   1.00   21.44 ? 154 ASP B OD1   1 
ATOM   3920  O  OD2   . ASP B  1 47  ? 37.551  -18.353 1.944   1.00   22.74 ? 154 ASP B OD2   1 
ATOM   3921  N  N     . GLY B  1 48  ? 33.464  -16.914 4.653   1.00   23.66 ? 155 GLY B N     1 
ATOM   3922  C  CA    . GLY B  1 48  ? 32.642  -17.819 5.432   1.00   25.31 ? 155 GLY B CA    1 
ATOM   3923  C  C     . GLY B  1 48  ? 33.336  -18.346 6.672   1.00   28.34 ? 155 GLY B C     1 
ATOM   3924  O  O     . GLY B  1 48  ? 34.529  -18.099 6.896   1.00   27.90 ? 155 GLY B O     1 
ATOM   3925  N  N     . ILE B  1 49  ? 32.578  -19.069 7.490   1.00   27.80 ? 156 ILE B N     1 
ATOM   3926  C  CA    . ILE B  1 49  ? 33.108  -19.649 8.717   1.00   28.65 ? 156 ILE B CA    1 
ATOM   3927  C  C     . ILE B  1 49  ? 32.415  -20.986 8.993   1.00   31.32 ? 156 ILE B C     1 
ATOM   3928  O  O     . ILE B  1 49  ? 31.186  -21.079 8.962   1.00   33.06 ? 156 ILE B O     1 
ATOM   3929  C  CB    . ILE B  1 49  ? 32.895  -18.695 9.914   1.00   25.94 ? 156 ILE B CB    1 
ATOM   3930  C  CG1   . ILE B  1 49  ? 33.454  -19.318 11.195  1.00   24.08 ? 156 ILE B CG1   1 
ATOM   3931  C  CG2   . ILE B  1 49  ? 31.412  -18.364 10.052  1.00   27.34 ? 156 ILE B CG2   1 
ATOM   3932  C  CD1   . ILE B  1 49  ? 33.384  -18.381 12.406  1.00   22.78 ? 156 ILE B CD1   1 
ATOM   3933  N  N     . GLU B  1 50  ? 33.211  -22.022 9.239   1.00   31.59 ? 157 GLU B N     1 
ATOM   3934  C  CA    . GLU B  1 50  ? 32.684  -23.351 9.527   1.00   29.44 ? 157 GLU B CA    1 
ATOM   3935  C  C     . GLU B  1 50  ? 32.256  -23.347 10.991  1.00   30.08 ? 157 GLU B C     1 
ATOM   3936  O  O     . GLU B  1 50  ? 32.999  -23.790 11.869  1.00   28.50 ? 157 GLU B O     1 
ATOM   3937  C  CB    . GLU B  1 50  ? 33.778  -24.386 9.298   1.00   31.89 ? 157 GLU B CB    1 
ATOM   3938  C  CG    . GLU B  1 50  ? 33.289  -25.810 9.138   1.00   33.18 ? 157 GLU B CG    1 
ATOM   3939  C  CD    . GLU B  1 50  ? 34.410  -26.747 8.695   1.00   35.29 ? 157 GLU B CD    1 
ATOM   3940  O  OE1   . GLU B  1 50  ? 35.305  -27.031 9.523   1.00   35.24 ? 157 GLU B OE1   1 
ATOM   3941  O  OE2   . GLU B  1 50  ? 34.400  -27.181 7.518   1.00   32.87 ? 157 GLU B OE2   1 
ATOM   3942  N  N     . LYS B  1 51  ? 31.055  -22.835 11.245  1.00   30.34 ? 158 LYS B N     1 
ATOM   3943  C  CA    . LYS B  1 51  ? 30.522  -22.727 12.602  1.00   30.90 ? 158 LYS B CA    1 
ATOM   3944  C  C     . LYS B  1 51  ? 30.451  -24.027 13.403  1.00   32.28 ? 158 LYS B C     1 
ATOM   3945  O  O     . LYS B  1 51  ? 30.432  -24.003 14.640  1.00   31.74 ? 158 LYS B O     1 
ATOM   3946  C  CB    . LYS B  1 51  ? 29.138  -22.083 12.563  1.00   31.01 ? 158 LYS B CB    1 
ATOM   3947  C  CG    . LYS B  1 51  ? 28.110  -22.836 11.735  1.00   30.18 ? 158 LYS B CG    1 
ATOM   3948  C  CD    . LYS B  1 51  ? 26.765  -22.120 11.786  1.00   30.78 ? 158 LYS B CD    1 
ATOM   3949  C  CE    . LYS B  1 51  ? 25.719  -22.896 11.030  1.00   30.32 ? 158 LYS B CE    1 
ATOM   3950  N  NZ    . LYS B  1 51  ? 26.177  -23.151 9.642   1.00   29.84 ? 158 LYS B NZ    1 
ATOM   3951  N  N     . ASN B  1 52  ? 30.420  -25.158 12.704  1.00   32.40 ? 159 ASN B N     1 
ATOM   3952  C  CA    . ASN B  1 52  ? 30.338  -26.453 13.364  1.00   29.94 ? 159 ASN B CA    1 
ATOM   3953  C  C     . ASN B  1 52  ? 31.713  -27.092 13.569  1.00   31.38 ? 159 ASN B C     1 
ATOM   3954  O  O     . ASN B  1 52  ? 31.812  -28.244 13.997  1.00   32.71 ? 159 ASN B O     1 
ATOM   3955  C  CB    . ASN B  1 52  ? 29.435  -27.385 12.558  1.00   26.90 ? 159 ASN B CB    1 
ATOM   3956  C  CG    . ASN B  1 52  ? 29.920  -27.574 11.149  1.00   29.49 ? 159 ASN B CG    1 
ATOM   3957  O  OD1   . ASN B  1 52  ? 30.267  -26.607 10.469  1.00   31.61 ? 159 ASN B OD1   1 
ATOM   3958  N  ND2   . ASN B  1 52  ? 29.942  -28.822 10.689  1.00   29.34 ? 159 ASN B ND2   1 
ATOM   3959  N  N     . HIS B  1 53  ? 32.774  -26.351 13.266  1.00   30.33 ? 160 HIS B N     1 
ATOM   3960  C  CA    . HIS B  1 53  ? 34.121  -26.875 13.454  1.00   30.33 ? 160 HIS B CA    1 
ATOM   3961  C  C     . HIS B  1 53  ? 34.292  -27.185 14.943  1.00   30.71 ? 160 HIS B C     1 
ATOM   3962  O  O     . HIS B  1 53  ? 33.929  -26.377 15.798  1.00   31.65 ? 160 HIS B O     1 
ATOM   3963  C  CB    . HIS B  1 53  ? 35.157  -25.840 13.017  1.00   29.42 ? 160 HIS B CB    1 
ATOM   3964  C  CG    . HIS B  1 53  ? 36.546  -26.386 12.904  1.00   26.11 ? 160 HIS B CG    1 
ATOM   3965  N  ND1   . HIS B  1 53  ? 37.210  -26.954 13.967  1.00   26.25 ? 160 HIS B ND1   1 
ATOM   3966  C  CD2   . HIS B  1 53  ? 37.392  -26.449 11.850  1.00   23.44 ? 160 HIS B CD2   1 
ATOM   3967  C  CE1   . HIS B  1 53  ? 38.411  -27.345 13.572  1.00   26.61 ? 160 HIS B CE1   1 
ATOM   3968  N  NE2   . HIS B  1 53  ? 38.545  -27.051 12.293  1.00   24.18 ? 160 HIS B NE2   1 
ATOM   3969  N  N     . PRO B  1 54  ? 34.838  -28.365 15.275  1.00   30.11 ? 161 PRO B N     1 
ATOM   3970  C  CA    . PRO B  1 54  ? 35.026  -28.731 16.679  1.00   28.39 ? 161 PRO B CA    1 
ATOM   3971  C  C     . PRO B  1 54  ? 35.801  -27.746 17.543  1.00   29.20 ? 161 PRO B C     1 
ATOM   3972  O  O     . PRO B  1 54  ? 35.671  -27.766 18.765  1.00   30.94 ? 161 PRO B O     1 
ATOM   3973  C  CB    . PRO B  1 54  ? 35.692  -30.108 16.599  1.00   27.01 ? 161 PRO B CB    1 
ATOM   3974  C  CG    . PRO B  1 54  ? 36.326  -30.124 15.256  1.00   30.25 ? 161 PRO B CG    1 
ATOM   3975  C  CD    . PRO B  1 54  ? 35.300  -29.445 14.390  1.00   30.32 ? 161 PRO B CD    1 
ATOM   3976  N  N     . ASP B  1 55  ? 36.593  -26.874 16.933  1.00   30.16 ? 162 ASP B N     1 
ATOM   3977  C  CA    . ASP B  1 55  ? 37.360  -25.918 17.725  1.00   31.41 ? 162 ASP B CA    1 
ATOM   3978  C  C     . ASP B  1 55  ? 36.771  -24.511 17.644  1.00   31.41 ? 162 ASP B C     1 
ATOM   3979  O  O     . ASP B  1 55  ? 37.375  -23.553 18.132  1.00   32.90 ? 162 ASP B O     1 
ATOM   3980  C  CB    . ASP B  1 55  ? 38.823  -25.918 17.265  1.00   35.61 ? 162 ASP B CB    1 
ATOM   3981  C  CG    . ASP B  1 55  ? 39.814  -25.805 18.435  1.00   38.26 ? 162 ASP B CG    1 
ATOM   3982  O  OD1   . ASP B  1 55  ? 39.448  -26.189 19.570  1.00   40.02 ? 162 ASP B OD1   1 
ATOM   3983  O  OD2   . ASP B  1 55  ? 40.964  -25.350 18.219  1.00   39.58 ? 162 ASP B OD2   1 
ATOM   3984  N  N     . LEU B  1 56  ? 35.588  -24.395 17.038  1.00   29.39 ? 163 LEU B N     1 
ATOM   3985  C  CA    . LEU B  1 56  ? 34.915  -23.104 16.896  1.00   26.90 ? 163 LEU B CA    1 
ATOM   3986  C  C     . LEU B  1 56  ? 33.492  -23.082 17.434  1.00   28.16 ? 163 LEU B C     1 
ATOM   3987  O  O     . LEU B  1 56  ? 33.050  -22.068 17.975  1.00   29.63 ? 163 LEU B O     1 
ATOM   3988  C  CB    . LEU B  1 56  ? 34.870  -22.673 15.431  1.00   23.93 ? 163 LEU B CB    1 
ATOM   3989  C  CG    . LEU B  1 56  ? 36.173  -22.197 14.801  1.00   23.06 ? 163 LEU B CG    1 
ATOM   3990  C  CD1   . LEU B  1 56  ? 35.921  -21.833 13.355  1.00   24.46 ? 163 LEU B CD1   1 
ATOM   3991  C  CD2   . LEU B  1 56  ? 36.703  -21.000 15.556  1.00   21.45 ? 163 LEU B CD2   1 
ATOM   3992  N  N     . ALA B  1 57  ? 32.774  -24.193 17.276  1.00   28.08 ? 164 ALA B N     1 
ATOM   3993  C  CA    . ALA B  1 57  ? 31.382  -24.285 17.718  1.00   26.08 ? 164 ALA B CA    1 
ATOM   3994  C  C     . ALA B  1 57  ? 31.155  -23.732 19.122  1.00   24.02 ? 164 ALA B C     1 
ATOM   3995  O  O     . ALA B  1 57  ? 30.210  -22.978 19.354  1.00   24.26 ? 164 ALA B O     1 
ATOM   3996  C  CB    . ALA B  1 57  ? 30.904  -25.729 17.634  1.00   26.50 ? 164 ALA B CB    1 
ATOM   3997  N  N     . GLY B  1 58  ? 32.028  -24.096 20.051  1.00   23.81 ? 165 GLY B N     1 
ATOM   3998  C  CA    . GLY B  1 58  ? 31.888  -23.621 21.415  1.00   23.69 ? 165 GLY B CA    1 
ATOM   3999  C  C     . GLY B  1 58  ? 31.825  -22.114 21.576  1.00   24.93 ? 165 GLY B C     1 
ATOM   4000  O  O     . GLY B  1 58  ? 31.232  -21.621 22.535  1.00   25.80 ? 165 GLY B O     1 
ATOM   4001  N  N     . ASN B  1 59  ? 32.436  -21.377 20.650  1.00   25.35 ? 166 ASN B N     1 
ATOM   4002  C  CA    . ASN B  1 59  ? 32.441  -19.918 20.716  1.00   25.03 ? 166 ASN B CA    1 
ATOM   4003  C  C     . ASN B  1 59  ? 31.656  -19.249 19.603  1.00   26.51 ? 166 ASN B C     1 
ATOM   4004  O  O     . ASN B  1 59  ? 31.493  -18.030 19.610  1.00   27.36 ? 166 ASN B O     1 
ATOM   4005  C  CB    . ASN B  1 59  ? 33.873  -19.372 20.697  1.00   24.20 ? 166 ASN B CB    1 
ATOM   4006  C  CG    . ASN B  1 59  ? 34.614  -19.650 21.979  1.00   24.54 ? 166 ASN B CG    1 
ATOM   4007  O  OD1   . ASN B  1 59  ? 34.015  -19.654 23.052  1.00   25.47 ? 166 ASN B OD1   1 
ATOM   4008  N  ND2   . ASN B  1 59  ? 35.923  -19.875 21.883  1.00   22.10 ? 166 ASN B ND2   1 
ATOM   4009  N  N     . TYR B  1 60  ? 31.165  -20.030 18.649  1.00   25.92 ? 167 TYR B N     1 
ATOM   4010  C  CA    . TYR B  1 60  ? 30.416  -19.446 17.547  1.00   27.70 ? 167 TYR B CA    1 
ATOM   4011  C  C     . TYR B  1 60  ? 29.246  -18.589 18.023  1.00   28.35 ? 167 TYR B C     1 
ATOM   4012  O  O     . TYR B  1 60  ? 28.519  -18.971 18.941  1.00   30.66 ? 167 TYR B O     1 
ATOM   4013  C  CB    . TYR B  1 60  ? 29.894  -20.527 16.615  1.00   26.70 ? 167 TYR B CB    1 
ATOM   4014  C  CG    . TYR B  1 60  ? 29.109  -19.942 15.472  1.00   27.65 ? 167 TYR B CG    1 
ATOM   4015  C  CD1   . TYR B  1 60  ? 29.742  -19.168 14.502  1.00   27.36 ? 167 TYR B CD1   1 
ATOM   4016  C  CD2   . TYR B  1 60  ? 27.733  -20.148 15.366  1.00   26.34 ? 167 TYR B CD2   1 
ATOM   4017  C  CE1   . TYR B  1 60  ? 29.032  -18.616 13.450  1.00   30.93 ? 167 TYR B CE1   1 
ATOM   4018  C  CE2   . TYR B  1 60  ? 27.008  -19.603 14.323  1.00   29.94 ? 167 TYR B CE2   1 
ATOM   4019  C  CZ    . TYR B  1 60  ? 27.660  -18.839 13.363  1.00   33.32 ? 167 TYR B CZ    1 
ATOM   4020  O  OH    . TYR B  1 60  ? 26.940  -18.316 12.307  1.00   33.84 ? 167 TYR B OH    1 
ATOM   4021  N  N     . ASP B  1 61  ? 29.065  -17.435 17.385  1.00   28.29 ? 168 ASP B N     1 
ATOM   4022  C  CA    . ASP B  1 61  ? 27.994  -16.513 17.734  1.00   27.30 ? 168 ASP B CA    1 
ATOM   4023  C  C     . ASP B  1 61  ? 27.195  -16.147 16.490  1.00   28.28 ? 168 ASP B C     1 
ATOM   4024  O  O     . ASP B  1 61  ? 27.671  -15.423 15.618  1.00   26.31 ? 168 ASP B O     1 
ATOM   4025  C  CB    . ASP B  1 61  ? 28.569  -15.242 18.356  1.00   26.85 ? 168 ASP B CB    1 
ATOM   4026  C  CG    . ASP B  1 61  ? 27.488  -14.257 18.777  1.00   31.35 ? 168 ASP B CG    1 
ATOM   4027  O  OD1   . ASP B  1 61  ? 26.308  -14.424 18.377  1.00   30.25 ? 168 ASP B OD1   1 
ATOM   4028  O  OD2   . ASP B  1 61  ? 27.820  -13.302 19.510  1.00   33.13 ? 168 ASP B OD2   1 
ATOM   4029  N  N     . PRO B  1 62  ? 25.955  -16.638 16.399  1.00   30.06 ? 169 PRO B N     1 
ATOM   4030  C  CA    . PRO B  1 62  ? 25.083  -16.360 15.254  1.00   29.83 ? 169 PRO B CA    1 
ATOM   4031  C  C     . PRO B  1 62  ? 24.830  -14.861 15.107  1.00   29.48 ? 169 PRO B C     1 
ATOM   4032  O  O     . PRO B  1 62  ? 24.691  -14.348 13.994  1.00   29.94 ? 169 PRO B O     1 
ATOM   4033  C  CB    . PRO B  1 62  ? 23.803  -17.111 15.606  1.00   28.87 ? 169 PRO B CB    1 
ATOM   4034  C  CG    . PRO B  1 62  ? 24.278  -18.197 16.516  1.00   28.68 ? 169 PRO B CG    1 
ATOM   4035  C  CD    . PRO B  1 62  ? 25.269  -17.489 17.381  1.00   29.20 ? 169 PRO B CD    1 
ATOM   4036  N  N     . GLY B  1 63  ? 24.766  -14.170 16.242  1.00   28.54 ? 170 GLY B N     1 
ATOM   4037  C  CA    . GLY B  1 63  ? 24.511  -12.739 16.232  1.00   28.20 ? 170 GLY B CA    1 
ATOM   4038  C  C     . GLY B  1 63  ? 25.608  -11.905 15.595  1.00   28.08 ? 170 GLY B C     1 
ATOM   4039  O  O     . GLY B  1 63  ? 25.396  -10.731 15.285  1.00   28.40 ? 170 GLY B O     1 
ATOM   4040  N  N     . ALA B  1 64  ? 26.779  -12.509 15.408  1.00   26.70 ? 171 ALA B N     1 
ATOM   4041  C  CA    . ALA B  1 64  ? 27.915  -11.827 14.802  1.00   24.78 ? 171 ALA B CA    1 
ATOM   4042  C  C     . ALA B  1 64  ? 28.181  -12.390 13.404  1.00   24.82 ? 171 ALA B C     1 
ATOM   4043  O  O     . ALA B  1 64  ? 29.235  -12.144 12.809  1.00   23.40 ? 171 ALA B O     1 
ATOM   4044  C  CB    . ALA B  1 64  ? 29.144  -12.007 15.672  1.00   20.43 ? 171 ALA B CB    1 
ATOM   4045  N  N     . SER B  1 65  ? 27.221  -13.145 12.880  1.00   24.30 ? 172 SER B N     1 
ATOM   4046  C  CA    . SER B  1 65  ? 27.379  -13.761 11.568  1.00   24.96 ? 172 SER B CA    1 
ATOM   4047  C  C     . SER B  1 65  ? 26.266  -13.443 10.591  1.00   26.04 ? 172 SER B C     1 
ATOM   4048  O  O     . SER B  1 65  ? 25.186  -12.984 10.972  1.00   27.33 ? 172 SER B O     1 
ATOM   4049  C  CB    . SER B  1 65  ? 27.478  -15.280 11.709  1.00   22.83 ? 172 SER B CB    1 
ATOM   4050  O  OG    . SER B  1 65  ? 28.619  -15.638 12.459  1.00   22.52 ? 172 SER B OG    1 
ATOM   4051  N  N     . PHE B  1 66  ? 26.549  -13.705 9.322   1.00   25.65 ? 173 PHE B N     1 
ATOM   4052  C  CA    . PHE B  1 66  ? 25.590  -13.500 8.258   1.00   26.43 ? 173 PHE B CA    1 
ATOM   4053  C  C     . PHE B  1 66  ? 26.199  -13.872 6.909   1.00   26.71 ? 173 PHE B C     1 
ATOM   4054  O  O     . PHE B  1 66  ? 27.419  -13.884 6.747   1.00   27.82 ? 173 PHE B O     1 
ATOM   4055  C  CB    . PHE B  1 66  ? 25.122  -12.052 8.221   1.00   25.84 ? 173 PHE B CB    1 
ATOM   4056  C  CG    . PHE B  1 66  ? 23.801  -11.883 7.549   1.00   26.77 ? 173 PHE B CG    1 
ATOM   4057  C  CD1   . PHE B  1 66  ? 22.621  -12.125 8.245   1.00   24.55 ? 173 PHE B CD1   1 
ATOM   4058  C  CD2   . PHE B  1 66  ? 23.734  -11.556 6.200   1.00   27.09 ? 173 PHE B CD2   1 
ATOM   4059  C  CE1   . PHE B  1 66  ? 21.397  -12.043 7.608   1.00   25.10 ? 173 PHE B CE1   1 
ATOM   4060  C  CE2   . PHE B  1 66  ? 22.513  -11.472 5.551   1.00   28.85 ? 173 PHE B CE2   1 
ATOM   4061  C  CZ    . PHE B  1 66  ? 21.341  -11.718 6.255   1.00   27.90 ? 173 PHE B CZ    1 
ATOM   4062  N  N     . ASP B  1 67  ? 25.341  -14.187 5.945   1.00   26.80 ? 174 ASP B N     1 
ATOM   4063  C  CA    . ASP B  1 67  ? 25.779  -14.558 4.602   1.00   25.78 ? 174 ASP B CA    1 
ATOM   4064  C  C     . ASP B  1 67  ? 25.292  -13.489 3.621   1.00   26.27 ? 174 ASP B C     1 
ATOM   4065  O  O     . ASP B  1 67  ? 24.166  -13.544 3.128   1.00   27.08 ? 174 ASP B O     1 
ATOM   4066  C  CB    . ASP B  1 67  ? 25.192  -15.916 4.216   1.00   25.22 ? 174 ASP B CB    1 
ATOM   4067  C  CG    . ASP B  1 67  ? 25.690  -16.410 2.864   1.00   24.72 ? 174 ASP B CG    1 
ATOM   4068  O  OD1   . ASP B  1 67  ? 26.247  -15.601 2.098   1.00   23.12 ? 174 ASP B OD1   1 
ATOM   4069  O  OD2   . ASP B  1 67  ? 25.510  -17.610 2.565   1.00   23.48 ? 174 ASP B OD2   1 
ATOM   4070  N  N     . VAL B  1 68  ? 26.146  -12.515 3.339   1.00   26.31 ? 175 VAL B N     1 
ATOM   4071  C  CA    . VAL B  1 68  ? 25.789  -11.438 2.433   1.00   25.60 ? 175 VAL B CA    1 
ATOM   4072  C  C     . VAL B  1 68  ? 25.825  -11.898 0.980   1.00   26.71 ? 175 VAL B C     1 
ATOM   4073  O  O     . VAL B  1 68  ? 25.129  -11.349 0.127   1.00   28.46 ? 175 VAL B O     1 
ATOM   4074  C  CB    . VAL B  1 68  ? 26.736  -10.225 2.610   1.00   23.67 ? 175 VAL B CB    1 
ATOM   4075  C  CG1   . VAL B  1 68  ? 26.408  -9.156  1.588   1.00   23.09 ? 175 VAL B CG1   1 
ATOM   4076  C  CG2   . VAL B  1 68  ? 26.597  -9.661  4.016   1.00   15.72 ? 175 VAL B CG2   1 
ATOM   4077  N  N     . ASN B  1 69  ? 26.635  -12.909 0.699   1.00   27.69 ? 176 ASN B N     1 
ATOM   4078  C  CA    . ASN B  1 69  ? 26.743  -13.437 -0.656  1.00   29.96 ? 176 ASN B CA    1 
ATOM   4079  C  C     . ASN B  1 69  ? 25.445  -14.104 -1.124  1.00   30.58 ? 176 ASN B C     1 
ATOM   4080  O  O     . ASN B  1 69  ? 25.007  -13.893 -2.255  1.00   31.05 ? 176 ASN B O     1 
ATOM   4081  C  CB    . ASN B  1 69  ? 27.902  -14.432 -0.734  1.00   29.52 ? 176 ASN B CB    1 
ATOM   4082  C  CG    . ASN B  1 69  ? 29.260  -13.747 -0.736  1.00   31.63 ? 176 ASN B CG    1 
ATOM   4083  O  OD1   . ASN B  1 69  ? 30.272  -14.353 -0.371  1.00   32.89 ? 176 ASN B OD1   1 
ATOM   4084  N  ND2   . ASN B  1 69  ? 29.292  -12.482 -1.160  1.00   28.42 ? 176 ASN B ND2   1 
ATOM   4085  N  N     . ASP B  1 70  ? 24.831  -14.907 -0.263  1.00   31.12 ? 177 ASP B N     1 
ATOM   4086  C  CA    . ASP B  1 70  ? 23.585  -15.572 -0.630  1.00   33.72 ? 177 ASP B CA    1 
ATOM   4087  C  C     . ASP B  1 70  ? 22.372  -15.025 0.120   1.00   34.78 ? 177 ASP B C     1 
ATOM   4088  O  O     . ASP B  1 70  ? 21.288  -15.615 0.071   1.00   38.09 ? 177 ASP B O     1 
ATOM   4089  C  CB    . ASP B  1 70  ? 23.682  -17.089 -0.403  1.00   33.96 ? 177 ASP B CB    1 
ATOM   4090  C  CG    . ASP B  1 70  ? 24.644  -17.771 -1.363  1.00   35.19 ? 177 ASP B CG    1 
ATOM   4091  O  OD1   . ASP B  1 70  ? 24.984  -17.171 -2.406  1.00   36.03 ? 177 ASP B OD1   1 
ATOM   4092  O  OD2   . ASP B  1 70  ? 25.055  -18.917 -1.082  1.00   36.60 ? 177 ASP B OD2   1 
ATOM   4093  N  N     . GLN B  1 71  ? 22.553  -13.908 0.818   1.00   33.24 ? 178 GLN B N     1 
ATOM   4094  C  CA    . GLN B  1 71  ? 21.458  -13.288 1.559   1.00   31.83 ? 178 GLN B CA    1 
ATOM   4095  C  C     . GLN B  1 71  ? 20.720  -14.202 2.547   1.00   31.60 ? 178 GLN B C     1 
ATOM   4096  O  O     . GLN B  1 71  ? 19.510  -14.396 2.421   1.00   31.61 ? 178 GLN B O     1 
ATOM   4097  C  CB    . GLN B  1 71  ? 20.433  -12.709 0.581   1.00   31.61 ? 178 GLN B CB    1 
ATOM   4098  C  CG    . GLN B  1 71  ? 20.457  -11.193 0.418   1.00   31.94 ? 178 GLN B CG    1 
ATOM   4099  C  CD    . GLN B  1 71  ? 21.759  -10.678 -0.157  1.00   32.09 ? 178 GLN B CD    1 
ATOM   4100  O  OE1   . GLN B  1 71  ? 22.765  -10.595 0.544   0.0000 31.02 ? 178 GLN B OE1   1 
ATOM   4101  N  NE2   . GLN B  1 71  ? 21.749  -10.335 -1.440  0.0000 31.02 ? 178 GLN B NE2   1 
ATOM   4102  N  N     . ASP B  1 72  ? 21.439  -14.768 3.514   1.00   30.27 ? 179 ASP B N     1 
ATOM   4103  C  CA    . ASP B  1 72  ? 20.824  -15.610 4.545   1.00   30.89 ? 179 ASP B CA    1 
ATOM   4104  C  C     . ASP B  1 72  ? 21.687  -15.484 5.797   1.00   29.47 ? 179 ASP B C     1 
ATOM   4105  O  O     . ASP B  1 72  ? 22.820  -15.025 5.726   1.00   29.64 ? 179 ASP B O     1 
ATOM   4106  C  CB    . ASP B  1 72  ? 20.703  -17.078 4.100   1.00   29.93 ? 179 ASP B CB    1 
ATOM   4107  C  CG    . ASP B  1 72  ? 22.053  -17.741 3.853   1.00   33.29 ? 179 ASP B CG    1 
ATOM   4108  O  OD1   . ASP B  1 72  ? 22.870  -17.850 4.803   1.00   30.11 ? 179 ASP B OD1   1 
ATOM   4109  O  OD2   . ASP B  1 72  ? 22.291  -18.161 2.695   1.00   35.84 ? 179 ASP B OD2   1 
ATOM   4110  N  N     . PRO B  1 73  ? 21.168  -15.887 6.959   1.00   28.10 ? 180 PRO B N     1 
ATOM   4111  C  CA    . PRO B  1 73  ? 21.981  -15.756 8.163   1.00   29.07 ? 180 PRO B CA    1 
ATOM   4112  C  C     . PRO B  1 73  ? 23.025  -16.822 8.415   1.00   30.53 ? 180 PRO B C     1 
ATOM   4113  O  O     . PRO B  1 73  ? 23.778  -16.717 9.383   1.00   32.02 ? 180 PRO B O     1 
ATOM   4114  C  CB    . PRO B  1 73  ? 20.934  -15.702 9.269   1.00   28.86 ? 180 PRO B CB    1 
ATOM   4115  C  CG    . PRO B  1 73  ? 19.909  -16.616 8.769   1.00   28.40 ? 180 PRO B CG    1 
ATOM   4116  C  CD    . PRO B  1 73  ? 19.785  -16.247 7.305   1.00   29.00 ? 180 PRO B CD    1 
ATOM   4117  N  N     . ASP B  1 74  ? 23.080  -17.838 7.559   1.00   31.39 ? 181 ASP B N     1 
ATOM   4118  C  CA    . ASP B  1 74  ? 24.048  -18.922 7.732   1.00   30.95 ? 181 ASP B CA    1 
ATOM   4119  C  C     . ASP B  1 74  ? 25.329  -18.674 6.932   1.00   29.68 ? 181 ASP B C     1 
ATOM   4120  O  O     . ASP B  1 74  ? 25.327  -18.725 5.698   1.00   29.12 ? 181 ASP B O     1 
ATOM   4121  C  CB    . ASP B  1 74  ? 23.424  -20.249 7.310   1.00   31.82 ? 181 ASP B CB    1 
ATOM   4122  C  CG    . ASP B  1 74  ? 24.370  -21.413 7.474   1.00   34.17 ? 181 ASP B CG    1 
ATOM   4123  O  OD1   . ASP B  1 74  ? 25.589  -21.174 7.597   1.00   35.98 ? 181 ASP B OD1   1 
ATOM   4124  O  OD2   . ASP B  1 74  ? 23.894  -22.568 7.461   1.00   37.19 ? 181 ASP B OD2   1 
ATOM   4125  N  N     . PRO B  1 75  ? 26.448  -18.415 7.635   1.00   29.30 ? 182 PRO B N     1 
ATOM   4126  C  CA    . PRO B  1 75  ? 27.759  -18.149 7.033   1.00   29.61 ? 182 PRO B CA    1 
ATOM   4127  C  C     . PRO B  1 75  ? 28.607  -19.377 6.703   1.00   30.15 ? 182 PRO B C     1 
ATOM   4128  O  O     . PRO B  1 75  ? 29.805  -19.247 6.474   1.00   30.63 ? 182 PRO B O     1 
ATOM   4129  C  CB    . PRO B  1 75  ? 28.428  -17.270 8.077   1.00   29.54 ? 182 PRO B CB    1 
ATOM   4130  C  CG    . PRO B  1 75  ? 27.961  -17.885 9.339   1.00   29.56 ? 182 PRO B CG    1 
ATOM   4131  C  CD    . PRO B  1 75  ? 26.480  -18.123 9.080   1.00   29.11 ? 182 PRO B CD    1 
ATOM   4132  N  N     . GLN B  1 76  ? 27.995  -20.558 6.686   1.00   29.34 ? 183 GLN B N     1 
ATOM   4133  C  CA    . GLN B  1 76  ? 28.715  -21.791 6.384   1.00   26.62 ? 183 GLN B CA    1 
ATOM   4134  C  C     . GLN B  1 76  ? 29.409  -21.656 5.028   1.00   25.82 ? 183 GLN B C     1 
ATOM   4135  O  O     . GLN B  1 76  ? 28.821  -21.172 4.066   1.00   26.38 ? 183 GLN B O     1 
ATOM   4136  C  CB    . GLN B  1 76  ? 27.738  -22.969 6.350   1.00   27.22 ? 183 GLN B CB    1 
ATOM   4137  C  CG    . GLN B  1 76  ? 28.389  -24.347 6.368   1.00   26.53 ? 183 GLN B CG    1 
ATOM   4138  C  CD    . GLN B  1 76  ? 29.048  -24.667 7.696   1.00   27.72 ? 183 GLN B CD    1 
ATOM   4139  O  OE1   . GLN B  1 76  ? 28.515  -24.355 8.768   1.00   27.89 ? 183 GLN B OE1   1 
ATOM   4140  N  NE2   . GLN B  1 76  ? 30.207  -25.312 7.633   1.00   28.67 ? 183 GLN B NE2   1 
ATOM   4141  N  N     . PRO B  1 77  ? 30.676  -22.085 4.936   1.00   25.42 ? 184 PRO B N     1 
ATOM   4142  C  CA    . PRO B  1 77  ? 31.415  -21.991 3.674   1.00   25.08 ? 184 PRO B CA    1 
ATOM   4143  C  C     . PRO B  1 77  ? 30.845  -22.894 2.584   1.00   26.62 ? 184 PRO B C     1 
ATOM   4144  O  O     . PRO B  1 77  ? 30.140  -23.862 2.870   1.00   30.69 ? 184 PRO B O     1 
ATOM   4145  C  CB    . PRO B  1 77  ? 32.828  -22.428 4.066   1.00   23.46 ? 184 PRO B CB    1 
ATOM   4146  C  CG    . PRO B  1 77  ? 32.913  -22.099 5.525   1.00   24.84 ? 184 PRO B CG    1 
ATOM   4147  C  CD    . PRO B  1 77  ? 31.560  -22.537 6.024   1.00   25.00 ? 184 PRO B CD    1 
ATOM   4148  N  N     . ARG B  1 78  ? 31.151  -22.574 1.331   1.00   25.62 ? 185 ARG B N     1 
ATOM   4149  C  CA    . ARG B  1 78  ? 30.714  -23.391 0.205   1.00   24.07 ? 185 ARG B CA    1 
ATOM   4150  C  C     . ARG B  1 78  ? 31.853  -24.364 -0.085  1.00   26.79 ? 185 ARG B C     1 
ATOM   4151  O  O     . ARG B  1 78  ? 32.938  -23.949 -0.502  1.00   27.11 ? 185 ARG B O     1 
ATOM   4152  C  CB    . ARG B  1 78  ? 30.461  -22.517 -1.019  1.00   23.21 ? 185 ARG B CB    1 
ATOM   4153  C  CG    . ARG B  1 78  ? 30.151  -23.291 -2.299  1.00   19.87 ? 185 ARG B CG    1 
ATOM   4154  C  CD    . ARG B  1 78  ? 29.749  -22.339 -3.406  1.00   19.38 ? 185 ARG B CD    1 
ATOM   4155  N  NE    . ARG B  1 78  ? 30.823  -21.404 -3.720  1.00   22.18 ? 185 ARG B NE    1 
ATOM   4156  C  CZ    . ARG B  1 78  ? 31.837  -21.680 -4.532  1.00   22.62 ? 185 ARG B CZ    1 
ATOM   4157  N  NH1   . ARG B  1 78  ? 32.774  -20.773 -4.752  1.00   19.15 ? 185 ARG B NH1   1 
ATOM   4158  N  NH2   . ARG B  1 78  ? 31.901  -22.858 -5.137  1.00   25.22 ? 185 ARG B NH2   1 
ATOM   4159  N  N     . TYR B  1 79  ? 31.616  -25.657 0.136   1.00   28.77 ? 186 TYR B N     1 
ATOM   4160  C  CA    . TYR B  1 79  ? 32.656  -26.663 -0.082  1.00   27.56 ? 186 TYR B CA    1 
ATOM   4161  C  C     . TYR B  1 79  ? 32.924  -26.987 -1.543  1.00   29.00 ? 186 TYR B C     1 
ATOM   4162  O  O     . TYR B  1 79  ? 32.003  -27.086 -2.354  1.00   28.24 ? 186 TYR B O     1 
ATOM   4163  C  CB    . TYR B  1 79  ? 32.318  -27.949 0.675   1.00   23.95 ? 186 TYR B CB    1 
ATOM   4164  C  CG    . TYR B  1 79  ? 32.227  -27.743 2.165   1.00   23.95 ? 186 TYR B CG    1 
ATOM   4165  C  CD1   . TYR B  1 79  ? 31.031  -27.339 2.761   1.00   22.22 ? 186 TYR B CD1   1 
ATOM   4166  C  CD2   . TYR B  1 79  ? 33.355  -27.889 2.976   1.00   22.74 ? 186 TYR B CD2   1 
ATOM   4167  C  CE1   . TYR B  1 79  ? 30.960  -27.080 4.127   1.00   19.52 ? 186 TYR B CE1   1 
ATOM   4168  C  CE2   . TYR B  1 79  ? 33.292  -27.631 4.341   1.00   22.84 ? 186 TYR B CE2   1 
ATOM   4169  C  CZ    . TYR B  1 79  ? 32.089  -27.227 4.907   1.00   22.15 ? 186 TYR B CZ    1 
ATOM   4170  O  OH    . TYR B  1 79  ? 32.023  -26.960 6.250   1.00   25.26 ? 186 TYR B OH    1 
ATOM   4171  N  N     . THR B  1 80  ? 34.203  -27.146 -1.868  1.00   30.39 ? 187 THR B N     1 
ATOM   4172  C  CA    . THR B  1 80  ? 34.630  -27.464 -3.227  1.00   33.56 ? 187 THR B CA    1 
ATOM   4173  C  C     . THR B  1 80  ? 35.891  -28.320 -3.128  1.00   35.95 ? 187 THR B C     1 
ATOM   4174  O  O     . THR B  1 80  ? 36.560  -28.305 -2.099  1.00   37.25 ? 187 THR B O     1 
ATOM   4175  C  CB    . THR B  1 80  ? 34.955  -26.181 -4.033  1.00   34.20 ? 187 THR B CB    1 
ATOM   4176  O  OG1   . THR B  1 80  ? 36.197  -25.623 -3.589  1.00   34.45 ? 187 THR B OG1   1 
ATOM   4177  C  CG2   . THR B  1 80  ? 33.867  -25.141 -3.832  1.00   32.20 ? 187 THR B CG2   1 
ATOM   4178  N  N     . GLN B  1 81  ? 36.211  -29.065 -4.185  1.00   38.04 ? 188 GLN B N     1 
ATOM   4179  C  CA    . GLN B  1 81  ? 37.404  -29.916 -4.186  1.00   40.28 ? 188 GLN B CA    1 
ATOM   4180  C  C     . GLN B  1 81  ? 38.690  -29.164 -3.835  1.00   41.78 ? 188 GLN B C     1 
ATOM   4181  O  O     . GLN B  1 81  ? 39.540  -29.672 -3.098  1.00   44.18 ? 188 GLN B O     1 
ATOM   4182  C  CB    . GLN B  1 81  ? 37.602  -30.576 -5.548  1.00   40.55 ? 188 GLN B CB    1 
ATOM   4183  C  CG    . GLN B  1 81  ? 37.153  -32.007 -5.625  1.00   43.09 ? 188 GLN B CG    1 
ATOM   4184  C  CD    . GLN B  1 81  ? 37.666  -32.677 -6.876  1.00   45.73 ? 188 GLN B CD    1 
ATOM   4185  O  OE1   . GLN B  1 81  ? 37.554  -32.132 -7.976  1.00   48.98 ? 188 GLN B OE1   1 
ATOM   4186  N  NE2   . GLN B  1 81  ? 38.235  -33.865 -6.720  1.00   46.76 ? 188 GLN B NE2   1 
ATOM   4187  N  N     . MET B  1 82  ? 38.839  -27.960 -4.379  1.00   41.90 ? 189 MET B N     1 
ATOM   4188  C  CA    . MET B  1 82  ? 40.027  -27.155 -4.127  1.00   41.86 ? 189 MET B CA    1 
ATOM   4189  C  C     . MET B  1 82  ? 40.040  -26.504 -2.741  1.00   39.61 ? 189 MET B C     1 
ATOM   4190  O  O     . MET B  1 82  ? 41.065  -25.967 -2.327  1.00   39.42 ? 189 MET B O     1 
ATOM   4191  C  CB    . MET B  1 82  ? 40.169  -26.080 -5.213  1.00   45.41 ? 189 MET B CB    1 
ATOM   4192  C  CG    . MET B  1 82  ? 40.533  -26.633 -6.595  1.00   54.11 ? 189 MET B CG    1 
ATOM   4193  S  SD    . MET B  1 82  ? 40.440  -25.410 -7.957  1.00   61.21 ? 189 MET B SD    1 
ATOM   4194  C  CE    . MET B  1 82  ? 42.010  -24.581 -7.871  1.00   60.39 ? 189 MET B CE    1 
ATOM   4195  N  N     . ASN B  1 83  ? 38.916  -26.555 -2.026  1.00   36.58 ? 190 ASN B N     1 
ATOM   4196  C  CA    . ASN B  1 83  ? 38.807  -25.946 -0.696  1.00   34.42 ? 190 ASN B CA    1 
ATOM   4197  C  C     . ASN B  1 83  ? 39.071  -24.443 -0.740  1.00   33.01 ? 190 ASN B C     1 
ATOM   4198  O  O     . ASN B  1 83  ? 39.781  -23.911 0.116   1.00   32.11 ? 190 ASN B O     1 
ATOM   4199  C  CB    . ASN B  1 83  ? 39.789  -26.587 0.282   1.00   34.33 ? 190 ASN B CB    1 
ATOM   4200  C  CG    . ASN B  1 83  ? 39.381  -27.979 0.688   1.00   36.50 ? 190 ASN B CG    1 
ATOM   4201  O  OD1   . ASN B  1 83  ? 38.232  -28.220 1.066   1.00   38.47 ? 190 ASN B OD1   1 
ATOM   4202  N  ND2   . ASN B  1 83  ? 40.328  -28.910 0.626   1.00   35.53 ? 190 ASN B ND2   1 
ATOM   4203  N  N     . ASP B  1 84  ? 38.485  -23.767 -1.725  1.00   31.02 ? 191 ASP B N     1 
ATOM   4204  C  CA    . ASP B  1 84  ? 38.672  -22.329 -1.897  1.00   29.39 ? 191 ASP B CA    1 
ATOM   4205  C  C     . ASP B  1 84  ? 38.231  -21.507 -0.700  1.00   29.08 ? 191 ASP B C     1 
ATOM   4206  O  O     . ASP B  1 84  ? 38.899  -20.537 -0.321  1.00   32.26 ? 191 ASP B O     1 
ATOM   4207  C  CB    . ASP B  1 84  ? 37.901  -21.827 -3.115  1.00   29.75 ? 191 ASP B CB    1 
ATOM   4208  C  CG    . ASP B  1 84  ? 38.131  -22.675 -4.340  1.00   30.39 ? 191 ASP B CG    1 
ATOM   4209  O  OD1   . ASP B  1 84  ? 37.475  -23.731 -4.460  1.00   30.96 ? 191 ASP B OD1   1 
ATOM   4210  O  OD2   . ASP B  1 84  ? 38.977  -22.289 -5.176  1.00   31.95 ? 191 ASP B OD2   1 
ATOM   4211  N  N     . ASN B  1 85  ? 37.104  -21.891 -0.112  1.00   25.61 ? 192 ASN B N     1 
ATOM   4212  C  CA    . ASN B  1 85  ? 36.555  -21.159 1.016   1.00   24.59 ? 192 ASN B CA    1 
ATOM   4213  C  C     . ASN B  1 85  ? 36.974  -21.610 2.416   1.00   24.31 ? 192 ASN B C     1 
ATOM   4214  O  O     . ASN B  1 85  ? 36.149  -21.733 3.318   1.00   25.48 ? 192 ASN B O     1 
ATOM   4215  C  CB    . ASN B  1 85  ? 35.040  -21.147 0.880   1.00   21.49 ? 192 ASN B CB    1 
ATOM   4216  C  CG    . ASN B  1 85  ? 34.612  -20.621 -0.454  1.00   20.25 ? 192 ASN B CG    1 
ATOM   4217  O  OD1   . ASN B  1 85  ? 35.044  -19.547 -0.864  1.00   21.02 ? 192 ASN B OD1   1 
ATOM   4218  N  ND2   . ASN B  1 85  ? 33.773  -21.370 -1.155  1.00   21.73 ? 192 ASN B ND2   1 
ATOM   4219  N  N     . ARG B  1 86  ? 38.268  -21.829 2.597   1.00   23.57 ? 193 ARG B N     1 
ATOM   4220  C  CA    . ARG B  1 86  ? 38.795  -22.256 3.886   1.00   24.98 ? 193 ARG B CA    1 
ATOM   4221  C  C     . ARG B  1 86  ? 39.411  -21.057 4.607   1.00   24.80 ? 193 ARG B C     1 
ATOM   4222  O  O     . ARG B  1 86  ? 39.620  -21.081 5.824   1.00   25.14 ? 193 ARG B O     1 
ATOM   4223  C  CB    . ARG B  1 86  ? 39.882  -23.301 3.673   1.00   24.53 ? 193 ARG B CB    1 
ATOM   4224  C  CG    . ARG B  1 86  ? 41.099  -22.701 3.016   1.00   25.06 ? 193 ARG B CG    1 
ATOM   4225  C  CD    . ARG B  1 86  ? 42.159  -23.718 2.739   1.00   26.27 ? 193 ARG B CD    1 
ATOM   4226  N  NE    . ARG B  1 86  ? 43.321  -23.085 2.131   1.00   27.85 ? 193 ARG B NE    1 
ATOM   4227  C  CZ    . ARG B  1 86  ? 44.408  -23.740 1.744   1.00   30.75 ? 193 ARG B CZ    1 
ATOM   4228  N  NH1   . ARG B  1 86  ? 44.473  -25.062 1.904   1.00   35.73 ? 193 ARG B NH1   1 
ATOM   4229  N  NH2   . ARG B  1 86  ? 45.428  -23.083 1.203   1.00   28.52 ? 193 ARG B NH2   1 
ATOM   4230  N  N     . HIS B  1 87  ? 39.690  -20.010 3.837   1.00   23.59 ? 194 HIS B N     1 
ATOM   4231  C  CA    . HIS B  1 87  ? 40.320  -18.796 4.345   1.00   21.32 ? 194 HIS B CA    1 
ATOM   4232  C  C     . HIS B  1 87  ? 39.686  -18.179 5.595   1.00   20.68 ? 194 HIS B C     1 
ATOM   4233  O  O     . HIS B  1 87  ? 40.380  -17.945 6.592   1.00   19.09 ? 194 HIS B O     1 
ATOM   4234  C  CB    . HIS B  1 87  ? 40.385  -17.762 3.220   1.00   20.44 ? 194 HIS B CB    1 
ATOM   4235  C  CG    . HIS B  1 87  ? 41.285  -16.604 3.508   1.00   21.28 ? 194 HIS B CG    1 
ATOM   4236  N  ND1   . HIS B  1 87  ? 40.809  -15.343 3.793   1.00   22.40 ? 194 HIS B ND1   1 
ATOM   4237  C  CD2   . HIS B  1 87  ? 42.637  -16.510 3.532   1.00   22.85 ? 194 HIS B CD2   1 
ATOM   4238  C  CE1   . HIS B  1 87  ? 41.827  -14.522 3.977   1.00   24.59 ? 194 HIS B CE1   1 
ATOM   4239  N  NE2   . HIS B  1 87  ? 42.949  -15.205 3.824   1.00   22.79 ? 194 HIS B NE2   1 
ATOM   4240  N  N     . GLY B  1 88  ? 38.381  -17.921 5.544   1.00   18.42 ? 195 GLY B N     1 
ATOM   4241  C  CA    . GLY B  1 88  ? 37.706  -17.324 6.680   1.00   16.53 ? 195 GLY B CA    1 
ATOM   4242  C  C     . GLY B  1 88  ? 37.773  -18.179 7.930   1.00   18.40 ? 195 GLY B C     1 
ATOM   4243  O  O     . GLY B  1 88  ? 37.893  -17.659 9.040   1.00   16.64 ? 195 GLY B O     1 
ATOM   4244  N  N     . THR B  1 89  ? 37.697  -19.495 7.749   1.00   18.97 ? 196 THR B N     1 
ATOM   4245  C  CA    . THR B  1 89  ? 37.735  -20.425 8.869   1.00   20.42 ? 196 THR B CA    1 
ATOM   4246  C  C     . THR B  1 89  ? 39.090  -20.411 9.552   1.00   23.81 ? 196 THR B C     1 
ATOM   4247  O  O     . THR B  1 89  ? 39.182  -20.521 10.780  1.00   24.83 ? 196 THR B O     1 
ATOM   4248  C  CB    . THR B  1 89  ? 37.425  -21.849 8.405   1.00   20.05 ? 196 THR B CB    1 
ATOM   4249  O  OG1   . THR B  1 89  ? 36.083  -21.898 7.907   1.00   23.82 ? 196 THR B OG1   1 
ATOM   4250  C  CG2   . THR B  1 89  ? 37.577  -22.838 9.556   1.00   16.11 ? 196 THR B CG2   1 
ATOM   4251  N  N     . ARG B  1 90  ? 40.144  -20.280 8.755   1.00   23.24 ? 197 ARG B N     1 
ATOM   4252  C  CA    . ARG B  1 90  ? 41.480  -20.239 9.315   1.00   23.31 ? 197 ARG B CA    1 
ATOM   4253  C  C     . ARG B  1 90  ? 41.678  -18.979 10.147  1.00   23.47 ? 197 ARG B C     1 
ATOM   4254  O  O     . ARG B  1 90  ? 42.241  -19.042 11.239  1.00   24.00 ? 197 ARG B O     1 
ATOM   4255  C  CB    . ARG B  1 90  ? 42.510  -20.316 8.203   1.00   23.66 ? 197 ARG B CB    1 
ATOM   4256  C  CG    . ARG B  1 90  ? 42.532  -21.676 7.563   1.00   21.96 ? 197 ARG B CG    1 
ATOM   4257  C  CD    . ARG B  1 90  ? 43.661  -21.781 6.588   1.00   25.61 ? 197 ARG B CD    1 
ATOM   4258  N  NE    . ARG B  1 90  ? 43.826  -23.141 6.098   1.00   25.76 ? 197 ARG B NE    1 
ATOM   4259  C  CZ    . ARG B  1 90  ? 44.843  -23.530 5.338   1.00   25.76 ? 197 ARG B CZ    1 
ATOM   4260  N  NH1   . ARG B  1 90  ? 44.923  -24.790 4.932   1.00   25.35 ? 197 ARG B NH1   1 
ATOM   4261  N  NH2   . ARG B  1 90  ? 45.779  -22.654 4.987   1.00   24.85 ? 197 ARG B NH2   1 
ATOM   4262  N  N     . CYS B  1 91  ? 41.197  -17.845 9.638   1.00   21.52 ? 198 CYS B N     1 
ATOM   4263  C  CA    . CYS B  1 91  ? 41.322  -16.578 10.344  1.00   20.37 ? 198 CYS B CA    1 
ATOM   4264  C  C     . CYS B  1 91  ? 40.539  -16.600 11.650  1.00   21.24 ? 198 CYS B C     1 
ATOM   4265  O  O     . CYS B  1 91  ? 41.037  -16.152 12.682  1.00   23.13 ? 198 CYS B O     1 
ATOM   4266  C  CB    . CYS B  1 91  ? 40.848  -15.417 9.461   1.00   21.14 ? 198 CYS B CB    1 
ATOM   4267  S  SG    . CYS B  1 91  ? 42.022  -14.962 8.136   1.00   22.72 ? 198 CYS B SG    1 
ATOM   4268  N  N     . ALA B  1 92  ? 39.320  -17.130 11.613  1.00   21.45 ? 199 ALA B N     1 
ATOM   4269  C  CA    . ALA B  1 92  ? 38.482  -17.219 12.809  1.00   19.67 ? 199 ALA B CA    1 
ATOM   4270  C  C     . ALA B  1 92  ? 39.198  -17.974 13.936  1.00   21.74 ? 199 ALA B C     1 
ATOM   4271  O  O     . ALA B  1 92  ? 39.224  -17.515 15.077  1.00   21.20 ? 199 ALA B O     1 
ATOM   4272  C  CB    . ALA B  1 92  ? 37.174  -17.917 12.472  1.00   20.60 ? 199 ALA B CB    1 
ATOM   4273  N  N     . GLY B  1 93  ? 39.779  -19.126 13.602  1.00   22.78 ? 200 GLY B N     1 
ATOM   4274  C  CA    . GLY B  1 93  ? 40.480  -19.932 14.586  1.00   24.61 ? 200 GLY B CA    1 
ATOM   4275  C  C     . GLY B  1 93  ? 41.588  -19.202 15.321  1.00   26.04 ? 200 GLY B C     1 
ATOM   4276  O  O     . GLY B  1 93  ? 41.809  -19.439 16.518  1.00   24.33 ? 200 GLY B O     1 
ATOM   4277  N  N     . GLU B  1 94  ? 42.287  -18.317 14.611  1.00   25.37 ? 201 GLU B N     1 
ATOM   4278  C  CA    . GLU B  1 94  ? 43.381  -17.552 15.204  1.00   24.41 ? 201 GLU B CA    1 
ATOM   4279  C  C     . GLU B  1 94  ? 42.871  -16.690 16.342  1.00   25.41 ? 201 GLU B C     1 
ATOM   4280  O  O     . GLU B  1 94  ? 43.534  -16.536 17.369  1.00   25.47 ? 201 GLU B O     1 
ATOM   4281  C  CB    . GLU B  1 94  ? 44.016  -16.629 14.171  1.00   24.00 ? 201 GLU B CB    1 
ATOM   4282  C  CG    . GLU B  1 94  ? 44.818  -17.296 13.089  1.00   23.66 ? 201 GLU B CG    1 
ATOM   4283  C  CD    . GLU B  1 94  ? 45.410  -16.269 12.146  1.00   24.89 ? 201 GLU B CD    1 
ATOM   4284  O  OE1   . GLU B  1 94  ? 44.779  -15.958 11.115  1.00   25.89 ? 201 GLU B OE1   1 
ATOM   4285  O  OE2   . GLU B  1 94  ? 46.498  -15.750 12.453  1.00   27.78 ? 201 GLU B OE2   1 
ATOM   4286  N  N     . VAL B  1 95  ? 41.686  -16.123 16.143  1.00   24.85 ? 202 VAL B N     1 
ATOM   4287  C  CA    . VAL B  1 95  ? 41.085  -15.248 17.133  1.00   24.38 ? 202 VAL B CA    1 
ATOM   4288  C  C     . VAL B  1 95  ? 40.461  -15.965 18.317  1.00   25.58 ? 202 VAL B C     1 
ATOM   4289  O  O     . VAL B  1 95  ? 40.795  -15.671 19.465  1.00   22.87 ? 202 VAL B O     1 
ATOM   4290  C  CB    . VAL B  1 95  ? 40.003  -14.355 16.495  1.00   23.56 ? 202 VAL B CB    1 
ATOM   4291  C  CG1   . VAL B  1 95  ? 39.415  -13.429 17.537  1.00   22.11 ? 202 VAL B CG1   1 
ATOM   4292  C  CG2   . VAL B  1 95  ? 40.608  -13.552 15.363  1.00   23.64 ? 202 VAL B CG2   1 
ATOM   4293  N  N     . ALA B  1 96  ? 39.569  -16.915 18.044  1.00   27.49 ? 203 ALA B N     1 
ATOM   4294  C  CA    . ALA B  1 96  ? 38.886  -17.600 19.135  1.00   28.19 ? 203 ALA B CA    1 
ATOM   4295  C  C     . ALA B  1 96  ? 38.722  -19.119 19.102  1.00   28.33 ? 203 ALA B C     1 
ATOM   4296  O  O     . ALA B  1 96  ? 37.652  -19.622 19.444  1.00   27.32 ? 203 ALA B O     1 
ATOM   4297  C  CB    . ALA B  1 96  ? 37.526  -16.955 19.342  1.00   26.71 ? 203 ALA B CB    1 
ATOM   4298  N  N     . ALA B  1 97  ? 39.757  -19.856 18.708  1.00   30.03 ? 204 ALA B N     1 
ATOM   4299  C  CA    . ALA B  1 97  ? 39.659  -21.320 18.712  1.00   29.17 ? 204 ALA B CA    1 
ATOM   4300  C  C     . ALA B  1 97  ? 39.492  -21.730 20.185  1.00   28.11 ? 204 ALA B C     1 
ATOM   4301  O  O     . ALA B  1 97  ? 40.153  -21.170 21.068  1.00   26.89 ? 204 ALA B O     1 
ATOM   4302  C  CB    . ALA B  1 97  ? 40.930  -21.937 18.131  1.00   26.70 ? 204 ALA B CB    1 
ATOM   4303  N  N     . VAL B  1 98  ? 38.603  -22.682 20.453  1.00   25.65 ? 205 VAL B N     1 
ATOM   4304  C  CA    . VAL B  1 98  ? 38.366  -23.139 21.820  1.00   24.33 ? 205 VAL B CA    1 
ATOM   4305  C  C     . VAL B  1 98  ? 39.632  -23.681 22.501  1.00   23.92 ? 205 VAL B C     1 
ATOM   4306  O  O     . VAL B  1 98  ? 40.486  -24.303 21.858  1.00   20.06 ? 205 VAL B O     1 
ATOM   4307  C  CB    . VAL B  1 98  ? 37.288  -24.230 21.837  1.00   25.72 ? 205 VAL B CB    1 
ATOM   4308  C  CG1   . VAL B  1 98  ? 37.134  -24.808 23.241  1.00   24.47 ? 205 VAL B CG1   1 
ATOM   4309  C  CG2   . VAL B  1 98  ? 35.976  -23.643 21.344  1.00   27.07 ? 205 VAL B CG2   1 
ATOM   4310  N  N     . ALA B  1 99  ? 39.741  -23.453 23.808  1.00   23.96 ? 206 ALA B N     1 
ATOM   4311  C  CA    . ALA B  1 99  ? 40.907  -23.910 24.566  1.00   26.15 ? 206 ALA B CA    1 
ATOM   4312  C  C     . ALA B  1 99  ? 40.620  -25.125 25.459  1.00   26.92 ? 206 ALA B C     1 
ATOM   4313  O  O     . ALA B  1 99  ? 39.473  -25.361 25.879  1.00   28.49 ? 206 ALA B O     1 
ATOM   4314  C  CB    . ALA B  1 99  ? 41.461  -22.756 25.419  1.00   22.68 ? 206 ALA B CB    1 
ATOM   4315  N  N     . ASN B  1 100 ? 41.672  -25.892 25.736  1.00   25.47 ? 207 ASN B N     1 
ATOM   4316  C  CA    . ASN B  1 100 ? 41.582  -27.072 26.594  1.00   26.24 ? 207 ASN B CA    1 
ATOM   4317  C  C     . ASN B  1 100 ? 40.478  -28.031 26.184  1.00   26.64 ? 207 ASN B C     1 
ATOM   4318  O  O     . ASN B  1 100 ? 39.721  -28.505 27.033  1.00   27.78 ? 207 ASN B O     1 
ATOM   4319  C  CB    . ASN B  1 100 ? 41.346  -26.641 28.041  1.00   24.40 ? 207 ASN B CB    1 
ATOM   4320  C  CG    . ASN B  1 100 ? 42.362  -25.639 28.511  1.00   26.32 ? 207 ASN B CG    1 
ATOM   4321  O  OD1   . ASN B  1 100 ? 43.566  -25.924 28.530  1.00   28.18 ? 207 ASN B OD1   1 
ATOM   4322  N  ND2   . ASN B  1 100 ? 41.891  -24.445 28.886  1.00   19.16 ? 207 ASN B ND2   1 
ATOM   4323  N  N     . ASN B  1 101 ? 40.391  -28.332 24.895  1.00   26.43 ? 208 ASN B N     1 
ATOM   4324  C  CA    . ASN B  1 101 ? 39.353  -29.229 24.423  1.00   25.93 ? 208 ASN B CA    1 
ATOM   4325  C  C     . ASN B  1 101 ? 39.954  -30.363 23.601  1.00   25.28 ? 208 ASN B C     1 
ATOM   4326  O  O     . ASN B  1 101 ? 39.268  -31.006 22.809  1.00   24.73 ? 208 ASN B O     1 
ATOM   4327  C  CB    . ASN B  1 101 ? 38.317  -28.439 23.606  1.00   29.07 ? 208 ASN B CB    1 
ATOM   4328  C  CG    . ASN B  1 101 ? 38.826  -28.026 22.222  1.00   31.89 ? 208 ASN B CG    1 
ATOM   4329  O  OD1   . ASN B  1 101 ? 40.032  -27.883 21.990  1.00   33.55 ? 208 ASN B OD1   1 
ATOM   4330  N  ND2   . ASN B  1 101 ? 37.893  -27.819 21.300  1.00   31.73 ? 208 ASN B ND2   1 
ATOM   4331  N  N     . GLY B  1 102 ? 41.246  -30.597 23.809  1.00   24.26 ? 209 GLY B N     1 
ATOM   4332  C  CA    . GLY B  1 102 ? 41.948  -31.651 23.101  1.00   25.89 ? 209 GLY B CA    1 
ATOM   4333  C  C     . GLY B  1 102 ? 41.904  -31.548 21.587  1.00   25.89 ? 209 GLY B C     1 
ATOM   4334  O  O     . GLY B  1 102 ? 42.185  -32.520 20.887  1.00   24.27 ? 209 GLY B O     1 
ATOM   4335  N  N     . VAL B  1 103 ? 41.560  -30.372 21.072  1.00   27.79 ? 210 VAL B N     1 
ATOM   4336  C  CA    . VAL B  1 103 ? 41.487  -30.175 19.628  1.00   28.62 ? 210 VAL B CA    1 
ATOM   4337  C  C     . VAL B  1 103 ? 42.369  -29.035 19.123  1.00   29.43 ? 210 VAL B C     1 
ATOM   4338  O  O     . VAL B  1 103 ? 42.273  -27.898 19.593  1.00   27.72 ? 210 VAL B O     1 
ATOM   4339  C  CB    . VAL B  1 103 ? 40.037  -29.876 19.173  1.00   27.84 ? 210 VAL B CB    1 
ATOM   4340  C  CG1   . VAL B  1 103 ? 39.984  -29.675 17.670  1.00   24.95 ? 210 VAL B CG1   1 
ATOM   4341  C  CG2   . VAL B  1 103 ? 39.127  -31.001 19.573  1.00   26.63 ? 210 VAL B CG2   1 
ATOM   4342  N  N     . CYS B  1 104 ? 43.229  -29.362 18.164  1.00   30.46 ? 211 CYS B N     1 
ATOM   4343  C  CA    . CYS B  1 104 ? 44.101  -28.390 17.529  1.00   30.76 ? 211 CYS B CA    1 
ATOM   4344  C  C     . CYS B  1 104 ? 44.790  -27.461 18.545  1.00   30.54 ? 211 CYS B C     1 
ATOM   4345  O  O     . CYS B  1 104 ? 45.360  -27.935 19.535  1.00   29.80 ? 211 CYS B O     1 
ATOM   4346  C  CB    . CYS B  1 104 ? 43.258  -27.601 16.527  1.00   31.47 ? 211 CYS B CB    1 
ATOM   4347  S  SG    . CYS B  1 104 ? 44.111  -26.792 15.141  1.00   39.55 ? 211 CYS B SG    1 
ATOM   4348  N  N     . GLY B  1 105 ? 44.738  -26.150 18.305  1.00   29.20 ? 212 GLY B N     1 
ATOM   4349  C  CA    . GLY B  1 105 ? 45.370  -25.207 19.214  1.00   26.23 ? 212 GLY B CA    1 
ATOM   4350  C  C     . GLY B  1 105 ? 44.367  -24.329 19.934  1.00   26.06 ? 212 GLY B C     1 
ATOM   4351  O  O     . GLY B  1 105 ? 43.284  -24.791 20.290  1.00   27.32 ? 212 GLY B O     1 
ATOM   4352  N  N     . VAL B  1 106 ? 44.718  -23.064 20.157  1.00   24.92 ? 213 VAL B N     1 
ATOM   4353  C  CA    . VAL B  1 106 ? 43.811  -22.127 20.821  1.00   24.02 ? 213 VAL B CA    1 
ATOM   4354  C  C     . VAL B  1 106 ? 43.868  -20.750 20.172  1.00   24.56 ? 213 VAL B C     1 
ATOM   4355  O  O     . VAL B  1 106 ? 44.861  -20.400 19.529  1.00   23.59 ? 213 VAL B O     1 
ATOM   4356  C  CB    . VAL B  1 106 ? 44.155  -21.945 22.319  1.00   23.95 ? 213 VAL B CB    1 
ATOM   4357  C  CG1   . VAL B  1 106 ? 44.144  -23.290 23.019  1.00   24.94 ? 213 VAL B CG1   1 
ATOM   4358  C  CG2   . VAL B  1 106 ? 45.511  -21.262 22.476  1.00   23.44 ? 213 VAL B CG2   1 
ATOM   4359  N  N     . GLY B  1 107 ? 42.802  -19.971 20.343  1.00   24.60 ? 214 GLY B N     1 
ATOM   4360  C  CA    . GLY B  1 107 ? 42.775  -18.626 19.793  1.00   23.78 ? 214 GLY B CA    1 
ATOM   4361  C  C     . GLY B  1 107 ? 43.377  -17.649 20.792  1.00   24.26 ? 214 GLY B C     1 
ATOM   4362  O  O     . GLY B  1 107 ? 43.482  -17.962 21.983  1.00   24.10 ? 214 GLY B O     1 
ATOM   4363  N  N     . VAL B  1 108 ? 43.791  -16.473 20.329  1.00   23.94 ? 215 VAL B N     1 
ATOM   4364  C  CA    . VAL B  1 108 ? 44.363  -15.479 21.235  1.00   21.86 ? 215 VAL B CA    1 
ATOM   4365  C  C     . VAL B  1 108 ? 43.326  -15.127 22.301  1.00   21.83 ? 215 VAL B C     1 
ATOM   4366  O  O     . VAL B  1 108 ? 43.661  -14.984 23.475  1.00   23.66 ? 215 VAL B O     1 
ATOM   4367  C  CB    . VAL B  1 108 ? 44.770  -14.198 20.471  1.00   22.15 ? 215 VAL B CB    1 
ATOM   4368  C  CG1   . VAL B  1 108 ? 45.262  -13.139 21.440  1.00   20.68 ? 215 VAL B CG1   1 
ATOM   4369  C  CG2   . VAL B  1 108 ? 45.862  -14.526 19.476  1.00   18.75 ? 215 VAL B CG2   1 
ATOM   4370  N  N     . ALA B  1 109 ? 42.069  -14.980 21.884  1.00   19.71 ? 216 ALA B N     1 
ATOM   4371  C  CA    . ALA B  1 109 ? 40.983  -14.678 22.807  1.00   19.45 ? 216 ALA B CA    1 
ATOM   4372  C  C     . ALA B  1 109 ? 40.073  -15.905 22.808  1.00   22.35 ? 216 ALA B C     1 
ATOM   4373  O  O     . ALA B  1 109 ? 38.963  -15.861 22.272  1.00   24.43 ? 216 ALA B O     1 
ATOM   4374  C  CB    . ALA B  1 109 ? 40.222  -13.455 22.332  1.00   16.37 ? 216 ALA B CB    1 
ATOM   4375  N  N     . TYR B  1 110 ? 40.540  -16.994 23.421  1.00   23.60 ? 217 TYR B N     1 
ATOM   4376  C  CA    . TYR B  1 110 ? 39.787  -18.245 23.421  1.00   25.45 ? 217 TYR B CA    1 
ATOM   4377  C  C     . TYR B  1 110 ? 38.472  -18.282 24.178  1.00   27.03 ? 217 TYR B C     1 
ATOM   4378  O  O     . TYR B  1 110 ? 37.809  -19.322 24.222  1.00   26.70 ? 217 TYR B O     1 
ATOM   4379  C  CB    . TYR B  1 110 ? 40.682  -19.411 23.861  1.00   24.68 ? 217 TYR B CB    1 
ATOM   4380  C  CG    . TYR B  1 110 ? 41.299  -19.269 25.221  1.00   25.49 ? 217 TYR B CG    1 
ATOM   4381  C  CD1   . TYR B  1 110 ? 40.515  -19.289 26.372  1.00   24.19 ? 217 TYR B CD1   1 
ATOM   4382  C  CD2   . TYR B  1 110 ? 42.679  -19.161 25.363  1.00   26.37 ? 217 TYR B CD2   1 
ATOM   4383  C  CE1   . TYR B  1 110 ? 41.091  -19.214 27.633  1.00   23.12 ? 217 TYR B CE1   1 
ATOM   4384  C  CE2   . TYR B  1 110 ? 43.267  -19.088 26.619  1.00   26.36 ? 217 TYR B CE2   1 
ATOM   4385  C  CZ    . TYR B  1 110 ? 42.466  -19.118 27.751  1.00   25.79 ? 217 TYR B CZ    1 
ATOM   4386  O  OH    . TYR B  1 110 ? 43.040  -19.073 28.998  1.00   29.25 ? 217 TYR B OH    1 
ATOM   4387  N  N     . ASN B  1 111 ? 38.085  -17.159 24.770  1.00   29.12 ? 218 ASN B N     1 
ATOM   4388  C  CA    . ASN B  1 111 ? 36.808  -17.110 25.469  1.00   31.24 ? 218 ASN B CA    1 
ATOM   4389  C  C     . ASN B  1 111 ? 35.900  -16.061 24.853  1.00   31.70 ? 218 ASN B C     1 
ATOM   4390  O  O     . ASN B  1 111 ? 34.814  -15.790 25.363  1.00   32.62 ? 218 ASN B O     1 
ATOM   4391  C  CB    . ASN B  1 111 ? 36.993  -16.830 26.962  1.00   31.41 ? 218 ASN B CB    1 
ATOM   4392  C  CG    . ASN B  1 111 ? 37.351  -18.082 27.735  1.00   30.37 ? 218 ASN B CG    1 
ATOM   4393  O  OD1   . ASN B  1 111 ? 36.803  -19.163 27.476  1.00   26.87 ? 218 ASN B OD1   1 
ATOM   4394  N  ND2   . ASN B  1 111 ? 38.264  -17.948 28.692  1.00   30.30 ? 218 ASN B ND2   1 
ATOM   4395  N  N     . ALA B  1 112 ? 36.355  -15.479 23.749  1.00   31.47 ? 219 ALA B N     1 
ATOM   4396  C  CA    . ALA B  1 112 ? 35.583  -14.467 23.051  1.00   31.89 ? 219 ALA B CA    1 
ATOM   4397  C  C     . ALA B  1 112 ? 34.567  -15.179 22.165  1.00   31.49 ? 219 ALA B C     1 
ATOM   4398  O  O     . ALA B  1 112 ? 34.708  -16.373 21.882  1.00   31.48 ? 219 ALA B O     1 
ATOM   4399  C  CB    . ALA B  1 112 ? 36.502  -13.602 22.199  1.00   31.69 ? 219 ALA B CB    1 
ATOM   4400  N  N     . ARG B  1 113 ? 33.534  -14.462 21.741  1.00   29.96 ? 220 ARG B N     1 
ATOM   4401  C  CA    . ARG B  1 113 ? 32.546  -15.062 20.867  1.00   28.89 ? 220 ARG B CA    1 
ATOM   4402  C  C     . ARG B  1 113 ? 32.976  -14.695 19.465  1.00   27.20 ? 220 ARG B C     1 
ATOM   4403  O  O     . ARG B  1 113 ? 33.299  -13.541 19.189  1.00   26.38 ? 220 ARG B O     1 
ATOM   4404  C  CB    . ARG B  1 113 ? 31.154  -14.536 21.197  1.00   31.02 ? 220 ARG B CB    1 
ATOM   4405  C  CG    . ARG B  1 113 ? 30.599  -15.156 22.466  1.00   32.18 ? 220 ARG B CG    1 
ATOM   4406  C  CD    . ARG B  1 113 ? 29.660  -14.210 23.154  1.00   38.53 ? 220 ARG B CD    1 
ATOM   4407  N  NE    . ARG B  1 113 ? 28.396  -14.096 22.441  1.00   41.00 ? 220 ARG B NE    1 
ATOM   4408  C  CZ    . ARG B  1 113 ? 27.528  -13.109 22.629  1.00   39.79 ? 220 ARG B CZ    1 
ATOM   4409  N  NH1   . ARG B  1 113 ? 26.392  -13.089 21.939  1.00   41.48 ? 220 ARG B NH1   1 
ATOM   4410  N  NH2   . ARG B  1 113 ? 27.807  -12.136 23.495  1.00   36.94 ? 220 ARG B NH2   1 
ATOM   4411  N  N     . ILE B  1 114 ? 33.005  -15.688 18.586  1.00   26.41 ? 221 ILE B N     1 
ATOM   4412  C  CA    . ILE B  1 114 ? 33.442  -15.480 17.215  1.00   26.55 ? 221 ILE B CA    1 
ATOM   4413  C  C     . ILE B  1 114 ? 32.315  -15.666 16.206  1.00   26.02 ? 221 ILE B C     1 
ATOM   4414  O  O     . ILE B  1 114 ? 31.565  -16.636 16.266  1.00   25.38 ? 221 ILE B O     1 
ATOM   4415  C  CB    . ILE B  1 114 ? 34.586  -16.456 16.874  1.00   27.84 ? 221 ILE B CB    1 
ATOM   4416  C  CG1   . ILE B  1 114 ? 35.117  -16.187 15.466  1.00   26.97 ? 221 ILE B CG1   1 
ATOM   4417  C  CG2   . ILE B  1 114 ? 34.085  -17.884 16.996  1.00   24.80 ? 221 ILE B CG2   1 
ATOM   4418  C  CD1   . ILE B  1 114 ? 35.853  -14.884 15.335  1.00   27.07 ? 221 ILE B CD1   1 
ATOM   4419  N  N     . GLY B  1 115 ? 32.209  -14.725 15.279  1.00   25.43 ? 222 GLY B N     1 
ATOM   4420  C  CA    . GLY B  1 115 ? 31.186  -14.804 14.258  1.00   25.23 ? 222 GLY B CA    1 
ATOM   4421  C  C     . GLY B  1 115 ? 31.853  -14.674 12.903  1.00   25.61 ? 222 GLY B C     1 
ATOM   4422  O  O     . GLY B  1 115 ? 33.064  -14.430 12.831  1.00   26.57 ? 222 GLY B O     1 
ATOM   4423  N  N     . GLY B  1 116 ? 31.083  -14.833 11.832  1.00   22.45 ? 223 GLY B N     1 
ATOM   4424  C  CA    . GLY B  1 116 ? 31.665  -14.725 10.509  1.00   21.18 ? 223 GLY B CA    1 
ATOM   4425  C  C     . GLY B  1 116 ? 30.673  -14.217 9.491   1.00   21.86 ? 223 GLY B C     1 
ATOM   4426  O  O     . GLY B  1 116 ? 29.498  -14.572 9.531   1.00   23.60 ? 223 GLY B O     1 
ATOM   4427  N  N     . VAL B  1 117 ? 31.140  -13.360 8.590   1.00   19.77 ? 224 VAL B N     1 
ATOM   4428  C  CA    . VAL B  1 117 ? 30.281  -12.821 7.548   1.00   19.31 ? 224 VAL B CA    1 
ATOM   4429  C  C     . VAL B  1 117 ? 30.791  -13.360 6.227   1.00   21.34 ? 224 VAL B C     1 
ATOM   4430  O  O     . VAL B  1 117 ? 31.917  -13.071 5.824   1.00   20.97 ? 224 VAL B O     1 
ATOM   4431  C  CB    . VAL B  1 117 ? 30.322  -11.275 7.476   1.00   18.00 ? 224 VAL B CB    1 
ATOM   4432  C  CG1   . VAL B  1 117 ? 29.462  -10.792 6.310   1.00   12.76 ? 224 VAL B CG1   1 
ATOM   4433  C  CG2   . VAL B  1 117 ? 29.841  -10.668 8.779   1.00   16.61 ? 224 VAL B CG2   1 
ATOM   4434  N  N     . ARG B  1 118 ? 29.972  -14.164 5.562   1.00   22.31 ? 225 ARG B N     1 
ATOM   4435  C  CA    . ARG B  1 118 ? 30.368  -14.718 4.282   1.00   20.80 ? 225 ARG B CA    1 
ATOM   4436  C  C     . ARG B  1 118 ? 30.111  -13.613 3.271   1.00   21.33 ? 225 ARG B C     1 
ATOM   4437  O  O     . ARG B  1 118 ? 28.957  -13.288 2.980   1.00   20.88 ? 225 ARG B O     1 
ATOM   4438  C  CB    . ARG B  1 118 ? 29.536  -15.970 3.961   1.00   20.51 ? 225 ARG B CB    1 
ATOM   4439  C  CG    . ARG B  1 118 ? 29.915  -16.669 2.662   1.00   18.50 ? 225 ARG B CG    1 
ATOM   4440  C  CD    . ARG B  1 118 ? 29.216  -18.029 2.522   1.00   22.53 ? 225 ARG B CD    1 
ATOM   4441  N  NE    . ARG B  1 118 ? 29.408  -18.615 1.194   1.00   23.10 ? 225 ARG B NE    1 
ATOM   4442  C  CZ    . ARG B  1 118 ? 28.532  -18.531 0.196   1.00   22.68 ? 225 ARG B CZ    1 
ATOM   4443  N  NH1   . ARG B  1 118 ? 28.799  -19.086 -0.981  1.00   23.09 ? 225 ARG B NH1   1 
ATOM   4444  N  NH2   . ARG B  1 118 ? 27.375  -17.914 0.374   1.00   22.37 ? 225 ARG B NH2   1 
ATOM   4445  N  N     . MET B  1 119 ? 31.184  -13.004 2.770   1.00   21.30 ? 226 MET B N     1 
ATOM   4446  C  CA    . MET B  1 119 ? 31.033  -11.934 1.791   1.00   21.84 ? 226 MET B CA    1 
ATOM   4447  C  C     . MET B  1 119 ? 32.087  -11.881 0.689   1.00   20.88 ? 226 MET B C     1 
ATOM   4448  O  O     . MET B  1 119 ? 32.008  -11.020 -0.187  1.00   21.84 ? 226 MET B O     1 
ATOM   4449  C  CB    . MET B  1 119 ? 30.925  -10.564 2.492   1.00   20.80 ? 226 MET B CB    1 
ATOM   4450  C  CG    . MET B  1 119 ? 32.012  -10.229 3.518   1.00   20.58 ? 226 MET B CG    1 
ATOM   4451  S  SD    . MET B  1 119 ? 33.683  -9.907  2.886   1.00   26.39 ? 226 MET B SD    1 
ATOM   4452  C  CE    . MET B  1 119 ? 33.518  -8.284  2.215   1.00   26.25 ? 226 MET B CE    1 
ATOM   4453  N  N     . LEU B  1 120 ? 33.064  -12.786 0.715   1.00   18.82 ? 227 LEU B N     1 
ATOM   4454  C  CA    . LEU B  1 120 ? 34.087  -12.798 -0.339  1.00   20.97 ? 227 LEU B CA    1 
ATOM   4455  C  C     . LEU B  1 120 ? 33.779  -13.819 -1.445  1.00   22.08 ? 227 LEU B C     1 
ATOM   4456  O  O     . LEU B  1 120 ? 34.329  -13.739 -2.550  1.00   21.24 ? 227 LEU B O     1 
ATOM   4457  C  CB    . LEU B  1 120 ? 35.479  -13.100 0.236   1.00   17.28 ? 227 LEU B CB    1 
ATOM   4458  C  CG    . LEU B  1 120 ? 36.155  -12.038 1.091   1.00   17.36 ? 227 LEU B CG    1 
ATOM   4459  C  CD1   . LEU B  1 120 ? 37.477  -12.581 1.598   1.00   15.31 ? 227 LEU B CD1   1 
ATOM   4460  C  CD2   . LEU B  1 120 ? 36.349  -10.762 0.286   1.00   15.56 ? 227 LEU B CD2   1 
ATOM   4461  N  N     . ASP B  1 121 ? 32.899  -14.773 -1.147  1.00   21.86 ? 228 ASP B N     1 
ATOM   4462  C  CA    . ASP B  1 121 ? 32.541  -15.807 -2.104  1.00   21.95 ? 228 ASP B CA    1 
ATOM   4463  C  C     . ASP B  1 121 ? 31.379  -15.369 -2.984  1.00   21.97 ? 228 ASP B C     1 
ATOM   4464  O  O     . ASP B  1 121 ? 30.251  -15.829 -2.831  1.00   23.12 ? 228 ASP B O     1 
ATOM   4465  C  CB    . ASP B  1 121 ? 32.197  -17.096 -1.351  1.00   24.46 ? 228 ASP B CB    1 
ATOM   4466  C  CG    . ASP B  1 121 ? 32.186  -18.326 -2.252  1.00   25.56 ? 228 ASP B CG    1 
ATOM   4467  O  OD1   . ASP B  1 121 ? 32.820  -18.290 -3.332  1.00   24.97 ? 228 ASP B OD1   1 
ATOM   4468  O  OD2   . ASP B  1 121 ? 31.555  -19.335 -1.867  1.00   24.39 ? 228 ASP B OD2   1 
ATOM   4469  N  N     . GLY B  1 122 ? 31.674  -14.471 -3.914  1.00   22.19 ? 229 GLY B N     1 
ATOM   4470  C  CA    . GLY B  1 122 ? 30.665  -13.953 -4.818  1.00   22.51 ? 229 GLY B CA    1 
ATOM   4471  C  C     . GLY B  1 122 ? 31.125  -12.600 -5.316  1.00   23.78 ? 229 GLY B C     1 
ATOM   4472  O  O     . GLY B  1 122 ? 32.300  -12.261 -5.159  1.00   26.17 ? 229 GLY B O     1 
ATOM   4473  N  N     . GLU B  1 123 ? 30.234  -11.818 -5.919  1.00   24.32 ? 230 GLU B N     1 
ATOM   4474  C  CA    . GLU B  1 123 ? 30.634  -10.497 -6.394  1.00   24.49 ? 230 GLU B CA    1 
ATOM   4475  C  C     . GLU B  1 123 ? 30.732  -9.579  -5.167  1.00   22.68 ? 230 GLU B C     1 
ATOM   4476  O  O     . GLU B  1 123 ? 29.740  -9.370  -4.457  1.00   22.73 ? 230 GLU B O     1 
ATOM   4477  C  CB    . GLU B  1 123 ? 29.609  -9.938  -7.396  1.00   23.66 ? 230 GLU B CB    1 
ATOM   4478  C  CG    . GLU B  1 123 ? 30.237  -9.143  -8.548  1.00   28.29 ? 230 GLU B CG    1 
ATOM   4479  C  CD    . GLU B  1 123 ? 29.273  -8.160  -9.209  1.00   28.49 ? 230 GLU B CD    1 
ATOM   4480  O  OE1   . GLU B  1 123 ? 28.153  -8.568  -9.580  0.0000 28.41 ? 230 GLU B OE1   1 
ATOM   4481  O  OE2   . GLU B  1 123 ? 29.653  -6.978  -9.360  0.0000 28.41 ? 230 GLU B OE2   1 
ATOM   4482  N  N     . VAL B  1 124 ? 31.926  -9.053  -4.910  1.00   20.72 ? 231 VAL B N     1 
ATOM   4483  C  CA    . VAL B  1 124 ? 32.139  -8.160  -3.771  1.00   21.08 ? 231 VAL B CA    1 
ATOM   4484  C  C     . VAL B  1 124 ? 31.844  -6.707  -4.171  1.00   21.09 ? 231 VAL B C     1 
ATOM   4485  O  O     . VAL B  1 124 ? 32.739  -5.972  -4.594  1.00   19.11 ? 231 VAL B O     1 
ATOM   4486  C  CB    . VAL B  1 124 ? 33.598  -8.251  -3.265  1.00   18.36 ? 231 VAL B CB    1 
ATOM   4487  C  CG1   . VAL B  1 124 ? 33.778  -7.376  -2.055  1.00   16.87 ? 231 VAL B CG1   1 
ATOM   4488  C  CG2   . VAL B  1 124 ? 33.951  -9.696  -2.951  1.00   17.25 ? 231 VAL B CG2   1 
ATOM   4489  N  N     . THR B  1 125 ? 30.587  -6.298  -4.042  1.00   20.74 ? 232 THR B N     1 
ATOM   4490  C  CA    . THR B  1 125 ? 30.194  -4.943  -4.408  1.00   22.23 ? 232 THR B CA    1 
ATOM   4491  C  C     . THR B  1 125 ? 30.298  -3.991  -3.221  1.00   24.29 ? 232 THR B C     1 
ATOM   4492  O  O     . THR B  1 125 ? 30.568  -4.416  -2.096  1.00   27.32 ? 232 THR B O     1 
ATOM   4493  C  CB    . THR B  1 125 ? 28.745  -4.913  -4.916  1.00   22.42 ? 232 THR B CB    1 
ATOM   4494  O  OG1   . THR B  1 125 ? 27.874  -5.367  -3.874  1.00   24.29 ? 232 THR B OG1   1 
ATOM   4495  C  CG2   . THR B  1 125 ? 28.574  -5.822  -6.130  1.00   17.83 ? 232 THR B CG2   1 
ATOM   4496  N  N     . ASP B  1 126 ? 30.076  -2.705  -3.474  1.00   24.40 ? 233 ASP B N     1 
ATOM   4497  C  CA    . ASP B  1 126 ? 30.132  -1.694  -2.432  1.00   23.47 ? 233 ASP B CA    1 
ATOM   4498  C  C     . ASP B  1 126 ? 29.067  -2.037  -1.387  1.00   23.14 ? 233 ASP B C     1 
ATOM   4499  O  O     . ASP B  1 126 ? 29.346  -2.037  -0.182  1.00   24.13 ? 233 ASP B O     1 
ATOM   4500  C  CB    . ASP B  1 126 ? 29.898  -0.308  -3.062  1.00   23.11 ? 233 ASP B CB    1 
ATOM   4501  C  CG    . ASP B  1 126 ? 30.027  0.835   -2.062  1.00   26.84 ? 233 ASP B CG    1 
ATOM   4502  O  OD1   . ASP B  1 126 ? 30.897  0.776   -1.159  1.00   26.62 ? 233 ASP B OD1   1 
ATOM   4503  O  OD2   . ASP B  1 126 ? 29.260  1.811   -2.195  1.00   28.66 ? 233 ASP B OD2   1 
ATOM   4504  N  N     . ALA B  1 127 ? 27.862  -2.363  -1.851  1.00   22.00 ? 234 ALA B N     1 
ATOM   4505  C  CA    . ALA B  1 127 ? 26.770  -2.722  -0.944  1.00   22.24 ? 234 ALA B CA    1 
ATOM   4506  C  C     . ALA B  1 127 ? 27.152  -3.946  -0.114  1.00   22.44 ? 234 ALA B C     1 
ATOM   4507  O  O     . ALA B  1 127 ? 26.821  -4.029  1.068   1.00   23.57 ? 234 ALA B O     1 
ATOM   4508  C  CB    . ALA B  1 127 ? 25.490  -2.995  -1.733  1.00   17.01 ? 234 ALA B CB    1 
ATOM   4509  N  N     . VAL B  1 128 ? 27.852  -4.892  -0.734  1.00   21.91 ? 235 VAL B N     1 
ATOM   4510  C  CA    . VAL B  1 128 ? 28.287  -6.098  -0.035  1.00   21.06 ? 235 VAL B CA    1 
ATOM   4511  C  C     . VAL B  1 128 ? 29.222  -5.722  1.107   1.00   21.32 ? 235 VAL B C     1 
ATOM   4512  O  O     . VAL B  1 128 ? 29.030  -6.142  2.249   1.00   22.32 ? 235 VAL B O     1 
ATOM   4513  C  CB    . VAL B  1 128 ? 29.034  -7.068  -0.983  1.00   20.72 ? 235 VAL B CB    1 
ATOM   4514  C  CG1   . VAL B  1 128 ? 29.743  -8.144  -0.183  1.00   19.49 ? 235 VAL B CG1   1 
ATOM   4515  C  CG2   . VAL B  1 128 ? 28.065  -7.689  -1.962  1.00   18.28 ? 235 VAL B CG2   1 
ATOM   4516  N  N     . GLU B  1 129 ? 30.234  -4.922  0.799   1.00   21.00 ? 236 GLU B N     1 
ATOM   4517  C  CA    . GLU B  1 129 ? 31.184  -4.502  1.822   1.00   20.91 ? 236 GLU B CA    1 
ATOM   4518  C  C     . GLU B  1 129 ? 30.477  -3.704  2.926   1.00   22.47 ? 236 GLU B C     1 
ATOM   4519  O  O     . GLU B  1 129 ? 30.707  -3.933  4.123   1.00   21.51 ? 236 GLU B O     1 
ATOM   4520  C  CB    . GLU B  1 129 ? 32.294  -3.650  1.195   1.00   16.56 ? 236 GLU B CB    1 
ATOM   4521  C  CG    . GLU B  1 129 ? 33.247  -4.415  0.287   1.00   15.68 ? 236 GLU B CG    1 
ATOM   4522  C  CD    . GLU B  1 129 ? 34.276  -3.517  -0.410  1.00   20.46 ? 236 GLU B CD    1 
ATOM   4523  O  OE1   . GLU B  1 129 ? 34.283  -2.289  -0.155  1.00   19.84 ? 236 GLU B OE1   1 
ATOM   4524  O  OE2   . GLU B  1 129 ? 35.084  -4.042  -1.215  1.00   17.69 ? 236 GLU B OE2   1 
ATOM   4525  N  N     . ALA B  1 130 ? 29.606  -2.781  2.520   1.00   20.97 ? 237 ALA B N     1 
ATOM   4526  C  CA    . ALA B  1 130 ? 28.898  -1.940  3.472   1.00   18.97 ? 237 ALA B CA    1 
ATOM   4527  C  C     . ALA B  1 130 ? 28.047  -2.727  4.468   1.00   19.32 ? 237 ALA B C     1 
ATOM   4528  O  O     . ALA B  1 130 ? 28.040  -2.425  5.661   1.00   16.97 ? 237 ALA B O     1 
ATOM   4529  C  CB    . ALA B  1 130 ? 28.040  -0.938  2.728   1.00   17.57 ? 237 ALA B CB    1 
ATOM   4530  N  N     . ARG B  1 131 ? 27.340  -3.742  3.985   1.00   19.35 ? 238 ARG B N     1 
ATOM   4531  C  CA    . ARG B  1 131 ? 26.491  -4.525  4.866   1.00   21.42 ? 238 ARG B CA    1 
ATOM   4532  C  C     . ARG B  1 131 ? 27.325  -5.357  5.834   1.00   21.50 ? 238 ARG B C     1 
ATOM   4533  O  O     . ARG B  1 131 ? 26.915  -5.598  6.973   1.00   22.81 ? 238 ARG B O     1 
ATOM   4534  C  CB    . ARG B  1 131 ? 25.560  -5.422  4.044   1.00   21.70 ? 238 ARG B CB    1 
ATOM   4535  C  CG    . ARG B  1 131 ? 24.686  -4.675  3.050   1.00   24.35 ? 238 ARG B CG    1 
ATOM   4536  C  CD    . ARG B  1 131 ? 23.682  -5.617  2.430   1.00   27.73 ? 238 ARG B CD    1 
ATOM   4537  N  NE    . ARG B  1 131 ? 22.766  -6.105  3.453   1.00   34.30 ? 238 ARG B NE    1 
ATOM   4538  C  CZ    . ARG B  1 131 ? 22.270  -7.338  3.495   1.00   40.09 ? 238 ARG B CZ    1 
ATOM   4539  N  NH1   . ARG B  1 131 ? 21.435  -7.673  4.479   1.00   42.17 ? 238 ARG B NH1   1 
ATOM   4540  N  NH2   . ARG B  1 131 ? 22.615  -8.238  2.565   1.00   38.23 ? 238 ARG B NH2   1 
ATOM   4541  N  N     . SER B  1 132 ? 28.503  -5.782  5.383   1.00   21.53 ? 239 SER B N     1 
ATOM   4542  C  CA    . SER B  1 132 ? 29.397  -6.586  6.216   1.00   20.09 ? 239 SER B CA    1 
ATOM   4543  C  C     . SER B  1 132 ? 30.037  -5.718  7.294   1.00   20.50 ? 239 SER B C     1 
ATOM   4544  O  O     . SER B  1 132 ? 30.017  -6.065  8.469   1.00   22.36 ? 239 SER B O     1 
ATOM   4545  C  CB    . SER B  1 132 ? 30.493  -7.218  5.361   1.00   19.36 ? 239 SER B CB    1 
ATOM   4546  O  OG    . SER B  1 132 ? 29.953  -7.878  4.234   1.00   23.81 ? 239 SER B OG    1 
ATOM   4547  N  N     . LEU B  1 133 ? 30.600  -4.585  6.887   1.00   20.37 ? 240 LEU B N     1 
ATOM   4548  C  CA    . LEU B  1 133 ? 31.244  -3.672  7.818   1.00   18.51 ? 240 LEU B CA    1 
ATOM   4549  C  C     . LEU B  1 133 ? 30.244  -3.073  8.808   1.00   18.99 ? 240 LEU B C     1 
ATOM   4550  O  O     . LEU B  1 133 ? 30.601  -2.711  9.932   1.00   21.36 ? 240 LEU B O     1 
ATOM   4551  C  CB    . LEU B  1 133 ? 31.937  -2.550  7.038   1.00   17.70 ? 240 LEU B CB    1 
ATOM   4552  C  CG    . LEU B  1 133 ? 33.144  -2.944  6.169   1.00   15.75 ? 240 LEU B CG    1 
ATOM   4553  C  CD1   . LEU B  1 133 ? 33.562  -1.783  5.264   1.00   14.58 ? 240 LEU B CD1   1 
ATOM   4554  C  CD2   . LEU B  1 133 ? 34.292  -3.350  7.069   1.00   13.40 ? 240 LEU B CD2   1 
ATOM   4555  N  N     . GLY B  1 134 ? 28.988  -2.975  8.394   1.00   18.11 ? 241 GLY B N     1 
ATOM   4556  C  CA    . GLY B  1 134 ? 27.986  -2.391  9.263   1.00   19.34 ? 241 GLY B CA    1 
ATOM   4557  C  C     . GLY B  1 134 ? 27.039  -3.380  9.910   1.00   23.45 ? 241 GLY B C     1 
ATOM   4558  O  O     . GLY B  1 134 ? 25.957  -3.007  10.370  1.00   21.77 ? 241 GLY B O     1 
ATOM   4559  N  N     . LEU B  1 135 ? 27.438  -4.643  9.957   1.00   24.95 ? 242 LEU B N     1 
ATOM   4560  C  CA    . LEU B  1 135 ? 26.607  -5.675  10.554  1.00   26.20 ? 242 LEU B CA    1 
ATOM   4561  C  C     . LEU B  1 135 ? 26.578  -5.582  12.080  1.00   28.02 ? 242 LEU B C     1 
ATOM   4562  O  O     . LEU B  1 135 ? 27.626  -5.655  12.713  1.00   33.44 ? 242 LEU B O     1 
ATOM   4563  C  CB    . LEU B  1 135 ? 27.136  -7.047  10.144  1.00   22.74 ? 242 LEU B CB    1 
ATOM   4564  C  CG    . LEU B  1 135 ? 26.416  -8.245  10.762  1.00   21.14 ? 242 LEU B CG    1 
ATOM   4565  C  CD1   . LEU B  1 135 ? 25.074  -8.401  10.085  1.00   16.12 ? 242 LEU B CD1   1 
ATOM   4566  C  CD2   . LEU B  1 135 ? 27.259  -9.496  10.616  1.00   19.63 ? 242 LEU B CD2   1 
ATOM   4567  N  N     . ASN B  1 136 ? 25.393  -5.427  12.670  1.00   27.23 ? 243 ASN B N     1 
ATOM   4568  C  CA    . ASN B  1 136 ? 25.269  -5.363  14.133  1.00   30.53 ? 243 ASN B CA    1 
ATOM   4569  C  C     . ASN B  1 136 ? 26.303  -4.520  14.855  1.00   28.65 ? 243 ASN B C     1 
ATOM   4570  O  O     . ASN B  1 136 ? 27.010  -5.037  15.723  1.00   28.75 ? 243 ASN B O     1 
ATOM   4571  C  CB    . ASN B  1 136 ? 25.382  -6.752  14.740  1.00   34.43 ? 243 ASN B CB    1 
ATOM   4572  C  CG    . ASN B  1 136 ? 24.060  -7.420  14.908  1.00   39.52 ? 243 ASN B CG    1 
ATOM   4573  O  OD1   . ASN B  1 136 ? 23.528  -8.021  13.966  1.00   45.00 ? 243 ASN B OD1   1 
ATOM   4574  N  ND2   . ASN B  1 136 ? 23.500  -7.319  16.115  1.00   35.37 ? 243 ASN B ND2   1 
ATOM   4575  N  N     . PRO B  1 137 ? 26.393  -3.224  14.538  1.00   26.72 ? 244 PRO B N     1 
ATOM   4576  C  CA    . PRO B  1 137 ? 27.372  -2.346  15.187  1.00   25.53 ? 244 PRO B CA    1 
ATOM   4577  C  C     . PRO B  1 137 ? 27.283  -2.339  16.710  1.00   24.82 ? 244 PRO B C     1 
ATOM   4578  O  O     . PRO B  1 137 ? 28.260  -2.042  17.390  1.00   26.20 ? 244 PRO B O     1 
ATOM   4579  C  CB    . PRO B  1 137 ? 27.056  -0.975  14.601  1.00   26.26 ? 244 PRO B CB    1 
ATOM   4580  C  CG    . PRO B  1 137 ? 26.374  -1.293  13.305  1.00   25.72 ? 244 PRO B CG    1 
ATOM   4581  C  CD    . PRO B  1 137 ? 25.503  -2.454  13.659  1.00   25.27 ? 244 PRO B CD    1 
ATOM   4582  N  N     . ASN B  1 138 ? 26.116  -2.672  17.250  1.00   25.65 ? 245 ASN B N     1 
ATOM   4583  C  CA    . ASN B  1 138 ? 25.960  -2.661  18.696  1.00   27.82 ? 245 ASN B CA    1 
ATOM   4584  C  C     . ASN B  1 138 ? 26.092  -4.007  19.375  1.00   26.79 ? 245 ASN B C     1 
ATOM   4585  O  O     . ASN B  1 138 ? 25.923  -4.112  20.591  1.00   27.73 ? 245 ASN B O     1 
ATOM   4586  C  CB    . ASN B  1 138 ? 24.639  -2.007  19.080  1.00   27.94 ? 245 ASN B CB    1 
ATOM   4587  C  CG    . ASN B  1 138 ? 24.596  -0.545  18.701  1.00   32.77 ? 245 ASN B CG    1 
ATOM   4588  O  OD1   . ASN B  1 138 ? 25.522  0.223   19.018  1.00   32.98 ? 245 ASN B OD1   1 
ATOM   4589  N  ND2   . ASN B  1 138 ? 23.526  -0.142  18.015  1.00   31.31 ? 245 ASN B ND2   1 
ATOM   4590  N  N     . HIS B  1 139 ? 26.393  -5.037  18.595  1.00   24.87 ? 246 HIS B N     1 
ATOM   4591  C  CA    . HIS B  1 139 ? 26.588  -6.356  19.162  1.00   24.59 ? 246 HIS B CA    1 
ATOM   4592  C  C     . HIS B  1 139 ? 28.050  -6.753  18.973  1.00   26.45 ? 246 HIS B C     1 
ATOM   4593  O  O     . HIS B  1 139 ? 28.700  -7.220  19.913  1.00   27.83 ? 246 HIS B O     1 
ATOM   4594  C  CB    . HIS B  1 139 ? 25.695  -7.391  18.494  1.00   23.78 ? 246 HIS B CB    1 
ATOM   4595  C  CG    . HIS B  1 139 ? 25.964  -8.788  18.960  1.00   25.44 ? 246 HIS B CG    1 
ATOM   4596  N  ND1   . HIS B  1 139 ? 25.853  -9.165  20.282  1.00   26.52 ? 246 HIS B ND1   1 
ATOM   4597  C  CD2   . HIS B  1 139 ? 26.377  -9.889  18.289  1.00   24.74 ? 246 HIS B CD2   1 
ATOM   4598  C  CE1   . HIS B  1 139 ? 26.187  -10.437 20.404  1.00   24.81 ? 246 HIS B CE1   1 
ATOM   4599  N  NE2   . HIS B  1 139 ? 26.509  -10.900 19.210  1.00   24.66 ? 246 HIS B NE2   1 
ATOM   4600  N  N     . ILE B  1 140 ? 28.550  -6.558  17.749  1.00   25.67 ? 247 ILE B N     1 
ATOM   4601  C  CA    . ILE B  1 140 ? 29.930  -6.874  17.377  1.00   24.67 ? 247 ILE B CA    1 
ATOM   4602  C  C     . ILE B  1 140 ? 30.857  -5.748  17.827  1.00   24.71 ? 247 ILE B C     1 
ATOM   4603  O  O     . ILE B  1 140 ? 30.574  -4.576  17.571  1.00   25.38 ? 247 ILE B O     1 
ATOM   4604  C  CB    . ILE B  1 140 ? 30.069  -7.026  15.839  1.00   23.18 ? 247 ILE B CB    1 
ATOM   4605  C  CG1   . ILE B  1 140 ? 29.137  -8.134  15.335  1.00   23.12 ? 247 ILE B CG1   1 
ATOM   4606  C  CG2   . ILE B  1 140 ? 31.522  -7.314  15.468  1.00   23.02 ? 247 ILE B CG2   1 
ATOM   4607  C  CD1   . ILE B  1 140 ? 29.107  -8.304  13.825  1.00   15.28 ? 247 ILE B CD1   1 
ATOM   4608  N  N     . HIS B  1 141 ? 31.957  -6.093  18.492  1.00   22.53 ? 248 HIS B N     1 
ATOM   4609  C  CA    . HIS B  1 141 ? 32.900  -5.074  18.946  1.00   24.14 ? 248 HIS B CA    1 
ATOM   4610  C  C     . HIS B  1 141 ? 34.032  -4.882  17.941  1.00   23.95 ? 248 HIS B C     1 
ATOM   4611  O  O     . HIS B  1 141 ? 34.393  -3.760  17.588  1.00   24.53 ? 248 HIS B O     1 
ATOM   4612  C  CB    . HIS B  1 141 ? 33.535  -5.457  20.294  1.00   26.35 ? 248 HIS B CB    1 
ATOM   4613  C  CG    . HIS B  1 141 ? 32.549  -5.762  21.378  1.00   28.89 ? 248 HIS B CG    1 
ATOM   4614  N  ND1   . HIS B  1 141 ? 32.116  -7.045  21.651  1.00   29.73 ? 248 HIS B ND1   1 
ATOM   4615  C  CD2   . HIS B  1 141 ? 31.900  -4.953  22.249  1.00   26.54 ? 248 HIS B CD2   1 
ATOM   4616  C  CE1   . HIS B  1 141 ? 31.245  -7.010  22.642  1.00   27.33 ? 248 HIS B CE1   1 
ATOM   4617  N  NE2   . HIS B  1 141 ? 31.095  -5.752  23.022  1.00   25.85 ? 248 HIS B NE2   1 
ATOM   4618  N  N     . ILE B  1 142 ? 34.584  -5.996  17.482  1.00   21.79 ? 249 ILE B N     1 
ATOM   4619  C  CA    . ILE B  1 142 ? 35.715  -5.985  16.577  1.00   21.27 ? 249 ILE B CA    1 
ATOM   4620  C  C     . ILE B  1 142 ? 35.453  -6.668  15.242  1.00   21.92 ? 249 ILE B C     1 
ATOM   4621  O  O     . ILE B  1 142 ? 34.920  -7.776  15.196  1.00   22.85 ? 249 ILE B O     1 
ATOM   4622  C  CB    . ILE B  1 142 ? 36.906  -6.690  17.272  1.00   20.84 ? 249 ILE B CB    1 
ATOM   4623  C  CG1   . ILE B  1 142 ? 37.238  -5.949  18.565  1.00   22.39 ? 249 ILE B CG1   1 
ATOM   4624  C  CG2   . ILE B  1 142 ? 38.111  -6.777  16.352  1.00   17.21 ? 249 ILE B CG2   1 
ATOM   4625  C  CD1   . ILE B  1 142 ? 38.193  -6.687  19.473  1.00   23.71 ? 249 ILE B CD1   1 
ATOM   4626  N  N     . TYR B  1 143 ? 35.838  -6.005  14.159  1.00   20.42 ? 250 TYR B N     1 
ATOM   4627  C  CA    . TYR B  1 143 ? 35.688  -6.576  12.828  1.00   19.83 ? 250 TYR B CA    1 
ATOM   4628  C  C     . TYR B  1 143 ? 37.087  -6.868  12.311  1.00   18.49 ? 250 TYR B C     1 
ATOM   4629  O  O     . TYR B  1 143 ? 37.986  -6.042  12.467  1.00   20.21 ? 250 TYR B O     1 
ATOM   4630  C  CB    . TYR B  1 143 ? 35.000  -5.590  11.886  1.00   20.17 ? 250 TYR B CB    1 
ATOM   4631  C  CG    . TYR B  1 143 ? 33.599  -5.219  12.299  1.00   24.05 ? 250 TYR B CG    1 
ATOM   4632  C  CD1   . TYR B  1 143 ? 33.373  -4.404  13.404  1.00   25.18 ? 250 TYR B CD1   1 
ATOM   4633  C  CD2   . TYR B  1 143 ? 32.492  -5.665  11.568  1.00   24.26 ? 250 TYR B CD2   1 
ATOM   4634  C  CE1   . TYR B  1 143 ? 32.085  -4.028  13.770  1.00   26.02 ? 250 TYR B CE1   1 
ATOM   4635  C  CE2   . TYR B  1 143 ? 31.201  -5.297  11.924  1.00   23.90 ? 250 TYR B CE2   1 
ATOM   4636  C  CZ    . TYR B  1 143 ? 31.002  -4.472  13.025  1.00   26.99 ? 250 TYR B CZ    1 
ATOM   4637  O  OH    . TYR B  1 143 ? 29.735  -4.040  13.353  1.00   26.68 ? 250 TYR B OH    1 
ATOM   4638  N  N     . SER B  1 144 ? 37.276  -8.032  11.700  1.00   15.87 ? 251 SER B N     1 
ATOM   4639  C  CA    . SER B  1 144 ? 38.585  -8.400  11.161  1.00   17.65 ? 251 SER B CA    1 
ATOM   4640  C  C     . SER B  1 144 ? 38.496  -8.665  9.665   1.00   16.26 ? 251 SER B C     1 
ATOM   4641  O  O     . SER B  1 144 ? 37.678  -9.471  9.225   1.00   16.98 ? 251 SER B O     1 
ATOM   4642  C  CB    . SER B  1 144 ? 39.120  -9.649  11.861  1.00   19.70 ? 251 SER B CB    1 
ATOM   4643  O  OG    . SER B  1 144 ? 40.415  -9.981  11.391  1.00   18.09 ? 251 SER B OG    1 
ATOM   4644  N  N     . ALA B  1 145 ? 39.345  -7.999  8.887   1.00   13.57 ? 252 ALA B N     1 
ATOM   4645  C  CA    . ALA B  1 145 ? 39.325  -8.170  7.440   1.00   15.22 ? 252 ALA B CA    1 
ATOM   4646  C  C     . ALA B  1 145 ? 40.688  -8.509  6.844   1.00   16.42 ? 252 ALA B C     1 
ATOM   4647  O  O     . ALA B  1 145 ? 41.588  -7.669  6.794   1.00   18.06 ? 252 ALA B O     1 
ATOM   4648  C  CB    . ALA B  1 145 ? 38.770  -6.911  6.777   1.00   12.07 ? 252 ALA B CB    1 
ATOM   4649  N  N     . SER B  1 146 ? 40.824  -9.749  6.393   1.00   16.80 ? 253 SER B N     1 
ATOM   4650  C  CA    . SER B  1 146 ? 42.046  -10.219 5.754   1.00   17.47 ? 253 SER B CA    1 
ATOM   4651  C  C     . SER B  1 146 ? 41.832  -10.271 4.241   1.00   18.38 ? 253 SER B C     1 
ATOM   4652  O  O     . SER B  1 146 ? 42.036  -11.313 3.614   1.00   17.07 ? 253 SER B O     1 
ATOM   4653  C  CB    . SER B  1 146 ? 42.410  -11.614 6.257   1.00   15.76 ? 253 SER B CB    1 
ATOM   4654  O  OG    . SER B  1 146 ? 42.841  -11.563 7.596   1.00   18.71 ? 253 SER B OG    1 
ATOM   4655  N  N     . TRP B  1 147 ? 41.408  -9.145  3.669   1.00   17.12 ? 254 TRP B N     1 
ATOM   4656  C  CA    . TRP B  1 147 ? 41.173  -9.047  2.234   1.00   16.53 ? 254 TRP B CA    1 
ATOM   4657  C  C     . TRP B  1 147 ? 41.289  -7.591  1.812   1.00   17.67 ? 254 TRP B C     1 
ATOM   4658  O  O     . TRP B  1 147 ? 41.457  -6.718  2.652   1.00   19.16 ? 254 TRP B O     1 
ATOM   4659  C  CB    . TRP B  1 147 ? 39.786  -9.591  1.873   1.00   13.45 ? 254 TRP B CB    1 
ATOM   4660  C  CG    . TRP B  1 147 ? 38.667  -9.008  2.676   1.00   11.21 ? 254 TRP B CG    1 
ATOM   4661  C  CD1   . TRP B  1 147 ? 38.142  -9.511  3.826   1.00   12.05 ? 254 TRP B CD1   1 
ATOM   4662  C  CD2   . TRP B  1 147 ? 37.929  -7.809  2.387   1.00   10.82 ? 254 TRP B CD2   1 
ATOM   4663  N  NE1   . TRP B  1 147 ? 37.123  -8.706  4.274   1.00   13.74 ? 254 TRP B NE1   1 
ATOM   4664  C  CE2   . TRP B  1 147 ? 36.969  -7.654  3.410   1.00   12.45 ? 254 TRP B CE2   1 
ATOM   4665  C  CE3   . TRP B  1 147 ? 37.985  -6.855  1.363   1.00   9.67  ? 254 TRP B CE3   1 
ATOM   4666  C  CZ2   . TRP B  1 147 ? 36.065  -6.581  3.439   1.00   10.15 ? 254 TRP B CZ2   1 
ATOM   4667  C  CZ3   . TRP B  1 147 ? 37.083  -5.787  1.390   1.00   12.67 ? 254 TRP B CZ3   1 
ATOM   4668  C  CH2   . TRP B  1 147 ? 36.136  -5.661  2.425   1.00   10.70 ? 254 TRP B CH2   1 
ATOM   4669  N  N     . GLY B  1 148 ? 41.207  -7.332  0.512   1.00   19.43 ? 255 GLY B N     1 
ATOM   4670  C  CA    . GLY B  1 148 ? 41.298  -5.967  0.030   1.00   19.18 ? 255 GLY B CA    1 
ATOM   4671  C  C     . GLY B  1 148 ? 41.555  -5.911  -1.463  1.00   19.77 ? 255 GLY B C     1 
ATOM   4672  O  O     . GLY B  1 148 ? 41.488  -6.944  -2.151  1.00   18.23 ? 255 GLY B O     1 
ATOM   4673  N  N     . PRO B  1 149 ? 41.852  -4.714  -1.996  1.00   17.34 ? 256 PRO B N     1 
ATOM   4674  C  CA    . PRO B  1 149 ? 42.122  -4.535  -3.421  1.00   17.94 ? 256 PRO B CA    1 
ATOM   4675  C  C     . PRO B  1 149 ? 43.247  -5.452  -3.875  1.00   19.42 ? 256 PRO B C     1 
ATOM   4676  O  O     . PRO B  1 149 ? 44.088  -5.863  -3.078  1.00   19.85 ? 256 PRO B O     1 
ATOM   4677  C  CB    . PRO B  1 149 ? 42.507  -3.065  -3.512  1.00   17.00 ? 256 PRO B CB    1 
ATOM   4678  C  CG    . PRO B  1 149 ? 41.687  -2.448  -2.438  1.00   16.54 ? 256 PRO B CG    1 
ATOM   4679  C  CD    . PRO B  1 149 ? 41.894  -3.421  -1.298  1.00   14.69 ? 256 PRO B CD    1 
ATOM   4680  N  N     . GLU B  1 150 ? 43.259  -5.776  -5.158  1.00   23.35 ? 257 GLU B N     1 
ATOM   4681  C  CA    . GLU B  1 150 ? 44.287  -6.645  -5.698  1.00   27.64 ? 257 GLU B CA    1 
ATOM   4682  C  C     . GLU B  1 150 ? 45.691  -6.055  -5.471  1.00   26.49 ? 257 GLU B C     1 
ATOM   4683  O  O     . GLU B  1 150 ? 45.896  -4.844  -5.598  1.00   25.29 ? 257 GLU B O     1 
ATOM   4684  C  CB    . GLU B  1 150 ? 44.027  -6.864  -7.185  1.00   31.25 ? 257 GLU B CB    1 
ATOM   4685  C  CG    . GLU B  1 150 ? 44.993  -7.820  -7.832  1.00   40.40 ? 257 GLU B CG    1 
ATOM   4686  C  CD    . GLU B  1 150 ? 44.545  -8.231  -9.220  1.00   46.17 ? 257 GLU B CD    1 
ATOM   4687  O  OE1   . GLU B  1 150 ? 45.313  -8.951  -9.909  1.00   47.82 ? 257 GLU B OE1   1 
ATOM   4688  O  OE2   . GLU B  1 150 ? 43.421  -7.832  -9.607  1.00   47.46 ? 257 GLU B OE2   1 
ATOM   4689  N  N     . ASP B  1 151 ? 46.650  -6.911  -5.125  1.00   24.36 ? 258 ASP B N     1 
ATOM   4690  C  CA    . ASP B  1 151 ? 48.022  -6.459  -4.878  1.00   24.51 ? 258 ASP B CA    1 
ATOM   4691  C  C     . ASP B  1 151 ? 48.930  -6.553  -6.113  1.00   23.61 ? 258 ASP B C     1 
ATOM   4692  O  O     . ASP B  1 151 ? 50.041  -7.095  -6.020  1.00   20.76 ? 258 ASP B O     1 
ATOM   4693  C  CB    . ASP B  1 151 ? 48.675  -7.278  -3.755  1.00   23.41 ? 258 ASP B CB    1 
ATOM   4694  C  CG    . ASP B  1 151 ? 47.999  -7.100  -2.404  1.00   23.70 ? 258 ASP B CG    1 
ATOM   4695  O  OD1   . ASP B  1 151 ? 47.650  -5.956  -2.036  1.00   22.27 ? 258 ASP B OD1   1 
ATOM   4696  O  OD2   . ASP B  1 151 ? 47.844  -8.117  -1.696  1.00   21.99 ? 258 ASP B OD2   1 
ATOM   4697  N  N     . ASP B  1 152 ? 48.474  -6.035  -7.254  1.00   21.70 ? 259 ASP B N     1 
ATOM   4698  C  CA    . ASP B  1 152 ? 49.278  -6.105  -8.465  1.00   21.21 ? 259 ASP B CA    1 
ATOM   4699  C  C     . ASP B  1 152 ? 50.381  -5.060  -8.474  1.00   22.18 ? 259 ASP B C     1 
ATOM   4700  O  O     . ASP B  1 152 ? 51.251  -5.073  -9.350  1.00   23.92 ? 259 ASP B O     1 
ATOM   4701  C  CB    . ASP B  1 152 ? 48.396  -5.962  -9.705  1.00   24.37 ? 259 ASP B CB    1 
ATOM   4702  C  CG    . ASP B  1 152 ? 47.590  -4.681  -9.716  1.00   28.43 ? 259 ASP B CG    1 
ATOM   4703  O  OD1   . ASP B  1 152 ? 47.649  -3.885  -8.743  1.00   27.91 ? 259 ASP B OD1   1 
ATOM   4704  O  OD2   . ASP B  1 152 ? 46.884  -4.482  -10.727 1.00   33.02 ? 259 ASP B OD2   1 
ATOM   4705  N  N     . GLY B  1 153 ? 50.347  -4.161  -7.494  1.00   19.42 ? 260 GLY B N     1 
ATOM   4706  C  CA    . GLY B  1 153 ? 51.367  -3.139  -7.406  1.00   20.12 ? 260 GLY B CA    1 
ATOM   4707  C  C     . GLY B  1 153 ? 51.207  -2.053  -8.451  1.00   23.81 ? 260 GLY B C     1 
ATOM   4708  O  O     . GLY B  1 153 ? 52.152  -1.313  -8.753  1.00   22.75 ? 260 GLY B O     1 
ATOM   4709  N  N     . LYS B  1 154 ? 50.011  -1.946  -9.015  1.00   24.28 ? 261 LYS B N     1 
ATOM   4710  C  CA    . LYS B  1 154 ? 49.777  -0.925  -10.010 1.00   24.30 ? 261 LYS B CA    1 
ATOM   4711  C  C     . LYS B  1 154 ? 48.404  -0.294  -9.873  1.00   24.28 ? 261 LYS B C     1 
ATOM   4712  O  O     . LYS B  1 154 ? 48.058  0.612   -10.633 1.00   23.64 ? 261 LYS B O     1 
ATOM   4713  C  CB    . LYS B  1 154 ? 49.973  -1.490  -11.421 1.00   25.59 ? 261 LYS B CB    1 
ATOM   4714  C  CG    . LYS B  1 154 ? 49.118  -2.677  -11.774 1.00   25.50 ? 261 LYS B CG    1 
ATOM   4715  C  CD    . LYS B  1 154 ? 49.385  -3.100  -13.209 1.00   29.39 ? 261 LYS B CD    1 
ATOM   4716  C  CE    . LYS B  1 154 ? 48.529  -4.296  -13.588 1.00   33.23 ? 261 LYS B CE    1 
ATOM   4717  N  NZ    . LYS B  1 154 ? 48.729  -4.698  -15.002 0.0000 31.81 ? 261 LYS B NZ    1 
ATOM   4718  N  N     . THR B  1 155 ? 47.621  -0.753  -8.903  1.00   21.76 ? 262 THR B N     1 
ATOM   4719  C  CA    . THR B  1 155 ? 46.308  -0.159  -8.730  1.00   24.09 ? 262 THR B CA    1 
ATOM   4720  C  C     . THR B  1 155 ? 46.201  0.689   -7.479  1.00   23.13 ? 262 THR B C     1 
ATOM   4721  O  O     . THR B  1 155 ? 46.917  0.472   -6.501  1.00   24.00 ? 262 THR B O     1 
ATOM   4722  C  CB    . THR B  1 155 ? 45.156  -1.222  -8.719  1.00   24.61 ? 262 THR B CB    1 
ATOM   4723  O  OG1   . THR B  1 155 ? 45.349  -2.166  -7.666  1.00   22.83 ? 262 THR B OG1   1 
ATOM   4724  C  CG2   . THR B  1 155 ? 45.096  -1.958  -10.051 1.00   27.88 ? 262 THR B CG2   1 
ATOM   4725  N  N     . VAL B  1 156 ? 45.320  1.683   -7.548  1.00   21.66 ? 263 VAL B N     1 
ATOM   4726  C  CA    . VAL B  1 156 ? 45.028  2.573   -6.433  1.00   20.08 ? 263 VAL B CA    1 
ATOM   4727  C  C     . VAL B  1 156 ? 43.524  2.371   -6.242  1.00   20.47 ? 263 VAL B C     1 
ATOM   4728  O  O     . VAL B  1 156 ? 42.729  2.719   -7.106  1.00   19.36 ? 263 VAL B O     1 
ATOM   4729  C  CB    . VAL B  1 156 ? 45.323  4.043   -6.785  1.00   18.89 ? 263 VAL B CB    1 
ATOM   4730  C  CG1   . VAL B  1 156 ? 45.027  4.935   -5.591  1.00   16.39 ? 263 VAL B CG1   1 
ATOM   4731  C  CG2   . VAL B  1 156 ? 46.778  4.190   -7.197  1.00   15.36 ? 263 VAL B CG2   1 
ATOM   4732  N  N     . ASP B  1 157 ? 43.132  1.787   -5.119  1.00   21.20 ? 264 ASP B N     1 
ATOM   4733  C  CA    . ASP B  1 157 ? 41.721  1.518   -4.893  1.00   21.38 ? 264 ASP B CA    1 
ATOM   4734  C  C     . ASP B  1 157 ? 41.380  1.565   -3.410  1.00   22.75 ? 264 ASP B C     1 
ATOM   4735  O  O     . ASP B  1 157 ? 42.223  1.288   -2.558  1.00   24.72 ? 264 ASP B O     1 
ATOM   4736  C  CB    . ASP B  1 157 ? 41.374  0.141   -5.481  1.00   21.09 ? 264 ASP B CB    1 
ATOM   4737  C  CG    . ASP B  1 157 ? 39.864  -0.112  -5.591  1.00   24.96 ? 264 ASP B CG    1 
ATOM   4738  O  OD1   . ASP B  1 157 ? 39.059  0.829   -5.390  1.00   22.81 ? 264 ASP B OD1   1 
ATOM   4739  O  OD2   . ASP B  1 157 ? 39.480  -1.270  -5.899  1.00   24.02 ? 264 ASP B OD2   1 
ATOM   4740  N  N     . GLY B  1 158 ? 40.136  1.926   -3.114  1.00   24.18 ? 265 GLY B N     1 
ATOM   4741  C  CA    . GLY B  1 158 ? 39.683  2.003   -1.739  1.00   23.32 ? 265 GLY B CA    1 
ATOM   4742  C  C     . GLY B  1 158 ? 38.184  1.797   -1.672  1.00   23.74 ? 265 GLY B C     1 
ATOM   4743  O  O     . GLY B  1 158 ? 37.547  1.531   -2.694  1.00   23.41 ? 265 GLY B O     1 
ATOM   4744  N  N     . PRO B  1 159 ? 37.585  1.925   -0.485  1.00   23.44 ? 266 PRO B N     1 
ATOM   4745  C  CA    . PRO B  1 159 ? 36.140  1.742   -0.323  1.00   24.15 ? 266 PRO B CA    1 
ATOM   4746  C  C     . PRO B  1 159 ? 35.307  2.761   -1.095  1.00   22.41 ? 266 PRO B C     1 
ATOM   4747  O  O     . PRO B  1 159 ? 35.718  3.909   -1.271  1.00   22.62 ? 266 PRO B O     1 
ATOM   4748  C  CB    . PRO B  1 159 ? 35.950  1.882   1.187   1.00   25.12 ? 266 PRO B CB    1 
ATOM   4749  C  CG    . PRO B  1 159 ? 36.968  2.920   1.529   1.00   24.16 ? 266 PRO B CG    1 
ATOM   4750  C  CD    . PRO B  1 159 ? 38.189  2.418   0.764   1.00   23.23 ? 266 PRO B CD    1 
ATOM   4751  N  N     . ALA B  1 160 ? 34.137  2.332   -1.556  1.00   19.34 ? 267 ALA B N     1 
ATOM   4752  C  CA    . ALA B  1 160 ? 33.242  3.222   -2.273  1.00   19.15 ? 267 ALA B CA    1 
ATOM   4753  C  C     . ALA B  1 160 ? 32.340  3.924   -1.254  1.00   19.63 ? 267 ALA B C     1 
ATOM   4754  O  O     . ALA B  1 160 ? 32.464  3.697   -0.050  1.00   20.98 ? 267 ALA B O     1 
ATOM   4755  C  CB    . ALA B  1 160 ? 32.419  2.439   -3.258  1.00   18.99 ? 267 ALA B CB    1 
ATOM   4756  N  N     . ARG B  1 161 ? 31.427  4.762   -1.730  1.00   20.75 ? 268 ARG B N     1 
ATOM   4757  C  CA    . ARG B  1 161 ? 30.538  5.518   -0.849  1.00   23.45 ? 268 ARG B CA    1 
ATOM   4758  C  C     . ARG B  1 161 ? 29.904  4.757   0.321   1.00   23.81 ? 268 ARG B C     1 
ATOM   4759  O  O     . ARG B  1 161 ? 30.104  5.120   1.487   1.00   23.50 ? 268 ARG B O     1 
ATOM   4760  C  CB    . ARG B  1 161 ? 29.435  6.176   -1.673  1.00   27.67 ? 268 ARG B CB    1 
ATOM   4761  C  CG    . ARG B  1 161 ? 29.617  7.674   -1.914  1.00   34.14 ? 268 ARG B CG    1 
ATOM   4762  C  CD    . ARG B  1 161 ? 30.746  7.979   -2.902  1.00   35.56 ? 268 ARG B CD    1 
ATOM   4763  N  NE    . ARG B  1 161 ? 30.728  9.377   -3.315  0.0000 32.78 ? 268 ARG B NE    1 
ATOM   4764  C  CZ    . ARG B  1 161 ? 31.654  9.942   -4.080  0.0000 32.36 ? 268 ARG B CZ    1 
ATOM   4765  N  NH1   . ARG B  1 161 ? 32.683  9.230   -4.520  0.0000 31.94 ? 268 ARG B NH1   1 
ATOM   4766  N  NH2   . ARG B  1 161 ? 31.552  11.222  -4.403  0.0000 31.94 ? 268 ARG B NH2   1 
ATOM   4767  N  N     . LEU B  1 162 ? 29.129  3.717   0.025   1.00   22.19 ? 269 LEU B N     1 
ATOM   4768  C  CA    . LEU B  1 162 ? 28.478  2.950   1.084   1.00   21.51 ? 269 LEU B CA    1 
ATOM   4769  C  C     . LEU B  1 162 ? 29.467  2.395   2.100   1.00   21.57 ? 269 LEU B C     1 
ATOM   4770  O  O     . LEU B  1 162 ? 29.234  2.473   3.309   1.00   21.95 ? 269 LEU B O     1 
ATOM   4771  C  CB    . LEU B  1 162 ? 27.639  1.818   0.484   1.00   22.16 ? 269 LEU B CB    1 
ATOM   4772  C  CG    . LEU B  1 162 ? 26.436  2.305   -0.339  1.00   23.56 ? 269 LEU B CG    1 
ATOM   4773  C  CD1   . LEU B  1 162 ? 25.636  1.119   -0.836  1.00   22.95 ? 269 LEU B CD1   1 
ATOM   4774  C  CD2   . LEU B  1 162 ? 25.563  3.214   0.511   1.00   20.11 ? 269 LEU B CD2   1 
ATOM   4775  N  N     . ALA B  1 163 ? 30.574  1.837   1.620   1.00   20.25 ? 270 ALA B N     1 
ATOM   4776  C  CA    . ALA B  1 163 ? 31.586  1.297   2.527   1.00   18.94 ? 270 ALA B CA    1 
ATOM   4777  C  C     . ALA B  1 163 ? 32.161  2.403   3.425   1.00   20.39 ? 270 ALA B C     1 
ATOM   4778  O  O     . ALA B  1 163 ? 32.356  2.195   4.625   1.00   20.09 ? 270 ALA B O     1 
ATOM   4779  C  CB    . ALA B  1 163 ? 32.692  0.643   1.735   1.00   15.89 ? 270 ALA B CB    1 
ATOM   4780  N  N     . GLU B  1 164 ? 32.438  3.573   2.850   1.00   20.46 ? 271 GLU B N     1 
ATOM   4781  C  CA    . GLU B  1 164 ? 32.969  4.673   3.646   1.00   20.75 ? 271 GLU B CA    1 
ATOM   4782  C  C     . GLU B  1 164 ? 31.946  5.051   4.690   1.00   20.35 ? 271 GLU B C     1 
ATOM   4783  O  O     . GLU B  1 164 ? 32.281  5.217   5.861   1.00   20.66 ? 271 GLU B O     1 
ATOM   4784  C  CB    . GLU B  1 164 ? 33.265  5.906   2.797   1.00   22.80 ? 271 GLU B CB    1 
ATOM   4785  C  CG    . GLU B  1 164 ? 34.329  5.714   1.748   1.00   32.39 ? 271 GLU B CG    1 
ATOM   4786  C  CD    . GLU B  1 164 ? 34.769  7.030   1.124   1.00   36.78 ? 271 GLU B CD    1 
ATOM   4787  O  OE1   . GLU B  1 164 ? 35.660  7.695   1.697   1.00   38.97 ? 271 GLU B OE1   1 
ATOM   4788  O  OE2   . GLU B  1 164 ? 34.209  7.403   0.070   1.00   40.59 ? 271 GLU B OE2   1 
ATOM   4789  N  N     . GLU B  1 165 ? 30.695  5.194   4.259   1.00   17.91 ? 272 GLU B N     1 
ATOM   4790  C  CA    . GLU B  1 165 ? 29.630  5.555   5.183   1.00   17.05 ? 272 GLU B CA    1 
ATOM   4791  C  C     . GLU B  1 165 ? 29.523  4.513   6.295   1.00   16.31 ? 272 GLU B C     1 
ATOM   4792  O  O     . GLU B  1 165 ? 29.188  4.843   7.425   1.00   16.59 ? 272 GLU B O     1 
ATOM   4793  C  CB    . GLU B  1 165 ? 28.300  5.697   4.431   1.00   16.68 ? 272 GLU B CB    1 
ATOM   4794  C  CG    . GLU B  1 165 ? 28.208  6.978   3.617   1.00   18.48 ? 272 GLU B CG    1 
ATOM   4795  C  CD    . GLU B  1 165 ? 26.982  7.063   2.738   1.00   19.59 ? 272 GLU B CD    1 
ATOM   4796  O  OE1   . GLU B  1 165 ? 26.703  8.162   2.206   1.00   20.63 ? 272 GLU B OE1   1 
ATOM   4797  O  OE2   . GLU B  1 165 ? 26.296  6.035   2.566   1.00   24.26 ? 272 GLU B OE2   1 
ATOM   4798  N  N     . ALA B  1 166 ? 29.828  3.259   5.975   1.00   14.86 ? 273 ALA B N     1 
ATOM   4799  C  CA    . ALA B  1 166 ? 29.763  2.201   6.967   1.00   16.26 ? 273 ALA B CA    1 
ATOM   4800  C  C     . ALA B  1 166 ? 30.893  2.370   7.977   1.00   18.16 ? 273 ALA B C     1 
ATOM   4801  O  O     . ALA B  1 166 ? 30.691  2.187   9.181   1.00   19.89 ? 273 ALA B O     1 
ATOM   4802  C  CB    . ALA B  1 166 ? 29.841  0.832   6.292   1.00   15.60 ? 273 ALA B CB    1 
ATOM   4803  N  N     . PHE B  1 167 ? 32.081  2.715   7.485   1.00   18.41 ? 274 PHE B N     1 
ATOM   4804  C  CA    . PHE B  1 167 ? 33.233  2.930   8.355   1.00   17.75 ? 274 PHE B CA    1 
ATOM   4805  C  C     . PHE B  1 167 ? 32.930  4.083   9.298   1.00   21.30 ? 274 PHE B C     1 
ATOM   4806  O  O     . PHE B  1 167 ? 33.197  4.003   10.506  1.00   21.11 ? 274 PHE B O     1 
ATOM   4807  C  CB    . PHE B  1 167 ? 34.474  3.298   7.542   1.00   15.01 ? 274 PHE B CB    1 
ATOM   4808  C  CG    . PHE B  1 167 ? 35.243  2.122   7.022   1.00   13.52 ? 274 PHE B CG    1 
ATOM   4809  C  CD1   . PHE B  1 167 ? 35.651  1.106   7.875   1.00   13.76 ? 274 PHE B CD1   1 
ATOM   4810  C  CD2   . PHE B  1 167 ? 35.611  2.053   5.685   1.00   13.53 ? 274 PHE B CD2   1 
ATOM   4811  C  CE1   . PHE B  1 167 ? 36.421  0.032   7.406   1.00   12.87 ? 274 PHE B CE1   1 
ATOM   4812  C  CE2   . PHE B  1 167 ? 36.378  0.986   5.207   1.00   13.46 ? 274 PHE B CE2   1 
ATOM   4813  C  CZ    . PHE B  1 167 ? 36.784  -0.027  6.074   1.00   11.21 ? 274 PHE B CZ    1 
ATOM   4814  N  N     . PHE B  1 168 ? 32.371  5.157   8.740   1.00   21.76 ? 275 PHE B N     1 
ATOM   4815  C  CA    . PHE B  1 168 ? 32.072  6.336   9.536   1.00   23.19 ? 275 PHE B CA    1 
ATOM   4816  C  C     . PHE B  1 168 ? 30.978  6.109   10.559  1.00   21.58 ? 275 PHE B C     1 
ATOM   4817  O  O     . PHE B  1 168 ? 31.100  6.548   11.706  1.00   21.77 ? 275 PHE B O     1 
ATOM   4818  C  CB    . PHE B  1 168 ? 31.719  7.528   8.649   1.00   26.01 ? 275 PHE B CB    1 
ATOM   4819  C  CG    . PHE B  1 168 ? 32.132  8.846   9.248   1.00   33.25 ? 275 PHE B CG    1 
ATOM   4820  C  CD1   . PHE B  1 168 ? 31.582  9.280   10.453  1.00   35.71 ? 275 PHE B CD1   1 
ATOM   4821  C  CD2   . PHE B  1 168 ? 33.092  9.641   8.632   1.00   34.37 ? 275 PHE B CD2   1 
ATOM   4822  C  CE1   . PHE B  1 168 ? 31.979  10.477  11.039  1.00   35.59 ? 275 PHE B CE1   1 
ATOM   4823  C  CE2   . PHE B  1 168 ? 33.497  10.844  9.213   1.00   36.44 ? 275 PHE B CE2   1 
ATOM   4824  C  CZ    . PHE B  1 168 ? 32.936  11.260  10.419  1.00   35.63 ? 275 PHE B CZ    1 
ATOM   4825  N  N     . ARG B  1 169 ? 29.910  5.428   10.159  1.00   19.42 ? 276 ARG B N     1 
ATOM   4826  C  CA    . ARG B  1 169 ? 28.829  5.160   11.099  1.00   19.19 ? 276 ARG B CA    1 
ATOM   4827  C  C     . ARG B  1 169 ? 29.418  4.298   12.208  1.00   21.08 ? 276 ARG B C     1 
ATOM   4828  O  O     . ARG B  1 169 ? 29.139  4.500   13.393  1.00   21.83 ? 276 ARG B O     1 
ATOM   4829  C  CB    . ARG B  1 169 ? 27.676  4.406   10.427  1.00   14.31 ? 276 ARG B CB    1 
ATOM   4830  C  CG    . ARG B  1 169 ? 26.947  5.131   9.302   1.00   12.36 ? 276 ARG B CG    1 
ATOM   4831  C  CD    . ARG B  1 169 ? 25.936  4.192   8.632   1.00   15.06 ? 276 ARG B CD    1 
ATOM   4832  N  NE    . ARG B  1 169 ? 24.774  3.928   9.478   1.00   14.27 ? 276 ARG B NE    1 
ATOM   4833  C  CZ    . ARG B  1 169 ? 23.724  4.740   9.586   1.00   18.26 ? 276 ARG B CZ    1 
ATOM   4834  N  NH1   . ARG B  1 169 ? 22.719  4.424   10.392  1.00   19.83 ? 276 ARG B NH1   1 
ATOM   4835  N  NH2   . ARG B  1 169 ? 23.658  5.859   8.873   1.00   18.58 ? 276 ARG B NH2   1 
ATOM   4836  N  N     . GLY B  1 170 ? 30.259  3.346   11.808  1.00   20.52 ? 277 GLY B N     1 
ATOM   4837  C  CA    . GLY B  1 170 ? 30.890  2.440   12.760  1.00   19.59 ? 277 GLY B CA    1 
ATOM   4838  C  C     . GLY B  1 170 ? 31.702  3.091   13.871  1.00   20.40 ? 277 GLY B C     1 
ATOM   4839  O  O     . GLY B  1 170 ? 31.494  2.798   15.050  1.00   21.46 ? 277 GLY B O     1 
ATOM   4840  N  N     . VAL B  1 171 ? 32.630  3.972   13.511  1.00   17.65 ? 278 VAL B N     1 
ATOM   4841  C  CA    . VAL B  1 171 ? 33.458  4.626   14.513  1.00   18.44 ? 278 VAL B CA    1 
ATOM   4842  C  C     . VAL B  1 171 ? 32.686  5.684   15.286  1.00   19.43 ? 278 VAL B C     1 
ATOM   4843  O  O     . VAL B  1 171 ? 33.104  6.087   16.369  1.00   22.39 ? 278 VAL B O     1 
ATOM   4844  C  CB    . VAL B  1 171 ? 34.708  5.292   13.878  1.00   18.13 ? 278 VAL B CB    1 
ATOM   4845  C  CG1   . VAL B  1 171 ? 35.557  4.247   13.176  1.00   15.84 ? 278 VAL B CG1   1 
ATOM   4846  C  CG2   . VAL B  1 171 ? 34.283  6.362   12.894  1.00   19.03 ? 278 VAL B CG2   1 
ATOM   4847  N  N     . SER B  1 172 ? 31.564  6.132   14.730  1.00   18.54 ? 279 SER B N     1 
ATOM   4848  C  CA    . SER B  1 172 ? 30.735  7.145   15.371  1.00   19.98 ? 279 SER B CA    1 
ATOM   4849  C  C     . SER B  1 172 ? 29.705  6.553   16.310  1.00   22.35 ? 279 SER B C     1 
ATOM   4850  O  O     . SER B  1 172 ? 29.599  6.953   17.469  1.00   23.92 ? 279 SER B O     1 
ATOM   4851  C  CB    . SER B  1 172 ? 29.987  7.973   14.326  1.00   18.31 ? 279 SER B CB    1 
ATOM   4852  O  OG    . SER B  1 172 ? 30.865  8.775   13.569  1.00   21.97 ? 279 SER B OG    1 
ATOM   4853  N  N     . GLN B  1 173 ? 28.951  5.588   15.796  1.00   23.66 ? 280 GLN B N     1 
ATOM   4854  C  CA    . GLN B  1 173 ? 27.876  4.972   16.548  1.00   24.26 ? 280 GLN B CA    1 
ATOM   4855  C  C     . GLN B  1 173 ? 28.094  3.546   17.054  1.00   25.21 ? 280 GLN B C     1 
ATOM   4856  O  O     . GLN B  1 173 ? 27.427  3.128   18.001  1.00   27.70 ? 280 GLN B O     1 
ATOM   4857  C  CB    . GLN B  1 173 ? 26.600  5.028   15.703  1.00   25.15 ? 280 GLN B CB    1 
ATOM   4858  C  CG    . GLN B  1 173 ? 26.072  6.431   15.443  1.00   29.99 ? 280 GLN B CG    1 
ATOM   4859  C  CD    . GLN B  1 173 ? 25.753  6.687   13.976  1.00   36.02 ? 280 GLN B CD    1 
ATOM   4860  O  OE1   . GLN B  1 173 ? 25.050  5.898   13.329  1.00   35.75 ? 280 GLN B OE1   1 
ATOM   4861  N  NE2   . GLN B  1 173 ? 26.263  7.804   13.444  1.00   38.43 ? 280 GLN B NE2   1 
ATOM   4862  N  N     . GLY B  1 174 ? 29.009  2.799   16.438  1.00   23.85 ? 281 GLY B N     1 
ATOM   4863  C  CA    . GLY B  1 174 ? 29.253  1.430   16.873  1.00   19.95 ? 281 GLY B CA    1 
ATOM   4864  C  C     . GLY B  1 174 ? 29.579  1.321   18.353  1.00   20.22 ? 281 GLY B C     1 
ATOM   4865  O  O     . GLY B  1 174 ? 30.025  2.290   18.966  1.00   18.74 ? 281 GLY B O     1 
ATOM   4866  N  N     . ARG B  1 175 ? 29.365  0.143   18.932  1.00   21.73 ? 282 ARG B N     1 
ATOM   4867  C  CA    . ARG B  1 175 ? 29.643  -0.078  20.354  1.00   23.90 ? 282 ARG B CA    1 
ATOM   4868  C  C     . ARG B  1 175 ? 29.117  1.069   21.216  1.00   26.46 ? 282 ARG B C     1 
ATOM   4869  O  O     . ARG B  1 175 ? 29.848  1.633   22.041  1.00   26.83 ? 282 ARG B O     1 
ATOM   4870  C  CB    . ARG B  1 175 ? 31.148  -0.235  20.594  1.00   23.94 ? 282 ARG B CB    1 
ATOM   4871  C  CG    . ARG B  1 175 ? 31.740  -1.550  20.100  1.00   24.91 ? 282 ARG B CG    1 
ATOM   4872  C  CD    . ARG B  1 175 ? 33.254  -1.482  20.118  1.00   23.32 ? 282 ARG B CD    1 
ATOM   4873  N  NE    . ARG B  1 175 ? 33.736  -1.190  21.462  1.00   27.61 ? 282 ARG B NE    1 
ATOM   4874  C  CZ    . ARG B  1 175 ? 34.702  -0.323  21.746  1.00   28.50 ? 282 ARG B CZ    1 
ATOM   4875  N  NH1   . ARG B  1 175 ? 35.308  0.357   20.775  1.00   27.62 ? 282 ARG B NH1   1 
ATOM   4876  N  NH2   . ARG B  1 175 ? 35.056  -0.132  23.010  1.00   26.13 ? 282 ARG B NH2   1 
ATOM   4877  N  N     . GLY B  1 176 ? 27.849  1.409   21.014  1.00   27.05 ? 283 GLY B N     1 
ATOM   4878  C  CA    . GLY B  1 176 ? 27.235  2.474   21.777  1.00   26.10 ? 283 GLY B CA    1 
ATOM   4879  C  C     . GLY B  1 176 ? 27.982  3.796   21.787  1.00   26.13 ? 283 GLY B C     1 
ATOM   4880  O  O     . GLY B  1 176 ? 28.010  4.477   22.812  1.00   27.12 ? 283 GLY B O     1 
ATOM   4881  N  N     . GLY B  1 177 ? 28.588  4.169   20.662  1.00   24.38 ? 284 GLY B N     1 
ATOM   4882  C  CA    . GLY B  1 177 ? 29.296  5.438   20.604  1.00   22.40 ? 284 GLY B CA    1 
ATOM   4883  C  C     . GLY B  1 177 ? 30.805  5.375   20.733  1.00   22.52 ? 284 GLY B C     1 
ATOM   4884  O  O     . GLY B  1 177 ? 31.501  6.292   20.305  1.00   22.58 ? 284 GLY B O     1 
ATOM   4885  N  N     . LEU B  1 178 ? 31.316  4.303   21.324  1.00   21.29 ? 285 LEU B N     1 
ATOM   4886  C  CA    . LEU B  1 178 ? 32.751  4.145   21.493  1.00   20.57 ? 285 LEU B CA    1 
ATOM   4887  C  C     . LEU B  1 178 ? 33.444  3.888   20.153  1.00   21.12 ? 285 LEU B C     1 
ATOM   4888  O  O     . LEU B  1 178 ? 34.635  4.142   20.003  1.00   20.67 ? 285 LEU B O     1 
ATOM   4889  C  CB    . LEU B  1 178 ? 33.034  2.994   22.458  1.00   20.30 ? 285 LEU B CB    1 
ATOM   4890  C  CG    . LEU B  1 178 ? 32.402  3.193   23.837  1.00   18.38 ? 285 LEU B CG    1 
ATOM   4891  C  CD1   . LEU B  1 178 ? 32.664  1.979   24.722  1.00   16.36 ? 285 LEU B CD1   1 
ATOM   4892  C  CD2   . LEU B  1 178 ? 32.984  4.451   24.447  1.00   13.13 ? 285 LEU B CD2   1 
ATOM   4893  N  N     . GLY B  1 179 ? 32.690  3.376   19.183  1.00   22.85 ? 286 GLY B N     1 
ATOM   4894  C  CA    . GLY B  1 179 ? 33.252  3.103   17.868  1.00   20.76 ? 286 GLY B CA    1 
ATOM   4895  C  C     . GLY B  1 179 ? 33.690  1.670   17.596  1.00   21.27 ? 286 GLY B C     1 
ATOM   4896  O  O     . GLY B  1 179 ? 34.373  1.045   18.409  1.00   21.43 ? 286 GLY B O     1 
ATOM   4897  N  N     . SER B  1 180 ? 33.290  1.142   16.443  1.00   21.05 ? 287 SER B N     1 
ATOM   4898  C  CA    . SER B  1 180 ? 33.662  -0.210  16.042  1.00   18.29 ? 287 SER B CA    1 
ATOM   4899  C  C     . SER B  1 180 ? 35.168  -0.263  15.816  1.00   18.33 ? 287 SER B C     1 
ATOM   4900  O  O     . SER B  1 180 ? 35.765  0.709   15.352  1.00   19.44 ? 287 SER B O     1 
ATOM   4901  C  CB    . SER B  1 180 ? 32.970  -0.591  14.731  1.00   17.80 ? 287 SER B CB    1 
ATOM   4902  O  OG    . SER B  1 180 ? 31.564  -0.619  14.858  1.00   20.39 ? 287 SER B OG    1 
ATOM   4903  N  N     . ILE B  1 181 ? 35.784  -1.392  16.146  1.00   16.17 ? 288 ILE B N     1 
ATOM   4904  C  CA    . ILE B  1 181 ? 37.215  -1.557  15.931  1.00   15.02 ? 288 ILE B CA    1 
ATOM   4905  C  C     . ILE B  1 181 ? 37.386  -2.319  14.615  1.00   16.16 ? 288 ILE B C     1 
ATOM   4906  O  O     . ILE B  1 181 ? 36.946  -3.465  14.501  1.00   16.40 ? 288 ILE B O     1 
ATOM   4907  C  CB    . ILE B  1 181 ? 37.888  -2.389  17.052  1.00   13.74 ? 288 ILE B CB    1 
ATOM   4908  C  CG1   . ILE B  1 181 ? 37.550  -1.820  18.434  1.00   9.78  ? 288 ILE B CG1   1 
ATOM   4909  C  CG2   . ILE B  1 181 ? 39.402  -2.389  16.843  1.00   7.77  ? 288 ILE B CG2   1 
ATOM   4910  C  CD1   . ILE B  1 181 ? 38.166  -0.479  18.715  1.00   12.75 ? 288 ILE B CD1   1 
ATOM   4911  N  N     . PHE B  1 182 ? 38.016  -1.688  13.627  1.00   16.02 ? 289 PHE B N     1 
ATOM   4912  C  CA    . PHE B  1 182 ? 38.235  -2.323  12.327  1.00   17.55 ? 289 PHE B CA    1 
ATOM   4913  C  C     . PHE B  1 182 ? 39.704  -2.691  12.137  1.00   20.06 ? 289 PHE B C     1 
ATOM   4914  O  O     . PHE B  1 182 ? 40.544  -1.810  11.937  1.00   20.51 ? 289 PHE B O     1 
ATOM   4915  C  CB    . PHE B  1 182 ? 37.812  -1.385  11.188  1.00   16.49 ? 289 PHE B CB    1 
ATOM   4916  C  CG    . PHE B  1 182 ? 36.332  -1.093  11.145  1.00   16.28 ? 289 PHE B CG    1 
ATOM   4917  C  CD1   . PHE B  1 182 ? 35.417  -2.085  10.817  1.00   13.48 ? 289 PHE B CD1   1 
ATOM   4918  C  CD2   . PHE B  1 182 ? 35.855  0.186   11.411  1.00   15.25 ? 289 PHE B CD2   1 
ATOM   4919  C  CE1   . PHE B  1 182 ? 34.063  -1.808  10.755  1.00   11.99 ? 289 PHE B CE1   1 
ATOM   4920  C  CE2   . PHE B  1 182 ? 34.496  0.464   11.349  1.00   12.63 ? 289 PHE B CE2   1 
ATOM   4921  C  CZ    . PHE B  1 182 ? 33.603  -0.539  11.017  1.00   10.83 ? 289 PHE B CZ    1 
ATOM   4922  N  N     . VAL B  1 183 ? 40.007  -3.990  12.186  1.00   21.11 ? 290 VAL B N     1 
ATOM   4923  C  CA    . VAL B  1 183 ? 41.377  -4.479  12.015  1.00   20.19 ? 290 VAL B CA    1 
ATOM   4924  C  C     . VAL B  1 183 ? 41.577  -4.953  10.584  1.00   19.94 ? 290 VAL B C     1 
ATOM   4925  O  O     . VAL B  1 183 ? 40.815  -5.778  10.084  1.00   20.89 ? 290 VAL B O     1 
ATOM   4926  C  CB    . VAL B  1 183 ? 41.663  -5.633  12.969  1.00   19.72 ? 290 VAL B CB    1 
ATOM   4927  C  CG1   . VAL B  1 183 ? 43.127  -6.062  12.856  1.00   20.82 ? 290 VAL B CG1   1 
ATOM   4928  C  CG2   . VAL B  1 183 ? 41.334  -5.197  14.373  1.00   16.31 ? 290 VAL B CG2   1 
ATOM   4929  N  N     . TRP B  1 184 ? 42.615  -4.442  9.929   1.00   19.40 ? 291 TRP B N     1 
ATOM   4930  C  CA    . TRP B  1 184 ? 42.872  -4.781  8.530   1.00   17.08 ? 291 TRP B CA    1 
ATOM   4931  C  C     . TRP B  1 184 ? 44.261  -5.358  8.250   1.00   16.28 ? 291 TRP B C     1 
ATOM   4932  O  O     . TRP B  1 184 ? 45.240  -4.965  8.886   1.00   17.29 ? 291 TRP B O     1 
ATOM   4933  C  CB    . TRP B  1 184 ? 42.672  -3.519  7.686   1.00   15.10 ? 291 TRP B CB    1 
ATOM   4934  C  CG    . TRP B  1 184 ? 41.966  -3.771  6.417   1.00   16.90 ? 291 TRP B CG    1 
ATOM   4935  C  CD1   . TRP B  1 184 ? 42.507  -4.219  5.244   1.00   14.76 ? 291 TRP B CD1   1 
ATOM   4936  C  CD2   . TRP B  1 184 ? 40.553  -3.688  6.206   1.00   17.93 ? 291 TRP B CD2   1 
ATOM   4937  N  NE1   . TRP B  1 184 ? 41.515  -4.429  4.318   1.00   16.33 ? 291 TRP B NE1   1 
ATOM   4938  C  CE2   . TRP B  1 184 ? 40.304  -4.113  4.879   1.00   18.47 ? 291 TRP B CE2   1 
ATOM   4939  C  CE3   . TRP B  1 184 ? 39.471  -3.301  7.012   1.00   14.98 ? 291 TRP B CE3   1 
ATOM   4940  C  CZ2   . TRP B  1 184 ? 39.005  -4.165  4.335   1.00   17.99 ? 291 TRP B CZ2   1 
ATOM   4941  C  CZ3   . TRP B  1 184 ? 38.180  -3.352  6.476   1.00   16.78 ? 291 TRP B CZ3   1 
ATOM   4942  C  CH2   . TRP B  1 184 ? 37.961  -3.783  5.148   1.00   19.63 ? 291 TRP B CH2   1 
ATOM   4943  N  N     . ALA B  1 185 ? 44.340  -6.290  7.301   1.00   12.99 ? 292 ALA B N     1 
ATOM   4944  C  CA    . ALA B  1 185 ? 45.619  -6.879  6.898   1.00   12.19 ? 292 ALA B CA    1 
ATOM   4945  C  C     . ALA B  1 185 ? 46.202  -5.919  5.855   1.00   14.15 ? 292 ALA B C     1 
ATOM   4946  O  O     . ALA B  1 185 ? 45.512  -5.562  4.899   1.00   14.49 ? 292 ALA B O     1 
ATOM   4947  C  CB    . ALA B  1 185 ? 45.394  -8.248  6.287   1.00   9.08  ? 292 ALA B CB    1 
ATOM   4948  N  N     . SER B  1 186 ? 47.457  -5.504  6.024   1.00   14.09 ? 293 SER B N     1 
ATOM   4949  C  CA    . SER B  1 186 ? 48.052  -4.544  5.095   1.00   15.34 ? 293 SER B CA    1 
ATOM   4950  C  C     . SER B  1 186 ? 48.288  -4.989  3.654   1.00   17.05 ? 293 SER B C     1 
ATOM   4951  O  O     . SER B  1 186 ? 48.437  -4.141  2.773   1.00   17.26 ? 293 SER B O     1 
ATOM   4952  C  CB    . SER B  1 186 ? 49.348  -3.953  5.681   1.00   12.77 ? 293 SER B CB    1 
ATOM   4953  O  OG    . SER B  1 186 ? 50.281  -4.946  6.022   1.00   14.03 ? 293 SER B OG    1 
ATOM   4954  N  N     . GLY B  1 187 ? 48.325  -6.295  3.396   1.00   18.67 ? 294 GLY B N     1 
ATOM   4955  C  CA    . GLY B  1 187 ? 48.517  -6.759  2.025   1.00   20.11 ? 294 GLY B CA    1 
ATOM   4956  C  C     . GLY B  1 187 ? 49.660  -7.723  1.722   1.00   21.84 ? 294 GLY B C     1 
ATOM   4957  O  O     . GLY B  1 187 ? 50.614  -7.848  2.491   1.00   22.11 ? 294 GLY B O     1 
ATOM   4958  N  N     . ASN B  1 188 ? 49.558  -8.411  0.585   1.00   19.37 ? 295 ASN B N     1 
ATOM   4959  C  CA    . ASN B  1 188 ? 50.580  -9.368  0.169   1.00   17.89 ? 295 ASN B CA    1 
ATOM   4960  C  C     . ASN B  1 188 ? 51.340  -8.941  -1.085  1.00   18.22 ? 295 ASN B C     1 
ATOM   4961  O  O     . ASN B  1 188 ? 52.030  -9.752  -1.695  1.00   16.43 ? 295 ASN B O     1 
ATOM   4962  C  CB    . ASN B  1 188 ? 49.969  -10.750 -0.090  1.00   16.40 ? 295 ASN B CB    1 
ATOM   4963  C  CG    . ASN B  1 188 ? 49.556  -11.458 1.186   1.00   18.31 ? 295 ASN B CG    1 
ATOM   4964  O  OD1   . ASN B  1 188 ? 50.174  -11.282 2.239   1.00   19.41 ? 295 ASN B OD1   1 
ATOM   4965  N  ND2   . ASN B  1 188 ? 48.514  -12.278 1.095   1.00   14.85 ? 295 ASN B ND2   1 
ATOM   4966  N  N     . GLY B  1 189 ? 51.236  -7.672  -1.464  1.00   15.87 ? 296 GLY B N     1 
ATOM   4967  C  CA    . GLY B  1 189 ? 51.907  -7.214  -2.668  1.00   14.27 ? 296 GLY B CA    1 
ATOM   4968  C  C     . GLY B  1 189 ? 53.402  -6.976  -2.593  1.00   17.15 ? 296 GLY B C     1 
ATOM   4969  O  O     . GLY B  1 189 ? 53.965  -6.322  -3.468  1.00   19.72 ? 296 GLY B O     1 
ATOM   4970  N  N     . GLY B  1 190 ? 54.058  -7.501  -1.567  1.00   17.32 ? 297 GLY B N     1 
ATOM   4971  C  CA    . GLY B  1 190 ? 55.490  -7.295  -1.435  1.00   19.57 ? 297 GLY B CA    1 
ATOM   4972  C  C     . GLY B  1 190 ? 56.339  -7.629  -2.654  1.00   21.33 ? 297 GLY B C     1 
ATOM   4973  O  O     . GLY B  1 190 ? 57.255  -6.891  -3.005  1.00   18.41 ? 297 GLY B O     1 
ATOM   4974  N  N     . ARG B  1 191 ? 56.039  -8.746  -3.307  1.00   24.03 ? 298 ARG B N     1 
ATOM   4975  C  CA    . ARG B  1 191 ? 56.793  -9.165  -4.477  1.00   24.93 ? 298 ARG B CA    1 
ATOM   4976  C  C     . ARG B  1 191 ? 56.566  -8.250  -5.687  1.00   25.73 ? 298 ARG B C     1 
ATOM   4977  O  O     . ARG B  1 191 ? 57.406  -8.176  -6.578  1.00   25.73 ? 298 ARG B O     1 
ATOM   4978  C  CB    . ARG B  1 191 ? 56.432  -10.606 -4.838  1.00   27.67 ? 298 ARG B CB    1 
ATOM   4979  C  CG    . ARG B  1 191 ? 57.429  -11.270 -5.768  1.00   33.33 ? 298 ARG B CG    1 
ATOM   4980  C  CD    . ARG B  1 191 ? 56.728  -12.025 -6.859  1.00   37.66 ? 298 ARG B CD    1 
ATOM   4981  N  NE    . ARG B  1 191 ? 56.004  -13.174 -6.336  1.00   45.36 ? 298 ARG B NE    1 
ATOM   4982  C  CZ    . ARG B  1 191 ? 55.137  -13.887 -7.050  1.00   51.12 ? 298 ARG B CZ    1 
ATOM   4983  N  NH1   . ARG B  1 191 ? 54.513  -14.932 -6.508  1.00   51.37 ? 298 ARG B NH1   1 
ATOM   4984  N  NH2   . ARG B  1 191 ? 54.879  -13.538 -8.310  1.00   54.03 ? 298 ARG B NH2   1 
ATOM   4985  N  N     . GLU B  1 192 ? 55.441  -7.543  -5.715  1.00   27.33 ? 299 GLU B N     1 
ATOM   4986  C  CA    . GLU B  1 192 ? 55.148  -6.641  -6.829  1.00   27.80 ? 299 GLU B CA    1 
ATOM   4987  C  C     . GLU B  1 192 ? 55.496  -5.207  -6.442  1.00   26.69 ? 299 GLU B C     1 
ATOM   4988  O  O     . GLU B  1 192 ? 55.141  -4.263  -7.151  1.00   25.87 ? 299 GLU B O     1 
ATOM   4989  C  CB    . GLU B  1 192 ? 53.662  -6.710  -7.221  1.00   30.03 ? 299 GLU B CB    1 
ATOM   4990  C  CG    . GLU B  1 192 ? 53.052  -8.106  -7.258  1.00   35.57 ? 299 GLU B CG    1 
ATOM   4991  C  CD    . GLU B  1 192 ? 54.024  -9.165  -7.742  1.00   40.79 ? 299 GLU B CD    1 
ATOM   4992  O  OE1   . GLU B  1 192 ? 54.629  -8.981  -8.823  1.00   43.41 ? 299 GLU B OE1   1 
ATOM   4993  O  OE2   . GLU B  1 192 ? 54.178  -10.184 -7.033  1.00   43.06 ? 299 GLU B OE2   1 
ATOM   4994  N  N     . HIS B  1 193 ? 56.199  -5.054  -5.323  1.00   25.72 ? 300 HIS B N     1 
ATOM   4995  C  CA    . HIS B  1 193 ? 56.594  -3.739  -4.824  1.00   25.51 ? 300 HIS B CA    1 
ATOM   4996  C  C     . HIS B  1 193 ? 55.387  -2.858  -4.537  1.00   23.89 ? 300 HIS B C     1 
ATOM   4997  O  O     . HIS B  1 193 ? 55.438  -1.640  -4.717  1.00   23.42 ? 300 HIS B O     1 
ATOM   4998  C  CB    . HIS B  1 193 ? 57.498  -3.029  -5.826  1.00   27.22 ? 300 HIS B CB    1 
ATOM   4999  C  CG    . HIS B  1 193 ? 58.785  -3.739  -6.080  1.00   33.47 ? 300 HIS B CG    1 
ATOM   5000  N  ND1   . HIS B  1 193 ? 58.893  -4.796  -6.956  1.00   37.47 ? 300 HIS B ND1   1 
ATOM   5001  C  CD2   . HIS B  1 193 ? 60.021  -3.556  -5.557  1.00   34.62 ? 300 HIS B CD2   1 
ATOM   5002  C  CE1   . HIS B  1 193 ? 60.140  -5.233  -6.963  1.00   37.24 ? 300 HIS B CE1   1 
ATOM   5003  N  NE2   . HIS B  1 193 ? 60.844  -4.497  -6.122  1.00   34.51 ? 300 HIS B NE2   1 
ATOM   5004  N  N     . ASP B  1 194 ? 54.304  -3.477  -4.086  1.00   21.92 ? 301 ASP B N     1 
ATOM   5005  C  CA    . ASP B  1 194 ? 53.080  -2.752  -3.791  1.00   21.30 ? 301 ASP B CA    1 
ATOM   5006  C  C     . ASP B  1 194 ? 53.253  -1.852  -2.561  1.00   23.84 ? 301 ASP B C     1 
ATOM   5007  O  O     . ASP B  1 194 ? 54.112  -2.099  -1.705  1.00   22.99 ? 301 ASP B O     1 
ATOM   5008  C  CB    . ASP B  1 194 ? 51.950  -3.757  -3.570  1.00   19.29 ? 301 ASP B CB    1 
ATOM   5009  C  CG    . ASP B  1 194 ? 50.573  -3.161  -3.798  1.00   20.22 ? 301 ASP B CG    1 
ATOM   5010  O  OD1   . ASP B  1 194 ? 50.471  -2.062  -4.387  1.00   18.49 ? 301 ASP B OD1   1 
ATOM   5011  O  OD2   . ASP B  1 194 ? 49.587  -3.814  -3.403  1.00   16.12 ? 301 ASP B OD2   1 
ATOM   5012  N  N     . SER B  1 195 ? 52.438  -0.801  -2.490  1.00   24.30 ? 302 SER B N     1 
ATOM   5013  C  CA    . SER B  1 195 ? 52.466  0.149   -1.379  1.00   25.61 ? 302 SER B CA    1 
ATOM   5014  C  C     . SER B  1 195 ? 51.110  0.123   -0.712  1.00   24.95 ? 302 SER B C     1 
ATOM   5015  O  O     . SER B  1 195 ? 50.096  0.345   -1.372  1.00   26.31 ? 302 SER B O     1 
ATOM   5016  C  CB    . SER B  1 195 ? 52.742  1.567   -1.888  1.00   26.81 ? 302 SER B CB    1 
ATOM   5017  O  OG    . SER B  1 195 ? 52.678  2.512   -0.832  1.00   27.64 ? 302 SER B OG    1 
ATOM   5018  N  N     . CYS B  1 196 ? 51.071  -0.134  0.590   1.00   24.46 ? 303 CYS B N     1 
ATOM   5019  C  CA    . CYS B  1 196 ? 49.778  -0.182  1.252   1.00   23.82 ? 303 CYS B CA    1 
ATOM   5020  C  C     . CYS B  1 196 ? 49.119  1.169   1.465   1.00   23.32 ? 303 CYS B C     1 
ATOM   5021  O  O     . CYS B  1 196 ? 48.080  1.251   2.118   1.00   23.15 ? 303 CYS B O     1 
ATOM   5022  C  CB    . CYS B  1 196 ? 49.856  -0.944  2.579   1.00   23.38 ? 303 CYS B CB    1 
ATOM   5023  S  SG    . CYS B  1 196 ? 51.376  -0.801  3.571   1.00   27.78 ? 303 CYS B SG    1 
ATOM   5024  N  N     . ASN B  1 197 ? 49.716  2.228   0.923   1.00   21.98 ? 304 ASN B N     1 
ATOM   5025  C  CA    . ASN B  1 197 ? 49.117  3.550   1.043   1.00   21.34 ? 304 ASN B CA    1 
ATOM   5026  C  C     . ASN B  1 197 ? 48.257  3.767   -0.195  1.00   21.52 ? 304 ASN B C     1 
ATOM   5027  O  O     . ASN B  1 197 ? 47.547  4.774   -0.306  1.00   20.39 ? 304 ASN B O     1 
ATOM   5028  C  CB    . ASN B  1 197 ? 50.189  4.638   1.157   1.00   21.35 ? 304 ASN B CB    1 
ATOM   5029  C  CG    . ASN B  1 197 ? 50.577  4.931   2.603   1.00   24.25 ? 304 ASN B CG    1 
ATOM   5030  O  OD1   . ASN B  1 197 ? 50.122  4.264   3.535   1.00   22.57 ? 304 ASN B OD1   1 
ATOM   5031  N  ND2   . ASN B  1 197 ? 51.427  5.938   2.793   1.00   24.41 ? 304 ASN B ND2   1 
ATOM   5032  N  N     . CYS B  1 198 ? 48.328  2.808   -1.120  1.00   18.38 ? 305 CYS B N     1 
ATOM   5033  C  CA    . CYS B  1 198 ? 47.551  2.851   -2.355  1.00   18.17 ? 305 CYS B CA    1 
ATOM   5034  C  C     . CYS B  1 198 ? 46.326  1.971   -2.180  1.00   19.25 ? 305 CYS B C     1 
ATOM   5035  O  O     . CYS B  1 198 ? 45.632  1.639   -3.140  1.00   20.77 ? 305 CYS B O     1 
ATOM   5036  C  CB    . CYS B  1 198 ? 48.390  2.346   -3.528  1.00   17.49 ? 305 CYS B CB    1 
ATOM   5037  S  SG    . CYS B  1 198 ? 49.710  3.462   -3.970  1.00   13.85 ? 305 CYS B SG    1 
ATOM   5038  N  N     . ASP B  1 199 ? 46.076  1.606   -0.931  1.00   19.34 ? 306 ASP B N     1 
ATOM   5039  C  CA    . ASP B  1 199 ? 44.957  0.760   -0.545  1.00   16.91 ? 306 ASP B CA    1 
ATOM   5040  C  C     . ASP B  1 199 ? 44.115  1.594   0.421   1.00   18.41 ? 306 ASP B C     1 
ATOM   5041  O  O     . ASP B  1 199 ? 44.517  1.834   1.562   1.00   19.56 ? 306 ASP B O     1 
ATOM   5042  C  CB    . ASP B  1 199 ? 45.511  -0.473  0.159   1.00   18.61 ? 306 ASP B CB    1 
ATOM   5043  C  CG    . ASP B  1 199 ? 44.436  -1.421  0.633   1.00   21.09 ? 306 ASP B CG    1 
ATOM   5044  O  OD1   . ASP B  1 199 ? 43.293  -0.977  0.923   1.00   18.89 ? 306 ASP B OD1   1 
ATOM   5045  O  OD2   . ASP B  1 199 ? 44.764  -2.623  0.733   1.00   20.16 ? 306 ASP B OD2   1 
ATOM   5046  N  N     . GLY B  1 200 ? 42.952  2.036   -0.037  1.00   18.40 ? 307 GLY B N     1 
ATOM   5047  C  CA    . GLY B  1 200 ? 42.097  2.867   0.791   1.00   17.66 ? 307 GLY B CA    1 
ATOM   5048  C  C     . GLY B  1 200 ? 41.558  2.271   2.079   1.00   16.72 ? 307 GLY B C     1 
ATOM   5049  O  O     . GLY B  1 200 ? 41.075  3.004   2.942   1.00   13.94 ? 307 GLY B O     1 
ATOM   5050  N  N     . TYR B  1 201 ? 41.630  0.953   2.225   1.00   17.62 ? 308 TYR B N     1 
ATOM   5051  C  CA    . TYR B  1 201 ? 41.120  0.321   3.438   1.00   17.61 ? 308 TYR B CA    1 
ATOM   5052  C  C     . TYR B  1 201 ? 42.158  0.370   4.544   1.00   16.14 ? 308 TYR B C     1 
ATOM   5053  O  O     . TYR B  1 201 ? 41.857  0.736   5.677   1.00   16.20 ? 308 TYR B O     1 
ATOM   5054  C  CB    . TYR B  1 201 ? 40.709  -1.133  3.159   1.00   16.67 ? 308 TYR B CB    1 
ATOM   5055  C  CG    . TYR B  1 201 ? 39.629  -1.268  2.101   1.00   18.28 ? 308 TYR B CG    1 
ATOM   5056  C  CD1   . TYR B  1 201 ? 39.948  -1.236  0.741   1.00   18.25 ? 308 TYR B CD1   1 
ATOM   5057  C  CD2   . TYR B  1 201 ? 38.279  -1.386  2.456   1.00   19.38 ? 308 TYR B CD2   1 
ATOM   5058  C  CE1   . TYR B  1 201 ? 38.948  -1.319  -0.251  1.00   14.76 ? 308 TYR B CE1   1 
ATOM   5059  C  CE2   . TYR B  1 201 ? 37.267  -1.467  1.467   1.00   18.51 ? 308 TYR B CE2   1 
ATOM   5060  C  CZ    . TYR B  1 201 ? 37.617  -1.432  0.117   1.00   16.76 ? 308 TYR B CZ    1 
ATOM   5061  O  OH    . TYR B  1 201 ? 36.644  -1.509  -0.862  1.00   12.87 ? 308 TYR B OH    1 
ATOM   5062  N  N     . THR B  1 202 ? 43.386  0.008   4.206   1.00   15.43 ? 309 THR B N     1 
ATOM   5063  C  CA    . THR B  1 202 ? 44.471  0.020   5.176   1.00   15.48 ? 309 THR B CA    1 
ATOM   5064  C  C     . THR B  1 202 ? 44.851  1.468   5.473   1.00   14.65 ? 309 THR B C     1 
ATOM   5065  O  O     . THR B  1 202 ? 45.137  1.847   6.603   1.00   14.98 ? 309 THR B O     1 
ATOM   5066  C  CB    . THR B  1 202 ? 45.719  -0.699  4.608   1.00   15.78 ? 309 THR B CB    1 
ATOM   5067  O  OG1   . THR B  1 202 ? 46.035  -0.148  3.325   1.00   12.71 ? 309 THR B OG1   1 
ATOM   5068  C  CG2   . THR B  1 202 ? 45.477  -2.190  4.451   1.00   15.00 ? 309 THR B CG2   1 
ATOM   5069  N  N     . ASN B  1 203 ? 44.839  2.271   4.422   1.00   16.02 ? 310 ASN B N     1 
ATOM   5070  C  CA    . ASN B  1 203 ? 45.198  3.683   4.480   1.00   16.99 ? 310 ASN B CA    1 
ATOM   5071  C  C     . ASN B  1 203 ? 44.226  4.540   5.300   1.00   17.67 ? 310 ASN B C     1 
ATOM   5072  O  O     . ASN B  1 203 ? 44.554  5.653   5.700   1.00   18.69 ? 310 ASN B O     1 
ATOM   5073  C  CB    . ASN B  1 203 ? 45.287  4.208   3.045   1.00   18.30 ? 310 ASN B CB    1 
ATOM   5074  C  CG    . ASN B  1 203 ? 45.890  5.586   2.959   1.00   22.48 ? 310 ASN B CG    1 
ATOM   5075  O  OD1   . ASN B  1 203 ? 47.056  5.800   3.316   1.00   24.61 ? 310 ASN B OD1   1 
ATOM   5076  N  ND2   . ASN B  1 203 ? 45.099  6.539   2.477   1.00   22.26 ? 310 ASN B ND2   1 
ATOM   5077  N  N     . SER B  1 204 ? 43.029  4.018   5.545   1.00   17.63 ? 311 SER B N     1 
ATOM   5078  C  CA    . SER B  1 204 ? 42.014  4.737   6.308   1.00   18.71 ? 311 SER B CA    1 
ATOM   5079  C  C     . SER B  1 204 ? 42.392  4.913   7.780   1.00   19.49 ? 311 SER B C     1 
ATOM   5080  O  O     . SER B  1 204 ? 43.034  4.047   8.362   1.00   22.64 ? 311 SER B O     1 
ATOM   5081  C  CB    . SER B  1 204 ? 40.689  3.989   6.214   1.00   16.31 ? 311 SER B CB    1 
ATOM   5082  O  OG    . SER B  1 204 ? 39.734  4.534   7.097   1.00   16.86 ? 311 SER B OG    1 
ATOM   5083  N  N     . ILE B  1 205 ? 41.992  6.024   8.390   1.00   18.69 ? 312 ILE B N     1 
ATOM   5084  C  CA    . ILE B  1 205 ? 42.310  6.233   9.802   1.00   18.79 ? 312 ILE B CA    1 
ATOM   5085  C  C     . ILE B  1 205 ? 41.364  5.434   10.688  1.00   18.94 ? 312 ILE B C     1 
ATOM   5086  O  O     . ILE B  1 205 ? 41.622  5.270   11.875  1.00   21.78 ? 312 ILE B O     1 
ATOM   5087  C  CB    . ILE B  1 205 ? 42.208  7.717   10.233  1.00   17.25 ? 312 ILE B CB    1 
ATOM   5088  C  CG1   . ILE B  1 205 ? 40.744  8.155   10.263  1.00   16.79 ? 312 ILE B CG1   1 
ATOM   5089  C  CG2   . ILE B  1 205 ? 43.028  8.590   9.300   1.00   17.30 ? 312 ILE B CG2   1 
ATOM   5090  C  CD1   . ILE B  1 205 ? 40.531  9.524   10.871  1.00   18.76 ? 312 ILE B CD1   1 
ATOM   5091  N  N     . TYR B  1 206 ? 40.267  4.942   10.110  1.00   19.22 ? 313 TYR B N     1 
ATOM   5092  C  CA    . TYR B  1 206 ? 39.282  4.165   10.865  1.00   15.73 ? 313 TYR B CA    1 
ATOM   5093  C  C     . TYR B  1 206 ? 39.705  2.701   11.056  1.00   16.77 ? 313 TYR B C     1 
ATOM   5094  O  O     . TYR B  1 206 ? 39.081  1.958   11.820  1.00   15.44 ? 313 TYR B O     1 
ATOM   5095  C  CB    . TYR B  1 206 ? 37.922  4.193   10.166  1.00   13.00 ? 313 TYR B CB    1 
ATOM   5096  C  CG    . TYR B  1 206 ? 37.448  5.554   9.702   1.00   14.52 ? 313 TYR B CG    1 
ATOM   5097  C  CD1   . TYR B  1 206 ? 37.539  6.677   10.528  1.00   17.29 ? 313 TYR B CD1   1 
ATOM   5098  C  CD2   . TYR B  1 206 ? 36.885  5.715   8.431   1.00   13.17 ? 313 TYR B CD2   1 
ATOM   5099  C  CE1   . TYR B  1 206 ? 37.080  7.940   10.094  1.00   17.74 ? 313 TYR B CE1   1 
ATOM   5100  C  CE2   . TYR B  1 206 ? 36.426  6.949   7.985   1.00   13.86 ? 313 TYR B CE2   1 
ATOM   5101  C  CZ    . TYR B  1 206 ? 36.525  8.069   8.811   1.00   19.90 ? 313 TYR B CZ    1 
ATOM   5102  O  OH    . TYR B  1 206 ? 36.095  9.307   8.334   1.00   15.77 ? 313 TYR B OH    1 
ATOM   5103  N  N     . THR B  1 207 ? 40.759  2.280   10.364  1.00   14.98 ? 314 THR B N     1 
ATOM   5104  C  CA    . THR B  1 207 ? 41.221  0.902   10.485  1.00   15.29 ? 314 THR B CA    1 
ATOM   5105  C  C     . THR B  1 207 ? 42.640  0.801   11.037  1.00   14.44 ? 314 THR B C     1 
ATOM   5106  O  O     . THR B  1 207 ? 43.479  1.648   10.767  1.00   14.65 ? 314 THR B O     1 
ATOM   5107  C  CB    . THR B  1 207 ? 41.219  0.171   9.111   1.00   12.50 ? 314 THR B CB    1 
ATOM   5108  O  OG1   . THR B  1 207 ? 42.209  0.754   8.265   1.00   9.89  ? 314 THR B OG1   1 
ATOM   5109  C  CG2   . THR B  1 207 ? 39.881  0.287   8.418   1.00   11.52 ? 314 THR B CG2   1 
ATOM   5110  N  N     . LEU B  1 208 ? 42.898  -0.238  11.824  1.00   14.96 ? 315 LEU B N     1 
ATOM   5111  C  CA    . LEU B  1 208 ? 44.238  -0.483  12.345  1.00   15.75 ? 315 LEU B CA    1 
ATOM   5112  C  C     . LEU B  1 208 ? 44.883  -1.436  11.348  1.00   15.98 ? 315 LEU B C     1 
ATOM   5113  O  O     . LEU B  1 208 ? 44.588  -2.625  11.368  1.00   19.22 ? 315 LEU B O     1 
ATOM   5114  C  CB    . LEU B  1 208 ? 44.200  -1.171  13.708  1.00   16.39 ? 315 LEU B CB    1 
ATOM   5115  C  CG    . LEU B  1 208 ? 43.519  -0.483  14.890  1.00   17.19 ? 315 LEU B CG    1 
ATOM   5116  C  CD1   . LEU B  1 208 ? 42.051  -0.804  14.864  1.00   16.86 ? 315 LEU B CD1   1 
ATOM   5117  C  CD2   . LEU B  1 208 ? 44.136  -0.993  16.188  1.00   16.92 ? 315 LEU B CD2   1 
ATOM   5118  N  N     . SER B  1 209 ? 45.733  -0.918  10.465  1.00   14.70 ? 316 SER B N     1 
ATOM   5119  C  CA    . SER B  1 209 ? 46.395  -1.741  9.461   1.00   14.42 ? 316 SER B CA    1 
ATOM   5120  C  C     . SER B  1 209 ? 47.530  -2.513  10.126  1.00   14.34 ? 316 SER B C     1 
ATOM   5121  O  O     . SER B  1 209 ? 48.389  -1.925  10.780  1.00   16.28 ? 316 SER B O     1 
ATOM   5122  C  CB    . SER B  1 209 ? 46.925  -0.846  8.345   1.00   16.02 ? 316 SER B CB    1 
ATOM   5123  O  OG    . SER B  1 209 ? 47.321  -1.615  7.226   1.00   21.25 ? 316 SER B OG    1 
ATOM   5124  N  N     . ILE B  1 210 ? 47.533  -3.831  9.953   1.00   12.37 ? 317 ILE B N     1 
ATOM   5125  C  CA    . ILE B  1 210 ? 48.539  -4.691  10.583  1.00   12.72 ? 317 ILE B CA    1 
ATOM   5126  C  C     . ILE B  1 210 ? 49.463  -5.427  9.611   1.00   14.37 ? 317 ILE B C     1 
ATOM   5127  O  O     . ILE B  1 210 ? 48.992  -6.165  8.759   1.00   15.02 ? 317 ILE B O     1 
ATOM   5128  C  CB    . ILE B  1 210 ? 47.844  -5.750  11.469  1.00   11.76 ? 317 ILE B CB    1 
ATOM   5129  C  CG1   . ILE B  1 210 ? 46.859  -5.075  12.424  1.00   11.46 ? 317 ILE B CG1   1 
ATOM   5130  C  CG2   . ILE B  1 210 ? 48.870  -6.528  12.248  1.00   11.25 ? 317 ILE B CG2   1 
ATOM   5131  C  CD1   . ILE B  1 210 ? 47.511  -4.084  13.382  1.00   11.10 ? 317 ILE B CD1   1 
ATOM   5132  N  N     . SER B  1 211 ? 50.776  -5.227  9.758   1.00   18.08 ? 318 SER B N     1 
ATOM   5133  C  CA    . SER B  1 211 ? 51.781  -5.892  8.915   1.00   17.34 ? 318 SER B CA    1 
ATOM   5134  C  C     . SER B  1 211 ? 52.300  -7.193  9.547   1.00   18.18 ? 318 SER B C     1 
ATOM   5135  O  O     . SER B  1 211 ? 51.915  -7.552  10.659  1.00   17.60 ? 318 SER B O     1 
ATOM   5136  C  CB    . SER B  1 211 ? 52.971  -4.967  8.646   1.00   16.28 ? 318 SER B CB    1 
ATOM   5137  O  OG    . SER B  1 211 ? 52.657  -3.975  7.695   1.00   15.32 ? 318 SER B OG    1 
ATOM   5138  N  N     . SER B  1 212 ? 53.197  -7.876  8.838   1.00   20.23 ? 319 SER B N     1 
ATOM   5139  C  CA    . SER B  1 212 ? 53.739  -9.156  9.296   1.00   19.60 ? 319 SER B CA    1 
ATOM   5140  C  C     . SER B  1 212 ? 55.239  -9.190  9.540   1.00   20.20 ? 319 SER B C     1 
ATOM   5141  O  O     . SER B  1 212 ? 55.991  -8.377  9.009   1.00   20.39 ? 319 SER B O     1 
ATOM   5142  C  CB    . SER B  1 212 ? 53.401  -10.250 8.282   1.00   17.69 ? 319 SER B CB    1 
ATOM   5143  O  OG    . SER B  1 212 ? 52.017  -10.286 8.013   1.00   18.61 ? 319 SER B OG    1 
ATOM   5144  N  N     . ALA B  1 213 ? 55.657  -10.161 10.345  1.00   19.64 ? 320 ALA B N     1 
ATOM   5145  C  CA    . ALA B  1 213 ? 57.063  -10.373 10.666  1.00   21.86 ? 320 ALA B CA    1 
ATOM   5146  C  C     . ALA B  1 213 ? 57.267  -11.884 10.687  1.00   24.67 ? 320 ALA B C     1 
ATOM   5147  O  O     . ALA B  1 213 ? 56.395  -12.615 11.171  1.00   25.49 ? 320 ALA B O     1 
ATOM   5148  C  CB    . ALA B  1 213 ? 57.377  -9.793  12.021  1.00   20.13 ? 320 ALA B CB    1 
ATOM   5149  N  N     . THR B  1 214 ? 58.393  -12.360 10.154  1.00   24.75 ? 321 THR B N     1 
ATOM   5150  C  CA    . THR B  1 214 ? 58.670  -13.801 10.140  1.00   23.73 ? 321 THR B CA    1 
ATOM   5151  C  C     . THR B  1 214 ? 59.141  -14.234 11.521  1.00   23.91 ? 321 THR B C     1 
ATOM   5152  O  O     . THR B  1 214 ? 59.446  -13.391 12.371  1.00   23.93 ? 321 THR B O     1 
ATOM   5153  C  CB    . THR B  1 214 ? 59.761  -14.168 9.134   1.00   21.42 ? 321 THR B CB    1 
ATOM   5154  O  OG1   . THR B  1 214 ? 61.000  -13.604 9.571   1.00   24.28 ? 321 THR B OG1   1 
ATOM   5155  C  CG2   . THR B  1 214 ? 59.416  -13.633 7.746   1.00   22.73 ? 321 THR B CG2   1 
ATOM   5156  N  N     . GLN B  1 215 ? 59.202  -15.546 11.741  1.00   22.92 ? 322 GLN B N     1 
ATOM   5157  C  CA    . GLN B  1 215 ? 59.617  -16.071 13.038  1.00   21.71 ? 322 GLN B CA    1 
ATOM   5158  C  C     . GLN B  1 215 ? 60.983  -15.567 13.468  1.00   20.73 ? 322 GLN B C     1 
ATOM   5159  O  O     . GLN B  1 215 ? 61.180  -15.282 14.637  1.00   22.07 ? 322 GLN B O     1 
ATOM   5160  C  CB    . GLN B  1 215 ? 59.605  -17.603 13.037  1.00   22.00 ? 322 GLN B CB    1 
ATOM   5161  C  CG    . GLN B  1 215 ? 60.267  -18.224 14.259  1.00   21.68 ? 322 GLN B CG    1 
ATOM   5162  C  CD    . GLN B  1 215 ? 60.154  -19.744 14.287  1.00   25.84 ? 322 GLN B CD    1 
ATOM   5163  O  OE1   . GLN B  1 215 ? 60.312  -20.413 13.260  1.00   28.15 ? 322 GLN B OE1   1 
ATOM   5164  N  NE2   . GLN B  1 215 ? 59.894  -20.296 15.465  1.00   25.37 ? 322 GLN B NE2   1 
ATOM   5165  N  N     . PHE B  1 216 ? 61.923  -15.448 12.534  1.00   20.98 ? 323 PHE B N     1 
ATOM   5166  C  CA    . PHE B  1 216 ? 63.260  -14.966 12.877  1.00   19.68 ? 323 PHE B CA    1 
ATOM   5167  C  C     . PHE B  1 216 ? 63.336  -13.435 12.923  1.00   19.58 ? 323 PHE B C     1 
ATOM   5168  O  O     . PHE B  1 216 ? 64.421  -12.871 13.011  1.00   20.07 ? 323 PHE B O     1 
ATOM   5169  C  CB    . PHE B  1 216 ? 64.304  -15.504 11.887  1.00   19.18 ? 323 PHE B CB    1 
ATOM   5170  C  CG    . PHE B  1 216 ? 64.350  -17.019 11.791  1.00   21.48 ? 323 PHE B CG    1 
ATOM   5171  C  CD1   . PHE B  1 216 ? 63.862  -17.826 12.825  1.00   19.75 ? 323 PHE B CD1   1 
ATOM   5172  C  CD2   . PHE B  1 216 ? 64.904  -17.642 10.667  1.00   19.75 ? 323 PHE B CD2   1 
ATOM   5173  C  CE1   . PHE B  1 216 ? 63.935  -19.225 12.743  1.00   16.79 ? 323 PHE B CE1   1 
ATOM   5174  C  CE2   . PHE B  1 216 ? 64.978  -19.041 10.579  1.00   17.80 ? 323 PHE B CE2   1 
ATOM   5175  C  CZ    . PHE B  1 216 ? 64.492  -19.830 11.615  1.00   15.80 ? 323 PHE B CZ    1 
ATOM   5176  N  N     . GLY B  1 217 ? 62.184  -12.772 12.854  1.00   17.00 ? 324 GLY B N     1 
ATOM   5177  C  CA    . GLY B  1 217 ? 62.150  -11.324 12.909  1.00   17.89 ? 324 GLY B CA    1 
ATOM   5178  C  C     . GLY B  1 217 ? 62.491  -10.542 11.649  1.00   21.67 ? 324 GLY B C     1 
ATOM   5179  O  O     . GLY B  1 217 ? 63.077  -9.456  11.732  1.00   24.23 ? 324 GLY B O     1 
ATOM   5180  N  N     . ASN B  1 218 ? 62.126  -11.064 10.484  1.00   20.66 ? 325 ASN B N     1 
ATOM   5181  C  CA    . ASN B  1 218 ? 62.416  -10.347 9.253   1.00   22.17 ? 325 ASN B CA    1 
ATOM   5182  C  C     . ASN B  1 218 ? 61.160  -9.928  8.519   1.00   21.79 ? 325 ASN B C     1 
ATOM   5183  O  O     . ASN B  1 218 ? 60.059  -10.378 8.847   1.00   23.24 ? 325 ASN B O     1 
ATOM   5184  C  CB    . ASN B  1 218 ? 63.289  -11.203 8.345   1.00   23.28 ? 325 ASN B CB    1 
ATOM   5185  C  CG    . ASN B  1 218 ? 64.667  -11.402 8.914   1.00   25.29 ? 325 ASN B CG    1 
ATOM   5186  O  OD1   . ASN B  1 218 ? 65.343  -10.435 9.276   1.00   23.20 ? 325 ASN B OD1   1 
ATOM   5187  N  ND2   . ASN B  1 218 ? 65.093  -12.654 9.010   1.00   29.08 ? 325 ASN B ND2   1 
ATOM   5188  N  N     . VAL B  1 219 ? 61.330  -9.046  7.539   1.00   18.48 ? 326 VAL B N     1 
ATOM   5189  C  CA    . VAL B  1 219 ? 60.217  -8.575  6.729   1.00   16.87 ? 326 VAL B CA    1 
ATOM   5190  C  C     . VAL B  1 219 ? 59.925  -9.655  5.696   1.00   14.48 ? 326 VAL B C     1 
ATOM   5191  O  O     . VAL B  1 219 ? 60.758  -9.935  4.838   1.00   13.09 ? 326 VAL B O     1 
ATOM   5192  C  CB    . VAL B  1 219 ? 60.589  -7.256  6.008   1.00   18.50 ? 326 VAL B CB    1 
ATOM   5193  C  CG1   . VAL B  1 219 ? 59.402  -6.737  5.196   1.00   15.37 ? 326 VAL B CG1   1 
ATOM   5194  C  CG2   . VAL B  1 219 ? 61.061  -6.229  7.038   1.00   12.14 ? 326 VAL B CG2   1 
ATOM   5195  N  N     . PRO B  1 220 ? 58.741  -10.279 5.766   1.00   15.46 ? 327 PRO B N     1 
ATOM   5196  C  CA    . PRO B  1 220 ? 58.352  -11.341 4.825   1.00   17.22 ? 327 PRO B CA    1 
ATOM   5197  C  C     . PRO B  1 220 ? 58.409  -10.897 3.361   1.00   18.23 ? 327 PRO B C     1 
ATOM   5198  O  O     . PRO B  1 220 ? 58.328  -9.704  3.052   1.00   17.64 ? 327 PRO B O     1 
ATOM   5199  C  CB    . PRO B  1 220 ? 56.927  -11.689 5.262   1.00   17.55 ? 327 PRO B CB    1 
ATOM   5200  C  CG    . PRO B  1 220 ? 56.905  -11.348 6.714   1.00   18.47 ? 327 PRO B CG    1 
ATOM   5201  C  CD    . PRO B  1 220 ? 57.661  -10.026 6.734   1.00   17.94 ? 327 PRO B CD    1 
ATOM   5202  N  N     . TRP B  1 221 ? 58.541  -11.860 2.456   1.00   18.46 ? 328 TRP B N     1 
ATOM   5203  C  CA    . TRP B  1 221 ? 58.610  -11.536 1.038   1.00   18.39 ? 328 TRP B CA    1 
ATOM   5204  C  C     . TRP B  1 221 ? 57.338  -10.849 0.547   1.00   17.71 ? 328 TRP B C     1 
ATOM   5205  O  O     . TRP B  1 221 ? 57.387  -10.001 -0.336  1.00   18.17 ? 328 TRP B O     1 
ATOM   5206  C  CB    . TRP B  1 221 ? 58.862  -12.802 0.211   1.00   14.93 ? 328 TRP B CB    1 
ATOM   5207  C  CG    . TRP B  1 221 ? 57.763  -13.812 0.295   1.00   15.16 ? 328 TRP B CG    1 
ATOM   5208  C  CD1   . TRP B  1 221 ? 57.639  -14.817 1.214   1.00   17.39 ? 328 TRP B CD1   1 
ATOM   5209  C  CD2   . TRP B  1 221 ? 56.603  -13.895 -0.549  1.00   15.31 ? 328 TRP B CD2   1 
ATOM   5210  N  NE1   . TRP B  1 221 ? 56.474  -15.518 0.995   1.00   16.47 ? 328 TRP B NE1   1 
ATOM   5211  C  CE2   . TRP B  1 221 ? 55.820  -14.972 -0.078  1.00   13.81 ? 328 TRP B CE2   1 
ATOM   5212  C  CE3   . TRP B  1 221 ? 56.148  -13.158 -1.654  1.00   16.91 ? 328 TRP B CE3   1 
ATOM   5213  C  CZ2   . TRP B  1 221 ? 54.603  -15.334 -0.674  1.00   14.61 ? 328 TRP B CZ2   1 
ATOM   5214  C  CZ3   . TRP B  1 221 ? 54.935  -13.516 -2.248  1.00   16.14 ? 328 TRP B CZ3   1 
ATOM   5215  C  CH2   . TRP B  1 221 ? 54.178  -14.597 -1.753  1.00   15.98 ? 328 TRP B CH2   1 
ATOM   5216  N  N     . TYR B  1 222 ? 56.205  -11.206 1.140   1.00   18.40 ? 329 TYR B N     1 
ATOM   5217  C  CA    . TYR B  1 222 ? 54.905  -10.651 0.746   1.00   19.67 ? 329 TYR B CA    1 
ATOM   5218  C  C     . TYR B  1 222 ? 54.554  -9.293  1.371   1.00   19.04 ? 329 TYR B C     1 
ATOM   5219  O  O     . TYR B  1 222 ? 53.589  -8.648  0.963   1.00   18.99 ? 329 TYR B O     1 
ATOM   5220  C  CB    . TYR B  1 222 ? 53.812  -11.667 1.087   1.00   18.92 ? 329 TYR B CB    1 
ATOM   5221  C  CG    . TYR B  1 222 ? 53.837  -12.115 2.537   1.00   20.37 ? 329 TYR B CG    1 
ATOM   5222  C  CD1   . TYR B  1 222 ? 53.273  -11.329 3.542   1.00   16.71 ? 329 TYR B CD1   1 
ATOM   5223  C  CD2   . TYR B  1 222 ? 54.438  -13.323 2.901   1.00   18.84 ? 329 TYR B CD2   1 
ATOM   5224  C  CE1   . TYR B  1 222 ? 53.306  -11.732 4.866   1.00   20.18 ? 329 TYR B CE1   1 
ATOM   5225  C  CE2   . TYR B  1 222 ? 54.473  -13.739 4.226   1.00   19.43 ? 329 TYR B CE2   1 
ATOM   5226  C  CZ    . TYR B  1 222 ? 53.907  -12.937 5.205   1.00   21.65 ? 329 TYR B CZ    1 
ATOM   5227  O  OH    . TYR B  1 222 ? 53.949  -13.329 6.528   1.00   22.06 ? 329 TYR B OH    1 
ATOM   5228  N  N     . SER B  1 223 ? 55.349  -8.864  2.346   1.00   17.56 ? 330 SER B N     1 
ATOM   5229  C  CA    . SER B  1 223 ? 55.119  -7.606  3.049   1.00   17.50 ? 330 SER B CA    1 
ATOM   5230  C  C     . SER B  1 223 ? 55.113  -6.331  2.186   1.00   17.98 ? 330 SER B C     1 
ATOM   5231  O  O     . SER B  1 223 ? 55.951  -6.157  1.302   1.00   17.97 ? 330 SER B O     1 
ATOM   5232  C  CB    . SER B  1 223 ? 56.162  -7.473  4.163   1.00   17.24 ? 330 SER B CB    1 
ATOM   5233  O  OG    . SER B  1 223 ? 56.131  -6.204  4.788   1.00   15.96 ? 330 SER B OG    1 
ATOM   5234  N  N     . GLU B  1 224 ? 54.158  -5.441  2.448   1.00   18.09 ? 331 GLU B N     1 
ATOM   5235  C  CA    . GLU B  1 224 ? 54.084  -4.167  1.731   1.00   16.44 ? 331 GLU B CA    1 
ATOM   5236  C  C     . GLU B  1 224 ? 54.467  -3.104  2.739   1.00   14.99 ? 331 GLU B C     1 
ATOM   5237  O  O     . GLU B  1 224 ? 54.075  -3.183  3.899   1.00   16.06 ? 331 GLU B O     1 
ATOM   5238  C  CB    . GLU B  1 224 ? 52.663  -3.861  1.241   1.00   15.18 ? 331 GLU B CB    1 
ATOM   5239  C  CG    . GLU B  1 224 ? 52.011  -4.965  0.454   1.00   19.84 ? 331 GLU B CG    1 
ATOM   5240  C  CD    . GLU B  1 224 ? 50.737  -4.530  -0.239  1.00   19.28 ? 331 GLU B CD    1 
ATOM   5241  O  OE1   . GLU B  1 224 ? 49.964  -5.418  -0.651  1.00   20.40 ? 331 GLU B OE1   1 
ATOM   5242  O  OE2   . GLU B  1 224 ? 50.508  -3.309  -0.383  1.00   19.88 ? 331 GLU B OE2   1 
ATOM   5243  N  N     . ALA B  1 225 ? 55.230  -2.111  2.305   1.00   14.46 ? 332 ALA B N     1 
ATOM   5244  C  CA    . ALA B  1 225 ? 55.625  -1.028  3.196   1.00   14.19 ? 332 ALA B CA    1 
ATOM   5245  C  C     . ALA B  1 225 ? 54.839  0.242   2.863   1.00   14.23 ? 332 ALA B C     1 
ATOM   5246  O  O     . ALA B  1 225 ? 54.515  0.501   1.701   1.00   14.31 ? 332 ALA B O     1 
ATOM   5247  C  CB    . ALA B  1 225 ? 57.129  -0.770  3.072   1.00   8.67  ? 332 ALA B CB    1 
ATOM   5248  N  N     . CYS B  1 226 ? 54.518  1.015   3.898   1.00   16.33 ? 333 CYS B N     1 
ATOM   5249  C  CA    . CYS B  1 226 ? 53.784  2.283   3.765   1.00   20.06 ? 333 CYS B CA    1 
ATOM   5250  C  C     . CYS B  1 226 ? 53.723  2.926   5.151   1.00   20.50 ? 333 CYS B C     1 
ATOM   5251  O  O     . CYS B  1 226 ? 53.963  2.266   6.164   1.00   21.43 ? 333 CYS B O     1 
ATOM   5252  C  CB    . CYS B  1 226 ? 52.360  2.060   3.228   1.00   20.69 ? 333 CYS B CB    1 
ATOM   5253  S  SG    . CYS B  1 226 ? 51.325  1.074   4.356   1.00   26.46 ? 333 CYS B SG    1 
ATOM   5254  N  N     . SER B  1 227 ? 53.405  4.213   5.197   1.00   19.98 ? 334 SER B N     1 
ATOM   5255  C  CA    . SER B  1 227 ? 53.341  4.934   6.459   1.00   18.64 ? 334 SER B CA    1 
ATOM   5256  C  C     . SER B  1 227 ? 52.025  4.792   7.201   1.00   19.28 ? 334 SER B C     1 
ATOM   5257  O  O     . SER B  1 227 ? 51.909  5.252   8.334   1.00   21.14 ? 334 SER B O     1 
ATOM   5258  C  CB    . SER B  1 227 ? 53.610  6.419   6.218   1.00   19.96 ? 334 SER B CB    1 
ATOM   5259  O  OG    . SER B  1 227 ? 52.644  6.972   5.339   1.00   17.38 ? 334 SER B OG    1 
ATOM   5260  N  N     . SER B  1 228 ? 51.033  4.163   6.576   1.00   21.86 ? 335 SER B N     1 
ATOM   5261  C  CA    . SER B  1 228 ? 49.721  4.012   7.215   1.00   21.85 ? 335 SER B CA    1 
ATOM   5262  C  C     . SER B  1 228 ? 49.629  2.817   8.162   1.00   19.70 ? 335 SER B C     1 
ATOM   5263  O  O     . SER B  1 228 ? 48.738  2.761   9.006   1.00   19.14 ? 335 SER B O     1 
ATOM   5264  C  CB    . SER B  1 228 ? 48.603  3.932   6.158   1.00   19.72 ? 335 SER B CB    1 
ATOM   5265  O  OG    . SER B  1 228 ? 48.792  2.842   5.276   1.00   22.29 ? 335 SER B OG    1 
ATOM   5266  N  N     . THR B  1 229 ? 50.548  1.866   8.022   1.00   18.90 ? 336 THR B N     1 
ATOM   5267  C  CA    . THR B  1 229 ? 50.565  0.689   8.890   1.00   17.64 ? 336 THR B CA    1 
ATOM   5268  C  C     . THR B  1 229 ? 50.788  1.142   10.331  1.00   17.17 ? 336 THR B C     1 
ATOM   5269  O  O     . THR B  1 229 ? 51.634  2.001   10.591  1.00   16.11 ? 336 THR B O     1 
ATOM   5270  C  CB    . THR B  1 229 ? 51.703  -0.273  8.510   1.00   16.13 ? 336 THR B CB    1 
ATOM   5271  O  OG1   . THR B  1 229 ? 51.514  -0.731  7.172   1.00   16.37 ? 336 THR B OG1   1 
ATOM   5272  C  CG2   . THR B  1 229 ? 51.737  -1.454  9.450   1.00   14.56 ? 336 THR B CG2   1 
ATOM   5273  N  N     . LEU B  1 230 ? 50.045  0.549   11.261  1.00   17.00 ? 337 LEU B N     1 
ATOM   5274  C  CA    . LEU B  1 230 ? 50.141  0.917   12.671  1.00   16.64 ? 337 LEU B CA    1 
ATOM   5275  C  C     . LEU B  1 230 ? 50.997  -0.021  13.522  1.00   17.48 ? 337 LEU B C     1 
ATOM   5276  O  O     . LEU B  1 230 ? 51.785  0.440   14.340  1.00   18.85 ? 337 LEU B O     1 
ATOM   5277  C  CB    . LEU B  1 230 ? 48.739  1.021   13.278  1.00   16.69 ? 337 LEU B CB    1 
ATOM   5278  C  CG    . LEU B  1 230 ? 48.618  1.692   14.649  1.00   17.42 ? 337 LEU B CG    1 
ATOM   5279  C  CD1   . LEU B  1 230 ? 49.063  3.163   14.556  1.00   17.29 ? 337 LEU B CD1   1 
ATOM   5280  C  CD2   . LEU B  1 230 ? 47.181  1.579   15.135  1.00   15.22 ? 337 LEU B CD2   1 
ATOM   5281  N  N     . ALA B  1 231 ? 50.842  -1.330  13.347  1.00   17.43 ? 338 ALA B N     1 
ATOM   5282  C  CA    . ALA B  1 231 ? 51.634  -2.293  14.111  1.00   16.70 ? 338 ALA B CA    1 
ATOM   5283  C  C     . ALA B  1 231 ? 51.835  -3.618  13.365  1.00   19.00 ? 338 ALA B C     1 
ATOM   5284  O  O     . ALA B  1 231 ? 51.380  -3.790  12.224  1.00   16.93 ? 338 ALA B O     1 
ATOM   5285  C  CB    . ALA B  1 231 ? 50.988  -2.545  15.463  1.00   16.36 ? 338 ALA B CB    1 
ATOM   5286  N  N     . THR B  1 232 ? 52.498  -4.563  14.027  1.00   18.57 ? 339 THR B N     1 
ATOM   5287  C  CA    . THR B  1 232 ? 52.806  -5.854  13.425  1.00   17.28 ? 339 THR B CA    1 
ATOM   5288  C  C     . THR B  1 232 ? 52.528  -7.060  14.314  1.00   19.69 ? 339 THR B C     1 
ATOM   5289  O  O     . THR B  1 232 ? 52.550  -6.959  15.541  1.00   22.29 ? 339 THR B O     1 
ATOM   5290  C  CB    . THR B  1 232 ? 54.308  -5.905  13.050  1.00   15.05 ? 339 THR B CB    1 
ATOM   5291  O  OG1   . THR B  1 232 ? 54.594  -4.891  12.082  1.00   16.05 ? 339 THR B OG1   1 
ATOM   5292  C  CG2   . THR B  1 232 ? 54.692  -7.270  12.504  1.00   11.96 ? 339 THR B CG2   1 
ATOM   5293  N  N     . THR B  1 233 ? 52.260  -8.198  13.681  1.00   19.67 ? 340 THR B N     1 
ATOM   5294  C  CA    . THR B  1 233 ? 52.080  -9.463  14.391  1.00   21.69 ? 340 THR B CA    1 
ATOM   5295  C  C     . THR B  1 233 ? 52.807  -10.514 13.549  1.00   21.19 ? 340 THR B C     1 
ATOM   5296  O  O     . THR B  1 233 ? 53.031  -10.323 12.356  1.00   21.21 ? 340 THR B O     1 
ATOM   5297  C  CB    . THR B  1 233 ? 50.597  -9.880  14.545  1.00   23.73 ? 340 THR B CB    1 
ATOM   5298  O  OG1   . THR B  1 233 ? 50.049  -10.196 13.264  1.00   28.02 ? 340 THR B OG1   1 
ATOM   5299  C  CG2   . THR B  1 233 ? 49.790  -8.763  15.180  1.00   24.12 ? 340 THR B CG2   1 
ATOM   5300  N  N     . TYR B  1 234 ? 53.190  -11.617 14.173  1.00   21.87 ? 341 TYR B N     1 
ATOM   5301  C  CA    . TYR B  1 234 ? 53.901  -12.677 13.477  1.00   20.10 ? 341 TYR B CA    1 
ATOM   5302  C  C     . TYR B  1 234 ? 53.084  -13.402 12.413  1.00   21.11 ? 341 TYR B C     1 
ATOM   5303  O  O     . TYR B  1 234 ? 51.856  -13.459 12.477  1.00   20.54 ? 341 TYR B O     1 
ATOM   5304  C  CB    . TYR B  1 234 ? 54.400  -13.700 14.488  1.00   19.49 ? 341 TYR B CB    1 
ATOM   5305  C  CG    . TYR B  1 234 ? 55.598  -13.242 15.281  1.00   20.76 ? 341 TYR B CG    1 
ATOM   5306  C  CD1   . TYR B  1 234 ? 56.841  -13.108 14.670  1.00   22.14 ? 341 TYR B CD1   1 
ATOM   5307  C  CD2   . TYR B  1 234 ? 55.497  -12.960 16.640  1.00   19.17 ? 341 TYR B CD2   1 
ATOM   5308  C  CE1   . TYR B  1 234 ? 57.959  -12.711 15.386  1.00   22.72 ? 341 TYR B CE1   1 
ATOM   5309  C  CE2   . TYR B  1 234 ? 56.612  -12.561 17.373  1.00   21.04 ? 341 TYR B CE2   1 
ATOM   5310  C  CZ    . TYR B  1 234 ? 57.843  -12.438 16.733  1.00   22.91 ? 341 TYR B CZ    1 
ATOM   5311  O  OH    . TYR B  1 234 ? 58.968  -12.048 17.427  1.00   23.19 ? 341 TYR B OH    1 
ATOM   5312  N  N     . SER B  1 235 ? 53.789  -13.950 11.428  1.00   21.34 ? 342 SER B N     1 
ATOM   5313  C  CA    . SER B  1 235 ? 53.166  -14.720 10.360  1.00   20.26 ? 342 SER B CA    1 
ATOM   5314  C  C     . SER B  1 235 ? 54.225  -15.615 9.716   1.00   18.84 ? 342 SER B C     1 
ATOM   5315  O  O     . SER B  1 235 ? 55.257  -15.885 10.326  1.00   18.12 ? 342 SER B O     1 
ATOM   5316  C  CB    . SER B  1 235 ? 52.527  -13.803 9.314   1.00   19.34 ? 342 SER B CB    1 
ATOM   5317  O  OG    . SER B  1 235 ? 51.546  -14.519 8.570   1.00   15.04 ? 342 SER B OG    1 
ATOM   5318  N  N     . SER B  1 236 ? 53.978  -16.068 8.490   1.00   19.19 ? 343 SER B N     1 
ATOM   5319  C  CA    . SER B  1 236 ? 54.916  -16.955 7.804   1.00   16.19 ? 343 SER B CA    1 
ATOM   5320  C  C     . SER B  1 236 ? 56.092  -16.242 7.163   1.00   14.29 ? 343 SER B C     1 
ATOM   5321  O  O     . SER B  1 236 ? 56.052  -15.042 6.942   1.00   11.46 ? 343 SER B O     1 
ATOM   5322  C  CB    . SER B  1 236 ? 54.175  -17.787 6.742   1.00   18.21 ? 343 SER B CB    1 
ATOM   5323  O  OG    . SER B  1 236 ? 53.467  -16.974 5.816   1.00   20.31 ? 343 SER B OG    1 
ATOM   5324  N  N     . GLY B  1 237 ? 57.138  -17.013 6.873   1.00   15.80 ? 344 GLY B N     1 
ATOM   5325  C  CA    . GLY B  1 237 ? 58.338  -16.502 6.235   1.00   15.42 ? 344 GLY B CA    1 
ATOM   5326  C  C     . GLY B  1 237 ? 58.878  -17.576 5.298   1.00   17.99 ? 344 GLY B C     1 
ATOM   5327  O  O     . GLY B  1 237 ? 58.146  -18.081 4.443   1.00   17.88 ? 344 GLY B O     1 
ATOM   5328  N  N     . ASN B  1 238 ? 60.149  -17.941 5.449   1.00   17.84 ? 345 ASN B N     1 
ATOM   5329  C  CA    . ASN B  1 238 ? 60.718  -18.977 4.601   1.00   17.06 ? 345 ASN B CA    1 
ATOM   5330  C  C     . ASN B  1 238 ? 60.376  -20.363 5.136   1.00   17.43 ? 345 ASN B C     1 
ATOM   5331  O  O     . ASN B  1 238 ? 59.701  -20.493 6.160   1.00   16.04 ? 345 ASN B O     1 
ATOM   5332  C  CB    . ASN B  1 238 ? 62.238  -18.811 4.462   1.00   19.25 ? 345 ASN B CB    1 
ATOM   5333  C  CG    . ASN B  1 238 ? 62.972  -18.859 5.797   1.00   19.80 ? 345 ASN B CG    1 
ATOM   5334  O  OD1   . ASN B  1 238 ? 62.757  -19.761 6.613   1.00   20.13 ? 345 ASN B OD1   1 
ATOM   5335  N  ND2   . ASN B  1 238 ? 63.867  -17.902 6.009   1.00   17.95 ? 345 ASN B ND2   1 
ATOM   5336  N  N     . GLN B  1 239 ? 60.843  -21.401 4.453   1.00   17.87 ? 346 GLN B N     1 
ATOM   5337  C  CA    . GLN B  1 239 ? 60.508  -22.756 4.865   1.00   18.96 ? 346 GLN B CA    1 
ATOM   5338  C  C     . GLN B  1 239 ? 61.232  -23.308 6.082   1.00   20.42 ? 346 GLN B C     1 
ATOM   5339  O  O     . GLN B  1 239 ? 61.035  -24.469 6.446   1.00   21.70 ? 346 GLN B O     1 
ATOM   5340  C  CB    . GLN B  1 239 ? 60.657  -23.703 3.676   1.00   19.04 ? 346 GLN B CB    1 
ATOM   5341  C  CG    . GLN B  1 239 ? 59.760  -23.318 2.496   1.00   18.27 ? 346 GLN B CG    1 
ATOM   5342  C  CD    . GLN B  1 239 ? 59.787  -24.338 1.363   1.00   15.70 ? 346 GLN B CD    1 
ATOM   5343  O  OE1   . GLN B  1 239 ? 59.714  -23.977 0.190   1.00   18.35 ? 346 GLN B OE1   1 
ATOM   5344  N  NE2   . GLN B  1 239 ? 59.876  -25.609 1.710   1.00   12.19 ? 346 GLN B NE2   1 
ATOM   5345  N  N     . ASN B  1 240 ? 62.069  -22.489 6.711   1.00   22.03 ? 347 ASN B N     1 
ATOM   5346  C  CA    . ASN B  1 240 ? 62.770  -22.923 7.916   1.00   22.08 ? 347 ASN B CA    1 
ATOM   5347  C  C     . ASN B  1 240 ? 62.093  -22.267 9.105   1.00   22.37 ? 347 ASN B C     1 
ATOM   5348  O  O     . ASN B  1 240 ? 62.368  -22.596 10.257  1.00   25.02 ? 347 ASN B O     1 
ATOM   5349  C  CB    . ASN B  1 240 ? 64.237  -22.516 7.877   1.00   23.86 ? 347 ASN B CB    1 
ATOM   5350  C  CG    . ASN B  1 240 ? 64.994  -23.218 6.783   1.00   26.43 ? 347 ASN B CG    1 
ATOM   5351  O  OD1   . ASN B  1 240 ? 65.244  -22.652 5.720   1.00   30.42 ? 347 ASN B OD1   1 
ATOM   5352  N  ND2   . ASN B  1 240 ? 65.349  -24.475 7.028   1.00   27.85 ? 347 ASN B ND2   1 
ATOM   5353  N  N     . GLU B  1 241 ? 61.201  -21.331 8.805   1.00   20.99 ? 348 GLU B N     1 
ATOM   5354  C  CA    . GLU B  1 241 ? 60.459  -20.614 9.822   1.00   19.73 ? 348 GLU B CA    1 
ATOM   5355  C  C     . GLU B  1 241 ? 59.074  -21.210 9.932   1.00   19.87 ? 348 GLU B C     1 
ATOM   5356  O  O     . GLU B  1 241 ? 58.455  -21.563 8.929   1.00   21.61 ? 348 GLU B O     1 
ATOM   5357  C  CB    . GLU B  1 241 ? 60.385  -19.131 9.460   1.00   15.84 ? 348 GLU B CB    1 
ATOM   5358  C  CG    . GLU B  1 241 ? 61.753  -18.496 9.386   1.00   14.10 ? 348 GLU B CG    1 
ATOM   5359  C  CD    . GLU B  1 241 ? 61.708  -17.080 8.862   1.00   19.33 ? 348 GLU B CD    1 
ATOM   5360  O  OE1   . GLU B  1 241 ? 62.184  -16.159 9.565   1.00   16.94 ? 348 GLU B OE1   1 
ATOM   5361  O  OE2   . GLU B  1 241 ? 61.199  -16.889 7.737   1.00   20.46 ? 348 GLU B OE2   1 
ATOM   5362  N  N     . LYS B  1 242 ? 58.588  -21.326 11.158  1.00   22.17 ? 349 LYS B N     1 
ATOM   5363  C  CA    . LYS B  1 242 ? 57.271  -21.895 11.397  1.00   24.08 ? 349 LYS B CA    1 
ATOM   5364  C  C     . LYS B  1 242 ? 56.156  -20.952 10.953  1.00   23.13 ? 349 LYS B C     1 
ATOM   5365  O  O     . LYS B  1 242 ? 56.384  -19.758 10.742  1.00   23.04 ? 349 LYS B O     1 
ATOM   5366  C  CB    . LYS B  1 242 ? 57.141  -22.266 12.879  1.00   28.23 ? 349 LYS B CB    1 
ATOM   5367  C  CG    . LYS B  1 242 ? 58.091  -23.404 13.287  1.00   31.57 ? 349 LYS B CG    1 
ATOM   5368  C  CD    . LYS B  1 242 ? 58.024  -23.702 14.779  1.00   36.60 ? 349 LYS B CD    1 
ATOM   5369  C  CE    . LYS B  1 242 ? 58.948  -24.858 15.152  1.00   39.81 ? 349 LYS B CE    1 
ATOM   5370  N  NZ    . LYS B  1 242 ? 58.938  -25.122 16.615  0.0000 38.81 ? 349 LYS B NZ    1 
ATOM   5371  N  N     . GLN B  1 243 ? 54.950  -21.492 10.804  1.00   22.07 ? 350 GLN B N     1 
ATOM   5372  C  CA    . GLN B  1 243 ? 53.823  -20.692 10.348  1.00   20.96 ? 350 GLN B CA    1 
ATOM   5373  C  C     . GLN B  1 243 ? 52.700  -20.622 11.368  1.00   21.60 ? 350 GLN B C     1 
ATOM   5374  O  O     . GLN B  1 243 ? 52.924  -20.861 12.554  1.00   22.73 ? 350 GLN B O     1 
ATOM   5375  C  CB    . GLN B  1 243 ? 53.339  -21.247 9.015   1.00   19.80 ? 350 GLN B CB    1 
ATOM   5376  C  CG    . GLN B  1 243 ? 54.512  -21.451 8.077   1.00   16.18 ? 350 GLN B CG    1 
ATOM   5377  C  CD    . GLN B  1 243 ? 54.108  -21.820 6.687   1.00   16.79 ? 350 GLN B CD    1 
ATOM   5378  O  OE1   . GLN B  1 243 ? 53.186  -22.607 6.485   1.00   21.42 ? 350 GLN B OE1   1 
ATOM   5379  N  NE2   . GLN B  1 243 ? 54.813  -21.273 5.706   1.00   14.36 ? 350 GLN B NE2   1 
ATOM   5380  N  N     . ILE B  1 244 ? 51.494  -20.293 10.920  1.00   20.16 ? 351 ILE B N     1 
ATOM   5381  C  CA    . ILE B  1 244 ? 50.376  -20.159 11.845  1.00   19.58 ? 351 ILE B CA    1 
ATOM   5382  C  C     . ILE B  1 244 ? 49.500  -21.401 11.949  1.00   20.03 ? 351 ILE B C     1 
ATOM   5383  O  O     . ILE B  1 244 ? 49.057  -21.955 10.947  1.00   19.97 ? 351 ILE B O     1 
ATOM   5384  C  CB    . ILE B  1 244 ? 49.509  -18.953 11.469  1.00   18.66 ? 351 ILE B CB    1 
ATOM   5385  C  CG1   . ILE B  1 244 ? 50.385  -17.712 11.356  1.00   19.56 ? 351 ILE B CG1   1 
ATOM   5386  C  CG2   . ILE B  1 244 ? 48.487  -18.699 12.536  1.00   20.01 ? 351 ILE B CG2   1 
ATOM   5387  C  CD1   . ILE B  1 244 ? 51.190  -17.416 12.604  1.00   22.61 ? 351 ILE B CD1   1 
ATOM   5388  N  N     . VAL B  1 245 ? 49.258  -21.826 13.184  1.00   20.87 ? 352 VAL B N     1 
ATOM   5389  C  CA    . VAL B  1 245 ? 48.457  -23.007 13.476  1.00   21.53 ? 352 VAL B CA    1 
ATOM   5390  C  C     . VAL B  1 245 ? 47.032  -22.583 13.800  1.00   20.84 ? 352 VAL B C     1 
ATOM   5391  O  O     . VAL B  1 245 ? 46.809  -21.786 14.706  1.00   22.19 ? 352 VAL B O     1 
ATOM   5392  C  CB    . VAL B  1 245 ? 49.057  -23.771 14.680  1.00   23.79 ? 352 VAL B CB    1 
ATOM   5393  C  CG1   . VAL B  1 245 ? 48.211  -24.974 15.030  1.00   23.73 ? 352 VAL B CG1   1 
ATOM   5394  C  CG2   . VAL B  1 245 ? 50.492  -24.195 14.352  1.00   20.77 ? 352 VAL B CG2   1 
ATOM   5395  N  N     . THR B  1 246 ? 46.064  -23.122 13.067  1.00   20.33 ? 353 THR B N     1 
ATOM   5396  C  CA    . THR B  1 246 ? 44.682  -22.744 13.291  1.00   19.94 ? 353 THR B CA    1 
ATOM   5397  C  C     . THR B  1 246 ? 43.699  -23.762 12.709  1.00   23.57 ? 353 THR B C     1 
ATOM   5398  O  O     . THR B  1 246 ? 44.101  -24.771 12.136  1.00   25.35 ? 353 THR B O     1 
ATOM   5399  C  CB    . THR B  1 246 ? 44.424  -21.331 12.695  1.00   18.02 ? 353 THR B CB    1 
ATOM   5400  O  OG1   . THR B  1 246 ? 43.063  -20.949 12.909  1.00   16.50 ? 353 THR B OG1   1 
ATOM   5401  C  CG2   . THR B  1 246 ? 44.742  -21.303 11.210  1.00   15.93 ? 353 THR B CG2   1 
ATOM   5402  N  N     . THR B  1 247 ? 42.407  -23.492 12.880  1.00   26.41 ? 354 THR B N     1 
ATOM   5403  C  CA    . THR B  1 247 ? 41.338  -24.357 12.391  1.00   28.16 ? 354 THR B CA    1 
ATOM   5404  C  C     . THR B  1 247 ? 41.229  -24.306 10.866  1.00   29.77 ? 354 THR B C     1 
ATOM   5405  O  O     . THR B  1 247 ? 41.308  -23.230 10.267  1.00   32.55 ? 354 THR B O     1 
ATOM   5406  C  CB    . THR B  1 247 ? 39.977  -23.936 12.988  1.00   28.64 ? 354 THR B CB    1 
ATOM   5407  O  OG1   . THR B  1 247 ? 39.704  -22.572 12.649  1.00   32.38 ? 354 THR B OG1   1 
ATOM   5408  C  CG2   . THR B  1 247 ? 39.987  -24.074 14.492  1.00   27.08 ? 354 THR B CG2   1 
ATOM   5409  N  N     . ASP B  1 248 ? 41.039  -25.465 10.241  1.00   29.74 ? 355 ASP B N     1 
ATOM   5410  C  CA    . ASP B  1 248 ? 40.925  -25.520 8.792   1.00   28.91 ? 355 ASP B CA    1 
ATOM   5411  C  C     . ASP B  1 248 ? 39.595  -26.117 8.365   1.00   28.53 ? 355 ASP B C     1 
ATOM   5412  O  O     . ASP B  1 248 ? 38.934  -26.813 9.137   1.00   27.96 ? 355 ASP B O     1 
ATOM   5413  C  CB    . ASP B  1 248 ? 42.071  -26.339 8.197   1.00   28.81 ? 355 ASP B CB    1 
ATOM   5414  C  CG    . ASP B  1 248 ? 42.370  -25.958 6.755   1.00   30.26 ? 355 ASP B CG    1 
ATOM   5415  O  OD1   . ASP B  1 248 ? 41.645  -25.109 6.195   1.00   31.47 ? 355 ASP B OD1   1 
ATOM   5416  O  OD2   . ASP B  1 248 ? 43.331  -26.502 6.178   1.00   29.71 ? 355 ASP B OD2   1 
ATOM   5417  N  N     . LEU B  1 249 ? 39.211  -25.828 7.127   1.00   27.99 ? 356 LEU B N     1 
ATOM   5418  C  CA    . LEU B  1 249 ? 37.963  -26.312 6.563   1.00   27.86 ? 356 LEU B CA    1 
ATOM   5419  C  C     . LEU B  1 249 ? 37.847  -27.831 6.716   1.00   29.96 ? 356 LEU B C     1 
ATOM   5420  O  O     . LEU B  1 249 ? 38.852  -28.551 6.794   1.00   28.50 ? 356 LEU B O     1 
ATOM   5421  C  CB    . LEU B  1 249 ? 37.905  -25.919 5.094   1.00   27.78 ? 356 LEU B CB    1 
ATOM   5422  C  CG    . LEU B  1 249 ? 36.565  -26.012 4.380   1.00   31.38 ? 356 LEU B CG    1 
ATOM   5423  C  CD1   . LEU B  1 249 ? 35.520  -25.171 5.113   1.00   31.08 ? 356 LEU B CD1   1 
ATOM   5424  C  CD2   . LEU B  1 249 ? 36.742  -25.526 2.946   1.00   30.11 ? 356 LEU B CD2   1 
ATOM   5425  N  N     . ARG B  1 250 ? 36.609  -28.309 6.762   1.00   29.91 ? 357 ARG B N     1 
ATOM   5426  C  CA    . ARG B  1 250 ? 36.329  -29.734 6.902   1.00   28.78 ? 357 ARG B CA    1 
ATOM   5427  C  C     . ARG B  1 250 ? 36.772  -30.275 8.248   1.00   29.48 ? 357 ARG B C     1 
ATOM   5428  O  O     . ARG B  1 250 ? 37.230  -31.411 8.358   1.00   28.46 ? 357 ARG B O     1 
ATOM   5429  C  CB    . ARG B  1 250 ? 36.979  -30.521 5.766   1.00   27.09 ? 357 ARG B CB    1 
ATOM   5430  C  CG    . ARG B  1 250 ? 36.441  -30.146 4.388   1.00   25.81 ? 357 ARG B CG    1 
ATOM   5431  C  CD    . ARG B  1 250 ? 37.176  -30.885 3.281   1.00   28.17 ? 357 ARG B CD    1 
ATOM   5432  N  NE    . ARG B  1 250 ? 36.826  -30.400 1.941   1.00   32.59 ? 357 ARG B NE    1 
ATOM   5433  C  CZ    . ARG B  1 250 ? 35.625  -30.526 1.372   1.00   31.76 ? 357 ARG B CZ    1 
ATOM   5434  N  NH1   . ARG B  1 250 ? 35.416  -30.050 0.151   1.00   31.21 ? 357 ARG B NH1   1 
ATOM   5435  N  NH2   . ARG B  1 250 ? 34.631  -31.126 2.019   1.00   30.02 ? 357 ARG B NH2   1 
ATOM   5436  N  N     . GLN B  1 251 ? 36.624  -29.434 9.268   1.00   30.30 ? 358 GLN B N     1 
ATOM   5437  C  CA    . GLN B  1 251 ? 36.950  -29.774 10.647  1.00   32.60 ? 358 GLN B CA    1 
ATOM   5438  C  C     . GLN B  1 251 ? 38.366  -30.267 10.873  1.00   33.14 ? 358 GLN B C     1 
ATOM   5439  O  O     . GLN B  1 251 ? 38.613  -31.087 11.753  1.00   33.38 ? 358 GLN B O     1 
ATOM   5440  C  CB    . GLN B  1 251 ? 35.946  -30.802 11.153  1.00   30.69 ? 358 GLN B CB    1 
ATOM   5441  C  CG    . GLN B  1 251 ? 34.536  -30.327 10.950  1.00   35.15 ? 358 GLN B CG    1 
ATOM   5442  C  CD    . GLN B  1 251 ? 33.510  -31.386 11.215  1.00   36.42 ? 358 GLN B CD    1 
ATOM   5443  O  OE1   . GLN B  1 251 ? 33.256  -31.752 12.365  1.00   38.10 ? 358 GLN B OE1   1 
ATOM   5444  N  NE2   . GLN B  1 251 ? 32.907  -31.897 10.144  1.00   38.76 ? 358 GLN B NE2   1 
ATOM   5445  N  N     . LYS B  1 252 ? 39.299  -29.747 10.087  1.00   34.35 ? 359 LYS B N     1 
ATOM   5446  C  CA    . LYS B  1 252 ? 40.688  -30.135 10.220  1.00   34.64 ? 359 LYS B CA    1 
ATOM   5447  C  C     . LYS B  1 252 ? 41.489  -29.068 10.959  1.00   34.03 ? 359 LYS B C     1 
ATOM   5448  O  O     . LYS B  1 252 ? 40.943  -28.041 11.376  1.00   30.54 ? 359 LYS B O     1 
ATOM   5449  C  CB    . LYS B  1 252 ? 41.277  -30.410 8.840   1.00   36.25 ? 359 LYS B CB    1 
ATOM   5450  C  CG    . LYS B  1 252 ? 40.588  -31.568 8.138   1.00   38.78 ? 359 LYS B CG    1 
ATOM   5451  C  CD    . LYS B  1 252 ? 41.129  -31.774 6.732   1.00   44.99 ? 359 LYS B CD    1 
ATOM   5452  C  CE    . LYS B  1 252 ? 40.376  -32.896 6.019   1.00   47.82 ? 359 LYS B CE    1 
ATOM   5453  N  NZ    . LYS B  1 252 ? 40.765  -33.003 4.580   1.00   49.78 ? 359 LYS B NZ    1 
ATOM   5454  N  N     . CYS B  1 253 ? 42.780  -29.330 11.127  1.00   33.75 ? 360 CYS B N     1 
ATOM   5455  C  CA    . CYS B  1 253 ? 43.681  -28.432 11.833  1.00   34.46 ? 360 CYS B CA    1 
ATOM   5456  C  C     . CYS B  1 253 ? 44.869  -28.200 10.918  1.00   34.23 ? 360 CYS B C     1 
ATOM   5457  O  O     . CYS B  1 253 ? 45.476  -29.154 10.435  1.00   39.04 ? 360 CYS B O     1 
ATOM   5458  C  CB    . CYS B  1 253 ? 44.121  -29.108 13.139  1.00   34.79 ? 360 CYS B CB    1 
ATOM   5459  S  SG    . CYS B  1 253 ? 45.256  -28.226 14.271  1.00   42.12 ? 360 CYS B SG    1 
ATOM   5460  N  N     . THR B  1 254 ? 45.199  -26.944 10.658  1.00   31.89 ? 361 THR B N     1 
ATOM   5461  C  CA    . THR B  1 254 ? 46.324  -26.654 9.780   1.00   31.47 ? 361 THR B CA    1 
ATOM   5462  C  C     . THR B  1 254 ? 47.460  -25.969 10.521  1.00   31.61 ? 361 THR B C     1 
ATOM   5463  O  O     . THR B  1 254 ? 47.244  -25.219 11.471  1.00   30.77 ? 361 THR B O     1 
ATOM   5464  C  CB    . THR B  1 254 ? 45.906  -25.764 8.595   1.00   30.22 ? 361 THR B CB    1 
ATOM   5465  O  OG1   . THR B  1 254 ? 47.050  -25.476 7.787   1.00   32.47 ? 361 THR B OG1   1 
ATOM   5466  C  CG2   . THR B  1 254 ? 45.322  -24.457 9.094   1.00   31.01 ? 361 THR B CG2   1 
ATOM   5467  N  N     . GLU B  1 255 ? 48.677  -26.237 10.073  1.00   31.97 ? 362 GLU B N     1 
ATOM   5468  C  CA    . GLU B  1 255 ? 49.854  -25.643 10.676  1.00   33.71 ? 362 GLU B CA    1 
ATOM   5469  C  C     . GLU B  1 255 ? 50.497  -24.750 9.644   1.00   31.95 ? 362 GLU B C     1 
ATOM   5470  O  O     . GLU B  1 255 ? 51.620  -24.276 9.836   1.00   32.58 ? 362 GLU B O     1 
ATOM   5471  C  CB    . GLU B  1 255 ? 50.848  -26.721 11.100  1.00   35.48 ? 362 GLU B CB    1 
ATOM   5472  C  CG    . GLU B  1 255 ? 50.366  -27.579 12.235  1.00   42.76 ? 362 GLU B CG    1 
ATOM   5473  C  CD    . GLU B  1 255 ? 51.427  -28.555 12.706  1.00   45.76 ? 362 GLU B CD    1 
ATOM   5474  O  OE1   . GLU B  1 255 ? 52.601  -28.134 12.842  1.00   46.66 ? 362 GLU B OE1   1 
ATOM   5475  O  OE2   . GLU B  1 255 ? 51.084  -29.737 12.949  1.00   46.18 ? 362 GLU B OE2   1 
ATOM   5476  N  N     . SER B  1 256 ? 49.783  -24.512 8.549   1.00   28.84 ? 363 SER B N     1 
ATOM   5477  C  CA    . SER B  1 256 ? 50.337  -23.683 7.497   1.00   29.00 ? 363 SER B CA    1 
ATOM   5478  C  C     . SER B  1 256 ? 49.454  -22.547 6.977   1.00   28.17 ? 363 SER B C     1 
ATOM   5479  O  O     . SER B  1 256 ? 49.230  -22.422 5.772   1.00   27.10 ? 363 SER B O     1 
ATOM   5480  C  CB    . SER B  1 256 ? 50.783  -24.569 6.332   1.00   30.90 ? 363 SER B CB    1 
ATOM   5481  O  OG    . SER B  1 256 ? 49.685  -25.286 5.802   1.00   32.82 ? 363 SER B OG    1 
ATOM   5482  N  N     . HIS B  1 257 ? 48.933  -21.735 7.892   1.00   28.01 ? 364 HIS B N     1 
ATOM   5483  C  CA    . HIS B  1 257 ? 48.142  -20.571 7.506   1.00   25.39 ? 364 HIS B CA    1 
ATOM   5484  C  C     . HIS B  1 257 ? 49.233  -19.509 7.303   1.00   23.17 ? 364 HIS B C     1 
ATOM   5485  O  O     . HIS B  1 257 ? 50.070  -19.304 8.185   1.00   21.37 ? 364 HIS B O     1 
ATOM   5486  C  CB    . HIS B  1 257 ? 47.188  -20.176 8.636   1.00   25.35 ? 364 HIS B CB    1 
ATOM   5487  C  CG    . HIS B  1 257 ? 46.285  -19.031 8.293   1.00   24.85 ? 364 HIS B CG    1 
ATOM   5488  N  ND1   . HIS B  1 257 ? 46.008  -18.662 6.997   1.00   25.76 ? 364 HIS B ND1   1 
ATOM   5489  C  CD2   . HIS B  1 257 ? 45.566  -18.198 9.082   1.00   25.86 ? 364 HIS B CD2   1 
ATOM   5490  C  CE1   . HIS B  1 257 ? 45.158  -17.649 6.998   1.00   25.16 ? 364 HIS B CE1   1 
ATOM   5491  N  NE2   . HIS B  1 257 ? 44.874  -17.350 8.251   1.00   25.28 ? 364 HIS B NE2   1 
ATOM   5492  N  N     . THR B  1 258 ? 49.235  -18.840 6.156   1.00   19.62 ? 365 THR B N     1 
ATOM   5493  C  CA    . THR B  1 258 ? 50.302  -17.881 5.873   1.00   18.59 ? 365 THR B CA    1 
ATOM   5494  C  C     . THR B  1 258 ? 49.915  -16.489 5.391   1.00   19.31 ? 365 THR B C     1 
ATOM   5495  O  O     . THR B  1 258 ? 48.739  -16.150 5.258   1.00   22.97 ? 365 THR B O     1 
ATOM   5496  C  CB    . THR B  1 258 ? 51.246  -18.466 4.814   1.00   17.51 ? 365 THR B CB    1 
ATOM   5497  O  OG1   . THR B  1 258 ? 50.554  -18.553 3.559   1.00   14.68 ? 365 THR B OG1   1 
ATOM   5498  C  CG2   . THR B  1 258 ? 51.710  -19.864 5.232   1.00   13.81 ? 365 THR B CG2   1 
ATOM   5499  N  N     . GLY B  1 259 ? 50.940  -15.685 5.139   1.00   18.50 ? 366 GLY B N     1 
ATOM   5500  C  CA    . GLY B  1 259 ? 50.744  -14.347 4.626   1.00   19.39 ? 366 GLY B CA    1 
ATOM   5501  C  C     . GLY B  1 259 ? 50.096  -13.325 5.528   1.00   23.23 ? 366 GLY B C     1 
ATOM   5502  O  O     . GLY B  1 259 ? 49.810  -13.582 6.700   1.00   21.52 ? 366 GLY B O     1 
ATOM   5503  N  N     . THR B  1 260 ? 49.868  -12.145 4.955   1.00   25.07 ? 367 THR B N     1 
ATOM   5504  C  CA    . THR B  1 260 ? 49.257  -11.034 5.664   1.00   24.72 ? 367 THR B CA    1 
ATOM   5505  C  C     . THR B  1 260 ? 47.926  -11.451 6.295   1.00   23.87 ? 367 THR B C     1 
ATOM   5506  O  O     . THR B  1 260 ? 47.524  -10.896 7.317   1.00   25.65 ? 367 THR B O     1 
ATOM   5507  C  CB    . THR B  1 260 ? 49.039  -9.823  4.702   1.00   25.53 ? 367 THR B CB    1 
ATOM   5508  O  OG1   . THR B  1 260 ? 48.564  -8.689  5.443   1.00   24.40 ? 367 THR B OG1   1 
ATOM   5509  C  CG2   . THR B  1 260 ? 48.031  -10.168 3.622   1.00   23.66 ? 367 THR B CG2   1 
ATOM   5510  N  N     . SER B  1 261 ? 47.259  -12.438 5.698   1.00   21.85 ? 368 SER B N     1 
ATOM   5511  C  CA    . SER B  1 261 ? 45.968  -12.917 6.200   1.00   22.21 ? 368 SER B CA    1 
ATOM   5512  C  C     . SER B  1 261 ? 45.993  -13.380 7.654   1.00   22.25 ? 368 SER B C     1 
ATOM   5513  O  O     . SER B  1 261 ? 45.015  -13.229 8.385   1.00   22.34 ? 368 SER B O     1 
ATOM   5514  C  CB    . SER B  1 261 ? 45.451  -14.079 5.351   1.00   19.86 ? 368 SER B CB    1 
ATOM   5515  O  OG    . SER B  1 261 ? 45.278  -13.717 3.998   1.00   22.24 ? 368 SER B OG    1 
ATOM   5516  N  N     . ALA B  1 262 ? 47.108  -13.962 8.072   1.00   21.12 ? 369 ALA B N     1 
ATOM   5517  C  CA    . ALA B  1 262 ? 47.223  -14.464 9.436   1.00   19.99 ? 369 ALA B CA    1 
ATOM   5518  C  C     . ALA B  1 262 ? 47.549  -13.398 10.476  1.00   20.24 ? 369 ALA B C     1 
ATOM   5519  O  O     . ALA B  1 262 ? 47.320  -13.610 11.662  1.00   22.14 ? 369 ALA B O     1 
ATOM   5520  C  CB    . ALA B  1 262 ? 48.268  -15.572 9.488   1.00   17.73 ? 369 ALA B CB    1 
ATOM   5521  N  N     . SER B  1 263 ? 48.073  -12.253 10.050  1.00   17.93 ? 370 SER B N     1 
ATOM   5522  C  CA    . SER B  1 263 ? 48.424  -11.214 11.011  1.00   17.73 ? 370 SER B CA    1 
ATOM   5523  C  C     . SER B  1 263 ? 47.248  -10.439 11.597  1.00   18.31 ? 370 SER B C     1 
ATOM   5524  O  O     . SER B  1 263 ? 47.157  -10.250 12.810  1.00   17.80 ? 370 SER B O     1 
ATOM   5525  C  CB    . SER B  1 263 ? 49.428  -10.241 10.396  1.00   17.42 ? 370 SER B CB    1 
ATOM   5526  O  OG    . SER B  1 263 ? 50.718  -10.820 10.365  1.00   14.63 ? 370 SER B OG    1 
ATOM   5527  N  N     . ALA B  1 264 ? 46.341  -9.990  10.747  1.00   19.03 ? 371 ALA B N     1 
ATOM   5528  C  CA    . ALA B  1 264 ? 45.197  -9.235  11.239  1.00   20.75 ? 371 ALA B CA    1 
ATOM   5529  C  C     . ALA B  1 264 ? 44.403  -9.959  12.336  1.00   19.92 ? 371 ALA B C     1 
ATOM   5530  O  O     . ALA B  1 264 ? 44.102  -9.366  13.370  1.00   17.18 ? 371 ALA B O     1 
ATOM   5531  C  CB    . ALA B  1 264 ? 44.269  -8.865  10.075  1.00   22.33 ? 371 ALA B CB    1 
ATOM   5532  N  N     . PRO B  1 265 ? 44.061  -11.245 12.124  1.00   19.57 ? 372 PRO B N     1 
ATOM   5533  C  CA    . PRO B  1 265 ? 43.295  -12.000 13.125  1.00   19.59 ? 372 PRO B CA    1 
ATOM   5534  C  C     . PRO B  1 265 ? 43.950  -12.037 14.503  1.00   19.99 ? 372 PRO B C     1 
ATOM   5535  O  O     . PRO B  1 265 ? 43.262  -11.982 15.516  1.00   19.77 ? 372 PRO B O     1 
ATOM   5536  C  CB    . PRO B  1 265 ? 43.170  -13.386 12.495  1.00   19.94 ? 372 PRO B CB    1 
ATOM   5537  C  CG    . PRO B  1 265 ? 43.210  -13.094 11.021  1.00   21.15 ? 372 PRO B CG    1 
ATOM   5538  C  CD    . PRO B  1 265 ? 44.329  -12.079 10.941  1.00   19.65 ? 372 PRO B CD    1 
ATOM   5539  N  N     . LEU B  1 266 ? 45.277  -12.132 14.543  1.00   19.11 ? 373 LEU B N     1 
ATOM   5540  C  CA    . LEU B  1 266 ? 45.987  -12.150 15.818  1.00   16.69 ? 373 LEU B CA    1 
ATOM   5541  C  C     . LEU B  1 266 ? 45.827  -10.779 16.476  1.00   17.87 ? 373 LEU B C     1 
ATOM   5542  O  O     . LEU B  1 266 ? 45.595  -10.678 17.675  1.00   19.00 ? 373 LEU B O     1 
ATOM   5543  C  CB    . LEU B  1 266 ? 47.467  -12.485 15.596  1.00   13.54 ? 373 LEU B CB    1 
ATOM   5544  C  CG    . LEU B  1 266 ? 47.692  -13.899 15.038  1.00   13.68 ? 373 LEU B CG    1 
ATOM   5545  C  CD1   . LEU B  1 266 ? 49.100  -14.019 14.485  1.00   13.96 ? 373 LEU B CD1   1 
ATOM   5546  C  CD2   . LEU B  1 266 ? 47.439  -14.945 16.123  1.00   11.19 ? 373 LEU B CD2   1 
ATOM   5547  N  N     . ALA B  1 267 ? 45.937  -9.719  15.685  1.00   17.60 ? 374 ALA B N     1 
ATOM   5548  C  CA    . ALA B  1 267 ? 45.770  -8.379  16.219  1.00   18.10 ? 374 ALA B CA    1 
ATOM   5549  C  C     . ALA B  1 267 ? 44.342  -8.239  16.764  1.00   20.05 ? 374 ALA B C     1 
ATOM   5550  O  O     . ALA B  1 267 ? 44.124  -7.668  17.835  1.00   20.65 ? 374 ALA B O     1 
ATOM   5551  C  CB    . ALA B  1 267 ? 46.025  -7.354  15.131  1.00   18.33 ? 374 ALA B CB    1 
ATOM   5552  N  N     . ALA B  1 268 ? 43.369  -8.762  16.023  1.00   19.82 ? 375 ALA B N     1 
ATOM   5553  C  CA    . ALA B  1 268 ? 41.977  -8.700  16.450  1.00   19.91 ? 375 ALA B CA    1 
ATOM   5554  C  C     . ALA B  1 268 ? 41.815  -9.419  17.794  1.00   21.08 ? 375 ALA B C     1 
ATOM   5555  O  O     . ALA B  1 268 ? 41.102  -8.939  18.679  1.00   21.67 ? 375 ALA B O     1 
ATOM   5556  C  CB    . ALA B  1 268 ? 41.079  -9.335  15.408  1.00   16.23 ? 375 ALA B CB    1 
ATOM   5557  N  N     . GLY B  1 269 ? 42.484  -10.561 17.943  1.00   19.51 ? 376 GLY B N     1 
ATOM   5558  C  CA    . GLY B  1 269 ? 42.407  -11.313 19.184  1.00   18.92 ? 376 GLY B CA    1 
ATOM   5559  C  C     . GLY B  1 269 ? 43.005  -10.554 20.353  1.00   19.58 ? 376 GLY B C     1 
ATOM   5560  O  O     . GLY B  1 269 ? 42.433  -10.512 21.446  1.00   19.06 ? 376 GLY B O     1 
ATOM   5561  N  N     . ILE B  1 270 ? 44.162  -9.941  20.127  1.00   18.89 ? 377 ILE B N     1 
ATOM   5562  C  CA    . ILE B  1 270 ? 44.820  -9.180  21.178  1.00   18.60 ? 377 ILE B CA    1 
ATOM   5563  C  C     . ILE B  1 270 ? 43.971  -7.971  21.562  1.00   21.53 ? 377 ILE B C     1 
ATOM   5564  O  O     . ILE B  1 270 ? 43.868  -7.622  22.737  1.00   23.83 ? 377 ILE B O     1 
ATOM   5565  C  CB    . ILE B  1 270 ? 46.209  -8.705  20.731  1.00   16.60 ? 377 ILE B CB    1 
ATOM   5566  C  CG1   . ILE B  1 270 ? 47.116  -9.913  20.504  1.00   14.22 ? 377 ILE B CG1   1 
ATOM   5567  C  CG2   . ILE B  1 270 ? 46.800  -7.773  21.774  1.00   16.32 ? 377 ILE B CG2   1 
ATOM   5568  C  CD1   . ILE B  1 270 ? 48.535  -9.552  20.157  1.00   11.14 ? 377 ILE B CD1   1 
ATOM   5569  N  N     . ILE B  1 271 ? 43.359  -7.334  20.568  1.00   23.23 ? 378 ILE B N     1 
ATOM   5570  C  CA    . ILE B  1 271 ? 42.515  -6.174  20.822  1.00   23.49 ? 378 ILE B CA    1 
ATOM   5571  C  C     . ILE B  1 271 ? 41.282  -6.618  21.613  1.00   24.20 ? 378 ILE B C     1 
ATOM   5572  O  O     . ILE B  1 271 ? 40.728  -5.851  22.402  1.00   24.92 ? 378 ILE B O     1 
ATOM   5573  C  CB    . ILE B  1 271 ? 42.107  -5.492  19.487  1.00   24.38 ? 378 ILE B CB    1 
ATOM   5574  C  CG1   . ILE B  1 271 ? 43.360  -4.901  18.830  1.00   24.81 ? 378 ILE B CG1   1 
ATOM   5575  C  CG2   . ILE B  1 271 ? 41.059  -4.407  19.728  1.00   22.87 ? 378 ILE B CG2   1 
ATOM   5576  C  CD1   . ILE B  1 271 ? 43.129  -4.196  17.507  1.00   23.45 ? 378 ILE B CD1   1 
ATOM   5577  N  N     . ALA B  1 272 ? 40.867  -7.867  21.413  1.00   23.66 ? 379 ALA B N     1 
ATOM   5578  C  CA    . ALA B  1 272 ? 39.708  -8.405  22.122  1.00   22.74 ? 379 ALA B CA    1 
ATOM   5579  C  C     . ALA B  1 272 ? 40.058  -8.532  23.601  1.00   22.74 ? 379 ALA B C     1 
ATOM   5580  O  O     . ALA B  1 272 ? 39.238  -8.238  24.468  1.00   23.29 ? 379 ALA B O     1 
ATOM   5581  C  CB    . ALA B  1 272 ? 39.320  -9.759  21.551  1.00   22.20 ? 379 ALA B CB    1 
ATOM   5582  N  N     . LEU B  1 273 ? 41.282  -8.963  23.887  1.00   21.20 ? 380 LEU B N     1 
ATOM   5583  C  CA    . LEU B  1 273 ? 41.718  -9.097  25.272  1.00   20.37 ? 380 LEU B CA    1 
ATOM   5584  C  C     . LEU B  1 273 ? 41.771  -7.714  25.900  1.00   21.57 ? 380 LEU B C     1 
ATOM   5585  O  O     . LEU B  1 273 ? 41.417  -7.536  27.061  1.00   24.91 ? 380 LEU B O     1 
ATOM   5586  C  CB    . LEU B  1 273 ? 43.099  -9.742  25.353  1.00   14.48 ? 380 LEU B CB    1 
ATOM   5587  C  CG    . LEU B  1 273 ? 43.227  -11.134 24.736  1.00   17.01 ? 380 LEU B CG    1 
ATOM   5588  C  CD1   . LEU B  1 273 ? 44.631  -11.683 24.973  1.00   18.74 ? 380 LEU B CD1   1 
ATOM   5589  C  CD2   . LEU B  1 273 ? 42.191  -12.055 25.348  1.00   15.69 ? 380 LEU B CD2   1 
ATOM   5590  N  N     . THR B  1 274 ? 42.205  -6.729  25.125  1.00   22.11 ? 381 THR B N     1 
ATOM   5591  C  CA    . THR B  1 274 ? 42.296  -5.370  25.633  1.00   21.16 ? 381 THR B CA    1 
ATOM   5592  C  C     . THR B  1 274 ? 40.916  -4.791  25.954  1.00   22.44 ? 381 THR B C     1 
ATOM   5593  O  O     . THR B  1 274 ? 40.754  -4.067  26.940  1.00   21.98 ? 381 THR B O     1 
ATOM   5594  C  CB    . THR B  1 274 ? 43.014  -4.479  24.629  1.00   19.54 ? 381 THR B CB    1 
ATOM   5595  O  OG1   . THR B  1 274 ? 44.292  -5.059  24.335  1.00   21.23 ? 381 THR B OG1   1 
ATOM   5596  C  CG2   . THR B  1 274 ? 43.201  -3.070  25.199  1.00   18.73 ? 381 THR B CG2   1 
ATOM   5597  N  N     . LEU B  1 275 ? 39.915  -5.106  25.135  1.00   22.83 ? 382 LEU B N     1 
ATOM   5598  C  CA    . LEU B  1 275 ? 38.569  -4.604  25.397  1.00   23.02 ? 382 LEU B CA    1 
ATOM   5599  C  C     . LEU B  1 275 ? 38.011  -5.213  26.665  1.00   24.17 ? 382 LEU B C     1 
ATOM   5600  O  O     . LEU B  1 275 ? 37.268  -4.558  27.394  1.00   25.95 ? 382 LEU B O     1 
ATOM   5601  C  CB    . LEU B  1 275 ? 37.619  -4.904  24.239  1.00   22.65 ? 382 LEU B CB    1 
ATOM   5602  C  CG    . LEU B  1 275 ? 37.575  -3.872  23.117  1.00   22.40 ? 382 LEU B CG    1 
ATOM   5603  C  CD1   . LEU B  1 275 ? 36.389  -4.165  22.215  1.00   22.54 ? 382 LEU B CD1   1 
ATOM   5604  C  CD2   . LEU B  1 275 ? 37.445  -2.481  23.710  1.00   23.25 ? 382 LEU B CD2   1 
ATOM   5605  N  N     . GLU B  1 276 ? 38.352  -6.471  26.930  1.00   23.54 ? 383 GLU B N     1 
ATOM   5606  C  CA    . GLU B  1 276 ? 37.869  -7.096  28.147  1.00   24.27 ? 383 GLU B CA    1 
ATOM   5607  C  C     . GLU B  1 276 ? 38.497  -6.365  29.334  1.00   24.88 ? 383 GLU B C     1 
ATOM   5608  O  O     . GLU B  1 276 ? 37.836  -6.120  30.341  1.00   26.44 ? 383 GLU B O     1 
ATOM   5609  C  CB    . GLU B  1 276 ? 38.233  -8.578  28.185  1.00   24.70 ? 383 GLU B CB    1 
ATOM   5610  C  CG    . GLU B  1 276 ? 37.941  -9.230  29.522  1.00   28.09 ? 383 GLU B CG    1 
ATOM   5611  C  CD    . GLU B  1 276 ? 38.093  -10.742 29.487  1.00   31.01 ? 383 GLU B CD    1 
ATOM   5612  O  OE1   . GLU B  1 276 ? 39.066  -11.239 28.879  1.00   31.42 ? 383 GLU B OE1   1 
ATOM   5613  O  OE2   . GLU B  1 276 ? 37.243  -11.432 30.081  1.00   32.02 ? 383 GLU B OE2   1 
ATOM   5614  N  N     . ALA B  1 277 ? 39.768  -5.998  29.203  1.00   23.85 ? 384 ALA B N     1 
ATOM   5615  C  CA    . ALA B  1 277 ? 40.476  -5.296  30.263  1.00   23.21 ? 384 ALA B CA    1 
ATOM   5616  C  C     . ALA B  1 277 ? 39.890  -3.905  30.495  1.00   24.17 ? 384 ALA B C     1 
ATOM   5617  O  O     . ALA B  1 277 ? 40.050  -3.328  31.569  1.00   27.16 ? 384 ALA B O     1 
ATOM   5618  C  CB    . ALA B  1 277 ? 41.962  -5.197  29.928  1.00   20.23 ? 384 ALA B CB    1 
ATOM   5619  N  N     . ASN B  1 278 ? 39.217  -3.360  29.489  1.00   23.48 ? 385 ASN B N     1 
ATOM   5620  C  CA    . ASN B  1 278 ? 38.606  -2.035  29.607  1.00   23.71 ? 385 ASN B CA    1 
ATOM   5621  C  C     . ASN B  1 278 ? 37.589  -1.847  28.490  1.00   25.40 ? 385 ASN B C     1 
ATOM   5622  O  O     . ASN B  1 278 ? 37.934  -1.417  27.388  1.00   24.94 ? 385 ASN B O     1 
ATOM   5623  C  CB    . ASN B  1 278 ? 39.666  -0.935  29.521  1.00   23.04 ? 385 ASN B CB    1 
ATOM   5624  C  CG    . ASN B  1 278 ? 39.085  0.450   29.756  1.00   21.66 ? 385 ASN B CG    1 
ATOM   5625  O  OD1   . ASN B  1 278 ? 37.867  0.644   29.729  1.00   18.51 ? 385 ASN B OD1   1 
ATOM   5626  N  ND2   . ASN B  1 278 ? 39.958  1.420   29.979  1.00   18.77 ? 385 ASN B ND2   1 
ATOM   5627  N  N     . LYS B  1 279 ? 36.332  -2.161  28.787  1.00   27.03 ? 386 LYS B N     1 
ATOM   5628  C  CA    . LYS B  1 279 ? 35.270  -2.068  27.800  1.00   28.51 ? 386 LYS B CA    1 
ATOM   5629  C  C     . LYS B  1 279 ? 34.904  -0.656  27.378  1.00   29.39 ? 386 LYS B C     1 
ATOM   5630  O  O     . LYS B  1 279 ? 34.167  -0.477  26.409  1.00   29.53 ? 386 LYS B O     1 
ATOM   5631  C  CB    . LYS B  1 279 ? 34.022  -2.779  28.321  1.00   29.66 ? 386 LYS B CB    1 
ATOM   5632  C  CG    . LYS B  1 279 ? 34.198  -4.279  28.531  1.00   34.59 ? 386 LYS B CG    1 
ATOM   5633  C  CD    . LYS B  1 279 ? 32.856  -4.970  28.756  1.00   36.46 ? 386 LYS B CD    1 
ATOM   5634  C  CE    . LYS B  1 279 ? 33.035  -6.460  29.029  1.00   39.32 ? 386 LYS B CE    1 
ATOM   5635  N  NZ    . LYS B  1 279 ? 33.669  -7.168  27.886  0.0000 38.02 ? 386 LYS B NZ    1 
ATOM   5636  N  N     . ASN B  1 280 ? 35.419  0.343   28.091  1.00   30.49 ? 387 ASN B N     1 
ATOM   5637  C  CA    . ASN B  1 280 ? 35.099  1.740   27.791  1.00   31.94 ? 387 ASN B CA    1 
ATOM   5638  C  C     . ASN B  1 280 ? 36.089  2.443   26.853  1.00   31.14 ? 387 ASN B C     1 
ATOM   5639  O  O     . ASN B  1 280 ? 36.039  3.669   26.691  1.00   30.70 ? 387 ASN B O     1 
ATOM   5640  C  CB    . ASN B  1 280 ? 34.966  2.533   29.102  1.00   33.98 ? 387 ASN B CB    1 
ATOM   5641  C  CG    . ASN B  1 280 ? 33.775  2.081   29.950  1.00   38.82 ? 387 ASN B CG    1 
ATOM   5642  O  OD1   . ASN B  1 280 ? 33.750  2.272   31.175  1.00   41.62 ? 387 ASN B OD1   1 
ATOM   5643  N  ND2   . ASN B  1 280 ? 32.775  1.492   29.296  1.00   41.20 ? 387 ASN B ND2   1 
ATOM   5644  N  N     . LEU B  1 281 ? 36.979  1.666   26.238  1.00   27.79 ? 388 LEU B N     1 
ATOM   5645  C  CA    . LEU B  1 281 ? 37.962  2.212   25.308  1.00   24.18 ? 388 LEU B CA    1 
ATOM   5646  C  C     . LEU B  1 281 ? 37.285  2.604   23.994  1.00   24.91 ? 388 LEU B C     1 
ATOM   5647  O  O     . LEU B  1 281 ? 36.445  1.871   23.477  1.00   24.76 ? 388 LEU B O     1 
ATOM   5648  C  CB    . LEU B  1 281 ? 39.059  1.178   25.023  1.00   20.70 ? 388 LEU B CB    1 
ATOM   5649  C  CG    . LEU B  1 281 ? 39.938  0.753   26.206  1.00   16.77 ? 388 LEU B CG    1 
ATOM   5650  C  CD1   . LEU B  1 281 ? 40.779  -0.439  25.792  1.00   15.28 ? 388 LEU B CD1   1 
ATOM   5651  C  CD2   . LEU B  1 281 ? 40.810  1.903   26.660  1.00   14.35 ? 388 LEU B CD2   1 
ATOM   5652  N  N     . THR B  1 282 ? 37.646  3.765   23.458  1.00   26.36 ? 389 THR B N     1 
ATOM   5653  C  CA    . THR B  1 282 ? 37.074  4.230   22.199  1.00   23.77 ? 389 THR B CA    1 
ATOM   5654  C  C     . THR B  1 282 ? 37.928  3.682   21.065  1.00   23.76 ? 389 THR B C     1 
ATOM   5655  O  O     . THR B  1 282 ? 39.002  3.128   21.315  1.00   23.10 ? 389 THR B O     1 
ATOM   5656  C  CB    . THR B  1 282 ? 37.078  5.764   22.117  1.00   24.17 ? 389 THR B CB    1 
ATOM   5657  O  OG1   . THR B  1 282 ? 38.431  6.241   22.039  1.00   22.60 ? 389 THR B OG1   1 
ATOM   5658  C  CG2   . THR B  1 282 ? 36.408  6.355   23.350  1.00   21.32 ? 389 THR B CG2   1 
ATOM   5659  N  N     . TRP B  1 283 ? 37.459  3.833   19.826  1.00   22.01 ? 390 TRP B N     1 
ATOM   5660  C  CA    . TRP B  1 283 ? 38.217  3.346   18.682  1.00   18.60 ? 390 TRP B CA    1 
ATOM   5661  C  C     . TRP B  1 283 ? 39.570  4.064   18.610  1.00   19.22 ? 390 TRP B C     1 
ATOM   5662  O  O     . TRP B  1 283 ? 40.559  3.495   18.141  1.00   21.46 ? 390 TRP B O     1 
ATOM   5663  C  CB    . TRP B  1 283 ? 37.430  3.530   17.375  1.00   16.57 ? 390 TRP B CB    1 
ATOM   5664  C  CG    . TRP B  1 283 ? 37.209  4.948   16.952  1.00   16.74 ? 390 TRP B CG    1 
ATOM   5665  C  CD1   . TRP B  1 283 ? 36.262  5.806   17.421  1.00   16.72 ? 390 TRP B CD1   1 
ATOM   5666  C  CD2   . TRP B  1 283 ? 37.992  5.691   16.005  1.00   18.18 ? 390 TRP B CD2   1 
ATOM   5667  N  NE1   . TRP B  1 283 ? 36.403  7.041   16.830  1.00   17.68 ? 390 TRP B NE1   1 
ATOM   5668  C  CE2   . TRP B  1 283 ? 37.456  7.000   15.958  1.00   16.25 ? 390 TRP B CE2   1 
ATOM   5669  C  CE3   . TRP B  1 283 ? 39.095  5.378   15.196  1.00   17.16 ? 390 TRP B CE3   1 
ATOM   5670  C  CZ2   . TRP B  1 283 ? 37.985  7.997   15.135  1.00   14.84 ? 390 TRP B CZ2   1 
ATOM   5671  C  CZ3   . TRP B  1 283 ? 39.621  6.367   14.377  1.00   18.03 ? 390 TRP B CZ3   1 
ATOM   5672  C  CH2   . TRP B  1 283 ? 39.063  7.665   14.353  1.00   19.22 ? 390 TRP B CH2   1 
ATOM   5673  N  N     . ARG B  1 284 ? 39.624  5.307   19.080  1.00   17.96 ? 391 ARG B N     1 
ATOM   5674  C  CA    . ARG B  1 284 ? 40.889  6.045   19.085  1.00   19.31 ? 391 ARG B CA    1 
ATOM   5675  C  C     . ARG B  1 284 ? 41.755  5.622   20.287  1.00   19.08 ? 391 ARG B C     1 
ATOM   5676  O  O     . ARG B  1 284 ? 42.980  5.532   20.177  1.00   17.39 ? 391 ARG B O     1 
ATOM   5677  C  CB    . ARG B  1 284 ? 40.634  7.557   19.112  1.00   18.40 ? 391 ARG B CB    1 
ATOM   5678  C  CG    . ARG B  1 284 ? 40.280  8.152   17.765  1.00   16.71 ? 391 ARG B CG    1 
ATOM   5679  C  CD    . ARG B  1 284 ? 39.718  9.550   17.915  1.00   18.80 ? 391 ARG B CD    1 
ATOM   5680  N  NE    . ARG B  1 284 ? 40.609  10.435  18.647  1.00   19.41 ? 391 ARG B NE    1 
ATOM   5681  C  CZ    . ARG B  1 284 ? 40.207  11.287  19.589  1.00   17.89 ? 391 ARG B CZ    1 
ATOM   5682  N  NH1   . ARG B  1 284 ? 38.922  11.372  19.916  1.00   17.48 ? 391 ARG B NH1   1 
ATOM   5683  N  NH2   . ARG B  1 284 ? 41.092  12.053  20.217  1.00   16.43 ? 391 ARG B NH2   1 
ATOM   5684  N  N     . ASP B  1 285 ? 41.126  5.366   21.435  1.00   19.82 ? 392 ASP B N     1 
ATOM   5685  C  CA    . ASP B  1 285 ? 41.885  4.932   22.603  1.00   20.21 ? 392 ASP B CA    1 
ATOM   5686  C  C     . ASP B  1 285 ? 42.678  3.689   22.190  1.00   20.71 ? 392 ASP B C     1 
ATOM   5687  O  O     . ASP B  1 285 ? 43.858  3.543   22.495  1.00   19.15 ? 392 ASP B O     1 
ATOM   5688  C  CB    . ASP B  1 285 ? 40.955  4.548   23.766  1.00   20.69 ? 392 ASP B CB    1 
ATOM   5689  C  CG    . ASP B  1 285 ? 40.411  5.750   24.520  1.00   23.64 ? 392 ASP B CG    1 
ATOM   5690  O  OD1   . ASP B  1 285 ? 41.120  6.778   24.594  1.00   26.37 ? 392 ASP B OD1   1 
ATOM   5691  O  OD2   . ASP B  1 285 ? 39.284  5.659   25.065  1.00   21.90 ? 392 ASP B OD2   1 
ATOM   5692  N  N     . MET B  1 286 ? 42.005  2.793   21.479  1.00   21.84 ? 393 MET B N     1 
ATOM   5693  C  CA    . MET B  1 286 ? 42.618  1.550   21.044  1.00   22.22 ? 393 MET B CA    1 
ATOM   5694  C  C     . MET B  1 286 ? 43.870  1.777   20.215  1.00   20.54 ? 393 MET B C     1 
ATOM   5695  O  O     . MET B  1 286 ? 44.877  1.096   20.412  1.00   18.64 ? 393 MET B O     1 
ATOM   5696  C  CB    . MET B  1 286 ? 41.606  0.706   20.262  1.00   20.98 ? 393 MET B CB    1 
ATOM   5697  C  CG    . MET B  1 286 ? 42.046  -0.736  20.033  1.00   21.00 ? 393 MET B CG    1 
ATOM   5698  S  SD    . MET B  1 286 ? 42.453  -1.629  21.575  1.00   23.15 ? 393 MET B SD    1 
ATOM   5699  C  CE    . MET B  1 286 ? 40.860  -1.873  22.301  1.00   19.60 ? 393 MET B CE    1 
ATOM   5700  N  N     . GLN B  1 287 ? 43.822  2.731   19.292  1.00   21.16 ? 394 GLN B N     1 
ATOM   5701  C  CA    . GLN B  1 287 ? 44.998  3.004   18.469  1.00   20.34 ? 394 GLN B CA    1 
ATOM   5702  C  C     . GLN B  1 287 ? 46.123  3.611   19.299  1.00   19.45 ? 394 GLN B C     1 
ATOM   5703  O  O     . GLN B  1 287 ? 47.303  3.357   19.042  1.00   20.98 ? 394 GLN B O     1 
ATOM   5704  C  CB    . GLN B  1 287 ? 44.617  3.892   17.282  1.00   18.55 ? 394 GLN B CB    1 
ATOM   5705  C  CG    . GLN B  1 287 ? 43.766  3.127   16.286  1.00   19.44 ? 394 GLN B CG    1 
ATOM   5706  C  CD    . GLN B  1 287 ? 43.527  3.877   15.005  1.00   20.03 ? 394 GLN B CD    1 
ATOM   5707  O  OE1   . GLN B  1 287 ? 44.425  4.530   14.478  1.00   18.88 ? 394 GLN B OE1   1 
ATOM   5708  N  NE2   . GLN B  1 287 ? 42.308  3.770   14.476  1.00   20.20 ? 394 GLN B NE2   1 
ATOM   5709  N  N     . HIS B  1 288 ? 45.762  4.395   20.310  1.00   19.10 ? 395 HIS B N     1 
ATOM   5710  C  CA    . HIS B  1 288 ? 46.764  4.982   21.201  1.00   18.91 ? 395 HIS B CA    1 
ATOM   5711  C  C     . HIS B  1 288 ? 47.503  3.867   21.938  1.00   19.22 ? 395 HIS B C     1 
ATOM   5712  O  O     . HIS B  1 288 ? 48.732  3.879   22.025  1.00   21.68 ? 395 HIS B O     1 
ATOM   5713  C  CB    . HIS B  1 288 ? 46.102  5.894   22.227  1.00   17.92 ? 395 HIS B CB    1 
ATOM   5714  C  CG    . HIS B  1 288 ? 45.916  7.294   21.750  1.00   21.15 ? 395 HIS B CG    1 
ATOM   5715  N  ND1   . HIS B  1 288 ? 46.958  8.192   21.665  1.00   20.13 ? 395 HIS B ND1   1 
ATOM   5716  C  CD2   . HIS B  1 288 ? 44.818  7.939   21.287  1.00   17.64 ? 395 HIS B CD2   1 
ATOM   5717  C  CE1   . HIS B  1 288 ? 46.510  9.331   21.167  1.00   19.96 ? 395 HIS B CE1   1 
ATOM   5718  N  NE2   . HIS B  1 288 ? 45.215  9.203   20.930  1.00   17.41 ? 395 HIS B NE2   1 
ATOM   5719  N  N     . LEU B  1 289 ? 46.746  2.909   22.469  1.00   17.10 ? 396 LEU B N     1 
ATOM   5720  C  CA    . LEU B  1 289 ? 47.333  1.796   23.196  1.00   17.32 ? 396 LEU B CA    1 
ATOM   5721  C  C     . LEU B  1 289 ? 48.338  1.030   22.331  1.00   19.08 ? 396 LEU B C     1 
ATOM   5722  O  O     . LEU B  1 289 ? 49.403  0.643   22.807  1.00   19.53 ? 396 LEU B O     1 
ATOM   5723  C  CB    . LEU B  1 289 ? 46.238  0.847   23.683  1.00   16.82 ? 396 LEU B CB    1 
ATOM   5724  C  CG    . LEU B  1 289 ? 45.272  1.360   24.751  1.00   17.21 ? 396 LEU B CG    1 
ATOM   5725  C  CD1   . LEU B  1 289 ? 44.275  0.274   25.067  1.00   16.03 ? 396 LEU B CD1   1 
ATOM   5726  C  CD2   . LEU B  1 289 ? 46.032  1.760   26.004  1.00   17.09 ? 396 LEU B CD2   1 
ATOM   5727  N  N     . VAL B  1 290 ? 47.999  0.814   21.062  1.00   17.80 ? 397 VAL B N     1 
ATOM   5728  C  CA    . VAL B  1 290 ? 48.889  0.099   20.159  1.00   16.52 ? 397 VAL B CA    1 
ATOM   5729  C  C     . VAL B  1 290 ? 50.180  0.873   19.909  1.00   16.53 ? 397 VAL B C     1 
ATOM   5730  O  O     . VAL B  1 290 ? 51.268  0.302   19.906  1.00   16.18 ? 397 VAL B O     1 
ATOM   5731  C  CB    . VAL B  1 290 ? 48.201  -0.192  18.796  1.00   14.78 ? 397 VAL B CB    1 
ATOM   5732  C  CG1   . VAL B  1 290 ? 49.246  -0.572  17.752  1.00   10.08 ? 397 VAL B CG1   1 
ATOM   5733  C  CG2   . VAL B  1 290 ? 47.166  -1.320  18.964  1.00   10.56 ? 397 VAL B CG2   1 
ATOM   5734  N  N     . VAL B  1 291 ? 50.057  2.177   19.704  1.00   16.86 ? 398 VAL B N     1 
ATOM   5735  C  CA    . VAL B  1 291 ? 51.224  3.004   19.450  1.00   17.93 ? 398 VAL B CA    1 
ATOM   5736  C  C     . VAL B  1 291 ? 52.178  2.982   20.632  1.00   21.20 ? 398 VAL B C     1 
ATOM   5737  O  O     . VAL B  1 291 ? 53.395  2.854   20.465  1.00   23.62 ? 398 VAL B O     1 
ATOM   5738  C  CB    . VAL B  1 291 ? 50.825  4.469   19.183  1.00   15.69 ? 398 VAL B CB    1 
ATOM   5739  C  CG1   . VAL B  1 291 ? 52.072  5.325   19.039  1.00   12.75 ? 398 VAL B CG1   1 
ATOM   5740  C  CG2   . VAL B  1 291 ? 49.989  4.551   17.930  1.00   17.42 ? 398 VAL B CG2   1 
ATOM   5741  N  N     . GLN B  1 292 ? 51.614  3.098   21.827  1.00   20.35 ? 399 GLN B N     1 
ATOM   5742  C  CA    . GLN B  1 292 ? 52.403  3.131   23.044  1.00   17.64 ? 399 GLN B CA    1 
ATOM   5743  C  C     . GLN B  1 292 ? 53.025  1.835   23.515  1.00   17.63 ? 399 GLN B C     1 
ATOM   5744  O  O     . GLN B  1 292 ? 54.111  1.853   24.078  1.00   20.34 ? 399 GLN B O     1 
ATOM   5745  C  CB    . GLN B  1 292 ? 51.559  3.704   24.171  1.00   17.67 ? 399 GLN B CB    1 
ATOM   5746  C  CG    . GLN B  1 292 ? 51.348  5.173   24.026  1.00   21.39 ? 399 GLN B CG    1 
ATOM   5747  C  CD    . GLN B  1 292 ? 50.854  5.804   25.294  1.00   20.33 ? 399 GLN B CD    1 
ATOM   5748  O  OE1   . GLN B  1 292 ? 51.145  5.327   26.390  1.00   22.47 ? 399 GLN B OE1   1 
ATOM   5749  N  NE2   . GLN B  1 292 ? 50.122  6.898   25.159  1.00   15.93 ? 399 GLN B NE2   1 
ATOM   5750  N  N     . THR B  1 293 ? 52.357  0.712   23.280  1.00   17.56 ? 400 THR B N     1 
ATOM   5751  C  CA    . THR B  1 293 ? 52.861  -0.568  23.750  1.00   16.36 ? 400 THR B CA    1 
ATOM   5752  C  C     . THR B  1 293 ? 53.614  -1.450  22.762  1.00   17.56 ? 400 THR B C     1 
ATOM   5753  O  O     . THR B  1 293 ? 54.303  -2.383  23.174  1.00   16.68 ? 400 THR B O     1 
ATOM   5754  C  CB    . THR B  1 293 ? 51.716  -1.400  24.356  1.00   16.27 ? 400 THR B CB    1 
ATOM   5755  O  OG1   . THR B  1 293 ? 50.720  -1.654  23.359  1.00   19.41 ? 400 THR B OG1   1 
ATOM   5756  C  CG2   . THR B  1 293 ? 51.067  -0.646  25.490  1.00   15.32 ? 400 THR B CG2   1 
ATOM   5757  N  N     . SER B  1 294 ? 53.502  -1.163  21.469  1.00   18.78 ? 401 SER B N     1 
ATOM   5758  C  CA    . SER B  1 294 ? 54.180  -1.987  20.474  1.00   20.72 ? 401 SER B CA    1 
ATOM   5759  C  C     . SER B  1 294 ? 55.701  -1.925  20.588  1.00   22.49 ? 401 SER B C     1 
ATOM   5760  O  O     . SER B  1 294 ? 56.286  -0.868  20.814  1.00   23.22 ? 401 SER B O     1 
ATOM   5761  C  CB    . SER B  1 294 ? 53.704  -1.609  19.079  1.00   19.66 ? 401 SER B CB    1 
ATOM   5762  O  OG    . SER B  1 294 ? 52.335  -1.957  18.958  1.00   16.82 ? 401 SER B OG    1 
ATOM   5763  N  N     . LYS B  1 295 ? 56.330  -3.084  20.434  1.00   25.90 ? 402 LYS B N     1 
ATOM   5764  C  CA    . LYS B  1 295 ? 57.774  -3.217  20.578  1.00   26.45 ? 402 LYS B CA    1 
ATOM   5765  C  C     . LYS B  1 295 ? 58.546  -3.403  19.277  1.00   25.48 ? 402 LYS B C     1 
ATOM   5766  O  O     . LYS B  1 295 ? 58.252  -4.300  18.495  1.00   24.58 ? 402 LYS B O     1 
ATOM   5767  C  CB    . LYS B  1 295 ? 58.079  -4.418  21.487  1.00   28.80 ? 402 LYS B CB    1 
ATOM   5768  C  CG    . LYS B  1 295 ? 57.327  -4.456  22.821  1.00   31.59 ? 402 LYS B CG    1 
ATOM   5769  C  CD    . LYS B  1 295 ? 57.833  -3.373  23.782  1.00   34.43 ? 402 LYS B CD    1 
ATOM   5770  C  CE    . LYS B  1 295 ? 57.264  -3.528  25.194  1.00   31.76 ? 402 LYS B CE    1 
ATOM   5771  N  NZ    . LYS B  1 295 ? 55.793  -3.320  25.240  1.00   31.26 ? 402 LYS B NZ    1 
ATOM   5772  N  N     . PRO B  1 296 ? 59.548  -2.549  19.032  1.00   25.78 ? 403 PRO B N     1 
ATOM   5773  C  CA    . PRO B  1 296 ? 60.358  -2.664  17.812  1.00   26.69 ? 403 PRO B CA    1 
ATOM   5774  C  C     . PRO B  1 296 ? 61.334  -3.822  18.017  1.00   27.97 ? 403 PRO B C     1 
ATOM   5775  O  O     . PRO B  1 296 ? 61.381  -4.764  17.229  1.00   29.37 ? 403 PRO B O     1 
ATOM   5776  C  CB    . PRO B  1 296 ? 61.102  -1.329  17.749  1.00   23.16 ? 403 PRO B CB    1 
ATOM   5777  C  CG    . PRO B  1 296 ? 60.257  -0.409  18.570  1.00   24.46 ? 403 PRO B CG    1 
ATOM   5778  C  CD    . PRO B  1 296 ? 59.791  -1.267  19.709  1.00   23.60 ? 403 PRO B CD    1 
ATOM   5779  N  N     . ALA B  1 297 ? 62.094  -3.728  19.108  1.00   31.09 ? 404 ALA B N     1 
ATOM   5780  C  CA    . ALA B  1 297 ? 63.112  -4.710  19.483  1.00   32.84 ? 404 ALA B CA    1 
ATOM   5781  C  C     . ALA B  1 297 ? 62.832  -6.125  18.987  1.00   33.57 ? 404 ALA B C     1 
ATOM   5782  O  O     . ALA B  1 297 ? 61.722  -6.646  19.151  1.00   34.94 ? 404 ALA B O     1 
ATOM   5783  C  CB    . ALA B  1 297 ? 63.287  -4.712  20.990  1.00   34.66 ? 404 ALA B CB    1 
ATOM   5784  N  N     . HIS B  1 298 ? 63.857  -6.725  18.382  1.00   30.87 ? 405 HIS B N     1 
ATOM   5785  C  CA    . HIS B  1 298 ? 63.807  -8.079  17.819  1.00   31.67 ? 405 HIS B CA    1 
ATOM   5786  C  C     . HIS B  1 298 ? 63.463  -8.091  16.323  1.00   31.23 ? 405 HIS B C     1 
ATOM   5787  O  O     . HIS B  1 298 ? 63.878  -8.998  15.597  1.00   33.32 ? 405 HIS B O     1 
ATOM   5788  C  CB    . HIS B  1 298 ? 62.823  -8.968  18.595  1.00   29.33 ? 405 HIS B CB    1 
ATOM   5789  C  CG    . HIS B  1 298 ? 63.196  -9.164  20.032  0.0000 28.30 ? 405 HIS B CG    1 
ATOM   5790  N  ND1   . HIS B  1 298 ? 64.449  -9.580  20.424  0.0000 27.66 ? 405 HIS B ND1   1 
ATOM   5791  C  CD2   . HIS B  1 298 ? 62.475  -9.013  21.169  0.0000 27.66 ? 405 HIS B CD2   1 
ATOM   5792  C  CE1   . HIS B  1 298 ? 64.486  -9.677  21.742  0.0000 27.34 ? 405 HIS B CE1   1 
ATOM   5793  N  NE2   . HIS B  1 298 ? 63.302  -9.339  22.217  0.0000 27.34 ? 405 HIS B NE2   1 
ATOM   5794  N  N     . LEU B  1 299 ? 62.722  -7.083  15.864  1.00   28.50 ? 406 LEU B N     1 
ATOM   5795  C  CA    . LEU B  1 299 ? 62.336  -6.975  14.457  1.00   25.30 ? 406 LEU B CA    1 
ATOM   5796  C  C     . LEU B  1 299 ? 63.407  -6.267  13.625  1.00   24.05 ? 406 LEU B C     1 
ATOM   5797  O  O     . LEU B  1 299 ? 63.809  -5.152  13.944  1.00   23.23 ? 406 LEU B O     1 
ATOM   5798  C  CB    . LEU B  1 299 ? 61.001  -6.223  14.350  1.00   24.21 ? 406 LEU B CB    1 
ATOM   5799  C  CG    . LEU B  1 299 ? 59.700  -7.034  14.177  1.00   23.96 ? 406 LEU B CG    1 
ATOM   5800  C  CD1   . LEU B  1 299 ? 59.788  -8.357  14.894  1.00   22.11 ? 406 LEU B CD1   1 
ATOM   5801  C  CD2   . LEU B  1 299 ? 58.519  -6.234  14.699  1.00   20.13 ? 406 LEU B CD2   1 
ATOM   5802  N  N     . ASN B  1 300 ? 63.866  -6.914  12.557  1.00   21.61 ? 407 ASN B N     1 
ATOM   5803  C  CA    . ASN B  1 300 ? 64.890  -6.321  11.707  1.00   22.74 ? 407 ASN B CA    1 
ATOM   5804  C  C     . ASN B  1 300 ? 64.300  -5.566  10.529  1.00   22.41 ? 407 ASN B C     1 
ATOM   5805  O  O     . ASN B  1 300 ? 63.443  -6.079  9.818   1.00   23.50 ? 407 ASN B O     1 
ATOM   5806  C  CB    . ASN B  1 300 ? 65.836  -7.407  11.209  1.00   25.10 ? 407 ASN B CB    1 
ATOM   5807  C  CG    . ASN B  1 300 ? 66.396  -8.229  12.348  1.00   28.69 ? 407 ASN B CG    1 
ATOM   5808  O  OD1   . ASN B  1 300 ? 67.081  -7.700  13.230  1.00   30.29 ? 407 ASN B OD1   1 
ATOM   5809  N  ND2   . ASN B  1 300 ? 66.093  -9.526  12.352  1.00   29.12 ? 407 ASN B ND2   1 
ATOM   5810  N  N     . ALA B  1 301 ? 64.764  -4.337  10.330  1.00   21.66 ? 408 ALA B N     1 
ATOM   5811  C  CA    . ALA B  1 301 ? 64.296  -3.508  9.227   1.00   21.25 ? 408 ALA B CA    1 
ATOM   5812  C  C     . ALA B  1 301 ? 65.376  -2.499  8.885   1.00   22.03 ? 408 ALA B C     1 
ATOM   5813  O  O     . ALA B  1 301 ? 66.097  -2.022  9.762   1.00   22.34 ? 408 ALA B O     1 
ATOM   5814  C  CB    . ALA B  1 301 ? 63.017  -2.796  9.616   1.00   18.35 ? 408 ALA B CB    1 
ATOM   5815  N  N     . ASN B  1 302 ? 65.485  -2.164  7.610   1.00   23.23 ? 409 ASN B N     1 
ATOM   5816  C  CA    . ASN B  1 302 ? 66.501  -1.218  7.177   1.00   24.48 ? 409 ASN B CA    1 
ATOM   5817  C  C     . ASN B  1 302 ? 66.078  0.243   7.379   1.00   22.31 ? 409 ASN B C     1 
ATOM   5818  O  O     . ASN B  1 302 ? 66.877  1.149   7.177   1.00   24.23 ? 409 ASN B O     1 
ATOM   5819  C  CB    . ASN B  1 302 ? 66.827  -1.480  5.702   1.00   29.28 ? 409 ASN B CB    1 
ATOM   5820  C  CG    . ASN B  1 302 ? 68.023  -0.682  5.211   1.00   36.13 ? 409 ASN B CG    1 
ATOM   5821  O  OD1   . ASN B  1 302 ? 67.982  0.546   5.141   0.0000 33.59 ? 409 ASN B OD1   1 
ATOM   5822  N  ND2   . ASN B  1 302 ? 69.095  -1.382  4.864   0.0000 33.59 ? 409 ASN B ND2   1 
ATOM   5823  N  N     . ASP B  1 303 ? 64.844  0.475   7.821   1.00   20.05 ? 410 ASP B N     1 
ATOM   5824  C  CA    . ASP B  1 303 ? 64.364  1.849   7.970   1.00   17.58 ? 410 ASP B CA    1 
ATOM   5825  C  C     . ASP B  1 303 ? 63.842  2.300   9.342   1.00   16.87 ? 410 ASP B C     1 
ATOM   5826  O  O     . ASP B  1 303 ? 63.016  3.211   9.421   1.00   17.13 ? 410 ASP B O     1 
ATOM   5827  C  CB    . ASP B  1 303 ? 63.286  2.102   6.926   1.00   12.88 ? 410 ASP B CB    1 
ATOM   5828  C  CG    . ASP B  1 303 ? 62.010  1.368   7.242   1.00   15.36 ? 410 ASP B CG    1 
ATOM   5829  O  OD1   . ASP B  1 303 ? 62.096  0.278   7.848   1.00   11.97 ? 410 ASP B OD1   1 
ATOM   5830  O  OD2   . ASP B  1 303 ? 60.928  1.872   6.880   1.00   18.27 ? 410 ASP B OD2   1 
ATOM   5831  N  N     . TRP B  1 304 ? 64.298  1.670   10.418  1.00   16.63 ? 411 TRP B N     1 
ATOM   5832  C  CA    . TRP B  1 304 ? 63.869  2.093   11.752  1.00   16.01 ? 411 TRP B CA    1 
ATOM   5833  C  C     . TRP B  1 304 ? 64.319  3.539   11.963  1.00   15.85 ? 411 TRP B C     1 
ATOM   5834  O  O     . TRP B  1 304 ? 65.476  3.880   11.733  1.00   16.58 ? 411 TRP B O     1 
ATOM   5835  C  CB    . TRP B  1 304 ? 64.494  1.216   12.843  1.00   12.16 ? 411 TRP B CB    1 
ATOM   5836  C  CG    . TRP B  1 304 ? 63.802  -0.102  13.067  1.00   15.10 ? 411 TRP B CG    1 
ATOM   5837  C  CD1   . TRP B  1 304 ? 64.337  -1.350  12.892  1.00   14.18 ? 411 TRP B CD1   1 
ATOM   5838  C  CD2   . TRP B  1 304 ? 62.455  -0.307  13.531  1.00   14.54 ? 411 TRP B CD2   1 
ATOM   5839  N  NE1   . TRP B  1 304 ? 63.411  -2.316  13.221  1.00   12.22 ? 411 TRP B NE1   1 
ATOM   5840  C  CE2   . TRP B  1 304 ? 62.249  -1.706  13.617  1.00   14.32 ? 411 TRP B CE2   1 
ATOM   5841  C  CE3   . TRP B  1 304 ? 61.406  0.554   13.886  1.00   13.66 ? 411 TRP B CE3   1 
ATOM   5842  C  CZ2   . TRP B  1 304 ? 61.031  -2.267  14.042  1.00   14.06 ? 411 TRP B CZ2   1 
ATOM   5843  C  CZ3   . TRP B  1 304 ? 60.195  -0.003  14.311  1.00   16.19 ? 411 TRP B CZ3   1 
ATOM   5844  C  CH2   . TRP B  1 304 ? 60.021  -1.404  14.384  1.00   15.71 ? 411 TRP B CH2   1 
ATOM   5845  N  N     . ALA B  1 305 ? 63.406  4.395   12.389  1.00   15.53 ? 412 ALA B N     1 
ATOM   5846  C  CA    . ALA B  1 305 ? 63.758  5.786   12.623  1.00   16.92 ? 412 ALA B CA    1 
ATOM   5847  C  C     . ALA B  1 305 ? 63.025  6.261   13.863  1.00   18.94 ? 412 ALA B C     1 
ATOM   5848  O  O     . ALA B  1 305 ? 61.924  5.794   14.154  1.00   21.98 ? 412 ALA B O     1 
ATOM   5849  C  CB    . ALA B  1 305 ? 63.373  6.625   11.426  1.00   14.67 ? 412 ALA B CB    1 
ATOM   5850  N  N     . THR B  1 306 ? 63.634  7.185   14.594  1.00   16.69 ? 413 THR B N     1 
ATOM   5851  C  CA    . THR B  1 306 ? 63.038  7.712   15.814  1.00   18.50 ? 413 THR B CA    1 
ATOM   5852  C  C     . THR B  1 306 ? 62.235  8.973   15.505  1.00   18.95 ? 413 THR B C     1 
ATOM   5853  O  O     . THR B  1 306 ? 62.793  9.954   15.006  1.00   23.15 ? 413 THR B O     1 
ATOM   5854  C  CB    . THR B  1 306 ? 64.144  8.051   16.838  1.00   18.43 ? 413 THR B CB    1 
ATOM   5855  O  OG1   . THR B  1 306 ? 64.974  6.902   17.029  1.00   20.62 ? 413 THR B OG1   1 
ATOM   5856  C  CG2   . THR B  1 306 ? 63.552  8.458   18.179  1.00   20.52 ? 413 THR B CG2   1 
ATOM   5857  N  N     . ASN B  1 307 ? 60.935  8.961   15.799  1.00   17.05 ? 414 ASN B N     1 
ATOM   5858  C  CA    . ASN B  1 307 ? 60.123  10.139  15.514  1.00   18.13 ? 414 ASN B CA    1 
ATOM   5859  C  C     . ASN B  1 307 ? 60.310  11.241  16.556  1.00   20.29 ? 414 ASN B C     1 
ATOM   5860  O  O     . ASN B  1 307 ? 61.117  11.120  17.480  1.00   20.05 ? 414 ASN B O     1 
ATOM   5861  C  CB    . ASN B  1 307 ? 58.637  9.777   15.384  1.00   16.27 ? 414 ASN B CB    1 
ATOM   5862  C  CG    . ASN B  1 307 ? 58.065  9.207   16.643  1.00   17.61 ? 414 ASN B CG    1 
ATOM   5863  O  OD1   . ASN B  1 307 ? 58.604  9.409   17.727  1.00   19.02 ? 414 ASN B OD1   1 
ATOM   5864  N  ND2   . ASN B  1 307 ? 56.943  8.502   16.516  1.00   18.19 ? 414 ASN B ND2   1 
ATOM   5865  N  N     . GLY B  1 308 ? 59.558  12.322  16.387  1.00   20.85 ? 415 GLY B N     1 
ATOM   5866  C  CA    . GLY B  1 308 ? 59.661  13.460  17.277  1.00   20.05 ? 415 GLY B CA    1 
ATOM   5867  C  C     . GLY B  1 308 ? 59.422  13.185  18.744  1.00   20.15 ? 415 GLY B C     1 
ATOM   5868  O  O     . GLY B  1 308 ? 59.817  13.992  19.576  1.00   19.59 ? 415 GLY B O     1 
ATOM   5869  N  N     . VAL B  1 309 ? 58.782  12.068  19.078  1.00   19.55 ? 416 VAL B N     1 
ATOM   5870  C  CA    . VAL B  1 309 ? 58.523  11.776  20.483  1.00   19.00 ? 416 VAL B CA    1 
ATOM   5871  C  C     . VAL B  1 309 ? 59.353  10.618  21.036  1.00   20.17 ? 416 VAL B C     1 
ATOM   5872  O  O     . VAL B  1 309 ? 59.038  10.071  22.093  1.00   19.04 ? 416 VAL B O     1 
ATOM   5873  C  CB    . VAL B  1 309 ? 57.031  11.495  20.731  1.00   17.15 ? 416 VAL B CB    1 
ATOM   5874  C  CG1   . VAL B  1 309 ? 56.208  12.703  20.289  1.00   15.83 ? 416 VAL B CG1   1 
ATOM   5875  C  CG2   . VAL B  1 309 ? 56.610  10.238  19.994  1.00   15.28 ? 416 VAL B CG2   1 
ATOM   5876  N  N     . GLY B  1 310 ? 60.411  10.248  20.319  1.00   19.13 ? 417 GLY B N     1 
ATOM   5877  C  CA    . GLY B  1 310 ? 61.278  9.184   20.787  1.00   19.00 ? 417 GLY B CA    1 
ATOM   5878  C  C     . GLY B  1 310 ? 60.876  7.744   20.516  1.00   19.72 ? 417 GLY B C     1 
ATOM   5879  O  O     . GLY B  1 310 ? 61.476  6.813   21.065  1.00   18.28 ? 417 GLY B O     1 
ATOM   5880  N  N     . ARG B  1 311 ? 59.868  7.536   19.681  1.00   18.32 ? 418 ARG B N     1 
ATOM   5881  C  CA    . ARG B  1 311 ? 59.458  6.179   19.371  1.00   17.07 ? 418 ARG B CA    1 
ATOM   5882  C  C     . ARG B  1 311 ? 60.042  5.750   18.039  1.00   17.62 ? 418 ARG B C     1 
ATOM   5883  O  O     . ARG B  1 311 ? 60.199  6.573   17.137  1.00   17.47 ? 418 ARG B O     1 
ATOM   5884  C  CB    . ARG B  1 311 ? 57.934  6.074   19.357  1.00   15.39 ? 418 ARG B CB    1 
ATOM   5885  C  CG    . ARG B  1 311 ? 57.331  6.138   20.743  1.00   16.94 ? 418 ARG B CG    1 
ATOM   5886  C  CD    . ARG B  1 311 ? 55.892  5.676   20.777  1.00   16.76 ? 418 ARG B CD    1 
ATOM   5887  N  NE    . ARG B  1 311 ? 54.985  6.805   20.724  1.00   21.03 ? 418 ARG B NE    1 
ATOM   5888  C  CZ    . ARG B  1 311 ? 54.241  7.221   21.743  1.00   20.97 ? 418 ARG B CZ    1 
ATOM   5889  N  NH1   . ARG B  1 311 ? 53.448  8.277   21.592  1.00   15.54 ? 418 ARG B NH1   1 
ATOM   5890  N  NH2   . ARG B  1 311 ? 54.281  6.585   22.906  1.00   18.14 ? 418 ARG B NH2   1 
ATOM   5891  N  N     . LYS B  1 312 ? 60.386  4.466   17.932  1.00   18.48 ? 419 LYS B N     1 
ATOM   5892  C  CA    . LYS B  1 312 ? 60.955  3.900   16.700  1.00   20.16 ? 419 LYS B CA    1 
ATOM   5893  C  C     . LYS B  1 312 ? 59.814  3.462   15.783  1.00   17.40 ? 419 LYS B C     1 
ATOM   5894  O  O     . LYS B  1 312 ? 58.864  2.819   16.228  1.00   15.15 ? 419 LYS B O     1 
ATOM   5895  C  CB    . LYS B  1 312 ? 61.835  2.672   17.003  1.00   21.20 ? 419 LYS B CB    1 
ATOM   5896  C  CG    . LYS B  1 312 ? 62.851  2.844   18.129  1.00   28.39 ? 419 LYS B CG    1 
ATOM   5897  C  CD    . LYS B  1 312 ? 64.081  3.686   17.740  1.00   33.51 ? 419 LYS B CD    1 
ATOM   5898  C  CE    . LYS B  1 312 ? 64.996  2.958   16.774  1.00   39.59 ? 419 LYS B CE    1 
ATOM   5899  N  NZ    . LYS B  1 312 ? 65.399  1.597   17.280  1.00   45.42 ? 419 LYS B NZ    1 
ATOM   5900  N  N     . VAL B  1 313 ? 59.906  3.822   14.509  1.00   16.89 ? 420 VAL B N     1 
ATOM   5901  C  CA    . VAL B  1 313 ? 58.893  3.437   13.533  1.00   19.48 ? 420 VAL B CA    1 
ATOM   5902  C  C     . VAL B  1 313 ? 59.538  2.961   12.238  1.00   20.63 ? 420 VAL B C     1 
ATOM   5903  O  O     . VAL B  1 313 ? 60.599  3.447   11.829  1.00   21.80 ? 420 VAL B O     1 
ATOM   5904  C  CB    . VAL B  1 313 ? 57.930  4.608   13.166  1.00   20.40 ? 420 VAL B CB    1 
ATOM   5905  C  CG1   . VAL B  1 313 ? 57.097  5.024   14.363  1.00   24.56 ? 420 VAL B CG1   1 
ATOM   5906  C  CG2   . VAL B  1 313 ? 58.734  5.795   12.640  1.00   22.71 ? 420 VAL B CG2   1 
ATOM   5907  N  N     . SER B  1 314 ? 58.882  1.999   11.602  1.00   20.71 ? 421 SER B N     1 
ATOM   5908  C  CA    . SER B  1 314 ? 59.332  1.457   10.335  1.00   19.69 ? 421 SER B CA    1 
ATOM   5909  C  C     . SER B  1 314 ? 58.128  1.350   9.406   1.00   19.63 ? 421 SER B C     1 
ATOM   5910  O  O     . SER B  1 314 ? 57.019  1.081   9.855   1.00   19.44 ? 421 SER B O     1 
ATOM   5911  C  CB    . SER B  1 314 ? 59.951  0.078   10.536  1.00   20.56 ? 421 SER B CB    1 
ATOM   5912  O  OG    . SER B  1 314 ? 60.144  -0.557  9.286   1.00   20.69 ? 421 SER B OG    1 
ATOM   5913  N  N     . HIS B  1 315 ? 58.347  1.563   8.112   1.00   21.25 ? 422 HIS B N     1 
ATOM   5914  C  CA    . HIS B  1 315 ? 57.270  1.471   7.134   1.00   20.54 ? 422 HIS B CA    1 
ATOM   5915  C  C     . HIS B  1 315 ? 56.875  0.012   6.889   1.00   21.56 ? 422 HIS B C     1 
ATOM   5916  O  O     . HIS B  1 315 ? 55.871  -0.277  6.228   1.00   22.88 ? 422 HIS B O     1 
ATOM   5917  C  CB    . HIS B  1 315 ? 57.688  2.140   5.823   1.00   17.45 ? 422 HIS B CB    1 
ATOM   5918  C  CG    . HIS B  1 315 ? 57.841  3.627   5.927   1.00   18.78 ? 422 HIS B CG    1 
ATOM   5919  N  ND1   . HIS B  1 315 ? 58.828  4.226   6.686   1.00   17.86 ? 422 HIS B ND1   1 
ATOM   5920  C  CD2   . HIS B  1 315 ? 57.127  4.640   5.377   1.00   17.94 ? 422 HIS B CD2   1 
ATOM   5921  C  CE1   . HIS B  1 315 ? 58.716  5.539   6.594   1.00   15.04 ? 422 HIS B CE1   1 
ATOM   5922  N  NE2   . HIS B  1 315 ? 57.691  5.816   5.806   1.00   18.56 ? 422 HIS B NE2   1 
ATOM   5923  N  N     . SER B  1 316 ? 57.660  -0.907  7.439   1.00   22.99 ? 423 SER B N     1 
ATOM   5924  C  CA    . SER B  1 316 ? 57.382  -2.332  7.296   1.00   25.06 ? 423 SER B CA    1 
ATOM   5925  C  C     . SER B  1 316 ? 56.652  -2.893  8.502   1.00   26.41 ? 423 SER B C     1 
ATOM   5926  O  O     . SER B  1 316 ? 55.929  -3.889  8.389   1.00   26.63 ? 423 SER B O     1 
ATOM   5927  C  CB    . SER B  1 316 ? 58.677  -3.125  7.117   1.00   22.92 ? 423 SER B CB    1 
ATOM   5928  O  OG    . SER B  1 316 ? 59.097  -3.130  5.769   1.00   23.22 ? 423 SER B OG    1 
ATOM   5929  N  N     . TYR B  1 317 ? 56.824  -2.245  9.652   1.00   25.29 ? 424 TYR B N     1 
ATOM   5930  C  CA    . TYR B  1 317 ? 56.224  -2.736  10.890  1.00   23.65 ? 424 TYR B CA    1 
ATOM   5931  C  C     . TYR B  1 317 ? 55.365  -1.750  11.673  1.00   23.29 ? 424 TYR B C     1 
ATOM   5932  O  O     . TYR B  1 317 ? 54.679  -2.143  12.620  1.00   23.45 ? 424 TYR B O     1 
ATOM   5933  C  CB    . TYR B  1 317 ? 57.327  -3.226  11.836  1.00   23.28 ? 424 TYR B CB    1 
ATOM   5934  C  CG    . TYR B  1 317 ? 58.261  -4.287  11.295  1.00   19.90 ? 424 TYR B CG    1 
ATOM   5935  C  CD1   . TYR B  1 317 ? 57.785  -5.540  10.914  1.00   18.87 ? 424 TYR B CD1   1 
ATOM   5936  C  CD2   . TYR B  1 317 ? 59.635  -4.058  11.237  1.00   17.18 ? 424 TYR B CD2   1 
ATOM   5937  C  CE1   . TYR B  1 317 ? 58.663  -6.546  10.494  1.00   18.13 ? 424 TYR B CE1   1 
ATOM   5938  C  CE2   . TYR B  1 317 ? 60.519  -5.054  10.823  1.00   15.66 ? 424 TYR B CE2   1 
ATOM   5939  C  CZ    . TYR B  1 317 ? 60.031  -6.290  10.456  1.00   16.78 ? 424 TYR B CZ    1 
ATOM   5940  O  OH    . TYR B  1 317 ? 60.919  -7.263  10.057  1.00   17.33 ? 424 TYR B OH    1 
ATOM   5941  N  N     . GLY B  1 318 ? 55.398  -0.477  11.300  1.00   23.24 ? 425 GLY B N     1 
ATOM   5942  C  CA    . GLY B  1 318 ? 54.644  0.500   12.063  1.00   20.67 ? 425 GLY B CA    1 
ATOM   5943  C  C     . GLY B  1 318 ? 55.409  0.732   13.362  1.00   21.42 ? 425 GLY B C     1 
ATOM   5944  O  O     . GLY B  1 318 ? 56.615  0.989   13.326  1.00   18.56 ? 425 GLY B O     1 
ATOM   5945  N  N     . TYR B  1 319 ? 54.737  0.631   14.511  1.00   21.63 ? 426 TYR B N     1 
ATOM   5946  C  CA    . TYR B  1 319 ? 55.416  0.834   15.790  1.00   19.81 ? 426 TYR B CA    1 
ATOM   5947  C  C     . TYR B  1 319 ? 56.021  -0.435  16.341  1.00   21.60 ? 426 TYR B C     1 
ATOM   5948  O  O     . TYR B  1 319 ? 56.585  -0.436  17.434  1.00   23.58 ? 426 TYR B O     1 
ATOM   5949  C  CB    . TYR B  1 319 ? 54.481  1.441   16.828  1.00   14.81 ? 426 TYR B CB    1 
ATOM   5950  C  CG    . TYR B  1 319 ? 54.272  2.901   16.575  1.00   16.88 ? 426 TYR B CG    1 
ATOM   5951  C  CD1   . TYR B  1 319 ? 53.369  3.334   15.602  1.00   17.51 ? 426 TYR B CD1   1 
ATOM   5952  C  CD2   . TYR B  1 319 ? 55.044  3.849   17.226  1.00   13.00 ? 426 TYR B CD2   1 
ATOM   5953  C  CE1   . TYR B  1 319 ? 53.252  4.676   15.281  1.00   16.47 ? 426 TYR B CE1   1 
ATOM   5954  C  CE2   . TYR B  1 319 ? 54.936  5.186   16.914  1.00   13.73 ? 426 TYR B CE2   1 
ATOM   5955  C  CZ    . TYR B  1 319 ? 54.043  5.596   15.938  1.00   15.33 ? 426 TYR B CZ    1 
ATOM   5956  O  OH    . TYR B  1 319 ? 53.968  6.924   15.588  1.00   18.09 ? 426 TYR B OH    1 
ATOM   5957  N  N     . GLY B  1 320 ? 55.904  -1.517  15.584  1.00   20.47 ? 427 GLY B N     1 
ATOM   5958  C  CA    . GLY B  1 320 ? 56.477  -2.766  16.035  1.00   22.12 ? 427 GLY B CA    1 
ATOM   5959  C  C     . GLY B  1 320 ? 55.500  -3.888  16.321  1.00   21.93 ? 427 GLY B C     1 
ATOM   5960  O  O     . GLY B  1 320 ? 54.332  -3.844  15.944  1.00   23.08 ? 427 GLY B O     1 
ATOM   5961  N  N     . LEU B  1 321 ? 56.008  -4.901  17.009  1.00   21.76 ? 428 LEU B N     1 
ATOM   5962  C  CA    . LEU B  1 321 ? 55.255  -6.086  17.367  1.00   20.72 ? 428 LEU B CA    1 
ATOM   5963  C  C     . LEU B  1 321 ? 54.273  -5.776  18.487  1.00   20.76 ? 428 LEU B C     1 
ATOM   5964  O  O     . LEU B  1 321 ? 54.601  -5.043  19.426  1.00   20.42 ? 428 LEU B O     1 
ATOM   5965  C  CB    . LEU B  1 321 ? 56.240  -7.157  17.827  1.00   23.11 ? 428 LEU B CB    1 
ATOM   5966  C  CG    . LEU B  1 321 ? 55.927  -8.621  17.574  1.00   26.38 ? 428 LEU B CG    1 
ATOM   5967  C  CD1   . LEU B  1 321 ? 55.847  -8.892  16.078  1.00   25.63 ? 428 LEU B CD1   1 
ATOM   5968  C  CD2   . LEU B  1 321 ? 57.030  -9.454  18.215  1.00   28.99 ? 428 LEU B CD2   1 
ATOM   5969  N  N     . LEU B  1 322 ? 53.067  -6.325  18.390  1.00   17.96 ? 429 LEU B N     1 
ATOM   5970  C  CA    . LEU B  1 322 ? 52.080  -6.102  19.433  1.00   18.42 ? 429 LEU B CA    1 
ATOM   5971  C  C     . LEU B  1 322 ? 52.518  -6.850  20.695  1.00   19.55 ? 429 LEU B C     1 
ATOM   5972  O  O     . LEU B  1 322 ? 53.175  -7.887  20.618  1.00   19.82 ? 429 LEU B O     1 
ATOM   5973  C  CB    . LEU B  1 322 ? 50.700  -6.587  18.984  1.00   17.44 ? 429 LEU B CB    1 
ATOM   5974  C  CG    . LEU B  1 322 ? 50.015  -5.862  17.819  1.00   16.00 ? 429 LEU B CG    1 
ATOM   5975  C  CD1   . LEU B  1 322 ? 48.661  -6.514  17.572  1.00   15.28 ? 429 LEU B CD1   1 
ATOM   5976  C  CD2   . LEU B  1 322 ? 49.856  -4.377  18.135  1.00   13.02 ? 429 LEU B CD2   1 
ATOM   5977  N  N     . ASP B  1 323 ? 52.157  -6.303  21.851  1.00   20.99 ? 430 ASP B N     1 
ATOM   5978  C  CA    . ASP B  1 323 ? 52.493  -6.884  23.146  1.00   20.45 ? 430 ASP B CA    1 
ATOM   5979  C  C     . ASP B  1 323 ? 51.179  -7.034  23.916  1.00   19.74 ? 430 ASP B C     1 
ATOM   5980  O  O     . ASP B  1 323 ? 50.722  -6.089  24.553  1.00   21.73 ? 430 ASP B O     1 
ATOM   5981  C  CB    . ASP B  1 323 ? 53.432  -5.937  23.900  1.00   22.26 ? 430 ASP B CB    1 
ATOM   5982  C  CG    . ASP B  1 323 ? 54.045  -6.573  25.136  1.00   24.57 ? 430 ASP B CG    1 
ATOM   5983  O  OD1   . ASP B  1 323 ? 53.360  -7.380  25.809  1.00   24.45 ? 430 ASP B OD1   1 
ATOM   5984  O  OD2   . ASP B  1 323 ? 55.216  -6.255  25.443  1.00   25.22 ? 430 ASP B OD2   1 
ATOM   5985  N  N     . ALA B  1 324 ? 50.560  -8.208  23.854  1.00   19.43 ? 431 ALA B N     1 
ATOM   5986  C  CA    . ALA B  1 324 ? 49.285  -8.423  24.544  1.00   15.96 ? 431 ALA B CA    1 
ATOM   5987  C  C     . ALA B  1 324 ? 49.355  -8.081  26.026  1.00   15.52 ? 431 ALA B C     1 
ATOM   5988  O  O     . ALA B  1 324 ? 48.477  -7.393  26.543  1.00   15.39 ? 431 ALA B O     1 
ATOM   5989  C  CB    . ALA B  1 324 ? 48.825  -9.851  24.360  1.00   14.90 ? 431 ALA B CB    1 
ATOM   5990  N  N     . GLY B  1 325 ? 50.394  -8.561  26.706  1.00   16.54 ? 432 GLY B N     1 
ATOM   5991  C  CA    . GLY B  1 325 ? 50.553  -8.279  28.121  1.00   13.70 ? 432 GLY B CA    1 
ATOM   5992  C  C     . GLY B  1 325 ? 50.572  -6.788  28.385  1.00   15.92 ? 432 GLY B C     1 
ATOM   5993  O  O     . GLY B  1 325 ? 49.855  -6.294  29.256  1.00   15.59 ? 432 GLY B O     1 
ATOM   5994  N  N     . ALA B  1 326 ? 51.388  -6.065  27.624  1.00   16.89 ? 433 ALA B N     1 
ATOM   5995  C  CA    . ALA B  1 326 ? 51.491  -4.614  27.766  1.00   17.85 ? 433 ALA B CA    1 
ATOM   5996  C  C     . ALA B  1 326 ? 50.159  -3.922  27.442  1.00   18.65 ? 433 ALA B C     1 
ATOM   5997  O  O     . ALA B  1 326 ? 49.790  -2.944  28.089  1.00   22.18 ? 433 ALA B O     1 
ATOM   5998  C  CB    . ALA B  1 326 ? 52.600  -4.079  26.849  1.00   13.84 ? 433 ALA B CB    1 
ATOM   5999  N  N     . MET B  1 327 ? 49.446  -4.436  26.443  1.00   18.39 ? 434 MET B N     1 
ATOM   6000  C  CA    . MET B  1 327 ? 48.166  -3.866  26.037  1.00   19.84 ? 434 MET B CA    1 
ATOM   6001  C  C     . MET B  1 327 ? 47.138  -3.914  27.159  1.00   22.70 ? 434 MET B C     1 
ATOM   6002  O  O     . MET B  1 327 ? 46.589  -2.878  27.539  1.00   23.98 ? 434 MET B O     1 
ATOM   6003  C  CB    . MET B  1 327 ? 47.604  -4.595  24.807  1.00   18.52 ? 434 MET B CB    1 
ATOM   6004  C  CG    . MET B  1 327 ? 48.263  -4.247  23.470  1.00   15.63 ? 434 MET B CG    1 
ATOM   6005  S  SD    . MET B  1 327 ? 47.804  -2.627  22.817  1.00   17.17 ? 434 MET B SD    1 
ATOM   6006  C  CE    . MET B  1 327 ? 46.179  -2.980  22.113  1.00   16.32 ? 434 MET B CE    1 
ATOM   6007  N  N     . VAL B  1 328 ? 46.869  -5.108  27.690  1.00   23.72 ? 435 VAL B N     1 
ATOM   6008  C  CA    . VAL B  1 328 ? 45.882  -5.234  28.767  1.00   22.94 ? 435 VAL B CA    1 
ATOM   6009  C  C     . VAL B  1 328 ? 46.322  -4.486  30.025  1.00   22.38 ? 435 VAL B C     1 
ATOM   6010  O  O     . VAL B  1 328 ? 45.493  -3.975  30.777  1.00   19.30 ? 435 VAL B O     1 
ATOM   6011  C  CB    . VAL B  1 328 ? 45.606  -6.711  29.139  1.00   22.01 ? 435 VAL B CB    1 
ATOM   6012  C  CG1   . VAL B  1 328 ? 45.063  -7.452  27.937  1.00   21.68 ? 435 VAL B CG1   1 
ATOM   6013  C  CG2   . VAL B  1 328 ? 46.860  -7.360  29.664  1.00   21.59 ? 435 VAL B CG2   1 
ATOM   6014  N  N     . ALA B  1 329 ? 47.631  -4.414  30.244  1.00   21.17 ? 436 ALA B N     1 
ATOM   6015  C  CA    . ALA B  1 329 ? 48.159  -3.710  31.402  1.00   20.97 ? 436 ALA B CA    1 
ATOM   6016  C  C     . ALA B  1 329 ? 47.831  -2.225  31.319  1.00   23.03 ? 436 ALA B C     1 
ATOM   6017  O  O     . ALA B  1 329 ? 47.196  -1.670  32.222  1.00   24.53 ? 436 ALA B O     1 
ATOM   6018  C  CB    . ALA B  1 329 ? 49.654  -3.902  31.488  1.00   18.20 ? 436 ALA B CB    1 
ATOM   6019  N  N     . LEU B  1 330 ? 48.249  -1.587  30.227  1.00   23.64 ? 437 LEU B N     1 
ATOM   6020  C  CA    . LEU B  1 330 ? 48.008  -0.161  30.028  1.00   24.72 ? 437 LEU B CA    1 
ATOM   6021  C  C     . LEU B  1 330 ? 46.516  0.156   29.928  1.00   26.17 ? 437 LEU B C     1 
ATOM   6022  O  O     . LEU B  1 330 ? 46.061  1.196   30.398  1.00   27.09 ? 437 LEU B O     1 
ATOM   6023  C  CB    . LEU B  1 330 ? 48.730  0.318   28.762  1.00   23.12 ? 437 LEU B CB    1 
ATOM   6024  C  CG    . LEU B  1 330 ? 48.820  1.822   28.496  1.00   23.63 ? 437 LEU B CG    1 
ATOM   6025  C  CD1   . LEU B  1 330 ? 49.636  2.493   29.577  1.00   21.71 ? 437 LEU B CD1   1 
ATOM   6026  C  CD2   . LEU B  1 330 ? 49.463  2.066   27.149  1.00   25.32 ? 437 LEU B CD2   1 
ATOM   6027  N  N     . ALA B  1 331 ? 45.755  -0.756  29.336  1.00   26.87 ? 438 ALA B N     1 
ATOM   6028  C  CA    . ALA B  1 331 ? 44.323  -0.556  29.162  1.00   27.23 ? 438 ALA B CA    1 
ATOM   6029  C  C     . ALA B  1 331 ? 43.585  -0.264  30.458  1.00   28.52 ? 438 ALA B C     1 
ATOM   6030  O  O     . ALA B  1 331 ? 42.716  0.599   30.506  1.00   28.40 ? 438 ALA B O     1 
ATOM   6031  C  CB    . ALA B  1 331 ? 43.714  -1.773  28.496  1.00   24.92 ? 438 ALA B CB    1 
ATOM   6032  N  N     . GLN B  1 332 ? 43.939  -0.991  31.508  1.00   31.75 ? 439 GLN B N     1 
ATOM   6033  C  CA    . GLN B  1 332 ? 43.287  -0.845  32.803  1.00   33.47 ? 439 GLN B CA    1 
ATOM   6034  C  C     . GLN B  1 332 ? 43.309  0.542   33.429  1.00   34.90 ? 439 GLN B C     1 
ATOM   6035  O  O     . GLN B  1 332 ? 42.303  0.985   33.979  1.00   35.53 ? 439 GLN B O     1 
ATOM   6036  C  CB    . GLN B  1 332 ? 43.876  -1.845  33.789  1.00   33.69 ? 439 GLN B CB    1 
ATOM   6037  C  CG    . GLN B  1 332 ? 43.532  -3.276  33.462  1.00   36.82 ? 439 GLN B CG    1 
ATOM   6038  C  CD    . GLN B  1 332 ? 44.209  -4.242  34.395  1.00   37.32 ? 439 GLN B CD    1 
ATOM   6039  O  OE1   . GLN B  1 332 ? 44.110  -4.107  35.616  1.00   41.75 ? 439 GLN B OE1   1 
ATOM   6040  N  NE2   . GLN B  1 332 ? 44.906  -5.225  33.833  1.00   35.53 ? 439 GLN B NE2   1 
ATOM   6041  N  N     . ASN B  1 333 ? 44.445  1.225   33.366  1.00   34.61 ? 440 ASN B N     1 
ATOM   6042  C  CA    . ASN B  1 333 ? 44.526  2.549   33.961  1.00   35.86 ? 440 ASN B CA    1 
ATOM   6043  C  C     . ASN B  1 333 ? 44.330  3.660   32.925  1.00   34.63 ? 440 ASN B C     1 
ATOM   6044  O  O     . ASN B  1 333 ? 44.491  4.844   33.228  1.00   37.03 ? 440 ASN B O     1 
ATOM   6045  C  CB    . ASN B  1 333 ? 45.878  2.713   34.674  1.00   37.42 ? 440 ASN B CB    1 
ATOM   6046  C  CG    . ASN B  1 333 ? 45.985  1.869   35.924  0.0000 35.71 ? 440 ASN B CG    1 
ATOM   6047  O  OD1   . ASN B  1 333 ? 47.009  1.884   36.606  0.0000 35.55 ? 440 ASN B OD1   1 
ATOM   6048  N  ND2   . ASN B  1 333 ? 44.925  1.131   36.238  0.0000 35.55 ? 440 ASN B ND2   1 
ATOM   6049  N  N     . TRP B  1 334 ? 43.943  3.284   31.712  1.00   31.50 ? 441 TRP B N     1 
ATOM   6050  C  CA    . TRP B  1 334 ? 43.776  4.258   30.640  1.00   28.15 ? 441 TRP B CA    1 
ATOM   6051  C  C     . TRP B  1 334 ? 42.635  5.269   30.777  1.00   28.15 ? 441 TRP B C     1 
ATOM   6052  O  O     . TRP B  1 334 ? 41.483  4.909   31.035  1.00   29.01 ? 441 TRP B O     1 
ATOM   6053  C  CB    . TRP B  1 334 ? 43.656  3.528   29.303  1.00   22.78 ? 441 TRP B CB    1 
ATOM   6054  C  CG    . TRP B  1 334 ? 43.691  4.436   28.126  1.00   20.03 ? 441 TRP B CG    1 
ATOM   6055  C  CD1   . TRP B  1 334 ? 42.623  4.940   27.454  1.00   17.18 ? 441 TRP B CD1   1 
ATOM   6056  C  CD2   . TRP B  1 334 ? 44.862  4.985   27.498  1.00   19.52 ? 441 TRP B CD2   1 
ATOM   6057  N  NE1   . TRP B  1 334 ? 43.049  5.771   26.447  1.00   19.24 ? 441 TRP B NE1   1 
ATOM   6058  C  CE2   . TRP B  1 334 ? 44.416  5.818   26.450  1.00   19.05 ? 441 TRP B CE2   1 
ATOM   6059  C  CE3   . TRP B  1 334 ? 46.241  4.852   27.721  1.00   17.62 ? 441 TRP B CE3   1 
ATOM   6060  C  CZ2   . TRP B  1 334 ? 45.307  6.526   25.618  1.00   18.17 ? 441 TRP B CZ2   1 
ATOM   6061  C  CZ3   . TRP B  1 334 ? 47.133  5.560   26.890  1.00   17.34 ? 441 TRP B CZ3   1 
ATOM   6062  C  CH2   . TRP B  1 334 ? 46.655  6.385   25.854  1.00   16.05 ? 441 TRP B CH2   1 
ATOM   6063  N  N     . THR B  1 335 ? 42.984  6.541   30.590  1.00   25.90 ? 442 THR B N     1 
ATOM   6064  C  CA    . THR B  1 335 ? 42.041  7.654   30.651  1.00   24.36 ? 442 THR B CA    1 
ATOM   6065  C  C     . THR B  1 335 ? 41.617  8.008   29.222  1.00   23.91 ? 442 THR B C     1 
ATOM   6066  O  O     . THR B  1 335 ? 42.450  8.400   28.405  1.00   25.24 ? 442 THR B O     1 
ATOM   6067  C  CB    . THR B  1 335 ? 42.704  8.895   31.285  1.00   22.92 ? 442 THR B CB    1 
ATOM   6068  O  OG1   . THR B  1 335 ? 42.985  8.636   32.661  1.00   27.62 ? 442 THR B OG1   1 
ATOM   6069  C  CG2   . THR B  1 335 ? 41.806  10.096  31.178  1.00   20.94 ? 442 THR B CG2   1 
ATOM   6070  N  N     . THR B  1 336 ? 40.329  7.877   28.921  1.00   23.36 ? 443 THR B N     1 
ATOM   6071  C  CA    . THR B  1 336 ? 39.829  8.176   27.583  1.00   23.63 ? 443 THR B CA    1 
ATOM   6072  C  C     . THR B  1 336 ? 40.349  9.499   27.048  1.00   23.10 ? 443 THR B C     1 
ATOM   6073  O  O     . THR B  1 336 ? 40.257  10.520  27.722  1.00   24.25 ? 443 THR B O     1 
ATOM   6074  C  CB    . THR B  1 336 ? 38.298  8.200   27.552  1.00   23.08 ? 443 THR B CB    1 
ATOM   6075  O  OG1   . THR B  1 336 ? 37.809  6.857   27.605  1.00   28.32 ? 443 THR B OG1   1 
ATOM   6076  C  CG2   . THR B  1 336 ? 37.797  8.835   26.272  1.00   26.55 ? 443 THR B CG2   1 
ATOM   6077  N  N     . VAL B  1 337 ? 40.889  9.476   25.832  1.00   20.64 ? 444 VAL B N     1 
ATOM   6078  C  CA    . VAL B  1 337 ? 41.439  10.674  25.210  1.00   18.49 ? 444 VAL B CA    1 
ATOM   6079  C  C     . VAL B  1 337 ? 40.378  11.729  24.930  1.00   19.87 ? 444 VAL B C     1 
ATOM   6080  O  O     . VAL B  1 337 ? 39.183  11.433  24.845  1.00   20.31 ? 444 VAL B O     1 
ATOM   6081  C  CB    . VAL B  1 337 ? 42.183  10.339  23.881  1.00   20.33 ? 444 VAL B CB    1 
ATOM   6082  C  CG1   . VAL B  1 337 ? 43.355  9.391   24.163  1.00   16.15 ? 444 VAL B CG1   1 
ATOM   6083  C  CG2   . VAL B  1 337 ? 41.216  9.716   22.858  1.00   19.90 ? 444 VAL B CG2   1 
ATOM   6084  N  N     . ALA B  1 338 ? 40.827  12.971  24.803  1.00   20.31 ? 445 ALA B N     1 
ATOM   6085  C  CA    . ALA B  1 338 ? 39.935  14.087  24.532  1.00   19.02 ? 445 ALA B CA    1 
ATOM   6086  C  C     . ALA B  1 338 ? 39.273  13.956  23.159  1.00   19.10 ? 445 ALA B C     1 
ATOM   6087  O  O     . ALA B  1 338 ? 39.724  13.191  22.295  1.00   15.99 ? 445 ALA B O     1 
ATOM   6088  C  CB    . ALA B  1 338 ? 40.702  15.396  24.620  1.00   14.75 ? 445 ALA B CB    1 
ATOM   6089  N  N     . PRO B  1 339 ? 38.185  14.709  22.941  1.00   19.85 ? 446 PRO B N     1 
ATOM   6090  C  CA    . PRO B  1 339 ? 37.472  14.658  21.663  1.00   17.09 ? 446 PRO B CA    1 
ATOM   6091  C  C     . PRO B  1 339 ? 38.418  14.891  20.496  1.00   15.43 ? 446 PRO B C     1 
ATOM   6092  O  O     . PRO B  1 339 ? 39.335  15.693  20.587  1.00   17.93 ? 446 PRO B O     1 
ATOM   6093  C  CB    . PRO B  1 339 ? 36.428  15.761  21.817  1.00   14.36 ? 446 PRO B CB    1 
ATOM   6094  C  CG    . PRO B  1 339 ? 36.127  15.728  23.292  1.00   14.71 ? 446 PRO B CG    1 
ATOM   6095  C  CD    . PRO B  1 339 ? 37.510  15.618  23.888  1.00   16.36 ? 446 PRO B CD    1 
ATOM   6096  N  N     . GLN B  1 340 ? 38.193  14.178  19.404  1.00   15.18 ? 447 GLN B N     1 
ATOM   6097  C  CA    . GLN B  1 340 ? 39.032  14.298  18.219  1.00   15.66 ? 447 GLN B CA    1 
ATOM   6098  C  C     . GLN B  1 340 ? 38.837  15.633  17.507  1.00   16.81 ? 447 GLN B C     1 
ATOM   6099  O  O     . GLN B  1 340 ? 37.711  16.013  17.191  1.00   21.62 ? 447 GLN B O     1 
ATOM   6100  C  CB    . GLN B  1 340 ? 38.715  13.153  17.236  1.00   14.73 ? 447 GLN B CB    1 
ATOM   6101  C  CG    . GLN B  1 340 ? 39.499  13.202  15.927  1.00   15.78 ? 447 GLN B CG    1 
ATOM   6102  C  CD    . GLN B  1 340 ? 38.793  12.494  14.775  1.00   19.47 ? 447 GLN B CD    1 
ATOM   6103  O  OE1   . GLN B  1 340 ? 37.708  12.893  14.358  1.00   20.65 ? 447 GLN B OE1   1 
ATOM   6104  N  NE2   . GLN B  1 340 ? 39.411  11.443  14.254  1.00   22.53 ? 447 GLN B NE2   1 
ATOM   6105  N  N     . ARG B  1 341 ? 39.934  16.337  17.249  1.00   16.60 ? 448 ARG B N     1 
ATOM   6106  C  CA    . ARG B  1 341 ? 39.890  17.608  16.535  1.00   15.56 ? 448 ARG B CA    1 
ATOM   6107  C  C     . ARG B  1 341 ? 40.452  17.348  15.147  1.00   18.43 ? 448 ARG B C     1 
ATOM   6108  O  O     . ARG B  1 341 ? 41.281  16.452  14.965  1.00   18.08 ? 448 ARG B O     1 
ATOM   6109  C  CB    . ARG B  1 341 ? 40.773  18.651  17.214  1.00   17.28 ? 448 ARG B CB    1 
ATOM   6110  C  CG    . ARG B  1 341 ? 40.504  18.848  18.669  1.00   16.94 ? 448 ARG B CG    1 
ATOM   6111  C  CD    . ARG B  1 341 ? 41.285  20.012  19.195  1.00   15.36 ? 448 ARG B CD    1 
ATOM   6112  N  NE    . ARG B  1 341 ? 40.839  20.350  20.536  1.00   18.72 ? 448 ARG B NE    1 
ATOM   6113  C  CZ    . ARG B  1 341 ? 41.150  21.476  21.157  1.00   17.87 ? 448 ARG B CZ    1 
ATOM   6114  N  NH1   . ARG B  1 341 ? 40.699  21.706  22.381  1.00   18.98 ? 448 ARG B NH1   1 
ATOM   6115  N  NH2   . ARG B  1 341 ? 41.912  22.373  20.549  1.00   22.34 ? 448 ARG B NH2   1 
ATOM   6116  N  N     . LYS B  1 342 ? 40.021  18.146  14.175  1.00   20.21 ? 449 LYS B N     1 
ATOM   6117  C  CA    . LYS B  1 342 ? 40.484  18.006  12.794  1.00   18.58 ? 449 LYS B CA    1 
ATOM   6118  C  C     . LYS B  1 342 ? 40.881  19.386  12.283  1.00   18.82 ? 449 LYS B C     1 
ATOM   6119  O  O     . LYS B  1 342 ? 40.094  20.327  12.363  1.00   21.40 ? 449 LYS B O     1 
ATOM   6120  C  CB    . LYS B  1 342 ? 39.354  17.417  11.940  1.00   18.20 ? 449 LYS B CB    1 
ATOM   6121  C  CG    . LYS B  1 342 ? 39.689  17.168  10.472  1.00   19.67 ? 449 LYS B CG    1 
ATOM   6122  C  CD    . LYS B  1 342 ? 38.527  16.461  9.775   1.00   18.83 ? 449 LYS B CD    1 
ATOM   6123  C  CE    . LYS B  1 342 ? 38.807  16.211  8.304   1.00   18.25 ? 449 LYS B CE    1 
ATOM   6124  N  NZ    . LYS B  1 342 ? 37.694  15.453  7.655   1.00   19.41 ? 449 LYS B NZ    1 
ATOM   6125  N  N     . CYS B  1 343 ? 42.103  19.515  11.779  1.00   19.08 ? 450 CYS B N     1 
ATOM   6126  C  CA    . CYS B  1 343 ? 42.571  20.804  11.273  1.00   19.63 ? 450 CYS B CA    1 
ATOM   6127  C  C     . CYS B  1 343 ? 42.966  20.674  9.811   1.00   20.16 ? 450 CYS B C     1 
ATOM   6128  O  O     . CYS B  1 343 ? 43.901  19.948  9.471   1.00   19.97 ? 450 CYS B O     1 
ATOM   6129  C  CB    . CYS B  1 343 ? 43.759  21.304  12.111  1.00   20.24 ? 450 CYS B CB    1 
ATOM   6130  S  SG    . CYS B  1 343 ? 44.486  22.895  11.577  1.00   22.62 ? 450 CYS B SG    1 
ATOM   6131  N  N     . ILE B  1 344 ? 42.250  21.385  8.948   1.00   18.96 ? 451 ILE B N     1 
ATOM   6132  C  CA    . ILE B  1 344 ? 42.515  21.326  7.518   1.00   18.89 ? 451 ILE B CA    1 
ATOM   6133  C  C     . ILE B  1 344 ? 43.346  22.504  7.039   1.00   20.98 ? 451 ILE B C     1 
ATOM   6134  O  O     . ILE B  1 344 ? 43.013  23.650  7.318   1.00   22.20 ? 451 ILE B O     1 
ATOM   6135  C  CB    . ILE B  1 344 ? 41.212  21.316  6.724   1.00   18.56 ? 451 ILE B CB    1 
ATOM   6136  C  CG1   . ILE B  1 344 ? 40.302  20.205  7.262   1.00   17.48 ? 451 ILE B CG1   1 
ATOM   6137  C  CG2   . ILE B  1 344 ? 41.517  21.163  5.231   1.00   12.17 ? 451 ILE B CG2   1 
ATOM   6138  C  CD1   . ILE B  1 344 ? 38.947  20.172  6.603   1.00   13.75 ? 451 ILE B CD1   1 
ATOM   6139  N  N     . ILE B  1 345 ? 44.413  22.215  6.301   1.00   21.47 ? 452 ILE B N     1 
ATOM   6140  C  CA    . ILE B  1 345 ? 45.298  23.254  5.791   1.00   20.26 ? 452 ILE B CA    1 
ATOM   6141  C  C     . ILE B  1 345 ? 45.614  23.050  4.311   1.00   21.29 ? 452 ILE B C     1 
ATOM   6142  O  O     . ILE B  1 345 ? 46.388  22.164  3.960   1.00   19.48 ? 452 ILE B O     1 
ATOM   6143  C  CB    . ILE B  1 345 ? 46.634  23.253  6.564   1.00   21.41 ? 452 ILE B CB    1 
ATOM   6144  C  CG1   . ILE B  1 345 ? 46.370  23.336  8.064   1.00   20.05 ? 452 ILE B CG1   1 
ATOM   6145  C  CG2   . ILE B  1 345 ? 47.501  24.414  6.126   1.00   15.41 ? 452 ILE B CG2   1 
ATOM   6146  C  CD1   . ILE B  1 345 ? 47.527  22.806  8.894   1.00   25.22 ? 452 ILE B CD1   1 
ATOM   6147  N  N     . ASP B  1 346 ? 45.017  23.866  3.446   1.00   23.08 ? 453 ASP B N     1 
ATOM   6148  C  CA    . ASP B  1 346 ? 45.294  23.764  2.016   1.00   24.87 ? 453 ASP B CA    1 
ATOM   6149  C  C     . ASP B  1 346 ? 46.623  24.497  1.802   1.00   25.76 ? 453 ASP B C     1 
ATOM   6150  O  O     . ASP B  1 346 ? 46.749  25.662  2.145   1.00   30.37 ? 453 ASP B O     1 
ATOM   6151  C  CB    . ASP B  1 346 ? 44.179  24.413  1.201   1.00   23.15 ? 453 ASP B CB    1 
ATOM   6152  C  CG    . ASP B  1 346 ? 43.830  23.608  -0.052  1.00   28.14 ? 453 ASP B CG    1 
ATOM   6153  O  OD1   . ASP B  1 346 ? 44.538  22.620  -0.353  1.00   23.68 ? 453 ASP B OD1   1 
ATOM   6154  O  OD2   . ASP B  1 346 ? 42.846  23.964  -0.738  1.00   31.37 ? 453 ASP B OD2   1 
ATOM   6155  N  N     . ILE B  1 347 ? 47.611  23.815  1.238   1.00   25.40 ? 454 ILE B N     1 
ATOM   6156  C  CA    . ILE B  1 347 ? 48.932  24.404  1.053   1.00   23.90 ? 454 ILE B CA    1 
ATOM   6157  C  C     . ILE B  1 347 ? 49.211  25.227  -0.205  1.00   24.70 ? 454 ILE B C     1 
ATOM   6158  O  O     . ILE B  1 347 ? 49.729  26.339  -0.110  1.00   24.19 ? 454 ILE B O     1 
ATOM   6159  C  CB    . ILE B  1 347 ? 50.027  23.308  1.146   1.00   23.39 ? 454 ILE B CB    1 
ATOM   6160  C  CG1   . ILE B  1 347 ? 49.847  22.504  2.439   1.00   20.51 ? 454 ILE B CG1   1 
ATOM   6161  C  CG2   . ILE B  1 347 ? 51.424  23.940  1.077   1.00   21.71 ? 454 ILE B CG2   1 
ATOM   6162  C  CD1   . ILE B  1 347 ? 49.954  23.321  3.691   1.00   20.91 ? 454 ILE B CD1   1 
ATOM   6163  N  N     . LEU B  1 348 ? 48.883  24.687  -1.374  1.00   24.06 ? 455 LEU B N     1 
ATOM   6164  C  CA    . LEU B  1 348 ? 49.172  25.371  -2.626  1.00   24.63 ? 455 LEU B CA    1 
ATOM   6165  C  C     . LEU B  1 348 ? 48.378  26.627  -2.968  1.00   28.47 ? 455 LEU B C     1 
ATOM   6166  O  O     . LEU B  1 348 ? 47.160  26.681  -2.779  1.00   30.46 ? 455 LEU B O     1 
ATOM   6167  C  CB    . LEU B  1 348 ? 49.044  24.393  -3.788  1.00   22.63 ? 455 LEU B CB    1 
ATOM   6168  C  CG    . LEU B  1 348 ? 49.859  23.101  -3.721  1.00   21.93 ? 455 LEU B CG    1 
ATOM   6169  C  CD1   . LEU B  1 348 ? 49.771  22.404  -5.069  1.00   20.34 ? 455 LEU B CD1   1 
ATOM   6170  C  CD2   . LEU B  1 348 ? 51.309  23.387  -3.375  1.00   18.36 ? 455 LEU B CD2   1 
ATOM   6171  N  N     . THR B  1 349 ? 49.089  27.633  -3.482  1.00   30.55 ? 456 THR B N     1 
ATOM   6172  C  CA    . THR B  1 349 ? 48.475  28.890  -3.912  1.00   31.22 ? 456 THR B CA    1 
ATOM   6173  C  C     . THR B  1 349 ? 48.542  28.919  -5.441  1.00   31.47 ? 456 THR B C     1 
ATOM   6174  O  O     . THR B  1 349 ? 48.052  29.849  -6.081  1.00   32.68 ? 456 THR B O     1 
ATOM   6175  C  CB    . THR B  1 349 ? 49.228  30.125  -3.374  1.00   28.47 ? 456 THR B CB    1 
ATOM   6176  O  OG1   . THR B  1 349 ? 50.598  30.054  -3.773  1.00   31.21 ? 456 THR B OG1   1 
ATOM   6177  C  CG2   . THR B  1 349 ? 49.145  30.189  -1.865  1.00   24.84 ? 456 THR B CG2   1 
ATOM   6178  N  N     . GLU B  1 350 ? 49.152  27.885  -6.014  1.00   33.14 ? 457 GLU B N     1 
ATOM   6179  C  CA    . GLU B  1 350 ? 49.306  27.764  -7.462  1.00   35.20 ? 457 GLU B CA    1 
ATOM   6180  C  C     . GLU B  1 350 ? 49.843  26.373  -7.813  1.00   32.09 ? 457 GLU B C     1 
ATOM   6181  O  O     . GLU B  1 350 ? 50.535  25.744  -7.013  1.00   28.67 ? 457 GLU B O     1 
ATOM   6182  C  CB    . GLU B  1 350 ? 50.295  28.823  -7.982  1.00   38.72 ? 457 GLU B CB    1 
ATOM   6183  C  CG    . GLU B  1 350 ? 51.615  28.866  -7.183  1.00   47.87 ? 457 GLU B CG    1 
ATOM   6184  C  CD    . GLU B  1 350 ? 52.809  29.444  -7.968  1.00   52.96 ? 457 GLU B CD    1 
ATOM   6185  O  OE1   . GLU B  1 350 ? 52.713  30.591  -8.468  1.00   55.35 ? 457 GLU B OE1   1 
ATOM   6186  O  OE2   . GLU B  1 350 ? 53.851  28.745  -8.073  1.00   52.91 ? 457 GLU B OE2   1 
ATOM   6187  N  N     . PRO B  1 351 ? 49.512  25.866  -9.008  1.00   31.10 ? 458 PRO B N     1 
ATOM   6188  C  CA    . PRO B  1 351 ? 50.007  24.547  -9.411  1.00   30.93 ? 458 PRO B CA    1 
ATOM   6189  C  C     . PRO B  1 351 ? 51.531  24.548  -9.371  1.00   31.94 ? 458 PRO B C     1 
ATOM   6190  O  O     . PRO B  1 351 ? 52.155  25.609  -9.442  1.00   33.59 ? 458 PRO B O     1 
ATOM   6191  C  CB    . PRO B  1 351 ? 49.455  24.376  -10.830 1.00   30.15 ? 458 PRO B CB    1 
ATOM   6192  C  CG    . PRO B  1 351 ? 49.011  25.752  -11.232 1.00   30.95 ? 458 PRO B CG    1 
ATOM   6193  C  CD    . PRO B  1 351 ? 48.508  26.352  -9.959  1.00   31.21 ? 458 PRO B CD    1 
ATOM   6194  N  N     . LYS B  1 352 ? 52.130  23.370  -9.245  1.00   31.79 ? 459 LYS B N     1 
ATOM   6195  C  CA    . LYS B  1 352 ? 53.579  23.270  -9.184  1.00   30.26 ? 459 LYS B CA    1 
ATOM   6196  C  C     . LYS B  1 352 ? 54.046  22.205  -10.157 1.00   30.10 ? 459 LYS B C     1 
ATOM   6197  O  O     . LYS B  1 352 ? 53.429  21.139  -10.264 1.00   28.80 ? 459 LYS B O     1 
ATOM   6198  C  CB    . LYS B  1 352 ? 54.019  22.919  -7.761  1.00   32.92 ? 459 LYS B CB    1 
ATOM   6199  C  CG    . LYS B  1 352 ? 54.556  24.105  -6.958  1.00   34.77 ? 459 LYS B CG    1 
ATOM   6200  C  CD    . LYS B  1 352 ? 53.550  25.222  -6.841  1.00   36.04 ? 459 LYS B CD    1 
ATOM   6201  C  CE    . LYS B  1 352 ? 54.153  26.409  -6.112  1.00   37.65 ? 459 LYS B CE    1 
ATOM   6202  N  NZ    . LYS B  1 352 ? 54.625  26.036  -4.748  1.00   38.58 ? 459 LYS B NZ    1 
ATOM   6203  N  N     . ASP B  1 353 ? 55.122  22.493  -10.882 1.00   29.25 ? 460 ASP B N     1 
ATOM   6204  C  CA    . ASP B  1 353 ? 55.635  21.526  -11.838 1.00   29.75 ? 460 ASP B CA    1 
ATOM   6205  C  C     . ASP B  1 353 ? 56.480  20.510  -11.086 1.00   29.36 ? 460 ASP B C     1 
ATOM   6206  O  O     . ASP B  1 353 ? 57.290  20.881  -10.233 1.00   28.14 ? 460 ASP B O     1 
ATOM   6207  C  CB    . ASP B  1 353 ? 56.478  22.218  -12.893 1.00   29.31 ? 460 ASP B CB    1 
ATOM   6208  C  CG    . ASP B  1 353 ? 56.711  21.342  -14.101 1.00   32.24 ? 460 ASP B CG    1 
ATOM   6209  O  OD1   . ASP B  1 353 ? 55.710  20.973  -14.755 1.00   35.09 ? 460 ASP B OD1   1 
ATOM   6210  O  OD2   . ASP B  1 353 ? 57.886  21.022  -14.398 1.00   31.66 ? 460 ASP B OD2   1 
ATOM   6211  N  N     . ILE B  1 354 ? 56.292  19.230  -11.393 1.00   28.79 ? 461 ILE B N     1 
ATOM   6212  C  CA    . ILE B  1 354 ? 57.040  18.195  -10.701 1.00   29.76 ? 461 ILE B CA    1 
ATOM   6213  C  C     . ILE B  1 354 ? 58.456  18.011  -11.252 1.00   31.04 ? 461 ILE B C     1 
ATOM   6214  O  O     . ILE B  1 354 ? 59.439  18.078  -10.502 1.00   31.22 ? 461 ILE B O     1 
ATOM   6215  C  CB    . ILE B  1 354 ? 56.272  16.859  -10.734 1.00   28.50 ? 461 ILE B CB    1 
ATOM   6216  C  CG1   . ILE B  1 354 ? 55.042  16.964  -9.824  1.00   27.38 ? 461 ILE B CG1   1 
ATOM   6217  C  CG2   . ILE B  1 354 ? 57.174  15.722  -10.275 1.00   27.49 ? 461 ILE B CG2   1 
ATOM   6218  C  CD1   . ILE B  1 354 ? 54.063  15.843  -9.974  1.00   23.99 ? 461 ILE B CD1   1 
ATOM   6219  N  N     . GLY B  1 355 ? 58.570  17.787  -12.555 1.00   27.76 ? 462 GLY B N     1 
ATOM   6220  C  CA    . GLY B  1 355 ? 59.889  17.607  -13.126 1.00   28.79 ? 462 GLY B CA    1 
ATOM   6221  C  C     . GLY B  1 355 ? 60.660  16.460  -12.482 1.00   33.19 ? 462 GLY B C     1 
ATOM   6222  O  O     . GLY B  1 355 ? 60.096  15.385  -12.222 1.00   35.44 ? 462 GLY B O     1 
ATOM   6223  N  N     . LYS B  1 356 ? 61.947  16.683  -12.216 1.00   31.32 ? 463 LYS B N     1 
ATOM   6224  C  CA    . LYS B  1 356 ? 62.790  15.657  -11.617 1.00   30.92 ? 463 LYS B CA    1 
ATOM   6225  C  C     . LYS B  1 356 ? 62.541  15.568  -10.123 1.00   30.84 ? 463 LYS B C     1 
ATOM   6226  O  O     . LYS B  1 356 ? 62.580  14.485  -9.533  1.00   29.31 ? 463 LYS B O     1 
ATOM   6227  C  CB    . LYS B  1 356 ? 64.265  15.965  -11.856 1.00   29.98 ? 463 LYS B CB    1 
ATOM   6228  C  CG    . LYS B  1 356 ? 65.060  14.782  -12.381 1.00   34.64 ? 463 LYS B CG    1 
ATOM   6229  C  CD    . LYS B  1 356 ? 65.002  13.551  -11.469 1.00   35.10 ? 463 LYS B CD    1 
ATOM   6230  C  CE    . LYS B  1 356 ? 65.660  12.368  -12.175 1.00   37.53 ? 463 LYS B CE    1 
ATOM   6231  N  NZ    . LYS B  1 356 ? 65.721  11.127  -11.341 1.00   40.34 ? 463 LYS B NZ    1 
ATOM   6232  N  N     . ARG B  1 357 ? 62.297  16.721  -9.512  1.00   31.12 ? 464 ARG B N     1 
ATOM   6233  C  CA    . ARG B  1 357 ? 62.039  16.782  -8.082  1.00   30.41 ? 464 ARG B CA    1 
ATOM   6234  C  C     . ARG B  1 357 ? 61.295  18.058  -7.728  1.00   27.95 ? 464 ARG B C     1 
ATOM   6235  O  O     . ARG B  1 357 ? 61.546  19.123  -8.294  1.00   26.76 ? 464 ARG B O     1 
ATOM   6236  C  CB    . ARG B  1 357 ? 63.346  16.723  -7.283  1.00   30.46 ? 464 ARG B CB    1 
ATOM   6237  C  CG    . ARG B  1 357 ? 63.127  16.781  -5.769  1.00   32.95 ? 464 ARG B CG    1 
ATOM   6238  C  CD    . ARG B  1 357 ? 64.446  16.791  -5.014  1.00   36.75 ? 464 ARG B CD    1 
ATOM   6239  N  NE    . ARG B  1 357 ? 64.353  16.102  -3.721  1.00   41.74 ? 464 ARG B NE    1 
ATOM   6240  C  CZ    . ARG B  1 357 ? 64.156  16.708  -2.547  1.00   45.47 ? 464 ARG B CZ    1 
ATOM   6241  N  NH1   . ARG B  1 357 ? 64.088  15.982  -1.433  1.00   45.14 ? 464 ARG B NH1   1 
ATOM   6242  N  NH2   . ARG B  1 357 ? 64.038  18.041  -2.480  1.00   44.26 ? 464 ARG B NH2   1 
ATOM   6243  N  N     . LEU B  1 358 ? 60.372  17.935  -6.784  1.00   26.29 ? 465 LEU B N     1 
ATOM   6244  C  CA    . LEU B  1 358 ? 59.590  19.066  -6.320  1.00   24.93 ? 465 LEU B CA    1 
ATOM   6245  C  C     . LEU B  1 358 ? 59.602  19.079  -4.808  1.00   25.20 ? 465 LEU B C     1 
ATOM   6246  O  O     . LEU B  1 358 ? 59.473  18.039  -4.161  1.00   26.91 ? 465 LEU B O     1 
ATOM   6247  C  CB    . LEU B  1 358 ? 58.146  18.966  -6.806  1.00   24.86 ? 465 LEU B CB    1 
ATOM   6248  C  CG    . LEU B  1 358 ? 57.163  19.947  -6.152  1.00   25.57 ? 465 LEU B CG    1 
ATOM   6249  C  CD1   . LEU B  1 358 ? 57.556  21.383  -6.473  1.00   23.89 ? 465 LEU B CD1   1 
ATOM   6250  C  CD2   . LEU B  1 358 ? 55.755  19.662  -6.645  1.00   24.97 ? 465 LEU B CD2   1 
ATOM   6251  N  N     . GLU B  1 359 ? 59.757  20.260  -4.238  1.00   24.54 ? 466 GLU B N     1 
ATOM   6252  C  CA    . GLU B  1 359 ? 59.771  20.369  -2.799  1.00   25.07 ? 466 GLU B CA    1 
ATOM   6253  C  C     . GLU B  1 359 ? 58.806  21.483  -2.425  1.00   24.32 ? 466 GLU B C     1 
ATOM   6254  O  O     . GLU B  1 359 ? 58.828  22.552  -3.030  1.00   24.96 ? 466 GLU B O     1 
ATOM   6255  C  CB    . GLU B  1 359 ? 61.177  20.694  -2.329  1.00   25.92 ? 466 GLU B CB    1 
ATOM   6256  C  CG    . GLU B  1 359 ? 61.458  20.299  -0.921  1.00   31.93 ? 466 GLU B CG    1 
ATOM   6257  C  CD    . GLU B  1 359 ? 62.836  20.742  -0.490  1.00   35.83 ? 466 GLU B CD    1 
ATOM   6258  O  OE1   . GLU B  1 359 ? 63.005  21.951  -0.211  1.00   36.95 ? 466 GLU B OE1   1 
ATOM   6259  O  OE2   . GLU B  1 359 ? 63.747  19.882  -0.450  1.00   33.44 ? 466 GLU B OE2   1 
ATOM   6260  N  N     . VAL B  1 360 ? 57.938  21.221  -1.453  1.00   23.00 ? 467 VAL B N     1 
ATOM   6261  C  CA    . VAL B  1 360 ? 56.981  22.219  -1.013  1.00   20.47 ? 467 VAL B CA    1 
ATOM   6262  C  C     . VAL B  1 360 ? 57.081  22.379  0.492   1.00   21.73 ? 467 VAL B C     1 
ATOM   6263  O  O     . VAL B  1 360 ? 56.878  21.429  1.248   1.00   24.09 ? 467 VAL B O     1 
ATOM   6264  C  CB    . VAL B  1 360 ? 55.548  21.820  -1.403  1.00   20.02 ? 467 VAL B CB    1 
ATOM   6265  C  CG1   . VAL B  1 360 ? 54.569  22.874  -0.933  1.00   17.20 ? 467 VAL B CG1   1 
ATOM   6266  C  CG2   . VAL B  1 360 ? 55.455  21.657  -2.913  1.00   14.56 ? 467 VAL B CG2   1 
ATOM   6267  N  N     . ARG B  1 361 ? 57.423  23.585  0.922   1.00   21.65 ? 468 ARG B N     1 
ATOM   6268  C  CA    . ARG B  1 361 ? 57.554  23.883  2.342   1.00   23.86 ? 468 ARG B CA    1 
ATOM   6269  C  C     . ARG B  1 361 ? 56.386  24.730  2.803   1.00   23.74 ? 468 ARG B C     1 
ATOM   6270  O  O     . ARG B  1 361 ? 55.805  25.471  2.016   1.00   25.05 ? 468 ARG B O     1 
ATOM   6271  C  CB    . ARG B  1 361 ? 58.862  24.622  2.609   1.00   23.76 ? 468 ARG B CB    1 
ATOM   6272  C  CG    . ARG B  1 361 ? 60.064  23.722  2.497   1.00   25.55 ? 468 ARG B CG    1 
ATOM   6273  C  CD    . ARG B  1 361 ? 61.357  24.484  2.368   1.00   24.21 ? 468 ARG B CD    1 
ATOM   6274  N  NE    . ARG B  1 361 ? 62.443  23.522  2.293   1.00   29.88 ? 468 ARG B NE    1 
ATOM   6275  C  CZ    . ARG B  1 361 ? 62.941  22.879  3.346   1.00   31.57 ? 468 ARG B CZ    1 
ATOM   6276  N  NH1   . ARG B  1 361 ? 63.922  22.001  3.180   1.00   30.77 ? 468 ARG B NH1   1 
ATOM   6277  N  NH2   . ARG B  1 361 ? 62.485  23.140  4.570   1.00   31.96 ? 468 ARG B NH2   1 
ATOM   6278  N  N     . LYS B  1 362 ? 56.042  24.622  4.079   1.00   22.90 ? 469 LYS B N     1 
ATOM   6279  C  CA    . LYS B  1 362 ? 54.932  25.385  4.605   1.00   22.61 ? 469 LYS B CA    1 
ATOM   6280  C  C     . LYS B  1 362 ? 54.937  25.349  6.119   1.00   20.70 ? 469 LYS B C     1 
ATOM   6281  O  O     . LYS B  1 362 ? 54.982  24.287  6.727   1.00   21.56 ? 469 LYS B O     1 
ATOM   6282  C  CB    . LYS B  1 362 ? 53.616  24.818  4.059   1.00   25.66 ? 469 LYS B CB    1 
ATOM   6283  C  CG    . LYS B  1 362 ? 52.341  25.406  4.664   1.00   30.23 ? 469 LYS B CG    1 
ATOM   6284  C  CD    . LYS B  1 362 ? 52.091  26.838  4.229   1.00   32.25 ? 469 LYS B CD    1 
ATOM   6285  C  CE    . LYS B  1 362 ? 50.807  27.364  4.857   1.00   34.94 ? 469 LYS B CE    1 
ATOM   6286  N  NZ    . LYS B  1 362 ? 50.453  28.729  4.382   1.00   36.02 ? 469 LYS B NZ    1 
ATOM   6287  N  N     . THR B  1 363 ? 54.906  26.524  6.724   1.00   19.33 ? 470 THR B N     1 
ATOM   6288  C  CA    . THR B  1 363 ? 54.883  26.611  8.166   1.00   19.10 ? 470 THR B CA    1 
ATOM   6289  C  C     . THR B  1 363 ? 53.417  26.742  8.528   1.00   18.66 ? 470 THR B C     1 
ATOM   6290  O  O     . THR B  1 363 ? 52.726  27.605  7.996   1.00   19.56 ? 470 THR B O     1 
ATOM   6291  C  CB    . THR B  1 363 ? 55.650  27.829  8.656   1.00   16.24 ? 470 THR B CB    1 
ATOM   6292  O  OG1   . THR B  1 363 ? 57.029  27.696  8.280   1.00   16.45 ? 470 THR B OG1   1 
ATOM   6293  C  CG2   . THR B  1 363 ? 55.532  27.953  10.149  1.00   12.05 ? 470 THR B CG2   1 
ATOM   6294  N  N     . VAL B  1 364 ? 52.944  25.865  9.407   1.00   18.50 ? 471 VAL B N     1 
ATOM   6295  C  CA    . VAL B  1 364 ? 51.548  25.874  9.814   1.00   17.15 ? 471 VAL B CA    1 
ATOM   6296  C  C     . VAL B  1 364 ? 51.457  26.148  11.303  1.00   18.47 ? 471 VAL B C     1 
ATOM   6297  O  O     . VAL B  1 364 ? 52.419  25.917  12.040  1.00   20.27 ? 471 VAL B O     1 
ATOM   6298  C  CB    . VAL B  1 364 ? 50.863  24.513  9.508   1.00   16.73 ? 471 VAL B CB    1 
ATOM   6299  C  CG1   . VAL B  1 364 ? 51.050  24.158  8.037   1.00   14.57 ? 471 VAL B CG1   1 
ATOM   6300  C  CG2   . VAL B  1 364 ? 51.433  23.415  10.418  1.00   12.60 ? 471 VAL B CG2   1 
ATOM   6301  N  N     . THR B  1 365 ? 50.305  26.642  11.743  1.00   17.42 ? 472 THR B N     1 
ATOM   6302  C  CA    . THR B  1 365 ? 50.110  26.915  13.154  1.00   18.89 ? 472 THR B CA    1 
ATOM   6303  C  C     . THR B  1 365 ? 49.196  25.854  13.747  1.00   21.49 ? 472 THR B C     1 
ATOM   6304  O  O     . THR B  1 365 ? 48.849  25.913  14.927  1.00   22.19 ? 472 THR B O     1 
ATOM   6305  C  CB    . THR B  1 365 ? 49.483  28.291  13.381  1.00   17.72 ? 472 THR B CB    1 
ATOM   6306  O  OG1   . THR B  1 365 ? 48.166  28.317  12.829  1.00   21.09 ? 472 THR B OG1   1 
ATOM   6307  C  CG2   . THR B  1 365 ? 50.314  29.353  12.723  1.00   15.88 ? 472 THR B CG2   1 
ATOM   6308  N  N     . ALA B  1 366 ? 48.806  24.889  12.915  1.00   23.14 ? 473 ALA B N     1 
ATOM   6309  C  CA    . ALA B  1 366 ? 47.940  23.799  13.347  1.00   22.69 ? 473 ALA B CA    1 
ATOM   6310  C  C     . ALA B  1 366 ? 46.669  24.321  14.010  1.00   23.71 ? 473 ALA B C     1 
ATOM   6311  O  O     . ALA B  1 366 ? 46.280  23.863  15.088  1.00   23.31 ? 473 ALA B O     1 
ATOM   6312  C  CB    . ALA B  1 366 ? 48.702  22.878  14.310  1.00   22.26 ? 473 ALA B CB    1 
ATOM   6313  N  N     . CYS B  1 367 ? 46.033  25.293  13.362  1.00   24.05 ? 474 CYS B N     1 
ATOM   6314  C  CA    . CYS B  1 367 ? 44.790  25.870  13.862  1.00   22.99 ? 474 CYS B CA    1 
ATOM   6315  C  C     . CYS B  1 367 ? 44.894  26.541  15.232  1.00   23.50 ? 474 CYS B C     1 
ATOM   6316  O  O     . CYS B  1 367 ? 43.970  26.453  16.049  1.00   23.18 ? 474 CYS B O     1 
ATOM   6317  C  CB    . CYS B  1 367 ? 43.704  24.786  13.885  1.00   22.24 ? 474 CYS B CB    1 
ATOM   6318  S  SG    . CYS B  1 367 ? 43.155  24.296  12.219  1.00   25.18 ? 474 CYS B SG    1 
ATOM   6319  N  N     . LEU B  1 368 ? 46.011  27.225  15.474  1.00   23.27 ? 475 LEU B N     1 
ATOM   6320  C  CA    . LEU B  1 368 ? 46.220  27.924  16.737  1.00   21.96 ? 475 LEU B CA    1 
ATOM   6321  C  C     . LEU B  1 368 ? 45.108  28.940  16.926  1.00   24.52 ? 475 LEU B C     1 
ATOM   6322  O  O     . LEU B  1 368 ? 44.718  29.621  15.982  1.00   25.21 ? 475 LEU B O     1 
ATOM   6323  C  CB    . LEU B  1 368 ? 47.563  28.653  16.721  1.00   21.11 ? 475 LEU B CB    1 
ATOM   6324  C  CG    . LEU B  1 368 ? 47.952  29.426  17.986  1.00   16.68 ? 475 LEU B CG    1 
ATOM   6325  C  CD1   . LEU B  1 368 ? 48.046  28.472  19.152  1.00   14.84 ? 475 LEU B CD1   1 
ATOM   6326  C  CD2   . LEU B  1 368 ? 49.279  30.115  17.784  1.00   10.96 ? 475 LEU B CD2   1 
ATOM   6327  N  N     . GLY B  1 369 ? 44.590  29.036  18.144  1.00   26.55 ? 476 GLY B N     1 
ATOM   6328  C  CA    . GLY B  1 369 ? 43.537  29.994  18.418  1.00   27.16 ? 476 GLY B CA    1 
ATOM   6329  C  C     . GLY B  1 369 ? 42.146  29.568  17.995  1.00   29.67 ? 476 GLY B C     1 
ATOM   6330  O  O     . GLY B  1 369 ? 41.188  30.288  18.263  1.00   32.15 ? 476 GLY B O     1 
ATOM   6331  N  N     . GLU B  1 370 ? 42.019  28.423  17.328  1.00   30.50 ? 477 GLU B N     1 
ATOM   6332  C  CA    . GLU B  1 370 ? 40.708  27.942  16.900  1.00   32.37 ? 477 GLU B CA    1 
ATOM   6333  C  C     . GLU B  1 370 ? 40.295  26.746  17.772  1.00   31.38 ? 477 GLU B C     1 
ATOM   6334  O  O     . GLU B  1 370 ? 41.118  26.172  18.493  1.00   29.38 ? 477 GLU B O     1 
ATOM   6335  C  CB    . GLU B  1 370 ? 40.742  27.513  15.436  1.00   37.90 ? 477 GLU B CB    1 
ATOM   6336  C  CG    . GLU B  1 370 ? 41.257  28.559  14.455  1.00   43.75 ? 477 GLU B CG    1 
ATOM   6337  C  CD    . GLU B  1 370 ? 41.473  27.971  13.038  1.00   49.57 ? 477 GLU B CD    1 
ATOM   6338  O  OE1   . GLU B  1 370 ? 42.144  28.628  12.202  1.00   49.57 ? 477 GLU B OE1   1 
ATOM   6339  O  OE2   . GLU B  1 370 ? 40.964  26.850  12.768  1.00   49.61 ? 477 GLU B OE2   1 
ATOM   6340  N  N     . PRO B  1 371 ? 39.011  26.356  17.719  1.00   31.19 ? 478 PRO B N     1 
ATOM   6341  C  CA    . PRO B  1 371 ? 38.494  25.230  18.508  1.00   28.76 ? 478 PRO B CA    1 
ATOM   6342  C  C     . PRO B  1 371 ? 39.145  23.894  18.149  1.00   27.13 ? 478 PRO B C     1 
ATOM   6343  O  O     . PRO B  1 371 ? 39.137  22.957  18.951  1.00   24.58 ? 478 PRO B O     1 
ATOM   6344  C  CB    . PRO B  1 371 ? 36.999  25.230  18.183  1.00   30.09 ? 478 PRO B CB    1 
ATOM   6345  C  CG    . PRO B  1 371 ? 36.722  26.635  17.847  1.00   31.91 ? 478 PRO B CG    1 
ATOM   6346  C  CD    . PRO B  1 371 ? 37.913  27.020  17.000  1.00   31.64 ? 478 PRO B CD    1 
ATOM   6347  N  N     . ASN B  1 372 ? 39.699  23.808  16.942  1.00   25.51 ? 479 ASN B N     1 
ATOM   6348  C  CA    . ASN B  1 372 ? 40.338  22.583  16.475  1.00   25.27 ? 479 ASN B CA    1 
ATOM   6349  C  C     . ASN B  1 372 ? 41.864  22.684  16.456  1.00   25.04 ? 479 ASN B C     1 
ATOM   6350  O  O     . ASN B  1 372 ? 42.538  22.071  15.621  1.00   25.14 ? 479 ASN B O     1 
ATOM   6351  C  CB    . ASN B  1 372 ? 39.822  22.250  15.084  1.00   28.44 ? 479 ASN B CB    1 
ATOM   6352  C  CG    . ASN B  1 372 ? 39.868  23.449  14.165  1.00   32.56 ? 479 ASN B CG    1 
ATOM   6353  O  OD1   . ASN B  1 372 ? 39.644  23.335  12.964  1.00   36.97 ? 479 ASN B OD1   1 
ATOM   6354  N  ND2   . ASN B  1 372 ? 40.160  24.616  14.731  1.00   31.07 ? 479 ASN B ND2   1 
ATOM   6355  N  N     . HIS B  1 373 ? 42.403  23.469  17.379  1.00   24.46 ? 480 HIS B N     1 
ATOM   6356  C  CA    . HIS B  1 373 ? 43.842  23.645  17.514  1.00   22.74 ? 480 HIS B CA    1 
ATOM   6357  C  C     . HIS B  1 373 ? 44.392  22.290  17.941  1.00   22.69 ? 480 HIS B C     1 
ATOM   6358  O  O     . HIS B  1 373 ? 43.820  21.639  18.812  1.00   22.60 ? 480 HIS B O     1 
ATOM   6359  C  CB    . HIS B  1 373 ? 44.116  24.721  18.581  1.00   23.49 ? 480 HIS B CB    1 
ATOM   6360  C  CG    . HIS B  1 373 ? 45.535  24.775  19.066  1.00   24.58 ? 480 HIS B CG    1 
ATOM   6361  N  ND1   . HIS B  1 373 ? 46.622  24.750  18.218  1.00   25.21 ? 480 HIS B ND1   1 
ATOM   6362  C  CD2   . HIS B  1 373 ? 46.042  24.901  20.317  1.00   22.74 ? 480 HIS B CD2   1 
ATOM   6363  C  CE1   . HIS B  1 373 ? 47.735  24.858  18.923  1.00   22.63 ? 480 HIS B CE1   1 
ATOM   6364  N  NE2   . HIS B  1 373 ? 47.410  24.951  20.199  1.00   21.30 ? 480 HIS B NE2   1 
ATOM   6365  N  N     . ILE B  1 374 ? 45.488  21.857  17.322  1.00   21.83 ? 481 ILE B N     1 
ATOM   6366  C  CA    . ILE B  1 374 ? 46.097  20.561  17.645  1.00   18.85 ? 481 ILE B CA    1 
ATOM   6367  C  C     . ILE B  1 374 ? 47.542  20.687  18.124  1.00   18.80 ? 481 ILE B C     1 
ATOM   6368  O  O     . ILE B  1 374 ? 48.380  21.279  17.441  1.00   17.67 ? 481 ILE B O     1 
ATOM   6369  C  CB    . ILE B  1 374 ? 46.102  19.619  16.409  1.00   17.08 ? 481 ILE B CB    1 
ATOM   6370  C  CG1   . ILE B  1 374 ? 44.677  19.237  16.033  1.00   17.46 ? 481 ILE B CG1   1 
ATOM   6371  C  CG2   . ILE B  1 374 ? 46.962  18.377  16.678  1.00   14.05 ? 481 ILE B CG2   1 
ATOM   6372  C  CD1   . ILE B  1 374 ? 44.605  18.320  14.824  1.00   17.77 ? 481 ILE B CD1   1 
ATOM   6373  N  N     . THR B  1 375 ? 47.834  20.120  19.291  1.00   18.24 ? 482 THR B N     1 
ATOM   6374  C  CA    . THR B  1 375 ? 49.195  20.153  19.824  1.00   19.65 ? 482 THR B CA    1 
ATOM   6375  C  C     . THR B  1 375 ? 49.722  18.728  19.943  1.00   20.44 ? 482 THR B C     1 
ATOM   6376  O  O     . THR B  1 375 ? 50.928  18.501  19.997  1.00   23.46 ? 482 THR B O     1 
ATOM   6377  C  CB    . THR B  1 375 ? 49.264  20.814  21.213  1.00   18.50 ? 482 THR B CB    1 
ATOM   6378  O  OG1   . THR B  1 375 ? 48.446  20.085  22.139  1.00   20.75 ? 482 THR B OG1   1 
ATOM   6379  C  CG2   . THR B  1 375 ? 48.804  22.252  21.135  1.00   19.04 ? 482 THR B CG2   1 
ATOM   6380  N  N     . ARG B  1 376 ? 48.801  17.773  19.977  1.00   20.06 ? 483 ARG B N     1 
ATOM   6381  C  CA    . ARG B  1 376 ? 49.136  16.362  20.079  1.00   21.21 ? 483 ARG B CA    1 
ATOM   6382  C  C     . ARG B  1 376 ? 48.530  15.680  18.849  1.00   21.40 ? 483 ARG B C     1 
ATOM   6383  O  O     . ARG B  1 376 ? 47.320  15.450  18.782  1.00   21.22 ? 483 ARG B O     1 
ATOM   6384  C  CB    . ARG B  1 376 ? 48.535  15.774  21.355  1.00   23.81 ? 483 ARG B CB    1 
ATOM   6385  C  CG    . ARG B  1 376 ? 49.480  14.915  22.156  1.00   26.04 ? 483 ARG B CG    1 
ATOM   6386  C  CD    . ARG B  1 376 ? 48.738  14.182  23.261  1.00   32.71 ? 483 ARG B CD    1 
ATOM   6387  N  NE    . ARG B  1 376 ? 49.643  13.334  24.029  1.00   37.34 ? 483 ARG B NE    1 
ATOM   6388  C  CZ    . ARG B  1 376 ? 49.303  12.168  24.573  1.00   39.96 ? 483 ARG B CZ    1 
ATOM   6389  N  NH1   . ARG B  1 376 ? 50.207  11.469  25.251  1.00   40.59 ? 483 ARG B NH1   1 
ATOM   6390  N  NH2   . ARG B  1 376 ? 48.062  11.695  24.441  1.00   41.97 ? 483 ARG B NH2   1 
ATOM   6391  N  N     . LEU B  1 377 ? 49.376  15.357  17.878  1.00   20.73 ? 484 LEU B N     1 
ATOM   6392  C  CA    . LEU B  1 377 ? 48.917  14.744  16.644  1.00   18.96 ? 484 LEU B CA    1 
ATOM   6393  C  C     . LEU B  1 377 ? 48.570  13.262  16.739  1.00   17.85 ? 484 LEU B C     1 
ATOM   6394  O  O     . LEU B  1 377 ? 49.105  12.533  17.563  1.00   17.74 ? 484 LEU B O     1 
ATOM   6395  C  CB    . LEU B  1 377 ? 49.979  14.936  15.562  1.00   17.12 ? 484 LEU B CB    1 
ATOM   6396  C  CG    . LEU B  1 377 ? 49.573  14.540  14.142  1.00   21.48 ? 484 LEU B CG    1 
ATOM   6397  C  CD1   . LEU B  1 377 ? 48.600  15.574  13.587  1.00   22.39 ? 484 LEU B CD1   1 
ATOM   6398  C  CD2   . LEU B  1 377 ? 50.803  14.461  13.251  1.00   20.95 ? 484 LEU B CD2   1 
ATOM   6399  N  N     . GLU B  1 378 ? 47.644  12.831  15.894  1.00   17.88 ? 485 GLU B N     1 
ATOM   6400  C  CA    . GLU B  1 378 ? 47.271  11.422  15.814  1.00   18.41 ? 485 GLU B CA    1 
ATOM   6401  C  C     . GLU B  1 378 ? 47.552  11.053  14.353  1.00   18.18 ? 485 GLU B C     1 
ATOM   6402  O  O     . GLU B  1 378 ? 48.721  10.929  13.973  1.00   17.62 ? 485 GLU B O     1 
ATOM   6403  C  CB    . GLU B  1 378 ? 45.800  11.216  16.204  1.00   16.01 ? 485 GLU B CB    1 
ATOM   6404  C  CG    . GLU B  1 378 ? 45.604  11.336  17.706  1.00   15.09 ? 485 GLU B CG    1 
ATOM   6405  C  CD    . GLU B  1 378 ? 44.157  11.283  18.167  1.00   16.39 ? 485 GLU B CD    1 
ATOM   6406  O  OE1   . GLU B  1 378 ? 43.939  11.442  19.390  1.00   14.95 ? 485 GLU B OE1   1 
ATOM   6407  O  OE2   . GLU B  1 378 ? 43.240  11.085  17.336  1.00   14.41 ? 485 GLU B OE2   1 
ATOM   6408  N  N     . HIS B  1 379 ? 46.520  10.891  13.529  1.00   15.15 ? 486 HIS B N     1 
ATOM   6409  C  CA    . HIS B  1 379 ? 46.764  10.581  12.122  1.00   12.64 ? 486 HIS B CA    1 
ATOM   6410  C  C     . HIS B  1 379 ? 47.013  11.886  11.383  1.00   13.31 ? 486 HIS B C     1 
ATOM   6411  O  O     . HIS B  1 379 ? 46.639  12.956  11.845  1.00   14.08 ? 486 HIS B O     1 
ATOM   6412  C  CB    . HIS B  1 379 ? 45.557  9.914   11.468  1.00   10.18 ? 486 HIS B CB    1 
ATOM   6413  C  CG    . HIS B  1 379 ? 44.959  8.816   12.277  1.00   9.60  ? 486 HIS B CG    1 
ATOM   6414  N  ND1   . HIS B  1 379 ? 44.006  9.044   13.244  1.00   7.64  ? 486 HIS B ND1   1 
ATOM   6415  C  CD2   . HIS B  1 379 ? 45.168  7.477   12.255  1.00   10.77 ? 486 HIS B CD2   1 
ATOM   6416  C  CE1   . HIS B  1 379 ? 43.646  7.890   13.780  1.00   12.89 ? 486 HIS B CE1   1 
ATOM   6417  N  NE2   . HIS B  1 379 ? 44.336  6.924   13.196  1.00   11.88 ? 486 HIS B NE2   1 
ATOM   6418  N  N     . ALA B  1 380 ? 47.655  11.796  10.232  1.00   14.81 ? 487 ALA B N     1 
ATOM   6419  C  CA    . ALA B  1 380 ? 47.895  12.971  9.400   1.00   16.11 ? 487 ALA B CA    1 
ATOM   6420  C  C     . ALA B  1 380 ? 47.733  12.514  7.952   1.00   15.65 ? 487 ALA B C     1 
ATOM   6421  O  O     . ALA B  1 380 ? 48.234  11.455  7.570   1.00   15.61 ? 487 ALA B O     1 
ATOM   6422  C  CB    . ALA B  1 380 ? 49.303  13.537  9.633   1.00   12.71 ? 487 ALA B CB    1 
ATOM   6423  N  N     . GLN B  1 381 ? 47.002  13.292  7.163   1.00   14.87 ? 488 GLN B N     1 
ATOM   6424  C  CA    . GLN B  1 381 ? 46.793  12.962  5.761   1.00   15.78 ? 488 GLN B CA    1 
ATOM   6425  C  C     . GLN B  1 381 ? 47.353  14.050  4.884   1.00   14.96 ? 488 GLN B C     1 
ATOM   6426  O  O     . GLN B  1 381 ? 47.298  15.227  5.226   1.00   16.99 ? 488 GLN B O     1 
ATOM   6427  C  CB    . GLN B  1 381 ? 45.305  12.824  5.428   1.00   15.56 ? 488 GLN B CB    1 
ATOM   6428  C  CG    . GLN B  1 381 ? 44.570  11.747  6.192   1.00   19.67 ? 488 GLN B CG    1 
ATOM   6429  C  CD    . GLN B  1 381 ? 43.070  11.759  5.924   1.00   20.60 ? 488 GLN B CD    1 
ATOM   6430  O  OE1   . GLN B  1 381 ? 42.424  12.811  5.982   1.00   20.80 ? 488 GLN B OE1   1 
ATOM   6431  N  NE2   . GLN B  1 381 ? 42.506  10.582  5.645   1.00   19.10 ? 488 GLN B NE2   1 
ATOM   6432  N  N     . ALA B  1 382 ? 47.907  13.644  3.756   1.00   15.36 ? 489 ALA B N     1 
ATOM   6433  C  CA    . ALA B  1 382 ? 48.416  14.584  2.782   1.00   15.95 ? 489 ALA B CA    1 
ATOM   6434  C  C     . ALA B  1 382 ? 47.587  14.251  1.540   1.00   17.19 ? 489 ALA B C     1 
ATOM   6435  O  O     . ALA B  1 382 ? 47.887  13.310  0.809   1.00   17.63 ? 489 ALA B O     1 
ATOM   6436  C  CB    . ALA B  1 382 ? 49.890  14.345  2.536   1.00   15.05 ? 489 ALA B CB    1 
ATOM   6437  N  N     . ARG B  1 383 ? 46.510  15.001  1.338   1.00   17.50 ? 490 ARG B N     1 
ATOM   6438  C  CA    . ARG B  1 383 ? 45.636  14.782  0.193   1.00   18.86 ? 490 ARG B CA    1 
ATOM   6439  C  C     . ARG B  1 383 ? 46.269  15.421  -1.039  1.00   18.22 ? 490 ARG B C     1 
ATOM   6440  O  O     . ARG B  1 383 ? 46.359  16.644  -1.141  1.00   17.47 ? 490 ARG B O     1 
ATOM   6441  C  CB    . ARG B  1 383 ? 44.259  15.402  0.443   1.00   20.80 ? 490 ARG B CB    1 
ATOM   6442  C  CG    . ARG B  1 383 ? 43.616  15.021  1.759   1.00   24.17 ? 490 ARG B CG    1 
ATOM   6443  C  CD    . ARG B  1 383 ? 42.186  15.533  1.799   1.00   28.70 ? 490 ARG B CD    1 
ATOM   6444  N  NE    . ARG B  1 383 ? 41.310  14.736  0.946   1.00   29.68 ? 490 ARG B NE    1 
ATOM   6445  C  CZ    . ARG B  1 383 ? 40.676  13.645  1.357   1.00   31.51 ? 490 ARG B CZ    1 
ATOM   6446  N  NH1   . ARG B  1 383 ? 39.901  12.967  0.514   1.00   31.67 ? 490 ARG B NH1   1 
ATOM   6447  N  NH2   . ARG B  1 383 ? 40.803  13.252  2.622   1.00   28.58 ? 490 ARG B NH2   1 
ATOM   6448  N  N     . LEU B  1 384 ? 46.711  14.592  -1.973  1.00   16.98 ? 491 LEU B N     1 
ATOM   6449  C  CA    . LEU B  1 384 ? 47.353  15.105  -3.171  1.00   17.10 ? 491 LEU B CA    1 
ATOM   6450  C  C     . LEU B  1 384 ? 46.563  14.868  -4.447  1.00   17.61 ? 491 LEU B C     1 
ATOM   6451  O  O     . LEU B  1 384 ? 45.870  13.856  -4.599  1.00   16.02 ? 491 LEU B O     1 
ATOM   6452  C  CB    . LEU B  1 384 ? 48.739  14.474  -3.340  1.00   14.30 ? 491 LEU B CB    1 
ATOM   6453  C  CG    . LEU B  1 384 ? 49.705  14.545  -2.159  1.00   14.54 ? 491 LEU B CG    1 
ATOM   6454  C  CD1   . LEU B  1 384 ? 51.023  13.883  -2.557  1.00   14.31 ? 491 LEU B CD1   1 
ATOM   6455  C  CD2   . LEU B  1 384 ? 49.922  15.996  -1.737  1.00   10.53 ? 491 LEU B CD2   1 
ATOM   6456  N  N     . THR B  1 385 ? 46.671  15.822  -5.362  1.00   16.16 ? 492 THR B N     1 
ATOM   6457  C  CA    . THR B  1 385 ? 46.032  15.716  -6.662  1.00   18.19 ? 492 THR B CA    1 
ATOM   6458  C  C     . THR B  1 385 ? 47.108  16.121  -7.650  1.00   16.05 ? 492 THR B C     1 
ATOM   6459  O  O     . THR B  1 385 ? 47.541  17.273  -7.675  1.00   16.11 ? 492 THR B O     1 
ATOM   6460  C  CB    . THR B  1 385 ? 44.825  16.646  -6.793  1.00   17.44 ? 492 THR B CB    1 
ATOM   6461  O  OG1   . THR B  1 385 ? 43.892  16.343  -5.754  1.00   19.50 ? 492 THR B OG1   1 
ATOM   6462  C  CG2   . THR B  1 385 ? 44.132  16.423  -8.124  1.00   17.64 ? 492 THR B CG2   1 
ATOM   6463  N  N     . LEU B  1 386 ? 47.551  15.167  -8.454  1.00   13.75 ? 493 LEU B N     1 
ATOM   6464  C  CA    . LEU B  1 386 ? 48.605  15.446  -9.410  1.00   17.12 ? 493 LEU B CA    1 
ATOM   6465  C  C     . LEU B  1 386 ? 48.466  14.630  -10.683 1.00   19.24 ? 493 LEU B C     1 
ATOM   6466  O  O     . LEU B  1 386 ? 47.756  13.616  -10.724 1.00   20.94 ? 493 LEU B O     1 
ATOM   6467  C  CB    . LEU B  1 386 ? 49.963  15.151  -8.763  1.00   17.79 ? 493 LEU B CB    1 
ATOM   6468  C  CG    . LEU B  1 386 ? 50.225  13.695  -8.334  1.00   16.73 ? 493 LEU B CG    1 
ATOM   6469  C  CD1   . LEU B  1 386 ? 50.613  12.865  -9.546  1.00   18.15 ? 493 LEU B CD1   1 
ATOM   6470  C  CD2   . LEU B  1 386 ? 51.346  13.651  -7.313  1.00   14.86 ? 493 LEU B CD2   1 
ATOM   6471  N  N     . SER B  1 387 ? 49.157  15.080  -11.722 1.00   17.97 ? 494 SER B N     1 
ATOM   6472  C  CA    . SER B  1 387 ? 49.147  14.393  -13.006 1.00   19.26 ? 494 SER B CA    1 
ATOM   6473  C  C     . SER B  1 387 ? 50.586  13.980  -13.271 1.00   21.53 ? 494 SER B C     1 
ATOM   6474  O  O     . SER B  1 387 ? 51.519  14.696  -12.886 1.00   23.32 ? 494 SER B O     1 
ATOM   6475  C  CB    . SER B  1 387 ? 48.642  15.328  -14.109 1.00   16.61 ? 494 SER B CB    1 
ATOM   6476  O  OG    . SER B  1 387 ? 49.283  16.598  -14.046 1.00   21.27 ? 494 SER B OG    1 
ATOM   6477  N  N     . TYR B  1 388 ? 50.767  12.822  -13.898 1.00   20.37 ? 495 TYR B N     1 
ATOM   6478  C  CA    . TYR B  1 388 ? 52.104  12.333  -14.194 1.00   22.45 ? 495 TYR B CA    1 
ATOM   6479  C  C     . TYR B  1 388 ? 52.003  11.297  -15.316 1.00   23.94 ? 495 TYR B C     1 
ATOM   6480  O  O     . TYR B  1 388 ? 50.982  10.615  -15.444 1.00   23.32 ? 495 TYR B O     1 
ATOM   6481  C  CB    . TYR B  1 388 ? 52.721  11.725  -12.927 1.00   19.44 ? 495 TYR B CB    1 
ATOM   6482  C  CG    . TYR B  1 388 ? 54.211  11.875  -12.868 1.00   21.44 ? 495 TYR B CG    1 
ATOM   6483  C  CD1   . TYR B  1 388 ? 54.798  13.143  -12.860 1.00   20.84 ? 495 TYR B CD1   1 
ATOM   6484  C  CD2   . TYR B  1 388 ? 55.048  10.753  -12.862 1.00   22.35 ? 495 TYR B CD2   1 
ATOM   6485  C  CE1   . TYR B  1 388 ? 56.182  13.298  -12.853 1.00   20.45 ? 495 TYR B CE1   1 
ATOM   6486  C  CE2   . TYR B  1 388 ? 56.444  10.898  -12.855 1.00   20.83 ? 495 TYR B CE2   1 
ATOM   6487  C  CZ    . TYR B  1 388 ? 56.997  12.177  -12.852 1.00   19.79 ? 495 TYR B CZ    1 
ATOM   6488  O  OH    . TYR B  1 388 ? 58.361  12.349  -12.864 1.00   19.37 ? 495 TYR B OH    1 
ATOM   6489  N  N     . ASN B  1 389 ? 53.048  11.185  -16.134 1.00   22.40 ? 496 ASN B N     1 
ATOM   6490  C  CA    . ASN B  1 389 ? 53.025  10.244  -17.241 1.00   23.39 ? 496 ASN B CA    1 
ATOM   6491  C  C     . ASN B  1 389 ? 53.256  8.802   -16.804 1.00   26.06 ? 496 ASN B C     1 
ATOM   6492  O  O     . ASN B  1 389 ? 52.753  7.871   -17.435 1.00   27.01 ? 496 ASN B O     1 
ATOM   6493  C  CB    . ASN B  1 389 ? 54.057  10.644  -18.290 1.00   25.41 ? 496 ASN B CB    1 
ATOM   6494  C  CG    . ASN B  1 389 ? 55.447  10.729  -17.728 1.00   29.23 ? 496 ASN B CG    1 
ATOM   6495  O  OD1   . ASN B  1 389 ? 55.784  11.666  -17.001 1.00   29.77 ? 496 ASN B OD1   1 
ATOM   6496  N  ND2   . ASN B  1 389 ? 56.271  9.732   -18.052 1.00   29.67 ? 496 ASN B ND2   1 
ATOM   6497  N  N     . ARG B  1 390 ? 54.009  8.607   -15.725 1.00   26.86 ? 497 ARG B N     1 
ATOM   6498  C  CA    . ARG B  1 390 ? 54.282  7.257   -15.236 1.00   27.08 ? 497 ARG B CA    1 
ATOM   6499  C  C     . ARG B  1 390 ? 54.258  7.285   -13.715 1.00   27.42 ? 497 ARG B C     1 
ATOM   6500  O  O     . ARG B  1 390 ? 55.284  7.496   -13.067 1.00   27.85 ? 497 ARG B O     1 
ATOM   6501  C  CB    . ARG B  1 390 ? 55.648  6.775   -15.740 1.00   28.11 ? 497 ARG B CB    1 
ATOM   6502  C  CG    . ARG B  1 390 ? 55.640  5.365   -16.271 1.00   28.29 ? 497 ARG B CG    1 
ATOM   6503  C  CD    . ARG B  1 390 ? 56.514  4.446   -15.446 1.00   29.97 ? 497 ARG B CD    1 
ATOM   6504  N  NE    . ARG B  1 390 ? 56.360  3.059   -15.884 1.00   34.00 ? 497 ARG B NE    1 
ATOM   6505  C  CZ    . ARG B  1 390 ? 56.698  1.998   -15.154 1.00   35.79 ? 497 ARG B CZ    1 
ATOM   6506  N  NH1   . ARG B  1 390 ? 56.514  0.778   -15.641 1.00   34.80 ? 497 ARG B NH1   1 
ATOM   6507  N  NH2   . ARG B  1 390 ? 57.215  2.157   -13.937 1.00   34.40 ? 497 ARG B NH2   1 
ATOM   6508  N  N     . ARG B  1 391 ? 53.074  7.058   -13.156 1.00   27.09 ? 498 ARG B N     1 
ATOM   6509  C  CA    . ARG B  1 391 ? 52.860  7.088   -11.714 1.00   26.36 ? 498 ARG B CA    1 
ATOM   6510  C  C     . ARG B  1 391 ? 53.857  6.282   -10.865 1.00   27.34 ? 498 ARG B C     1 
ATOM   6511  O  O     . ARG B  1 391 ? 54.383  6.787   -9.862  1.00   29.17 ? 498 ARG B O     1 
ATOM   6512  C  CB    . ARG B  1 391 ? 51.429  6.644   -11.419 1.00   22.81 ? 498 ARG B CB    1 
ATOM   6513  C  CG    . ARG B  1 391 ? 50.921  7.012   -10.037 1.00   22.39 ? 498 ARG B CG    1 
ATOM   6514  C  CD    . ARG B  1 391 ? 49.415  6.851   -9.975  1.00   20.30 ? 498 ARG B CD    1 
ATOM   6515  N  NE    . ARG B  1 391 ? 49.011  5.471   -10.218 1.00   21.84 ? 498 ARG B NE    1 
ATOM   6516  C  CZ    . ARG B  1 391 ? 47.749  5.077   -10.369 1.00   20.93 ? 498 ARG B CZ    1 
ATOM   6517  N  NH1   . ARG B  1 391 ? 47.460  3.798   -10.586 1.00   19.07 ? 498 ARG B NH1   1 
ATOM   6518  N  NH2   . ARG B  1 391 ? 46.773  5.969   -10.311 1.00   18.77 ? 498 ARG B NH2   1 
ATOM   6519  N  N     . GLY B  1 392 ? 54.123  5.042   -11.265 1.00   25.29 ? 499 GLY B N     1 
ATOM   6520  C  CA    . GLY B  1 392 ? 55.046  4.202   -10.521 1.00   23.47 ? 499 GLY B CA    1 
ATOM   6521  C  C     . GLY B  1 392 ? 56.462  4.727   -10.331 1.00   23.04 ? 499 GLY B C     1 
ATOM   6522  O  O     . GLY B  1 392 ? 57.190  4.232   -9.472  1.00   25.05 ? 499 GLY B O     1 
ATOM   6523  N  N     . ASP B  1 393 ? 56.869  5.719   -11.117 1.00   21.52 ? 500 ASP B N     1 
ATOM   6524  C  CA    . ASP B  1 393 ? 58.220  6.259   -10.982 1.00   22.49 ? 500 ASP B CA    1 
ATOM   6525  C  C     . ASP B  1 393 ? 58.319  7.291   -9.862  1.00   22.74 ? 500 ASP B C     1 
ATOM   6526  O  O     . ASP B  1 393 ? 59.417  7.677   -9.446  1.00   22.82 ? 500 ASP B O     1 
ATOM   6527  C  CB    . ASP B  1 393 ? 58.689  6.893   -12.298 1.00   23.36 ? 500 ASP B CB    1 
ATOM   6528  C  CG    . ASP B  1 393 ? 58.966  5.863   -13.387 1.00   25.01 ? 500 ASP B CG    1 
ATOM   6529  O  OD1   . ASP B  1 393 ? 58.973  4.647   -13.097 1.00   27.19 ? 500 ASP B OD1   1 
ATOM   6530  O  OD2   . ASP B  1 393 ? 59.186  6.272   -14.545 1.00   26.53 ? 500 ASP B OD2   1 
ATOM   6531  N  N     . LEU B  1 394 ? 57.167  7.729   -9.370  1.00   20.23 ? 501 LEU B N     1 
ATOM   6532  C  CA    . LEU B  1 394 ? 57.119  8.717   -8.302  1.00   20.93 ? 501 LEU B CA    1 
ATOM   6533  C  C     . LEU B  1 394 ? 57.437  8.160   -6.915  1.00   21.43 ? 501 LEU B C     1 
ATOM   6534  O  O     . LEU B  1 394 ? 57.227  6.988   -6.631  1.00   24.41 ? 501 LEU B O     1 
ATOM   6535  C  CB    . LEU B  1 394 ? 55.735  9.364   -8.251  1.00   21.02 ? 501 LEU B CB    1 
ATOM   6536  C  CG    . LEU B  1 394 ? 55.345  10.259  -9.420  1.00   22.01 ? 501 LEU B CG    1 
ATOM   6537  C  CD1   . LEU B  1 394 ? 53.884  10.658  -9.285  1.00   20.22 ? 501 LEU B CD1   1 
ATOM   6538  C  CD2   . LEU B  1 394 ? 56.241  11.485  -9.438  1.00   19.57 ? 501 LEU B CD2   1 
ATOM   6539  N  N     . ALA B  1 395 ? 57.959  9.024   -6.061  1.00   19.51 ? 502 ALA B N     1 
ATOM   6540  C  CA    . ALA B  1 395 ? 58.266  8.675   -4.688  1.00   18.34 ? 502 ALA B CA    1 
ATOM   6541  C  C     . ALA B  1 395 ? 57.890  9.948   -3.935  1.00   19.93 ? 502 ALA B C     1 
ATOM   6542  O  O     . ALA B  1 395 ? 58.341  11.036  -4.287  1.00   22.11 ? 502 ALA B O     1 
ATOM   6543  C  CB    . ALA B  1 395 ? 59.720  8.371   -4.531  1.00   15.55 ? 502 ALA B CB    1 
ATOM   6544  N  N     . ILE B  1 396 ? 57.041  9.814   -2.924  1.00   17.63 ? 503 ILE B N     1 
ATOM   6545  C  CA    . ILE B  1 396 ? 56.578  10.967  -2.174  1.00   18.03 ? 503 ILE B CA    1 
ATOM   6546  C  C     . ILE B  1 396 ? 56.911  10.848  -0.699  1.00   19.01 ? 503 ILE B C     1 
ATOM   6547  O  O     . ILE B  1 396 ? 56.737  9.790   -0.090  1.00   20.00 ? 503 ILE B O     1 
ATOM   6548  C  CB    . ILE B  1 396 ? 55.054  11.128  -2.355  1.00   15.68 ? 503 ILE B CB    1 
ATOM   6549  C  CG1   . ILE B  1 396 ? 54.737  11.245  -3.841  1.00   14.37 ? 503 ILE B CG1   1 
ATOM   6550  C  CG2   . ILE B  1 396 ? 54.558  12.344  -1.621  1.00   16.59 ? 503 ILE B CG2   1 
ATOM   6551  C  CD1   . ILE B  1 396 ? 53.274  11.417  -4.141  1.00   15.61 ? 503 ILE B CD1   1 
ATOM   6552  N  N     . HIS B  1 397 ? 57.383  11.947  -0.126  1.00   17.91 ? 504 HIS B N     1 
ATOM   6553  C  CA    . HIS B  1 397 ? 57.763  11.974  1.280   1.00   18.16 ? 504 HIS B CA    1 
ATOM   6554  C  C     . HIS B  1 397 ? 57.180  13.178  1.996   1.00   19.39 ? 504 HIS B C     1 
ATOM   6555  O  O     . HIS B  1 397 ? 57.009  14.248  1.411   1.00   22.88 ? 504 HIS B O     1 
ATOM   6556  C  CB    . HIS B  1 397 ? 59.283  12.014  1.390   1.00   16.46 ? 504 HIS B CB    1 
ATOM   6557  C  CG    . HIS B  1 397 ? 59.964  10.934  0.614   1.00   18.20 ? 504 HIS B CG    1 
ATOM   6558  N  ND1   . HIS B  1 397 ? 60.035  9.629   1.059   1.00   17.89 ? 504 HIS B ND1   1 
ATOM   6559  C  CD2   . HIS B  1 397 ? 60.555  10.952  -0.606  1.00   15.24 ? 504 HIS B CD2   1 
ATOM   6560  C  CE1   . HIS B  1 397 ? 60.640  8.893   0.144   1.00   18.29 ? 504 HIS B CE1   1 
ATOM   6561  N  NE2   . HIS B  1 397 ? 60.965  9.670   -0.875  1.00   16.24 ? 504 HIS B NE2   1 
ATOM   6562  N  N     . LEU B  1 398 ? 56.882  13.002  3.275   1.00   18.77 ? 505 LEU B N     1 
ATOM   6563  C  CA    . LEU B  1 398 ? 56.331  14.084  4.077   1.00   17.39 ? 505 LEU B CA    1 
ATOM   6564  C  C     . LEU B  1 398 ? 57.169  14.195  5.348   1.00   17.77 ? 505 LEU B C     1 
ATOM   6565  O  O     . LEU B  1 398 ? 57.301  13.226  6.099   1.00   19.98 ? 505 LEU B O     1 
ATOM   6566  C  CB    . LEU B  1 398 ? 54.874  13.783  4.421   1.00   14.80 ? 505 LEU B CB    1 
ATOM   6567  C  CG    . LEU B  1 398 ? 54.093  14.892  5.114   1.00   15.80 ? 505 LEU B CG    1 
ATOM   6568  C  CD1   . LEU B  1 398 ? 53.963  16.088  4.189   1.00   13.99 ? 505 LEU B CD1   1 
ATOM   6569  C  CD2   . LEU B  1 398 ? 52.730  14.373  5.514   1.00   12.13 ? 505 LEU B CD2   1 
ATOM   6570  N  N     . VAL B  1 399 ? 57.753  15.367  5.579   1.00   14.94 ? 506 VAL B N     1 
ATOM   6571  C  CA    . VAL B  1 399 ? 58.569  15.559  6.767   1.00   15.08 ? 506 VAL B CA    1 
ATOM   6572  C  C     . VAL B  1 399 ? 57.864  16.471  7.755   1.00   16.42 ? 506 VAL B C     1 
ATOM   6573  O  O     . VAL B  1 399 ? 57.533  17.602  7.423   1.00   19.76 ? 506 VAL B O     1 
ATOM   6574  C  CB    . VAL B  1 399 ? 59.935  16.179  6.410   1.00   14.55 ? 506 VAL B CB    1 
ATOM   6575  C  CG1   . VAL B  1 399 ? 60.839  16.183  7.635   1.00   11.97 ? 506 VAL B CG1   1 
ATOM   6576  C  CG2   . VAL B  1 399 ? 60.582  15.399  5.284   1.00   13.67 ? 506 VAL B CG2   1 
ATOM   6577  N  N     . SER B  1 400 ? 57.640  15.982  8.970   1.00   17.04 ? 507 SER B N     1 
ATOM   6578  C  CA    . SER B  1 400 ? 56.965  16.773  9.995   1.00   17.26 ? 507 SER B CA    1 
ATOM   6579  C  C     . SER B  1 400 ? 57.909  17.806  10.583  1.00   17.45 ? 507 SER B C     1 
ATOM   6580  O  O     . SER B  1 400 ? 59.125  17.690  10.454  1.00   17.11 ? 507 SER B O     1 
ATOM   6581  C  CB    . SER B  1 400 ? 56.452  15.877  11.125  1.00   16.04 ? 507 SER B CB    1 
ATOM   6582  O  OG    . SER B  1 400 ? 57.530  15.289  11.834  1.00   15.45 ? 507 SER B OG    1 
ATOM   6583  N  N     . PRO B  1 401 ? 57.354  18.840  11.230  1.00   18.13 ? 508 PRO B N     1 
ATOM   6584  C  CA    . PRO B  1 401 ? 58.175  19.886  11.840  1.00   18.36 ? 508 PRO B CA    1 
ATOM   6585  C  C     . PRO B  1 401 ? 59.242  19.291  12.761  1.00   16.89 ? 508 PRO B C     1 
ATOM   6586  O  O     . PRO B  1 401 ? 60.350  19.807  12.851  1.00   15.65 ? 508 PRO B O     1 
ATOM   6587  C  CB    . PRO B  1 401 ? 57.149  20.724  12.600  1.00   19.05 ? 508 PRO B CB    1 
ATOM   6588  C  CG    . PRO B  1 401 ? 55.947  20.626  11.727  1.00   20.22 ? 508 PRO B CG    1 
ATOM   6589  C  CD    . PRO B  1 401 ? 55.922  19.169  11.325  1.00   17.80 ? 508 PRO B CD    1 
ATOM   6590  N  N     . MET B  1 402 ? 58.908  18.194  13.433  1.00   16.89 ? 509 MET B N     1 
ATOM   6591  C  CA    . MET B  1 402 ? 59.856  17.563  14.335  1.00   17.82 ? 509 MET B CA    1 
ATOM   6592  C  C     . MET B  1 402 ? 60.817  16.597  13.643  1.00   18.01 ? 509 MET B C     1 
ATOM   6593  O  O     . MET B  1 402 ? 61.437  15.752  14.280  1.00   17.83 ? 509 MET B O     1 
ATOM   6594  C  CB    . MET B  1 402 ? 59.101  16.880  15.468  1.00   19.88 ? 509 MET B CB    1 
ATOM   6595  C  CG    . MET B  1 402 ? 58.432  17.901  16.372  1.00   20.91 ? 509 MET B CG    1 
ATOM   6596  S  SD    . MET B  1 402 ? 57.506  17.190  17.718  1.00   27.70 ? 509 MET B SD    1 
ATOM   6597  C  CE    . MET B  1 402 ? 58.801  17.058  18.952  1.00   21.29 ? 509 MET B CE    1 
ATOM   6598  N  N     . GLY B  1 403 ? 60.930  16.733  12.326  1.00   19.41 ? 510 GLY B N     1 
ATOM   6599  C  CA    . GLY B  1 403 ? 61.853  15.916  11.555  1.00   18.79 ? 510 GLY B CA    1 
ATOM   6600  C  C     . GLY B  1 403 ? 61.509  14.484  11.192  1.00   18.72 ? 510 GLY B C     1 
ATOM   6601  O  O     . GLY B  1 403 ? 62.359  13.771  10.665  1.00   17.21 ? 510 GLY B O     1 
ATOM   6602  N  N     . THR B  1 404 ? 60.292  14.040  11.472  1.00   18.70 ? 511 THR B N     1 
ATOM   6603  C  CA    . THR B  1 404 ? 59.929  12.680  11.120  1.00   16.36 ? 511 THR B CA    1 
ATOM   6604  C  C     . THR B  1 404 ? 59.584  12.623  9.641   1.00   19.07 ? 511 THR B C     1 
ATOM   6605  O  O     . THR B  1 404 ? 58.722  13.357  9.140   1.00   19.62 ? 511 THR B O     1 
ATOM   6606  C  CB    . THR B  1 404 ? 58.746  12.185  11.943  1.00   16.97 ? 511 THR B CB    1 
ATOM   6607  O  OG1   . THR B  1 404 ? 59.081  12.272  13.329  1.00   18.00 ? 511 THR B OG1   1 
ATOM   6608  C  CG2   . THR B  1 404 ? 58.440  10.726  11.601  1.00   14.76 ? 511 THR B CG2   1 
ATOM   6609  N  N     . ARG B  1 405 ? 60.272  11.740  8.939   1.00   20.71 ? 512 ARG B N     1 
ATOM   6610  C  CA    . ARG B  1 405 ? 60.096  11.584  7.502   1.00   21.72 ? 512 ARG B CA    1 
ATOM   6611  C  C     . ARG B  1 405 ? 59.239  10.374  7.106   1.00   18.49 ? 512 ARG B C     1 
ATOM   6612  O  O     . ARG B  1 405 ? 59.686  9.224   7.150   1.00   19.75 ? 512 ARG B O     1 
ATOM   6613  C  CB    . ARG B  1 405 ? 61.484  11.511  6.878   1.00   22.88 ? 512 ARG B CB    1 
ATOM   6614  C  CG    . ARG B  1 405 ? 61.525  11.048  5.458   1.00   30.48 ? 512 ARG B CG    1 
ATOM   6615  C  CD    . ARG B  1 405 ? 62.969  11.068  5.011   1.00   34.07 ? 512 ARG B CD    1 
ATOM   6616  N  NE    . ARG B  1 405 ? 63.333  12.404  4.569   1.00   33.30 ? 512 ARG B NE    1 
ATOM   6617  C  CZ    . ARG B  1 405 ? 63.088  12.845  3.344   1.00   33.71 ? 512 ARG B CZ    1 
ATOM   6618  N  NH1   . ARG B  1 405 ? 63.432  14.077  3.001   1.00   34.26 ? 512 ARG B NH1   1 
ATOM   6619  N  NH2   . ARG B  1 405 ? 62.524  12.028  2.457   1.00   29.69 ? 512 ARG B NH2   1 
ATOM   6620  N  N     . SER B  1 406 ? 58.000  10.651  6.721   1.00   15.79 ? 513 SER B N     1 
ATOM   6621  C  CA    . SER B  1 406 ? 57.065  9.603   6.331   1.00   15.51 ? 513 SER B CA    1 
ATOM   6622  C  C     . SER B  1 406 ? 57.070  9.418   4.831   1.00   14.95 ? 513 SER B C     1 
ATOM   6623  O  O     . SER B  1 406 ? 56.860  10.378  4.091   1.00   19.21 ? 513 SER B O     1 
ATOM   6624  C  CB    . SER B  1 406 ? 55.632  9.961   6.755   1.00   13.50 ? 513 SER B CB    1 
ATOM   6625  O  OG    . SER B  1 406 ? 55.474  10.009  8.156   1.00   16.19 ? 513 SER B OG    1 
ATOM   6626  N  N     . THR B  1 407 ? 57.310  8.202   4.364   1.00   13.19 ? 514 THR B N     1 
ATOM   6627  C  CA    . THR B  1 407 ? 57.274  7.981   2.927   1.00   15.79 ? 514 THR B CA    1 
ATOM   6628  C  C     . THR B  1 407 ? 55.844  7.612   2.571   1.00   16.25 ? 514 THR B C     1 
ATOM   6629  O  O     . THR B  1 407 ? 55.402  6.485   2.817   1.00   17.10 ? 514 THR B O     1 
ATOM   6630  C  CB    . THR B  1 407 ? 58.211  6.846   2.474   1.00   15.19 ? 514 THR B CB    1 
ATOM   6631  O  OG1   . THR B  1 407 ? 59.573  7.261   2.635   1.00   17.12 ? 514 THR B OG1   1 
ATOM   6632  C  CG2   . THR B  1 407 ? 57.961  6.515   0.988   1.00   11.41 ? 514 THR B CG2   1 
ATOM   6633  N  N     . LEU B  1 408 ? 55.125  8.574   2.000   1.00   16.29 ? 515 LEU B N     1 
ATOM   6634  C  CA    . LEU B  1 408 ? 53.732  8.383   1.615   1.00   17.22 ? 515 LEU B CA    1 
ATOM   6635  C  C     . LEU B  1 408 ? 53.606  7.405   0.457   1.00   17.63 ? 515 LEU B C     1 
ATOM   6636  O  O     . LEU B  1 408 ? 52.648  6.631   0.387   1.00   18.54 ? 515 LEU B O     1 
ATOM   6637  C  CB    . LEU B  1 408 ? 53.113  9.726   1.225   1.00   15.67 ? 515 LEU B CB    1 
ATOM   6638  C  CG    . LEU B  1 408 ? 53.170  10.813  2.298   1.00   14.66 ? 515 LEU B CG    1 
ATOM   6639  C  CD1   . LEU B  1 408 ? 52.750  12.136  1.685   1.00   14.04 ? 515 LEU B CD1   1 
ATOM   6640  C  CD2   . LEU B  1 408 ? 52.271  10.425  3.484   1.00   13.67 ? 515 LEU B CD2   1 
ATOM   6641  N  N     . LEU B  1 409 ? 54.580  7.438   -0.445  1.00   15.41 ? 516 LEU B N     1 
ATOM   6642  C  CA    . LEU B  1 409 ? 54.561  6.553   -1.602  1.00   16.89 ? 516 LEU B CA    1 
ATOM   6643  C  C     . LEU B  1 409 ? 55.960  6.222   -2.101  1.00   16.98 ? 516 LEU B C     1 
ATOM   6644  O  O     . LEU B  1 409 ? 56.739  7.112   -2.416  1.00   17.37 ? 516 LEU B O     1 
ATOM   6645  C  CB    . LEU B  1 409 ? 53.773  7.205   -2.742  1.00   17.01 ? 516 LEU B CB    1 
ATOM   6646  C  CG    . LEU B  1 409 ? 53.739  6.486   -4.099  1.00   16.65 ? 516 LEU B CG    1 
ATOM   6647  C  CD1   . LEU B  1 409 ? 52.785  5.288   -4.018  1.00   13.96 ? 516 LEU B CD1   1 
ATOM   6648  C  CD2   . LEU B  1 409 ? 53.297  7.470   -5.188  1.00   9.10  ? 516 LEU B CD2   1 
ATOM   6649  N  N     . ALA B  1 410 ? 56.275  4.936   -2.172  1.00   18.08 ? 517 ALA B N     1 
ATOM   6650  C  CA    . ALA B  1 410 ? 57.576  4.510   -2.678  1.00   16.90 ? 517 ALA B CA    1 
ATOM   6651  C  C     . ALA B  1 410 ? 57.365  4.113   -4.135  1.00   16.88 ? 517 ALA B C     1 
ATOM   6652  O  O     . ALA B  1 410 ? 56.234  3.904   -4.577  1.00   18.66 ? 517 ALA B O     1 
ATOM   6653  C  CB    . ALA B  1 410 ? 58.103  3.325   -1.875  1.00   15.00 ? 517 ALA B CB    1 
ATOM   6654  N  N     . ALA B  1 411 ? 58.449  4.015   -4.886  1.00   16.61 ? 518 ALA B N     1 
ATOM   6655  C  CA    . ALA B  1 411 ? 58.342  3.654   -6.289  1.00   17.98 ? 518 ALA B CA    1 
ATOM   6656  C  C     . ALA B  1 411 ? 57.663  2.296   -6.473  1.00   19.50 ? 518 ALA B C     1 
ATOM   6657  O  O     . ALA B  1 411 ? 57.897  1.358   -5.702  1.00   20.09 ? 518 ALA B O     1 
ATOM   6658  C  CB    . ALA B  1 411 ? 59.721  3.642   -6.927  1.00   14.91 ? 518 ALA B CB    1 
ATOM   6659  N  N     . ARG B  1 412 ? 56.799  2.216   -7.482  1.00   18.49 ? 519 ARG B N     1 
ATOM   6660  C  CA    . ARG B  1 412 ? 56.094  0.986   -7.812  1.00   17.81 ? 519 ARG B CA    1 
ATOM   6661  C  C     . ARG B  1 412 ? 56.384  0.720   -9.281  1.00   17.82 ? 519 ARG B C     1 
ATOM   6662  O  O     . ARG B  1 412 ? 55.656  1.157   -10.169 1.00   20.05 ? 519 ARG B O     1 
ATOM   6663  C  CB    . ARG B  1 412 ? 54.588  1.135   -7.584  1.00   16.32 ? 519 ARG B CB    1 
ATOM   6664  C  CG    . ARG B  1 412 ? 54.206  1.364   -6.140  1.00   18.61 ? 519 ARG B CG    1 
ATOM   6665  C  CD    . ARG B  1 412 ? 52.773  0.931   -5.880  1.00   19.44 ? 519 ARG B CD    1 
ATOM   6666  N  NE    . ARG B  1 412 ? 51.813  1.644   -6.716  1.00   21.48 ? 519 ARG B NE    1 
ATOM   6667  C  CZ    . ARG B  1 412 ? 50.531  1.301   -6.839  1.00   19.80 ? 519 ARG B CZ    1 
ATOM   6668  N  NH1   . ARG B  1 412 ? 49.713  1.998   -7.622  1.00   17.98 ? 519 ARG B NH1   1 
ATOM   6669  N  NH2   . ARG B  1 412 ? 50.068  0.252   -6.183  1.00   19.92 ? 519 ARG B NH2   1 
ATOM   6670  N  N     . PRO B  1 413 ? 57.465  -0.008  -9.555  1.00   17.86 ? 520 PRO B N     1 
ATOM   6671  C  CA    . PRO B  1 413 ? 57.865  -0.328  -10.925 1.00   17.27 ? 520 PRO B CA    1 
ATOM   6672  C  C     . PRO B  1 413 ? 56.791  -0.832  -11.885 1.00   16.49 ? 520 PRO B C     1 
ATOM   6673  O  O     . PRO B  1 413 ? 56.873  -0.573  -13.081 1.00   17.58 ? 520 PRO B O     1 
ATOM   6674  C  CB    . PRO B  1 413 ? 59.009  -1.322  -10.723 1.00   16.13 ? 520 PRO B CB    1 
ATOM   6675  C  CG    . PRO B  1 413 ? 58.732  -1.916  -9.372  1.00   18.12 ? 520 PRO B CG    1 
ATOM   6676  C  CD    . PRO B  1 413 ? 58.309  -0.722  -8.583  1.00   17.60 ? 520 PRO B CD    1 
ATOM   6677  N  N     . HIS B  1 414 ? 55.785  -1.534  -11.380 1.00   17.48 ? 521 HIS B N     1 
ATOM   6678  C  CA    . HIS B  1 414 ? 54.730  -2.048  -12.255 1.00   21.22 ? 521 HIS B CA    1 
ATOM   6679  C  C     . HIS B  1 414 ? 53.621  -1.044  -12.551 1.00   23.98 ? 521 HIS B C     1 
ATOM   6680  O  O     . HIS B  1 414 ? 52.804  -1.272  -13.444 1.00   23.81 ? 521 HIS B O     1 
ATOM   6681  C  CB    . HIS B  1 414 ? 54.092  -3.313  -11.671 1.00   18.91 ? 521 HIS B CB    1 
ATOM   6682  C  CG    . HIS B  1 414 ? 55.048  -4.449  -11.512 1.00   21.96 ? 521 HIS B CG    1 
ATOM   6683  N  ND1   . HIS B  1 414 ? 55.963  -4.792  -12.483 1.00   23.19 ? 521 HIS B ND1   1 
ATOM   6684  C  CD2   . HIS B  1 414 ? 55.261  -5.298  -10.479 1.00   23.71 ? 521 HIS B CD2   1 
ATOM   6685  C  CE1   . HIS B  1 414 ? 56.702  -5.797  -12.052 1.00   23.86 ? 521 HIS B CE1   1 
ATOM   6686  N  NE2   . HIS B  1 414 ? 56.296  -6.124  -10.838 1.00   25.19 ? 521 HIS B NE2   1 
ATOM   6687  N  N     . ASP B  1 415 ? 53.583  0.060   -11.811 1.00   26.08 ? 522 ASP B N     1 
ATOM   6688  C  CA    . ASP B  1 415 ? 52.543  1.065   -12.017 1.00   27.41 ? 522 ASP B CA    1 
ATOM   6689  C  C     . ASP B  1 415 ? 52.913  2.003   -13.174 1.00   28.11 ? 522 ASP B C     1 
ATOM   6690  O  O     . ASP B  1 415 ? 53.694  2.946   -13.012 1.00   26.62 ? 522 ASP B O     1 
ATOM   6691  C  CB    . ASP B  1 415 ? 52.319  1.853   -10.720 1.00   29.20 ? 522 ASP B CB    1 
ATOM   6692  C  CG    . ASP B  1 415 ? 51.125  2.804   -10.803 1.00   29.84 ? 522 ASP B CG    1 
ATOM   6693  O  OD1   . ASP B  1 415 ? 50.277  2.625   -11.704 1.00   26.00 ? 522 ASP B OD1   1 
ATOM   6694  O  OD2   . ASP B  1 415 ? 51.029  3.718   -9.953  1.00   28.14 ? 522 ASP B OD2   1 
ATOM   6695  N  N     . TYR B  1 416 ? 52.345  1.727   -14.345 1.00   27.40 ? 523 TYR B N     1 
ATOM   6696  C  CA    . TYR B  1 416 ? 52.610  2.513   -15.546 1.00   25.95 ? 523 TYR B CA    1 
ATOM   6697  C  C     . TYR B  1 416 ? 51.445  3.444   -15.860 1.00   22.17 ? 523 TYR B C     1 
ATOM   6698  O  O     . TYR B  1 416 ? 51.385  4.025   -16.937 1.00   23.43 ? 523 TYR B O     1 
ATOM   6699  C  CB    . TYR B  1 416 ? 52.854  1.566   -16.724 1.00   28.19 ? 523 TYR B CB    1 
ATOM   6700  C  CG    . TYR B  1 416 ? 51.691  0.633   -16.956 1.00   33.94 ? 523 TYR B CG    1 
ATOM   6701  C  CD1   . TYR B  1 416 ? 50.539  1.070   -17.615 1.00   36.30 ? 523 TYR B CD1   1 
ATOM   6702  C  CD2   . TYR B  1 416 ? 51.707  -0.668  -16.449 1.00   37.81 ? 523 TYR B CD2   1 
ATOM   6703  C  CE1   . TYR B  1 416 ? 49.426  0.232   -17.761 1.00   38.21 ? 523 TYR B CE1   1 
ATOM   6704  C  CE2   . TYR B  1 416 ? 50.604  -1.513  -16.585 1.00   39.67 ? 523 TYR B CE2   1 
ATOM   6705  C  CZ    . TYR B  1 416 ? 49.467  -1.060  -17.240 1.00   40.03 ? 523 TYR B CZ    1 
ATOM   6706  O  OH    . TYR B  1 416 ? 48.383  -1.903  -17.365 1.00   40.06 ? 523 TYR B OH    1 
ATOM   6707  N  N     . SER B  1 417 ? 50.525  3.583   -14.914 1.00   19.58 ? 524 SER B N     1 
ATOM   6708  C  CA    . SER B  1 417 ? 49.359  4.434   -15.097 1.00   19.19 ? 524 SER B CA    1 
ATOM   6709  C  C     . SER B  1 417 ? 49.706  5.871   -15.416 1.00   20.22 ? 524 SER B C     1 
ATOM   6710  O  O     . SER B  1 417 ? 50.728  6.391   -14.975 1.00   23.80 ? 524 SER B O     1 
ATOM   6711  C  CB    . SER B  1 417 ? 48.483  4.417   -13.851 1.00   19.06 ? 524 SER B CB    1 
ATOM   6712  O  OG    . SER B  1 417 ? 47.404  5.326   -13.991 1.00   22.68 ? 524 SER B OG    1 
ATOM   6713  N  N     . ALA B  1 418 ? 48.841  6.515   -16.188 1.00   18.47 ? 525 ALA B N     1 
ATOM   6714  C  CA    . ALA B  1 418 ? 49.045  7.901   -16.557 1.00   19.81 ? 525 ALA B CA    1 
ATOM   6715  C  C     . ALA B  1 418 ? 47.914  8.739   -15.955 1.00   22.42 ? 525 ALA B C     1 
ATOM   6716  O  O     . ALA B  1 418 ? 47.741  9.914   -16.295 1.00   22.02 ? 525 ALA B O     1 
ATOM   6717  C  CB    . ALA B  1 418 ? 49.055  8.034   -18.064 1.00   15.55 ? 525 ALA B CB    1 
ATOM   6718  N  N     . ASP B  1 419 ? 47.156  8.131   -15.045 1.00   23.16 ? 526 ASP B N     1 
ATOM   6719  C  CA    . ASP B  1 419 ? 46.039  8.811   -14.406 1.00   23.21 ? 526 ASP B CA    1 
ATOM   6720  C  C     . ASP B  1 419 ? 46.401  9.588   -13.138 1.00   23.19 ? 526 ASP B C     1 
ATOM   6721  O  O     . ASP B  1 419 ? 45.544  10.211  -12.527 1.00   22.17 ? 526 ASP B O     1 
ATOM   6722  C  CB    . ASP B  1 419 ? 44.931  7.813   -14.065 1.00   25.11 ? 526 ASP B CB    1 
ATOM   6723  C  CG    . ASP B  1 419 ? 44.420  7.048   -15.278 1.00   28.46 ? 526 ASP B CG    1 
ATOM   6724  O  OD1   . ASP B  1 419 ? 44.198  7.664   -16.346 1.00   29.99 ? 526 ASP B OD1   1 
ATOM   6725  O  OD2   . ASP B  1 419 ? 44.224  5.820   -15.153 1.00   32.55 ? 526 ASP B OD2   1 
ATOM   6726  N  N     . GLY B  1 420 ? 47.658  9.545   -12.728 1.00   22.97 ? 527 GLY B N     1 
ATOM   6727  C  CA    . GLY B  1 420 ? 48.054  10.274  -11.537 1.00   24.32 ? 527 GLY B CA    1 
ATOM   6728  C  C     . GLY B  1 420 ? 47.245  9.963   -10.291 1.00   24.97 ? 527 GLY B C     1 
ATOM   6729  O  O     . GLY B  1 420 ? 46.806  8.831   -10.089 1.00   24.87 ? 527 GLY B O     1 
ATOM   6730  N  N     . PHE B  1 421 ? 47.070  10.976  -9.444  1.00   24.79 ? 528 PHE B N     1 
ATOM   6731  C  CA    . PHE B  1 421 ? 46.309  10.840  -8.197  1.00   24.40 ? 528 PHE B CA    1 
ATOM   6732  C  C     . PHE B  1 421 ? 45.248  11.936  -8.123  1.00   24.75 ? 528 PHE B C     1 
ATOM   6733  O  O     . PHE B  1 421 ? 45.549  13.123  -8.285  1.00   23.79 ? 528 PHE B O     1 
ATOM   6734  C  CB    . PHE B  1 421 ? 47.237  10.939  -6.976  1.00   19.24 ? 528 PHE B CB    1 
ATOM   6735  C  CG    . PHE B  1 421 ? 48.087  9.731   -6.770  1.00   14.96 ? 528 PHE B CG    1 
ATOM   6736  C  CD1   . PHE B  1 421 ? 47.540  8.573   -6.244  1.00   13.35 ? 528 PHE B CD1   1 
ATOM   6737  C  CD2   . PHE B  1 421 ? 49.431  9.734   -7.128  1.00   15.41 ? 528 PHE B CD2   1 
ATOM   6738  C  CE1   . PHE B  1 421 ? 48.315  7.424   -6.072  1.00   14.83 ? 528 PHE B CE1   1 
ATOM   6739  C  CE2   . PHE B  1 421 ? 50.223  8.583   -6.961  1.00   16.29 ? 528 PHE B CE2   1 
ATOM   6740  C  CZ    . PHE B  1 421 ? 49.661  7.426   -6.432  1.00   13.68 ? 528 PHE B CZ    1 
ATOM   6741  N  N     . ASN B  1 422 ? 44.005  11.526  -7.894  1.00   24.82 ? 529 ASN B N     1 
ATOM   6742  C  CA    . ASN B  1 422 ? 42.913  12.473  -7.805  1.00   23.31 ? 529 ASN B CA    1 
ATOM   6743  C  C     . ASN B  1 422 ? 42.420  12.594  -6.371  1.00   21.88 ? 529 ASN B C     1 
ATOM   6744  O  O     . ASN B  1 422 ? 41.570  11.828  -5.925  1.00   16.96 ? 529 ASN B O     1 
ATOM   6745  C  CB    . ASN B  1 422 ? 41.774  12.052  -8.730  1.00   27.68 ? 529 ASN B CB    1 
ATOM   6746  C  CG    . ASN B  1 422 ? 40.584  12.996  -8.643  1.00   35.08 ? 529 ASN B CG    1 
ATOM   6747  O  OD1   . ASN B  1 422 ? 40.752  14.221  -8.538  1.00   38.51 ? 529 ASN B OD1   1 
ATOM   6748  N  ND2   . ASN B  1 422 ? 39.372  12.436  -8.689  1.00   36.41 ? 529 ASN B ND2   1 
ATOM   6749  N  N     . ASP B  1 423 ? 42.974  13.572  -5.659  1.00   22.08 ? 530 ASP B N     1 
ATOM   6750  C  CA    . ASP B  1 423 ? 42.642  13.826  -4.265  1.00   20.30 ? 530 ASP B CA    1 
ATOM   6751  C  C     . ASP B  1 423 ? 42.783  12.558  -3.423  1.00   20.71 ? 530 ASP B C     1 
ATOM   6752  O  O     . ASP B  1 423 ? 41.887  12.187  -2.674  1.00   22.93 ? 530 ASP B O     1 
ATOM   6753  C  CB    . ASP B  1 423 ? 41.225  14.393  -4.147  1.00   18.34 ? 530 ASP B CB    1 
ATOM   6754  C  CG    . ASP B  1 423 ? 40.888  14.817  -2.732  1.00   21.80 ? 530 ASP B CG    1 
ATOM   6755  O  OD1   . ASP B  1 423 ? 41.721  15.514  -2.120  1.00   23.62 ? 530 ASP B OD1   1 
ATOM   6756  O  OD2   . ASP B  1 423 ? 39.799  14.460  -2.229  1.00   24.03 ? 530 ASP B OD2   1 
ATOM   6757  N  N     . TRP B  1 424 ? 43.925  11.892  -3.555  1.00   21.83 ? 531 TRP B N     1 
ATOM   6758  C  CA    . TRP B  1 424 ? 44.194  10.676  -2.792  1.00   20.01 ? 531 TRP B CA    1 
ATOM   6759  C  C     . TRP B  1 424 ? 44.771  11.067  -1.431  1.00   19.99 ? 531 TRP B C     1 
ATOM   6760  O  O     . TRP B  1 424 ? 45.723  11.850  -1.354  1.00   20.56 ? 531 TRP B O     1 
ATOM   6761  C  CB    . TRP B  1 424 ? 45.184  9.786   -3.546  1.00   18.77 ? 531 TRP B CB    1 
ATOM   6762  C  CG    . TRP B  1 424 ? 45.378  8.487   -2.886  1.00   14.25 ? 531 TRP B CG    1 
ATOM   6763  C  CD1   . TRP B  1 424 ? 46.449  8.094   -2.135  1.00   12.42 ? 531 TRP B CD1   1 
ATOM   6764  C  CD2   . TRP B  1 424 ? 44.445  7.411   -2.859  1.00   13.48 ? 531 TRP B CD2   1 
ATOM   6765  N  NE1   . TRP B  1 424 ? 46.234  6.831   -1.639  1.00   15.66 ? 531 TRP B NE1   1 
ATOM   6766  C  CE2   . TRP B  1 424 ? 45.010  6.387   -2.070  1.00   14.36 ? 531 TRP B CE2   1 
ATOM   6767  C  CE3   . TRP B  1 424 ? 43.181  7.213   -3.424  1.00   10.84 ? 531 TRP B CE3   1 
ATOM   6768  C  CZ2   . TRP B  1 424 ? 44.356  5.177   -1.833  1.00   12.91 ? 531 TRP B CZ2   1 
ATOM   6769  C  CZ3   . TRP B  1 424 ? 42.527  6.011   -3.189  1.00   11.72 ? 531 TRP B CZ3   1 
ATOM   6770  C  CH2   . TRP B  1 424 ? 43.116  5.007   -2.400  1.00   15.09 ? 531 TRP B CH2   1 
ATOM   6771  N  N     . ALA B  1 425 ? 44.206  10.516  -0.363  1.00   20.54 ? 532 ALA B N     1 
ATOM   6772  C  CA    . ALA B  1 425 ? 44.653  10.860  0.984   1.00   22.60 ? 532 ALA B CA    1 
ATOM   6773  C  C     . ALA B  1 425 ? 45.732  9.973   1.608   1.00   21.17 ? 532 ALA B C     1 
ATOM   6774  O  O     . ALA B  1 425 ? 45.430  9.100   2.420   1.00   21.70 ? 532 ALA B O     1 
ATOM   6775  C  CB    . ALA B  1 425 ? 43.434  10.937  1.922   1.00   21.29 ? 532 ALA B CB    1 
ATOM   6776  N  N     . PHE B  1 426 ? 46.986  10.214  1.241   1.00   21.03 ? 533 PHE B N     1 
ATOM   6777  C  CA    . PHE B  1 426 ? 48.110  9.458   1.797   1.00   20.70 ? 533 PHE B CA    1 
ATOM   6778  C  C     . PHE B  1 426 ? 48.113  9.691   3.311   1.00   21.32 ? 533 PHE B C     1 
ATOM   6779  O  O     . PHE B  1 426 ? 48.112  10.832  3.769   1.00   22.22 ? 533 PHE B O     1 
ATOM   6780  C  CB    . PHE B  1 426 ? 49.421  9.953   1.176   1.00   19.94 ? 533 PHE B CB    1 
ATOM   6781  C  CG    . PHE B  1 426 ? 49.542  9.661   -0.300  1.00   18.70 ? 533 PHE B CG    1 
ATOM   6782  C  CD1   . PHE B  1 426 ? 50.002  8.419   -0.743  1.00   15.94 ? 533 PHE B CD1   1 
ATOM   6783  C  CD2   . PHE B  1 426 ? 49.162  10.616  -1.250  1.00   16.02 ? 533 PHE B CD2   1 
ATOM   6784  C  CE1   . PHE B  1 426 ? 50.086  8.130   -2.103  1.00   13.48 ? 533 PHE B CE1   1 
ATOM   6785  C  CE2   . PHE B  1 426 ? 49.239  10.339  -2.615  1.00   13.91 ? 533 PHE B CE2   1 
ATOM   6786  C  CZ    . PHE B  1 426 ? 49.705  9.087   -3.043  1.00   15.59 ? 533 PHE B CZ    1 
ATOM   6787  N  N     . MET B  1 427 ? 48.118  8.614   4.087   1.00   20.18 ? 534 MET B N     1 
ATOM   6788  C  CA    . MET B  1 427 ? 48.069  8.732   5.537   1.00   17.97 ? 534 MET B CA    1 
ATOM   6789  C  C     . MET B  1 427 ? 49.322  8.215   6.225   1.00   17.93 ? 534 MET B C     1 
ATOM   6790  O  O     . MET B  1 427 ? 49.921  7.238   5.789   1.00   18.77 ? 534 MET B O     1 
ATOM   6791  C  CB    . MET B  1 427 ? 46.834  7.979   6.053   1.00   16.70 ? 534 MET B CB    1 
ATOM   6792  C  CG    . MET B  1 427 ? 46.476  8.197   7.522   1.00   18.71 ? 534 MET B CG    1 
ATOM   6793  S  SD    . MET B  1 427 ? 47.333  7.088   8.659   1.00   22.50 ? 534 MET B SD    1 
ATOM   6794  C  CE    . MET B  1 427 ? 46.202  5.720   8.739   1.00   22.32 ? 534 MET B CE    1 
ATOM   6795  N  N     . THR B  1 428 ? 49.727  8.881   7.300   1.00   17.12 ? 535 THR B N     1 
ATOM   6796  C  CA    . THR B  1 428 ? 50.896  8.445   8.062   1.00   16.57 ? 535 THR B CA    1 
ATOM   6797  C  C     . THR B  1 428 ? 50.597  8.409   9.557   1.00   16.19 ? 535 THR B C     1 
ATOM   6798  O  O     . THR B  1 428 ? 49.899  9.271   10.084  1.00   16.28 ? 535 THR B O     1 
ATOM   6799  C  CB    . THR B  1 428 ? 52.126  9.353   7.848   1.00   15.65 ? 535 THR B CB    1 
ATOM   6800  O  OG1   . THR B  1 428 ? 53.197  8.877   8.678   1.00   12.69 ? 535 THR B OG1   1 
ATOM   6801  C  CG2   . THR B  1 428 ? 51.810  10.800  8.211   1.00   11.16 ? 535 THR B CG2   1 
ATOM   6802  N  N     . THR B  1 429 ? 51.142  7.408   10.230  1.00   15.52 ? 536 THR B N     1 
ATOM   6803  C  CA    . THR B  1 429 ? 50.928  7.240   11.657  1.00   18.13 ? 536 THR B CA    1 
ATOM   6804  C  C     . THR B  1 429 ? 52.237  7.487   12.383  1.00   17.67 ? 536 THR B C     1 
ATOM   6805  O  O     . THR B  1 429 ? 52.306  7.382   13.607  1.00   18.68 ? 536 THR B O     1 
ATOM   6806  C  CB    . THR B  1 429 ? 50.476  5.790   11.987  1.00   19.63 ? 536 THR B CB    1 
ATOM   6807  O  OG1   . THR B  1 429 ? 51.539  4.884   11.654  1.00   17.00 ? 536 THR B OG1   1 
ATOM   6808  C  CG2   . THR B  1 429 ? 49.233  5.401   11.185  1.00   17.04 ? 536 THR B CG2   1 
ATOM   6809  N  N     . HIS B  1 430 ? 53.269  7.832   11.624  1.00   16.83 ? 537 HIS B N     1 
ATOM   6810  C  CA    . HIS B  1 430 ? 54.594  8.037   12.196  1.00   17.78 ? 537 HIS B CA    1 
ATOM   6811  C  C     . HIS B  1 430 ? 54.833  9.275   13.057  1.00   17.75 ? 537 HIS B C     1 
ATOM   6812  O  O     . HIS B  1 430 ? 55.781  9.308   13.847  1.00   19.31 ? 537 HIS B O     1 
ATOM   6813  C  CB    . HIS B  1 430 ? 55.650  7.968   11.085  1.00   16.09 ? 537 HIS B CB    1 
ATOM   6814  C  CG    . HIS B  1 430 ? 55.706  6.641   10.395  1.00   18.99 ? 537 HIS B CG    1 
ATOM   6815  N  ND1   . HIS B  1 430 ? 56.802  6.215   9.678   1.00   20.50 ? 537 HIS B ND1   1 
ATOM   6816  C  CD2   . HIS B  1 430 ? 54.795  5.642   10.315  1.00   19.95 ? 537 HIS B CD2   1 
ATOM   6817  C  CE1   . HIS B  1 430 ? 56.566  5.011   9.186   1.00   20.60 ? 537 HIS B CE1   1 
ATOM   6818  N  NE2   . HIS B  1 430 ? 55.355  4.642   9.559   1.00   21.47 ? 537 HIS B NE2   1 
ATOM   6819  N  N     . SER B  1 431 ? 53.994  10.292  12.928  1.00   17.39 ? 538 SER B N     1 
ATOM   6820  C  CA    . SER B  1 431 ? 54.193  11.495  13.730  1.00   15.91 ? 538 SER B CA    1 
ATOM   6821  C  C     . SER B  1 431 ? 53.200  11.542  14.877  1.00   15.51 ? 538 SER B C     1 
ATOM   6822  O  O     . SER B  1 431 ? 52.940  12.598  15.447  1.00   14.71 ? 538 SER B O     1 
ATOM   6823  C  CB    . SER B  1 431 ? 54.082  12.754  12.857  1.00   14.06 ? 538 SER B CB    1 
ATOM   6824  O  OG    . SER B  1 431 ? 55.265  12.945  12.091  1.00   10.10 ? 538 SER B OG    1 
ATOM   6825  N  N     . TRP B  1 432 ? 52.667  10.373  15.222  1.00   15.28 ? 539 TRP B N     1 
ATOM   6826  C  CA    . TRP B  1 432 ? 51.704  10.240  16.309  1.00   16.81 ? 539 TRP B CA    1 
ATOM   6827  C  C     . TRP B  1 432 ? 52.266  10.860  17.599  1.00   16.85 ? 539 TRP B C     1 
ATOM   6828  O  O     . TRP B  1 432 ? 53.384  10.565  18.002  1.00   18.00 ? 539 TRP B O     1 
ATOM   6829  C  CB    . TRP B  1 432 ? 51.384  8.759   16.517  1.00   16.63 ? 539 TRP B CB    1 
ATOM   6830  C  CG    . TRP B  1 432 ? 50.164  8.477   17.366  1.00   18.56 ? 539 TRP B CG    1 
ATOM   6831  C  CD1   . TRP B  1 432 ? 50.065  8.575   18.727  1.00   18.50 ? 539 TRP B CD1   1 
ATOM   6832  C  CD2   . TRP B  1 432 ? 48.864  8.069   16.898  1.00   17.39 ? 539 TRP B CD2   1 
ATOM   6833  N  NE1   . TRP B  1 432 ? 48.787  8.257   19.132  1.00   18.91 ? 539 TRP B NE1   1 
ATOM   6834  C  CE2   . TRP B  1 432 ? 48.033  7.947   18.032  1.00   17.78 ? 539 TRP B CE2   1 
ATOM   6835  C  CE3   . TRP B  1 432 ? 48.325  7.798   15.631  1.00   17.15 ? 539 TRP B CE3   1 
ATOM   6836  C  CZ2   . TRP B  1 432 ? 46.689  7.565   17.935  1.00   17.76 ? 539 TRP B CZ2   1 
ATOM   6837  C  CZ3   . TRP B  1 432 ? 46.990  7.417   15.535  1.00   14.61 ? 539 TRP B CZ3   1 
ATOM   6838  C  CH2   . TRP B  1 432 ? 46.187  7.305   16.682  1.00   15.52 ? 539 TRP B CH2   1 
ATOM   6839  N  N     . ASP B  1 433 ? 51.475  11.724  18.228  1.00   17.23 ? 540 ASP B N     1 
ATOM   6840  C  CA    . ASP B  1 433 ? 51.840  12.425  19.463  1.00   16.04 ? 540 ASP B CA    1 
ATOM   6841  C  C     . ASP B  1 433 ? 52.780  13.612  19.318  1.00   16.06 ? 540 ASP B C     1 
ATOM   6842  O  O     . ASP B  1 433 ? 53.089  14.278  20.296  1.00   16.57 ? 540 ASP B O     1 
ATOM   6843  C  CB    . ASP B  1 433 ? 52.405  11.462  20.503  1.00   13.76 ? 540 ASP B CB    1 
ATOM   6844  C  CG    . ASP B  1 433 ? 51.321  10.815  21.327  1.00   15.80 ? 540 ASP B CG    1 
ATOM   6845  O  OD1   . ASP B  1 433 ? 50.451  11.552  21.837  1.00   16.86 ? 540 ASP B OD1   1 
ATOM   6846  O  OD2   . ASP B  1 433 ? 51.333  9.579   21.469  1.00   17.66 ? 540 ASP B OD2   1 
ATOM   6847  N  N     . GLU B  1 434 ? 53.236  13.887  18.103  1.00   17.74 ? 541 GLU B N     1 
ATOM   6848  C  CA    . GLU B  1 434 ? 54.119  15.028  17.860  1.00   17.52 ? 541 GLU B CA    1 
ATOM   6849  C  C     . GLU B  1 434 ? 53.318  16.333  17.860  1.00   18.48 ? 541 GLU B C     1 
ATOM   6850  O  O     . GLU B  1 434 ? 52.096  16.314  17.745  1.00   20.33 ? 541 GLU B O     1 
ATOM   6851  C  CB    . GLU B  1 434 ? 54.787  14.902  16.494  1.00   16.61 ? 541 GLU B CB    1 
ATOM   6852  C  CG    . GLU B  1 434 ? 55.968  13.963  16.412  1.00   19.58 ? 541 GLU B CG    1 
ATOM   6853  C  CD    . GLU B  1 434 ? 56.471  13.820  14.984  1.00   20.85 ? 541 GLU B CD    1 
ATOM   6854  O  OE1   . GLU B  1 434 ? 56.225  14.735  14.172  1.00   21.69 ? 541 GLU B OE1   1 
ATOM   6855  O  OE2   . GLU B  1 434 ? 57.118  12.804  14.671  1.00   18.47 ? 541 GLU B OE2   1 
ATOM   6856  N  N     . ASP B  1 435 ? 54.008  17.463  17.997  1.00   17.91 ? 542 ASP B N     1 
ATOM   6857  C  CA    . ASP B  1 435 ? 53.346  18.763  17.937  1.00   16.50 ? 542 ASP B CA    1 
ATOM   6858  C  C     . ASP B  1 435 ? 53.393  19.031  16.436  1.00   15.44 ? 542 ASP B C     1 
ATOM   6859  O  O     . ASP B  1 435 ? 54.468  19.096  15.844  1.00   14.13 ? 542 ASP B O     1 
ATOM   6860  C  CB    . ASP B  1 435 ? 54.145  19.828  18.688  1.00   19.92 ? 542 ASP B CB    1 
ATOM   6861  C  CG    . ASP B  1 435 ? 53.482  21.201  18.653  1.00   22.55 ? 542 ASP B CG    1 
ATOM   6862  O  OD1   . ASP B  1 435 ? 53.012  21.628  17.577  1.00   25.46 ? 542 ASP B OD1   1 
ATOM   6863  O  OD2   . ASP B  1 435 ? 53.447  21.863  19.705  1.00   23.13 ? 542 ASP B OD2   1 
ATOM   6864  N  N     . PRO B  1 436 ? 52.225  19.177  15.799  1.00   15.24 ? 543 PRO B N     1 
ATOM   6865  C  CA    . PRO B  1 436 ? 52.189  19.419  14.354  1.00   14.97 ? 543 PRO B CA    1 
ATOM   6866  C  C     . PRO B  1 436 ? 52.534  20.816  13.856  1.00   16.39 ? 543 PRO B C     1 
ATOM   6867  O  O     . PRO B  1 436 ? 52.727  21.002  12.652  1.00   15.27 ? 543 PRO B O     1 
ATOM   6868  C  CB    . PRO B  1 436 ? 50.770  19.000  13.979  1.00   13.59 ? 543 PRO B CB    1 
ATOM   6869  C  CG    . PRO B  1 436 ? 49.980  19.415  15.205  1.00   17.01 ? 543 PRO B CG    1 
ATOM   6870  C  CD    . PRO B  1 436 ? 50.868  18.974  16.347  1.00   14.07 ? 543 PRO B CD    1 
ATOM   6871  N  N     . SER B  1 437 ? 52.619  21.799  14.748  1.00   16.98 ? 544 SER B N     1 
ATOM   6872  C  CA    . SER B  1 437 ? 52.927  23.152  14.280  1.00   19.76 ? 544 SER B CA    1 
ATOM   6873  C  C     . SER B  1 437 ? 54.384  23.262  13.855  1.00   18.67 ? 544 SER B C     1 
ATOM   6874  O  O     . SER B  1 437 ? 55.251  22.580  14.395  1.00   17.39 ? 544 SER B O     1 
ATOM   6875  C  CB    . SER B  1 437 ? 52.623  24.194  15.355  1.00   18.06 ? 544 SER B CB    1 
ATOM   6876  O  OG    . SER B  1 437 ? 53.546  24.093  16.415  1.00   22.24 ? 544 SER B OG    1 
ATOM   6877  N  N     . GLY B  1 438 ? 54.640  24.123  12.878  1.00   18.37 ? 545 GLY B N     1 
ATOM   6878  C  CA    . GLY B  1 438 ? 55.988  24.289  12.384  1.00   20.16 ? 545 GLY B CA    1 
ATOM   6879  C  C     . GLY B  1 438 ? 56.028  24.096  10.878  1.00   24.27 ? 545 GLY B C     1 
ATOM   6880  O  O     . GLY B  1 438 ? 54.994  24.170  10.209  1.00   26.10 ? 545 GLY B O     1 
ATOM   6881  N  N     . GLU B  1 439 ? 57.217  23.830  10.344  1.00   24.31 ? 546 GLU B N     1 
ATOM   6882  C  CA    . GLU B  1 439 ? 57.382  23.643  8.911   1.00   24.50 ? 546 GLU B CA    1 
ATOM   6883  C  C     . GLU B  1 439 ? 57.228  22.198  8.459   1.00   23.29 ? 546 GLU B C     1 
ATOM   6884  O  O     . GLU B  1 439 ? 57.927  21.307  8.936   1.00   24.94 ? 546 GLU B O     1 
ATOM   6885  C  CB    . GLU B  1 439 ? 58.752  24.146  8.465   1.00   26.12 ? 546 GLU B CB    1 
ATOM   6886  C  CG    . GLU B  1 439 ? 58.921  24.206  6.953   1.00   30.74 ? 546 GLU B CG    1 
ATOM   6887  C  CD    . GLU B  1 439 ? 60.339  24.571  6.539   1.00   34.38 ? 546 GLU B CD    1 
ATOM   6888  O  OE1   . GLU B  1 439 ? 60.505  25.243  5.494   1.00   34.47 ? 546 GLU B OE1   1 
ATOM   6889  O  OE2   . GLU B  1 439 ? 61.288  24.176  7.253   1.00   36.15 ? 546 GLU B OE2   1 
ATOM   6890  N  N     . TRP B  1 440 ? 56.297  21.975  7.541   1.00   21.89 ? 547 TRP B N     1 
ATOM   6891  C  CA    . TRP B  1 440 ? 56.070  20.654  6.980   1.00   20.53 ? 547 TRP B CA    1 
ATOM   6892  C  C     . TRP B  1 440 ? 56.680  20.699  5.590   1.00   20.79 ? 547 TRP B C     1 
ATOM   6893  O  O     . TRP B  1 440 ? 56.628  21.735  4.920   1.00   23.05 ? 547 TRP B O     1 
ATOM   6894  C  CB    . TRP B  1 440 ? 54.576  20.347  6.865   1.00   18.28 ? 547 TRP B CB    1 
ATOM   6895  C  CG    . TRP B  1 440 ? 53.950  19.904  8.139   1.00   17.13 ? 547 TRP B CG    1 
ATOM   6896  C  CD1   . TRP B  1 440 ? 53.448  20.698  9.126   1.00   17.81 ? 547 TRP B CD1   1 
ATOM   6897  C  CD2   . TRP B  1 440 ? 53.740  18.554  8.560   1.00   16.99 ? 547 TRP B CD2   1 
ATOM   6898  N  NE1   . TRP B  1 440 ? 52.932  19.926  10.137  1.00   16.93 ? 547 TRP B NE1   1 
ATOM   6899  C  CE2   . TRP B  1 440 ? 53.098  18.604  9.817   1.00   17.43 ? 547 TRP B CE2   1 
ATOM   6900  C  CE3   . TRP B  1 440 ? 54.033  17.303  7.997   1.00   19.05 ? 547 TRP B CE3   1 
ATOM   6901  C  CZ2   . TRP B  1 440 ? 52.740  17.446  10.526  1.00   16.32 ? 547 TRP B CZ2   1 
ATOM   6902  C  CZ3   . TRP B  1 440 ? 53.676  16.149  8.703   1.00   18.04 ? 547 TRP B CZ3   1 
ATOM   6903  C  CH2   . TRP B  1 440 ? 53.035  16.234  9.957   1.00   16.99 ? 547 TRP B CH2   1 
ATOM   6904  N  N     . VAL B  1 441 ? 57.260  19.589  5.151   1.00   19.28 ? 548 VAL B N     1 
ATOM   6905  C  CA    . VAL B  1 441 ? 57.875  19.546  3.831   1.00   18.47 ? 548 VAL B CA    1 
ATOM   6906  C  C     . VAL B  1 441 ? 57.396  18.347  3.030   1.00   21.55 ? 548 VAL B C     1 
ATOM   6907  O  O     . VAL B  1 441 ? 57.453  17.203  3.508   1.00   23.30 ? 548 VAL B O     1 
ATOM   6908  C  CB    . VAL B  1 441 ? 59.420  19.469  3.927   1.00   16.46 ? 548 VAL B CB    1 
ATOM   6909  C  CG1   . VAL B  1 441 ? 60.012  19.449  2.532   1.00   17.52 ? 548 VAL B CG1   1 
ATOM   6910  C  CG2   . VAL B  1 441 ? 59.973  20.652  4.715   1.00   12.14 ? 548 VAL B CG2   1 
ATOM   6911  N  N     . LEU B  1 442 ? 56.915  18.607  1.817   1.00   21.74 ? 549 LEU B N     1 
ATOM   6912  C  CA    . LEU B  1 442 ? 56.446  17.538  0.942   1.00   21.94 ? 549 LEU B CA    1 
ATOM   6913  C  C     . LEU B  1 442 ? 57.497  17.362  -0.134  1.00   23.94 ? 549 LEU B C     1 
ATOM   6914  O  O     . LEU B  1 442 ? 57.968  18.345  -0.714  1.00   25.99 ? 549 LEU B O     1 
ATOM   6915  C  CB    . LEU B  1 442 ? 55.113  17.895  0.287   1.00   21.03 ? 549 LEU B CB    1 
ATOM   6916  C  CG    . LEU B  1 442 ? 54.586  16.809  -0.666  1.00   21.33 ? 549 LEU B CG    1 
ATOM   6917  C  CD1   . LEU B  1 442 ? 54.181  15.581  0.143   1.00   19.62 ? 549 LEU B CD1   1 
ATOM   6918  C  CD2   . LEU B  1 442 ? 53.395  17.330  -1.469  1.00   20.59 ? 549 LEU B CD2   1 
ATOM   6919  N  N     . GLU B  1 443 ? 57.878  16.115  -0.389  1.00   23.18 ? 550 GLU B N     1 
ATOM   6920  C  CA    . GLU B  1 443 ? 58.881  15.835  -1.402  1.00   24.49 ? 550 GLU B CA    1 
ATOM   6921  C  C     . GLU B  1 443 ? 58.349  14.872  -2.448  1.00   23.06 ? 550 GLU B C     1 
ATOM   6922  O  O     . GLU B  1 443 ? 57.873  13.783  -2.123  1.00   23.11 ? 550 GLU B O     1 
ATOM   6923  C  CB    . GLU B  1 443 ? 60.134  15.236  -0.767  1.00   27.27 ? 550 GLU B CB    1 
ATOM   6924  C  CG    . GLU B  1 443 ? 60.774  16.107  0.286   1.00   34.23 ? 550 GLU B CG    1 
ATOM   6925  C  CD    . GLU B  1 443 ? 62.010  15.454  0.889   1.00   37.88 ? 550 GLU B CD    1 
ATOM   6926  O  OE1   . GLU B  1 443 ? 62.616  16.059  1.802   1.00   38.46 ? 550 GLU B OE1   1 
ATOM   6927  O  OE2   . GLU B  1 443 ? 62.377  14.340  0.447   1.00   38.71 ? 550 GLU B OE2   1 
ATOM   6928  N  N     . ILE B  1 444 ? 58.422  15.286  -3.706  1.00   21.20 ? 551 ILE B N     1 
ATOM   6929  C  CA    . ILE B  1 444 ? 57.982  14.451  -4.811  1.00   22.48 ? 551 ILE B CA    1 
ATOM   6930  C  C     . ILE B  1 444 ? 59.187  14.338  -5.722  1.00   24.40 ? 551 ILE B C     1 
ATOM   6931  O  O     . ILE B  1 444 ? 59.744  15.351  -6.148  1.00   25.31 ? 551 ILE B O     1 
ATOM   6932  C  CB    . ILE B  1 444 ? 56.840  15.100  -5.583  1.00   21.65 ? 551 ILE B CB    1 
ATOM   6933  C  CG1   . ILE B  1 444 ? 55.643  15.293  -4.655  1.00   21.11 ? 551 ILE B CG1   1 
ATOM   6934  C  CG2   . ILE B  1 444 ? 56.497  14.262  -6.796  1.00   21.63 ? 551 ILE B CG2   1 
ATOM   6935  C  CD1   . ILE B  1 444 ? 54.472  15.997  -5.297  1.00   19.71 ? 551 ILE B CD1   1 
ATOM   6936  N  N     . GLU B  1 445 ? 59.598  13.115  -6.026  1.00   25.68 ? 552 GLU B N     1 
ATOM   6937  C  CA    . GLU B  1 445 ? 60.769  12.931  -6.870  1.00   27.07 ? 552 GLU B CA    1 
ATOM   6938  C  C     . GLU B  1 445 ? 60.583  11.835  -7.901  1.00   25.93 ? 552 GLU B C     1 
ATOM   6939  O  O     . GLU B  1 445 ? 59.851  10.871  -7.680  1.00   25.99 ? 552 GLU B O     1 
ATOM   6940  C  CB    . GLU B  1 445 ? 61.973  12.577  -6.008  1.00   30.37 ? 552 GLU B CB    1 
ATOM   6941  C  CG    . GLU B  1 445 ? 61.863  11.203  -5.394  1.00   37.02 ? 552 GLU B CG    1 
ATOM   6942  C  CD    . GLU B  1 445 ? 63.037  10.882  -4.489  1.00   41.90 ? 552 GLU B CD    1 
ATOM   6943  O  OE1   . GLU B  1 445 ? 64.170  11.317  -4.828  1.00   42.10 ? 552 GLU B OE1   1 
ATOM   6944  O  OE2   . GLU B  1 445 ? 62.828  10.193  -3.455  1.00   40.22 ? 552 GLU B OE2   1 
ATOM   6945  N  N     . ASN B  1 446 ? 61.259  11.996  -9.031  1.00   24.80 ? 553 ASN B N     1 
ATOM   6946  C  CA    . ASN B  1 446 ? 61.226  11.010  -10.098 1.00   23.66 ? 553 ASN B CA    1 
ATOM   6947  C  C     . ASN B  1 446 ? 62.384  10.058  -9.803  1.00   24.53 ? 553 ASN B C     1 
ATOM   6948  O  O     . ASN B  1 446 ? 63.555  10.427  -9.944  1.00   23.51 ? 553 ASN B O     1 
ATOM   6949  C  CB    . ASN B  1 446 ? 61.449  11.676  -11.455 1.00   23.49 ? 553 ASN B CB    1 
ATOM   6950  C  CG    . ASN B  1 446 ? 61.479  10.669  -12.601 1.00   24.67 ? 553 ASN B CG    1 
ATOM   6951  O  OD1   . ASN B  1 446 ? 61.333  9.460   -12.396 1.00   22.59 ? 553 ASN B OD1   1 
ATOM   6952  N  ND2   . ASN B  1 446 ? 61.666  11.169  -13.814 1.00   26.17 ? 553 ASN B ND2   1 
ATOM   6953  N  N     . THR B  1 447 ? 62.059  8.840   -9.387  1.00   23.88 ? 554 THR B N     1 
ATOM   6954  C  CA    . THR B  1 447 ? 63.081  7.858   -9.052  1.00   24.63 ? 554 THR B CA    1 
ATOM   6955  C  C     . THR B  1 447 ? 63.676  7.152   -10.271 1.00   25.53 ? 554 THR B C     1 
ATOM   6956  O  O     . THR B  1 447 ? 64.480  6.231   -10.141 1.00   26.04 ? 554 THR B O     1 
ATOM   6957  C  CB    . THR B  1 447 ? 62.507  6.818   -8.087  1.00   22.69 ? 554 THR B CB    1 
ATOM   6958  O  OG1   . THR B  1 447 ? 61.438  6.116   -8.726  1.00   21.51 ? 554 THR B OG1   1 
ATOM   6959  C  CG2   . THR B  1 447 ? 61.946  7.510   -6.861  1.00   21.63 ? 554 THR B CG2   1 
ATOM   6960  N  N     . SER B  1 448 ? 63.292  7.603   -11.456 1.00   28.03 ? 555 SER B N     1 
ATOM   6961  C  CA    . SER B  1 448 ? 63.771  7.015   -12.698 1.00   30.79 ? 555 SER B CA    1 
ATOM   6962  C  C     . SER B  1 448 ? 64.657  7.974   -13.512 1.00   32.98 ? 555 SER B C     1 
ATOM   6963  O  O     . SER B  1 448 ? 64.657  9.192   -13.292 1.00   32.31 ? 555 SER B O     1 
ATOM   6964  C  CB    . SER B  1 448 ? 62.565  6.579   -13.532 1.00   32.07 ? 555 SER B CB    1 
ATOM   6965  O  OG    . SER B  1 448 ? 62.903  6.405   -14.898 1.00   36.44 ? 555 SER B OG    1 
ATOM   6966  N  N     . GLU B  1 449 ? 65.417  7.416   -14.449 1.00   33.50 ? 556 GLU B N     1 
ATOM   6967  C  CA    . GLU B  1 449 ? 66.283  8.223   -15.302 1.00   35.63 ? 556 GLU B CA    1 
ATOM   6968  C  C     . GLU B  1 449 ? 65.461  8.794   -16.452 1.00   35.78 ? 556 GLU B C     1 
ATOM   6969  O  O     . GLU B  1 449 ? 65.889  9.727   -17.128 1.00   36.19 ? 556 GLU B O     1 
ATOM   6970  C  CB    . GLU B  1 449 ? 67.424  7.385   -15.895 1.00   38.30 ? 556 GLU B CB    1 
ATOM   6971  C  CG    . GLU B  1 449 ? 68.494  6.915   -14.921 1.00   43.36 ? 556 GLU B CG    1 
ATOM   6972  C  CD    . GLU B  1 449 ? 69.144  8.060   -14.147 1.00   46.34 ? 556 GLU B CD    1 
ATOM   6973  O  OE1   . GLU B  1 449 ? 69.122  9.211   -14.636 1.00   47.70 ? 556 GLU B OE1   1 
ATOM   6974  O  OE2   . GLU B  1 449 ? 69.692  7.801   -13.052 1.00   47.95 ? 556 GLU B OE2   1 
ATOM   6975  N  N     . ALA B  1 450 ? 64.283  8.217   -16.675 1.00   36.22 ? 557 ALA B N     1 
ATOM   6976  C  CA    . ALA B  1 450 ? 63.384  8.655   -17.743 1.00   36.77 ? 557 ALA B CA    1 
ATOM   6977  C  C     . ALA B  1 450 ? 62.970  10.110  -17.548 1.00   38.21 ? 557 ALA B C     1 
ATOM   6978  O  O     . ALA B  1 450 ? 62.859  10.590  -16.418 1.00   41.30 ? 557 ALA B O     1 
ATOM   6979  C  CB    . ALA B  1 450 ? 62.148  7.763   -17.780 1.00   35.60 ? 557 ALA B CB    1 
ATOM   6980  N  N     . ASN B  1 451 ? 62.738  10.813  -18.651 1.00   38.19 ? 558 ASN B N     1 
ATOM   6981  C  CA    . ASN B  1 451 ? 62.330  12.215  -18.573 1.00   38.68 ? 558 ASN B CA    1 
ATOM   6982  C  C     . ASN B  1 451 ? 60.816  12.286  -18.399 1.00   38.31 ? 558 ASN B C     1 
ATOM   6983  O  O     . ASN B  1 451 ? 60.082  12.489  -19.364 1.00   41.29 ? 558 ASN B O     1 
ATOM   6984  C  CB    . ASN B  1 451 ? 62.756  12.971  -19.843 1.00   38.48 ? 558 ASN B CB    1 
ATOM   6985  C  CG    . ASN B  1 451 ? 64.266  13.179  -19.925 1.00   37.25 ? 558 ASN B CG    1 
ATOM   6986  O  OD1   . ASN B  1 451 ? 64.841  13.943  -19.149 0.0000 36.96 ? 558 ASN B OD1   1 
ATOM   6987  N  ND2   . ASN B  1 451 ? 64.909  12.490  -20.859 0.0000 36.96 ? 558 ASN B ND2   1 
ATOM   6988  N  N     . ASN B  1 452 ? 60.354  12.105  -17.165 1.00   36.96 ? 559 ASN B N     1 
ATOM   6989  C  CA    . ASN B  1 452 ? 58.930  12.141  -16.872 1.00   32.77 ? 559 ASN B CA    1 
ATOM   6990  C  C     . ASN B  1 452 ? 58.478  13.575  -16.631 1.00   32.32 ? 559 ASN B C     1 
ATOM   6991  O  O     . ASN B  1 452 ? 59.297  14.460  -16.384 1.00   34.40 ? 559 ASN B O     1 
ATOM   6992  C  CB    . ASN B  1 452 ? 58.618  11.293  -15.638 1.00   32.51 ? 559 ASN B CB    1 
ATOM   6993  C  CG    . ASN B  1 452 ? 58.994  9.826   -15.810 1.00   32.57 ? 559 ASN B CG    1 
ATOM   6994  O  OD1   . ASN B  1 452 ? 58.690  9.206   -16.829 1.00   34.24 ? 559 ASN B OD1   1 
ATOM   6995  N  ND2   . ASN B  1 452 ? 59.638  9.260   -14.796 1.00   31.76 ? 559 ASN B ND2   1 
ATOM   6996  N  N     . TYR B  1 453 ? 57.170  13.796  -16.691 1.00   30.30 ? 560 TYR B N     1 
ATOM   6997  C  CA    . TYR B  1 453 ? 56.605  15.126  -16.502 1.00   30.85 ? 560 TYR B CA    1 
ATOM   6998  C  C     . TYR B  1 453 ? 55.227  15.086  -15.824 1.00   30.39 ? 560 TYR B C     1 
ATOM   6999  O  O     . TYR B  1 453 ? 54.470  14.118  -15.962 1.00   28.89 ? 560 TYR B O     1 
ATOM   7000  C  CB    . TYR B  1 453 ? 56.482  15.830  -17.861 1.00   30.53 ? 560 TYR B CB    1 
ATOM   7001  C  CG    . TYR B  1 453 ? 55.721  15.026  -18.898 1.00   31.67 ? 560 TYR B CG    1 
ATOM   7002  C  CD1   . TYR B  1 453 ? 56.343  13.994  -19.601 1.00   31.60 ? 560 TYR B CD1   1 
ATOM   7003  C  CD2   . TYR B  1 453 ? 54.360  15.259  -19.134 1.00   31.65 ? 560 TYR B CD2   1 
ATOM   7004  C  CE1   . TYR B  1 453 ? 55.632  13.211  -20.509 1.00   33.77 ? 560 TYR B CE1   1 
ATOM   7005  C  CE2   . TYR B  1 453 ? 53.639  14.483  -20.038 1.00   32.51 ? 560 TYR B CE2   1 
ATOM   7006  C  CZ    . TYR B  1 453 ? 54.281  13.456  -20.720 1.00   35.60 ? 560 TYR B CZ    1 
ATOM   7007  O  OH    . TYR B  1 453 ? 53.572  12.656  -21.592 1.00   37.38 ? 560 TYR B OH    1 
ATOM   7008  N  N     . GLY B  1 454 ? 54.902  16.152  -15.100 1.00   28.91 ? 561 GLY B N     1 
ATOM   7009  C  CA    . GLY B  1 454 ? 53.621  16.216  -14.425 1.00   28.00 ? 561 GLY B CA    1 
ATOM   7010  C  C     . GLY B  1 454 ? 53.442  17.481  -13.606 1.00   28.06 ? 561 GLY B C     1 
ATOM   7011  O  O     . GLY B  1 454 ? 54.365  18.290  -13.468 1.00   26.57 ? 561 GLY B O     1 
ATOM   7012  N  N     . THR B  1 455 ? 52.248  17.642  -13.044 1.00   28.07 ? 562 THR B N     1 
ATOM   7013  C  CA    . THR B  1 455 ? 51.934  18.813  -12.240 1.00   27.75 ? 562 THR B CA    1 
ATOM   7014  C  C     . THR B  1 455 ? 51.184  18.479  -10.956 1.00   27.89 ? 562 THR B C     1 
ATOM   7015  O  O     . THR B  1 455 ? 50.234  17.691  -10.968 1.00   28.64 ? 562 THR B O     1 
ATOM   7016  C  CB    . THR B  1 455 ? 51.060  19.800  -13.043 1.00   26.67 ? 562 THR B CB    1 
ATOM   7017  O  OG1   . THR B  1 455 ? 51.816  20.315  -14.146 1.00   26.60 ? 562 THR B OG1   1 
ATOM   7018  C  CG2   . THR B  1 455 ? 50.572  20.956  -12.154 1.00   25.56 ? 562 THR B CG2   1 
ATOM   7019  N  N     . LEU B  1 456 ? 51.615  19.080  -9.850  1.00   27.07 ? 563 LEU B N     1 
ATOM   7020  C  CA    . LEU B  1 456 ? 50.943  18.901  -8.564  1.00   26.44 ? 563 LEU B CA    1 
ATOM   7021  C  C     . LEU B  1 456 ? 49.953  20.063  -8.478  1.00   27.23 ? 563 LEU B C     1 
ATOM   7022  O  O     . LEU B  1 456 ? 50.361  21.230  -8.443  1.00   27.30 ? 563 LEU B O     1 
ATOM   7023  C  CB    . LEU B  1 456 ? 51.934  18.999  -7.404  1.00   24.57 ? 563 LEU B CB    1 
ATOM   7024  C  CG    . LEU B  1 456 ? 51.297  19.034  -6.011  1.00   24.19 ? 563 LEU B CG    1 
ATOM   7025  C  CD1   . LEU B  1 456 ? 50.640  17.684  -5.708  1.00   23.39 ? 563 LEU B CD1   1 
ATOM   7026  C  CD2   . LEU B  1 456 ? 52.364  19.362  -4.973  1.00   23.92 ? 563 LEU B CD2   1 
ATOM   7027  N  N     . THR B  1 457 ? 48.659  19.759  -8.450  1.00   27.43 ? 564 THR B N     1 
ATOM   7028  C  CA    . THR B  1 457 ? 47.656  20.819  -8.405  1.00   27.74 ? 564 THR B CA    1 
ATOM   7029  C  C     . THR B  1 457 ? 47.009  21.014  -7.047  1.00   26.71 ? 564 THR B C     1 
ATOM   7030  O  O     . THR B  1 457 ? 46.386  22.044  -6.798  1.00   26.47 ? 564 THR B O     1 
ATOM   7031  C  CB    . THR B  1 457 ? 46.540  20.567  -9.431  1.00   28.28 ? 564 THR B CB    1 
ATOM   7032  O  OG1   . THR B  1 457 ? 45.897  19.318  -9.133  1.00   28.23 ? 564 THR B OG1   1 
ATOM   7033  C  CG2   . THR B  1 457 ? 47.116  20.525  -10.843 1.00   28.15 ? 564 THR B CG2   1 
ATOM   7034  N  N     . LYS B  1 458 ? 47.132  20.029  -6.168  1.00   25.08 ? 565 LYS B N     1 
ATOM   7035  C  CA    . LYS B  1 458 ? 46.543  20.175  -4.848  1.00   23.17 ? 565 LYS B CA    1 
ATOM   7036  C  C     . LYS B  1 458 ? 47.298  19.395  -3.801  1.00   20.97 ? 565 LYS B C     1 
ATOM   7037  O  O     . LYS B  1 458 ? 47.672  18.244  -4.013  1.00   21.91 ? 565 LYS B O     1 
ATOM   7038  C  CB    . LYS B  1 458 ? 45.079  19.727  -4.841  1.00   23.03 ? 565 LYS B CB    1 
ATOM   7039  C  CG    . LYS B  1 458 ? 44.311  20.233  -3.627  1.00   25.00 ? 565 LYS B CG    1 
ATOM   7040  C  CD    . LYS B  1 458 ? 42.876  19.713  -3.589  1.00   30.52 ? 565 LYS B CD    1 
ATOM   7041  C  CE    . LYS B  1 458 ? 42.754  18.421  -2.771  1.00   34.64 ? 565 LYS B CE    1 
ATOM   7042  N  NZ    . LYS B  1 458 ? 43.719  17.345  -3.195  1.00   33.12 ? 565 LYS B NZ    1 
ATOM   7043  N  N     . PHE B  1 459 ? 47.518  20.044  -2.667  1.00   18.67 ? 566 PHE B N     1 
ATOM   7044  C  CA    . PHE B  1 459 ? 48.199  19.444  -1.533  1.00   18.69 ? 566 PHE B CA    1 
ATOM   7045  C  C     . PHE B  1 459 ? 47.530  19.971  -0.268  1.00   19.68 ? 566 PHE B C     1 
ATOM   7046  O  O     . PHE B  1 459 ? 47.840  21.064  0.202   1.00   22.54 ? 566 PHE B O     1 
ATOM   7047  C  CB    . PHE B  1 459 ? 49.698  19.800  -1.547  1.00   16.84 ? 566 PHE B CB    1 
ATOM   7048  C  CG    . PHE B  1 459 ? 50.426  19.502  -0.244  1.00   17.62 ? 566 PHE B CG    1 
ATOM   7049  C  CD1   . PHE B  1 459 ? 50.006  18.473  0.602   1.00   17.53 ? 566 PHE B CD1   1 
ATOM   7050  C  CD2   . PHE B  1 459 ? 51.542  20.241  0.126   1.00   16.92 ? 566 PHE B CD2   1 
ATOM   7051  C  CE1   . PHE B  1 459 ? 50.686  18.195  1.787   1.00   15.28 ? 566 PHE B CE1   1 
ATOM   7052  C  CE2   . PHE B  1 459 ? 52.227  19.966  1.310   1.00   16.72 ? 566 PHE B CE2   1 
ATOM   7053  C  CZ    . PHE B  1 459 ? 51.796  18.940  2.141   1.00   14.66 ? 566 PHE B CZ    1 
ATOM   7054  N  N     . THR B  1 460 ? 46.593  19.197  0.266   1.00   18.81 ? 567 THR B N     1 
ATOM   7055  C  CA    . THR B  1 460 ? 45.896  19.589  1.482   1.00   18.58 ? 567 THR B CA    1 
ATOM   7056  C  C     . THR B  1 460 ? 46.391  18.738  2.641   1.00   18.51 ? 567 THR B C     1 
ATOM   7057  O  O     . THR B  1 460 ? 46.378  17.509  2.574   1.00   17.88 ? 567 THR B O     1 
ATOM   7058  C  CB    . THR B  1 460 ? 44.379  19.385  1.346   1.00   19.70 ? 567 THR B CB    1 
ATOM   7059  O  OG1   . THR B  1 460 ? 43.920  20.034  0.154   1.00   21.61 ? 567 THR B OG1   1 
ATOM   7060  C  CG2   . THR B  1 460 ? 43.646  19.979  2.532   1.00   17.10 ? 567 THR B CG2   1 
ATOM   7061  N  N     . LEU B  1 461 ? 46.844  19.401  3.698   1.00   19.83 ? 568 LEU B N     1 
ATOM   7062  C  CA    . LEU B  1 461 ? 47.331  18.711  4.889   1.00   18.96 ? 568 LEU B CA    1 
ATOM   7063  C  C     . LEU B  1 461 ? 46.162  18.624  5.884   1.00   18.39 ? 568 LEU B C     1 
ATOM   7064  O  O     . LEU B  1 461 ? 45.513  19.626  6.194   1.00   17.14 ? 568 LEU B O     1 
ATOM   7065  C  CB    . LEU B  1 461 ? 48.507  19.489  5.502   1.00   17.21 ? 568 LEU B CB    1 
ATOM   7066  C  CG    . LEU B  1 461 ? 49.310  18.825  6.636   1.00   19.75 ? 568 LEU B CG    1 
ATOM   7067  C  CD1   . LEU B  1 461 ? 50.003  17.582  6.112   1.00   15.19 ? 568 LEU B CD1   1 
ATOM   7068  C  CD2   . LEU B  1 461 ? 50.345  19.803  7.193   1.00   18.24 ? 568 LEU B CD2   1 
ATOM   7069  N  N     . VAL B  1 462 ? 45.875  17.421  6.360   1.00   14.78 ? 569 VAL B N     1 
ATOM   7070  C  CA    . VAL B  1 462 ? 44.793  17.249  7.311   1.00   15.26 ? 569 VAL B CA    1 
ATOM   7071  C  C     . VAL B  1 462 ? 45.337  16.640  8.587   1.00   16.20 ? 569 VAL B C     1 
ATOM   7072  O  O     . VAL B  1 462 ? 45.855  15.533  8.584   1.00   18.63 ? 569 VAL B O     1 
ATOM   7073  C  CB    . VAL B  1 462 ? 43.685  16.341  6.753   1.00   15.01 ? 569 VAL B CB    1 
ATOM   7074  C  CG1   . VAL B  1 462 ? 42.581  16.175  7.795   1.00   14.69 ? 569 VAL B CG1   1 
ATOM   7075  C  CG2   . VAL B  1 462 ? 43.133  16.938  5.459   1.00   14.26 ? 569 VAL B CG2   1 
ATOM   7076  N  N     . LEU B  1 463 ? 45.216  17.378  9.681   1.00   17.33 ? 570 LEU B N     1 
ATOM   7077  C  CA    . LEU B  1 463 ? 45.702  16.928  10.975  1.00   18.74 ? 570 LEU B CA    1 
ATOM   7078  C  C     . LEU B  1 463 ? 44.561  16.513  11.917  1.00   19.20 ? 570 LEU B C     1 
ATOM   7079  O  O     . LEU B  1 463 ? 43.576  17.234  12.073  1.00   20.28 ? 570 LEU B O     1 
ATOM   7080  C  CB    . LEU B  1 463 ? 46.519  18.051  11.629  1.00   19.84 ? 570 LEU B CB    1 
ATOM   7081  C  CG    . LEU B  1 463 ? 47.568  18.754  10.749  1.00   21.72 ? 570 LEU B CG    1 
ATOM   7082  C  CD1   . LEU B  1 463 ? 48.076  19.998  11.453  1.00   19.33 ? 570 LEU B CD1   1 
ATOM   7083  C  CD2   . LEU B  1 463 ? 48.715  17.809  10.444  1.00   20.06 ? 570 LEU B CD2   1 
ATOM   7084  N  N     . TYR B  1 464 ? 44.704  15.345  12.536  1.00   18.84 ? 571 TYR B N     1 
ATOM   7085  C  CA    . TYR B  1 464 ? 43.727  14.831  13.493  1.00   19.45 ? 571 TYR B CA    1 
ATOM   7086  C  C     . TYR B  1 464 ? 44.456  14.808  14.825  1.00   21.57 ? 571 TYR B C     1 
ATOM   7087  O  O     . TYR B  1 464 ? 45.669  14.590  14.860  1.00   24.64 ? 571 TYR B O     1 
ATOM   7088  C  CB    . TYR B  1 464 ? 43.303  13.403  13.135  1.00   17.54 ? 571 TYR B CB    1 
ATOM   7089  C  CG    . TYR B  1 464 ? 42.466  13.287  11.881  1.00   19.10 ? 571 TYR B CG    1 
ATOM   7090  C  CD1   . TYR B  1 464 ? 41.084  13.474  11.917  1.00   18.57 ? 571 TYR B CD1   1 
ATOM   7091  C  CD2   . TYR B  1 464 ? 43.061  13.018  10.646  1.00   20.75 ? 571 TYR B CD2   1 
ATOM   7092  C  CE1   . TYR B  1 464 ? 40.310  13.398  10.742  1.00   20.20 ? 571 TYR B CE1   1 
ATOM   7093  C  CE2   . TYR B  1 464 ? 42.299  12.941  9.472   1.00   20.97 ? 571 TYR B CE2   1 
ATOM   7094  C  CZ    . TYR B  1 464 ? 40.930  13.134  9.528   1.00   20.75 ? 571 TYR B CZ    1 
ATOM   7095  O  OH    . TYR B  1 464 ? 40.194  13.074  8.362   1.00   25.13 ? 571 TYR B OH    1 
ATOM   7096  N  N     . GLY B  1 465 ? 43.740  15.030  15.922  1.00   21.94 ? 572 GLY B N     1 
ATOM   7097  C  CA    . GLY B  1 465 ? 44.406  15.014  17.212  1.00   22.48 ? 572 GLY B CA    1 
ATOM   7098  C  C     . GLY B  1 465 ? 43.743  15.813  18.321  1.00   23.35 ? 572 GLY B C     1 
ATOM   7099  O  O     . GLY B  1 465 ? 42.575  16.187  18.228  1.00   23.76 ? 572 GLY B O     1 
ATOM   7100  N  N     . THR B  1 466 ? 44.509  16.089  19.371  1.00   22.96 ? 573 THR B N     1 
ATOM   7101  C  CA    . THR B  1 466 ? 43.997  16.810  20.527  1.00   23.50 ? 573 THR B CA    1 
ATOM   7102  C  C     . THR B  1 466 ? 44.949  17.917  20.967  1.00   24.56 ? 573 THR B C     1 
ATOM   7103  O  O     . THR B  1 466 ? 46.017  18.104  20.376  1.00   22.58 ? 573 THR B O     1 
ATOM   7104  C  CB    . THR B  1 466 ? 43.820  15.862  21.706  1.00   22.30 ? 573 THR B CB    1 
ATOM   7105  O  OG1   . THR B  1 466 ? 45.108  15.361  22.076  1.00   23.38 ? 573 THR B OG1   1 
ATOM   7106  C  CG2   . THR B  1 466 ? 42.902  14.687  21.329  1.00   16.67 ? 573 THR B CG2   1 
ATOM   7107  N  N     . ALA B  1 467 ? 44.555  18.636  22.017  1.00   26.28 ? 574 ALA B N     1 
ATOM   7108  C  CA    . ALA B  1 467 ? 45.354  19.738  22.549  1.00   28.26 ? 574 ALA B CA    1 
ATOM   7109  C  C     . ALA B  1 467 ? 45.701  19.581  24.033  1.00   29.44 ? 574 ALA B C     1 
ATOM   7110  O  O     . ALA B  1 467 ? 45.575  18.455  24.565  1.00   30.67 ? 574 ALA B O     1 
ATOM   7111  C  CB    . ALA B  1 467 ? 44.630  21.049  22.328  1.00   28.16 ? 574 ALA B CB    1 
ATOM   7112  N  N     . VAL C  1 2   ? -14.455 71.878  25.377  1.00   30.52 ? 109 VAL C N     1 
ATOM   7113  C  CA    . VAL C  1 2   ? -12.961 71.769  25.243  1.00   33.54 ? 109 VAL C CA    1 
ATOM   7114  C  C     . VAL C  1 2   ? -12.262 72.104  26.565  1.00   34.94 ? 109 VAL C C     1 
ATOM   7115  O  O     . VAL C  1 2   ? -12.614 73.086  27.235  1.00   35.78 ? 109 VAL C O     1 
ATOM   7116  C  CB    . VAL C  1 2   ? -12.402 72.723  24.164  1.00   30.82 ? 109 VAL C CB    1 
ATOM   7117  C  CG1   . VAL C  1 2   ? -10.893 72.674  24.157  1.00   30.84 ? 109 VAL C CG1   1 
ATOM   7118  C  CG2   . VAL C  1 2   ? -12.910 72.327  22.808  1.00   31.51 ? 109 VAL C CG2   1 
ATOM   7119  N  N     . TYR C  1 3   ? -11.274 71.288  26.931  1.00   32.58 ? 110 TYR C N     1 
ATOM   7120  C  CA    . TYR C  1 3   ? -10.530 71.497  28.167  1.00   30.59 ? 110 TYR C CA    1 
ATOM   7121  C  C     . TYR C  1 3   ? -9.521  72.642  28.040  1.00   30.76 ? 110 TYR C C     1 
ATOM   7122  O  O     . TYR C  1 3   ? -8.672  72.644  27.137  1.00   28.20 ? 110 TYR C O     1 
ATOM   7123  C  CB    . TYR C  1 3   ? -9.776  70.223  28.567  1.00   27.52 ? 110 TYR C CB    1 
ATOM   7124  C  CG    . TYR C  1 3   ? -8.824  70.434  29.733  1.00   27.83 ? 110 TYR C CG    1 
ATOM   7125  C  CD1   . TYR C  1 3   ? -9.295  70.495  31.053  1.00   24.56 ? 110 TYR C CD1   1 
ATOM   7126  C  CD2   . TYR C  1 3   ? -7.456  70.636  29.513  1.00   26.18 ? 110 TYR C CD2   1 
ATOM   7127  C  CE1   . TYR C  1 3   ? -8.426  70.755  32.119  1.00   23.86 ? 110 TYR C CE1   1 
ATOM   7128  C  CE2   . TYR C  1 3   ? -6.579  70.898  30.572  1.00   25.33 ? 110 TYR C CE2   1 
ATOM   7129  C  CZ    . TYR C  1 3   ? -7.068  70.957  31.871  1.00   25.67 ? 110 TYR C CZ    1 
ATOM   7130  O  OH    . TYR C  1 3   ? -6.197  71.223  32.910  1.00   25.40 ? 110 TYR C OH    1 
ATOM   7131  N  N     . GLN C  1 4   ? -9.607  73.603  28.959  1.00   28.28 ? 111 GLN C N     1 
ATOM   7132  C  CA    . GLN C  1 4   ? -8.688  74.737  28.963  1.00   26.95 ? 111 GLN C CA    1 
ATOM   7133  C  C     . GLN C  1 4   ? -7.598  74.440  29.987  1.00   26.58 ? 111 GLN C C     1 
ATOM   7134  O  O     . GLN C  1 4   ? -7.888  74.187  31.158  1.00   25.90 ? 111 GLN C O     1 
ATOM   7135  C  CB    . GLN C  1 4   ? -9.425  76.026  29.349  1.00   25.41 ? 111 GLN C CB    1 
ATOM   7136  C  CG    . GLN C  1 4   ? -8.549  77.251  29.364  1.00   24.72 ? 111 GLN C CG    1 
ATOM   7137  C  CD    . GLN C  1 4   ? -9.261  78.499  29.878  1.00   27.80 ? 111 GLN C CD    1 
ATOM   7138  O  OE1   . GLN C  1 4   ? -8.658  79.568  29.979  1.00   28.40 ? 111 GLN C OE1   1 
ATOM   7139  N  NE2   . GLN C  1 4   ? -10.542 78.368  30.202  1.00   28.12 ? 111 GLN C NE2   1 
ATOM   7140  N  N     . GLU C  1 5   ? -6.345  74.462  29.549  1.00   25.71 ? 112 GLU C N     1 
ATOM   7141  C  CA    . GLU C  1 5   ? -5.248  74.187  30.457  1.00   25.88 ? 112 GLU C CA    1 
ATOM   7142  C  C     . GLU C  1 5   ? -5.108  75.299  31.496  1.00   25.20 ? 112 GLU C C     1 
ATOM   7143  O  O     . GLU C  1 5   ? -5.658  76.390  31.340  1.00   27.96 ? 112 GLU C O     1 
ATOM   7144  C  CB    . GLU C  1 5   ? -3.940  73.993  29.674  1.00   25.73 ? 112 GLU C CB    1 
ATOM   7145  C  CG    . GLU C  1 5   ? -3.384  75.209  28.961  1.00   22.24 ? 112 GLU C CG    1 
ATOM   7146  C  CD    . GLU C  1 5   ? -2.231  74.850  28.032  1.00   22.99 ? 112 GLU C CD    1 
ATOM   7147  O  OE1   . GLU C  1 5   ? -1.308  75.673  27.875  1.00   24.36 ? 112 GLU C OE1   1 
ATOM   7148  O  OE2   . GLU C  1 5   ? -2.249  73.745  27.448  1.00   20.88 ? 112 GLU C OE2   1 
ATOM   7149  N  N     . PRO C  1 6   ? -4.381  75.025  32.583  1.00   22.36 ? 113 PRO C N     1 
ATOM   7150  C  CA    . PRO C  1 6   ? -4.149  75.971  33.671  1.00   21.28 ? 113 PRO C CA    1 
ATOM   7151  C  C     . PRO C  1 6   ? -3.700  77.343  33.195  1.00   20.92 ? 113 PRO C C     1 
ATOM   7152  O  O     . PRO C  1 6   ? -2.985  77.470  32.197  1.00   22.25 ? 113 PRO C O     1 
ATOM   7153  C  CB    . PRO C  1 6   ? -3.072  75.278  34.490  1.00   20.46 ? 113 PRO C CB    1 
ATOM   7154  C  CG    . PRO C  1 6   ? -3.383  73.867  34.311  1.00   22.22 ? 113 PRO C CG    1 
ATOM   7155  C  CD    . PRO C  1 6   ? -3.622  73.790  32.827  1.00   22.06 ? 113 PRO C CD    1 
ATOM   7156  N  N     . THR C  1 7   ? -4.113  78.367  33.929  1.00   20.08 ? 114 THR C N     1 
ATOM   7157  C  CA    . THR C  1 7   ? -3.758  79.742  33.607  1.00   20.91 ? 114 THR C CA    1 
ATOM   7158  C  C     . THR C  1 7   ? -2.652  80.267  34.524  1.00   19.03 ? 114 THR C C     1 
ATOM   7159  O  O     . THR C  1 7   ? -2.249  81.425  34.413  1.00   19.90 ? 114 THR C O     1 
ATOM   7160  C  CB    . THR C  1 7   ? -4.975  80.673  33.750  1.00   22.55 ? 114 THR C CB    1 
ATOM   7161  O  OG1   . THR C  1 7   ? -5.424  80.647  35.112  1.00   23.92 ? 114 THR C OG1   1 
ATOM   7162  C  CG2   . THR C  1 7   ? -6.119  80.220  32.843  1.00   21.85 ? 114 THR C CG2   1 
ATOM   7163  N  N     . ASP C  1 8   ? -2.175  79.422  35.434  1.00   17.39 ? 115 ASP C N     1 
ATOM   7164  C  CA    . ASP C  1 8   ? -1.115  79.810  36.361  1.00   19.08 ? 115 ASP C CA    1 
ATOM   7165  C  C     . ASP C  1 8   ? 0.086   80.422  35.628  1.00   18.71 ? 115 ASP C C     1 
ATOM   7166  O  O     . ASP C  1 8   ? 0.490   79.970  34.551  1.00   19.63 ? 115 ASP C O     1 
ATOM   7167  C  CB    . ASP C  1 8   ? -0.679  78.606  37.192  1.00   22.12 ? 115 ASP C CB    1 
ATOM   7168  C  CG    . ASP C  1 8   ? -1.813  78.036  38.018  1.00   24.88 ? 115 ASP C CG    1 
ATOM   7169  O  OD1   . ASP C  1 8   ? -2.785  77.552  37.420  1.00   26.29 ? 115 ASP C OD1   1 
ATOM   7170  O  OD2   . ASP C  1 8   ? -1.741  78.072  39.263  1.00   30.76 ? 115 ASP C OD2   1 
ATOM   7171  N  N     . PRO C  1 9   ? 0.686   81.458  36.221  1.00   17.59 ? 116 PRO C N     1 
ATOM   7172  C  CA    . PRO C  1 9   ? 1.828   82.119  35.590  1.00   16.61 ? 116 PRO C CA    1 
ATOM   7173  C  C     . PRO C  1 9   ? 2.984   81.227  35.173  1.00   19.09 ? 116 PRO C C     1 
ATOM   7174  O  O     . PRO C  1 9   ? 3.570   81.425  34.102  1.00   20.40 ? 116 PRO C O     1 
ATOM   7175  C  CB    . PRO C  1 9   ? 2.225   83.183  36.621  1.00   10.53 ? 116 PRO C CB    1 
ATOM   7176  C  CG    . PRO C  1 9   ? 1.781   82.603  37.924  1.00   12.68 ? 116 PRO C CG    1 
ATOM   7177  C  CD    . PRO C  1 9   ? 0.452   81.984  37.581  1.00   16.84 ? 116 PRO C CD    1 
ATOM   7178  N  N     . LYS C  1 10  ? 3.291   80.231  35.995  1.00   21.31 ? 117 LYS C N     1 
ATOM   7179  C  CA    . LYS C  1 10  ? 4.412   79.347  35.705  1.00   23.08 ? 117 LYS C CA    1 
ATOM   7180  C  C     . LYS C  1 10  ? 4.088   78.073  34.932  1.00   23.76 ? 117 LYS C C     1 
ATOM   7181  O  O     . LYS C  1 10  ? 4.998   77.323  34.586  1.00   25.30 ? 117 LYS C O     1 
ATOM   7182  C  CB    . LYS C  1 10  ? 5.127   78.988  37.010  1.00   26.45 ? 117 LYS C CB    1 
ATOM   7183  C  CG    . LYS C  1 10  ? 5.791   80.172  37.699  1.00   27.65 ? 117 LYS C CG    1 
ATOM   7184  C  CD    . LYS C  1 10  ? 6.842   80.743  36.782  1.00   32.58 ? 117 LYS C CD    1 
ATOM   7185  C  CE    . LYS C  1 10  ? 7.590   81.885  37.416  1.00   36.05 ? 117 LYS C CE    1 
ATOM   7186  N  NZ    . LYS C  1 10  ? 8.413   82.570  36.378  1.00   39.21 ? 117 LYS C NZ    1 
ATOM   7187  N  N     . PHE C  1 11  ? 2.812   77.824  34.649  1.00   22.11 ? 118 PHE C N     1 
ATOM   7188  C  CA    . PHE C  1 11  ? 2.450   76.617  33.917  1.00   20.71 ? 118 PHE C CA    1 
ATOM   7189  C  C     . PHE C  1 11  ? 3.217   76.457  32.602  1.00   18.50 ? 118 PHE C C     1 
ATOM   7190  O  O     . PHE C  1 11  ? 3.667   75.365  32.253  1.00   16.40 ? 118 PHE C O     1 
ATOM   7191  C  CB    . PHE C  1 11  ? 0.959   76.590  33.618  1.00   20.54 ? 118 PHE C CB    1 
ATOM   7192  C  CG    . PHE C  1 11  ? 0.544   75.388  32.841  1.00   21.61 ? 118 PHE C CG    1 
ATOM   7193  C  CD1   . PHE C  1 11  ? 0.587   74.128  33.424  1.00   20.30 ? 118 PHE C CD1   1 
ATOM   7194  C  CD2   . PHE C  1 11  ? 0.163   75.501  31.511  1.00   21.78 ? 118 PHE C CD2   1 
ATOM   7195  C  CE1   . PHE C  1 11  ? 0.260   72.992  32.697  1.00   19.92 ? 118 PHE C CE1   1 
ATOM   7196  C  CE2   . PHE C  1 11  ? -0.164  74.371  30.771  1.00   20.48 ? 118 PHE C CE2   1 
ATOM   7197  C  CZ    . PHE C  1 11  ? -0.116  73.113  31.371  1.00   22.31 ? 118 PHE C CZ    1 
ATOM   7198  N  N     . PRO C  1 12  ? 3.369   77.549  31.848  1.00   19.70 ? 119 PRO C N     1 
ATOM   7199  C  CA    . PRO C  1 12  ? 4.094   77.459  30.578  1.00   20.62 ? 119 PRO C CA    1 
ATOM   7200  C  C     . PRO C  1 12  ? 5.519   76.933  30.735  1.00   22.37 ? 119 PRO C C     1 
ATOM   7201  O  O     . PRO C  1 12  ? 6.092   76.417  29.780  1.00   25.06 ? 119 PRO C O     1 
ATOM   7202  C  CB    . PRO C  1 12  ? 4.083   78.898  30.064  1.00   16.00 ? 119 PRO C CB    1 
ATOM   7203  C  CG    . PRO C  1 12  ? 2.898   79.497  30.700  1.00   19.56 ? 119 PRO C CG    1 
ATOM   7204  C  CD    . PRO C  1 12  ? 2.932   78.932  32.096  1.00   19.28 ? 119 PRO C CD    1 
ATOM   7205  N  N     . GLN C  1 13  ? 6.093   77.071  31.931  1.00   23.49 ? 120 GLN C N     1 
ATOM   7206  C  CA    . GLN C  1 13  ? 7.453   76.604  32.168  1.00   23.64 ? 120 GLN C CA    1 
ATOM   7207  C  C     . GLN C  1 13  ? 7.501   75.169  32.674  1.00   23.02 ? 120 GLN C C     1 
ATOM   7208  O  O     . GLN C  1 13  ? 8.579   74.604  32.869  1.00   24.47 ? 120 GLN C O     1 
ATOM   7209  C  CB    . GLN C  1 13  ? 8.183   77.525  33.149  1.00   26.19 ? 120 GLN C CB    1 
ATOM   7210  C  CG    . GLN C  1 13  ? 8.577   78.859  32.546  1.00   33.55 ? 120 GLN C CG    1 
ATOM   7211  C  CD    . GLN C  1 13  ? 7.590   79.957  32.879  1.00   40.68 ? 120 GLN C CD    1 
ATOM   7212  O  OE1   . GLN C  1 13  ? 7.532   80.428  34.017  1.00   46.78 ? 120 GLN C OE1   1 
ATOM   7213  N  NE2   . GLN C  1 13  ? 6.796   80.368  31.889  1.00   42.92 ? 120 GLN C NE2   1 
ATOM   7214  N  N     . GLN C  1 14  ? 6.336   74.573  32.884  1.00   21.53 ? 121 GLN C N     1 
ATOM   7215  C  CA    . GLN C  1 14  ? 6.286   73.197  33.357  1.00   21.03 ? 121 GLN C CA    1 
ATOM   7216  C  C     . GLN C  1 14  ? 6.267   72.265  32.145  1.00   19.43 ? 121 GLN C C     1 
ATOM   7217  O  O     . GLN C  1 14  ? 5.305   71.538  31.900  1.00   19.13 ? 121 GLN C O     1 
ATOM   7218  C  CB    . GLN C  1 14  ? 5.061   72.998  34.260  1.00   19.17 ? 121 GLN C CB    1 
ATOM   7219  C  CG    . GLN C  1 14  ? 5.088   73.911  35.484  1.00   17.53 ? 121 GLN C CG    1 
ATOM   7220  C  CD    . GLN C  1 14  ? 3.948   73.653  36.474  1.00   22.30 ? 121 GLN C CD    1 
ATOM   7221  O  OE1   . GLN C  1 14  ? 2.789   73.990  36.219  1.00   23.63 ? 121 GLN C OE1   1 
ATOM   7222  N  NE2   . GLN C  1 14  ? 4.283   73.056  37.615  1.00   19.24 ? 121 GLN C NE2   1 
ATOM   7223  N  N     . TRP C  1 15  ? 7.368   72.316  31.399  1.00   17.97 ? 122 TRP C N     1 
ATOM   7224  C  CA    . TRP C  1 15  ? 7.575   71.533  30.187  1.00   16.58 ? 122 TRP C CA    1 
ATOM   7225  C  C     . TRP C  1 15  ? 7.253   70.059  30.295  1.00   14.77 ? 122 TRP C C     1 
ATOM   7226  O  O     . TRP C  1 15  ? 6.807   69.453  29.330  1.00   18.43 ? 122 TRP C O     1 
ATOM   7227  C  CB    . TRP C  1 15  ? 9.019   71.668  29.726  1.00   15.66 ? 122 TRP C CB    1 
ATOM   7228  C  CG    . TRP C  1 15  ? 9.999   71.281  30.779  1.00   18.23 ? 122 TRP C CG    1 
ATOM   7229  C  CD1   . TRP C  1 15  ? 10.447  72.065  31.810  1.00   19.48 ? 122 TRP C CD1   1 
ATOM   7230  C  CD2   . TRP C  1 15  ? 10.635  70.002  30.940  1.00   16.58 ? 122 TRP C CD2   1 
ATOM   7231  N  NE1   . TRP C  1 15  ? 11.322  71.353  32.602  1.00   19.98 ? 122 TRP C NE1   1 
ATOM   7232  C  CE2   . TRP C  1 15  ? 11.457  70.087  32.094  1.00   19.19 ? 122 TRP C CE2   1 
ATOM   7233  C  CE3   . TRP C  1 15  ? 10.591  68.799  30.228  1.00   15.17 ? 122 TRP C CE3   1 
ATOM   7234  C  CZ2   . TRP C  1 15  ? 12.234  69.005  32.550  1.00   18.41 ? 122 TRP C CZ2   1 
ATOM   7235  C  CZ3   . TRP C  1 15  ? 11.364  67.720  30.683  1.00   18.79 ? 122 TRP C CZ3   1 
ATOM   7236  C  CH2   . TRP C  1 15  ? 12.172  67.834  31.833  1.00   18.64 ? 122 TRP C CH2   1 
ATOM   7237  N  N     . TYR C  1 16  ? 7.503   69.482  31.462  1.00   16.33 ? 123 TYR C N     1 
ATOM   7238  C  CA    . TYR C  1 16  ? 7.247   68.060  31.701  1.00   16.70 ? 123 TYR C CA    1 
ATOM   7239  C  C     . TYR C  1 16  ? 5.766   67.657  31.785  1.00   17.30 ? 123 TYR C C     1 
ATOM   7240  O  O     . TYR C  1 16  ? 5.436   66.491  31.588  1.00   17.15 ? 123 TYR C O     1 
ATOM   7241  C  CB    . TYR C  1 16  ? 7.971   67.610  32.978  1.00   15.11 ? 123 TYR C CB    1 
ATOM   7242  C  CG    . TYR C  1 16  ? 7.775   68.530  34.161  1.00   11.33 ? 123 TYR C CG    1 
ATOM   7243  C  CD1   . TYR C  1 16  ? 8.540   69.687  34.302  1.00   11.33 ? 123 TYR C CD1   1 
ATOM   7244  C  CD2   . TYR C  1 16  ? 6.785   68.274  35.108  1.00   12.57 ? 123 TYR C CD2   1 
ATOM   7245  C  CE1   . TYR C  1 16  ? 8.319   70.581  35.362  1.00   16.23 ? 123 TYR C CE1   1 
ATOM   7246  C  CE2   . TYR C  1 16  ? 6.553   69.152  36.171  1.00   16.10 ? 123 TYR C CE2   1 
ATOM   7247  C  CZ    . TYR C  1 16  ? 7.323   70.310  36.294  1.00   17.20 ? 123 TYR C CZ    1 
ATOM   7248  O  OH    . TYR C  1 16  ? 7.089   71.188  37.337  1.00   16.87 ? 123 TYR C OH    1 
ATOM   7249  N  N     . LEU C  1 17  ? 4.881   68.607  32.081  1.00   17.81 ? 124 LEU C N     1 
ATOM   7250  C  CA    . LEU C  1 17  ? 3.457   68.310  32.174  1.00   18.80 ? 124 LEU C CA    1 
ATOM   7251  C  C     . LEU C  1 17  ? 2.800   68.332  30.804  1.00   22.95 ? 124 LEU C C     1 
ATOM   7252  O  O     . LEU C  1 17  ? 2.053   67.414  30.440  1.00   22.69 ? 124 LEU C O     1 
ATOM   7253  C  CB    . LEU C  1 17  ? 2.753   69.317  33.077  1.00   16.47 ? 124 LEU C CB    1 
ATOM   7254  C  CG    . LEU C  1 17  ? 3.183   69.314  34.543  1.00   17.36 ? 124 LEU C CG    1 
ATOM   7255  C  CD1   . LEU C  1 17  ? 2.432   70.420  35.287  1.00   16.40 ? 124 LEU C CD1   1 
ATOM   7256  C  CD2   . LEU C  1 17  ? 2.901   67.956  35.166  1.00   18.25 ? 124 LEU C CD2   1 
ATOM   7257  N  N     . SER C  1 18  ? 3.086   69.381  30.044  1.00   25.66 ? 125 SER C N     1 
ATOM   7258  C  CA    . SER C  1 18  ? 2.509   69.536  28.723  1.00   28.02 ? 125 SER C CA    1 
ATOM   7259  C  C     . SER C  1 18  ? 3.473   70.328  27.843  1.00   29.85 ? 125 SER C C     1 
ATOM   7260  O  O     . SER C  1 18  ? 4.038   71.336  28.274  1.00   30.67 ? 125 SER C O     1 
ATOM   7261  C  CB    . SER C  1 18  ? 1.169   70.266  28.852  1.00   28.69 ? 125 SER C CB    1 
ATOM   7262  O  OG    . SER C  1 18  ? 0.504   70.395  27.613  1.00   36.76 ? 125 SER C OG    1 
ATOM   7263  N  N     . GLY C  1 19  ? 3.669   69.866  26.614  1.00   32.18 ? 126 GLY C N     1 
ATOM   7264  C  CA    . GLY C  1 19  ? 4.568   70.557  25.708  1.00   35.60 ? 126 GLY C CA    1 
ATOM   7265  C  C     . GLY C  1 19  ? 4.359   70.198  24.247  1.00   37.07 ? 126 GLY C C     1 
ATOM   7266  O  O     . GLY C  1 19  ? 3.998   69.060  23.920  1.00   38.44 ? 126 GLY C O     1 
ATOM   7267  N  N     . VAL C  1 20  ? 4.583   71.174  23.366  1.00   38.02 ? 127 VAL C N     1 
ATOM   7268  C  CA    . VAL C  1 20  ? 4.445   70.972  21.926  1.00   37.83 ? 127 VAL C CA    1 
ATOM   7269  C  C     . VAL C  1 20  ? 5.382   69.832  21.512  1.00   39.80 ? 127 VAL C C     1 
ATOM   7270  O  O     . VAL C  1 20  ? 4.978   68.909  20.802  1.00   40.40 ? 127 VAL C O     1 
ATOM   7271  C  CB    . VAL C  1 20  ? 4.816   72.263  21.139  1.00   34.09 ? 127 VAL C CB    1 
ATOM   7272  C  CG1   . VAL C  1 20  ? 3.808   73.359  21.437  0.0000 35.41 ? 127 VAL C CG1   1 
ATOM   7273  C  CG2   . VAL C  1 20  ? 6.219   72.722  21.507  0.0000 35.41 ? 127 VAL C CG2   1 
ATOM   7274  N  N     . THR C  1 21  ? 6.621   69.896  21.998  1.00   41.96 ? 128 THR C N     1 
ATOM   7275  C  CA    . THR C  1 21  ? 7.662   68.907  21.709  1.00   42.06 ? 128 THR C CA    1 
ATOM   7276  C  C     . THR C  1 21  ? 7.281   67.436  21.920  1.00   44.84 ? 128 THR C C     1 
ATOM   7277  O  O     . THR C  1 21  ? 8.101   66.550  21.662  1.00   49.53 ? 128 THR C O     1 
ATOM   7278  C  CB    . THR C  1 21  ? 8.936   69.188  22.538  1.00   38.00 ? 128 THR C CB    1 
ATOM   7279  O  OG1   . THR C  1 21  ? 9.944   68.223  22.209  0.0000 39.29 ? 128 THR C OG1   1 
ATOM   7280  C  CG2   . THR C  1 21  ? 8.632   69.111  24.025  0.0000 39.29 ? 128 THR C CG2   1 
ATOM   7281  N  N     . GLN C  1 22  ? 6.062   67.172  22.391  1.00   45.29 ? 129 GLN C N     1 
ATOM   7282  C  CA    . GLN C  1 22  ? 5.601   65.797  22.602  1.00   47.23 ? 129 GLN C CA    1 
ATOM   7283  C  C     . GLN C  1 22  ? 6.584   64.959  23.451  1.00   49.41 ? 129 GLN C C     1 
ATOM   7284  O  O     . GLN C  1 22  ? 6.555   63.718  23.422  1.00   52.85 ? 129 GLN C O     1 
ATOM   7285  C  CB    . GLN C  1 22  ? 5.375   65.107  21.246  1.00   44.73 ? 129 GLN C CB    1 
ATOM   7286  C  CG    . GLN C  1 22  ? 4.587   63.813  21.310  0.0000 40.20 ? 129 GLN C CG    1 
ATOM   7287  C  CD    . GLN C  1 22  ? 3.115   64.034  21.598  0.0000 38.06 ? 129 GLN C CD    1 
ATOM   7288  O  OE1   . GLN C  1 22  ? 2.343   63.081  21.701  0.0000 36.61 ? 129 GLN C OE1   1 
ATOM   7289  N  NE2   . GLN C  1 22  ? 2.716   65.296  21.724  0.0000 36.61 ? 129 GLN C NE2   1 
ATOM   7290  N  N     . ARG C  1 23  ? 7.457   65.643  24.190  1.00   47.21 ? 130 ARG C N     1 
ATOM   7291  C  CA    . ARG C  1 23  ? 8.425   64.988  25.066  1.00   43.36 ? 130 ARG C CA    1 
ATOM   7292  C  C     . ARG C  1 23  ? 8.036   65.390  26.497  1.00   41.43 ? 130 ARG C C     1 
ATOM   7293  O  O     . ARG C  1 23  ? 8.728   66.193  27.141  1.00   40.44 ? 130 ARG C O     1 
ATOM   7294  C  CB    . ARG C  1 23  ? 9.844   65.479  24.761  1.00   43.13 ? 130 ARG C CB    1 
ATOM   7295  C  CG    . ARG C  1 23  ? 10.354  65.197  23.342  1.00   39.35 ? 130 ARG C CG    1 
ATOM   7296  C  CD    . ARG C  1 23  ? 10.455  63.715  23.037  0.0000 35.82 ? 130 ARG C CD    1 
ATOM   7297  N  NE    . ARG C  1 23  ? 11.131  63.474  21.763  0.0000 32.19 ? 130 ARG C NE    1 
ATOM   7298  C  CZ    . ARG C  1 23  ? 10.701  63.918  20.585  0.0000 30.27 ? 130 ARG C CZ    1 
ATOM   7299  N  NH1   . ARG C  1 23  ? 9.587   64.633  20.505  0.0000 28.94 ? 130 ARG C NH1   1 
ATOM   7300  N  NH2   . ARG C  1 23  ? 11.386  63.644  19.482  0.0000 28.94 ? 130 ARG C NH2   1 
ATOM   7301  N  N     . ASP C  1 24  ? 6.916   64.844  26.973  1.00   37.36 ? 131 ASP C N     1 
ATOM   7302  C  CA    . ASP C  1 24  ? 6.397   65.149  28.307  1.00   32.03 ? 131 ASP C CA    1 
ATOM   7303  C  C     . ASP C  1 24  ? 5.726   63.927  28.941  1.00   29.64 ? 131 ASP C C     1 
ATOM   7304  O  O     . ASP C  1 24  ? 5.725   62.842  28.355  1.00   31.23 ? 131 ASP C O     1 
ATOM   7305  C  CB    . ASP C  1 24  ? 5.389   66.305  28.226  1.00   30.70 ? 131 ASP C CB    1 
ATOM   7306  C  CG    . ASP C  1 24  ? 4.261   66.042  27.228  1.00   30.52 ? 131 ASP C CG    1 
ATOM   7307  O  OD1   . ASP C  1 24  ? 3.493   65.077  27.418  1.00   31.55 ? 131 ASP C OD1   1 
ATOM   7308  O  OD2   . ASP C  1 24  ? 4.138   66.806  26.248  1.00   33.27 ? 131 ASP C OD2   1 
ATOM   7309  N  N     . LEU C  1 25  ? 5.160   64.106  30.134  1.00   24.88 ? 132 LEU C N     1 
ATOM   7310  C  CA    . LEU C  1 25  ? 4.488   63.016  30.839  1.00   21.49 ? 132 LEU C CA    1 
ATOM   7311  C  C     . LEU C  1 25  ? 3.029   62.831  30.404  1.00   20.16 ? 132 LEU C C     1 
ATOM   7312  O  O     . LEU C  1 25  ? 2.292   62.027  30.985  1.00   20.90 ? 132 LEU C O     1 
ATOM   7313  C  CB    . LEU C  1 25  ? 4.568   63.237  32.354  1.00   17.29 ? 132 LEU C CB    1 
ATOM   7314  C  CG    . LEU C  1 25  ? 6.005   63.220  32.884  1.00   14.41 ? 132 LEU C CG    1 
ATOM   7315  C  CD1   . LEU C  1 25  ? 6.028   63.495  34.364  1.00   14.37 ? 132 LEU C CD1   1 
ATOM   7316  C  CD2   . LEU C  1 25  ? 6.630   61.871  32.598  1.00   16.47 ? 132 LEU C CD2   1 
ATOM   7317  N  N     . ASN C  1 26  ? 2.616   63.594  29.394  1.00   16.29 ? 133 ASN C N     1 
ATOM   7318  C  CA    . ASN C  1 26  ? 1.271   63.494  28.844  1.00   15.13 ? 133 ASN C CA    1 
ATOM   7319  C  C     . ASN C  1 26  ? 0.193   63.628  29.905  1.00   15.71 ? 133 ASN C C     1 
ATOM   7320  O  O     . ASN C  1 26  ? -0.790  62.881  29.909  1.00   16.46 ? 133 ASN C O     1 
ATOM   7321  C  CB    . ASN C  1 26  ? 1.134   62.153  28.128  1.00   14.92 ? 133 ASN C CB    1 
ATOM   7322  C  CG    . ASN C  1 26  ? -0.003  62.131  27.148  1.00   14.74 ? 133 ASN C CG    1 
ATOM   7323  O  OD1   . ASN C  1 26  ? -0.297  63.141  26.501  1.00   15.57 ? 133 ASN C OD1   1 
ATOM   7324  N  ND2   . ASN C  1 26  ? -0.637  60.969  27.004  1.00   14.37 ? 133 ASN C ND2   1 
ATOM   7325  N  N     . VAL C  1 27  ? 0.380   64.594  30.794  1.00   16.02 ? 134 VAL C N     1 
ATOM   7326  C  CA    . VAL C  1 27  ? -0.557  64.840  31.881  1.00   18.39 ? 134 VAL C CA    1 
ATOM   7327  C  C     . VAL C  1 27  ? -1.821  65.574  31.419  1.00   21.58 ? 134 VAL C C     1 
ATOM   7328  O  O     . VAL C  1 27  ? -2.920  65.299  31.903  1.00   21.99 ? 134 VAL C O     1 
ATOM   7329  C  CB    . VAL C  1 27  ? 0.117   65.668  32.994  1.00   17.20 ? 134 VAL C CB    1 
ATOM   7330  C  CG1   . VAL C  1 27  ? -0.873  65.954  34.101  1.00   16.18 ? 134 VAL C CG1   1 
ATOM   7331  C  CG2   . VAL C  1 27  ? 1.338   64.931  33.526  1.00   16.42 ? 134 VAL C CG2   1 
ATOM   7332  N  N     . LYS C  1 28  ? -1.663  66.514  30.493  1.00   22.15 ? 135 LYS C N     1 
ATOM   7333  C  CA    . LYS C  1 28  ? -2.804  67.267  29.999  1.00   22.71 ? 135 LYS C CA    1 
ATOM   7334  C  C     . LYS C  1 28  ? -3.833  66.308  29.389  1.00   21.47 ? 135 LYS C C     1 
ATOM   7335  O  O     . LYS C  1 28  ? -5.041  66.508  29.514  1.00   21.49 ? 135 LYS C O     1 
ATOM   7336  C  CB    . LYS C  1 28  ? -2.336  68.299  28.967  1.00   22.84 ? 135 LYS C CB    1 
ATOM   7337  C  CG    . LYS C  1 28  ? -3.419  69.279  28.528  1.00   23.97 ? 135 LYS C CG    1 
ATOM   7338  C  CD    . LYS C  1 28  ? -2.860  70.295  27.537  1.00   24.47 ? 135 LYS C CD    1 
ATOM   7339  C  CE    . LYS C  1 28  ? -3.957  71.187  26.975  1.00   22.93 ? 135 LYS C CE    1 
ATOM   7340  N  NZ    . LYS C  1 28  ? -3.432  72.081  25.905  1.00   22.41 ? 135 LYS C NZ    1 
ATOM   7341  N  N     . ALA C  1 29  ? -3.345  65.256  28.743  1.00   20.61 ? 136 ALA C N     1 
ATOM   7342  C  CA    . ALA C  1 29  ? -4.226  64.278  28.125  1.00   20.92 ? 136 ALA C CA    1 
ATOM   7343  C  C     . ALA C  1 29  ? -5.131  63.646  29.174  1.00   21.81 ? 136 ALA C C     1 
ATOM   7344  O  O     . ALA C  1 29  ? -6.276  63.319  28.887  1.00   24.72 ? 136 ALA C O     1 
ATOM   7345  C  CB    . ALA C  1 29  ? -3.410  63.208  27.420  1.00   16.91 ? 136 ALA C CB    1 
ATOM   7346  N  N     . ALA C  1 30  ? -4.612  63.480  30.388  1.00   21.90 ? 137 ALA C N     1 
ATOM   7347  C  CA    . ALA C  1 30  ? -5.379  62.893  31.483  1.00   20.67 ? 137 ALA C CA    1 
ATOM   7348  C  C     . ALA C  1 30  ? -6.385  63.907  32.020  1.00   21.30 ? 137 ALA C C     1 
ATOM   7349  O  O     . ALA C  1 30  ? -7.524  63.564  32.345  1.00   22.35 ? 137 ALA C O     1 
ATOM   7350  C  CB    . ALA C  1 30  ? -4.445  62.434  32.601  1.00   20.53 ? 137 ALA C CB    1 
ATOM   7351  N  N     . TRP C  1 31  ? -5.964  65.159  32.115  1.00   21.98 ? 138 TRP C N     1 
ATOM   7352  C  CA    . TRP C  1 31  ? -6.855  66.199  32.599  1.00   22.71 ? 138 TRP C CA    1 
ATOM   7353  C  C     . TRP C  1 31  ? -8.051  66.289  31.662  1.00   22.71 ? 138 TRP C C     1 
ATOM   7354  O  O     . TRP C  1 31  ? -9.203  66.385  32.101  1.00   22.20 ? 138 TRP C O     1 
ATOM   7355  C  CB    . TRP C  1 31  ? -6.145  67.558  32.635  1.00   21.83 ? 138 TRP C CB    1 
ATOM   7356  C  CG    . TRP C  1 31  ? -4.993  67.662  33.610  1.00   21.83 ? 138 TRP C CG    1 
ATOM   7357  C  CD1   . TRP C  1 31  ? -4.806  66.937  34.761  1.00   21.03 ? 138 TRP C CD1   1 
ATOM   7358  C  CD2   . TRP C  1 31  ? -3.913  68.604  33.554  1.00   21.49 ? 138 TRP C CD2   1 
ATOM   7359  N  NE1   . TRP C  1 31  ? -3.678  67.378  35.421  1.00   16.94 ? 138 TRP C NE1   1 
ATOM   7360  C  CE2   . TRP C  1 31  ? -3.113  68.398  34.703  1.00   18.61 ? 138 TRP C CE2   1 
ATOM   7361  C  CE3   . TRP C  1 31  ? -3.544  69.606  32.645  1.00   20.99 ? 138 TRP C CE3   1 
ATOM   7362  C  CZ2   . TRP C  1 31  ? -1.969  69.157  34.964  1.00   17.44 ? 138 TRP C CZ2   1 
ATOM   7363  C  CZ3   . TRP C  1 31  ? -2.402  70.364  32.906  1.00   15.71 ? 138 TRP C CZ3   1 
ATOM   7364  C  CH2   . TRP C  1 31  ? -1.630  70.133  34.056  1.00   16.57 ? 138 TRP C CH2   1 
ATOM   7365  N  N     . ALA C  1 32  ? -7.761  66.258  30.364  1.00   23.45 ? 139 ALA C N     1 
ATOM   7366  C  CA    . ALA C  1 32  ? -8.789  66.344  29.337  1.00   20.07 ? 139 ALA C CA    1 
ATOM   7367  C  C     . ALA C  1 32  ? -9.804  65.218  29.483  1.00   20.24 ? 139 ALA C C     1 
ATOM   7368  O  O     . ALA C  1 32  ? -10.987 65.411  29.194  1.00   19.61 ? 139 ALA C O     1 
ATOM   7369  C  CB    . ALA C  1 32  ? -8.149  66.298  27.975  1.00   17.64 ? 139 ALA C CB    1 
ATOM   7370  N  N     . GLN C  1 33  ? -9.350  64.045  29.923  1.00   19.25 ? 140 GLN C N     1 
ATOM   7371  C  CA    . GLN C  1 33  ? -10.259 62.921  30.106  1.00   20.83 ? 140 GLN C CA    1 
ATOM   7372  C  C     . GLN C  1 33  ? -11.082 63.126  31.373  1.00   22.30 ? 140 GLN C C     1 
ATOM   7373  O  O     . GLN C  1 33  ? -11.910 62.290  31.727  1.00   25.94 ? 140 GLN C O     1 
ATOM   7374  C  CB    . GLN C  1 33  ? -9.486  61.609  30.187  1.00   20.10 ? 140 GLN C CB    1 
ATOM   7375  C  CG    . GLN C  1 33  ? -8.831  61.218  28.886  1.00   23.05 ? 140 GLN C CG    1 
ATOM   7376  C  CD    . GLN C  1 33  ? -8.011  59.950  29.017  1.00   28.01 ? 140 GLN C CD    1 
ATOM   7377  O  OE1   . GLN C  1 33  ? -8.554  58.852  29.191  1.00   28.26 ? 140 GLN C OE1   1 
ATOM   7378  N  NE2   . GLN C  1 33  ? -6.690  60.096  28.950  1.00   30.05 ? 140 GLN C NE2   1 
ATOM   7379  N  N     . GLY C  1 34  ? -10.840 64.241  32.057  1.00   21.70 ? 141 GLY C N     1 
ATOM   7380  C  CA    . GLY C  1 34  ? -11.590 64.555  33.261  1.00   19.07 ? 141 GLY C CA    1 
ATOM   7381  C  C     . GLY C  1 34  ? -10.973 64.164  34.589  1.00   20.38 ? 141 GLY C C     1 
ATOM   7382  O  O     . GLY C  1 34  ? -11.664 64.164  35.600  1.00   21.83 ? 141 GLY C O     1 
ATOM   7383  N  N     . TYR C  1 35  ? -9.681  63.856  34.611  1.00   21.14 ? 142 TYR C N     1 
ATOM   7384  C  CA    . TYR C  1 35  ? -9.052  63.452  35.859  1.00   22.08 ? 142 TYR C CA    1 
ATOM   7385  C  C     . TYR C  1 35  ? -8.041  64.459  36.391  1.00   22.84 ? 142 TYR C C     1 
ATOM   7386  O  O     . TYR C  1 35  ? -7.095  64.837  35.690  1.00   24.52 ? 142 TYR C O     1 
ATOM   7387  C  CB    . TYR C  1 35  ? -8.408  62.084  35.667  1.00   19.62 ? 142 TYR C CB    1 
ATOM   7388  C  CG    . TYR C  1 35  ? -9.411  61.053  35.217  1.00   18.25 ? 142 TYR C CG    1 
ATOM   7389  C  CD1   . TYR C  1 35  ? -10.445 60.639  36.063  1.00   16.64 ? 142 TYR C CD1   1 
ATOM   7390  C  CD2   . TYR C  1 35  ? -9.359  60.520  33.933  1.00   20.37 ? 142 TYR C CD2   1 
ATOM   7391  C  CE1   . TYR C  1 35  ? -11.403 59.721  35.636  1.00   17.84 ? 142 TYR C CE1   1 
ATOM   7392  C  CE2   . TYR C  1 35  ? -10.313 59.602  33.495  1.00   21.32 ? 142 TYR C CE2   1 
ATOM   7393  C  CZ    . TYR C  1 35  ? -11.332 59.210  34.350  1.00   19.56 ? 142 TYR C CZ    1 
ATOM   7394  O  OH    . TYR C  1 35  ? -12.287 58.334  33.913  1.00   19.99 ? 142 TYR C OH    1 
ATOM   7395  N  N     . THR C  1 36  ? -8.248  64.893  37.635  1.00   20.98 ? 143 THR C N     1 
ATOM   7396  C  CA    . THR C  1 36  ? -7.359  65.868  38.259  1.00   20.25 ? 143 THR C CA    1 
ATOM   7397  C  C     . THR C  1 36  ? -6.987  65.510  39.701  1.00   20.39 ? 143 THR C C     1 
ATOM   7398  O  O     . THR C  1 36  ? -6.365  66.303  40.410  1.00   20.94 ? 143 THR C O     1 
ATOM   7399  C  CB    . THR C  1 36  ? -7.986  67.283  38.237  1.00   19.17 ? 143 THR C CB    1 
ATOM   7400  O  OG1   . THR C  1 36  ? -9.242  67.265  38.915  1.00   20.82 ? 143 THR C OG1   1 
ATOM   7401  C  CG2   . THR C  1 36  ? -8.201  67.753  36.814  1.00   18.43 ? 143 THR C CG2   1 
ATOM   7402  N  N     . GLY C  1 37  ? -7.374  64.318  40.135  1.00   22.09 ? 144 GLY C N     1 
ATOM   7403  C  CA    . GLY C  1 37  ? -7.043  63.890  41.481  1.00   22.30 ? 144 GLY C CA    1 
ATOM   7404  C  C     . GLY C  1 37  ? -8.111  64.146  42.520  1.00   22.73 ? 144 GLY C C     1 
ATOM   7405  O  O     . GLY C  1 37  ? -7.883  63.946  43.713  1.00   24.67 ? 144 GLY C O     1 
ATOM   7406  N  N     . HIS C  1 38  ? -9.276  64.595  42.080  1.00   22.92 ? 145 HIS C N     1 
ATOM   7407  C  CA    . HIS C  1 38  ? -10.363 64.859  43.001  1.00   23.11 ? 145 HIS C CA    1 
ATOM   7408  C  C     . HIS C  1 38  ? -10.683 63.622  43.848  1.00   21.18 ? 145 HIS C C     1 
ATOM   7409  O  O     . HIS C  1 38  ? -10.856 62.523  43.325  1.00   19.07 ? 145 HIS C O     1 
ATOM   7410  C  CB    . HIS C  1 38  ? -11.601 65.278  42.223  1.00   29.75 ? 145 HIS C CB    1 
ATOM   7411  C  CG    . HIS C  1 38  ? -12.747 65.655  43.095  1.00   40.91 ? 145 HIS C CG    1 
ATOM   7412  N  ND1   . HIS C  1 38  ? -12.798 66.857  43.770  1.00   45.63 ? 145 HIS C ND1   1 
ATOM   7413  C  CD2   . HIS C  1 38  ? -13.842 64.959  43.481  1.00   45.89 ? 145 HIS C CD2   1 
ATOM   7414  C  CE1   . HIS C  1 38  ? -13.872 66.879  44.538  1.00   48.36 ? 145 HIS C CE1   1 
ATOM   7415  N  NE2   . HIS C  1 38  ? -14.525 65.740  44.384  1.00   48.21 ? 145 HIS C NE2   1 
ATOM   7416  N  N     . GLY C  1 39  ? -10.753 63.805  45.162  1.00   20.50 ? 146 GLY C N     1 
ATOM   7417  C  CA    . GLY C  1 39  ? -11.059 62.697  46.048  1.00   18.35 ? 146 GLY C CA    1 
ATOM   7418  C  C     . GLY C  1 39  ? -9.898  61.797  46.446  1.00   19.40 ? 146 GLY C C     1 
ATOM   7419  O  O     . GLY C  1 39  ? -10.081 60.840  47.199  1.00   18.47 ? 146 GLY C O     1 
ATOM   7420  N  N     . ILE C  1 40  ? -8.704  62.087  45.944  1.00   18.16 ? 147 ILE C N     1 
ATOM   7421  C  CA    . ILE C  1 40  ? -7.543  61.275  46.282  1.00   20.92 ? 147 ILE C CA    1 
ATOM   7422  C  C     . ILE C  1 40  ? -6.645  61.981  47.303  1.00   18.96 ? 147 ILE C C     1 
ATOM   7423  O  O     . ILE C  1 40  ? -6.415  63.186  47.209  1.00   21.26 ? 147 ILE C O     1 
ATOM   7424  C  CB    . ILE C  1 40  ? -6.713  60.918  45.019  1.00   21.30 ? 147 ILE C CB    1 
ATOM   7425  C  CG1   . ILE C  1 40  ? -7.587  60.174  44.003  1.00   21.58 ? 147 ILE C CG1   1 
ATOM   7426  C  CG2   . ILE C  1 40  ? -5.538  60.039  45.405  1.00   20.96 ? 147 ILE C CG2   1 
ATOM   7427  C  CD1   . ILE C  1 40  ? -8.214  58.902  44.535  1.00   22.31 ? 147 ILE C CD1   1 
ATOM   7428  N  N     . VAL C  1 41  ? -6.150  61.226  48.278  1.00   15.29 ? 148 VAL C N     1 
ATOM   7429  C  CA    . VAL C  1 41  ? -5.297  61.787  49.317  1.00   17.75 ? 148 VAL C CA    1 
ATOM   7430  C  C     . VAL C  1 41  ? -3.846  61.339  49.162  1.00   17.94 ? 148 VAL C C     1 
ATOM   7431  O  O     . VAL C  1 41  ? -3.562  60.140  49.136  1.00   18.01 ? 148 VAL C O     1 
ATOM   7432  C  CB    . VAL C  1 41  ? -5.785  61.368  50.734  1.00   17.93 ? 148 VAL C CB    1 
ATOM   7433  C  CG1   . VAL C  1 41  ? -4.879  61.974  51.806  1.00   16.53 ? 148 VAL C CG1   1 
ATOM   7434  C  CG2   . VAL C  1 41  ? -7.226  61.793  50.944  1.00   20.96 ? 148 VAL C CG2   1 
ATOM   7435  N  N     . VAL C  1 42  ? -2.931  62.301  49.060  1.00   16.83 ? 149 VAL C N     1 
ATOM   7436  C  CA    . VAL C  1 42  ? -1.511  61.984  48.929  1.00   16.71 ? 149 VAL C CA    1 
ATOM   7437  C  C     . VAL C  1 42  ? -0.736  62.604  50.077  1.00   16.47 ? 149 VAL C C     1 
ATOM   7438  O  O     . VAL C  1 42  ? -0.966  63.757  50.443  1.00   17.53 ? 149 VAL C O     1 
ATOM   7439  C  CB    . VAL C  1 42  ? -0.910  62.519  47.605  1.00   15.44 ? 149 VAL C CB    1 
ATOM   7440  C  CG1   . VAL C  1 42  ? 0.571   62.146  47.526  1.00   13.04 ? 149 VAL C CG1   1 
ATOM   7441  C  CG2   . VAL C  1 42  ? -1.663  61.940  46.413  1.00   15.56 ? 149 VAL C CG2   1 
ATOM   7442  N  N     . SER C  1 43  ? 0.182   61.842  50.652  1.00   15.79 ? 150 SER C N     1 
ATOM   7443  C  CA    . SER C  1 43  ? 0.985   62.363  51.745  1.00   17.20 ? 150 SER C CA    1 
ATOM   7444  C  C     . SER C  1 43  ? 2.466   62.333  51.384  1.00   17.25 ? 150 SER C C     1 
ATOM   7445  O  O     . SER C  1 43  ? 2.963   61.338  50.865  1.00   19.10 ? 150 SER C O     1 
ATOM   7446  C  CB    . SER C  1 43  ? 0.738   61.553  53.020  1.00   16.73 ? 150 SER C CB    1 
ATOM   7447  O  OG    . SER C  1 43  ? 1.331   62.182  54.144  1.00   18.26 ? 150 SER C OG    1 
ATOM   7448  N  N     . ILE C  1 44  ? 3.158   63.437  51.654  1.00   19.28 ? 151 ILE C N     1 
ATOM   7449  C  CA    . ILE C  1 44  ? 4.592   63.554  51.389  1.00   18.83 ? 151 ILE C CA    1 
ATOM   7450  C  C     . ILE C  1 44  ? 5.383   63.310  52.681  1.00   18.62 ? 151 ILE C C     1 
ATOM   7451  O  O     . ILE C  1 44  ? 5.318   64.115  53.608  1.00   20.47 ? 151 ILE C O     1 
ATOM   7452  C  CB    . ILE C  1 44  ? 4.948   64.966  50.855  1.00   18.89 ? 151 ILE C CB    1 
ATOM   7453  C  CG1   . ILE C  1 44  ? 4.109   65.281  49.614  1.00   18.48 ? 151 ILE C CG1   1 
ATOM   7454  C  CG2   . ILE C  1 44  ? 6.428   65.038  50.508  1.00   16.92 ? 151 ILE C CG2   1 
ATOM   7455  C  CD1   . ILE C  1 44  ? 4.290   64.302  48.497  1.00   21.04 ? 151 ILE C CD1   1 
ATOM   7456  N  N     . LEU C  1 45  ? 6.114   62.196  52.742  1.00   17.67 ? 152 LEU C N     1 
ATOM   7457  C  CA    . LEU C  1 45  ? 6.926   61.867  53.912  1.00   16.39 ? 152 LEU C CA    1 
ATOM   7458  C  C     . LEU C  1 45  ? 8.268   62.538  53.684  1.00   17.63 ? 152 LEU C C     1 
ATOM   7459  O  O     . LEU C  1 45  ? 9.092   62.031  52.936  1.00   19.42 ? 152 LEU C O     1 
ATOM   7460  C  CB    . LEU C  1 45  ? 7.113   60.354  54.029  1.00   14.55 ? 152 LEU C CB    1 
ATOM   7461  C  CG    . LEU C  1 45  ? 5.836   59.503  53.910  1.00   19.29 ? 152 LEU C CG    1 
ATOM   7462  C  CD1   . LEU C  1 45  ? 6.163   58.029  54.154  1.00   16.65 ? 152 LEU C CD1   1 
ATOM   7463  C  CD2   . LEU C  1 45  ? 4.783   59.982  54.911  1.00   17.35 ? 152 LEU C CD2   1 
ATOM   7464  N  N     . ASP C  1 46  ? 8.492   63.679  54.324  1.00   18.64 ? 153 ASP C N     1 
ATOM   7465  C  CA    . ASP C  1 46  ? 9.736   64.406  54.119  1.00   19.52 ? 153 ASP C CA    1 
ATOM   7466  C  C     . ASP C  1 46  ? 10.132  65.245  55.337  1.00   19.84 ? 153 ASP C C     1 
ATOM   7467  O  O     . ASP C  1 46  ? 9.946   64.816  56.482  1.00   17.79 ? 153 ASP C O     1 
ATOM   7468  C  CB    . ASP C  1 46  ? 9.579   65.293  52.877  1.00   18.89 ? 153 ASP C CB    1 
ATOM   7469  C  CG    . ASP C  1 46  ? 10.863  65.421  52.080  1.00   19.30 ? 153 ASP C CG    1 
ATOM   7470  O  OD1   . ASP C  1 46  ? 11.702  66.285  52.404  1.00   18.08 ? 153 ASP C OD1   1 
ATOM   7471  O  OD2   . ASP C  1 46  ? 11.041  64.643  51.123  1.00   22.13 ? 153 ASP C OD2   1 
ATOM   7472  N  N     . ASP C  1 47  ? 10.682  66.433  55.087  1.00   17.99 ? 154 ASP C N     1 
ATOM   7473  C  CA    . ASP C  1 47  ? 11.110  67.325  56.163  1.00   19.10 ? 154 ASP C CA    1 
ATOM   7474  C  C     . ASP C  1 47  ? 10.046  68.358  56.531  1.00   19.05 ? 154 ASP C C     1 
ATOM   7475  O  O     . ASP C  1 47  ? 10.351  69.394  57.130  1.00   18.75 ? 154 ASP C O     1 
ATOM   7476  C  CB    . ASP C  1 47  ? 12.422  68.039  55.788  1.00   18.82 ? 154 ASP C CB    1 
ATOM   7477  C  CG    . ASP C  1 47  ? 12.285  68.924  54.560  1.00   19.35 ? 154 ASP C CG    1 
ATOM   7478  O  OD1   . ASP C  1 47  ? 11.155  69.088  54.048  1.00   20.32 ? 154 ASP C OD1   1 
ATOM   7479  O  OD2   . ASP C  1 47  ? 13.318  69.461  54.110  1.00   18.52 ? 154 ASP C OD2   1 
ATOM   7480  N  N     . GLY C  1 48  ? 8.800   68.066  56.176  1.00   18.22 ? 155 GLY C N     1 
ATOM   7481  C  CA    . GLY C  1 48  ? 7.715   68.974  56.488  1.00   18.99 ? 155 GLY C CA    1 
ATOM   7482  C  C     . GLY C  1 48  ? 7.016   69.540  55.267  1.00   20.91 ? 155 GLY C C     1 
ATOM   7483  O  O     . GLY C  1 48  ? 7.413   69.300  54.126  1.00   20.14 ? 155 GLY C O     1 
ATOM   7484  N  N     . ILE C  1 49  ? 5.953   70.295  55.514  1.00   21.22 ? 156 ILE C N     1 
ATOM   7485  C  CA    . ILE C  1 49  ? 5.189   70.912  54.442  1.00   21.91 ? 156 ILE C CA    1 
ATOM   7486  C  C     . ILE C  1 49  ? 4.642   72.257  54.899  1.00   23.43 ? 156 ILE C C     1 
ATOM   7487  O  O     . ILE C  1 49  ? 4.048   72.360  55.969  1.00   25.46 ? 156 ILE C O     1 
ATOM   7488  C  CB    . ILE C  1 49  ? 4.011   70.015  53.996  1.00   19.94 ? 156 ILE C CB    1 
ATOM   7489  C  CG1   . ILE C  1 49  ? 3.310   70.655  52.795  1.00   15.59 ? 156 ILE C CG1   1 
ATOM   7490  C  CG2   . ILE C  1 49  ? 3.020   69.821  55.143  1.00   20.20 ? 156 ILE C CG2   1 
ATOM   7491  C  CD1   . ILE C  1 49  ? 2.177   69.829  52.230  1.00   14.04 ? 156 ILE C CD1   1 
ATOM   7492  N  N     . GLU C  1 50  ? 4.859   73.289  54.090  1.00   22.89 ? 157 GLU C N     1 
ATOM   7493  C  CA    . GLU C  1 50  ? 4.370   74.626  54.405  1.00   21.26 ? 157 GLU C CA    1 
ATOM   7494  C  C     . GLU C  1 50  ? 2.887   74.660  54.057  1.00   20.68 ? 157 GLU C C     1 
ATOM   7495  O  O     . GLU C  1 50  ? 2.510   75.116  52.987  1.00   22.60 ? 157 GLU C O     1 
ATOM   7496  C  CB    . GLU C  1 50  ? 5.133   75.640  53.571  1.00   19.28 ? 157 GLU C CB    1 
ATOM   7497  C  CG    . GLU C  1 50  ? 5.000   77.055  54.028  1.00   22.18 ? 157 GLU C CG    1 
ATOM   7498  C  CD    . GLU C  1 50  ? 5.973   77.970  53.312  1.00   25.69 ? 157 GLU C CD    1 
ATOM   7499  O  OE1   . GLU C  1 50  ? 5.777   78.220  52.104  1.00   28.96 ? 157 GLU C OE1   1 
ATOM   7500  O  OE2   . GLU C  1 50  ? 6.941   78.430  53.954  1.00   22.99 ? 157 GLU C OE2   1 
ATOM   7501  N  N     . LYS C  1 51  ? 2.053   74.170  54.967  1.00   22.01 ? 158 LYS C N     1 
ATOM   7502  C  CA    . LYS C  1 51  ? 0.611   74.108  54.738  1.00   24.59 ? 158 LYS C CA    1 
ATOM   7503  C  C     . LYS C  1 51  ? -0.081  75.424  54.401  1.00   24.49 ? 158 LYS C C     1 
ATOM   7504  O  O     . LYS C  1 51  ? -1.158  75.428  53.798  1.00   24.58 ? 158 LYS C O     1 
ATOM   7505  C  CB    . LYS C  1 51  ? -0.086  73.461  55.943  1.00   23.58 ? 158 LYS C CB    1 
ATOM   7506  C  CG    . LYS C  1 51  ? 0.027   74.216  57.262  1.00   22.19 ? 158 LYS C CG    1 
ATOM   7507  C  CD    . LYS C  1 51  ? -0.701  73.459  58.379  1.00   18.54 ? 158 LYS C CD    1 
ATOM   7508  C  CE    . LYS C  1 51  ? -0.681  74.214  59.694  1.00   17.30 ? 158 LYS C CE    1 
ATOM   7509  N  NZ    . LYS C  1 51  ? 0.701   74.554  60.144  1.00   21.38 ? 158 LYS C NZ    1 
ATOM   7510  N  N     . ASN C  1 52  ? 0.539   76.535  54.779  1.00   24.47 ? 159 ASN C N     1 
ATOM   7511  C  CA    . ASN C  1 52  ? -0.039  77.843  54.522  1.00   23.46 ? 159 ASN C CA    1 
ATOM   7512  C  C     . ASN C  1 52  ? 0.473   78.474  53.225  1.00   24.37 ? 159 ASN C C     1 
ATOM   7513  O  O     . ASN C  1 52  ? 0.162   79.624  52.917  1.00   27.39 ? 159 ASN C O     1 
ATOM   7514  C  CB    . ASN C  1 52  ? 0.247   78.759  55.710  1.00   23.45 ? 159 ASN C CB    1 
ATOM   7515  C  CG    . ASN C  1 52  ? 1.720   78.953  55.940  1.00   25.85 ? 159 ASN C CG    1 
ATOM   7516  O  OD1   . ASN C  1 52  ? 2.491   77.993  55.961  1.00   29.48 ? 159 ASN C OD1   1 
ATOM   7517  N  ND2   . ASN C  1 52  ? 2.127   80.200  56.115  1.00   28.62 ? 159 ASN C ND2   1 
ATOM   7518  N  N     . HIS C  1 53  ? 1.259   77.723  52.462  1.00   23.42 ? 160 HIS C N     1 
ATOM   7519  C  CA    . HIS C  1 53  ? 1.780   78.230  51.197  1.00   23.02 ? 160 HIS C CA    1 
ATOM   7520  C  C     . HIS C  1 53  ? 0.584   78.574  50.303  1.00   22.71 ? 160 HIS C C     1 
ATOM   7521  O  O     . HIS C  1 53  ? -0.362  77.792  50.193  1.00   22.94 ? 160 HIS C O     1 
ATOM   7522  C  CB    . HIS C  1 53  ? 2.658   77.167  50.531  1.00   21.22 ? 160 HIS C CB    1 
ATOM   7523  C  CG    . HIS C  1 53  ? 3.448   77.677  49.371  1.00   20.81 ? 160 HIS C CG    1 
ATOM   7524  N  ND1   . HIS C  1 53  ? 2.858   78.188  48.235  1.00   22.05 ? 160 HIS C ND1   1 
ATOM   7525  C  CD2   . HIS C  1 53  ? 4.784   77.763  49.172  1.00   21.05 ? 160 HIS C CD2   1 
ATOM   7526  C  CE1   . HIS C  1 53  ? 3.798   78.565  47.385  1.00   22.13 ? 160 HIS C CE1   1 
ATOM   7527  N  NE2   . HIS C  1 53  ? 4.975   78.318  47.930  1.00   21.12 ? 160 HIS C NE2   1 
ATOM   7528  N  N     . PRO C  1 54  ? 0.602   79.756  49.664  1.00   21.99 ? 161 PRO C N     1 
ATOM   7529  C  CA    . PRO C  1 54  ? -0.516  80.150  48.795  1.00   20.95 ? 161 PRO C CA    1 
ATOM   7530  C  C     . PRO C  1 54  ? -0.897  79.165  47.690  1.00   21.04 ? 161 PRO C C     1 
ATOM   7531  O  O     . PRO C  1 54  ? -2.029  79.184  47.197  1.00   20.84 ? 161 PRO C O     1 
ATOM   7532  C  CB    . PRO C  1 54  ? -0.081  81.516  48.243  1.00   15.77 ? 161 PRO C CB    1 
ATOM   7533  C  CG    . PRO C  1 54  ? 1.417   81.523  48.419  1.00   21.11 ? 161 PRO C CG    1 
ATOM   7534  C  CD    . PRO C  1 54  ? 1.621   80.817  49.734  1.00   19.57 ? 161 PRO C CD    1 
ATOM   7535  N  N     . ASP C  1 55  ? 0.025   78.292  47.304  1.00   20.02 ? 162 ASP C N     1 
ATOM   7536  C  CA    . ASP C  1 55  ? -0.297  77.340  46.251  1.00   21.59 ? 162 ASP C CA    1 
ATOM   7537  C  C     . ASP C  1 55  ? -0.575  75.935  46.785  1.00   23.07 ? 162 ASP C C     1 
ATOM   7538  O  O     . ASP C  1 55  ? -0.755  74.988  46.007  1.00   23.07 ? 162 ASP C O     1 
ATOM   7539  C  CB    . ASP C  1 55  ? 0.825   77.308  45.202  1.00   20.94 ? 162 ASP C CB    1 
ATOM   7540  C  CG    . ASP C  1 55  ? 0.286   77.270  43.784  1.00   20.56 ? 162 ASP C CG    1 
ATOM   7541  O  OD1   . ASP C  1 55  ? -0.881  77.657  43.583  1.00   20.53 ? 162 ASP C OD1   1 
ATOM   7542  O  OD2   . ASP C  1 55  ? 1.024   76.868  42.869  1.00   21.40 ? 162 ASP C OD2   1 
ATOM   7543  N  N     . LEU C  1 56  ? -0.632  75.811  48.111  1.00   22.47 ? 163 LEU C N     1 
ATOM   7544  C  CA    . LEU C  1 56  ? -0.890  74.529  48.759  1.00   22.07 ? 163 LEU C CA    1 
ATOM   7545  C  C     . LEU C  1 56  ? -2.082  74.537  49.714  1.00   22.06 ? 163 LEU C C     1 
ATOM   7546  O  O     . LEU C  1 56  ? -2.820  73.553  49.804  1.00   22.89 ? 163 LEU C O     1 
ATOM   7547  C  CB    . LEU C  1 56  ? 0.351   74.063  49.528  1.00   22.57 ? 163 LEU C CB    1 
ATOM   7548  C  CG    . LEU C  1 56  ? 1.582   73.605  48.735  1.00   22.12 ? 163 LEU C CG    1 
ATOM   7549  C  CD1   . LEU C  1 56  ? 2.681   73.182  49.707  1.00   18.86 ? 163 LEU C CD1   1 
ATOM   7550  C  CD2   . LEU C  1 56  ? 1.201   72.450  47.816  1.00   20.65 ? 163 LEU C CD2   1 
ATOM   7551  N  N     . ALA C  1 57  ? -2.263  75.640  50.429  1.00   20.04 ? 164 ALA C N     1 
ATOM   7552  C  CA    . ALA C  1 57  ? -3.346  75.756  51.400  1.00   19.93 ? 164 ALA C CA    1 
ATOM   7553  C  C     . ALA C  1 57  ? -4.690  75.237  50.889  1.00   19.98 ? 164 ALA C C     1 
ATOM   7554  O  O     . ALA C  1 57  ? -5.384  74.502  51.589  1.00   21.51 ? 164 ALA C O     1 
ATOM   7555  C  CB    . ALA C  1 57  ? -3.476  77.206  51.856  1.00   19.81 ? 164 ALA C CB    1 
ATOM   7556  N  N     . GLY C  1 58  ? -5.052  75.612  49.669  1.00   18.22 ? 165 GLY C N     1 
ATOM   7557  C  CA    . GLY C  1 58  ? -6.315  75.170  49.117  1.00   16.93 ? 165 GLY C CA    1 
ATOM   7558  C  C     . GLY C  1 58  ? -6.507  73.664  49.077  1.00   21.12 ? 165 GLY C C     1 
ATOM   7559  O  O     . GLY C  1 58  ? -7.646  73.181  49.113  1.00   24.31 ? 165 GLY C O     1 
ATOM   7560  N  N     . ASN C  1 59  ? -5.412  72.912  49.001  1.00   20.49 ? 166 ASN C N     1 
ATOM   7561  C  CA    . ASN C  1 59  ? -5.500  71.461  48.946  1.00   21.38 ? 166 ASN C CA    1 
ATOM   7562  C  C     . ASN C  1 59  ? -4.961  70.766  50.193  1.00   24.29 ? 166 ASN C C     1 
ATOM   7563  O  O     . ASN C  1 59  ? -5.094  69.543  50.322  1.00   24.99 ? 166 ASN C O     1 
ATOM   7564  C  CB    . ASN C  1 59  ? -4.751  70.911  47.720  1.00   21.41 ? 166 ASN C CB    1 
ATOM   7565  C  CG    . ASN C  1 59  ? -5.432  71.253  46.401  1.00   22.13 ? 166 ASN C CG    1 
ATOM   7566  O  OD1   . ASN C  1 59  ? -6.624  71.559  46.369  1.00   23.97 ? 166 ASN C OD1   1 
ATOM   7567  N  ND2   . ASN C  1 59  ? -4.680  71.179  45.302  1.00   17.59 ? 166 ASN C ND2   1 
ATOM   7568  N  N     . TYR C  1 60  ? -4.357  71.526  51.103  1.00   22.51 ? 167 TYR C N     1 
ATOM   7569  C  CA    . TYR C  1 60  ? -3.798  70.934  52.311  1.00   23.46 ? 167 TYR C CA    1 
ATOM   7570  C  C     . TYR C  1 60  ? -4.821  70.101  53.085  1.00   24.52 ? 167 TYR C C     1 
ATOM   7571  O  O     . TYR C  1 60  ? -5.965  70.510  53.249  1.00   26.45 ? 167 TYR C O     1 
ATOM   7572  C  CB    . TYR C  1 60  ? -3.229  72.016  53.220  1.00   22.11 ? 167 TYR C CB    1 
ATOM   7573  C  CG    . TYR C  1 60  ? -2.646  71.451  54.489  1.00   24.14 ? 167 TYR C CG    1 
ATOM   7574  C  CD1   . TYR C  1 60  ? -1.469  70.704  54.466  1.00   23.69 ? 167 TYR C CD1   1 
ATOM   7575  C  CD2   . TYR C  1 60  ? -3.284  71.635  55.710  1.00   22.39 ? 167 TYR C CD2   1 
ATOM   7576  C  CE1   . TYR C  1 60  ? -0.945  70.158  55.629  1.00   24.35 ? 167 TYR C CE1   1 
ATOM   7577  C  CE2   . TYR C  1 60  ? -2.771  71.096  56.876  1.00   24.36 ? 167 TYR C CE2   1 
ATOM   7578  C  CZ    . TYR C  1 60  ? -1.600  70.358  56.836  1.00   25.25 ? 167 TYR C CZ    1 
ATOM   7579  O  OH    . TYR C  1 60  ? -1.088  69.835  58.010  1.00   25.23 ? 167 TYR C OH    1 
ATOM   7580  N  N     . ASP C  1 61  ? -4.397  68.928  53.552  1.00   25.21 ? 168 ASP C N     1 
ATOM   7581  C  CA    . ASP C  1 61  ? -5.264  68.022  54.304  1.00   25.96 ? 168 ASP C CA    1 
ATOM   7582  C  C     . ASP C  1 61  ? -4.592  67.631  55.621  1.00   25.87 ? 168 ASP C C     1 
ATOM   7583  O  O     . ASP C  1 61  ? -3.615  66.877  55.632  1.00   25.10 ? 168 ASP C O     1 
ATOM   7584  C  CB    . ASP C  1 61  ? -5.545  66.756  53.483  1.00   25.18 ? 168 ASP C CB    1 
ATOM   7585  C  CG    . ASP C  1 61  ? -6.548  65.818  54.156  1.00   27.16 ? 168 ASP C CG    1 
ATOM   7586  O  OD1   . ASP C  1 61  ? -6.794  65.936  55.383  1.00   25.41 ? 168 ASP C OD1   1 
ATOM   7587  O  OD2   . ASP C  1 61  ? -7.086  64.943  53.449  1.00   26.34 ? 168 ASP C OD2   1 
ATOM   7588  N  N     . PRO C  1 62  ? -5.119  68.129  56.751  1.00   25.90 ? 169 PRO C N     1 
ATOM   7589  C  CA    . PRO C  1 62  ? -4.572  67.837  58.076  1.00   23.54 ? 169 PRO C CA    1 
ATOM   7590  C  C     . PRO C  1 62  ? -4.619  66.346  58.370  1.00   21.53 ? 169 PRO C C     1 
ATOM   7591  O  O     . PRO C  1 62  ? -3.740  65.813  59.042  1.00   21.44 ? 169 PRO C O     1 
ATOM   7592  C  CB    . PRO C  1 62  ? -5.486  68.621  59.010  1.00   22.82 ? 169 PRO C CB    1 
ATOM   7593  C  CG    . PRO C  1 62  ? -6.024  69.703  58.154  1.00   24.72 ? 169 PRO C CG    1 
ATOM   7594  C  CD    . PRO C  1 62  ? -6.315  68.975  56.878  1.00   27.19 ? 169 PRO C CD    1 
ATOM   7595  N  N     . GLY C  1 63  ? -5.649  65.681  57.858  1.00   20.07 ? 170 GLY C N     1 
ATOM   7596  C  CA    . GLY C  1 63  ? -5.801  64.254  58.084  1.00   20.02 ? 170 GLY C CA    1 
ATOM   7597  C  C     . GLY C  1 63  ? -4.728  63.390  57.446  1.00   21.02 ? 170 GLY C C     1 
ATOM   7598  O  O     . GLY C  1 63  ? -4.607  62.205  57.768  1.00   21.16 ? 170 GLY C O     1 
ATOM   7599  N  N     . ALA C  1 64  ? -3.950  63.977  56.542  1.00   21.38 ? 171 ALA C N     1 
ATOM   7600  C  CA    . ALA C  1 64  ? -2.873  63.260  55.860  1.00   20.88 ? 171 ALA C CA    1 
ATOM   7601  C  C     . ALA C  1 64  ? -1.521  63.790  56.332  1.00   21.24 ? 171 ALA C C     1 
ATOM   7602  O  O     . ALA C  1 64  ? -0.489  63.500  55.725  1.00   19.52 ? 171 ALA C O     1 
ATOM   7603  C  CB    . ALA C  1 64  ? -2.998  63.441  54.346  1.00   18.43 ? 171 ALA C CB    1 
ATOM   7604  N  N     . SER C  1 65  ? -1.532  64.561  57.419  1.00   20.94 ? 172 SER C N     1 
ATOM   7605  C  CA    . SER C  1 65  ? -0.303  65.153  57.943  1.00   21.07 ? 172 SER C CA    1 
ATOM   7606  C  C     . SER C  1 65  ? -0.022  64.836  59.403  1.00   22.01 ? 172 SER C C     1 
ATOM   7607  O  O     . SER C  1 65  ? -0.906  64.423  60.157  1.00   22.84 ? 172 SER C O     1 
ATOM   7608  C  CB    . SER C  1 65  ? -0.350  66.672  57.790  1.00   18.44 ? 172 SER C CB    1 
ATOM   7609  O  OG    . SER C  1 65  ? -0.820  67.035  56.512  1.00   18.76 ? 172 SER C OG    1 
ATOM   7610  N  N     . PHE C  1 66  ? 1.223   65.053  59.799  1.00   22.27 ? 173 PHE C N     1 
ATOM   7611  C  CA    . PHE C  1 66  ? 1.636   64.828  61.171  1.00   23.77 ? 173 PHE C CA    1 
ATOM   7612  C  C     . PHE C  1 66  ? 3.109   65.171  61.320  1.00   24.53 ? 173 PHE C C     1 
ATOM   7613  O  O     . PHE C  1 66  ? 3.854   65.162  60.342  1.00   26.71 ? 173 PHE C O     1 
ATOM   7614  C  CB    . PHE C  1 66  ? 1.408   63.372  61.571  1.00   23.93 ? 173 PHE C CB    1 
ATOM   7615  C  CG    . PHE C  1 66  ? 1.341   63.173  63.048  1.00   24.86 ? 173 PHE C CG    1 
ATOM   7616  C  CD1   . PHE C  1 66  ? 0.158   63.423  63.740  1.00   25.03 ? 173 PHE C CD1   1 
ATOM   7617  C  CD2   . PHE C  1 66  ? 2.478   62.813  63.768  1.00   26.13 ? 173 PHE C CD2   1 
ATOM   7618  C  CE1   . PHE C  1 66  ? 0.103   63.328  65.133  1.00   23.80 ? 173 PHE C CE1   1 
ATOM   7619  C  CE2   . PHE C  1 66  ? 2.436   62.715  65.163  1.00   27.08 ? 173 PHE C CE2   1 
ATOM   7620  C  CZ    . PHE C  1 66  ? 1.241   62.975  65.845  1.00   25.61 ? 173 PHE C CZ    1 
ATOM   7621  N  N     . ASP C  1 67  ? 3.523   65.477  62.541  1.00   24.44 ? 174 ASP C N     1 
ATOM   7622  C  CA    . ASP C  1 67  ? 4.914   65.807  62.813  1.00   25.48 ? 174 ASP C CA    1 
ATOM   7623  C  C     . ASP C  1 67  ? 5.492   64.722  63.719  1.00   26.57 ? 174 ASP C C     1 
ATOM   7624  O  O     . ASP C  1 67  ? 5.343   64.771  64.937  1.00   27.56 ? 174 ASP C O     1 
ATOM   7625  C  CB    . ASP C  1 67  ? 5.010   67.170  63.502  1.00   25.35 ? 174 ASP C CB    1 
ATOM   7626  C  CG    . ASP C  1 67  ? 6.450   67.620  63.707  1.00   25.85 ? 174 ASP C CG    1 
ATOM   7627  O  OD1   . ASP C  1 67  ? 7.364   66.802  63.483  1.00   26.17 ? 174 ASP C OD1   1 
ATOM   7628  O  OD2   . ASP C  1 67  ? 6.675   68.787  64.098  1.00   27.47 ? 174 ASP C OD2   1 
ATOM   7629  N  N     . VAL C  1 68  ? 6.142   63.736  63.121  1.00   25.91 ? 175 VAL C N     1 
ATOM   7630  C  CA    . VAL C  1 68  ? 6.723   62.641  63.884  1.00   28.29 ? 175 VAL C CA    1 
ATOM   7631  C  C     . VAL C  1 68  ? 8.004   63.066  64.601  1.00   29.36 ? 175 VAL C C     1 
ATOM   7632  O  O     . VAL C  1 68  ? 8.366   62.499  65.631  1.00   30.52 ? 175 VAL C O     1 
ATOM   7633  C  CB    . VAL C  1 68  ? 7.006   61.437  62.953  1.00   26.84 ? 175 VAL C CB    1 
ATOM   7634  C  CG1   . VAL C  1 68  ? 7.794   60.372  63.670  1.00   29.18 ? 175 VAL C CG1   1 
ATOM   7635  C  CG2   . VAL C  1 68  ? 5.703   60.861  62.479  1.00   21.97 ? 175 VAL C CG2   1 
ATOM   7636  N  N     . ASN C  1 69  ? 8.681   64.069  64.055  1.00   29.69 ? 176 ASN C N     1 
ATOM   7637  C  CA    . ASN C  1 69  ? 9.915   64.566  64.645  1.00   30.76 ? 176 ASN C CA    1 
ATOM   7638  C  C     . ASN C  1 69  ? 9.688   65.225  66.003  1.00   31.55 ? 176 ASN C C     1 
ATOM   7639  O  O     . ASN C  1 69  ? 10.442  64.983  66.947  1.00   31.78 ? 176 ASN C O     1 
ATOM   7640  C  CB    . ASN C  1 69  ? 10.579  65.552  63.686  1.00   30.95 ? 176 ASN C CB    1 
ATOM   7641  C  CG    . ASN C  1 69  ? 11.184  64.866  62.490  1.00   31.77 ? 176 ASN C CG    1 
ATOM   7642  O  OD1   . ASN C  1 69  ? 11.293  65.448  61.413  1.00   35.70 ? 176 ASN C OD1   1 
ATOM   7643  N  ND2   . ASN C  1 69  ? 11.597  63.619  62.675  1.00   31.16 ? 176 ASN C ND2   1 
ATOM   7644  N  N     . ASP C  1 70  ? 8.657   66.061  66.102  1.00   31.97 ? 177 ASP C N     1 
ATOM   7645  C  CA    . ASP C  1 70  ? 8.363   66.733  67.366  1.00   34.15 ? 177 ASP C CA    1 
ATOM   7646  C  C     . ASP C  1 70  ? 7.089   66.222  68.034  1.00   35.94 ? 177 ASP C C     1 
ATOM   7647  O  O     . ASP C  1 70  ? 6.589   66.827  68.986  1.00   38.68 ? 177 ASP C O     1 
ATOM   7648  C  CB    . ASP C  1 70  ? 8.257   68.252  67.176  1.00   32.74 ? 177 ASP C CB    1 
ATOM   7649  C  CG    . ASP C  1 70  ? 9.569   68.881  66.758  1.00   33.67 ? 177 ASP C CG    1 
ATOM   7650  O  OD1   . ASP C  1 70  ? 10.633  68.287  67.032  1.00   35.29 ? 177 ASP C OD1   1 
ATOM   7651  O  OD2   . ASP C  1 70  ? 9.540   69.976  66.164  1.00   33.86 ? 177 ASP C OD2   1 
ATOM   7652  N  N     . GLN C  1 71  ? 6.559   65.115  67.528  1.00   34.90 ? 178 GLN C N     1 
ATOM   7653  C  CA    . GLN C  1 71  ? 5.356   64.526  68.096  1.00   33.75 ? 178 GLN C CA    1 
ATOM   7654  C  C     . GLN C  1 71  ? 4.151   65.465  68.240  1.00   33.47 ? 178 GLN C C     1 
ATOM   7655  O  O     . GLN C  1 71  ? 3.671   65.682  69.348  1.00   34.63 ? 178 GLN C O     1 
ATOM   7656  C  CB    . GLN C  1 71  ? 5.678   63.919  69.464  1.00   33.31 ? 178 GLN C CB    1 
ATOM   7657  C  CG    . GLN C  1 71  ? 5.826   62.408  69.493  1.00   30.89 ? 178 GLN C CG    1 
ATOM   7658  C  CD    . GLN C  1 71  ? 6.973   61.906  68.649  1.00   29.78 ? 178 GLN C CD    1 
ATOM   7659  O  OE1   . GLN C  1 71  ? 6.873   61.842  67.426  0.0000 29.58 ? 178 GLN C OE1   1 
ATOM   7660  N  NE2   . GLN C  1 71  ? 8.076   61.549  69.297  0.0000 29.58 ? 178 GLN C NE2   1 
ATOM   7661  N  N     . ASP C  1 72  ? 3.671   66.028  67.133  1.00   32.54 ? 179 ASP C N     1 
ATOM   7662  C  CA    . ASP C  1 72  ? 2.486   66.884  67.154  1.00   29.29 ? 179 ASP C CA    1 
ATOM   7663  C  C     . ASP C  1 72  ? 1.844   66.786  65.778  1.00   29.11 ? 179 ASP C C     1 
ATOM   7664  O  O     . ASP C  1 72  ? 2.458   66.306  64.831  1.00   29.40 ? 179 ASP C O     1 
ATOM   7665  C  CB    . ASP C  1 72  ? 2.829   68.341  67.513  1.00   29.19 ? 179 ASP C CB    1 
ATOM   7666  C  CG    . ASP C  1 72  ? 3.756   69.001  66.514  1.00   30.72 ? 179 ASP C CG    1 
ATOM   7667  O  OD1   . ASP C  1 72  ? 3.309   69.345  65.402  1.00   31.60 ? 179 ASP C OD1   1 
ATOM   7668  O  OD2   . ASP C  1 72  ? 4.944   69.183  66.844  1.00   34.99 ? 179 ASP C OD2   1 
ATOM   7669  N  N     . PRO C  1 73  ? 0.595   67.230  65.644  1.00   28.91 ? 180 PRO C N     1 
ATOM   7670  C  CA    . PRO C  1 73  ? -0.038  67.131  64.328  1.00   27.67 ? 180 PRO C CA    1 
ATOM   7671  C  C     . PRO C  1 73  ? 0.298   68.202  63.294  1.00   26.32 ? 180 PRO C C     1 
ATOM   7672  O  O     . PRO C  1 73  ? -0.157  68.117  62.158  1.00   26.65 ? 180 PRO C O     1 
ATOM   7673  C  CB    . PRO C  1 73  ? -1.522  67.102  64.677  1.00   27.13 ? 180 PRO C CB    1 
ATOM   7674  C  CG    . PRO C  1 73  ? -1.588  67.999  65.857  1.00   26.01 ? 180 PRO C CG    1 
ATOM   7675  C  CD    . PRO C  1 73  ? -0.394  67.572  66.681  1.00   28.90 ? 180 PRO C CD    1 
ATOM   7676  N  N     . ASP C  1 74  ? 1.091   69.197  63.670  1.00   25.68 ? 181 ASP C N     1 
ATOM   7677  C  CA    . ASP C  1 74  ? 1.451   70.272  62.745  1.00   26.08 ? 181 ASP C CA    1 
ATOM   7678  C  C     . ASP C  1 74  ? 2.785   69.996  62.026  1.00   24.97 ? 181 ASP C C     1 
ATOM   7679  O  O     . ASP C  1 74  ? 3.856   70.026  62.639  1.00   25.68 ? 181 ASP C O     1 
ATOM   7680  C  CB    . ASP C  1 74  ? 1.536   71.590  63.510  1.00   28.29 ? 181 ASP C CB    1 
ATOM   7681  C  CG    . ASP C  1 74  ? 1.716   72.781  62.600  1.00   31.04 ? 181 ASP C CG    1 
ATOM   7682  O  OD1   . ASP C  1 74  ? 2.128   72.592  61.431  1.00   34.13 ? 181 ASP C OD1   1 
ATOM   7683  O  OD2   . ASP C  1 74  ? 1.457   73.910  63.063  1.00   32.35 ? 181 ASP C OD2   1 
ATOM   7684  N  N     . PRO C  1 75  ? 2.733   69.732  60.710  1.00   23.34 ? 182 PRO C N     1 
ATOM   7685  C  CA    . PRO C  1 75  ? 3.917   69.441  59.897  1.00   23.08 ? 182 PRO C CA    1 
ATOM   7686  C  C     . PRO C  1 75  ? 4.656   70.644  59.331  1.00   22.84 ? 182 PRO C C     1 
ATOM   7687  O  O     . PRO C  1 75  ? 5.467   70.494  58.414  1.00   21.02 ? 182 PRO C O     1 
ATOM   7688  C  CB    . PRO C  1 75  ? 3.353   68.557  58.795  1.00   21.39 ? 182 PRO C CB    1 
ATOM   7689  C  CG    . PRO C  1 75  ? 2.047   69.185  58.542  1.00   22.09 ? 182 PRO C CG    1 
ATOM   7690  C  CD    . PRO C  1 75  ? 1.508   69.460  59.937  1.00   24.24 ? 182 PRO C CD    1 
ATOM   7691  N  N     . GLN C  1 76  ? 4.378   71.827  59.870  1.00   23.60 ? 183 GLN C N     1 
ATOM   7692  C  CA    . GLN C  1 76  ? 5.030   73.050  59.411  1.00   23.24 ? 183 GLN C CA    1 
ATOM   7693  C  C     . GLN C  1 76  ? 6.549   72.890  59.496  1.00   21.71 ? 183 GLN C C     1 
ATOM   7694  O  O     . GLN C  1 76  ? 7.074   72.401  60.490  1.00   22.67 ? 183 GLN C O     1 
ATOM   7695  C  CB    . GLN C  1 76  ? 4.589   74.226  60.281  1.00   24.67 ? 183 GLN C CB    1 
ATOM   7696  C  CG    . GLN C  1 76  ? 4.908   75.591  59.714  1.00   25.56 ? 183 GLN C CG    1 
ATOM   7697  C  CD    . GLN C  1 76  ? 4.062   75.925  58.500  1.00   26.85 ? 183 GLN C CD    1 
ATOM   7698  O  OE1   . GLN C  1 76  ? 2.959   75.392  58.328  1.00   24.07 ? 183 GLN C OE1   1 
ATOM   7699  N  NE2   . GLN C  1 76  ? 4.567   76.825  57.658  1.00   24.07 ? 183 GLN C NE2   1 
ATOM   7700  N  N     . PRO C  1 77  ? 7.271   73.294  58.446  1.00   21.46 ? 184 PRO C N     1 
ATOM   7701  C  CA    . PRO C  1 77  ? 8.737   73.183  58.435  1.00   22.90 ? 184 PRO C CA    1 
ATOM   7702  C  C     . PRO C  1 77  ? 9.416   74.070  59.485  1.00   24.04 ? 184 PRO C C     1 
ATOM   7703  O  O     . PRO C  1 77  ? 8.839   75.054  59.965  1.00   25.12 ? 184 PRO C O     1 
ATOM   7704  C  CB    . PRO C  1 77  ? 9.113   73.626  57.017  1.00   20.62 ? 184 PRO C CB    1 
ATOM   7705  C  CG    . PRO C  1 77  ? 7.880   73.309  56.205  1.00   23.13 ? 184 PRO C CG    1 
ATOM   7706  C  CD    . PRO C  1 77  ? 6.759   73.723  57.132  1.00   22.98 ? 184 PRO C CD    1 
ATOM   7707  N  N     . ARG C  1 78  ? 10.642  73.715  59.843  1.00   24.06 ? 185 ARG C N     1 
ATOM   7708  C  CA    . ARG C  1 78  ? 11.418  74.501  60.798  1.00   23.66 ? 185 ARG C CA    1 
ATOM   7709  C  C     . ARG C  1 78  ? 12.276  75.452  59.964  1.00   23.54 ? 185 ARG C C     1 
ATOM   7710  O  O     . ARG C  1 78  ? 13.163  75.019  59.221  1.00   21.17 ? 185 ARG C O     1 
ATOM   7711  C  CB    . ARG C  1 78  ? 12.310  73.582  61.641  1.00   23.78 ? 185 ARG C CB    1 
ATOM   7712  C  CG    . ARG C  1 78  ? 13.277  74.299  62.579  1.00   20.38 ? 185 ARG C CG    1 
ATOM   7713  C  CD    . ARG C  1 78  ? 14.011  73.281  63.441  1.00   19.70 ? 185 ARG C CD    1 
ATOM   7714  N  NE    . ARG C  1 78  ? 14.803  72.356  62.631  1.00   19.99 ? 185 ARG C NE    1 
ATOM   7715  C  CZ    . ARG C  1 78  ? 16.036  72.609  62.197  1.00   21.89 ? 185 ARG C CZ    1 
ATOM   7716  N  NH1   . ARG C  1 78  ? 16.676  71.719  61.456  1.00   18.38 ? 185 ARG C NH1   1 
ATOM   7717  N  NH2   . ARG C  1 78  ? 16.644  73.744  62.524  1.00   24.15 ? 185 ARG C NH2   1 
ATOM   7718  N  N     . TYR C  1 79  ? 12.006  76.748  60.081  1.00   22.83 ? 186 TYR C N     1 
ATOM   7719  C  CA    . TYR C  1 79  ? 12.737  77.730  59.292  1.00   22.02 ? 186 TYR C CA    1 
ATOM   7720  C  C     . TYR C  1 79  ? 14.143  78.012  59.779  1.00   23.11 ? 186 TYR C C     1 
ATOM   7721  O  O     . TYR C  1 79  ? 14.394  78.077  60.976  1.00   24.61 ? 186 TYR C O     1 
ATOM   7722  C  CB    . TYR C  1 79  ? 11.935  79.032  59.199  1.00   17.60 ? 186 TYR C CB    1 
ATOM   7723  C  CG    . TYR C  1 79  ? 10.585  78.834  58.539  1.00   18.19 ? 186 TYR C CG    1 
ATOM   7724  C  CD1   . TYR C  1 79  ? 9.475   78.430  59.279  1.00   12.01 ? 186 TYR C CD1   1 
ATOM   7725  C  CD2   . TYR C  1 79  ? 10.433  78.991  57.154  1.00   17.73 ? 186 TYR C CD2   1 
ATOM   7726  C  CE1   . TYR C  1 79  ? 8.252   78.185  58.662  1.00   12.56 ? 186 TYR C CE1   1 
ATOM   7727  C  CE2   . TYR C  1 79  ? 9.212   78.742  56.530  1.00   13.52 ? 186 TYR C CE2   1 
ATOM   7728  C  CZ    . TYR C  1 79  ? 8.126   78.340  57.292  1.00   14.20 ? 186 TYR C CZ    1 
ATOM   7729  O  OH    . TYR C  1 79  ? 6.916   78.082  56.682  1.00   17.39 ? 186 TYR C OH    1 
ATOM   7730  N  N     . THR C  1 80  ? 15.065  78.159  58.836  1.00   25.20 ? 187 THR C N     1 
ATOM   7731  C  CA    . THR C  1 80  ? 16.461  78.452  59.144  1.00   29.77 ? 187 THR C CA    1 
ATOM   7732  C  C     . THR C  1 80  ? 17.027  79.297  58.001  1.00   32.08 ? 187 THR C C     1 
ATOM   7733  O  O     . THR C  1 80  ? 16.472  79.304  56.902  1.00   33.14 ? 187 THR C O     1 
ATOM   7734  C  CB    . THR C  1 80  ? 17.299  77.164  59.278  1.00   32.02 ? 187 THR C CB    1 
ATOM   7735  O  OG1   . THR C  1 80  ? 17.446  76.541  57.999  1.00   31.35 ? 187 THR C OG1   1 
ATOM   7736  C  CG2   . THR C  1 80  ? 16.623  76.183  60.227  1.00   31.01 ? 187 THR C CG2   1 
ATOM   7737  N  N     . GLN C  1 81  ? 18.123  80.006  58.257  1.00   34.36 ? 188 GLN C N     1 
ATOM   7738  C  CA    . GLN C  1 81  ? 18.739  80.857  57.238  1.00   35.92 ? 188 GLN C CA    1 
ATOM   7739  C  C     . GLN C  1 81  ? 19.066  80.099  55.955  1.00   37.54 ? 188 GLN C C     1 
ATOM   7740  O  O     . GLN C  1 81  ? 18.878  80.612  54.850  1.00   38.86 ? 188 GLN C O     1 
ATOM   7741  C  CB    . GLN C  1 81  ? 20.028  81.517  57.763  1.00   34.29 ? 188 GLN C CB    1 
ATOM   7742  C  CG    . GLN C  1 81  ? 19.843  82.942  58.266  1.00   33.33 ? 188 GLN C CG    1 
ATOM   7743  C  CD    . GLN C  1 81  ? 21.157  83.634  58.563  1.00   31.03 ? 188 GLN C CD    1 
ATOM   7744  O  OE1   . GLN C  1 81  ? 21.980  83.130  59.326  0.0000 31.09 ? 188 GLN C OE1   1 
ATOM   7745  N  NE2   . GLN C  1 81  ? 21.358  84.802  57.964  0.0000 31.09 ? 188 GLN C NE2   1 
ATOM   7746  N  N     . MET C  1 82  ? 19.560  78.877  56.099  1.00   38.48 ? 189 MET C N     1 
ATOM   7747  C  CA    . MET C  1 82  ? 19.921  78.076  54.938  1.00   40.09 ? 189 MET C CA    1 
ATOM   7748  C  C     . MET C  1 82  ? 18.729  77.450  54.225  1.00   37.26 ? 189 MET C C     1 
ATOM   7749  O  O     . MET C  1 82  ? 18.883  76.895  53.142  1.00   36.37 ? 189 MET C O     1 
ATOM   7750  C  CB    . MET C  1 82  ? 20.894  76.971  55.340  1.00   44.38 ? 189 MET C CB    1 
ATOM   7751  C  CG    . MET C  1 82  ? 22.279  77.451  55.674  1.00   52.43 ? 189 MET C CG    1 
ATOM   7752  S  SD    . MET C  1 82  ? 23.163  76.098  56.463  1.00   65.66 ? 189 MET C SD    1 
ATOM   7753  C  CE    . MET C  1 82  ? 23.888  75.248  55.062  1.00   63.32 ? 189 MET C CE    1 
ATOM   7754  N  N     . ASN C  1 83  ? 17.547  77.534  54.831  1.00   36.25 ? 190 ASN C N     1 
ATOM   7755  C  CA    . ASN C  1 83  ? 16.335  76.945  54.256  1.00   34.56 ? 190 ASN C CA    1 
ATOM   7756  C  C     . ASN C  1 83  ? 16.488  75.436  54.044  1.00   35.25 ? 190 ASN C C     1 
ATOM   7757  O  O     . ASN C  1 83  ? 16.128  74.913  52.985  1.00   34.33 ? 190 ASN C O     1 
ATOM   7758  C  CB    . ASN C  1 83  ? 16.001  77.610  52.921  1.00   31.32 ? 190 ASN C CB    1 
ATOM   7759  C  CG    . ASN C  1 83  ? 15.561  79.047  53.082  1.00   31.21 ? 190 ASN C CG    1 
ATOM   7760  O  OD1   . ASN C  1 83  ? 14.723  79.361  53.932  1.00   31.41 ? 190 ASN C OD1   1 
ATOM   7761  N  ND2   . ASN C  1 83  ? 16.120  79.933  52.263  1.00   28.30 ? 190 ASN C ND2   1 
ATOM   7762  N  N     . ASP C  1 84  ? 17.017  74.747  55.056  1.00   34.69 ? 191 ASP C N     1 
ATOM   7763  C  CA    . ASP C  1 84  ? 17.236  73.299  54.993  1.00   35.23 ? 191 ASP C CA    1 
ATOM   7764  C  C     . ASP C  1 84  ? 15.962  72.495  54.766  1.00   34.79 ? 191 ASP C C     1 
ATOM   7765  O  O     . ASP C  1 84  ? 15.951  71.515  54.018  1.00   35.39 ? 191 ASP C O     1 
ATOM   7766  C  CB    . ASP C  1 84  ? 17.860  72.782  56.291  1.00   37.24 ? 191 ASP C CB    1 
ATOM   7767  C  CG    . ASP C  1 84  ? 19.013  73.643  56.786  1.00   39.80 ? 191 ASP C CG    1 
ATOM   7768  O  OD1   . ASP C  1 84  ? 18.763  74.783  57.233  1.00   38.79 ? 191 ASP C OD1   1 
ATOM   7769  O  OD2   . ASP C  1 84  ? 20.174  73.179  56.728  1.00   40.91 ? 191 ASP C OD2   1 
ATOM   7770  N  N     . ASN C  1 85  ? 14.891  72.910  55.429  1.00   33.60 ? 192 ASN C N     1 
ATOM   7771  C  CA    . ASN C  1 85  ? 13.622  72.208  55.345  1.00   31.00 ? 192 ASN C CA    1 
ATOM   7772  C  C     . ASN C  1 85  ? 12.626  72.689  54.291  1.00   30.43 ? 192 ASN C C     1 
ATOM   7773  O  O     . ASN C  1 85  ? 11.434  72.840  54.574  1.00   29.98 ? 192 ASN C O     1 
ATOM   7774  C  CB    . ASN C  1 85  ? 12.993  72.213  56.736  1.00   31.88 ? 192 ASN C CB    1 
ATOM   7775  C  CG    . ASN C  1 85  ? 13.927  71.618  57.780  1.00   34.13 ? 192 ASN C CG    1 
ATOM   7776  O  OD1   . ASN C  1 85  ? 14.404  70.485  57.621  1.00   33.08 ? 192 ASN C OD1   1 
ATOM   7777  N  ND2   . ASN C  1 85  ? 14.211  72.379  58.840  1.00   32.23 ? 192 ASN C ND2   1 
ATOM   7778  N  N     . ARG C  1 86  ? 13.116  72.903  53.071  1.00   28.76 ? 193 ARG C N     1 
ATOM   7779  C  CA    . ARG C  1 86  ? 12.274  73.353  51.961  1.00   27.60 ? 193 ARG C CA    1 
ATOM   7780  C  C     . ARG C  1 86  ? 11.941  72.159  51.062  1.00   25.16 ? 193 ARG C C     1 
ATOM   7781  O  O     . ARG C  1 86  ? 11.012  72.206  50.257  1.00   24.33 ? 193 ARG C O     1 
ATOM   7782  C  CB    . ARG C  1 86  ? 13.023  74.389  51.130  1.00   27.60 ? 193 ARG C CB    1 
ATOM   7783  C  CG    . ARG C  1 86  ? 14.206  73.773  50.415  1.00   31.20 ? 193 ARG C CG    1 
ATOM   7784  C  CD    . ARG C  1 86  ? 14.960  74.767  49.587  1.00   32.10 ? 193 ARG C CD    1 
ATOM   7785  N  NE    . ARG C  1 86  ? 16.073  74.107  48.914  1.00   35.49 ? 193 ARG C NE    1 
ATOM   7786  C  CZ    . ARG C  1 86  ? 16.976  74.741  48.174  1.00   38.35 ? 193 ARG C CZ    1 
ATOM   7787  N  NH1   . ARG C  1 86  ? 16.893  76.064  48.017  1.00   38.41 ? 193 ARG C NH1   1 
ATOM   7788  N  NH2   . ARG C  1 86  ? 17.954  74.054  47.590  1.00   35.15 ? 193 ARG C NH2   1 
ATOM   7789  N  N     . HIS C  1 87  ? 12.718  71.092  51.212  1.00   23.28 ? 194 HIS C N     1 
ATOM   7790  C  CA    . HIS C  1 87  ? 12.573  69.882  50.410  1.00   22.11 ? 194 HIS C CA    1 
ATOM   7791  C  C     . HIS C  1 87  ? 11.169  69.289  50.337  1.00   21.09 ? 194 HIS C C     1 
ATOM   7792  O  O     . HIS C  1 87  ? 10.662  69.024  49.250  1.00   20.67 ? 194 HIS C O     1 
ATOM   7793  C  CB    . HIS C  1 87  ? 13.560  68.838  50.927  1.00   22.16 ? 194 HIS C CB    1 
ATOM   7794  C  CG    . HIS C  1 87  ? 13.778  67.682  50.000  1.00   21.58 ? 194 HIS C CG    1 
ATOM   7795  N  ND1   . HIS C  1 87  ? 13.206  66.445  50.203  1.00   22.12 ? 194 HIS C ND1   1 
ATOM   7796  C  CD2   . HIS C  1 87  ? 14.555  67.559  48.898  1.00   19.05 ? 194 HIS C CD2   1 
ATOM   7797  C  CE1   . HIS C  1 87  ? 13.627  65.608  49.271  1.00   21.02 ? 194 HIS C CE1   1 
ATOM   7798  N  NE2   . HIS C  1 87  ? 14.447  66.259  48.467  1.00   17.19 ? 194 HIS C NE2   1 
ATOM   7799  N  N     . GLY C  1 88  ? 10.542  69.081  51.487  1.00   21.15 ? 195 GLY C N     1 
ATOM   7800  C  CA    . GLY C  1 88  ? 9.208   68.511  51.495  1.00   21.52 ? 195 GLY C CA    1 
ATOM   7801  C  C     . GLY C  1 88  ? 8.171   69.379  50.809  1.00   22.86 ? 195 GLY C C     1 
ATOM   7802  O  O     . GLY C  1 88  ? 7.254   68.876  50.154  1.00   22.18 ? 195 GLY C O     1 
ATOM   7803  N  N     . THR C  1 89  ? 8.318   70.691  50.958  1.00   23.42 ? 196 THR C N     1 
ATOM   7804  C  CA    . THR C  1 89  ? 7.383   71.631  50.360  1.00   24.50 ? 196 THR C CA    1 
ATOM   7805  C  C     . THR C  1 89  ? 7.491   71.624  48.839  1.00   23.43 ? 196 THR C C     1 
ATOM   7806  O  O     . THR C  1 89  ? 6.487   71.759  48.133  1.00   23.38 ? 196 THR C O     1 
ATOM   7807  C  CB    . THR C  1 89  ? 7.619   73.060  50.899  1.00   24.85 ? 196 THR C CB    1 
ATOM   7808  O  OG1   . THR C  1 89  ? 7.268   73.106  52.287  1.00   25.57 ? 196 THR C OG1   1 
ATOM   7809  C  CG2   . THR C  1 89  ? 6.753   74.057  50.159  1.00   21.60 ? 196 THR C CG2   1 
ATOM   7810  N  N     . ARG C  1 90  ? 8.708   71.460  48.336  1.00   21.46 ? 197 ARG C N     1 
ATOM   7811  C  CA    . ARG C  1 90  ? 8.914   71.423  46.900  1.00   22.24 ? 197 ARG C CA    1 
ATOM   7812  C  C     . ARG C  1 90  ? 8.247   70.183  46.313  1.00   23.22 ? 197 ARG C C     1 
ATOM   7813  O  O     . ARG C  1 90  ? 7.566   70.258  45.283  1.00   24.30 ? 197 ARG C O     1 
ATOM   7814  C  CB    . ARG C  1 90  ? 10.408  71.417  46.574  1.00   19.62 ? 197 ARG C CB    1 
ATOM   7815  C  CG    . ARG C  1 90  ? 11.109  72.680  47.002  1.00   18.53 ? 197 ARG C CG    1 
ATOM   7816  C  CD    . ARG C  1 90  ? 12.495  72.764  46.430  1.00   17.59 ? 197 ARG C CD    1 
ATOM   7817  N  NE    . ARG C  1 90  ? 13.005  74.125  46.537  1.00   16.44 ? 197 ARG C NE    1 
ATOM   7818  C  CZ    . ARG C  1 90  ? 14.157  74.538  46.019  1.00   17.14 ? 197 ARG C CZ    1 
ATOM   7819  N  NH1   . ARG C  1 90  ? 14.533  75.803  46.168  1.00   17.10 ? 197 ARG C NH1   1 
ATOM   7820  N  NH2   . ARG C  1 90  ? 14.932  73.693  45.352  1.00   14.32 ? 197 ARG C NH2   1 
ATOM   7821  N  N     . CYS C  1 91  ? 8.430   69.047  46.978  1.00   20.21 ? 198 CYS C N     1 
ATOM   7822  C  CA    . CYS C  1 91  ? 7.840   67.805  46.511  1.00   20.79 ? 198 CYS C CA    1 
ATOM   7823  C  C     . CYS C  1 91  ? 6.309   67.866  46.534  1.00   22.17 ? 198 CYS C C     1 
ATOM   7824  O  O     . CYS C  1 91  ? 5.641   67.421  45.595  1.00   22.31 ? 198 CYS C O     1 
ATOM   7825  C  CB    . CYS C  1 91  ? 8.358   66.638  47.361  1.00   20.93 ? 198 CYS C CB    1 
ATOM   7826  S  SG    . CYS C  1 91  ? 10.156  66.326  47.160  1.00   17.57 ? 198 CYS C SG    1 
ATOM   7827  N  N     . ALA C  1 92  ? 5.753   68.428  47.599  1.00   21.44 ? 199 ALA C N     1 
ATOM   7828  C  CA    . ALA C  1 92  ? 4.307   68.546  47.720  1.00   21.62 ? 199 ALA C CA    1 
ATOM   7829  C  C     . ALA C  1 92  ? 3.703   69.309  46.533  1.00   22.15 ? 199 ALA C C     1 
ATOM   7830  O  O     . ALA C  1 92  ? 2.713   68.881  45.936  1.00   23.97 ? 199 ALA C O     1 
ATOM   7831  C  CB    . ALA C  1 92  ? 3.964   69.251  49.025  1.00   19.90 ? 199 ALA C CB    1 
ATOM   7832  N  N     . GLY C  1 93  ? 4.311   70.439  46.194  1.00   20.89 ? 200 GLY C N     1 
ATOM   7833  C  CA    . GLY C  1 93  ? 3.818   71.253  45.097  1.00   19.83 ? 200 GLY C CA    1 
ATOM   7834  C  C     . GLY C  1 93  ? 3.735   70.526  43.774  1.00   19.33 ? 200 GLY C C     1 
ATOM   7835  O  O     . GLY C  1 93  ? 2.838   70.787  42.972  1.00   21.21 ? 200 GLY C O     1 
ATOM   7836  N  N     . GLU C  1 94  ? 4.670   69.612  43.539  1.00   17.74 ? 201 GLU C N     1 
ATOM   7837  C  CA    . GLU C  1 94  ? 4.694   68.851  42.296  1.00   15.20 ? 201 GLU C CA    1 
ATOM   7838  C  C     . GLU C  1 94  ? 3.444   68.022  42.158  1.00   15.08 ? 201 GLU C C     1 
ATOM   7839  O  O     . GLU C  1 94  ? 2.909   67.865  41.065  1.00   14.93 ? 201 GLU C O     1 
ATOM   7840  C  CB    . GLU C  1 94  ? 5.885   67.902  42.268  1.00   16.07 ? 201 GLU C CB    1 
ATOM   7841  C  CG    . GLU C  1 94  ? 7.227   68.557  42.133  1.00   18.78 ? 201 GLU C CG    1 
ATOM   7842  C  CD    . GLU C  1 94  ? 8.325   67.531  42.066  1.00   21.62 ? 201 GLU C CD    1 
ATOM   7843  O  OE1   . GLU C  1 94  ? 8.935   67.220  43.115  1.00   19.49 ? 201 GLU C OE1   1 
ATOM   7844  O  OE2   . GLU C  1 94  ? 8.558   67.019  40.954  1.00   22.77 ? 201 GLU C OE2   1 
ATOM   7845  N  N     . VAL C  1 95  ? 2.990   67.483  43.282  1.00   14.70 ? 202 VAL C N     1 
ATOM   7846  C  CA    . VAL C  1 95  ? 1.819   66.634  43.298  1.00   13.00 ? 202 VAL C CA    1 
ATOM   7847  C  C     . VAL C  1 95  ? 0.507   67.387  43.248  1.00   13.34 ? 202 VAL C C     1 
ATOM   7848  O  O     . VAL C  1 95  ? -0.343  67.108  42.402  1.00   11.76 ? 202 VAL C O     1 
ATOM   7849  C  CB    . VAL C  1 95  ? 1.794   65.728  44.558  1.00   13.25 ? 202 VAL C CB    1 
ATOM   7850  C  CG1   . VAL C  1 95  ? 0.600   64.774  44.480  1.00   12.94 ? 202 VAL C CG1   1 
ATOM   7851  C  CG2   . VAL C  1 95  ? 3.095   64.946  44.680  1.00   9.68  ? 202 VAL C CG2   1 
ATOM   7852  N  N     . ALA C  1 96  ? 0.331   68.349  44.143  1.00   14.45 ? 203 ALA C N     1 
ATOM   7853  C  CA    . ALA C  1 96  ? -0.942  69.049  44.175  1.00   17.08 ? 203 ALA C CA    1 
ATOM   7854  C  C     . ALA C  1 96  ? -0.948  70.561  44.344  1.00   18.01 ? 203 ALA C C     1 
ATOM   7855  O  O     . ALA C  1 96  ? -1.754  71.082  45.115  1.00   17.17 ? 203 ALA C O     1 
ATOM   7856  C  CB    . ALA C  1 96  ? -1.839  68.409  45.248  1.00   14.79 ? 203 ALA C CB    1 
ATOM   7857  N  N     . ALA C  1 97  ? -0.074  71.272  43.637  1.00   17.66 ? 204 ALA C N     1 
ATOM   7858  C  CA    . ALA C  1 97  ? -0.094  72.732  43.730  1.00   19.68 ? 204 ALA C CA    1 
ATOM   7859  C  C     . ALA C  1 97  ? -1.447  73.176  43.136  1.00   21.40 ? 204 ALA C C     1 
ATOM   7860  O  O     . ALA C  1 97  ? -1.897  72.631  42.116  1.00   22.54 ? 204 ALA C O     1 
ATOM   7861  C  CB    . ALA C  1 97  ? 1.064   73.334  42.935  1.00   16.31 ? 204 ALA C CB    1 
ATOM   7862  N  N     . VAL C  1 98  ? -2.102  74.141  43.775  1.00   18.46 ? 205 VAL C N     1 
ATOM   7863  C  CA    . VAL C  1 98  ? -3.397  74.618  43.293  1.00   16.23 ? 205 VAL C CA    1 
ATOM   7864  C  C     . VAL C  1 98  ? -3.348  75.163  41.864  1.00   16.02 ? 205 VAL C C     1 
ATOM   7865  O  O     . VAL C  1 98  ? -2.349  75.759  41.441  1.00   14.84 ? 205 VAL C O     1 
ATOM   7866  C  CB    . VAL C  1 98  ? -3.956  75.704  44.245  1.00   15.49 ? 205 VAL C CB    1 
ATOM   7867  C  CG1   . VAL C  1 98  ? -5.281  76.218  43.730  1.00   7.99  ? 205 VAL C CG1   1 
ATOM   7868  C  CG2   . VAL C  1 98  ? -4.107  75.114  45.654  1.00   10.91 ? 205 VAL C CG2   1 
ATOM   7869  N  N     . ALA C  1 99  ? -4.433  74.965  41.120  1.00   16.66 ? 206 ALA C N     1 
ATOM   7870  C  CA    . ALA C  1 99  ? -4.488  75.431  39.734  1.00   20.26 ? 206 ALA C CA    1 
ATOM   7871  C  C     . ALA C  1 99  ? -5.369  76.663  39.513  1.00   21.47 ? 206 ALA C C     1 
ATOM   7872  O  O     . ALA C  1 99  ? -6.318  76.909  40.263  1.00   23.73 ? 206 ALA C O     1 
ATOM   7873  C  CB    . ALA C  1 99  ? -4.961  74.301  38.835  1.00   20.36 ? 206 ALA C CB    1 
ATOM   7874  N  N     . ASN C  1 100 ? -5.043  77.437  38.480  1.00   20.18 ? 207 ASN C N     1 
ATOM   7875  C  CA    . ASN C  1 100 ? -5.815  78.631  38.134  1.00   20.32 ? 207 ASN C CA    1 
ATOM   7876  C  C     . ASN C  1 100 ? -6.004  79.588  39.301  1.00   19.16 ? 207 ASN C C     1 
ATOM   7877  O  O     . ASN C  1 100 ? -7.111  80.064  39.538  1.00   19.16 ? 207 ASN C O     1 
ATOM   7878  C  CB    . ASN C  1 100 ? -7.188  78.213  37.604  1.00   17.34 ? 207 ASN C CB    1 
ATOM   7879  C  CG    . ASN C  1 100 ? -7.087  77.275  36.418  1.00   20.67 ? 207 ASN C CG    1 
ATOM   7880  O  OD1   . ASN C  1 100 ? -6.480  77.611  35.396  1.00   22.56 ? 207 ASN C OD1   1 
ATOM   7881  N  ND2   . ASN C  1 100 ? -7.670  76.088  36.547  1.00   18.56 ? 207 ASN C ND2   1 
ATOM   7882  N  N     . ASN C  1 101 ? -4.927  79.878  40.019  1.00   19.12 ? 208 ASN C N     1 
ATOM   7883  C  CA    . ASN C  1 101 ? -5.014  80.766  41.162  1.00   18.73 ? 208 ASN C CA    1 
ATOM   7884  C  C     . ASN C  1 101 ? -3.981  81.868  41.060  1.00   19.45 ? 208 ASN C C     1 
ATOM   7885  O  O     . ASN C  1 101 ? -3.628  82.490  42.058  1.00   21.62 ? 208 ASN C O     1 
ATOM   7886  C  CB    . ASN C  1 101 ? -4.816  79.959  42.452  1.00   19.85 ? 208 ASN C CB    1 
ATOM   7887  C  CG    . ASN C  1 101 ? -3.389  79.457  42.619  1.00   21.74 ? 208 ASN C CG    1 
ATOM   7888  O  OD1   . ASN C  1 101 ? -2.680  79.211  41.640  1.00   21.14 ? 208 ASN C OD1   1 
ATOM   7889  N  ND2   . ASN C  1 101 ? -2.965  79.297  43.866  1.00   23.62 ? 208 ASN C ND2   1 
ATOM   7890  N  N     . GLY C  1 102 ? -3.493  82.093  39.843  1.00   19.63 ? 209 GLY C N     1 
ATOM   7891  C  CA    . GLY C  1 102 ? -2.507  83.136  39.602  1.00   19.54 ? 209 GLY C CA    1 
ATOM   7892  C  C     . GLY C  1 102 ? -1.215  82.985  40.371  1.00   19.72 ? 209 GLY C C     1 
ATOM   7893  O  O     . GLY C  1 102 ? -0.420  83.913  40.430  1.00   18.90 ? 209 GLY C O     1 
ATOM   7894  N  N     . VAL C  1 103 ? -0.993  81.812  40.949  1.00   22.97 ? 210 VAL C N     1 
ATOM   7895  C  CA    . VAL C  1 103 ? 0.221   81.589  41.715  1.00   22.98 ? 210 VAL C CA    1 
ATOM   7896  C  C     . VAL C  1 103 ? 1.071   80.440  41.204  1.00   23.56 ? 210 VAL C C     1 
ATOM   7897  O  O     . VAL C  1 103 ? 0.578   79.331  41.016  1.00   23.09 ? 210 VAL C O     1 
ATOM   7898  C  CB    . VAL C  1 103 ? -0.108  81.306  43.182  1.00   21.91 ? 210 VAL C CB    1 
ATOM   7899  C  CG1   . VAL C  1 103 ? 1.162   80.967  43.948  1.00   18.58 ? 210 VAL C CG1   1 
ATOM   7900  C  CG2   . VAL C  1 103 ? -0.808  82.487  43.772  1.00   17.60 ? 210 VAL C CG2   1 
ATOM   7901  N  N     . CYS C  1 104 ? 2.347   80.730  40.976  1.00   25.16 ? 211 CYS C N     1 
ATOM   7902  C  CA    . CYS C  1 104 ? 3.317   79.732  40.548  1.00   27.62 ? 211 CYS C CA    1 
ATOM   7903  C  C     . CYS C  1 104 ? 2.774   78.820  39.435  1.00   26.65 ? 211 CYS C C     1 
ATOM   7904  O  O     . CYS C  1 104 ? 2.226   79.307  38.443  1.00   29.10 ? 211 CYS C O     1 
ATOM   7905  C  CB    . CYS C  1 104 ? 3.721   78.928  41.794  1.00   29.77 ? 211 CYS C CB    1 
ATOM   7906  S  SG    . CYS C  1 104 ? 5.340   78.092  41.831  1.00   37.68 ? 211 CYS C SG    1 
ATOM   7907  N  N     . GLY C  1 105 ? 2.925   77.508  39.603  1.00   24.77 ? 212 GLY C N     1 
ATOM   7908  C  CA    . GLY C  1 105 ? 2.450   76.571  38.599  1.00   22.81 ? 212 GLY C CA    1 
ATOM   7909  C  C     . GLY C  1 105 ? 1.304   75.716  39.102  1.00   21.04 ? 212 GLY C C     1 
ATOM   7910  O  O     . GLY C  1 105 ? 0.464   76.192  39.857  1.00   22.13 ? 212 GLY C O     1 
ATOM   7911  N  N     . VAL C  1 106 ? 1.260   74.456  38.679  1.00   19.89 ? 213 VAL C N     1 
ATOM   7912  C  CA    . VAL C  1 106 ? 0.203   73.540  39.112  1.00   19.33 ? 213 VAL C CA    1 
ATOM   7913  C  C     . VAL C  1 106 ? 0.747   72.145  39.380  1.00   18.06 ? 213 VAL C C     1 
ATOM   7914  O  O     . VAL C  1 106 ? 1.775   71.752  38.840  1.00   18.12 ? 213 VAL C O     1 
ATOM   7915  C  CB    . VAL C  1 106 ? -0.915  73.398  38.052  1.00   17.85 ? 213 VAL C CB    1 
ATOM   7916  C  CG1   . VAL C  1 106 ? -1.428  74.770  37.654  1.00   16.99 ? 213 VAL C CG1   1 
ATOM   7917  C  CG2   . VAL C  1 106 ? -0.397  72.617  36.848  1.00   14.87 ? 213 VAL C CG2   1 
ATOM   7918  N  N     . GLY C  1 107 ? 0.050   71.392  40.217  1.00   17.24 ? 214 GLY C N     1 
ATOM   7919  C  CA    . GLY C  1 107 ? 0.491   70.040  40.499  1.00   18.89 ? 214 GLY C CA    1 
ATOM   7920  C  C     . GLY C  1 107 ? -0.109  69.081  39.485  1.00   17.44 ? 214 GLY C C     1 
ATOM   7921  O  O     . GLY C  1 107 ? -1.076  69.429  38.813  1.00   19.01 ? 214 GLY C O     1 
ATOM   7922  N  N     . VAL C  1 108 ? 0.459   67.884  39.355  1.00   15.85 ? 215 VAL C N     1 
ATOM   7923  C  CA    . VAL C  1 108 ? -0.066  66.901  38.413  1.00   14.32 ? 215 VAL C CA    1 
ATOM   7924  C  C     . VAL C  1 108 ? -1.526  66.594  38.759  1.00   15.46 ? 215 VAL C C     1 
ATOM   7925  O  O     . VAL C  1 108 ? -2.378  66.500  37.880  1.00   15.91 ? 215 VAL C O     1 
ATOM   7926  C  CB    . VAL C  1 108 ? 0.763   65.607  38.455  1.00   13.19 ? 215 VAL C CB    1 
ATOM   7927  C  CG1   . VAL C  1 108 ? 0.065   64.497  37.665  1.00   15.12 ? 215 VAL C CG1   1 
ATOM   7928  C  CG2   . VAL C  1 108 ? 2.133   65.872  37.871  1.00   14.99 ? 215 VAL C CG2   1 
ATOM   7929  N  N     . ALA C  1 109 ? -1.804  66.443  40.049  1.00   16.75 ? 216 ALA C N     1 
ATOM   7930  C  CA    . ALA C  1 109 ? -3.153  66.173  40.525  1.00   17.21 ? 216 ALA C CA    1 
ATOM   7931  C  C     . ALA C  1 109 ? -3.578  67.413  41.314  1.00   17.93 ? 216 ALA C C     1 
ATOM   7932  O  O     . ALA C  1 109 ? -3.663  67.378  42.542  1.00   17.44 ? 216 ALA C O     1 
ATOM   7933  C  CB    . ALA C  1 109 ? -3.149  64.944  41.418  1.00   15.48 ? 216 ALA C CB    1 
ATOM   7934  N  N     . TYR C  1 110 ? -3.851  68.504  40.599  1.00   17.26 ? 217 TYR C N     1 
ATOM   7935  C  CA    . TYR C  1 110 ? -4.195  69.765  41.242  1.00   19.21 ? 217 TYR C CA    1 
ATOM   7936  C  C     . TYR C  1 110 ? -5.515  69.839  41.995  1.00   19.47 ? 217 TYR C C     1 
ATOM   7937  O  O     . TYR C  1 110 ? -5.855  70.887  42.546  1.00   20.52 ? 217 TYR C O     1 
ATOM   7938  C  CB    . TYR C  1 110 ? -4.065  70.935  40.246  1.00   19.41 ? 217 TYR C CB    1 
ATOM   7939  C  CG    . TYR C  1 110 ? -4.931  70.877  39.002  1.00   19.46 ? 217 TYR C CG    1 
ATOM   7940  C  CD1   . TYR C  1 110 ? -6.311  71.065  39.078  1.00   19.51 ? 217 TYR C CD1   1 
ATOM   7941  C  CD2   . TYR C  1 110 ? -4.362  70.682  37.741  1.00   18.70 ? 217 TYR C CD2   1 
ATOM   7942  C  CE1   . TYR C  1 110 ? -7.103  71.064  37.934  1.00   18.45 ? 217 TYR C CE1   1 
ATOM   7943  C  CE2   . TYR C  1 110 ? -5.142  70.678  36.589  1.00   17.75 ? 217 TYR C CE2   1 
ATOM   7944  C  CZ    . TYR C  1 110 ? -6.514  70.876  36.690  1.00   20.50 ? 217 TYR C CZ    1 
ATOM   7945  O  OH    . TYR C  1 110 ? -7.295  70.922  35.545  1.00   20.70 ? 217 TYR C OH    1 
ATOM   7946  N  N     . ASN C  1 111 ? -6.247  68.733  42.043  1.00   17.83 ? 218 ASN C N     1 
ATOM   7947  C  CA    . ASN C  1 111 ? -7.484  68.717  42.800  1.00   18.22 ? 218 ASN C CA    1 
ATOM   7948  C  C     . ASN C  1 111 ? -7.436  67.673  43.892  1.00   20.11 ? 218 ASN C C     1 
ATOM   7949  O  O     . ASN C  1 111 ? -8.425  67.446  44.589  1.00   23.18 ? 218 ASN C O     1 
ATOM   7950  C  CB    . ASN C  1 111 ? -8.686  68.485  41.896  1.00   19.97 ? 218 ASN C CB    1 
ATOM   7951  C  CG    . ASN C  1 111 ? -9.144  69.766  41.230  1.00   22.44 ? 218 ASN C CG    1 
ATOM   7952  O  OD1   . ASN C  1 111 ? -9.147  70.834  41.859  1.00   22.21 ? 218 ASN C OD1   1 
ATOM   7953  N  ND2   . ASN C  1 111 ? -9.531  69.678  39.962  1.00   19.61 ? 218 ASN C ND2   1 
ATOM   7954  N  N     . ALA C  1 112 ? -6.274  67.043  44.042  1.00   20.10 ? 219 ALA C N     1 
ATOM   7955  C  CA    . ALA C  1 112 ? -6.078  66.029  45.066  1.00   20.82 ? 219 ALA C CA    1 
ATOM   7956  C  C     . ALA C  1 112 ? -5.832  66.730  46.397  1.00   21.35 ? 219 ALA C C     1 
ATOM   7957  O  O     . ALA C  1 112 ? -5.529  67.922  46.434  1.00   20.07 ? 219 ALA C O     1 
ATOM   7958  C  CB    . ALA C  1 112 ? -4.888  65.148  44.707  1.00   16.99 ? 219 ALA C CB    1 
ATOM   7959  N  N     . ARG C  1 113 ? -5.984  66.003  47.495  1.00   22.87 ? 220 ARG C N     1 
ATOM   7960  C  CA    . ARG C  1 113 ? -5.720  66.596  48.795  1.00   25.15 ? 220 ARG C CA    1 
ATOM   7961  C  C     . ARG C  1 113 ? -4.297  66.187  49.119  1.00   24.45 ? 220 ARG C C     1 
ATOM   7962  O  O     . ARG C  1 113 ? -3.923  65.022  48.960  1.00   24.96 ? 220 ARG C O     1 
ATOM   7963  C  CB    . ARG C  1 113 ? -6.724  66.078  49.825  1.00   27.86 ? 220 ARG C CB    1 
ATOM   7964  C  CG    . ARG C  1 113 ? -8.133  66.604  49.547  1.00   32.91 ? 220 ARG C CG    1 
ATOM   7965  C  CD    . ARG C  1 113 ? -9.187  65.655  50.064  1.00   39.31 ? 220 ARG C CD    1 
ATOM   7966  N  NE    . ARG C  1 113 ? -9.312  65.718  51.517  1.00   44.07 ? 220 ARG C NE    1 
ATOM   7967  C  CZ    . ARG C  1 113 ? -9.968  64.824  52.251  1.00   41.95 ? 220 ARG C CZ    1 
ATOM   7968  N  NH1   . ARG C  1 113 ? -10.028 64.970  53.572  1.00   41.49 ? 220 ARG C NH1   1 
ATOM   7969  N  NH2   . ARG C  1 113 ? -10.550 63.780  51.666  1.00   41.52 ? 220 ARG C NH2   1 
ATOM   7970  N  N     . ILE C  1 114 ? -3.498  67.157  49.547  1.00   23.23 ? 221 ILE C N     1 
ATOM   7971  C  CA    . ILE C  1 114 ? -2.095  66.911  49.849  1.00   22.29 ? 221 ILE C CA    1 
ATOM   7972  C  C     . ILE C  1 114 ? -1.779  67.097  51.333  1.00   21.19 ? 221 ILE C C     1 
ATOM   7973  O  O     . ILE C  1 114 ? -2.193  68.069  51.953  1.00   21.70 ? 221 ILE C O     1 
ATOM   7974  C  CB    . ILE C  1 114 ? -1.201  67.849  48.987  1.00   20.52 ? 221 ILE C CB    1 
ATOM   7975  C  CG1   . ILE C  1 114 ? 0.270   67.492  49.161  1.00   21.26 ? 221 ILE C CG1   1 
ATOM   7976  C  CG2   . ILE C  1 114 ? -1.471  69.288  49.333  1.00   18.82 ? 221 ILE C CG2   1 
ATOM   7977  C  CD1   . ILE C  1 114 ? 0.657   66.203  48.496  1.00   19.69 ? 221 ILE C CD1   1 
ATOM   7978  N  N     . GLY C  1 115 ? -1.044  66.146  51.892  1.00   21.51 ? 222 GLY C N     1 
ATOM   7979  C  CA    . GLY C  1 115 ? -0.666  66.218  53.290  1.00   20.19 ? 222 GLY C CA    1 
ATOM   7980  C  C     . GLY C  1 115 ? 0.834   66.051  53.392  1.00   20.94 ? 222 GLY C C     1 
ATOM   7981  O  O     . GLY C  1 115 ? 1.507   65.795  52.399  1.00   21.54 ? 222 GLY C O     1 
ATOM   7982  N  N     . GLY C  1 116 ? 1.369   66.192  54.592  1.00   22.42 ? 223 GLY C N     1 
ATOM   7983  C  CA    . GLY C  1 116 ? 2.799   66.049  54.766  1.00   22.59 ? 223 GLY C CA    1 
ATOM   7984  C  C     . GLY C  1 116 ? 3.154   65.519  56.141  1.00   24.46 ? 223 GLY C C     1 
ATOM   7985  O  O     . GLY C  1 116 ? 2.526   65.881  57.141  1.00   27.56 ? 223 GLY C O     1 
ATOM   7986  N  N     . VAL C  1 117 ? 4.150   64.643  56.194  1.00   21.44 ? 224 VAL C N     1 
ATOM   7987  C  CA    . VAL C  1 117 ? 4.601   64.083  57.452  1.00   18.77 ? 224 VAL C CA    1 
ATOM   7988  C  C     . VAL C  1 117 ? 6.005   64.585  57.672  1.00   18.74 ? 224 VAL C C     1 
ATOM   7989  O  O     . VAL C  1 117 ? 6.909   64.274  56.903  1.00   20.60 ? 224 VAL C O     1 
ATOM   7990  C  CB    . VAL C  1 117 ? 4.630   62.532  57.419  1.00   19.52 ? 224 VAL C CB    1 
ATOM   7991  C  CG1   . VAL C  1 117 ? 5.283   61.980  58.675  1.00   15.70 ? 224 VAL C CG1   1 
ATOM   7992  C  CG2   . VAL C  1 117 ? 3.222   61.998  57.289  1.00   18.58 ? 224 VAL C CG2   1 
ATOM   7993  N  N     . ARG C  1 118 ? 6.184   65.389  58.707  1.00   18.75 ? 225 ARG C N     1 
ATOM   7994  C  CA    . ARG C  1 118 ? 7.501   65.905  59.033  1.00   17.83 ? 225 ARG C CA    1 
ATOM   7995  C  C     . ARG C  1 118 ? 8.232   64.776  59.761  1.00   18.47 ? 225 ARG C C     1 
ATOM   7996  O  O     . ARG C  1 118 ? 7.918   64.454  60.907  1.00   18.71 ? 225 ARG C O     1 
ATOM   7997  C  CB    . ARG C  1 118 ? 7.380   67.143  59.930  1.00   15.71 ? 225 ARG C CB    1 
ATOM   7998  C  CG    . ARG C  1 118 ? 8.703   67.735  60.320  1.00   12.96 ? 225 ARG C CG    1 
ATOM   7999  C  CD    . ARG C  1 118 ? 8.533   69.052  61.027  1.00   14.67 ? 225 ARG C CD    1 
ATOM   8000  N  NE    . ARG C  1 118 ? 9.835   69.586  61.410  1.00   19.81 ? 225 ARG C NE    1 
ATOM   8001  C  CZ    . ARG C  1 118 ? 10.282  69.635  62.660  1.00   19.71 ? 225 ARG C CZ    1 
ATOM   8002  N  NH1   . ARG C  1 118 ? 11.487  70.130  62.911  1.00   17.11 ? 225 ARG C NH1   1 
ATOM   8003  N  NH2   . ARG C  1 118 ? 9.513   69.215  63.657  1.00   16.95 ? 225 ARG C NH2   1 
ATOM   8004  N  N     . MET C  1 119 ? 9.189   64.152  59.084  1.00   20.16 ? 226 MET C N     1 
ATOM   8005  C  CA    . MET C  1 119 ? 9.936   63.069  59.701  1.00   19.54 ? 226 MET C CA    1 
ATOM   8006  C  C     . MET C  1 119 ? 11.411  62.972  59.337  1.00   19.03 ? 226 MET C C     1 
ATOM   8007  O  O     . MET C  1 119 ? 12.097  62.087  59.831  1.00   22.76 ? 226 MET C O     1 
ATOM   8008  C  CB    . MET C  1 119 ? 9.236   61.729  59.437  1.00   20.67 ? 226 MET C CB    1 
ATOM   8009  C  CG    . MET C  1 119 ? 8.792   61.481  57.996  1.00   19.36 ? 226 MET C CG    1 
ATOM   8010  S  SD    . MET C  1 119 ? 10.120  61.084  56.843  1.00   22.31 ? 226 MET C SD    1 
ATOM   8011  C  CE    . MET C  1 119 ? 10.502  59.392  57.297  1.00   17.98 ? 226 MET C CE    1 
ATOM   8012  N  N     . LEU C  1 120 ? 11.909  63.873  58.495  1.00   18.22 ? 227 LEU C N     1 
ATOM   8013  C  CA    . LEU C  1 120 ? 13.327  63.853  58.134  1.00   19.57 ? 227 LEU C CA    1 
ATOM   8014  C  C     . LEU C  1 120 ? 14.156  64.849  58.962  1.00   19.60 ? 227 LEU C C     1 
ATOM   8015  O  O     . LEU C  1 120 ? 15.389  64.744  59.033  1.00   18.00 ? 227 LEU C O     1 
ATOM   8016  C  CB    . LEU C  1 120 ? 13.509  64.162  56.643  1.00   19.50 ? 227 LEU C CB    1 
ATOM   8017  C  CG    . LEU C  1 120 ? 13.067  63.095  55.650  1.00   20.92 ? 227 LEU C CG    1 
ATOM   8018  C  CD1   . LEU C  1 120 ? 13.348  63.579  54.247  1.00   21.98 ? 227 LEU C CD1   1 
ATOM   8019  C  CD2   . LEU C  1 120 ? 13.804  61.789  55.927  1.00   19.61 ? 227 LEU C CD2   1 
ATOM   8020  N  N     . ASP C  1 121 ? 13.478  65.810  59.584  1.00   17.64 ? 228 ASP C N     1 
ATOM   8021  C  CA    . ASP C  1 121 ? 14.149  66.835  60.377  1.00   19.94 ? 228 ASP C CA    1 
ATOM   8022  C  C     . ASP C  1 121 ? 14.330  66.403  61.824  1.00   18.28 ? 228 ASP C C     1 
ATOM   8023  O  O     . ASP C  1 121 ? 13.669  66.907  62.721  1.00   17.57 ? 228 ASP C O     1 
ATOM   8024  C  CB    . ASP C  1 121 ? 13.345  68.138  60.310  1.00   22.83 ? 228 ASP C CB    1 
ATOM   8025  C  CG    . ASP C  1 121 ? 14.138  69.332  60.795  1.00   23.64 ? 228 ASP C CG    1 
ATOM   8026  O  OD1   . ASP C  1 121 ? 15.392  69.251  60.783  1.00   17.79 ? 228 ASP C OD1   1 
ATOM   8027  O  OD2   . ASP C  1 121 ? 13.507  70.348  61.169  1.00   25.20 ? 228 ASP C OD2   1 
ATOM   8028  N  N     . GLY C  1 122 ? 15.244  65.468  62.033  1.00   20.26 ? 229 GLY C N     1 
ATOM   8029  C  CA    . GLY C  1 122 ? 15.507  64.941  63.357  1.00   22.23 ? 229 GLY C CA    1 
ATOM   8030  C  C     . GLY C  1 122 ? 16.138  63.576  63.201  1.00   23.51 ? 229 GLY C C     1 
ATOM   8031  O  O     . GLY C  1 122 ? 16.588  63.230  62.109  1.00   23.68 ? 229 GLY C O     1 
ATOM   8032  N  N     . GLU C  1 123 ? 16.190  62.789  64.269  1.00   26.50 ? 230 GLU C N     1 
ATOM   8033  C  CA    . GLU C  1 123 ? 16.785  61.458  64.162  1.00   27.07 ? 230 GLU C CA    1 
ATOM   8034  C  C     . GLU C  1 123 ? 15.765  60.560  63.470  1.00   25.48 ? 230 GLU C C     1 
ATOM   8035  O  O     . GLU C  1 123 ? 14.658  60.363  63.971  1.00   25.86 ? 230 GLU C O     1 
ATOM   8036  C  CB    . GLU C  1 123 ? 17.132  60.896  65.551  1.00   29.13 ? 230 GLU C CB    1 
ATOM   8037  C  CG    . GLU C  1 123 ? 18.415  60.065  65.571  1.00   29.79 ? 230 GLU C CG    1 
ATOM   8038  C  CD    . GLU C  1 123 ? 18.467  59.079  66.718  0.0000 29.11 ? 230 GLU C CD    1 
ATOM   8039  O  OE1   . GLU C  1 123 ? 18.231  59.490  67.873  0.0000 29.09 ? 230 GLU C OE1   1 
ATOM   8040  O  OE2   . GLU C  1 123 ? 18.750  57.890  66.460  0.0000 29.09 ? 230 GLU C OE2   1 
ATOM   8041  N  N     . VAL C  1 124 ? 16.126  60.031  62.309  1.00   22.81 ? 231 VAL C N     1 
ATOM   8042  C  CA    . VAL C  1 124 ? 15.209  59.173  61.570  1.00   22.79 ? 231 VAL C CA    1 
ATOM   8043  C  C     . VAL C  1 124 ? 15.382  57.722  62.001  1.00   23.02 ? 231 VAL C C     1 
ATOM   8044  O  O     . VAL C  1 124 ? 16.177  56.985  61.419  1.00   21.19 ? 231 VAL C O     1 
ATOM   8045  C  CB    . VAL C  1 124 ? 15.456  59.273  60.050  1.00   22.71 ? 231 VAL C CB    1 
ATOM   8046  C  CG1   . VAL C  1 124 ? 14.421  58.454  59.309  1.00   22.55 ? 231 VAL C CG1   1 
ATOM   8047  C  CG2   . VAL C  1 124 ? 15.395  60.721  59.609  1.00   19.68 ? 231 VAL C CG2   1 
ATOM   8048  N  N     . THR C  1 125 ? 14.628  57.313  63.017  1.00   22.97 ? 232 THR C N     1 
ATOM   8049  C  CA    . THR C  1 125 ? 14.707  55.945  63.528  1.00   22.05 ? 232 THR C CA    1 
ATOM   8050  C  C     . THR C  1 125 ? 13.723  55.023  62.829  1.00   23.68 ? 232 THR C C     1 
ATOM   8051  O  O     . THR C  1 125 ? 12.906  55.466  62.025  1.00   27.54 ? 232 THR C O     1 
ATOM   8052  C  CB    . THR C  1 125 ? 14.371  55.906  65.004  1.00   20.61 ? 232 THR C CB    1 
ATOM   8053  O  OG1   . THR C  1 125 ? 12.993  56.269  65.172  1.00   22.33 ? 232 THR C OG1   1 
ATOM   8054  C  CG2   . THR C  1 125 ? 15.241  56.871  65.769  1.00   15.95 ? 232 THR C CG2   1 
ATOM   8055  N  N     . ASP C  1 126 ? 13.797  53.735  63.145  1.00   23.77 ? 233 ASP C N     1 
ATOM   8056  C  CA    . ASP C  1 126 ? 12.882  52.756  62.569  1.00   21.86 ? 233 ASP C CA    1 
ATOM   8057  C  C     . ASP C  1 126 ? 11.445  53.125  62.974  1.00   23.56 ? 233 ASP C C     1 
ATOM   8058  O  O     . ASP C  1 126 ? 10.531  53.107  62.145  1.00   25.38 ? 233 ASP C O     1 
ATOM   8059  C  CB    . ASP C  1 126 ? 13.251  51.354  63.071  1.00   19.70 ? 233 ASP C CB    1 
ATOM   8060  C  CG    . ASP C  1 126 ? 12.394  50.247  62.454  1.00   20.07 ? 233 ASP C CG    1 
ATOM   8061  O  OD1   . ASP C  1 126 ? 12.111  50.305  61.242  1.00   20.80 ? 233 ASP C OD1   1 
ATOM   8062  O  OD2   . ASP C  1 126 ? 12.020  49.295  63.178  1.00   21.68 ? 233 ASP C OD2   1 
ATOM   8063  N  N     . ALA C  1 127 ? 11.253  53.486  64.241  1.00   22.52 ? 234 ALA C N     1 
ATOM   8064  C  CA    . ALA C  1 127 ? 9.929   53.852  64.727  1.00   20.39 ? 234 ALA C CA    1 
ATOM   8065  C  C     . ALA C  1 127 ? 9.436   55.078  63.987  1.00   20.48 ? 234 ALA C C     1 
ATOM   8066  O  O     . ALA C  1 127 ? 8.248   55.191  63.677  1.00   19.05 ? 234 ALA C O     1 
ATOM   8067  C  CB    . ALA C  1 127 ? 9.964   54.119  66.224  1.00   19.69 ? 234 ALA C CB    1 
ATOM   8068  N  N     . VAL C  1 128 ? 10.351  56.000  63.703  1.00   21.51 ? 235 VAL C N     1 
ATOM   8069  C  CA    . VAL C  1 128 ? 9.981   57.220  62.985  1.00   22.00 ? 235 VAL C CA    1 
ATOM   8070  C  C     . VAL C  1 128 ? 9.452   56.852  61.607  1.00   21.12 ? 235 VAL C C     1 
ATOM   8071  O  O     . VAL C  1 128 ? 8.374   57.282  61.208  1.00   21.15 ? 235 VAL C O     1 
ATOM   8072  C  CB    . VAL C  1 128 ? 11.187  58.169  62.813  1.00   23.80 ? 235 VAL C CB    1 
ATOM   8073  C  CG1   . VAL C  1 128 ? 10.828  59.324  61.864  1.00   24.57 ? 235 VAL C CG1   1 
ATOM   8074  C  CG2   . VAL C  1 128 ? 11.614  58.696  64.155  1.00   21.59 ? 235 VAL C CG2   1 
ATOM   8075  N  N     . GLU C  1 129 ? 10.217  56.048  60.883  1.00   19.17 ? 236 GLU C N     1 
ATOM   8076  C  CA    . GLU C  1 129 ? 9.805   55.629  59.555  1.00   19.00 ? 236 GLU C CA    1 
ATOM   8077  C  C     . GLU C  1 129 ? 8.474   54.876  59.601  1.00   19.41 ? 236 GLU C C     1 
ATOM   8078  O  O     . GLU C  1 129 ? 7.570   55.130  58.800  1.00   19.45 ? 236 GLU C O     1 
ATOM   8079  C  CB    . GLU C  1 129 ? 10.884  54.744  58.935  1.00   17.39 ? 236 GLU C CB    1 
ATOM   8080  C  CG    . GLU C  1 129 ? 12.091  55.506  58.432  1.00   16.34 ? 236 GLU C CG    1 
ATOM   8081  C  CD    . GLU C  1 129 ? 13.213  54.587  57.993  1.00   18.83 ? 236 GLU C CD    1 
ATOM   8082  O  OE1   . GLU C  1 129 ? 12.932  53.395  57.737  1.00   16.45 ? 236 GLU C OE1   1 
ATOM   8083  O  OE2   . GLU C  1 129 ? 14.375  55.056  57.895  1.00   20.47 ? 236 GLU C OE2   1 
ATOM   8084  N  N     . ALA C  1 130 ? 8.354   53.954  60.550  1.00   18.38 ? 237 ALA C N     1 
ATOM   8085  C  CA    . ALA C  1 130 ? 7.143   53.149  60.678  1.00   17.04 ? 237 ALA C CA    1 
ATOM   8086  C  C     . ALA C  1 130 ? 5.886   53.969  60.908  1.00   16.10 ? 237 ALA C C     1 
ATOM   8087  O  O     . ALA C  1 130 ? 4.852   53.723  60.290  1.00   14.08 ? 237 ALA C O     1 
ATOM   8088  C  CB    . ALA C  1 130 ? 7.306   52.137  61.794  1.00   17.59 ? 237 ALA C CB    1 
ATOM   8089  N  N     . ARG C  1 131 ? 5.969   54.951  61.794  1.00   16.89 ? 238 ARG C N     1 
ATOM   8090  C  CA    . ARG C  1 131 ? 4.809   55.774  62.072  1.00   18.69 ? 238 ARG C CA    1 
ATOM   8091  C  C     . ARG C  1 131 ? 4.417   56.621  60.861  1.00   18.81 ? 238 ARG C C     1 
ATOM   8092  O  O     . ARG C  1 131 ? 3.240   56.891  60.639  1.00   19.30 ? 238 ARG C O     1 
ATOM   8093  C  CB    . ARG C  1 131 ? 5.078   56.652  63.292  1.00   19.91 ? 238 ARG C CB    1 
ATOM   8094  C  CG    . ARG C  1 131 ? 5.352   55.852  64.560  1.00   23.24 ? 238 ARG C CG    1 
ATOM   8095  C  CD    . ARG C  1 131 ? 5.404   56.759  65.765  1.00   26.07 ? 238 ARG C CD    1 
ATOM   8096  N  NE    . ARG C  1 131 ? 4.097   57.338  66.036  1.00   31.68 ? 238 ARG C NE    1 
ATOM   8097  C  CZ    . ARG C  1 131 ? 3.910   58.579  66.475  1.00   37.12 ? 238 ARG C CZ    1 
ATOM   8098  N  NH1   . ARG C  1 131 ? 2.674   59.016  66.697  1.00   38.53 ? 238 ARG C NH1   1 
ATOM   8099  N  NH2   . ARG C  1 131 ? 4.956   59.386  66.678  1.00   36.55 ? 238 ARG C NH2   1 
ATOM   8100  N  N     . SER C  1 132 ? 5.405   57.024  60.070  1.00   18.81 ? 239 SER C N     1 
ATOM   8101  C  CA    . SER C  1 132 ? 5.148   57.823  58.880  1.00   18.95 ? 239 SER C CA    1 
ATOM   8102  C  C     . SER C  1 132 ? 4.520   56.959  57.789  1.00   19.31 ? 239 SER C C     1 
ATOM   8103  O  O     . SER C  1 132 ? 3.470   57.297  57.242  1.00   20.02 ? 239 SER C O     1 
ATOM   8104  C  CB    . SER C  1 132 ? 6.449   58.432  58.369  1.00   18.58 ? 239 SER C CB    1 
ATOM   8105  O  OG    . SER C  1 132 ? 7.057   59.209  59.378  1.00   24.58 ? 239 SER C OG    1 
ATOM   8106  N  N     . LEU C  1 133 ? 5.158   55.835  57.483  1.00   19.15 ? 240 LEU C N     1 
ATOM   8107  C  CA    . LEU C  1 133 ? 4.654   54.927  56.456  1.00   17.62 ? 240 LEU C CA    1 
ATOM   8108  C  C     . LEU C  1 133 ? 3.284   54.369  56.815  1.00   18.75 ? 240 LEU C C     1 
ATOM   8109  O  O     . LEU C  1 133 ? 2.491   54.036  55.930  1.00   17.98 ? 240 LEU C O     1 
ATOM   8110  C  CB    . LEU C  1 133 ? 5.627   53.766  56.264  1.00   16.42 ? 240 LEU C CB    1 
ATOM   8111  C  CG    . LEU C  1 133 ? 6.967   54.019  55.568  1.00   14.97 ? 240 LEU C CG    1 
ATOM   8112  C  CD1   . LEU C  1 133 ? 7.861   52.802  55.689  1.00   15.16 ? 240 LEU C CD1   1 
ATOM   8113  C  CD2   . LEU C  1 133 ? 6.718   54.327  54.120  1.00   14.09 ? 240 LEU C CD2   1 
ATOM   8114  N  N     . GLY C  1 134 ? 3.010   54.271  58.114  1.00   18.25 ? 241 GLY C N     1 
ATOM   8115  C  CA    . GLY C  1 134 ? 1.738   53.729  58.545  1.00   19.59 ? 241 GLY C CA    1 
ATOM   8116  C  C     . GLY C  1 134 ? 0.715   54.743  59.014  1.00   22.19 ? 241 GLY C C     1 
ATOM   8117  O  O     . GLY C  1 134 ? -0.248  54.379  59.690  1.00   23.23 ? 241 GLY C O     1 
ATOM   8118  N  N     . LEU C  1 135 ? 0.906   56.009  58.659  1.00   22.52 ? 242 LEU C N     1 
ATOM   8119  C  CA    . LEU C  1 135 ? -0.019  57.058  59.075  1.00   22.79 ? 242 LEU C CA    1 
ATOM   8120  C  C     . LEU C  1 135 ? -1.333  56.987  58.316  1.00   23.77 ? 242 LEU C C     1 
ATOM   8121  O  O     . LEU C  1 135 ? -1.338  57.067  57.097  1.00   24.28 ? 242 LEU C O     1 
ATOM   8122  C  CB    . LEU C  1 135 ? 0.609   58.441  58.843  1.00   20.62 ? 242 LEU C CB    1 
ATOM   8123  C  CG    . LEU C  1 135 ? -0.272  59.677  59.111  1.00   17.93 ? 242 LEU C CG    1 
ATOM   8124  C  CD1   . LEU C  1 135 ? -0.495  59.798  60.590  1.00   14.40 ? 242 LEU C CD1   1 
ATOM   8125  C  CD2   . LEU C  1 135 ? 0.379   60.950  58.595  1.00   13.56 ? 242 LEU C CD2   1 
ATOM   8126  N  N     . ASN C  1 136 ? -2.440  56.846  59.039  1.00   27.18 ? 243 ASN C N     1 
ATOM   8127  C  CA    . ASN C  1 136 ? -3.775  56.808  58.431  1.00   30.07 ? 243 ASN C CA    1 
ATOM   8128  C  C     . ASN C  1 136 ? -3.911  55.985  57.174  1.00   29.94 ? 243 ASN C C     1 
ATOM   8129  O  O     . ASN C  1 136 ? -4.319  56.506  56.134  1.00   29.05 ? 243 ASN C O     1 
ATOM   8130  C  CB    . ASN C  1 136 ? -4.231  58.211  58.086  1.00   33.68 ? 243 ASN C CB    1 
ATOM   8131  C  CG    . ASN C  1 136 ? -4.836  58.908  59.245  1.00   39.50 ? 243 ASN C CG    1 
ATOM   8132  O  OD1   . ASN C  1 136 ? -4.126  59.402  60.128  1.00   39.96 ? 243 ASN C OD1   1 
ATOM   8133  N  ND2   . ASN C  1 136 ? -6.170  58.943  59.276  1.00   42.66 ? 243 ASN C ND2   1 
ATOM   8134  N  N     . PRO C  1 137 ? -3.607  54.689  57.251  1.00   28.90 ? 244 PRO C N     1 
ATOM   8135  C  CA    . PRO C  1 137 ? -3.702  53.814  56.082  1.00   28.13 ? 244 PRO C CA    1 
ATOM   8136  C  C     . PRO C  1 137 ? -5.066  53.834  55.392  1.00   26.85 ? 244 PRO C C     1 
ATOM   8137  O  O     . PRO C  1 137 ? -5.169  53.525  54.210  1.00   26.97 ? 244 PRO C O     1 
ATOM   8138  C  CB    . PRO C  1 137 ? -3.366  52.443  56.656  1.00   30.71 ? 244 PRO C CB    1 
ATOM   8139  C  CG    . PRO C  1 137 ? -2.483  52.772  57.827  1.00   30.12 ? 244 PRO C CG    1 
ATOM   8140  C  CD    . PRO C  1 137 ? -3.211  53.927  58.442  1.00   28.29 ? 244 PRO C CD    1 
ATOM   8141  N  N     . ASN C  1 138 ? -6.114  54.199  56.119  1.00   26.26 ? 245 ASN C N     1 
ATOM   8142  C  CA    . ASN C  1 138 ? -7.434  54.216  55.517  1.00   26.24 ? 245 ASN C CA    1 
ATOM   8143  C  C     . ASN C  1 138 ? -7.920  55.586  55.080  1.00   25.60 ? 245 ASN C C     1 
ATOM   8144  O  O     . ASN C  1 138 ? -9.056  55.737  54.620  1.00   26.19 ? 245 ASN C O     1 
ATOM   8145  C  CB    . ASN C  1 138 ? -8.442  53.566  56.455  1.00   29.72 ? 245 ASN C CB    1 
ATOM   8146  C  CG    . ASN C  1 138 ? -8.205  52.086  56.600  1.00   34.09 ? 245 ASN C CG    1 
ATOM   8147  O  OD1   . ASN C  1 138 ? -8.164  51.352  55.600  1.00   34.76 ? 245 ASN C OD1   1 
ATOM   8148  N  ND2   . ASN C  1 138 ? -8.032  51.630  57.841  1.00   34.39 ? 245 ASN C ND2   1 
ATOM   8149  N  N     . HIS C  1 139 ? -7.067  56.590  55.224  1.00   23.41 ? 246 HIS C N     1 
ATOM   8150  C  CA    . HIS C  1 139 ? -7.424  57.925  54.780  1.00   22.26 ? 246 HIS C CA    1 
ATOM   8151  C  C     . HIS C  1 139 ? -6.511  58.314  53.620  1.00   23.38 ? 246 HIS C C     1 
ATOM   8152  O  O     . HIS C  1 139 ? -6.973  58.800  52.593  1.00   25.22 ? 246 HIS C O     1 
ATOM   8153  C  CB    . HIS C  1 139 ? -7.276  58.947  55.899  1.00   20.31 ? 246 HIS C CB    1 
ATOM   8154  C  CG    . HIS C  1 139 ? -7.515  60.351  55.441  1.00   20.09 ? 246 HIS C CG    1 
ATOM   8155  N  ND1   . HIS C  1 139 ? -8.725  60.763  54.925  1.00   17.15 ? 246 HIS C ND1   1 
ATOM   8156  C  CD2   . HIS C  1 139 ? -6.681  61.415  55.350  1.00   19.08 ? 246 HIS C CD2   1 
ATOM   8157  C  CE1   . HIS C  1 139 ? -8.623  62.021  54.532  1.00   18.46 ? 246 HIS C CE1   1 
ATOM   8158  N  NE2   . HIS C  1 139 ? -7.394  62.440  54.777  1.00   20.18 ? 246 HIS C NE2   1 
ATOM   8159  N  N     . ILE C  1 140 ? -5.211  58.095  53.801  1.00   22.78 ? 247 ILE C N     1 
ATOM   8160  C  CA    . ILE C  1 140 ? -4.215  58.396  52.781  1.00   21.08 ? 247 ILE C CA    1 
ATOM   8161  C  C     . ILE C  1 140 ? -4.146  57.262  51.771  1.00   19.87 ? 247 ILE C C     1 
ATOM   8162  O  O     . ILE C  1 140 ? -4.045  56.099  52.160  1.00   19.79 ? 247 ILE C O     1 
ATOM   8163  C  CB    . ILE C  1 140 ? -2.818  58.551  53.409  1.00   22.77 ? 247 ILE C CB    1 
ATOM   8164  C  CG1   . ILE C  1 140 ? -2.797  59.764  54.338  1.00   22.32 ? 247 ILE C CG1   1 
ATOM   8165  C  CG2   . ILE C  1 140 ? -1.763  58.701  52.316  1.00   21.33 ? 247 ILE C CG2   1 
ATOM   8166  C  CD1   . ILE C  1 140 ? -1.510  59.891  55.153  1.00   18.61 ? 247 ILE C CD1   1 
ATOM   8167  N  N     . HIS C  1 141 ? -4.190  57.596  50.482  1.00   18.49 ? 248 HIS C N     1 
ATOM   8168  C  CA    . HIS C  1 141 ? -4.112  56.576  49.433  1.00   16.94 ? 248 HIS C CA    1 
ATOM   8169  C  C     . HIS C  1 141 ? -2.681  56.349  48.959  1.00   14.26 ? 248 HIS C C     1 
ATOM   8170  O  O     . HIS C  1 141 ? -2.242  55.218  48.803  1.00   13.36 ? 248 HIS C O     1 
ATOM   8171  C  CB    . HIS C  1 141 ? -4.936  56.969  48.205  1.00   18.68 ? 248 HIS C CB    1 
ATOM   8172  C  CG    . HIS C  1 141 ? -6.355  57.329  48.507  1.00   21.94 ? 248 HIS C CG    1 
ATOM   8173  N  ND1   . HIS C  1 141 ? -6.783  58.635  48.620  1.00   25.29 ? 248 HIS C ND1   1 
ATOM   8174  C  CD2   . HIS C  1 141 ? -7.448  56.558  48.704  1.00   23.80 ? 248 HIS C CD2   1 
ATOM   8175  C  CE1   . HIS C  1 141 ? -8.079  58.651  48.872  1.00   21.87 ? 248 HIS C CE1   1 
ATOM   8176  N  NE2   . HIS C  1 141 ? -8.507  57.404  48.928  1.00   22.21 ? 248 HIS C NE2   1 
ATOM   8177  N  N     . ILE C  1 142 ? -1.962  57.440  48.739  1.00   12.78 ? 249 ILE C N     1 
ATOM   8178  C  CA    . ILE C  1 142 ? -0.608  57.375  48.219  1.00   14.94 ? 249 ILE C CA    1 
ATOM   8179  C  C     . ILE C  1 142 ? 0.441   58.051  49.091  1.00   15.07 ? 249 ILE C C     1 
ATOM   8180  O  O     . ILE C  1 142 ? 0.255   59.176  49.550  1.00   18.88 ? 249 ILE C O     1 
ATOM   8181  C  CB    . ILE C  1 142 ? -0.573  58.018  46.808  1.00   15.11 ? 249 ILE C CB    1 
ATOM   8182  C  CG1   . ILE C  1 142 ? -1.495  57.224  45.875  1.00   15.33 ? 249 ILE C CG1   1 
ATOM   8183  C  CG2   . ILE C  1 142 ? 0.850   58.048  46.267  1.00   9.79  ? 249 ILE C CG2   1 
ATOM   8184  C  CD1   . ILE C  1 142 ? -2.165  58.059  44.781  1.00   14.86 ? 249 ILE C CD1   1 
ATOM   8185  N  N     . TYR C  1 143 ? 1.548   57.354  49.310  1.00   13.29 ? 250 TYR C N     1 
ATOM   8186  C  CA    . TYR C  1 143 ? 2.649   57.884  50.096  1.00   13.72 ? 250 TYR C CA    1 
ATOM   8187  C  C     . TYR C  1 143 ? 3.807   58.156  49.153  1.00   13.02 ? 250 TYR C C     1 
ATOM   8188  O  O     . TYR C  1 143 ? 4.115   57.330  48.294  1.00   13.58 ? 250 TYR C O     1 
ATOM   8189  C  CB    . TYR C  1 143 ? 3.101   56.871  51.143  1.00   14.14 ? 250 TYR C CB    1 
ATOM   8190  C  CG    . TYR C  1 143 ? 2.050   56.515  52.145  1.00   16.86 ? 250 TYR C CG    1 
ATOM   8191  C  CD1   . TYR C  1 143 ? 0.975   55.694  51.797  1.00   16.43 ? 250 TYR C CD1   1 
ATOM   8192  C  CD2   . TYR C  1 143 ? 2.126   56.999  53.454  1.00   15.07 ? 250 TYR C CD2   1 
ATOM   8193  C  CE1   . TYR C  1 143 ? 0.006   55.365  52.731  1.00   17.92 ? 250 TYR C CE1   1 
ATOM   8194  C  CE2   . TYR C  1 143 ? 1.160   56.674  54.394  1.00   16.09 ? 250 TYR C CE2   1 
ATOM   8195  C  CZ    . TYR C  1 143 ? 0.106   55.857  54.026  1.00   18.08 ? 250 TYR C CZ    1 
ATOM   8196  O  OH    . TYR C  1 143 ? -0.846  55.530  54.952  1.00   22.14 ? 250 TYR C OH    1 
ATOM   8197  N  N     . SER C  1 144 ? 4.457   59.301  49.317  1.00   11.55 ? 251 SER C N     1 
ATOM   8198  C  CA    . SER C  1 144 ? 5.579   59.655  48.454  1.00   14.44 ? 251 SER C CA    1 
ATOM   8199  C  C     . SER C  1 144 ? 6.829   59.893  49.290  1.00   15.03 ? 251 SER C C     1 
ATOM   8200  O  O     . SER C  1 144 ? 6.814   60.701  50.218  1.00   15.81 ? 251 SER C O     1 
ATOM   8201  C  CB    . SER C  1 144 ? 5.238   60.917  47.657  1.00   15.79 ? 251 SER C CB    1 
ATOM   8202  O  OG    . SER C  1 144 ? 6.218   61.186  46.682  1.00   18.09 ? 251 SER C OG    1 
ATOM   8203  N  N     . ALA C  1 145 ? 7.909   59.194  48.961  1.00   13.08 ? 252 ALA C N     1 
ATOM   8204  C  CA    . ALA C  1 145 ? 9.146   59.343  49.708  1.00   13.02 ? 252 ALA C CA    1 
ATOM   8205  C  C     . ALA C  1 145 ? 10.338  59.664  48.828  1.00   14.98 ? 252 ALA C C     1 
ATOM   8206  O  O     . ALA C  1 145 ? 10.791  58.823  48.050  1.00   16.65 ? 252 ALA C O     1 
ATOM   8207  C  CB    . ALA C  1 145 ? 9.427   58.073  50.510  1.00   9.83  ? 252 ALA C CB    1 
ATOM   8208  N  N     . SER C  1 146 ? 10.844  60.886  48.961  1.00   16.34 ? 253 SER C N     1 
ATOM   8209  C  CA    . SER C  1 146 ? 12.006  61.330  48.208  1.00   16.32 ? 253 SER C CA    1 
ATOM   8210  C  C     . SER C  1 146 ? 13.212  61.362  49.138  1.00   18.19 ? 253 SER C C     1 
ATOM   8211  O  O     . SER C  1 146 ? 13.897  62.386  49.255  1.00   18.15 ? 253 SER C O     1 
ATOM   8212  C  CB    . SER C  1 146 ? 11.772  62.727  47.626  1.00   16.34 ? 253 SER C CB    1 
ATOM   8213  O  OG    . SER C  1 146 ? 10.780  62.711  46.619  1.00   17.44 ? 253 SER C OG    1 
ATOM   8214  N  N     . TRP C  1 147 ? 13.461  60.234  49.803  1.00   18.45 ? 254 TRP C N     1 
ATOM   8215  C  CA    . TRP C  1 147 ? 14.589  60.093  50.729  1.00   18.90 ? 254 TRP C CA    1 
ATOM   8216  C  C     . TRP C  1 147 ? 14.977  58.619  50.842  1.00   18.86 ? 254 TRP C C     1 
ATOM   8217  O  O     . TRP C  1 147 ? 14.316  57.757  50.272  1.00   18.80 ? 254 TRP C O     1 
ATOM   8218  C  CB    . TRP C  1 147 ? 14.222  60.642  52.120  1.00   16.94 ? 254 TRP C CB    1 
ATOM   8219  C  CG    . TRP C  1 147 ? 12.931  60.093  52.676  1.00   15.87 ? 254 TRP C CG    1 
ATOM   8220  C  CD1   . TRP C  1 147 ? 11.690  60.629  52.526  1.00   15.29 ? 254 TRP C CD1   1 
ATOM   8221  C  CD2   . TRP C  1 147 ? 12.755  58.872  53.414  1.00   15.47 ? 254 TRP C CD2   1 
ATOM   8222  N  NE1   . TRP C  1 147 ? 10.748  59.822  53.119  1.00   18.22 ? 254 TRP C NE1   1 
ATOM   8223  C  CE2   . TRP C  1 147 ? 11.374  58.733  53.672  1.00   18.06 ? 254 TRP C CE2   1 
ATOM   8224  C  CE3   . TRP C  1 147 ? 13.629  57.879  53.879  1.00   14.31 ? 254 TRP C CE3   1 
ATOM   8225  C  CZ2   . TRP C  1 147 ? 10.840  57.638  54.376  1.00   16.46 ? 254 TRP C CZ2   1 
ATOM   8226  C  CZ3   . TRP C  1 147 ? 13.097  56.784  54.584  1.00   14.94 ? 254 TRP C CZ3   1 
ATOM   8227  C  CH2   . TRP C  1 147 ? 11.719  56.677  54.822  1.00   13.50 ? 254 TRP C CH2   1 
ATOM   8228  N  N     . GLY C  1 148 ? 16.047  58.336  51.573  1.00   16.85 ? 255 GLY C N     1 
ATOM   8229  C  CA    . GLY C  1 148 ? 16.476  56.964  51.729  1.00   17.13 ? 255 GLY C CA    1 
ATOM   8230  C  C     . GLY C  1 148 ? 17.903  56.866  52.227  1.00   18.90 ? 255 GLY C C     1 
ATOM   8231  O  O     . GLY C  1 148 ? 18.499  57.875  52.607  1.00   18.31 ? 255 GLY C O     1 
ATOM   8232  N  N     . PRO C  1 149 ? 18.477  55.654  52.250  1.00   19.95 ? 256 PRO C N     1 
ATOM   8233  C  CA    . PRO C  1 149 ? 19.848  55.435  52.705  1.00   20.51 ? 256 PRO C CA    1 
ATOM   8234  C  C     . PRO C  1 149 ? 20.827  56.331  51.962  1.00   22.21 ? 256 PRO C C     1 
ATOM   8235  O  O     . PRO C  1 149 ? 20.572  56.739  50.834  1.00   23.27 ? 256 PRO C O     1 
ATOM   8236  C  CB    . PRO C  1 149 ? 20.074  53.964  52.397  1.00   19.30 ? 256 PRO C CB    1 
ATOM   8237  C  CG    . PRO C  1 149 ? 18.715  53.381  52.623  1.00   19.15 ? 256 PRO C CG    1 
ATOM   8238  C  CD    . PRO C  1 149 ? 17.834  54.373  51.911  1.00   19.89 ? 256 PRO C CD    1 
ATOM   8239  N  N     . GLU C  1 150 ? 21.950  56.633  52.601  1.00   25.58 ? 257 GLU C N     1 
ATOM   8240  C  CA    . GLU C  1 150 ? 22.956  57.491  51.999  1.00   25.87 ? 257 GLU C CA    1 
ATOM   8241  C  C     . GLU C  1 150 ? 23.432  56.895  50.676  1.00   24.30 ? 257 GLU C C     1 
ATOM   8242  O  O     . GLU C  1 150 ? 23.576  55.678  50.561  1.00   22.94 ? 257 GLU C O     1 
ATOM   8243  C  CB    . GLU C  1 150 ? 24.119  57.651  52.971  1.00   29.40 ? 257 GLU C CB    1 
ATOM   8244  C  CG    . GLU C  1 150 ? 25.108  58.722  52.586  1.00   39.81 ? 257 GLU C CG    1 
ATOM   8245  C  CD    . GLU C  1 150 ? 26.138  58.989  53.674  1.00   43.65 ? 257 GLU C CD    1 
ATOM   8246  O  OE1   . GLU C  1 150 ? 27.087  59.756  53.407  1.00   48.48 ? 257 GLU C OE1   1 
ATOM   8247  O  OE2   . GLU C  1 150 ? 25.997  58.442  54.793  1.00   45.05 ? 257 GLU C OE2   1 
ATOM   8248  N  N     . ASP C  1 151 ? 23.659  57.750  49.677  1.00   22.19 ? 258 ASP C N     1 
ATOM   8249  C  CA    . ASP C  1 151 ? 24.123  57.290  48.367  1.00   23.04 ? 258 ASP C CA    1 
ATOM   8250  C  C     . ASP C  1 151 ? 25.650  57.348  48.205  1.00   24.17 ? 258 ASP C C     1 
ATOM   8251  O  O     . ASP C  1 151 ? 26.147  57.871  47.205  1.00   23.57 ? 258 ASP C O     1 
ATOM   8252  C  CB    . ASP C  1 151 ? 23.494  58.125  47.251  1.00   20.89 ? 258 ASP C CB    1 
ATOM   8253  C  CG    . ASP C  1 151 ? 21.987  58.016  47.204  1.00   21.42 ? 258 ASP C CG    1 
ATOM   8254  O  OD1   . ASP C  1 151 ? 21.450  56.891  47.305  1.00   20.68 ? 258 ASP C OD1   1 
ATOM   8255  O  OD2   . ASP C  1 151 ? 21.336  59.067  47.040  1.00   22.88 ? 258 ASP C OD2   1 
ATOM   8256  N  N     . ASP C  1 152 ? 26.396  56.810  49.168  1.00   25.06 ? 259 ASP C N     1 
ATOM   8257  C  CA    . ASP C  1 152 ? 27.849  56.856  49.080  1.00   25.77 ? 259 ASP C CA    1 
ATOM   8258  C  C     . ASP C  1 152 ? 28.383  55.801  48.119  1.00   26.32 ? 259 ASP C C     1 
ATOM   8259  O  O     . ASP C  1 152 ? 29.571  55.792  47.790  1.00   26.38 ? 259 ASP C O     1 
ATOM   8260  C  CB    . ASP C  1 152 ? 28.482  56.683  50.462  1.00   26.91 ? 259 ASP C CB    1 
ATOM   8261  C  CG    . ASP C  1 152 ? 28.026  55.422  51.161  1.00   31.12 ? 259 ASP C CG    1 
ATOM   8262  O  OD1   . ASP C  1 152 ? 27.459  54.521  50.498  1.00   30.51 ? 259 ASP C OD1   1 
ATOM   8263  O  OD2   . ASP C  1 152 ? 28.252  55.335  52.383  1.00   34.81 ? 259 ASP C OD2   1 
ATOM   8264  N  N     . GLY C  1 153 ? 27.502  54.917  47.663  1.00   25.48 ? 260 GLY C N     1 
ATOM   8265  C  CA    . GLY C  1 153 ? 27.925  53.888  46.735  1.00   24.12 ? 260 GLY C CA    1 
ATOM   8266  C  C     . GLY C  1 153 ? 28.714  52.779  47.398  1.00   24.14 ? 260 GLY C C     1 
ATOM   8267  O  O     . GLY C  1 153 ? 29.423  52.022  46.727  1.00   22.99 ? 260 GLY C O     1 
ATOM   8268  N  N     . LYS C  1 154 ? 28.597  52.673  48.717  1.00   23.66 ? 261 LYS C N     1 
ATOM   8269  C  CA    . LYS C  1 154 ? 29.309  51.629  49.428  1.00   22.61 ? 261 LYS C CA    1 
ATOM   8270  C  C     . LYS C  1 154 ? 28.487  51.014  50.541  1.00   23.07 ? 261 LYS C C     1 
ATOM   8271  O  O     . LYS C  1 154 ? 28.949  50.105  51.219  1.00   26.74 ? 261 LYS C O     1 
ATOM   8272  C  CB    . LYS C  1 154 ? 30.646  52.156  49.970  1.00   23.54 ? 261 LYS C CB    1 
ATOM   8273  C  CG    . LYS C  1 154 ? 30.582  53.355  50.917  1.00   23.64 ? 261 LYS C CG    1 
ATOM   8274  C  CD    . LYS C  1 154 ? 32.003  53.834  51.265  1.00   21.93 ? 261 LYS C CD    1 
ATOM   8275  C  CE    . LYS C  1 154 ? 31.995  54.943  52.305  1.00   24.35 ? 261 LYS C CE    1 
ATOM   8276  N  NZ    . LYS C  1 154 ? 33.354  55.326  52.763  0.0000 23.48 ? 261 LYS C NZ    1 
ATOM   8277  N  N     . THR C  1 155 ? 27.264  51.490  50.733  1.00   23.11 ? 262 THR C N     1 
ATOM   8278  C  CA    . THR C  1 155 ? 26.436  50.913  51.782  1.00   23.59 ? 262 THR C CA    1 
ATOM   8279  C  C     . THR C  1 155 ? 25.271  50.098  51.226  1.00   23.75 ? 262 THR C C     1 
ATOM   8280  O  O     . THR C  1 155 ? 24.793  50.330  50.109  1.00   24.15 ? 262 THR C O     1 
ATOM   8281  C  CB    . THR C  1 155 ? 25.862  51.994  52.763  1.00   24.95 ? 262 THR C CB    1 
ATOM   8282  O  OG1   . THR C  1 155 ? 24.908  52.829  52.092  1.00   18.57 ? 262 THR C OG1   1 
ATOM   8283  C  CG2   . THR C  1 155 ? 26.980  52.857  53.319  1.00   27.73 ? 262 THR C CG2   1 
ATOM   8284  N  N     . VAL C  1 156 ? 24.855  49.122  52.022  1.00   21.72 ? 263 VAL C N     1 
ATOM   8285  C  CA    . VAL C  1 156 ? 23.735  48.254  51.713  1.00   21.07 ? 263 VAL C CA    1 
ATOM   8286  C  C     . VAL C  1 156 ? 22.827  48.476  52.919  1.00   22.23 ? 263 VAL C C     1 
ATOM   8287  O  O     . VAL C  1 156 ? 23.177  48.131  54.052  1.00   22.03 ? 263 VAL C O     1 
ATOM   8288  C  CB    . VAL C  1 156 ? 24.154  46.774  51.657  1.00   19.44 ? 263 VAL C CB    1 
ATOM   8289  C  CG1   . VAL C  1 156 ? 22.937  45.910  51.379  1.00   20.50 ? 263 VAL C CG1   1 
ATOM   8290  C  CG2   . VAL C  1 156 ? 25.215  46.576  50.585  1.00   18.56 ? 263 VAL C CG2   1 
ATOM   8291  N  N     . ASP C  1 157 ? 21.667  49.072  52.688  1.00   22.05 ? 264 ASP C N     1 
ATOM   8292  C  CA    . ASP C  1 157 ? 20.776  49.376  53.790  1.00   20.86 ? 264 ASP C CA    1 
ATOM   8293  C  C     . ASP C  1 157 ? 19.319  49.363  53.347  1.00   20.72 ? 264 ASP C C     1 
ATOM   8294  O  O     . ASP C  1 157 ? 19.011  49.653  52.202  1.00   22.30 ? 264 ASP C O     1 
ATOM   8295  C  CB    . ASP C  1 157 ? 21.173  50.747  54.345  1.00   20.89 ? 264 ASP C CB    1 
ATOM   8296  C  CG    . ASP C  1 157 ? 20.512  51.077  55.664  1.00   23.98 ? 264 ASP C CG    1 
ATOM   8297  O  OD1   . ASP C  1 157 ? 19.921  50.174  56.289  1.00   28.85 ? 264 ASP C OD1   1 
ATOM   8298  O  OD2   . ASP C  1 157 ? 20.600  52.252  56.083  1.00   24.69 ? 264 ASP C OD2   1 
ATOM   8299  N  N     . GLY C  1 158 ? 18.431  49.009  54.266  1.00   22.23 ? 265 GLY C N     1 
ATOM   8300  C  CA    . GLY C  1 158 ? 17.013  48.966  53.966  1.00   21.70 ? 265 GLY C CA    1 
ATOM   8301  C  C     . GLY C  1 158 ? 16.192  49.199  55.222  1.00   20.30 ? 265 GLY C C     1 
ATOM   8302  O  O     . GLY C  1 158 ? 16.754  49.480  56.281  1.00   21.54 ? 265 GLY C O     1 
ATOM   8303  N  N     . PRO C  1 159 ? 14.862  49.091  55.143  1.00   18.55 ? 266 PRO C N     1 
ATOM   8304  C  CA    . PRO C  1 159 ? 14.012  49.304  56.316  1.00   18.25 ? 266 PRO C CA    1 
ATOM   8305  C  C     . PRO C  1 159 ? 14.236  48.272  57.412  1.00   18.72 ? 266 PRO C C     1 
ATOM   8306  O  O     . PRO C  1 159 ? 14.563  47.119  57.131  1.00   19.37 ? 266 PRO C O     1 
ATOM   8307  C  CB    . PRO C  1 159 ? 12.604  49.218  55.733  1.00   19.04 ? 266 PRO C CB    1 
ATOM   8308  C  CG    . PRO C  1 159 ? 12.770  48.244  54.592  1.00   16.11 ? 266 PRO C CG    1 
ATOM   8309  C  CD    . PRO C  1 159 ? 14.057  48.732  53.962  1.00   16.89 ? 266 PRO C CD    1 
ATOM   8310  N  N     . ALA C  1 160 ? 14.066  48.695  58.661  1.00   18.35 ? 267 ALA C N     1 
ATOM   8311  C  CA    . ALA C  1 160 ? 14.214  47.798  59.796  1.00   17.96 ? 267 ALA C CA    1 
ATOM   8312  C  C     . ALA C  1 160 ? 12.855  47.136  60.055  1.00   20.19 ? 267 ALA C C     1 
ATOM   8313  O  O     . ALA C  1 160 ? 11.881  47.403  59.339  1.00   19.81 ? 267 ALA C O     1 
ATOM   8314  C  CB    . ALA C  1 160 ? 14.668  48.570  61.008  1.00   14.10 ? 267 ALA C CB    1 
ATOM   8315  N  N     . ARG C  1 161 ? 12.785  46.289  61.077  1.00   21.27 ? 268 ARG C N     1 
ATOM   8316  C  CA    . ARG C  1 161 ? 11.555  45.564  61.400  1.00   22.78 ? 268 ARG C CA    1 
ATOM   8317  C  C     . ARG C  1 161 ? 10.247  46.353  61.369  1.00   23.98 ? 268 ARG C C     1 
ATOM   8318  O  O     . ARG C  1 161 ? 9.339   46.006  60.619  1.00   24.83 ? 268 ARG C O     1 
ATOM   8319  C  CB    . ARG C  1 161 ? 11.686  44.888  62.762  1.00   25.72 ? 268 ARG C CB    1 
ATOM   8320  C  CG    . ARG C  1 161 ? 11.949  43.397  62.699  1.00   28.36 ? 268 ARG C CG    1 
ATOM   8321  C  CD    . ARG C  1 161 ? 13.345  43.078  62.208  0.0000 26.48 ? 268 ARG C CD    1 
ATOM   8322  N  NE    . ARG C  1 161 ? 13.673  41.677  62.448  0.0000 26.16 ? 268 ARG C NE    1 
ATOM   8323  C  CZ    . ARG C  1 161 ? 14.797  41.091  62.054  0.0000 25.76 ? 268 ARG C CZ    1 
ATOM   8324  N  NH1   . ARG C  1 161 ? 15.714  41.783  61.393  0.0000 25.61 ? 268 ARG C NH1   1 
ATOM   8325  N  NH2   . ARG C  1 161 ? 15.006  39.810  62.327  0.0000 25.61 ? 268 ARG C NH2   1 
ATOM   8326  N  N     . LEU C  1 162 ? 10.137  47.399  62.185  1.00   23.18 ? 269 LEU C N     1 
ATOM   8327  C  CA    . LEU C  1 162 ? 8.908   48.188  62.222  1.00   22.47 ? 269 LEU C CA    1 
ATOM   8328  C  C     . LEU C  1 162 ? 8.530   48.748  60.854  1.00   23.49 ? 269 LEU C C     1 
ATOM   8329  O  O     . LEU C  1 162 ? 7.375   48.679  60.447  1.00   24.01 ? 269 LEU C O     1 
ATOM   8330  C  CB    . LEU C  1 162 ? 9.042   49.321  63.243  1.00   20.96 ? 269 LEU C CB    1 
ATOM   8331  C  CG    . LEU C  1 162 ? 9.114   48.830  64.691  1.00   19.61 ? 269 LEU C CG    1 
ATOM   8332  C  CD1   . LEU C  1 162 ? 9.334   50.026  65.596  1.00   19.12 ? 269 LEU C CD1   1 
ATOM   8333  C  CD2   . LEU C  1 162 ? 7.831   48.063  65.061  1.00   15.81 ? 269 LEU C CD2   1 
ATOM   8334  N  N     . ALA C  1 163 ? 9.504   49.303  60.142  1.00   26.16 ? 270 ALA C N     1 
ATOM   8335  C  CA    . ALA C  1 163 ? 9.243   49.858  58.818  1.00   25.11 ? 270 ALA C CA    1 
ATOM   8336  C  C     . ALA C  1 163 ? 8.737   48.771  57.868  1.00   25.12 ? 270 ALA C C     1 
ATOM   8337  O  O     . ALA C  1 163 ? 7.797   49.007  57.109  1.00   25.94 ? 270 ALA C O     1 
ATOM   8338  C  CB    . ALA C  1 163 ? 10.503  50.500  58.265  1.00   27.27 ? 270 ALA C CB    1 
ATOM   8339  N  N     . GLU C  1 164 ? 9.355   47.588  57.894  1.00   23.58 ? 271 GLU C N     1 
ATOM   8340  C  CA    . GLU C  1 164 ? 8.905   46.497  57.029  1.00   23.25 ? 271 GLU C CA    1 
ATOM   8341  C  C     . GLU C  1 164 ? 7.479   46.131  57.394  1.00   22.72 ? 271 GLU C C     1 
ATOM   8342  O  O     . GLU C  1 164 ? 6.633   45.962  56.521  1.00   22.83 ? 271 GLU C O     1 
ATOM   8343  C  CB    . GLU C  1 164 ? 9.776   45.253  57.184  1.00   25.16 ? 271 GLU C CB    1 
ATOM   8344  C  CG    . GLU C  1 164 ? 11.191  45.423  56.672  1.00   31.51 ? 271 GLU C CG    1 
ATOM   8345  C  CD    . GLU C  1 164 ? 11.966  44.116  56.652  1.00   33.87 ? 271 GLU C CD    1 
ATOM   8346  O  OE1   . GLU C  1 164 ? 11.879  43.375  55.641  1.00   33.80 ? 271 GLU C OE1   1 
ATOM   8347  O  OE2   . GLU C  1 164 ? 12.652  43.823  57.657  1.00   36.67 ? 271 GLU C OE2   1 
ATOM   8348  N  N     . GLU C  1 165 ? 7.214   46.001  58.689  1.00   21.70 ? 272 GLU C N     1 
ATOM   8349  C  CA    . GLU C  1 165 ? 5.876   45.664  59.140  1.00   22.82 ? 272 GLU C CA    1 
ATOM   8350  C  C     . GLU C  1 165 ? 4.888   46.730  58.686  1.00   23.26 ? 272 GLU C C     1 
ATOM   8351  O  O     . GLU C  1 165 ? 3.728   46.423  58.402  1.00   24.72 ? 272 GLU C O     1 
ATOM   8352  C  CB    . GLU C  1 165 ? 5.852   45.500  60.659  1.00   23.47 ? 272 GLU C CB    1 
ATOM   8353  C  CG    . GLU C  1 165 ? 6.486   44.190  61.089  1.00   25.42 ? 272 GLU C CG    1 
ATOM   8354  C  CD    . GLU C  1 165 ? 6.601   44.048  62.584  1.00   27.10 ? 272 GLU C CD    1 
ATOM   8355  O  OE1   . GLU C  1 165 ? 6.966   42.945  63.039  1.00   28.55 ? 272 GLU C OE1   1 
ATOM   8356  O  OE2   . GLU C  1 165 ? 6.332   45.039  63.298  1.00   30.60 ? 272 GLU C OE2   1 
ATOM   8357  N  N     . ALA C  1 166 ? 5.352   47.975  58.596  1.00   20.33 ? 273 ALA C N     1 
ATOM   8358  C  CA    . ALA C  1 166 ? 4.492   49.068  58.156  1.00   19.46 ? 273 ALA C CA    1 
ATOM   8359  C  C     . ALA C  1 166 ? 4.190   48.903  56.668  1.00   18.42 ? 273 ALA C C     1 
ATOM   8360  O  O     . ALA C  1 166 ? 3.052   49.090  56.233  1.00   18.25 ? 273 ALA C O     1 
ATOM   8361  C  CB    . ALA C  1 166 ? 5.162   50.415  58.424  1.00   19.01 ? 273 ALA C CB    1 
ATOM   8362  N  N     . PHE C  1 167 ? 5.208   48.550  55.890  1.00   15.78 ? 274 PHE C N     1 
ATOM   8363  C  CA    . PHE C  1 167 ? 5.023   48.335  54.457  1.00   17.39 ? 274 PHE C CA    1 
ATOM   8364  C  C     . PHE C  1 167 ? 4.032   47.201  54.240  1.00   19.98 ? 274 PHE C C     1 
ATOM   8365  O  O     . PHE C  1 167 ? 3.119   47.307  53.417  1.00   23.20 ? 274 PHE C O     1 
ATOM   8366  C  CB    . PHE C  1 167 ? 6.339   47.933  53.789  1.00   17.29 ? 274 PHE C CB    1 
ATOM   8367  C  CG    . PHE C  1 167 ? 7.194   49.083  53.373  1.00   17.29 ? 274 PHE C CG    1 
ATOM   8368  C  CD1   . PHE C  1 167 ? 6.688   50.074  52.535  1.00   16.16 ? 274 PHE C CD1   1 
ATOM   8369  C  CD2   . PHE C  1 167 ? 8.521   49.164  53.788  1.00   17.31 ? 274 PHE C CD2   1 
ATOM   8370  C  CE1   . PHE C  1 167 ? 7.491   51.137  52.106  1.00   16.97 ? 274 PHE C CE1   1 
ATOM   8371  C  CE2   . PHE C  1 167 ? 9.340   50.223  53.369  1.00   16.16 ? 274 PHE C CE2   1 
ATOM   8372  C  CZ    . PHE C  1 167 ? 8.822   51.215  52.522  1.00   16.72 ? 274 PHE C CZ    1 
ATOM   8373  N  N     . PHE C  1 168 ? 4.223   46.109  54.977  1.00   20.23 ? 275 PHE C N     1 
ATOM   8374  C  CA    . PHE C  1 168 ? 3.364   44.947  54.835  1.00   21.11 ? 275 PHE C CA    1 
ATOM   8375  C  C     . PHE C  1 168 ? 1.922   45.202  55.259  1.00   20.01 ? 275 PHE C C     1 
ATOM   8376  O  O     . PHE C  1 168 ? 0.985   44.785  54.565  1.00   16.52 ? 275 PHE C O     1 
ATOM   8377  C  CB    . PHE C  1 168 ? 3.943   43.769  55.615  1.00   25.50 ? 275 PHE C CB    1 
ATOM   8378  C  CG    . PHE C  1 168 ? 3.614   42.434  55.016  1.00   32.74 ? 275 PHE C CG    1 
ATOM   8379  C  CD1   . PHE C  1 168 ? 2.292   42.058  54.805  1.00   37.09 ? 275 PHE C CD1   1 
ATOM   8380  C  CD2   . PHE C  1 168 ? 4.624   41.552  54.653  1.00   35.75 ? 275 PHE C CD2   1 
ATOM   8381  C  CE1   . PHE C  1 168 ? 1.979   40.824  54.240  1.00   38.13 ? 275 PHE C CE1   1 
ATOM   8382  C  CE2   . PHE C  1 168 ? 4.318   40.319  54.089  1.00   35.75 ? 275 PHE C CE2   1 
ATOM   8383  C  CZ    . PHE C  1 168 ? 2.994   39.958  53.882  1.00   36.33 ? 275 PHE C CZ    1 
ATOM   8384  N  N     . ARG C  1 169 ? 1.734   45.879  56.391  1.00   19.02 ? 276 ARG C N     1 
ATOM   8385  C  CA    . ARG C  1 169 ? 0.380   46.169  56.851  1.00   19.66 ? 276 ARG C CA    1 
ATOM   8386  C  C     . ARG C  1 169 ? -0.260  47.071  55.808  1.00   21.31 ? 276 ARG C C     1 
ATOM   8387  O  O     . ARG C  1 169 ? -1.444  46.919  55.490  1.00   21.95 ? 276 ARG C O     1 
ATOM   8388  C  CB    . ARG C  1 169 ? 0.404   46.863  58.217  1.00   20.40 ? 276 ARG C CB    1 
ATOM   8389  C  CG    . ARG C  1 169 ? 1.006   46.024  59.332  1.00   19.87 ? 276 ARG C CG    1 
ATOM   8390  C  CD    . ARG C  1 169 ? 1.113   46.807  60.622  1.00   19.24 ? 276 ARG C CD    1 
ATOM   8391  N  NE    . ARG C  1 169 ? -0.197  47.098  61.202  1.00   23.41 ? 276 ARG C NE    1 
ATOM   8392  C  CZ    . ARG C  1 169 ? -0.889  46.251  61.964  1.00   24.27 ? 276 ARG C CZ    1 
ATOM   8393  N  NH1   . ARG C  1 169 ? -2.069  46.602  62.451  1.00   23.58 ? 276 ARG C NH1   1 
ATOM   8394  N  NH2   . ARG C  1 169 ? -0.402  45.052  62.254  1.00   25.05 ? 276 ARG C NH2   1 
ATOM   8395  N  N     . GLY C  1 170 ? 0.544   47.990  55.265  1.00   20.06 ? 277 GLY C N     1 
ATOM   8396  C  CA    . GLY C  1 170 ? 0.063   48.923  54.256  1.00   18.41 ? 277 GLY C CA    1 
ATOM   8397  C  C     . GLY C  1 170 ? -0.504  48.294  52.992  1.00   20.00 ? 277 GLY C C     1 
ATOM   8398  O  O     . GLY C  1 170 ? -1.615  48.624  52.572  1.00   20.34 ? 277 GLY C O     1 
ATOM   8399  N  N     . VAL C  1 171 ? 0.246   47.391  52.369  1.00   18.65 ? 278 VAL C N     1 
ATOM   8400  C  CA    . VAL C  1 171 ? -0.241  46.765  51.149  1.00   18.41 ? 278 VAL C CA    1 
ATOM   8401  C  C     . VAL C  1 171 ? -1.324  45.735  51.423  1.00   19.07 ? 278 VAL C C     1 
ATOM   8402  O  O     . VAL C  1 171 ? -2.076  45.374  50.526  1.00   18.78 ? 278 VAL C O     1 
ATOM   8403  C  CB    . VAL C  1 171 ? 0.896   46.089  50.355  1.00   18.40 ? 278 VAL C CB    1 
ATOM   8404  C  CG1   . VAL C  1 171 ? 1.892   47.131  49.899  1.00   16.00 ? 278 VAL C CG1   1 
ATOM   8405  C  CG2   . VAL C  1 171 ? 1.565   45.018  51.201  1.00   19.26 ? 278 VAL C CG2   1 
ATOM   8406  N  N     . SER C  1 172 ? -1.409  45.273  52.667  1.00   20.70 ? 279 SER C N     1 
ATOM   8407  C  CA    . SER C  1 172 ? -2.408  44.282  53.056  1.00   21.13 ? 279 SER C CA    1 
ATOM   8408  C  C     . SER C  1 172 ? -3.710  44.899  53.490  1.00   22.06 ? 279 SER C C     1 
ATOM   8409  O  O     . SER C  1 172 ? -4.771  44.510  53.013  1.00   24.55 ? 279 SER C O     1 
ATOM   8410  C  CB    . SER C  1 172 ? -1.901  43.428  54.215  1.00   22.07 ? 279 SER C CB    1 
ATOM   8411  O  OG    . SER C  1 172 ? -0.686  42.793  53.877  1.00   29.94 ? 279 SER C OG    1 
ATOM   8412  N  N     . GLN C  1 173 ? -3.620  45.867  54.396  1.00   24.14 ? 280 GLN C N     1 
ATOM   8413  C  CA    . GLN C  1 173 ? -4.793  46.509  54.956  1.00   24.73 ? 280 GLN C CA    1 
ATOM   8414  C  C     . GLN C  1 173 ? -5.092  47.937  54.525  1.00   23.95 ? 280 GLN C C     1 
ATOM   8415  O  O     . GLN C  1 173 ? -6.226  48.388  54.648  1.00   26.29 ? 280 GLN C O     1 
ATOM   8416  C  CB    . GLN C  1 173 ? -4.694  46.439  56.482  1.00   26.55 ? 280 GLN C CB    1 
ATOM   8417  C  CG    . GLN C  1 173 ? -4.777  45.022  57.019  1.00   31.02 ? 280 GLN C CG    1 
ATOM   8418  C  CD    . GLN C  1 173 ? -3.725  44.697  58.068  1.00   35.89 ? 280 GLN C CD    1 
ATOM   8419  O  OE1   . GLN C  1 173 ? -3.537  45.445  59.030  1.00   35.00 ? 280 GLN C OE1   1 
ATOM   8420  N  NE2   . GLN C  1 173 ? -3.042  43.557  57.894  1.00   39.15 ? 280 GLN C NE2   1 
ATOM   8421  N  N     . GLY C  1 174 ? -4.091  48.654  54.031  1.00   24.15 ? 281 GLY C N     1 
ATOM   8422  C  CA    . GLY C  1 174 ? -4.322  50.032  53.617  1.00   22.52 ? 281 GLY C CA    1 
ATOM   8423  C  C     . GLY C  1 174 ? -5.435  50.173  52.594  1.00   20.84 ? 281 GLY C C     1 
ATOM   8424  O  O     . GLY C  1 174 ? -5.780  49.212  51.909  1.00   20.30 ? 281 GLY C O     1 
ATOM   8425  N  N     . ARG C  1 175 ? -5.994  51.371  52.478  1.00   20.82 ? 282 ARG C N     1 
ATOM   8426  C  CA    . ARG C  1 175 ? -7.070  51.613  51.524  1.00   21.44 ? 282 ARG C CA    1 
ATOM   8427  C  C     . ARG C  1 175 ? -8.116  50.508  51.553  1.00   21.07 ? 282 ARG C C     1 
ATOM   8428  O  O     . ARG C  1 175 ? -8.510  49.973  50.508  1.00   20.61 ? 282 ARG C O     1 
ATOM   8429  C  CB    . ARG C  1 175 ? -6.507  51.735  50.108  1.00   24.47 ? 282 ARG C CB    1 
ATOM   8430  C  CG    . ARG C  1 175 ? -5.751  53.024  49.849  1.00   26.87 ? 282 ARG C CG    1 
ATOM   8431  C  CD    . ARG C  1 175 ? -5.044  52.928  48.522  1.00   27.26 ? 282 ARG C CD    1 
ATOM   8432  N  NE    . ARG C  1 175 ? -5.980  52.607  47.457  1.00   27.92 ? 282 ARG C NE    1 
ATOM   8433  C  CZ    . ARG C  1 175 ? -5.713  51.781  46.454  1.00   28.37 ? 282 ARG C CZ    1 
ATOM   8434  N  NH1   . ARG C  1 175 ? -4.533  51.180  46.374  1.00   25.19 ? 282 ARG C NH1   1 
ATOM   8435  N  NH2   . ARG C  1 175 ? -6.627  51.572  45.522  1.00   31.16 ? 282 ARG C NH2   1 
ATOM   8436  N  N     . GLY C  1 176 ? -8.554  50.160  52.759  1.00   19.90 ? 283 GLY C N     1 
ATOM   8437  C  CA    . GLY C  1 176 ? -9.560  49.127  52.904  1.00   18.81 ? 283 GLY C CA    1 
ATOM   8438  C  C     . GLY C  1 176 ? -9.236  47.812  52.225  1.00   18.95 ? 283 GLY C C     1 
ATOM   8439  O  O     . GLY C  1 176 ? -10.116 47.180  51.654  1.00   20.63 ? 283 GLY C O     1 
ATOM   8440  N  N     . GLY C  1 177 ? -7.976  47.396  52.272  1.00   18.49 ? 284 GLY C N     1 
ATOM   8441  C  CA    . GLY C  1 177 ? -7.610  46.127  51.666  1.00   18.19 ? 284 GLY C CA    1 
ATOM   8442  C  C     . GLY C  1 177 ? -6.971  46.180  50.292  1.00   19.59 ? 284 GLY C C     1 
ATOM   8443  O  O     . GLY C  1 177 ? -6.292  45.238  49.883  1.00   20.49 ? 284 GLY C O     1 
ATOM   8444  N  N     . LEU C  1 178 ? -7.186  47.267  49.563  1.00   20.15 ? 285 LEU C N     1 
ATOM   8445  C  CA    . LEU C  1 178 ? -6.602  47.391  48.234  1.00   17.36 ? 285 LEU C CA    1 
ATOM   8446  C  C     . LEU C  1 178 ? -5.085  47.609  48.330  1.00   18.97 ? 285 LEU C C     1 
ATOM   8447  O  O     . LEU C  1 178 ? -4.343  47.308  47.392  1.00   17.40 ? 285 LEU C O     1 
ATOM   8448  C  CB    . LEU C  1 178 ? -7.271  48.548  47.493  1.00   18.04 ? 285 LEU C CB    1 
ATOM   8449  C  CG    . LEU C  1 178 ? -8.793  48.403  47.346  1.00   18.38 ? 285 LEU C CG    1 
ATOM   8450  C  CD1   . LEU C  1 178 ? -9.394  49.645  46.682  1.00   16.79 ? 285 LEU C CD1   1 
ATOM   8451  C  CD2   . LEU C  1 178 ? -9.102  47.161  46.523  1.00   16.85 ? 285 LEU C CD2   1 
ATOM   8452  N  N     . GLY C  1 179 ? -4.630  48.133  49.469  1.00   18.78 ? 286 GLY C N     1 
ATOM   8453  C  CA    . GLY C  1 179 ? -3.209  48.368  49.669  1.00   18.65 ? 286 GLY C CA    1 
ATOM   8454  C  C     . GLY C  1 179 ? -2.713  49.788  49.431  1.00   18.55 ? 286 GLY C C     1 
ATOM   8455  O  O     . GLY C  1 179 ? -3.039  50.424  48.435  1.00   19.15 ? 286 GLY C O     1 
ATOM   8456  N  N     . SER C  1 180 ? -1.907  50.285  50.358  1.00   17.56 ? 287 SER C N     1 
ATOM   8457  C  CA    . SER C  1 180 ? -1.338  51.620  50.244  1.00   16.47 ? 287 SER C CA    1 
ATOM   8458  C  C     . SER C  1 180 ? -0.385  51.662  49.048  1.00   16.49 ? 287 SER C C     1 
ATOM   8459  O  O     . SER C  1 180 ? 0.286   50.673  48.762  1.00   18.86 ? 287 SER C O     1 
ATOM   8460  C  CB    . SER C  1 180 ? -0.552  51.961  51.517  1.00   15.12 ? 287 SER C CB    1 
ATOM   8461  O  OG    . SER C  1 180 ? -1.378  51.911  52.670  1.00   13.52 ? 287 SER C OG    1 
ATOM   8462  N  N     . ILE C  1 181 ? -0.333  52.792  48.348  1.00   13.68 ? 288 ILE C N     1 
ATOM   8463  C  CA    . ILE C  1 181 ? 0.585   52.930  47.226  1.00   15.97 ? 288 ILE C CA    1 
ATOM   8464  C  C     . ILE C  1 181 ? 1.825   53.678  47.734  1.00   17.60 ? 288 ILE C C     1 
ATOM   8465  O  O     . ILE C  1 181 ? 1.726   54.822  48.183  1.00   18.42 ? 288 ILE C O     1 
ATOM   8466  C  CB    . ILE C  1 181 ? -0.022  53.745  46.067  1.00   16.42 ? 288 ILE C CB    1 
ATOM   8467  C  CG1   . ILE C  1 181 ? -1.397  53.182  45.674  1.00   14.71 ? 288 ILE C CG1   1 
ATOM   8468  C  CG2   . ILE C  1 181 ? 0.924   53.687  44.869  1.00   12.40 ? 288 ILE C CG2   1 
ATOM   8469  C  CD1   . ILE C  1 181 ? -1.333  51.839  45.033  1.00   13.40 ? 288 ILE C CD1   1 
ATOM   8470  N  N     . PHE C  1 182 ? 2.986   53.028  47.676  1.00   16.47 ? 289 PHE C N     1 
ATOM   8471  C  CA    . PHE C  1 182 ? 4.242   53.629  48.137  1.00   17.26 ? 289 PHE C CA    1 
ATOM   8472  C  C     . PHE C  1 182 ? 5.151   53.973  46.959  1.00   18.59 ? 289 PHE C C     1 
ATOM   8473  O  O     . PHE C  1 182 ? 5.703   53.082  46.309  1.00   18.55 ? 289 PHE C O     1 
ATOM   8474  C  CB    . PHE C  1 182 ? 4.993   52.666  49.076  1.00   14.71 ? 289 PHE C CB    1 
ATOM   8475  C  CG    . PHE C  1 182 ? 4.261   52.359  50.354  1.00   15.31 ? 289 PHE C CG    1 
ATOM   8476  C  CD1   . PHE C  1 182 ? 4.033   53.353  51.302  1.00   15.38 ? 289 PHE C CD1   1 
ATOM   8477  C  CD2   . PHE C  1 182 ? 3.803   51.069  50.616  1.00   12.86 ? 289 PHE C CD2   1 
ATOM   8478  C  CE1   . PHE C  1 182 ? 3.361   53.062  52.497  1.00   16.53 ? 289 PHE C CE1   1 
ATOM   8479  C  CE2   . PHE C  1 182 ? 3.134   50.773  51.798  1.00   12.95 ? 289 PHE C CE2   1 
ATOM   8480  C  CZ    . PHE C  1 182 ? 2.912   51.769  52.743  1.00   14.12 ? 289 PHE C CZ    1 
ATOM   8481  N  N     . VAL C  1 183 ? 5.300   55.267  46.693  1.00   18.02 ? 290 VAL C N     1 
ATOM   8482  C  CA    . VAL C  1 183 ? 6.151   55.739  45.599  1.00   20.32 ? 290 VAL C CA    1 
ATOM   8483  C  C     . VAL C  1 183 ? 7.503   56.178  46.158  1.00   20.05 ? 290 VAL C C     1 
ATOM   8484  O  O     . VAL C  1 183 ? 7.569   56.998  47.070  1.00   22.34 ? 290 VAL C O     1 
ATOM   8485  C  CB    . VAL C  1 183 ? 5.505   56.932  44.863  1.00   20.52 ? 290 VAL C CB    1 
ATOM   8486  C  CG1   . VAL C  1 183 ? 6.399   57.374  43.716  1.00   18.36 ? 290 VAL C CG1   1 
ATOM   8487  C  CG2   . VAL C  1 183 ? 4.126   56.541  44.358  1.00   22.19 ? 290 VAL C CG2   1 
ATOM   8488  N  N     . TRP C  1 184 ? 8.580   55.645  45.596  1.00   20.00 ? 291 TRP C N     1 
ATOM   8489  C  CA    . TRP C  1 184 ? 9.922   55.955  46.075  1.00   18.23 ? 291 TRP C CA    1 
ATOM   8490  C  C     . TRP C  1 184 ? 10.882  56.506  45.006  1.00   17.53 ? 291 TRP C C     1 
ATOM   8491  O  O     . TRP C  1 184 ? 10.802  56.143  43.833  1.00   17.58 ? 291 TRP C O     1 
ATOM   8492  C  CB    . TRP C  1 184 ? 10.518  54.686  46.701  1.00   16.68 ? 291 TRP C CB    1 
ATOM   8493  C  CG    . TRP C  1 184 ? 11.260  54.925  47.982  1.00   16.87 ? 291 TRP C CG    1 
ATOM   8494  C  CD1   . TRP C  1 184 ? 12.540  55.372  48.116  1.00   15.04 ? 291 TRP C CD1   1 
ATOM   8495  C  CD2   . TRP C  1 184 ? 10.736  54.803  49.313  1.00   16.54 ? 291 TRP C CD2   1 
ATOM   8496  N  NE1   . TRP C  1 184 ? 12.847  55.541  49.444  1.00   15.75 ? 291 TRP C NE1   1 
ATOM   8497  C  CE2   . TRP C  1 184 ? 11.757  55.199  50.202  1.00   15.13 ? 291 TRP C CE2   1 
ATOM   8498  C  CE3   . TRP C  1 184 ? 9.499   54.398  49.839  1.00   16.19 ? 291 TRP C CE3   1 
ATOM   8499  C  CZ2   . TRP C  1 184 ? 11.584  55.210  51.588  1.00   13.51 ? 291 TRP C CZ2   1 
ATOM   8500  C  CZ3   . TRP C  1 184 ? 9.326   54.405  51.224  1.00   14.20 ? 291 TRP C CZ3   1 
ATOM   8501  C  CH2   . TRP C  1 184 ? 10.363  54.809  52.078  1.00   15.27 ? 291 TRP C CH2   1 
ATOM   8502  N  N     . ALA C  1 185 ? 11.780  57.392  45.422  1.00   15.84 ? 292 ALA C N     1 
ATOM   8503  C  CA    . ALA C  1 185 ? 12.773  57.970  44.523  1.00   16.01 ? 292 ALA C CA    1 
ATOM   8504  C  C     . ALA C  1 185 ? 13.943  56.995  44.520  1.00   16.30 ? 292 ALA C C     1 
ATOM   8505  O  O     . ALA C  1 185 ? 14.441  56.631  45.582  1.00   17.05 ? 292 ALA C O     1 
ATOM   8506  C  CB    . ALA C  1 185 ? 13.214  59.338  45.041  1.00   14.89 ? 292 ALA C CB    1 
ATOM   8507  N  N     . SER C  1 186 ? 14.394  56.567  43.344  1.00   16.40 ? 293 SER C N     1 
ATOM   8508  C  CA    . SER C  1 186 ? 15.479  55.586  43.285  1.00   17.39 ? 293 SER C CA    1 
ATOM   8509  C  C     . SER C  1 186 ? 16.860  56.006  43.811  1.00   17.55 ? 293 SER C C     1 
ATOM   8510  O  O     . SER C  1 186 ? 17.686  55.150  44.114  1.00   20.16 ? 293 SER C O     1 
ATOM   8511  C  CB    . SER C  1 186 ? 15.594  55.012  41.865  1.00   15.56 ? 293 SER C CB    1 
ATOM   8512  O  OG    . SER C  1 186 ? 15.968  55.996  40.930  1.00   14.90 ? 293 SER C OG    1 
ATOM   8513  N  N     . GLY C  1 187 ? 17.129  57.301  43.925  1.00   18.11 ? 294 GLY C N     1 
ATOM   8514  C  CA    . GLY C  1 187 ? 18.419  57.713  44.466  1.00   18.33 ? 294 GLY C CA    1 
ATOM   8515  C  C     . GLY C  1 187 ? 19.274  58.667  43.646  1.00   19.54 ? 294 GLY C C     1 
ATOM   8516  O  O     . GLY C  1 187 ? 19.088  58.793  42.436  1.00   20.27 ? 294 GLY C O     1 
ATOM   8517  N  N     . ASN C  1 188 ? 20.215  59.337  44.314  1.00   17.67 ? 295 ASN C N     1 
ATOM   8518  C  CA    . ASN C  1 188 ? 21.118  60.282  43.649  1.00   19.46 ? 295 ASN C CA    1 
ATOM   8519  C  C     . ASN C  1 188 ? 22.572  59.811  43.619  1.00   20.01 ? 295 ASN C C     1 
ATOM   8520  O  O     . ASN C  1 188 ? 23.471  60.598  43.334  1.00   21.18 ? 295 ASN C O     1 
ATOM   8521  C  CB    . ASN C  1 188 ? 21.093  61.659  44.331  1.00   20.39 ? 295 ASN C CB    1 
ATOM   8522  C  CG    . ASN C  1 188 ? 19.794  62.438  44.089  1.00   23.02 ? 295 ASN C CG    1 
ATOM   8523  O  OD1   . ASN C  1 188 ? 19.185  62.360  43.020  1.00   24.83 ? 295 ASN C OD1   1 
ATOM   8524  N  ND2   . ASN C  1 188 ? 19.389  63.221  45.084  1.00   21.15 ? 295 ASN C ND2   1 
ATOM   8525  N  N     . GLY C  1 189 ? 22.807  58.532  43.891  1.00   18.84 ? 296 GLY C N     1 
ATOM   8526  C  CA    . GLY C  1 189 ? 24.167  58.021  43.910  1.00   17.65 ? 296 GLY C CA    1 
ATOM   8527  C  C     . GLY C  1 189 ? 24.853  57.783  42.581  1.00   17.84 ? 296 GLY C C     1 
ATOM   8528  O  O     . GLY C  1 189 ? 25.876  57.104  42.537  1.00   19.35 ? 296 GLY C O     1 
ATOM   8529  N  N     . GLY C  1 190 ? 24.316  58.338  41.502  1.00   18.14 ? 297 GLY C N     1 
ATOM   8530  C  CA    . GLY C  1 190 ? 24.919  58.137  40.195  1.00   19.98 ? 297 GLY C CA    1 
ATOM   8531  C  C     . GLY C  1 190 ? 26.412  58.424  40.097  1.00   20.24 ? 297 GLY C C     1 
ATOM   8532  O  O     . GLY C  1 190 ? 27.173  57.651  39.513  1.00   17.77 ? 297 GLY C O     1 
ATOM   8533  N  N     . ARG C  1 191 ? 26.840  59.537  40.677  1.00   22.89 ? 298 ARG C N     1 
ATOM   8534  C  CA    . ARG C  1 191 ? 28.240  59.911  40.614  1.00   25.80 ? 298 ARG C CA    1 
ATOM   8535  C  C     . ARG C  1 191 ? 29.146  58.963  41.394  1.00   25.64 ? 298 ARG C C     1 
ATOM   8536  O  O     . ARG C  1 191 ? 30.331  58.850  41.099  1.00   26.36 ? 298 ARG C O     1 
ATOM   8537  C  CB    . ARG C  1 191 ? 28.426  61.334  41.126  1.00   27.10 ? 298 ARG C CB    1 
ATOM   8538  C  CG    . ARG C  1 191 ? 29.746  61.934  40.713  1.00   34.94 ? 298 ARG C CG    1 
ATOM   8539  C  CD    . ARG C  1 191 ? 30.338  62.755  41.826  1.00   42.38 ? 298 ARG C CD    1 
ATOM   8540  N  NE    . ARG C  1 191 ? 29.442  63.827  42.235  1.00   47.83 ? 298 ARG C NE    1 
ATOM   8541  C  CZ    . ARG C  1 191 ? 29.587  64.513  43.361  1.00   51.96 ? 298 ARG C CZ    1 
ATOM   8542  N  NH1   . ARG C  1 191 ? 28.732  65.481  43.677  1.00   54.80 ? 298 ARG C NH1   1 
ATOM   8543  N  NH2   . ARG C  1 191 ? 30.593  64.220  44.179  1.00   56.13 ? 298 ARG C NH2   1 
ATOM   8544  N  N     . GLU C  1 192 ? 28.589  58.275  42.384  1.00   25.92 ? 299 GLU C N     1 
ATOM   8545  C  CA    . GLU C  1 192 ? 29.365  57.344  43.192  1.00   26.17 ? 299 GLU C CA    1 
ATOM   8546  C  C     . GLU C  1 192 ? 29.189  55.920  42.683  1.00   26.34 ? 299 GLU C C     1 
ATOM   8547  O  O     . GLU C  1 192 ? 29.617  54.965  43.333  1.00   26.67 ? 299 GLU C O     1 
ATOM   8548  C  CB    . GLU C  1 192 ? 28.926  57.409  44.658  1.00   27.83 ? 299 GLU C CB    1 
ATOM   8549  C  CG    . GLU C  1 192 ? 28.597  58.798  45.150  1.00   30.82 ? 299 GLU C CG    1 
ATOM   8550  C  CD    . GLU C  1 192 ? 29.638  59.812  44.742  1.00   33.01 ? 299 GLU C CD    1 
ATOM   8551  O  OE1   . GLU C  1 192 ? 30.837  59.548  44.975  1.00   36.38 ? 299 GLU C OE1   1 
ATOM   8552  O  OE2   . GLU C  1 192 ? 29.259  60.868  44.192  1.00   35.97 ? 299 GLU C OE2   1 
ATOM   8553  N  N     . HIS C  1 193 ? 28.562  55.784  41.520  1.00   26.33 ? 300 HIS C N     1 
ATOM   8554  C  CA    . HIS C  1 193 ? 28.311  54.478  40.915  1.00   27.34 ? 300 HIS C CA    1 
ATOM   8555  C  C     . HIS C  1 193 ? 27.442  53.612  41.801  1.00   26.24 ? 300 HIS C C     1 
ATOM   8556  O  O     . HIS C  1 193 ? 27.590  52.389  41.833  1.00   27.39 ? 300 HIS C O     1 
ATOM   8557  C  CB    . HIS C  1 193 ? 29.613  53.735  40.649  1.00   29.25 ? 300 HIS C CB    1 
ATOM   8558  C  CG    . HIS C  1 193 ? 30.513  54.430  39.687  1.00   33.01 ? 300 HIS C CG    1 
ATOM   8559  N  ND1   . HIS C  1 193 ? 31.565  55.218  40.094  1.00   36.26 ? 300 HIS C ND1   1 
ATOM   8560  C  CD2   . HIS C  1 193 ? 30.511  54.468  38.336  1.00   33.27 ? 300 HIS C CD2   1 
ATOM   8561  C  CE1   . HIS C  1 193 ? 32.176  55.714  39.034  1.00   36.87 ? 300 HIS C CE1   1 
ATOM   8562  N  NE2   . HIS C  1 193 ? 31.556  55.274  37.954  1.00   34.75 ? 300 HIS C NE2   1 
ATOM   8563  N  N     . ASP C  1 194 ? 26.535  54.251  42.522  1.00   23.65 ? 301 ASP C N     1 
ATOM   8564  C  CA    . ASP C  1 194 ? 25.659  53.536  43.419  1.00   22.58 ? 301 ASP C CA    1 
ATOM   8565  C  C     . ASP C  1 194 ? 24.671  52.656  42.645  1.00   23.83 ? 301 ASP C C     1 
ATOM   8566  O  O     . ASP C  1 194 ? 24.389  52.903  41.471  1.00   23.01 ? 301 ASP C O     1 
ATOM   8567  C  CB    . ASP C  1 194 ? 24.917  54.542  44.294  1.00   20.66 ? 301 ASP C CB    1 
ATOM   8568  C  CG    . ASP C  1 194 ? 24.359  53.914  45.541  1.00   21.59 ? 301 ASP C CG    1 
ATOM   8569  O  OD1   . ASP C  1 194 ? 24.755  52.764  45.837  1.00   15.62 ? 301 ASP C OD1   1 
ATOM   8570  O  OD2   . ASP C  1 194 ? 23.541  54.573  46.222  1.00   20.88 ? 301 ASP C OD2   1 
ATOM   8571  N  N     . SER C  1 195 ? 24.174  51.615  43.306  1.00   23.76 ? 302 SER C N     1 
ATOM   8572  C  CA    . SER C  1 195 ? 23.194  50.705  42.718  1.00   24.05 ? 302 SER C CA    1 
ATOM   8573  C  C     . SER C  1 195 ? 21.925  50.763  43.565  1.00   24.49 ? 302 SER C C     1 
ATOM   8574  O  O     . SER C  1 195 ? 21.974  50.538  44.776  1.00   26.81 ? 302 SER C O     1 
ATOM   8575  C  CB    . SER C  1 195 ? 23.731  49.275  42.709  1.00   25.72 ? 302 SER C CB    1 
ATOM   8576  O  OG    . SER C  1 195 ? 22.736  48.363  42.267  1.00   24.98 ? 302 SER C OG    1 
ATOM   8577  N  N     . CYS C  1 196 ? 20.787  51.054  42.949  1.00   23.58 ? 303 CYS C N     1 
ATOM   8578  C  CA    . CYS C  1 196 ? 19.558  51.130  43.729  1.00   23.45 ? 303 CYS C CA    1 
ATOM   8579  C  C     . CYS C  1 196 ? 19.001  49.787  44.190  1.00   23.04 ? 303 CYS C C     1 
ATOM   8580  O  O     . CYS C  1 196 ? 17.908  49.730  44.747  1.00   21.54 ? 303 CYS C O     1 
ATOM   8581  C  CB    . CYS C  1 196 ? 18.481  51.929  42.984  1.00   23.83 ? 303 CYS C CB    1 
ATOM   8582  S  SG    . CYS C  1 196 ? 18.402  51.794  41.162  1.00   25.47 ? 303 CYS C SG    1 
ATOM   8583  N  N     . ASN C  1 197 ? 19.751  48.709  43.962  1.00   24.36 ? 304 ASN C N     1 
ATOM   8584  C  CA    . ASN C  1 197 ? 19.327  47.383  44.412  1.00   24.33 ? 304 ASN C CA    1 
ATOM   8585  C  C     . ASN C  1 197 ? 19.952  47.162  45.790  1.00   25.09 ? 304 ASN C C     1 
ATOM   8586  O  O     . ASN C  1 197 ? 19.650  46.177  46.480  1.00   24.47 ? 304 ASN C O     1 
ATOM   8587  C  CB    . ASN C  1 197 ? 19.790  46.287  43.443  1.00   25.01 ? 304 ASN C CB    1 
ATOM   8588  C  CG    . ASN C  1 197 ? 18.773  45.995  42.342  1.00   28.51 ? 304 ASN C CG    1 
ATOM   8589  O  OD1   . ASN C  1 197 ? 17.762  46.685  42.201  1.00   29.79 ? 304 ASN C OD1   1 
ATOM   8590  N  ND2   . ASN C  1 197 ? 19.051  44.970  41.546  1.00   27.57 ? 304 ASN C ND2   1 
ATOM   8591  N  N     . CYS C  1 198 ? 20.830  48.090  46.177  1.00   22.99 ? 305 CYS C N     1 
ATOM   8592  C  CA    . CYS C  1 198 ? 21.501  48.045  47.477  1.00   22.27 ? 305 CYS C CA    1 
ATOM   8593  C  C     . CYS C  1 198 ? 20.743  48.939  48.447  1.00   22.14 ? 305 CYS C C     1 
ATOM   8594  O  O     . CYS C  1 198 ? 21.238  49.265  49.520  1.00   21.74 ? 305 CYS C O     1 
ATOM   8595  C  CB    . CYS C  1 198 ? 22.944  48.539  47.363  1.00   22.72 ? 305 CYS C CB    1 
ATOM   8596  S  SG    . CYS C  1 198 ? 24.041  47.454  46.423  1.00   22.67 ? 305 CYS C SG    1 
ATOM   8597  N  N     . ASP C  1 199 ? 19.536  49.320  48.037  1.00   21.53 ? 306 ASP C N     1 
ATOM   8598  C  CA    . ASP C  1 199 ? 18.645  50.182  48.796  1.00   19.80 ? 306 ASP C CA    1 
ATOM   8599  C  C     . ASP C  1 199 ? 17.368  49.386  49.033  1.00   19.78 ? 306 ASP C C     1 
ATOM   8600  O  O     . ASP C  1 199 ? 16.575  49.197  48.122  1.00   17.61 ? 306 ASP C O     1 
ATOM   8601  C  CB    . ASP C  1 199 ? 18.330  51.431  47.969  1.00   22.77 ? 306 ASP C CB    1 
ATOM   8602  C  CG    . ASP C  1 199 ? 17.322  52.351  48.640  1.00   24.92 ? 306 ASP C CG    1 
ATOM   8603  O  OD1   . ASP C  1 199 ? 16.444  51.842  49.377  1.00   27.02 ? 306 ASP C OD1   1 
ATOM   8604  O  OD2   . ASP C  1 199 ? 17.402  53.581  48.412  1.00   19.65 ? 306 ASP C OD2   1 
ATOM   8605  N  N     . GLY C  1 200 ? 17.175  48.925  50.263  1.00   21.81 ? 307 GLY C N     1 
ATOM   8606  C  CA    . GLY C  1 200 ? 16.007  48.126  50.598  1.00   19.57 ? 307 GLY C CA    1 
ATOM   8607  C  C     . GLY C  1 200 ? 14.644  48.768  50.413  1.00   19.64 ? 307 GLY C C     1 
ATOM   8608  O  O     . GLY C  1 200 ? 13.633  48.073  50.377  1.00   15.66 ? 307 GLY C O     1 
ATOM   8609  N  N     . TYR C  1 201 ? 14.591  50.089  50.301  1.00   21.20 ? 308 TYR C N     1 
ATOM   8610  C  CA    . TYR C  1 201 ? 13.301  50.755  50.117  1.00   20.60 ? 308 TYR C CA    1 
ATOM   8611  C  C     . TYR C  1 201 ? 12.857  50.723  48.666  1.00   18.62 ? 308 TYR C C     1 
ATOM   8612  O  O     . TYR C  1 201 ? 11.709  50.399  48.356  1.00   18.46 ? 308 TYR C O     1 
ATOM   8613  C  CB    . TYR C  1 201 ? 13.367  52.204  50.610  1.00   18.44 ? 308 TYR C CB    1 
ATOM   8614  C  CG    . TYR C  1 201 ? 13.725  52.297  52.070  1.00   18.03 ? 308 TYR C CG    1 
ATOM   8615  C  CD1   . TYR C  1 201 ? 15.056  52.223  52.487  1.00   16.11 ? 308 TYR C CD1   1 
ATOM   8616  C  CD2   . TYR C  1 201 ? 12.728  52.427  53.046  1.00   14.95 ? 308 TYR C CD2   1 
ATOM   8617  C  CE1   . TYR C  1 201 ? 15.394  52.282  53.847  1.00   15.09 ? 308 TYR C CE1   1 
ATOM   8618  C  CE2   . TYR C  1 201 ? 13.051  52.482  54.409  1.00   16.10 ? 308 TYR C CE2   1 
ATOM   8619  C  CZ    . TYR C  1 201 ? 14.390  52.410  54.801  1.00   15.73 ? 308 TYR C CZ    1 
ATOM   8620  O  OH    . TYR C  1 201 ? 14.710  52.452  56.142  1.00   12.39 ? 308 TYR C OH    1 
ATOM   8621  N  N     . THR C  1 202 ? 13.780  51.062  47.780  1.00   17.17 ? 309 THR C N     1 
ATOM   8622  C  CA    . THR C  1 202 ? 13.504  51.064  46.352  1.00   15.59 ? 309 THR C CA    1 
ATOM   8623  C  C     . THR C  1 202 ? 13.398  49.615  45.863  1.00   15.20 ? 309 THR C C     1 
ATOM   8624  O  O     . THR C  1 202 ? 12.562  49.270  45.038  1.00   14.85 ? 309 THR C O     1 
ATOM   8625  C  CB    . THR C  1 202 ? 14.649  51.759  45.593  1.00   13.31 ? 309 THR C CB    1 
ATOM   8626  O  OG1   . THR C  1 202 ? 15.894  51.167  45.978  1.00   12.77 ? 309 THR C OG1   1 
ATOM   8627  C  CG2   . THR C  1 202 ? 14.707  53.230  45.915  1.00   9.91  ? 309 THR C CG2   1 
ATOM   8628  N  N     . ASN C  1 203 ? 14.265  48.779  46.412  1.00   15.72 ? 310 ASN C N     1 
ATOM   8629  C  CA    . ASN C  1 203 ? 14.370  47.371  46.077  1.00   15.89 ? 310 ASN C CA    1 
ATOM   8630  C  C     . ASN C  1 203 ? 13.161  46.539  46.493  1.00   16.33 ? 310 ASN C C     1 
ATOM   8631  O  O     . ASN C  1 203 ? 12.962  45.432  46.004  1.00   16.55 ? 310 ASN C O     1 
ATOM   8632  C  CB    . ASN C  1 203 ? 15.628  46.826  46.737  1.00   17.54 ? 310 ASN C CB    1 
ATOM   8633  C  CG    . ASN C  1 203 ? 15.988  45.461  46.256  1.00   20.78 ? 310 ASN C CG    1 
ATOM   8634  O  OD1   . ASN C  1 203 ? 16.263  45.259  45.064  1.00   24.08 ? 310 ASN C OD1   1 
ATOM   8635  N  ND2   . ASN C  1 203 ? 16.004  44.501  47.176  1.00   18.40 ? 310 ASN C ND2   1 
ATOM   8636  N  N     . SER C  1 204 ? 12.360  47.077  47.404  1.00   17.94 ? 311 SER C N     1 
ATOM   8637  C  CA    . SER C  1 204 ? 11.164  46.390  47.893  1.00   18.26 ? 311 SER C CA    1 
ATOM   8638  C  C     . SER C  1 204 ? 10.079  46.252  46.821  1.00   18.89 ? 311 SER C C     1 
ATOM   8639  O  O     . SER C  1 204 ? 9.914   47.128  45.980  1.00   22.13 ? 311 SER C O     1 
ATOM   8640  C  CB    . SER C  1 204 ? 10.598  47.154  49.099  1.00   15.20 ? 311 SER C CB    1 
ATOM   8641  O  OG    . SER C  1 204 ? 9.275   46.754  49.415  1.00   12.65 ? 311 SER C OG    1 
ATOM   8642  N  N     . ILE C  1 205 ? 9.335   45.154  46.849  1.00   18.61 ? 312 ILE C N     1 
ATOM   8643  C  CA    . ILE C  1 205 ? 8.262   44.963  45.878  1.00   18.99 ? 312 ILE C CA    1 
ATOM   8644  C  C     . ILE C  1 205 ? 7.027   45.801  46.266  1.00   21.13 ? 312 ILE C C     1 
ATOM   8645  O  O     . ILE C  1 205 ? 6.109   45.991  45.455  1.00   21.08 ? 312 ILE C O     1 
ATOM   8646  C  CB    . ILE C  1 205 ? 7.836   43.475  45.773  1.00   17.09 ? 312 ILE C CB    1 
ATOM   8647  C  CG1   . ILE C  1 205 ? 7.042   43.067  47.018  1.00   13.78 ? 312 ILE C CG1   1 
ATOM   8648  C  CG2   . ILE C  1 205 ? 9.066   42.582  45.620  1.00   14.33 ? 312 ILE C CG2   1 
ATOM   8649  C  CD1   . ILE C  1 205 ? 6.543   41.633  46.972  1.00   13.33 ? 312 ILE C CD1   1 
ATOM   8650  N  N     . TYR C  1 206 ? 7.011   46.309  47.499  1.00   20.41 ? 313 TYR C N     1 
ATOM   8651  C  CA    . TYR C  1 206 ? 5.887   47.114  47.974  1.00   19.62 ? 313 TYR C CA    1 
ATOM   8652  C  C     . TYR C  1 206 ? 5.959   48.562  47.516  1.00   20.45 ? 313 TYR C C     1 
ATOM   8653  O  O     . TYR C  1 206 ? 5.001   49.318  47.665  1.00   21.83 ? 313 TYR C O     1 
ATOM   8654  C  CB    . TYR C  1 206 ? 5.818   47.098  49.496  1.00   16.66 ? 313 TYR C CB    1 
ATOM   8655  C  CG    . TYR C  1 206 ? 5.921   45.727  50.109  1.00   15.59 ? 313 TYR C CG    1 
ATOM   8656  C  CD1   . TYR C  1 206 ? 5.155   44.668  49.626  1.00   16.83 ? 313 TYR C CD1   1 
ATOM   8657  C  CD2   . TYR C  1 206 ? 6.756   45.495  51.198  1.00   11.46 ? 313 TYR C CD2   1 
ATOM   8658  C  CE1   . TYR C  1 206 ? 5.220   43.412  50.216  1.00   17.17 ? 313 TYR C CE1   1 
ATOM   8659  C  CE2   . TYR C  1 206 ? 6.827   44.250  51.794  1.00   10.96 ? 313 TYR C CE2   1 
ATOM   8660  C  CZ    . TYR C  1 206 ? 6.061   43.214  51.300  1.00   14.09 ? 313 TYR C CZ    1 
ATOM   8661  O  OH    . TYR C  1 206 ? 6.150   41.980  51.889  1.00   15.55 ? 313 TYR C OH    1 
ATOM   8662  N  N     . THR C  1 207 ? 7.094   48.961  46.961  1.00   20.20 ? 314 THR C N     1 
ATOM   8663  C  CA    . THR C  1 207 ? 7.239   50.335  46.493  1.00   20.06 ? 314 THR C CA    1 
ATOM   8664  C  C     . THR C  1 207 ? 7.478   50.415  44.986  1.00   20.95 ? 314 THR C C     1 
ATOM   8665  O  O     . THR C  1 207 ? 8.086   49.522  44.399  1.00   21.14 ? 314 THR C O     1 
ATOM   8666  C  CB    . THR C  1 207 ? 8.422   51.041  47.193  1.00   19.49 ? 314 THR C CB    1 
ATOM   8667  O  OG1   . THR C  1 207 ? 9.664   50.492  46.729  1.00   19.87 ? 314 THR C OG1   1 
ATOM   8668  C  CG2   . THR C  1 207 ? 8.338   50.866  48.697  1.00   18.68 ? 314 THR C CG2   1 
ATOM   8669  N  N     . LEU C  1 208 ? 6.974   51.480  44.361  1.00   20.77 ? 315 LEU C N     1 
ATOM   8670  C  CA    . LEU C  1 208 ? 7.202   51.713  42.933  1.00   17.62 ? 315 LEU C CA    1 
ATOM   8671  C  C     . LEU C  1 208 ? 8.409   52.633  42.909  1.00   15.70 ? 315 LEU C C     1 
ATOM   8672  O  O     . LEU C  1 208 ? 8.293   53.813  43.224  1.00   14.42 ? 315 LEU C O     1 
ATOM   8673  C  CB    . LEU C  1 208 ? 6.019   52.427  42.258  1.00   18.04 ? 315 LEU C CB    1 
ATOM   8674  C  CG    . LEU C  1 208 ? 4.640   51.753  42.214  1.00   19.52 ? 315 LEU C CG    1 
ATOM   8675  C  CD1   . LEU C  1 208 ? 3.872   52.141  43.476  1.00   18.95 ? 315 LEU C CD1   1 
ATOM   8676  C  CD2   . LEU C  1 208 ? 3.867   52.193  40.969  1.00   14.77 ? 315 LEU C CD2   1 
ATOM   8677  N  N     . SER C  1 209 ? 9.571   52.091  42.569  1.00   15.34 ? 316 SER C N     1 
ATOM   8678  C  CA    . SER C  1 209 ? 10.778  52.896  42.530  1.00   16.20 ? 316 SER C CA    1 
ATOM   8679  C  C     . SER C  1 209 ? 10.805  53.655  41.206  1.00   16.45 ? 316 SER C C     1 
ATOM   8680  O  O     . SER C  1 209 ? 10.667  53.055  40.144  1.00   16.99 ? 316 SER C O     1 
ATOM   8681  C  CB    . SER C  1 209 ? 12.003  52.000  42.674  1.00   14.90 ? 316 SER C CB    1 
ATOM   8682  O  OG    . SER C  1 209 ? 13.131  52.793  42.961  1.00   18.07 ? 316 SER C OG    1 
ATOM   8683  N  N     . ILE C  1 210 ? 10.984  54.972  41.284  1.00   16.10 ? 317 ILE C N     1 
ATOM   8684  C  CA    . ILE C  1 210 ? 10.981  55.839  40.111  1.00   15.19 ? 317 ILE C CA    1 
ATOM   8685  C  C     . ILE C  1 210 ? 12.300  56.545  39.819  1.00   16.66 ? 317 ILE C C     1 
ATOM   8686  O  O     . ILE C  1 210 ? 12.831  57.246  40.681  1.00   20.92 ? 317 ILE C O     1 
ATOM   8687  C  CB    . ILE C  1 210 ? 9.879   56.918  40.268  1.00   15.70 ? 317 ILE C CB    1 
ATOM   8688  C  CG1   . ILE C  1 210 ? 8.538   56.229  40.541  1.00   11.19 ? 317 ILE C CG1   1 
ATOM   8689  C  CG2   . ILE C  1 210 ? 9.817   57.809  39.021  1.00   10.64 ? 317 ILE C CG2   1 
ATOM   8690  C  CD1   . ILE C  1 210 ? 8.074   55.323  39.417  1.00   8.09  ? 317 ILE C CD1   1 
ATOM   8691  N  N     . SER C  1 211 ? 12.810  56.373  38.598  1.00   17.35 ? 318 SER C N     1 
ATOM   8692  C  CA    . SER C  1 211 ? 14.064  57.004  38.172  1.00   16.59 ? 318 SER C CA    1 
ATOM   8693  C  C     . SER C  1 211 ? 13.823  58.306  37.413  1.00   17.19 ? 318 SER C C     1 
ATOM   8694  O  O     . SER C  1 211 ? 12.676  58.700  37.202  1.00   18.40 ? 318 SER C O     1 
ATOM   8695  C  CB    . SER C  1 211 ? 14.877  56.057  37.296  1.00   15.41 ? 318 SER C CB    1 
ATOM   8696  O  OG    . SER C  1 211 ? 15.436  55.028  38.082  1.00   18.91 ? 318 SER C OG    1 
ATOM   8697  N  N     . SER C  1 212 ? 14.906  58.956  36.984  1.00   15.29 ? 319 SER C N     1 
ATOM   8698  C  CA    . SER C  1 212 ? 14.810  60.234  36.287  1.00   11.98 ? 319 SER C CA    1 
ATOM   8699  C  C     . SER C  1 212 ? 15.364  60.264  34.872  1.00   13.52 ? 319 SER C C     1 
ATOM   8700  O  O     . SER C  1 212 ? 16.180  59.441  34.487  1.00   15.89 ? 319 SER C O     1 
ATOM   8701  C  CB    . SER C  1 212 ? 15.526  61.311  37.100  1.00   11.73 ? 319 SER C CB    1 
ATOM   8702  O  OG    . SER C  1 212 ? 15.084  61.303  38.443  1.00   9.43  ? 319 SER C OG    1 
ATOM   8703  N  N     . ALA C  1 213 ? 14.905  61.242  34.102  1.00   14.39 ? 320 ALA C N     1 
ATOM   8704  C  CA    . ALA C  1 213 ? 15.351  61.442  32.726  1.00   15.18 ? 320 ALA C CA    1 
ATOM   8705  C  C     . ALA C  1 213 ? 15.476  62.949  32.543  1.00   16.17 ? 320 ALA C C     1 
ATOM   8706  O  O     . ALA C  1 213 ? 14.661  63.704  33.065  1.00   18.77 ? 320 ALA C O     1 
ATOM   8707  C  CB    . ALA C  1 213 ? 14.326  60.869  31.748  1.00   12.90 ? 320 ALA C CB    1 
ATOM   8708  N  N     . THR C  1 214 ? 16.507  63.394  31.833  1.00   17.85 ? 321 THR C N     1 
ATOM   8709  C  CA    . THR C  1 214 ? 16.691  64.827  31.616  1.00   21.01 ? 321 THR C CA    1 
ATOM   8710  C  C     . THR C  1 214 ? 15.735  65.291  30.528  1.00   22.49 ? 321 THR C C     1 
ATOM   8711  O  O     . THR C  1 214 ? 15.106  64.475  29.851  1.00   20.58 ? 321 THR C O     1 
ATOM   8712  C  CB    . THR C  1 214 ? 18.127  65.168  31.173  1.00   19.85 ? 321 THR C CB    1 
ATOM   8713  O  OG1   . THR C  1 214 ? 18.349  64.669  29.846  1.00   20.97 ? 321 THR C OG1   1 
ATOM   8714  C  CG2   . THR C  1 214 ? 19.134  64.547  32.116  1.00   20.52 ? 321 THR C CG2   1 
ATOM   8715  N  N     . GLN C  1 215 ? 15.630  66.605  30.361  1.00   23.23 ? 322 GLN C N     1 
ATOM   8716  C  CA    . GLN C  1 215 ? 14.735  67.162  29.359  1.00   24.78 ? 322 GLN C CA    1 
ATOM   8717  C  C     . GLN C  1 215 ? 15.045  66.654  27.955  1.00   23.61 ? 322 GLN C C     1 
ATOM   8718  O  O     . GLN C  1 215 ? 14.133  66.402  27.176  1.00   27.14 ? 322 GLN C O     1 
ATOM   8719  C  CB    . GLN C  1 215 ? 14.779  68.693  29.403  1.00   23.22 ? 322 GLN C CB    1 
ATOM   8720  C  CG    . GLN C  1 215 ? 14.095  69.369  28.237  1.00   24.28 ? 322 GLN C CG    1 
ATOM   8721  C  CD    . GLN C  1 215 ? 14.003  70.887  28.398  1.00   25.90 ? 322 GLN C CD    1 
ATOM   8722  O  OE1   . GLN C  1 215 ? 14.882  71.518  28.992  1.00   22.19 ? 322 GLN C OE1   1 
ATOM   8723  N  NE2   . GLN C  1 215 ? 12.939  71.478  27.852  1.00   24.75 ? 322 GLN C NE2   1 
ATOM   8724  N  N     . PHE C  1 216 ? 16.320  66.477  27.633  1.00   23.59 ? 323 PHE C N     1 
ATOM   8725  C  CA    . PHE C  1 216 ? 16.683  66.000  26.301  1.00   24.00 ? 323 PHE C CA    1 
ATOM   8726  C  C     . PHE C  1 216 ? 16.654  64.477  26.204  1.00   23.85 ? 323 PHE C C     1 
ATOM   8727  O  O     . PHE C  1 216 ? 17.123  63.899  25.226  1.00   26.20 ? 323 PHE C O     1 
ATOM   8728  C  CB    . PHE C  1 216 ? 18.070  66.525  25.887  1.00   21.29 ? 323 PHE C CB    1 
ATOM   8729  C  CG    . PHE C  1 216 ? 18.176  68.034  25.856  1.00   21.32 ? 323 PHE C CG    1 
ATOM   8730  C  CD1   . PHE C  1 216 ? 17.038  68.836  25.733  1.00   18.84 ? 323 PHE C CD1   1 
ATOM   8731  C  CD2   . PHE C  1 216 ? 19.420  68.655  25.947  1.00   22.67 ? 323 PHE C CD2   1 
ATOM   8732  C  CE1   . PHE C  1 216 ? 17.141  70.228  25.707  1.00   18.02 ? 323 PHE C CE1   1 
ATOM   8733  C  CE2   . PHE C  1 216 ? 19.531  70.052  25.919  1.00   20.56 ? 323 PHE C CE2   1 
ATOM   8734  C  CZ    . PHE C  1 216 ? 18.391  70.837  25.798  1.00   16.17 ? 323 PHE C CZ    1 
ATOM   8735  N  N     . GLY C  1 217 ? 16.113  63.829  27.226  1.00   23.44 ? 324 GLY C N     1 
ATOM   8736  C  CA    . GLY C  1 217 ? 16.004  62.378  27.210  1.00   23.87 ? 324 GLY C CA    1 
ATOM   8737  C  C     . GLY C  1 217 ? 17.237  61.555  27.545  1.00   24.27 ? 324 GLY C C     1 
ATOM   8738  O  O     . GLY C  1 217 ? 17.419  60.458  27.011  1.00   23.62 ? 324 GLY C O     1 
ATOM   8739  N  N     . ASN C  1 218 ? 18.077  62.062  28.435  1.00   23.18 ? 325 ASN C N     1 
ATOM   8740  C  CA    . ASN C  1 218 ? 19.276  61.330  28.808  1.00   22.74 ? 325 ASN C CA    1 
ATOM   8741  C  C     . ASN C  1 218 ? 19.257  60.916  30.264  1.00   20.20 ? 325 ASN C C     1 
ATOM   8742  O  O     . ASN C  1 218 ? 18.425  61.388  31.042  1.00   22.05 ? 325 ASN C O     1 
ATOM   8743  C  CB    . ASN C  1 218 ? 20.517  62.176  28.522  1.00   24.03 ? 325 ASN C CB    1 
ATOM   8744  C  CG    . ASN C  1 218 ? 20.716  62.428  27.031  1.00   24.68 ? 325 ASN C CG    1 
ATOM   8745  O  OD1   . ASN C  1 218 ? 20.853  61.490  26.241  1.00   23.89 ? 325 ASN C OD1   1 
ATOM   8746  N  ND2   . ASN C  1 218 ? 20.730  63.695  26.643  1.00   22.51 ? 325 ASN C ND2   1 
ATOM   8747  N  N     . VAL C  1 219 ? 20.169  60.018  30.619  1.00   17.78 ? 326 VAL C N     1 
ATOM   8748  C  CA    . VAL C  1 219 ? 20.298  59.528  31.992  1.00   16.54 ? 326 VAL C CA    1 
ATOM   8749  C  C     . VAL C  1 219 ? 21.057  60.596  32.772  1.00   15.97 ? 326 VAL C C     1 
ATOM   8750  O  O     . VAL C  1 219 ? 22.223  60.872  32.496  1.00   15.55 ? 326 VAL C O     1 
ATOM   8751  C  CB    . VAL C  1 219 ? 21.110  58.196  32.046  1.00   16.73 ? 326 VAL C CB    1 
ATOM   8752  C  CG1   . VAL C  1 219 ? 21.262  57.733  33.474  1.00   11.19 ? 326 VAL C CG1   1 
ATOM   8753  C  CG2   . VAL C  1 219 ? 20.437  57.127  31.198  1.00   11.20 ? 326 VAL C CG2   1 
ATOM   8754  N  N     . PRO C  1 220 ? 20.403  61.217  33.758  1.00   17.14 ? 327 PRO C N     1 
ATOM   8755  C  CA    . PRO C  1 220 ? 21.055  62.263  34.557  1.00   17.61 ? 327 PRO C CA    1 
ATOM   8756  C  C     . PRO C  1 220 ? 22.341  61.780  35.233  1.00   18.42 ? 327 PRO C C     1 
ATOM   8757  O  O     . PRO C  1 220 ? 22.537  60.574  35.429  1.00   18.77 ? 327 PRO C O     1 
ATOM   8758  C  CB    . PRO C  1 220 ? 19.971  62.643  35.563  1.00   19.32 ? 327 PRO C CB    1 
ATOM   8759  C  CG    . PRO C  1 220 ? 18.674  62.318  34.836  1.00   17.62 ? 327 PRO C CG    1 
ATOM   8760  C  CD    . PRO C  1 220 ? 19.007  61.004  34.186  1.00   17.05 ? 327 PRO C CD    1 
ATOM   8761  N  N     . TRP C  1 221 ? 23.217  62.717  35.582  1.00   17.22 ? 328 TRP C N     1 
ATOM   8762  C  CA    . TRP C  1 221 ? 24.468  62.362  36.237  1.00   17.81 ? 328 TRP C CA    1 
ATOM   8763  C  C     . TRP C  1 221 ? 24.230  61.687  37.592  1.00   18.79 ? 328 TRP C C     1 
ATOM   8764  O  O     . TRP C  1 221 ? 25.007  60.832  38.009  1.00   22.00 ? 328 TRP C O     1 
ATOM   8765  C  CB    . TRP C  1 221 ? 25.323  63.608  36.452  1.00   18.38 ? 328 TRP C CB    1 
ATOM   8766  C  CG    . TRP C  1 221 ? 24.692  64.637  37.357  1.00   20.87 ? 328 TRP C CG    1 
ATOM   8767  C  CD1   . TRP C  1 221 ? 23.875  65.673  36.990  1.00   20.36 ? 328 TRP C CD1   1 
ATOM   8768  C  CD2   . TRP C  1 221 ? 24.848  64.732  38.780  1.00   20.28 ? 328 TRP C CD2   1 
ATOM   8769  N  NE1   . TRP C  1 221 ? 23.523  66.412  38.097  1.00   19.66 ? 328 TRP C NE1   1 
ATOM   8770  C  CE2   . TRP C  1 221 ? 24.105  65.857  39.208  1.00   19.54 ? 328 TRP C CE2   1 
ATOM   8771  C  CE3   . TRP C  1 221 ? 25.543  63.973  39.736  1.00   19.36 ? 328 TRP C CE3   1 
ATOM   8772  C  CZ2   . TRP C  1 221 ? 24.040  66.244  40.554  1.00   20.93 ? 328 TRP C CZ2   1 
ATOM   8773  C  CZ3   . TRP C  1 221 ? 25.476  64.357  41.075  1.00   20.88 ? 328 TRP C CZ3   1 
ATOM   8774  C  CH2   . TRP C  1 221 ? 24.729  65.485  41.469  1.00   20.87 ? 328 TRP C CH2   1 
ATOM   8775  N  N     . TYR C  1 222 ? 23.151  62.070  38.271  1.00   17.19 ? 329 TYR C N     1 
ATOM   8776  C  CA    . TYR C  1 222 ? 22.824  61.534  39.589  1.00   17.27 ? 329 TYR C CA    1 
ATOM   8777  C  C     . TYR C  1 222 ? 22.070  60.192  39.580  1.00   17.57 ? 329 TYR C C     1 
ATOM   8778  O  O     . TYR C  1 222 ? 21.906  59.544  40.615  1.00   17.68 ? 329 TYR C O     1 
ATOM   8779  C  CB    . TYR C  1 222 ? 22.026  62.594  40.368  1.00   13.36 ? 329 TYR C CB    1 
ATOM   8780  C  CG    . TYR C  1 222 ? 20.775  63.067  39.658  1.00   14.35 ? 329 TYR C CG    1 
ATOM   8781  C  CD1   . TYR C  1 222 ? 19.611  62.290  39.660  1.00   15.61 ? 329 TYR C CD1   1 
ATOM   8782  C  CD2   . TYR C  1 222 ? 20.762  64.264  38.941  1.00   15.09 ? 329 TYR C CD2   1 
ATOM   8783  C  CE1   . TYR C  1 222 ? 18.464  62.687  38.962  1.00   16.64 ? 329 TYR C CE1   1 
ATOM   8784  C  CE2   . TYR C  1 222 ? 19.612  64.679  38.232  1.00   16.46 ? 329 TYR C CE2   1 
ATOM   8785  C  CZ    . TYR C  1 222 ? 18.466  63.879  38.249  1.00   18.47 ? 329 TYR C CZ    1 
ATOM   8786  O  OH    . TYR C  1 222 ? 17.328  64.248  37.548  1.00   18.05 ? 329 TYR C OH    1 
ATOM   8787  N  N     . SER C  1 223 ? 21.627  59.770  38.405  1.00   18.41 ? 330 SER C N     1 
ATOM   8788  C  CA    . SER C  1 223 ? 20.875  58.526  38.252  1.00   18.47 ? 330 SER C CA    1 
ATOM   8789  C  C     . SER C  1 223 ? 21.590  57.248  38.674  1.00   18.26 ? 330 SER C C     1 
ATOM   8790  O  O     . SER C  1 223 ? 22.778  57.063  38.388  1.00   18.66 ? 330 SER C O     1 
ATOM   8791  C  CB    . SER C  1 223 ? 20.431  58.389  36.793  1.00   20.72 ? 330 SER C CB    1 
ATOM   8792  O  OG    . SER C  1 223 ? 19.910  57.102  36.521  1.00   24.66 ? 330 SER C OG    1 
ATOM   8793  N  N     . GLU C  1 224 ? 20.861  56.371  39.362  1.00   17.13 ? 331 GLU C N     1 
ATOM   8794  C  CA    . GLU C  1 224 ? 21.408  55.075  39.788  1.00   17.33 ? 331 GLU C CA    1 
ATOM   8795  C  C     . GLU C  1 224 ? 20.708  54.013  38.953  1.00   15.95 ? 331 GLU C C     1 
ATOM   8796  O  O     . GLU C  1 224 ? 19.514  54.102  38.699  1.00   17.80 ? 331 GLU C O     1 
ATOM   8797  C  CB    . GLU C  1 224 ? 21.123  54.785  41.271  1.00   16.37 ? 331 GLU C CB    1 
ATOM   8798  C  CG    . GLU C  1 224 ? 21.642  55.815  42.251  1.00   17.60 ? 331 GLU C CG    1 
ATOM   8799  C  CD    . GLU C  1 224 ? 21.542  55.345  43.685  1.00   18.72 ? 331 GLU C CD    1 
ATOM   8800  O  OE1   . GLU C  1 224 ? 21.521  56.202  44.592  1.00   17.10 ? 331 GLU C OE1   1 
ATOM   8801  O  OE2   . GLU C  1 224 ? 21.493  54.116  43.912  1.00   20.04 ? 331 GLU C OE2   1 
ATOM   8802  N  N     . ALA C  1 225 ? 21.445  53.010  38.514  1.00   15.05 ? 332 ALA C N     1 
ATOM   8803  C  CA    . ALA C  1 225 ? 20.833  51.952  37.724  1.00   15.45 ? 332 ALA C CA    1 
ATOM   8804  C  C     . ALA C  1 225 ? 20.685  50.685  38.562  1.00   16.20 ? 332 ALA C C     1 
ATOM   8805  O  O     . ALA C  1 225 ? 21.513  50.407  39.432  1.00   17.77 ? 332 ALA C O     1 
ATOM   8806  C  CB    . ALA C  1 225 ? 21.673  51.664  36.493  1.00   11.65 ? 332 ALA C CB    1 
ATOM   8807  N  N     . CYS C  1 226 ? 19.617  49.936  38.308  1.00   16.22 ? 333 CYS C N     1 
ATOM   8808  C  CA    . CYS C  1 226 ? 19.351  48.680  39.006  1.00   18.67 ? 333 CYS C CA    1 
ATOM   8809  C  C     . CYS C  1 226 ? 18.100  48.079  38.373  1.00   18.21 ? 333 CYS C C     1 
ATOM   8810  O  O     . CYS C  1 226 ? 17.352  48.779  37.692  1.00   17.02 ? 333 CYS C O     1 
ATOM   8811  C  CB    . CYS C  1 226 ? 19.128  48.909  40.509  1.00   20.23 ? 333 CYS C CB    1 
ATOM   8812  S  SG    . CYS C  1 226 ? 17.663  49.922  40.847  1.00   27.94 ? 333 CYS C SG    1 
ATOM   8813  N  N     . SER C  1 227 ? 17.872  46.791  38.604  1.00   16.18 ? 334 SER C N     1 
ATOM   8814  C  CA    . SER C  1 227 ? 16.726  46.102  38.031  1.00   15.50 ? 334 SER C CA    1 
ATOM   8815  C  C     . SER C  1 227 ? 15.428  46.253  38.812  1.00   17.11 ? 334 SER C C     1 
ATOM   8816  O  O     . SER C  1 227 ? 14.374  45.797  38.356  1.00   17.94 ? 334 SER C O     1 
ATOM   8817  C  CB    . SER C  1 227 ? 17.041  44.620  37.890  1.00   13.70 ? 334 SER C CB    1 
ATOM   8818  O  OG    . SER C  1 227 ? 17.341  44.074  39.153  1.00   15.16 ? 334 SER C OG    1 
ATOM   8819  N  N     . SER C  1 228 ? 15.489  46.883  39.983  1.00   17.56 ? 335 SER C N     1 
ATOM   8820  C  CA    . SER C  1 228 ? 14.289  47.048  40.794  1.00   17.62 ? 335 SER C CA    1 
ATOM   8821  C  C     . SER C  1 228 ? 13.461  48.265  40.387  1.00   18.63 ? 335 SER C C     1 
ATOM   8822  O  O     . SER C  1 228 ? 12.276  48.352  40.724  1.00   21.39 ? 335 SER C O     1 
ATOM   8823  C  CB    . SER C  1 228 ? 14.651  47.138  42.277  1.00   15.23 ? 335 SER C CB    1 
ATOM   8824  O  OG    . SER C  1 228 ? 15.494  48.247  42.529  1.00   19.42 ? 335 SER C OG    1 
ATOM   8825  N  N     . THR C  1 229 ? 14.072  49.200  39.666  1.00   16.08 ? 336 THR C N     1 
ATOM   8826  C  CA    . THR C  1 229 ? 13.346  50.389  39.226  1.00   17.89 ? 336 THR C CA    1 
ATOM   8827  C  C     . THR C  1 229 ? 12.205  49.992  38.297  1.00   18.41 ? 336 THR C C     1 
ATOM   8828  O  O     . THR C  1 229 ? 12.385  49.157  37.414  1.00   17.09 ? 336 THR C O     1 
ATOM   8829  C  CB    . THR C  1 229 ? 14.275  51.373  38.496  1.00   18.27 ? 336 THR C CB    1 
ATOM   8830  O  OG1   . THR C  1 229 ? 15.215  51.905  39.436  1.00   17.86 ? 336 THR C OG1   1 
ATOM   8831  C  CG2   . THR C  1 229 ? 13.480  52.513  37.873  1.00   14.57 ? 336 THR C CG2   1 
ATOM   8832  N  N     . LEU C  1 230 ? 11.035  50.595  38.492  1.00   20.23 ? 337 LEU C N     1 
ATOM   8833  C  CA    . LEU C  1 230 ? 9.873   50.261  37.675  1.00   19.51 ? 337 LEU C CA    1 
ATOM   8834  C  C     . LEU C  1 230 ? 9.592   51.212  36.512  1.00   19.15 ? 337 LEU C C     1 
ATOM   8835  O  O     . LEU C  1 230 ? 9.272   50.752  35.414  1.00   22.15 ? 337 LEU C O     1 
ATOM   8836  C  CB    . LEU C  1 230 ? 8.629   50.161  38.554  1.00   21.02 ? 337 LEU C CB    1 
ATOM   8837  C  CG    . LEU C  1 230 ? 7.412   49.522  37.889  1.00   20.59 ? 337 LEU C CG    1 
ATOM   8838  C  CD1   . LEU C  1 230 ? 7.694   48.045  37.638  1.00   21.76 ? 337 LEU C CD1   1 
ATOM   8839  C  CD2   . LEU C  1 230 ? 6.199   49.683  38.790  1.00   22.71 ? 337 LEU C CD2   1 
ATOM   8840  N  N     . ALA C  1 231 ? 9.691   52.522  36.740  1.00   15.45 ? 338 ALA C N     1 
ATOM   8841  C  CA    . ALA C  1 231 ? 9.439   53.494  35.674  1.00   15.36 ? 338 ALA C CA    1 
ATOM   8842  C  C     . ALA C  1 231 ? 10.221  54.795  35.860  1.00   16.91 ? 338 ALA C C     1 
ATOM   8843  O  O     . ALA C  1 231 ? 10.998  54.944  36.811  1.00   17.88 ? 338 ALA C O     1 
ATOM   8844  C  CB    . ALA C  1 231 ? 7.934   53.785  35.566  1.00   12.41 ? 338 ALA C CB    1 
ATOM   8845  N  N     . THR C  1 232 ? 9.996   55.745  34.956  1.00   14.10 ? 339 THR C N     1 
ATOM   8846  C  CA    . THR C  1 232 ? 10.705  57.022  34.997  1.00   15.48 ? 339 THR C CA    1 
ATOM   8847  C  C     . THR C  1 232 ? 9.842   58.269  34.780  1.00   15.88 ? 339 THR C C     1 
ATOM   8848  O  O     . THR C  1 232 ? 8.820   58.216  34.109  1.00   16.91 ? 339 THR C O     1 
ATOM   8849  C  CB    . THR C  1 232 ? 11.798  57.039  33.903  1.00   15.34 ? 339 THR C CB    1 
ATOM   8850  O  OG1   . THR C  1 232 ? 12.669  55.918  34.093  1.00   17.53 ? 339 THR C OG1   1 
ATOM   8851  C  CG2   . THR C  1 232 ? 12.597  58.344  33.938  1.00   10.78 ? 339 THR C CG2   1 
ATOM   8852  N  N     . THR C  1 233 ? 10.263  59.387  35.359  1.00   14.91 ? 340 THR C N     1 
ATOM   8853  C  CA    . THR C  1 233 ? 9.585   60.658  35.148  1.00   16.84 ? 340 THR C CA    1 
ATOM   8854  C  C     . THR C  1 233 ? 10.706  61.669  34.961  1.00   18.22 ? 340 THR C C     1 
ATOM   8855  O  O     . THR C  1 233 ? 11.831  61.428  35.387  1.00   18.66 ? 340 THR C O     1 
ATOM   8856  C  CB    . THR C  1 233 ? 8.703   61.093  36.342  1.00   15.80 ? 340 THR C CB    1 
ATOM   8857  O  OG1   . THR C  1 233 ? 9.529   61.489  37.435  1.00   16.79 ? 340 THR C OG1   1 
ATOM   8858  C  CG2   . THR C  1 233 ? 7.799   59.963  36.771  1.00   15.44 ? 340 THR C CG2   1 
ATOM   8859  N  N     . TYR C  1 234 ? 10.408  62.785  34.306  1.00   20.15 ? 341 TYR C N     1 
ATOM   8860  C  CA    . TYR C  1 234 ? 11.402  63.821  34.054  1.00   17.81 ? 341 TYR C CA    1 
ATOM   8861  C  C     . TYR C  1 234 ? 11.912  64.519  35.308  1.00   19.19 ? 341 TYR C C     1 
ATOM   8862  O  O     . TYR C  1 234 ? 11.234  64.562  36.337  1.00   18.44 ? 341 TYR C O     1 
ATOM   8863  C  CB    . TYR C  1 234 ? 10.822  64.877  33.116  1.00   18.20 ? 341 TYR C CB    1 
ATOM   8864  C  CG    . TYR C  1 234 ? 10.773  64.447  31.672  1.00   19.76 ? 341 TYR C CG    1 
ATOM   8865  C  CD1   . TYR C  1 234 ? 11.947  64.239  30.945  1.00   18.65 ? 341 TYR C CD1   1 
ATOM   8866  C  CD2   . TYR C  1 234 ? 9.556   64.258  31.023  1.00   16.86 ? 341 TYR C CD2   1 
ATOM   8867  C  CE1   . TYR C  1 234 ? 11.908  63.853  29.608  1.00   16.82 ? 341 TYR C CE1   1 
ATOM   8868  C  CE2   . TYR C  1 234 ? 9.510   63.873  29.690  1.00   16.05 ? 341 TYR C CE2   1 
ATOM   8869  C  CZ    . TYR C  1 234 ? 10.688  63.671  28.989  1.00   15.94 ? 341 TYR C CZ    1 
ATOM   8870  O  OH    . TYR C  1 234 ? 10.646  63.274  27.673  1.00   19.42 ? 341 TYR C OH    1 
ATOM   8871  N  N     . SER C  1 235 ? 13.123  65.058  35.199  1.00   18.32 ? 342 SER C N     1 
ATOM   8872  C  CA    . SER C  1 235 ? 13.752  65.818  36.272  1.00   18.22 ? 342 SER C CA    1 
ATOM   8873  C  C     . SER C  1 235 ? 14.874  66.677  35.679  1.00   19.68 ? 342 SER C C     1 
ATOM   8874  O  O     . SER C  1 235 ? 14.901  66.917  34.472  1.00   19.45 ? 342 SER C O     1 
ATOM   8875  C  CB    . SER C  1 235 ? 14.313  64.899  37.351  1.00   19.40 ? 342 SER C CB    1 
ATOM   8876  O  OG    . SER C  1 235 ? 14.694  65.669  38.488  1.00   18.93 ? 342 SER C OG    1 
ATOM   8877  N  N     . SER C  1 236 ? 15.805  67.128  36.515  1.00   20.40 ? 343 SER C N     1 
ATOM   8878  C  CA    . SER C  1 236 ? 16.892  67.982  36.040  1.00   18.73 ? 343 SER C CA    1 
ATOM   8879  C  C     . SER C  1 236 ? 18.019  67.242  35.337  1.00   19.04 ? 343 SER C C     1 
ATOM   8880  O  O     . SER C  1 236 ? 18.149  66.028  35.450  1.00   20.51 ? 343 SER C O     1 
ATOM   8881  C  CB    . SER C  1 236 ? 17.466  68.786  37.200  1.00   14.75 ? 343 SER C CB    1 
ATOM   8882  O  OG    . SER C  1 236 ? 17.957  67.926  38.206  1.00   17.43 ? 343 SER C OG    1 
ATOM   8883  N  N     . GLY C  1 237 ? 18.823  68.001  34.598  1.00   18.57 ? 344 GLY C N     1 
ATOM   8884  C  CA    . GLY C  1 237 ? 19.957  67.454  33.872  1.00   17.63 ? 344 GLY C CA    1 
ATOM   8885  C  C     . GLY C  1 237 ? 21.065  68.498  33.868  1.00   19.53 ? 344 GLY C C     1 
ATOM   8886  O  O     . GLY C  1 237 ? 21.470  68.975  34.934  1.00   22.63 ? 344 GLY C O     1 
ATOM   8887  N  N     . ASN C  1 238 ? 21.562  68.871  32.692  1.00   17.12 ? 345 ASN C N     1 
ATOM   8888  C  CA    . ASN C  1 238 ? 22.613  69.876  32.639  1.00   17.38 ? 345 ASN C CA    1 
ATOM   8889  C  C     . ASN C  1 238 ? 22.016  71.278  32.662  1.00   17.88 ? 345 ASN C C     1 
ATOM   8890  O  O     . ASN C  1 238 ? 20.801  71.439  32.720  1.00   16.87 ? 345 ASN C O     1 
ATOM   8891  C  CB    . ASN C  1 238 ? 23.512  69.690  31.412  1.00   17.41 ? 345 ASN C CB    1 
ATOM   8892  C  CG    . ASN C  1 238 ? 22.748  69.739  30.100  1.00   22.17 ? 345 ASN C CG    1 
ATOM   8893  O  OD1   . ASN C  1 238 ? 21.986  70.673  29.841  1.00   23.40 ? 345 ASN C OD1   1 
ATOM   8894  N  ND2   . ASN C  1 238 ? 22.968  68.732  29.251  1.00   20.27 ? 345 ASN C ND2   1 
ATOM   8895  N  N     . GLN C  1 239 ? 22.868  72.294  32.621  1.00   18.04 ? 346 GLN C N     1 
ATOM   8896  C  CA    . GLN C  1 239 ? 22.388  73.662  32.696  1.00   18.56 ? 346 GLN C CA    1 
ATOM   8897  C  C     . GLN C  1 239 ? 21.705  74.223  31.445  1.00   19.63 ? 346 GLN C C     1 
ATOM   8898  O  O     . GLN C  1 239 ? 21.300  75.388  31.425  1.00   19.82 ? 346 GLN C O     1 
ATOM   8899  C  CB    . GLN C  1 239 ? 23.531  74.571  33.155  1.00   16.15 ? 346 GLN C CB    1 
ATOM   8900  C  CG    . GLN C  1 239 ? 24.140  74.109  34.471  1.00   16.57 ? 346 GLN C CG    1 
ATOM   8901  C  CD    . GLN C  1 239 ? 25.079  75.125  35.091  1.00   17.30 ? 346 GLN C CD    1 
ATOM   8902  O  OE1   . GLN C  1 239 ? 25.978  74.761  35.850  1.00   21.05 ? 346 GLN C OE1   1 
ATOM   8903  N  NE2   . GLN C  1 239 ? 24.869  76.400  34.788  1.00   17.12 ? 346 GLN C NE2   1 
ATOM   8904  N  N     . ASN C  1 240 ? 21.567  73.403  30.407  1.00   18.95 ? 347 ASN C N     1 
ATOM   8905  C  CA    . ASN C  1 240 ? 20.894  73.841  29.184  1.00   19.07 ? 347 ASN C CA    1 
ATOM   8906  C  C     . ASN C  1 240 ? 19.506  73.225  29.196  1.00   19.30 ? 347 ASN C C     1 
ATOM   8907  O  O     . ASN C  1 240 ? 18.648  73.556  28.378  1.00   19.49 ? 347 ASN C O     1 
ATOM   8908  C  CB    . ASN C  1 240 ? 21.614  73.352  27.921  1.00   20.21 ? 347 ASN C CB    1 
ATOM   8909  C  CG    . ASN C  1 240 ? 23.002  73.928  27.764  1.00   24.77 ? 347 ASN C CG    1 
ATOM   8910  O  OD1   . ASN C  1 240 ? 23.983  73.356  28.239  1.00   29.02 ? 347 ASN C OD1   1 
ATOM   8911  N  ND2   . ASN C  1 240 ? 23.095  75.073  27.096  1.00   26.15 ? 347 ASN C ND2   1 
ATOM   8912  N  N     . GLU C  1 241 ? 19.304  72.305  30.127  1.00   18.85 ? 348 GLU C N     1 
ATOM   8913  C  CA    . GLU C  1 241 ? 18.037  71.618  30.261  1.00   18.94 ? 348 GLU C CA    1 
ATOM   8914  C  C     . GLU C  1 241 ? 17.251  72.234  31.403  1.00   19.39 ? 348 GLU C C     1 
ATOM   8915  O  O     . GLU C  1 241 ? 17.808  72.571  32.439  1.00   19.83 ? 348 GLU C O     1 
ATOM   8916  C  CB    . GLU C  1 241 ? 18.284  70.130  30.516  1.00   17.77 ? 348 GLU C CB    1 
ATOM   8917  C  CG    . GLU C  1 241 ? 18.849  69.393  29.309  1.00   17.85 ? 348 GLU C CG    1 
ATOM   8918  C  CD    . GLU C  1 241 ? 19.322  67.980  29.640  1.00   21.98 ? 348 GLU C CD    1 
ATOM   8919  O  OE1   . GLU C  1 241 ? 19.040  67.048  28.850  1.00   22.74 ? 348 GLU C OE1   1 
ATOM   8920  O  OE2   . GLU C  1 241 ? 19.987  67.801  30.686  1.00   20.25 ? 348 GLU C OE2   1 
ATOM   8921  N  N     . LYS C  1 242 ? 15.949  72.386  31.204  1.00   22.68 ? 349 LYS C N     1 
ATOM   8922  C  CA    . LYS C  1 242 ? 15.100  72.975  32.226  1.00   23.27 ? 349 LYS C CA    1 
ATOM   8923  C  C     . LYS C  1 242 ? 14.919  72.035  33.414  1.00   22.36 ? 349 LYS C C     1 
ATOM   8924  O  O     . LYS C  1 242 ? 15.210  70.837  33.324  1.00   22.34 ? 349 LYS C O     1 
ATOM   8925  C  CB    . LYS C  1 242 ? 13.754  73.370  31.608  1.00   23.28 ? 349 LYS C CB    1 
ATOM   8926  C  CG    . LYS C  1 242 ? 13.925  74.423  30.530  1.00   27.04 ? 349 LYS C CG    1 
ATOM   8927  C  CD    . LYS C  1 242 ? 12.602  74.821  29.931  1.00   33.01 ? 349 LYS C CD    1 
ATOM   8928  C  CE    . LYS C  1 242 ? 12.792  75.937  28.925  1.00   36.22 ? 349 LYS C CE    1 
ATOM   8929  N  NZ    . LYS C  1 242 ? 11.477  76.429  28.422  1.00   37.24 ? 349 LYS C NZ    1 
ATOM   8930  N  N     . GLN C  1 243 ? 14.448  72.584  34.531  1.00   20.98 ? 350 GLN C N     1 
ATOM   8931  C  CA    . GLN C  1 243 ? 14.248  71.793  35.731  1.00   19.72 ? 350 GLN C CA    1 
ATOM   8932  C  C     . GLN C  1 243 ? 12.789  71.770  36.179  1.00   20.42 ? 350 GLN C C     1 
ATOM   8933  O  O     . GLN C  1 243 ? 11.888  72.048  35.386  1.00   18.37 ? 350 GLN C O     1 
ATOM   8934  C  CB    . GLN C  1 243 ? 15.180  72.305  36.825  1.00   16.36 ? 350 GLN C CB    1 
ATOM   8935  C  CG    . GLN C  1 243 ? 16.581  72.536  36.262  1.00   16.92 ? 350 GLN C CG    1 
ATOM   8936  C  CD    . GLN C  1 243 ? 17.642  72.776  37.311  1.00   17.68 ? 350 GLN C CD    1 
ATOM   8937  O  OE1   . GLN C  1 243 ? 17.420  73.486  38.285  1.00   22.94 ? 350 GLN C OE1   1 
ATOM   8938  N  NE2   . GLN C  1 243 ? 18.817  72.198  37.103  1.00   17.98 ? 350 GLN C NE2   1 
ATOM   8939  N  N     . ILE C  1 244 ? 12.555  71.427  37.439  1.00   20.80 ? 351 ILE C N     1 
ATOM   8940  C  CA    . ILE C  1 244 ? 11.192  71.315  37.944  1.00   20.48 ? 351 ILE C CA    1 
ATOM   8941  C  C     . ILE C  1 244 ? 10.693  72.568  38.635  1.00   21.41 ? 351 ILE C C     1 
ATOM   8942  O  O     . ILE C  1 244 ? 11.362  73.108  39.518  1.00   22.95 ? 351 ILE C O     1 
ATOM   8943  C  CB    . ILE C  1 244 ? 11.077  70.118  38.912  1.00   16.60 ? 351 ILE C CB    1 
ATOM   8944  C  CG1   . ILE C  1 244 ? 11.580  68.858  38.220  1.00   16.48 ? 351 ILE C CG1   1 
ATOM   8945  C  CG2   . ILE C  1 244 ? 9.649   69.942  39.373  1.00   16.69 ? 351 ILE C CG2   1 
ATOM   8946  C  CD1   . ILE C  1 244 ? 10.938  68.588  36.890  1.00   17.23 ? 351 ILE C CD1   1 
ATOM   8947  N  N     . VAL C  1 245 ? 9.507   73.011  38.227  1.00   19.51 ? 352 VAL C N     1 
ATOM   8948  C  CA    . VAL C  1 245 ? 8.876   74.203  38.775  1.00   19.86 ? 352 VAL C CA    1 
ATOM   8949  C  C     . VAL C  1 245 ? 7.875   73.796  39.853  1.00   20.59 ? 352 VAL C C     1 
ATOM   8950  O  O     . VAL C  1 245 ? 6.969   72.998  39.596  1.00   22.57 ? 352 VAL C O     1 
ATOM   8951  C  CB    . VAL C  1 245 ? 8.148   74.986  37.657  1.00   20.82 ? 352 VAL C CB    1 
ATOM   8952  C  CG1   . VAL C  1 245 ? 7.422   76.191  38.231  1.00   23.31 ? 352 VAL C CG1   1 
ATOM   8953  C  CG2   . VAL C  1 245 ? 9.149   75.416  36.602  1.00   16.64 ? 352 VAL C CG2   1 
ATOM   8954  N  N     . THR C  1 246 ? 8.028   74.346  41.056  1.00   18.38 ? 353 THR C N     1 
ATOM   8955  C  CA    . THR C  1 246 ? 7.132   73.992  42.147  1.00   15.00 ? 353 THR C CA    1 
ATOM   8956  C  C     . THR C  1 246 ? 7.154   75.008  43.293  1.00   15.96 ? 353 THR C C     1 
ATOM   8957  O  O     . THR C  1 246 ? 7.889   75.998  43.255  1.00   14.96 ? 353 THR C O     1 
ATOM   8958  C  CB    . THR C  1 246 ? 7.511   72.601  42.698  1.00   15.45 ? 353 THR C CB    1 
ATOM   8959  O  OG1   . THR C  1 246 ? 6.630   72.235  43.767  1.00   16.47 ? 353 THR C OG1   1 
ATOM   8960  C  CG2   . THR C  1 246 ? 8.938   72.615  43.214  1.00   12.07 ? 353 THR C CG2   1 
ATOM   8961  N  N     . THR C  1 247 ? 6.336   74.756  44.310  1.00   15.95 ? 354 THR C N     1 
ATOM   8962  C  CA    . THR C  1 247 ? 6.258   75.619  45.483  1.00   18.58 ? 354 THR C CA    1 
ATOM   8963  C  C     . THR C  1 247 ? 7.526   75.550  46.351  1.00   21.67 ? 354 THR C C     1 
ATOM   8964  O  O     . THR C  1 247 ? 8.078   74.467  46.600  1.00   23.10 ? 354 THR C O     1 
ATOM   8965  C  CB    . THR C  1 247 ? 5.054   75.236  46.357  1.00   17.24 ? 354 THR C CB    1 
ATOM   8966  O  OG1   . THR C  1 247 ? 5.096   73.836  46.651  1.00   14.98 ? 354 THR C OG1   1 
ATOM   8967  C  CG2   . THR C  1 247 ? 3.767   75.547  45.643  1.00   20.19 ? 354 THR C CG2   1 
ATOM   8968  N  N     . ASP C  1 248 ? 7.985   76.706  46.818  1.00   22.04 ? 355 ASP C N     1 
ATOM   8969  C  CA    . ASP C  1 248 ? 9.183   76.741  47.641  1.00   23.88 ? 355 ASP C CA    1 
ATOM   8970  C  C     . ASP C  1 248 ? 8.895   77.322  49.022  1.00   24.08 ? 355 ASP C C     1 
ATOM   8971  O  O     . ASP C  1 248 ? 7.909   78.035  49.216  1.00   23.79 ? 355 ASP C O     1 
ATOM   8972  C  CB    . ASP C  1 248 ? 10.265  77.566  46.952  1.00   22.70 ? 355 ASP C CB    1 
ATOM   8973  C  CG    . ASP C  1 248 ? 11.654  77.157  47.368  1.00   23.78 ? 355 ASP C CG    1 
ATOM   8974  O  OD1   . ASP C  1 248 ? 11.785  76.391  48.343  1.00   23.78 ? 355 ASP C OD1   1 
ATOM   8975  O  OD2   . ASP C  1 248 ? 12.615  77.606  46.715  1.00   26.47 ? 355 ASP C OD2   1 
ATOM   8976  N  N     . LEU C  1 249 ? 9.766   77.006  49.974  1.00   21.29 ? 356 LEU C N     1 
ATOM   8977  C  CA    . LEU C  1 249 ? 9.636   77.472  51.343  1.00   21.28 ? 356 LEU C CA    1 
ATOM   8978  C  C     . LEU C  1 249 ? 9.487   78.995  51.393  1.00   21.03 ? 356 LEU C C     1 
ATOM   8979  O  O     . LEU C  1 249 ? 9.952   79.709  50.500  1.00   20.33 ? 356 LEU C O     1 
ATOM   8980  C  CB    . LEU C  1 249 ? 10.861  77.019  52.144  1.00   22.24 ? 356 LEU C CB    1 
ATOM   8981  C  CG    . LEU C  1 249 ? 10.776  76.967  53.670  1.00   24.24 ? 356 LEU C CG    1 
ATOM   8982  C  CD1   . LEU C  1 249 ? 9.548   76.199  54.125  1.00   24.29 ? 356 LEU C CD1   1 
ATOM   8983  C  CD2   . LEU C  1 249 ? 12.037  76.306  54.197  1.00   25.44 ? 356 LEU C CD2   1 
ATOM   8984  N  N     . ARG C  1 250 ? 8.826   79.483  52.439  1.00   18.89 ? 357 ARG C N     1 
ATOM   8985  C  CA    . ARG C  1 250 ? 8.603   80.912  52.610  1.00   20.43 ? 357 ARG C CA    1 
ATOM   8986  C  C     . ARG C  1 250 ? 7.690   81.475  51.531  1.00   22.44 ? 357 ARG C C     1 
ATOM   8987  O  O     . ARG C  1 250 ? 7.872   82.595  51.057  1.00   21.53 ? 357 ARG C O     1 
ATOM   8988  C  CB    . ARG C  1 250 ? 9.939   81.658  52.636  1.00   19.56 ? 357 ARG C CB    1 
ATOM   8989  C  CG    . ARG C  1 250 ? 10.831  81.229  53.797  1.00   16.87 ? 357 ARG C CG    1 
ATOM   8990  C  CD    . ARG C  1 250 ? 12.197  81.863  53.709  1.00   20.22 ? 357 ARG C CD    1 
ATOM   8991  N  NE    . ARG C  1 250 ? 13.144  81.357  54.700  1.00   21.73 ? 357 ARG C NE    1 
ATOM   8992  C  CZ    . ARG C  1 250 ? 13.022  81.494  56.021  1.00   24.96 ? 357 ARG C CZ    1 
ATOM   8993  N  NH1   . ARG C  1 250 ? 13.951  80.992  56.826  1.00   25.80 ? 357 ARG C NH1   1 
ATOM   8994  N  NH2   . ARG C  1 250 ? 11.978  82.123  56.542  1.00   24.74 ? 357 ARG C NH2   1 
ATOM   8995  N  N     . GLN C  1 251 ? 6.707   80.664  51.153  1.00   25.79 ? 358 GLN C N     1 
ATOM   8996  C  CA    . GLN C  1 251 ? 5.699   81.025  50.167  1.00   26.87 ? 358 GLN C CA    1 
ATOM   8997  C  C     . GLN C  1 251 ? 6.229   81.512  48.831  1.00   26.87 ? 358 GLN C C     1 
ATOM   8998  O  O     . GLN C  1 251 ? 5.614   82.341  48.175  1.00   28.98 ? 358 GLN C O     1 
ATOM   8999  C  CB    . GLN C  1 251 ? 4.764   82.048  50.793  1.00   26.13 ? 358 GLN C CB    1 
ATOM   9000  C  CG    . GLN C  1 251 ? 4.146   81.471  52.045  1.00   30.14 ? 358 GLN C CG    1 
ATOM   9001  C  CD    . GLN C  1 251 ? 3.437   82.490  52.888  1.00   31.19 ? 358 GLN C CD    1 
ATOM   9002  O  OE1   . GLN C  1 251 ? 2.432   83.074  52.474  1.00   30.14 ? 358 GLN C OE1   1 
ATOM   9003  N  NE2   . GLN C  1 251 ? 3.954   82.713  54.088  1.00   34.18 ? 358 GLN C NE2   1 
ATOM   9004  N  N     . LYS C  1 252 ? 7.369   80.973  48.422  1.00   27.84 ? 359 LYS C N     1 
ATOM   9005  C  CA    . LYS C  1 252 ? 7.966   81.347  47.153  1.00   27.60 ? 359 LYS C CA    1 
ATOM   9006  C  C     . LYS C  1 252 ? 7.702   80.292  46.080  1.00   26.02 ? 359 LYS C C     1 
ATOM   9007  O  O     . LYS C  1 252 ? 7.067   79.267  46.330  1.00   25.31 ? 359 LYS C O     1 
ATOM   9008  C  CB    . LYS C  1 252 ? 9.471   81.562  47.323  1.00   29.77 ? 359 LYS C CB    1 
ATOM   9009  C  CG    . LYS C  1 252 ? 9.805   82.720  48.231  1.00   32.48 ? 359 LYS C CG    1 
ATOM   9010  C  CD    . LYS C  1 252 ? 11.287  82.848  48.480  1.00   34.92 ? 359 LYS C CD    1 
ATOM   9011  C  CE    . LYS C  1 252 ? 11.532  83.993  49.451  1.00   40.01 ? 359 LYS C CE    1 
ATOM   9012  N  NZ    . LYS C  1 252 ? 12.956  84.093  49.875  1.00   42.03 ? 359 LYS C NZ    1 
ATOM   9013  N  N     . CYS C  1 253 ? 8.201   80.558  44.883  1.00   24.82 ? 360 CYS C N     1 
ATOM   9014  C  CA    . CYS C  1 253 ? 8.026   79.672  43.751  1.00   25.76 ? 360 CYS C CA    1 
ATOM   9015  C  C     . CYS C  1 253 ? 9.409   79.403  43.186  1.00   24.65 ? 360 CYS C C     1 
ATOM   9016  O  O     . CYS C  1 253 ? 10.160  80.338  42.914  1.00   29.18 ? 360 CYS C O     1 
ATOM   9017  C  CB    . CYS C  1 253 ? 7.141   80.377  42.727  1.00   28.15 ? 360 CYS C CB    1 
ATOM   9018  S  SG    . CYS C  1 253 ? 6.700   79.472  41.214  1.00   40.12 ? 360 CYS C SG    1 
ATOM   9019  N  N     . THR C  1 254 ? 9.770   78.136  43.034  1.00   21.78 ? 361 THR C N     1 
ATOM   9020  C  CA    . THR C  1 254 ? 11.083  77.827  42.492  1.00   20.35 ? 361 THR C CA    1 
ATOM   9021  C  C     . THR C  1 254 ? 11.001  77.155  41.140  1.00   20.29 ? 361 THR C C     1 
ATOM   9022  O  O     . THR C  1 254 ? 10.047  76.431  40.841  1.00   19.34 ? 361 THR C O     1 
ATOM   9023  C  CB    . THR C  1 254 ? 11.916  76.911  43.428  1.00   21.09 ? 361 THR C CB    1 
ATOM   9024  O  OG1   . THR C  1 254 ? 13.177  76.630  42.798  1.00   18.48 ? 361 THR C OG1   1 
ATOM   9025  C  CG2   . THR C  1 254 ? 11.181  75.586  43.716  1.00   16.23 ? 361 THR C CG2   1 
ATOM   9026  N  N     . GLU C  1 255 ? 12.012  77.406  40.321  1.00   19.91 ? 362 GLU C N     1 
ATOM   9027  C  CA    . GLU C  1 255 ? 12.083  76.811  39.002  1.00   21.30 ? 362 GLU C CA    1 
ATOM   9028  C  C     . GLU C  1 255 ? 13.271  75.886  38.954  1.00   19.84 ? 362 GLU C C     1 
ATOM   9029  O  O     . GLU C  1 255 ? 13.654  75.418  37.882  1.00   21.77 ? 362 GLU C O     1 
ATOM   9030  C  CB    . GLU C  1 255 ? 12.222  77.888  37.936  1.00   23.15 ? 362 GLU C CB    1 
ATOM   9031  C  CG    . GLU C  1 255 ? 10.949  78.662  37.725  1.00   31.33 ? 362 GLU C CG    1 
ATOM   9032  C  CD    . GLU C  1 255 ? 11.092  79.735  36.669  1.00   36.33 ? 362 GLU C CD    1 
ATOM   9033  O  OE1   . GLU C  1 255 ? 11.575  79.411  35.561  1.00   36.85 ? 362 GLU C OE1   1 
ATOM   9034  O  OE2   . GLU C  1 255 ? 10.710  80.894  36.950  1.00   38.38 ? 362 GLU C OE2   1 
ATOM   9035  N  N     . SER C  1 256 ? 13.844  75.606  40.120  1.00   17.40 ? 363 SER C N     1 
ATOM   9036  C  CA    . SER C  1 256 ? 14.997  74.742  40.159  1.00   16.30 ? 363 SER C CA    1 
ATOM   9037  C  C     . SER C  1 256 ? 14.974  73.630  41.191  1.00   18.02 ? 363 SER C C     1 
ATOM   9038  O  O     . SER C  1 256 ? 15.891  73.502  41.998  1.00   20.44 ? 363 SER C O     1 
ATOM   9039  C  CB    . SER C  1 256 ? 16.262  75.581  40.304  1.00   13.44 ? 363 SER C CB    1 
ATOM   9040  O  OG    . SER C  1 256 ? 16.143  76.495  41.362  1.00   17.02 ? 363 SER C OG    1 
ATOM   9041  N  N     . HIS C  1 257 ? 13.913  72.827  41.170  1.00   20.39 ? 364 HIS C N     1 
ATOM   9042  C  CA    . HIS C  1 257 ? 13.825  71.666  42.053  1.00   19.83 ? 364 HIS C CA    1 
ATOM   9043  C  C     . HIS C  1 257 ? 14.520  70.586  41.204  1.00   20.40 ? 364 HIS C C     1 
ATOM   9044  O  O     . HIS C  1 257 ? 14.187  70.400  40.028  1.00   18.83 ? 364 HIS C O     1 
ATOM   9045  C  CB    . HIS C  1 257 ? 12.369  71.310  42.329  1.00   19.05 ? 364 HIS C CB    1 
ATOM   9046  C  CG    . HIS C  1 257 ? 12.200  70.162  43.274  1.00   22.25 ? 364 HIS C CG    1 
ATOM   9047  N  ND1   . HIS C  1 257 ? 13.132  69.855  44.244  1.00   21.87 ? 364 HIS C ND1   1 
ATOM   9048  C  CD2   . HIS C  1 257 ? 11.192  69.270  43.425  1.00   21.28 ? 364 HIS C CD2   1 
ATOM   9049  C  CE1   . HIS C  1 257 ? 12.703  68.825  44.951  1.00   20.53 ? 364 HIS C CE1   1 
ATOM   9050  N  NE2   . HIS C  1 257 ? 11.528  68.451  44.476  1.00   19.58 ? 364 HIS C NE2   1 
ATOM   9051  N  N     . THR C  1 258 ? 15.488  69.884  41.783  1.00   19.50 ? 365 THR C N     1 
ATOM   9052  C  CA    . THR C  1 258 ? 16.255  68.918  41.005  1.00   18.40 ? 365 THR C CA    1 
ATOM   9053  C  C     . THR C  1 258 ? 16.419  67.517  41.580  1.00   19.77 ? 365 THR C C     1 
ATOM   9054  O  O     . THR C  1 258 ? 15.889  67.184  42.638  1.00   21.79 ? 365 THR C O     1 
ATOM   9055  C  CB    . THR C  1 258 ? 17.670  69.466  40.775  1.00   16.41 ? 365 THR C CB    1 
ATOM   9056  O  OG1   . THR C  1 258 ? 18.358  69.483  42.033  1.00   18.22 ? 365 THR C OG1   1 
ATOM   9057  C  CG2   . THR C  1 258 ? 17.618  70.902  40.232  1.00   12.56 ? 365 THR C CG2   1 
ATOM   9058  N  N     . GLY C  1 259 ? 17.174  66.704  40.844  1.00   19.87 ? 366 GLY C N     1 
ATOM   9059  C  CA    . GLY C  1 259 ? 17.483  65.346  41.254  1.00   19.32 ? 366 GLY C CA    1 
ATOM   9060  C  C     . GLY C  1 259 ? 16.353  64.351  41.347  1.00   21.57 ? 366 GLY C C     1 
ATOM   9061  O  O     . GLY C  1 259 ? 15.211  64.639  40.991  1.00   23.55 ? 366 GLY C O     1 
ATOM   9062  N  N     . THR C  1 260 ? 16.696  63.167  41.842  1.00   22.33 ? 367 THR C N     1 
ATOM   9063  C  CA    . THR C  1 260 ? 15.755  62.066  42.006  1.00   22.63 ? 367 THR C CA    1 
ATOM   9064  C  C     . THR C  1 260 ? 14.534  62.497  42.834  1.00   21.20 ? 367 THR C C     1 
ATOM   9065  O  O     . THR C  1 260 ? 13.428  61.982  42.644  1.00   20.97 ? 367 THR C O     1 
ATOM   9066  C  CB    . THR C  1 260 ? 16.477  60.842  42.675  1.00   24.09 ? 367 THR C CB    1 
ATOM   9067  O  OG1   . THR C  1 260 ? 15.672  59.661  42.565  1.00   26.43 ? 367 THR C OG1   1 
ATOM   9068  C  CG2   . THR C  1 260 ? 16.757  61.118  44.144  1.00   21.58 ? 367 THR C CG2   1 
ATOM   9069  N  N     . SER C  1 261 ? 14.739  63.457  43.732  1.00   20.57 ? 368 SER C N     1 
ATOM   9070  C  CA    . SER C  1 261 ? 13.663  63.961  44.588  1.00   20.35 ? 368 SER C CA    1 
ATOM   9071  C  C     . SER C  1 261 ? 12.441  64.455  43.829  1.00   17.82 ? 368 SER C C     1 
ATOM   9072  O  O     . SER C  1 261 ? 11.325  64.314  44.309  1.00   18.02 ? 368 SER C O     1 
ATOM   9073  C  CB    . SER C  1 261 ? 14.159  65.113  45.467  1.00   18.78 ? 368 SER C CB    1 
ATOM   9074  O  OG    . SER C  1 261 ? 15.129  64.683  46.389  1.00   22.17 ? 368 SER C OG    1 
ATOM   9075  N  N     . ALA C  1 262 ? 12.655  65.049  42.662  1.00   15.12 ? 369 ALA C N     1 
ATOM   9076  C  CA    . ALA C  1 262 ? 11.561  65.592  41.876  1.00   17.70 ? 369 ALA C CA    1 
ATOM   9077  C  C     . ALA C  1 262 ? 10.795  64.549  41.063  1.00   19.38 ? 369 ALA C C     1 
ATOM   9078  O  O     . ALA C  1 262 ? 9.655   64.787  40.651  1.00   19.37 ? 369 ALA C O     1 
ATOM   9079  C  CB    . ALA C  1 262 ? 12.092  66.694  40.949  1.00   16.31 ? 369 ALA C CB    1 
ATOM   9080  N  N     . SER C  1 263 ? 11.402  63.391  40.832  1.00   16.89 ? 370 SER C N     1 
ATOM   9081  C  CA    . SER C  1 263 ? 10.723  62.378  40.042  1.00   16.30 ? 370 SER C CA    1 
ATOM   9082  C  C     . SER C  1 263 ? 9.605   61.631  40.747  1.00   16.11 ? 370 SER C C     1 
ATOM   9083  O  O     . SER C  1 263 ? 8.516   61.474  40.187  1.00   19.53 ? 370 SER C O     1 
ATOM   9084  C  CB    . SER C  1 263 ? 11.732  61.389  39.477  1.00   14.56 ? 370 SER C CB    1 
ATOM   9085  O  OG    . SER C  1 263 ? 12.410  61.983  38.390  1.00   12.32 ? 370 SER C OG    1 
ATOM   9086  N  N     . ALA C  1 264 ? 9.854   61.172  41.967  1.00   13.77 ? 371 ALA C N     1 
ATOM   9087  C  CA    . ALA C  1 264 ? 8.835   60.437  42.716  1.00   15.06 ? 371 ALA C CA    1 
ATOM   9088  C  C     . ALA C  1 264 ? 7.506   61.192  42.854  1.00   15.28 ? 371 ALA C C     1 
ATOM   9089  O  O     . ALA C  1 264 ? 6.444   60.628  42.593  1.00   12.66 ? 371 ALA C O     1 
ATOM   9090  C  CB    . ALA C  1 264 ? 9.368   60.062  44.103  1.00   14.60 ? 371 ALA C CB    1 
ATOM   9091  N  N     . PRO C  1 265 ? 7.548   62.477  43.262  1.00   15.12 ? 372 PRO C N     1 
ATOM   9092  C  CA    . PRO C  1 265 ? 6.312   63.253  43.416  1.00   16.15 ? 372 PRO C CA    1 
ATOM   9093  C  C     . PRO C  1 265 ? 5.447   63.303  42.152  1.00   17.24 ? 372 PRO C C     1 
ATOM   9094  O  O     . PRO C  1 265 ? 4.218   63.267  42.236  1.00   17.14 ? 372 PRO C O     1 
ATOM   9095  C  CB    . PRO C  1 265 ? 6.822   64.635  43.828  1.00   17.00 ? 372 PRO C CB    1 
ATOM   9096  C  CG    . PRO C  1 265 ? 8.079   64.316  44.578  1.00   14.40 ? 372 PRO C CG    1 
ATOM   9097  C  CD    . PRO C  1 265 ? 8.713   63.274  43.682  1.00   13.05 ? 372 PRO C CD    1 
ATOM   9098  N  N     . LEU C  1 266 ? 6.086   63.391  40.986  1.00   16.11 ? 373 LEU C N     1 
ATOM   9099  C  CA    . LEU C  1 266 ? 5.359   63.439  39.726  1.00   12.41 ? 373 LEU C CA    1 
ATOM   9100  C  C     . LEU C  1 266 ? 4.678   62.104  39.513  1.00   12.94 ? 373 LEU C C     1 
ATOM   9101  O  O     . LEU C  1 266 ? 3.527   62.044  39.084  1.00   13.66 ? 373 LEU C O     1 
ATOM   9102  C  CB    . LEU C  1 266 ? 6.318   63.737  38.575  1.00   12.17 ? 373 LEU C CB    1 
ATOM   9103  C  CG    . LEU C  1 266 ? 6.979   65.116  38.635  1.00   9.53  ? 373 LEU C CG    1 
ATOM   9104  C  CD1   . LEU C  1 266 ? 7.972   65.259  37.490  1.00   7.08  ? 373 LEU C CD1   1 
ATOM   9105  C  CD2   . LEU C  1 266 ? 5.902   66.194  38.568  1.00   4.48  ? 373 LEU C CD2   1 
ATOM   9106  N  N     . ALA C  1 267 ? 5.390   61.026  39.818  1.00   12.78 ? 374 ALA C N     1 
ATOM   9107  C  CA    . ALA C  1 267 ? 4.816   59.693  39.674  1.00   11.18 ? 374 ALA C CA    1 
ATOM   9108  C  C     . ALA C  1 267 ? 3.616   59.580  40.623  1.00   10.24 ? 374 ALA C C     1 
ATOM   9109  O  O     . ALA C  1 267 ? 2.572   59.050  40.248  1.00   10.29 ? 374 ALA C O     1 
ATOM   9110  C  CB    . ALA C  1 267 ? 5.878   58.624  40.006  1.00   7.91  ? 374 ALA C CB    1 
ATOM   9111  N  N     . ALA C  1 268 ? 3.771   60.089  41.845  1.00   9.98  ? 375 ALA C N     1 
ATOM   9112  C  CA    . ALA C  1 268 ? 2.708   60.041  42.839  1.00   11.98 ? 375 ALA C CA    1 
ATOM   9113  C  C     . ALA C  1 268 ? 1.478   60.791  42.313  1.00   15.80 ? 375 ALA C C     1 
ATOM   9114  O  O     . ALA C  1 268 ? 0.338   60.330  42.477  1.00   14.71 ? 375 ALA C O     1 
ATOM   9115  C  CB    . ALA C  1 268 ? 3.191   60.650  44.148  1.00   11.04 ? 375 ALA C CB    1 
ATOM   9116  N  N     . GLY C  1 269 ? 1.720   61.935  41.673  1.00   15.42 ? 376 GLY C N     1 
ATOM   9117  C  CA    . GLY C  1 269 ? 0.630   62.720  41.121  1.00   16.63 ? 376 GLY C CA    1 
ATOM   9118  C  C     . GLY C  1 269 ? -0.106  61.972  40.022  1.00   17.29 ? 376 GLY C C     1 
ATOM   9119  O  O     . GLY C  1 269 ? -1.334  61.944  39.996  1.00   17.31 ? 376 GLY C O     1 
ATOM   9120  N  N     . ILE C  1 270 ? 0.643   61.361  39.110  1.00   16.42 ? 377 ILE C N     1 
ATOM   9121  C  CA    . ILE C  1 270 ? 0.047   60.606  38.020  1.00   16.62 ? 377 ILE C CA    1 
ATOM   9122  C  C     . ILE C  1 270 ? -0.723  59.407  38.557  1.00   19.01 ? 377 ILE C C     1 
ATOM   9123  O  O     . ILE C  1 270 ? -1.801  59.077  38.055  1.00   19.24 ? 377 ILE C O     1 
ATOM   9124  C  CB    . ILE C  1 270 ? 1.129   60.145  37.016  1.00   16.15 ? 377 ILE C CB    1 
ATOM   9125  C  CG1   . ILE C  1 270 ? 1.638   61.368  36.242  1.00   16.90 ? 377 ILE C CG1   1 
ATOM   9126  C  CG2   . ILE C  1 270 ? 0.568   59.109  36.054  1.00   9.87  ? 377 ILE C CG2   1 
ATOM   9127  C  CD1   . ILE C  1 270 ? 2.835   61.089  35.355  1.00   13.90 ? 377 ILE C CD1   1 
ATOM   9128  N  N     . ILE C  1 271 ? -0.182  58.764  39.588  1.00   19.99 ? 378 ILE C N     1 
ATOM   9129  C  CA    . ILE C  1 271 ? -0.854  57.613  40.178  1.00   19.91 ? 378 ILE C CA    1 
ATOM   9130  C  C     . ILE C  1 271 ? -2.146  58.074  40.853  1.00   22.06 ? 378 ILE C C     1 
ATOM   9131  O  O     . ILE C  1 271 ? -3.117  57.313  40.945  1.00   22.03 ? 378 ILE C O     1 
ATOM   9132  C  CB    . ILE C  1 271 ? 0.071   56.890  41.186  1.00   16.28 ? 378 ILE C CB    1 
ATOM   9133  C  CG1   . ILE C  1 271 ? 1.229   56.260  40.414  1.00   13.13 ? 378 ILE C CG1   1 
ATOM   9134  C  CG2   . ILE C  1 271 ? -0.709  55.833  41.969  1.00   10.38 ? 378 ILE C CG2   1 
ATOM   9135  C  CD1   . ILE C  1 271 ? 2.286   55.603  41.276  1.00   15.04 ? 378 ILE C CD1   1 
ATOM   9136  N  N     . ALA C  1 272 ? -2.154  59.330  41.305  1.00   22.68 ? 379 ALA C N     1 
ATOM   9137  C  CA    . ALA C  1 272 ? -3.334  59.905  41.948  1.00   22.71 ? 379 ALA C CA    1 
ATOM   9138  C  C     . ALA C  1 272 ? -4.441  60.055  40.899  1.00   22.92 ? 379 ALA C C     1 
ATOM   9139  O  O     . ALA C  1 272 ? -5.611  59.764  41.162  1.00   24.70 ? 379 ALA C O     1 
ATOM   9140  C  CB    . ALA C  1 272 ? -2.993  61.262  42.561  1.00   20.17 ? 379 ALA C CB    1 
ATOM   9141  N  N     . LEU C  1 273 ? -4.068  60.504  39.706  1.00   21.79 ? 380 LEU C N     1 
ATOM   9142  C  CA    . LEU C  1 273 ? -5.038  60.664  38.634  1.00   21.16 ? 380 LEU C CA    1 
ATOM   9143  C  C     . LEU C  1 273 ? -5.591  59.283  38.278  1.00   22.04 ? 380 LEU C C     1 
ATOM   9144  O  O     . LEU C  1 273 ? -6.785  59.127  38.015  1.00   23.54 ? 380 LEU C O     1 
ATOM   9145  C  CB    . LEU C  1 273 ? -4.385  61.300  37.395  1.00   19.77 ? 380 LEU C CB    1 
ATOM   9146  C  CG    . LEU C  1 273 ? -3.739  62.696  37.451  1.00   22.18 ? 380 LEU C CG    1 
ATOM   9147  C  CD1   . LEU C  1 273 ? -3.409  63.158  36.034  1.00   18.60 ? 380 LEU C CD1   1 
ATOM   9148  C  CD2   . LEU C  1 273 ? -4.672  63.707  38.095  1.00   20.90 ? 380 LEU C CD2   1 
ATOM   9149  N  N     . THR C  1 274 ? -4.719  58.279  38.277  1.00   20.78 ? 381 THR C N     1 
ATOM   9150  C  CA    . THR C  1 274 ? -5.125  56.922  37.942  1.00   19.86 ? 381 THR C CA    1 
ATOM   9151  C  C     . THR C  1 274 ? -6.115  56.368  38.967  1.00   18.61 ? 381 THR C C     1 
ATOM   9152  O  O     . THR C  1 274 ? -7.074  55.693  38.603  1.00   15.75 ? 381 THR C O     1 
ATOM   9153  C  CB    . THR C  1 274 ? -3.888  56.005  37.829  1.00   20.79 ? 381 THR C CB    1 
ATOM   9154  O  OG1   . THR C  1 274 ? -2.910  56.644  36.996  1.00   23.05 ? 381 THR C OG1   1 
ATOM   9155  C  CG2   . THR C  1 274 ? -4.252  54.673  37.189  1.00   19.79 ? 381 THR C CG2   1 
ATOM   9156  N  N     . LEU C  1 275 ? -5.897  56.652  40.247  1.00   19.60 ? 382 LEU C N     1 
ATOM   9157  C  CA    . LEU C  1 275 ? -6.826  56.170  41.265  1.00   20.41 ? 382 LEU C CA    1 
ATOM   9158  C  C     . LEU C  1 275 ? -8.191  56.820  41.115  1.00   21.00 ? 382 LEU C C     1 
ATOM   9159  O  O     . LEU C  1 275 ? -9.215  56.187  41.376  1.00   21.36 ? 382 LEU C O     1 
ATOM   9160  C  CB    . LEU C  1 275 ? -6.300  56.427  42.678  1.00   20.34 ? 382 LEU C CB    1 
ATOM   9161  C  CG    . LEU C  1 275 ? -5.412  55.316  43.245  1.00   21.75 ? 382 LEU C CG    1 
ATOM   9162  C  CD1   . LEU C  1 275 ? -5.127  55.601  44.716  1.00   20.74 ? 382 LEU C CD1   1 
ATOM   9163  C  CD2   . LEU C  1 275 ? -6.099  53.964  43.085  1.00   17.67 ? 382 LEU C CD2   1 
ATOM   9164  N  N     . GLU C  1 276 ? -8.216  58.083  40.703  1.00   20.69 ? 383 GLU C N     1 
ATOM   9165  C  CA    . GLU C  1 276 ? -9.495  58.745  40.516  1.00   22.12 ? 383 GLU C CA    1 
ATOM   9166  C  C     . GLU C  1 276 ? -10.231 58.056  39.370  1.00   20.89 ? 383 GLU C C     1 
ATOM   9167  O  O     . GLU C  1 276 ? -11.444 57.884  39.429  1.00   21.24 ? 383 GLU C O     1 
ATOM   9168  C  CB    . GLU C  1 276 ? -9.317  60.232  40.204  1.00   22.80 ? 383 GLU C CB    1 
ATOM   9169  C  CG    . GLU C  1 276 ? -10.630 60.893  39.842  1.00   23.93 ? 383 GLU C CG    1 
ATOM   9170  C  CD    . GLU C  1 276 ? -10.504 62.370  39.568  1.00   25.90 ? 383 GLU C CD    1 
ATOM   9171  O  OE1   . GLU C  1 276 ? -9.427  62.814  39.110  1.00   26.96 ? 383 GLU C OE1   1 
ATOM   9172  O  OE2   . GLU C  1 276 ? -11.502 63.082  39.795  1.00   25.63 ? 383 GLU C OE2   1 
ATOM   9173  N  N     . ALA C  1 277 ? -9.490  57.661  38.335  1.00   19.47 ? 384 ALA C N     1 
ATOM   9174  C  CA    . ALA C  1 277 ? -10.080 56.981  37.185  1.00   18.27 ? 384 ALA C CA    1 
ATOM   9175  C  C     . ALA C  1 277 ? -10.604 55.594  37.560  1.00   19.48 ? 384 ALA C C     1 
ATOM   9176  O  O     . ALA C  1 277 ? -11.458 55.053  36.867  1.00   21.32 ? 384 ALA C O     1 
ATOM   9177  C  CB    . ALA C  1 277 ? -9.062  56.868  36.063  1.00   17.77 ? 384 ALA C CB    1 
ATOM   9178  N  N     . ASN C  1 278 ? -10.086 55.021  38.647  1.00   18.55 ? 385 ASN C N     1 
ATOM   9179  C  CA    . ASN C  1 278 ? -10.513 53.705  39.116  1.00   16.93 ? 385 ASN C CA    1 
ATOM   9180  C  C     . ASN C  1 278 ? -10.066 53.511  40.561  1.00   19.35 ? 385 ASN C C     1 
ATOM   9181  O  O     . ASN C  1 278 ? -8.962  53.040  40.820  1.00   20.96 ? 385 ASN C O     1 
ATOM   9182  C  CB    . ASN C  1 278 ? -9.911  52.597  38.250  1.00   15.33 ? 385 ASN C CB    1 
ATOM   9183  C  CG    . ASN C  1 278 ? -10.443 51.211  38.613  1.00   13.74 ? 385 ASN C CG    1 
ATOM   9184  O  OD1   . ASN C  1 278 ? -10.934 50.989  39.716  1.00   10.88 ? 385 ASN C OD1   1 
ATOM   9185  N  ND2   . ASN C  1 278 ? -10.332 50.271  37.680  1.00   10.45 ? 385 ASN C ND2   1 
ATOM   9186  N  N     . LYS C  1 279 ? -10.936 53.864  41.500  1.00   20.24 ? 386 LYS C N     1 
ATOM   9187  C  CA    . LYS C  1 279 ? -10.631 53.746  42.919  1.00   22.14 ? 386 LYS C CA    1 
ATOM   9188  C  C     . LYS C  1 279 ? -10.493 52.319  43.445  1.00   22.65 ? 386 LYS C C     1 
ATOM   9189  O  O     . LYS C  1 279 ? -10.036 52.118  44.571  1.00   23.96 ? 386 LYS C O     1 
ATOM   9190  C  CB    . LYS C  1 279 ? -11.692 54.493  43.734  1.00   23.02 ? 386 LYS C CB    1 
ATOM   9191  C  CG    . LYS C  1 279 ? -11.691 56.000  43.496  1.00   25.43 ? 386 LYS C CG    1 
ATOM   9192  C  CD    . LYS C  1 279 ? -12.700 56.722  44.377  1.00   28.31 ? 386 LYS C CD    1 
ATOM   9193  C  CE    . LYS C  1 279 ? -12.696 58.215  44.099  0.0000 27.39 ? 386 LYS C CE    1 
ATOM   9194  N  NZ    . LYS C  1 279 ? -11.354 58.822  44.316  0.0000 27.81 ? 386 LYS C NZ    1 
ATOM   9195  N  N     . ASN C  1 280 ? -10.867 51.331  42.639  1.00   23.34 ? 387 ASN C N     1 
ATOM   9196  C  CA    . ASN C  1 280 ? -10.789 49.942  43.074  1.00   25.90 ? 387 ASN C CA    1 
ATOM   9197  C  C     . ASN C  1 280 ? -9.500  49.216  42.691  1.00   24.40 ? 387 ASN C C     1 
ATOM   9198  O  O     . ASN C  1 280 ? -9.409  47.988  42.814  1.00   23.98 ? 387 ASN C O     1 
ATOM   9199  C  CB    . ASN C  1 280 ? -12.011 49.177  42.552  1.00   27.17 ? 387 ASN C CB    1 
ATOM   9200  C  CG    . ASN C  1 280 ? -13.276 49.503  43.332  1.00   34.08 ? 387 ASN C CG    1 
ATOM   9201  O  OD1   . ASN C  1 280 ? -14.398 49.269  42.855  1.00   39.16 ? 387 ASN C OD1   1 
ATOM   9202  N  ND2   . ASN C  1 280 ? -13.105 50.038  44.549  1.00   32.23 ? 387 ASN C ND2   1 
ATOM   9203  N  N     . LEU C  1 281 ? -8.503  49.972  42.238  1.00   21.79 ? 388 LEU C N     1 
ATOM   9204  C  CA    . LEU C  1 281 ? -7.222  49.384  41.855  1.00   21.85 ? 388 LEU C CA    1 
ATOM   9205  C  C     . LEU C  1 281 ? -6.430  48.959  43.094  1.00   22.46 ? 388 LEU C C     1 
ATOM   9206  O  O     . LEU C  1 281 ? -6.391  49.671  44.095  1.00   22.13 ? 388 LEU C O     1 
ATOM   9207  C  CB    . LEU C  1 281 ? -6.401  50.385  41.044  1.00   20.47 ? 388 LEU C CB    1 
ATOM   9208  C  CG    . LEU C  1 281 ? -7.010  50.811  39.707  1.00   23.03 ? 388 LEU C CG    1 
ATOM   9209  C  CD1   . LEU C  1 281 ? -6.175  51.938  39.106  1.00   22.06 ? 388 LEU C CD1   1 
ATOM   9210  C  CD2   . LEU C  1 281 ? -7.080  49.625  38.763  1.00   19.72 ? 388 LEU C CD2   1 
ATOM   9211  N  N     . THR C  1 282 ? -5.800  47.791  43.035  1.00   21.13 ? 389 THR C N     1 
ATOM   9212  C  CA    . THR C  1 282 ? -5.013  47.315  44.167  1.00   16.64 ? 389 THR C CA    1 
ATOM   9213  C  C     . THR C  1 282 ? -3.588  47.826  44.009  1.00   17.45 ? 389 THR C C     1 
ATOM   9214  O  O     . THR C  1 282 ? -3.228  48.382  42.964  1.00   17.10 ? 389 THR C O     1 
ATOM   9215  C  CB    . THR C  1 282 ? -4.993  45.775  44.221  1.00   15.03 ? 389 THR C CB    1 
ATOM   9216  O  OG1   . THR C  1 282 ? -4.207  45.260  43.134  1.00   13.31 ? 389 THR C OG1   1 
ATOM   9217  C  CG2   . THR C  1 282 ? -6.411  45.230  44.121  1.00   11.34 ? 389 THR C CG2   1 
ATOM   9218  N  N     . TRP C  1 283 ? -2.773  47.656  45.040  1.00   16.23 ? 390 TRP C N     1 
ATOM   9219  C  CA    . TRP C  1 283 ? -1.393  48.104  44.946  1.00   14.77 ? 390 TRP C CA    1 
ATOM   9220  C  C     . TRP C  1 283 ? -0.681  47.363  43.809  1.00   17.50 ? 390 TRP C C     1 
ATOM   9221  O  O     . TRP C  1 283 ? 0.238   47.910  43.195  1.00   19.04 ? 390 TRP C O     1 
ATOM   9222  C  CB    . TRP C  1 283 ? -0.648  47.877  46.270  1.00   14.42 ? 390 TRP C CB    1 
ATOM   9223  C  CG    . TRP C  1 283 ? -0.436  46.421  46.658  1.00   13.59 ? 390 TRP C CG    1 
ATOM   9224  C  CD1   . TRP C  1 283 ? -1.357  45.568  47.193  1.00   12.70 ? 390 TRP C CD1   1 
ATOM   9225  C  CD2   . TRP C  1 283 ? 0.778   45.668  46.535  1.00   13.56 ? 390 TRP C CD2   1 
ATOM   9226  N  NE1   . TRP C  1 283 ? -0.794  44.331  47.412  1.00   10.78 ? 390 TRP C NE1   1 
ATOM   9227  C  CE2   . TRP C  1 283 ? 0.515   44.365  47.019  1.00   11.68 ? 390 TRP C CE2   1 
ATOM   9228  C  CE3   . TRP C  1 283 ? 2.062   45.967  46.060  1.00   11.26 ? 390 TRP C CE3   1 
ATOM   9229  C  CZ2   . TRP C  1 283 ? 1.489   43.366  47.044  1.00   9.25  ? 390 TRP C CZ2   1 
ATOM   9230  C  CZ3   . TRP C  1 283 ? 3.028   44.974  46.083  1.00   9.65  ? 390 TRP C CZ3   1 
ATOM   9231  C  CH2   . TRP C  1 283 ? 2.737   43.690  46.572  1.00   10.02 ? 390 TRP C CH2   1 
ATOM   9232  N  N     . ARG C  1 284 ? -1.094  46.126  43.523  1.00   14.97 ? 391 ARG C N     1 
ATOM   9233  C  CA    . ARG C  1 284 ? -0.474  45.372  42.433  1.00   17.19 ? 391 ARG C CA    1 
ATOM   9234  C  C     . ARG C  1 284 ? -1.059  45.804  41.087  1.00   19.47 ? 391 ARG C C     1 
ATOM   9235  O  O     . ARG C  1 284 ? -0.343  45.864  40.079  1.00   19.99 ? 391 ARG C O     1 
ATOM   9236  C  CB    . ARG C  1 284 ? -0.649  43.862  42.637  1.00   15.85 ? 391 ARG C CB    1 
ATOM   9237  C  CG    . ARG C  1 284 ? 0.305   43.258  43.673  1.00   16.37 ? 391 ARG C CG    1 
ATOM   9238  C  CD    . ARG C  1 284 ? -0.128  41.865  44.109  1.00   17.33 ? 391 ARG C CD    1 
ATOM   9239  N  NE    . ARG C  1 284 ? -0.203  40.955  42.976  1.00   21.12 ? 391 ARG C NE    1 
ATOM   9240  C  CZ    . ARG C  1 284 ? -1.245  40.172  42.707  1.00   21.85 ? 391 ARG C CZ    1 
ATOM   9241  N  NH1   . ARG C  1 284 ? -2.315  40.180  43.495  1.00   21.10 ? 391 ARG C NH1   1 
ATOM   9242  N  NH2   . ARG C  1 284 ? -1.221  39.382  41.637  1.00   22.85 ? 391 ARG C NH2   1 
ATOM   9243  N  N     . ASP C  1 285 ? -2.356  46.109  41.064  1.00   20.14 ? 392 ASP C N     1 
ATOM   9244  C  CA    . ASP C  1 285 ? -2.979  46.562  39.819  1.00   21.09 ? 392 ASP C CA    1 
ATOM   9245  C  C     . ASP C  1 285 ? -2.196  47.777  39.324  1.00   19.48 ? 392 ASP C C     1 
ATOM   9246  O  O     . ASP C  1 285 ? -1.879  47.896  38.137  1.00   17.15 ? 392 ASP C O     1 
ATOM   9247  C  CB    . ASP C  1 285 ? -4.443  46.989  40.038  1.00   20.64 ? 392 ASP C CB    1 
ATOM   9248  C  CG    . ASP C  1 285 ? -5.408  45.816  40.114  1.00   21.07 ? 392 ASP C CG    1 
ATOM   9249  O  OD1   . ASP C  1 285 ? -5.204  44.808  39.397  1.00   21.36 ? 392 ASP C OD1   1 
ATOM   9250  O  OD2   . ASP C  1 285 ? -6.394  45.925  40.876  1.00   18.51 ? 392 ASP C OD2   1 
ATOM   9251  N  N     . MET C  1 286 ? -1.886  48.671  40.260  1.00   18.43 ? 393 MET C N     1 
ATOM   9252  C  CA    . MET C  1 286 ? -1.172  49.902  39.958  1.00   16.16 ? 393 MET C CA    1 
ATOM   9253  C  C     . MET C  1 286 ? 0.164   49.649  39.296  1.00   14.93 ? 393 MET C C     1 
ATOM   9254  O  O     . MET C  1 286 ? 0.526   50.321  38.338  1.00   15.25 ? 393 MET C O     1 
ATOM   9255  C  CB    . MET C  1 286 ? -0.980  50.710  41.237  1.00   15.23 ? 393 MET C CB    1 
ATOM   9256  C  CG    . MET C  1 286 ? -0.542  52.132  41.003  1.00   15.92 ? 393 MET C CG    1 
ATOM   9257  S  SD    . MET C  1 286 ? -1.623  52.990  39.838  1.00   20.48 ? 393 MET C SD    1 
ATOM   9258  C  CE    . MET C  1 286 ? -3.062  53.354  40.848  1.00   18.18 ? 393 MET C CE    1 
ATOM   9259  N  N     . GLN C  1 287 ? 0.905   48.674  39.796  1.00   15.48 ? 394 GLN C N     1 
ATOM   9260  C  CA    . GLN C  1 287 ? 2.199   48.380  39.201  1.00   16.49 ? 394 GLN C CA    1 
ATOM   9261  C  C     . GLN C  1 287 ? 2.038   47.806  37.798  1.00   16.98 ? 394 GLN C C     1 
ATOM   9262  O  O     . GLN C  1 287 ? 2.839   48.101  36.914  1.00   16.43 ? 394 GLN C O     1 
ATOM   9263  C  CB    . GLN C  1 287 ? 2.998   47.449  40.120  1.00   15.61 ? 394 GLN C CB    1 
ATOM   9264  C  CG    . GLN C  1 287 ? 3.542   48.211  41.322  1.00   15.85 ? 394 GLN C CG    1 
ATOM   9265  C  CD    . GLN C  1 287 ? 4.420   47.373  42.213  1.00   15.85 ? 394 GLN C CD    1 
ATOM   9266  O  OE1   . GLN C  1 287 ? 5.265   46.620  41.733  1.00   15.71 ? 394 GLN C OE1   1 
ATOM   9267  N  NE2   . GLN C  1 287 ? 4.243   47.515  43.524  1.00   16.04 ? 394 GLN C NE2   1 
ATOM   9268  N  N     . HIS C  1 288 ? 0.989   47.010  37.594  1.00   16.75 ? 395 HIS C N     1 
ATOM   9269  C  CA    . HIS C  1 288 ? 0.697   46.431  36.287  1.00   12.32 ? 395 HIS C CA    1 
ATOM   9270  C  C     . HIS C  1 288 ? 0.443   47.548  35.287  1.00   12.40 ? 395 HIS C C     1 
ATOM   9271  O  O     . HIS C  1 288 ? 0.966   47.533  34.180  1.00   13.36 ? 395 HIS C O     1 
ATOM   9272  C  CB    . HIS C  1 288 ? -0.543  45.560  36.370  1.00   13.49 ? 395 HIS C CB    1 
ATOM   9273  C  CG    . HIS C  1 288 ? -0.276  44.169  36.844  1.00   16.44 ? 395 HIS C CG    1 
ATOM   9274  N  ND1   . HIS C  1 288 ? 0.257   43.196  36.025  1.00   17.45 ? 395 HIS C ND1   1 
ATOM   9275  C  CD2   . HIS C  1 288 ? -0.492  43.576  38.041  1.00   16.31 ? 395 HIS C CD2   1 
ATOM   9276  C  CE1   . HIS C  1 288 ? 0.352   42.062  36.695  1.00   15.74 ? 395 HIS C CE1   1 
ATOM   9277  N  NE2   . HIS C  1 288 ? -0.097  42.265  37.921  1.00   17.10 ? 395 HIS C NE2   1 
ATOM   9278  N  N     . LEU C  1 289 ? -0.376  48.518  35.680  1.00   12.30 ? 396 LEU C N     1 
ATOM   9279  C  CA    . LEU C  1 289 ? -0.685  49.644  34.811  1.00   13.37 ? 396 LEU C CA    1 
ATOM   9280  C  C     . LEU C  1 289 ? 0.571   50.396  34.377  1.00   17.42 ? 396 LEU C C     1 
ATOM   9281  O  O     . LEU C  1 289 ? 0.680   50.806  33.221  1.00   18.67 ? 396 LEU C O     1 
ATOM   9282  C  CB    . LEU C  1 289 ? -1.640  50.604  35.512  1.00   11.68 ? 396 LEU C CB    1 
ATOM   9283  C  CG    . LEU C  1 289 ? -3.059  50.072  35.744  1.00   13.58 ? 396 LEU C CG    1 
ATOM   9284  C  CD1   . LEU C  1 289 ? -3.898  51.181  36.367  1.00   14.95 ? 396 LEU C CD1   1 
ATOM   9285  C  CD2   . LEU C  1 289 ? -3.684  49.619  34.425  1.00   10.14 ? 396 LEU C CD2   1 
ATOM   9286  N  N     . VAL C  1 290 ? 1.517   50.576  35.300  1.00   17.87 ? 397 VAL C N     1 
ATOM   9287  C  CA    . VAL C  1 290 ? 2.767   51.275  34.994  1.00   15.12 ? 397 VAL C CA    1 
ATOM   9288  C  C     . VAL C  1 290 ? 3.609   50.495  33.986  1.00   14.20 ? 397 VAL C C     1 
ATOM   9289  O  O     . VAL C  1 290 ? 4.137   51.068  33.036  1.00   12.20 ? 397 VAL C O     1 
ATOM   9290  C  CB    . VAL C  1 290 ? 3.599   51.506  36.277  1.00   12.84 ? 397 VAL C CB    1 
ATOM   9291  C  CG1   . VAL C  1 290 ? 5.005   52.008  35.927  1.00   7.67  ? 397 VAL C CG1   1 
ATOM   9292  C  CG2   . VAL C  1 290 ? 2.870   52.487  37.168  1.00   11.10 ? 397 VAL C CG2   1 
ATOM   9293  N  N     . VAL C  1 291 ? 3.720   49.189  34.202  1.00   12.03 ? 398 VAL C N     1 
ATOM   9294  C  CA    . VAL C  1 291 ? 4.497   48.331  33.326  1.00   13.44 ? 398 VAL C CA    1 
ATOM   9295  C  C     . VAL C  1 291 ? 3.948   48.371  31.904  1.00   14.50 ? 398 VAL C C     1 
ATOM   9296  O  O     . VAL C  1 291 ? 4.691   48.473  30.929  1.00   14.24 ? 398 VAL C O     1 
ATOM   9297  C  CB    . VAL C  1 291 ? 4.464   46.859  33.818  1.00   12.47 ? 398 VAL C CB    1 
ATOM   9298  C  CG1   . VAL C  1 291 ? 5.045   45.936  32.762  1.00   9.30  ? 398 VAL C CG1   1 
ATOM   9299  C  CG2   . VAL C  1 291 ? 5.228   46.731  35.129  1.00   15.16 ? 398 VAL C CG2   1 
ATOM   9300  N  N     . GLN C  1 292 ? 2.629   48.302  31.799  1.00   16.70 ? 399 GLN C N     1 
ATOM   9301  C  CA    . GLN C  1 292 ? 1.960   48.282  30.507  1.00   15.14 ? 399 GLN C CA    1 
ATOM   9302  C  C     . GLN C  1 292 ? 1.904   49.575  29.711  1.00   14.49 ? 399 GLN C C     1 
ATOM   9303  O  O     . GLN C  1 292 ? 1.970   49.546  28.485  1.00   11.39 ? 399 GLN C O     1 
ATOM   9304  C  CB    . GLN C  1 292 ? 0.541   47.747  30.683  1.00   14.94 ? 399 GLN C CB    1 
ATOM   9305  C  CG    . GLN C  1 292 ? 0.481   46.238  30.796  1.00   18.67 ? 399 GLN C CG    1 
ATOM   9306  C  CD    . GLN C  1 292 ? -0.932  45.707  30.654  1.00   21.72 ? 399 GLN C CD    1 
ATOM   9307  O  OE1   . GLN C  1 292 ? -1.689  46.152  29.781  1.00   18.51 ? 399 GLN C OE1   1 
ATOM   9308  N  NE2   . GLN C  1 292 ? -1.295  44.744  31.502  1.00   19.44 ? 399 GLN C NE2   1 
ATOM   9309  N  N     . THR C  1 293 ? 1.803   50.707  30.397  1.00   15.89 ? 400 THR C N     1 
ATOM   9310  C  CA    . THR C  1 293 ? 1.685   51.991  29.722  1.00   13.93 ? 400 THR C CA    1 
ATOM   9311  C  C     . THR C  1 293 ? 2.945   52.835  29.590  1.00   16.06 ? 400 THR C C     1 
ATOM   9312  O  O     . THR C  1 293 ? 2.968   53.785  28.801  1.00   13.29 ? 400 THR C O     1 
ATOM   9313  C  CB    . THR C  1 293 ? 0.617   52.876  30.409  1.00   15.53 ? 400 THR C CB    1 
ATOM   9314  O  OG1   . THR C  1 293 ? 1.027   53.162  31.754  1.00   19.64 ? 400 THR C OG1   1 
ATOM   9315  C  CG2   . THR C  1 293 ? -0.742  52.188  30.432  1.00   12.97 ? 400 THR C CG2   1 
ATOM   9316  N  N     . SER C  1 294 ? 3.992   52.514  30.342  1.00   17.47 ? 401 SER C N     1 
ATOM   9317  C  CA    . SER C  1 294 ? 5.207   53.318  30.258  1.00   18.63 ? 401 SER C CA    1 
ATOM   9318  C  C     . SER C  1 294 ? 5.877   53.252  28.884  1.00   19.78 ? 401 SER C C     1 
ATOM   9319  O  O     . SER C  1 294 ? 5.949   52.203  28.250  1.00   22.26 ? 401 SER C O     1 
ATOM   9320  C  CB    . SER C  1 294 ? 6.165   52.918  31.371  1.00   17.97 ? 401 SER C CB    1 
ATOM   9321  O  OG    . SER C  1 294 ? 5.570   53.225  32.622  1.00   14.15 ? 401 SER C OG    1 
ATOM   9322  N  N     . LYS C  1 295 ? 6.358   54.398  28.423  1.00   21.51 ? 402 LYS C N     1 
ATOM   9323  C  CA    . LYS C  1 295 ? 6.972   54.501  27.104  1.00   21.44 ? 402 LYS C CA    1 
ATOM   9324  C  C     . LYS C  1 295 ? 8.488   54.664  27.095  1.00   22.95 ? 402 LYS C C     1 
ATOM   9325  O  O     . LYS C  1 295 ? 9.026   55.567  27.735  1.00   20.86 ? 402 LYS C O     1 
ATOM   9326  C  CB    . LYS C  1 295 ? 6.371   55.690  26.359  1.00   17.18 ? 402 LYS C CB    1 
ATOM   9327  C  CG    . LYS C  1 295 ? 4.862   55.732  26.316  1.00   16.87 ? 402 LYS C CG    1 
ATOM   9328  C  CD    . LYS C  1 295 ? 4.275   54.570  25.525  1.00   19.44 ? 402 LYS C CD    1 
ATOM   9329  C  CE    . LYS C  1 295 ? 2.798   54.811  25.191  1.00   14.29 ? 402 LYS C CE    1 
ATOM   9330  N  NZ    . LYS C  1 295 ? 1.970   54.972  26.412  1.00   19.89 ? 402 LYS C NZ    1 
ATOM   9331  N  N     . PRO C  1 296 ? 9.193   53.789  26.363  1.00   23.61 ? 403 PRO C N     1 
ATOM   9332  C  CA    . PRO C  1 296 ? 10.653  53.869  26.278  1.00   26.15 ? 403 PRO C CA    1 
ATOM   9333  C  C     . PRO C  1 296 ? 11.013  54.994  25.325  1.00   29.43 ? 403 PRO C C     1 
ATOM   9334  O  O     . PRO C  1 296 ? 11.775  55.888  25.668  1.00   31.50 ? 403 PRO C O     1 
ATOM   9335  C  CB    . PRO C  1 296 ? 11.051  52.511  25.701  1.00   24.51 ? 403 PRO C CB    1 
ATOM   9336  C  CG    . PRO C  1 296 ? 9.952   51.608  26.151  1.00   26.26 ? 403 PRO C CG    1 
ATOM   9337  C  CD    . PRO C  1 296 ? 8.724   52.464  25.931  1.00   24.36 ? 403 PRO C CD    1 
ATOM   9338  N  N     . ALA C  1 297 ? 10.427  54.930  24.129  1.00   33.33 ? 404 ALA C N     1 
ATOM   9339  C  CA    . ALA C  1 297 ? 10.653  55.898  23.058  1.00   34.44 ? 404 ALA C CA    1 
ATOM   9340  C  C     . ALA C  1 297 ? 10.971  57.301  23.557  1.00   35.53 ? 404 ALA C C     1 
ATOM   9341  O  O     . ALA C  1 297 ? 10.278  57.832  24.438  1.00   35.41 ? 404 ALA C O     1 
ATOM   9342  C  CB    . ALA C  1 297 ? 9.444   55.933  22.135  1.00   35.54 ? 404 ALA C CB    1 
ATOM   9343  N  N     . HIS C  1 298 ? 12.018  57.884  22.975  1.00   35.09 ? 405 HIS C N     1 
ATOM   9344  C  CA    . HIS C  1 298 ? 12.506  59.225  23.311  1.00   37.77 ? 405 HIS C CA    1 
ATOM   9345  C  C     . HIS C  1 298 ? 13.623  59.212  24.359  1.00   37.03 ? 405 HIS C C     1 
ATOM   9346  O  O     . HIS C  1 298 ? 14.466  60.118  24.380  1.00   41.96 ? 405 HIS C O     1 
ATOM   9347  C  CB    . HIS C  1 298 ? 11.370  60.141  23.795  1.00   40.75 ? 405 HIS C CB    1 
ATOM   9348  C  CG    . HIS C  1 298 ? 10.326  60.418  22.757  1.00   49.43 ? 405 HIS C CG    1 
ATOM   9349  N  ND1   . HIS C  1 298 ? 10.638  60.782  21.465  1.00   51.71 ? 405 HIS C ND1   1 
ATOM   9350  C  CD2   . HIS C  1 298 ? 8.972   60.396  22.823  1.00   50.50 ? 405 HIS C CD2   1 
ATOM   9351  C  CE1   . HIS C  1 298 ? 9.524   60.968  20.779  1.00   52.22 ? 405 HIS C CE1   1 
ATOM   9352  N  NE2   . HIS C  1 298 ? 8.499   60.739  21.580  1.00   52.00 ? 405 HIS C NE2   1 
ATOM   9353  N  N     . LEU C  1 299 ? 13.640  58.187  25.210  1.00   30.82 ? 406 LEU C N     1 
ATOM   9354  C  CA    . LEU C  1 299 ? 14.651  58.062  26.254  1.00   25.01 ? 406 LEU C CA    1 
ATOM   9355  C  C     . LEU C  1 299 ? 15.888  57.331  25.753  1.00   24.13 ? 406 LEU C C     1 
ATOM   9356  O  O     . LEU C  1 299 ? 15.788  56.204  25.272  1.00   23.75 ? 406 LEU C O     1 
ATOM   9357  C  CB    . LEU C  1 299 ? 14.067  57.310  27.448  1.00   23.43 ? 406 LEU C CB    1 
ATOM   9358  C  CG    . LEU C  1 299 ? 13.579  58.082  28.676  1.00   23.48 ? 406 LEU C CG    1 
ATOM   9359  C  CD1   . LEU C  1 299 ? 12.883  59.378  28.275  1.00   22.29 ? 406 LEU C CD1   1 
ATOM   9360  C  CD2   . LEU C  1 299 ? 12.644  57.178  29.467  1.00   18.61 ? 406 LEU C CD2   1 
ATOM   9361  N  N     . ASN C  1 300 ? 17.054  57.961  25.880  1.00   23.17 ? 407 ASN C N     1 
ATOM   9362  C  CA    . ASN C  1 300 ? 18.300  57.343  25.434  1.00   24.33 ? 407 ASN C CA    1 
ATOM   9363  C  C     . ASN C  1 300 ? 19.011  56.561  26.538  1.00   24.40 ? 407 ASN C C     1 
ATOM   9364  O  O     . ASN C  1 300 ? 19.226  57.064  27.645  1.00   21.57 ? 407 ASN C O     1 
ATOM   9365  C  CB    . ASN C  1 300 ? 19.234  58.407  24.869  1.00   25.87 ? 407 ASN C CB    1 
ATOM   9366  C  CG    . ASN C  1 300 ? 18.562  59.234  23.783  1.00   32.24 ? 407 ASN C CG    1 
ATOM   9367  O  OD1   . ASN C  1 300 ? 18.019  58.687  22.813  1.00   33.34 ? 407 ASN C OD1   1 
ATOM   9368  N  ND2   . ASN C  1 300 ? 18.589  60.557  23.939  1.00   32.52 ? 407 ASN C ND2   1 
ATOM   9369  N  N     . ALA C  1 301 ? 19.375  55.321  26.227  1.00   23.16 ? 408 ALA C N     1 
ATOM   9370  C  CA    . ALA C  1 301 ? 20.065  54.468  27.179  1.00   23.17 ? 408 ALA C CA    1 
ATOM   9371  C  C     . ALA C  1 301 ? 20.873  53.431  26.423  1.00   22.89 ? 408 ALA C C     1 
ATOM   9372  O  O     . ALA C  1 301 ? 20.477  52.977  25.358  1.00   23.35 ? 408 ALA C O     1 
ATOM   9373  C  CB    . ALA C  1 301 ? 19.070  53.790  28.105  1.00   22.54 ? 408 ALA C CB    1 
ATOM   9374  N  N     . ASN C  1 302 ? 22.003  53.044  26.990  1.00   24.57 ? 409 ASN C N     1 
ATOM   9375  C  CA    . ASN C  1 302 ? 22.882  52.091  26.339  1.00   25.87 ? 409 ASN C CA    1 
ATOM   9376  C  C     . ASN C  1 302 ? 22.466  50.649  26.591  1.00   24.10 ? 409 ASN C C     1 
ATOM   9377  O  O     . ASN C  1 302 ? 23.036  49.734  26.011  1.00   24.27 ? 409 ASN C O     1 
ATOM   9378  C  CB    . ASN C  1 302 ? 24.325  52.330  26.825  1.00   29.07 ? 409 ASN C CB    1 
ATOM   9379  C  CG    . ASN C  1 302 ? 25.347  51.493  26.082  1.00   33.30 ? 409 ASN C CG    1 
ATOM   9380  O  OD1   . ASN C  1 302 ? 25.358  50.266  26.183  0.0000 31.55 ? 409 ASN C OD1   1 
ATOM   9381  N  ND2   . ASN C  1 302 ? 26.216  52.155  25.327  0.0000 31.55 ? 409 ASN C ND2   1 
ATOM   9382  N  N     . ASP C  1 303 ? 21.447  50.437  27.418  1.00   22.18 ? 410 ASP C N     1 
ATOM   9383  C  CA    . ASP C  1 303 ? 21.050  49.069  27.743  1.00   19.87 ? 410 ASP C CA    1 
ATOM   9384  C  C     . ASP C  1 303 ? 19.600  48.648  27.490  1.00   19.39 ? 410 ASP C C     1 
ATOM   9385  O  O     . ASP C  1 303 ? 19.097  47.713  28.122  1.00   17.85 ? 410 ASP C O     1 
ATOM   9386  C  CB    . ASP C  1 303 ? 21.394  48.793  29.200  1.00   18.69 ? 410 ASP C CB    1 
ATOM   9387  C  CG    . ASP C  1 303 ? 20.546  49.595  30.141  1.00   20.93 ? 410 ASP C CG    1 
ATOM   9388  O  OD1   . ASP C  1 303 ? 20.283  50.771  29.820  1.00   24.66 ? 410 ASP C OD1   1 
ATOM   9389  O  OD2   . ASP C  1 303 ? 20.146  49.064  31.198  1.00   23.76 ? 410 ASP C OD2   1 
ATOM   9390  N  N     . TRP C  1 304 ? 18.917  49.317  26.575  1.00   19.05 ? 411 TRP C N     1 
ATOM   9391  C  CA    . TRP C  1 304 ? 17.551  48.920  26.293  1.00   17.77 ? 411 TRP C CA    1 
ATOM   9392  C  C     . TRP C  1 304 ? 17.559  47.487  25.783  1.00   19.93 ? 411 TRP C C     1 
ATOM   9393  O  O     . TRP C  1 304 ? 18.320  47.142  24.880  1.00   21.84 ? 411 TRP C O     1 
ATOM   9394  C  CB    . TRP C  1 304 ? 16.931  49.821  25.236  1.00   16.70 ? 411 TRP C CB    1 
ATOM   9395  C  CG    . TRP C  1 304 ? 16.449  51.135  25.762  1.00   19.88 ? 411 TRP C CG    1 
ATOM   9396  C  CD1   . TRP C  1 304 ? 16.920  52.376  25.429  1.00   19.80 ? 411 TRP C CD1   1 
ATOM   9397  C  CD2   . TRP C  1 304 ? 15.366  51.346  26.678  1.00   19.26 ? 411 TRP C CD2   1 
ATOM   9398  N  NE1   . TRP C  1 304 ? 16.191  53.346  26.076  1.00   21.33 ? 411 TRP C NE1   1 
ATOM   9399  C  CE2   . TRP C  1 304 ? 15.230  52.741  26.849  1.00   19.39 ? 411 TRP C CE2   1 
ATOM   9400  C  CE3   . TRP C  1 304 ? 14.495  50.491  27.370  1.00   19.27 ? 411 TRP C CE3   1 
ATOM   9401  C  CZ2   . TRP C  1 304 ? 14.258  53.303  27.683  1.00   17.67 ? 411 TRP C CZ2   1 
ATOM   9402  C  CZ3   . TRP C  1 304 ? 13.528  51.052  28.200  1.00   19.38 ? 411 TRP C CZ3   1 
ATOM   9403  C  CH2   . TRP C  1 304 ? 13.420  52.446  28.346  1.00   18.36 ? 411 TRP C CH2   1 
ATOM   9404  N  N     . ALA C  1 305 ? 16.717  46.644  26.364  1.00   18.68 ? 412 ALA C N     1 
ATOM   9405  C  CA    . ALA C  1 305 ? 16.641  45.261  25.932  1.00   15.95 ? 412 ALA C CA    1 
ATOM   9406  C  C     . ALA C  1 305 ? 15.187  44.819  25.955  1.00   17.26 ? 412 ALA C C     1 
ATOM   9407  O  O     . ALA C  1 305 ? 14.399  45.290  26.778  1.00   18.56 ? 412 ALA C O     1 
ATOM   9408  C  CB    . ALA C  1 305 ? 17.466  44.395  26.840  1.00   12.97 ? 412 ALA C CB    1 
ATOM   9409  N  N     . THR C  1 306 ? 14.831  43.919  25.049  1.00   14.42 ? 413 THR C N     1 
ATOM   9410  C  CA    . THR C  1 306 ? 13.462  43.430  24.966  1.00   16.11 ? 413 THR C CA    1 
ATOM   9411  C  C     . THR C  1 306 ? 13.289  42.166  25.804  1.00   18.00 ? 413 THR C C     1 
ATOM   9412  O  O     . THR C  1 306 ? 13.970  41.166  25.566  1.00   19.71 ? 413 THR C O     1 
ATOM   9413  C  CB    . THR C  1 306 ? 13.079  43.116  23.499  1.00   15.39 ? 413 THR C CB    1 
ATOM   9414  O  OG1   . THR C  1 306 ? 13.192  44.304  22.702  1.00   20.34 ? 413 THR C OG1   1 
ATOM   9415  C  CG2   . THR C  1 306 ? 11.664  42.586  23.418  1.00   13.28 ? 413 THR C CG2   1 
ATOM   9416  N  N     . ASN C  1 307 ? 12.378  42.203  26.781  1.00   18.64 ? 414 ASN C N     1 
ATOM   9417  C  CA    . ASN C  1 307 ? 12.155  41.031  27.633  1.00   18.61 ? 414 ASN C CA    1 
ATOM   9418  C  C     . ASN C  1 307 ? 11.310  39.953  26.952  1.00   19.71 ? 414 ASN C C     1 
ATOM   9419  O  O     . ASN C  1 307 ? 10.885  40.094  25.802  1.00   20.20 ? 414 ASN C O     1 
ATOM   9420  C  CB    . ASN C  1 307 ? 11.538  41.417  29.003  1.00   17.18 ? 414 ASN C CB    1 
ATOM   9421  C  CG    . ASN C  1 307 ? 10.090  41.898  28.912  1.00   19.19 ? 414 ASN C CG    1 
ATOM   9422  O  OD1   . ASN C  1 307 ? 9.381   41.598  27.957  1.00   24.50 ? 414 ASN C OD1   1 
ATOM   9423  N  ND2   . ASN C  1 307 ? 9.640   42.630  29.931  1.00   16.99 ? 414 ASN C ND2   1 
ATOM   9424  N  N     . GLY C  1 308 ? 11.070  38.873  27.681  1.00   20.68 ? 415 GLY C N     1 
ATOM   9425  C  CA    . GLY C  1 308 ? 10.313  37.762  27.141  1.00   19.95 ? 415 GLY C CA    1 
ATOM   9426  C  C     . GLY C  1 308 ? 8.938   38.069  26.595  1.00   18.55 ? 415 GLY C C     1 
ATOM   9427  O  O     . GLY C  1 308 ? 8.396   37.280  25.817  1.00   21.54 ? 415 GLY C O     1 
ATOM   9428  N  N     . VAL C  1 309 ? 8.348   39.190  26.989  1.00   16.41 ? 416 VAL C N     1 
ATOM   9429  C  CA    . VAL C  1 309 ? 7.015   39.507  26.482  1.00   16.00 ? 416 VAL C CA    1 
ATOM   9430  C  C     . VAL C  1 309 ? 6.996   40.658  25.480  1.00   16.52 ? 416 VAL C C     1 
ATOM   9431  O  O     . VAL C  1 309 ? 5.943   41.214  25.182  1.00   15.10 ? 416 VAL C O     1 
ATOM   9432  C  CB    . VAL C  1 309 ? 5.997   39.826  27.620  1.00   15.01 ? 416 VAL C CB    1 
ATOM   9433  C  CG1   . VAL C  1 309 ? 5.800   38.616  28.513  1.00   14.61 ? 416 VAL C CG1   1 
ATOM   9434  C  CG2   . VAL C  1 309 ? 6.446   41.020  28.410  1.00   15.83 ? 416 VAL C CG2   1 
ATOM   9435  N  N     . GLY C  1 310 ? 8.166   41.017  24.965  1.00   17.31 ? 417 GLY C N     1 
ATOM   9436  C  CA    . GLY C  1 310 ? 8.231   42.067  23.968  1.00   18.72 ? 417 GLY C CA    1 
ATOM   9437  C  C     . GLY C  1 310 ? 8.314   43.504  24.440  1.00   18.28 ? 417 GLY C C     1 
ATOM   9438  O  O     . GLY C  1 310 ? 8.158   44.429  23.645  1.00   16.66 ? 417 GLY C O     1 
ATOM   9439  N  N     . ARG C  1 311 ? 8.558   43.711  25.724  1.00   19.52 ? 418 ARG C N     1 
ATOM   9440  C  CA    . ARG C  1 311 ? 8.662   45.068  26.235  1.00   19.45 ? 418 ARG C CA    1 
ATOM   9441  C  C     . ARG C  1 311 ? 10.110  45.465  26.425  1.00   18.26 ? 418 ARG C C     1 
ATOM   9442  O  O     . ARG C  1 311 ? 10.942  44.635  26.773  1.00   19.08 ? 418 ARG C O     1 
ATOM   9443  C  CB    . ARG C  1 311 ? 7.898   45.202  27.546  1.00   17.58 ? 418 ARG C CB    1 
ATOM   9444  C  CG    . ARG C  1 311 ? 6.428   45.224  27.336  1.00   18.73 ? 418 ARG C CG    1 
ATOM   9445  C  CD    . ARG C  1 311 ? 5.741   45.658  28.593  1.00   24.19 ? 418 ARG C CD    1 
ATOM   9446  N  NE    . ARG C  1 311 ? 5.223   44.526  29.343  1.00   25.43 ? 418 ARG C NE    1 
ATOM   9447  C  CZ    . ARG C  1 311 ? 3.934   44.218  29.401  1.00   25.81 ? 418 ARG C CZ    1 
ATOM   9448  N  NH1   . ARG C  1 311 ? 3.530   43.169  30.107  1.00   26.41 ? 418 ARG C NH1   1 
ATOM   9449  N  NH2   . ARG C  1 311 ? 3.050   44.972  28.758  1.00   23.93 ? 418 ARG C NH2   1 
ATOM   9450  N  N     . LYS C  1 312 ? 10.403  46.735  26.173  1.00   19.42 ? 419 LYS C N     1 
ATOM   9451  C  CA    . LYS C  1 312 ? 11.756  47.269  26.308  1.00   21.85 ? 419 LYS C CA    1 
ATOM   9452  C  C     . LYS C  1 312 ? 11.977  47.686  27.747  1.00   21.53 ? 419 LYS C C     1 
ATOM   9453  O  O     . LYS C  1 312 ? 11.130  48.351  28.334  1.00   24.05 ? 419 LYS C O     1 
ATOM   9454  C  CB    . LYS C  1 312 ? 11.934  48.511  25.433  1.00   23.09 ? 419 LYS C CB    1 
ATOM   9455  C  CG    . LYS C  1 312 ? 11.513  48.347  24.005  1.00   27.38 ? 419 LYS C CG    1 
ATOM   9456  C  CD    . LYS C  1 312 ? 12.676  47.914  23.170  1.00   27.73 ? 419 LYS C CD    1 
ATOM   9457  C  CE    . LYS C  1 312 ? 13.748  48.989  23.189  1.00   28.64 ? 419 LYS C CE    1 
ATOM   9458  N  NZ    . LYS C  1 312 ? 13.221  50.294  22.706  1.00   21.39 ? 419 LYS C NZ    1 
ATOM   9459  N  N     . VAL C  1 313 ? 13.114  47.306  28.311  1.00   21.39 ? 420 VAL C N     1 
ATOM   9460  C  CA    . VAL C  1 313 ? 13.433  47.687  29.679  1.00   21.48 ? 420 VAL C CA    1 
ATOM   9461  C  C     . VAL C  1 313 ? 14.880  48.118  29.779  1.00   19.36 ? 420 VAL C C     1 
ATOM   9462  O  O     . VAL C  1 313 ? 15.740  47.610  29.056  1.00   19.34 ? 420 VAL C O     1 
ATOM   9463  C  CB    . VAL C  1 313 ? 13.203  46.529  30.671  1.00   20.55 ? 420 VAL C CB    1 
ATOM   9464  C  CG1   . VAL C  1 313 ? 11.749  46.166  30.701  1.00   22.01 ? 420 VAL C CG1   1 
ATOM   9465  C  CG2   . VAL C  1 313 ? 14.008  45.324  30.261  1.00   24.03 ? 420 VAL C CG2   1 
ATOM   9466  N  N     . SER C  1 314 ? 15.128  49.078  30.664  1.00   18.28 ? 421 SER C N     1 
ATOM   9467  C  CA    . SER C  1 314 ? 16.474  49.585  30.915  1.00   17.32 ? 421 SER C CA    1 
ATOM   9468  C  C     . SER C  1 314 ? 16.683  49.690  32.414  1.00   15.81 ? 421 SER C C     1 
ATOM   9469  O  O     . SER C  1 314 ? 15.748  49.979  33.150  1.00   16.81 ? 421 SER C O     1 
ATOM   9470  C  CB    . SER C  1 314 ? 16.672  50.957  30.283  1.00   16.81 ? 421 SER C CB    1 
ATOM   9471  O  OG    . SER C  1 314 ? 17.833  51.558  30.820  1.00   16.11 ? 421 SER C OG    1 
ATOM   9472  N  N     . HIS C  1 315 ? 17.906  49.452  32.870  1.00   15.48 ? 422 HIS C N     1 
ATOM   9473  C  CA    . HIS C  1 315 ? 18.192  49.530  34.294  1.00   14.35 ? 422 HIS C CA    1 
ATOM   9474  C  C     . HIS C  1 315 ? 18.227  50.980  34.777  1.00   15.56 ? 422 HIS C C     1 
ATOM   9475  O  O     . HIS C  1 315 ? 18.263  51.247  35.983  1.00   16.27 ? 422 HIS C O     1 
ATOM   9476  C  CB    . HIS C  1 315 ? 19.511  48.819  34.597  1.00   13.11 ? 422 HIS C CB    1 
ATOM   9477  C  CG    . HIS C  1 315 ? 19.449  47.334  34.398  1.00   15.00 ? 422 HIS C CG    1 
ATOM   9478  N  ND1   . HIS C  1 315 ? 19.288  46.754  33.156  1.00   14.69 ? 422 HIS C ND1   1 
ATOM   9479  C  CD2   . HIS C  1 315 ? 19.503  46.311  35.283  1.00   14.35 ? 422 HIS C CD2   1 
ATOM   9480  C  CE1   . HIS C  1 315 ? 19.249  45.441  33.285  1.00   14.47 ? 422 HIS C CE1   1 
ATOM   9481  N  NE2   . HIS C  1 315 ? 19.376  45.145  34.566  1.00   14.63 ? 422 HIS C NE2   1 
ATOM   9482  N  N     . SER C  1 316 ? 18.204  51.908  33.827  1.00   14.19 ? 423 SER C N     1 
ATOM   9483  C  CA    . SER C  1 316 ? 18.215  53.324  34.139  1.00   16.73 ? 423 SER C CA    1 
ATOM   9484  C  C     . SER C  1 316 ? 16.818  53.924  34.148  1.00   19.79 ? 423 SER C C     1 
ATOM   9485  O  O     . SER C  1 316 ? 16.583  54.937  34.813  1.00   21.52 ? 423 SER C O     1 
ATOM   9486  C  CB    . SER C  1 316 ? 19.046  54.094  33.116  1.00   15.58 ? 423 SER C CB    1 
ATOM   9487  O  OG    . SER C  1 316 ? 20.409  54.094  33.468  1.00   17.25 ? 423 SER C OG    1 
ATOM   9488  N  N     . TYR C  1 317 ? 15.893  53.293  33.425  1.00   18.96 ? 424 TYR C N     1 
ATOM   9489  C  CA    . TYR C  1 317 ? 14.536  53.813  33.301  1.00   18.45 ? 424 TYR C CA    1 
ATOM   9490  C  C     . TYR C  1 317 ? 13.397  52.859  33.638  1.00   19.30 ? 424 TYR C C     1 
ATOM   9491  O  O     . TYR C  1 317 ? 12.233  53.271  33.730  1.00   19.91 ? 424 TYR C O     1 
ATOM   9492  C  CB    . TYR C  1 317 ? 14.303  54.297  31.870  1.00   17.68 ? 424 TYR C CB    1 
ATOM   9493  C  CG    . TYR C  1 317 ? 15.287  55.323  31.340  1.00   16.45 ? 424 TYR C CG    1 
ATOM   9494  C  CD1   . TYR C  1 317 ? 15.441  56.565  31.966  1.00   17.10 ? 424 TYR C CD1   1 
ATOM   9495  C  CD2   . TYR C  1 317 ? 16.016  55.075  30.174  1.00   14.40 ? 424 TYR C CD2   1 
ATOM   9496  C  CE1   . TYR C  1 317 ? 16.287  57.536  31.443  1.00   16.13 ? 424 TYR C CE1   1 
ATOM   9497  C  CE2   . TYR C  1 317 ? 16.866  56.037  29.640  1.00   14.40 ? 424 TYR C CE2   1 
ATOM   9498  C  CZ    . TYR C  1 317 ? 16.994  57.264  30.281  1.00   17.36 ? 424 TYR C CZ    1 
ATOM   9499  O  OH    . TYR C  1 317 ? 17.824  58.230  29.757  1.00   21.49 ? 424 TYR C OH    1 
ATOM   9500  N  N     . GLY C  1 318 ? 13.708  51.587  33.816  1.00   18.37 ? 425 GLY C N     1 
ATOM   9501  C  CA    . GLY C  1 318 ? 12.644  50.643  34.078  1.00   17.21 ? 425 GLY C CA    1 
ATOM   9502  C  C     . GLY C  1 318 ? 11.902  50.446  32.765  1.00   17.15 ? 425 GLY C C     1 
ATOM   9503  O  O     . GLY C  1 318 ? 12.526  50.215  31.726  1.00   17.55 ? 425 GLY C O     1 
ATOM   9504  N  N     . TYR C  1 319 ? 10.580  50.541  32.786  1.00   16.50 ? 426 TYR C N     1 
ATOM   9505  C  CA    . TYR C  1 319 ? 9.814   50.359  31.558  1.00   16.15 ? 426 TYR C CA    1 
ATOM   9506  C  C     . TYR C  1 319 ? 9.676   51.638  30.739  1.00   17.98 ? 426 TYR C C     1 
ATOM   9507  O  O     . TYR C  1 319 ? 9.036   51.651  29.680  1.00   16.23 ? 426 TYR C O     1 
ATOM   9508  C  CB    . TYR C  1 319 ? 8.436   49.781  31.875  1.00   11.50 ? 426 TYR C CB    1 
ATOM   9509  C  CG    . TYR C  1 319 ? 8.522   48.317  32.172  1.00   11.69 ? 426 TYR C CG    1 
ATOM   9510  C  CD1   . TYR C  1 319 ? 8.824   47.861  33.449  1.00   12.30 ? 426 TYR C CD1   1 
ATOM   9511  C  CD2   . TYR C  1 319 ? 8.424   47.383  31.144  1.00   11.94 ? 426 TYR C CD2   1 
ATOM   9512  C  CE1   . TYR C  1 319 ? 9.035   46.502  33.696  1.00   11.95 ? 426 TYR C CE1   1 
ATOM   9513  C  CE2   . TYR C  1 319 ? 8.630   46.029  31.376  1.00   13.41 ? 426 TYR C CE2   1 
ATOM   9514  C  CZ    . TYR C  1 319 ? 8.939   45.595  32.653  1.00   12.75 ? 426 TYR C CZ    1 
ATOM   9515  O  OH    . TYR C  1 319 ? 9.152   44.253  32.873  1.00   13.00 ? 426 TYR C OH    1 
ATOM   9516  N  N     . GLY C  1 320 ? 10.290  52.712  31.226  1.00   16.43 ? 427 GLY C N     1 
ATOM   9517  C  CA    . GLY C  1 320 ? 10.220  53.969  30.511  1.00   16.52 ? 427 GLY C CA    1 
ATOM   9518  C  C     . GLY C  1 320 ? 9.504   55.108  31.216  1.00   17.31 ? 427 GLY C C     1 
ATOM   9519  O  O     . GLY C  1 320 ? 9.239   55.075  32.411  1.00   21.33 ? 427 GLY C O     1 
ATOM   9520  N  N     . LEU C  1 321 ? 9.186   56.129  30.439  1.00   18.72 ? 428 LEU C N     1 
ATOM   9521  C  CA    . LEU C  1 321 ? 8.530   57.331  30.914  1.00   16.81 ? 428 LEU C CA    1 
ATOM   9522  C  C     . LEU C  1 321 ? 7.072   57.057  31.188  1.00   17.25 ? 428 LEU C C     1 
ATOM   9523  O  O     . LEU C  1 321 ? 6.422   56.349  30.424  1.00   18.73 ? 428 LEU C O     1 
ATOM   9524  C  CB    . LEU C  1 321 ? 8.653   58.398  29.836  1.00   20.22 ? 428 LEU C CB    1 
ATOM   9525  C  CG    . LEU C  1 321 ? 8.852   59.859  30.221  1.00   26.81 ? 428 LEU C CG    1 
ATOM   9526  C  CD1   . LEU C  1 321 ? 10.031  59.996  31.175  1.00   27.84 ? 428 LEU C CD1   1 
ATOM   9527  C  CD2   . LEU C  1 321 ? 9.098   60.665  28.948  1.00   28.07 ? 428 LEU C CD2   1 
ATOM   9528  N  N     . LEU C  1 322 ? 6.552   57.608  32.277  1.00   16.91 ? 429 LEU C N     1 
ATOM   9529  C  CA    . LEU C  1 322 ? 5.144   57.415  32.611  1.00   17.01 ? 429 LEU C CA    1 
ATOM   9530  C  C     . LEU C  1 322 ? 4.294   58.189  31.605  1.00   17.25 ? 429 LEU C C     1 
ATOM   9531  O  O     . LEU C  1 322 ? 4.716   59.227  31.087  1.00   18.87 ? 429 LEU C O     1 
ATOM   9532  C  CB    . LEU C  1 322 ? 4.844   57.907  34.032  1.00   15.94 ? 429 LEU C CB    1 
ATOM   9533  C  CG    . LEU C  1 322 ? 5.426   57.127  35.213  1.00   15.67 ? 429 LEU C CG    1 
ATOM   9534  C  CD1   . LEU C  1 322 ? 5.039   57.816  36.512  1.00   15.30 ? 429 LEU C CD1   1 
ATOM   9535  C  CD2   . LEU C  1 322 ? 4.908   55.692  35.191  1.00   17.27 ? 429 LEU C CD2   1 
ATOM   9536  N  N     . ASP C  1 323 ? 3.106   57.665  31.323  1.00   16.27 ? 430 ASP C N     1 
ATOM   9537  C  CA    . ASP C  1 323 ? 2.168   58.279  30.393  1.00   14.86 ? 430 ASP C CA    1 
ATOM   9538  C  C     . ASP C  1 323 ? 0.839   58.471  31.131  1.00   15.36 ? 430 ASP C C     1 
ATOM   9539  O  O     . ASP C  1 323 ? 0.032   57.547  31.224  1.00   15.97 ? 430 ASP C O     1 
ATOM   9540  C  CB    . ASP C  1 323 ? 1.968   57.366  29.198  1.00   15.98 ? 430 ASP C CB    1 
ATOM   9541  C  CG    . ASP C  1 323 ? 1.193   58.029  28.106  1.00   18.88 ? 430 ASP C CG    1 
ATOM   9542  O  OD1   . ASP C  1 323 ? 0.354   58.901  28.432  1.00   18.21 ? 430 ASP C OD1   1 
ATOM   9543  O  OD2   . ASP C  1 323 ? 1.421   57.672  26.931  1.00   20.05 ? 430 ASP C OD2   1 
ATOM   9544  N  N     . ALA C  1 324 ? 0.612   59.668  31.659  1.00   12.99 ? 431 ALA C N     1 
ATOM   9545  C  CA    . ALA C  1 324 ? -0.600  59.920  32.420  1.00   15.63 ? 431 ALA C CA    1 
ATOM   9546  C  C     . ALA C  1 324 ? -1.859  59.597  31.623  1.00   16.92 ? 431 ALA C C     1 
ATOM   9547  O  O     . ALA C  1 324 ? -2.773  58.925  32.114  1.00   17.46 ? 431 ALA C O     1 
ATOM   9548  C  CB    . ALA C  1 324 ? -0.620  61.359  32.890  1.00   14.76 ? 431 ALA C CB    1 
ATOM   9549  N  N     . GLY C  1 325 ? -1.904  60.076  30.388  1.00   17.39 ? 432 GLY C N     1 
ATOM   9550  C  CA    . GLY C  1 325 ? -3.054  59.803  29.554  1.00   16.84 ? 432 GLY C CA    1 
ATOM   9551  C  C     . GLY C  1 325 ? -3.310  58.310  29.420  1.00   18.28 ? 432 GLY C C     1 
ATOM   9552  O  O     . GLY C  1 325 ? -4.445  57.853  29.601  1.00   19.19 ? 432 GLY C O     1 
ATOM   9553  N  N     . ALA C  1 326 ? -2.256  57.553  29.110  1.00   15.36 ? 433 ALA C N     1 
ATOM   9554  C  CA    . ALA C  1 326 ? -2.363  56.107  28.938  1.00   15.43 ? 433 ALA C CA    1 
ATOM   9555  C  C     . ALA C  1 326 ? -2.770  55.418  30.241  1.00   17.85 ? 433 ALA C C     1 
ATOM   9556  O  O     . ALA C  1 326 ? -3.540  54.448  30.234  1.00   19.49 ? 433 ALA C O     1 
ATOM   9557  C  CB    . ALA C  1 326 ? -1.031  55.539  28.428  1.00   12.23 ? 433 ALA C CB    1 
ATOM   9558  N  N     . MET C  1 327 ? -2.255  55.929  31.357  1.00   17.70 ? 434 MET C N     1 
ATOM   9559  C  CA    . MET C  1 327 ? -2.557  55.369  32.668  1.00   17.60 ? 434 MET C CA    1 
ATOM   9560  C  C     . MET C  1 327 ? -4.038  55.456  33.000  1.00   18.79 ? 434 MET C C     1 
ATOM   9561  O  O     . MET C  1 327 ? -4.660  54.439  33.308  1.00   18.43 ? 434 MET C O     1 
ATOM   9562  C  CB    . MET C  1 327 ? -1.743  56.078  33.756  1.00   17.65 ? 434 MET C CB    1 
ATOM   9563  C  CG    . MET C  1 327 ? -0.276  55.659  33.835  1.00   17.15 ? 434 MET C CG    1 
ATOM   9564  S  SD    . MET C  1 327 ? 0.003   54.032  34.617  1.00   21.73 ? 434 MET C SD    1 
ATOM   9565  C  CE    . MET C  1 327 ? -0.185  54.478  36.398  1.00   16.50 ? 434 MET C CE    1 
ATOM   9566  N  N     . VAL C  1 328 ? -4.609  56.659  32.939  1.00   19.89 ? 435 VAL C N     1 
ATOM   9567  C  CA    . VAL C  1 328 ? -6.027  56.821  33.262  1.00   23.08 ? 435 VAL C CA    1 
ATOM   9568  C  C     . VAL C  1 328 ? -6.930  56.092  32.253  1.00   24.34 ? 435 VAL C C     1 
ATOM   9569  O  O     . VAL C  1 328 ? -8.021  55.612  32.598  1.00   23.29 ? 435 VAL C O     1 
ATOM   9570  C  CB    . VAL C  1 328 ? -6.417  58.316  33.322  1.00   24.27 ? 435 VAL C CB    1 
ATOM   9571  C  CG1   . VAL C  1 328 ? -5.620  59.006  34.430  1.00   20.08 ? 435 VAL C CG1   1 
ATOM   9572  C  CG2   . VAL C  1 328 ? -6.169  58.980  31.967  1.00   22.50 ? 435 VAL C CG2   1 
ATOM   9573  N  N     . ALA C  1 329 ? -6.463  56.002  31.010  1.00   23.22 ? 436 ALA C N     1 
ATOM   9574  C  CA    . ALA C  1 329 ? -7.217  55.325  29.966  1.00   20.22 ? 436 ALA C CA    1 
ATOM   9575  C  C     . ALA C  1 329 ? -7.339  53.843  30.275  1.00   20.37 ? 436 ALA C C     1 
ATOM   9576  O  O     . ALA C  1 329 ? -8.442  53.312  30.317  1.00   22.46 ? 436 ALA C O     1 
ATOM   9577  C  CB    . ALA C  1 329 ? -6.536  55.517  28.641  1.00   18.53 ? 436 ALA C CB    1 
ATOM   9578  N  N     . LEU C  1 330 ? -6.204  53.182  30.500  1.00   19.40 ? 437 LEU C N     1 
ATOM   9579  C  CA    . LEU C  1 330 ? -6.191  51.750  30.793  1.00   17.44 ? 437 LEU C CA    1 
ATOM   9580  C  C     . LEU C  1 330 ? -6.870  51.438  32.120  1.00   19.56 ? 437 LEU C C     1 
ATOM   9581  O  O     . LEU C  1 330 ? -7.532  50.414  32.262  1.00   18.79 ? 437 LEU C O     1 
ATOM   9582  C  CB    . LEU C  1 330 ? -4.750  51.235  30.826  1.00   16.37 ? 437 LEU C CB    1 
ATOM   9583  C  CG    . LEU C  1 330 ? -4.540  49.719  30.904  1.00   14.26 ? 437 LEU C CG    1 
ATOM   9584  C  CD1   . LEU C  1 330 ? -5.133  49.082  29.674  1.00   7.84  ? 437 LEU C CD1   1 
ATOM   9585  C  CD2   . LEU C  1 330 ? -3.063  49.383  31.000  1.00   11.50 ? 437 LEU C CD2   1 
ATOM   9586  N  N     . ALA C  1 331 ? -6.708  52.334  33.085  1.00   22.15 ? 438 ALA C N     1 
ATOM   9587  C  CA    . ALA C  1 331 ? -7.286  52.163  34.410  1.00   24.73 ? 438 ALA C CA    1 
ATOM   9588  C  C     . ALA C  1 331 ? -8.789  51.915  34.407  1.00   26.50 ? 438 ALA C C     1 
ATOM   9589  O  O     . ALA C  1 331 ? -9.293  51.070  35.152  1.00   24.75 ? 438 ALA C O     1 
ATOM   9590  C  CB    . ALA C  1 331 ? -6.979  53.382  35.259  1.00   25.32 ? 438 ALA C CB    1 
ATOM   9591  N  N     . GLN C  1 332 ? -9.499  52.657  33.567  1.00   28.70 ? 439 GLN C N     1 
ATOM   9592  C  CA    . GLN C  1 332 ? -10.949 52.548  33.483  1.00   32.30 ? 439 GLN C CA    1 
ATOM   9593  C  C     . GLN C  1 332 ? -11.509 51.168  33.145  1.00   34.31 ? 439 GLN C C     1 
ATOM   9594  O  O     . GLN C  1 332 ? -12.488 50.736  33.748  1.00   34.42 ? 439 GLN C O     1 
ATOM   9595  C  CB    . GLN C  1 332 ? -11.483 53.579  32.490  1.00   33.13 ? 439 GLN C CB    1 
ATOM   9596  C  CG    . GLN C  1 332 ? -11.272 55.012  32.946  1.00   34.05 ? 439 GLN C CG    1 
ATOM   9597  C  CD    . GLN C  1 332 ? -11.751 56.029  31.931  1.00   35.32 ? 439 GLN C CD    1 
ATOM   9598  O  OE1   . GLN C  1 332 ? -12.938 56.090  31.612  1.00   37.24 ? 439 GLN C OE1   1 
ATOM   9599  N  NE2   . GLN C  1 332 ? -10.826 56.837  31.416  1.00   35.54 ? 439 GLN C NE2   1 
ATOM   9600  N  N     . ASN C  1 333 ? -10.902 50.474  32.188  1.00   36.36 ? 440 ASN C N     1 
ATOM   9601  C  CA    . ASN C  1 333 ? -11.392 49.151  31.815  1.00   37.62 ? 440 ASN C CA    1 
ATOM   9602  C  C     . ASN C  1 333 ? -10.613 48.022  32.496  1.00   37.02 ? 440 ASN C C     1 
ATOM   9603  O  O     . ASN C  1 333 ? -10.808 46.848  32.179  1.00   40.59 ? 440 ASN C O     1 
ATOM   9604  C  CB    . ASN C  1 333 ? -11.322 48.978  30.291  1.00   39.47 ? 440 ASN C CB    1 
ATOM   9605  C  CG    . ASN C  1 333 ? -12.345 49.826  29.559  1.00   39.69 ? 440 ASN C CG    1 
ATOM   9606  O  OD1   . ASN C  1 333 ? -12.416 49.804  28.331  0.0000 39.08 ? 440 ASN C OD1   1 
ATOM   9607  N  ND2   . ASN C  1 333 ? -13.141 50.580  30.309  0.0000 39.08 ? 440 ASN C ND2   1 
ATOM   9608  N  N     . TRP C  1 334 ? -9.755  48.369  33.448  1.00   32.90 ? 441 TRP C N     1 
ATOM   9609  C  CA    . TRP C  1 334 ? -8.928  47.372  34.120  1.00   29.69 ? 441 TRP C CA    1 
ATOM   9610  C  C     . TRP C  1 334 ? -9.649  46.383  35.033  1.00   29.19 ? 441 TRP C C     1 
ATOM   9611  O  O     . TRP C  1 334 ? -10.437 46.768  35.897  1.00   29.74 ? 441 TRP C O     1 
ATOM   9612  C  CB    . TRP C  1 334 ? -7.806  48.067  34.903  1.00   26.95 ? 441 TRP C CB    1 
ATOM   9613  C  CG    . TRP C  1 334 ? -6.794  47.117  35.474  1.00   23.37 ? 441 TRP C CG    1 
ATOM   9614  C  CD1   . TRP C  1 334 ? -6.775  46.595  36.735  1.00   20.62 ? 441 TRP C CD1   1 
ATOM   9615  C  CD2   . TRP C  1 334 ? -5.691  46.521  34.777  1.00   22.55 ? 441 TRP C CD2   1 
ATOM   9616  N  NE1   . TRP C  1 334 ? -5.732  45.708  36.866  1.00   19.44 ? 441 TRP C NE1   1 
ATOM   9617  C  CE2   . TRP C  1 334 ? -5.052  45.644  35.681  1.00   19.79 ? 441 TRP C CE2   1 
ATOM   9618  C  CE3   . TRP C  1 334 ? -5.183  46.641  33.476  1.00   21.72 ? 441 TRP C CE3   1 
ATOM   9619  C  CZ2   . TRP C  1 334 ? -3.930  44.886  35.326  1.00   20.97 ? 441 TRP C CZ2   1 
ATOM   9620  C  CZ3   . TRP C  1 334 ? -4.063  45.883  33.124  1.00   22.31 ? 441 TRP C CZ3   1 
ATOM   9621  C  CH2   . TRP C  1 334 ? -3.451  45.018  34.049  1.00   19.98 ? 441 TRP C CH2   1 
ATOM   9622  N  N     . THR C  1 335 ? -9.354  45.101  34.828  1.00   27.57 ? 442 THR C N     1 
ATOM   9623  C  CA    . THR C  1 335 ? -9.928  44.012  35.613  1.00   27.48 ? 442 THR C CA    1 
ATOM   9624  C  C     . THR C  1 335 ? -8.913  43.622  36.692  1.00   27.96 ? 442 THR C C     1 
ATOM   9625  O  O     . THR C  1 335 ? -7.810  43.174  36.372  1.00   27.76 ? 442 THR C O     1 
ATOM   9626  C  CB    . THR C  1 335 ? -10.186 42.766  34.736  1.00   26.56 ? 442 THR C CB    1 
ATOM   9627  O  OG1   . THR C  1 335 ? -11.058 43.095  33.649  1.00   26.53 ? 442 THR C OG1   1 
ATOM   9628  C  CG2   . THR C  1 335 ? -10.797 41.665  35.568  1.00   25.50 ? 442 THR C CG2   1 
ATOM   9629  N  N     . THR C  1 336 ? -9.282  43.782  37.959  1.00   26.80 ? 443 THR C N     1 
ATOM   9630  C  CA    . THR C  1 336 ? -8.384  43.453  39.063  1.00   25.97 ? 443 THR C CA    1 
ATOM   9631  C  C     . THR C  1 336 ? -7.682  42.107  38.887  1.00   24.49 ? 443 THR C C     1 
ATOM   9632  O  O     . THR C  1 336 ? -8.322  41.090  38.638  1.00   25.36 ? 443 THR C O     1 
ATOM   9633  C  CB    . THR C  1 336 ? -9.146  43.470  40.412  1.00   26.59 ? 443 THR C CB    1 
ATOM   9634  O  OG1   . THR C  1 336 ? -9.401  44.829  40.790  1.00   29.78 ? 443 THR C OG1   1 
ATOM   9635  C  CG2   . THR C  1 336 ? -8.335  42.818  41.498  1.00   23.60 ? 443 THR C CG2   1 
ATOM   9636  N  N     . VAL C  1 337 ? -6.359  42.108  39.024  1.00   22.84 ? 444 VAL C N     1 
ATOM   9637  C  CA    . VAL C  1 337 ? -5.581  40.886  38.869  1.00   21.36 ? 444 VAL C CA    1 
ATOM   9638  C  C     . VAL C  1 337 ? -5.915  39.833  39.919  1.00   22.61 ? 444 VAL C C     1 
ATOM   9639  O  O     . VAL C  1 337 ? -6.447  40.143  40.986  1.00   21.72 ? 444 VAL C O     1 
ATOM   9640  C  CB    . VAL C  1 337 ? -4.063  41.174  38.912  1.00   20.93 ? 444 VAL C CB    1 
ATOM   9641  C  CG1   . VAL C  1 337 ? -3.689  42.097  37.758  1.00   22.90 ? 444 VAL C CG1   1 
ATOM   9642  C  CG2   . VAL C  1 337 ? -3.665  41.794  40.259  1.00   16.69 ? 444 VAL C CG2   1 
ATOM   9643  N  N     . ALA C  1 338 ? -5.596  38.581  39.605  1.00   22.69 ? 445 ALA C N     1 
ATOM   9644  C  CA    . ALA C  1 338 ? -5.854  37.473  40.512  1.00   21.63 ? 445 ALA C CA    1 
ATOM   9645  C  C     . ALA C  1 338 ? -5.001  37.584  41.774  1.00   23.16 ? 445 ALA C C     1 
ATOM   9646  O  O     . ALA C  1 338 ? -4.025  38.339  41.822  1.00   22.01 ? 445 ALA C O     1 
ATOM   9647  C  CB    . ALA C  1 338 ? -5.580  36.152  39.808  1.00   18.69 ? 445 ALA C CB    1 
ATOM   9648  N  N     . PRO C  1 339 ? -5.372  36.837  42.825  1.00   24.51 ? 446 PRO C N     1 
ATOM   9649  C  CA    . PRO C  1 339 ? -4.620  36.866  44.087  1.00   24.07 ? 446 PRO C CA    1 
ATOM   9650  C  C     . PRO C  1 339 ? -3.140  36.575  43.873  1.00   22.24 ? 446 PRO C C     1 
ATOM   9651  O  O     . PRO C  1 339 ? -2.773  35.715  43.078  1.00   23.43 ? 446 PRO C O     1 
ATOM   9652  C  CB    . PRO C  1 339 ? -5.313  35.797  44.918  1.00   22.11 ? 446 PRO C CB    1 
ATOM   9653  C  CG    . PRO C  1 339 ? -6.739  35.901  44.441  1.00   21.01 ? 446 PRO C CG    1 
ATOM   9654  C  CD    . PRO C  1 339 ? -6.572  35.989  42.950  1.00   21.57 ? 446 PRO C CD    1 
ATOM   9655  N  N     . GLN C  1 340 ? -2.293  37.296  44.590  1.00   20.00 ? 447 GLN C N     1 
ATOM   9656  C  CA    . GLN C  1 340 ? -0.857  37.128  44.459  1.00   18.39 ? 447 GLN C CA    1 
ATOM   9657  C  C     . GLN C  1 340 ? -0.362  35.784  44.973  1.00   19.62 ? 447 GLN C C     1 
ATOM   9658  O  O     . GLN C  1 340 ? -0.659  35.406  46.099  1.00   23.78 ? 447 GLN C O     1 
ATOM   9659  C  CB    . GLN C  1 340 ? -0.150  38.242  45.220  1.00   15.46 ? 447 GLN C CB    1 
ATOM   9660  C  CG    . GLN C  1 340 ? 1.344   38.208  45.092  1.00   17.58 ? 447 GLN C CG    1 
ATOM   9661  C  CD    . GLN C  1 340 ? 2.038   38.941  46.221  1.00   20.60 ? 447 GLN C CD    1 
ATOM   9662  O  OE1   . GLN C  1 340 ? 1.880   38.586  47.393  1.00   19.47 ? 447 GLN C OE1   1 
ATOM   9663  N  NE2   . GLN C  1 340 ? 2.815   39.969  45.879  1.00   18.73 ? 447 GLN C NE2   1 
ATOM   9664  N  N     . ARG C  1 341 ? 0.396   35.071  44.147  1.00   18.52 ? 448 ARG C N     1 
ATOM   9665  C  CA    . ARG C  1 341 ? 0.965   33.786  44.534  1.00   17.39 ? 448 ARG C CA    1 
ATOM   9666  C  C     . ARG C  1 341 ? 2.455   33.994  44.747  1.00   17.90 ? 448 ARG C C     1 
ATOM   9667  O  O     . ARG C  1 341 ? 3.060   34.880  44.138  1.00   17.00 ? 448 ARG C O     1 
ATOM   9668  C  CB    . ARG C  1 341 ? 0.762   32.740  43.440  1.00   18.82 ? 448 ARG C CB    1 
ATOM   9669  C  CG    . ARG C  1 341 ? -0.682  32.465  43.102  1.00   19.58 ? 448 ARG C CG    1 
ATOM   9670  C  CD    . ARG C  1 341 ? -0.792  31.388  42.042  1.00   23.20 ? 448 ARG C CD    1 
ATOM   9671  N  NE    . ARG C  1 341 ? -2.176  30.967  41.858  1.00   26.48 ? 448 ARG C NE    1 
ATOM   9672  C  CZ    . ARG C  1 341 ? -2.541  29.841  41.256  1.00   26.93 ? 448 ARG C CZ    1 
ATOM   9673  N  NH1   . ARG C  1 341 ? -3.826  29.541  41.138  1.00   27.52 ? 448 ARG C NH1   1 
ATOM   9674  N  NH2   . ARG C  1 341 ? -1.621  29.013  40.778  1.00   27.91 ? 448 ARG C NH2   1 
ATOM   9675  N  N     . LYS C  1 342 ? 3.046   33.171  45.605  1.00   19.20 ? 449 LYS C N     1 
ATOM   9676  C  CA    . LYS C  1 342 ? 4.471   33.274  45.911  1.00   19.55 ? 449 LYS C CA    1 
ATOM   9677  C  C     . LYS C  1 342 ? 5.089   31.884  45.841  1.00   19.84 ? 449 LYS C C     1 
ATOM   9678  O  O     . LYS C  1 342 ? 4.632   30.959  46.510  1.00   20.61 ? 449 LYS C O     1 
ATOM   9679  C  CB    . LYS C  1 342 ? 4.651   33.868  47.316  1.00   16.47 ? 449 LYS C CB    1 
ATOM   9680  C  CG    . LYS C  1 342 ? 6.084   34.164  47.711  1.00   15.48 ? 449 LYS C CG    1 
ATOM   9681  C  CD    . LYS C  1 342 ? 6.116   34.779  49.096  1.00   15.89 ? 449 LYS C CD    1 
ATOM   9682  C  CE    . LYS C  1 342 ? 7.527   35.032  49.581  1.00   12.99 ? 449 LYS C CE    1 
ATOM   9683  N  NZ    . LYS C  1 342 ? 7.501   35.447  51.012  1.00   14.89 ? 449 LYS C NZ    1 
ATOM   9684  N  N     . CYS C  1 343 ? 6.126   31.730  45.028  1.00   20.99 ? 450 CYS C N     1 
ATOM   9685  C  CA    . CYS C  1 343 ? 6.777   30.432  44.878  1.00   21.05 ? 450 CYS C CA    1 
ATOM   9686  C  C     . CYS C  1 343 ? 8.244   30.539  45.269  1.00   20.56 ? 450 CYS C C     1 
ATOM   9687  O  O     . CYS C  1 343 ? 9.019   31.262  44.632  1.00   19.44 ? 450 CYS C O     1 
ATOM   9688  C  CB    . CYS C  1 343 ? 6.627   29.950  43.427  1.00   21.36 ? 450 CYS C CB    1 
ATOM   9689  S  SG    . CYS C  1 343 ? 7.396   28.348  43.029  1.00   24.29 ? 450 CYS C SG    1 
ATOM   9690  N  N     . ILE C  1 344 ? 8.615   29.824  46.329  1.00   19.18 ? 451 ILE C N     1 
ATOM   9691  C  CA    . ILE C  1 344 ? 9.987   29.842  46.845  1.00   18.78 ? 451 ILE C CA    1 
ATOM   9692  C  C     . ILE C  1 344 ? 10.794  28.647  46.356  1.00   18.23 ? 451 ILE C C     1 
ATOM   9693  O  O     . ILE C  1 344 ? 10.371  27.507  46.504  1.00   20.69 ? 451 ILE C O     1 
ATOM   9694  C  CB    . ILE C  1 344 ? 10.004  29.810  48.386  1.00   16.85 ? 451 ILE C CB    1 
ATOM   9695  C  CG1   . ILE C  1 344 ? 9.243   31.005  48.949  1.00   14.99 ? 451 ILE C CG1   1 
ATOM   9696  C  CG2   . ILE C  1 344 ? 11.433  29.831  48.893  1.00   14.21 ? 451 ILE C CG2   1 
ATOM   9697  C  CD1   . ILE C  1 344 ? 9.188   31.009  50.465  1.00   13.02 ? 451 ILE C CD1   1 
ATOM   9698  N  N     . ILE C  1 345 ? 11.971  28.911  45.800  1.00   18.48 ? 452 ILE C N     1 
ATOM   9699  C  CA    . ILE C  1 345 ? 12.822  27.846  45.278  1.00   19.33 ? 452 ILE C CA    1 
ATOM   9700  C  C     . ILE C  1 345 ? 14.263  28.008  45.737  1.00   21.02 ? 452 ILE C C     1 
ATOM   9701  O  O     . ILE C  1 345 ? 14.977  28.882  45.250  1.00   19.15 ? 452 ILE C O     1 
ATOM   9702  C  CB    . ILE C  1 345 ? 12.826  27.848  43.735  1.00   18.10 ? 452 ILE C CB    1 
ATOM   9703  C  CG1   . ILE C  1 345 ? 11.397  27.907  43.211  1.00   15.75 ? 452 ILE C CG1   1 
ATOM   9704  C  CG2   . ILE C  1 345 ? 13.481  26.588  43.220  1.00   16.71 ? 452 ILE C CG2   1 
ATOM   9705  C  CD1   . ILE C  1 345 ? 11.277  28.420  41.811  1.00   15.16 ? 452 ILE C CD1   1 
ATOM   9706  N  N     . ASP C  1 346 ? 14.693  27.168  46.672  1.00   23.59 ? 453 ASP C N     1 
ATOM   9707  C  CA    . ASP C  1 346 ? 16.065  27.238  47.158  1.00   26.26 ? 453 ASP C CA    1 
ATOM   9708  C  C     . ASP C  1 346 ? 16.909  26.476  46.133  1.00   28.25 ? 453 ASP C C     1 
ATOM   9709  O  O     . ASP C  1 346 ? 16.660  25.300  45.878  1.00   31.17 ? 453 ASP C O     1 
ATOM   9710  C  CB    . ASP C  1 346 ? 16.162  26.600  48.537  1.00   24.25 ? 453 ASP C CB    1 
ATOM   9711  C  CG    . ASP C  1 346 ? 17.233  27.239  49.383  1.00   27.05 ? 453 ASP C CG    1 
ATOM   9712  O  OD1   . ASP C  1 346 ? 17.775  28.285  48.959  1.00   26.00 ? 453 ASP C OD1   1 
ATOM   9713  O  OD2   . ASP C  1 346 ? 17.527  26.703  50.467  1.00   29.94 ? 453 ASP C OD2   1 
ATOM   9714  N  N     . ILE C  1 347 ? 17.904  27.139  45.551  1.00   28.10 ? 454 ILE C N     1 
ATOM   9715  C  CA    . ILE C  1 347 ? 18.723  26.529  44.502  1.00   27.35 ? 454 ILE C CA    1 
ATOM   9716  C  C     . ILE C  1 347 ? 19.944  25.689  44.898  1.00   29.58 ? 454 ILE C C     1 
ATOM   9717  O  O     . ILE C  1 347 ? 20.124  24.582  44.396  1.00   30.49 ? 454 ILE C O     1 
ATOM   9718  C  CB    . ILE C  1 347 ? 19.226  27.608  43.495  1.00   27.18 ? 454 ILE C CB    1 
ATOM   9719  C  CG1   . ILE C  1 347 ? 18.056  28.476  43.004  1.00   22.94 ? 454 ILE C CG1   1 
ATOM   9720  C  CG2   . ILE C  1 347 ? 19.954  26.941  42.327  1.00   24.19 ? 454 ILE C CG2   1 
ATOM   9721  C  CD1   . ILE C  1 347 ? 16.955  27.722  42.334  1.00   24.29 ? 454 ILE C CD1   1 
ATOM   9722  N  N     . LEU C  1 348 ? 20.790  26.207  45.780  1.00   29.83 ? 455 LEU C N     1 
ATOM   9723  C  CA    . LEU C  1 348 ? 22.002  25.494  46.163  1.00   29.87 ? 455 LEU C CA    1 
ATOM   9724  C  C     . LEU C  1 348 ? 21.869  24.239  47.024  1.00   32.35 ? 455 LEU C C     1 
ATOM   9725  O  O     . LEU C  1 348 ? 21.099  24.196  47.985  1.00   33.52 ? 455 LEU C O     1 
ATOM   9726  C  CB    . LEU C  1 348 ? 22.972  26.458  46.848  1.00   26.76 ? 455 LEU C CB    1 
ATOM   9727  C  CG    . LEU C  1 348 ? 23.399  27.730  46.106  1.00   27.37 ? 455 LEU C CG    1 
ATOM   9728  C  CD1   . LEU C  1 348 ? 24.524  28.397  46.881  1.00   25.55 ? 455 LEU C CD1   1 
ATOM   9729  C  CD2   . LEU C  1 348 ? 23.870  27.410  44.711  1.00   24.87 ? 455 LEU C CD2   1 
ATOM   9730  N  N     . THR C  1 349 ? 22.649  23.221  46.667  1.00   33.57 ? 456 THR C N     1 
ATOM