data_4OQB
# 
_entry.id   4OQB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4OQB         
NDB   NA2914       
RCSB  RCSB084816   
WWPDB D_1000084816 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DQY . unspecified 
PDB 4OPX . unspecified 
PDB 4OQA . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4OQB 
_pdbx_database_status.recvd_initial_deposition_date   2014-02-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pascal, J.M.'  1 
'Steffen, J.D.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Discovery and Structure-Activity Relationship of Novel 2,3-Dihydrobenzofuran-7-carboxamide and 2,3-Dihydrobenzofuran-3(2H)-one-7-carboxamide Derivatives as Poly(ADP-ribose)polymerase-1 Inhibitors.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            57 
_citation.page_first                5579 
_citation.page_last                 5601 
_citation.year                      2014 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24922587 
_citation.pdbx_database_id_DOI      10.1021/jm5002502 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patel, M.R.'     1  
primary 'Bhatt, A.'       2  
primary 'Steffen, J.D.'   3  
primary 'Chergui, A.'     4  
primary 'Murai, J.'       5  
primary 'Pommier, Y.'     6  
primary 'Pascal, J.M.'    7  
primary 'Trombetta, L.D.' 8  
primary 'Fronczek, F.R.'  9  
primary 'Talele, T.T.'    10 
# 
_cell.entry_id           4OQB 
_cell.length_a           65.100 
_cell.length_b           113.080 
_cell.length_c           296.230 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4OQB 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly [ADP-ribose] polymerase 1'                                                                30520.051 2 ? ? 
'N-terminus (Zn1-Zn3, SEE REMARK 999)'        ? 
2 polymer     man 'Poly [ADP-ribose] polymerase 1'                                                                57035.020 2 
2.4.2.30 ? 'C-terminus (WGR-CAT, UNP residues 518-1014)' ? 
3 polymer     syn 'DNA (26-MER)'                                                                                  7990.130  2 ? ? 
?                                             ? 
4 non-polymer syn 'ZINC ION'                                                                                      65.409    4 ? ? 
?                                             ? 
5 non-polymer syn '(2Z)-2-{4-[2-(morpholin-4-yl)ethoxy]benzylidene}-3-oxo-2,3-dihydro-1-benzofuran-7-carboxamide' 394.420   1 ? ? 
?                                             ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;PARP-1, ADP-ribosyltransferase diphtheria toxin-like 1, ARTD1, NAD(+) ADP-ribosyltransferase 1, ADPRT 1, Poly[ADP-ribose] synthase 1
;
2 
;PARP-1, ADP-ribosyltransferase diphtheria toxin-like 1, ARTD1, NAD(+) ADP-ribosyltransferase 1, ADPRT 1, Poly[ADP-ribose] synthase 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWD
DQQKVKKTAEAGGVTGKDIKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIF
NKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKK
LKVKKQDRIFPPETSASVALEHHHHHH
;
;MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWD
DQQKVKKTAEAGGVTGKDIKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIF
NKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKK
LKVKKQDRIFPPETSASVALEHHHHHH
;
A,D ? 
2 'polypeptide(L)'        no no 
;KSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIG
SNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIF
DVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADS
VQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIF
KIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIG
LILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQV
NLKYLLKLKFNFKTSLWLEHHHHHH
;
;KSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIG
SNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIF
DVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADS
VQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIF
KIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIG
LILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQV
NLKYLLKLKFNFKTSLWLEHHHHHH
;
C,F ? 
3 polydeoxyribonucleotide no no 
;(DG)(DC)(DC)(DT)(DA)(DC)(DC)(DG)(DG)(DT)(DT)(DC)(DG)(DC)(DG)(DA)(DA)(DC)(DC)(DG)
(DG)(DT)(DA)(DG)(DG)(DC)
;
GCCTACCGGTTCGCGAACCGGTAGGC M,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLU n 
1 4   SER n 
1 5   SER n 
1 6   ASP n 
1 7   LYS n 
1 8   LEU n 
1 9   TYR n 
1 10  ARG n 
1 11  VAL n 
1 12  GLU n 
1 13  TYR n 
1 14  ALA n 
1 15  LYS n 
1 16  SER n 
1 17  GLY n 
1 18  ARG n 
1 19  ALA n 
1 20  SER n 
1 21  CYS n 
1 22  LYS n 
1 23  LYS n 
1 24  CYS n 
1 25  SER n 
1 26  GLU n 
1 27  SER n 
1 28  ILE n 
1 29  PRO n 
1 30  LYS n 
1 31  ASP n 
1 32  SER n 
1 33  LEU n 
1 34  ARG n 
1 35  MET n 
1 36  ALA n 
1 37  ILE n 
1 38  MET n 
1 39  VAL n 
1 40  GLN n 
1 41  SER n 
1 42  PRO n 
1 43  MET n 
1 44  PHE n 
1 45  ASP n 
1 46  GLY n 
1 47  LYS n 
1 48  VAL n 
1 49  PRO n 
1 50  HIS n 
1 51  TRP n 
1 52  TYR n 
1 53  HIS n 
1 54  PHE n 
1 55  SER n 
1 56  CYS n 
1 57  PHE n 
1 58  TRP n 
1 59  LYS n 
1 60  VAL n 
1 61  GLY n 
1 62  HIS n 
1 63  SER n 
1 64  ILE n 
1 65  ARG n 
1 66  HIS n 
1 67  PRO n 
1 68  ASP n 
1 69  VAL n 
1 70  GLU n 
1 71  VAL n 
1 72  ASP n 
1 73  GLY n 
1 74  PHE n 
1 75  SER n 
1 76  GLU n 
1 77  LEU n 
1 78  ARG n 
1 79  TRP n 
1 80  ASP n 
1 81  ASP n 
1 82  GLN n 
1 83  GLN n 
1 84  LYS n 
1 85  VAL n 
1 86  LYS n 
1 87  LYS n 
1 88  THR n 
1 89  ALA n 
1 90  GLU n 
1 91  ALA n 
1 92  GLY n 
1 93  GLY n 
1 94  VAL n 
1 95  THR n 
1 96  GLY n 
1 97  LYS n 
1 98  ASP n 
1 99  ILE n 
1 100 LYS n 
1 101 ARG n 
1 102 LYS n 
1 103 GLY n 
1 104 ASP n 
1 105 GLU n 
1 106 VAL n 
1 107 ASP n 
1 108 GLY n 
1 109 VAL n 
1 110 ASP n 
1 111 GLU n 
1 112 VAL n 
1 113 ALA n 
1 114 LYS n 
1 115 LYS n 
1 116 LYS n 
1 117 SER n 
1 118 LYS n 
1 119 LYS n 
1 120 GLU n 
1 121 LYS n 
1 122 ASP n 
1 123 LYS n 
1 124 ASP n 
1 125 SER n 
1 126 LYS n 
1 127 LEU n 
1 128 GLU n 
1 129 LYS n 
1 130 ALA n 
1 131 LEU n 
1 132 LYS n 
1 133 ALA n 
1 134 GLN n 
1 135 ASN n 
1 136 ASP n 
1 137 LEU n 
1 138 ILE n 
1 139 TRP n 
1 140 ASN n 
1 141 ILE n 
1 142 LYS n 
1 143 ASP n 
1 144 GLU n 
1 145 LEU n 
1 146 LYS n 
1 147 LYS n 
1 148 VAL n 
1 149 CYS n 
1 150 SER n 
1 151 THR n 
1 152 ASN n 
1 153 ASP n 
1 154 LEU n 
1 155 LYS n 
1 156 GLU n 
1 157 LEU n 
1 158 LEU n 
1 159 ILE n 
1 160 PHE n 
1 161 ASN n 
1 162 LYS n 
1 163 GLN n 
1 164 GLN n 
1 165 VAL n 
1 166 PRO n 
1 167 SER n 
1 168 GLY n 
1 169 GLU n 
1 170 SER n 
1 171 ALA n 
1 172 ILE n 
1 173 LEU n 
1 174 ASP n 
1 175 ARG n 
1 176 VAL n 
1 177 ALA n 
1 178 ASP n 
1 179 GLY n 
1 180 MET n 
1 181 VAL n 
1 182 PHE n 
1 183 GLY n 
1 184 ALA n 
1 185 LEU n 
1 186 LEU n 
1 187 PRO n 
1 188 CYS n 
1 189 GLU n 
1 190 GLU n 
1 191 CYS n 
1 192 SER n 
1 193 GLY n 
1 194 GLN n 
1 195 LEU n 
1 196 VAL n 
1 197 PHE n 
1 198 LYS n 
1 199 SER n 
1 200 ASP n 
1 201 ALA n 
1 202 TYR n 
1 203 TYR n 
1 204 CYS n 
1 205 THR n 
1 206 GLY n 
1 207 ASP n 
1 208 VAL n 
1 209 THR n 
1 210 ALA n 
1 211 TRP n 
1 212 THR n 
1 213 LYS n 
1 214 CYS n 
1 215 MET n 
1 216 VAL n 
1 217 LYS n 
1 218 THR n 
1 219 GLN n 
1 220 THR n 
1 221 PRO n 
1 222 ASN n 
1 223 ARG n 
1 224 LYS n 
1 225 GLU n 
1 226 TRP n 
1 227 VAL n 
1 228 THR n 
1 229 PRO n 
1 230 LYS n 
1 231 GLU n 
1 232 PHE n 
1 233 ARG n 
1 234 GLU n 
1 235 ILE n 
1 236 SER n 
1 237 TYR n 
1 238 LEU n 
1 239 LYS n 
1 240 LYS n 
1 241 LEU n 
1 242 LYS n 
1 243 VAL n 
1 244 LYS n 
1 245 LYS n 
1 246 GLN n 
1 247 ASP n 
1 248 ARG n 
1 249 ILE n 
1 250 PHE n 
1 251 PRO n 
1 252 PRO n 
1 253 GLU n 
1 254 THR n 
1 255 SER n 
1 256 ALA n 
1 257 SER n 
1 258 VAL n 
1 259 ALA n 
1 260 LEU n 
1 261 GLU n 
1 262 HIS n 
1 263 HIS n 
1 264 HIS n 
1 265 HIS n 
1 266 HIS n 
1 267 HIS n 
2 1   LYS n 
2 2   SER n 
2 3   GLU n 
2 4   LYS n 
2 5   ARG n 
2 6   MET n 
2 7   LYS n 
2 8   LEU n 
2 9   THR n 
2 10  LEU n 
2 11  LYS n 
2 12  GLY n 
2 13  GLY n 
2 14  ALA n 
2 15  ALA n 
2 16  VAL n 
2 17  ASP n 
2 18  PRO n 
2 19  ASP n 
2 20  SER n 
2 21  GLY n 
2 22  LEU n 
2 23  GLU n 
2 24  HIS n 
2 25  SER n 
2 26  ALA n 
2 27  HIS n 
2 28  VAL n 
2 29  LEU n 
2 30  GLU n 
2 31  LYS n 
2 32  GLY n 
2 33  GLY n 
2 34  LYS n 
2 35  VAL n 
2 36  PHE n 
2 37  SER n 
2 38  ALA n 
2 39  THR n 
2 40  LEU n 
2 41  GLY n 
2 42  LEU n 
2 43  VAL n 
2 44  ASP n 
2 45  ILE n 
2 46  VAL n 
2 47  LYS n 
2 48  GLY n 
2 49  THR n 
2 50  ASN n 
2 51  SER n 
2 52  TYR n 
2 53  TYR n 
2 54  LYS n 
2 55  LEU n 
2 56  GLN n 
2 57  LEU n 
2 58  LEU n 
2 59  GLU n 
2 60  ASP n 
2 61  ASP n 
2 62  LYS n 
2 63  GLU n 
2 64  ASN n 
2 65  ARG n 
2 66  TYR n 
2 67  TRP n 
2 68  ILE n 
2 69  PHE n 
2 70  ARG n 
2 71  SER n 
2 72  TRP n 
2 73  GLY n 
2 74  ARG n 
2 75  VAL n 
2 76  GLY n 
2 77  THR n 
2 78  VAL n 
2 79  ILE n 
2 80  GLY n 
2 81  SER n 
2 82  ASN n 
2 83  LYS n 
2 84  LEU n 
2 85  GLU n 
2 86  GLN n 
2 87  MET n 
2 88  PRO n 
2 89  SER n 
2 90  LYS n 
2 91  GLU n 
2 92  ASP n 
2 93  ALA n 
2 94  ILE n 
2 95  GLU n 
2 96  HIS n 
2 97  PHE n 
2 98  MET n 
2 99  LYS n 
2 100 LEU n 
2 101 TYR n 
2 102 GLU n 
2 103 GLU n 
2 104 LYS n 
2 105 THR n 
2 106 GLY n 
2 107 ASN n 
2 108 ALA n 
2 109 TRP n 
2 110 HIS n 
2 111 SER n 
2 112 LYS n 
2 113 ASN n 
2 114 PHE n 
2 115 THR n 
2 116 LYS n 
2 117 TYR n 
2 118 PRO n 
2 119 LYS n 
2 120 LYS n 
2 121 PHE n 
2 122 TYR n 
2 123 PRO n 
2 124 LEU n 
2 125 GLU n 
2 126 ILE n 
2 127 ASP n 
2 128 TYR n 
2 129 GLY n 
2 130 GLN n 
2 131 ASP n 
2 132 GLU n 
2 133 GLU n 
2 134 ALA n 
2 135 VAL n 
2 136 LYS n 
2 137 LYS n 
2 138 LEU n 
2 139 THR n 
2 140 VAL n 
2 141 ASN n 
2 142 PRO n 
2 143 GLY n 
2 144 THR n 
2 145 LYS n 
2 146 SER n 
2 147 LYS n 
2 148 LEU n 
2 149 PRO n 
2 150 LYS n 
2 151 PRO n 
2 152 VAL n 
2 153 GLN n 
2 154 ASP n 
2 155 LEU n 
2 156 ILE n 
2 157 LYS n 
2 158 MET n 
2 159 ILE n 
2 160 PHE n 
2 161 ASP n 
2 162 VAL n 
2 163 GLU n 
2 164 SER n 
2 165 MET n 
2 166 LYS n 
2 167 LYS n 
2 168 ALA n 
2 169 MET n 
2 170 VAL n 
2 171 GLU n 
2 172 TYR n 
2 173 GLU n 
2 174 ILE n 
2 175 ASP n 
2 176 LEU n 
2 177 GLN n 
2 178 LYS n 
2 179 MET n 
2 180 PRO n 
2 181 LEU n 
2 182 GLY n 
2 183 LYS n 
2 184 LEU n 
2 185 SER n 
2 186 LYS n 
2 187 ARG n 
2 188 GLN n 
2 189 ILE n 
2 190 GLN n 
2 191 ALA n 
2 192 ALA n 
2 193 TYR n 
2 194 SER n 
2 195 ILE n 
2 196 LEU n 
2 197 SER n 
2 198 GLU n 
2 199 VAL n 
2 200 GLN n 
2 201 GLN n 
2 202 ALA n 
2 203 VAL n 
2 204 SER n 
2 205 GLN n 
2 206 GLY n 
2 207 SER n 
2 208 SER n 
2 209 ASP n 
2 210 SER n 
2 211 GLN n 
2 212 ILE n 
2 213 LEU n 
2 214 ASP n 
2 215 LEU n 
2 216 SER n 
2 217 ASN n 
2 218 ARG n 
2 219 PHE n 
2 220 TYR n 
2 221 THR n 
2 222 LEU n 
2 223 ILE n 
2 224 PRO n 
2 225 HIS n 
2 226 ASP n 
2 227 PHE n 
2 228 GLY n 
2 229 MET n 
2 230 LYS n 
2 231 LYS n 
2 232 PRO n 
2 233 PRO n 
2 234 LEU n 
2 235 LEU n 
2 236 ASN n 
2 237 ASN n 
2 238 ALA n 
2 239 ASP n 
2 240 SER n 
2 241 VAL n 
2 242 GLN n 
2 243 ALA n 
2 244 LYS n 
2 245 VAL n 
2 246 GLU n 
2 247 MET n 
2 248 LEU n 
2 249 ASP n 
2 250 ASN n 
2 251 LEU n 
2 252 LEU n 
2 253 ASP n 
2 254 ILE n 
2 255 GLU n 
2 256 VAL n 
2 257 ALA n 
2 258 TYR n 
2 259 SER n 
2 260 LEU n 
2 261 LEU n 
2 262 ARG n 
2 263 GLY n 
2 264 GLY n 
2 265 SER n 
2 266 ASP n 
2 267 ASP n 
2 268 SER n 
2 269 SER n 
2 270 LYS n 
2 271 ASP n 
2 272 PRO n 
2 273 ILE n 
2 274 ASP n 
2 275 VAL n 
2 276 ASN n 
2 277 TYR n 
2 278 GLU n 
2 279 LYS n 
2 280 LEU n 
2 281 LYS n 
2 282 THR n 
2 283 ASP n 
2 284 ILE n 
2 285 LYS n 
2 286 VAL n 
2 287 VAL n 
2 288 ASP n 
2 289 ARG n 
2 290 ASP n 
2 291 SER n 
2 292 GLU n 
2 293 GLU n 
2 294 ALA n 
2 295 GLU n 
2 296 ILE n 
2 297 ILE n 
2 298 ARG n 
2 299 LYS n 
2 300 TYR n 
2 301 VAL n 
2 302 LYS n 
2 303 ASN n 
2 304 THR n 
2 305 HIS n 
2 306 ALA n 
2 307 THR n 
2 308 THR n 
2 309 HIS n 
2 310 ASN n 
2 311 ALA n 
2 312 TYR n 
2 313 ASP n 
2 314 LEU n 
2 315 GLU n 
2 316 VAL n 
2 317 ILE n 
2 318 ASP n 
2 319 ILE n 
2 320 PHE n 
2 321 LYS n 
2 322 ILE n 
2 323 GLU n 
2 324 ARG n 
2 325 GLU n 
2 326 GLY n 
2 327 GLU n 
2 328 CYS n 
2 329 GLN n 
2 330 ARG n 
2 331 TYR n 
2 332 LYS n 
2 333 PRO n 
2 334 PHE n 
2 335 LYS n 
2 336 GLN n 
2 337 LEU n 
2 338 HIS n 
2 339 ASN n 
2 340 ARG n 
2 341 ARG n 
2 342 LEU n 
2 343 LEU n 
2 344 TRP n 
2 345 HIS n 
2 346 GLY n 
2 347 SER n 
2 348 ARG n 
2 349 THR n 
2 350 THR n 
2 351 ASN n 
2 352 PHE n 
2 353 ALA n 
2 354 GLY n 
2 355 ILE n 
2 356 LEU n 
2 357 SER n 
2 358 GLN n 
2 359 GLY n 
2 360 LEU n 
2 361 ARG n 
2 362 ILE n 
2 363 ALA n 
2 364 PRO n 
2 365 PRO n 
2 366 GLU n 
2 367 ALA n 
2 368 PRO n 
2 369 VAL n 
2 370 THR n 
2 371 GLY n 
2 372 TYR n 
2 373 MET n 
2 374 PHE n 
2 375 GLY n 
2 376 LYS n 
2 377 GLY n 
2 378 ILE n 
2 379 TYR n 
2 380 PHE n 
2 381 ALA n 
2 382 ASP n 
2 383 MET n 
2 384 VAL n 
2 385 SER n 
2 386 LYS n 
2 387 SER n 
2 388 ALA n 
2 389 ASN n 
2 390 TYR n 
2 391 CYS n 
2 392 HIS n 
2 393 THR n 
2 394 SER n 
2 395 GLN n 
2 396 GLY n 
2 397 ASP n 
2 398 PRO n 
2 399 ILE n 
2 400 GLY n 
2 401 LEU n 
2 402 ILE n 
2 403 LEU n 
2 404 LEU n 
2 405 GLY n 
2 406 GLU n 
2 407 VAL n 
2 408 ALA n 
2 409 LEU n 
2 410 GLY n 
2 411 ASN n 
2 412 MET n 
2 413 TYR n 
2 414 GLU n 
2 415 LEU n 
2 416 LYS n 
2 417 HIS n 
2 418 ALA n 
2 419 SER n 
2 420 HIS n 
2 421 ILE n 
2 422 SER n 
2 423 LYS n 
2 424 LEU n 
2 425 PRO n 
2 426 LYS n 
2 427 GLY n 
2 428 LYS n 
2 429 HIS n 
2 430 SER n 
2 431 VAL n 
2 432 LYS n 
2 433 GLY n 
2 434 LEU n 
2 435 GLY n 
2 436 LYS n 
2 437 THR n 
2 438 THR n 
2 439 PRO n 
2 440 ASP n 
2 441 PRO n 
2 442 SER n 
2 443 ALA n 
2 444 ASN n 
2 445 ILE n 
2 446 SER n 
2 447 LEU n 
2 448 ASP n 
2 449 GLY n 
2 450 VAL n 
2 451 ASP n 
2 452 VAL n 
2 453 PRO n 
2 454 LEU n 
2 455 GLY n 
2 456 THR n 
2 457 GLY n 
2 458 ILE n 
2 459 SER n 
2 460 SER n 
2 461 GLY n 
2 462 VAL n 
2 463 ASN n 
2 464 ASP n 
2 465 THR n 
2 466 SER n 
2 467 LEU n 
2 468 LEU n 
2 469 TYR n 
2 470 ASN n 
2 471 GLU n 
2 472 TYR n 
2 473 ILE n 
2 474 VAL n 
2 475 TYR n 
2 476 ASP n 
2 477 ILE n 
2 478 ALA n 
2 479 GLN n 
2 480 VAL n 
2 481 ASN n 
2 482 LEU n 
2 483 LYS n 
2 484 TYR n 
2 485 LEU n 
2 486 LEU n 
2 487 LYS n 
2 488 LEU n 
2 489 LYS n 
2 490 PHE n 
2 491 ASN n 
2 492 PHE n 
2 493 LYS n 
2 494 THR n 
2 495 SER n 
2 496 LEU n 
2 497 TRP n 
2 498 LEU n 
2 499 GLU n 
2 500 HIS n 
2 501 HIS n 
2 502 HIS n 
2 503 HIS n 
2 504 HIS n 
2 505 HIS n 
3 1   DG  n 
3 2   DC  n 
3 3   DC  n 
3 4   DT  n 
3 5   DA  n 
3 6   DC  n 
3 7   DC  n 
3 8   DG  n 
3 9   DG  n 
3 10  DT  n 
3 11  DT  n 
3 12  DC  n 
3 13  DG  n 
3 14  DC  n 
3 15  DG  n 
3 16  DA  n 
3 17  DA  n 
3 18  DC  n 
3 19  DC  n 
3 20  DG  n 
3 21  DG  n 
3 22  DT  n 
3 23  DA  n 
3 24  DG  n 
3 25  DG  n 
3 26  DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   97  human ? 'PARP1, ADPRT, PPOL' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 100 259 human ? 'PARP1, ADPRT, PPOL' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ?   ?   human ? 'PARP1, ADPRT, PPOL' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PARP1_HUMAN P09874 1 
;MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWD
DQQKVKKTAEAGGVTGK
;
1   ? 
2 UNP PARP1_HUMAN P09874 1 
;KRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADG
MVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVA

;
207 ? 
3 UNP PARP1_HUMAN P09874 2 
;KSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIG
SNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIF
DVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADS
VQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIF
KIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIG
LILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQV
NLKYLLKLKFNFKTSLW
;
518 ? 
4 PDB 4OQB        4OQB   3 GCCTACCGGTTCGCGAACCGGTAGGC 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4OQB A 1   ? 97  ? P09874 1   ? 97   ? 1   204  
2 2 4OQB A 100 ? 259 ? P09874 207 ? 366  ? 207 366  
3 3 4OQB C 1   ? 497 ? P09874 518 ? 1014 ? 518 1014 
4 1 4OQB D 1   ? 97  ? P09874 1   ? 97   ? 1   204  
5 2 4OQB D 100 ? 259 ? P09874 207 ? 366  ? 207 366  
6 3 4OQB F 1   ? 497 ? P09874 518 ? 1014 ? 518 1014 
7 4 4OQB M 1   ? 26  ? 4OQB   1   ? 26   ? 1   26   
8 4 4OQB N 1   ? 26  ? 4OQB   1   ? 26   ? 1   26   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 4OQB ASP A 98  ? UNP P09874 ? ? LINKER           205  1  
2 4OQB ILE A 99  ? UNP P09874 ? ? LINKER           206  2  
2 4OQB LEU A 260 ? UNP P09874 ? ? 'EXPRESSION TAG' 367  3  
2 4OQB GLU A 261 ? UNP P09874 ? ? 'EXPRESSION TAG' 368  4  
2 4OQB HIS A 262 ? UNP P09874 ? ? 'EXPRESSION TAG' 369  5  
2 4OQB HIS A 263 ? UNP P09874 ? ? 'EXPRESSION TAG' 370  6  
2 4OQB HIS A 264 ? UNP P09874 ? ? 'EXPRESSION TAG' 371  7  
2 4OQB HIS A 265 ? UNP P09874 ? ? 'EXPRESSION TAG' 372  8  
2 4OQB HIS A 266 ? UNP P09874 ? ? 'EXPRESSION TAG' 373  9  
2 4OQB HIS A 267 ? UNP P09874 ? ? 'EXPRESSION TAG' 374  10 
3 4OQB LEU C 498 ? UNP P09874 ? ? 'EXPRESSION TAG' 1015 11 
3 4OQB GLU C 499 ? UNP P09874 ? ? 'EXPRESSION TAG' 1016 12 
3 4OQB HIS C 500 ? UNP P09874 ? ? 'EXPRESSION TAG' 1017 13 
3 4OQB HIS C 501 ? UNP P09874 ? ? 'EXPRESSION TAG' 1018 14 
3 4OQB HIS C 502 ? UNP P09874 ? ? 'EXPRESSION TAG' 1019 15 
3 4OQB HIS C 503 ? UNP P09874 ? ? 'EXPRESSION TAG' 1020 16 
3 4OQB HIS C 504 ? UNP P09874 ? ? 'EXPRESSION TAG' 1021 17 
3 4OQB HIS C 505 ? UNP P09874 ? ? 'EXPRESSION TAG' 1022 18 
5 4OQB ASP D 98  ? UNP P09874 ? ? LINKER           205  19 
5 4OQB ILE D 99  ? UNP P09874 ? ? LINKER           206  20 
5 4OQB LEU D 260 ? UNP P09874 ? ? 'EXPRESSION TAG' 367  21 
5 4OQB GLU D 261 ? UNP P09874 ? ? 'EXPRESSION TAG' 368  22 
5 4OQB HIS D 262 ? UNP P09874 ? ? 'EXPRESSION TAG' 369  23 
5 4OQB HIS D 263 ? UNP P09874 ? ? 'EXPRESSION TAG' 370  24 
5 4OQB HIS D 264 ? UNP P09874 ? ? 'EXPRESSION TAG' 371  25 
5 4OQB HIS D 265 ? UNP P09874 ? ? 'EXPRESSION TAG' 372  26 
5 4OQB HIS D 266 ? UNP P09874 ? ? 'EXPRESSION TAG' 373  27 
5 4OQB HIS D 267 ? UNP P09874 ? ? 'EXPRESSION TAG' 374  28 
6 4OQB LEU F 498 ? UNP P09874 ? ? 'EXPRESSION TAG' 1015 29 
6 4OQB GLU F 499 ? UNP P09874 ? ? 'EXPRESSION TAG' 1016 30 
6 4OQB HIS F 500 ? UNP P09874 ? ? 'EXPRESSION TAG' 1017 31 
6 4OQB HIS F 501 ? UNP P09874 ? ? 'EXPRESSION TAG' 1018 32 
6 4OQB HIS F 502 ? UNP P09874 ? ? 'EXPRESSION TAG' 1019 33 
6 4OQB HIS F 503 ? UNP P09874 ? ? 'EXPRESSION TAG' 1020 34 
6 4OQB HIS F 504 ? UNP P09874 ? ? 'EXPRESSION TAG' 1021 35 
6 4OQB HIS F 505 ? UNP P09874 ? ? 'EXPRESSION TAG' 1022 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2UT non-polymer         . '(2Z)-2-{4-[2-(morpholin-4-yl)ethoxy]benzylidene}-3-oxo-2,3-dihydro-1-benzofuran-7-carboxamide' ? 
'C22 H22 N2 O5'   394.420 
ALA 'L-peptide linking' y ALANINE                                                                                         ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                        ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                      ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                 ? 
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                        ? 
'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                            ? 
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                             ? 
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                            ? 
'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                    ? 
'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                       ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                 ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                         ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                       ? 
'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                      ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                         ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                          ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                      ? 
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                   ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                         ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                          ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                       ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                      ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                        ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                          ? 
'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                                                                                      ? 'Zn 2' 
65.409  
# 
_exptl.entry_id          4OQB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_percent_sol   56.89 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;25 mM HEPES, 150 mM sodium chloride, 1 mM EDTA, 0.1 mM TCEP, 6.8% PEG3350, 2% ethylene glycol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2013-07-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.075 
# 
_reflns.entry_id                     4OQB 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.362 
_reflns.number_obs                   31785 
_reflns.number_all                   32044 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.362 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4OQB 
_refine.ls_number_reflns_obs                     30120 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.362 
_refine.ls_percent_reflns_obs                    98.88 
_refine.ls_R_factor_obs                          0.32306 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.32171 
_refine.ls_R_factor_R_free                       0.34904 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1625 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.924 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.B_iso_mean                               213.836 
_refine.aniso_B[1][1]                            -3.04 
_refine.aniso_B[2][2]                            4.09 
_refine.aniso_B[3][3]                            -1.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 4DQY' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.750 
_refine.overall_SU_ML                            1.034 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             165.478 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10666 
_refine_hist.pdbx_number_atoms_nucleic_acid   1060 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               11759 
_refine_hist.d_res_high                       3.362 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.004  0.019  ? 12142 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.001  0.020  ? 11134 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          0.768  1.882  ? 16612 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            0.859  3.001  ? 25767 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       4.372  5.000  ? 1350  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       32.468 24.828 ? 464   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.930 15.000 ? 2014  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       11.397 15.000 ? 44    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.059  0.200  ? 1772  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.003  0.021  ? 12897 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           0.001  0.020  ? 2645  ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.838  11.062 ? 5420  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               0.838  11.063 ? 5421  ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.599  16.589 ? 6757  ? 'X-RAY DIFFRACTION' 
r_mcangle_other              1.599  16.589 ? 6757  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  0.353  10.689 ? 6722  ? 'X-RAY DIFFRACTION' 
r_scbond_other               0.353  10.690 ? 6723  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scangle_other              0.776  16.015 ? 9840  ? 'X-RAY DIFFRACTION' 
r_long_range_B_refined       3.294  86.596 ? 13569 ? 'X-RAY DIFFRACTION' 
r_long_range_B_other         3.295  86.588 ? 13567 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
1 A 5123  0.00 0.05 'interatomic distance' 1 ? ? ? ? ? ? 1 'X-RAY DIFFRACTION' 
2 D 5123  0.00 0.05 'interatomic distance' 1 ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 
1 A 7596  0.00 0.05 'interatomic distance' 2 ? ? ? ? ? ? 3 'X-RAY DIFFRACTION' 
2 D 7596  0.00 0.05 'interatomic distance' 2 ? ? ? ? ? ? 4 'X-RAY DIFFRACTION' 
1 C 28572 0.02 0.05 'interatomic distance' 3 ? ? ? ? ? ? 5 'X-RAY DIFFRACTION' 
2 F 28572 0.02 0.05 'interatomic distance' 3 ? ? ? ? ? ? 6 'X-RAY DIFFRACTION' 
1 M 1999  0.14 0.05 'interatomic distance' 4 ? ? ? ? ? ? 7 'X-RAY DIFFRACTION' 
2 N 1999  0.14 0.05 'interatomic distance' 4 ? ? ? ? ? ? 8 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.362 
_refine_ls_shell.d_res_low                        3.447 
_refine_ls_shell.number_reflns_R_work             2114 
_refine_ls_shell.R_factor_R_work                  0.525 
_refine_ls_shell.percent_reflns_obs               96.66 
_refine_ls_shell.R_factor_R_free                  0.526 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             117 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 D 1 
1 A 2 
2 D 2 
1 C 3 
2 F 3 
1 M 4 
2 N 4 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 6   A 91   0 0 ? ? ? ? ? ? ? ? 1 ? 
2 D 6   D 91   0 0 ? ? ? ? ? ? ? ? 1 ? 
1 A 224 A 359  0 0 ? ? ? ? ? ? ? ? 2 ? 
2 D 224 D 359  0 0 ? ? ? ? ? ? ? ? 2 ? 
1 C 531 C 1011 0 0 ? ? ? ? ? ? ? ? 3 ? 
2 F 531 F 1011 0 0 ? ? ? ? ? ? ? ? 3 ? 
1 M 1   M 26   0 0 ? ? ? ? ? ? ? ? 4 ? 
2 N 1   N 26   0 0 ? ? ? ? ? ? ? ? 4 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                  4OQB 
_struct.title                     
;Structure of Human PARP-1 bound to a DNA double strand break in complex with (2Z)-2-{4-[2-(morpholin-4-yl)ethoxy]benzylidene}-3-oxo-2,3-dihydro-1-benzofuran-7-carboxamide
;
_struct.pdbx_descriptor           'Poly [ADP-ribose] polymerase 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4OQB 
_struct_keywords.pdbx_keywords   'TRANSFERASE/DNA/TRANSFERASE INHIBITOR' 
_struct_keywords.text            
'zinc finger, DNA binding, PARP, polymerase, DNA repair, poly(ADP-ribosyl)ation, TRANSFERASE-DNA-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 4 ? 
K N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 55  ? LYS A 59  ? SER A 55  LYS A 59  5 ? 5  
HELX_P HELX_P2  2  HIS A 66  ? GLU A 70  ? HIS A 66  GLU A 70  1 ? 5  
HELX_P HELX_P3  3  ARG A 78  ? ALA A 91  ? ARG A 78  ALA A 91  1 ? 14 
HELX_P HELX_P4  4  LYS A 118 ? CYS A 149 ? LYS A 225 CYS A 256 1 ? 32 
HELX_P HELX_P5  5  SER A 150 ? ASN A 161 ? SER A 257 ASN A 268 1 ? 12 
HELX_P HELX_P6  6  GLY A 168 ? PHE A 182 ? GLY A 275 PHE A 289 1 ? 15 
HELX_P HELX_P7  7  GLU A 234 ? LYS A 239 ? GLU A 341 LYS A 346 1 ? 6  
HELX_P HELX_P8  8  SER B 89  ? GLY B 106 ? SER C 606 GLY C 623 1 ? 18 
HELX_P HELX_P9  9  PRO B 149 ? PHE B 160 ? PRO C 666 PHE C 677 1 ? 12 
HELX_P HELX_P10 10 ASP B 161 ? GLU B 171 ? ASP C 678 GLU C 688 1 ? 11 
HELX_P HELX_P11 11 SER B 185 ? GLN B 205 ? SER C 702 GLN C 722 1 ? 21 
HELX_P HELX_P12 12 SER B 208 ? ILE B 223 ? SER C 725 ILE C 740 1 ? 16 
HELX_P HELX_P13 13 ASN B 237 ? ARG B 262 ? ASN C 754 ARG C 779 1 ? 26 
HELX_P HELX_P14 14 ASP B 271 ? LYS B 281 ? ASP C 788 LYS C 798 1 ? 11 
HELX_P HELX_P15 15 SER B 291 ? THR B 304 ? SER C 808 THR C 821 1 ? 14 
HELX_P HELX_P16 16 GLY B 326 ? LYS B 332 ? GLY C 843 LYS C 849 1 ? 7  
HELX_P HELX_P17 17 PRO B 333 ? GLN B 336 ? PRO C 850 GLN C 853 5 ? 4  
HELX_P HELX_P18 18 ASN B 351 ? GLY B 359 ? ASN C 868 GLY C 876 1 ? 9  
HELX_P HELX_P19 19 MET B 383 ? ASN B 389 ? MET C 900 ASN C 906 1 ? 7  
HELX_P HELX_P20 20 TYR B 390 ? HIS B 392 ? TYR C 907 HIS C 909 5 ? 3  
HELX_P HELX_P21 21 PRO B 441 ? ASN B 444 ? PRO C 958 ASN C 961 5 ? 4  
HELX_P HELX_P22 22 SER C 55  ? LYS C 59  ? SER D 55  LYS D 59  5 ? 5  
HELX_P HELX_P23 23 HIS C 66  ? GLU C 70  ? HIS D 66  GLU D 70  1 ? 5  
HELX_P HELX_P24 24 ARG C 78  ? ALA C 91  ? ARG D 78  ALA D 91  1 ? 14 
HELX_P HELX_P25 25 LYS C 118 ? CYS C 149 ? LYS D 225 CYS D 256 1 ? 32 
HELX_P HELX_P26 26 SER C 150 ? ASN C 161 ? SER D 257 ASN D 268 1 ? 12 
HELX_P HELX_P27 27 GLY C 168 ? PHE C 182 ? GLY D 275 PHE D 289 1 ? 15 
HELX_P HELX_P28 28 GLU C 234 ? LYS C 239 ? GLU D 341 LYS D 346 1 ? 6  
HELX_P HELX_P29 29 SER D 89  ? GLY D 106 ? SER F 606 GLY F 623 1 ? 18 
HELX_P HELX_P30 30 PRO D 149 ? PHE D 160 ? PRO F 666 PHE F 677 1 ? 12 
HELX_P HELX_P31 31 ASP D 161 ? GLU D 171 ? ASP F 678 GLU F 688 1 ? 11 
HELX_P HELX_P32 32 SER D 185 ? GLN D 205 ? SER F 702 GLN F 722 1 ? 21 
HELX_P HELX_P33 33 SER D 208 ? ILE D 223 ? SER F 725 ILE F 740 1 ? 16 
HELX_P HELX_P34 34 ASN D 237 ? ARG D 262 ? ASN F 754 ARG F 779 1 ? 26 
HELX_P HELX_P35 35 ASP D 271 ? LYS D 281 ? ASP F 788 LYS F 798 1 ? 11 
HELX_P HELX_P36 36 SER D 291 ? THR D 304 ? SER F 808 THR F 821 1 ? 14 
HELX_P HELX_P37 37 GLY D 326 ? LYS D 332 ? GLY F 843 LYS F 849 1 ? 7  
HELX_P HELX_P38 38 PRO D 333 ? GLN D 336 ? PRO F 850 GLN F 853 5 ? 4  
HELX_P HELX_P39 39 ASN D 351 ? GLY D 359 ? ASN F 868 GLY F 876 1 ? 9  
HELX_P HELX_P40 40 MET D 383 ? ASN D 389 ? MET F 900 ASN F 906 1 ? 7  
HELX_P HELX_P41 41 TYR D 390 ? HIS D 392 ? TYR F 907 HIS F 909 5 ? 3  
HELX_P HELX_P42 42 PRO D 441 ? ASN D 444 ? PRO F 958 ASN F 961 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C HIS 53  ND1 ? ? ? 1_555 J ZN .  ZN ? ? D HIS 53  D ZN 401 1_555 ? ? ? ? ? ? ?            2.072 ? 
metalc2  metalc ? ? A HIS 53  ND1 ? ? ? 1_555 G ZN .  ZN ? ? A HIS 53  A ZN 401 1_555 ? ? ? ? ? ? ?            2.073 ? 
metalc3  metalc ? ? A CYS 24  SG  ? ? ? 1_555 G ZN .  ZN ? ? A CYS 24  A ZN 401 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc4  metalc ? ? A CYS 56  SG  ? ? ? 1_555 G ZN .  ZN ? ? A CYS 56  A ZN 401 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc5  metalc ? ? C CYS 214 SG  ? ? ? 1_555 K ZN .  ZN ? ? D CYS 321 D ZN 402 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc6  metalc ? ? C CYS 56  SG  ? ? ? 1_555 J ZN .  ZN ? ? D CYS 56  D ZN 401 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc7  metalc ? ? A CYS 214 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 321 A ZN 402 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc8  metalc ? ? A CYS 188 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 295 A ZN 402 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc9  metalc ? ? C CYS 24  SG  ? ? ? 1_555 J ZN .  ZN ? ? D CYS 24  D ZN 401 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc10 metalc ? ? C CYS 188 SG  ? ? ? 1_555 K ZN .  ZN ? ? D CYS 295 D ZN 402 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc11 metalc ? ? A CYS 191 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 298 A ZN 402 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc12 metalc ? ? A CYS 21  SG  ? ? ? 1_555 G ZN .  ZN ? ? A CYS 21  A ZN 401 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc13 metalc ? ? C CYS 204 SG  ? ? ? 1_555 K ZN .  ZN ? ? D CYS 311 D ZN 402 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc14 metalc ? ? C CYS 21  SG  ? ? ? 1_555 J ZN .  ZN ? ? D CYS 21  D ZN 401 1_555 ? ? ? ? ? ? ?            2.342 ? 
metalc15 metalc ? ? C CYS 191 SG  ? ? ? 1_555 K ZN .  ZN ? ? D CYS 298 D ZN 402 1_555 ? ? ? ? ? ? ?            2.342 ? 
metalc16 metalc ? ? A CYS 204 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 311 A ZN 402 1_555 ? ? ? ? ? ? ?            2.342 ? 
hydrog1  hydrog ? ? E DG  1   N1  ? ? ? 1_555 F DC 26 N3 ? ? M DG  1   N DC 26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? E DG  1   N2  ? ? ? 1_555 F DC 26 O2 ? ? M DG  1   N DC 26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? E DG  1   O6  ? ? ? 1_555 F DC 26 N4 ? ? M DG  1   N DC 26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? E DC  2   N3  ? ? ? 1_555 F DG 25 N1 ? ? M DC  2   N DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? E DC  2   N4  ? ? ? 1_555 F DG 25 O6 ? ? M DC  2   N DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? E DC  2   O2  ? ? ? 1_555 F DG 25 N2 ? ? M DC  2   N DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? E DC  3   N3  ? ? ? 1_555 F DG 24 N1 ? ? M DC  3   N DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? E DC  3   N4  ? ? ? 1_555 F DG 24 O6 ? ? M DC  3   N DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? E DC  3   O2  ? ? ? 1_555 F DG 24 N2 ? ? M DC  3   N DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? E DT  4   N3  ? ? ? 1_555 F DA 23 N1 ? ? M DT  4   N DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? E DT  4   O4  ? ? ? 1_555 F DA 23 N6 ? ? M DT  4   N DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? E DA  5   N1  ? ? ? 1_555 F DT 22 N3 ? ? M DA  5   N DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? E DA  5   N6  ? ? ? 1_555 F DT 22 O4 ? ? M DA  5   N DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? E DC  6   N4  ? ? ? 1_555 F DG 20 O6 ? ? M DC  6   N DG 20  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog15 hydrog ? ? E DC  6   O2  ? ? ? 1_555 F DG 21 N2 ? ? M DC  6   N DG 21  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog16 hydrog ? ? E DC  7   N3  ? ? ? 1_555 F DG 20 N1 ? ? M DC  7   N DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? E DC  7   N4  ? ? ? 1_555 F DG 20 O6 ? ? M DC  7   N DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? E DC  7   O2  ? ? ? 1_555 F DG 20 N2 ? ? M DC  7   N DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? E DG  8   N1  ? ? ? 1_555 F DC 19 N3 ? ? M DG  8   N DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? E DG  8   N2  ? ? ? 1_555 F DC 19 O2 ? ? M DG  8   N DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? E DG  8   O6  ? ? ? 1_555 F DC 19 N4 ? ? M DG  8   N DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? E DG  9   N1  ? ? ? 1_555 F DC 18 N3 ? ? M DG  9   N DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? E DG  9   N2  ? ? ? 1_555 F DC 18 O2 ? ? M DG  9   N DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? E DG  9   O6  ? ? ? 1_555 F DC 18 N4 ? ? M DG  9   N DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? E DT  10  N3  ? ? ? 1_555 F DA 17 N1 ? ? M DT  10  N DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? E DT  10  O4  ? ? ? 1_555 F DA 17 N6 ? ? M DT  10  N DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? E DT  11  N3  ? ? ? 1_555 F DA 16 N1 ? ? M DT  11  N DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? E DT  11  O4  ? ? ? 1_555 F DA 16 N6 ? ? M DT  11  N DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E DC  12  N3  ? ? ? 1_555 F DG 15 N1 ? ? M DC  12  N DG 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E DC  12  N4  ? ? ? 1_555 F DG 15 O6 ? ? M DC  12  N DG 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DC  12  O2  ? ? ? 1_555 F DG 15 N2 ? ? M DC  12  N DG 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DG  13  N1  ? ? ? 1_555 F DC 14 N3 ? ? M DG  13  N DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DG  13  N2  ? ? ? 1_555 F DC 14 O2 ? ? M DG  13  N DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DG  13  O6  ? ? ? 1_555 F DC 14 N4 ? ? M DG  13  N DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DC  14  O2  ? ? ? 1_555 F DG 13 N2 ? ? M DC  14  N DG 13  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog36 hydrog ? ? E DG  15  N1  ? ? ? 1_555 F DC 12 N3 ? ? M DG  15  N DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DG  15  N2  ? ? ? 1_555 F DC 12 O2 ? ? M DG  15  N DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DG  15  O6  ? ? ? 1_555 F DC 12 N4 ? ? M DG  15  N DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DA  16  N1  ? ? ? 1_555 F DT 11 N3 ? ? M DA  16  N DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DA  16  N6  ? ? ? 1_555 F DT 11 O4 ? ? M DA  16  N DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DA  17  N1  ? ? ? 1_555 F DT 10 N3 ? ? M DA  17  N DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DA  17  N6  ? ? ? 1_555 F DT 10 O4 ? ? M DA  17  N DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DC  18  O2  ? ? ? 1_555 F DG 9  N2 ? ? M DC  18  N DG 9   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog44 hydrog ? ? E DC  19  O2  ? ? ? 1_555 F DG 8  N2 ? ? M DC  19  N DG 8   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog45 hydrog ? ? E DG  20  N2  ? ? ? 1_555 F DC 7  O2 ? ? M DG  20  N DC 7   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog46 hydrog ? ? E DA  23  N1  ? ? ? 1_555 F DT 4  N3 ? ? M DA  23  N DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DA  23  N6  ? ? ? 1_555 F DT 4  O4 ? ? M DA  23  N DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DG  24  N1  ? ? ? 1_555 F DC 3  N3 ? ? M DG  24  N DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DG  24  N2  ? ? ? 1_555 F DC 3  O2 ? ? M DG  24  N DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DG  24  O6  ? ? ? 1_555 F DC 3  N4 ? ? M DG  24  N DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DG  25  N1  ? ? ? 1_555 F DC 2  N3 ? ? M DG  25  N DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DG  25  N2  ? ? ? 1_555 F DC 2  O2 ? ? M DG  25  N DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DG  25  O6  ? ? ? 1_555 F DC 2  N4 ? ? M DG  25  N DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DC  26  N3  ? ? ? 1_555 F DG 1  N1 ? ? M DC  26  N DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DC  26  N4  ? ? ? 1_555 F DG 1  O6 ? ? M DC  26  N DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DC  26  O2  ? ? ? 1_555 F DG 1  N2 ? ? M DC  26  N DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 5 ? 
F ? 5 ? 
G ? 4 ? 
H ? 2 ? 
I ? 2 ? 
J ? 4 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 5 ? 
O ? 5 ? 
P ? 4 ? 
Q ? 2 ? 
R ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? parallel      
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 47  ? HIS A 53  ? LYS A 47  HIS A 53   
A 2 LEU A 33  ? GLN A 40  ? LEU A 33  GLN A 40   
A 3 TYR A 9   ? TYR A 13  ? TYR A 9   TYR A 13   
A 4 VAL A 71  ? ASP A 72  ? VAL A 71  ASP A 72   
B 1 ALA A 184 ? LEU A 185 ? ALA A 291 LEU A 292  
B 2 ARG A 223 ? LYS A 224 ? ARG A 330 LYS A 331  
C 1 LEU A 195 ? LYS A 198 ? LEU A 302 LYS A 305  
C 2 ALA A 201 ? CYS A 204 ? ALA A 308 CYS A 311  
C 3 LYS A 217 ? THR A 218 ? LYS A 324 THR A 325  
D 1 GLU B 30  ? LYS B 31  ? GLU C 547 LYS C 548  
D 2 LYS B 34  ? VAL B 35  ? LYS C 551 VAL C 552  
E 1 GLY B 80  ? GLU B 85  ? GLY C 597 GLU C 602  
E 2 ILE B 68  ? ARG B 74  ? ILE C 585 ARG C 591  
E 3 ASN B 50  ? GLN B 56  ? ASN C 567 GLN C 573  
E 4 SER B 37  ? VAL B 43  ? SER C 554 VAL C 560  
E 5 TYR B 122 ? LEU B 124 ? TYR C 639 LEU C 641  
F 1 THR B 282 ? VAL B 286 ? THR C 799 VAL C 803  
F 2 VAL B 316 ? ARG B 324 ? VAL C 833 ARG C 841  
F 3 LEU B 482 ? LYS B 489 ? LEU C 999 LYS C 1006 
F 4 ILE B 399 ? ALA B 408 ? ILE C 916 ALA C 925  
F 5 ARG B 340 ? GLY B 346 ? ARG C 857 GLY C 863  
G 1 ILE B 378 ? PHE B 380 ? ILE C 895 PHE C 897  
G 2 GLU B 471 ? VAL B 474 ? GLU C 988 VAL C 991  
G 3 SER B 430 ? GLY B 433 ? SER C 947 GLY C 950  
G 4 MET B 412 ? LEU B 415 ? MET C 929 LEU C 932  
H 1 THR B 437 ? PRO B 439 ? THR C 954 PRO C 956  
H 2 GLY B 457 ? SER B 459 ? GLY C 974 SER C 976  
I 1 ILE B 445 ? SER B 446 ? ILE C 962 SER C 963  
I 2 ASP B 451 ? VAL B 452 ? ASP C 968 VAL C 969  
J 1 LYS C 47  ? HIS C 53  ? LYS D 47  HIS D 53   
J 2 LEU C 33  ? GLN C 40  ? LEU D 33  GLN D 40   
J 3 TYR C 9   ? TYR C 13  ? TYR D 9   TYR D 13   
J 4 VAL C 71  ? ASP C 72  ? VAL D 71  ASP D 72   
K 1 ALA C 184 ? LEU C 185 ? ALA D 291 LEU D 292  
K 2 ARG C 223 ? LYS C 224 ? ARG D 330 LYS D 331  
L 1 LEU C 195 ? LYS C 198 ? LEU D 302 LYS D 305  
L 2 ALA C 201 ? CYS C 204 ? ALA D 308 CYS D 311  
L 3 LYS C 217 ? THR C 218 ? LYS D 324 THR D 325  
M 1 GLU D 30  ? LYS D 31  ? GLU F 547 LYS F 548  
M 2 LYS D 34  ? VAL D 35  ? LYS F 551 VAL F 552  
N 1 GLY D 80  ? GLU D 85  ? GLY F 597 GLU F 602  
N 2 ILE D 68  ? ARG D 74  ? ILE F 585 ARG F 591  
N 3 ASN D 50  ? GLN D 56  ? ASN F 567 GLN F 573  
N 4 SER D 37  ? VAL D 43  ? SER F 554 VAL F 560  
N 5 TYR D 122 ? LEU D 124 ? TYR F 639 LEU F 641  
O 1 THR D 282 ? VAL D 286 ? THR F 799 VAL F 803  
O 2 VAL D 316 ? ARG D 324 ? VAL F 833 ARG F 841  
O 3 LEU D 482 ? LYS D 489 ? LEU F 999 LYS F 1006 
O 4 ILE D 399 ? ALA D 408 ? ILE F 916 ALA F 925  
O 5 ARG D 340 ? GLY D 346 ? ARG F 857 GLY F 863  
P 1 ILE D 378 ? PHE D 380 ? ILE F 895 PHE F 897  
P 2 GLU D 471 ? VAL D 474 ? GLU F 988 VAL F 991  
P 3 SER D 430 ? GLY D 433 ? SER F 947 GLY F 950  
P 4 MET D 412 ? LEU D 415 ? MET F 929 LEU F 932  
Q 1 THR D 437 ? PRO D 439 ? THR F 954 PRO F 956  
Q 2 GLY D 457 ? SER D 459 ? GLY F 974 SER F 976  
R 1 ILE D 445 ? SER D 446 ? ILE F 962 SER F 963  
R 2 ASP D 451 ? VAL D 452 ? ASP F 968 VAL F 969  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 48  ? O VAL A 48   N VAL A 39  ? N VAL A 39   
A 2 3 O ALA A 36  ? O ALA A 36   N ARG A 10  ? N ARG A 10   
A 3 4 N VAL A 11  ? N VAL A 11   O ASP A 72  ? O ASP A 72   
B 1 2 N ALA A 184 ? N ALA A 291  O LYS A 224 ? O LYS A 331  
C 1 2 N LYS A 198 ? N LYS A 305  O ALA A 201 ? O ALA A 308  
C 2 3 N TYR A 202 ? N TYR A 309  O THR A 218 ? O THR A 325  
D 1 2 N LYS B 31  ? N LYS C 548  O LYS B 34  ? O LYS C 551  
E 1 2 O GLU B 85  ? O GLU C 602  N ILE B 68  ? N ILE C 585  
E 2 3 O SER B 71  ? O SER C 588  N LYS B 54  ? N LYS C 571  
E 3 4 O LEU B 55  ? O LEU C 572  N ALA B 38  ? N ALA C 555  
E 4 5 N THR B 39  ? N THR C 556  O LEU B 124 ? O LEU C 641  
F 1 2 N ASP B 283 ? N ASP C 800  O GLU B 323 ? O GLU C 840  
F 2 3 N PHE B 320 ? N PHE C 837  O LEU B 485 ? O LEU C 1002 
F 3 4 O LEU B 488 ? O LEU C 1005 N GLY B 400 ? N GLY C 917  
F 4 5 O LEU B 403 ? O LEU C 920  N HIS B 345 ? N HIS C 862  
G 1 2 N PHE B 380 ? N PHE C 897  O TYR B 472 ? O TYR C 989  
G 2 3 O GLU B 471 ? O GLU C 988  N GLY B 433 ? N GLY C 950  
G 3 4 O LYS B 432 ? O LYS C 949  N LEU B 415 ? N LEU C 932  
H 1 2 N THR B 438 ? N THR C 955  O ILE B 458 ? O ILE C 975  
I 1 2 N ILE B 445 ? N ILE C 962  O VAL B 452 ? O VAL C 969  
J 1 2 O VAL C 48  ? O VAL D 48   N VAL C 39  ? N VAL D 39   
J 2 3 O ALA C 36  ? O ALA D 36   N ARG C 10  ? N ARG D 10   
J 3 4 N VAL C 11  ? N VAL D 11   O ASP C 72  ? O ASP D 72   
K 1 2 N ALA C 184 ? N ALA D 291  O LYS C 224 ? O LYS D 331  
L 1 2 N LYS C 198 ? N LYS D 305  O ALA C 201 ? O ALA D 308  
L 2 3 N TYR C 202 ? N TYR D 309  O THR C 218 ? O THR D 325  
M 1 2 N LYS D 31  ? N LYS F 548  O LYS D 34  ? O LYS F 551  
N 1 2 O GLU D 85  ? O GLU F 602  N ILE D 68  ? N ILE F 585  
N 2 3 O SER D 71  ? O SER F 588  N LYS D 54  ? N LYS F 571  
N 3 4 O LEU D 55  ? O LEU F 572  N ALA D 38  ? N ALA F 555  
N 4 5 N THR D 39  ? N THR F 556  O LEU D 124 ? O LEU F 641  
O 1 2 N ASP D 283 ? N ASP F 800  O GLU D 323 ? O GLU F 840  
O 2 3 N PHE D 320 ? N PHE F 837  O LEU D 485 ? O LEU F 1002 
O 3 4 O LEU D 488 ? O LEU F 1005 N GLY D 400 ? N GLY F 917  
O 4 5 O LEU D 403 ? O LEU F 920  N HIS D 345 ? N HIS F 862  
P 1 2 N PHE D 380 ? N PHE F 897  O TYR D 472 ? O TYR F 989  
P 2 3 O GLU D 471 ? O GLU F 988  N GLY D 433 ? N GLY F 950  
P 3 4 O LYS D 432 ? O LYS F 949  N LEU D 415 ? N LEU F 932  
Q 1 2 N THR D 438 ? N THR F 955  O ILE D 458 ? O ILE F 975  
R 1 2 N ILE D 445 ? N ILE F 962  O VAL D 452 ? O VAL F 969  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 401'   
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 402'   
AC3 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE 2UT C 1101' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 401'   
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 402'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 21  ? CYS A 21  . ? 1_555 ? 
2  AC1 4 CYS A 24  ? CYS A 24  . ? 1_555 ? 
3  AC1 4 HIS A 53  ? HIS A 53  . ? 1_555 ? 
4  AC1 4 CYS A 56  ? CYS A 56  . ? 1_555 ? 
5  AC2 4 CYS A 188 ? CYS A 295 . ? 1_555 ? 
6  AC2 4 CYS A 191 ? CYS A 298 . ? 1_555 ? 
7  AC2 4 CYS A 204 ? CYS A 311 . ? 1_555 ? 
8  AC2 4 CYS A 214 ? CYS A 321 . ? 1_555 ? 
9  AC3 9 ASP B 249 ? ASP C 766 . ? 1_555 ? 
10 AC3 9 HIS B 345 ? HIS C 862 . ? 1_555 ? 
11 AC3 9 GLY B 346 ? GLY C 863 . ? 1_555 ? 
12 AC3 9 ARG B 361 ? ARG C 878 . ? 1_555 ? 
13 AC3 9 TYR B 372 ? TYR C 889 . ? 1_555 ? 
14 AC3 9 ALA B 381 ? ALA C 898 . ? 1_555 ? 
15 AC3 9 SER B 387 ? SER C 904 . ? 1_555 ? 
16 AC3 9 TYR B 390 ? TYR C 907 . ? 1_555 ? 
17 AC3 9 GLU B 471 ? GLU C 988 . ? 1_555 ? 
18 AC4 4 CYS C 21  ? CYS D 21  . ? 1_555 ? 
19 AC4 4 CYS C 24  ? CYS D 24  . ? 1_555 ? 
20 AC4 4 HIS C 53  ? HIS D 53  . ? 1_555 ? 
21 AC4 4 CYS C 56  ? CYS D 56  . ? 1_555 ? 
22 AC5 4 CYS C 188 ? CYS D 295 . ? 1_555 ? 
23 AC5 4 CYS C 191 ? CYS D 298 . ? 1_555 ? 
24 AC5 4 CYS C 204 ? CYS D 311 . ? 1_555 ? 
25 AC5 4 CYS C 214 ? CYS D 321 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4OQB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4OQB 
_atom_sites.fract_transf_matrix[1][1]   0.015361 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008843 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003376 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASP A 1 6   ? -19.125 56.646 1.635   1.00 153.01 ? 6    ASP A N     1 
ATOM   2     C  CA    . ASP A 1 6   ? -20.359 56.450 0.818   1.00 155.32 ? 6    ASP A CA    1 
ATOM   3     C  C     . ASP A 1 6   ? -20.969 57.794 0.421   1.00 153.84 ? 6    ASP A C     1 
ATOM   4     O  O     . ASP A 1 6   ? -21.252 58.033 -0.753  1.00 154.94 ? 6    ASP A O     1 
ATOM   5     C  CB    . ASP A 1 6   ? -21.383 55.614 1.595   1.00 157.44 ? 6    ASP A CB    1 
ATOM   6     C  CG    . ASP A 1 6   ? -22.558 55.169 0.736   1.00 161.18 ? 6    ASP A CG    1 
ATOM   7     O  OD1   . ASP A 1 6   ? -22.340 54.790 -0.436  1.00 163.46 ? 6    ASP A OD1   1 
ATOM   8     O  OD2   . ASP A 1 6   ? -23.701 55.187 1.239   1.00 162.25 ? 6    ASP A OD2   1 
ATOM   9     N  N     . LYS A 1 7   ? -21.160 58.664 1.410   1.00 151.45 ? 7    LYS A N     1 
ATOM   10    C  CA    . LYS A 1 7   ? -21.754 59.982 1.188   1.00 150.55 ? 7    LYS A CA    1 
ATOM   11    C  C     . LYS A 1 7   ? -20.698 60.971 0.700   1.00 148.77 ? 7    LYS A C     1 
ATOM   12    O  O     . LYS A 1 7   ? -19.499 60.735 0.852   1.00 148.04 ? 7    LYS A O     1 
ATOM   13    C  CB    . LYS A 1 7   ? -22.384 60.515 2.480   1.00 149.65 ? 7    LYS A CB    1 
ATOM   14    C  CG    . LYS A 1 7   ? -23.379 59.580 3.156   1.00 151.05 ? 7    LYS A CG    1 
ATOM   15    C  CD    . LYS A 1 7   ? -24.600 59.310 2.291   1.00 153.64 ? 7    LYS A CD    1 
ATOM   16    C  CE    . LYS A 1 7   ? -25.841 59.070 3.139   1.00 154.92 ? 7    LYS A CE    1 
ATOM   17    N  NZ    . LYS A 1 7   ? -26.351 60.328 3.753   1.00 153.54 ? 7    LYS A NZ    1 
ATOM   18    N  N     . LEU A 1 8   ? -21.153 62.079 0.119   1.00 148.36 ? 8    LEU A N     1 
ATOM   19    C  CA    . LEU A 1 8   ? -20.253 63.144 -0.330  1.00 147.21 ? 8    LEU A CA    1 
ATOM   20    C  C     . LEU A 1 8   ? -19.798 64.005 0.846   1.00 144.80 ? 8    LEU A C     1 
ATOM   21    O  O     . LEU A 1 8   ? -18.613 64.314 0.970   1.00 144.13 ? 8    LEU A O     1 
ATOM   22    C  CB    . LEU A 1 8   ? -20.932 64.022 -1.390  1.00 148.88 ? 8    LEU A CB    1 
ATOM   23    C  CG    . LEU A 1 8   ? -20.174 65.264 -1.881  1.00 149.18 ? 8    LEU A CG    1 
ATOM   24    C  CD1   . LEU A 1 8   ? -18.757 64.931 -2.327  1.00 149.31 ? 8    LEU A CD1   1 
ATOM   25    C  CD2   . LEU A 1 8   ? -20.941 65.934 -3.012  1.00 151.42 ? 8    LEU A CD2   1 
ATOM   26    N  N     . TYR A 1 9   ? -20.744 64.386 1.702   1.00 143.96 ? 9    TYR A N     1 
ATOM   27    C  CA    . TYR A 1 9   ? -20.463 65.276 2.830   1.00 142.72 ? 9    TYR A CA    1 
ATOM   28    C  C     . TYR A 1 9   ? -20.420 64.525 4.161   1.00 141.55 ? 9    TYR A C     1 
ATOM   29    O  O     . TYR A 1 9   ? -20.805 63.355 4.239   1.00 142.02 ? 9    TYR A O     1 
ATOM   30    C  CB    . TYR A 1 9   ? -21.497 66.403 2.877   1.00 143.29 ? 9    TYR A CB    1 
ATOM   31    C  CG    . TYR A 1 9   ? -21.547 67.212 1.598   1.00 144.78 ? 9    TYR A CG    1 
ATOM   32    C  CD1   . TYR A 1 9   ? -20.572 68.165 1.316   1.00 145.06 ? 9    TYR A CD1   1 
ATOM   33    C  CD2   . TYR A 1 9   ? -22.562 67.016 0.664   1.00 146.29 ? 9    TYR A CD2   1 
ATOM   34    C  CE1   . TYR A 1 9   ? -20.609 68.906 0.145   1.00 146.82 ? 9    TYR A CE1   1 
ATOM   35    C  CE2   . TYR A 1 9   ? -22.607 67.752 -0.510  1.00 148.02 ? 9    TYR A CE2   1 
ATOM   36    C  CZ    . TYR A 1 9   ? -21.629 68.695 -0.764  1.00 148.29 ? 9    TYR A CZ    1 
ATOM   37    O  OH    . TYR A 1 9   ? -21.671 69.428 -1.928  1.00 150.47 ? 9    TYR A OH    1 
ATOM   38    N  N     . ARG A 1 10  ? -19.947 65.214 5.198   1.00 140.61 ? 10   ARG A N     1 
ATOM   39    C  CA    A ARG A 1 10  ? -19.755 64.616 6.523   0.50 139.89 ? 10   ARG A CA    1 
ATOM   40    C  CA    B ARG A 1 10  ? -19.768 64.617 6.514   0.50 139.89 ? 10   ARG A CA    1 
ATOM   41    C  C     . ARG A 1 10  ? -19.763 65.707 7.593   1.00 139.95 ? 10   ARG A C     1 
ATOM   42    O  O     . ARG A 1 10  ? -19.118 66.744 7.433   1.00 140.18 ? 10   ARG A O     1 
ATOM   43    C  CB    A ARG A 1 10  ? -18.427 63.841 6.562   0.50 139.52 ? 10   ARG A CB    1 
ATOM   44    C  CB    B ARG A 1 10  ? -18.468 63.810 6.543   0.50 139.51 ? 10   ARG A CB    1 
ATOM   45    C  CG    A ARG A 1 10  ? -17.959 63.380 7.941   0.50 139.07 ? 10   ARG A CG    1 
ATOM   46    C  CG    B ARG A 1 10  ? -18.228 63.088 7.859   0.50 139.10 ? 10   ARG A CG    1 
ATOM   47    C  CD    A ARG A 1 10  ? -18.879 62.345 8.563   0.50 139.12 ? 10   ARG A CD    1 
ATOM   48    C  CD    B ARG A 1 10  ? -16.869 62.400 7.902   0.50 139.10 ? 10   ARG A CD    1 
ATOM   49    N  NE    A ARG A 1 10  ? -18.450 62.007 9.918   0.50 139.05 ? 10   ARG A NE    1 
ATOM   50    N  NE    B ARG A 1 10  ? -16.892 61.052 7.333   0.50 139.60 ? 10   ARG A NE    1 
ATOM   51    C  CZ    A ARG A 1 10  ? -19.084 61.153 10.714  0.50 139.59 ? 10   ARG A CZ    1 
ATOM   52    C  CZ    B ARG A 1 10  ? -15.823 60.267 7.232   0.50 139.91 ? 10   ARG A CZ    1 
ATOM   53    N  NH1   A ARG A 1 10  ? -20.182 60.542 10.294  0.50 140.30 ? 10   ARG A NH1   1 
ATOM   54    N  NH1   B ARG A 1 10  ? -14.642 60.696 7.657   0.50 139.77 ? 10   ARG A NH1   1 
ATOM   55    N  NH2   A ARG A 1 10  ? -18.619 60.909 11.931  0.50 139.96 ? 10   ARG A NH2   1 
ATOM   56    N  NH2   B ARG A 1 10  ? -15.930 59.053 6.705   0.50 140.79 ? 10   ARG A NH2   1 
ATOM   57    N  N     . VAL A 1 11  ? -20.489 65.465 8.685   1.00 140.11 ? 11   VAL A N     1 
ATOM   58    C  CA    . VAL A 1 11  ? -20.562 66.412 9.805   1.00 140.28 ? 11   VAL A CA    1 
ATOM   59    C  C     . VAL A 1 11  ? -20.329 65.695 11.137  1.00 140.26 ? 11   VAL A C     1 
ATOM   60    O  O     . VAL A 1 11  ? -20.820 64.585 11.349  1.00 140.55 ? 11   VAL A O     1 
ATOM   61    C  CB    . VAL A 1 11  ? -21.915 67.169 9.832   1.00 140.69 ? 11   VAL A CB    1 
ATOM   62    C  CG1   . VAL A 1 11  ? -23.071 66.237 10.171  1.00 140.65 ? 11   VAL A CG1   1 
ATOM   63    C  CG2   . VAL A 1 11  ? -21.868 68.333 10.814  1.00 141.36 ? 11   VAL A CG2   1 
ATOM   64    N  N     . GLU A 1 12  ? -19.571 66.337 12.024  1.00 140.67 ? 12   GLU A N     1 
ATOM   65    C  CA    . GLU A 1 12  ? -19.285 65.792 13.352  1.00 141.25 ? 12   GLU A CA    1 
ATOM   66    C  C     . GLU A 1 12  ? -18.698 66.863 14.268  1.00 141.83 ? 12   GLU A C     1 
ATOM   67    O  O     . GLU A 1 12  ? -18.409 67.979 13.829  1.00 142.07 ? 12   GLU A O     1 
ATOM   68    C  CB    . GLU A 1 12  ? -18.307 64.615 13.252  1.00 141.63 ? 12   GLU A CB    1 
ATOM   69    C  CG    . GLU A 1 12  ? -16.908 65.005 12.790  1.00 142.40 ? 12   GLU A CG    1 
ATOM   70    C  CD    . GLU A 1 12  ? -16.037 63.814 12.435  1.00 143.07 ? 12   GLU A CD    1 
ATOM   71    O  OE1   . GLU A 1 12  ? -16.579 62.740 12.092  1.00 142.96 ? 12   GLU A OE1   1 
ATOM   72    O  OE2   . GLU A 1 12  ? -14.796 63.953 12.494  1.00 144.30 ? 12   GLU A OE2   1 
ATOM   73    N  N     . TYR A 1 13  ? -18.524 66.511 15.538  1.00 142.05 ? 13   TYR A N     1 
ATOM   74    C  CA    . TYR A 1 13  ? -17.811 67.360 16.486  1.00 143.30 ? 13   TYR A CA    1 
ATOM   75    C  C     . TYR A 1 13  ? -16.330 67.026 16.395  1.00 143.19 ? 13   TYR A C     1 
ATOM   76    O  O     . TYR A 1 13  ? -15.953 65.853 16.432  1.00 142.65 ? 13   TYR A O     1 
ATOM   77    C  CB    . TYR A 1 13  ? -18.330 67.147 17.908  1.00 144.60 ? 13   TYR A CB    1 
ATOM   78    C  CG    . TYR A 1 13  ? -19.811 67.414 18.042  1.00 144.90 ? 13   TYR A CG    1 
ATOM   79    C  CD1   . TYR A 1 13  ? -20.328 68.687 17.821  1.00 145.68 ? 13   TYR A CD1   1 
ATOM   80    C  CD2   . TYR A 1 13  ? -20.697 66.394 18.379  1.00 144.84 ? 13   TYR A CD2   1 
ATOM   81    C  CE1   . TYR A 1 13  ? -21.685 68.939 17.934  1.00 145.87 ? 13   TYR A CE1   1 
ATOM   82    C  CE2   . TYR A 1 13  ? -22.056 66.637 18.496  1.00 145.12 ? 13   TYR A CE2   1 
ATOM   83    C  CZ    . TYR A 1 13  ? -22.544 67.910 18.273  1.00 145.54 ? 13   TYR A CZ    1 
ATOM   84    O  OH    . TYR A 1 13  ? -23.891 68.157 18.386  1.00 146.25 ? 13   TYR A OH    1 
ATOM   85    N  N     . ALA A 1 14  ? -15.498 68.058 16.267  1.00 144.17 ? 14   ALA A N     1 
ATOM   86    C  CA    . ALA A 1 14  ? -14.064 67.885 16.035  1.00 144.56 ? 14   ALA A CA    1 
ATOM   87    C  C     . ALA A 1 14  ? -13.448 66.862 16.983  1.00 145.03 ? 14   ALA A C     1 
ATOM   88    O  O     . ALA A 1 14  ? -13.410 67.074 18.196  1.00 146.69 ? 14   ALA A O     1 
ATOM   89    C  CB    . ALA A 1 14  ? -13.342 69.217 16.164  1.00 147.03 ? 14   ALA A CB    1 
ATOM   90    N  N     . LYS A 1 15  ? -12.974 65.752 16.420  1.00 144.22 ? 15   LYS A N     1 
ATOM   91    C  CA    . LYS A 1 15  ? -12.322 64.702 17.205  1.00 145.39 ? 15   LYS A CA    1 
ATOM   92    C  C     . LYS A 1 15  ? -10.971 65.163 17.768  1.00 148.43 ? 15   LYS A C     1 
ATOM   93    O  O     . LYS A 1 15  ? -10.454 64.565 18.713  1.00 150.25 ? 15   LYS A O     1 
ATOM   94    C  CB    . LYS A 1 15  ? -12.156 63.424 16.373  1.00 143.80 ? 15   LYS A CB    1 
ATOM   95    C  CG    . LYS A 1 15  ? -13.473 62.742 16.021  1.00 141.94 ? 15   LYS A CG    1 
ATOM   96    C  CD    . LYS A 1 15  ? -13.298 61.257 15.726  1.00 141.78 ? 15   LYS A CD    1 
ATOM   97    C  CE    . LYS A 1 15  ? -12.942 60.986 14.273  1.00 140.84 ? 15   LYS A CE    1 
ATOM   98    N  NZ    . LYS A 1 15  ? -14.147 60.980 13.399  1.00 139.43 ? 15   LYS A NZ    1 
ATOM   99    N  N     . SER A 1 16  ? -10.405 66.216 17.180  1.00 149.61 ? 16   SER A N     1 
ATOM   100   C  CA    . SER A 1 16  ? -9.238  66.892 17.745  1.00 152.98 ? 16   SER A CA    1 
ATOM   101   C  C     . SER A 1 16  ? -9.131  68.321 17.212  1.00 154.56 ? 16   SER A C     1 
ATOM   102   O  O     . SER A 1 16  ? -9.529  68.599 16.079  1.00 152.85 ? 16   SER A O     1 
ATOM   103   C  CB    . SER A 1 16  ? -7.958  66.120 17.424  1.00 153.88 ? 16   SER A CB    1 
ATOM   104   O  OG    . SER A 1 16  ? -7.752  66.033 16.026  1.00 152.41 ? 16   SER A OG    1 
ATOM   105   N  N     . GLY A 1 17  ? -8.587  69.219 18.031  1.00 158.47 ? 17   GLY A N     1 
ATOM   106   C  CA    . GLY A 1 17  ? -8.389  70.616 17.640  1.00 161.11 ? 17   GLY A CA    1 
ATOM   107   C  C     . GLY A 1 17  ? -7.082  70.792 16.891  1.00 163.42 ? 17   GLY A C     1 
ATOM   108   O  O     . GLY A 1 17  ? -6.247  71.617 17.266  1.00 167.49 ? 17   GLY A O     1 
ATOM   109   N  N     . ARG A 1 18  ? -6.923  70.017 15.821  1.00 161.39 ? 18   ARG A N     1 
ATOM   110   C  CA    . ARG A 1 18  ? -5.655  69.891 15.105  1.00 163.48 ? 18   ARG A CA    1 
ATOM   111   C  C     . ARG A 1 18  ? -5.811  70.220 13.622  1.00 162.59 ? 18   ARG A C     1 
ATOM   112   O  O     . ARG A 1 18  ? -5.026  70.990 13.066  1.00 165.52 ? 18   ARG A O     1 
ATOM   113   C  CB    . ARG A 1 18  ? -5.136  68.461 15.264  1.00 162.34 ? 18   ARG A CB    1 
ATOM   114   C  CG    . ARG A 1 18  ? -3.691  68.244 14.847  1.00 164.91 ? 18   ARG A CG    1 
ATOM   115   C  CD    . ARG A 1 18  ? -3.372  66.758 14.778  1.00 163.47 ? 18   ARG A CD    1 
ATOM   116   N  NE    . ARG A 1 18  ? -3.633  66.081 16.049  1.00 163.41 ? 18   ARG A NE    1 
ATOM   117   C  CZ    . ARG A 1 18  ? -3.689  64.760 16.213  1.00 162.02 ? 18   ARG A CZ    1 
ATOM   118   N  NH1   . ARG A 1 18  ? -3.506  63.932 15.187  1.00 160.39 ? 18   ARG A NH1   1 
ATOM   119   N  NH2   . ARG A 1 18  ? -3.935  64.259 17.419  1.00 162.66 ? 18   ARG A NH2   1 
ATOM   120   N  N     . ALA A 1 19  ? -6.819  69.623 12.990  1.00 159.31 ? 19   ALA A N     1 
ATOM   121   C  CA    . ALA A 1 19  ? -7.078  69.813 11.564  1.00 158.36 ? 19   ALA A CA    1 
ATOM   122   C  C     . ALA A 1 19  ? -7.432  71.261 11.241  1.00 160.62 ? 19   ALA A C     1 
ATOM   123   O  O     . ALA A 1 19  ? -8.147  71.917 12.000  1.00 161.14 ? 19   ALA A O     1 
ATOM   124   C  CB    . ALA A 1 19  ? -8.200  68.893 11.112  1.00 154.70 ? 19   ALA A CB    1 
ATOM   125   N  N     . SER A 1 20  ? -6.928  71.747 10.108  1.00 162.74 ? 20   SER A N     1 
ATOM   126   C  CA    . SER A 1 20  ? -7.191  73.112 9.660   1.00 165.87 ? 20   SER A CA    1 
ATOM   127   C  C     . SER A 1 20  ? -8.390  73.159 8.716   1.00 163.94 ? 20   SER A C     1 
ATOM   128   O  O     . SER A 1 20  ? -8.869  72.125 8.245   1.00 160.75 ? 20   SER A O     1 
ATOM   129   C  CB    . SER A 1 20  ? -5.955  73.696 8.971   1.00 169.81 ? 20   SER A CB    1 
ATOM   130   O  OG    . SER A 1 20  ? -5.564  72.905 7.863   1.00 168.73 ? 20   SER A OG    1 
ATOM   131   N  N     . CYS A 1 21  ? -8.857  74.374 8.444   1.00 166.82 ? 21   CYS A N     1 
ATOM   132   C  CA    . CYS A 1 21  ? -10.053 74.608 7.634   1.00 165.99 ? 21   CYS A CA    1 
ATOM   133   C  C     . CYS A 1 21  ? -9.656  74.997 6.212   1.00 167.34 ? 21   CYS A C     1 
ATOM   134   O  O     . CYS A 1 21  ? -8.804  75.858 6.017   1.00 171.13 ? 21   CYS A O     1 
ATOM   135   C  CB    . CYS A 1 21  ? -10.912 75.689 8.299   1.00 168.35 ? 21   CYS A CB    1 
ATOM   136   S  SG    . CYS A 1 21  ? -11.901 76.741 7.215   1.00 170.52 ? 21   CYS A SG    1 
ATOM   137   N  N     . LYS A 1 22  ? -10.279 74.364 5.221   1.00 165.06 ? 22   LYS A N     1 
ATOM   138   C  CA    . LYS A 1 22  ? -9.834  74.486 3.828   1.00 166.59 ? 22   LYS A CA    1 
ATOM   139   C  C     . LYS A 1 22  ? -9.970  75.903 3.263   1.00 170.51 ? 22   LYS A C     1 
ATOM   140   O  O     . LYS A 1 22  ? -9.146  76.323 2.448   1.00 173.22 ? 22   LYS A O     1 
ATOM   141   C  CB    . LYS A 1 22  ? -10.589 73.501 2.927   1.00 163.72 ? 22   LYS A CB    1 
ATOM   142   C  CG    . LYS A 1 22  ? -9.815  73.069 1.688   1.00 164.50 ? 22   LYS A CG    1 
ATOM   143   C  CD    . LYS A 1 22  ? -9.247  71.663 1.827   1.00 162.43 ? 22   LYS A CD    1 
ATOM   144   C  CE    . LYS A 1 22  ? -8.204  71.545 2.929   1.00 163.26 ? 22   LYS A CE    1 
ATOM   145   N  NZ    . LYS A 1 22  ? -7.902  70.121 3.243   1.00 161.00 ? 22   LYS A NZ    1 
ATOM   146   N  N     . LYS A 1 23  ? -11.000 76.632 3.690   1.00 171.42 ? 23   LYS A N     1 
ATOM   147   C  CA    . LYS A 1 23  ? -11.246 77.983 3.182   1.00 175.67 ? 23   LYS A CA    1 
ATOM   148   C  C     . LYS A 1 23  ? -10.333 79.019 3.839   1.00 179.77 ? 23   LYS A C     1 
ATOM   149   O  O     . LYS A 1 23  ? -9.546  79.678 3.158   1.00 183.22 ? 23   LYS A O     1 
ATOM   150   C  CB    . LYS A 1 23  ? -12.715 78.383 3.375   1.00 175.38 ? 23   LYS A CB    1 
ATOM   151   C  CG    . LYS A 1 23  ? -13.096 79.665 2.649   1.00 179.91 ? 23   LYS A CG    1 
ATOM   152   C  CD    . LYS A 1 23  ? -14.603 79.831 2.522   1.00 179.14 ? 23   LYS A CD    1 
ATOM   153   C  CE    . LYS A 1 23  ? -14.962 80.828 1.429   1.00 183.13 ? 23   LYS A CE    1 
ATOM   154   N  NZ    . LYS A 1 23  ? -14.464 82.202 1.720   1.00 188.65 ? 23   LYS A NZ    1 
ATOM   155   N  N     . CYS A 1 24  ? -10.439 79.149 5.160   1.00 179.42 ? 24   CYS A N     1 
ATOM   156   C  CA    . CYS A 1 24  ? -9.740  80.206 5.899   1.00 183.94 ? 24   CYS A CA    1 
ATOM   157   C  C     . CYS A 1 24  ? -8.356  79.787 6.413   1.00 184.39 ? 24   CYS A C     1 
ATOM   158   O  O     . CYS A 1 24  ? -7.518  80.644 6.692   1.00 189.44 ? 24   CYS A O     1 
ATOM   159   C  CB    . CYS A 1 24  ? -10.609 80.696 7.062   1.00 184.53 ? 24   CYS A CB    1 
ATOM   160   S  SG    . CYS A 1 24  ? -10.666 79.589 8.488   1.00 180.89 ? 24   CYS A SG    1 
ATOM   161   N  N     . SER A 1 25  ? -8.133  78.479 6.548   1.00 179.60 ? 25   SER A N     1 
ATOM   162   C  CA    . SER A 1 25  ? -6.827  77.916 6.933   1.00 180.02 ? 25   SER A CA    1 
ATOM   163   C  C     . SER A 1 25  ? -6.422  78.227 8.379   1.00 181.75 ? 25   SER A C     1 
ATOM   164   O  O     . SER A 1 25  ? -5.278  78.601 8.647   1.00 186.35 ? 25   SER A O     1 
ATOM   165   C  CB    . SER A 1 25  ? -5.727  78.343 5.946   1.00 183.96 ? 25   SER A CB    1 
ATOM   166   O  OG    . SER A 1 25  ? -5.245  79.648 6.215   1.00 190.48 ? 25   SER A OG    1 
ATOM   167   N  N     . GLU A 1 26  ? -7.368  78.058 9.302   1.00 178.80 ? 26   GLU A N     1 
ATOM   168   C  CA    . GLU A 1 26  ? -7.092  78.140 10.738  1.00 180.09 ? 26   GLU A CA    1 
ATOM   169   C  C     . GLU A 1 26  ? -7.528  76.840 11.409  1.00 175.15 ? 26   GLU A C     1 
ATOM   170   O  O     . GLU A 1 26  ? -8.357  76.104 10.872  1.00 171.09 ? 26   GLU A O     1 
ATOM   171   C  CB    . GLU A 1 26  ? -7.814  79.330 11.375  1.00 182.84 ? 26   GLU A CB    1 
ATOM   172   C  CG    . GLU A 1 26  ? -7.336  80.686 10.874  1.00 188.42 ? 26   GLU A CG    1 
ATOM   173   C  CD    . GLU A 1 26  ? -8.001  81.855 11.583  1.00 191.79 ? 26   GLU A CD    1 
ATOM   174   O  OE1   . GLU A 1 26  ? -8.914  81.629 12.405  1.00 189.37 ? 26   GLU A OE1   1 
ATOM   175   O  OE2   . GLU A 1 26  ? -7.608  83.009 11.313  1.00 197.29 ? 26   GLU A OE2   1 
ATOM   176   N  N     . SER A 1 27  ? -6.968  76.570 12.586  1.00 176.12 ? 27   SER A N     1 
ATOM   177   C  CA    . SER A 1 27  ? -7.224  75.318 13.297  1.00 172.12 ? 27   SER A CA    1 
ATOM   178   C  C     . SER A 1 27  ? -8.663  75.232 13.806  1.00 169.22 ? 27   SER A C     1 
ATOM   179   O  O     . SER A 1 27  ? -9.097  76.065 14.603  1.00 171.68 ? 27   SER A O     1 
ATOM   180   C  CB    . SER A 1 27  ? -6.252  75.161 14.469  1.00 174.95 ? 27   SER A CB    1 
ATOM   181   O  OG    . SER A 1 27  ? -6.366  76.244 15.377  1.00 178.81 ? 27   SER A OG    1 
ATOM   182   N  N     . ILE A 1 28  ? -9.393  74.221 13.335  1.00 164.42 ? 28   ILE A N     1 
ATOM   183   C  CA    . ILE A 1 28  ? -10.752 73.953 13.801  1.00 161.16 ? 28   ILE A CA    1 
ATOM   184   C  C     . ILE A 1 28  ? -10.668 73.367 15.211  1.00 160.60 ? 28   ILE A C     1 
ATOM   185   O  O     . ILE A 1 28  ? -10.147 72.266 15.383  1.00 159.45 ? 28   ILE A O     1 
ATOM   186   C  CB    . ILE A 1 28  ? -11.487 72.963 12.868  1.00 157.16 ? 28   ILE A CB    1 
ATOM   187   C  CG1   . ILE A 1 28  ? -11.667 73.573 11.472  1.00 157.37 ? 28   ILE A CG1   1 
ATOM   188   C  CG2   . ILE A 1 28  ? -12.844 72.577 13.448  1.00 155.08 ? 28   ILE A CG2   1 
ATOM   189   C  CD1   . ILE A 1 28  ? -11.873 72.550 10.374  1.00 154.36 ? 28   ILE A CD1   1 
ATOM   190   N  N     . PRO A 1 29  ? -11.182 74.096 16.223  1.00 161.58 ? 29   PRO A N     1 
ATOM   191   C  CA    . PRO A 1 29  ? -11.002 73.684 17.621  1.00 162.12 ? 29   PRO A CA    1 
ATOM   192   C  C     . PRO A 1 29  ? -11.749 72.399 17.981  1.00 157.86 ? 29   PRO A C     1 
ATOM   193   O  O     . PRO A 1 29  ? -12.711 72.033 17.307  1.00 154.63 ? 29   PRO A O     1 
ATOM   194   C  CB    . PRO A 1 29  ? -11.557 74.873 18.411  1.00 165.37 ? 29   PRO A CB    1 
ATOM   195   C  CG    . PRO A 1 29  ? -12.552 75.502 17.501  1.00 164.29 ? 29   PRO A CG    1 
ATOM   196   C  CD    . PRO A 1 29  ? -12.034 75.294 16.107  1.00 162.95 ? 29   PRO A CD    1 
ATOM   197   N  N     . LYS A 1 30  ? -11.299 71.731 19.041  1.00 158.06 ? 30   LYS A N     1 
ATOM   198   C  CA    . LYS A 1 30  ? -11.844 70.430 19.439  1.00 155.08 ? 30   LYS A CA    1 
ATOM   199   C  C     . LYS A 1 30  ? -13.290 70.530 19.927  1.00 154.03 ? 30   LYS A C     1 
ATOM   200   O  O     . LYS A 1 30  ? -13.696 71.549 20.488  1.00 156.94 ? 30   LYS A O     1 
ATOM   201   C  CB    . LYS A 1 30  ? -10.974 69.795 20.529  1.00 156.88 ? 30   LYS A CB    1 
ATOM   202   C  CG    . LYS A 1 30  ? -11.371 68.370 20.884  1.00 154.65 ? 30   LYS A CG    1 
ATOM   203   C  CD    . LYS A 1 30  ? -10.299 67.662 21.695  1.00 156.85 ? 30   LYS A CD    1 
ATOM   204   C  CE    . LYS A 1 30  ? -10.731 66.249 22.054  1.00 155.30 ? 30   LYS A CE    1 
ATOM   205   N  NZ    . LYS A 1 30  ? -9.668  65.498 22.776  1.00 157.70 ? 30   LYS A NZ    1 
ATOM   206   N  N     . ASP A 1 31  ? -14.053 69.461 19.698  1.00 150.90 ? 31   ASP A N     1 
ATOM   207   C  CA    . ASP A 1 31  ? -15.466 69.368 20.093  1.00 149.70 ? 31   ASP A CA    1 
ATOM   208   C  C     . ASP A 1 31  ? -16.349 70.480 19.507  1.00 149.19 ? 31   ASP A C     1 
ATOM   209   O  O     . ASP A 1 31  ? -17.389 70.818 20.077  1.00 150.41 ? 31   ASP A O     1 
ATOM   210   C  CB    . ASP A 1 31  ? -15.602 69.329 21.625  1.00 152.04 ? 31   ASP A CB    1 
ATOM   211   C  CG    . ASP A 1 31  ? -14.874 68.148 22.254  1.00 152.52 ? 31   ASP A CG    1 
ATOM   212   O  OD1   . ASP A 1 31  ? -14.605 68.201 23.472  1.00 155.34 ? 31   ASP A OD1   1 
ATOM   213   O  OD2   . ASP A 1 31  ? -14.572 67.168 21.539  1.00 150.45 ? 31   ASP A OD2   1 
ATOM   214   N  N     . SER A 1 32  ? -15.938 71.032 18.366  1.00 148.14 ? 32   SER A N     1 
ATOM   215   C  CA    . SER A 1 32  ? -16.703 72.071 17.682  1.00 147.94 ? 32   SER A CA    1 
ATOM   216   C  C     . SER A 1 32  ? -17.381 71.480 16.453  1.00 144.69 ? 32   SER A C     1 
ATOM   217   O  O     . SER A 1 32  ? -16.822 70.604 15.791  1.00 143.03 ? 32   SER A O     1 
ATOM   218   C  CB    . SER A 1 32  ? -15.791 73.228 17.268  1.00 150.38 ? 32   SER A CB    1 
ATOM   219   O  OG    . SER A 1 32  ? -14.924 72.849 16.212  1.00 149.13 ? 32   SER A OG    1 
ATOM   220   N  N     . LEU A 1 33  ? -18.583 71.964 16.154  1.00 144.24 ? 33   LEU A N     1 
ATOM   221   C  CA    . LEU A 1 33  ? -19.322 71.528 14.972  1.00 141.93 ? 33   LEU A CA    1 
ATOM   222   C  C     . LEU A 1 33  ? -18.552 71.920 13.712  1.00 141.64 ? 33   LEU A C     1 
ATOM   223   O  O     . LEU A 1 33  ? -18.262 73.098 13.498  1.00 144.08 ? 33   LEU A O     1 
ATOM   224   C  CB    . LEU A 1 33  ? -20.717 72.161 14.953  1.00 142.43 ? 33   LEU A CB    1 
ATOM   225   C  CG    . LEU A 1 33  ? -21.676 71.728 13.839  1.00 140.89 ? 33   LEU A CG    1 
ATOM   226   C  CD1   . LEU A 1 33  ? -22.241 70.342 14.115  1.00 139.36 ? 33   LEU A CD1   1 
ATOM   227   C  CD2   . LEU A 1 33  ? -22.804 72.736 13.690  1.00 142.33 ? 33   LEU A CD2   1 
ATOM   228   N  N     . ARG A 1 34  ? -18.211 70.922 12.899  1.00 139.08 ? 34   ARG A N     1 
ATOM   229   C  CA    . ARG A 1 34  ? -17.489 71.138 11.647  1.00 138.86 ? 34   ARG A CA    1 
ATOM   230   C  C     . ARG A 1 34  ? -18.087 70.272 10.543  1.00 136.94 ? 34   ARG A C     1 
ATOM   231   O  O     . ARG A 1 34  ? -18.622 69.196 10.814  1.00 135.57 ? 34   ARG A O     1 
ATOM   232   C  CB    . ARG A 1 34  ? -16.002 70.808 11.822  1.00 139.10 ? 34   ARG A CB    1 
ATOM   233   C  CG    . ARG A 1 34  ? -15.724 69.362 12.208  1.00 137.22 ? 34   ARG A CG    1 
ATOM   234   C  CD    . ARG A 1 34  ? -14.236 69.061 12.267  1.00 137.71 ? 34   ARG A CD    1 
ATOM   235   N  NE    . ARG A 1 34  ? -13.983 67.630 12.429  1.00 136.08 ? 34   ARG A NE    1 
ATOM   236   C  CZ    . ARG A 1 34  ? -12.785 67.083 12.630  1.00 136.57 ? 34   ARG A CZ    1 
ATOM   237   N  NH1   . ARG A 1 34  ? -11.693 67.839 12.705  1.00 138.60 ? 34   ARG A NH1   1 
ATOM   238   N  NH2   . ARG A 1 34  ? -12.681 65.765 12.765  1.00 135.56 ? 34   ARG A NH2   1 
ATOM   239   N  N     . MET A 1 35  ? -17.986 70.744 9.303   1.00 137.57 ? 35   MET A N     1 
ATOM   240   C  CA    . MET A 1 35  ? -18.488 70.007 8.145   1.00 136.81 ? 35   MET A CA    1 
ATOM   241   C  C     . MET A 1 35  ? -17.368 69.720 7.150   1.00 136.94 ? 35   MET A C     1 
ATOM   242   O  O     . MET A 1 35  ? -16.390 70.466 7.068   1.00 138.24 ? 35   MET A O     1 
ATOM   243   C  CB    . MET A 1 35  ? -19.611 70.787 7.464   1.00 137.99 ? 35   MET A CB    1 
ATOM   244   C  CG    . MET A 1 35  ? -20.933 70.722 8.211   1.00 138.19 ? 35   MET A CG    1 
ATOM   245   S  SD    . MET A 1 35  ? -22.307 71.437 7.291   1.00 140.10 ? 35   MET A SD    1 
ATOM   246   C  CE    . MET A 1 35  ? -22.530 70.214 6.000   1.00 139.38 ? 35   MET A CE    1 
ATOM   247   N  N     . ALA A 1 36  ? -17.528 68.634 6.397   1.00 135.78 ? 36   ALA A N     1 
ATOM   248   C  CA    . ALA A 1 36  ? -16.512 68.177 5.451   1.00 135.68 ? 36   ALA A CA    1 
ATOM   249   C  C     . ALA A 1 36  ? -17.105 67.880 4.078   1.00 135.74 ? 36   ALA A C     1 
ATOM   250   O  O     . ALA A 1 36  ? -18.315 67.700 3.935   1.00 136.05 ? 36   ALA A O     1 
ATOM   251   C  CB    . ALA A 1 36  ? -15.820 66.935 5.993   1.00 134.91 ? 36   ALA A CB    1 
ATOM   252   N  N     . ILE A 1 37  ? -16.229 67.835 3.078   1.00 135.98 ? 37   ILE A N     1 
ATOM   253   C  CA    . ILE A 1 37  ? -16.572 67.360 1.737   1.00 136.22 ? 37   ILE A CA    1 
ATOM   254   C  C     . ILE A 1 37  ? -15.508 66.339 1.331   1.00 136.10 ? 37   ILE A C     1 
ATOM   255   O  O     . ILE A 1 37  ? -14.314 66.635 1.341   1.00 136.97 ? 37   ILE A O     1 
ATOM   256   C  CB    . ILE A 1 37  ? -16.706 68.525 0.717   1.00 137.89 ? 37   ILE A CB    1 
ATOM   257   C  CG1   . ILE A 1 37  ? -17.084 68.003 -0.686  1.00 138.83 ? 37   ILE A CG1   1 
ATOM   258   C  CG2   . ILE A 1 37  ? -15.461 69.410 0.701   1.00 139.28 ? 37   ILE A CG2   1 
ATOM   259   C  CD1   . ILE A 1 37  ? -15.934 67.588 -1.587  1.00 139.69 ? 37   ILE A CD1   1 
ATOM   260   N  N     . MET A 1 38  ? -15.949 65.131 0.991   1.00 135.62 ? 38   MET A N     1 
ATOM   261   C  CA    . MET A 1 38  ? -15.035 64.017 0.752   1.00 136.01 ? 38   MET A CA    1 
ATOM   262   C  C     . MET A 1 38  ? -14.478 64.071 -0.668  1.00 137.81 ? 38   MET A C     1 
ATOM   263   O  O     . MET A 1 38  ? -15.239 64.081 -1.637  1.00 139.01 ? 38   MET A O     1 
ATOM   264   C  CB    . MET A 1 38  ? -15.748 62.683 0.991   1.00 135.85 ? 38   MET A CB    1 
ATOM   265   C  CG    . MET A 1 38  ? -16.356 62.539 2.381   1.00 134.84 ? 38   MET A CG    1 
ATOM   266   S  SD    . MET A 1 38  ? -15.137 62.310 3.689   1.00 134.26 ? 38   MET A SD    1 
ATOM   267   C  CE    . MET A 1 38  ? -14.912 60.534 3.629   1.00 135.43 ? 38   MET A CE    1 
ATOM   268   N  N     . VAL A 1 39  ? -13.149 64.108 -0.780  1.00 138.55 ? 39   VAL A N     1 
ATOM   269   C  CA    . VAL A 1 39  ? -12.466 64.160 -2.075  1.00 140.25 ? 39   VAL A CA    1 
ATOM   270   C  C     . VAL A 1 39  ? -11.508 62.984 -2.229  1.00 140.64 ? 39   VAL A C     1 
ATOM   271   O  O     . VAL A 1 39  ? -11.196 62.297 -1.256  1.00 139.79 ? 39   VAL A O     1 
ATOM   272   C  CB    . VAL A 1 39  ? -11.668 65.473 -2.251  1.00 141.43 ? 39   VAL A CB    1 
ATOM   273   C  CG1   . VAL A 1 39  ? -12.542 66.679 -1.938  1.00 141.09 ? 39   VAL A CG1   1 
ATOM   274   C  CG2   . VAL A 1 39  ? -10.418 65.481 -1.379  1.00 141.47 ? 39   VAL A CG2   1 
ATOM   275   N  N     . GLN A 1 40  ? -11.028 62.775 -3.452  1.00 142.40 ? 40   GLN A N     1 
ATOM   276   C  CA    . GLN A 1 40  ? -10.059 61.717 -3.732  1.00 143.48 ? 40   GLN A CA    1 
ATOM   277   C  C     . GLN A 1 40  ? -8.667  62.226 -3.364  1.00 144.04 ? 40   GLN A C     1 
ATOM   278   O  O     . GLN A 1 40  ? -8.251  63.289 -3.828  1.00 144.97 ? 40   GLN A O     1 
ATOM   279   C  CB    . GLN A 1 40  ? -10.102 61.317 -5.216  1.00 145.72 ? 40   GLN A CB    1 
ATOM   280   C  CG    . GLN A 1 40  ? -10.161 59.816 -5.481  1.00 146.77 ? 40   GLN A CG    1 
ATOM   281   C  CD    . GLN A 1 40  ? -9.089  59.017 -4.758  1.00 146.93 ? 40   GLN A CD    1 
ATOM   282   O  OE1   . GLN A 1 40  ? -9.372  57.966 -4.181  1.00 146.89 ? 40   GLN A OE1   1 
ATOM   283   N  NE2   . GLN A 1 40  ? -7.854  59.505 -4.787  1.00 147.86 ? 40   GLN A NE2   1 
ATOM   284   N  N     . SER A 1 41  ? -7.956  61.472 -2.528  1.00 144.19 ? 41   SER A N     1 
ATOM   285   C  CA    . SER A 1 41  ? -6.605  61.846 -2.109  1.00 145.53 ? 41   SER A CA    1 
ATOM   286   C  C     . SER A 1 41  ? -5.597  61.578 -3.227  1.00 148.10 ? 41   SER A C     1 
ATOM   287   O  O     . SER A 1 41  ? -5.553  60.471 -3.761  1.00 148.92 ? 41   SER A O     1 
ATOM   288   C  CB    . SER A 1 41  ? -6.194  61.069 -0.856  1.00 144.89 ? 41   SER A CB    1 
ATOM   289   O  OG    . SER A 1 41  ? -4.897  61.444 -0.423  1.00 145.97 ? 41   SER A OG    1 
ATOM   290   N  N     . PRO A 1 42  ? -4.782  62.589 -3.585  1.00 150.03 ? 42   PRO A N     1 
ATOM   291   C  CA    . PRO A 1 42  ? -3.709  62.373 -4.563  1.00 153.32 ? 42   PRO A CA    1 
ATOM   292   C  C     . PRO A 1 42  ? -2.628  61.387 -4.106  1.00 154.96 ? 42   PRO A C     1 
ATOM   293   O  O     . PRO A 1 42  ? -1.972  60.764 -4.943  1.00 157.52 ? 42   PRO A O     1 
ATOM   294   C  CB    . PRO A 1 42  ? -3.088  63.766 -4.718  1.00 155.06 ? 42   PRO A CB    1 
ATOM   295   C  CG    . PRO A 1 42  ? -4.141  64.719 -4.280  1.00 153.19 ? 42   PRO A CG    1 
ATOM   296   C  CD    . PRO A 1 42  ? -4.899  64.009 -3.204  1.00 150.08 ? 42   PRO A CD    1 
ATOM   297   N  N     . MET A 1 43  ? -2.454  61.253 -2.794  1.00 154.21 ? 43   MET A N     1 
ATOM   298   C  CA    . MET A 1 43  ? -1.336  60.500 -2.223  1.00 155.87 ? 43   MET A CA    1 
ATOM   299   C  C     . MET A 1 43  ? -1.603  58.997 -2.098  1.00 155.45 ? 43   MET A C     1 
ATOM   300   O  O     . MET A 1 43  ? -0.659  58.206 -2.077  1.00 157.19 ? 43   MET A O     1 
ATOM   301   C  CB    . MET A 1 43  ? -0.976  61.069 -0.846  1.00 155.76 ? 43   MET A CB    1 
ATOM   302   C  CG    . MET A 1 43  ? -0.668  62.561 -0.840  1.00 157.15 ? 43   MET A CG    1 
ATOM   303   S  SD    . MET A 1 43  ? 0.808   62.999 -1.779  1.00 162.15 ? 43   MET A SD    1 
ATOM   304   C  CE    . MET A 1 43  ? 2.093   62.341 -0.719  1.00 163.75 ? 43   MET A CE    1 
ATOM   305   N  N     . PHE A 1 44  ? -2.874  58.605 -2.003  1.00 153.28 ? 44   PHE A N     1 
ATOM   306   C  CA    . PHE A 1 44  ? -3.234  57.191 -1.856  1.00 153.08 ? 44   PHE A CA    1 
ATOM   307   C  C     . PHE A 1 44  ? -4.650  56.901 -2.352  1.00 151.73 ? 44   PHE A C     1 
ATOM   308   O  O     . PHE A 1 44  ? -5.466  57.811 -2.503  1.00 149.59 ? 44   PHE A O     1 
ATOM   309   C  CB    . PHE A 1 44  ? -3.093  56.753 -0.394  1.00 152.36 ? 44   PHE A CB    1 
ATOM   310   C  CG    . PHE A 1 44  ? -4.188  57.263 0.505   1.00 149.75 ? 44   PHE A CG    1 
ATOM   311   C  CD1   . PHE A 1 44  ? -5.165  56.402 0.990   1.00 148.86 ? 44   PHE A CD1   1 
ATOM   312   C  CD2   . PHE A 1 44  ? -4.243  58.602 0.866   1.00 148.53 ? 44   PHE A CD2   1 
ATOM   313   C  CE1   . PHE A 1 44  ? -6.174  56.867 1.818   1.00 146.67 ? 44   PHE A CE1   1 
ATOM   314   C  CE2   . PHE A 1 44  ? -5.249  59.073 1.692   1.00 146.39 ? 44   PHE A CE2   1 
ATOM   315   C  CZ    . PHE A 1 44  ? -6.217  58.206 2.169   1.00 145.33 ? 44   PHE A CZ    1 
ATOM   316   N  N     . ASP A 1 45  ? -4.930  55.621 -2.591  1.00 153.16 ? 45   ASP A N     1 
ATOM   317   C  CA    . ASP A 1 45  ? -6.237  55.186 -3.078  1.00 153.00 ? 45   ASP A CA    1 
ATOM   318   C  C     . ASP A 1 45  ? -7.263  55.197 -1.945  1.00 150.59 ? 45   ASP A C     1 
ATOM   319   O  O     . ASP A 1 45  ? -7.480  54.185 -1.274  1.00 151.21 ? 45   ASP A O     1 
ATOM   320   C  CB    . ASP A 1 45  ? -6.134  53.787 -3.703  1.00 155.86 ? 45   ASP A CB    1 
ATOM   321   C  CG    . ASP A 1 45  ? -7.430  53.335 -4.366  1.00 156.62 ? 45   ASP A CG    1 
ATOM   322   O  OD1   . ASP A 1 45  ? -8.428  54.091 -4.351  1.00 154.46 ? 45   ASP A OD1   1 
ATOM   323   O  OD2   . ASP A 1 45  ? -7.449  52.212 -4.911  1.00 159.69 ? 45   ASP A OD2   1 
ATOM   324   N  N     . GLY A 1 46  ? -7.890  56.351 -1.738  1.00 148.29 ? 46   GLY A N     1 
ATOM   325   C  CA    . GLY A 1 46  ? -8.914  56.489 -0.708  1.00 146.27 ? 46   GLY A CA    1 
ATOM   326   C  C     . GLY A 1 46  ? -9.485  57.891 -0.622  1.00 144.28 ? 46   GLY A C     1 
ATOM   327   O  O     . GLY A 1 46  ? -8.815  58.867 -0.966  1.00 144.14 ? 46   GLY A O     1 
ATOM   328   N  N     . LYS A 1 47  ? -10.730 57.987 -0.162  1.00 143.06 ? 47   LYS A N     1 
ATOM   329   C  CA    . LYS A 1 47  ? -11.382 59.281 0.044   1.00 141.70 ? 47   LYS A CA    1 
ATOM   330   C  C     . LYS A 1 47  ? -10.835 59.966 1.292   1.00 140.80 ? 47   LYS A C     1 
ATOM   331   O  O     . LYS A 1 47  ? -10.470 59.300 2.263   1.00 140.72 ? 47   LYS A O     1 
ATOM   332   C  CB    . LYS A 1 47  ? -12.907 59.127 0.152   1.00 141.14 ? 47   LYS A CB    1 
ATOM   333   C  CG    . LYS A 1 47  ? -13.679 59.702 -1.026  1.00 141.82 ? 47   LYS A CG    1 
ATOM   334   C  CD    . LYS A 1 47  ? -13.473 58.905 -2.304  1.00 144.01 ? 47   LYS A CD    1 
ATOM   335   C  CE    . LYS A 1 47  ? -14.042 59.638 -3.510  1.00 145.10 ? 47   LYS A CE    1 
ATOM   336   N  NZ    . LYS A 1 47  ? -15.475 60.013 -3.336  1.00 144.61 ? 47   LYS A NZ    1 
ATOM   337   N  N     . VAL A 1 48  ? -10.783 61.296 1.257   1.00 140.69 ? 48   VAL A N     1 
ATOM   338   C  CA    . VAL A 1 48  ? -10.265 62.085 2.372   1.00 140.76 ? 48   VAL A CA    1 
ATOM   339   C  C     . VAL A 1 48  ? -11.190 63.281 2.634   1.00 140.22 ? 48   VAL A C     1 
ATOM   340   O  O     . VAL A 1 48  ? -11.665 63.913 1.688   1.00 140.40 ? 48   VAL A O     1 
ATOM   341   C  CB    . VAL A 1 48  ? -8.803  62.536 2.098   1.00 142.67 ? 48   VAL A CB    1 
ATOM   342   C  CG1   . VAL A 1 48  ? -8.735  63.892 1.403   1.00 143.76 ? 48   VAL A CG1   1 
ATOM   343   C  CG2   . VAL A 1 48  ? -7.994  62.564 3.383   1.00 142.80 ? 48   VAL A CG2   1 
ATOM   344   N  N     . PRO A 1 49  ? -11.465 63.583 3.917   1.00 140.24 ? 49   PRO A N     1 
ATOM   345   C  CA    . PRO A 1 49  ? -12.340 64.713 4.235   1.00 140.34 ? 49   PRO A CA    1 
ATOM   346   C  C     . PRO A 1 49  ? -11.640 66.068 4.145   1.00 142.20 ? 49   PRO A C     1 
ATOM   347   O  O     . PRO A 1 49  ? -10.561 66.242 4.712   1.00 142.97 ? 49   PRO A O     1 
ATOM   348   C  CB    . PRO A 1 49  ? -12.753 64.433 5.683   1.00 139.42 ? 49   PRO A CB    1 
ATOM   349   C  CG    . PRO A 1 49  ? -11.617 63.660 6.250   1.00 139.71 ? 49   PRO A CG    1 
ATOM   350   C  CD    . PRO A 1 49  ? -11.102 62.815 5.123   1.00 140.08 ? 49   PRO A CD    1 
ATOM   351   N  N     . HIS A 1 50  ? -12.256 67.011 3.433   1.00 143.98 ? 50   HIS A N     1 
ATOM   352   C  CA    . HIS A 1 50  ? -11.812 68.405 3.432   1.00 147.03 ? 50   HIS A CA    1 
ATOM   353   C  C     . HIS A 1 50  ? -12.594 69.165 4.496   1.00 147.55 ? 50   HIS A C     1 
ATOM   354   O  O     . HIS A 1 50  ? -13.703 69.636 4.240   1.00 147.91 ? 50   HIS A O     1 
ATOM   355   C  CB    . HIS A 1 50  ? -12.029 69.065 2.064   1.00 148.87 ? 50   HIS A CB    1 
ATOM   356   C  CG    . HIS A 1 50  ? -10.932 68.809 1.078   1.00 150.95 ? 50   HIS A CG    1 
ATOM   357   N  ND1   . HIS A 1 50  ? -11.030 69.172 -0.248  1.00 152.72 ? 50   HIS A ND1   1 
ATOM   358   C  CD2   . HIS A 1 50  ? -9.714  68.234 1.221   1.00 151.81 ? 50   HIS A CD2   1 
ATOM   359   C  CE1   . HIS A 1 50  ? -9.918  68.838 -0.878  1.00 154.23 ? 50   HIS A CE1   1 
ATOM   360   N  NE2   . HIS A 1 50  ? -9.105  68.263 -0.010  1.00 153.70 ? 50   HIS A NE2   1 
ATOM   361   N  N     . TRP A 1 51  ? -12.011 69.283 5.686   1.00 148.72 ? 51   TRP A N     1 
ATOM   362   C  CA    . TRP A 1 51  ? -12.702 69.892 6.822   1.00 149.28 ? 51   TRP A CA    1 
ATOM   363   C  C     . TRP A 1 51  ? -12.845 71.404 6.678   1.00 152.32 ? 51   TRP A C     1 
ATOM   364   O  O     . TRP A 1 51  ? -11.905 72.095 6.285   1.00 154.38 ? 51   TRP A O     1 
ATOM   365   C  CB    . TRP A 1 51  ? -11.993 69.551 8.137   1.00 149.24 ? 51   TRP A CB    1 
ATOM   366   C  CG    . TRP A 1 51  ? -12.180 68.125 8.533   1.00 146.91 ? 51   TRP A CG    1 
ATOM   367   C  CD1   . TRP A 1 51  ? -11.221 67.159 8.609   1.00 146.78 ? 51   TRP A CD1   1 
ATOM   368   C  CD2   . TRP A 1 51  ? -13.414 67.493 8.888   1.00 144.83 ? 51   TRP A CD2   1 
ATOM   369   N  NE1   . TRP A 1 51  ? -11.778 65.966 8.998   1.00 145.11 ? 51   TRP A NE1   1 
ATOM   370   C  CE2   . TRP A 1 51  ? -13.124 66.144 9.175   1.00 144.00 ? 51   TRP A CE2   1 
ATOM   371   C  CE3   . TRP A 1 51  ? -14.737 67.940 8.996   1.00 144.21 ? 51   TRP A CE3   1 
ATOM   372   C  CZ2   . TRP A 1 51  ? -14.107 65.234 9.563   1.00 143.07 ? 51   TRP A CZ2   1 
ATOM   373   C  CZ3   . TRP A 1 51  ? -15.714 67.033 9.377   1.00 143.09 ? 51   TRP A CZ3   1 
ATOM   374   C  CH2   . TRP A 1 51  ? -15.392 65.696 9.657   1.00 142.66 ? 51   TRP A CH2   1 
ATOM   375   N  N     . TYR A 1 52  ? -14.043 71.895 6.988   1.00 153.40 ? 52   TYR A N     1 
ATOM   376   C  CA    . TYR A 1 52  ? -14.341 73.322 7.019   1.00 156.77 ? 52   TYR A CA    1 
ATOM   377   C  C     . TYR A 1 52  ? -14.844 73.695 8.407   1.00 157.84 ? 52   TYR A C     1 
ATOM   378   O  O     . TYR A 1 52  ? -15.406 72.854 9.113   1.00 155.88 ? 52   TYR A O     1 
ATOM   379   C  CB    . TYR A 1 52  ? -15.434 73.661 6.001   1.00 156.83 ? 52   TYR A CB    1 
ATOM   380   C  CG    . TYR A 1 52  ? -14.982 73.685 4.558   1.00 157.73 ? 52   TYR A CG    1 
ATOM   381   C  CD1   . TYR A 1 52  ? -14.243 74.754 4.059   1.00 160.85 ? 52   TYR A CD1   1 
ATOM   382   C  CD2   . TYR A 1 52  ? -15.316 72.654 3.683   1.00 156.02 ? 52   TYR A CD2   1 
ATOM   383   C  CE1   . TYR A 1 52  ? -13.837 74.788 2.736   1.00 161.97 ? 52   TYR A CE1   1 
ATOM   384   C  CE2   . TYR A 1 52  ? -14.911 72.680 2.358   1.00 157.09 ? 52   TYR A CE2   1 
ATOM   385   C  CZ    . TYR A 1 52  ? -14.172 73.748 1.890   1.00 160.01 ? 52   TYR A CZ    1 
ATOM   386   O  OH    . TYR A 1 52  ? -13.768 73.780 0.575   1.00 161.39 ? 52   TYR A OH    1 
ATOM   387   N  N     . HIS A 1 53  ? -14.640 74.951 8.800   1.00 161.68 ? 53   HIS A N     1 
ATOM   388   C  CA    . HIS A 1 53  ? -15.380 75.518 9.925   1.00 163.16 ? 53   HIS A CA    1 
ATOM   389   C  C     . HIS A 1 53  ? -16.847 75.537 9.512   1.00 162.41 ? 53   HIS A C     1 
ATOM   390   O  O     . HIS A 1 53  ? -17.157 75.836 8.356   1.00 163.07 ? 53   HIS A O     1 
ATOM   391   C  CB    . HIS A 1 53  ? -14.924 76.946 10.241  1.00 167.31 ? 53   HIS A CB    1 
ATOM   392   C  CG    . HIS A 1 53  ? -13.602 77.030 10.940  1.00 169.35 ? 53   HIS A CG    1 
ATOM   393   N  ND1   . HIS A 1 53  ? -12.460 77.491 10.320  1.00 172.13 ? 53   HIS A ND1   1 
ATOM   394   C  CD2   . HIS A 1 53  ? -13.245 76.735 12.212  1.00 169.54 ? 53   HIS A CD2   1 
ATOM   395   C  CE1   . HIS A 1 53  ? -11.455 77.464 11.177  1.00 173.53 ? 53   HIS A CE1   1 
ATOM   396   N  NE2   . HIS A 1 53  ? -11.904 77.009 12.332  1.00 172.08 ? 53   HIS A NE2   1 
ATOM   397   N  N     . PHE A 1 54  ? -17.747 75.224 10.440  1.00 161.82 ? 54   PHE A N     1 
ATOM   398   C  CA    . PHE A 1 54  ? -19.181 75.225 10.137  1.00 161.56 ? 54   PHE A CA    1 
ATOM   399   C  C     . PHE A 1 54  ? -19.630 76.568 9.556   1.00 165.23 ? 54   PHE A C     1 
ATOM   400   O  O     . PHE A 1 54  ? -20.492 76.611 8.678   1.00 165.16 ? 54   PHE A O     1 
ATOM   401   C  CB    . PHE A 1 54  ? -20.009 74.883 11.379  1.00 160.61 ? 54   PHE A CB    1 
ATOM   402   C  CG    . PHE A 1 54  ? -21.493 74.923 11.145  1.00 160.09 ? 54   PHE A CG    1 
ATOM   403   C  CD1   . PHE A 1 54  ? -22.142 73.853 10.544  1.00 157.89 ? 54   PHE A CD1   1 
ATOM   404   C  CD2   . PHE A 1 54  ? -22.241 76.033 11.517  1.00 162.44 ? 54   PHE A CD2   1 
ATOM   405   C  CE1   . PHE A 1 54  ? -23.508 73.887 10.322  1.00 158.06 ? 54   PHE A CE1   1 
ATOM   406   C  CE2   . PHE A 1 54  ? -23.608 76.074 11.297  1.00 162.33 ? 54   PHE A CE2   1 
ATOM   407   C  CZ    . PHE A 1 54  ? -24.243 74.999 10.699  1.00 160.20 ? 54   PHE A CZ    1 
ATOM   408   N  N     . SER A 1 55  ? -19.038 77.654 10.049  1.00 169.46 ? 55   SER A N     1 
ATOM   409   C  CA    . SER A 1 55  ? -19.302 78.993 9.525   1.00 173.69 ? 55   SER A CA    1 
ATOM   410   C  C     . SER A 1 55  ? -18.805 79.152 8.085   1.00 175.14 ? 55   SER A C     1 
ATOM   411   O  O     . SER A 1 55  ? -19.503 79.718 7.243   1.00 176.77 ? 55   SER A O     1 
ATOM   412   C  CB    . SER A 1 55  ? -18.646 80.048 10.420  1.00 177.52 ? 55   SER A CB    1 
ATOM   413   O  OG    . SER A 1 55  ? -18.991 81.359 10.007  1.00 181.49 ? 55   SER A OG    1 
ATOM   414   N  N     . CYS A 1 56  ? -17.604 78.646 7.810   1.00 175.29 ? 56   CYS A N     1 
ATOM   415   C  CA    . CYS A 1 56  ? -16.982 78.781 6.487   1.00 176.88 ? 56   CYS A CA    1 
ATOM   416   C  C     . CYS A 1 56  ? -17.574 77.857 5.421   1.00 175.86 ? 56   CYS A C     1 
ATOM   417   O  O     . CYS A 1 56  ? -17.427 78.123 4.226   1.00 177.30 ? 56   CYS A O     1 
ATOM   418   C  CB    . CYS A 1 56  ? -15.478 78.517 6.579   1.00 176.44 ? 56   CYS A CB    1 
ATOM   419   S  SG    . CYS A 1 56  ? -14.578 79.641 7.667   1.00 180.43 ? 56   CYS A SG    1 
ATOM   420   N  N     . PHE A 1 57  ? -18.229 76.777 5.846   1.00 174.44 ? 57   PHE A N     1 
ATOM   421   C  CA    . PHE A 1 57  ? -18.729 75.755 4.919   1.00 173.62 ? 57   PHE A CA    1 
ATOM   422   C  C     . PHE A 1 57  ? -19.737 76.290 3.897   1.00 176.58 ? 57   PHE A C     1 
ATOM   423   O  O     . PHE A 1 57  ? -19.780 75.810 2.764   1.00 176.54 ? 57   PHE A O     1 
ATOM   424   C  CB    . PHE A 1 57  ? -19.357 74.587 5.694   1.00 170.67 ? 57   PHE A CB    1 
ATOM   425   C  CG    . PHE A 1 57  ? -19.793 73.443 4.819   1.00 169.00 ? 57   PHE A CG    1 
ATOM   426   C  CD1   . PHE A 1 57  ? -21.072 73.413 4.277   1.00 169.30 ? 57   PHE A CD1   1 
ATOM   427   C  CD2   . PHE A 1 57  ? -18.924 72.398 4.530   1.00 167.56 ? 57   PHE A CD2   1 
ATOM   428   C  CE1   . PHE A 1 57  ? -21.475 72.366 3.466   1.00 168.24 ? 57   PHE A CE1   1 
ATOM   429   C  CE2   . PHE A 1 57  ? -19.323 71.347 3.721   1.00 166.49 ? 57   PHE A CE2   1 
ATOM   430   C  CZ    . PHE A 1 57  ? -20.600 71.331 3.187   1.00 166.67 ? 57   PHE A CZ    1 
ATOM   431   N  N     . TRP A 1 58  ? -20.535 77.279 4.291   1.00 180.28 ? 58   TRP A N     1 
ATOM   432   C  CA    . TRP A 1 58  ? -21.643 77.755 3.455   1.00 183.18 ? 58   TRP A CA    1 
ATOM   433   C  C     . TRP A 1 58  ? -21.274 78.933 2.543   1.00 188.57 ? 58   TRP A C     1 
ATOM   434   O  O     . TRP A 1 58  ? -22.144 79.474 1.857   1.00 190.85 ? 58   TRP A O     1 
ATOM   435   C  CB    . TRP A 1 58  ? -22.843 78.125 4.334   1.00 183.35 ? 58   TRP A CB    1 
ATOM   436   C  CG    . TRP A 1 58  ? -23.172 77.075 5.358   1.00 179.79 ? 58   TRP A CG    1 
ATOM   437   C  CD1   . TRP A 1 58  ? -22.814 77.078 6.673   1.00 179.14 ? 58   TRP A CD1   1 
ATOM   438   C  CD2   . TRP A 1 58  ? -23.908 75.864 5.145   1.00 177.02 ? 58   TRP A CD2   1 
ATOM   439   N  NE1   . TRP A 1 58  ? -23.285 75.948 7.297   1.00 176.13 ? 58   TRP A NE1   1 
ATOM   440   C  CE2   . TRP A 1 58  ? -23.960 75.185 6.382   1.00 175.01 ? 58   TRP A CE2   1 
ATOM   441   C  CE3   . TRP A 1 58  ? -24.531 75.288 4.031   1.00 176.83 ? 58   TRP A CE3   1 
ATOM   442   C  CZ2   . TRP A 1 58  ? -24.613 73.960 6.537   1.00 173.01 ? 58   TRP A CZ2   1 
ATOM   443   C  CZ3   . TRP A 1 58  ? -25.180 74.068 4.187   1.00 174.92 ? 58   TRP A CZ3   1 
ATOM   444   C  CH2   . TRP A 1 58  ? -25.215 73.418 5.432   1.00 173.14 ? 58   TRP A CH2   1 
ATOM   445   N  N     . LYS A 1 59  ? -19.999 79.324 2.532   1.00 191.63 ? 59   LYS A N     1 
ATOM   446   C  CA    . LYS A 1 59  ? -19.518 80.391 1.643   1.00 196.99 ? 59   LYS A CA    1 
ATOM   447   C  C     . LYS A 1 59  ? -18.761 79.869 0.416   1.00 197.83 ? 59   LYS A C     1 
ATOM   448   O  O     . LYS A 1 59  ? -18.529 80.625 -0.530  1.00 201.26 ? 59   LYS A O     1 
ATOM   449   C  CB    . LYS A 1 59  ? -18.640 81.389 2.411   1.00 200.41 ? 59   LYS A CB    1 
ATOM   450   C  CG    . LYS A 1 59  ? -19.414 82.531 3.057   1.00 203.70 ? 59   LYS A CG    1 
ATOM   451   C  CD    . LYS A 1 59  ? -18.543 83.765 3.245   1.00 209.03 ? 59   LYS A CD    1 
ATOM   452   C  CE    . LYS A 1 59  ? -19.374 84.985 3.612   1.00 213.26 ? 59   LYS A CE    1 
ATOM   453   N  NZ    . LYS A 1 59  ? -18.571 86.239 3.571   1.00 219.30 ? 59   LYS A NZ    1 
ATOM   454   N  N     . VAL A 1 60  ? -18.380 78.592 0.427   1.00 195.67 ? 60   VAL A N     1 
ATOM   455   C  CA    . VAL A 1 60  ? -17.694 77.984 -0.723  1.00 196.66 ? 60   VAL A CA    1 
ATOM   456   C  C     . VAL A 1 60  ? -18.628 77.772 -1.919  1.00 197.66 ? 60   VAL A C     1 
ATOM   457   O  O     . VAL A 1 60  ? -18.163 77.633 -3.052  1.00 198.86 ? 60   VAL A O     1 
ATOM   458   C  CB    . VAL A 1 60  ? -17.005 76.644 -0.366  1.00 193.47 ? 60   VAL A CB    1 
ATOM   459   C  CG1   . VAL A 1 60  ? -15.960 76.855 0.719   1.00 193.66 ? 60   VAL A CG1   1 
ATOM   460   C  CG2   . VAL A 1 60  ? -18.017 75.584 0.051   1.00 190.08 ? 60   VAL A CG2   1 
ATOM   461   N  N     . GLY A 1 61  ? -19.936 77.739 -1.662  1.00 197.72 ? 61   GLY A N     1 
ATOM   462   C  CA    . GLY A 1 61  ? -20.941 77.618 -2.719  1.00 199.36 ? 61   GLY A CA    1 
ATOM   463   C  C     . GLY A 1 61  ? -21.703 76.303 -2.733  1.00 196.96 ? 61   GLY A C     1 
ATOM   464   O  O     . GLY A 1 61  ? -22.539 76.086 -3.612  1.00 198.08 ? 61   GLY A O     1 
ATOM   465   N  N     . HIS A 1 62  ? -21.425 75.426 -1.769  1.00 194.33 ? 62   HIS A N     1 
ATOM   466   C  CA    . HIS A 1 62  ? -22.122 74.143 -1.676  1.00 192.14 ? 62   HIS A CA    1 
ATOM   467   C  C     . HIS A 1 62  ? -23.508 74.345 -1.072  1.00 192.15 ? 62   HIS A C     1 
ATOM   468   O  O     . HIS A 1 62  ? -23.662 75.072 -0.088  1.00 192.28 ? 62   HIS A O     1 
ATOM   469   C  CB    . HIS A 1 62  ? -21.329 73.136 -0.834  1.00 189.25 ? 62   HIS A CB    1 
ATOM   470   C  CG    . HIS A 1 62  ? -19.946 72.865 -1.344  1.00 189.32 ? 62   HIS A CG    1 
ATOM   471   N  ND1   . HIS A 1 62  ? -19.617 72.916 -2.683  1.00 191.39 ? 62   HIS A ND1   1 
ATOM   472   C  CD2   . HIS A 1 62  ? -18.811 72.514 -0.693  1.00 187.92 ? 62   HIS A CD2   1 
ATOM   473   C  CE1   . HIS A 1 62  ? -18.337 72.626 -2.831  1.00 191.16 ? 62   HIS A CE1   1 
ATOM   474   N  NE2   . HIS A 1 62  ? -17.825 72.378 -1.639  1.00 189.17 ? 62   HIS A NE2   1 
ATOM   475   N  N     . SER A 1 63  ? -24.510 73.700 -1.667  1.00 192.29 ? 63   SER A N     1 
ATOM   476   C  CA    . SER A 1 63  ? -25.895 73.819 -1.218  1.00 192.93 ? 63   SER A CA    1 
ATOM   477   C  C     . SER A 1 63  ? -26.530 72.442 -1.041  1.00 191.46 ? 63   SER A C     1 
ATOM   478   O  O     . SER A 1 63  ? -27.060 71.862 -1.991  1.00 192.62 ? 63   SER A O     1 
ATOM   479   C  CB    . SER A 1 63  ? -26.707 74.651 -2.213  1.00 196.43 ? 63   SER A CB    1 
ATOM   480   O  OG    . SER A 1 63  ? -26.234 75.986 -2.267  1.00 198.32 ? 63   SER A OG    1 
ATOM   481   N  N     . ILE A 1 64  ? -26.464 71.926 0.183   1.00 189.32 ? 64   ILE A N     1 
ATOM   482   C  CA    . ILE A 1 64  ? -27.086 70.651 0.527   1.00 188.27 ? 64   ILE A CA    1 
ATOM   483   C  C     . ILE A 1 64  ? -28.584 70.876 0.718   1.00 190.12 ? 64   ILE A C     1 
ATOM   484   O  O     . ILE A 1 64  ? -28.998 71.587 1.635   1.00 189.99 ? 64   ILE A O     1 
ATOM   485   C  CB    . ILE A 1 64  ? -26.469 70.054 1.809   1.00 185.57 ? 64   ILE A CB    1 
ATOM   486   C  CG1   . ILE A 1 64  ? -24.979 69.759 1.593   1.00 183.82 ? 64   ILE A CG1   1 
ATOM   487   C  CG2   . ILE A 1 64  ? -27.195 68.778 2.219   1.00 185.16 ? 64   ILE A CG2   1 
ATOM   488   C  CD1   . ILE A 1 64  ? -24.166 69.761 2.868   1.00 181.61 ? 64   ILE A CD1   1 
ATOM   489   N  N     . ARG A 1 65  ? -29.387 70.273 -0.156  1.00 192.40 ? 65   ARG A N     1 
ATOM   490   C  CA    . ARG A 1 65  ? -30.839 70.460 -0.141  1.00 195.12 ? 65   ARG A CA    1 
ATOM   491   C  C     . ARG A 1 65  ? -31.475 69.849 1.105   1.00 193.28 ? 65   ARG A C     1 
ATOM   492   O  O     . ARG A 1 65  ? -32.259 70.505 1.794   1.00 193.95 ? 65   ARG A O     1 
ATOM   493   C  CB    . ARG A 1 65  ? -31.469 69.848 -1.396  1.00 198.83 ? 65   ARG A CB    1 
ATOM   494   C  CG    . ARG A 1 65  ? -31.078 70.545 -2.690  1.00 201.72 ? 65   ARG A CG    1 
ATOM   495   C  CD    . ARG A 1 65  ? -31.502 69.737 -3.905  1.00 205.23 ? 65   ARG A CD    1 
ATOM   496   N  NE    . ARG A 1 65  ? -31.244 70.452 -5.155  1.00 208.53 ? 65   ARG A NE    1 
ATOM   497   C  CZ    . ARG A 1 65  ? -32.007 71.426 -5.653  1.00 212.58 ? 65   ARG A CZ    1 
ATOM   498   N  NH1   . ARG A 1 65  ? -33.102 71.836 -5.016  1.00 214.05 ? 65   ARG A NH1   1 
ATOM   499   N  NH2   . ARG A 1 65  ? -31.670 72.002 -6.803  1.00 215.41 ? 65   ARG A NH2   1 
ATOM   500   N  N     . HIS A 1 66  ? -31.132 68.593 1.381   1.00 190.74 ? 66   HIS A N     1 
ATOM   501   C  CA    . HIS A 1 66  ? -31.640 67.873 2.548   1.00 189.00 ? 66   HIS A CA    1 
ATOM   502   C  C     . HIS A 1 66  ? -30.471 67.228 3.306   1.00 184.60 ? 66   HIS A C     1 
ATOM   503   O  O     . HIS A 1 66  ? -29.997 66.160 2.917   1.00 183.75 ? 66   HIS A O     1 
ATOM   504   C  CB    . HIS A 1 66  ? -32.654 66.814 2.110   1.00 191.74 ? 66   HIS A CB    1 
ATOM   505   C  CG    . HIS A 1 66  ? -33.855 67.380 1.416   1.00 195.56 ? 66   HIS A CG    1 
ATOM   506   N  ND1   . HIS A 1 66  ? -35.027 67.678 2.077   1.00 197.58 ? 66   HIS A ND1   1 
ATOM   507   C  CD2   . HIS A 1 66  ? -34.063 67.705 0.118   1.00 198.02 ? 66   HIS A CD2   1 
ATOM   508   C  CE1   . HIS A 1 66  ? -35.906 68.161 1.216   1.00 200.75 ? 66   HIS A CE1   1 
ATOM   509   N  NE2   . HIS A 1 66  ? -35.346 68.188 0.020   1.00 201.16 ? 66   HIS A NE2   1 
ATOM   510   N  N     . PRO A 1 67  ? -29.990 67.887 4.379   1.00 181.10 ? 67   PRO A N     1 
ATOM   511   C  CA    . PRO A 1 67  ? -28.840 67.407 5.160   1.00 177.45 ? 67   PRO A CA    1 
ATOM   512   C  C     . PRO A 1 67  ? -28.966 65.981 5.704   1.00 175.54 ? 67   PRO A C     1 
ATOM   513   O  O     . PRO A 1 67  ? -28.001 65.219 5.643   1.00 174.38 ? 67   PRO A O     1 
ATOM   514   C  CB    . PRO A 1 67  ? -28.769 68.402 6.323   1.00 177.31 ? 67   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1 67  ? -29.349 69.654 5.775   1.00 179.34 ? 67   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1 67  ? -30.435 69.219 4.834   1.00 181.61 ? 67   PRO A CD    1 
ATOM   517   N  N     . ASP A 1 68  ? -30.138 65.633 6.229   1.00 175.12 ? 68   ASP A N     1 
ATOM   518   C  CA    . ASP A 1 68  ? -30.348 64.325 6.863   1.00 174.32 ? 68   ASP A CA    1 
ATOM   519   C  C     . ASP A 1 68  ? -30.109 63.136 5.924   1.00 173.61 ? 68   ASP A C     1 
ATOM   520   O  O     . ASP A 1 68  ? -29.685 62.070 6.374   1.00 172.80 ? 68   ASP A O     1 
ATOM   521   C  CB    . ASP A 1 68  ? -31.752 64.235 7.482   1.00 177.14 ? 68   ASP A CB    1 
ATOM   522   C  CG    . ASP A 1 68  ? -32.865 64.340 6.449   1.00 180.40 ? 68   ASP A CG    1 
ATOM   523   O  OD1   . ASP A 1 68  ? -32.680 65.043 5.433   1.00 180.91 ? 68   ASP A OD1   1 
ATOM   524   O  OD2   . ASP A 1 68  ? -33.931 63.723 6.660   1.00 182.89 ? 68   ASP A OD2   1 
ATOM   525   N  N     . VAL A 1 69  ? -30.378 63.322 4.632   1.00 173.49 ? 69   VAL A N     1 
ATOM   526   C  CA    . VAL A 1 69  ? -30.186 62.258 3.637   1.00 173.97 ? 69   VAL A CA    1 
ATOM   527   C  C     . VAL A 1 69  ? -28.865 62.376 2.868   1.00 170.97 ? 69   VAL A C     1 
ATOM   528   O  O     . VAL A 1 69  ? -28.391 61.387 2.306   1.00 171.43 ? 69   VAL A O     1 
ATOM   529   C  CB    . VAL A 1 69  ? -31.363 62.186 2.630   1.00 178.04 ? 69   VAL A CB    1 
ATOM   530   C  CG1   . VAL A 1 69  ? -32.687 62.046 3.367   1.00 180.25 ? 69   VAL A CG1   1 
ATOM   531   C  CG2   . VAL A 1 69  ? -31.393 63.398 1.706   1.00 178.30 ? 69   VAL A CG2   1 
ATOM   532   N  N     . GLU A 1 70  ? -28.277 63.573 2.843   1.00 168.03 ? 70   GLU A N     1 
ATOM   533   C  CA    . GLU A 1 70  ? -27.047 63.825 2.083   1.00 165.96 ? 70   GLU A CA    1 
ATOM   534   C  C     . GLU A 1 70  ? -25.789 63.807 2.956   1.00 162.03 ? 70   GLU A C     1 
ATOM   535   O  O     . GLU A 1 70  ? -24.784 63.201 2.582   1.00 161.15 ? 70   GLU A O     1 
ATOM   536   C  CB    . GLU A 1 70  ? -27.143 65.159 1.335   1.00 166.70 ? 70   GLU A CB    1 
ATOM   537   C  CG    . GLU A 1 70  ? -28.190 65.168 0.230   1.00 169.91 ? 70   GLU A CG    1 
ATOM   538   C  CD    . GLU A 1 70  ? -28.174 66.439 -0.601  1.00 170.96 ? 70   GLU A CD    1 
ATOM   539   O  OE1   . GLU A 1 70  ? -29.266 66.923 -0.965  1.00 173.39 ? 70   GLU A OE1   1 
ATOM   540   O  OE2   . GLU A 1 70  ? -27.074 66.956 -0.894  1.00 169.68 ? 70   GLU A OE2   1 
ATOM   541   N  N     . VAL A 1 71  ? -25.848 64.471 4.109   1.00 159.41 ? 71   VAL A N     1 
ATOM   542   C  CA    . VAL A 1 71  ? -24.691 64.578 5.003   1.00 156.21 ? 71   VAL A CA    1 
ATOM   543   C  C     . VAL A 1 71  ? -24.597 63.365 5.929   1.00 155.01 ? 71   VAL A C     1 
ATOM   544   O  O     . VAL A 1 71  ? -25.601 62.920 6.487   1.00 155.45 ? 71   VAL A O     1 
ATOM   545   C  CB    . VAL A 1 71  ? -24.748 65.867 5.853   1.00 155.35 ? 71   VAL A CB    1 
ATOM   546   C  CG1   . VAL A 1 71  ? -23.568 65.938 6.813   1.00 153.87 ? 71   VAL A CG1   1 
ATOM   547   C  CG2   . VAL A 1 71  ? -24.767 67.092 4.953   1.00 156.11 ? 71   VAL A CG2   1 
ATOM   548   N  N     . ASP A 1 72  ? -23.380 62.848 6.089   1.00 153.16 ? 72   ASP A N     1 
ATOM   549   C  CA    . ASP A 1 72  ? -23.117 61.706 6.964   1.00 152.53 ? 72   ASP A CA    1 
ATOM   550   C  C     . ASP A 1 72  ? -22.875 62.187 8.394   1.00 150.73 ? 72   ASP A C     1 
ATOM   551   O  O     . ASP A 1 72  ? -22.307 63.257 8.607   1.00 149.62 ? 72   ASP A O     1 
ATOM   552   C  CB    . ASP A 1 72  ? -21.899 60.926 6.458   1.00 152.66 ? 72   ASP A CB    1 
ATOM   553   C  CG    . ASP A 1 72  ? -21.693 59.609 7.191   1.00 153.64 ? 72   ASP A CG    1 
ATOM   554   O  OD1   . ASP A 1 72  ? -22.691 58.911 7.475   1.00 155.19 ? 72   ASP A OD1   1 
ATOM   555   O  OD2   . ASP A 1 72  ? -20.525 59.267 7.476   1.00 153.26 ? 72   ASP A OD2   1 
ATOM   556   N  N     . GLY A 1 73  ? -23.308 61.387 9.366   1.00 150.64 ? 73   GLY A N     1 
ATOM   557   C  CA    . GLY A 1 73  ? -23.142 61.715 10.781  1.00 149.64 ? 73   GLY A CA    1 
ATOM   558   C  C     . GLY A 1 73  ? -24.167 62.697 11.321  1.00 149.54 ? 73   GLY A C     1 
ATOM   559   O  O     . GLY A 1 73  ? -23.995 63.230 12.416  1.00 149.11 ? 73   GLY A O     1 
ATOM   560   N  N     . PHE A 1 74  ? -25.237 62.928 10.561  1.00 150.35 ? 74   PHE A N     1 
ATOM   561   C  CA    . PHE A 1 74  ? -26.281 63.881 10.944  1.00 150.77 ? 74   PHE A CA    1 
ATOM   562   C  C     . PHE A 1 74  ? -27.103 63.376 12.130  1.00 151.74 ? 74   PHE A C     1 
ATOM   563   O  O     . PHE A 1 74  ? -27.394 64.135 13.055  1.00 152.23 ? 74   PHE A O     1 
ATOM   564   C  CB    . PHE A 1 74  ? -27.201 64.164 9.750   1.00 151.74 ? 74   PHE A CB    1 
ATOM   565   C  CG    . PHE A 1 74  ? -28.293 65.158 10.039  1.00 152.63 ? 74   PHE A CG    1 
ATOM   566   C  CD1   . PHE A 1 74  ? -29.556 64.730 10.430  1.00 154.34 ? 74   PHE A CD1   1 
ATOM   567   C  CD2   . PHE A 1 74  ? -28.062 66.522 9.914   1.00 152.05 ? 74   PHE A CD2   1 
ATOM   568   C  CE1   . PHE A 1 74  ? -30.564 65.641 10.696  1.00 155.36 ? 74   PHE A CE1   1 
ATOM   569   C  CE2   . PHE A 1 74  ? -29.067 67.439 10.177  1.00 153.33 ? 74   PHE A CE2   1 
ATOM   570   C  CZ    . PHE A 1 74  ? -30.320 66.998 10.568  1.00 154.87 ? 74   PHE A CZ    1 
ATOM   571   N  N     . SER A 1 75  ? -27.474 62.098 12.096  1.00 152.54 ? 75   SER A N     1 
ATOM   572   C  CA    . SER A 1 75  ? -28.277 61.493 13.161  1.00 153.93 ? 75   SER A CA    1 
ATOM   573   C  C     . SER A 1 75  ? -27.513 61.383 14.483  1.00 153.49 ? 75   SER A C     1 
ATOM   574   O  O     . SER A 1 75  ? -28.116 61.429 15.557  1.00 154.84 ? 75   SER A O     1 
ATOM   575   C  CB    . SER A 1 75  ? -28.767 60.107 12.737  1.00 155.72 ? 75   SER A CB    1 
ATOM   576   O  OG    . SER A 1 75  ? -27.687 59.198 12.637  1.00 154.60 ? 75   SER A OG    1 
ATOM   577   N  N     . GLU A 1 76  ? -26.191 61.237 14.399  1.00 151.91 ? 76   GLU A N     1 
ATOM   578   C  CA    . GLU A 1 76  ? -25.343 61.116 15.589  1.00 151.29 ? 76   GLU A CA    1 
ATOM   579   C  C     . GLU A 1 76  ? -25.189 62.437 16.349  1.00 150.17 ? 76   GLU A C     1 
ATOM   580   O  O     . GLU A 1 76  ? -24.859 62.428 17.534  1.00 150.45 ? 76   GLU A O     1 
ATOM   581   C  CB    . GLU A 1 76  ? -23.958 60.559 15.227  1.00 150.57 ? 76   GLU A CB    1 
ATOM   582   C  CG    . GLU A 1 76  ? -23.913 59.047 15.028  1.00 152.36 ? 76   GLU A CG    1 
ATOM   583   C  CD    . GLU A 1 76  ? -24.548 58.579 13.728  1.00 153.42 ? 76   GLU A CD    1 
ATOM   584   O  OE1   . GLU A 1 76  ? -24.685 57.350 13.548  1.00 155.66 ? 76   GLU A OE1   1 
ATOM   585   O  OE2   . GLU A 1 76  ? -24.910 59.427 12.884  1.00 153.07 ? 76   GLU A OE2   1 
ATOM   586   N  N     . LEU A 1 77  ? -25.426 63.563 15.673  1.00 149.30 ? 77   LEU A N     1 
ATOM   587   C  CA    . LEU A 1 77  ? -25.329 64.887 16.300  1.00 149.51 ? 77   LEU A CA    1 
ATOM   588   C  C     . LEU A 1 77  ? -26.356 65.080 17.415  1.00 151.68 ? 77   LEU A C     1 
ATOM   589   O  O     . LEU A 1 77  ? -27.314 64.314 17.534  1.00 153.26 ? 77   LEU A O     1 
ATOM   590   C  CB    . LEU A 1 77  ? -25.527 65.999 15.262  1.00 148.68 ? 77   LEU A CB    1 
ATOM   591   C  CG    . LEU A 1 77  ? -24.513 66.151 14.129  1.00 147.32 ? 77   LEU A CG    1 
ATOM   592   C  CD1   . LEU A 1 77  ? -24.978 67.242 13.177  1.00 147.51 ? 77   LEU A CD1   1 
ATOM   593   C  CD2   . LEU A 1 77  ? -23.122 66.459 14.662  1.00 146.99 ? 77   LEU A CD2   1 
ATOM   594   N  N     . ARG A 1 78  ? -26.146 66.118 18.222  1.00 152.64 ? 78   ARG A N     1 
ATOM   595   C  CA    . ARG A 1 78  ? -27.100 66.502 19.263  1.00 154.99 ? 78   ARG A CA    1 
ATOM   596   C  C     . ARG A 1 78  ? -28.312 67.155 18.599  1.00 156.53 ? 78   ARG A C     1 
ATOM   597   O  O     . ARG A 1 78  ? -28.170 67.836 17.582  1.00 155.89 ? 78   ARG A O     1 
ATOM   598   C  CB    . ARG A 1 78  ? -26.453 67.463 20.265  1.00 155.42 ? 78   ARG A CB    1 
ATOM   599   C  CG    . ARG A 1 78  ? -25.219 66.904 20.968  1.00 154.91 ? 78   ARG A CG    1 
ATOM   600   C  CD    . ARG A 1 78  ? -24.485 67.966 21.778  1.00 155.78 ? 78   ARG A CD    1 
ATOM   601   N  NE    . ARG A 1 78  ? -24.768 67.863 23.211  1.00 157.73 ? 78   ARG A NE    1 
ATOM   602   C  CZ    . ARG A 1 78  ? -24.009 67.224 24.105  1.00 158.25 ? 78   ARG A CZ    1 
ATOM   603   N  NH1   . ARG A 1 78  ? -24.380 67.204 25.381  1.00 160.69 ? 78   ARG A NH1   1 
ATOM   604   N  NH2   . ARG A 1 78  ? -22.884 66.609 23.747  1.00 156.97 ? 78   ARG A NH2   1 
ATOM   605   N  N     . TRP A 1 79  ? -29.494 66.952 19.177  1.00 159.50 ? 79   TRP A N     1 
ATOM   606   C  CA    . TRP A 1 79  ? -30.756 67.354 18.540  1.00 161.66 ? 79   TRP A CA    1 
ATOM   607   C  C     . TRP A 1 79  ? -30.791 68.828 18.138  1.00 163.62 ? 79   TRP A C     1 
ATOM   608   O  O     . TRP A 1 79  ? -31.179 69.160 17.018  1.00 163.73 ? 79   TRP A O     1 
ATOM   609   C  CB    . TRP A 1 79  ? -31.950 67.050 19.451  1.00 163.66 ? 79   TRP A CB    1 
ATOM   610   C  CG    . TRP A 1 79  ? -33.269 67.196 18.756  1.00 164.53 ? 79   TRP A CG    1 
ATOM   611   C  CD1   . TRP A 1 79  ? -34.080 68.294 18.758  1.00 165.61 ? 79   TRP A CD1   1 
ATOM   612   C  CD2   . TRP A 1 79  ? -33.922 66.215 17.944  1.00 164.69 ? 79   TRP A CD2   1 
ATOM   613   N  NE1   . TRP A 1 79  ? -35.202 68.055 18.002  1.00 166.66 ? 79   TRP A NE1   1 
ATOM   614   C  CE2   . TRP A 1 79  ? -35.130 66.786 17.490  1.00 166.15 ? 79   TRP A CE2   1 
ATOM   615   C  CE3   . TRP A 1 79  ? -33.606 64.906 17.558  1.00 164.28 ? 79   TRP A CE3   1 
ATOM   616   C  CZ2   . TRP A 1 79  ? -36.023 66.094 16.669  1.00 167.62 ? 79   TRP A CZ2   1 
ATOM   617   C  CZ3   . TRP A 1 79  ? -34.495 64.219 16.741  1.00 165.69 ? 79   TRP A CZ3   1 
ATOM   618   C  CH2   . TRP A 1 79  ? -35.689 64.815 16.307  1.00 167.42 ? 79   TRP A CH2   1 
ATOM   619   N  N     . ASP A 1 80  ? -30.401 69.704 19.060  1.00 166.79 ? 80   ASP A N     1 
ATOM   620   C  CA    . ASP A 1 80  ? -30.385 71.147 18.796  1.00 169.33 ? 80   ASP A CA    1 
ATOM   621   C  C     . ASP A 1 80  ? -29.382 71.530 17.703  1.00 168.57 ? 80   ASP A C     1 
ATOM   622   O  O     . ASP A 1 80  ? -29.622 72.468 16.940  1.00 169.45 ? 80   ASP A O     1 
ATOM   623   C  CB    . ASP A 1 80  ? -30.101 71.938 20.080  1.00 171.72 ? 80   ASP A CB    1 
ATOM   624   C  CG    . ASP A 1 80  ? -28.754 71.597 20.703  1.00 171.55 ? 80   ASP A CG    1 
ATOM   625   O  OD1   . ASP A 1 80  ? -28.122 72.506 21.282  1.00 173.70 ? 80   ASP A OD1   1 
ATOM   626   O  OD2   . ASP A 1 80  ? -28.330 70.425 20.618  1.00 170.27 ? 80   ASP A OD2   1 
ATOM   627   N  N     . ASP A 1 81  ? -28.268 70.804 17.634  1.00 167.89 ? 81   ASP A N     1 
ATOM   628   C  CA    . ASP A 1 81  ? -27.258 71.032 16.599  1.00 167.39 ? 81   ASP A CA    1 
ATOM   629   C  C     . ASP A 1 81  ? -27.722 70.545 15.223  1.00 166.90 ? 81   ASP A C     1 
ATOM   630   O  O     . ASP A 1 81  ? -27.319 71.105 14.204  1.00 166.99 ? 81   ASP A O     1 
ATOM   631   C  CB    . ASP A 1 81  ? -25.927 70.369 16.979  1.00 166.48 ? 81   ASP A CB    1 
ATOM   632   C  CG    . ASP A 1 81  ? -25.193 71.119 18.080  1.00 168.07 ? 81   ASP A CG    1 
ATOM   633   O  OD1   . ASP A 1 81  ? -24.861 70.498 19.111  1.00 168.42 ? 81   ASP A OD1   1 
ATOM   634   O  OD2   . ASP A 1 81  ? -24.950 72.334 17.916  1.00 169.51 ? 81   ASP A OD2   1 
ATOM   635   N  N     . GLN A 1 82  ? -28.560 69.507 15.196  1.00 167.03 ? 82   GLN A N     1 
ATOM   636   C  CA    . GLN A 1 82  ? -29.153 69.026 13.943  1.00 166.97 ? 82   GLN A CA    1 
ATOM   637   C  C     . GLN A 1 82  ? -30.045 70.093 13.309  1.00 169.38 ? 82   GLN A C     1 
ATOM   638   O  O     . GLN A 1 82  ? -30.025 70.283 12.092  1.00 169.17 ? 82   GLN A O     1 
ATOM   639   C  CB    . GLN A 1 82  ? -29.974 67.752 14.173  1.00 166.97 ? 82   GLN A CB    1 
ATOM   640   C  CG    . GLN A 1 82  ? -29.152 66.527 14.534  1.00 165.43 ? 82   GLN A CG    1 
ATOM   641   C  CD    . GLN A 1 82  ? -30.005 65.281 14.716  1.00 166.39 ? 82   GLN A CD    1 
ATOM   642   O  OE1   . GLN A 1 82  ? -30.929 65.031 13.941  1.00 167.06 ? 82   GLN A OE1   1 
ATOM   643   N  NE2   . GLN A 1 82  ? -29.695 64.490 15.739  1.00 166.56 ? 82   GLN A NE2   1 
ATOM   644   N  N     . GLN A 1 83  ? -30.825 70.778 14.143  1.00 172.40 ? 83   GLN A N     1 
ATOM   645   C  CA    . GLN A 1 83  ? -31.713 71.848 13.680  1.00 175.42 ? 83   GLN A CA    1 
ATOM   646   C  C     . GLN A 1 83  ? -30.947 73.056 13.139  1.00 176.21 ? 83   GLN A C     1 
ATOM   647   O  O     . GLN A 1 83  ? -31.433 73.742 12.240  1.00 177.81 ? 83   GLN A O     1 
ATOM   648   C  CB    . GLN A 1 83  ? -32.660 72.288 14.802  1.00 177.86 ? 83   GLN A CB    1 
ATOM   649   C  CG    . GLN A 1 83  ? -33.842 71.354 15.012  1.00 178.94 ? 83   GLN A CG    1 
ATOM   650   C  CD    . GLN A 1 83  ? -34.615 71.672 16.277  1.00 181.36 ? 83   GLN A CD    1 
ATOM   651   O  OE1   . GLN A 1 83  ? -34.087 71.558 17.384  1.00 181.17 ? 83   GLN A OE1   1 
ATOM   652   N  NE2   . GLN A 1 83  ? -35.875 72.067 16.122  1.00 184.03 ? 83   GLN A NE2   1 
ATOM   653   N  N     . LYS A 1 84  ? -29.761 73.317 13.690  1.00 176.10 ? 84   LYS A N     1 
ATOM   654   C  CA    . LYS A 1 84  ? -28.904 74.396 13.193  1.00 177.33 ? 84   LYS A CA    1 
ATOM   655   C  C     . LYS A 1 84  ? -28.418 74.099 11.775  1.00 176.80 ? 84   LYS A C     1 
ATOM   656   O  O     . LYS A 1 84  ? -28.367 74.995 10.934  1.00 178.03 ? 84   LYS A O     1 
ATOM   657   C  CB    . LYS A 1 84  ? -27.710 74.626 14.125  1.00 176.95 ? 84   LYS A CB    1 
ATOM   658   C  CG    . LYS A 1 84  ? -26.782 75.745 13.670  1.00 178.34 ? 84   LYS A CG    1 
ATOM   659   C  CD    . LYS A 1 84  ? -25.905 76.271 14.797  1.00 179.77 ? 84   LYS A CD    1 
ATOM   660   C  CE    . LYS A 1 84  ? -24.989 75.193 15.353  1.00 177.77 ? 84   LYS A CE    1 
ATOM   661   N  NZ    . LYS A 1 84  ? -23.842 75.769 16.107  1.00 179.20 ? 84   LYS A NZ    1 
ATOM   662   N  N     . VAL A 1 85  ? -28.068 72.840 11.517  1.00 175.65 ? 85   VAL A N     1 
ATOM   663   C  CA    . VAL A 1 85  ? -27.661 72.407 10.178  1.00 175.55 ? 85   VAL A CA    1 
ATOM   664   C  C     . VAL A 1 85  ? -28.851 72.458 9.221   1.00 177.71 ? 85   VAL A C     1 
ATOM   665   O  O     . VAL A 1 85  ? -28.719 72.905 8.081   1.00 177.86 ? 85   VAL A O     1 
ATOM   666   C  CB    . VAL A 1 85  ? -27.085 70.971 10.187  1.00 173.59 ? 85   VAL A CB    1 
ATOM   667   C  CG1   . VAL A 1 85  ? -26.763 70.505 8.771   1.00 173.17 ? 85   VAL A CG1   1 
ATOM   668   C  CG2   . VAL A 1 85  ? -25.842 70.890 11.063  1.00 172.65 ? 85   VAL A CG2   1 
ATOM   669   N  N     . LYS A 1 86  ? -30.008 72.004 9.698   1.00 180.22 ? 86   LYS A N     1 
ATOM   670   C  CA    . LYS A 1 86  ? -31.223 71.928 8.884   1.00 183.54 ? 86   LYS A CA    1 
ATOM   671   C  C     . LYS A 1 86  ? -31.717 73.310 8.446   1.00 187.11 ? 86   LYS A C     1 
ATOM   672   O  O     . LYS A 1 86  ? -32.124 73.490 7.297   1.00 188.15 ? 86   LYS A O     1 
ATOM   673   C  CB    . LYS A 1 86  ? -32.327 71.191 9.650   1.00 184.77 ? 86   LYS A CB    1 
ATOM   674   C  CG    . LYS A 1 86  ? -33.466 70.684 8.778   1.00 186.99 ? 86   LYS A CG    1 
ATOM   675   C  CD    . LYS A 1 86  ? -34.490 69.894 9.581   1.00 188.49 ? 86   LYS A CD    1 
ATOM   676   C  CE    . LYS A 1 86  ? -33.956 68.533 10.007  1.00 187.30 ? 86   LYS A CE    1 
ATOM   677   N  NZ    . LYS A 1 86  ? -35.008 67.692 10.643  1.00 189.21 ? 86   LYS A NZ    1 
ATOM   678   N  N     . LYS A 1 87  ? -31.680 74.276 9.362   1.00 189.89 ? 87   LYS A N     1 
ATOM   679   C  CA    . LYS A 1 87  ? -32.072 75.658 9.053   1.00 193.81 ? 87   LYS A CA    1 
ATOM   680   C  C     . LYS A 1 87  ? -31.028 76.370 8.192   1.00 194.63 ? 87   LYS A C     1 
ATOM   681   O  O     . LYS A 1 87  ? -31.378 77.050 7.226   1.00 196.58 ? 87   LYS A O     1 
ATOM   682   C  CB    . LYS A 1 87  ? -32.325 76.464 10.337  1.00 195.71 ? 87   LYS A CB    1 
ATOM   683   C  CG    . LYS A 1 87  ? -33.777 76.483 10.793  1.00 198.14 ? 87   LYS A CG    1 
ATOM   684   C  CD    . LYS A 1 87  ? -34.622 77.403 9.922   1.00 201.49 ? 87   LYS A CD    1 
ATOM   685   C  CE    . LYS A 1 87  ? -36.037 77.554 10.459  1.00 204.12 ? 87   LYS A CE    1 
ATOM   686   N  NZ    . LYS A 1 87  ? -36.091 78.324 11.733  1.00 205.73 ? 87   LYS A NZ    1 
ATOM   687   N  N     . THR A 1 88  ? -29.754 76.212 8.547   1.00 193.64 ? 88   THR A N     1 
ATOM   688   C  CA    . THR A 1 88  ? -28.655 76.849 7.814   1.00 194.73 ? 88   THR A CA    1 
ATOM   689   C  C     . THR A 1 88  ? -28.472 76.253 6.412   1.00 194.63 ? 88   THR A C     1 
ATOM   690   O  O     . THR A 1 88  ? -27.900 76.899 5.532   1.00 195.65 ? 88   THR A O     1 
ATOM   691   C  CB    . THR A 1 88  ? -27.325 76.753 8.594   1.00 193.51 ? 88   THR A CB    1 
ATOM   692   O  OG1   . THR A 1 88  ? -27.527 77.187 9.944   1.00 194.53 ? 88   THR A OG1   1 
ATOM   693   C  CG2   . THR A 1 88  ? -26.245 77.621 7.953   1.00 195.15 ? 88   THR A CG2   1 
ATOM   694   N  N     . ALA A 1 89  ? -28.953 75.027 6.209   1.00 194.08 ? 89   ALA A N     1 
ATOM   695   C  CA    . ALA A 1 89  ? -28.950 74.403 4.884   1.00 194.89 ? 89   ALA A CA    1 
ATOM   696   C  C     . ALA A 1 89  ? -29.786 75.208 3.888   1.00 198.91 ? 89   ALA A C     1 
ATOM   697   O  O     . ALA A 1 89  ? -29.399 75.365 2.729   1.00 200.22 ? 89   ALA A O     1 
ATOM   698   C  CB    . ALA A 1 89  ? -29.467 72.974 4.968   1.00 193.28 ? 89   ALA A CB    1 
ATOM   699   N  N     . GLU A 1 90  ? -30.928 75.715 4.348   1.00 201.74 ? 90   GLU A N     1 
ATOM   700   C  CA    . GLU A 1 90  ? -31.807 76.538 3.517   1.00 205.99 ? 90   GLU A CA    1 
ATOM   701   C  C     . GLU A 1 90  ? -31.287 77.971 3.372   1.00 208.76 ? 90   GLU A C     1 
ATOM   702   O  O     . GLU A 1 90  ? -31.530 78.620 2.353   1.00 211.82 ? 90   GLU A O     1 
ATOM   703   C  CB    . GLU A 1 90  ? -33.227 76.555 4.091   1.00 207.93 ? 90   GLU A CB    1 
ATOM   704   C  CG    . GLU A 1 90  ? -33.885 75.183 4.145   1.00 207.10 ? 90   GLU A CG    1 
ATOM   705   C  CD    . GLU A 1 90  ? -35.298 75.222 4.701   1.00 209.43 ? 90   GLU A CD    1 
ATOM   706   O  OE1   . GLU A 1 90  ? -36.013 76.220 4.471   1.00 212.20 ? 90   GLU A OE1   1 
ATOM   707   O  OE2   . GLU A 1 90  ? -35.698 74.244 5.367   1.00 208.78 ? 90   GLU A OE2   1 
ATOM   708   N  N     . ALA A 1 91  ? -30.579 78.460 4.390   1.00 208.56 ? 91   ALA A N     1 
ATOM   709   C  CA    . ALA A 1 91  ? -30.007 79.807 4.362   1.00 211.35 ? 91   ALA A CA    1 
ATOM   710   C  C     . ALA A 1 91  ? -28.838 79.932 5.334   1.00 210.18 ? 91   ALA A C     1 
ATOM   711   O  O     . ALA A 1 91  ? -27.675 79.863 4.934   1.00 209.48 ? 91   ALA A O     1 
ATOM   712   C  CB    . ALA A 1 91  ? -31.076 80.838 4.689   1.00 214.73 ? 91   ALA A CB    1 
ATOM   713   N  N     . SER A 1 117 ? -55.466 62.943 8.246   1.00 265.23 ? 224  SER A N     1 
ATOM   714   C  CA    . SER A 1 117 ? -54.491 64.014 8.619   1.00 260.67 ? 224  SER A CA    1 
ATOM   715   C  C     . SER A 1 117 ? -54.388 64.254 10.130  1.00 260.98 ? 224  SER A C     1 
ATOM   716   O  O     . SER A 1 117 ? -53.388 64.796 10.598  1.00 257.20 ? 224  SER A O     1 
ATOM   717   C  CB    . SER A 1 117 ? -54.848 65.325 7.913   1.00 260.43 ? 224  SER A CB    1 
ATOM   718   O  OG    . SER A 1 117 ? -54.787 65.178 6.505   1.00 259.90 ? 224  SER A OG    1 
ATOM   719   N  N     . LYS A 1 118 ? -55.413 63.860 10.886  1.00 265.96 ? 225  LYS A N     1 
ATOM   720   C  CA    . LYS A 1 118 ? -55.414 64.036 12.339  1.00 267.34 ? 225  LYS A CA    1 
ATOM   721   C  C     . LYS A 1 118 ? -54.530 62.986 13.002  1.00 265.47 ? 225  LYS A C     1 
ATOM   722   O  O     . LYS A 1 118 ? -53.612 63.328 13.745  1.00 262.36 ? 225  LYS A O     1 
ATOM   723   C  CB    . LYS A 1 118 ? -56.842 63.969 12.894  1.00 273.80 ? 225  LYS A CB    1 
ATOM   724   C  CG    . LYS A 1 118 ? -56.970 64.360 14.361  1.00 275.80 ? 225  LYS A CG    1 
ATOM   725   C  CD    . LYS A 1 118 ? -57.112 63.153 15.277  1.00 278.73 ? 225  LYS A CD    1 
ATOM   726   C  CE    . LYS A 1 118 ? -57.356 63.579 16.717  1.00 281.43 ? 225  LYS A CE    1 
ATOM   727   N  NZ    . LYS A 1 118 ? -57.931 62.478 17.538  1.00 286.21 ? 225  LYS A NZ    1 
ATOM   728   N  N     . LYS A 1 119 ? -54.807 61.713 12.726  1.00 267.36 ? 226  LYS A N     1 
ATOM   729   C  CA    . LYS A 1 119 ? -53.976 60.618 13.232  1.00 265.72 ? 226  LYS A CA    1 
ATOM   730   C  C     . LYS A 1 119 ? -52.617 60.589 12.530  1.00 259.56 ? 226  LYS A C     1 
ATOM   731   O  O     . LYS A 1 119 ? -51.617 60.204 13.130  1.00 257.06 ? 226  LYS A O     1 
ATOM   732   C  CB    . LYS A 1 119 ? -54.680 59.266 13.067  1.00 270.22 ? 226  LYS A CB    1 
ATOM   733   C  CG    . LYS A 1 119 ? -53.954 58.112 13.746  1.00 270.03 ? 226  LYS A CG    1 
ATOM   734   C  CD    . LYS A 1 119 ? -54.789 56.842 13.768  1.00 275.37 ? 226  LYS A CD    1 
ATOM   735   C  CE    . LYS A 1 119 ? -54.085 55.738 14.542  1.00 275.50 ? 226  LYS A CE    1 
ATOM   736   N  NZ    . LYS A 1 119 ? -54.887 54.484 14.599  1.00 281.22 ? 226  LYS A NZ    1 
ATOM   737   N  N     . GLU A 1 120 ? -52.587 60.999 11.263  1.00 257.21 ? 227  GLU A N     1 
ATOM   738   C  CA    . GLU A 1 120 ? -51.343 61.035 10.493  1.00 252.10 ? 227  GLU A CA    1 
ATOM   739   C  C     . GLU A 1 120 ? -50.356 62.042 11.081  1.00 247.70 ? 227  GLU A C     1 
ATOM   740   O  O     . GLU A 1 120 ? -49.194 61.712 11.318  1.00 244.55 ? 227  GLU A O     1 
ATOM   741   C  CB    . GLU A 1 120 ? -51.621 61.388 9.029   1.00 251.80 ? 227  GLU A CB    1 
ATOM   742   C  CG    . GLU A 1 120 ? -52.438 60.349 8.276   1.00 255.33 ? 227  GLU A CG    1 
ATOM   743   C  CD    . GLU A 1 120 ? -52.881 60.830 6.907   1.00 255.82 ? 227  GLU A CD    1 
ATOM   744   O  OE1   . GLU A 1 120 ? -52.185 61.680 6.311   1.00 251.98 ? 227  GLU A OE1   1 
ATOM   745   O  OE2   . GLU A 1 120 ? -53.929 60.354 6.424   1.00 260.23 ? 227  GLU A OE2   1 
ATOM   746   N  N     . LYS A 1 121 ? -50.830 63.263 11.319  1.00 247.15 ? 228  LYS A N     1 
ATOM   747   C  CA    . LYS A 1 121 ? -49.991 64.333 11.862  1.00 242.92 ? 228  LYS A CA    1 
ATOM   748   C  C     . LYS A 1 121 ? -49.676 64.134 13.349  1.00 242.33 ? 228  LYS A C     1 
ATOM   749   O  O     . LYS A 1 121 ? -48.646 64.607 13.830  1.00 239.36 ? 228  LYS A O     1 
ATOM   750   C  CB    . LYS A 1 121 ? -50.658 65.696 11.644  1.00 244.26 ? 228  LYS A CB    1 
ATOM   751   C  CG    . LYS A 1 121 ? -49.757 66.890 11.917  1.00 241.84 ? 228  LYS A CG    1 
ATOM   752   C  CD    . LYS A 1 121 ? -50.419 68.191 11.494  1.00 243.44 ? 228  LYS A CD    1 
ATOM   753   C  CE    . LYS A 1 121 ? -49.539 69.389 11.807  1.00 241.43 ? 228  LYS A CE    1 
ATOM   754   N  NZ    . LYS A 1 121 ? -50.158 70.670 11.367  1.00 243.08 ? 228  LYS A NZ    1 
ATOM   755   N  N     . ASP A 1 122 ? -50.557 63.439 14.069  1.00 245.38 ? 229  ASP A N     1 
ATOM   756   C  CA    . ASP A 1 122 ? -50.355 63.180 15.497  1.00 245.95 ? 229  ASP A CA    1 
ATOM   757   C  C     . ASP A 1 122 ? -49.211 62.190 15.712  1.00 242.48 ? 229  ASP A C     1 
ATOM   758   O  O     . ASP A 1 122 ? -48.287 62.467 16.476  1.00 240.41 ? 229  ASP A O     1 
ATOM   759   C  CB    . ASP A 1 122 ? -51.644 62.648 16.142  1.00 251.70 ? 229  ASP A CB    1 
ATOM   760   C  CG    . ASP A 1 122 ? -51.594 62.651 17.667  1.00 253.80 ? 229  ASP A CG    1 
ATOM   761   O  OD1   . ASP A 1 122 ? -50.599 63.133 18.253  1.00 251.38 ? 229  ASP A OD1   1 
ATOM   762   O  OD2   . ASP A 1 122 ? -52.568 62.168 18.285  1.00 258.38 ? 229  ASP A OD2   1 
ATOM   763   N  N     . LYS A 1 123 ? -49.273 61.046 15.032  1.00 241.55 ? 230  LYS A N     1 
ATOM   764   C  CA    . LYS A 1 123 ? -48.213 60.036 15.122  1.00 238.36 ? 230  LYS A CA    1 
ATOM   765   C  C     . LYS A 1 123 ? -46.903 60.584 14.552  1.00 231.75 ? 230  LYS A C     1 
ATOM   766   O  O     . LYS A 1 123 ? -45.821 60.244 15.031  1.00 228.74 ? 230  LYS A O     1 
ATOM   767   C  CB    . LYS A 1 123 ? -48.596 58.748 14.378  1.00 240.62 ? 230  LYS A CB    1 
ATOM   768   C  CG    . LYS A 1 123 ? -49.919 58.111 14.791  1.00 246.58 ? 230  LYS A CG    1 
ATOM   769   C  CD    . LYS A 1 123 ? -49.933 57.620 16.228  1.00 249.41 ? 230  LYS A CD    1 
ATOM   770   C  CE    . LYS A 1 123 ? -51.307 57.074 16.585  1.00 255.83 ? 230  LYS A CE    1 
ATOM   771   N  NZ    . LYS A 1 123 ? -51.381 56.556 17.979  1.00 259.17 ? 230  LYS A NZ    1 
ATOM   772   N  N     . ASP A 1 124 ? -47.014 61.430 13.528  1.00 228.70 ? 231  ASP A N     1 
ATOM   773   C  CA    . ASP A 1 124 ? -45.861 62.109 12.934  1.00 222.93 ? 231  ASP A CA    1 
ATOM   774   C  C     . ASP A 1 124 ? -45.204 63.068 13.927  1.00 219.76 ? 231  ASP A C     1 
ATOM   775   O  O     . ASP A 1 124 ? -43.983 63.064 14.086  1.00 216.89 ? 231  ASP A O     1 
ATOM   776   C  CB    . ASP A 1 124 ? -46.293 62.875 11.676  1.00 222.74 ? 231  ASP A CB    1 
ATOM   777   C  CG    . ASP A 1 124 ? -45.154 63.652 11.036  1.00 218.90 ? 231  ASP A CG    1 
ATOM   778   O  OD1   . ASP A 1 124 ? -44.034 63.107 10.940  1.00 216.77 ? 231  ASP A OD1   1 
ATOM   779   O  OD2   . ASP A 1 124 ? -45.384 64.807 10.619  1.00 218.59 ? 231  ASP A OD2   1 
ATOM   780   N  N     . SER A 1 125 ? -46.021 63.885 14.589  1.00 220.21 ? 232  SER A N     1 
ATOM   781   C  CA    . SER A 1 125 ? -45.525 64.868 15.553  1.00 218.15 ? 232  SER A CA    1 
ATOM   782   C  C     . SER A 1 125 ? -45.064 64.215 16.857  1.00 217.52 ? 232  SER A C     1 
ATOM   783   O  O     . SER A 1 125 ? -44.061 64.630 17.440  1.00 215.01 ? 232  SER A O     1 
ATOM   784   C  CB    . SER A 1 125 ? -46.602 65.915 15.852  1.00 221.11 ? 232  SER A CB    1 
ATOM   785   O  OG    . SER A 1 125 ? -46.097 66.947 16.682  1.00 220.64 ? 232  SER A OG    1 
ATOM   786   N  N     . LYS A 1 126 ? -45.798 63.199 17.308  1.00 219.12 ? 233  LYS A N     1 
ATOM   787   C  CA    . LYS A 1 126 ? -45.485 62.512 18.565  1.00 219.25 ? 233  LYS A CA    1 
ATOM   788   C  C     . LYS A 1 126 ? -44.250 61.613 18.444  1.00 214.87 ? 233  LYS A C     1 
ATOM   789   O  O     . LYS A 1 126 ? -43.603 61.312 19.449  1.00 214.68 ? 233  LYS A O     1 
ATOM   790   C  CB    . LYS A 1 126 ? -46.695 61.697 19.049  1.00 223.96 ? 233  LYS A CB    1 
ATOM   791   C  CG    . LYS A 1 126 ? -46.653 61.289 20.516  1.00 226.71 ? 233  LYS A CG    1 
ATOM   792   C  CD    . LYS A 1 126 ? -46.713 62.494 21.444  1.00 227.90 ? 233  LYS A CD    1 
ATOM   793   C  CE    . LYS A 1 126 ? -46.876 62.075 22.895  1.00 231.66 ? 233  LYS A CE    1 
ATOM   794   N  NZ    . LYS A 1 126 ? -46.546 63.182 23.834  1.00 232.19 ? 233  LYS A NZ    1 
ATOM   795   N  N     . LEU A 1 127 ? -43.927 61.185 17.224  1.00 210.94 ? 234  LEU A N     1 
ATOM   796   C  CA    . LEU A 1 127 ? -42.705 60.414 16.975  1.00 206.71 ? 234  LEU A CA    1 
ATOM   797   C  C     . LEU A 1 127 ? -41.474 61.310 17.083  1.00 201.37 ? 234  LEU A C     1 
ATOM   798   O  O     . LEU A 1 127 ? -40.475 60.921 17.688  1.00 199.93 ? 234  LEU A O     1 
ATOM   799   C  CB    . LEU A 1 127 ? -42.751 59.738 15.600  1.00 206.07 ? 234  LEU A CB    1 
ATOM   800   C  CG    . LEU A 1 127 ? -41.540 58.870 15.219  1.00 203.70 ? 234  LEU A CG    1 
ATOM   801   C  CD1   . LEU A 1 127 ? -41.982 57.636 14.443  1.00 205.40 ? 234  LEU A CD1   1 
ATOM   802   C  CD2   . LEU A 1 127 ? -40.495 59.649 14.428  1.00 199.88 ? 234  LEU A CD2   1 
ATOM   803   N  N     . GLU A 1 128 ? -41.552 62.503 16.494  1.00 197.96 ? 235  GLU A N     1 
ATOM   804   C  CA    . GLU A 1 128 ? -40.465 63.483 16.574  1.00 193.60 ? 235  GLU A CA    1 
ATOM   805   C  C     . GLU A 1 128 ? -40.218 63.924 18.019  1.00 193.20 ? 235  GLU A C     1 
ATOM   806   O  O     . GLU A 1 128 ? -39.107 64.327 18.368  1.00 191.04 ? 235  GLU A O     1 
ATOM   807   C  CB    . GLU A 1 128 ? -40.767 64.702 15.696  1.00 192.94 ? 235  GLU A CB    1 
ATOM   808   C  CG    . GLU A 1 128 ? -39.573 65.618 15.471  1.00 190.33 ? 235  GLU A CG    1 
ATOM   809   C  CD    . GLU A 1 128 ? -39.845 66.703 14.445  1.00 190.00 ? 235  GLU A CD    1 
ATOM   810   O  OE1   . GLU A 1 128 ? -40.963 67.261 14.443  1.00 192.55 ? 235  GLU A OE1   1 
ATOM   811   O  OE2   . GLU A 1 128 ? -38.937 67.005 13.643  1.00 187.95 ? 235  GLU A OE2   1 
ATOM   812   N  N     . LYS A 1 129 ? -41.258 63.850 18.848  1.00 195.02 ? 236  LYS A N     1 
ATOM   813   C  CA    . LYS A 1 129 ? -41.124 64.077 20.285  1.00 195.70 ? 236  LYS A CA    1 
ATOM   814   C  C     . LYS A 1 129 ? -40.310 62.948 20.923  1.00 193.63 ? 236  LYS A C     1 
ATOM   815   O  O     . LYS A 1 129 ? -39.424 63.199 21.741  1.00 192.92 ? 236  LYS A O     1 
ATOM   816   C  CB    . LYS A 1 129 ? -42.502 64.166 20.953  1.00 200.37 ? 236  LYS A CB    1 
ATOM   817   C  CG    . LYS A 1 129 ? -42.479 64.828 22.322  1.00 203.05 ? 236  LYS A CG    1 
ATOM   818   C  CD    . LYS A 1 129 ? -42.358 66.343 22.212  1.00 202.45 ? 236  LYS A CD    1 
ATOM   819   C  CE    . LYS A 1 129 ? -41.206 66.887 23.044  1.00 201.52 ? 236  LYS A CE    1 
ATOM   820   N  NZ    . LYS A 1 129 ? -39.884 66.567 22.437  1.00 197.32 ? 236  LYS A NZ    1 
ATOM   821   N  N     . ALA A 1 130 ? -40.621 61.711 20.540  1.00 192.24 ? 237  ALA A N     1 
ATOM   822   C  CA    . ALA A 1 130 ? -39.910 60.532 21.038  1.00 190.61 ? 237  ALA A CA    1 
ATOM   823   C  C     . ALA A 1 130 ? -38.516 60.381 20.422  1.00 185.12 ? 237  ALA A C     1 
ATOM   824   O  O     . ALA A 1 130 ? -37.653 59.714 20.997  1.00 184.35 ? 237  ALA A O     1 
ATOM   825   C  CB    . ALA A 1 130 ? -40.732 59.277 20.784  1.00 193.18 ? 237  ALA A CB    1 
ATOM   826   N  N     . LEU A 1 131 ? -38.301 60.990 19.256  1.00 180.88 ? 238  LEU A N     1 
ATOM   827   C  CA    . LEU A 1 131 ? -37.003 60.933 18.579  1.00 176.12 ? 238  LEU A CA    1 
ATOM   828   C  C     . LEU A 1 131 ? -36.004 61.859 19.274  1.00 173.61 ? 238  LEU A C     1 
ATOM   829   O  O     . LEU A 1 131 ? -34.838 61.502 19.449  1.00 171.84 ? 238  LEU A O     1 
ATOM   830   C  CB    . LEU A 1 131 ? -37.141 61.307 17.096  1.00 174.25 ? 238  LEU A CB    1 
ATOM   831   C  CG    . LEU A 1 131 ? -36.231 60.555 16.121  1.00 172.00 ? 238  LEU A CG    1 
ATOM   832   C  CD1   . LEU A 1 131 ? -36.624 59.085 16.036  1.00 173.61 ? 238  LEU A CD1   1 
ATOM   833   C  CD2   . LEU A 1 131 ? -36.283 61.198 14.743  1.00 170.39 ? 238  LEU A CD2   1 
ATOM   834   N  N     . LYS A 1 132 ? -36.469 63.048 19.659  1.00 173.19 ? 239  LYS A N     1 
ATOM   835   C  CA    . LYS A 1 132 ? -35.685 63.958 20.496  1.00 172.10 ? 239  LYS A CA    1 
ATOM   836   C  C     . LYS A 1 132 ? -35.441 63.334 21.866  1.00 173.49 ? 239  LYS A C     1 
ATOM   837   O  O     . LYS A 1 132 ? -34.338 63.421 22.405  1.00 172.74 ? 239  LYS A O     1 
ATOM   838   C  CB    . LYS A 1 132 ? -36.402 65.303 20.661  1.00 173.53 ? 239  LYS A CB    1 
ATOM   839   C  CG    . LYS A 1 132 ? -35.751 66.244 21.667  1.00 174.32 ? 239  LYS A CG    1 
ATOM   840   C  CD    . LYS A 1 132 ? -36.423 67.608 21.683  1.00 175.89 ? 239  LYS A CD    1 
ATOM   841   C  CE    . LYS A 1 132 ? -36.244 68.311 23.021  1.00 178.64 ? 239  LYS A CE    1 
ATOM   842   N  NZ    . LYS A 1 132 ? -34.820 68.623 23.328  1.00 177.41 ? 239  LYS A NZ    1 
ATOM   843   N  N     . ALA A 1 133 ? -36.481 62.716 22.424  1.00 175.90 ? 240  ALA A N     1 
ATOM   844   C  CA    . ALA A 1 133 ? -36.390 62.044 23.721  1.00 178.05 ? 240  ALA A CA    1 
ATOM   845   C  C     . ALA A 1 133 ? -35.272 61.004 23.740  1.00 175.59 ? 240  ALA A C     1 
ATOM   846   O  O     . ALA A 1 133 ? -34.568 60.867 24.737  1.00 176.28 ? 240  ALA A O     1 
ATOM   847   C  CB    . ALA A 1 133 ? -37.720 61.391 24.075  1.00 181.91 ? 240  ALA A CB    1 
ATOM   848   N  N     . GLN A 1 134 ? -35.114 60.283 22.632  1.00 172.59 ? 241  GLN A N     1 
ATOM   849   C  CA    . GLN A 1 134 ? -34.071 59.266 22.508  1.00 170.54 ? 241  GLN A CA    1 
ATOM   850   C  C     . GLN A 1 134 ? -32.701 59.872 22.202  1.00 166.94 ? 241  GLN A C     1 
ATOM   851   O  O     . GLN A 1 134 ? -31.684 59.389 22.704  1.00 166.38 ? 241  GLN A O     1 
ATOM   852   C  CB    . GLN A 1 134 ? -34.447 58.253 21.425  1.00 169.89 ? 241  GLN A CB    1 
ATOM   853   C  CG    . GLN A 1 134 ? -33.448 57.117 21.270  1.00 168.75 ? 241  GLN A CG    1 
ATOM   854   C  CD    . GLN A 1 134 ? -34.085 55.846 20.747  1.00 170.14 ? 241  GLN A CD    1 
ATOM   855   O  OE1   . GLN A 1 134 ? -33.826 55.428 19.619  1.00 168.50 ? 241  GLN A OE1   1 
ATOM   856   N  NE2   . GLN A 1 134 ? -34.927 55.224 21.567  1.00 173.73 ? 241  GLN A NE2   1 
ATOM   857   N  N     . ASN A 1 135 ? -32.676 60.918 21.377  1.00 164.44 ? 242  ASN A N     1 
ATOM   858   C  CA    . ASN A 1 135 ? -31.425 61.575 20.993  1.00 161.44 ? 242  ASN A CA    1 
ATOM   859   C  C     . ASN A 1 135 ? -30.661 62.115 22.199  1.00 162.36 ? 242  ASN A C     1 
ATOM   860   O  O     . ASN A 1 135 ? -29.520 61.721 22.443  1.00 161.94 ? 242  ASN A O     1 
ATOM   861   C  CB    . ASN A 1 135 ? -31.690 62.716 20.005  1.00 159.77 ? 242  ASN A CB    1 
ATOM   862   C  CG    . ASN A 1 135 ? -30.414 63.397 19.543  1.00 157.36 ? 242  ASN A CG    1 
ATOM   863   O  OD1   . ASN A 1 135 ? -30.042 64.452 20.054  1.00 157.60 ? 242  ASN A OD1   1 
ATOM   864   N  ND2   . ASN A 1 135 ? -29.726 62.785 18.585  1.00 155.43 ? 242  ASN A ND2   1 
ATOM   865   N  N     . ASP A 1 136 ? -31.299 63.010 22.950  1.00 164.34 ? 243  ASP A N     1 
ATOM   866   C  CA    . ASP A 1 136 ? -30.650 63.647 24.101  1.00 165.94 ? 243  ASP A CA    1 
ATOM   867   C  C     . ASP A 1 136 ? -30.681 62.802 25.382  1.00 168.56 ? 243  ASP A C     1 
ATOM   868   O  O     . ASP A 1 136 ? -30.150 63.221 26.410  1.00 170.49 ? 243  ASP A O     1 
ATOM   869   C  CB    . ASP A 1 136 ? -31.212 65.061 24.352  1.00 167.58 ? 243  ASP A CB    1 
ATOM   870   C  CG    . ASP A 1 136 ? -32.715 65.078 24.588  1.00 170.32 ? 243  ASP A CG    1 
ATOM   871   O  OD1   . ASP A 1 136 ? -33.345 66.107 24.266  1.00 171.20 ? 243  ASP A OD1   1 
ATOM   872   O  OD2   . ASP A 1 136 ? -33.270 64.078 25.091  1.00 172.42 ? 243  ASP A OD2   1 
ATOM   873   N  N     . LEU A 1 137 ? -31.300 61.622 25.322  1.00 168.98 ? 244  LEU A N     1 
ATOM   874   C  CA    . LEU A 1 137 ? -31.174 60.631 26.397  1.00 171.23 ? 244  LEU A CA    1 
ATOM   875   C  C     . LEU A 1 137 ? -29.785 60.010 26.341  1.00 169.14 ? 244  LEU A C     1 
ATOM   876   O  O     . LEU A 1 137 ? -29.088 59.934 27.353  1.00 170.74 ? 244  LEU A O     1 
ATOM   877   C  CB    . LEU A 1 137 ? -32.240 59.535 26.275  1.00 172.92 ? 244  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1 137 ? -32.064 58.276 27.135  1.00 175.39 ? 244  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1 137 ? -31.992 58.623 28.615  1.00 178.90 ? 244  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1 137 ? -33.192 57.289 26.873  1.00 177.26 ? 244  LEU A CD2   1 
ATOM   881   N  N     . ILE A 1 138 ? -29.394 59.567 25.149  1.00 165.76 ? 245  ILE A N     1 
ATOM   882   C  CA    . ILE A 1 138 ? -28.074 58.979 24.932  1.00 163.78 ? 245  ILE A CA    1 
ATOM   883   C  C     . ILE A 1 138 ? -26.980 60.019 25.176  1.00 162.73 ? 245  ILE A C     1 
ATOM   884   O  O     . ILE A 1 138 ? -25.956 59.708 25.782  1.00 162.95 ? 245  ILE A O     1 
ATOM   885   C  CB    . ILE A 1 138 ? -27.946 58.374 23.513  1.00 160.93 ? 245  ILE A CB    1 
ATOM   886   C  CG1   . ILE A 1 138 ? -28.924 57.201 23.358  1.00 162.33 ? 245  ILE A CG1   1 
ATOM   887   C  CG2   . ILE A 1 138 ? -26.520 57.906 23.240  1.00 159.24 ? 245  ILE A CG2   1 
ATOM   888   C  CD1   . ILE A 1 138 ? -28.814 56.457 22.044  1.00 160.46 ? 245  ILE A CD1   1 
ATOM   889   N  N     . TRP A 1 139 ? -27.204 61.248 24.716  1.00 161.88 ? 246  TRP A N     1 
ATOM   890   C  CA    . TRP A 1 139 ? -26.231 62.329 24.910  1.00 161.82 ? 246  TRP A CA    1 
ATOM   891   C  C     . TRP A 1 139 ? -26.042 62.698 26.380  1.00 165.22 ? 246  TRP A C     1 
ATOM   892   O  O     . TRP A 1 139 ? -24.924 62.992 26.802  1.00 165.63 ? 246  TRP A O     1 
ATOM   893   C  CB    . TRP A 1 139 ? -26.607 63.570 24.093  1.00 160.70 ? 246  TRP A CB    1 
ATOM   894   C  CG    . TRP A 1 139 ? -26.043 63.545 22.712  1.00 157.84 ? 246  TRP A CG    1 
ATOM   895   C  CD1   . TRP A 1 139 ? -26.736 63.463 21.541  1.00 156.23 ? 246  TRP A CD1   1 
ATOM   896   C  CD2   . TRP A 1 139 ? -24.657 63.587 22.358  1.00 156.75 ? 246  TRP A CD2   1 
ATOM   897   N  NE1   . TRP A 1 139 ? -25.866 63.460 20.476  1.00 154.09 ? 246  TRP A NE1   1 
ATOM   898   C  CE2   . TRP A 1 139 ? -24.583 63.534 20.951  1.00 154.40 ? 246  TRP A CE2   1 
ATOM   899   C  CE3   . TRP A 1 139 ? -23.469 63.666 23.096  1.00 157.65 ? 246  TRP A CE3   1 
ATOM   900   C  CZ2   . TRP A 1 139 ? -23.365 63.560 20.265  1.00 152.97 ? 246  TRP A CZ2   1 
ATOM   901   C  CZ3   . TRP A 1 139 ? -22.260 63.693 22.414  1.00 156.10 ? 246  TRP A CZ3   1 
ATOM   902   C  CH2   . TRP A 1 139 ? -22.219 63.640 21.012  1.00 153.79 ? 246  TRP A CH2   1 
ATOM   903   N  N     . ASN A 1 140 ? -27.127 62.688 27.152  1.00 168.19 ? 247  ASN A N     1 
ATOM   904   C  CA    . ASN A 1 140 ? -27.025 62.827 28.606  1.00 172.05 ? 247  ASN A CA    1 
ATOM   905   C  C     . ASN A 1 140 ? -26.185 61.694 29.192  1.00 172.57 ? 247  ASN A C     1 
ATOM   906   O  O     . ASN A 1 140 ? -25.333 61.925 30.048  1.00 174.32 ? 247  ASN A O     1 
ATOM   907   C  CB    . ASN A 1 140 ? -28.412 62.836 29.264  1.00 175.45 ? 247  ASN A CB    1 
ATOM   908   C  CG    . ASN A 1 140 ? -29.120 64.174 29.133  1.00 176.41 ? 247  ASN A CG    1 
ATOM   909   O  OD1   . ASN A 1 140 ? -28.743 65.018 28.319  1.00 174.47 ? 247  ASN A OD1   1 
ATOM   910   N  ND2   . ASN A 1 140 ? -30.160 64.370 29.936  1.00 179.94 ? 247  ASN A ND2   1 
ATOM   911   N  N     . ILE A 1 141 ? -26.427 60.477 28.711  1.00 171.26 ? 248  ILE A N     1 
ATOM   912   C  CA    . ILE A 1 141 ? -25.693 59.291 29.155  1.00 171.75 ? 248  ILE A CA    1 
ATOM   913   C  C     . ILE A 1 141 ? -24.234 59.303 28.681  1.00 169.68 ? 248  ILE A C     1 
ATOM   914   O  O     . ILE A 1 141 ? -23.343 58.854 29.406  1.00 170.90 ? 248  ILE A O     1 
ATOM   915   C  CB    . ILE A 1 141 ? -26.399 57.998 28.681  1.00 171.32 ? 248  ILE A CB    1 
ATOM   916   C  CG1   . ILE A 1 141 ? -27.738 57.832 29.408  1.00 174.74 ? 248  ILE A CG1   1 
ATOM   917   C  CG2   . ILE A 1 141 ? -25.531 56.771 28.928  1.00 171.56 ? 248  ILE A CG2   1 
ATOM   918   C  CD1   . ILE A 1 141 ? -28.678 56.839 28.758  1.00 174.77 ? 248  ILE A CD1   1 
ATOM   919   N  N     . LYS A 1 142 ? -23.995 59.813 27.473  1.00 166.92 ? 249  LYS A N     1 
ATOM   920   C  CA    . LYS A 1 142 ? -22.644 59.851 26.899  1.00 165.12 ? 249  LYS A CA    1 
ATOM   921   C  C     . LYS A 1 142 ? -21.688 60.698 27.737  1.00 167.19 ? 249  LYS A C     1 
ATOM   922   O  O     . LYS A 1 142 ? -20.694 60.186 28.254  1.00 168.22 ? 249  LYS A O     1 
ATOM   923   C  CB    . LYS A 1 142 ? -22.669 60.362 25.450  1.00 161.86 ? 249  LYS A CB    1 
ATOM   924   C  CG    . LYS A 1 142 ? -23.015 59.293 24.423  1.00 160.06 ? 249  LYS A CG    1 
ATOM   925   C  CD    . LYS A 1 142 ? -22.862 59.798 22.994  1.00 157.25 ? 249  LYS A CD    1 
ATOM   926   C  CE    . LYS A 1 142 ? -21.434 59.651 22.491  1.00 155.93 ? 249  LYS A CE    1 
ATOM   927   N  NZ    . LYS A 1 142 ? -21.288 60.052 21.064  1.00 153.72 ? 249  LYS A NZ    1 
ATOM   928   N  N     . ASP A 1 143 ? -21.995 61.985 27.877  1.00 168.64 ? 250  ASP A N     1 
ATOM   929   C  CA    . ASP A 1 143 ? -21.135 62.901 28.641  1.00 171.32 ? 250  ASP A CA    1 
ATOM   930   C  C     . ASP A 1 143 ? -21.230 62.713 30.165  1.00 176.04 ? 250  ASP A C     1 
ATOM   931   O  O     . ASP A 1 143 ? -20.452 63.311 30.910  1.00 178.39 ? 250  ASP A O     1 
ATOM   932   C  CB    . ASP A 1 143 ? -21.377 64.371 28.247  1.00 170.97 ? 250  ASP A CB    1 
ATOM   933   C  CG    . ASP A 1 143 ? -22.847 64.756 28.243  1.00 171.53 ? 250  ASP A CG    1 
ATOM   934   O  OD1   . ASP A 1 143 ? -23.266 65.472 27.309  1.00 169.89 ? 250  ASP A OD1   1 
ATOM   935   O  OD2   . ASP A 1 143 ? -23.586 64.343 29.162  1.00 174.08 ? 250  ASP A OD2   1 
ATOM   936   N  N     . GLU A 1 144 ? -22.176 61.890 30.621  1.00 178.36 ? 251  GLU A N     1 
ATOM   937   C  CA    . GLU A 1 144 ? -22.184 61.425 32.013  1.00 183.07 ? 251  GLU A CA    1 
ATOM   938   C  C     . GLU A 1 144 ? -21.015 60.472 32.249  1.00 183.84 ? 251  GLU A C     1 
ATOM   939   O  O     . GLU A 1 144 ? -20.310 60.582 33.254  1.00 186.93 ? 251  GLU A O     1 
ATOM   940   C  CB    . GLU A 1 144 ? -23.505 60.726 32.367  1.00 184.77 ? 251  GLU A CB    1 
ATOM   941   C  CG    . GLU A 1 144 ? -24.566 61.645 32.960  1.00 187.45 ? 251  GLU A CG    1 
ATOM   942   C  CD    . GLU A 1 144 ? -24.375 61.906 34.446  1.00 192.16 ? 251  GLU A CD    1 
ATOM   943   O  OE1   . GLU A 1 144 ? -23.235 61.790 34.944  1.00 192.85 ? 251  GLU A OE1   1 
ATOM   944   O  OE2   . GLU A 1 144 ? -25.375 62.234 35.119  1.00 195.45 ? 251  GLU A OE2   1 
ATOM   945   N  N     . LEU A 1 145 ? -20.819 59.539 31.319  1.00 181.64 ? 252  LEU A N     1 
ATOM   946   C  CA    . LEU A 1 145 ? -19.696 58.602 31.378  1.00 182.07 ? 252  LEU A CA    1 
ATOM   947   C  C     . LEU A 1 145 ? -18.355 59.300 31.151  1.00 181.96 ? 252  LEU A C     1 
ATOM   948   O  O     . LEU A 1 145 ? -17.338 58.889 31.711  1.00 183.43 ? 252  LEU A O     1 
ATOM   949   C  CB    . LEU A 1 145 ? -19.874 57.478 30.354  1.00 179.51 ? 252  LEU A CB    1 
ATOM   950   C  CG    . LEU A 1 145 ? -20.989 56.471 30.642  1.00 180.93 ? 252  LEU A CG    1 
ATOM   951   C  CD1   . LEU A 1 145 ? -21.260 55.624 29.409  1.00 178.18 ? 252  LEU A CD1   1 
ATOM   952   C  CD2   . LEU A 1 145 ? -20.641 55.590 31.834  1.00 184.38 ? 252  LEU A CD2   1 
ATOM   953   N  N     . LYS A 1 146 ? -18.357 60.348 30.329  1.00 180.85 ? 253  LYS A N     1 
ATOM   954   C  CA    . LYS A 1 146 ? -17.153 61.143 30.086  1.00 181.38 ? 253  LYS A CA    1 
ATOM   955   C  C     . LYS A 1 146 ? -16.740 61.929 31.334  1.00 185.71 ? 253  LYS A C     1 
ATOM   956   O  O     . LYS A 1 146 ? -15.557 62.209 31.533  1.00 187.08 ? 253  LYS A O     1 
ATOM   957   C  CB    . LYS A 1 146 ? -17.369 62.096 28.906  1.00 179.00 ? 253  LYS A CB    1 
ATOM   958   C  CG    . LYS A 1 146 ? -16.107 62.814 28.445  1.00 178.85 ? 253  LYS A CG    1 
ATOM   959   C  CD    . LYS A 1 146 ? -16.096 63.042 26.941  1.00 175.77 ? 253  LYS A CD    1 
ATOM   960   C  CE    . LYS A 1 146 ? -15.714 61.775 26.188  1.00 173.95 ? 253  LYS A CE    1 
ATOM   961   N  NZ    . LYS A 1 146 ? -15.616 61.995 24.719  1.00 171.44 ? 253  LYS A NZ    1 
ATOM   962   N  N     . LYS A 1 147 ? -17.720 62.278 32.167  1.00 188.68 ? 254  LYS A N     1 
ATOM   963   C  CA    . LYS A 1 147 ? -17.461 62.967 33.430  1.00 193.33 ? 254  LYS A CA    1 
ATOM   964   C  C     . LYS A 1 147 ? -16.885 62.012 34.480  1.00 196.19 ? 254  LYS A C     1 
ATOM   965   O  O     . LYS A 1 147 ? -15.949 62.370 35.198  1.00 199.04 ? 254  LYS A O     1 
ATOM   966   C  CB    . LYS A 1 147 ? -18.750 63.604 33.964  1.00 195.70 ? 254  LYS A CB    1 
ATOM   967   C  CG    . LYS A 1 147 ? -18.535 64.607 35.091  1.00 200.33 ? 254  LYS A CG    1 
ATOM   968   C  CD    . LYS A 1 147 ? -19.822 64.904 35.847  1.00 203.45 ? 254  LYS A CD    1 
ATOM   969   C  CE    . LYS A 1 147 ? -20.835 65.641 34.985  1.00 201.54 ? 254  LYS A CE    1 
ATOM   970   N  NZ    . LYS A 1 147 ? -22.036 66.043 35.769  1.00 205.08 ? 254  LYS A NZ    1 
ATOM   971   N  N     . VAL A 1 148 ? -17.443 60.804 34.561  1.00 195.92 ? 255  VAL A N     1 
ATOM   972   C  CA    . VAL A 1 148 ? -17.108 59.860 35.637  1.00 199.17 ? 255  VAL A CA    1 
ATOM   973   C  C     . VAL A 1 148 ? -16.040 58.828 35.256  1.00 197.80 ? 255  VAL A C     1 
ATOM   974   O  O     . VAL A 1 148 ? -15.121 58.576 36.038  1.00 200.22 ? 255  VAL A O     1 
ATOM   975   C  CB    . VAL A 1 148 ? -18.367 59.134 36.183  1.00 201.03 ? 255  VAL A CB    1 
ATOM   976   C  CG1   . VAL A 1 148 ? -19.412 60.146 36.634  1.00 203.00 ? 255  VAL A CG1   1 
ATOM   977   C  CG2   . VAL A 1 148 ? -18.960 58.172 35.160  1.00 197.77 ? 255  VAL A CG2   1 
ATOM   978   N  N     . CYS A 1 149 ? -16.153 58.244 34.064  1.00 194.24 ? 256  CYS A N     1 
ATOM   979   C  CA    . CYS A 1 149 ? -15.287 57.132 33.657  1.00 193.25 ? 256  CYS A CA    1 
ATOM   980   C  C     . CYS A 1 149 ? -14.175 57.566 32.706  1.00 190.76 ? 256  CYS A C     1 
ATOM   981   O  O     . CYS A 1 149 ? -14.364 58.458 31.877  1.00 188.35 ? 256  CYS A O     1 
ATOM   982   C  CB    . CYS A 1 149 ? -16.112 56.025 32.992  1.00 191.35 ? 256  CYS A CB    1 
ATOM   983   S  SG    . CYS A 1 149 ? -17.138 55.065 34.129  1.00 195.22 ? 256  CYS A SG    1 
ATOM   984   N  N     . SER A 1 150 ? -13.017 56.922 32.838  1.00 191.69 ? 257  SER A N     1 
ATOM   985   C  CA    . SER A 1 150 ? -11.920 57.080 31.887  1.00 190.00 ? 257  SER A CA    1 
ATOM   986   C  C     . SER A 1 150 ? -12.143 56.133 30.709  1.00 186.88 ? 257  SER A C     1 
ATOM   987   O  O     . SER A 1 150 ? -13.092 55.347 30.710  1.00 186.81 ? 257  SER A O     1 
ATOM   988   C  CB    . SER A 1 150 ? -10.578 56.779 32.561  1.00 192.80 ? 257  SER A CB    1 
ATOM   989   O  OG    . SER A 1 150 ? -10.526 55.441 33.026  1.00 194.33 ? 257  SER A OG    1 
ATOM   990   N  N     . THR A 1 151 ? -11.270 56.211 29.708  1.00 184.72 ? 258  THR A N     1 
ATOM   991   C  CA    . THR A 1 151 ? -11.392 55.373 28.514  1.00 181.96 ? 258  THR A CA    1 
ATOM   992   C  C     . THR A 1 151 ? -11.192 53.891 28.838  1.00 183.16 ? 258  THR A C     1 
ATOM   993   O  O     . THR A 1 151 ? -11.915 53.039 28.320  1.00 182.29 ? 258  THR A O     1 
ATOM   994   C  CB    . THR A 1 151 ? -10.387 55.793 27.422  1.00 180.34 ? 258  THR A CB    1 
ATOM   995   O  OG1   . THR A 1 151 ? -10.481 57.206 27.197  1.00 179.69 ? 258  THR A OG1   1 
ATOM   996   C  CG2   . THR A 1 151 ? -10.665 55.054 26.115  1.00 177.81 ? 258  THR A CG2   1 
ATOM   997   N  N     . ASN A 1 152 ? -10.218 53.592 29.696  1.00 185.56 ? 259  ASN A N     1 
ATOM   998   C  CA    . ASN A 1 152 ? -9.915  52.208 30.081  1.00 187.02 ? 259  ASN A CA    1 
ATOM   999   C  C     . ASN A 1 152 ? -11.077 51.511 30.793  1.00 188.14 ? 259  ASN A C     1 
ATOM   1000  O  O     . ASN A 1 152 ? -11.243 50.296 30.668  1.00 188.62 ? 259  ASN A O     1 
ATOM   1001  C  CB    . ASN A 1 152 ? -8.660  52.154 30.961  1.00 189.99 ? 259  ASN A CB    1 
ATOM   1002  C  CG    . ASN A 1 152 ? -7.395  52.528 30.206  1.00 189.11 ? 259  ASN A CG    1 
ATOM   1003  O  OD1   . ASN A 1 152 ? -7.409  52.709 28.987  1.00 186.23 ? 259  ASN A OD1   1 
ATOM   1004  N  ND2   . ASN A 1 152 ? -6.290  52.644 30.932  1.00 191.84 ? 259  ASN A ND2   1 
ATOM   1005  N  N     . ASP A 1 153 ? -11.869 52.279 31.538  1.00 188.97 ? 260  ASP A N     1 
ATOM   1006  C  CA    . ASP A 1 153 ? -13.084 51.758 32.167  1.00 190.50 ? 260  ASP A CA    1 
ATOM   1007  C  C     . ASP A 1 153 ? -14.133 51.421 31.108  1.00 187.37 ? 260  ASP A C     1 
ATOM   1008  O  O     . ASP A 1 153 ? -14.792 50.382 31.184  1.00 188.41 ? 260  ASP A O     1 
ATOM   1009  C  CB    . ASP A 1 153 ? -13.661 52.773 33.161  1.00 192.66 ? 260  ASP A CB    1 
ATOM   1010  C  CG    . ASP A 1 153 ? -12.743 53.024 34.347  1.00 196.13 ? 260  ASP A CG    1 
ATOM   1011  O  OD1   . ASP A 1 153 ? -11.554 52.645 34.282  1.00 196.69 ? 260  ASP A OD1   1 
ATOM   1012  O  OD2   . ASP A 1 153 ? -13.213 53.608 35.345  1.00 198.75 ? 260  ASP A OD2   1 
ATOM   1013  N  N     . LEU A 1 154 ? -14.277 52.307 30.124  1.00 183.74 ? 261  LEU A N     1 
ATOM   1014  C  CA    . LEU A 1 154 ? -15.229 52.117 29.028  1.00 180.87 ? 261  LEU A CA    1 
ATOM   1015  C  C     . LEU A 1 154 ? -14.798 50.992 28.088  1.00 179.84 ? 261  LEU A C     1 
ATOM   1016  O  O     . LEU A 1 154 ? -15.644 50.307 27.510  1.00 179.36 ? 261  LEU A O     1 
ATOM   1017  C  CB    . LEU A 1 154 ? -15.399 53.419 28.239  1.00 178.04 ? 261  LEU A CB    1 
ATOM   1018  C  CG    . LEU A 1 154 ? -15.966 54.607 29.022  1.00 179.09 ? 261  LEU A CG    1 
ATOM   1019  C  CD1   . LEU A 1 154 ? -15.706 55.913 28.287  1.00 176.89 ? 261  LEU A CD1   1 
ATOM   1020  C  CD2   . LEU A 1 154 ? -17.453 54.425 29.288  1.00 179.91 ? 261  LEU A CD2   1 
ATOM   1021  N  N     . LYS A 1 155 ? -13.488 50.814 27.929  1.00 179.97 ? 262  LYS A N     1 
ATOM   1022  C  CA    . LYS A 1 155 ? -12.948 49.700 27.147  1.00 179.55 ? 262  LYS A CA    1 
ATOM   1023  C  C     . LYS A 1 155 ? -13.264 48.365 27.818  1.00 182.32 ? 262  LYS A C     1 
ATOM   1024  O  O     . LYS A 1 155 ? -13.754 47.440 27.172  1.00 181.84 ? 262  LYS A O     1 
ATOM   1025  C  CB    . LYS A 1 155 ? -11.433 49.842 26.960  1.00 179.60 ? 262  LYS A CB    1 
ATOM   1026  C  CG    . LYS A 1 155 ? -11.023 50.863 25.911  1.00 177.06 ? 262  LYS A CG    1 
ATOM   1027  C  CD    . LYS A 1 155 ? -9.526  50.812 25.648  1.00 177.64 ? 262  LYS A CD    1 
ATOM   1028  C  CE    . LYS A 1 155 ? -9.128  51.725 24.500  1.00 175.62 ? 262  LYS A CE    1 
ATOM   1029  N  NZ    . LYS A 1 155 ? -7.696  51.562 24.127  1.00 176.48 ? 262  LYS A NZ    1 
ATOM   1030  N  N     . GLU A 1 156 ? -12.988 48.280 29.118  1.00 185.55 ? 263  GLU A N     1 
ATOM   1031  C  CA    . GLU A 1 156 ? -13.247 47.062 29.891  1.00 188.85 ? 263  GLU A CA    1 
ATOM   1032  C  C     . GLU A 1 156 ? -14.740 46.828 30.154  1.00 189.34 ? 263  GLU A C     1 
ATOM   1033  O  O     . GLU A 1 156 ? -15.140 45.712 30.486  1.00 191.83 ? 263  GLU A O     1 
ATOM   1034  C  CB    . GLU A 1 156 ? -12.464 47.085 31.208  1.00 192.59 ? 263  GLU A CB    1 
ATOM   1035  C  CG    . GLU A 1 156 ? -10.960 46.936 31.018  1.00 193.10 ? 263  GLU A CG    1 
ATOM   1036  C  CD    . GLU A 1 156 ? -10.171 47.116 32.303  1.00 196.76 ? 263  GLU A CD    1 
ATOM   1037  O  OE1   . GLU A 1 156 ? -10.772 47.060 33.397  1.00 199.61 ? 263  GLU A OE1   1 
ATOM   1038  O  OE2   . GLU A 1 156 ? -8.940  47.310 32.217  1.00 197.21 ? 263  GLU A OE2   1 
ATOM   1039  N  N     . LEU A 1 157 ? -15.553 47.876 30.013  1.00 187.21 ? 264  LEU A N     1 
ATOM   1040  C  CA    . LEU A 1 157 ? -17.012 47.731 30.051  1.00 187.54 ? 264  LEU A CA    1 
ATOM   1041  C  C     . LEU A 1 157 ? -17.498 46.901 28.866  1.00 185.58 ? 264  LEU A C     1 
ATOM   1042  O  O     . LEU A 1 157 ? -18.273 45.960 29.034  1.00 187.59 ? 264  LEU A O     1 
ATOM   1043  C  CB    . LEU A 1 157 ? -17.710 49.100 30.043  1.00 186.44 ? 264  LEU A CB    1 
ATOM   1044  C  CG    . LEU A 1 157 ? -18.058 49.716 31.401  1.00 189.87 ? 264  LEU A CG    1 
ATOM   1045  C  CD1   . LEU A 1 157 ? -18.377 51.198 31.253  1.00 188.34 ? 264  LEU A CD1   1 
ATOM   1046  C  CD2   . LEU A 1 157 ? -19.224 48.977 32.044  1.00 193.12 ? 264  LEU A CD2   1 
ATOM   1047  N  N     . LEU A 1 158 ? -17.033 47.261 27.672  1.00 181.99 ? 265  LEU A N     1 
ATOM   1048  C  CA    . LEU A 1 158 ? -17.408 46.563 26.442  1.00 180.37 ? 265  LEU A CA    1 
ATOM   1049  C  C     . LEU A 1 158 ? -16.863 45.133 26.396  1.00 182.12 ? 265  LEU A C     1 
ATOM   1050  O  O     . LEU A 1 158 ? -17.558 44.217 25.955  1.00 183.19 ? 265  LEU A O     1 
ATOM   1051  C  CB    . LEU A 1 158 ? -16.920 47.345 25.216  1.00 176.78 ? 265  LEU A CB    1 
ATOM   1052  C  CG    . LEU A 1 158 ? -17.553 48.721 24.982  1.00 174.67 ? 265  LEU A CG    1 
ATOM   1053  C  CD1   . LEU A 1 158 ? -16.760 49.505 23.949  1.00 171.80 ? 265  LEU A CD1   1 
ATOM   1054  C  CD2   . LEU A 1 158 ? -19.007 48.595 24.551  1.00 174.56 ? 265  LEU A CD2   1 
ATOM   1055  N  N     . ILE A 1 159 ? -15.626 44.949 26.855  1.00 182.78 ? 266  ILE A N     1 
ATOM   1056  C  CA    . ILE A 1 159 ? -14.986 43.628 26.864  1.00 184.73 ? 266  ILE A CA    1 
ATOM   1057  C  C     . ILE A 1 159 ? -15.747 42.659 27.772  1.00 188.24 ? 266  ILE A C     1 
ATOM   1058  O  O     . ILE A 1 159 ? -15.911 41.485 27.434  1.00 189.91 ? 266  ILE A O     1 
ATOM   1059  C  CB    . ILE A 1 159 ? -13.506 43.709 27.310  1.00 185.29 ? 266  ILE A CB    1 
ATOM   1060  C  CG1   . ILE A 1 159 ? -12.681 44.504 26.291  1.00 182.26 ? 266  ILE A CG1   1 
ATOM   1061  C  CG2   . ILE A 1 159 ? -12.907 42.314 27.470  1.00 187.99 ? 266  ILE A CG2   1 
ATOM   1062  C  CD1   . ILE A 1 159 ? -11.402 45.086 26.854  1.00 182.75 ? 266  ILE A CD1   1 
ATOM   1063  N  N     . PHE A 1 160 ? -16.207 43.158 28.917  1.00 189.65 ? 267  PHE A N     1 
ATOM   1064  C  CA    . PHE A 1 160 ? -17.013 42.365 29.848  1.00 193.52 ? 267  PHE A CA    1 
ATOM   1065  C  C     . PHE A 1 160 ? -18.324 41.902 29.209  1.00 193.19 ? 267  PHE A C     1 
ATOM   1066  O  O     . PHE A 1 160 ? -18.791 40.793 29.477  1.00 196.66 ? 267  PHE A O     1 
ATOM   1067  C  CB    . PHE A 1 160 ? -17.305 43.172 31.117  1.00 195.47 ? 267  PHE A CB    1 
ATOM   1068  C  CG    . PHE A 1 160 ? -18.045 42.399 32.173  1.00 200.46 ? 267  PHE A CG    1 
ATOM   1069  C  CD1   . PHE A 1 160 ? -17.355 41.659 33.124  1.00 204.17 ? 267  PHE A CD1   1 
ATOM   1070  C  CD2   . PHE A 1 160 ? -19.433 42.414 32.219  1.00 201.77 ? 267  PHE A CD2   1 
ATOM   1071  C  CE1   . PHE A 1 160 ? -18.035 40.946 34.099  1.00 209.04 ? 267  PHE A CE1   1 
ATOM   1072  C  CE2   . PHE A 1 160 ? -20.119 41.703 33.190  1.00 206.68 ? 267  PHE A CE2   1 
ATOM   1073  C  CZ    . PHE A 1 160 ? -19.419 40.969 34.132  1.00 210.31 ? 267  PHE A CZ    1 
ATOM   1074  N  N     . ASN A 1 161 ? -18.905 42.751 28.361  1.00 189.16 ? 268  ASN A N     1 
ATOM   1075  C  CA    . ASN A 1 161 ? -20.153 42.430 27.661  1.00 188.85 ? 268  ASN A CA    1 
ATOM   1076  C  C     . ASN A 1 161 ? -19.935 41.700 26.327  1.00 187.16 ? 268  ASN A C     1 
ATOM   1077  O  O     . ASN A 1 161 ? -20.870 41.567 25.533  1.00 186.93 ? 268  ASN A O     1 
ATOM   1078  C  CB    . ASN A 1 161 ? -20.977 43.705 27.434  1.00 186.57 ? 268  ASN A CB    1 
ATOM   1079  C  CG    . ASN A 1 161 ? -21.544 44.272 28.723  1.00 189.01 ? 268  ASN A CG    1 
ATOM   1080  O  OD1   . ASN A 1 161 ? -22.741 44.163 28.985  1.00 191.25 ? 268  ASN A OD1   1 
ATOM   1081  N  ND2   . ASN A 1 161 ? -20.685 44.875 29.537  1.00 189.20 ? 268  ASN A ND2   1 
ATOM   1082  N  N     . LYS A 1 162 ? -18.710 41.226 26.092  1.00 186.23 ? 269  LYS A N     1 
ATOM   1083  C  CA    . LYS A 1 162 ? -18.351 40.492 24.873  1.00 184.77 ? 269  LYS A CA    1 
ATOM   1084  C  C     . LYS A 1 162 ? -18.566 41.337 23.614  1.00 180.02 ? 269  LYS A C     1 
ATOM   1085  O  O     . LYS A 1 162 ? -19.127 40.865 22.623  1.00 180.11 ? 269  LYS A O     1 
ATOM   1086  C  CB    . LYS A 1 162 ? -19.123 39.165 24.780  1.00 188.46 ? 269  LYS A CB    1 
ATOM   1087  C  CG    . LYS A 1 162 ? -19.105 38.323 26.050  1.00 192.86 ? 269  LYS A CG    1 
ATOM   1088  C  CD    . LYS A 1 162 ? -17.701 37.875 26.426  1.00 193.69 ? 269  LYS A CD    1 
ATOM   1089  C  CE    . LYS A 1 162 ? -17.701 37.101 27.734  1.00 198.29 ? 269  LYS A CE    1 
ATOM   1090  N  NZ    . LYS A 1 162 ? -16.322 36.778 28.194  1.00 199.24 ? 269  LYS A NZ    1 
ATOM   1091  N  N     . GLN A 1 163 ? -18.104 42.585 23.669  1.00 175.97 ? 270  GLN A N     1 
ATOM   1092  C  CA    . GLN A 1 163 ? -18.232 43.524 22.558  1.00 171.77 ? 270  GLN A CA    1 
ATOM   1093  C  C     . GLN A 1 163 ? -16.857 43.894 22.013  1.00 169.17 ? 270  GLN A C     1 
ATOM   1094  O  O     . GLN A 1 163 ? -15.887 43.989 22.767  1.00 169.81 ? 270  GLN A O     1 
ATOM   1095  C  CB    . GLN A 1 163 ? -18.951 44.796 23.016  1.00 170.28 ? 270  GLN A CB    1 
ATOM   1096  C  CG    . GLN A 1 163 ? -20.365 44.574 23.531  1.00 172.20 ? 270  GLN A CG    1 
ATOM   1097  C  CD    . GLN A 1 163 ? -21.340 44.209 22.429  1.00 171.88 ? 270  GLN A CD    1 
ATOM   1098  O  OE1   . GLN A 1 163 ? -21.431 44.897 21.411  1.00 169.30 ? 270  GLN A OE1   1 
ATOM   1099  N  NE2   . GLN A 1 163 ? -22.079 43.125 22.627  1.00 174.99 ? 270  GLN A NE2   1 
ATOM   1100  N  N     . GLN A 1 164 ? -16.781 44.096 20.700  1.00 166.33 ? 271  GLN A N     1 
ATOM   1101  C  CA    . GLN A 1 164 ? -15.554 44.551 20.052  1.00 163.91 ? 271  GLN A CA    1 
ATOM   1102  C  C     . GLN A 1 164 ? -15.276 45.995 20.458  1.00 161.10 ? 271  GLN A C     1 
ATOM   1103  O  O     . GLN A 1 164 ? -16.145 46.857 20.321  1.00 159.56 ? 271  GLN A O     1 
ATOM   1104  C  CB    . GLN A 1 164 ? -15.684 44.459 18.528  1.00 162.84 ? 271  GLN A CB    1 
ATOM   1105  C  CG    . GLN A 1 164 ? -14.400 44.741 17.760  1.00 161.83 ? 271  GLN A CG    1 
ATOM   1106  C  CD    . GLN A 1 164 ? -14.635 44.944 16.274  1.00 160.73 ? 271  GLN A CD    1 
ATOM   1107  O  OE1   . GLN A 1 164 ? -14.105 45.880 15.675  1.00 159.19 ? 271  GLN A OE1   1 
ATOM   1108  N  NE2   . GLN A 1 164 ? -15.437 44.071 15.672  1.00 162.04 ? 271  GLN A NE2   1 
ATOM   1109  N  N     . VAL A 1 165 ? -14.069 46.249 20.956  1.00 160.40 ? 272  VAL A N     1 
ATOM   1110  C  CA    . VAL A 1 165 ? -13.672 47.591 21.377  1.00 158.49 ? 272  VAL A CA    1 
ATOM   1111  C  C     . VAL A 1 165 ? -13.252 48.400 20.149  1.00 155.59 ? 272  VAL A C     1 
ATOM   1112  O  O     . VAL A 1 165 ? -12.276 48.048 19.485  1.00 155.73 ? 272  VAL A O     1 
ATOM   1113  C  CB    . VAL A 1 165 ? -12.505 47.547 22.386  1.00 160.23 ? 272  VAL A CB    1 
ATOM   1114  C  CG1   . VAL A 1 165 ? -12.093 48.955 22.797  1.00 159.32 ? 272  VAL A CG1   1 
ATOM   1115  C  CG2   . VAL A 1 165 ? -12.894 46.729 23.610  1.00 163.06 ? 272  VAL A CG2   1 
ATOM   1116  N  N     . PRO A 1 166 ? -13.984 49.488 19.842  1.00 153.11 ? 273  PRO A N     1 
ATOM   1117  C  CA    . PRO A 1 166 ? -13.672 50.271 18.648  1.00 150.80 ? 273  PRO A CA    1 
ATOM   1118  C  C     . PRO A 1 166 ? -12.486 51.214 18.830  1.00 150.09 ? 273  PRO A C     1 
ATOM   1119  O  O     . PRO A 1 166 ? -12.111 51.539 19.959  1.00 150.92 ? 273  PRO A O     1 
ATOM   1120  C  CB    . PRO A 1 166 ? -14.950 51.077 18.424  1.00 149.61 ? 273  PRO A CB    1 
ATOM   1121  C  CG    . PRO A 1 166 ? -15.498 51.279 19.792  1.00 150.75 ? 273  PRO A CG    1 
ATOM   1122  C  CD    . PRO A 1 166 ? -15.137 50.047 20.575  1.00 152.99 ? 273  PRO A CD    1 
ATOM   1123  N  N     . SER A 1 167 ? -11.914 51.646 17.710  1.00 148.76 ? 274  SER A N     1 
ATOM   1124  C  CA    . SER A 1 167 ? -10.840 52.633 17.704  1.00 148.73 ? 274  SER A CA    1 
ATOM   1125  C  C     . SER A 1 167 ? -11.442 54.036 17.711  1.00 147.19 ? 274  SER A C     1 
ATOM   1126  O  O     . SER A 1 167 ? -12.210 54.388 16.815  1.00 145.72 ? 274  SER A O     1 
ATOM   1127  C  CB    . SER A 1 167 ? -9.956  52.444 16.467  1.00 149.03 ? 274  SER A CB    1 
ATOM   1128  O  OG    . SER A 1 167 ? -9.056  53.526 16.300  1.00 149.59 ? 274  SER A OG    1 
ATOM   1129  N  N     . GLY A 1 168 ? -11.089 54.829 18.721  1.00 147.71 ? 275  GLY A N     1 
ATOM   1130  C  CA    . GLY A 1 168 ? -11.602 56.192 18.864  1.00 147.19 ? 275  GLY A CA    1 
ATOM   1131  C  C     . GLY A 1 168 ? -12.232 56.416 20.223  1.00 148.27 ? 275  GLY A C     1 
ATOM   1132  O  O     . GLY A 1 168 ? -12.862 55.514 20.773  1.00 148.84 ? 275  GLY A O     1 
ATOM   1133  N  N     . GLU A 1 169 ? -12.060 57.620 20.765  1.00 148.99 ? 276  GLU A N     1 
ATOM   1134  C  CA    . GLU A 1 169 ? -12.652 57.976 22.051  1.00 150.31 ? 276  GLU A CA    1 
ATOM   1135  C  C     . GLU A 1 169 ? -14.161 58.133 21.903  1.00 148.88 ? 276  GLU A C     1 
ATOM   1136  O  O     . GLU A 1 169 ? -14.925 57.481 22.612  1.00 149.78 ? 276  GLU A O     1 
ATOM   1137  C  CB    . GLU A 1 169 ? -12.037 59.268 22.599  1.00 152.20 ? 276  GLU A CB    1 
ATOM   1138  C  CG    . GLU A 1 169 ? -12.486 59.619 24.013  1.00 154.61 ? 276  GLU A CG    1 
ATOM   1139  C  CD    . GLU A 1 169 ? -11.827 60.875 24.559  1.00 156.90 ? 276  GLU A CD    1 
ATOM   1140  O  OE1   . GLU A 1 169 ? -12.167 61.275 25.693  1.00 159.12 ? 276  GLU A OE1   1 
ATOM   1141  O  OE2   . GLU A 1 169 ? -10.972 61.466 23.864  1.00 157.09 ? 276  GLU A OE2   1 
ATOM   1142  N  N     . SER A 1 170 ? -14.573 58.991 20.970  1.00 146.83 ? 277  SER A N     1 
ATOM   1143  C  CA    . SER A 1 170 ? -15.990 59.270 20.719  1.00 145.34 ? 277  SER A CA    1 
ATOM   1144  C  C     . SER A 1 170 ? -16.792 58.008 20.404  1.00 143.96 ? 277  SER A C     1 
ATOM   1145  O  O     . SER A 1 170 ? -17.914 57.848 20.881  1.00 144.05 ? 277  SER A O     1 
ATOM   1146  C  CB    . SER A 1 170 ? -16.140 60.269 19.568  1.00 144.08 ? 277  SER A CB    1 
ATOM   1147  O  OG    . SER A 1 170 ? -15.592 59.751 18.368  1.00 143.24 ? 277  SER A OG    1 
ATOM   1148  N  N     . ALA A 1 171 ? -16.207 57.120 19.604  1.00 142.83 ? 278  ALA A N     1 
ATOM   1149  C  CA    . ALA A 1 171 ? -16.870 55.881 19.192  1.00 142.40 ? 278  ALA A CA    1 
ATOM   1150  C  C     . ALA A 1 171 ? -17.032 54.874 20.333  1.00 143.92 ? 278  ALA A C     1 
ATOM   1151  O  O     . ALA A 1 171 ? -17.973 54.080 20.322  1.00 144.11 ? 278  ALA A O     1 
ATOM   1152  C  CB    . ALA A 1 171 ? -16.117 55.243 18.033  1.00 141.68 ? 278  ALA A CB    1 
ATOM   1153  N  N     . ILE A 1 172 ? -16.121 54.901 21.306  1.00 145.21 ? 279  ILE A N     1 
ATOM   1154  C  CA    . ILE A 1 172 ? -16.183 53.973 22.442  1.00 147.41 ? 279  ILE A CA    1 
ATOM   1155  C  C     . ILE A 1 172 ? -17.419 54.236 23.304  1.00 148.65 ? 279  ILE A C     1 
ATOM   1156  O  O     . ILE A 1 172 ? -18.223 53.330 23.520  1.00 149.85 ? 279  ILE A O     1 
ATOM   1157  C  CB    . ILE A 1 172 ? -14.887 54.006 23.294  1.00 148.92 ? 279  ILE A CB    1 
ATOM   1158  C  CG1   . ILE A 1 172 ? -13.810 53.140 22.630  1.00 148.73 ? 279  ILE A CG1   1 
ATOM   1159  C  CG2   . ILE A 1 172 ? -15.136 53.490 24.709  1.00 151.45 ? 279  ILE A CG2   1 
ATOM   1160  C  CD1   . ILE A 1 172 ? -12.412 53.347 23.173  1.00 149.95 ? 279  ILE A CD1   1 
ATOM   1161  N  N     . LEU A 1 173 ? -17.575 55.470 23.782  1.00 148.95 ? 280  LEU A N     1 
ATOM   1162  C  CA    . LEU A 1 173 ? -18.736 55.825 24.609  1.00 150.55 ? 280  LEU A CA    1 
ATOM   1163  C  C     . LEU A 1 173 ? -20.047 55.848 23.812  1.00 149.46 ? 280  LEU A C     1 
ATOM   1164  O  O     . LEU A 1 173 ? -21.127 55.771 24.397  1.00 150.84 ? 280  LEU A O     1 
ATOM   1165  C  CB    . LEU A 1 173 ? -18.528 57.159 25.346  1.00 151.59 ? 280  LEU A CB    1 
ATOM   1166  C  CG    . LEU A 1 173 ? -18.612 58.493 24.585  1.00 150.06 ? 280  LEU A CG    1 
ATOM   1167  C  CD1   . LEU A 1 173 ? -19.168 59.587 25.484  1.00 151.87 ? 280  LEU A CD1   1 
ATOM   1168  C  CD2   . LEU A 1 173 ? -17.260 58.919 24.042  1.00 149.16 ? 280  LEU A CD2   1 
ATOM   1169  N  N     . ASP A 1 174 ? -19.948 55.954 22.487  1.00 147.46 ? 281  ASP A N     1 
ATOM   1170  C  CA    . ASP A 1 174 ? -21.121 55.869 21.614  1.00 146.73 ? 281  ASP A CA    1 
ATOM   1171  C  C     . ASP A 1 174 ? -21.697 54.450 21.633  1.00 147.92 ? 281  ASP A C     1 
ATOM   1172  O  O     . ASP A 1 174 ? -22.915 54.271 21.610  1.00 148.82 ? 281  ASP A O     1 
ATOM   1173  C  CB    . ASP A 1 174 ? -20.762 56.278 20.177  1.00 144.67 ? 281  ASP A CB    1 
ATOM   1174  C  CG    . ASP A 1 174 ? -21.926 56.918 19.437  1.00 144.05 ? 281  ASP A CG    1 
ATOM   1175  O  OD1   . ASP A 1 174 ? -23.077 56.462 19.604  1.00 145.40 ? 281  ASP A OD1   1 
ATOM   1176  O  OD2   . ASP A 1 174 ? -21.685 57.881 18.678  1.00 142.77 ? 281  ASP A OD2   1 
ATOM   1177  N  N     . ARG A 1 175 ? -20.816 53.451 21.682  1.00 148.39 ? 282  ARG A N     1 
ATOM   1178  C  CA    . ARG A 1 175 ? -21.232 52.046 21.742  1.00 150.09 ? 282  ARG A CA    1 
ATOM   1179  C  C     . ARG A 1 175 ? -21.579 51.595 23.163  1.00 153.25 ? 282  ARG A C     1 
ATOM   1180  O  O     . ARG A 1 175 ? -22.424 50.717 23.341  1.00 155.41 ? 282  ARG A O     1 
ATOM   1181  C  CB    . ARG A 1 175 ? -20.153 51.135 21.153  1.00 149.68 ? 282  ARG A CB    1 
ATOM   1182  C  CG    . ARG A 1 175 ? -19.946 51.329 19.661  1.00 147.62 ? 282  ARG A CG    1 
ATOM   1183  C  CD    . ARG A 1 175 ? -19.139 50.195 19.051  1.00 147.87 ? 282  ARG A CD    1 
ATOM   1184  N  NE    . ARG A 1 175 ? -18.681 50.520 17.701  1.00 146.10 ? 282  ARG A NE    1 
ATOM   1185  C  CZ    . ARG A 1 175 ? -18.003 49.692 16.909  1.00 146.57 ? 282  ARG A CZ    1 
ATOM   1186  N  NH1   . ARG A 1 175 ? -17.689 48.465 17.316  1.00 148.47 ? 282  ARG A NH1   1 
ATOM   1187  N  NH2   . ARG A 1 175 ? -17.632 50.095 15.698  1.00 145.49 ? 282  ARG A NH2   1 
ATOM   1188  N  N     . VAL A 1 176 ? -20.924 52.183 24.164  1.00 154.20 ? 283  VAL A N     1 
ATOM   1189  C  CA    . VAL A 1 176 ? -21.254 51.908 25.565  1.00 157.43 ? 283  VAL A CA    1 
ATOM   1190  C  C     . VAL A 1 176 ? -22.648 52.452 25.880  1.00 158.82 ? 283  VAL A C     1 
ATOM   1191  O  O     . VAL A 1 176 ? -23.454 51.771 26.514  1.00 161.61 ? 283  VAL A O     1 
ATOM   1192  C  CB    . VAL A 1 176 ? -20.218 52.515 26.540  1.00 158.31 ? 283  VAL A CB    1 
ATOM   1193  C  CG1   . VAL A 1 176 ? -20.691 52.400 27.985  1.00 161.83 ? 283  VAL A CG1   1 
ATOM   1194  C  CG2   . VAL A 1 176 ? -18.868 51.829 26.381  1.00 158.08 ? 283  VAL A CG2   1 
ATOM   1195  N  N     . ALA A 1 177 ? -22.924 53.675 25.431  1.00 157.46 ? 284  ALA A N     1 
ATOM   1196  C  CA    . ALA A 1 177 ? -24.243 54.287 25.605  1.00 158.57 ? 284  ALA A CA    1 
ATOM   1197  C  C     . ALA A 1 177 ? -25.319 53.502 24.855  1.00 158.96 ? 284  ALA A C     1 
ATOM   1198  O  O     . ALA A 1 177 ? -26.420 53.304 25.369  1.00 161.38 ? 284  ALA A O     1 
ATOM   1199  C  CB    . ALA A 1 177 ? -24.223 55.736 25.143  1.00 156.64 ? 284  ALA A CB    1 
ATOM   1200  N  N     . ASP A 1 178 ? -24.994 53.064 23.640  1.00 157.10 ? 285  ASP A N     1 
ATOM   1201  C  CA    . ASP A 1 178 ? -25.867 52.177 22.869  1.00 157.83 ? 285  ASP A CA    1 
ATOM   1202  C  C     . ASP A 1 178 ? -26.081 50.854 23.604  1.00 161.20 ? 285  ASP A C     1 
ATOM   1203  O  O     . ASP A 1 178 ? -27.197 50.335 23.650  1.00 163.48 ? 285  ASP A O     1 
ATOM   1204  C  CB    . ASP A 1 178 ? -25.267 51.908 21.484  1.00 155.46 ? 285  ASP A CB    1 
ATOM   1205  C  CG    . ASP A 1 178 ? -26.028 50.846 20.708  1.00 156.57 ? 285  ASP A CG    1 
ATOM   1206  O  OD1   . ASP A 1 178 ? -25.409 49.833 20.317  1.00 156.73 ? 285  ASP A OD1   1 
ATOM   1207  O  OD2   . ASP A 1 178 ? -27.246 51.018 20.497  1.00 157.49 ? 285  ASP A OD2   1 
ATOM   1208  N  N     . GLY A 1 179 ? -25.004 50.319 24.175  1.00 162.22 ? 286  GLY A N     1 
ATOM   1209  C  CA    . GLY A 1 179 ? -25.057 49.065 24.919  1.00 165.86 ? 286  GLY A CA    1 
ATOM   1210  C  C     . GLY A 1 179 ? -25.958 49.127 26.138  1.00 169.65 ? 286  GLY A C     1 
ATOM   1211  O  O     . GLY A 1 179 ? -26.798 48.251 26.337  1.00 172.66 ? 286  GLY A O     1 
ATOM   1212  N  N     . MET A 1 180 ? -25.792 50.171 26.946  1.00 170.30 ? 287  MET A N     1 
ATOM   1213  C  CA    . MET A 1 180 ? -26.555 50.321 28.188  1.00 174.41 ? 287  MET A CA    1 
ATOM   1214  C  C     . MET A 1 180 ? -28.046 50.552 27.946  1.00 175.91 ? 287  MET A C     1 
ATOM   1215  O  O     . MET A 1 180 ? -28.887 49.939 28.607  1.00 179.76 ? 287  MET A O     1 
ATOM   1216  C  CB    . MET A 1 180 ? -25.996 51.476 29.023  1.00 174.51 ? 287  MET A CB    1 
ATOM   1217  C  CG    . MET A 1 180 ? -24.613 51.215 29.597  1.00 174.91 ? 287  MET A CG    1 
ATOM   1218  S  SD    . MET A 1 180 ? -24.103 52.429 30.829  1.00 176.81 ? 287  MET A SD    1 
ATOM   1219  C  CE    . MET A 1 180 ? -24.501 53.962 29.997  1.00 173.60 ? 287  MET A CE    1 
ATOM   1220  N  N     . VAL A 1 181 ? -28.366 51.435 27.003  1.00 173.38 ? 288  VAL A N     1 
ATOM   1221  C  CA    . VAL A 1 181 ? -29.753 51.836 26.753  1.00 174.63 ? 288  VAL A CA    1 
ATOM   1222  C  C     . VAL A 1 181 ? -30.574 50.712 26.118  1.00 176.47 ? 288  VAL A C     1 
ATOM   1223  O  O     . VAL A 1 181 ? -31.694 50.440 26.554  1.00 179.76 ? 288  VAL A O     1 
ATOM   1224  C  CB    . VAL A 1 181 ? -29.826 53.102 25.865  1.00 171.23 ? 288  VAL A CB    1 
ATOM   1225  C  CG1   . VAL A 1 181 ? -31.263 53.411 25.459  1.00 172.19 ? 288  VAL A CG1   1 
ATOM   1226  C  CG2   . VAL A 1 181 ? -29.219 54.296 26.591  1.00 170.75 ? 288  VAL A CG2   1 
ATOM   1227  N  N     . PHE A 1 182 ? -30.014 50.062 25.100  1.00 175.08 ? 289  PHE A N     1 
ATOM   1228  C  CA    . PHE A 1 182 ? -30.754 49.074 24.312  1.00 176.87 ? 289  PHE A CA    1 
ATOM   1229  C  C     . PHE A 1 182 ? -30.353 47.637 24.639  1.00 179.63 ? 289  PHE A C     1 
ATOM   1230  O  O     . PHE A 1 182 ? -31.220 46.790 24.863  1.00 183.37 ? 289  PHE A O     1 
ATOM   1231  C  CB    . PHE A 1 182 ? -30.583 49.365 22.821  1.00 173.54 ? 289  PHE A CB    1 
ATOM   1232  C  CG    . PHE A 1 182 ? -30.962 50.768 22.440  1.00 171.55 ? 289  PHE A CG    1 
ATOM   1233  C  CD1   . PHE A 1 182 ? -29.989 51.724 22.184  1.00 168.49 ? 289  PHE A CD1   1 
ATOM   1234  C  CD2   . PHE A 1 182 ? -32.297 51.141 22.364  1.00 173.35 ? 289  PHE A CD2   1 
ATOM   1235  C  CE1   . PHE A 1 182 ? -30.338 53.019 21.844  1.00 166.98 ? 289  PHE A CE1   1 
ATOM   1236  C  CE2   . PHE A 1 182 ? -32.654 52.436 22.026  1.00 171.78 ? 289  PHE A CE2   1 
ATOM   1237  C  CZ    . PHE A 1 182 ? -31.672 53.376 21.764  1.00 168.52 ? 289  PHE A CZ    1 
ATOM   1238  N  N     . GLY A 1 183 ? -29.051 47.362 24.665  1.00 178.39 ? 290  GLY A N     1 
ATOM   1239  C  CA    . GLY A 1 183 ? -28.556 46.036 25.046  1.00 181.11 ? 290  GLY A CA    1 
ATOM   1240  C  C     . GLY A 1 183 ? -27.219 45.656 24.439  1.00 178.95 ? 290  GLY A C     1 
ATOM   1241  O  O     . GLY A 1 183 ? -26.777 46.253 23.455  1.00 175.49 ? 290  GLY A O     1 
ATOM   1242  N  N     . ALA A 1 184 ? -26.580 44.653 25.037  1.00 181.40 ? 291  ALA A N     1 
ATOM   1243  C  CA    . ALA A 1 184 ? -25.326 44.105 24.525  1.00 179.95 ? 291  ALA A CA    1 
ATOM   1244  C  C     . ALA A 1 184 ? -25.601 43.312 23.252  1.00 179.85 ? 291  ALA A C     1 
ATOM   1245  O  O     . ALA A 1 184 ? -26.322 42.313 23.280  1.00 183.23 ? 291  ALA A O     1 
ATOM   1246  C  CB    . ALA A 1 184 ? -24.668 43.217 25.570  1.00 182.97 ? 291  ALA A CB    1 
ATOM   1247  N  N     . LEU A 1 185 ? -25.020 43.761 22.142  1.00 176.49 ? 292  LEU A N     1 
ATOM   1248  C  CA    . LEU A 1 185 ? -25.288 43.173 20.830  1.00 176.51 ? 292  LEU A CA    1 
ATOM   1249  C  C     . LEU A 1 185 ? -24.698 41.771 20.701  1.00 178.71 ? 292  LEU A C     1 
ATOM   1250  O  O     . LEU A 1 185 ? -23.501 41.574 20.914  1.00 178.07 ? 292  LEU A O     1 
ATOM   1251  C  CB    . LEU A 1 185 ? -24.728 44.071 19.722  1.00 172.82 ? 292  LEU A CB    1 
ATOM   1252  C  CG    . LEU A 1 185 ? -25.337 45.474 19.620  1.00 170.81 ? 292  LEU A CG    1 
ATOM   1253  C  CD1   . LEU A 1 185 ? -24.489 46.373 18.735  1.00 167.36 ? 292  LEU A CD1   1 
ATOM   1254  C  CD2   . LEU A 1 185 ? -26.764 45.407 19.099  1.00 172.14 ? 292  LEU A CD2   1 
ATOM   1255  N  N     . LEU A 1 186 ? -25.545 40.804 20.353  1.00 181.56 ? 293  LEU A N     1 
ATOM   1256  C  CA    . LEU A 1 186 ? -25.095 39.432 20.120  1.00 184.09 ? 293  LEU A CA    1 
ATOM   1257  C  C     . LEU A 1 186 ? -24.328 39.354 18.800  1.00 181.58 ? 293  LEU A C     1 
ATOM   1258  O  O     . LEU A 1 186 ? -24.515 40.205 17.926  1.00 178.45 ? 293  LEU A O     1 
ATOM   1259  C  CB    . LEU A 1 186 ? -26.281 38.458 20.094  1.00 188.67 ? 293  LEU A CB    1 
ATOM   1260  C  CG    . LEU A 1 186 ? -26.846 38.019 21.448  1.00 192.65 ? 293  LEU A CG    1 
ATOM   1261  C  CD1   . LEU A 1 186 ? -28.208 37.363 21.273  1.00 196.78 ? 293  LEU A CD1   1 
ATOM   1262  C  CD2   . LEU A 1 186 ? -25.886 37.076 22.160  1.00 194.93 ? 293  LEU A CD2   1 
ATOM   1263  N  N     . PRO A 1 187 ? -23.458 38.336 18.649  1.00 182.91 ? 294  PRO A N     1 
ATOM   1264  C  CA    . PRO A 1 187 ? -22.726 38.152 17.392  1.00 181.39 ? 294  PRO A CA    1 
ATOM   1265  C  C     . PRO A 1 187 ? -23.629 37.968 16.170  1.00 181.90 ? 294  PRO A C     1 
ATOM   1266  O  O     . PRO A 1 187 ? -24.816 37.667 16.306  1.00 184.33 ? 294  PRO A O     1 
ATOM   1267  C  CB    . PRO A 1 187 ? -21.907 36.882 17.644  1.00 184.44 ? 294  PRO A CB    1 
ATOM   1268  C  CG    . PRO A 1 187 ? -21.739 36.827 19.120  1.00 185.72 ? 294  PRO A CG    1 
ATOM   1269  C  CD    . PRO A 1 187 ? -23.006 37.393 19.689  1.00 186.09 ? 294  PRO A CD    1 
ATOM   1270  N  N     . CYS A 1 188 ? -23.046 38.141 14.987  1.00 179.96 ? 295  CYS A N     1 
ATOM   1271  C  CA    . CYS A 1 188 ? -23.781 38.059 13.726  1.00 180.34 ? 295  CYS A CA    1 
ATOM   1272  C  C     . CYS A 1 188 ? -24.209 36.619 13.432  1.00 185.20 ? 295  CYS A C     1 
ATOM   1273  O  O     . CYS A 1 188 ? -23.592 35.668 13.917  1.00 187.66 ? 295  CYS A O     1 
ATOM   1274  C  CB    . CYS A 1 188 ? -22.912 38.595 12.586  1.00 177.41 ? 295  CYS A CB    1 
ATOM   1275  S  SG    . CYS A 1 188 ? -23.787 39.068 11.081  1.00 176.74 ? 295  CYS A SG    1 
ATOM   1276  N  N     . GLU A 1 189 ? -25.269 36.471 12.640  1.00 186.88 ? 296  GLU A N     1 
ATOM   1277  C  CA    . GLU A 1 189 ? -25.830 35.155 12.321  1.00 191.85 ? 296  GLU A CA    1 
ATOM   1278  C  C     . GLU A 1 189 ? -24.867 34.267 11.529  1.00 193.40 ? 296  GLU A C     1 
ATOM   1279  O  O     . GLU A 1 189 ? -24.644 33.113 11.898  1.00 197.23 ? 296  GLU A O     1 
ATOM   1280  C  CB    . GLU A 1 189 ? -27.147 35.305 11.549  1.00 193.32 ? 296  GLU A CB    1 
ATOM   1281  C  CG    . GLU A 1 189 ? -28.302 35.859 12.375  1.00 193.39 ? 296  GLU A CG    1 
ATOM   1282  C  CD    . GLU A 1 189 ? -28.830 34.880 13.412  1.00 197.83 ? 296  GLU A CD    1 
ATOM   1283  O  OE1   . GLU A 1 189 ? -29.595 35.314 14.298  1.00 197.92 ? 296  GLU A OE1   1 
ATOM   1284  O  OE2   . GLU A 1 189 ? -28.489 33.679 13.350  1.00 201.50 ? 296  GLU A OE2   1 
ATOM   1285  N  N     . GLU A 1 190 ? -24.299 34.807 10.452  1.00 190.82 ? 297  GLU A N     1 
ATOM   1286  C  CA    . GLU A 1 190 ? -23.436 34.024 9.560   1.00 192.68 ? 297  GLU A CA    1 
ATOM   1287  C  C     . GLU A 1 190 ? -21.955 34.206 9.888   1.00 190.20 ? 297  GLU A C     1 
ATOM   1288  O  O     . GLU A 1 190 ? -21.263 33.241 10.215  1.00 192.90 ? 297  GLU A O     1 
ATOM   1289  C  CB    . GLU A 1 190 ? -23.683 34.389 8.089   1.00 192.40 ? 297  GLU A CB    1 
ATOM   1290  C  CG    . GLU A 1 190 ? -25.149 34.448 7.675   1.00 194.23 ? 297  GLU A CG    1 
ATOM   1291  C  CD    . GLU A 1 190 ? -25.734 35.849 7.737   1.00 190.32 ? 297  GLU A CD    1 
ATOM   1292  O  OE1   . GLU A 1 190 ? -25.332 36.629 8.625   1.00 187.03 ? 297  GLU A OE1   1 
ATOM   1293  O  OE2   . GLU A 1 190 ? -26.602 36.169 6.898   1.00 190.90 ? 297  GLU A OE2   1 
ATOM   1294  N  N     . CYS A 1 191 ? -21.479 35.446 9.803   1.00 185.45 ? 298  CYS A N     1 
ATOM   1295  C  CA    . CYS A 1 191 ? -20.048 35.742 9.905   1.00 183.19 ? 298  CYS A CA    1 
ATOM   1296  C  C     . CYS A 1 191 ? -19.530 35.822 11.347  1.00 182.38 ? 298  CYS A C     1 
ATOM   1297  O  O     . CYS A 1 191 ? -18.317 35.854 11.564  1.00 181.58 ? 298  CYS A O     1 
ATOM   1298  C  CB    . CYS A 1 191 ? -19.728 37.043 9.159   1.00 179.20 ? 298  CYS A CB    1 
ATOM   1299  S  SG    . CYS A 1 191 ? -20.110 38.561 10.065  1.00 174.34 ? 298  CYS A SG    1 
ATOM   1300  N  N     . SER A 1 192 ? -20.445 35.856 12.317  1.00 182.96 ? 299  SER A N     1 
ATOM   1301  C  CA    . SER A 1 192 ? -20.101 35.923 13.744  1.00 182.65 ? 299  SER A CA    1 
ATOM   1302  C  C     . SER A 1 192 ? -19.250 37.149 14.101  1.00 178.50 ? 299  SER A C     1 
ATOM   1303  O  O     . SER A 1 192 ? -18.333 37.063 14.922  1.00 178.42 ? 299  SER A O     1 
ATOM   1304  C  CB    . SER A 1 192 ? -19.397 34.635 14.191  1.00 186.17 ? 299  SER A CB    1 
ATOM   1305  O  OG    . SER A 1 192 ? -20.125 33.488 13.786  1.00 190.46 ? 299  SER A OG    1 
ATOM   1306  N  N     . GLY A 1 193 ? -19.569 38.284 13.483  1.00 175.41 ? 300  GLY A N     1 
ATOM   1307  C  CA    . GLY A 1 193 ? -18.874 39.546 13.734  1.00 171.70 ? 300  GLY A CA    1 
ATOM   1308  C  C     . GLY A 1 193 ? -19.666 40.447 14.660  1.00 170.13 ? 300  GLY A C     1 
ATOM   1309  O  O     . GLY A 1 193 ? -20.586 39.993 15.342  1.00 172.08 ? 300  GLY A O     1 
ATOM   1310  N  N     . GLN A 1 194 ? -19.310 41.730 14.676  1.00 167.03 ? 301  GLN A N     1 
ATOM   1311  C  CA    . GLN A 1 194 ? -19.941 42.704 15.565  1.00 165.60 ? 301  GLN A CA    1 
ATOM   1312  C  C     . GLN A 1 194 ? -20.796 43.682 14.762  1.00 163.39 ? 301  GLN A C     1 
ATOM   1313  O  O     . GLN A 1 194 ? -20.288 44.376 13.879  1.00 161.27 ? 301  GLN A O     1 
ATOM   1314  C  CB    . GLN A 1 194 ? -18.869 43.471 16.350  1.00 164.00 ? 301  GLN A CB    1 
ATOM   1315  C  CG    . GLN A 1 194 ? -19.161 43.660 17.834  1.00 164.94 ? 301  GLN A CG    1 
ATOM   1316  C  CD    . GLN A 1 194 ? -20.455 44.401 18.115  1.00 164.58 ? 301  GLN A CD    1 
ATOM   1317  O  OE1   . GLN A 1 194 ? -20.450 45.610 18.349  1.00 162.79 ? 301  GLN A OE1   1 
ATOM   1318  N  NE2   . GLN A 1 194 ? -21.571 43.679 18.102  1.00 166.88 ? 301  GLN A NE2   1 
ATOM   1319  N  N     . LEU A 1 195 ? -22.092 43.726 15.063  1.00 164.30 ? 302  LEU A N     1 
ATOM   1320  C  CA    . LEU A 1 195 ? -22.991 44.705 14.453  1.00 162.85 ? 302  LEU A CA    1 
ATOM   1321  C  C     . LEU A 1 195 ? -22.770 46.069 15.101  1.00 160.47 ? 302  LEU A C     1 
ATOM   1322  O  O     . LEU A 1 195 ? -22.492 46.154 16.297  1.00 160.89 ? 302  LEU A O     1 
ATOM   1323  C  CB    . LEU A 1 195 ? -24.458 44.284 14.597  1.00 165.25 ? 302  LEU A CB    1 
ATOM   1324  C  CG    . LEU A 1 195 ? -24.935 43.140 13.692  1.00 168.06 ? 302  LEU A CG    1 
ATOM   1325  C  CD1   . LEU A 1 195 ? -24.517 41.781 14.238  1.00 171.13 ? 302  LEU A CD1   1 
ATOM   1326  C  CD2   . LEU A 1 195 ? -26.446 43.198 13.516  1.00 169.62 ? 302  LEU A CD2   1 
ATOM   1327  N  N     . VAL A 1 196 ? -22.882 47.129 14.305  1.00 158.44 ? 303  VAL A N     1 
ATOM   1328  C  CA    . VAL A 1 196 ? -22.659 48.494 14.785  1.00 156.23 ? 303  VAL A CA    1 
ATOM   1329  C  C     . VAL A 1 196 ? -23.741 49.426 14.250  1.00 155.56 ? 303  VAL A C     1 
ATOM   1330  O  O     . VAL A 1 196 ? -24.080 49.373 13.067  1.00 155.49 ? 303  VAL A O     1 
ATOM   1331  C  CB    . VAL A 1 196 ? -21.283 49.035 14.340  1.00 154.35 ? 303  VAL A CB    1 
ATOM   1332  C  CG1   . VAL A 1 196 ? -21.046 50.432 14.903  1.00 152.71 ? 303  VAL A CG1   1 
ATOM   1333  C  CG2   . VAL A 1 196 ? -20.165 48.092 14.768  1.00 155.45 ? 303  VAL A CG2   1 
ATOM   1334  N  N     . PHE A 1 197 ? -24.273 50.281 15.123  1.00 155.61 ? 304  PHE A N     1 
ATOM   1335  C  CA    . PHE A 1 197 ? -25.249 51.289 14.715  1.00 155.27 ? 304  PHE A CA    1 
ATOM   1336  C  C     . PHE A 1 197 ? -24.577 52.331 13.827  1.00 153.37 ? 304  PHE A C     1 
ATOM   1337  O  O     . PHE A 1 197 ? -23.558 52.912 14.204  1.00 152.30 ? 304  PHE A O     1 
ATOM   1338  C  CB    . PHE A 1 197 ? -25.877 51.972 15.936  1.00 155.89 ? 304  PHE A CB    1 
ATOM   1339  C  CG    . PHE A 1 197 ? -26.779 53.126 15.588  1.00 155.33 ? 304  PHE A CG    1 
ATOM   1340  C  CD1   . PHE A 1 197 ? -28.097 52.907 15.211  1.00 156.90 ? 304  PHE A CD1   1 
ATOM   1341  C  CD2   . PHE A 1 197 ? -26.308 54.434 15.636  1.00 153.73 ? 304  PHE A CD2   1 
ATOM   1342  C  CE1   . PHE A 1 197 ? -28.928 53.967 14.888  1.00 156.54 ? 304  PHE A CE1   1 
ATOM   1343  C  CE2   . PHE A 1 197 ? -27.134 55.498 15.314  1.00 153.32 ? 304  PHE A CE2   1 
ATOM   1344  C  CZ    . PHE A 1 197 ? -28.446 55.265 14.940  1.00 154.69 ? 304  PHE A CZ    1 
ATOM   1345  N  N     . LYS A 1 198 ? -25.154 52.555 12.649  1.00 153.50 ? 305  LYS A N     1 
ATOM   1346  C  CA    . LYS A 1 198 ? -24.640 53.537 11.699  1.00 152.26 ? 305  LYS A CA    1 
ATOM   1347  C  C     . LYS A 1 198 ? -25.804 54.294 11.066  1.00 152.11 ? 305  LYS A C     1 
ATOM   1348  O  O     . LYS A 1 198 ? -26.444 53.804 10.135  1.00 152.88 ? 305  LYS A O     1 
ATOM   1349  C  CB    . LYS A 1 198 ? -23.784 52.844 10.630  1.00 152.83 ? 305  LYS A CB    1 
ATOM   1350  C  CG    . LYS A 1 198 ? -23.330 53.723 9.470   1.00 152.24 ? 305  LYS A CG    1 
ATOM   1351  C  CD    . LYS A 1 198 ? -22.508 54.919 9.927   1.00 151.23 ? 305  LYS A CD    1 
ATOM   1352  C  CE    . LYS A 1 198 ? -22.041 55.748 8.741   1.00 150.89 ? 305  LYS A CE    1 
ATOM   1353  N  NZ    . LYS A 1 198 ? -20.972 56.716 9.112   1.00 150.12 ? 305  LYS A NZ    1 
ATOM   1354  N  N     . SER A 1 199 ? -26.076 55.481 11.604  1.00 151.56 ? 306  SER A N     1 
ATOM   1355  C  CA    . SER A 1 199 ? -27.084 56.405 11.073  1.00 151.71 ? 306  SER A CA    1 
ATOM   1356  C  C     . SER A 1 199 ? -28.525 55.885 11.158  1.00 153.13 ? 306  SER A C     1 
ATOM   1357  O  O     . SER A 1 199 ? -29.298 56.346 11.999  1.00 153.85 ? 306  SER A O     1 
ATOM   1358  C  CB    . SER A 1 199 ? -26.741 56.830 9.637   1.00 151.27 ? 306  SER A CB    1 
ATOM   1359  O  OG    . SER A 1 199 ? -25.450 57.411 9.575   1.00 150.22 ? 306  SER A OG    1 
ATOM   1360  N  N     . ASP A 1 200 ? -28.879 54.932 10.296  1.00 153.98 ? 307  ASP A N     1 
ATOM   1361  C  CA    . ASP A 1 200 ? -30.268 54.474 10.169  1.00 155.90 ? 307  ASP A CA    1 
ATOM   1362  C  C     . ASP A 1 200 ? -30.480 52.970 10.397  1.00 157.70 ? 307  ASP A C     1 
ATOM   1363  O  O     . ASP A 1 200 ? -31.608 52.488 10.282  1.00 160.24 ? 307  ASP A O     1 
ATOM   1364  C  CB    . ASP A 1 200 ? -30.819 54.866 8.790   1.00 156.38 ? 307  ASP A CB    1 
ATOM   1365  C  CG    . ASP A 1 200 ? -30.123 54.141 7.647   1.00 156.88 ? 307  ASP A CG    1 
ATOM   1366  O  OD1   . ASP A 1 200 ? -28.906 53.876 7.754   1.00 156.18 ? 307  ASP A OD1   1 
ATOM   1367  O  OD2   . ASP A 1 200 ? -30.795 53.843 6.637   1.00 158.44 ? 307  ASP A OD2   1 
ATOM   1368  N  N     . ALA A 1 201 ? -29.416 52.234 10.720  1.00 156.71 ? 308  ALA A N     1 
ATOM   1369  C  CA    . ALA A 1 201 ? -29.517 50.786 10.933  1.00 158.22 ? 308  ALA A CA    1 
ATOM   1370  C  C     . ALA A 1 201 ? -28.270 50.213 11.606  1.00 157.11 ? 308  ALA A C     1 
ATOM   1371  O  O     . ALA A 1 201 ? -27.261 50.904 11.759  1.00 155.24 ? 308  ALA A O     1 
ATOM   1372  C  CB    . ALA A 1 201 ? -29.766 50.075 9.608   1.00 159.51 ? 308  ALA A CB    1 
ATOM   1373  N  N     . TYR A 1 202 ? -28.359 48.947 12.009  1.00 158.50 ? 309  TYR A N     1 
ATOM   1374  C  CA    . TYR A 1 202 ? -27.223 48.214 12.567  1.00 157.98 ? 309  TYR A CA    1 
ATOM   1375  C  C     . TYR A 1 202 ? -26.538 47.401 11.469  1.00 158.20 ? 309  TYR A C     1 
ATOM   1376  O  O     . TYR A 1 202 ? -27.071 46.387 11.016  1.00 160.68 ? 309  TYR A O     1 
ATOM   1377  C  CB    . TYR A 1 202 ? -27.676 47.284 13.696  1.00 160.49 ? 309  TYR A CB    1 
ATOM   1378  C  CG    . TYR A 1 202 ? -27.989 47.992 14.995  1.00 160.00 ? 309  TYR A CG    1 
ATOM   1379  C  CD1   . TYR A 1 202 ? -29.239 48.562 15.218  1.00 160.64 ? 309  TYR A CD1   1 
ATOM   1380  C  CD2   . TYR A 1 202 ? -27.037 48.081 16.007  1.00 159.25 ? 309  TYR A CD2   1 
ATOM   1381  C  CE1   . TYR A 1 202 ? -29.530 49.207 16.409  1.00 160.75 ? 309  TYR A CE1   1 
ATOM   1382  C  CE2   . TYR A 1 202 ? -27.318 48.724 17.202  1.00 159.37 ? 309  TYR A CE2   1 
ATOM   1383  C  CZ    . TYR A 1 202 ? -28.565 49.285 17.399  1.00 160.15 ? 309  TYR A CZ    1 
ATOM   1384  O  OH    . TYR A 1 202 ? -28.850 49.925 18.583  1.00 160.62 ? 309  TYR A OH    1 
ATOM   1385  N  N     . TYR A 1 203 ? -25.358 47.853 11.051  1.00 155.88 ? 310  TYR A N     1 
ATOM   1386  C  CA    . TYR A 1 203 ? -24.596 47.199 9.987   1.00 156.23 ? 310  TYR A CA    1 
ATOM   1387  C  C     . TYR A 1 203 ? -23.565 46.243 10.581  1.00 157.32 ? 310  TYR A C     1 
ATOM   1388  O  O     . TYR A 1 203 ? -22.886 46.583 11.551  1.00 156.08 ? 310  TYR A O     1 
ATOM   1389  C  CB    . TYR A 1 203 ? -23.878 48.242 9.125   1.00 153.69 ? 310  TYR A CB    1 
ATOM   1390  C  CG    . TYR A 1 203 ? -24.796 49.124 8.304   1.00 152.79 ? 310  TYR A CG    1 
ATOM   1391  C  CD1   . TYR A 1 203 ? -24.870 48.989 6.920   1.00 153.52 ? 310  TYR A CD1   1 
ATOM   1392  C  CD2   . TYR A 1 203 ? -25.583 50.101 8.909   1.00 151.62 ? 310  TYR A CD2   1 
ATOM   1393  C  CE1   . TYR A 1 203 ? -25.703 49.799 6.165   1.00 153.20 ? 310  TYR A CE1   1 
ATOM   1394  C  CE2   . TYR A 1 203 ? -26.419 50.914 8.162   1.00 151.21 ? 310  TYR A CE2   1 
ATOM   1395  C  CZ    . TYR A 1 203 ? -26.477 50.759 6.791   1.00 151.98 ? 310  TYR A CZ    1 
ATOM   1396  O  OH    . TYR A 1 203 ? -27.306 51.564 6.045   1.00 152.00 ? 310  TYR A OH    1 
ATOM   1397  N  N     . CYS A 1 204 ? -23.447 45.052 9.996   1.00 159.95 ? 311  CYS A N     1 
ATOM   1398  C  CA    . CYS A 1 204 ? -22.436 44.082 10.419  1.00 161.50 ? 311  CYS A CA    1 
ATOM   1399  C  C     . CYS A 1 204 ? -21.064 44.502 9.902   1.00 160.04 ? 311  CYS A C     1 
ATOM   1400  O  O     . CYS A 1 204 ? -20.909 44.810 8.719   1.00 159.80 ? 311  CYS A O     1 
ATOM   1401  C  CB    . CYS A 1 204 ? -22.779 42.679 9.913   1.00 165.15 ? 311  CYS A CB    1 
ATOM   1402  S  SG    . CYS A 1 204 ? -21.563 41.410 10.347  1.00 167.38 ? 311  CYS A SG    1 
ATOM   1403  N  N     . THR A 1 205 ? -20.077 44.507 10.795  1.00 159.66 ? 312  THR A N     1 
ATOM   1404  C  CA    . THR A 1 205 ? -18.718 44.936 10.462  1.00 158.72 ? 312  THR A CA    1 
ATOM   1405  C  C     . THR A 1 205 ? -17.741 43.760 10.400  1.00 161.32 ? 312  THR A C     1 
ATOM   1406  O  O     . THR A 1 205 ? -16.529 43.960 10.300  1.00 160.96 ? 312  THR A O     1 
ATOM   1407  C  CB    . THR A 1 205 ? -18.196 45.959 11.490  1.00 156.57 ? 312  THR A CB    1 
ATOM   1408  O  OG1   . THR A 1 205 ? -18.012 45.320 12.760  1.00 157.69 ? 312  THR A OG1   1 
ATOM   1409  C  CG2   . THR A 1 205 ? -19.173 47.118 11.642  1.00 154.86 ? 312  THR A CG2   1 
ATOM   1410  N  N     . GLY A 1 206 ? -18.269 42.538 10.450  1.00 164.57 ? 313  GLY A N     1 
ATOM   1411  C  CA    . GLY A 1 206 ? -17.441 41.336 10.445  1.00 167.35 ? 313  GLY A CA    1 
ATOM   1412  C  C     . GLY A 1 206 ? -16.929 40.971 9.066   1.00 168.81 ? 313  GLY A C     1 
ATOM   1413  O  O     . GLY A 1 206 ? -16.936 41.797 8.150   1.00 167.31 ? 313  GLY A O     1 
ATOM   1414  N  N     . ASP A 1 207 ? -16.483 39.726 8.923   1.00 172.27 ? 314  ASP A N     1 
ATOM   1415  C  CA    . ASP A 1 207 ? -15.925 39.237 7.665   1.00 174.60 ? 314  ASP A CA    1 
ATOM   1416  C  C     . ASP A 1 207 ? -16.500 37.875 7.287   1.00 178.68 ? 314  ASP A C     1 
ATOM   1417  O  O     . ASP A 1 207 ? -16.136 36.851 7.870   1.00 181.24 ? 314  ASP A O     1 
ATOM   1418  C  CB    . ASP A 1 207 ? -14.400 39.153 7.760   1.00 174.95 ? 314  ASP A CB    1 
ATOM   1419  C  CG    . ASP A 1 207 ? -13.748 40.517 7.844   1.00 171.93 ? 314  ASP A CG    1 
ATOM   1420  O  OD1   . ASP A 1 207 ? -13.681 41.079 8.957   1.00 170.27 ? 314  ASP A OD1   1 
ATOM   1421  O  OD2   . ASP A 1 207 ? -13.300 41.025 6.794   1.00 171.78 ? 314  ASP A OD2   1 
ATOM   1422  N  N     . VAL A 1 208 ? -17.409 37.879 6.314   1.00 179.64 ? 315  VAL A N     1 
ATOM   1423  C  CA    . VAL A 1 208 ? -17.936 36.643 5.726   1.00 183.84 ? 315  VAL A CA    1 
ATOM   1424  C  C     . VAL A 1 208 ? -16.810 35.811 5.097   1.00 186.67 ? 315  VAL A C     1 
ATOM   1425  O  O     . VAL A 1 208 ? -16.873 34.581 5.078   1.00 190.66 ? 315  VAL A O     1 
ATOM   1426  C  CB    . VAL A 1 208 ? -19.059 36.931 4.692   1.00 184.46 ? 315  VAL A CB    1 
ATOM   1427  C  CG1   . VAL A 1 208 ? -18.583 37.866 3.583   1.00 182.82 ? 315  VAL A CG1   1 
ATOM   1428  C  CG2   . VAL A 1 208 ? -19.609 35.636 4.106   1.00 189.36 ? 315  VAL A CG2   1 
ATOM   1429  N  N     . THR A 1 209 ? -15.784 36.495 4.593   1.00 185.09 ? 316  THR A N     1 
ATOM   1430  C  CA    . THR A 1 209 ? -14.572 35.846 4.093   1.00 187.63 ? 316  THR A CA    1 
ATOM   1431  C  C     . THR A 1 209 ? -13.392 36.819 4.167   1.00 184.80 ? 316  THR A C     1 
ATOM   1432  O  O     . THR A 1 209 ? -13.570 37.996 4.478   1.00 181.26 ? 316  THR A O     1 
ATOM   1433  C  CB    . THR A 1 209 ? -14.762 35.317 2.651   1.00 191.29 ? 316  THR A CB    1 
ATOM   1434  O  OG1   . THR A 1 209 ? -13.486 35.103 2.030   1.00 193.04 ? 316  THR A OG1   1 
ATOM   1435  C  CG2   . THR A 1 209 ? -15.578 36.290 1.812   1.00 189.69 ? 316  THR A CG2   1 
ATOM   1436  N  N     . ALA A 1 210 ? -12.191 36.318 3.896   1.00 186.83 ? 317  ALA A N     1 
ATOM   1437  C  CA    . ALA A 1 210 ? -10.980 37.137 3.966   1.00 185.08 ? 317  ALA A CA    1 
ATOM   1438  C  C     . ALA A 1 210 ? -10.938 38.206 2.872   1.00 183.83 ? 317  ALA A C     1 
ATOM   1439  O  O     . ALA A 1 210 ? -10.402 39.296 3.082   1.00 180.90 ? 317  ALA A O     1 
ATOM   1440  C  CB    . ALA A 1 210 ? -9.743  36.256 3.890   1.00 188.31 ? 317  ALA A CB    1 
ATOM   1441  N  N     . TRP A 1 211 ? -11.508 37.889 1.712   1.00 186.34 ? 318  TRP A N     1 
ATOM   1442  C  CA    . TRP A 1 211 ? -11.494 38.794 0.562   1.00 185.93 ? 318  TRP A CA    1 
ATOM   1443  C  C     . TRP A 1 211 ? -12.566 39.880 0.641   1.00 182.64 ? 318  TRP A C     1 
ATOM   1444  O  O     . TRP A 1 211 ? -12.352 40.995 0.161   1.00 181.03 ? 318  TRP A O     1 
ATOM   1445  C  CB    . TRP A 1 211 ? -11.665 38.002 -0.737  1.00 190.22 ? 318  TRP A CB    1 
ATOM   1446  C  CG    . TRP A 1 211 ? -10.573 37.007 -0.978  1.00 193.98 ? 318  TRP A CG    1 
ATOM   1447  C  CD1   . TRP A 1 211 ? -10.535 35.712 -0.549  1.00 196.92 ? 318  TRP A CD1   1 
ATOM   1448  C  CD2   . TRP A 1 211 ? -9.358  37.227 -1.703  1.00 195.64 ? 318  TRP A CD2   1 
ATOM   1449  N  NE1   . TRP A 1 211 ? -9.371  35.110 -0.964  1.00 200.33 ? 318  TRP A NE1   1 
ATOM   1450  C  CE2   . TRP A 1 211 ? -8.631  36.018 -1.675  1.00 199.65 ? 318  TRP A CE2   1 
ATOM   1451  C  CE3   . TRP A 1 211 ? -8.814  38.327 -2.377  1.00 194.55 ? 318  TRP A CE3   1 
ATOM   1452  C  CZ2   . TRP A 1 211 ? -7.387  35.878 -2.294  1.00 202.48 ? 318  TRP A CZ2   1 
ATOM   1453  C  CZ3   . TRP A 1 211 ? -7.577  38.187 -2.992  1.00 197.47 ? 318  TRP A CZ3   1 
ATOM   1454  C  CH2   . TRP A 1 211 ? -6.878  36.971 -2.945  1.00 201.36 ? 318  TRP A CH2   1 
ATOM   1455  N  N     . THR A 1 212 ? -13.711 39.557 1.242   1.00 182.06 ? 319  THR A N     1 
ATOM   1456  C  CA    . THR A 1 212 ? -14.866 40.459 1.253   1.00 179.62 ? 319  THR A CA    1 
ATOM   1457  C  C     . THR A 1 212 ? -15.389 40.709 2.661   1.00 176.88 ? 319  THR A C     1 
ATOM   1458  O  O     . THR A 1 212 ? -15.246 39.869 3.548   1.00 177.77 ? 319  THR A O     1 
ATOM   1459  C  CB    . THR A 1 212 ? -16.039 39.901 0.418   1.00 182.31 ? 319  THR A CB    1 
ATOM   1460  O  OG1   . THR A 1 212 ? -16.941 39.171 1.259   1.00 183.02 ? 319  THR A OG1   1 
ATOM   1461  C  CG2   . THR A 1 212 ? -15.544 38.993 -0.680  1.00 186.65 ? 319  THR A CG2   1 
ATOM   1462  N  N     . LYS A 1 213 ? -16.018 41.866 2.844   1.00 173.85 ? 320  LYS A N     1 
ATOM   1463  C  CA    . LYS A 1 213 ? -16.640 42.224 4.113   1.00 171.46 ? 320  LYS A CA    1 
ATOM   1464  C  C     . LYS A 1 213 ? -18.100 41.778 4.114   1.00 172.16 ? 320  LYS A C     1 
ATOM   1465  O  O     . LYS A 1 213 ? -18.727 41.684 3.056   1.00 173.53 ? 320  LYS A O     1 
ATOM   1466  C  CB    . LYS A 1 213 ? -16.550 43.735 4.330   1.00 168.33 ? 320  LYS A CB    1 
ATOM   1467  C  CG    . LYS A 1 213 ? -16.652 44.161 5.783   1.00 166.47 ? 320  LYS A CG    1 
ATOM   1468  C  CD    . LYS A 1 213 ? -16.642 45.675 5.908   1.00 163.91 ? 320  LYS A CD    1 
ATOM   1469  C  CE    . LYS A 1 213 ? -16.545 46.121 7.358   1.00 162.41 ? 320  LYS A CE    1 
ATOM   1470  N  NZ    . LYS A 1 213 ? -15.166 45.984 7.907   1.00 162.72 ? 320  LYS A NZ    1 
ATOM   1471  N  N     . CYS A 1 214 ? -18.635 41.508 5.302   1.00 171.34 ? 321  CYS A N     1 
ATOM   1472  C  CA    . CYS A 1 214 ? -20.037 41.114 5.451   1.00 172.40 ? 321  CYS A CA    1 
ATOM   1473  C  C     . CYS A 1 214 ? -20.963 42.306 5.210   1.00 170.42 ? 321  CYS A C     1 
ATOM   1474  O  O     . CYS A 1 214 ? -20.622 43.442 5.545   1.00 167.41 ? 321  CYS A O     1 
ATOM   1475  C  CB    . CYS A 1 214 ? -20.286 40.527 6.843   1.00 172.54 ? 321  CYS A CB    1 
ATOM   1476  S  SG    . CYS A 1 214 ? -22.027 40.209 7.214   1.00 173.83 ? 321  CYS A SG    1 
ATOM   1477  N  N     . MET A 1 215 ? -22.134 42.034 4.637   1.00 172.59 ? 322  MET A N     1 
ATOM   1478  C  CA    . MET A 1 215 ? -23.093 43.078 4.266   1.00 171.36 ? 322  MET A CA    1 
ATOM   1479  C  C     . MET A 1 215 ? -24.462 42.881 4.926   1.00 172.17 ? 322  MET A C     1 
ATOM   1480  O  O     . MET A 1 215 ? -25.496 43.202 4.334   1.00 172.81 ? 322  MET A O     1 
ATOM   1481  C  CB    . MET A 1 215 ? -23.242 43.120 2.741   1.00 173.37 ? 322  MET A CB    1 
ATOM   1482  C  CG    . MET A 1 215 ? -22.065 43.754 2.019   1.00 172.42 ? 322  MET A CG    1 
ATOM   1483  S  SD    . MET A 1 215 ? -21.958 43.258 0.287   1.00 176.77 ? 322  MET A SD    1 
ATOM   1484  C  CE    . MET A 1 215 ? -23.638 43.542 -0.266  1.00 177.89 ? 322  MET A CE    1 
ATOM   1485  N  N     . VAL A 1 216 ? -24.470 42.363 6.153   1.00 172.45 ? 323  VAL A N     1 
ATOM   1486  C  CA    . VAL A 1 216 ? -25.713 42.223 6.916   1.00 173.68 ? 323  VAL A CA    1 
ATOM   1487  C  C     . VAL A 1 216 ? -26.139 43.589 7.456   1.00 170.98 ? 323  VAL A C     1 
ATOM   1488  O  O     . VAL A 1 216 ? -25.307 44.375 7.914   1.00 168.02 ? 323  VAL A O     1 
ATOM   1489  C  CB    . VAL A 1 216 ? -25.570 41.197 8.065   1.00 175.46 ? 323  VAL A CB    1 
ATOM   1490  C  CG1   . VAL A 1 216 ? -26.702 41.327 9.078   1.00 175.98 ? 323  VAL A CG1   1 
ATOM   1491  C  CG2   . VAL A 1 216 ? -25.528 39.785 7.503   1.00 179.58 ? 323  VAL A CG2   1 
ATOM   1492  N  N     . LYS A 1 217 ? -27.441 43.856 7.391   1.00 172.51 ? 324  LYS A N     1 
ATOM   1493  C  CA    . LYS A 1 217 ? -28.011 45.136 7.806   1.00 170.58 ? 324  LYS A CA    1 
ATOM   1494  C  C     . LYS A 1 217 ? -29.398 44.907 8.403   1.00 173.09 ? 324  LYS A C     1 
ATOM   1495  O  O     . LYS A 1 217 ? -30.185 44.123 7.868   1.00 176.32 ? 324  LYS A O     1 
ATOM   1496  C  CB    . LYS A 1 217 ? -28.098 46.075 6.600   1.00 169.32 ? 324  LYS A CB    1 
ATOM   1497  C  CG    . LYS A 1 217 ? -28.697 47.444 6.888   1.00 167.26 ? 324  LYS A CG    1 
ATOM   1498  C  CD    . LYS A 1 217 ? -28.913 48.230 5.603   1.00 166.76 ? 324  LYS A CD    1 
ATOM   1499  C  CE    . LYS A 1 217 ? -29.906 49.366 5.794   1.00 165.88 ? 324  LYS A CE    1 
ATOM   1500  N  NZ    . LYS A 1 217 ? -31.316 48.886 5.797   1.00 168.78 ? 324  LYS A NZ    1 
ATOM   1501  N  N     . THR A 1 218 ? -29.695 45.590 9.507   1.00 172.22 ? 325  THR A N     1 
ATOM   1502  C  CA    . THR A 1 218 ? -30.979 45.423 10.190  1.00 174.95 ? 325  THR A CA    1 
ATOM   1503  C  C     . THR A 1 218 ? -31.301 46.575 11.143  1.00 173.36 ? 325  THR A C     1 
ATOM   1504  O  O     . THR A 1 218 ? -30.402 47.250 11.645  1.00 170.73 ? 325  THR A O     1 
ATOM   1505  C  CB    . THR A 1 218 ? -31.024 44.095 10.980  1.00 178.36 ? 325  THR A CB    1 
ATOM   1506  O  OG1   . THR A 1 218 ? -32.288 43.968 11.646  1.00 181.07 ? 325  THR A OG1   1 
ATOM   1507  C  CG2   . THR A 1 218 ? -29.897 44.023 12.014  1.00 176.85 ? 325  THR A CG2   1 
ATOM   1508  N  N     . GLN A 1 219 ? -32.595 46.783 11.378  1.00 175.53 ? 326  GLN A N     1 
ATOM   1509  C  CA    . GLN A 1 219 ? -33.077 47.751 12.366  1.00 174.93 ? 326  GLN A CA    1 
ATOM   1510  C  C     . GLN A 1 219 ? -33.445 47.072 13.689  1.00 177.94 ? 326  GLN A C     1 
ATOM   1511  O  O     . GLN A 1 219 ? -33.558 47.740 14.719  1.00 177.24 ? 326  GLN A O     1 
ATOM   1512  C  CB    . GLN A 1 219 ? -34.287 48.515 11.819  1.00 175.47 ? 326  GLN A CB    1 
ATOM   1513  C  CG    . GLN A 1 219 ? -33.924 49.642 10.862  1.00 172.45 ? 326  GLN A CG    1 
ATOM   1514  C  CD    . GLN A 1 219 ? -35.135 50.435 10.400  1.00 173.17 ? 326  GLN A CD    1 
ATOM   1515  O  OE1   . GLN A 1 219 ? -36.257 49.927 10.383  1.00 176.46 ? 326  GLN A OE1   1 
ATOM   1516  N  NE2   . GLN A 1 219 ? -34.911 51.690 10.016  1.00 170.38 ? 326  GLN A NE2   1 
ATOM   1517  N  N     . THR A 1 220 ? -33.635 45.753 13.656  1.00 181.72 ? 327  THR A N     1 
ATOM   1518  C  CA    . THR A 1 220 ? -33.974 44.976 14.847  1.00 185.38 ? 327  THR A CA    1 
ATOM   1519  C  C     . THR A 1 220 ? -32.988 43.817 15.027  1.00 186.81 ? 327  THR A C     1 
ATOM   1520  O  O     . THR A 1 220 ? -33.308 42.670 14.706  1.00 190.16 ? 327  THR A O     1 
ATOM   1521  C  CB    . THR A 1 220 ? -35.408 44.419 14.758  1.00 189.71 ? 327  THR A CB    1 
ATOM   1522  O  OG1   . THR A 1 220 ? -35.564 43.673 13.544  1.00 191.22 ? 327  THR A OG1   1 
ATOM   1523  C  CG2   . THR A 1 220 ? -36.425 45.551 14.789  1.00 189.19 ? 327  THR A CG2   1 
ATOM   1524  N  N     . PRO A 1 221 ? -31.779 44.115 15.538  1.00 184.72 ? 328  PRO A N     1 
ATOM   1525  C  CA    . PRO A 1 221 ? -30.765 43.082 15.743  1.00 185.99 ? 328  PRO A CA    1 
ATOM   1526  C  C     . PRO A 1 221 ? -31.019 42.241 16.992  1.00 190.21 ? 328  PRO A C     1 
ATOM   1527  O  O     . PRO A 1 221 ? -31.836 42.614 17.837  1.00 191.57 ? 328  PRO A O     1 
ATOM   1528  C  CB    . PRO A 1 221 ? -29.479 43.893 15.908  1.00 181.83 ? 328  PRO A CB    1 
ATOM   1529  C  CG    . PRO A 1 221 ? -29.935 45.164 16.533  1.00 179.99 ? 328  PRO A CG    1 
ATOM   1530  C  CD    . PRO A 1 221 ? -31.286 45.448 15.937  1.00 181.08 ? 328  PRO A CD    1 
ATOM   1531  N  N     . ASN A 1 222 ? -30.313 41.119 17.098  1.00 192.89 ? 329  ASN A N     1 
ATOM   1532  C  CA    . ASN A 1 222 ? -30.408 40.240 18.263  1.00 197.38 ? 329  ASN A CA    1 
ATOM   1533  C  C     . ASN A 1 222 ? -29.460 40.720 19.357  1.00 196.23 ? 329  ASN A C     1 
ATOM   1534  O  O     . ASN A 1 222 ? -28.335 41.132 19.067  1.00 192.97 ? 329  ASN A O     1 
ATOM   1535  C  CB    . ASN A 1 222 ? -30.074 38.797 17.877  1.00 200.56 ? 329  ASN A CB    1 
ATOM   1536  C  CG    . ASN A 1 222 ? -30.936 38.279 16.739  1.00 202.76 ? 329  ASN A CG    1 
ATOM   1537  O  OD1   . ASN A 1 222 ? -30.428 37.709 15.774  1.00 202.76 ? 329  ASN A OD1   1 
ATOM   1538  N  ND2   . ASN A 1 222 ? -32.245 38.482 16.844  1.00 204.94 ? 329  ASN A ND2   1 
ATOM   1539  N  N     . ARG A 1 223 ? -29.911 40.660 20.608  1.00 199.66 ? 330  ARG A N     1 
ATOM   1540  C  CA    . ARG A 1 223 ? -29.127 41.176 21.732  1.00 199.38 ? 330  ARG A CA    1 
ATOM   1541  C  C     . ARG A 1 223 ? -29.668 40.739 23.092  1.00 204.42 ? 330  ARG A C     1 
ATOM   1542  O  O     . ARG A 1 223 ? -30.878 40.771 23.325  1.00 207.07 ? 330  ARG A O     1 
ATOM   1543  C  CB    . ARG A 1 223 ? -29.065 42.709 21.676  1.00 195.49 ? 330  ARG A CB    1 
ATOM   1544  C  CG    . ARG A 1 223 ? -30.392 43.394 21.378  1.00 195.93 ? 330  ARG A CG    1 
ATOM   1545  C  CD    . ARG A 1 223 ? -30.213 44.893 21.191  1.00 192.11 ? 330  ARG A CD    1 
ATOM   1546  N  NE    . ARG A 1 223 ? -31.229 45.466 20.309  1.00 191.66 ? 330  ARG A NE    1 
ATOM   1547  C  CZ    . ARG A 1 223 ? -31.206 46.709 19.827  1.00 188.53 ? 330  ARG A CZ    1 
ATOM   1548  N  NH1   . ARG A 1 223 ? -30.215 47.543 20.134  1.00 185.66 ? 330  ARG A NH1   1 
ATOM   1549  N  NH2   . ARG A 1 223 ? -32.184 47.123 19.028  1.00 188.53 ? 330  ARG A NH2   1 
ATOM   1550  N  N     . LYS A 1 224 ? -28.762 40.330 23.980  1.00 206.44 ? 331  LYS A N     1 
ATOM   1551  C  CA    . LYS A 1 224 ? -29.106 40.060 25.375  1.00 211.28 ? 331  LYS A CA    1 
ATOM   1552  C  C     . LYS A 1 224 ? -28.991 41.361 26.171  1.00 210.04 ? 331  LYS A C     1 
ATOM   1553  O  O     . LYS A 1 224 ? -28.566 42.387 25.634  1.00 205.83 ? 331  LYS A O     1 
ATOM   1554  C  CB    . LYS A 1 224 ? -28.204 38.965 25.964  1.00 213.83 ? 331  LYS A CB    1 
ATOM   1555  C  CG    . LYS A 1 224 ? -26.803 39.410 26.366  1.00 211.03 ? 331  LYS A CG    1 
ATOM   1556  C  CD    . LYS A 1 224 ? -25.928 38.214 26.718  1.00 213.62 ? 331  LYS A CD    1 
ATOM   1557  C  CE    . LYS A 1 224 ? -24.742 38.609 27.585  1.00 212.54 ? 331  LYS A CE    1 
ATOM   1558  N  NZ    . LYS A 1 224 ? -25.116 38.788 29.016  1.00 215.76 ? 331  LYS A NZ    1 
ATOM   1559  N  N     . GLU A 1 225 ? -29.366 41.316 27.447  1.00 214.49 ? 332  GLU A N     1 
ATOM   1560  C  CA    . GLU A 1 225 ? -29.362 42.511 28.291  1.00 214.30 ? 332  GLU A CA    1 
ATOM   1561  C  C     . GLU A 1 225 ? -27.940 42.913 28.685  1.00 212.25 ? 332  GLU A C     1 
ATOM   1562  O  O     . GLU A 1 225 ? -27.076 42.059 28.887  1.00 213.13 ? 332  GLU A O     1 
ATOM   1563  C  CB    . GLU A 1 225 ? -30.215 42.286 29.546  1.00 219.78 ? 332  GLU A CB    1 
ATOM   1564  C  CG    . GLU A 1 225 ? -30.445 43.531 30.396  1.00 219.75 ? 332  GLU A CG    1 
ATOM   1565  C  CD    . GLU A 1 225 ? -31.143 44.650 29.642  1.00 216.91 ? 332  GLU A CD    1 
ATOM   1566  O  OE1   . GLU A 1 225 ? -32.135 44.370 28.936  1.00 217.89 ? 332  GLU A OE1   1 
ATOM   1567  O  OE2   . GLU A 1 225 ? -30.703 45.813 29.762  1.00 214.14 ? 332  GLU A OE2   1 
ATOM   1568  N  N     . TRP A 1 226 ? -27.714 44.222 28.789  1.00 210.04 ? 333  TRP A N     1 
ATOM   1569  C  CA    . TRP A 1 226 ? -26.410 44.767 29.159  1.00 208.58 ? 333  TRP A CA    1 
ATOM   1570  C  C     . TRP A 1 226 ? -26.131 44.525 30.640  1.00 214.01 ? 333  TRP A C     1 
ATOM   1571  O  O     . TRP A 1 226 ? -26.923 44.921 31.497  1.00 217.03 ? 333  TRP A O     1 
ATOM   1572  C  CB    . TRP A 1 226 ? -26.357 46.267 28.849  1.00 204.26 ? 333  TRP A CB    1 
ATOM   1573  C  CG    . TRP A 1 226 ? -25.091 46.949 29.281  1.00 201.80 ? 333  TRP A CG    1 
ATOM   1574  C  CD1   . TRP A 1 226 ? -24.852 47.546 30.485  1.00 203.37 ? 333  TRP A CD1   1 
ATOM   1575  C  CD2   . TRP A 1 226 ? -23.895 47.113 28.509  1.00 197.93 ? 333  TRP A CD2   1 
ATOM   1576  N  NE1   . TRP A 1 226 ? -23.580 48.065 30.514  1.00 201.02 ? 333  TRP A NE1   1 
ATOM   1577  C  CE2   . TRP A 1 226 ? -22.971 47.815 29.313  1.00 197.72 ? 333  TRP A CE2   1 
ATOM   1578  C  CE3   . TRP A 1 226 ? -23.512 46.732 27.217  1.00 195.10 ? 333  TRP A CE3   1 
ATOM   1579  C  CZ2   . TRP A 1 226 ? -21.689 48.144 28.868  1.00 194.92 ? 333  TRP A CZ2   1 
ATOM   1580  C  CZ3   . TRP A 1 226 ? -22.236 47.060 26.775  1.00 192.22 ? 333  TRP A CZ3   1 
ATOM   1581  C  CH2   . TRP A 1 226 ? -21.341 47.760 27.601  1.00 192.17 ? 333  TRP A CH2   1 
ATOM   1582  N  N     . VAL A 1 227 ? -25.004 43.878 30.929  1.00 216.50 ? 334  VAL A N     1 
ATOM   1583  C  CA    . VAL A 1 227 ? -24.618 43.550 32.298  1.00 222.10 ? 334  VAL A CA    1 
ATOM   1584  C  C     . VAL A 1 227 ? -23.435 44.411 32.736  1.00 221.93 ? 334  VAL A C     1 
ATOM   1585  O  O     . VAL A 1 227 ? -22.298 44.177 32.321  1.00 219.84 ? 334  VAL A O     1 
ATOM   1586  C  CB    . VAL A 1 227 ? -24.250 42.056 32.437  1.00 225.23 ? 334  VAL A CB    1 
ATOM   1587  C  CG1   . VAL A 1 227 ? -23.939 41.710 33.889  1.00 229.77 ? 334  VAL A CG1   1 
ATOM   1588  C  CG2   . VAL A 1 227 ? -25.379 41.180 31.915  1.00 227.45 ? 334  VAL A CG2   1 
ATOM   1589  N  N     . THR A 1 228 ? -23.714 45.410 33.570  1.00 225.19 ? 335  THR A N     1 
ATOM   1590  C  CA    . THR A 1 228 ? -22.669 46.221 34.184  1.00 226.21 ? 335  THR A CA    1 
ATOM   1591  C  C     . THR A 1 228 ? -21.993 45.391 35.277  1.00 231.78 ? 335  THR A C     1 
ATOM   1592  O  O     . THR A 1 228 ? -22.679 44.700 36.030  1.00 236.15 ? 335  THR A O     1 
ATOM   1593  C  CB    . THR A 1 228 ? -23.249 47.504 34.815  1.00 226.97 ? 335  THR A CB    1 
ATOM   1594  O  OG1   . THR A 1 228 ? -24.078 48.180 33.862  1.00 224.22 ? 335  THR A OG1   1 
ATOM   1595  C  CG2   . THR A 1 228 ? -22.135 48.441 35.270  1.00 226.03 ? 335  THR A CG2   1 
ATOM   1596  N  N     . PRO A 1 229 ? -20.649 45.441 35.363  1.00 232.84 ? 336  PRO A N     1 
ATOM   1597  C  CA    . PRO A 1 229 ? -19.980 44.767 36.481  1.00 238.64 ? 336  PRO A CA    1 
ATOM   1598  C  C     . PRO A 1 229 ? -20.328 45.384 37.838  1.00 244.73 ? 336  PRO A C     1 
ATOM   1599  O  O     . PRO A 1 229 ? -20.822 46.512 37.897  1.00 243.85 ? 336  PRO A O     1 
ATOM   1600  C  CB    . PRO A 1 229 ? -18.488 44.961 36.175  1.00 235.64 ? 336  PRO A CB    1 
ATOM   1601  C  CG    . PRO A 1 229 ? -18.420 45.232 34.714  1.00 230.04 ? 336  PRO A CG    1 
ATOM   1602  C  CD    . PRO A 1 229 ? -19.685 45.960 34.376  1.00 228.45 ? 336  PRO A CD    1 
ATOM   1603  N  N     . LYS A 1 230 ? -20.067 44.643 38.913  1.00 252.17 ? 337  LYS A N     1 
ATOM   1604  C  CA    . LYS A 1 230 ? -20.284 45.136 40.281  1.00 258.76 ? 337  LYS A CA    1 
ATOM   1605  C  C     . LYS A 1 230 ? -19.620 46.490 40.548  1.00 259.08 ? 337  LYS A C     1 
ATOM   1606  O  O     . LYS A 1 230 ? -20.132 47.291 41.333  1.00 261.69 ? 337  LYS A O     1 
ATOM   1607  C  CB    . LYS A 1 230 ? -19.777 44.120 41.316  1.00 264.07 ? 337  LYS A CB    1 
ATOM   1608  C  CG    . LYS A 1 230 ? -20.865 43.275 41.960  1.00 269.27 ? 337  LYS A CG    1 
ATOM   1609  C  CD    . LYS A 1 230 ? -20.295 42.402 43.070  1.00 274.86 ? 337  LYS A CD    1 
ATOM   1610  C  CE    . LYS A 1 230 ? -21.328 42.105 44.146  1.00 281.28 ? 337  LYS A CE    1 
ATOM   1611  N  NZ    . LYS A 1 230 ? -20.742 41.336 45.280  1.00 287.03 ? 337  LYS A NZ    1 
ATOM   1612  N  N     . GLU A 1 231 ? -18.488 46.736 39.893  1.00 257.66 ? 338  GLU A N     1 
ATOM   1613  C  CA    . GLU A 1 231 ? -17.700 47.945 40.120  1.00 258.24 ? 338  GLU A CA    1 
ATOM   1614  C  C     . GLU A 1 231 ? -18.367 49.163 39.480  1.00 256.51 ? 338  GLU A C     1 
ATOM   1615  O  O     . GLU A 1 231 ? -18.049 49.537 38.349  1.00 251.96 ? 338  GLU A O     1 
ATOM   1616  C  CB    . GLU A 1 231 ? -16.274 47.771 39.578  1.00 255.74 ? 338  GLU A CB    1 
ATOM   1617  C  CG    . GLU A 1 231 ? -15.453 46.700 40.290  1.00 259.30 ? 338  GLU A CG    1 
ATOM   1618  C  CD    . GLU A 1 231 ? -15.818 45.279 39.889  1.00 259.88 ? 338  GLU A CD    1 
ATOM   1619  O  OE1   . GLU A 1 231 ? -16.214 45.058 38.724  1.00 256.18 ? 338  GLU A OE1   1 
ATOM   1620  O  OE2   . GLU A 1 231 ? -15.710 44.376 40.746  1.00 264.37 ? 338  GLU A OE2   1 
ATOM   1621  N  N     . PHE A 1 232 ? -19.297 49.769 40.215  1.00 261.23 ? 339  PHE A N     1 
ATOM   1622  C  CA    . PHE A 1 232 ? -20.021 50.947 39.740  1.00 260.57 ? 339  PHE A CA    1 
ATOM   1623  C  C     . PHE A 1 232 ? -20.735 51.663 40.888  1.00 266.77 ? 339  PHE A C     1 
ATOM   1624  O  O     . PHE A 1 232 ? -21.883 51.351 41.207  1.00 269.76 ? 339  PHE A O     1 
ATOM   1625  C  CB    . PHE A 1 232 ? -21.035 50.548 38.665  1.00 257.72 ? 339  PHE A CB    1 
ATOM   1626  N  N     . ARG A 1 233 ? -20.045 52.624 41.500  1.00 269.97 ? 340  ARG A N     1 
ATOM   1627  C  CA    . ARG A 1 233 ? -20.602 53.410 42.604  1.00 275.83 ? 340  ARG A CA    1 
ATOM   1628  C  C     . ARG A 1 233 ? -21.467 54.573 42.109  1.00 275.11 ? 340  ARG A C     1 
ATOM   1629  O  O     . ARG A 1 233 ? -22.185 55.192 42.896  1.00 278.70 ? 340  ARG A O     1 
ATOM   1630  C  CB    . ARG A 1 233 ? -19.482 53.943 43.499  1.00 278.53 ? 340  ARG A CB    1 
ATOM   1631  N  N     . GLU A 1 234 ? -21.388 54.868 40.811  1.00 271.22 ? 341  GLU A N     1 
ATOM   1632  C  CA    . GLU A 1 234 ? -22.211 55.905 40.187  1.00 270.13 ? 341  GLU A CA    1 
ATOM   1633  C  C     . GLU A 1 234 ? -23.150 55.326 39.124  1.00 268.06 ? 341  GLU A C     1 
ATOM   1634  O  O     . GLU A 1 234 ? -23.683 56.066 38.293  1.00 265.21 ? 341  GLU A O     1 
ATOM   1635  C  CB    . GLU A 1 234 ? -21.317 56.980 39.564  1.00 266.92 ? 341  GLU A CB    1 
ATOM   1636  N  N     . ILE A 1 235 ? -23.351 54.009 39.154  1.00 270.16 ? 342  ILE A N     1 
ATOM   1637  C  CA    . ILE A 1 235 ? -24.295 53.345 38.256  1.00 269.19 ? 342  ILE A CA    1 
ATOM   1638  C  C     . ILE A 1 235 ? -25.733 53.615 38.690  1.00 273.55 ? 342  ILE A C     1 
ATOM   1639  O  O     . ILE A 1 235 ? -26.636 53.690 37.856  1.00 271.39 ? 342  ILE A O     1 
ATOM   1640  C  CB    . ILE A 1 235 ? -24.068 51.823 38.220  1.00 269.87 ? 342  ILE A CB    1 
ATOM   1641  N  N     . SER A 1 236 ? -25.936 53.759 39.999  1.00 280.40 ? 343  SER A N     1 
ATOM   1642  C  CA    . SER A 1 236 ? -27.243 54.108 40.556  1.00 285.03 ? 343  SER A CA    1 
ATOM   1643  C  C     . SER A 1 236 ? -27.654 55.539 40.204  1.00 283.93 ? 343  SER A C     1 
ATOM   1644  O  O     . SER A 1 236 ? -28.843 55.851 40.168  1.00 285.60 ? 343  SER A O     1 
ATOM   1645  C  CB    . SER A 1 236 ? -27.238 53.933 42.077  1.00 291.37 ? 343  SER A CB    1 
ATOM   1646  N  N     . TYR A 1 237 ? -26.670 56.402 39.953  1.00 281.64 ? 344  TYR A N     1 
ATOM   1647  C  CA    . TYR A 1 237 ? -26.925 57.783 39.541  1.00 279.71 ? 344  TYR A CA    1 
ATOM   1648  C  C     . TYR A 1 237 ? -27.246 57.872 38.048  1.00 273.94 ? 344  TYR A C     1 
ATOM   1649  O  O     . TYR A 1 237 ? -28.158 58.597 37.647  1.00 273.65 ? 344  TYR A O     1 
ATOM   1650  C  CB    . TYR A 1 237 ? -25.717 58.667 39.862  1.00 279.36 ? 344  TYR A CB    1 
ATOM   1651  N  N     . LEU A 1 238 ? -26.489 57.136 37.235  1.00 269.31 ? 345  LEU A N     1 
ATOM   1652  C  CA    . LEU A 1 238 ? -26.682 57.126 35.783  1.00 263.39 ? 345  LEU A CA    1 
ATOM   1653  C  C     . LEU A 1 238 ? -27.972 56.409 35.384  1.00 263.42 ? 345  LEU A C     1 
ATOM   1654  O  O     . LEU A 1 238 ? -28.712 56.886 34.522  1.00 261.01 ? 345  LEU A O     1 
ATOM   1655  C  CB    . LEU A 1 238 ? -25.489 56.461 35.091  1.00 259.64 ? 345  LEU A CB    1 
ATOM   1656  N  N     . LYS A 1 239 ? -28.234 55.266 36.016  1.00 266.10 ? 346  LYS A N     1 
ATOM   1657  C  CA    . LYS A 1 239 ? -29.454 54.494 35.764  1.00 267.00 ? 346  LYS A CA    1 
ATOM   1658  C  C     . LYS A 1 239 ? -30.703 55.151 36.360  1.00 269.75 ? 346  LYS A C     1 
ATOM   1659  O  O     . LYS A 1 239 ? -31.824 54.818 35.971  1.00 270.38 ? 346  LYS A O     1 
ATOM   1660  C  CB    . LYS A 1 239 ? -29.309 53.073 36.314  1.00 270.10 ? 346  LYS A CB    1 
ATOM   1661  N  N     . LYS A 1 240 ? -30.509 56.079 37.297  1.00 271.06 ? 347  LYS A N     1 
ATOM   1662  C  CA    . LYS A 1 240 ? -31.618 56.818 37.908  1.00 273.67 ? 347  LYS A CA    1 
ATOM   1663  C  C     . LYS A 1 240 ? -32.189 57.918 37.007  1.00 269.34 ? 347  LYS A C     1 
ATOM   1664  O  O     . LYS A 1 240 ? -33.152 58.587 37.390  1.00 271.86 ? 347  LYS A O     1 
ATOM   1665  C  CB    . LYS A 1 240 ? -31.177 57.438 39.236  1.00 277.84 ? 347  LYS A CB    1 
ATOM   1666  N  N     . LEU A 1 241 ? -31.612 58.105 35.820  1.00 262.37 ? 348  LEU A N     1 
ATOM   1667  C  CA    . LEU A 1 241 ? -32.073 59.132 34.882  1.00 257.97 ? 348  LEU A CA    1 
ATOM   1668  C  C     . LEU A 1 241 ? -33.303 58.699 34.073  1.00 256.12 ? 348  LEU A C     1 
ATOM   1669  O  O     . LEU A 1 241 ? -33.356 58.908 32.859  1.00 252.01 ? 348  LEU A O     1 
ATOM   1670  C  CB    . LEU A 1 241 ? -30.936 59.520 33.930  1.00 252.68 ? 348  LEU A CB    1 
ATOM   1671  N  N     . LYS A 1 242 ? -34.286 58.105 34.753  1.00 258.71 ? 349  LYS A N     1 
ATOM   1672  C  CA    . LYS A 1 242 ? -35.567 57.731 34.148  1.00 257.77 ? 349  LYS A CA    1 
ATOM   1673  C  C     . LYS A 1 242 ? -35.415 56.893 32.875  1.00 252.23 ? 349  LYS A C     1 
ATOM   1674  O  O     . LYS A 1 242 ? -35.989 57.223 31.835  1.00 249.98 ? 349  LYS A O     1 
ATOM   1675  C  CB    . LYS A 1 242 ? -36.393 58.986 33.854  1.00 257.69 ? 349  LYS A CB    1 
ATOM   1676  N  N     . VAL A 1 243 ? -34.645 55.811 32.970  1.00 249.86 ? 350  VAL A N     1 
ATOM   1677  C  CA    . VAL A 1 243 ? -34.379 54.935 31.829  1.00 244.97 ? 350  VAL A CA    1 
ATOM   1678  C  C     . VAL A 1 243 ? -35.142 53.615 31.949  1.00 246.47 ? 350  VAL A C     1 
ATOM   1679  O  O     . VAL A 1 243 ? -34.844 52.798 32.822  1.00 249.90 ? 350  VAL A O     1 
ATOM   1680  C  CB    . VAL A 1 243 ? -32.876 54.622 31.709  1.00 242.04 ? 350  VAL A CB    1 
ATOM   1681  N  N     . LYS A 1 244 ? -36.125 53.420 31.070  1.00 243.56 ? 351  LYS A N     1 
ATOM   1682  C  CA    . LYS A 1 244 ? -36.912 52.187 31.024  1.00 244.69 ? 351  LYS A CA    1 
ATOM   1683  C  C     . LYS A 1 244 ? -36.560 51.377 29.777  1.00 239.45 ? 351  LYS A C     1 
ATOM   1684  O  O     . LYS A 1 244 ? -35.724 51.796 28.974  1.00 234.35 ? 351  LYS A O     1 
ATOM   1685  C  CB    . LYS A 1 244 ? -38.407 52.514 31.030  1.00 247.71 ? 351  LYS A CB    1 
ATOM   1686  N  N     . LYS A 1 245 ? -37.197 50.217 29.623  1.00 240.18 ? 352  LYS A N     1 
ATOM   1687  C  CA    . LYS A 1 245 ? -36.966 49.357 28.458  1.00 236.22 ? 352  LYS A CA    1 
ATOM   1688  C  C     . LYS A 1 245 ? -37.573 49.962 27.193  1.00 231.27 ? 352  LYS A C     1 
ATOM   1689  O  O     . LYS A 1 245 ? -38.741 50.355 27.181  1.00 233.24 ? 352  LYS A O     1 
ATOM   1690  C  CB    . LYS A 1 245 ? -37.531 47.950 28.689  1.00 241.28 ? 352  LYS A CB    1 
ATOM   1691  C  CG    . LYS A 1 245 ? -36.629 47.055 29.524  1.00 243.35 ? 352  LYS A CG    1 
ATOM   1692  C  CD    . LYS A 1 245 ? -37.114 45.614 29.526  1.00 247.89 ? 352  LYS A CD    1 
ATOM   1693  C  CE    . LYS A 1 245 ? -36.064 44.671 30.094  1.00 249.01 ? 352  LYS A CE    1 
ATOM   1694  N  NZ    . LYS A 1 245 ? -34.914 44.461 29.170  1.00 244.24 ? 352  LYS A NZ    1 
ATOM   1695  N  N     . GLN A 1 246 ? -36.768 50.028 26.135  1.00 224.19 ? 353  GLN A N     1 
ATOM   1696  C  CA    . GLN A 1 246 ? -37.196 50.604 24.860  1.00 219.35 ? 353  GLN A CA    1 
ATOM   1697  C  C     . GLN A 1 246 ? -36.253 50.197 23.729  1.00 213.36 ? 353  GLN A C     1 
ATOM   1698  O  O     . GLN A 1 246 ? -35.082 49.895 23.965  1.00 211.19 ? 353  GLN A O     1 
ATOM   1699  C  CB    . GLN A 1 246 ? -37.268 52.132 24.959  1.00 217.52 ? 353  GLN A CB    1 
ATOM   1700  C  CG    . GLN A 1 246 ? -35.998 52.795 25.475  1.00 214.80 ? 353  GLN A CG    1 
ATOM   1701  C  CD    . GLN A 1 246 ? -36.154 54.296 25.641  1.00 213.38 ? 353  GLN A CD    1 
ATOM   1702  O  OE1   . GLN A 1 246 ? -36.493 55.003 24.693  1.00 211.19 ? 353  GLN A OE1   1 
ATOM   1703  N  NE2   . GLN A 1 246 ? -35.901 54.790 26.849  1.00 214.93 ? 353  GLN A NE2   1 
ATOM   1704  N  N     . ASP A 1 247 ? -36.778 50.195 22.505  1.00 209.95 ? 354  ASP A N     1 
ATOM   1705  C  CA    . ASP A 1 247 ? -36.011 49.815 21.319  1.00 205.19 ? 354  ASP A CA    1 
ATOM   1706  C  C     . ASP A 1 247 ? -35.554 51.064 20.564  1.00 199.02 ? 354  ASP A C     1 
ATOM   1707  O  O     . ASP A 1 247 ? -36.114 52.148 20.741  1.00 198.65 ? 354  ASP A O     1 
ATOM   1708  C  CB    . ASP A 1 247 ? -36.865 48.921 20.410  1.00 207.48 ? 354  ASP A CB    1 
ATOM   1709  C  CG    . ASP A 1 247 ? -36.030 48.033 19.500  1.00 206.17 ? 354  ASP A CG    1 
ATOM   1710  O  OD1   . ASP A 1 247 ? -35.205 48.565 18.728  1.00 202.58 ? 354  ASP A OD1   1 
ATOM   1711  O  OD2   . ASP A 1 247 ? -36.210 46.797 19.549  1.00 209.13 ? 354  ASP A OD2   1 
ATOM   1712  N  N     . ARG A 1 248 ? -34.528 50.902 19.730  1.00 194.04 ? 355  ARG A N     1 
ATOM   1713  C  CA    . ARG A 1 248 ? -34.000 51.988 18.902  1.00 188.66 ? 355  ARG A CA    1 
ATOM   1714  C  C     . ARG A 1 248 ? -35.062 52.519 17.939  1.00 187.70 ? 355  ARG A C     1 
ATOM   1715  O  O     . ARG A 1 248 ? -35.667 51.753 17.187  1.00 188.91 ? 355  ARG A O     1 
ATOM   1716  C  CB    . ARG A 1 248 ? -32.775 51.501 18.115  1.00 185.92 ? 355  ARG A CB    1 
ATOM   1717  C  CG    . ARG A 1 248 ? -32.193 52.500 17.120  1.00 182.07 ? 355  ARG A CG    1 
ATOM   1718  C  CD    . ARG A 1 248 ? -31.320 53.551 17.786  1.00 179.65 ? 355  ARG A CD    1 
ATOM   1719  N  NE    . ARG A 1 248 ? -30.016 53.011 18.172  1.00 178.64 ? 355  ARG A NE    1 
ATOM   1720  C  CZ    . ARG A 1 248 ? -28.959 53.742 18.525  1.00 176.71 ? 355  ARG A CZ    1 
ATOM   1721  N  NH1   . ARG A 1 248 ? -29.019 55.072 18.546  1.00 175.50 ? 355  ARG A NH1   1 
ATOM   1722  N  NH2   . ARG A 1 248 ? -27.823 53.137 18.856  1.00 176.26 ? 355  ARG A NH2   1 
ATOM   1723  N  N     . ILE A 1 249 ? -35.277 53.834 17.975  1.00 185.29 ? 356  ILE A N     1 
ATOM   1724  C  CA    . ILE A 1 249 ? -36.166 54.514 17.037  1.00 184.37 ? 356  ILE A CA    1 
ATOM   1725  C  C     . ILE A 1 249 ? -35.305 55.091 15.917  1.00 180.30 ? 356  ILE A C     1 
ATOM   1726  O  O     . ILE A 1 249 ? -34.206 55.590 16.167  1.00 177.83 ? 356  ILE A O     1 
ATOM   1727  C  CB    . ILE A 1 249 ? -36.962 55.659 17.705  1.00 185.21 ? 356  ILE A CB    1 
ATOM   1728  C  CG1   . ILE A 1 249 ? -37.589 55.197 19.026  1.00 188.77 ? 356  ILE A CG1   1 
ATOM   1729  C  CG2   . ILE A 1 249 ? -38.056 56.164 16.770  1.00 185.81 ? 356  ILE A CG2   1 
ATOM   1730  C  CD1   . ILE A 1 249 ? -38.212 56.317 19.833  1.00 189.91 ? 356  ILE A CD1   1 
ATOM   1731  N  N     . PHE A 1 250 ? -35.811 55.021 14.688  1.00 179.98 ? 357  PHE A N     1 
ATOM   1732  C  CA    . PHE A 1 250 ? -35.058 55.437 13.507  1.00 177.12 ? 357  PHE A CA    1 
ATOM   1733  C  C     . PHE A 1 250 ? -35.740 56.612 12.807  1.00 176.66 ? 357  PHE A C     1 
ATOM   1734  O  O     . PHE A 1 250 ? -36.900 56.911 13.095  1.00 178.52 ? 357  PHE A O     1 
ATOM   1735  C  CB    . PHE A 1 250 ? -34.922 54.256 12.545  1.00 177.71 ? 357  PHE A CB    1 
ATOM   1736  C  CG    . PHE A 1 250 ? -34.243 53.062 13.150  1.00 178.42 ? 357  PHE A CG    1 
ATOM   1737  C  CD1   . PHE A 1 250 ? -34.980 52.079 13.799  1.00 181.70 ? 357  PHE A CD1   1 
ATOM   1738  C  CD2   . PHE A 1 250 ? -32.863 52.924 13.083  1.00 176.24 ? 357  PHE A CD2   1 
ATOM   1739  C  CE1   . PHE A 1 250 ? -34.354 50.980 14.363  1.00 182.71 ? 357  PHE A CE1   1 
ATOM   1740  C  CE2   . PHE A 1 250 ? -32.232 51.827 13.642  1.00 177.23 ? 357  PHE A CE2   1 
ATOM   1741  C  CZ    . PHE A 1 250 ? -32.978 50.853 14.283  1.00 180.45 ? 357  PHE A CZ    1 
ATOM   1742  N  N     . PRO A 1 251 ? -35.020 57.291 11.891  1.00 174.72 ? 358  PRO A N     1 
ATOM   1743  C  CA    . PRO A 1 251 ? -35.642 58.384 11.134  1.00 174.80 ? 358  PRO A CA    1 
ATOM   1744  C  C     . PRO A 1 251 ? -36.734 57.901 10.169  1.00 176.99 ? 358  PRO A C     1 
ATOM   1745  O  O     . PRO A 1 251 ? -36.811 56.703 9.886   1.00 178.53 ? 358  PRO A O     1 
ATOM   1746  C  CB    . PRO A 1 251 ? -34.469 58.991 10.349  1.00 172.26 ? 358  PRO A CB    1 
ATOM   1747  C  CG    . PRO A 1 251 ? -33.238 58.526 11.044  1.00 170.96 ? 358  PRO A CG    1 
ATOM   1748  C  CD    . PRO A 1 251 ? -33.579 57.179 11.602  1.00 172.66 ? 358  PRO A CD    1 
ATOM   1749  N  N     . PRO A 1 252 ? -37.574 58.826 9.664   1.00 177.75 ? 359  PRO A N     1 
ATOM   1750  C  CA    . PRO A 1 252 ? -38.634 58.442 8.726   1.00 180.17 ? 359  PRO A CA    1 
ATOM   1751  C  C     . PRO A 1 252 ? -38.093 57.933 7.389   1.00 179.66 ? 359  PRO A C     1 
ATOM   1752  O  O     . PRO A 1 252 ? -37.193 58.547 6.815   1.00 177.39 ? 359  PRO A O     1 
ATOM   1753  C  CB    . PRO A 1 252 ? -39.426 59.744 8.522   1.00 180.55 ? 359  PRO A CB    1 
ATOM   1754  C  CG    . PRO A 1 252 ? -39.024 60.642 9.641   1.00 179.16 ? 359  PRO A CG    1 
ATOM   1755  C  CD    . PRO A 1 252 ? -37.615 60.266 9.973   1.00 176.87 ? 359  PRO A CD    1 
ATOM   1756  N  N     . ALA B 2 14  ? 12.192  39.940 -10.782 1.00 221.47 ? 531  ALA C N     1 
ATOM   1757  C  CA    . ALA B 2 14  ? 11.975  41.262 -11.449 1.00 219.74 ? 531  ALA C CA    1 
ATOM   1758  C  C     . ALA B 2 14  ? 13.170  42.196 -11.259 1.00 221.01 ? 531  ALA C C     1 
ATOM   1759  O  O     . ALA B 2 14  ? 14.092  41.893 -10.497 1.00 223.17 ? 531  ALA C O     1 
ATOM   1760  C  CB    . ALA B 2 14  ? 10.706  41.918 -10.925 1.00 217.28 ? 531  ALA C CB    1 
ATOM   1761  N  N     . ALA B 2 15  ? 13.137  43.328 -11.959 1.00 219.30 ? 532  ALA C N     1 
ATOM   1762  C  CA    . ALA B 2 15  ? 14.192  44.338 -11.883 1.00 220.12 ? 532  ALA C CA    1 
ATOM   1763  C  C     . ALA B 2 15  ? 13.766  45.493 -10.974 1.00 218.35 ? 532  ALA C C     1 
ATOM   1764  O  O     . ALA B 2 15  ? 12.704  45.441 -10.350 1.00 216.37 ? 532  ALA C O     1 
ATOM   1765  C  CB    . ALA B 2 15  ? 14.528  44.845 -13.279 1.00 220.15 ? 532  ALA C CB    1 
ATOM   1766  N  N     . VAL B 2 16  ? 14.596  46.531 -10.905 1.00 219.05 ? 533  VAL C N     1 
ATOM   1767  C  CA    . VAL B 2 16  ? 14.332  47.683 -10.041 1.00 217.89 ? 533  VAL C CA    1 
ATOM   1768  C  C     . VAL B 2 16  ? 13.248  48.580 -10.641 1.00 214.86 ? 533  VAL C C     1 
ATOM   1769  O  O     . VAL B 2 16  ? 13.218  48.805 -11.852 1.00 214.24 ? 533  VAL C O     1 
ATOM   1770  C  CB    . VAL B 2 16  ? 15.609  48.524 -9.808  1.00 220.45 ? 533  VAL C CB    1 
ATOM   1771  C  CG1   . VAL B 2 16  ? 15.309  49.726 -8.918  1.00 219.93 ? 533  VAL C CG1   1 
ATOM   1772  C  CG2   . VAL B 2 16  ? 16.716  47.668 -9.202  1.00 223.31 ? 533  VAL C CG2   1 
ATOM   1773  N  N     . ASP B 2 17  ? 12.365  49.089 -9.783  1.00 212.75 ? 534  ASP C N     1 
ATOM   1774  C  CA    . ASP B 2 17  ? 11.327  50.030 -10.193 1.00 210.13 ? 534  ASP C CA    1 
ATOM   1775  C  C     . ASP B 2 17  ? 11.964  51.401 -10.439 1.00 210.99 ? 534  ASP C C     1 
ATOM   1776  O  O     . ASP B 2 17  ? 12.604  51.947 -9.539  1.00 211.75 ? 534  ASP C O     1 
ATOM   1777  C  CB    . ASP B 2 17  ? 10.247  50.135 -9.107  1.00 208.28 ? 534  ASP C CB    1 
ATOM   1778  C  CG    . ASP B 2 17  ? 9.037   50.960 -9.540  1.00 205.93 ? 534  ASP C CG    1 
ATOM   1779  O  OD1   . ASP B 2 17  ? 8.267   51.385 -8.654  1.00 204.36 ? 534  ASP C OD1   1 
ATOM   1780  O  OD2   . ASP B 2 17  ? 8.841   51.180 -10.753 1.00 206.12 ? 534  ASP C OD2   1 
ATOM   1781  N  N     . PRO B 2 18  ? 11.798  51.962 -11.656 1.00 210.80 ? 535  PRO C N     1 
ATOM   1782  C  CA    . PRO B 2 18  ? 12.381  53.281 -11.951 1.00 212.36 ? 535  PRO C CA    1 
ATOM   1783  C  C     . PRO B 2 18  ? 11.801  54.460 -11.155 1.00 212.29 ? 535  PRO C C     1 
ATOM   1784  O  O     . PRO B 2 18  ? 12.335  55.567 -11.240 1.00 213.21 ? 535  PRO C O     1 
ATOM   1785  C  CB    . PRO B 2 18  ? 12.103  53.468 -13.451 1.00 211.58 ? 535  PRO C CB    1 
ATOM   1786  C  CG    . PRO B 2 18  ? 11.017  52.507 -13.780 1.00 209.38 ? 535  PRO C CG    1 
ATOM   1787  C  CD    . PRO B 2 18  ? 11.220  51.343 -12.863 1.00 209.59 ? 535  PRO C CD    1 
ATOM   1788  N  N     . ASP B 2 19  ? 10.726  54.231 -10.401 1.00 211.77 ? 536  ASP C N     1 
ATOM   1789  C  CA    . ASP B 2 19  ? 10.157  55.260 -9.525  1.00 212.32 ? 536  ASP C CA    1 
ATOM   1790  C  C     . ASP B 2 19  ? 11.111  55.637 -8.387  1.00 215.54 ? 536  ASP C C     1 
ATOM   1791  O  O     . ASP B 2 19  ? 11.033  56.744 -7.852  1.00 216.11 ? 536  ASP C O     1 
ATOM   1792  C  CB    . ASP B 2 19  ? 8.815   54.797 -8.947  1.00 210.12 ? 536  ASP C CB    1 
ATOM   1793  C  CG    . ASP B 2 19  ? 7.749   54.605 -10.014 1.00 208.45 ? 536  ASP C CG    1 
ATOM   1794  O  OD1   . ASP B 2 19  ? 8.098   54.546 -11.213 1.00 208.90 ? 536  ASP C OD1   1 
ATOM   1795  O  OD2   . ASP B 2 19  ? 6.557   54.507 -9.650  1.00 207.01 ? 536  ASP C OD2   1 
ATOM   1796  N  N     . SER B 2 20  ? 11.996  54.712 -8.018  1.00 218.62 ? 537  SER C N     1 
ATOM   1797  C  CA    . SER B 2 20  ? 13.036  54.980 -7.025  1.00 221.97 ? 537  SER C CA    1 
ATOM   1798  C  C     . SER B 2 20  ? 14.042  56.016 -7.526  1.00 224.95 ? 537  SER C C     1 
ATOM   1799  O  O     . SER B 2 20  ? 14.501  56.865 -6.760  1.00 226.15 ? 537  SER C O     1 
ATOM   1800  C  CB    . SER B 2 20  ? 13.773  53.686 -6.663  1.00 223.57 ? 537  SER C CB    1 
ATOM   1801  O  OG    . SER B 2 20  ? 14.367  53.098 -7.808  1.00 224.50 ? 537  SER C OG    1 
ATOM   1802  N  N     . GLY B 2 21  ? 14.377  55.937 -8.813  1.00 226.76 ? 538  GLY C N     1 
ATOM   1803  C  CA    . GLY B 2 21  ? 15.388  56.805 -9.414  1.00 229.95 ? 538  GLY C CA    1 
ATOM   1804  C  C     . GLY B 2 21  ? 16.791  56.224 -9.336  1.00 233.57 ? 538  GLY C C     1 
ATOM   1805  O  O     . GLY B 2 21  ? 17.745  56.839 -9.815  1.00 235.77 ? 538  GLY C O     1 
ATOM   1806  N  N     . LEU B 2 22  ? 16.913  55.039 -8.736  1.00 234.53 ? 539  LEU C N     1 
ATOM   1807  C  CA    . LEU B 2 22  ? 18.198  54.363 -8.573  1.00 238.05 ? 539  LEU C CA    1 
ATOM   1808  C  C     . LEU B 2 22  ? 18.195  53.023 -9.318  1.00 238.66 ? 539  LEU C C     1 
ATOM   1809  O  O     . LEU B 2 22  ? 18.792  52.049 -8.855  1.00 240.64 ? 539  LEU C O     1 
ATOM   1810  C  CB    . LEU B 2 22  ? 18.484  54.125 -7.084  1.00 238.98 ? 539  LEU C CB    1 
ATOM   1811  C  CG    . LEU B 2 22  ? 18.177  55.242 -6.080  1.00 238.41 ? 539  LEU C CG    1 
ATOM   1812  C  CD1   . LEU B 2 22  ? 18.546  54.781 -4.676  1.00 239.70 ? 539  LEU C CD1   1 
ATOM   1813  C  CD2   . LEU B 2 22  ? 18.899  56.535 -6.429  1.00 240.19 ? 539  LEU C CD2   1 
ATOM   1814  N  N     . GLU B 2 23  ? 17.533  52.980 -10.475 1.00 237.68 ? 540  GLU C N     1 
ATOM   1815  C  CA    . GLU B 2 23  ? 17.336  51.720 -11.208 1.00 237.86 ? 540  GLU C CA    1 
ATOM   1816  C  C     . GLU B 2 23  ? 18.626  51.157 -11.812 1.00 241.24 ? 540  GLU C C     1 
ATOM   1817  O  O     . GLU B 2 23  ? 18.909  49.966 -11.668 1.00 241.86 ? 540  GLU C O     1 
ATOM   1818  C  CB    . GLU B 2 23  ? 16.249  51.851 -12.290 1.00 235.48 ? 540  GLU C CB    1 
ATOM   1819  C  CG    . GLU B 2 23  ? 16.351  53.077 -13.193 1.00 235.88 ? 540  GLU C CG    1 
ATOM   1820  C  CD    . GLU B 2 23  ? 15.607  52.921 -14.510 1.00 234.35 ? 540  GLU C CD    1 
ATOM   1821  O  OE1   . GLU B 2 23  ? 14.996  51.857 -14.747 1.00 232.92 ? 540  GLU C OE1   1 
ATOM   1822  O  OE2   . GLU B 2 23  ? 15.636  53.873 -15.318 1.00 234.81 ? 540  GLU C OE2   1 
ATOM   1823  N  N     . HIS B 2 24  ? 19.399  52.010 -12.479 1.00 243.62 ? 541  HIS C N     1 
ATOM   1824  C  CA    . HIS B 2 24  ? 20.683  51.611 -13.056 1.00 247.12 ? 541  HIS C CA    1 
ATOM   1825  C  C     . HIS B 2 24  ? 21.809  52.141 -12.172 1.00 250.51 ? 541  HIS C C     1 
ATOM   1826  O  O     . HIS B 2 24  ? 22.601  52.994 -12.582 1.00 252.26 ? 541  HIS C O     1 
ATOM   1827  C  CB    . HIS B 2 24  ? 20.813  52.114 -14.498 1.00 247.38 ? 541  HIS C CB    1 
ATOM   1828  C  CG    . HIS B 2 24  ? 19.995  51.336 -15.483 1.00 245.38 ? 541  HIS C CG    1 
ATOM   1829  N  ND1   . HIS B 2 24  ? 18.661  51.592 -15.710 1.00 242.40 ? 541  HIS C ND1   1 
ATOM   1830  C  CD2   . HIS B 2 24  ? 20.325  50.307 -16.299 1.00 246.07 ? 541  HIS C CD2   1 
ATOM   1831  C  CE1   . HIS B 2 24  ? 18.203  50.755 -16.624 1.00 241.29 ? 541  HIS C CE1   1 
ATOM   1832  N  NE2   . HIS B 2 24  ? 19.192  49.964 -16.997 1.00 243.41 ? 541  HIS C NE2   1 
ATOM   1833  N  N     . SER B 2 25  ? 21.856  51.627 -10.946 1.00 251.61 ? 542  SER C N     1 
ATOM   1834  C  CA    . SER B 2 25  ? 22.854  52.029 -9.957  1.00 255.40 ? 542  SER C CA    1 
ATOM   1835  C  C     . SER B 2 25  ? 23.140  50.884 -8.983  1.00 257.26 ? 542  SER C C     1 
ATOM   1836  O  O     . SER B 2 25  ? 24.278  50.422 -8.880  1.00 261.09 ? 542  SER C O     1 
ATOM   1837  C  CB    . SER B 2 25  ? 22.377  53.269 -9.195  1.00 254.40 ? 542  SER C CB    1 
ATOM   1838  O  OG    . SER B 2 25  ? 23.331  53.680 -8.230  1.00 257.41 ? 542  SER C OG    1 
ATOM   1839  N  N     . ALA B 2 26  ? 22.102  50.438 -8.276  1.00 255.08 ? 543  ALA C N     1 
ATOM   1840  C  CA    . ALA B 2 26  ? 22.209  49.323 -7.336  1.00 256.15 ? 543  ALA C CA    1 
ATOM   1841  C  C     . ALA B 2 26  ? 21.185  48.240 -7.676  1.00 253.77 ? 543  ALA C C     1 
ATOM   1842  O  O     . ALA B 2 26  ? 20.032  48.540 -7.990  1.00 250.59 ? 543  ALA C O     1 
ATOM   1843  C  CB    . ALA B 2 26  ? 22.010  49.812 -5.911  1.00 256.08 ? 543  ALA C CB    1 
ATOM   1844  N  N     . HIS B 2 27  ? 21.620  46.984 -7.607  1.00 255.66 ? 544  HIS C N     1 
ATOM   1845  C  CA    . HIS B 2 27  ? 20.778  45.838 -7.961  1.00 253.80 ? 544  HIS C CA    1 
ATOM   1846  C  C     . HIS B 2 27  ? 19.761  45.507 -6.867  1.00 251.27 ? 544  HIS C C     1 
ATOM   1847  O  O     . HIS B 2 27  ? 19.987  45.794 -5.690  1.00 252.01 ? 544  HIS C O     1 
ATOM   1848  C  CB    . HIS B 2 27  ? 21.652  44.607 -8.253  1.00 256.99 ? 544  HIS C CB    1 
ATOM   1849  C  CG    . HIS B 2 27  ? 22.193  43.934 -7.026  1.00 260.03 ? 544  HIS C CG    1 
ATOM   1850  N  ND1   . HIS B 2 27  ? 23.165  44.500 -6.228  1.00 262.98 ? 544  HIS C ND1   1 
ATOM   1851  C  CD2   . HIS B 2 27  ? 21.900  42.736 -6.466  1.00 260.65 ? 544  HIS C CD2   1 
ATOM   1852  C  CE1   . HIS B 2 27  ? 23.443  43.683 -5.228  1.00 264.92 ? 544  HIS C CE1   1 
ATOM   1853  N  NE2   . HIS B 2 27  ? 22.690  42.605 -5.350  1.00 263.58 ? 544  HIS C NE2   1 
ATOM   1854  N  N     . VAL B 2 28  ? 18.640  44.911 -7.271  1.00 248.02 ? 545  VAL C N     1 
ATOM   1855  C  CA    . VAL B 2 28  ? 17.646  44.398 -6.320  1.00 246.25 ? 545  VAL C CA    1 
ATOM   1856  C  C     . VAL B 2 28  ? 18.185  43.124 -5.661  1.00 248.15 ? 545  VAL C C     1 
ATOM   1857  O  O     . VAL B 2 28  ? 18.730  42.251 -6.338  1.00 249.88 ? 545  VAL C O     1 
ATOM   1858  C  CB    . VAL B 2 28  ? 16.262  44.150 -6.980  1.00 242.87 ? 545  VAL C CB    1 
ATOM   1859  C  CG1   . VAL B 2 28  ? 16.343  43.157 -8.137  1.00 242.73 ? 545  VAL C CG1   1 
ATOM   1860  C  CG2   . VAL B 2 28  ? 15.249  43.679 -5.944  1.00 241.58 ? 545  VAL C CG2   1 
ATOM   1861  N  N     . LEU B 2 29  ? 18.026  43.028 -4.343  1.00 247.83 ? 546  LEU C N     1 
ATOM   1862  C  CA    . LEU B 2 29  ? 18.688  41.988 -3.552  1.00 250.06 ? 546  LEU C CA    1 
ATOM   1863  C  C     . LEU B 2 29  ? 17.828  40.738 -3.369  1.00 248.59 ? 546  LEU C C     1 
ATOM   1864  O  O     . LEU B 2 29  ? 16.598  40.806 -3.395  1.00 245.18 ? 546  LEU C O     1 
ATOM   1865  C  CB    . LEU B 2 29  ? 19.092  42.555 -2.186  1.00 251.73 ? 546  LEU C CB    1 
ATOM   1866  C  CG    . LEU B 2 29  ? 20.008  41.688 -1.311  1.00 255.59 ? 546  LEU C CG    1 
ATOM   1867  C  CD1   . LEU B 2 29  ? 21.090  42.533 -0.654  1.00 258.19 ? 546  LEU C CD1   1 
ATOM   1868  C  CD2   . LEU B 2 29  ? 19.220  40.918 -0.259  1.00 255.23 ? 546  LEU C CD2   1 
ATOM   1869  N  N     . GLU B 2 30  ? 18.498  39.599 -3.195  1.00 250.89 ? 547  GLU C N     1 
ATOM   1870  C  CA    . GLU B 2 30  ? 17.845  38.325 -2.893  1.00 250.57 ? 547  GLU C CA    1 
ATOM   1871  C  C     . GLU B 2 30  ? 18.711  37.501 -1.936  1.00 253.88 ? 547  GLU C C     1 
ATOM   1872  O  O     . GLU B 2 30  ? 19.931  37.436 -2.100  1.00 256.96 ? 547  GLU C O     1 
ATOM   1873  C  CB    . GLU B 2 30  ? 17.581  37.538 -4.183  1.00 249.66 ? 547  GLU C CB    1 
ATOM   1874  C  CG    . GLU B 2 30  ? 18.828  37.193 -4.989  1.00 252.44 ? 547  GLU C CG    1 
ATOM   1875  C  CD    . GLU B 2 30  ? 18.508  36.591 -6.345  1.00 251.40 ? 547  GLU C CD    1 
ATOM   1876  O  OE1   . GLU B 2 30  ? 19.222  36.910 -7.319  1.00 252.20 ? 547  GLU C OE1   1 
ATOM   1877  O  OE2   . GLU B 2 30  ? 17.547  35.798 -6.440  1.00 249.98 ? 547  GLU C OE2   1 
ATOM   1878  N  N     . LYS B 2 31  ? 18.081  36.885 -0.937  1.00 253.38 ? 548  LYS C N     1 
ATOM   1879  C  CA    . LYS B 2 31  ? 18.787  36.020 0.011   1.00 256.47 ? 548  LYS C CA    1 
ATOM   1880  C  C     . LYS B 2 31  ? 18.723  34.572 -0.472  1.00 256.77 ? 548  LYS C C     1 
ATOM   1881  O  O     . LYS B 2 31  ? 17.822  33.818 -0.098  1.00 256.15 ? 548  LYS C O     1 
ATOM   1882  C  CB    . LYS B 2 31  ? 18.187  36.152 1.418   1.00 256.52 ? 548  LYS C CB    1 
ATOM   1883  C  CG    . LYS B 2 31  ? 18.856  35.315 2.505   1.00 260.67 ? 548  LYS C CG    1 
ATOM   1884  C  CD    . LYS B 2 31  ? 20.321  35.670 2.703   1.00 264.29 ? 548  LYS C CD    1 
ATOM   1885  C  CE    . LYS B 2 31  ? 20.935  34.858 3.832   1.00 268.46 ? 548  LYS C CE    1 
ATOM   1886  N  NZ    . LYS B 2 31  ? 22.402  35.080 3.951   1.00 272.39 ? 548  LYS C NZ    1 
ATOM   1887  N  N     . GLY B 2 32  ? 19.681  34.197 -1.315  1.00 257.56 ? 549  GLY C N     1 
ATOM   1888  C  CA    . GLY B 2 32  ? 19.757  32.840 -1.850  1.00 258.00 ? 549  GLY C CA    1 
ATOM   1889  C  C     . GLY B 2 32  ? 18.670  32.547 -2.867  1.00 253.75 ? 549  GLY C C     1 
ATOM   1890  O  O     . GLY B 2 32  ? 18.912  32.591 -4.074  1.00 252.94 ? 549  GLY C O     1 
ATOM   1891  N  N     . GLY B 2 33  ? 17.469  32.250 -2.371  1.00 250.52 ? 550  GLY C N     1 
ATOM   1892  C  CA    . GLY B 2 33  ? 16.333  31.885 -3.219  1.00 246.30 ? 550  GLY C CA    1 
ATOM   1893  C  C     . GLY B 2 33  ? 15.269  32.963 -3.298  1.00 241.21 ? 550  GLY C C     1 
ATOM   1894  O  O     . GLY B 2 33  ? 14.991  33.491 -4.378  1.00 238.97 ? 550  GLY C O     1 
ATOM   1895  N  N     . LYS B 2 34  ? 14.671  33.285 -2.152  1.00 239.06 ? 551  LYS C N     1 
ATOM   1896  C  CA    . LYS B 2 34  ? 13.579  34.261 -2.090  1.00 234.42 ? 551  LYS C CA    1 
ATOM   1897  C  C     . LYS B 2 34  ? 14.059  35.672 -2.436  1.00 231.46 ? 551  LYS C C     1 
ATOM   1898  O  O     . LYS B 2 34  ? 14.906  36.234 -1.741  1.00 233.17 ? 551  LYS C O     1 
ATOM   1899  C  CB    . LYS B 2 34  ? 12.933  34.260 -0.699  1.00 234.95 ? 551  LYS C CB    1 
ATOM   1900  C  CG    . LYS B 2 34  ? 12.147  32.998 -0.370  1.00 235.81 ? 551  LYS C CG    1 
ATOM   1901  C  CD    . LYS B 2 34  ? 10.771  32.992 -1.022  1.00 232.90 ? 551  LYS C CD    1 
ATOM   1902  C  CE    . LYS B 2 34  ? 9.758   33.786 -0.211  1.00 230.88 ? 551  LYS C CE    1 
ATOM   1903  N  NZ    . LYS B 2 34  ? 8.466   33.952 -0.931  1.00 227.98 ? 551  LYS C NZ    1 
ATOM   1904  N  N     . VAL B 2 35  ? 13.507  36.235 -3.510  1.00 226.41 ? 552  VAL C N     1 
ATOM   1905  C  CA    . VAL B 2 35  ? 13.868  37.579 -3.962  1.00 223.58 ? 552  VAL C CA    1 
ATOM   1906  C  C     . VAL B 2 35  ? 13.122  38.615 -3.129  1.00 220.15 ? 552  VAL C C     1 
ATOM   1907  O  O     . VAL B 2 35  ? 11.893  38.588 -3.066  1.00 218.28 ? 552  VAL C O     1 
ATOM   1908  C  CB    . VAL B 2 35  ? 13.523  37.796 -5.453  1.00 221.34 ? 552  VAL C CB    1 
ATOM   1909  C  CG1   . VAL B 2 35  ? 13.937  39.193 -5.908  1.00 220.29 ? 552  VAL C CG1   1 
ATOM   1910  C  CG2   . VAL B 2 35  ? 14.187  36.732 -6.318  1.00 223.18 ? 552  VAL C CG2   1 
ATOM   1911  N  N     . PHE B 2 36  ? 13.863  39.529 -2.506  1.00 219.09 ? 553  PHE C N     1 
ATOM   1912  C  CA    . PHE B 2 36  ? 13.264  40.569 -1.664  1.00 215.98 ? 553  PHE C CA    1 
ATOM   1913  C  C     . PHE B 2 36  ? 12.579  41.633 -2.525  1.00 210.60 ? 553  PHE C C     1 
ATOM   1914  O  O     . PHE B 2 36  ? 13.097  42.736 -2.716  1.00 210.49 ? 553  PHE C O     1 
ATOM   1915  C  CB    . PHE B 2 36  ? 14.311  41.198 -0.732  1.00 218.96 ? 553  PHE C CB    1 
ATOM   1916  C  CG    . PHE B 2 36  ? 14.605  40.374 0.494   1.00 222.24 ? 553  PHE C CG    1 
ATOM   1917  C  CD1   . PHE B 2 36  ? 14.331  40.869 1.764   1.00 222.62 ? 553  PHE C CD1   1 
ATOM   1918  C  CD2   . PHE B 2 36  ? 15.146  39.100 0.381   1.00 224.85 ? 553  PHE C CD2   1 
ATOM   1919  C  CE1   . PHE B 2 36  ? 14.598  40.114 2.894   1.00 225.11 ? 553  PHE C CE1   1 
ATOM   1920  C  CE2   . PHE B 2 36  ? 15.413  38.341 1.508   1.00 227.46 ? 553  PHE C CE2   1 
ATOM   1921  C  CZ    . PHE B 2 36  ? 15.139  38.847 2.766   1.00 227.61 ? 553  PHE C CZ    1 
ATOM   1922  N  N     . SER B 2 37  ? 11.405  41.275 -3.041  1.00 205.26 ? 554  SER C N     1 
ATOM   1923  C  CA    . SER B 2 37  ? 10.608  42.148 -3.899  1.00 199.60 ? 554  SER C CA    1 
ATOM   1924  C  C     . SER B 2 37  ? 9.231   41.524 -4.114  1.00 195.14 ? 554  SER C C     1 
ATOM   1925  O  O     . SER B 2 37  ? 9.130   40.392 -4.595  1.00 194.88 ? 554  SER C O     1 
ATOM   1926  C  CB    . SER B 2 37  ? 11.296  42.357 -5.250  1.00 199.58 ? 554  SER C CB    1 
ATOM   1927  O  OG    . SER B 2 37  ? 10.448  43.041 -6.159  1.00 196.65 ? 554  SER C OG    1 
ATOM   1928  N  N     . ALA B 2 38  ? 8.182   42.262 -3.755  1.00 190.48 ? 555  ALA C N     1 
ATOM   1929  C  CA    . ALA B 2 38  ? 6.810   41.773 -3.876  1.00 186.49 ? 555  ALA C CA    1 
ATOM   1930  C  C     . ALA B 2 38  ? 5.865   42.885 -4.332  1.00 181.74 ? 555  ALA C C     1 
ATOM   1931  O  O     . ALA B 2 38  ? 5.990   44.029 -3.895  1.00 180.89 ? 555  ALA C O     1 
ATOM   1932  C  CB    . ALA B 2 38  ? 6.346   41.198 -2.547  1.00 187.20 ? 555  ALA C CB    1 
ATOM   1933  N  N     . THR B 2 39  ? 4.926   42.537 -5.211  1.00 177.74 ? 556  THR C N     1 
ATOM   1934  C  CA    . THR B 2 39  ? 3.927   43.481 -5.719  1.00 173.42 ? 556  THR C CA    1 
ATOM   1935  C  C     . THR B 2 39  ? 2.543   43.043 -5.247  1.00 170.13 ? 556  THR C C     1 
ATOM   1936  O  O     . THR B 2 39  ? 1.989   42.063 -5.750  1.00 170.26 ? 556  THR C O     1 
ATOM   1937  C  CB    . THR B 2 39  ? 3.955   43.570 -7.261  1.00 172.78 ? 556  THR C CB    1 
ATOM   1938  O  OG1   . THR B 2 39  ? 5.309   43.675 -7.712  1.00 174.35 ? 556  THR C OG1   1 
ATOM   1939  C  CG2   . THR B 2 39  ? 3.163   44.780 -7.752  1.00 170.92 ? 556  THR C CG2   1 
ATOM   1940  N  N     . LEU B 2 40  ? 1.993   43.776 -4.281  1.00 166.55 ? 557  LEU C N     1 
ATOM   1941  C  CA    . LEU B 2 40  ? 0.725   43.411 -3.653  1.00 163.80 ? 557  LEU C CA    1 
ATOM   1942  C  C     . LEU B 2 40  ? -0.454  44.114 -4.322  1.00 159.74 ? 557  LEU C C     1 
ATOM   1943  O  O     . LEU B 2 40  ? -0.275  45.067 -5.084  1.00 158.46 ? 557  LEU C O     1 
ATOM   1944  C  CB    . LEU B 2 40  ? 0.748   43.744 -2.157  1.00 164.48 ? 557  LEU C CB    1 
ATOM   1945  C  CG    . LEU B 2 40  ? 2.028   43.445 -1.369  1.00 166.62 ? 557  LEU C CG    1 
ATOM   1946  C  CD1   . LEU B 2 40  ? 1.828   43.764 0.105   1.00 166.94 ? 557  LEU C CD1   1 
ATOM   1947  C  CD2   . LEU B 2 40  ? 2.463   41.999 -1.544  1.00 168.39 ? 557  LEU C CD2   1 
ATOM   1948  N  N     . GLY B 2 41  ? -1.658  43.632 -4.027  1.00 157.06 ? 558  GLY C N     1 
ATOM   1949  C  CA    . GLY B 2 41  ? -2.887  44.206 -4.573  1.00 154.11 ? 558  GLY C CA    1 
ATOM   1950  C  C     . GLY B 2 41  ? -4.077  43.991 -3.655  1.00 152.67 ? 558  GLY C C     1 
ATOM   1951  O  O     . GLY B 2 41  ? -4.137  42.999 -2.928  1.00 153.79 ? 558  GLY C O     1 
ATOM   1952  N  N     . LEU B 2 42  ? -5.021  44.928 -3.692  1.00 150.02 ? 559  LEU C N     1 
ATOM   1953  C  CA    . LEU B 2 42  ? -6.216  44.873 -2.851  1.00 148.83 ? 559  LEU C CA    1 
ATOM   1954  C  C     . LEU B 2 42  ? -7.372  45.581 -3.545  1.00 146.93 ? 559  LEU C C     1 
ATOM   1955  O  O     . LEU B 2 42  ? -7.237  46.730 -3.970  1.00 146.07 ? 559  LEU C O     1 
ATOM   1956  C  CB    . LEU B 2 42  ? -5.932  45.517 -1.488  1.00 149.08 ? 559  LEU C CB    1 
ATOM   1957  C  CG    . LEU B 2 42  ? -7.105  45.849 -0.553  1.00 148.72 ? 559  LEU C CG    1 
ATOM   1958  C  CD1   . LEU B 2 42  ? -8.060  44.675 -0.395  1.00 149.48 ? 559  LEU C CD1   1 
ATOM   1959  C  CD2   . LEU B 2 42  ? -6.577  46.297 0.802   1.00 149.25 ? 559  LEU C CD2   1 
ATOM   1960  N  N     . VAL B 2 43  ? -8.502  44.887 -3.661  1.00 146.54 ? 560  VAL C N     1 
ATOM   1961  C  CA    . VAL B 2 43  ? -9.707  45.455 -4.263  1.00 145.43 ? 560  VAL C CA    1 
ATOM   1962  C  C     . VAL B 2 43  ? -10.949 45.094 -3.446  1.00 145.69 ? 560  VAL C C     1 
ATOM   1963  O  O     . VAL B 2 43  ? -11.099 43.958 -2.990  1.00 146.58 ? 560  VAL C O     1 
ATOM   1964  C  CB    . VAL B 2 43  ? -9.878  45.009 -5.739  1.00 145.13 ? 560  VAL C CB    1 
ATOM   1965  C  CG1   . VAL B 2 43  ? -9.675  43.509 -5.895  1.00 146.07 ? 560  VAL C CG1   1 
ATOM   1966  C  CG2   . VAL B 2 43  ? -11.236 45.429 -6.291  1.00 144.62 ? 560  VAL C CG2   1 
ATOM   1967  N  N     . ASP B 2 44  ? -11.819 46.083 -3.255  1.00 145.16 ? 561  ASP C N     1 
ATOM   1968  C  CA    . ASP B 2 44  ? -13.131 45.879 -2.652  1.00 145.87 ? 561  ASP C CA    1 
ATOM   1969  C  C     . ASP B 2 44  ? -14.156 46.551 -3.557  1.00 145.03 ? 561  ASP C C     1 
ATOM   1970  O  O     . ASP B 2 44  ? -14.222 47.780 -3.630  1.00 143.98 ? 561  ASP C O     1 
ATOM   1971  C  CB    . ASP B 2 44  ? -13.182 46.471 -1.239  1.00 146.50 ? 561  ASP C CB    1 
ATOM   1972  C  CG    . ASP B 2 44  ? -14.404 46.019 -0.449  1.00 147.58 ? 561  ASP C CG    1 
ATOM   1973  O  OD1   . ASP B 2 44  ? -15.427 45.647 -1.061  1.00 147.88 ? 561  ASP C OD1   1 
ATOM   1974  O  OD2   . ASP B 2 44  ? -14.340 46.043 0.798   1.00 148.31 ? 561  ASP C OD2   1 
ATOM   1975  N  N     . ILE B 2 45  ? -14.942 45.735 -4.255  1.00 145.61 ? 562  ILE C N     1 
ATOM   1976  C  CA    . ILE B 2 45  ? -15.921 46.234 -5.222  1.00 145.55 ? 562  ILE C CA    1 
ATOM   1977  C  C     . ILE B 2 45  ? -16.951 47.178 -4.592  1.00 145.82 ? 562  ILE C C     1 
ATOM   1978  O  O     . ILE B 2 45  ? -17.388 48.134 -5.235  1.00 145.78 ? 562  ILE C O     1 
ATOM   1979  C  CB    . ILE B 2 45  ? -16.627 45.061 -5.949  1.00 146.19 ? 562  ILE C CB    1 
ATOM   1980  C  CG1   . ILE B 2 45  ? -15.639 44.396 -6.918  1.00 146.06 ? 562  ILE C CG1   1 
ATOM   1981  C  CG2   . ILE B 2 45  ? -17.887 45.534 -6.669  1.00 146.17 ? 562  ILE C CG2   1 
ATOM   1982  C  CD1   . ILE B 2 45  ? -16.259 43.478 -7.949  1.00 146.65 ? 562  ILE C CD1   1 
ATOM   1983  N  N     . VAL B 2 46  ? -17.319 46.921 -3.339  1.00 146.61 ? 563  VAL C N     1 
ATOM   1984  C  CA    . VAL B 2 46  ? -18.335 47.723 -2.653  1.00 146.77 ? 563  VAL C CA    1 
ATOM   1985  C  C     . VAL B 2 46  ? -17.803 49.124 -2.342  1.00 145.88 ? 563  VAL C C     1 
ATOM   1986  O  O     . VAL B 2 46  ? -18.450 50.124 -2.660  1.00 145.45 ? 563  VAL C O     1 
ATOM   1987  C  CB    . VAL B 2 46  ? -18.818 47.051 -1.348  1.00 147.79 ? 563  VAL C CB    1 
ATOM   1988  C  CG1   . VAL B 2 46  ? -19.958 47.849 -0.726  1.00 148.07 ? 563  VAL C CG1   1 
ATOM   1989  C  CG2   . VAL B 2 46  ? -19.252 45.612 -1.614  1.00 148.95 ? 563  VAL C CG2   1 
ATOM   1990  N  N     . LYS B 2 47  ? -16.629 49.186 -1.720  1.00 145.73 ? 564  LYS C N     1 
ATOM   1991  C  CA    . LYS B 2 47  ? -15.967 50.465 -1.435  1.00 145.13 ? 564  LYS C CA    1 
ATOM   1992  C  C     . LYS B 2 47  ? -15.491 51.165 -2.708  1.00 144.31 ? 564  LYS C C     1 
ATOM   1993  O  O     . LYS B 2 47  ? -15.479 52.396 -2.776  1.00 144.00 ? 564  LYS C O     1 
ATOM   1994  C  CB    . LYS B 2 47  ? -14.779 50.273 -0.481  1.00 145.67 ? 564  LYS C CB    1 
ATOM   1995  C  CG    . LYS B 2 47  ? -15.076 50.664 0.960   1.00 146.37 ? 564  LYS C CG    1 
ATOM   1996  C  CD    . LYS B 2 47  ? -14.010 50.164 1.925   1.00 147.34 ? 564  LYS C CD    1 
ATOM   1997  C  CE    . LYS B 2 47  ? -12.631 50.732 1.615   1.00 147.13 ? 564  LYS C CE    1 
ATOM   1998  N  NZ    . LYS B 2 47  ? -11.644 50.418 2.685   1.00 147.87 ? 564  LYS C NZ    1 
ATOM   1999  N  N     . GLY B 2 48  ? -15.095 50.376 -3.705  1.00 144.07 ? 565  GLY C N     1 
ATOM   2000  C  CA    . GLY B 2 48  ? -14.560 50.909 -4.955  1.00 143.37 ? 565  GLY C CA    1 
ATOM   2001  C  C     . GLY B 2 48  ? -13.042 50.922 -4.995  1.00 142.93 ? 565  GLY C C     1 
ATOM   2002  O  O     . GLY B 2 48  ? -12.449 51.080 -6.063  1.00 143.12 ? 565  GLY C O     1 
ATOM   2003  N  N     . THR B 2 49  ? -12.411 50.769 -3.832  1.00 142.45 ? 566  THR C N     1 
ATOM   2004  C  CA    . THR B 2 49  ? -10.950 50.705 -3.742  1.00 142.12 ? 566  THR C CA    1 
ATOM   2005  C  C     . THR B 2 49  ? -10.379 49.599 -4.636  1.00 141.90 ? 566  THR C C     1 
ATOM   2006  O  O     . THR B 2 49  ? -10.923 48.498 -4.709  1.00 141.87 ? 566  THR C O     1 
ATOM   2007  C  CB    . THR B 2 49  ? -10.458 50.523 -2.283  1.00 142.67 ? 566  THR C CB    1 
ATOM   2008  O  OG1   . THR B 2 49  ? -9.026  50.445 -2.261  1.00 143.25 ? 566  THR C OG1   1 
ATOM   2009  C  CG2   . THR B 2 49  ? -11.041 49.266 -1.636  1.00 143.31 ? 566  THR C CG2   1 
ATOM   2010  N  N     . ASN B 2 50  ? -9.289  49.929 -5.322  1.00 141.64 ? 567  ASN C N     1 
ATOM   2011  C  CA    . ASN B 2 50  ? -8.627  49.036 -6.266  1.00 142.01 ? 567  ASN C CA    1 
ATOM   2012  C  C     . ASN B 2 50  ? -7.171  49.487 -6.353  1.00 142.50 ? 567  ASN C C     1 
ATOM   2013  O  O     . ASN B 2 50  ? -6.808  50.292 -7.211  1.00 142.26 ? 567  ASN C O     1 
ATOM   2014  C  CB    . ASN B 2 50  ? -9.332  49.106 -7.628  1.00 141.47 ? 567  ASN C CB    1 
ATOM   2015  C  CG    . ASN B 2 50  ? -8.556  48.415 -8.737  1.00 141.75 ? 567  ASN C CG    1 
ATOM   2016  O  OD1   . ASN B 2 50  ? -8.009  47.327 -8.549  1.00 142.52 ? 567  ASN C OD1   1 
ATOM   2017  N  ND2   . ASN B 2 50  ? -8.512  49.045 -9.908  1.00 141.32 ? 567  ASN C ND2   1 
ATOM   2018  N  N     . SER B 2 51  ? -6.349  48.974 -5.441  1.00 143.61 ? 568  SER C N     1 
ATOM   2019  C  CA    . SER B 2 51  ? -5.034  49.552 -5.167  1.00 144.52 ? 568  SER C CA    1 
ATOM   2020  C  C     . SER B 2 51  ? -3.881  48.586 -5.428  1.00 146.24 ? 568  SER C C     1 
ATOM   2021  O  O     . SER B 2 51  ? -4.081  47.375 -5.541  1.00 146.81 ? 568  SER C O     1 
ATOM   2022  C  CB    . SER B 2 51  ? -4.974  50.015 -3.708  1.00 144.64 ? 568  SER C CB    1 
ATOM   2023  O  OG    . SER B 2 51  ? -6.228  50.515 -3.272  1.00 143.61 ? 568  SER C OG    1 
ATOM   2024  N  N     . TYR B 2 52  ? -2.676  49.146 -5.520  1.00 147.73 ? 569  TYR C N     1 
ATOM   2025  C  CA    . TYR B 2 52  ? -1.442  48.365 -5.611  1.00 149.82 ? 569  TYR C CA    1 
ATOM   2026  C  C     . TYR B 2 52  ? -0.514  48.723 -4.459  1.00 152.21 ? 569  TYR C C     1 
ATOM   2027  O  O     . TYR B 2 52  ? -0.714  49.729 -3.778  1.00 151.80 ? 569  TYR C O     1 
ATOM   2028  C  CB    . TYR B 2 52  ? -0.727  48.610 -6.946  1.00 149.59 ? 569  TYR C CB    1 
ATOM   2029  C  CG    . TYR B 2 52  ? -0.229  50.028 -7.154  1.00 149.06 ? 569  TYR C CG    1 
ATOM   2030  C  CD1   . TYR B 2 52  ? 1.025   50.428 -6.692  1.00 150.21 ? 569  TYR C CD1   1 
ATOM   2031  C  CD2   . TYR B 2 52  ? -1.008  50.964 -7.825  1.00 147.87 ? 569  TYR C CD2   1 
ATOM   2032  C  CE1   . TYR B 2 52  ? 1.480   51.722 -6.888  1.00 150.32 ? 569  TYR C CE1   1 
ATOM   2033  C  CE2   . TYR B 2 52  ? -0.563  52.260 -8.028  1.00 147.84 ? 569  TYR C CE2   1 
ATOM   2034  C  CZ    . TYR B 2 52  ? 0.680   52.635 -7.557  1.00 149.10 ? 569  TYR C CZ    1 
ATOM   2035  O  OH    . TYR B 2 52  ? 1.124   53.921 -7.757  1.00 149.36 ? 569  TYR C OH    1 
ATOM   2036  N  N     . TYR B 2 53  ? 0.502   47.890 -4.250  1.00 155.56 ? 570  TYR C N     1 
ATOM   2037  C  CA    . TYR B 2 53  ? 1.535   48.165 -3.257  1.00 158.48 ? 570  TYR C CA    1 
ATOM   2038  C  C     . TYR B 2 53  ? 2.800   47.367 -3.567  1.00 161.83 ? 570  TYR C C     1 
ATOM   2039  O  O     . TYR B 2 53  ? 2.902   46.190 -3.215  1.00 163.02 ? 570  TYR C O     1 
ATOM   2040  C  CB    . TYR B 2 53  ? 1.032   47.845 -1.845  1.00 158.82 ? 570  TYR C CB    1 
ATOM   2041  C  CG    . TYR B 2 53  ? 1.978   48.289 -0.753  1.00 160.22 ? 570  TYR C CG    1 
ATOM   2042  C  CD1   . TYR B 2 53  ? 1.959   49.598 -0.284  1.00 159.85 ? 570  TYR C CD1   1 
ATOM   2043  C  CD2   . TYR B 2 53  ? 2.892   47.403 -0.192  1.00 162.22 ? 570  TYR C CD2   1 
ATOM   2044  C  CE1   . TYR B 2 53  ? 2.823   50.016 0.714   1.00 161.14 ? 570  TYR C CE1   1 
ATOM   2045  C  CE2   . TYR B 2 53  ? 3.761   47.811 0.807   1.00 163.80 ? 570  TYR C CE2   1 
ATOM   2046  C  CZ    . TYR B 2 53  ? 3.721   49.117 1.256   1.00 163.23 ? 570  TYR C CZ    1 
ATOM   2047  O  OH    . TYR B 2 53  ? 4.582   49.522 2.246   1.00 165.33 ? 570  TYR C OH    1 
ATOM   2048  N  N     . LYS B 2 54  ? 3.756   48.010 -4.235  1.00 164.37 ? 571  LYS C N     1 
ATOM   2049  C  CA    . LYS B 2 54  ? 5.021   47.362 -4.578  1.00 167.91 ? 571  LYS C CA    1 
ATOM   2050  C  C     . LYS B 2 54  ? 6.088   47.656 -3.528  1.00 170.96 ? 571  LYS C C     1 
ATOM   2051  O  O     . LYS B 2 54  ? 6.390   48.817 -3.245  1.00 170.74 ? 571  LYS C O     1 
ATOM   2052  C  CB    . LYS B 2 54  ? 5.504   47.801 -5.963  1.00 168.26 ? 571  LYS C CB    1 
ATOM   2053  C  CG    . LYS B 2 54  ? 6.795   47.119 -6.398  1.00 170.79 ? 571  LYS C CG    1 
ATOM   2054  C  CD    . LYS B 2 54  ? 6.879   46.934 -7.906  1.00 170.80 ? 571  LYS C CD    1 
ATOM   2055  C  CE    . LYS B 2 54  ? 6.933   48.260 -8.644  1.00 170.36 ? 571  LYS C CE    1 
ATOM   2056  N  NZ    . LYS B 2 54  ? 7.297   48.074 -10.076 1.00 170.72 ? 571  LYS C NZ    1 
ATOM   2057  N  N     . LEU B 2 55  ? 6.646   46.590 -2.958  1.00 174.37 ? 572  LEU C N     1 
ATOM   2058  C  CA    . LEU B 2 55  ? 7.709   46.682 -1.962  1.00 177.90 ? 572  LEU C CA    1 
ATOM   2059  C  C     . LEU B 2 55  ? 8.980   46.069 -2.541  1.00 181.63 ? 572  LEU C C     1 
ATOM   2060  O  O     . LEU B 2 55  ? 8.923   45.041 -3.217  1.00 182.09 ? 572  LEU C O     1 
ATOM   2061  C  CB    . LEU B 2 55  ? 7.295   45.940 -0.688  1.00 178.41 ? 572  LEU C CB    1 
ATOM   2062  C  CG    . LEU B 2 55  ? 8.258   45.945 0.503   1.00 180.77 ? 572  LEU C CG    1 
ATOM   2063  C  CD1   . LEU B 2 55  ? 8.524   47.357 1.000   1.00 180.61 ? 572  LEU C CD1   1 
ATOM   2064  C  CD2   . LEU B 2 55  ? 7.701   45.082 1.625   1.00 181.18 ? 572  LEU C CD2   1 
ATOM   2065  N  N     . GLN B 2 56  ? 10.120  46.705 -2.278  1.00 185.36 ? 573  GLN C N     1 
ATOM   2066  C  CA    . GLN B 2 56  ? 11.410  46.233 -2.783  1.00 189.15 ? 573  GLN C CA    1 
ATOM   2067  C  C     . GLN B 2 56  ? 12.535  46.472 -1.784  1.00 193.14 ? 573  GLN C C     1 
ATOM   2068  O  O     . GLN B 2 56  ? 12.414  47.306 -0.886  1.00 192.71 ? 573  GLN C O     1 
ATOM   2069  C  CB    . GLN B 2 56  ? 11.755  46.931 -4.099  1.00 188.78 ? 573  GLN C CB    1 
ATOM   2070  C  CG    . GLN B 2 56  ? 11.062  46.340 -5.316  1.00 187.23 ? 573  GLN C CG    1 
ATOM   2071  C  CD    . GLN B 2 56  ? 11.524  46.959 -6.623  1.00 187.28 ? 573  GLN C CD    1 
ATOM   2072  O  OE1   . GLN B 2 56  ? 10.741  47.103 -7.562  1.00 185.15 ? 573  GLN C OE1   1 
ATOM   2073  N  NE2   . GLN B 2 56  ? 12.800  47.326 -6.691  1.00 189.79 ? 573  GLN C NE2   1 
ATOM   2074  N  N     . LEU B 2 57  ? 13.627  45.730 -1.956  1.00 197.78 ? 574  LEU C N     1 
ATOM   2075  C  CA    . LEU B 2 57  ? 14.839  45.928 -1.168  1.00 202.52 ? 574  LEU C CA    1 
ATOM   2076  C  C     . LEU B 2 57  ? 16.045  46.071 -2.094  1.00 205.47 ? 574  LEU C C     1 
ATOM   2077  O  O     . LEU B 2 57  ? 16.602  45.077 -2.567  1.00 207.35 ? 574  LEU C O     1 
ATOM   2078  C  CB    . LEU B 2 57  ? 15.043  44.767 -0.188  1.00 204.97 ? 574  LEU C CB    1 
ATOM   2079  C  CG    . LEU B 2 57  ? 16.212  44.888 0.796   1.00 208.51 ? 574  LEU C CG    1 
ATOM   2080  C  CD1   . LEU B 2 57  ? 16.077  46.123 1.675   1.00 208.17 ? 574  LEU C CD1   1 
ATOM   2081  C  CD2   . LEU B 2 57  ? 16.315  43.634 1.654   1.00 210.55 ? 574  LEU C CD2   1 
ATOM   2082  N  N     . LEU B 2 58  ? 16.439  47.317 -2.347  1.00 206.46 ? 575  LEU C N     1 
ATOM   2083  C  CA    . LEU B 2 58  ? 17.538  47.618 -3.261  1.00 208.86 ? 575  LEU C CA    1 
ATOM   2084  C  C     . LEU B 2 58  ? 18.883  47.463 -2.559  1.00 212.45 ? 575  LEU C C     1 
ATOM   2085  O  O     . LEU B 2 58  ? 19.185  48.182 -1.607  1.00 212.96 ? 575  LEU C O     1 
ATOM   2086  C  CB    . LEU B 2 58  ? 17.400  49.041 -3.813  1.00 208.02 ? 575  LEU C CB    1 
ATOM   2087  C  CG    . LEU B 2 58  ? 16.068  49.394 -4.481  1.00 204.79 ? 575  LEU C CG    1 
ATOM   2088  C  CD1   . LEU B 2 58  ? 16.047  50.863 -4.878  1.00 204.24 ? 575  LEU C CD1   1 
ATOM   2089  C  CD2   . LEU B 2 58  ? 15.808  48.508 -5.689  1.00 203.87 ? 575  LEU C CD2   1 
ATOM   2090  N  N     . TRP B 2 67  ? 18.856  50.182 1.245   1.00 212.37 ? 584  TRP C N     1 
ATOM   2091  C  CA    . TRP B 2 67  ? 17.728  50.947 0.725   1.00 208.79 ? 584  TRP C CA    1 
ATOM   2092  C  C     . TRP B 2 67  ? 16.465  50.102 0.652   1.00 205.13 ? 584  TRP C C     1 
ATOM   2093  O  O     . TRP B 2 67  ? 16.497  48.979 0.148   1.00 205.57 ? 584  TRP C O     1 
ATOM   2094  C  CB    . TRP B 2 67  ? 18.042  51.472 -0.675  1.00 209.27 ? 584  TRP C CB    1 
ATOM   2095  C  CG    . TRP B 2 67  ? 19.141  52.471 -0.711  1.00 212.40 ? 584  TRP C CG    1 
ATOM   2096  C  CD1   . TRP B 2 67  ? 19.013  53.828 -0.741  1.00 212.05 ? 584  TRP C CD1   1 
ATOM   2097  C  CD2   . TRP B 2 67  ? 20.545  52.198 -0.724  1.00 216.74 ? 584  TRP C CD2   1 
ATOM   2098  N  NE1   . TRP B 2 67  ? 20.252  54.420 -0.771  1.00 215.40 ? 584  TRP C NE1   1 
ATOM   2099  C  CE2   . TRP B 2 67  ? 21.210  53.441 -0.761  1.00 218.38 ? 584  TRP C CE2   1 
ATOM   2100  C  CE3   . TRP B 2 67  ? 21.306  51.023 -0.707  1.00 219.49 ? 584  TRP C CE3   1 
ATOM   2101  C  CZ2   . TRP B 2 67  ? 22.604  53.544 -0.782  1.00 222.41 ? 584  TRP C CZ2   1 
ATOM   2102  C  CZ3   . TRP B 2 67  ? 22.691  51.125 -0.728  1.00 223.36 ? 584  TRP C CZ3   1 
ATOM   2103  C  CH2   . TRP B 2 67  ? 23.324  52.378 -0.764  1.00 224.73 ? 584  TRP C CH2   1 
ATOM   2104  N  N     . ILE B 2 68  ? 15.359  50.651 1.148   1.00 201.02 ? 585  ILE C N     1 
ATOM   2105  C  CA    . ILE B 2 68  ? 14.051  50.022 1.005   1.00 196.91 ? 585  ILE C CA    1 
ATOM   2106  C  C     . ILE B 2 68  ? 13.138  50.965 0.222   1.00 192.78 ? 585  ILE C C     1 
ATOM   2107  O  O     . ILE B 2 68  ? 13.160  52.180 0.437   1.00 191.89 ? 585  ILE C O     1 
ATOM   2108  C  CB    . ILE B 2 68  ? 13.448  49.643 2.382   1.00 196.56 ? 585  ILE C CB    1 
ATOM   2109  C  CG1   . ILE B 2 68  ? 12.504  48.445 2.240   1.00 195.18 ? 585  ILE C CG1   1 
ATOM   2110  C  CG2   . ILE B 2 68  ? 12.743  50.827 3.039   1.00 194.91 ? 585  ILE C CG2   1 
ATOM   2111  C  CD1   . ILE B 2 68  ? 12.269  47.691 3.528   1.00 196.12 ? 585  ILE C CD1   1 
ATOM   2112  N  N     . PHE B 2 69  ? 12.356  50.405 -0.698  1.00 189.69 ? 586  PHE C N     1 
ATOM   2113  C  CA    . PHE B 2 69  ? 11.475  51.204 -1.546  1.00 186.12 ? 586  PHE C CA    1 
ATOM   2114  C  C     . PHE B 2 69  ? 10.026  50.740 -1.446  1.00 181.74 ? 586  PHE C C     1 
ATOM   2115  O  O     . PHE B 2 69  ? 9.723   49.566 -1.662  1.00 181.29 ? 586  PHE C O     1 
ATOM   2116  C  CB    . PHE B 2 69  ? 11.935  51.149 -3.004  1.00 186.87 ? 586  PHE C CB    1 
ATOM   2117  C  CG    . PHE B 2 69  ? 11.126  52.024 -3.919  1.00 185.08 ? 586  PHE C CG    1 
ATOM   2118  C  CD1   . PHE B 2 69  ? 11.272  53.404 -3.884  1.00 185.44 ? 586  PHE C CD1   1 
ATOM   2119  C  CD2   . PHE B 2 69  ? 10.209  51.472 -4.803  1.00 183.15 ? 586  PHE C CD2   1 
ATOM   2120  C  CE1   . PHE B 2 69  ? 10.525  54.218 -4.719  1.00 183.90 ? 586  PHE C CE1   1 
ATOM   2121  C  CE2   . PHE B 2 69  ? 9.460   52.280 -5.641  1.00 181.70 ? 586  PHE C CE2   1 
ATOM   2122  C  CZ    . PHE B 2 69  ? 9.618   53.655 -5.599  1.00 182.08 ? 586  PHE C CZ    1 
ATOM   2123  N  N     . ARG B 2 70  ? 9.142   51.681 -1.120  1.00 177.91 ? 587  ARG C N     1 
ATOM   2124  C  CA    . ARG B 2 70  ? 7.707   51.432 -1.048  1.00 174.00 ? 587  ARG C CA    1 
ATOM   2125  C  C     . ARG B 2 70  ? 6.985   52.269 -2.097  1.00 170.27 ? 587  ARG C C     1 
ATOM   2126  O  O     . ARG B 2 70  ? 7.179   53.483 -2.167  1.00 169.97 ? 587  ARG C O     1 
ATOM   2127  C  CB    . ARG B 2 70  ? 7.177   51.794 0.339   1.00 173.77 ? 587  ARG C CB    1 
ATOM   2128  C  CG    . ARG B 2 70  ? 7.529   50.795 1.427   1.00 175.39 ? 587  ARG C CG    1 
ATOM   2129  C  CD    . ARG B 2 70  ? 7.115   51.313 2.795   1.00 175.18 ? 587  ARG C CD    1 
ATOM   2130  N  NE    . ARG B 2 70  ? 8.098   52.228 3.372   1.00 176.78 ? 587  ARG C NE    1 
ATOM   2131  C  CZ    . ARG B 2 70  ? 7.944   52.879 4.524   1.00 177.19 ? 587  ARG C CZ    1 
ATOM   2132  N  NH1   . ARG B 2 70  ? 6.837   52.732 5.246   1.00 176.02 ? 587  ARG C NH1   1 
ATOM   2133  N  NH2   . ARG B 2 70  ? 8.904   53.687 4.959   1.00 179.03 ? 587  ARG C NH2   1 
ATOM   2134  N  N     . SER B 2 71  ? 6.164   51.613 -2.914  1.00 166.75 ? 588  SER C N     1 
ATOM   2135  C  CA    . SER B 2 71  ? 5.304   52.296 -3.877  1.00 163.48 ? 588  SER C CA    1 
ATOM   2136  C  C     . SER B 2 71  ? 3.855   51.919 -3.591  1.00 160.62 ? 588  SER C C     1 
ATOM   2137  O  O     . SER B 2 71  ? 3.573   50.780 -3.220  1.00 160.70 ? 588  SER C O     1 
ATOM   2138  C  CB    . SER B 2 71  ? 5.678   51.902 -5.305  1.00 163.53 ? 588  SER C CB    1 
ATOM   2139  O  OG    . SER B 2 71  ? 5.071   52.767 -6.249  1.00 162.29 ? 588  SER C OG    1 
ATOM   2140  N  N     . TRP B 2 72  ? 2.944   52.876 -3.753  1.00 157.74 ? 589  TRP C N     1 
ATOM   2141  C  CA    . TRP B 2 72  ? 1.523   52.640 -3.488  1.00 155.00 ? 589  TRP C CA    1 
ATOM   2142  C  C     . TRP B 2 72  ? 0.627   53.610 -4.256  1.00 152.45 ? 589  TRP C C     1 
ATOM   2143  O  O     . TRP B 2 72  ? 1.069   54.681 -4.673  1.00 152.41 ? 589  TRP C O     1 
ATOM   2144  C  CB    . TRP B 2 72  ? 1.236   52.735 -1.983  1.00 155.22 ? 589  TRP C CB    1 
ATOM   2145  C  CG    . TRP B 2 72  ? 1.341   54.122 -1.410  1.00 155.20 ? 589  TRP C CG    1 
ATOM   2146  C  CD1   . TRP B 2 72  ? 0.342   55.047 -1.312  1.00 153.98 ? 589  TRP C CD1   1 
ATOM   2147  C  CD2   . TRP B 2 72  ? 2.507   54.732 -0.845  1.00 156.65 ? 589  TRP C CD2   1 
ATOM   2148  N  NE1   . TRP B 2 72  ? 0.814   56.198 -0.729  1.00 154.57 ? 589  TRP C NE1   1 
ATOM   2149  C  CE2   . TRP B 2 72  ? 2.141   56.031 -0.432  1.00 156.20 ? 589  TRP C CE2   1 
ATOM   2150  C  CE3   . TRP B 2 72  ? 3.827   54.308 -0.651  1.00 158.44 ? 589  TRP C CE3   1 
ATOM   2151  C  CZ2   . TRP B 2 72  ? 3.046   56.911 0.166   1.00 157.27 ? 589  TRP C CZ2   1 
ATOM   2152  C  CZ3   . TRP B 2 72  ? 4.727   55.185 -0.060  1.00 159.76 ? 589  TRP C CZ3   1 
ATOM   2153  C  CH2   . TRP B 2 72  ? 4.331   56.472 0.340   1.00 159.03 ? 589  TRP C CH2   1 
ATOM   2154  N  N     . GLY B 2 73  ? -0.633  53.221 -4.437  1.00 150.18 ? 590  GLY C N     1 
ATOM   2155  C  CA    . GLY B 2 73  ? -1.612  54.052 -5.138  1.00 148.24 ? 590  GLY C CA    1 
ATOM   2156  C  C     . GLY B 2 73  ? -2.751  53.249 -5.739  1.00 146.48 ? 590  GLY C C     1 
ATOM   2157  O  O     . GLY B 2 73  ? -2.883  52.052 -5.479  1.00 146.98 ? 590  GLY C O     1 
ATOM   2158  N  N     . ARG B 2 74  ? -3.571  53.919 -6.546  1.00 144.48 ? 591  ARG C N     1 
ATOM   2159  C  CA    . ARG B 2 74  ? -4.669  53.270 -7.259  1.00 142.88 ? 591  ARG C CA    1 
ATOM   2160  C  C     . ARG B 2 74  ? -4.182  52.824 -8.634  1.00 143.11 ? 591  ARG C C     1 
ATOM   2161  O  O     . ARG B 2 74  ? -3.764  53.649 -9.447  1.00 143.30 ? 591  ARG C O     1 
ATOM   2162  C  CB    . ARG B 2 74  ? -5.856  54.226 -7.401  1.00 141.39 ? 591  ARG C CB    1 
ATOM   2163  C  CG    . ARG B 2 74  ? -7.123  53.573 -7.933  1.00 140.24 ? 591  ARG C CG    1 
ATOM   2164  C  CD    . ARG B 2 74  ? -8.324  54.492 -7.784  1.00 139.24 ? 591  ARG C CD    1 
ATOM   2165  N  NE    . ARG B 2 74  ? -9.523  53.961 -8.438  1.00 138.30 ? 591  ARG C NE    1 
ATOM   2166  C  CZ    . ARG B 2 74  ? -10.399 53.122 -7.884  1.00 137.87 ? 591  ARG C CZ    1 
ATOM   2167  N  NH1   . ARG B 2 74  ? -10.237 52.681 -6.640  1.00 137.88 ? 591  ARG C NH1   1 
ATOM   2168  N  NH2   . ARG B 2 74  ? -11.452 52.712 -8.584  1.00 137.75 ? 591  ARG C NH2   1 
ATOM   2169  N  N     . VAL B 2 75  ? -4.229  51.515 -8.879  1.00 143.35 ? 592  VAL C N     1 
ATOM   2170  C  CA    . VAL B 2 75  ? -3.740  50.927 -10.135 1.00 143.89 ? 592  VAL C CA    1 
ATOM   2171  C  C     . VAL B 2 75  ? -4.313  51.614 -11.379 1.00 143.82 ? 592  VAL C C     1 
ATOM   2172  O  O     . VAL B 2 75  ? -5.529  51.749 -11.528 1.00 142.95 ? 592  VAL C O     1 
ATOM   2173  C  CB    . VAL B 2 75  ? -3.982  49.389 -10.201 1.00 143.93 ? 592  VAL C CB    1 
ATOM   2174  C  CG1   . VAL B 2 75  ? -5.332  48.999 -9.611  1.00 143.24 ? 592  VAL C CG1   1 
ATOM   2175  C  CG2   . VAL B 2 75  ? -3.849  48.864 -11.628 1.00 144.12 ? 592  VAL C CG2   1 
ATOM   2176  N  N     . GLY B 2 76  ? -3.412  52.047 -12.259 1.00 145.22 ? 593  GLY C N     1 
ATOM   2177  C  CA    . GLY B 2 76  ? -3.777  52.619 -13.551 1.00 145.83 ? 593  GLY C CA    1 
ATOM   2178  C  C     . GLY B 2 76  ? -4.087  54.105 -13.540 1.00 146.33 ? 593  GLY C C     1 
ATOM   2179  O  O     . GLY B 2 76  ? -4.758  54.603 -14.445 1.00 145.98 ? 593  GLY C O     1 
ATOM   2180  N  N     . THR B 2 77  ? -3.586  54.817 -12.532 1.00 147.57 ? 594  THR C N     1 
ATOM   2181  C  CA    . THR B 2 77  ? -3.835  56.254 -12.398 1.00 148.55 ? 594  THR C CA    1 
ATOM   2182  C  C     . THR B 2 77  ? -2.695  56.972 -11.679 1.00 150.24 ? 594  THR C C     1 
ATOM   2183  O  O     . THR B 2 77  ? -1.828  56.340 -11.073 1.00 150.71 ? 594  THR C O     1 
ATOM   2184  C  CB    . THR B 2 77  ? -5.154  56.530 -11.641 1.00 147.66 ? 594  THR C CB    1 
ATOM   2185  O  OG1   . THR B 2 77  ? -5.370  55.514 -10.653 1.00 147.15 ? 594  THR C OG1   1 
ATOM   2186  C  CG2   . THR B 2 77  ? -6.333  56.555 -12.603 1.00 147.32 ? 594  THR C CG2   1 
ATOM   2187  N  N     . VAL B 2 78  ? -2.716  58.301 -11.754 1.00 151.58 ? 595  VAL C N     1 
ATOM   2188  C  CA    . VAL B 2 78  ? -1.715  59.144 -11.096 1.00 153.58 ? 595  VAL C CA    1 
ATOM   2189  C  C     . VAL B 2 78  ? -1.909  59.199 -9.572  1.00 154.23 ? 595  VAL C C     1 
ATOM   2190  O  O     . VAL B 2 78  ? -1.033  59.679 -8.851  1.00 155.35 ? 595  VAL C O     1 
ATOM   2191  C  CB    . VAL B 2 78  ? -1.713  60.578 -11.691 1.00 154.32 ? 595  VAL C CB    1 
ATOM   2192  C  CG1   . VAL B 2 78  ? -2.947  61.363 -11.255 1.00 153.58 ? 595  VAL C CG1   1 
ATOM   2193  C  CG2   . VAL B 2 78  ? -0.433  61.322 -11.324 1.00 155.69 ? 595  VAL C CG2   1 
ATOM   2194  N  N     . ILE B 2 79  ? -3.051  58.706 -9.090  1.00 154.20 ? 596  ILE C N     1 
ATOM   2195  C  CA    . ILE B 2 79  ? -3.326  58.632 -7.654  1.00 154.62 ? 596  ILE C CA    1 
ATOM   2196  C  C     . ILE B 2 79  ? -2.332  57.691 -6.977  1.00 156.01 ? 596  ILE C C     1 
ATOM   2197  O  O     . ILE B 2 79  ? -2.227  56.520 -7.346  1.00 156.12 ? 596  ILE C O     1 
ATOM   2198  C  CB    . ILE B 2 79  ? -4.763  58.129 -7.371  1.00 153.51 ? 596  ILE C CB    1 
ATOM   2199  C  CG1   . ILE B 2 79  ? -5.810  59.109 -7.923  1.00 153.28 ? 596  ILE C CG1   1 
ATOM   2200  C  CG2   . ILE B 2 79  ? -4.980  57.902 -5.878  1.00 153.18 ? 596  ILE C CG2   1 
ATOM   2201  C  CD1   . ILE B 2 79  ? -5.723  60.516 -7.369  1.00 153.74 ? 596  ILE C CD1   1 
ATOM   2202  N  N     . GLY B 2 80  ? -1.612  58.213 -5.987  1.00 157.80 ? 597  GLY C N     1 
ATOM   2203  C  CA    . GLY B 2 80  ? -0.621  57.435 -5.249  1.00 159.89 ? 597  GLY C CA    1 
ATOM   2204  C  C     . GLY B 2 80  ? 0.651   58.210 -4.967  1.00 162.77 ? 597  GLY C C     1 
ATOM   2205  O  O     . GLY B 2 80  ? 0.777   59.378 -5.339  1.00 163.50 ? 597  GLY C O     1 
ATOM   2206  N  N     . SER B 2 81  ? 1.593   57.549 -4.301  1.00 165.62 ? 598  SER C N     1 
ATOM   2207  C  CA    . SER B 2 81  ? 2.892   58.139 -3.985  1.00 168.40 ? 598  SER C CA    1 
ATOM   2208  C  C     . SER B 2 81  ? 3.907   57.039 -3.672  1.00 171.27 ? 598  SER C C     1 
ATOM   2209  O  O     . SER B 2 81  ? 3.586   55.851 -3.742  1.00 171.16 ? 598  SER C O     1 
ATOM   2210  C  CB    . SER B 2 81  ? 2.762   59.102 -2.802  1.00 168.32 ? 598  SER C CB    1 
ATOM   2211  O  OG    . SER B 2 81  ? 3.980   59.784 -2.559  1.00 170.12 ? 598  SER C OG    1 
ATOM   2212  N  N     . ASN B 2 82  ? 5.130   57.438 -3.332  1.00 174.90 ? 599  ASN C N     1 
ATOM   2213  C  CA    . ASN B 2 82  ? 6.198   56.486 -3.018  1.00 177.92 ? 599  ASN C CA    1 
ATOM   2214  C  C     . ASN B 2 82  ? 7.166   57.019 -1.967  1.00 181.25 ? 599  ASN C C     1 
ATOM   2215  O  O     . ASN B 2 82  ? 7.199   58.220 -1.694  1.00 181.13 ? 599  ASN C O     1 
ATOM   2216  C  CB    . ASN B 2 82  ? 6.962   56.090 -4.291  1.00 178.62 ? 599  ASN C CB    1 
ATOM   2217  C  CG    . ASN B 2 82  ? 7.263   57.274 -5.198  1.00 178.82 ? 599  ASN C CG    1 
ATOM   2218  O  OD1   . ASN B 2 82  ? 7.063   57.200 -6.410  1.00 178.29 ? 599  ASN C OD1   1 
ATOM   2219  N  ND2   . ASN B 2 82  ? 7.743   58.370 -4.617  1.00 179.64 ? 599  ASN C ND2   1 
ATOM   2220  N  N     . LYS B 2 83  ? 7.947   56.115 -1.380  1.00 184.83 ? 600  LYS C N     1 
ATOM   2221  C  CA    . LYS B 2 83  ? 8.975   56.496 -0.418  1.00 188.73 ? 600  LYS C CA    1 
ATOM   2222  C  C     . LYS B 2 83  ? 10.236  55.649 -0.567  1.00 193.30 ? 600  LYS C C     1 
ATOM   2223  O  O     . LYS B 2 83  ? 10.265  54.482 -0.171  1.00 194.07 ? 600  LYS C O     1 
ATOM   2224  C  CB    . LYS B 2 83  ? 8.448   56.391 1.015   1.00 188.12 ? 600  LYS C CB    1 
ATOM   2225  C  CG    . LYS B 2 83  ? 9.443   56.885 2.054   1.00 190.29 ? 600  LYS C CG    1 
ATOM   2226  C  CD    . LYS B 2 83  ? 8.883   56.820 3.463   1.00 189.75 ? 600  LYS C CD    1 
ATOM   2227  C  CE    . LYS B 2 83  ? 9.928   57.254 4.479   1.00 192.00 ? 600  LYS C CE    1 
ATOM   2228  N  NZ    . LYS B 2 83  ? 10.120  58.731 4.489   1.00 192.05 ? 600  LYS C NZ    1 
ATOM   2229  N  N     . LEU B 2 84  ? 11.270  56.252 -1.146  1.00 197.51 ? 601  LEU C N     1 
ATOM   2230  C  CA    . LEU B 2 84  ? 12.611  55.683 -1.131  1.00 202.38 ? 601  LEU C CA    1 
ATOM   2231  C  C     . LEU B 2 84  ? 13.269  56.086 0.185   1.00 205.75 ? 601  LEU C C     1 
ATOM   2232  O  O     . LEU B 2 84  ? 13.158  57.239 0.609   1.00 205.60 ? 601  LEU C O     1 
ATOM   2233  C  CB    . LEU B 2 84  ? 13.426  56.199 -2.318  1.00 204.25 ? 601  LEU C CB    1 
ATOM   2234  C  CG    . LEU B 2 84  ? 14.878  55.727 -2.438  1.00 207.93 ? 601  LEU C CG    1 
ATOM   2235  C  CD1   . LEU B 2 84  ? 14.960  54.211 -2.550  1.00 208.40 ? 601  LEU C CD1   1 
ATOM   2236  C  CD2   . LEU B 2 84  ? 15.549  56.389 -3.632  1.00 209.26 ? 601  LEU C CD2   1 
ATOM   2237  N  N     . GLU B 2 85  ? 13.949  55.140 0.827   1.00 209.53 ? 602  GLU C N     1 
ATOM   2238  C  CA    . GLU B 2 85  ? 14.531  55.373 2.147   1.00 212.80 ? 602  GLU C CA    1 
ATOM   2239  C  C     . GLU B 2 85  ? 15.767  54.501 2.367   1.00 217.76 ? 602  GLU C C     1 
ATOM   2240  O  O     . GLU B 2 85  ? 15.683  53.273 2.308   1.00 218.08 ? 602  GLU C O     1 
ATOM   2241  C  CB    . GLU B 2 85  ? 13.487  55.084 3.230   1.00 210.45 ? 602  GLU C CB    1 
ATOM   2242  C  CG    . GLU B 2 85  ? 13.879  55.546 4.627   1.00 211.32 ? 602  GLU C CG    1 
ATOM   2243  C  CD    . GLU B 2 85  ? 12.797  55.287 5.661   1.00 209.13 ? 602  GLU C CD    1 
ATOM   2244  O  OE1   . GLU B 2 85  ? 12.773  56.003 6.684   1.00 209.20 ? 602  GLU C OE1   1 
ATOM   2245  O  OE2   . GLU B 2 85  ? 11.970  54.371 5.457   1.00 206.96 ? 602  GLU C OE2   1 
ATOM   2246  N  N     . GLN B 2 86  ? 16.906  55.143 2.620   1.00 222.43 ? 603  GLN C N     1 
ATOM   2247  C  CA    . GLN B 2 86  ? 18.151  54.431 2.905   1.00 227.48 ? 603  GLN C CA    1 
ATOM   2248  C  C     . GLN B 2 86  ? 18.127  53.878 4.328   1.00 229.82 ? 603  GLN C C     1 
ATOM   2249  O  O     . GLN B 2 86  ? 17.616  54.525 5.244   1.00 228.78 ? 603  GLN C O     1 
ATOM   2250  C  CB    . GLN B 2 86  ? 19.357  55.356 2.720   1.00 230.63 ? 603  GLN C CB    1 
ATOM   2251  C  CG    . GLN B 2 86  ? 20.700  54.639 2.761   1.00 234.94 ? 603  GLN C CG    1 
ATOM   2252  C  CD    . GLN B 2 86  ? 21.876  55.560 2.488   1.00 238.19 ? 603  GLN C CD    1 
ATOM   2253  O  OE1   . GLN B 2 86  ? 21.720  56.778 2.382   1.00 237.80 ? 603  GLN C OE1   1 
ATOM   2254  N  NE2   . GLN B 2 86  ? 23.067  54.979 2.375   1.00 241.76 ? 603  GLN C NE2   1 
ATOM   2255  N  N     . MET B 2 87  ? 18.686  52.682 4.503   1.00 233.49 ? 604  MET C N     1 
ATOM   2256  C  CA    . MET B 2 87  ? 18.701  52.007 5.801   1.00 235.93 ? 604  MET C CA    1 
ATOM   2257  C  C     . MET B 2 87  ? 19.985  52.320 6.571   1.00 239.82 ? 604  MET C C     1 
ATOM   2258  O  O     . MET B 2 87  ? 20.988  52.709 5.969   1.00 241.91 ? 604  MET C O     1 
ATOM   2259  C  CB    . MET B 2 87  ? 18.580  50.492 5.615   1.00 236.83 ? 604  MET C CB    1 
ATOM   2260  C  CG    . MET B 2 87  ? 17.253  50.019 5.040   1.00 233.86 ? 604  MET C CG    1 
ATOM   2261  S  SD    . MET B 2 87  ? 15.910  49.994 6.246   1.00 232.28 ? 604  MET C SD    1 
ATOM   2262  C  CE    . MET B 2 87  ? 15.164  51.603 5.991   1.00 229.53 ? 604  MET C CE    1 
ATOM   2263  N  N     . PRO B 2 88  ? 19.957  52.155 7.908   1.00 241.06 ? 605  PRO C N     1 
ATOM   2264  C  CA    . PRO B 2 88  ? 21.191  52.248 8.695   1.00 244.86 ? 605  PRO C CA    1 
ATOM   2265  C  C     . PRO B 2 88  ? 22.181  51.123 8.375   1.00 247.49 ? 605  PRO C C     1 
ATOM   2266  O  O     . PRO B 2 88  ? 23.391  51.355 8.354   1.00 250.25 ? 605  PRO C O     1 
ATOM   2267  C  CB    . PRO B 2 88  ? 20.702  52.136 10.146  1.00 245.00 ? 605  PRO C CB    1 
ATOM   2268  C  CG    . PRO B 2 88  ? 19.255  52.479 10.105  1.00 240.92 ? 605  PRO C CG    1 
ATOM   2269  C  CD    . PRO B 2 88  ? 18.768  52.013 8.768   1.00 238.79 ? 605  PRO C CD    1 
ATOM   2270  N  N     . SER B 2 89  ? 21.662  49.919 8.134   1.00 246.27 ? 606  SER C N     1 
ATOM   2271  C  CA    . SER B 2 89  ? 22.492  48.763 7.787   1.00 249.06 ? 606  SER C CA    1 
ATOM   2272  C  C     . SER B 2 89  ? 21.703  47.732 6.973   1.00 246.95 ? 606  SER C C     1 
ATOM   2273  O  O     . SER B 2 89  ? 20.509  47.906 6.725   1.00 243.67 ? 606  SER C O     1 
ATOM   2274  C  CB    . SER B 2 89  ? 23.051  48.117 9.056   1.00 252.45 ? 606  SER C CB    1 
ATOM   2275  O  OG    . SER B 2 89  ? 23.990  47.103 8.744   1.00 256.30 ? 606  SER C OG    1 
ATOM   2276  N  N     . LYS B 2 90  ? 22.382  46.659 6.567   1.00 249.28 ? 607  LYS C N     1 
ATOM   2277  C  CA    . LYS B 2 90  ? 21.773  45.610 5.736   1.00 247.67 ? 607  LYS C CA    1 
ATOM   2278  C  C     . LYS B 2 90  ? 20.920  44.614 6.528   1.00 247.44 ? 607  LYS C C     1 
ATOM   2279  O  O     . LYS B 2 90  ? 19.972  44.049 5.985   1.00 244.99 ? 607  LYS C O     1 
ATOM   2280  C  CB    . LYS B 2 90  ? 22.843  44.860 4.925   1.00 250.34 ? 607  LYS C CB    1 
ATOM   2281  C  CG    . LYS B 2 90  ? 22.762  45.079 3.420   1.00 248.35 ? 607  LYS C CG    1 
ATOM   2282  C  CD    . LYS B 2 90  ? 23.023  46.523 3.016   1.00 247.42 ? 607  LYS C CD    1 
ATOM   2283  C  CE    . LYS B 2 90  ? 22.906  46.691 1.509   1.00 245.49 ? 607  LYS C CE    1 
ATOM   2284  N  NZ    . LYS B 2 90  ? 23.040  48.111 1.082   1.00 244.52 ? 607  LYS C NZ    1 
ATOM   2285  N  N     . GLU B 2 91  ? 21.261  44.383 7.795   1.00 250.47 ? 608  GLU C N     1 
ATOM   2286  C  CA    . GLU B 2 91  ? 20.445  43.520 8.658   1.00 250.40 ? 608  GLU C CA    1 
ATOM   2287  C  C     . GLU B 2 91  ? 19.191  44.245 9.152   1.00 246.77 ? 608  GLU C C     1 
ATOM   2288  O  O     . GLU B 2 91  ? 18.184  43.606 9.465   1.00 245.30 ? 608  GLU C O     1 
ATOM   2289  C  CB    . GLU B 2 91  ? 21.258  42.988 9.844   1.00 254.79 ? 608  GLU C CB    1 
ATOM   2290  C  CG    . GLU B 2 91  ? 22.133  41.786 9.509   1.00 258.38 ? 608  GLU C CG    1 
ATOM   2291  C  CD    . GLU B 2 91  ? 21.367  40.471 9.456   1.00 257.79 ? 608  GLU C CD    1 
ATOM   2292  O  OE1   . GLU B 2 91  ? 20.122  40.488 9.333   1.00 254.32 ? 608  GLU C OE1   1 
ATOM   2293  O  OE2   . GLU B 2 91  ? 22.018  39.407 9.535   1.00 261.07 ? 608  GLU C OE2   1 
ATOM   2294  N  N     . ASP B 2 92  ? 19.260  45.574 9.221   1.00 245.37 ? 609  ASP C N     1 
ATOM   2295  C  CA    . ASP B 2 92  ? 18.095  46.400 9.547   1.00 241.52 ? 609  ASP C CA    1 
ATOM   2296  C  C     . ASP B 2 92  ? 17.108  46.440 8.379   1.00 236.52 ? 609  ASP C C     1 
ATOM   2297  O  O     . ASP B 2 92  ? 15.919  46.698 8.573   1.00 233.57 ? 609  ASP C O     1 
ATOM   2298  C  CB    . ASP B 2 92  ? 18.528  47.825 9.908   1.00 242.42 ? 609  ASP C CB    1 
ATOM   2299  C  CG    . ASP B 2 92  ? 19.427  47.875 11.134  1.00 246.62 ? 609  ASP C CG    1 
ATOM   2300  O  OD1   . ASP B 2 92  ? 20.366  48.698 11.149  1.00 248.98 ? 609  ASP C OD1   1 
ATOM   2301  O  OD2   . ASP B 2 92  ? 19.199  47.093 12.082  1.00 248.18 ? 609  ASP C OD2   1 
ATOM   2302  N  N     . ALA B 2 93  ? 17.612  46.193 7.171   1.00 235.15 ? 610  ALA C N     1 
ATOM   2303  C  CA    . ALA B 2 93  ? 16.782  46.118 5.972   1.00 230.75 ? 610  ALA C CA    1 
ATOM   2304  C  C     . ALA B 2 93  ? 15.806  44.945 6.040   1.00 229.02 ? 610  ALA C C     1 
ATOM   2305  O  O     . ALA B 2 93  ? 14.619  45.106 5.760   1.00 225.76 ? 610  ALA C O     1 
ATOM   2306  C  CB    . ALA B 2 93  ? 17.658  45.995 4.737   1.00 231.45 ? 610  ALA C CB    1 
ATOM   2307  N  N     . ILE B 2 94  ? 16.318  43.770 6.405   1.00 231.40 ? 611  ILE C N     1 
ATOM   2308  C  CA    . ILE B 2 94  ? 15.487  42.578 6.601   1.00 230.99 ? 611  ILE C CA    1 
ATOM   2309  C  C     . ILE B 2 94  ? 14.423  42.832 7.671   1.00 229.33 ? 611  ILE C C     1 
ATOM   2310  O  O     . ILE B 2 94  ? 13.270  42.422 7.517   1.00 226.97 ? 611  ILE C O     1 
ATOM   2311  C  CB    . ILE B 2 94  ? 16.343  41.347 6.991   1.00 234.88 ? 611  ILE C CB    1 
ATOM   2312  C  CG1   . ILE B 2 94  ? 17.163  40.873 5.787   1.00 236.20 ? 611  ILE C CG1   1 
ATOM   2313  C  CG2   . ILE B 2 94  ? 15.468  40.206 7.503   1.00 234.75 ? 611  ILE C CG2   1 
ATOM   2314  C  CD1   . ILE B 2 94  ? 18.197  39.816 6.115   1.00 240.39 ? 611  ILE C CD1   1 
ATOM   2315  N  N     . GLU B 2 95  ? 14.820  43.508 8.746   1.00 230.46 ? 612  GLU C N     1 
ATOM   2316  C  CA    . GLU B 2 95  ? 13.908  43.845 9.839   1.00 229.15 ? 612  GLU C CA    1 
ATOM   2317  C  C     . GLU B 2 95  ? 12.795  44.778 9.361   1.00 224.62 ? 612  GLU C C     1 
ATOM   2318  O  O     . GLU B 2 95  ? 11.629  44.574 9.688   1.00 223.09 ? 612  GLU C O     1 
ATOM   2319  C  CB    . GLU B 2 95  ? 14.675  44.499 10.996  1.00 231.74 ? 612  GLU C CB    1 
ATOM   2320  C  CG    . GLU B 2 95  ? 13.936  44.505 12.329  1.00 231.67 ? 612  GLU C CG    1 
ATOM   2321  C  CD    . GLU B 2 95  ? 14.079  43.206 13.106  1.00 234.41 ? 612  GLU C CD    1 
ATOM   2322  O  OE1   . GLU B 2 95  ? 14.335  42.150 12.489  1.00 235.65 ? 612  GLU C OE1   1 
ATOM   2323  O  OE2   . GLU B 2 95  ? 13.929  43.243 14.347  1.00 235.45 ? 612  GLU C OE2   1 
ATOM   2324  N  N     . HIS B 2 96  ? 13.165  45.794 8.583   1.00 222.46 ? 613  HIS C N     1 
ATOM   2325  C  CA    . HIS B 2 96  ? 12.207  46.778 8.073   1.00 218.03 ? 613  HIS C CA    1 
ATOM   2326  C  C     . HIS B 2 96  ? 11.335  46.197 6.955   1.00 215.02 ? 613  HIS C C     1 
ATOM   2327  O  O     . HIS B 2 96  ? 10.152  46.522 6.853   1.00 212.32 ? 613  HIS C O     1 
ATOM   2328  C  CB    . HIS B 2 96  ? 12.947  48.025 7.571   1.00 217.72 ? 613  HIS C CB    1 
ATOM   2329  C  CG    . HIS B 2 96  ? 12.102  49.261 7.535   1.00 214.60 ? 613  HIS C CG    1 
ATOM   2330  N  ND1   . HIS B 2 96  ? 11.800  49.989 8.666   1.00 214.38 ? 613  HIS C ND1   1 
ATOM   2331  C  CD2   . HIS B 2 96  ? 11.509  49.907 6.504   1.00 211.74 ? 613  HIS C CD2   1 
ATOM   2332  C  CE1   . HIS B 2 96  ? 11.049  51.024 8.334   1.00 211.74 ? 613  HIS C CE1   1 
ATOM   2333  N  NE2   . HIS B 2 96  ? 10.857  50.997 7.028   1.00 210.27 ? 613  HIS C NE2   1 
ATOM   2334  N  N     . PHE B 2 97  ? 11.926  45.336 6.128   1.00 215.24 ? 614  PHE C N     1 
ATOM   2335  C  CA    . PHE B 2 97  ? 11.229  44.717 4.997   1.00 212.86 ? 614  PHE C CA    1 
ATOM   2336  C  C     . PHE B 2 97  ? 10.170  43.717 5.453   1.00 212.48 ? 614  PHE C C     1 
ATOM   2337  O  O     . PHE B 2 97  ? 9.000   43.832 5.080   1.00 210.23 ? 614  PHE C O     1 
ATOM   2338  C  CB    . PHE B 2 97  ? 12.242  44.024 4.077   1.00 214.25 ? 614  PHE C CB    1 
ATOM   2339  C  CG    . PHE B 2 97  ? 11.629  43.368 2.869   1.00 212.34 ? 614  PHE C CG    1 
ATOM   2340  C  CD1   . PHE B 2 97  ? 11.487  44.066 1.676   1.00 210.34 ? 614  PHE C CD1   1 
ATOM   2341  C  CD2   . PHE B 2 97  ? 11.211  42.044 2.918   1.00 212.73 ? 614  PHE C CD2   1 
ATOM   2342  C  CE1   . PHE B 2 97  ? 10.930  43.461 0.561   1.00 208.88 ? 614  PHE C CE1   1 
ATOM   2343  C  CE2   . PHE B 2 97  ? 10.651  41.435 1.808   1.00 211.26 ? 614  PHE C CE2   1 
ATOM   2344  C  CZ    . PHE B 2 97  ? 10.510  42.143 0.626   1.00 209.33 ? 614  PHE C CZ    1 
ATOM   2345  N  N     . MET B 2 98  ? 10.587  42.739 6.253   1.00 215.22 ? 615  MET C N     1 
ATOM   2346  C  CA    . MET B 2 98  ? 9.689   41.680 6.720   1.00 215.44 ? 615  MET C CA    1 
ATOM   2347  C  C     . MET B 2 98  ? 8.601   42.202 7.662   1.00 213.54 ? 615  MET C C     1 
ATOM   2348  O  O     . MET B 2 98  ? 7.529   41.603 7.763   1.00 212.24 ? 615  MET C O     1 
ATOM   2349  C  CB    . MET B 2 98  ? 10.484  40.564 7.406   1.00 219.37 ? 615  MET C CB    1 
ATOM   2350  C  CG    . MET B 2 98  ? 11.411  39.806 6.468   1.00 221.52 ? 615  MET C CG    1 
ATOM   2351  S  SD    . MET B 2 98  ? 12.236  38.415 7.267   1.00 226.29 ? 615  MET C SD    1 
ATOM   2352  C  CE    . MET B 2 98  ? 13.249  37.800 5.924   1.00 227.74 ? 615  MET C CE    1 
ATOM   2353  N  N     . LYS B 2 99  ? 8.880   43.312 8.346   1.00 213.26 ? 616  LYS C N     1 
ATOM   2354  C  CA    . LYS B 2 99  ? 7.898   43.958 9.218   1.00 211.67 ? 616  LYS C CA    1 
ATOM   2355  C  C     . LYS B 2 99  ? 6.847   44.696 8.392   1.00 207.86 ? 616  LYS C C     1 
ATOM   2356  O  O     . LYS B 2 99  ? 5.648   44.547 8.633   1.00 206.32 ? 616  LYS C O     1 
ATOM   2357  C  CB    . LYS B 2 99  ? 8.595   44.928 10.175  1.00 212.97 ? 616  LYS C CB    1 
ATOM   2358  C  CG    . LYS B 2 99  ? 7.700   45.507 11.259  1.00 212.03 ? 616  LYS C CG    1 
ATOM   2359  C  CD    . LYS B 2 99  ? 8.513   46.329 12.245  1.00 213.67 ? 616  LYS C CD    1 
ATOM   2360  C  CE    . LYS B 2 99  ? 7.668   46.797 13.417  1.00 212.99 ? 616  LYS C CE    1 
ATOM   2361  N  NZ    . LYS B 2 99  ? 8.475   47.566 14.404  1.00 214.69 ? 616  LYS C NZ    1 
ATOM   2362  N  N     . LEU B 2 100 ? 7.304   45.496 7.428   1.00 206.14 ? 617  LEU C N     1 
ATOM   2363  C  CA    . LEU B 2 100 ? 6.406   46.185 6.494   1.00 202.38 ? 617  LEU C CA    1 
ATOM   2364  C  C     . LEU B 2 100 ? 5.562   45.193 5.706   1.00 200.60 ? 617  LEU C C     1 
ATOM   2365  O  O     . LEU B 2 100 ? 4.367   45.408 5.509   1.00 198.11 ? 617  LEU C O     1 
ATOM   2366  C  CB    . LEU B 2 100 ? 7.196   47.057 5.512   1.00 201.91 ? 617  LEU C CB    1 
ATOM   2367  C  CG    . LEU B 2 100 ? 7.571   48.462 5.982   1.00 201.78 ? 617  LEU C CG    1 
ATOM   2368  C  CD1   . LEU B 2 100 ? 8.655   49.034 5.084   1.00 202.55 ? 617  LEU C CD1   1 
ATOM   2369  C  CD2   . LEU B 2 100 ? 6.350   49.370 6.006   1.00 199.11 ? 617  LEU C CD2   1 
ATOM   2370  N  N     . TYR B 2 101 ? 6.199   44.117 5.251   1.00 201.76 ? 618  TYR C N     1 
ATOM   2371  C  CA    . TYR B 2 101 ? 5.515   43.055 4.520   1.00 201.08 ? 618  TYR C CA    1 
ATOM   2372  C  C     . TYR B 2 101 ? 4.331   42.532 5.332   1.00 200.72 ? 618  TYR C C     1 
ATOM   2373  O  O     . TYR B 2 101 ? 3.183   42.694 4.923   1.00 198.71 ? 618  TYR C O     1 
ATOM   2374  C  CB    . TYR B 2 101 ? 6.497   41.924 4.189   1.00 203.40 ? 618  TYR C CB    1 
ATOM   2375  C  CG    . TYR B 2 101 ? 5.934   40.830 3.305   1.00 202.75 ? 618  TYR C CG    1 
ATOM   2376  C  CD1   . TYR B 2 101 ? 5.738   41.041 1.941   1.00 200.96 ? 618  TYR C CD1   1 
ATOM   2377  C  CD2   . TYR B 2 101 ? 5.618   39.578 3.827   1.00 204.10 ? 618  TYR C CD2   1 
ATOM   2378  C  CE1   . TYR B 2 101 ? 5.231   40.041 1.125   1.00 200.64 ? 618  TYR C CE1   1 
ATOM   2379  C  CE2   . TYR B 2 101 ? 5.113   38.571 3.017   1.00 203.78 ? 618  TYR C CE2   1 
ATOM   2380  C  CZ    . TYR B 2 101 ? 4.920   38.808 1.668   1.00 202.04 ? 618  TYR C CZ    1 
ATOM   2381  O  OH    . TYR B 2 101 ? 4.416   37.814 0.857   1.00 201.86 ? 618  TYR C OH    1 
ATOM   2382  N  N     . GLU B 2 102 ? 4.616   41.947 6.496   1.00 202.84 ? 619  GLU C N     1 
ATOM   2383  C  CA    . GLU B 2 102 ? 3.586   41.351 7.354   1.00 203.12 ? 619  GLU C CA    1 
ATOM   2384  C  C     . GLU B 2 102 ? 2.517   42.355 7.787   1.00 200.88 ? 619  GLU C C     1 
ATOM   2385  O  O     . GLU B 2 102 ? 1.342   42.003 7.887   1.00 200.03 ? 619  GLU C O     1 
ATOM   2386  C  CB    . GLU B 2 102 ? 4.228   40.711 8.592   1.00 206.26 ? 619  GLU C CB    1 
ATOM   2387  C  CG    . GLU B 2 102 ? 3.246   40.006 9.521   1.00 207.03 ? 619  GLU C CG    1 
ATOM   2388  C  CD    . GLU B 2 102 ? 3.920   39.362 10.720  1.00 210.37 ? 619  GLU C CD    1 
ATOM   2389  O  OE1   . GLU B 2 102 ? 5.018   38.787 10.559  1.00 213.12 ? 619  GLU C OE1   1 
ATOM   2390  O  OE2   . GLU B 2 102 ? 3.346   39.424 11.828  1.00 210.91 ? 619  GLU C OE2   1 
ATOM   2391  N  N     . GLU B 2 103 ? 2.929   43.594 8.047   1.00 199.88 ? 620  GLU C N     1 
ATOM   2392  C  CA    . GLU B 2 103 ? 1.998   44.667 8.401   1.00 197.36 ? 620  GLU C CA    1 
ATOM   2393  C  C     . GLU B 2 103 ? 0.972   44.912 7.293   1.00 194.35 ? 620  GLU C C     1 
ATOM   2394  O  O     . GLU B 2 103 ? -0.185  45.228 7.575   1.00 193.15 ? 620  GLU C O     1 
ATOM   2395  C  CB    . GLU B 2 103 ? 2.769   45.961 8.694   1.00 197.54 ? 620  GLU C CB    1 
ATOM   2396  C  CG    . GLU B 2 103 ? 1.901   47.147 9.097   1.00 195.92 ? 620  GLU C CG    1 
ATOM   2397  C  CD    . GLU B 2 103 ? 2.705   48.410 9.359   1.00 196.21 ? 620  GLU C CD    1 
ATOM   2398  O  OE1   . GLU B 2 103 ? 3.873   48.306 9.790   1.00 198.26 ? 620  GLU C OE1   1 
ATOM   2399  O  OE2   . GLU B 2 103 ? 2.164   49.513 9.136   1.00 194.54 ? 620  GLU C OE2   1 
ATOM   2400  N  N     . LYS B 2 104 ? 1.402   44.753 6.042   1.00 193.25 ? 621  LYS C N     1 
ATOM   2401  C  CA    . LYS B 2 104 ? 0.566   45.053 4.882   1.00 190.42 ? 621  LYS C CA    1 
ATOM   2402  C  C     . LYS B 2 104 ? -0.158  43.807 4.364   1.00 190.12 ? 621  LYS C C     1 
ATOM   2403  O  O     . LYS B 2 104 ? -1.353  43.861 4.076   1.00 188.39 ? 621  LYS C O     1 
ATOM   2404  C  CB    . LYS B 2 104 ? 1.418   45.674 3.763   1.00 189.74 ? 621  LYS C CB    1 
ATOM   2405  C  CG    . LYS B 2 104 ? 0.834   46.930 3.126   1.00 187.53 ? 621  LYS C CG    1 
ATOM   2406  C  CD    . LYS B 2 104 ? 0.580   48.063 4.119   1.00 186.80 ? 621  LYS C CD    1 
ATOM   2407  C  CE    . LYS B 2 104 ? 1.831   48.512 4.861   1.00 188.32 ? 621  LYS C CE    1 
ATOM   2408  N  NZ    . LYS B 2 104 ? 1.501   49.477 5.947   1.00 188.01 ? 621  LYS C NZ    1 
ATOM   2409  N  N     . THR B 2 105 ? 0.565   42.694 4.253   1.00 191.82 ? 622  THR C N     1 
ATOM   2410  C  CA    . THR B 2 105 ? 0.013   41.464 3.671   1.00 192.26 ? 622  THR C CA    1 
ATOM   2411  C  C     . THR B 2 105 ? -0.642  40.538 4.708   1.00 193.82 ? 622  THR C C     1 
ATOM   2412  O  O     . THR B 2 105 ? -1.570  39.798 4.375   1.00 193.30 ? 622  THR C O     1 
ATOM   2413  C  CB    . THR B 2 105 ? 1.080   40.695 2.851   1.00 193.73 ? 622  THR C CB    1 
ATOM   2414  O  OG1   . THR B 2 105 ? 0.442   39.718 2.020   1.00 193.62 ? 622  THR C OG1   1 
ATOM   2415  C  CG2   . THR B 2 105 ? 2.108   40.004 3.743   1.00 196.59 ? 622  THR C CG2   1 
ATOM   2416  N  N     . GLY B 2 106 ? -0.153  40.573 5.948   1.00 196.04 ? 623  GLY C N     1 
ATOM   2417  C  CA    . GLY B 2 106 ? -0.709  39.762 7.038   1.00 198.14 ? 623  GLY C CA    1 
ATOM   2418  C  C     . GLY B 2 106 ? 0.117   38.537 7.390   1.00 201.80 ? 623  GLY C C     1 
ATOM   2419  O  O     . GLY B 2 106 ? 0.181   38.140 8.556   1.00 203.76 ? 623  GLY C O     1 
ATOM   2420  N  N     . ASN B 2 107 ? 0.743   37.936 6.379   1.00 203.53 ? 624  ASN C N     1 
ATOM   2421  C  CA    . ASN B 2 107 ? 1.549   36.729 6.553   1.00 207.18 ? 624  ASN C CA    1 
ATOM   2422  C  C     . ASN B 2 107 ? 3.027   37.025 6.779   1.00 209.40 ? 624  ASN C C     1 
ATOM   2423  O  O     . ASN B 2 107 ? 3.474   38.166 6.654   1.00 208.18 ? 624  ASN C O     1 
ATOM   2424  C  CB    . ASN B 2 107 ? 1.418   35.831 5.322   1.00 207.37 ? 624  ASN C CB    1 
ATOM   2425  C  CG    . ASN B 2 107 ? -0.021  35.525 4.972   1.00 206.22 ? 624  ASN C CG    1 
ATOM   2426  O  OD1   . ASN B 2 107 ? -0.830  36.433 4.779   1.00 203.96 ? 624  ASN C OD1   1 
ATOM   2427  N  ND2   . ASN B 2 107 ? -0.346  34.243 4.877   1.00 208.03 ? 624  ASN C ND2   1 
ATOM   2428  N  N     . ALA B 2 108 ? 3.779   35.977 7.107   1.00 213.14 ? 625  ALA C N     1 
ATOM   2429  C  CA    . ALA B 2 108 ? 5.233   36.062 7.207   1.00 215.99 ? 625  ALA C CA    1 
ATOM   2430  C  C     . ALA B 2 108 ? 5.846   35.967 5.815   1.00 216.21 ? 625  ALA C C     1 
ATOM   2431  O  O     . ALA B 2 108 ? 5.171   35.591 4.853   1.00 214.76 ? 625  ALA C O     1 
ATOM   2432  C  CB    . ALA B 2 108 ? 5.770   34.955 8.101   1.00 219.64 ? 625  ALA C CB    1 
ATOM   2433  N  N     . TRP B 2 109 ? 7.130   36.301 5.715   1.00 218.51 ? 626  TRP C N     1 
ATOM   2434  C  CA    . TRP B 2 109 ? 7.825   36.318 4.429   1.00 219.03 ? 626  TRP C CA    1 
ATOM   2435  C  C     . TRP B 2 109 ? 7.950   34.912 3.832   1.00 221.21 ? 626  TRP C C     1 
ATOM   2436  O  O     . TRP B 2 109 ? 7.811   34.739 2.621   1.00 219.97 ? 626  TRP C O     1 
ATOM   2437  C  CB    . TRP B 2 109 ? 9.197   36.989 4.574   1.00 220.56 ? 626  TRP C CB    1 
ATOM   2438  C  CG    . TRP B 2 109 ? 9.987   37.030 3.306   1.00 220.73 ? 626  TRP C CG    1 
ATOM   2439  C  CD1   . TRP B 2 109 ? 11.189  36.428 3.075   1.00 223.57 ? 626  TRP C CD1   1 
ATOM   2440  C  CD2   . TRP B 2 109 ? 9.630   37.696 2.087   1.00 218.14 ? 626  TRP C CD2   1 
ATOM   2441  N  NE1   . TRP B 2 109 ? 11.605  36.683 1.793   1.00 222.83 ? 626  TRP C NE1   1 
ATOM   2442  C  CE2   . TRP B 2 109 ? 10.667  37.458 1.165   1.00 219.43 ? 626  TRP C CE2   1 
ATOM   2443  C  CE3   . TRP B 2 109 ? 8.534   38.472 1.686   1.00 215.06 ? 626  TRP C CE3   1 
ATOM   2444  C  CZ2   . TRP B 2 109 ? 10.645  37.967 -0.134  1.00 217.58 ? 626  TRP C CZ2   1 
ATOM   2445  C  CZ3   . TRP B 2 109 ? 8.513   38.980 0.390   1.00 213.28 ? 626  TRP C CZ3   1 
ATOM   2446  C  CH2   . TRP B 2 109 ? 9.563   38.724 -0.502  1.00 214.51 ? 626  TRP C CH2   1 
ATOM   2447  N  N     . HIS B 2 110 ? 8.217   33.921 4.681   1.00 224.78 ? 627  HIS C N     1 
ATOM   2448  C  CA    . HIS B 2 110 ? 8.183   32.510 4.278   1.00 227.01 ? 627  HIS C CA    1 
ATOM   2449  C  C     . HIS B 2 110 ? 6.837   31.861 4.642   1.00 226.54 ? 627  HIS C C     1 
ATOM   2450  O  O     . HIS B 2 110 ? 6.311   32.092 5.732   1.00 226.65 ? 627  HIS C O     1 
ATOM   2451  C  CB    . HIS B 2 110 ? 9.315   31.748 4.978   1.00 231.28 ? 627  HIS C CB    1 
ATOM   2452  C  CG    . HIS B 2 110 ? 10.615  32.490 5.017   1.00 232.78 ? 627  HIS C CG    1 
ATOM   2453  N  ND1   . HIS B 2 110 ? 11.505  32.497 3.964   1.00 233.36 ? 627  HIS C ND1   1 
ATOM   2454  C  CD2   . HIS B 2 110 ? 11.176  33.248 5.989   1.00 233.92 ? 627  HIS C CD2   1 
ATOM   2455  C  CE1   . HIS B 2 110 ? 12.557  33.230 4.286   1.00 234.68 ? 627  HIS C CE1   1 
ATOM   2456  N  NE2   . HIS B 2 110 ? 12.382  33.696 5.509   1.00 234.99 ? 627  HIS C NE2   1 
ATOM   2457  N  N     . SER B 2 111 ? 6.281   31.061 3.731   1.00 226.23 ? 628  SER C N     1 
ATOM   2458  C  CA    . SER B 2 111 ? 5.051   30.300 4.007   1.00 226.18 ? 628  SER C CA    1 
ATOM   2459  C  C     . SER B 2 111 ? 4.838   29.108 3.056   1.00 227.15 ? 628  SER C C     1 
ATOM   2460  O  O     . SER B 2 111 ? 5.248   29.130 1.889   1.00 226.52 ? 628  SER C O     1 
ATOM   2461  C  CB    . SER B 2 111 ? 3.825   31.234 3.951   1.00 222.67 ? 628  SER C CB    1 
ATOM   2462  O  OG    . SER B 2 111 ? 3.282   31.297 2.644   1.00 220.04 ? 628  SER C OG    1 
ATOM   2463  N  N     . LYS B 2 112 ? 4.165   28.078 3.565   1.00 228.92 ? 629  LYS C N     1 
ATOM   2464  C  CA    . LYS B 2 112 ? 3.919   26.849 2.801   1.00 230.07 ? 629  LYS C CA    1 
ATOM   2465  C  C     . LYS B 2 112 ? 2.792   27.061 1.803   1.00 226.80 ? 629  LYS C C     1 
ATOM   2466  O  O     . LYS B 2 112 ? 2.887   26.627 0.660   1.00 226.53 ? 629  LYS C O     1 
ATOM   2467  C  CB    . LYS B 2 112 ? 3.549   25.691 3.730   1.00 233.17 ? 629  LYS C CB    1 
ATOM   2468  C  CG    . LYS B 2 112 ? 3.451   24.331 3.053   1.00 235.04 ? 629  LYS C CG    1 
ATOM   2469  C  CD    . LYS B 2 112 ? 3.310   23.198 4.060   1.00 238.66 ? 629  LYS C CD    1 
ATOM   2470  C  CE    . LYS B 2 112 ? 3.252   21.844 3.370   1.00 240.72 ? 629  LYS C CE    1 
ATOM   2471  N  NZ    . LYS B 2 112 ? 3.509   20.722 4.316   1.00 244.84 ? 629  LYS C NZ    1 
ATOM   2472  N  N     . ASN B 2 113 ? 1.720   27.704 2.261   1.00 224.13 ? 630  ASN C N     1 
ATOM   2473  C  CA    . ASN B 2 113 ? 0.636   28.162 1.395   1.00 220.31 ? 630  ASN C CA    1 
ATOM   2474  C  C     . ASN B 2 113 ? 0.152   29.492 1.940   1.00 216.91 ? 630  ASN C C     1 
ATOM   2475  O  O     . ASN B 2 113 ? 0.085   29.674 3.156   1.00 217.93 ? 630  ASN C O     1 
ATOM   2476  C  CB    . ASN B 2 113 ? -0.531  27.160 1.316   1.00 221.05 ? 630  ASN C CB    1 
ATOM   2477  C  CG    . ASN B 2 113 ? -0.991  26.669 2.682   1.00 223.31 ? 630  ASN C CG    1 
ATOM   2478  O  OD1   . ASN B 2 113 ? -0.199  26.148 3.465   1.00 226.43 ? 630  ASN C OD1   1 
ATOM   2479  N  ND2   . ASN B 2 113 ? -2.282  26.815 2.964   1.00 222.25 ? 630  ASN C ND2   1 
ATOM   2480  N  N     . PHE B 2 114 ? -0.163  30.421 1.043   1.00 212.51 ? 631  PHE C N     1 
ATOM   2481  C  CA    . PHE B 2 114 ? -0.576  31.759 1.446   1.00 208.76 ? 631  PHE C CA    1 
ATOM   2482  C  C     . PHE B 2 114 ? -2.044  31.790 1.867   1.00 206.52 ? 631  PHE C C     1 
ATOM   2483  O  O     . PHE B 2 114 ? -2.854  30.991 1.394   1.00 206.82 ? 631  PHE C O     1 
ATOM   2484  C  CB    . PHE B 2 114 ? -0.328  32.772 0.323   1.00 206.17 ? 631  PHE C CB    1 
ATOM   2485  C  CG    . PHE B 2 114 ? -0.479  34.198 0.764   1.00 203.94 ? 631  PHE C CG    1 
ATOM   2486  C  CD1   . PHE B 2 114 ? 0.596   34.890 1.304   1.00 204.23 ? 631  PHE C CD1   1 
ATOM   2487  C  CD2   . PHE B 2 114 ? -1.707  34.839 0.671   1.00 201.71 ? 631  PHE C CD2   1 
ATOM   2488  C  CE1   . PHE B 2 114 ? 0.453   36.200 1.725   1.00 202.44 ? 631  PHE C CE1   1 
ATOM   2489  C  CE2   . PHE B 2 114 ? -1.856  36.146 1.095   1.00 199.98 ? 631  PHE C CE2   1 
ATOM   2490  C  CZ    . PHE B 2 114 ? -0.776  36.827 1.624   1.00 200.28 ? 631  PHE C CZ    1 
ATOM   2491  N  N     . THR B 2 115 ? -2.366  32.721 2.763   1.00 203.98 ? 632  THR C N     1 
ATOM   2492  C  CA    . THR B 2 115 ? -3.732  32.944 3.228   1.00 201.81 ? 632  THR C CA    1 
ATOM   2493  C  C     . THR B 2 115 ? -4.033  34.442 3.307   1.00 197.64 ? 632  THR C C     1 
ATOM   2494  O  O     . THR B 2 115 ? -3.335  35.186 3.996   1.00 197.48 ? 632  THR C O     1 
ATOM   2495  C  CB    . THR B 2 115 ? -3.963  32.319 4.618   1.00 204.26 ? 632  THR C CB    1 
ATOM   2496  O  OG1   . THR B 2 115 ? -2.946  32.766 5.523   1.00 205.57 ? 632  THR C OG1   1 
ATOM   2497  C  CG2   . THR B 2 115 ? -3.934  30.801 4.537   1.00 206.71 ? 632  THR C CG2   1 
ATOM   2498  N  N     . LYS B 2 116 ? -5.071  34.871 2.592   1.00 193.64 ? 633  LYS C N     1 
ATOM   2499  C  CA    . LYS B 2 116 ? -5.536  36.261 2.620   1.00 189.75 ? 633  LYS C CA    1 
ATOM   2500  C  C     . LYS B 2 116 ? -6.093  36.606 4.005   1.00 188.87 ? 633  LYS C C     1 
ATOM   2501  O  O     . LYS B 2 116 ? -6.630  35.737 4.695   1.00 190.28 ? 633  LYS C O     1 
ATOM   2502  C  CB    . LYS B 2 116 ? -6.598  36.466 1.524   1.00 187.65 ? 633  LYS C CB    1 
ATOM   2503  C  CG    . LYS B 2 116 ? -7.472  37.711 1.632   1.00 185.46 ? 633  LYS C CG    1 
ATOM   2504  C  CD    . LYS B 2 116 ? -6.762  38.979 1.190   1.00 183.64 ? 633  LYS C CD    1 
ATOM   2505  C  CE    . LYS B 2 116 ? -7.740  40.144 1.174   1.00 181.57 ? 633  LYS C CE    1 
ATOM   2506  N  NZ    . LYS B 2 116 ? -7.159  41.392 0.615   1.00 179.87 ? 633  LYS C NZ    1 
ATOM   2507  N  N     . TYR B 2 117 ? -5.949  37.868 4.409   1.00 186.23 ? 634  TYR C N     1 
ATOM   2508  C  CA    . TYR B 2 117 ? -6.497  38.353 5.679   1.00 185.49 ? 634  TYR C CA    1 
ATOM   2509  C  C     . TYR B 2 117 ? -7.362  39.602 5.472   1.00 182.01 ? 634  TYR C C     1 
ATOM   2510  O  O     . TYR B 2 117 ? -7.083  40.400 4.576   1.00 180.40 ? 634  TYR C O     1 
ATOM   2511  C  CB    . TYR B 2 117 ? -5.369  38.663 6.666   1.00 186.88 ? 634  TYR C CB    1 
ATOM   2512  C  CG    . TYR B 2 117 ? -4.694  37.433 7.228   1.00 189.93 ? 634  TYR C CG    1 
ATOM   2513  C  CD1   . TYR B 2 117 ? -5.340  36.627 8.163   1.00 191.74 ? 634  TYR C CD1   1 
ATOM   2514  C  CD2   . TYR B 2 117 ? -3.407  37.079 6.836   1.00 191.15 ? 634  TYR C CD2   1 
ATOM   2515  C  CE1   . TYR B 2 117 ? -4.727  35.501 8.686   1.00 194.46 ? 634  TYR C CE1   1 
ATOM   2516  C  CE2   . TYR B 2 117 ? -2.786  35.955 7.355   1.00 193.81 ? 634  TYR C CE2   1 
ATOM   2517  C  CZ    . TYR B 2 117 ? -3.449  35.169 8.278   1.00 195.47 ? 634  TYR C CZ    1 
ATOM   2518  O  OH    . TYR B 2 117 ? -2.834  34.052 8.795   1.00 198.28 ? 634  TYR C OH    1 
ATOM   2519  N  N     . PRO B 2 118 ? -8.416  39.769 6.301   1.00 180.52 ? 635  PRO C N     1 
ATOM   2520  C  CA    . PRO B 2 118 ? -9.327  40.918 6.260   1.00 177.78 ? 635  PRO C CA    1 
ATOM   2521  C  C     . PRO B 2 118 ? -8.640  42.279 6.114   1.00 175.19 ? 635  PRO C C     1 
ATOM   2522  O  O     . PRO B 2 118 ? -7.841  42.667 6.966   1.00 175.86 ? 635  PRO C O     1 
ATOM   2523  C  CB    . PRO B 2 118 ? -10.041 40.829 7.608   1.00 178.98 ? 635  PRO C CB    1 
ATOM   2524  C  CG    . PRO B 2 118 ? -10.120 39.369 7.872   1.00 181.35 ? 635  PRO C CG    1 
ATOM   2525  C  CD    . PRO B 2 118 ? -8.878  38.760 7.274   1.00 182.31 ? 635  PRO C CD    1 
ATOM   2526  N  N     . LYS B 2 119 ? -8.953  42.979 5.025   1.00 172.17 ? 636  LYS C N     1 
ATOM   2527  C  CA    . LYS B 2 119 ? -8.403  44.311 4.720   1.00 169.80 ? 636  LYS C CA    1 
ATOM   2528  C  C     . LYS B 2 119 ? -6.876  44.393 4.562   1.00 169.53 ? 636  LYS C C     1 
ATOM   2529  O  O     . LYS B 2 119 ? -6.334  45.479 4.343   1.00 168.13 ? 636  LYS C O     1 
ATOM   2530  C  CB    . LYS B 2 119 ? -8.908  45.362 5.729   1.00 169.14 ? 636  LYS C CB    1 
ATOM   2531  C  CG    . LYS B 2 119 ? -10.200 46.037 5.297   1.00 167.77 ? 636  LYS C CG    1 
ATOM   2532  C  CD    . LYS B 2 119 ? -9.972  46.961 4.104   1.00 166.33 ? 636  LYS C CD    1 
ATOM   2533  C  CE    . LYS B 2 119 ? -10.987 46.725 2.996   1.00 165.50 ? 636  LYS C CE    1 
ATOM   2534  N  NZ    . LYS B 2 119 ? -10.519 47.278 1.695   1.00 164.23 ? 636  LYS C NZ    1 
ATOM   2535  N  N     . LYS B 2 120 ? -6.191  43.256 4.651   1.00 170.58 ? 637  LYS C N     1 
ATOM   2536  C  CA    . LYS B 2 120 ? -4.769  43.190 4.329   1.00 171.27 ? 637  LYS C CA    1 
ATOM   2537  C  C     . LYS B 2 120 ? -4.612  42.917 2.837   1.00 170.72 ? 637  LYS C C     1 
ATOM   2538  O  O     . LYS B 2 120 ? -5.563  42.513 2.172   1.00 170.21 ? 637  LYS C O     1 
ATOM   2539  C  CB    . LYS B 2 120 ? -4.065  42.098 5.142   1.00 173.47 ? 637  LYS C CB    1 
ATOM   2540  C  CG    . LYS B 2 120 ? -3.326  42.599 6.376   1.00 174.46 ? 637  LYS C CG    1 
ATOM   2541  C  CD    . LYS B 2 120 ? -4.204  42.640 7.617   1.00 174.70 ? 637  LYS C CD    1 
ATOM   2542  C  CE    . LYS B 2 120 ? -3.389  42.987 8.853   1.00 175.96 ? 637  LYS C CE    1 
ATOM   2543  N  NZ    . LYS B 2 120 ? -4.116  42.688 10.118  1.00 176.87 ? 637  LYS C NZ    1 
ATOM   2544  N  N     . PHE B 2 121 ? -3.408  43.137 2.319   1.00 170.87 ? 638  PHE C N     1 
ATOM   2545  C  CA    . PHE B 2 121 ? -3.127  42.947 0.894   1.00 170.18 ? 638  PHE C CA    1 
ATOM   2546  C  C     . PHE B 2 121 ? -2.904  41.479 0.533   1.00 172.53 ? 638  PHE C C     1 
ATOM   2547  O  O     . PHE B 2 121 ? -2.798  40.620 1.410   1.00 174.28 ? 638  PHE C O     1 
ATOM   2548  C  CB    . PHE B 2 121 ? -1.903  43.767 0.476   1.00 169.41 ? 638  PHE C CB    1 
ATOM   2549  C  CG    . PHE B 2 121 ? -2.193  45.224 0.261   1.00 167.19 ? 638  PHE C CG    1 
ATOM   2550  C  CD1   . PHE B 2 121 ? -2.395  46.072 1.340   1.00 166.90 ? 638  PHE C CD1   1 
ATOM   2551  C  CD2   . PHE B 2 121 ? -2.257  45.752 -1.022  1.00 165.78 ? 638  PHE C CD2   1 
ATOM   2552  C  CE1   . PHE B 2 121 ? -2.659  47.418 1.146   1.00 165.33 ? 638  PHE C CE1   1 
ATOM   2553  C  CE2   . PHE B 2 121 ? -2.521  47.096 -1.223  1.00 164.42 ? 638  PHE C CE2   1 
ATOM   2554  C  CZ    . PHE B 2 121 ? -2.721  47.931 -0.138  1.00 164.07 ? 638  PHE C CZ    1 
ATOM   2555  N  N     . TYR B 2 122 ? -2.847  41.212 -0.772  1.00 173.12 ? 639  TYR C N     1 
ATOM   2556  C  CA    . TYR B 2 122 ? -2.516  39.892 -1.310  1.00 175.15 ? 639  TYR C CA    1 
ATOM   2557  C  C     . TYR B 2 122 ? -1.399  40.037 -2.351  1.00 176.26 ? 639  TYR C C     1 
ATOM   2558  O  O     . TYR B 2 122 ? -1.513  40.855 -3.266  1.00 174.70 ? 639  TYR C O     1 
ATOM   2559  C  CB    . TYR B 2 122 ? -3.752  39.249 -1.947  1.00 174.28 ? 639  TYR C CB    1 
ATOM   2560  C  CG    . TYR B 2 122 ? -3.479  37.932 -2.651  1.00 175.18 ? 639  TYR C CG    1 
ATOM   2561  C  CD1   . TYR B 2 122 ? -3.170  37.895 -4.013  1.00 174.47 ? 639  TYR C CD1   1 
ATOM   2562  C  CD2   . TYR B 2 122 ? -3.535  36.725 -1.958  1.00 176.86 ? 639  TYR C CD2   1 
ATOM   2563  C  CE1   . TYR B 2 122 ? -2.919  36.695 -4.664  1.00 175.40 ? 639  TYR C CE1   1 
ATOM   2564  C  CE2   . TYR B 2 122 ? -3.287  35.519 -2.600  1.00 177.92 ? 639  TYR C CE2   1 
ATOM   2565  C  CZ    . TYR B 2 122 ? -2.979  35.511 -3.952  1.00 177.20 ? 639  TYR C CZ    1 
ATOM   2566  O  OH    . TYR B 2 122 ? -2.731  34.323 -4.601  1.00 178.54 ? 639  TYR C OH    1 
ATOM   2567  N  N     . PRO B 2 123 ? -0.320  39.240 -2.222  1.00 179.41 ? 640  PRO C N     1 
ATOM   2568  C  CA    . PRO B 2 123 ? 0.821   39.342 -3.132  1.00 180.84 ? 640  PRO C CA    1 
ATOM   2569  C  C     . PRO B 2 123 ? 0.571   38.688 -4.493  1.00 181.96 ? 640  PRO C C     1 
ATOM   2570  O  O     . PRO B 2 123 ? 0.093   37.556 -4.552  1.00 182.74 ? 640  PRO C O     1 
ATOM   2571  C  CB    . PRO B 2 123 ? 1.925   38.594 -2.381  1.00 182.99 ? 640  PRO C CB    1 
ATOM   2572  C  CG    . PRO B 2 123 ? 1.197   37.568 -1.587  1.00 183.69 ? 640  PRO C CG    1 
ATOM   2573  C  CD    . PRO B 2 123 ? -0.108  38.203 -1.195  1.00 181.67 ? 640  PRO C CD    1 
ATOM   2574  N  N     . LEU B 2 124 ? 0.901   39.400 -5.569  1.00 182.95 ? 641  LEU C N     1 
ATOM   2575  C  CA    . LEU B 2 124 ? 0.766   38.870 -6.929  1.00 184.23 ? 641  LEU C CA    1 
ATOM   2576  C  C     . LEU B 2 124 ? 2.061   38.192 -7.366  1.00 187.86 ? 641  LEU C C     1 
ATOM   2577  O  O     . LEU B 2 124 ? 3.153   38.716 -7.138  1.00 188.99 ? 641  LEU C O     1 
ATOM   2578  C  CB    . LEU B 2 124 ? 0.394   39.985 -7.913  1.00 182.25 ? 641  LEU C CB    1 
ATOM   2579  C  CG    . LEU B 2 124 ? -0.810  40.852 -7.527  1.00 180.50 ? 641  LEU C CG    1 
ATOM   2580  C  CD1   . LEU B 2 124 ? -1.121  41.844 -8.640  1.00 179.06 ? 641  LEU C CD1   1 
ATOM   2581  C  CD2   . LEU B 2 124 ? -2.036  40.007 -7.212  1.00 180.27 ? 641  LEU C CD2   1 
ATOM   2582  N  N     . GLU B 2 125 ? 1.927   37.031 -8.004  1.00 190.51 ? 642  GLU C N     1 
ATOM   2583  C  CA    . GLU B 2 125 ? 3.074   36.200 -8.368  1.00 193.86 ? 642  GLU C CA    1 
ATOM   2584  C  C     . GLU B 2 125 ? 3.716   36.664 -9.678  1.00 194.35 ? 642  GLU C C     1 
ATOM   2585  O  O     . GLU B 2 125 ? 3.215   36.369 -10.764 1.00 193.42 ? 642  GLU C O     1 
ATOM   2586  C  CB    . GLU B 2 125 ? 2.660   34.724 -8.469  1.00 195.31 ? 642  GLU C CB    1 
ATOM   2587  C  CG    . GLU B 2 125 ? 2.560   34.001 -7.127  1.00 197.38 ? 642  GLU C CG    1 
ATOM   2588  C  CD    . GLU B 2 125 ? 1.568   34.632 -6.160  1.00 196.76 ? 642  GLU C CD    1 
ATOM   2589  O  OE1   . GLU B 2 125 ? 0.557   35.205 -6.619  1.00 195.00 ? 642  GLU C OE1   1 
ATOM   2590  O  OE2   . GLU B 2 125 ? 1.797   34.546 -4.933  1.00 198.35 ? 642  GLU C OE2   1 
ATOM   2591  N  N     . ILE B 2 126 ? 4.822   37.397 -9.559  1.00 196.54 ? 643  ILE C N     1 
ATOM   2592  C  CA    . ILE B 2 126 ? 5.602   37.845 -10.717 1.00 197.61 ? 643  ILE C CA    1 
ATOM   2593  C  C     . ILE B 2 126 ? 6.724   36.846 -11.008 1.00 200.51 ? 643  ILE C C     1 
ATOM   2594  O  O     . ILE B 2 126 ? 7.260   36.220 -10.091 1.00 202.85 ? 643  ILE C O     1 
ATOM   2595  C  CB    . ILE B 2 126 ? 6.186   39.260 -10.487 1.00 197.59 ? 643  ILE C CB    1 
ATOM   2596  C  CG1   . ILE B 2 126 ? 5.044   40.282 -10.413 1.00 195.50 ? 643  ILE C CG1   1 
ATOM   2597  C  CG2   . ILE B 2 126 ? 7.178   39.632 -11.586 1.00 198.13 ? 643  ILE C CG2   1 
ATOM   2598  C  CD1   . ILE B 2 126 ? 5.488   41.719 -10.236 1.00 195.22 ? 643  ILE C CD1   1 
ATOM   2599  N  N     . ASP B 2 127 ? 7.067   36.701 -12.288 1.00 200.65 ? 644  ASP C N     1 
ATOM   2600  C  CA    . ASP B 2 127 ? 8.140   35.803 -12.714 1.00 202.64 ? 644  ASP C CA    1 
ATOM   2601  C  C     . ASP B 2 127 ? 9.501   36.362 -12.304 1.00 204.41 ? 644  ASP C C     1 
ATOM   2602  O  O     . ASP B 2 127 ? 9.945   37.390 -12.817 1.00 203.95 ? 644  ASP C O     1 
ATOM   2603  C  CB    . ASP B 2 127 ? 8.086   35.593 -14.233 1.00 202.08 ? 644  ASP C CB    1 
ATOM   2604  C  CG    . ASP B 2 127 ? 8.987   34.463 -14.706 1.00 204.66 ? 644  ASP C CG    1 
ATOM   2605  O  OD1   . ASP B 2 127 ? 10.222  34.568 -14.544 1.00 206.86 ? 644  ASP C OD1   1 
ATOM   2606  O  OD2   . ASP B 2 127 ? 8.459   33.473 -15.255 1.00 205.14 ? 644  ASP C OD2   1 
ATOM   2607  N  N     . LYS B 2 145 ? 18.749  43.329 -46.057 1.00 279.43 ? 662  LYS C N     1 
ATOM   2608  C  CA    . LYS B 2 145 ? 19.622  42.187 -46.319 1.00 280.59 ? 662  LYS C CA    1 
ATOM   2609  C  C     . LYS B 2 145 ? 18.951  40.840 -46.012 1.00 277.39 ? 662  LYS C C     1 
ATOM   2610  O  O     . LYS B 2 145 ? 19.570  39.787 -46.176 1.00 278.45 ? 662  LYS C O     1 
ATOM   2611  C  CB    . LYS B 2 145 ? 20.948  42.323 -45.549 1.00 283.50 ? 662  LYS C CB    1 
ATOM   2612  C  CG    . LYS B 2 145 ? 20.839  42.933 -44.154 1.00 283.09 ? 662  LYS C CG    1 
ATOM   2613  C  CD    . LYS B 2 145 ? 20.963  44.455 -44.154 1.00 284.37 ? 662  LYS C CD    1 
ATOM   2614  C  CE    . LYS B 2 145 ? 22.370  44.940 -44.487 1.00 288.27 ? 662  LYS C CE    1 
ATOM   2615  N  NZ    . LYS B 2 145 ? 23.405  44.432 -43.545 1.00 289.98 ? 662  LYS C NZ    1 
ATOM   2616  N  N     . SER B 2 146 ? 17.690  40.877 -45.581 1.00 273.08 ? 663  SER C N     1 
ATOM   2617  C  CA    . SER B 2 146 ? 16.920  39.658 -45.337 1.00 269.69 ? 663  SER C CA    1 
ATOM   2618  C  C     . SER B 2 146 ? 16.469  39.043 -46.661 1.00 267.68 ? 663  SER C C     1 
ATOM   2619  O  O     . SER B 2 146 ? 15.932  39.742 -47.521 1.00 267.37 ? 663  SER C O     1 
ATOM   2620  C  CB    . SER B 2 146 ? 15.699  39.958 -44.462 1.00 267.25 ? 663  SER C CB    1 
ATOM   2621  O  OG    . SER B 2 146 ? 14.839  40.896 -45.086 1.00 266.53 ? 663  SER C OG    1 
ATOM   2622  N  N     . LYS B 2 147 ? 16.686  37.737 -46.814 1.00 265.72 ? 664  LYS C N     1 
ATOM   2623  C  CA    . LYS B 2 147 ? 16.354  37.031 -48.053 1.00 264.20 ? 664  LYS C CA    1 
ATOM   2624  C  C     . LYS B 2 147 ? 15.007  36.316 -47.948 1.00 259.76 ? 664  LYS C C     1 
ATOM   2625  O  O     . LYS B 2 147 ? 14.952  35.096 -47.780 1.00 259.51 ? 664  LYS C O     1 
ATOM   2626  C  CB    . LYS B 2 147 ? 17.459  36.030 -48.406 1.00 266.51 ? 664  LYS C CB    1 
ATOM   2627  C  CG    . LYS B 2 147 ? 18.795  36.673 -48.740 1.00 269.48 ? 664  LYS C CG    1 
ATOM   2628  C  CD    . LYS B 2 147 ? 19.813  35.634 -49.183 1.00 271.56 ? 664  LYS C CD    1 
ATOM   2629  C  CE    . LYS B 2 147 ? 21.111  36.282 -49.636 1.00 274.60 ? 664  LYS C CE    1 
ATOM   2630  N  NZ    . LYS B 2 147 ? 22.091  35.278 -50.132 1.00 276.77 ? 664  LYS C NZ    1 
ATOM   2631  N  N     . LEU B 2 148 ? 13.927  37.089 -48.044 1.00 255.73 ? 665  LEU C N     1 
ATOM   2632  C  CA    . LEU B 2 148 ? 12.565  36.547 -48.045 1.00 251.71 ? 665  LEU C CA    1 
ATOM   2633  C  C     . LEU B 2 148 ? 11.654  37.383 -48.950 1.00 249.62 ? 665  LEU C C     1 
ATOM   2634  O  O     . LEU B 2 148 ? 12.006  38.509 -49.307 1.00 250.03 ? 665  LEU C O     1 
ATOM   2635  C  CB    . LEU B 2 148 ? 11.995  36.519 -46.622 1.00 249.86 ? 665  LEU C CB    1 
ATOM   2636  C  CG    . LEU B 2 148 ? 12.602  35.530 -45.622 1.00 250.02 ? 665  LEU C CG    1 
ATOM   2637  C  CD1   . LEU B 2 148 ? 12.026  35.775 -44.236 1.00 248.29 ? 665  LEU C CD1   1 
ATOM   2638  C  CD2   . LEU B 2 148 ? 12.368  34.087 -46.045 1.00 250.05 ? 665  LEU C CD2   1 
ATOM   2639  N  N     . PRO B 2 149 ? 10.482  36.834 -49.329 1.00 246.87 ? 666  PRO C N     1 
ATOM   2640  C  CA    . PRO B 2 149 ? 9.517   37.610 -50.117 1.00 245.88 ? 666  PRO C CA    1 
ATOM   2641  C  C     . PRO B 2 149 ? 8.923   38.790 -49.344 1.00 244.23 ? 666  PRO C C     1 
ATOM   2642  O  O     . PRO B 2 149 ? 8.905   38.779 -48.112 1.00 243.08 ? 666  PRO C O     1 
ATOM   2643  C  CB    . PRO B 2 149 ? 8.419   36.589 -50.449 1.00 244.69 ? 666  PRO C CB    1 
ATOM   2644  C  CG    . PRO B 2 149 ? 9.048   35.254 -50.258 1.00 245.09 ? 666  PRO C CG    1 
ATOM   2645  C  CD    . PRO B 2 149 ? 10.043  35.437 -49.155 1.00 245.75 ? 666  PRO C CD    1 
ATOM   2646  N  N     . LYS B 2 150 ? 8.436   39.789 -50.075 1.00 244.00 ? 667  LYS C N     1 
ATOM   2647  C  CA    . LYS B 2 150 ? 7.876   41.001 -49.468 1.00 242.81 ? 667  LYS C CA    1 
ATOM   2648  C  C     . LYS B 2 150 ? 6.586   40.745 -48.674 1.00 239.49 ? 667  LYS C C     1 
ATOM   2649  O  O     . LYS B 2 150 ? 6.401   41.335 -47.609 1.00 237.98 ? 667  LYS C O     1 
ATOM   2650  C  CB    . LYS B 2 150 ? 7.642   42.082 -50.532 1.00 244.66 ? 667  LYS C CB    1 
ATOM   2651  C  CG    . LYS B 2 150 ? 8.920   42.586 -51.188 1.00 247.37 ? 667  LYS C CG    1 
ATOM   2652  C  CD    . LYS B 2 150 ? 8.629   43.417 -52.427 1.00 248.84 ? 667  LYS C CD    1 
ATOM   2653  C  CE    . LYS B 2 150 ? 9.905   43.723 -53.196 1.00 251.33 ? 667  LYS C CE    1 
ATOM   2654  N  NZ    . LYS B 2 150 ? 9.635   44.452 -54.466 1.00 252.85 ? 667  LYS C NZ    1 
ATOM   2655  N  N     . PRO B 2 151 ? 5.691   39.874 -49.185 1.00 237.82 ? 668  PRO C N     1 
ATOM   2656  C  CA    . PRO B 2 151 ? 4.491   39.532 -48.408 1.00 235.28 ? 668  PRO C CA    1 
ATOM   2657  C  C     . PRO B 2 151 ? 4.788   38.732 -47.135 1.00 233.54 ? 668  PRO C C     1 
ATOM   2658  O  O     . PRO B 2 151 ? 4.073   38.875 -46.141 1.00 231.72 ? 668  PRO C O     1 
ATOM   2659  C  CB    . PRO B 2 151 ? 3.659   38.686 -49.384 1.00 235.31 ? 668  PRO C CB    1 
ATOM   2660  C  CG    . PRO B 2 151 ? 4.208   38.980 -50.737 1.00 237.24 ? 668  PRO C CG    1 
ATOM   2661  C  CD    . PRO B 2 151 ? 5.664   39.252 -50.521 1.00 238.70 ? 668  PRO C CD    1 
ATOM   2662  N  N     . VAL B 2 152 ? 5.826   37.899 -47.174 1.00 233.60 ? 669  VAL C N     1 
ATOM   2663  C  CA    . VAL B 2 152 ? 6.234   37.103 -46.012 1.00 232.73 ? 669  VAL C CA    1 
ATOM   2664  C  C     . VAL B 2 152 ? 6.834   37.997 -44.924 1.00 232.48 ? 669  VAL C C     1 
ATOM   2665  O  O     . VAL B 2 152 ? 6.616   37.763 -43.733 1.00 231.37 ? 669  VAL C O     1 
ATOM   2666  C  CB    . VAL B 2 152 ? 7.241   35.996 -46.406 1.00 233.95 ? 669  VAL C CB    1 
ATOM   2667  C  CG1   . VAL B 2 152 ? 7.778   35.276 -45.174 1.00 233.70 ? 669  VAL C CG1   1 
ATOM   2668  C  CG2   . VAL B 2 152 ? 6.587   35.002 -47.357 1.00 234.07 ? 669  VAL C CG2   1 
ATOM   2669  N  N     . GLN B 2 153 ? 7.591   39.012 -45.336 1.00 233.46 ? 670  GLN C N     1 
ATOM   2670  C  CA    . GLN B 2 153 ? 8.122   40.010 -44.404 1.00 233.29 ? 670  GLN C CA    1 
ATOM   2671  C  C     . GLN B 2 153 ? 6.992   40.808 -43.754 1.00 230.76 ? 670  GLN C C     1 
ATOM   2672  O  O     . GLN B 2 153 ? 7.052   41.118 -42.564 1.00 229.64 ? 670  GLN C O     1 
ATOM   2673  C  CB    . GLN B 2 153 ? 9.089   40.961 -45.115 1.00 235.74 ? 670  GLN C CB    1 
ATOM   2674  C  CG    . GLN B 2 153 ? 10.405  40.316 -45.521 1.00 237.84 ? 670  GLN C CG    1 
ATOM   2675  C  CD    . GLN B 2 153 ? 11.268  41.226 -46.377 1.00 240.20 ? 670  GLN C CD    1 
ATOM   2676  O  OE1   . GLN B 2 153 ? 11.115  42.448 -46.358 1.00 240.77 ? 670  GLN C OE1   1 
ATOM   2677  N  NE2   . GLN B 2 153 ? 12.187  40.631 -47.132 1.00 241.96 ? 670  GLN C NE2   1 
ATOM   2678  N  N     . ASP B 2 154 ? 5.968   41.133 -44.543 1.00 229.36 ? 671  ASP C N     1 
ATOM   2679  C  CA    . ASP B 2 154 ? 4.783   41.831 -44.037 1.00 227.13 ? 671  ASP C CA    1 
ATOM   2680  C  C     . ASP B 2 154 ? 3.975   40.965 -43.068 1.00 223.93 ? 671  ASP C C     1 
ATOM   2681  O  O     . ASP B 2 154 ? 3.330   41.490 -42.161 1.00 222.32 ? 671  ASP C O     1 
ATOM   2682  C  CB    . ASP B 2 154 ? 3.882   42.282 -45.195 1.00 227.83 ? 671  ASP C CB    1 
ATOM   2683  C  CG    . ASP B 2 154 ? 4.515   43.372 -46.048 1.00 229.81 ? 671  ASP C CG    1 
ATOM   2684  O  OD1   . ASP B 2 154 ? 5.690   43.725 -45.810 1.00 231.11 ? 671  ASP C OD1   1 
ATOM   2685  O  OD2   . ASP B 2 154 ? 3.833   43.875 -46.964 1.00 230.55 ? 671  ASP C OD2   1 
ATOM   2686  N  N     . LEU B 2 155 ? 4.007   39.648 -43.266 1.00 222.25 ? 672  LEU C N     1 
ATOM   2687  C  CA    . LEU B 2 155 ? 3.315   38.717 -42.374 1.00 219.65 ? 672  LEU C CA    1 
ATOM   2688  C  C     . LEU B 2 155 ? 3.941   38.736 -40.981 1.00 218.12 ? 672  LEU C C     1 
ATOM   2689  O  O     . LEU B 2 155 ? 3.226   38.793 -39.982 1.00 216.97 ? 672  LEU C O     1 
ATOM   2690  C  CB    . LEU B 2 155 ? 3.333   37.294 -42.945 1.00 220.05 ? 672  LEU C CB    1 
ATOM   2691  C  CG    . LEU B 2 155 ? 2.489   36.241 -42.218 1.00 218.98 ? 672  LEU C CG    1 
ATOM   2692  C  CD1   . LEU B 2 155 ? 1.016   36.627 -42.199 1.00 217.78 ? 672  LEU C CD1   1 
ATOM   2693  C  CD2   . LEU B 2 155 ? 2.674   34.879 -42.868 1.00 219.98 ? 672  LEU C CD2   1 
ATOM   2694  N  N     . ILE B 2 156 ? 5.271   38.691 -40.922 1.00 217.82 ? 673  ILE C N     1 
ATOM   2695  C  CA    . ILE B 2 156 ? 5.996   38.830 -39.655 1.00 216.76 ? 673  ILE C CA    1 
ATOM   2696  C  C     . ILE B 2 156 ? 5.774   40.224 -39.073 1.00 215.86 ? 673  ILE C C     1 
ATOM   2697  O  O     . ILE B 2 156 ? 5.528   40.369 -37.876 1.00 214.96 ? 673  ILE C O     1 
ATOM   2698  C  CB    . ILE B 2 156 ? 7.509   38.567 -39.827 1.00 218.04 ? 673  ILE C CB    1 
ATOM   2699  C  CG1   . ILE B 2 156 ? 7.743   37.087 -40.132 1.00 218.43 ? 673  ILE C CG1   1 
ATOM   2700  C  CG2   . ILE B 2 156 ? 8.283   38.971 -38.574 1.00 218.17 ? 673  ILE C CG2   1 
ATOM   2701  C  CD1   . ILE B 2 156 ? 9.178   36.743 -40.456 1.00 220.48 ? 673  ILE C CD1   1 
ATOM   2702  N  N     . LYS B 2 157 ? 5.857   41.241 -39.929 1.00 216.11 ? 674  LYS C N     1 
ATOM   2703  C  CA    . LYS B 2 157 ? 5.589   42.627 -39.534 1.00 215.31 ? 674  LYS C CA    1 
ATOM   2704  C  C     . LYS B 2 157 ? 4.224   42.758 -38.855 1.00 211.94 ? 674  LYS C C     1 
ATOM   2705  O  O     . LYS B 2 157 ? 4.074   43.507 -37.890 1.00 211.17 ? 674  LYS C O     1 
ATOM   2706  C  CB    . LYS B 2 157 ? 5.637   43.551 -40.757 1.00 216.98 ? 674  LYS C CB    1 
ATOM   2707  C  CG    . LYS B 2 157 ? 5.899   45.016 -40.434 1.00 217.84 ? 674  LYS C CG    1 
ATOM   2708  C  CD    . LYS B 2 157 ? 7.380   45.358 -40.518 1.00 219.93 ? 674  LYS C CD    1 
ATOM   2709  C  CE    . LYS B 2 157 ? 7.832   45.543 -41.960 1.00 221.74 ? 674  LYS C CE    1 
ATOM   2710  N  NZ    . LYS B 2 157 ? 9.301   45.762 -42.067 1.00 223.89 ? 674  LYS C NZ    1 
ATOM   2711  N  N     . MET B 2 158 ? 3.242   42.019 -39.366 1.00 209.05 ? 675  MET C N     1 
ATOM   2712  C  CA    . MET B 2 158 ? 1.869   42.083 -38.868 1.00 205.71 ? 675  MET C CA    1 
ATOM   2713  C  C     . MET B 2 158 ? 1.680   41.310 -37.560 1.00 202.92 ? 675  MET C C     1 
ATOM   2714  O  O     . MET B 2 158 ? 1.020   41.802 -36.643 1.00 201.82 ? 675  MET C O     1 
ATOM   2715  C  CB    . MET B 2 158 ? 0.907   41.551 -39.935 1.00 205.48 ? 675  MET C CB    1 
ATOM   2716  C  CG    . MET B 2 158 ? -0.554  41.900 -39.699 1.00 204.45 ? 675  MET C CG    1 
ATOM   2717  S  SD    . MET B 2 158 ? -1.579  41.632 -41.160 1.00 204.67 ? 675  MET C SD    1 
ATOM   2718  C  CE    . MET B 2 158 ? -0.986  42.928 -42.248 1.00 205.90 ? 675  MET C CE    1 
ATOM   2719  N  N     . ILE B 2 159 ? 2.259   40.112 -37.474 1.00 201.30 ? 676  ILE C N     1 
ATOM   2720  C  CA    . ILE B 2 159 ? 2.042   39.226 -36.319 1.00 199.14 ? 676  ILE C CA    1 
ATOM   2721  C  C     . ILE B 2 159 ? 3.078   39.359 -35.193 1.00 198.18 ? 676  ILE C C     1 
ATOM   2722  O  O     . ILE B 2 159 ? 2.943   38.700 -34.163 1.00 196.79 ? 676  ILE C O     1 
ATOM   2723  C  CB    . ILE B 2 159 ? 1.946   37.736 -36.743 1.00 199.43 ? 676  ILE C CB    1 
ATOM   2724  C  CG1   . ILE B 2 159 ? 3.324   37.178 -37.139 1.00 200.85 ? 676  ILE C CG1   1 
ATOM   2725  C  CG2   . ILE B 2 159 ? 0.914   37.567 -37.854 1.00 199.23 ? 676  ILE C CG2   1 
ATOM   2726  C  CD1   . ILE B 2 159 ? 3.281   35.830 -37.829 1.00 201.41 ? 676  ILE C CD1   1 
ATOM   2727  N  N     . PHE B 2 160 ? 4.104   40.190 -35.381 1.00 198.07 ? 677  PHE C N     1 
ATOM   2728  C  CA    . PHE B 2 160 ? 5.102   40.433 -34.326 1.00 197.81 ? 677  PHE C CA    1 
ATOM   2729  C  C     . PHE B 2 160 ? 5.180   41.893 -33.865 1.00 196.34 ? 677  PHE C C     1 
ATOM   2730  O  O     . PHE B 2 160 ? 6.053   42.245 -33.067 1.00 196.48 ? 677  PHE C O     1 
ATOM   2731  C  CB    . PHE B 2 160 ? 6.486   39.926 -34.757 1.00 199.86 ? 677  PHE C CB    1 
ATOM   2732  C  CG    . PHE B 2 160 ? 6.754   38.498 -34.369 1.00 200.60 ? 677  PHE C CG    1 
ATOM   2733  C  CD1   . PHE B 2 160 ? 7.089   38.177 -33.059 1.00 200.97 ? 677  PHE C CD1   1 
ATOM   2734  C  CD2   . PHE B 2 160 ? 6.672   37.477 -35.306 1.00 201.26 ? 677  PHE C CD2   1 
ATOM   2735  C  CE1   . PHE B 2 160 ? 7.337   36.865 -32.691 1.00 201.80 ? 677  PHE C CE1   1 
ATOM   2736  C  CE2   . PHE B 2 160 ? 6.920   36.163 -34.944 1.00 201.97 ? 677  PHE C CE2   1 
ATOM   2737  C  CZ    . PHE B 2 160 ? 7.252   35.856 -33.635 1.00 202.17 ? 677  PHE C CZ    1 
ATOM   2738  N  N     . ASP B 2 161 ? 4.270   42.736 -34.350 1.00 194.34 ? 678  ASP C N     1 
ATOM   2739  C  CA    . ASP B 2 161 ? 4.134   44.093 -33.826 1.00 193.16 ? 678  ASP C CA    1 
ATOM   2740  C  C     . ASP B 2 161 ? 3.381   43.991 -32.502 1.00 190.63 ? 678  ASP C C     1 
ATOM   2741  O  O     . ASP B 2 161 ? 2.163   43.807 -32.485 1.00 189.10 ? 678  ASP C O     1 
ATOM   2742  C  CB    . ASP B 2 161 ? 3.388   44.992 -34.820 1.00 193.42 ? 678  ASP C CB    1 
ATOM   2743  C  CG    . ASP B 2 161 ? 3.480   46.473 -34.467 1.00 193.70 ? 678  ASP C CG    1 
ATOM   2744  O  OD1   . ASP B 2 161 ? 3.896   46.813 -33.338 1.00 193.49 ? 678  ASP C OD1   1 
ATOM   2745  O  OD2   . ASP B 2 161 ? 3.130   47.305 -35.331 1.00 194.11 ? 678  ASP C OD2   1 
ATOM   2746  N  N     . VAL B 2 162 ? 4.114   44.105 -31.397 1.00 189.75 ? 679  VAL C N     1 
ATOM   2747  C  CA    . VAL B 2 162 ? 3.550   43.854 -30.069 1.00 187.88 ? 679  VAL C CA    1 
ATOM   2748  C  C     . VAL B 2 162 ? 2.844   45.089 -29.504 1.00 185.63 ? 679  VAL C C     1 
ATOM   2749  O  O     . VAL B 2 162 ? 1.994   44.966 -28.621 1.00 184.54 ? 679  VAL C O     1 
ATOM   2750  C  CB    . VAL B 2 162 ? 4.621   43.361 -29.067 1.00 189.12 ? 679  VAL C CB    1 
ATOM   2751  C  CG1   . VAL B 2 162 ? 3.958   42.819 -27.805 1.00 188.39 ? 679  VAL C CG1   1 
ATOM   2752  C  CG2   . VAL B 2 162 ? 5.503   42.291 -29.701 1.00 190.43 ? 679  VAL C CG2   1 
ATOM   2753  N  N     . GLU B 2 163 ? 3.186   46.272 -30.012 1.00 184.65 ? 680  GLU C N     1 
ATOM   2754  C  CA    . GLU B 2 163 ? 2.490   47.503 -29.625 1.00 182.96 ? 680  GLU C CA    1 
ATOM   2755  C  C     . GLU B 2 163 ? 1.050   47.499 -30.150 1.00 180.98 ? 680  GLU C C     1 
ATOM   2756  O  O     . GLU B 2 163 ? 0.161   48.095 -29.540 1.00 179.78 ? 680  GLU C O     1 
ATOM   2757  C  CB    . GLU B 2 163 ? 3.235   48.740 -30.134 1.00 184.23 ? 680  GLU C CB    1 
ATOM   2758  C  CG    . GLU B 2 163 ? 2.873   50.021 -29.394 1.00 183.97 ? 680  GLU C CG    1 
ATOM   2759  C  CD    . GLU B 2 163 ? 3.461   51.263 -30.039 1.00 185.36 ? 680  GLU C CD    1 
ATOM   2760  O  OE1   . GLU B 2 163 ? 4.114   52.052 -29.323 1.00 185.93 ? 680  GLU C OE1   1 
ATOM   2761  O  OE2   . GLU B 2 163 ? 3.273   51.453 -31.260 1.00 186.00 ? 680  GLU C OE2   1 
ATOM   2762  N  N     . SER B 2 164 ? 0.832   46.834 -31.284 1.00 180.36 ? 681  SER C N     1 
ATOM   2763  C  CA    . SER B 2 164 ? -0.516  46.601 -31.803 1.00 179.00 ? 681  SER C CA    1 
ATOM   2764  C  C     . SER B 2 164 ? -1.284  45.639 -30.896 1.00 177.28 ? 681  SER C C     1 
ATOM   2765  O  O     . SER B 2 164 ? -2.498  45.765 -30.733 1.00 176.21 ? 681  SER C O     1 
ATOM   2766  C  CB    . SER B 2 164 ? -0.456  46.038 -33.225 1.00 179.69 ? 681  SER C CB    1 
ATOM   2767  O  OG    . SER B 2 164 ? 0.265   46.902 -34.087 1.00 180.78 ? 681  SER C OG    1 
ATOM   2768  N  N     . MET B 2 165 ? -0.566  44.678 -30.315 1.00 177.04 ? 682  MET C N     1 
ATOM   2769  C  CA    . MET B 2 165 ? -1.146  43.742 -29.351 1.00 176.03 ? 682  MET C CA    1 
ATOM   2770  C  C     . MET B 2 165 ? -1.438  44.425 -28.013 1.00 174.64 ? 682  MET C C     1 
ATOM   2771  O  O     . MET B 2 165 ? -2.374  44.038 -27.314 1.00 173.42 ? 682  MET C O     1 
ATOM   2772  C  CB    . MET B 2 165 ? -0.211  42.552 -29.117 1.00 176.99 ? 682  MET C CB    1 
ATOM   2773  C  CG    . MET B 2 165 ? 0.102   41.727 -30.356 1.00 177.87 ? 682  MET C CG    1 
ATOM   2774  S  SD    . MET B 2 165 ? 1.331   40.452 -30.016 1.00 178.97 ? 682  MET C SD    1 
ATOM   2775  C  CE    . MET B 2 165 ? 1.449   39.657 -31.615 1.00 180.06 ? 682  MET C CE    1 
ATOM   2776  N  N     . LYS B 2 166 ? -0.630  45.422 -27.652 1.00 174.50 ? 683  LYS C N     1 
ATOM   2777  C  CA    . LYS B 2 166 ? -0.867  46.209 -26.438 1.00 173.59 ? 683  LYS C CA    1 
ATOM   2778  C  C     . LYS B 2 166 ? -2.177  46.978 -26.547 1.00 172.42 ? 683  LYS C C     1 
ATOM   2779  O  O     . LYS B 2 166 ? -3.022  46.901 -25.654 1.00 171.77 ? 683  LYS C O     1 
ATOM   2780  C  CB    . LYS B 2 166 ? 0.278   47.192 -26.176 1.00 174.61 ? 683  LYS C CB    1 
ATOM   2781  C  CG    . LYS B 2 166 ? 1.533   46.565 -25.596 1.00 175.60 ? 683  LYS C CG    1 
ATOM   2782  C  CD    . LYS B 2 166 ? 2.537   47.639 -25.214 1.00 176.63 ? 683  LYS C CD    1 
ATOM   2783  C  CE    . LYS B 2 166 ? 3.865   47.041 -24.784 1.00 178.03 ? 683  LYS C CE    1 
ATOM   2784  N  NZ    . LYS B 2 166 ? 4.852   48.094 -24.419 1.00 179.16 ? 683  LYS C NZ    1 
ATOM   2785  N  N     . LYS B 2 167 ? -2.332  47.720 -27.642 1.00 172.45 ? 684  LYS C N     1 
ATOM   2786  C  CA    . LYS B 2 167 ? -3.581  48.428 -27.943 1.00 171.80 ? 684  LYS C CA    1 
ATOM   2787  C  C     . LYS B 2 167 ? -4.788  47.495 -27.855 1.00 170.35 ? 684  LYS C C     1 
ATOM   2788  O  O     . LYS B 2 167 ? -5.842  47.877 -27.345 1.00 169.18 ? 684  LYS C O     1 
ATOM   2789  C  CB    . LYS B 2 167 ? -3.525  49.070 -29.335 1.00 173.24 ? 684  LYS C CB    1 
ATOM   2790  C  CG    . LYS B 2 167 ? -4.894  49.362 -29.931 1.00 173.57 ? 684  LYS C CG    1 
ATOM   2791  C  CD    . LYS B 2 167 ? -4.830  50.317 -31.105 1.00 175.04 ? 684  LYS C CD    1 
ATOM   2792  C  CE    . LYS B 2 167 ? -6.168  50.352 -31.824 1.00 175.30 ? 684  LYS C CE    1 
ATOM   2793  N  NZ    . LYS B 2 167 ? -6.249  49.334 -32.909 1.00 175.59 ? 684  LYS C NZ    1 
ATOM   2794  N  N     . ALA B 2 168 ? -4.623  46.277 -28.364 1.00 170.16 ? 685  ALA C N     1 
ATOM   2795  C  CA    . ALA B 2 168 ? -5.681  45.268 -28.341 1.00 169.33 ? 685  ALA C CA    1 
ATOM   2796  C  C     . ALA B 2 168 ? -6.179  44.970 -26.923 1.00 168.44 ? 685  ALA C C     1 
ATOM   2797  O  O     . ALA B 2 168 ? -7.351  44.643 -26.736 1.00 168.01 ? 685  ALA C O     1 
ATOM   2798  C  CB    . ALA B 2 168 ? -5.201  43.988 -29.013 1.00 169.74 ? 685  ALA C CB    1 
ATOM   2799  N  N     . MET B 2 169 ? -5.290  45.081 -25.937 1.00 168.40 ? 686  MET C N     1 
ATOM   2800  C  CA    . MET B 2 169 ? -5.641  44.848 -24.531 1.00 168.00 ? 686  MET C CA    1 
ATOM   2801  C  C     . MET B 2 169 ? -6.262  46.062 -23.838 1.00 167.29 ? 686  MET C C     1 
ATOM   2802  O  O     . MET B 2 169 ? -6.888  45.914 -22.789 1.00 166.44 ? 686  MET C O     1 
ATOM   2803  C  CB    . MET B 2 169 ? -4.409  44.401 -23.738 1.00 168.72 ? 686  MET C CB    1 
ATOM   2804  C  CG    . MET B 2 169 ? -3.789  43.089 -24.195 1.00 169.63 ? 686  MET C CG    1 
ATOM   2805  S  SD    . MET B 2 169 ? -4.862  41.653 -23.986 1.00 169.65 ? 686  MET C SD    1 
ATOM   2806  C  CE    . MET B 2 169 ? -5.644  41.560 -25.597 1.00 169.67 ? 686  MET C CE    1 
ATOM   2807  N  N     . VAL B 2 170 ? -6.089  47.251 -24.414 1.00 167.93 ? 687  VAL C N     1 
ATOM   2808  C  CA    . VAL B 2 170 ? -6.596  48.490 -23.805 1.00 168.07 ? 687  VAL C CA    1 
ATOM   2809  C  C     . VAL B 2 170 ? -8.117  48.447 -23.635 1.00 167.80 ? 687  VAL C C     1 
ATOM   2810  O  O     . VAL B 2 170 ? -8.645  48.913 -22.626 1.00 167.69 ? 687  VAL C O     1 
ATOM   2811  C  CB    . VAL B 2 170 ? -6.210  49.748 -24.624 1.00 168.85 ? 687  VAL C CB    1 
ATOM   2812  C  CG1   . VAL B 2 170 ? -6.774  51.009 -23.980 1.00 168.66 ? 687  VAL C CG1   1 
ATOM   2813  C  CG2   . VAL B 2 170 ? -4.698  49.872 -24.763 1.00 169.52 ? 687  VAL C CG2   1 
ATOM   2814  N  N     . GLU B 2 171 ? -8.809  47.887 -24.624 1.00 167.96 ? 688  GLU C N     1 
ATOM   2815  C  CA    . GLU B 2 171 ? -10.269 47.754 -24.579 1.00 167.88 ? 688  GLU C CA    1 
ATOM   2816  C  C     . GLU B 2 171 ? -10.744 46.782 -23.492 1.00 167.25 ? 688  GLU C C     1 
ATOM   2817  O  O     . GLU B 2 171 ? -11.842 46.940 -22.956 1.00 166.97 ? 688  GLU C O     1 
ATOM   2818  C  CB    . GLU B 2 171 ? -10.807 47.321 -25.947 1.00 168.86 ? 688  GLU C CB    1 
ATOM   2819  C  CG    . GLU B 2 171 ? -10.428 45.902 -26.355 1.00 169.40 ? 688  GLU C CG    1 
ATOM   2820  C  CD    . GLU B 2 171 ? -10.312 45.725 -27.860 1.00 170.28 ? 688  GLU C CD    1 
ATOM   2821  O  OE1   . GLU B 2 171 ? -10.885 44.750 -28.390 1.00 170.81 ? 688  GLU C OE1   1 
ATOM   2822  O  OE2   . GLU B 2 171 ? -9.648  46.557 -28.514 1.00 170.61 ? 688  GLU C OE2   1 
ATOM   2823  N  N     . TYR B 2 172 ? -9.918  45.787 -23.172 1.00 167.38 ? 689  TYR C N     1 
ATOM   2824  C  CA    . TYR B 2 172 ? -10.225 44.834 -22.099 1.00 167.91 ? 689  TYR C CA    1 
ATOM   2825  C  C     . TYR B 2 172 ? -10.055 45.437 -20.699 1.00 168.61 ? 689  TYR C C     1 
ATOM   2826  O  O     . TYR B 2 172 ? -10.549 44.874 -19.723 1.00 168.63 ? 689  TYR C O     1 
ATOM   2827  C  CB    . TYR B 2 172 ? -9.350  43.581 -22.219 1.00 168.06 ? 689  TYR C CB    1 
ATOM   2828  C  CG    . TYR B 2 172 ? -9.738  42.652 -23.345 1.00 168.27 ? 689  TYR C CG    1 
ATOM   2829  C  CD1   . TYR B 2 172 ? -10.957 41.978 -23.332 1.00 168.56 ? 689  TYR C CD1   1 
ATOM   2830  C  CD2   . TYR B 2 172 ? -8.879  42.427 -24.415 1.00 168.56 ? 689  TYR C CD2   1 
ATOM   2831  C  CE1   . TYR B 2 172 ? -11.314 41.121 -24.359 1.00 169.06 ? 689  TYR C CE1   1 
ATOM   2832  C  CE2   . TYR B 2 172 ? -9.225  41.572 -25.445 1.00 169.02 ? 689  TYR C CE2   1 
ATOM   2833  C  CZ    . TYR B 2 172 ? -10.443 40.922 -25.413 1.00 169.24 ? 689  TYR C CZ    1 
ATOM   2834  O  OH    . TYR B 2 172 ? -10.791 40.071 -26.435 1.00 169.92 ? 689  TYR C OH    1 
ATOM   2835  N  N     . GLU B 2 173 ? -9.354  46.568 -20.612 1.00 169.71 ? 690  GLU C N     1 
ATOM   2836  C  CA    . GLU B 2 173 ? -9.086  47.266 -19.347 1.00 170.20 ? 690  GLU C CA    1 
ATOM   2837  C  C     . GLU B 2 173 ? -8.053  46.547 -18.468 1.00 171.56 ? 690  GLU C C     1 
ATOM   2838  O  O     . GLU B 2 173 ? -8.078  46.668 -17.244 1.00 171.15 ? 690  GLU C O     1 
ATOM   2839  C  CB    . GLU B 2 173 ? -10.381 47.538 -18.562 1.00 169.89 ? 690  GLU C CB    1 
ATOM   2840  C  CG    . GLU B 2 173 ? -11.439 48.305 -19.342 1.00 170.15 ? 690  GLU C CG    1 
ATOM   2841  C  CD    . GLU B 2 173 ? -12.744 48.448 -18.581 1.00 170.26 ? 690  GLU C CD    1 
ATOM   2842  O  OE1   . GLU B 2 173 ? -13.315 47.414 -18.173 1.00 170.20 ? 690  GLU C OE1   1 
ATOM   2843  O  OE2   . GLU B 2 173 ? -13.207 49.594 -18.402 1.00 170.65 ? 690  GLU C OE2   1 
ATOM   2844  N  N     . ILE B 2 174 ? -7.149  45.801 -19.101 1.00 174.02 ? 691  ILE C N     1 
ATOM   2845  C  CA    . ILE B 2 174 ? -5.972  45.253 -18.420 1.00 176.38 ? 691  ILE C CA    1 
ATOM   2846  C  C     . ILE B 2 174 ? -4.996  46.401 -18.170 1.00 179.60 ? 691  ILE C C     1 
ATOM   2847  O  O     . ILE B 2 174 ? -4.921  47.339 -18.965 1.00 179.84 ? 691  ILE C O     1 
ATOM   2848  C  CB    . ILE B 2 174 ? -5.300  44.131 -19.257 1.00 176.37 ? 691  ILE C CB    1 
ATOM   2849  C  CG1   . ILE B 2 174 ? -6.037  42.801 -19.057 1.00 176.15 ? 691  ILE C CG1   1 
ATOM   2850  C  CG2   . ILE B 2 174 ? -3.822  43.958 -18.907 1.00 177.05 ? 691  ILE C CG2   1 
ATOM   2851  C  CD1   . ILE B 2 174 ? -5.723  42.096 -17.751 1.00 176.40 ? 691  ILE C CD1   1 
ATOM   2852  N  N     . ASP B 2 175 ? -4.261  46.325 -17.063 1.00 184.11 ? 692  ASP C N     1 
ATOM   2853  C  CA    . ASP B 2 175 ? -3.258  47.334 -16.731 1.00 187.96 ? 692  ASP C CA    1 
ATOM   2854  C  C     . ASP B 2 175 ? -2.192  47.395 -17.826 1.00 192.28 ? 692  ASP C C     1 
ATOM   2855  O  O     . ASP B 2 175 ? -1.568  46.387 -18.151 1.00 193.25 ? 692  ASP C O     1 
ATOM   2856  C  CB    . ASP B 2 175 ? -2.614  47.026 -15.375 1.00 188.23 ? 692  ASP C CB    1 
ATOM   2857  C  CG    . ASP B 2 175 ? -1.697  48.137 -14.891 1.00 188.56 ? 692  ASP C CG    1 
ATOM   2858  O  OD1   . ASP B 2 175 ? -1.952  49.317 -15.212 1.00 187.99 ? 692  ASP C OD1   1 
ATOM   2859  O  OD2   . ASP B 2 175 ? -0.722  47.827 -14.176 1.00 189.56 ? 692  ASP C OD2   1 
ATOM   2860  N  N     . LEU B 2 176 ? -2.000  48.583 -18.393 1.00 196.94 ? 693  LEU C N     1 
ATOM   2861  C  CA    . LEU B 2 176 ? -1.087  48.779 -19.520 1.00 201.29 ? 693  LEU C CA    1 
ATOM   2862  C  C     . LEU B 2 176 ? 0.326   49.137 -19.064 1.00 205.71 ? 693  LEU C C     1 
ATOM   2863  O  O     . LEU B 2 176 ? 1.292   48.924 -19.799 1.00 207.18 ? 693  LEU C O     1 
ATOM   2864  C  CB    . LEU B 2 176 ? -1.612  49.892 -20.431 1.00 201.49 ? 693  LEU C CB    1 
ATOM   2865  C  CG    . LEU B 2 176 ? -3.077  49.796 -20.864 1.00 200.85 ? 693  LEU C CG    1 
ATOM   2866  C  CD1   . LEU B 2 176 ? -3.517  51.090 -21.532 1.00 200.94 ? 693  LEU C CD1   1 
ATOM   2867  C  CD2   . LEU B 2 176 ? -3.289  48.601 -21.781 1.00 200.99 ? 693  LEU C CD2   1 
ATOM   2868  N  N     . GLN B 2 177 ? 0.437   49.681 -17.854 1.00 209.58 ? 694  GLN C N     1 
ATOM   2869  C  CA    . GLN B 2 177 ? 1.696   50.229 -17.345 1.00 213.88 ? 694  GLN C CA    1 
ATOM   2870  C  C     . GLN B 2 177 ? 2.830   49.204 -17.244 1.00 217.51 ? 694  GLN C C     1 
ATOM   2871  O  O     . GLN B 2 177 ? 3.791   49.272 -18.012 1.00 218.63 ? 694  GLN C O     1 
ATOM   2872  C  CB    . GLN B 2 177 ? 1.470   50.896 -15.982 1.00 214.17 ? 694  GLN C CB    1 
ATOM   2873  C  CG    . GLN B 2 177 ? 0.675   52.193 -16.052 1.00 214.11 ? 694  GLN C CG    1 
ATOM   2874  C  CD    . GLN B 2 177 ? 1.518   53.387 -16.477 1.00 215.85 ? 694  GLN C CD    1 
ATOM   2875  O  OE1   . GLN B 2 177 ? 2.614   53.601 -15.957 1.00 217.40 ? 694  GLN C OE1   1 
ATOM   2876  N  NE2   . GLN B 2 177 ? 1.004   54.178 -17.415 1.00 216.13 ? 694  GLN C NE2   1 
ATOM   2877  N  N     . LYS B 2 178 ? 2.713   48.258 -16.311 1.00 220.59 ? 695  LYS C N     1 
ATOM   2878  C  CA    . LYS B 2 178 ? 3.826   47.355 -15.986 1.00 224.50 ? 695  LYS C CA    1 
ATOM   2879  C  C     . LYS B 2 178 ? 3.581   45.873 -16.314 1.00 226.51 ? 695  LYS C C     1 
ATOM   2880  O  O     . LYS B 2 178 ? 4.321   45.008 -15.841 1.00 228.40 ? 695  LYS C O     1 
ATOM   2881  C  CB    . LYS B 2 178 ? 4.230   47.513 -14.509 1.00 225.26 ? 695  LYS C CB    1 
ATOM   2882  C  CG    . LYS B 2 178 ? 3.287   46.883 -13.487 1.00 224.30 ? 695  LYS C CG    1 
ATOM   2883  C  CD    . LYS B 2 178 ? 2.286   47.878 -12.920 1.00 222.76 ? 695  LYS C CD    1 
ATOM   2884  C  CE    . LYS B 2 178 ? 1.364   47.206 -11.914 1.00 221.82 ? 695  LYS C CE    1 
ATOM   2885  N  NZ    . LYS B 2 178 ? 0.281   48.114 -11.442 1.00 220.48 ? 695  LYS C NZ    1 
ATOM   2886  N  N     . MET B 2 179 ? 2.561   45.581 -17.120 1.00 227.17 ? 696  MET C N     1 
ATOM   2887  C  CA    . MET B 2 179 ? 2.305   44.205 -17.565 1.00 228.28 ? 696  MET C CA    1 
ATOM   2888  C  C     . MET B 2 179 ? 3.252   43.685 -18.663 1.00 230.56 ? 696  MET C C     1 
ATOM   2889  O  O     . MET B 2 179 ? 3.469   42.474 -18.743 1.00 231.40 ? 696  MET C O     1 
ATOM   2890  C  CB    . MET B 2 179 ? 0.847   44.036 -18.014 1.00 226.54 ? 696  MET C CB    1 
ATOM   2891  C  CG    . MET B 2 179 ? -0.181  44.083 -16.888 1.00 225.26 ? 696  MET C CG    1 
ATOM   2892  S  SD    . MET B 2 179 ? 0.023   42.829 -15.606 1.00 225.85 ? 696  MET C SD    1 
ATOM   2893  C  CE    . MET B 2 179 ? 0.912   43.751 -14.353 1.00 226.41 ? 696  MET C CE    1 
ATOM   2894  N  N     . PRO B 2 180 ? 3.809   44.576 -19.517 1.00 231.96 ? 697  PRO C N     1 
ATOM   2895  C  CA    . PRO B 2 180 ? 4.767   44.041 -20.499 1.00 233.47 ? 697  PRO C CA    1 
ATOM   2896  C  C     . PRO B 2 180 ? 6.098   43.614 -19.873 1.00 235.48 ? 697  PRO C C     1 
ATOM   2897  O  O     . PRO B 2 180 ? 6.618   42.549 -20.208 1.00 236.22 ? 697  PRO C O     1 
ATOM   2898  C  CB    . PRO B 2 180 ? 4.968   45.204 -21.479 1.00 233.55 ? 697  PRO C CB    1 
ATOM   2899  C  CG    . PRO B 2 180 ? 4.582   46.424 -20.729 1.00 232.83 ? 697  PRO C CG    1 
ATOM   2900  C  CD    . PRO B 2 180 ? 3.534   46.009 -19.741 1.00 231.52 ? 697  PRO C CD    1 
ATOM   2901  N  N     . LEU B 2 181 ? 6.636   44.437 -18.974 1.00 236.22 ? 698  LEU C N     1 
ATOM   2902  C  CA    . LEU B 2 181 ? 7.874   44.102 -18.259 1.00 237.83 ? 698  LEU C CA    1 
ATOM   2903  C  C     . LEU B 2 181 ? 7.619   43.116 -17.113 1.00 237.52 ? 698  LEU C C     1 
ATOM   2904  O  O     . LEU B 2 181 ? 8.456   42.258 -16.834 1.00 239.59 ? 698  LEU C O     1 
ATOM   2905  C  CB    . LEU B 2 181 ? 8.586   45.360 -17.729 1.00 238.55 ? 698  LEU C CB    1 
ATOM   2906  C  CG    . LEU B 2 181 ? 7.784   46.421 -16.960 1.00 236.96 ? 698  LEU C CG    1 
ATOM   2907  C  CD1   . LEU B 2 181 ? 8.538   46.891 -15.724 1.00 237.78 ? 698  LEU C CD1   1 
ATOM   2908  C  CD2   . LEU B 2 181 ? 7.441   47.607 -17.853 1.00 236.21 ? 698  LEU C CD2   1 
ATOM   2909  N  N     . GLY B 2 182 ? 6.466   43.244 -16.457 1.00 234.81 ? 699  GLY C N     1 
ATOM   2910  C  CA    . GLY B 2 182 ? 6.082   42.351 -15.361 1.00 233.38 ? 699  GLY C CA    1 
ATOM   2911  C  C     . GLY B 2 182 ? 5.309   41.143 -15.861 1.00 231.30 ? 699  GLY C C     1 
ATOM   2912  O  O     . GLY B 2 182 ? 4.099   41.220 -16.083 1.00 229.85 ? 699  GLY C O     1 
ATOM   2913  N  N     . LYS B 2 183 ? 6.009   40.024 -16.039 1.00 230.61 ? 700  LYS C N     1 
ATOM   2914  C  CA    . LYS B 2 183 ? 5.382   38.783 -16.493 1.00 228.62 ? 700  LYS C CA    1 
ATOM   2915  C  C     . LYS B 2 183 ? 4.566   38.148 -15.368 1.00 225.90 ? 700  LYS C C     1 
ATOM   2916  O  O     . LYS B 2 183 ? 5.119   37.749 -14.340 1.00 227.53 ? 700  LYS C O     1 
ATOM   2917  C  CB    . LYS B 2 183 ? 6.440   37.791 -16.986 1.00 231.14 ? 700  LYS C CB    1 
ATOM   2918  C  CG    . LYS B 2 183 ? 7.090   38.179 -18.305 1.00 231.72 ? 700  LYS C CG    1 
ATOM   2919  C  CD    . LYS B 2 183 ? 8.085   37.127 -18.776 1.00 233.75 ? 700  LYS C CD    1 
ATOM   2920  C  CE    . LYS B 2 183 ? 9.428   37.248 -18.070 1.00 236.07 ? 700  LYS C CE    1 
ATOM   2921  N  NZ    . LYS B 2 183 ? 10.262  38.350 -18.627 1.00 236.87 ? 700  LYS C NZ    1 
ATOM   2922  N  N     . LEU B 2 184 ? 3.253   38.065 -15.569 1.00 220.99 ? 701  LEU C N     1 
ATOM   2923  C  CA    . LEU B 2 184 ? 2.360   37.432 -14.599 1.00 217.96 ? 701  LEU C CA    1 
ATOM   2924  C  C     . LEU B 2 184 ? 2.530   35.914 -14.679 1.00 217.07 ? 701  LEU C C     1 
ATOM   2925  O  O     . LEU B 2 184 ? 2.637   35.354 -15.773 1.00 217.11 ? 701  LEU C O     1 
ATOM   2926  C  CB    . LEU B 2 184 ? 0.906   37.834 -14.870 1.00 215.66 ? 701  LEU C CB    1 
ATOM   2927  C  CG    . LEU B 2 184 ? -0.108  37.578 -13.752 1.00 214.90 ? 701  LEU C CG    1 
ATOM   2928  C  CD1   . LEU B 2 184 ? 0.191   38.428 -12.522 1.00 214.83 ? 701  LEU C CD1   1 
ATOM   2929  C  CD2   . LEU B 2 184 ? -1.521  37.839 -14.252 1.00 213.21 ? 701  LEU C CD2   1 
ATOM   2930  N  N     . SER B 2 185 ? 2.553   35.257 -13.520 1.00 215.17 ? 702  SER C N     1 
ATOM   2931  C  CA    . SER B 2 185 ? 2.899   33.834 -13.435 1.00 214.61 ? 702  SER C CA    1 
ATOM   2932  C  C     . SER B 2 185 ? 1.885   32.920 -14.127 1.00 212.07 ? 702  SER C C     1 
ATOM   2933  O  O     . SER B 2 185 ? 0.755   33.321 -14.411 1.00 210.32 ? 702  SER C O     1 
ATOM   2934  C  CB    . SER B 2 185 ? 3.063   33.410 -11.971 1.00 215.77 ? 702  SER C CB    1 
ATOM   2935  O  OG    . SER B 2 185 ? 3.396   32.037 -11.867 1.00 217.58 ? 702  SER C OG    1 
ATOM   2936  N  N     . LYS B 2 186 ? 2.311   31.687 -14.388 1.00 210.77 ? 703  LYS C N     1 
ATOM   2937  C  CA    . LYS B 2 186 ? 1.474   30.693 -15.059 1.00 208.22 ? 703  LYS C CA    1 
ATOM   2938  C  C     . LYS B 2 186 ? 0.476   30.090 -14.070 1.00 206.22 ? 703  LYS C C     1 
ATOM   2939  O  O     . LYS B 2 186 ? -0.689  29.878 -14.406 1.00 204.72 ? 703  LYS C O     1 
ATOM   2940  C  CB    . LYS B 2 186 ? 2.339   29.587 -15.677 1.00 209.94 ? 703  LYS C CB    1 
ATOM   2941  C  CG    . LYS B 2 186 ? 1.838   29.080 -17.020 1.00 209.35 ? 703  LYS C CG    1 
ATOM   2942  C  CD    . LYS B 2 186 ? 2.162   30.062 -18.137 1.00 207.86 ? 703  LYS C CD    1 
ATOM   2943  C  CE    . LYS B 2 186 ? 1.780   29.511 -19.502 1.00 207.31 ? 703  LYS C CE    1 
ATOM   2944  N  NZ    . LYS B 2 186 ? 0.323   29.222 -19.609 1.00 206.16 ? 703  LYS C NZ    1 
ATOM   2945  N  N     . ARG B 2 187 ? 0.946   29.822 -12.853 1.00 204.98 ? 704  ARG C N     1 
ATOM   2946  C  CA    . ARG B 2 187 ? 0.090   29.328 -11.769 1.00 203.62 ? 704  ARG C CA    1 
ATOM   2947  C  C     . ARG B 2 187 ? -0.952  30.379 -11.370 1.00 199.01 ? 704  ARG C C     1 
ATOM   2948  O  O     . ARG B 2 187 ? -2.062  30.037 -10.959 1.00 199.20 ? 704  ARG C O     1 
ATOM   2949  C  CB    . ARG B 2 187 ? 0.935   28.951 -10.545 1.00 206.20 ? 704  ARG C CB    1 
ATOM   2950  C  CG    . ARG B 2 187 ? 1.939   27.830 -10.782 1.00 209.12 ? 704  ARG C CG    1 
ATOM   2951  C  CD    . ARG B 2 187 ? 2.928   27.714 -9.631  1.00 211.69 ? 704  ARG C CD    1 
ATOM   2952  N  NE    . ARG B 2 187 ? 4.071   26.863 -9.964  1.00 214.33 ? 704  ARG C NE    1 
ATOM   2953  C  CZ    . ARG B 2 187 ? 5.116   26.645 -9.165  1.00 216.70 ? 704  ARG C CZ    1 
ATOM   2954  N  NH1   . ARG B 2 187 ? 5.183   27.211 -7.962  1.00 217.14 ? 704  ARG C NH1   1 
ATOM   2955  N  NH2   . ARG B 2 187 ? 6.104   25.854 -9.570  1.00 218.71 ? 704  ARG C NH2   1 
ATOM   2956  N  N     . GLN B 2 188 ? -0.580  31.652 -11.492 1.00 193.88 ? 705  GLN C N     1 
ATOM   2957  C  CA    . GLN B 2 188 ? -1.479  32.776 -11.218 1.00 188.89 ? 705  GLN C CA    1 
ATOM   2958  C  C     . GLN B 2 188 ? -2.636  32.822 -12.218 1.00 184.81 ? 705  GLN C C     1 
ATOM   2959  O  O     . GLN B 2 188 ? -3.799  32.916 -11.823 1.00 184.13 ? 705  GLN C O     1 
ATOM   2960  C  CB    . GLN B 2 188 ? -0.697  34.095 -11.271 1.00 187.90 ? 705  GLN C CB    1 
ATOM   2961  C  CG    . GLN B 2 188 ? -1.525  35.359 -11.054 1.00 185.83 ? 705  GLN C CG    1 
ATOM   2962  C  CD    . GLN B 2 188 ? -1.491  35.870 -9.625  1.00 185.32 ? 705  GLN C CD    1 
ATOM   2963  O  OE1   . GLN B 2 188 ? -1.468  35.093 -8.670  1.00 186.34 ? 705  GLN C OE1   1 
ATOM   2964  N  NE2   . GLN B 2 188 ? -1.503  37.190 -9.473  1.00 183.61 ? 705  GLN C NE2   1 
ATOM   2965  N  N     . ILE B 2 189 ? -2.308  32.761 -13.508 1.00 181.30 ? 706  ILE C N     1 
ATOM   2966  C  CA    . ILE B 2 189 ? -3.312  32.862 -14.575 1.00 177.75 ? 706  ILE C CA    1 
ATOM   2967  C  C     . ILE B 2 189 ? -4.261  31.658 -14.565 1.00 176.69 ? 706  ILE C C     1 
ATOM   2968  O  O     . ILE B 2 189 ? -5.439  31.792 -14.897 1.00 175.25 ? 706  ILE C O     1 
ATOM   2969  C  CB    . ILE B 2 189 ? -2.652  33.025 -15.967 1.00 177.01 ? 706  ILE C CB    1 
ATOM   2970  C  CG1   . ILE B 2 189 ? -1.881  34.350 -16.036 1.00 176.23 ? 706  ILE C CG1   1 
ATOM   2971  C  CG2   . ILE B 2 189 ? -3.698  32.994 -17.076 1.00 175.72 ? 706  ILE C CG2   1 
ATOM   2972  C  CD1   . ILE B 2 189 ? -0.849  34.407 -17.142 1.00 176.49 ? 706  ILE C CD1   1 
ATOM   2973  N  N     . GLN B 2 190 ? -3.746  30.492 -14.181 1.00 176.62 ? 707  GLN C N     1 
ATOM   2974  C  CA    . GLN B 2 190 ? -4.577  29.297 -14.004 1.00 176.34 ? 707  GLN C CA    1 
ATOM   2975  C  C     . GLN B 2 190 ? -5.609  29.488 -12.889 1.00 174.81 ? 707  GLN C C     1 
ATOM   2976  O  O     . GLN B 2 190 ? -6.748  29.033 -13.010 1.00 174.64 ? 707  GLN C O     1 
ATOM   2977  C  CB    . GLN B 2 190 ? -3.709  28.071 -13.706 1.00 178.66 ? 707  GLN C CB    1 
ATOM   2978  C  CG    . GLN B 2 190 ? -2.981  27.518 -14.922 1.00 179.34 ? 707  GLN C CG    1 
ATOM   2979  C  CD    . GLN B 2 190 ? -2.060  26.357 -14.588 1.00 181.79 ? 707  GLN C CD    1 
ATOM   2980  O  OE1   . GLN B 2 190 ? -1.826  26.047 -13.418 1.00 183.20 ? 707  GLN C OE1   1 
ATOM   2981  N  NE2   . GLN B 2 190 ? -1.531  25.708 -15.620 1.00 182.36 ? 707  GLN C NE2   1 
ATOM   2982  N  N     . ALA B 2 191 ? -5.202  30.153 -11.809 1.00 172.88 ? 708  ALA C N     1 
ATOM   2983  C  CA    . ALA B 2 191 ? -6.115  30.487 -10.713 1.00 171.11 ? 708  ALA C CA    1 
ATOM   2984  C  C     . ALA B 2 191 ? -7.118  31.557 -11.144 1.00 167.73 ? 708  ALA C C     1 
ATOM   2985  O  O     . ALA B 2 191 ? -8.274  31.530 -10.724 1.00 167.58 ? 708  ALA C O     1 
ATOM   2986  C  CB    . ALA B 2 191 ? -5.339  30.949 -9.487  1.00 171.47 ? 708  ALA C CB    1 
ATOM   2987  N  N     . ALA B 2 192 ? -6.668  32.496 -11.975 1.00 164.70 ? 709  ALA C N     1 
ATOM   2988  C  CA    . ALA B 2 192 ? -7.555  33.507 -12.551 1.00 161.96 ? 709  ALA C CA    1 
ATOM   2989  C  C     . ALA B 2 192 ? -8.608  32.860 -13.450 1.00 161.25 ? 709  ALA C C     1 
ATOM   2990  O  O     . ALA B 2 192 ? -9.769  33.268 -13.443 1.00 160.30 ? 709  ALA C O     1 
ATOM   2991  C  CB    . ALA B 2 192 ? -6.755  34.537 -13.331 1.00 160.54 ? 709  ALA C CB    1 
ATOM   2992  N  N     . TYR B 2 193 ? -8.191  31.860 -14.226 1.00 161.35 ? 710  TYR C N     1 
ATOM   2993  C  CA    . TYR B 2 193 ? -9.122  31.041 -15.009 1.00 161.08 ? 710  TYR C CA    1 
ATOM   2994  C  C     . TYR B 2 193 ? -10.109 30.314 -14.099 1.00 161.75 ? 710  TYR C C     1 
ATOM   2995  O  O     . TYR B 2 193 ? -11.307 30.272 -14.382 1.00 161.37 ? 710  TYR C O     1 
ATOM   2996  C  CB    . TYR B 2 193 ? -8.373  30.001 -15.854 1.00 161.90 ? 710  TYR C CB    1 
ATOM   2997  C  CG    . TYR B 2 193 ? -7.963  30.471 -17.233 1.00 160.72 ? 710  TYR C CG    1 
ATOM   2998  C  CD1   . TYR B 2 193 ? -8.920  30.832 -18.178 1.00 159.67 ? 710  TYR C CD1   1 
ATOM   2999  C  CD2   . TYR B 2 193 ? -6.621  30.522 -17.604 1.00 160.81 ? 710  TYR C CD2   1 
ATOM   3000  C  CE1   . TYR B 2 193 ? -8.552  31.250 -19.446 1.00 158.84 ? 710  TYR C CE1   1 
ATOM   3001  C  CE2   . TYR B 2 193 ? -6.244  30.938 -18.870 1.00 159.94 ? 710  TYR C CE2   1 
ATOM   3002  C  CZ    . TYR B 2 193 ? -7.212  31.299 -19.788 1.00 158.93 ? 710  TYR C CZ    1 
ATOM   3003  O  OH    . TYR B 2 193 ? -6.841  31.714 -21.045 1.00 158.13 ? 710  TYR C OH    1 
ATOM   3004  N  N     . SER B 2 194 ? -9.594  29.740 -13.014 1.00 162.53 ? 711  SER C N     1 
ATOM   3005  C  CA    . SER B 2 194 ? -10.416 28.994 -12.061 1.00 163.72 ? 711  SER C CA    1 
ATOM   3006  C  C     . SER B 2 194 ? -11.484 29.872 -11.410 1.00 162.66 ? 711  SER C C     1 
ATOM   3007  O  O     . SER B 2 194 ? -12.610 29.424 -11.198 1.00 163.17 ? 711  SER C O     1 
ATOM   3008  C  CB    . SER B 2 194 ? -9.541  28.351 -10.981 1.00 165.30 ? 711  SER C CB    1 
ATOM   3009  O  OG    . SER B 2 194 ? -8.629  27.425 -11.550 1.00 166.51 ? 711  SER C OG    1 
ATOM   3010  N  N     . ILE B 2 195 ? -11.129 31.117 -11.099 1.00 161.19 ? 712  ILE C N     1 
ATOM   3011  C  CA    . ILE B 2 195 ? -12.082 32.068 -10.523 1.00 160.32 ? 712  ILE C CA    1 
ATOM   3012  C  C     . ILE B 2 195 ? -13.211 32.359 -11.514 1.00 159.81 ? 712  ILE C C     1 
ATOM   3013  O  O     . ILE B 2 195 ? -14.376 32.396 -11.126 1.00 160.01 ? 712  ILE C O     1 
ATOM   3014  C  CB    . ILE B 2 195 ? -11.399 33.383 -10.078 1.00 158.72 ? 712  ILE C CB    1 
ATOM   3015  C  CG1   . ILE B 2 195 ? -10.452 33.118 -8.901  1.00 159.57 ? 712  ILE C CG1   1 
ATOM   3016  C  CG2   . ILE B 2 195 ? -12.435 34.421 -9.659  1.00 157.77 ? 712  ILE C CG2   1 
ATOM   3017  C  CD1   . ILE B 2 195 ? -9.403  34.191 -8.698  1.00 158.38 ? 712  ILE C CD1   1 
ATOM   3018  N  N     . LEU B 2 196 ? -12.864 32.551 -12.787 1.00 159.40 ? 713  LEU C N     1 
ATOM   3019  C  CA    . LEU B 2 196 ? -13.869 32.772 -13.833 1.00 159.33 ? 713  LEU C CA    1 
ATOM   3020  C  C     . LEU B 2 196 ? -14.818 31.582 -13.966 1.00 161.62 ? 713  LEU C C     1 
ATOM   3021  O  O     . LEU B 2 196 ? -16.028 31.764 -14.105 1.00 162.17 ? 713  LEU C O     1 
ATOM   3022  C  CB    . LEU B 2 196 ? -13.209 33.046 -15.190 1.00 158.25 ? 713  LEU C CB    1 
ATOM   3023  C  CG    . LEU B 2 196 ? -12.465 34.369 -15.386 1.00 156.55 ? 713  LEU C CG    1 
ATOM   3024  C  CD1   . LEU B 2 196 ? -12.001 34.483 -16.830 1.00 156.10 ? 713  LEU C CD1   1 
ATOM   3025  C  CD2   . LEU B 2 196 ? -13.326 35.565 -15.007 1.00 155.64 ? 713  LEU C CD2   1 
ATOM   3026  N  N     . SER B 2 197 ? -14.265 30.371 -13.926 1.00 163.42 ? 714  SER C N     1 
ATOM   3027  C  CA    . SER B 2 197 ? -15.072 29.152 -14.008 1.00 165.67 ? 714  SER C CA    1 
ATOM   3028  C  C     . SER B 2 197 ? -15.971 28.987 -12.780 1.00 167.04 ? 714  SER C C     1 
ATOM   3029  O  O     . SER B 2 197 ? -17.066 28.432 -12.882 1.00 168.45 ? 714  SER C O     1 
ATOM   3030  C  CB    . SER B 2 197 ? -14.178 27.920 -14.182 1.00 167.14 ? 714  SER C CB    1 
ATOM   3031  O  OG    . SER B 2 197 ? -13.376 27.701 -13.036 1.00 168.05 ? 714  SER C OG    1 
ATOM   3032  N  N     . GLU B 2 198 ? -15.503 29.466 -11.627 1.00 167.00 ? 715  GLU C N     1 
ATOM   3033  C  CA    . GLU B 2 198 ? -16.319 29.483 -10.409 1.00 168.23 ? 715  GLU C CA    1 
ATOM   3034  C  C     . GLU B 2 198 ? -17.476 30.482 -10.512 1.00 167.87 ? 715  GLU C C     1 
ATOM   3035  O  O     . GLU B 2 198 ? -18.550 30.244 -9.957  1.00 168.59 ? 715  GLU C O     1 
ATOM   3036  C  CB    . GLU B 2 198 ? -15.466 29.800 -9.172  1.00 167.99 ? 715  GLU C CB    1 
ATOM   3037  C  CG    . GLU B 2 198 ? -14.633 28.628 -8.674  1.00 169.77 ? 715  GLU C CG    1 
ATOM   3038  C  CD    . GLU B 2 198 ? -13.913 28.927 -7.371  1.00 170.00 ? 715  GLU C CD    1 
ATOM   3039  O  OE1   . GLU B 2 198 ? -14.579 29.343 -6.400  1.00 170.04 ? 715  GLU C OE1   1 
ATOM   3040  O  OE2   . GLU B 2 198 ? -12.680 28.734 -7.314  1.00 170.34 ? 715  GLU C OE2   1 
ATOM   3041  N  N     . VAL B 2 199 ? -17.253 31.592 -11.218 1.00 167.00 ? 716  VAL C N     1 
ATOM   3042  C  CA    . VAL B 2 199 ? -18.288 32.615 -11.397 1.00 167.17 ? 716  VAL C CA    1 
ATOM   3043  C  C     . VAL B 2 199 ? -19.427 32.087 -12.267 1.00 169.70 ? 716  VAL C C     1 
ATOM   3044  O  O     . VAL B 2 199 ? -20.596 32.262 -11.928 1.00 170.86 ? 716  VAL C O     1 
ATOM   3045  C  CB    . VAL B 2 199 ? -17.727 33.918 -12.017 1.00 164.75 ? 716  VAL C CB    1 
ATOM   3046  C  CG1   . VAL B 2 199 ? -18.849 34.903 -12.319 1.00 164.29 ? 716  VAL C CG1   1 
ATOM   3047  C  CG2   . VAL B 2 199 ? -16.723 34.570 -11.081 1.00 163.61 ? 716  VAL C CG2   1 
ATOM   3048  N  N     . GLN B 2 200 ? -19.084 31.448 -13.385 1.00 171.55 ? 717  GLN C N     1 
ATOM   3049  C  CA    . GLN B 2 200 ? -20.087 30.858 -14.277 1.00 174.14 ? 717  GLN C CA    1 
ATOM   3050  C  C     . GLN B 2 200 ? -20.929 29.817 -13.543 1.00 177.35 ? 717  GLN C C     1 
ATOM   3051  O  O     . GLN B 2 200 ? -22.149 29.765 -13.715 1.00 178.57 ? 717  GLN C O     1 
ATOM   3052  C  CB    . GLN B 2 200 ? -19.421 30.236 -15.512 1.00 174.38 ? 717  GLN C CB    1 
ATOM   3053  C  CG    . GLN B 2 200 ? -20.377 29.508 -16.456 1.00 175.93 ? 717  GLN C CG    1 
ATOM   3054  C  CD    . GLN B 2 200 ? -20.342 27.992 -16.316 1.00 178.28 ? 717  GLN C CD    1 
ATOM   3055  O  OE1   . GLN B 2 200 ? -20.074 27.456 -15.240 1.00 179.32 ? 717  GLN C OE1   1 
ATOM   3056  N  NE2   . GLN B 2 200 ? -20.618 27.293 -17.414 1.00 179.42 ? 717  GLN C NE2   1 
ATOM   3057  N  N     . GLN B 2 201 ? -20.269 28.989 -12.736 1.00 179.45 ? 718  GLN C N     1 
ATOM   3058  C  CA    . GLN B 2 201 ? -20.957 28.014 -11.892 1.00 182.88 ? 718  GLN C CA    1 
ATOM   3059  C  C     . GLN B 2 201 ? -21.897 28.723 -10.916 1.00 183.78 ? 718  GLN C C     1 
ATOM   3060  O  O     . GLN B 2 201 ? -23.023 28.277 -10.699 1.00 185.58 ? 718  GLN C O     1 
ATOM   3061  C  CB    . GLN B 2 201 ? -19.944 27.168 -11.116 1.00 184.08 ? 718  GLN C CB    1 
ATOM   3062  C  CG    . GLN B 2 201 ? -20.543 25.954 -10.418 1.00 187.06 ? 718  GLN C CG    1 
ATOM   3063  C  CD    . GLN B 2 201 ? -19.671 25.436 -9.289  1.00 188.27 ? 718  GLN C CD    1 
ATOM   3064  O  OE1   . GLN B 2 201 ? -19.208 24.295 -9.322  1.00 190.25 ? 718  GLN C OE1   1 
ATOM   3065  N  NE2   . GLN B 2 201 ? -19.441 26.274 -8.282  1.00 187.41 ? 718  GLN C NE2   1 
ATOM   3066  N  N     . ALA B 2 202 ? -21.425 29.824 -10.334 1.00 182.90 ? 719  ALA C N     1 
ATOM   3067  C  CA    . ALA B 2 202 ? -22.226 30.622 -9.405  1.00 183.58 ? 719  ALA C CA    1 
ATOM   3068  C  C     . ALA B 2 202 ? -23.385 31.336 -10.108 1.00 184.27 ? 719  ALA C C     1 
ATOM   3069  O  O     . ALA B 2 202 ? -24.476 31.451 -9.549  1.00 185.63 ? 719  ALA C O     1 
ATOM   3070  C  CB    . ALA B 2 202 ? -21.345 31.632 -8.683  1.00 181.70 ? 719  ALA C CB    1 
ATOM   3071  N  N     . VAL B 2 203 ? -23.139 31.811 -11.328 1.00 184.06 ? 720  VAL C N     1 
ATOM   3072  C  CA    . VAL B 2 203 ? -24.164 32.491 -12.128 1.00 184.76 ? 720  VAL C CA    1 
ATOM   3073  C  C     . VAL B 2 203 ? -25.235 31.516 -12.626 1.00 187.78 ? 720  VAL C C     1 
ATOM   3074  O  O     . VAL B 2 203 ? -26.422 31.848 -12.635 1.00 189.11 ? 720  VAL C O     1 
ATOM   3075  C  CB    . VAL B 2 203 ? -23.534 33.240 -13.331 1.00 182.95 ? 720  VAL C CB    1 
ATOM   3076  C  CG1   . VAL B 2 203 ? -24.590 33.665 -14.346 1.00 183.33 ? 720  VAL C CG1   1 
ATOM   3077  C  CG2   . VAL B 2 203 ? -22.754 34.455 -12.849 1.00 180.88 ? 720  VAL C CG2   1 
ATOM   3078  N  N     . SER B 2 204 ? -24.812 30.321 -13.035 1.00 189.52 ? 721  SER C N     1 
ATOM   3079  C  CA    . SER B 2 204 ? -25.719 29.327 -13.617 1.00 192.29 ? 721  SER C CA    1 
ATOM   3080  C  C     . SER B 2 204 ? -26.830 28.895 -12.658 1.00 194.74 ? 721  SER C C     1 
ATOM   3081  O  O     . SER B 2 204 ? -27.996 28.823 -13.051 1.00 196.50 ? 721  SER C O     1 
ATOM   3082  C  CB    . SER B 2 204 ? -24.935 28.097 -14.087 1.00 193.17 ? 721  SER C CB    1 
ATOM   3083  O  OG    . SER B 2 204 ? -24.231 27.499 -13.013 1.00 194.02 ? 721  SER C OG    1 
ATOM   3084  N  N     . GLN B 2 205 ? -26.465 28.618 -11.407 1.00 195.29 ? 722  GLN C N     1 
ATOM   3085  C  CA    . GLN B 2 205 ? -27.429 28.164 -10.396 1.00 197.75 ? 722  GLN C CA    1 
ATOM   3086  C  C     . GLN B 2 205 ? -27.810 29.270 -9.402  1.00 196.33 ? 722  GLN C C     1 
ATOM   3087  O  O     . GLN B 2 205 ? -28.143 28.990 -8.247  1.00 197.23 ? 722  GLN C O     1 
ATOM   3088  C  CB    . GLN B 2 205 ? -26.900 26.917 -9.668  1.00 200.08 ? 722  GLN C CB    1 
ATOM   3089  C  CG    . GLN B 2 205 ? -25.664 27.130 -8.802  1.00 199.09 ? 722  GLN C CG    1 
ATOM   3090  C  CD    . GLN B 2 205 ? -24.925 25.835 -8.507  1.00 200.97 ? 722  GLN C CD    1 
ATOM   3091  O  OE1   . GLN B 2 205 ? -25.517 24.754 -8.496  1.00 203.32 ? 722  GLN C OE1   1 
ATOM   3092  N  NE2   . GLN B 2 205 ? -23.622 25.938 -8.269  1.00 199.86 ? 722  GLN C NE2   1 
ATOM   3093  N  N     . GLY B 2 206 ? -27.776 30.519 -9.869  1.00 193.84 ? 723  GLY C N     1 
ATOM   3094  C  CA    . GLY B 2 206 ? -28.206 31.679 -9.085  1.00 192.63 ? 723  GLY C CA    1 
ATOM   3095  C  C     . GLY B 2 206 ? -27.722 31.689 -7.648  1.00 192.07 ? 723  GLY C C     1 
ATOM   3096  O  O     . GLY B 2 206 ? -28.530 31.705 -6.720  1.00 193.50 ? 723  GLY C O     1 
ATOM   3097  N  N     . SER B 2 207 ? -26.404 31.684 -7.469  1.00 189.94 ? 724  SER C N     1 
ATOM   3098  C  CA    . SER B 2 207 ? -25.799 31.676 -6.136  1.00 189.20 ? 724  SER C CA    1 
ATOM   3099  C  C     . SER B 2 207 ? -25.886 33.052 -5.474  1.00 186.86 ? 724  SER C C     1 
ATOM   3100  O  O     . SER B 2 207 ? -26.337 34.021 -6.091  1.00 185.70 ? 724  SER C O     1 
ATOM   3101  C  CB    . SER B 2 207 ? -24.340 31.217 -6.216  1.00 188.37 ? 724  SER C CB    1 
ATOM   3102  O  OG    . SER B 2 207 ? -24.256 29.893 -6.714  1.00 190.22 ? 724  SER C OG    1 
ATOM   3103  N  N     . SER B 2 208 ? -25.458 33.126 -4.215  1.00 186.11 ? 725  SER C N     1 
ATOM   3104  C  CA    . SER B 2 208 ? -25.536 34.357 -3.426  1.00 184.07 ? 725  SER C CA    1 
ATOM   3105  C  C     . SER B 2 208 ? -24.759 35.514 -4.049  1.00 180.38 ? 725  SER C C     1 
ATOM   3106  O  O     . SER B 2 208 ? -23.838 35.305 -4.840  1.00 179.51 ? 725  SER C O     1 
ATOM   3107  C  CB    . SER B 2 208 ? -25.017 34.110 -2.006  1.00 184.67 ? 725  SER C CB    1 
ATOM   3108  O  OG    . SER B 2 208 ? -25.747 33.077 -1.368  1.00 187.48 ? 725  SER C OG    1 
ATOM   3109  N  N     . ASP B 2 209 ? -25.146 36.735 -3.689  1.00 177.93 ? 726  ASP C N     1 
ATOM   3110  C  CA    . ASP B 2 209 ? -24.429 37.931 -4.127  1.00 174.57 ? 726  ASP C CA    1 
ATOM   3111  C  C     . ASP B 2 209 ? -23.036 37.972 -3.506  1.00 172.41 ? 726  ASP C C     1 
ATOM   3112  O  O     . ASP B 2 209 ? -22.080 38.387 -4.158  1.00 170.38 ? 726  ASP C O     1 
ATOM   3113  C  CB    . ASP B 2 209 ? -25.205 39.201 -3.760  1.00 174.20 ? 726  ASP C CB    1 
ATOM   3114  C  CG    . ASP B 2 209 ? -26.515 39.333 -4.521  1.00 175.41 ? 726  ASP C CG    1 
ATOM   3115  O  OD1   . ASP B 2 209 ? -26.589 38.878 -5.684  1.00 175.70 ? 726  ASP C OD1   1 
ATOM   3116  O  OD2   . ASP B 2 209 ? -27.472 39.902 -3.956  1.00 176.31 ? 726  ASP C OD2   1 
ATOM   3117  N  N     . SER B 2 210 ? -22.933 37.534 -2.252  1.00 172.24 ? 727  SER C N     1 
ATOM   3118  C  CA    . SER B 2 210 ? -21.650 37.443 -1.550  1.00 170.78 ? 727  SER C CA    1 
ATOM   3119  C  C     . SER B 2 210 ? -20.699 36.471 -2.248  1.00 170.42 ? 727  SER C C     1 
ATOM   3120  O  O     . SER B 2 210 ? -19.520 36.776 -2.433  1.00 168.88 ? 727  SER C O     1 
ATOM   3121  C  CB    . SER B 2 210 ? -21.869 36.998 -0.101  1.00 172.03 ? 727  SER C CB    1 
ATOM   3122  O  OG    . SER B 2 210 ? -20.648 36.974 0.619   1.00 171.33 ? 727  SER C OG    1 
ATOM   3123  N  N     . GLN B 2 211 ? -21.221 35.303 -2.620  1.00 171.64 ? 728  GLN C N     1 
ATOM   3124  C  CA    . GLN B 2 211 ? -20.476 34.314 -3.406  1.00 171.88 ? 728  GLN C CA    1 
ATOM   3125  C  C     . GLN B 2 211 ? -19.910 34.946 -4.679  1.00 169.34 ? 728  GLN C C     1 
ATOM   3126  O  O     . GLN B 2 211 ? -18.734 34.769 -4.994  1.00 168.76 ? 728  GLN C O     1 
ATOM   3127  C  CB    . GLN B 2 211 ? -21.384 33.118 -3.746  1.00 174.42 ? 728  GLN C CB    1 
ATOM   3128  C  CG    . GLN B 2 211 ? -20.863 32.150 -4.807  1.00 175.15 ? 728  GLN C CG    1 
ATOM   3129  C  CD    . GLN B 2 211 ? -19.781 31.211 -4.301  1.00 176.34 ? 728  GLN C CD    1 
ATOM   3130  O  OE1   . GLN B 2 211 ? -19.146 31.463 -3.275  1.00 176.53 ? 728  GLN C OE1   1 
ATOM   3131  N  NE2   . GLN B 2 211 ? -19.566 30.117 -5.026  1.00 177.39 ? 728  GLN C NE2   1 
ATOM   3132  N  N     . ILE B 2 212 ? -20.756 35.681 -5.399  1.00 167.60 ? 729  ILE C N     1 
ATOM   3133  C  CA    . ILE B 2 212 ? -20.340 36.393 -6.611  1.00 165.05 ? 729  ILE C CA    1 
ATOM   3134  C  C     . ILE B 2 212 ? -19.386 37.546 -6.284  1.00 162.12 ? 729  ILE C C     1 
ATOM   3135  O  O     . ILE B 2 212 ? -18.393 37.748 -6.987  1.00 161.12 ? 729  ILE C O     1 
ATOM   3136  C  CB    . ILE B 2 212 ? -21.561 36.920 -7.403  1.00 165.30 ? 729  ILE C CB    1 
ATOM   3137  C  CG1   . ILE B 2 212 ? -22.280 35.753 -8.089  1.00 167.11 ? 729  ILE C CG1   1 
ATOM   3138  C  CG2   . ILE B 2 212 ? -21.141 37.956 -8.443  1.00 163.66 ? 729  ILE C CG2   1 
ATOM   3139  C  CD1   . ILE B 2 212 ? -23.636 36.103 -8.662  1.00 167.78 ? 729  ILE C CD1   1 
ATOM   3140  N  N     . LEU B 2 213 ? -19.693 38.294 -5.225  1.00 160.51 ? 730  LEU C N     1 
ATOM   3141  C  CA    . LEU B 2 213 ? -18.862 39.428 -4.797  1.00 158.15 ? 730  LEU C CA    1 
ATOM   3142  C  C     . LEU B 2 213 ? -17.421 38.972 -4.551  1.00 156.95 ? 730  LEU C C     1 
ATOM   3143  O  O     . LEU B 2 213 ? -16.472 39.641 -4.964  1.00 155.32 ? 730  LEU C O     1 
ATOM   3144  C  CB    . LEU B 2 213 ? -19.423 40.075 -3.516  1.00 158.32 ? 730  LEU C CB    1 
ATOM   3145  C  CG    . LEU B 2 213 ? -19.418 41.606 -3.362  1.00 156.65 ? 730  LEU C CG    1 
ATOM   3146  C  CD1   . LEU B 2 213 ? -18.206 42.260 -4.009  1.00 155.06 ? 730  LEU C CD1   1 
ATOM   3147  C  CD2   . LEU B 2 213 ? -20.700 42.206 -3.923  1.00 156.72 ? 730  LEU C CD2   1 
ATOM   3148  N  N     . ASP B 2 214 ? -17.275 37.831 -3.879  1.00 157.20 ? 731  ASP C N     1 
ATOM   3149  C  CA    . ASP B 2 214 ? -15.964 37.260 -3.561  1.00 156.63 ? 731  ASP C CA    1 
ATOM   3150  C  C     . ASP B 2 214 ? -15.140 36.973 -4.808  1.00 154.96 ? 731  ASP C C     1 
ATOM   3151  O  O     . ASP B 2 214 ? -13.984 37.380 -4.897  1.00 153.95 ? 731  ASP C O     1 
ATOM   3152  C  CB    . ASP B 2 214 ? -16.131 35.980 -2.729  1.00 159.07 ? 731  ASP C CB    1 
ATOM   3153  C  CG    . ASP B 2 214 ? -14.811 35.279 -2.450  1.00 160.26 ? 731  ASP C CG    1 
ATOM   3154  O  OD1   . ASP B 2 214 ? -14.195 35.564 -1.402  1.00 160.49 ? 731  ASP C OD1   1 
ATOM   3155  O  OD2   . ASP B 2 214 ? -14.389 34.444 -3.280  1.00 161.35 ? 731  ASP C OD2   1 
ATOM   3156  N  N     . LEU B 2 215 ? -15.742 36.280 -5.768  1.00 154.22 ? 732  LEU C N     1 
ATOM   3157  C  CA    . LEU B 2 215 ? -15.041 35.887 -6.986  1.00 153.11 ? 732  LEU C CA    1 
ATOM   3158  C  C     . LEU B 2 215 ? -14.664 37.104 -7.827  1.00 150.59 ? 732  LEU C C     1 
ATOM   3159  O  O     . LEU B 2 215 ? -13.591 37.138 -8.431  1.00 150.29 ? 732  LEU C O     1 
ATOM   3160  C  CB    . LEU B 2 215 ? -15.897 34.925 -7.808  1.00 154.16 ? 732  LEU C CB    1 
ATOM   3161  C  CG    . LEU B 2 215 ? -16.290 33.618 -7.115  1.00 156.24 ? 732  LEU C CG    1 
ATOM   3162  C  CD1   . LEU B 2 215 ? -17.360 32.898 -7.918  1.00 157.41 ? 732  LEU C CD1   1 
ATOM   3163  C  CD2   . LEU B 2 215 ? -15.078 32.724 -6.902  1.00 157.03 ? 732  LEU C CD2   1 
ATOM   3164  N  N     . SER B 2 216 ? -15.549 38.099 -7.858  1.00 148.82 ? 733  SER C N     1 
ATOM   3165  C  CA    . SER B 2 216 ? -15.277 39.352 -8.558  1.00 146.60 ? 733  SER C CA    1 
ATOM   3166  C  C     . SER B 2 216 ? -14.118 40.094 -7.895  1.00 145.02 ? 733  SER C C     1 
ATOM   3167  O  O     . SER B 2 216 ? -13.224 40.587 -8.583  1.00 144.02 ? 733  SER C O     1 
ATOM   3168  C  CB    . SER B 2 216 ? -16.527 40.234 -8.595  1.00 146.41 ? 733  SER C CB    1 
ATOM   3169  O  OG    . SER B 2 216 ? -17.648 39.515 -9.080  1.00 147.63 ? 733  SER C OG    1 
ATOM   3170  N  N     . ASN B 2 217 ? -14.135 40.165 -6.564  1.00 144.71 ? 734  ASN C N     1 
ATOM   3171  C  CA    . ASN B 2 217 ? -13.003 40.706 -5.808  1.00 143.97 ? 734  ASN C CA    1 
ATOM   3172  C  C     . ASN B 2 217 ? -11.733 39.912 -6.093  1.00 143.60 ? 734  ASN C C     1 
ATOM   3173  O  O     . ASN B 2 217 ? -10.718 40.483 -6.486  1.00 142.70 ? 734  ASN C O     1 
ATOM   3174  C  CB    . ASN B 2 217 ? -13.278 40.685 -4.299  1.00 145.09 ? 734  ASN C CB    1 
ATOM   3175  C  CG    . ASN B 2 217 ? -14.216 41.793 -3.853  1.00 144.85 ? 734  ASN C CG    1 
ATOM   3176  O  OD1   . ASN B 2 217 ? -14.089 42.944 -4.272  1.00 143.87 ? 734  ASN C OD1   1 
ATOM   3177  N  ND2   . ASN B 2 217 ? -15.152 41.453 -2.976  1.00 146.08 ? 734  ASN C ND2   1 
ATOM   3178  N  N     . ARG B 2 218 ? -11.811 38.595 -5.902  1.00 143.99 ? 735  ARG C N     1 
ATOM   3179  C  CA    . ARG B 2 218 ? -10.673 37.694 -6.114  1.00 144.03 ? 735  ARG C CA    1 
ATOM   3180  C  C     . ARG B 2 218 ? -10.015 37.874 -7.480  1.00 142.48 ? 735  ARG C C     1 
ATOM   3181  O  O     . ARG B 2 218 ? -8.790  37.908 -7.577  1.00 142.51 ? 735  ARG C O     1 
ATOM   3182  C  CB    . ARG B 2 218 ? -11.098 36.227 -5.955  1.00 145.74 ? 735  ARG C CB    1 
ATOM   3183  C  CG    . ARG B 2 218 ? -11.255 35.757 -4.516  1.00 147.08 ? 735  ARG C CG    1 
ATOM   3184  C  CD    . ARG B 2 218 ? -10.859 34.295 -4.373  1.00 149.03 ? 735  ARG C CD    1 
ATOM   3185  N  NE    . ARG B 2 218 ? -9.416  34.110 -4.529  1.00 149.44 ? 735  ARG C NE    1 
ATOM   3186  C  CZ    . ARG B 2 218 ? -8.810  32.940 -4.735  1.00 150.99 ? 735  ARG C CZ    1 
ATOM   3187  N  NH1   . ARG B 2 218 ? -9.508  31.810 -4.822  1.00 152.35 ? 735  ARG C NH1   1 
ATOM   3188  N  NH2   . ARG B 2 218 ? -7.488  32.900 -4.860  1.00 151.38 ? 735  ARG C NH2   1 
ATOM   3189  N  N     . PHE B 2 219 ? -10.831 37.989 -8.526  1.00 140.94 ? 736  PHE C N     1 
ATOM   3190  C  CA    . PHE B 2 219 ? -10.322 38.088 -9.894  1.00 139.81 ? 736  PHE C CA    1 
ATOM   3191  C  C     . PHE B 2 219 ? -9.545  39.383 -10.130 1.00 138.38 ? 736  PHE C C     1 
ATOM   3192  O  O     . PHE B 2 219 ? -8.417  39.348 -10.626 1.00 138.66 ? 736  PHE C O     1 
ATOM   3193  C  CB    . PHE B 2 219 ? -11.466 37.978 -10.907 1.00 139.44 ? 736  PHE C CB    1 
ATOM   3194  C  CG    . PHE B 2 219 ? -11.006 37.952 -12.339 1.00 138.99 ? 736  PHE C CG    1 
ATOM   3195  C  CD1   . PHE B 2 219 ? -10.631 36.757 -12.940 1.00 139.90 ? 736  PHE C CD1   1 
ATOM   3196  C  CD2   . PHE B 2 219 ? -10.941 39.122 -13.083 1.00 137.85 ? 736  PHE C CD2   1 
ATOM   3197  C  CE1   . PHE B 2 219 ? -10.203 36.731 -14.258 1.00 139.61 ? 736  PHE C CE1   1 
ATOM   3198  C  CE2   . PHE B 2 219 ? -10.514 39.101 -14.400 1.00 137.59 ? 736  PHE C CE2   1 
ATOM   3199  C  CZ    . PHE B 2 219 ? -10.145 37.905 -14.989 1.00 138.45 ? 736  PHE C CZ    1 
ATOM   3200  N  N     . TYR B 2 220 ? -10.149 40.516 -9.775  1.00 137.00 ? 737  TYR C N     1 
ATOM   3201  C  CA    . TYR B 2 220 ? -9.526  41.825 -10.005 1.00 135.76 ? 737  TYR C CA    1 
ATOM   3202  C  C     . TYR B 2 220 ? -8.306  42.065 -9.117  1.00 136.40 ? 737  TYR C C     1 
ATOM   3203  O  O     . TYR B 2 220 ? -7.434  42.861 -9.471  1.00 135.94 ? 737  TYR C O     1 
ATOM   3204  C  CB    . TYR B 2 220 ? -10.537 42.961 -9.815  1.00 134.58 ? 737  TYR C CB    1 
ATOM   3205  C  CG    . TYR B 2 220 ? -11.695 42.932 -10.788 1.00 134.11 ? 737  TYR C CG    1 
ATOM   3206  C  CD1   . TYR B 2 220 ? -11.479 42.835 -12.160 1.00 133.76 ? 737  TYR C CD1   1 
ATOM   3207  C  CD2   . TYR B 2 220 ? -13.009 43.021 -10.338 1.00 134.12 ? 737  TYR C CD2   1 
ATOM   3208  C  CE1   . TYR B 2 220 ? -12.539 42.810 -13.050 1.00 133.63 ? 737  TYR C CE1   1 
ATOM   3209  C  CE2   . TYR B 2 220 ? -14.073 42.999 -11.220 1.00 134.08 ? 737  TYR C CE2   1 
ATOM   3210  C  CZ    . TYR B 2 220 ? -13.834 42.894 -12.575 1.00 133.85 ? 737  TYR C CZ    1 
ATOM   3211  O  OH    . TYR B 2 220 ? -14.891 42.874 -13.455 1.00 134.02 ? 737  TYR C OH    1 
ATOM   3212  N  N     . THR B 2 221 ? -8.248  41.395 -7.967  1.00 137.78 ? 738  THR C N     1 
ATOM   3213  C  CA    . THR B 2 221 ? -7.044  41.413 -7.138  1.00 138.82 ? 738  THR C CA    1 
ATOM   3214  C  C     . THR B 2 221 ? -5.935  40.660 -7.867  1.00 139.74 ? 738  THR C C     1 
ATOM   3215  O  O     . THR B 2 221 ? -4.816  41.152 -7.988  1.00 139.79 ? 738  THR C O     1 
ATOM   3216  C  CB    . THR B 2 221 ? -7.253  40.744 -5.759  1.00 139.95 ? 738  THR C CB    1 
ATOM   3217  O  OG1   . THR B 2 221 ? -8.631  40.803 -5.378  1.00 139.77 ? 738  THR C OG1   1 
ATOM   3218  C  CG2   . THR B 2 221 ? -6.404  41.429 -4.696  1.00 140.15 ? 738  THR C CG2   1 
ATOM   3219  N  N     . LEU B 2 222 ? -6.276  39.473 -8.367  1.00 140.72 ? 739  LEU C N     1 
ATOM   3220  C  CA    . LEU B 2 222 ? -5.310  38.567 -8.989  1.00 142.13 ? 739  LEU C CA    1 
ATOM   3221  C  C     . LEU B 2 222 ? -4.798  39.099 -10.330 1.00 141.57 ? 739  LEU C C     1 
ATOM   3222  O  O     . LEU B 2 222 ? -3.619  38.941 -10.651 1.00 142.46 ? 739  LEU C O     1 
ATOM   3223  C  CB    . LEU B 2 222 ? -5.933  37.175 -9.175  1.00 143.26 ? 739  LEU C CB    1 
ATOM   3224  C  CG    . LEU B 2 222 ? -4.999  35.966 -9.093  1.00 145.23 ? 739  LEU C CG    1 
ATOM   3225  C  CD1   . LEU B 2 222 ? -4.460  35.794 -7.680  1.00 146.62 ? 739  LEU C CD1   1 
ATOM   3226  C  CD2   . LEU B 2 222 ? -5.725  34.706 -9.532  1.00 146.04 ? 739  LEU C CD2   1 
ATOM   3227  N  N     . ILE B 2 223 ? -5.687  39.719 -11.105 1.00 140.57 ? 740  ILE C N     1 
ATOM   3228  C  CA    . ILE B 2 223 ? -5.316  40.365 -12.365 1.00 140.29 ? 740  ILE C CA    1 
ATOM   3229  C  C     . ILE B 2 223 ? -5.643  41.858 -12.277 1.00 139.58 ? 740  ILE C C     1 
ATOM   3230  O  O     . ILE B 2 223 ? -6.818  42.232 -12.269 1.00 138.77 ? 740  ILE C O     1 
ATOM   3231  C  CB    . ILE B 2 223 ? -6.043  39.727 -13.569 1.00 140.33 ? 740  ILE C CB    1 
ATOM   3232  C  CG1   . ILE B 2 223 ? -5.665  38.245 -13.676 1.00 141.78 ? 740  ILE C CG1   1 
ATOM   3233  C  CG2   . ILE B 2 223 ? -5.696  40.459 -14.862 1.00 139.82 ? 740  ILE C CG2   1 
ATOM   3234  C  CD1   . ILE B 2 223 ? -6.304  37.505 -14.833 1.00 142.07 ? 740  ILE C CD1   1 
ATOM   3235  N  N     . PRO B 2 224 ? -4.605  42.717 -12.218 1.00 140.17 ? 741  PRO C N     1 
ATOM   3236  C  CA    . PRO B 2 224 ? -4.830  44.152 -12.032 1.00 139.74 ? 741  PRO C CA    1 
ATOM   3237  C  C     . PRO B 2 224 ? -5.466  44.825 -13.249 1.00 139.63 ? 741  PRO C C     1 
ATOM   3238  O  O     . PRO B 2 224 ? -4.900  44.790 -14.342 1.00 140.04 ? 741  PRO C O     1 
ATOM   3239  C  CB    . PRO B 2 224 ? -3.421  44.700 -11.786 1.00 140.15 ? 741  PRO C CB    1 
ATOM   3240  C  CG    . PRO B 2 224 ? -2.514  43.739 -12.467 1.00 141.02 ? 741  PRO C CG    1 
ATOM   3241  C  CD    . PRO B 2 224 ? -3.170  42.396 -12.340 1.00 141.26 ? 741  PRO C CD    1 
ATOM   3242  N  N     . HIS B 2 225 ? -6.638  45.424 -13.043 1.00 139.88 ? 742  HIS C N     1 
ATOM   3243  C  CA    . HIS B 2 225 ? -7.371  46.124 -14.097 1.00 140.05 ? 742  HIS C CA    1 
ATOM   3244  C  C     . HIS B 2 225 ? -7.256  47.634 -13.919 1.00 140.41 ? 742  HIS C C     1 
ATOM   3245  O  O     . HIS B 2 225 ? -6.928  48.114 -12.835 1.00 140.63 ? 742  HIS C O     1 
ATOM   3246  C  CB    . HIS B 2 225 ? -8.849  45.730 -14.070 1.00 139.89 ? 742  HIS C CB    1 
ATOM   3247  C  CG    . HIS B 2 225 ? -9.136  44.393 -14.677 1.00 140.61 ? 742  HIS C CG    1 
ATOM   3248  N  ND1   . HIS B 2 225 ? -8.373  43.274 -14.418 1.00 141.37 ? 742  HIS C ND1   1 
ATOM   3249  C  CD2   . HIS B 2 225 ? -10.119 43.991 -15.516 1.00 140.91 ? 742  HIS C CD2   1 
ATOM   3250  C  CE1   . HIS B 2 225 ? -8.866  42.245 -15.083 1.00 141.98 ? 742  HIS C CE1   1 
ATOM   3251  N  NE2   . HIS B 2 225 ? -9.927  42.653 -15.755 1.00 141.71 ? 742  HIS C NE2   1 
ATOM   3252  N  N     . ASP B 2 226 ? -7.540  48.371 -14.990 1.00 141.23 ? 743  ASP C N     1 
ATOM   3253  C  CA    . ASP B 2 226 ? -7.515  49.832 -14.973 1.00 141.90 ? 743  ASP C CA    1 
ATOM   3254  C  C     . ASP B 2 226 ? -8.904  50.385 -15.296 1.00 141.86 ? 743  ASP C C     1 
ATOM   3255  O  O     . ASP B 2 226 ? -9.277  50.514 -16.463 1.00 141.93 ? 743  ASP C O     1 
ATOM   3256  C  CB    . ASP B 2 226 ? -6.477  50.352 -15.976 1.00 142.86 ? 743  ASP C CB    1 
ATOM   3257  C  CG    . ASP B 2 226 ? -6.405  51.874 -16.024 1.00 143.37 ? 743  ASP C CG    1 
ATOM   3258  O  OD1   . ASP B 2 226 ? -6.822  52.537 -15.050 1.00 143.68 ? 743  ASP C OD1   1 
ATOM   3259  O  OD2   . ASP B 2 226 ? -5.922  52.409 -17.046 1.00 144.17 ? 743  ASP C OD2   1 
ATOM   3260  N  N     . PHE B 2 227 ? -9.665  50.703 -14.251 1.00 142.17 ? 744  PHE C N     1 
ATOM   3261  C  CA    . PHE B 2 227 ? -10.985 51.312 -14.406 1.00 142.79 ? 744  PHE C CA    1 
ATOM   3262  C  C     . PHE B 2 227 ? -10.945 52.820 -14.156 1.00 143.65 ? 744  PHE C C     1 
ATOM   3263  O  O     . PHE B 2 227 ? -11.969 53.493 -14.263 1.00 144.00 ? 744  PHE C O     1 
ATOM   3264  C  CB    . PHE B 2 227 ? -11.991 50.662 -13.454 1.00 142.62 ? 744  PHE C CB    1 
ATOM   3265  C  CG    . PHE B 2 227 ? -12.002 49.160 -13.512 1.00 142.61 ? 744  PHE C CG    1 
ATOM   3266  C  CD1   . PHE B 2 227 ? -12.410 48.501 -14.662 1.00 142.73 ? 744  PHE C CD1   1 
ATOM   3267  C  CD2   . PHE B 2 227 ? -11.610 48.405 -12.415 1.00 142.68 ? 744  PHE C CD2   1 
ATOM   3268  C  CE1   . PHE B 2 227 ? -12.421 47.117 -14.720 1.00 143.04 ? 744  PHE C CE1   1 
ATOM   3269  C  CE2   . PHE B 2 227 ? -11.620 47.021 -12.467 1.00 143.07 ? 744  PHE C CE2   1 
ATOM   3270  C  CZ    . PHE B 2 227 ? -12.029 46.376 -13.620 1.00 143.18 ? 744  PHE C CZ    1 
ATOM   3271  N  N     . GLY B 2 228 ? -9.767  53.346 -13.825 1.00 144.66 ? 745  GLY C N     1 
ATOM   3272  C  CA    . GLY B 2 228 ? -9.612  54.766 -13.530 1.00 145.52 ? 745  GLY C CA    1 
ATOM   3273  C  C     . GLY B 2 228 ? -10.183 55.121 -12.170 1.00 146.09 ? 745  GLY C C     1 
ATOM   3274  O  O     . GLY B 2 228 ? -9.784  54.545 -11.157 1.00 145.68 ? 745  GLY C O     1 
ATOM   3275  N  N     . MET B 2 229 ? -11.128 56.060 -12.152 1.00 147.64 ? 746  MET C N     1 
ATOM   3276  C  CA    . MET B 2 229 ? -11.721 56.558 -10.907 1.00 148.49 ? 746  MET C CA    1 
ATOM   3277  C  C     . MET B 2 229 ? -13.102 55.957 -10.603 1.00 149.18 ? 746  MET C C     1 
ATOM   3278  O  O     . MET B 2 229 ? -13.801 56.444 -9.712  1.00 149.24 ? 746  MET C O     1 
ATOM   3279  C  CB    . MET B 2 229 ? -11.837 58.088 -10.960 1.00 149.04 ? 746  MET C CB    1 
ATOM   3280  C  CG    . MET B 2 229 ? -10.514 58.839 -10.961 1.00 149.61 ? 746  MET C CG    1 
ATOM   3281  S  SD    . MET B 2 229 ? -9.659  58.802 -9.374  1.00 150.12 ? 746  MET C SD    1 
ATOM   3282  C  CE    . MET B 2 229 ? -8.404  57.571 -9.703  1.00 150.08 ? 746  MET C CE    1 
ATOM   3283  N  N     . LYS B 2 230 ? -13.493 54.904 -11.323 1.00 150.19 ? 747  LYS C N     1 
ATOM   3284  C  CA    . LYS B 2 230 ? -14.793 54.254 -11.093 1.00 151.02 ? 747  LYS C CA    1 
ATOM   3285  C  C     . LYS B 2 230 ? -14.642 52.817 -10.590 1.00 150.92 ? 747  LYS C C     1 
ATOM   3286  O  O     . LYS B 2 230 ? -13.573 52.215 -10.699 1.00 150.61 ? 747  LYS C O     1 
ATOM   3287  C  CB    . LYS B 2 230 ? -15.675 54.304 -12.349 1.00 152.30 ? 747  LYS C CB    1 
ATOM   3288  C  CG    . LYS B 2 230 ? -15.022 53.807 -13.631 1.00 153.12 ? 747  LYS C CG    1 
ATOM   3289  C  CD    . LYS B 2 230 ? -16.041 53.621 -14.748 1.00 154.60 ? 747  LYS C CD    1 
ATOM   3290  C  CE    . LYS B 2 230 ? -16.663 54.940 -15.186 1.00 155.77 ? 747  LYS C CE    1 
ATOM   3291  N  NZ    . LYS B 2 230 ? -17.609 54.765 -16.324 1.00 157.00 ? 747  LYS C NZ    1 
ATOM   3292  N  N     . LYS B 2 231 ? -15.732 52.282 -10.043 1.00 151.12 ? 748  LYS C N     1 
ATOM   3293  C  CA    . LYS B 2 231 ? -15.718 50.994 -9.348  1.00 151.19 ? 748  LYS C CA    1 
ATOM   3294  C  C     . LYS B 2 231 ? -15.569 49.815 -10.311 1.00 150.93 ? 748  LYS C C     1 
ATOM   3295  O  O     . LYS B 2 231 ? -16.148 49.833 -11.399 1.00 151.05 ? 748  LYS C O     1 
ATOM   3296  C  CB    . LYS B 2 231 ? -17.008 50.812 -8.540  1.00 152.07 ? 748  LYS C CB    1 
ATOM   3297  C  CG    . LYS B 2 231 ? -17.212 51.845 -7.440  1.00 152.26 ? 748  LYS C CG    1 
ATOM   3298  C  CD    . LYS B 2 231 ? -18.653 51.901 -6.947  1.00 153.16 ? 748  LYS C CD    1 
ATOM   3299  C  CE    . LYS B 2 231 ? -19.003 50.752 -6.009  1.00 153.92 ? 748  LYS C CE    1 
ATOM   3300  N  NZ    . LYS B 2 231 ? -19.269 49.457 -6.701  1.00 154.78 ? 748  LYS C NZ    1 
ATOM   3301  N  N     . PRO B 2 232 ? -14.785 48.789 -9.916  1.00 150.28 ? 749  PRO C N     1 
ATOM   3302  C  CA    . PRO B 2 232 ? -14.742 47.533 -10.669 1.00 150.02 ? 749  PRO C CA    1 
ATOM   3303  C  C     . PRO B 2 232 ? -16.129 46.888 -10.791 1.00 149.93 ? 749  PRO C C     1 
ATOM   3304  O  O     . PRO B 2 232 ? -16.808 46.710 -9.779  1.00 149.78 ? 749  PRO C O     1 
ATOM   3305  C  CB    . PRO B 2 232 ? -13.817 46.649 -9.827  1.00 150.36 ? 749  PRO C CB    1 
ATOM   3306  C  CG    . PRO B 2 232 ? -12.933 47.602 -9.106  1.00 149.92 ? 749  PRO C CG    1 
ATOM   3307  C  CD    . PRO B 2 232 ? -13.751 48.837 -8.864  1.00 149.76 ? 749  PRO C CD    1 
ATOM   3308  N  N     . PRO B 2 233 ? -16.552 46.545 -12.020 1.00 149.83 ? 750  PRO C N     1 
ATOM   3309  C  CA    . PRO B 2 233 ? -17.889 45.987 -12.221 1.00 150.47 ? 750  PRO C CA    1 
ATOM   3310  C  C     . PRO B 2 233 ? -17.984 44.514 -11.819 1.00 150.81 ? 750  PRO C C     1 
ATOM   3311  O  O     . PRO B 2 233 ? -17.054 43.746 -12.063 1.00 150.47 ? 750  PRO C O     1 
ATOM   3312  C  CB    . PRO B 2 233 ? -18.106 46.149 -13.725 1.00 150.80 ? 750  PRO C CB    1 
ATOM   3313  C  CG    . PRO B 2 233 ? -16.738 46.060 -14.305 1.00 150.36 ? 750  PRO C CG    1 
ATOM   3314  C  CD    . PRO B 2 233 ? -15.799 46.642 -13.284 1.00 149.68 ? 750  PRO C CD    1 
ATOM   3315  N  N     . LEU B 2 234 ? -19.109 44.135 -11.218 1.00 151.16 ? 751  LEU C N     1 
ATOM   3316  C  CA    . LEU B 2 234 ? -19.319 42.769 -10.735 1.00 151.84 ? 751  LEU C CA    1 
ATOM   3317  C  C     . LEU B 2 234 ? -19.473 41.781 -11.885 1.00 152.13 ? 751  LEU C C     1 
ATOM   3318  O  O     . LEU B 2 234 ? -20.179 42.057 -12.857 1.00 152.31 ? 751  LEU C O     1 
ATOM   3319  C  CB    . LEU B 2 234 ? -20.567 42.707 -9.852  1.00 153.00 ? 751  LEU C CB    1 
ATOM   3320  C  CG    . LEU B 2 234 ? -20.478 43.479 -8.533  1.00 152.75 ? 751  LEU C CG    1 
ATOM   3321  C  CD1   . LEU B 2 234 ? -21.793 44.174 -8.208  1.00 153.29 ? 751  LEU C CD1   1 
ATOM   3322  C  CD2   . LEU B 2 234 ? -20.052 42.561 -7.396  1.00 153.33 ? 751  LEU C CD2   1 
ATOM   3323  N  N     . LEU B 2 235 ? -18.814 40.630 -11.765 1.00 152.40 ? 752  LEU C N     1 
ATOM   3324  C  CA    . LEU B 2 235 ? -18.942 39.560 -12.748 1.00 153.09 ? 752  LEU C CA    1 
ATOM   3325  C  C     . LEU B 2 235 ? -20.213 38.760 -12.457 1.00 154.46 ? 752  LEU C C     1 
ATOM   3326  O  O     . LEU B 2 235 ? -20.171 37.712 -11.811 1.00 155.17 ? 752  LEU C O     1 
ATOM   3327  C  CB    . LEU B 2 235 ? -17.704 38.655 -12.730 1.00 153.20 ? 752  LEU C CB    1 
ATOM   3328  C  CG    . LEU B 2 235 ? -16.351 39.345 -12.942 1.00 152.10 ? 752  LEU C CG    1 
ATOM   3329  C  CD1   . LEU B 2 235 ? -15.219 38.331 -12.874 1.00 152.43 ? 752  LEU C CD1   1 
ATOM   3330  C  CD2   . LEU B 2 235 ? -16.309 40.101 -14.263 1.00 151.54 ? 752  LEU C CD2   1 
ATOM   3331  N  N     . ASN B 2 236 ? -21.343 39.280 -12.934 1.00 155.02 ? 753  ASN C N     1 
ATOM   3332  C  CA    . ASN B 2 236 ? -22.661 38.678 -12.692 1.00 156.75 ? 753  ASN C CA    1 
ATOM   3333  C  C     . ASN B 2 236 ? -23.326 38.086 -13.940 1.00 158.26 ? 753  ASN C C     1 
ATOM   3334  O  O     . ASN B 2 236 ? -24.241 37.268 -13.824 1.00 159.98 ? 753  ASN C O     1 
ATOM   3335  C  CB    . ASN B 2 236 ? -23.604 39.699 -12.032 1.00 156.52 ? 753  ASN C CB    1 
ATOM   3336  C  CG    . ASN B 2 236 ? -23.724 40.998 -12.818 1.00 155.35 ? 753  ASN C CG    1 
ATOM   3337  O  OD1   . ASN B 2 236 ? -23.185 41.131 -13.917 1.00 154.79 ? 753  ASN C OD1   1 
ATOM   3338  N  ND2   . ASN B 2 236 ? -24.434 41.966 -12.249 1.00 155.11 ? 753  ASN C ND2   1 
ATOM   3339  N  N     . ASN B 2 237 ? -22.869 38.496 -15.122 1.00 157.99 ? 754  ASN C N     1 
ATOM   3340  C  CA    . ASN B 2 237 ? -23.444 38.029 -16.384 1.00 159.24 ? 754  ASN C CA    1 
ATOM   3341  C  C     . ASN B 2 237 ? -22.803 36.730 -16.859 1.00 159.95 ? 754  ASN C C     1 
ATOM   3342  O  O     . ASN B 2 237 ? -21.801 36.278 -16.303 1.00 159.39 ? 754  ASN C O     1 
ATOM   3343  C  CB    . ASN B 2 237 ? -23.281 39.094 -17.474 1.00 158.56 ? 754  ASN C CB    1 
ATOM   3344  C  CG    . ASN B 2 237 ? -23.905 40.425 -17.095 1.00 158.50 ? 754  ASN C CG    1 
ATOM   3345  O  OD1   . ASN B 2 237 ? -23.260 41.470 -17.178 1.00 157.24 ? 754  ASN C OD1   1 
ATOM   3346  N  ND2   . ASN B 2 237 ? -25.166 40.393 -16.678 1.00 160.03 ? 754  ASN C ND2   1 
ATOM   3347  N  N     . ALA B 2 238 ? -23.396 36.138 -17.893 1.00 161.43 ? 755  ALA C N     1 
ATOM   3348  C  CA    . ALA B 2 238 ? -22.855 34.936 -18.522 1.00 162.41 ? 755  ALA C CA    1 
ATOM   3349  C  C     . ALA B 2 238 ? -21.785 35.286 -19.558 1.00 161.39 ? 755  ALA C C     1 
ATOM   3350  O  O     . ALA B 2 238 ? -20.871 34.499 -19.796 1.00 161.66 ? 755  ALA C O     1 
ATOM   3351  C  CB    . ALA B 2 238 ? -23.972 34.131 -19.170 1.00 164.36 ? 755  ALA C CB    1 
ATOM   3352  N  N     . ASP B 2 239 ? -21.905 36.461 -20.174 1.00 160.52 ? 756  ASP C N     1 
ATOM   3353  C  CA    . ASP B 2 239 ? -20.949 36.909 -21.197 1.00 159.18 ? 756  ASP C CA    1 
ATOM   3354  C  C     . ASP B 2 239 ? -19.817 37.779 -20.633 1.00 157.08 ? 756  ASP C C     1 
ATOM   3355  O  O     . ASP B 2 239 ? -18.822 38.022 -21.318 1.00 155.83 ? 756  ASP C O     1 
ATOM   3356  C  CB    . ASP B 2 239 ? -21.670 37.640 -22.343 1.00 159.50 ? 756  ASP C CB    1 
ATOM   3357  C  CG    . ASP B 2 239 ? -22.519 38.814 -21.867 1.00 159.48 ? 756  ASP C CG    1 
ATOM   3358  O  OD1   . ASP B 2 239 ? -23.129 39.485 -22.725 1.00 159.94 ? 756  ASP C OD1   1 
ATOM   3359  O  OD2   . ASP B 2 239 ? -22.584 39.065 -20.644 1.00 158.94 ? 756  ASP C OD2   1 
ATOM   3360  N  N     . SER B 2 240 ? -19.974 38.246 -19.395 1.00 156.38 ? 757  SER C N     1 
ATOM   3361  C  CA    . SER B 2 240 ? -18.925 39.013 -18.720 1.00 154.96 ? 757  SER C CA    1 
ATOM   3362  C  C     . SER B 2 240 ? -17.732 38.116 -18.390 1.00 154.71 ? 757  SER C C     1 
ATOM   3363  O  O     . SER B 2 240 ? -16.580 38.505 -18.586 1.00 153.74 ? 757  SER C O     1 
ATOM   3364  C  CB    . SER B 2 240 ? -19.466 39.658 -17.443 1.00 154.75 ? 757  SER C CB    1 
ATOM   3365  O  OG    . SER B 2 240 ? -19.948 38.677 -16.540 1.00 155.64 ? 757  SER C OG    1 
ATOM   3366  N  N     . VAL B 2 241 ? -18.021 36.920 -17.880 1.00 155.61 ? 758  VAL C N     1 
ATOM   3367  C  CA    . VAL B 2 241 ? -16.993 35.891 -17.663 1.00 155.73 ? 758  VAL C CA    1 
ATOM   3368  C  C     . VAL B 2 241 ? -16.358 35.468 -18.993 1.00 155.47 ? 758  VAL C C     1 
ATOM   3369  O  O     . VAL B 2 241 ? -15.143 35.282 -19.068 1.00 155.13 ? 758  VAL C O     1 
ATOM   3370  C  CB    . VAL B 2 241 ? -17.527 34.654 -16.875 1.00 157.24 ? 758  VAL C CB    1 
ATOM   3371  C  CG1   . VAL B 2 241 ? -18.978 34.338 -17.214 1.00 158.25 ? 758  VAL C CG1   1 
ATOM   3372  C  CG2   . VAL B 2 241 ? -16.653 33.424 -17.099 1.00 158.03 ? 758  VAL C CG2   1 
ATOM   3373  N  N     . GLN B 2 242 ? -17.178 35.328 -20.034 1.00 155.66 ? 759  GLN C N     1 
ATOM   3374  C  CA    . GLN B 2 242 ? -16.681 35.002 -21.372 1.00 155.74 ? 759  GLN C CA    1 
ATOM   3375  C  C     . GLN B 2 242 ? -15.752 36.095 -21.902 1.00 154.37 ? 759  GLN C C     1 
ATOM   3376  O  O     . GLN B 2 242 ? -14.742 35.800 -22.544 1.00 154.05 ? 759  GLN C O     1 
ATOM   3377  C  CB    . GLN B 2 242 ? -17.847 34.797 -22.344 1.00 156.78 ? 759  GLN C CB    1 
ATOM   3378  C  CG    . GLN B 2 242 ? -17.431 34.349 -23.739 1.00 157.11 ? 759  GLN C CG    1 
ATOM   3379  C  CD    . GLN B 2 242 ? -18.599 34.251 -24.703 1.00 158.14 ? 759  GLN C CD    1 
ATOM   3380  O  OE1   . GLN B 2 242 ? -19.758 34.409 -24.317 1.00 158.86 ? 759  GLN C OE1   1 
ATOM   3381  N  NE2   . GLN B 2 242 ? -18.296 33.986 -25.969 1.00 158.52 ? 759  GLN C NE2   1 
ATOM   3382  N  N     . ALA B 2 243 ? -16.105 37.352 -21.637 1.00 153.62 ? 760  ALA C N     1 
ATOM   3383  C  CA    . ALA B 2 243 ? -15.279 38.492 -22.035 1.00 152.53 ? 760  ALA C CA    1 
ATOM   3384  C  C     . ALA B 2 243 ? -13.929 38.472 -21.320 1.00 152.13 ? 760  ALA C C     1 
ATOM   3385  O  O     . ALA B 2 243 ? -12.890 38.725 -21.933 1.00 151.68 ? 760  ALA C O     1 
ATOM   3386  C  CB    . ALA B 2 243 ? -16.007 39.798 -21.752 1.00 152.00 ? 760  ALA C CB    1 
ATOM   3387  N  N     . LYS B 2 244 ? -13.953 38.164 -20.026 1.00 152.42 ? 761  LYS C N     1 
ATOM   3388  C  CA    . LYS B 2 244 ? -12.728 38.054 -19.233 1.00 152.43 ? 761  LYS C CA    1 
ATOM   3389  C  C     . LYS B 2 244 ? -11.974 36.754 -19.521 1.00 153.70 ? 761  LYS C C     1 
ATOM   3390  O  O     . LYS B 2 244 ? -10.764 36.684 -19.318 1.00 153.61 ? 761  LYS C O     1 
ATOM   3391  C  CB    . LYS B 2 244 ? -13.042 38.170 -17.737 1.00 152.32 ? 761  LYS C CB    1 
ATOM   3392  C  CG    . LYS B 2 244 ? -13.640 39.512 -17.334 1.00 151.39 ? 761  LYS C CG    1 
ATOM   3393  C  CD    . LYS B 2 244 ? -12.610 40.634 -17.389 1.00 150.41 ? 761  LYS C CD    1 
ATOM   3394  C  CE    . LYS B 2 244 ? -13.218 41.959 -17.832 1.00 149.64 ? 761  LYS C CE    1 
ATOM   3395  N  NZ    . LYS B 2 244 ? -14.002 42.626 -16.757 1.00 149.30 ? 761  LYS C NZ    1 
ATOM   3396  N  N     . VAL B 2 245 ? -12.686 35.730 -19.987 1.00 155.29 ? 762  VAL C N     1 
ATOM   3397  C  CA    . VAL B 2 245 ? -12.050 34.492 -20.436 1.00 157.15 ? 762  VAL C CA    1 
ATOM   3398  C  C     . VAL B 2 245 ? -11.282 34.731 -21.735 1.00 157.66 ? 762  VAL C C     1 
ATOM   3399  O  O     . VAL B 2 245 ? -10.161 34.247 -21.899 1.00 158.46 ? 762  VAL C O     1 
ATOM   3400  C  CB    . VAL B 2 245 ? -13.087 33.396 -20.629 1.00 158.45 ? 762  VAL C CB    1 
ATOM   3401  N  N     . GLU B 2 246 ? -11.896 35.481 -22.649 1.00 157.92 ? 763  GLU C N     1 
ATOM   3402  C  CA    . GLU B 2 246 ? -11.261 35.859 -23.913 1.00 158.36 ? 763  GLU C CA    1 
ATOM   3403  C  C     . GLU B 2 246 ? -10.030 36.736 -23.671 1.00 157.67 ? 763  GLU C C     1 
ATOM   3404  O  O     . GLU B 2 246 ? -9.021  36.603 -24.365 1.00 158.01 ? 763  GLU C O     1 
ATOM   3405  C  CB    . GLU B 2 246 ? -12.260 36.599 -24.810 1.00 158.72 ? 763  GLU C CB    1 
ATOM   3406  C  CG    . GLU B 2 246 ? -11.786 36.813 -26.242 1.00 159.19 ? 763  GLU C CG    1 
ATOM   3407  C  CD    . GLU B 2 246 ? -12.775 37.597 -27.090 1.00 159.64 ? 763  GLU C CD    1 
ATOM   3408  O  OE1   . GLU B 2 246 ? -12.429 37.933 -28.242 1.00 159.82 ? 763  GLU C OE1   1 
ATOM   3409  O  OE2   . GLU B 2 246 ? -13.893 37.884 -26.613 1.00 160.17 ? 763  GLU C OE2   1 
ATOM   3410  N  N     . MET B 2 247 ? -10.130 37.632 -22.691 1.00 156.80 ? 764  MET C N     1 
ATOM   3411  C  CA    . MET B 2 247 ? -9.012  38.485 -22.282 1.00 156.26 ? 764  MET C CA    1 
ATOM   3412  C  C     . MET B 2 247 ? -7.782  37.656 -21.921 1.00 156.65 ? 764  MET C C     1 
ATOM   3413  O  O     . MET B 2 247 ? -6.691  37.897 -22.439 1.00 156.68 ? 764  MET C O     1 
ATOM   3414  C  CB    . MET B 2 247 ? -9.427  39.347 -21.086 1.00 155.79 ? 764  MET C CB    1 
ATOM   3415  C  CG    . MET B 2 247 ? -8.290  40.052 -20.361 1.00 155.72 ? 764  MET C CG    1 
ATOM   3416  S  SD    . MET B 2 247 ? -8.780  40.531 -18.696 1.00 155.73 ? 764  MET C SD    1 
ATOM   3417  C  CE    . MET B 2 247 ? -9.821  41.937 -19.058 1.00 154.66 ? 764  MET C CE    1 
ATOM   3418  N  N     . LEU B 2 248 ? -7.968  36.690 -21.024 1.00 157.04 ? 765  LEU C N     1 
ATOM   3419  C  CA    . LEU B 2 248 ? -6.876  35.818 -20.583 1.00 157.88 ? 765  LEU C CA    1 
ATOM   3420  C  C     . LEU B 2 248 ? -6.270  35.034 -21.748 1.00 159.17 ? 765  LEU C C     1 
ATOM   3421  O  O     . LEU B 2 248 ? -5.053  34.874 -21.818 1.00 159.95 ? 765  LEU C O     1 
ATOM   3422  C  CB    . LEU B 2 248 ? -7.346  34.854 -19.484 1.00 158.10 ? 765  LEU C CB    1 
ATOM   3423  C  CG    . LEU B 2 248 ? -7.235  35.343 -18.035 1.00 157.57 ? 765  LEU C CG    1 
ATOM   3424  C  CD1   . LEU B 2 248 ? -7.817  36.738 -17.859 1.00 156.30 ? 765  LEU C CD1   1 
ATOM   3425  C  CD2   . LEU B 2 248 ? -7.908  34.354 -17.094 1.00 158.33 ? 765  LEU C CD2   1 
ATOM   3426  N  N     . ASP B 2 249 ? -7.120  34.557 -22.657 1.00 160.03 ? 766  ASP C N     1 
ATOM   3427  C  CA    . ASP B 2 249 ? -6.659  33.842 -23.851 1.00 161.36 ? 766  ASP C CA    1 
ATOM   3428  C  C     . ASP B 2 249 ? -5.761  34.727 -24.718 1.00 161.43 ? 766  ASP C C     1 
ATOM   3429  O  O     . ASP B 2 249 ? -4.703  34.287 -25.170 1.00 162.34 ? 766  ASP C O     1 
ATOM   3430  C  CB    . ASP B 2 249 ? -7.846  33.340 -24.684 1.00 161.69 ? 766  ASP C CB    1 
ATOM   3431  C  CG    . ASP B 2 249 ? -8.617  32.219 -24.001 1.00 162.75 ? 766  ASP C CG    1 
ATOM   3432  O  OD1   . ASP B 2 249 ? -9.865  32.238 -24.057 1.00 162.64 ? 766  ASP C OD1   1 
ATOM   3433  O  OD2   . ASP B 2 249 ? -7.981  31.316 -23.415 1.00 163.83 ? 766  ASP C OD2   1 
ATOM   3434  N  N     . ASN B 2 250 ? -6.190  35.968 -24.945 1.00 160.94 ? 767  ASN C N     1 
ATOM   3435  C  CA    . ASN B 2 250 ? -5.405  36.931 -25.719 1.00 161.17 ? 767  ASN C CA    1 
ATOM   3436  C  C     . ASN B 2 250 ? -4.146  37.372 -24.977 1.00 162.26 ? 767  ASN C C     1 
ATOM   3437  O  O     . ASN B 2 250 ? -3.059  37.391 -25.554 1.00 162.70 ? 767  ASN C O     1 
ATOM   3438  C  CB    . ASN B 2 250 ? -6.245  38.164 -26.071 1.00 160.21 ? 767  ASN C CB    1 
ATOM   3439  C  CG    . ASN B 2 250 ? -7.321  37.871 -27.100 1.00 160.27 ? 767  ASN C CG    1 
ATOM   3440  O  OD1   . ASN B 2 250 ? -8.505  38.099 -26.855 1.00 159.83 ? 767  ASN C OD1   1 
ATOM   3441  N  ND2   . ASN B 2 250 ? -6.915  37.377 -28.263 1.00 160.87 ? 767  ASN C ND2   1 
ATOM   3442  N  N     . LEU B 2 251 ? -4.305  37.725 -23.702 1.00 163.23 ? 768  LEU C N     1 
ATOM   3443  C  CA    . LEU B 2 251 ? -3.184  38.126 -22.843 1.00 164.95 ? 768  LEU C CA    1 
ATOM   3444  C  C     . LEU B 2 251 ? -2.084  37.064 -22.828 1.00 167.34 ? 768  LEU C C     1 
ATOM   3445  O  O     . LEU B 2 251 ? -0.898  37.392 -22.884 1.00 168.16 ? 768  LEU C O     1 
ATOM   3446  C  CB    . LEU B 2 251 ? -3.685  38.405 -21.415 1.00 164.85 ? 768  LEU C CB    1 
ATOM   3447  C  CG    . LEU B 2 251 ? -2.711  38.788 -20.283 1.00 165.50 ? 768  LEU C CG    1 
ATOM   3448  C  CD1   . LEU B 2 251 ? -2.109  37.566 -19.594 1.00 166.66 ? 768  LEU C CD1   1 
ATOM   3449  C  CD2   . LEU B 2 251 ? -1.616  39.736 -20.756 1.00 165.85 ? 768  LEU C CD2   1 
ATOM   3450  N  N     . LEU B 2 252 ? -2.485  35.797 -22.759 1.00 169.39 ? 769  LEU C N     1 
ATOM   3451  C  CA    . LEU B 2 252 ? -1.535  34.683 -22.755 1.00 172.20 ? 769  LEU C CA    1 
ATOM   3452  C  C     . LEU B 2 252 ? -0.697  34.681 -24.036 1.00 173.85 ? 769  LEU C C     1 
ATOM   3453  O  O     . LEU B 2 252 ? 0.527   34.566 -23.979 1.00 175.53 ? 769  LEU C O     1 
ATOM   3454  C  CB    . LEU B 2 252 ? -2.267  33.341 -22.600 1.00 173.04 ? 769  LEU C CB    1 
ATOM   3455  C  CG    . LEU B 2 252 ? -1.550  32.216 -21.843 1.00 174.94 ? 769  LEU C CG    1 
ATOM   3456  C  CD1   . LEU B 2 252 ? -0.229  31.844 -22.502 1.00 176.07 ? 769  LEU C CD1   1 
ATOM   3457  C  CD2   . LEU B 2 252 ? -1.344  32.593 -20.381 1.00 175.19 ? 769  LEU C CD2   1 
ATOM   3458  N  N     . ASP B 2 253 ? -1.361  34.829 -25.181 1.00 174.46 ? 770  ASP C N     1 
ATOM   3459  C  CA    . ASP B 2 253 ? -0.689  34.786 -26.486 1.00 176.18 ? 770  ASP C CA    1 
ATOM   3460  C  C     . ASP B 2 253 ? 0.282   35.948 -26.720 1.00 177.78 ? 770  ASP C C     1 
ATOM   3461  O  O     . ASP B 2 253 ? 1.222   35.817 -27.505 1.00 179.30 ? 770  ASP C O     1 
ATOM   3462  C  CB    . ASP B 2 253 ? -1.719  34.733 -27.622 1.00 175.53 ? 770  ASP C CB    1 
ATOM   3463  C  CG    . ASP B 2 253 ? -2.487  33.423 -27.655 1.00 175.81 ? 770  ASP C CG    1 
ATOM   3464  O  OD1   . ASP B 2 253 ? -2.566  32.745 -26.604 1.00 176.24 ? 770  ASP C OD1   1 
ATOM   3465  O  OD2   . ASP B 2 253 ? -3.014  33.075 -28.735 1.00 175.76 ? 770  ASP C OD2   1 
ATOM   3466  N  N     . ILE B 2 254 ? 0.055   37.076 -26.048 1.00 178.67 ? 771  ILE C N     1 
ATOM   3467  C  CA    . ILE B 2 254 ? 0.966   38.223 -26.132 1.00 180.64 ? 771  ILE C CA    1 
ATOM   3468  C  C     . ILE B 2 254 ? 2.261   37.922 -25.376 1.00 183.25 ? 771  ILE C C     1 
ATOM   3469  O  O     . ILE B 2 254 ? 3.353   38.227 -25.858 1.00 184.31 ? 771  ILE C O     1 
ATOM   3470  C  CB    . ILE B 2 254 ? 0.323   39.515 -25.578 1.00 179.98 ? 771  ILE C CB    1 
ATOM   3471  C  CG1   . ILE B 2 254 ? -0.902  39.893 -26.417 1.00 179.17 ? 771  ILE C CG1   1 
ATOM   3472  C  CG2   . ILE B 2 254 ? 1.327   40.665 -25.581 1.00 180.61 ? 771  ILE C CG2   1 
ATOM   3473  C  CD1   . ILE B 2 254 ? -1.687  41.070 -25.879 1.00 178.38 ? 771  ILE C CD1   1 
ATOM   3474  N  N     . GLU B 2 255 ? 2.129   37.328 -24.191 1.00 185.13 ? 772  GLU C N     1 
ATOM   3475  C  CA    . GLU B 2 255 ? 3.286   36.901 -23.400 1.00 187.55 ? 772  GLU C CA    1 
ATOM   3476  C  C     . GLU B 2 255 ? 4.034   35.760 -24.098 1.00 189.69 ? 772  GLU C C     1 
ATOM   3477  O  O     . GLU B 2 255 ? 5.247   35.619 -23.939 1.00 191.45 ? 772  GLU C O     1 
ATOM   3478  C  CB    . GLU B 2 255 ? 2.854   36.469 -21.993 1.00 187.63 ? 772  GLU C CB    1 
ATOM   3479  C  CG    . GLU B 2 255 ? 2.256   37.582 -21.136 1.00 186.65 ? 772  GLU C CG    1 
ATOM   3480  C  CD    . GLU B 2 255 ? 3.300   38.426 -20.418 1.00 187.38 ? 772  GLU C CD    1 
ATOM   3481  O  OE1   . GLU B 2 255 ? 3.004   38.904 -19.298 1.00 186.90 ? 772  GLU C OE1   1 
ATOM   3482  O  OE2   . GLU B 2 255 ? 4.411   38.611 -20.965 1.00 188.64 ? 772  GLU C OE2   1 
ATOM   3483  N  N     . VAL B 2 256 ? 3.303   34.950 -24.863 1.00 190.23 ? 773  VAL C N     1 
ATOM   3484  C  CA    . VAL B 2 256 ? 3.908   33.923 -25.712 1.00 192.24 ? 773  VAL C CA    1 
ATOM   3485  C  C     . VAL B 2 256 ? 4.659   34.583 -26.871 1.00 194.02 ? 773  VAL C C     1 
ATOM   3486  O  O     . VAL B 2 256 ? 5.773   34.180 -27.200 1.00 196.17 ? 773  VAL C O     1 
ATOM   3487  C  CB    . VAL B 2 256 ? 2.851   32.931 -26.255 1.00 191.43 ? 773  VAL C CB    1 
ATOM   3488  C  CG1   . VAL B 2 256 ? 3.450   32.007 -27.311 1.00 192.55 ? 773  VAL C CG1   1 
ATOM   3489  C  CG2   . VAL B 2 256 ? 2.255   32.110 -25.118 1.00 191.46 ? 773  VAL C CG2   1 
ATOM   3490  N  N     . ALA B 2 257 ? 4.049   35.600 -27.479 1.00 194.52 ? 774  ALA C N     1 
ATOM   3491  C  CA    . ALA B 2 257 ? 4.686   36.352 -28.566 1.00 196.50 ? 774  ALA C CA    1 
ATOM   3492  C  C     . ALA B 2 257 ? 5.967   37.052 -28.101 1.00 199.32 ? 774  ALA C C     1 
ATOM   3493  O  O     . ALA B 2 257 ? 6.924   37.176 -28.868 1.00 200.50 ? 774  ALA C O     1 
ATOM   3494  C  CB    . ALA B 2 257 ? 3.715   37.363 -29.158 1.00 195.15 ? 774  ALA C CB    1 
ATOM   3495  N  N     . TYR B 2 258 ? 5.974   37.512 -26.850 1.00 201.23 ? 775  TYR C N     1 
ATOM   3496  C  CA    . TYR B 2 258 ? 7.188   38.041 -26.222 1.00 204.22 ? 775  TYR C CA    1 
ATOM   3497  C  C     . TYR B 2 258 ? 8.238   36.943 -26.045 1.00 207.73 ? 775  TYR C C     1 
ATOM   3498  O  O     . TYR B 2 258 ? 9.415   37.152 -26.337 1.00 209.43 ? 775  TYR C O     1 
ATOM   3499  C  CB    . TYR B 2 258 ? 6.882   38.661 -24.851 1.00 203.57 ? 775  TYR C CB    1 
ATOM   3500  C  CG    . TYR B 2 258 ? 6.414   40.101 -24.887 1.00 202.42 ? 775  TYR C CG    1 
ATOM   3501  C  CD1   . TYR B 2 258 ? 7.230   41.108 -25.396 1.00 203.28 ? 775  TYR C CD1   1 
ATOM   3502  C  CD2   . TYR B 2 258 ? 5.167   40.463 -24.379 1.00 200.76 ? 775  TYR C CD2   1 
ATOM   3503  C  CE1   . TYR B 2 258 ? 6.809   42.428 -25.420 1.00 202.52 ? 775  TYR C CE1   1 
ATOM   3504  C  CE2   . TYR B 2 258 ? 4.740   41.780 -24.396 1.00 199.82 ? 775  TYR C CE2   1 
ATOM   3505  C  CZ    . TYR B 2 258 ? 5.565   42.759 -24.914 1.00 200.66 ? 775  TYR C CZ    1 
ATOM   3506  O  OH    . TYR B 2 258 ? 5.141   44.066 -24.936 1.00 199.74 ? 775  TYR C OH    1 
ATOM   3507  N  N     . SER B 2 259 ? 7.802   35.780 -25.560 1.00 209.82 ? 776  SER C N     1 
ATOM   3508  C  CA    . SER B 2 259 ? 8.700   34.648 -25.306 1.00 213.35 ? 776  SER C CA    1 
ATOM   3509  C  C     . SER B 2 259 ? 9.441   34.195 -26.564 1.00 216.63 ? 776  SER C C     1 
ATOM   3510  O  O     . SER B 2 259 ? 10.608  33.806 -26.492 1.00 218.74 ? 776  SER C O     1 
ATOM   3511  C  CB    . SER B 2 259 ? 7.926   33.471 -24.707 1.00 212.92 ? 776  SER C CB    1 
ATOM   3512  O  OG    . SER B 2 259 ? 7.286   33.843 -23.499 1.00 211.81 ? 776  SER C OG    1 
ATOM   3513  N  N     . LEU B 2 260 ? 8.761   34.243 -27.708 1.00 218.35 ? 777  LEU C N     1 
ATOM   3514  C  CA    . LEU B 2 260 ? 9.398   33.967 -28.996 1.00 221.80 ? 777  LEU C CA    1 
ATOM   3515  C  C     . LEU B 2 260 ? 10.377  35.087 -29.353 1.00 225.05 ? 777  LEU C C     1 
ATOM   3516  O  O     . LEU B 2 260 ? 11.553  34.828 -29.613 1.00 227.89 ? 777  LEU C O     1 
ATOM   3517  C  CB    . LEU B 2 260 ? 8.355   33.808 -30.114 1.00 220.48 ? 777  LEU C CB    1 
ATOM   3518  C  CG    . LEU B 2 260 ? 7.688   32.440 -30.330 1.00 220.28 ? 777  LEU C CG    1 
ATOM   3519  C  CD1   . LEU B 2 260 ? 8.714   31.380 -30.704 1.00 222.23 ? 777  LEU C CD1   1 
ATOM   3520  C  CD2   . LEU B 2 260 ? 6.873   31.991 -29.126 1.00 219.48 ? 777  LEU C CD2   1 
ATOM   3521  N  N     . LEU B 2 261 ? 9.884   36.325 -29.347 1.00 225.96 ? 778  LEU C N     1 
ATOM   3522  C  CA    . LEU B 2 261 ? 10.681  37.495 -29.737 1.00 228.40 ? 778  LEU C CA    1 
ATOM   3523  C  C     . LEU B 2 261 ? 11.940  37.664 -28.882 1.00 231.64 ? 778  LEU C C     1 
ATOM   3524  O  O     . LEU B 2 261 ? 13.018  37.938 -29.412 1.00 233.77 ? 778  LEU C O     1 
ATOM   3525  C  CB    . LEU B 2 261 ? 9.823   38.766 -29.675 1.00 226.88 ? 778  LEU C CB    1 
ATOM   3526  C  CG    . LEU B 2 261 ? 10.473  40.101 -30.061 1.00 227.87 ? 778  LEU C CG    1 
ATOM   3527  C  CD1   . LEU B 2 261 ? 11.175  40.019 -31.409 1.00 229.46 ? 778  LEU C CD1   1 
ATOM   3528  C  CD2   . LEU B 2 261 ? 9.426   41.205 -30.073 1.00 226.13 ? 778  LEU C CD2   1 
ATOM   3529  N  N     . ARG B 2 262 ? 11.799  37.497 -27.569 1.00 233.16 ? 779  ARG C N     1 
ATOM   3530  C  CA    . ARG B 2 262 ? 12.936  37.581 -26.651 1.00 236.67 ? 779  ARG C CA    1 
ATOM   3531  C  C     . ARG B 2 262 ? 13.656  36.235 -26.564 1.00 239.52 ? 779  ARG C C     1 
ATOM   3532  O  O     . ARG B 2 262 ? 13.180  35.314 -25.897 1.00 239.01 ? 779  ARG C O     1 
ATOM   3533  C  CB    . ARG B 2 262 ? 12.471  38.003 -25.253 1.00 236.43 ? 779  ARG C CB    1 
ATOM   3534  C  CG    . ARG B 2 262 ? 11.727  39.327 -25.195 1.00 235.15 ? 779  ARG C CG    1 
ATOM   3535  C  CD    . ARG B 2 262 ? 11.362  39.673 -23.758 1.00 234.93 ? 779  ARG C CD    1 
ATOM   3536  N  NE    . ARG B 2 262 ? 10.355  40.730 -23.667 1.00 233.11 ? 779  ARG C NE    1 
ATOM   3537  C  CZ    . ARG B 2 262 ? 9.837   41.187 -22.527 1.00 232.22 ? 779  ARG C CZ    1 
ATOM   3538  N  NH1   . ARG B 2 262 ? 10.222  40.687 -21.356 1.00 233.13 ? 779  ARG C NH1   1 
ATOM   3539  N  NH2   . ARG B 2 262 ? 8.924   42.154 -22.556 1.00 230.49 ? 779  ARG C NH2   1 
ATOM   3540  N  N     . GLY B 2 263 ? 14.797  36.122 -27.242 1.00 243.21 ? 780  GLY C N     1 
ATOM   3541  C  CA    . GLY B 2 263 ? 15.610  34.903 -27.193 1.00 246.83 ? 780  GLY C CA    1 
ATOM   3542  C  C     . GLY B 2 263 ? 16.405  34.637 -28.458 1.00 249.89 ? 780  GLY C C     1 
ATOM   3543  O  O     . GLY B 2 263 ? 16.626  35.539 -29.268 1.00 250.24 ? 780  GLY C O     1 
ATOM   3544  N  N     . GLY B 2 264 ? 16.837  33.387 -28.618 1.00 252.98 ? 781  GLY C N     1 
ATOM   3545  C  CA    . GLY B 2 264 ? 17.625  32.968 -29.776 1.00 255.82 ? 781  GLY C CA    1 
ATOM   3546  C  C     . GLY B 2 264 ? 19.114  33.162 -29.561 1.00 260.06 ? 781  GLY C C     1 
ATOM   3547  O  O     . GLY B 2 264 ? 19.586  33.201 -28.423 1.00 261.32 ? 781  GLY C O     1 
ATOM   3548  N  N     . SER B 2 265 ? 19.852  33.278 -30.664 1.00 262.97 ? 782  SER C N     1 
ATOM   3549  C  CA    . SER B 2 265 ? 21.298  33.491 -30.629 1.00 267.28 ? 782  SER C CA    1 
ATOM   3550  C  C     . SER B 2 265 ? 21.658  34.757 -31.404 1.00 268.73 ? 782  SER C C     1 
ATOM   3551  O  O     . SER B 2 265 ? 21.737  34.738 -32.634 1.00 269.29 ? 782  SER C O     1 
ATOM   3552  C  CB    . SER B 2 265 ? 22.027  32.285 -31.223 1.00 269.14 ? 782  SER C CB    1 
ATOM   3553  N  N     . ASP B 2 266 ? 21.873  35.851 -30.676 1.00 269.86 ? 783  ASP C N     1 
ATOM   3554  C  CA    . ASP B 2 266 ? 22.172  37.146 -31.286 1.00 270.82 ? 783  ASP C CA    1 
ATOM   3555  C  C     . ASP B 2 266 ? 23.601  37.194 -31.825 1.00 275.08 ? 783  ASP C C     1 
ATOM   3556  O  O     . ASP B 2 266 ? 24.506  37.718 -31.172 1.00 277.55 ? 783  ASP C O     1 
ATOM   3557  C  CB    . ASP B 2 266 ? 21.951  38.277 -30.276 1.00 269.97 ? 783  ASP C CB    1 
ATOM   3558  N  N     . ASP B 2 267 ? 23.787  36.637 -33.019 1.00 276.55 ? 784  ASP C N     1 
ATOM   3559  C  CA    . ASP B 2 267 ? 25.078  36.647 -33.705 1.00 280.42 ? 784  ASP C CA    1 
ATOM   3560  C  C     . ASP B 2 267 ? 24.961  37.421 -35.013 1.00 280.72 ? 784  ASP C C     1 
ATOM   3561  O  O     . ASP B 2 267 ? 23.945  37.331 -35.705 1.00 278.19 ? 784  ASP C O     1 
ATOM   3562  C  CB    . ASP B 2 267 ? 25.541  35.217 -33.985 1.00 281.77 ? 784  ASP C CB    1 
ATOM   3563  N  N     . SER B 2 268 ? 26.003  38.180 -35.346 1.00 284.09 ? 785  SER C N     1 
ATOM   3564  C  CA    . SER B 2 268 ? 26.009  39.003 -36.556 1.00 284.74 ? 785  SER C CA    1 
ATOM   3565  C  C     . SER B 2 268 ? 26.134  38.136 -37.808 1.00 285.80 ? 785  SER C C     1 
ATOM   3566  O  O     . SER B 2 268 ? 27.238  37.884 -38.295 1.00 289.30 ? 785  SER C O     1 
ATOM   3567  C  CB    . SER B 2 268 ? 27.150  40.023 -36.504 1.00 287.68 ? 785  SER C CB    1 
ATOM   3568  N  N     . SER B 2 269 ? 24.991  37.680 -38.317 1.00 283.14 ? 786  SER C N     1 
ATOM   3569  C  CA    . SER B 2 269 ? 24.947  36.849 -39.520 1.00 283.19 ? 786  SER C CA    1 
ATOM   3570  C  C     . SER B 2 269 ? 23.599  36.967 -40.232 1.00 279.74 ? 786  SER C C     1 
ATOM   3571  O  O     . SER B 2 269 ? 23.531  37.445 -41.366 1.00 279.79 ? 786  SER C O     1 
ATOM   3572  C  CB    . SER B 2 269 ? 25.226  35.386 -39.167 1.00 283.97 ? 786  SER C CB    1 
ATOM   3573  N  N     . LYS B 2 270 ? 22.535  36.534 -39.560 1.00 276.60 ? 787  LYS C N     1 
ATOM   3574  C  CA    . LYS B 2 270 ? 21.182  36.592 -40.115 1.00 273.01 ? 787  LYS C CA    1 
ATOM   3575  C  C     . LYS B 2 270 ? 20.567  37.977 -39.925 1.00 270.54 ? 787  LYS C C     1 
ATOM   3576  O  O     . LYS B 2 270 ? 21.081  38.795 -39.159 1.00 271.54 ? 787  LYS C O     1 
ATOM   3577  C  CB    . LYS B 2 270 ? 20.290  35.536 -39.457 1.00 271.04 ? 787  LYS C CB    1 
ATOM   3578  N  N     . ASP B 2 271 ? 19.462  38.228 -40.626 1.00 266.91 ? 788  ASP C N     1 
ATOM   3579  C  CA    . ASP B 2 271 ? 18.762  39.512 -40.555 1.00 264.11 ? 788  ASP C CA    1 
ATOM   3580  C  C     . ASP B 2 271 ? 17.658  39.475 -39.493 1.00 260.15 ? 788  ASP C C     1 
ATOM   3581  O  O     . ASP B 2 271 ? 17.201  38.395 -39.120 1.00 259.30 ? 788  ASP C O     1 
ATOM   3582  C  CB    . ASP B 2 271 ? 18.164  39.864 -41.918 1.00 263.53 ? 788  ASP C CB    1 
ATOM   3583  N  N     . PRO B 2 272 ? 17.219  40.656 -39.009 1.00 257.17 ? 789  PRO C N     1 
ATOM   3584  C  CA    . PRO B 2 272 ? 16.223  40.728 -37.927 1.00 253.46 ? 789  PRO C CA    1 
ATOM   3585  C  C     . PRO B 2 272 ? 14.897  40.028 -38.235 1.00 249.83 ? 789  PRO C C     1 
ATOM   3586  O  O     . PRO B 2 272 ? 14.333  39.371 -37.357 1.00 248.10 ? 789  PRO C O     1 
ATOM   3587  C  CB    . PRO B 2 272 ? 15.990  42.236 -37.755 1.00 253.25 ? 789  PRO C CB    1 
ATOM   3588  C  CG    . PRO B 2 272 ? 17.192  42.889 -38.340 1.00 256.25 ? 789  PRO C CG    1 
ATOM   3589  C  CD    . PRO B 2 272 ? 17.623  42.000 -39.465 1.00 257.90 ? 789  PRO C CD    1 
ATOM   3590  N  N     . ILE B 2 273 ? 14.410  40.172 -39.465 1.00 248.11 ? 790  ILE C N     1 
ATOM   3591  C  CA    . ILE B 2 273 ? 13.154  39.544 -39.883 1.00 244.84 ? 790  ILE C CA    1 
ATOM   3592  C  C     . ILE B 2 273 ? 13.322  38.024 -39.992 1.00 243.73 ? 790  ILE C C     1 
ATOM   3593  O  O     . ILE B 2 273 ? 12.410  37.269 -39.649 1.00 241.79 ? 790  ILE C O     1 
ATOM   3594  C  CB    . ILE B 2 273 ? 12.639  40.125 -41.223 1.00 244.87 ? 790  ILE C CB    1 
ATOM   3595  C  CG1   . ILE B 2 273 ? 12.357  41.626 -41.081 1.00 244.79 ? 790  ILE C CG1   1 
ATOM   3596  C  CG2   . ILE B 2 273 ? 11.373  39.405 -41.672 1.00 243.04 ? 790  ILE C CG2   1 
ATOM   3597  C  CD1   . ILE B 2 273 ? 11.986  42.317 -42.376 1.00 245.17 ? 790  ILE C CD1   1 
ATOM   3598  N  N     . ASP B 2 274 ? 14.488  37.587 -40.466 1.00 244.40 ? 791  ASP C N     1 
ATOM   3599  C  CA    . ASP B 2 274 ? 14.804  36.157 -40.570 1.00 243.70 ? 791  ASP C CA    1 
ATOM   3600  C  C     . ASP B 2 274 ? 14.912  35.477 -39.203 1.00 241.70 ? 791  ASP C C     1 
ATOM   3601  O  O     . ASP B 2 274 ? 14.574  34.300 -39.070 1.00 241.12 ? 791  ASP C O     1 
ATOM   3602  C  CB    . ASP B 2 274 ? 16.104  35.943 -41.355 1.00 246.42 ? 791  ASP C CB    1 
ATOM   3603  C  CG    . ASP B 2 274 ? 15.923  36.125 -42.851 1.00 246.71 ? 791  ASP C CG    1 
ATOM   3604  O  OD1   . ASP B 2 274 ? 15.066  35.432 -43.436 1.00 245.24 ? 791  ASP C OD1   1 
ATOM   3605  O  OD2   . ASP B 2 274 ? 16.648  36.950 -43.444 1.00 248.50 ? 791  ASP C OD2   1 
ATOM   3606  N  N     . VAL B 2 275 ? 15.387  36.212 -38.198 1.00 239.99 ? 792  VAL C N     1 
ATOM   3607  C  CA    . VAL B 2 275 ? 15.471  35.687 -36.833 1.00 238.16 ? 792  VAL C CA    1 
ATOM   3608  C  C     . VAL B 2 275 ? 14.072  35.358 -36.308 1.00 233.70 ? 792  VAL C C     1 
ATOM   3609  O  O     . VAL B 2 275 ? 13.859  34.296 -35.722 1.00 233.51 ? 792  VAL C O     1 
ATOM   3610  C  CB    . VAL B 2 275 ? 16.180  36.677 -35.876 1.00 239.28 ? 792  VAL C CB    1 
ATOM   3611  C  CG1   . VAL B 2 275 ? 16.046  36.234 -34.424 1.00 238.93 ? 792  VAL C CG1   1 
ATOM   3612  C  CG2   . VAL B 2 275 ? 17.652  36.813 -36.242 1.00 242.24 ? 792  VAL C CG2   1 
ATOM   3613  N  N     . ASN B 2 276 ? 13.127  36.268 -36.532 1.00 229.29 ? 793  ASN C N     1 
ATOM   3614  C  CA    . ASN B 2 276 ? 11.738  36.064 -36.115 1.00 225.08 ? 793  ASN C CA    1 
ATOM   3615  C  C     . ASN B 2 276 ? 10.995  35.030 -36.969 1.00 223.06 ? 793  ASN C C     1 
ATOM   3616  O  O     . ASN B 2 276 ? 10.042  34.409 -36.495 1.00 221.51 ? 793  ASN C O     1 
ATOM   3617  C  CB    . ASN B 2 276 ? 10.976  37.395 -36.118 1.00 223.32 ? 793  ASN C CB    1 
ATOM   3618  C  CG    . ASN B 2 276 ? 11.500  38.375 -35.078 1.00 223.27 ? 793  ASN C CG    1 
ATOM   3619  O  OD1   . ASN B 2 276 ? 12.050  37.976 -34.050 1.00 223.13 ? 793  ASN C OD1   1 
ATOM   3620  N  ND2   . ASN B 2 276 ? 11.325  39.666 -35.339 1.00 222.87 ? 793  ASN C ND2   1 
ATOM   3621  N  N     . TYR B 2 277 ? 11.426  34.851 -38.218 1.00 222.55 ? 794  TYR C N     1 
ATOM   3622  C  CA    . TYR B 2 277 ? 10.849  33.829 -39.099 1.00 221.13 ? 794  TYR C CA    1 
ATOM   3623  C  C     . TYR B 2 277 ? 11.193  32.425 -38.613 1.00 220.94 ? 794  TYR C C     1 
ATOM   3624  O  O     . TYR B 2 277 ? 10.328  31.551 -38.551 1.00 219.53 ? 794  TYR C O     1 
ATOM   3625  C  CB    . TYR B 2 277 ? 11.347  33.994 -40.538 1.00 222.19 ? 794  TYR C CB    1 
ATOM   3626  C  CG    . TYR B 2 277 ? 10.703  33.029 -41.516 1.00 221.62 ? 794  TYR C CG    1 
ATOM   3627  C  CD1   . TYR B 2 277 ? 9.394   33.217 -41.955 1.00 220.05 ? 794  TYR C CD1   1 
ATOM   3628  C  CD2   . TYR B 2 277 ? 11.401  31.923 -41.997 1.00 222.82 ? 794  TYR C CD2   1 
ATOM   3629  C  CE1   . TYR B 2 277 ? 8.801   32.336 -42.845 1.00 219.62 ? 794  TYR C CE1   1 
ATOM   3630  C  CE2   . TYR B 2 277 ? 10.816  31.037 -42.888 1.00 222.40 ? 794  TYR C CE2   1 
ATOM   3631  C  CZ    . TYR B 2 277 ? 9.517   31.248 -43.309 1.00 220.80 ? 794  TYR C CZ    1 
ATOM   3632  O  OH    . TYR B 2 277 ? 8.932   30.371 -44.193 1.00 220.54 ? 794  TYR C OH    1 
ATOM   3633  N  N     . GLU B 2 278 ? 12.465  32.216 -38.281 1.00 222.04 ? 795  GLU C N     1 
ATOM   3634  C  CA    . GLU B 2 278 ? 12.943  30.924 -37.784 1.00 222.64 ? 795  GLU C CA    1 
ATOM   3635  C  C     . GLU B 2 278 ? 12.336  30.570 -36.424 1.00 220.86 ? 795  GLU C C     1 
ATOM   3636  O  O     . GLU B 2 278 ? 12.201  29.392 -36.088 1.00 221.30 ? 795  GLU C O     1 
ATOM   3637  C  CB    . GLU B 2 278 ? 14.472  30.922 -37.693 1.00 225.26 ? 795  GLU C CB    1 
ATOM   3638  C  CG    . GLU B 2 278 ? 15.169  30.974 -39.046 1.00 226.65 ? 795  GLU C CG    1 
ATOM   3639  C  CD    . GLU B 2 278 ? 16.679  31.113 -38.940 1.00 229.18 ? 795  GLU C CD    1 
ATOM   3640  O  OE1   . GLU B 2 278 ? 17.349  31.074 -39.994 1.00 230.62 ? 795  GLU C OE1   1 
ATOM   3641  O  OE2   . GLU B 2 278 ? 17.200  31.261 -37.814 1.00 229.58 ? 795  GLU C OE2   1 
ATOM   3642  N  N     . LYS B 2 279 ? 11.976  31.592 -35.651 1.00 218.65 ? 796  LYS C N     1 
ATOM   3643  C  CA    . LYS B 2 279 ? 11.325  31.401 -34.354 1.00 216.95 ? 796  LYS C CA    1 
ATOM   3644  C  C     . LYS B 2 279 ? 9.886   30.892 -34.482 1.00 214.06 ? 796  LYS C C     1 
ATOM   3645  O  O     . LYS B 2 279 ? 9.393   30.203 -33.587 1.00 213.36 ? 796  LYS C O     1 
ATOM   3646  C  CB    . LYS B 2 279 ? 11.353  32.704 -33.549 1.00 216.78 ? 796  LYS C CB    1 
ATOM   3647  C  CG    . LYS B 2 279 ? 12.711  33.007 -32.940 1.00 219.26 ? 796  LYS C CG    1 
ATOM   3648  C  CD    . LYS B 2 279 ? 12.831  34.466 -32.534 1.00 219.23 ? 796  LYS C CD    1 
ATOM   3649  C  CE    . LYS B 2 279 ? 14.036  34.693 -31.637 1.00 221.31 ? 796  LYS C CE    1 
ATOM   3650  N  NZ    . LYS B 2 279 ? 14.148  36.112 -31.204 1.00 220.98 ? 796  LYS C NZ    1 
ATOM   3651  N  N     . LEU B 2 280 ? 9.220   31.228 -35.586 1.00 212.16 ? 797  LEU C N     1 
ATOM   3652  C  CA    . LEU B 2 280 ? 7.865   30.731 -35.853 1.00 210.33 ? 797  LEU C CA    1 
ATOM   3653  C  C     . LEU B 2 280 ? 7.830   29.214 -36.057 1.00 211.32 ? 797  LEU C C     1 
ATOM   3654  O  O     . LEU B 2 280 ? 6.797   28.587 -35.827 1.00 210.61 ? 797  LEU C O     1 
ATOM   3655  C  CB    . LEU B 2 280 ? 7.252   31.427 -37.075 1.00 209.11 ? 797  LEU C CB    1 
ATOM   3656  C  CG    . LEU B 2 280 ? 6.812   32.881 -36.887 1.00 207.74 ? 797  LEU C CG    1 
ATOM   3657  C  CD1   . LEU B 2 280 ? 6.543   33.540 -38.232 1.00 207.53 ? 797  LEU C CD1   1 
ATOM   3658  C  CD2   . LEU B 2 280 ? 5.582   32.965 -35.994 1.00 206.15 ? 797  LEU C CD2   1 
ATOM   3659  N  N     . LYS B 2 281 ? 8.951   28.640 -36.497 1.00 213.18 ? 798  LYS C N     1 
ATOM   3660  C  CA    . LYS B 2 281 ? 9.096   27.188 -36.658 1.00 214.23 ? 798  LYS C CA    1 
ATOM   3661  C  C     . LYS B 2 281 ? 8.116   26.637 -37.698 1.00 213.05 ? 798  LYS C C     1 
ATOM   3662  O  O     . LYS B 2 281 ? 7.459   25.621 -37.468 1.00 212.50 ? 798  LYS C O     1 
ATOM   3663  C  CB    . LYS B 2 281 ? 8.917   26.471 -35.310 1.00 214.94 ? 798  LYS C CB    1 
ATOM   3664  C  CG    . LYS B 2 281 ? 9.855   26.957 -34.208 1.00 216.27 ? 798  LYS C CG    1 
ATOM   3665  C  CD    . LYS B 2 281 ? 10.968  25.963 -33.898 1.00 218.90 ? 798  LYS C CD    1 
ATOM   3666  C  CE    . LYS B 2 281 ? 10.582  25.012 -32.772 1.00 219.59 ? 798  LYS C CE    1 
ATOM   3667  N  NZ    . LYS B 2 281 ? 9.347   24.225 -33.045 1.00 218.71 ? 798  LYS C NZ    1 
ATOM   3668  N  N     . THR B 2 282 ? 8.028   27.320 -38.839 1.00 212.53 ? 799  THR C N     1 
ATOM   3669  C  CA    . THR B 2 282 ? 7.121   26.940 -39.925 1.00 211.90 ? 799  THR C CA    1 
ATOM   3670  C  C     . THR B 2 282 ? 7.716   27.298 -41.286 1.00 213.27 ? 799  THR C C     1 
ATOM   3671  O  O     . THR B 2 282 ? 8.527   28.220 -41.393 1.00 213.70 ? 799  THR C O     1 
ATOM   3672  C  CB    . THR B 2 282 ? 5.765   27.663 -39.806 1.00 209.47 ? 799  THR C CB    1 
ATOM   3673  O  OG1   . THR B 2 282 ? 5.976   29.081 -39.818 1.00 208.72 ? 799  THR C OG1   1 
ATOM   3674  C  CG2   . THR B 2 282 ? 5.040   27.273 -38.525 1.00 208.33 ? 799  THR C CG2   1 
ATOM   3675  N  N     . ASP B 2 283 ? 7.301   26.566 -42.318 1.00 214.37 ? 800  ASP C N     1 
ATOM   3676  C  CA    . ASP B 2 283 ? 7.715   26.840 -43.693 1.00 215.83 ? 800  ASP C CA    1 
ATOM   3677  C  C     . ASP B 2 283 ? 6.568   27.505 -44.453 1.00 215.06 ? 800  ASP C C     1 
ATOM   3678  O  O     . ASP B 2 283 ? 5.637   26.834 -44.903 1.00 214.69 ? 800  ASP C O     1 
ATOM   3679  C  CB    . ASP B 2 283 ? 8.144   25.545 -44.392 1.00 217.42 ? 800  ASP C CB    1 
ATOM   3680  C  CG    . ASP B 2 283 ? 8.645   25.777 -45.810 1.00 218.33 ? 800  ASP C CG    1 
ATOM   3681  O  OD1   . ASP B 2 283 ? 9.415   26.737 -46.026 1.00 218.94 ? 800  ASP C OD1   1 
ATOM   3682  O  OD2   . ASP B 2 283 ? 8.273   24.992 -46.708 1.00 218.64 ? 800  ASP C OD2   1 
ATOM   3683  N  N     . ILE B 2 284 ? 6.642   28.829 -44.583 1.00 215.40 ? 801  ILE C N     1 
ATOM   3684  C  CA    . ILE B 2 284 ? 5.609   29.611 -45.261 1.00 215.22 ? 801  ILE C CA    1 
ATOM   3685  C  C     . ILE B 2 284 ? 6.033   29.901 -46.701 1.00 216.94 ? 801  ILE C C     1 
ATOM   3686  O  O     . ILE B 2 284 ? 7.186   30.251 -46.957 1.00 218.34 ? 801  ILE C O     1 
ATOM   3687  C  CB    . ILE B 2 284 ? 5.338   30.945 -44.528 1.00 214.17 ? 801  ILE C CB    1 
ATOM   3688  C  CG1   . ILE B 2 284 ? 4.990   30.685 -43.057 1.00 213.31 ? 801  ILE C CG1   1 
ATOM   3689  C  CG2   . ILE B 2 284 ? 4.210   31.715 -45.208 1.00 213.23 ? 801  ILE C CG2   1 
ATOM   3690  C  CD1   . ILE B 2 284 ? 4.901   31.936 -42.209 1.00 212.46 ? 801  ILE C CD1   1 
ATOM   3691  N  N     . LYS B 2 285 ? 5.091   29.747 -47.630 1.00 217.30 ? 802  LYS C N     1 
ATOM   3692  C  CA    . LYS B 2 285 ? 5.320   30.040 -49.045 1.00 218.69 ? 802  LYS C CA    1 
ATOM   3693  C  C     . LYS B 2 285 ? 4.188   30.900 -49.590 1.00 218.21 ? 802  LYS C C     1 
ATOM   3694  O  O     . LYS B 2 285 ? 3.067   30.855 -49.082 1.00 216.63 ? 802  LYS C O     1 
ATOM   3695  C  CB    . LYS B 2 285 ? 5.407   28.744 -49.855 1.00 219.95 ? 802  LYS C CB    1 
ATOM   3696  C  CG    . LYS B 2 285 ? 6.570   27.837 -49.485 1.00 221.24 ? 802  LYS C CG    1 
ATOM   3697  C  CD    . LYS B 2 285 ? 7.909   28.449 -49.869 1.00 222.65 ? 802  LYS C CD    1 
ATOM   3698  C  CE    . LYS B 2 285 ? 9.052   27.463 -49.681 1.00 224.08 ? 802  LYS C CE    1 
ATOM   3699  N  NZ    . LYS B 2 285 ? 9.018   26.348 -50.668 1.00 224.89 ? 802  LYS C NZ    1 
ATOM   3700  N  N     . VAL B 2 286 ? 4.488   31.678 -50.628 1.00 219.83 ? 803  VAL C N     1 
ATOM   3701  C  CA    . VAL B 2 286 ? 3.500   32.547 -51.262 1.00 220.46 ? 803  VAL C CA    1 
ATOM   3702  C  C     . VAL B 2 286 ? 2.906   31.851 -52.484 1.00 222.29 ? 803  VAL C C     1 
ATOM   3703  O  O     . VAL B 2 286 ? 3.611   31.597 -53.463 1.00 223.66 ? 803  VAL C O     1 
ATOM   3704  C  CB    . VAL B 2 286 ? 4.121   33.893 -51.701 1.00 221.13 ? 803  VAL C CB    1 
ATOM   3705  C  CG1   . VAL B 2 286 ? 3.043   34.844 -52.208 1.00 220.85 ? 803  VAL C CG1   1 
ATOM   3706  C  CG2   . VAL B 2 286 ? 4.893   34.527 -50.551 1.00 220.94 ? 803  VAL C CG2   1 
ATOM   3707  N  N     . VAL B 2 287 ? 1.614   31.537 -52.418 1.00 223.22 ? 804  VAL C N     1 
ATOM   3708  C  CA    . VAL B 2 287 ? 0.896   30.993 -53.568 1.00 225.32 ? 804  VAL C CA    1 
ATOM   3709  C  C     . VAL B 2 287 ? 0.630   32.142 -54.537 1.00 227.50 ? 804  VAL C C     1 
ATOM   3710  O  O     . VAL B 2 287 ? 0.039   33.155 -54.157 1.00 228.03 ? 804  VAL C O     1 
ATOM   3711  C  CB    . VAL B 2 287 ? -0.443  30.339 -53.161 1.00 224.53 ? 804  VAL C CB    1 
ATOM   3712  C  CG1   . VAL B 2 287 ? -1.191  29.826 -54.385 1.00 225.35 ? 804  VAL C CG1   1 
ATOM   3713  C  CG2   . VAL B 2 287 ? -0.209  29.204 -52.173 1.00 224.06 ? 804  VAL C CG2   1 
ATOM   3714  N  N     . ASP B 2 288 ? 1.072   31.982 -55.782 1.00 229.95 ? 805  ASP C N     1 
ATOM   3715  C  CA    . ASP B 2 288 ? 0.914   33.021 -56.798 1.00 231.80 ? 805  ASP C CA    1 
ATOM   3716  C  C     . ASP B 2 288 ? -0.554  33.152 -57.203 1.00 231.85 ? 805  ASP C C     1 
ATOM   3717  O  O     . ASP B 2 288 ? -1.306  32.178 -57.157 1.00 231.15 ? 805  ASP C O     1 
ATOM   3718  C  CB    . ASP B 2 288 ? 1.779   32.700 -58.024 1.00 233.82 ? 805  ASP C CB    1 
ATOM   3719  C  CG    . ASP B 2 288 ? 1.892   33.868 -58.994 1.00 235.49 ? 805  ASP C CG    1 
ATOM   3720  O  OD1   . ASP B 2 288 ? 1.670   35.028 -58.584 1.00 235.62 ? 805  ASP C OD1   1 
ATOM   3721  O  OD2   . ASP B 2 288 ? 2.214   33.623 -60.176 1.00 236.93 ? 805  ASP C OD2   1 
ATOM   3722  N  N     . ARG B 2 289 ? -0.951  34.361 -57.594 1.00 232.73 ? 806  ARG C N     1 
ATOM   3723  C  CA    . ARG B 2 289 ? -2.331  34.631 -58.004 1.00 233.32 ? 806  ARG C CA    1 
ATOM   3724  C  C     . ARG B 2 289 ? -2.669  33.942 -59.331 1.00 234.38 ? 806  ARG C C     1 
ATOM   3725  O  O     . ARG B 2 289 ? -3.830  33.617 -59.588 1.00 234.54 ? 806  ARG C O     1 
ATOM   3726  C  CB    . ARG B 2 289 ? -2.573  36.141 -58.116 1.00 234.46 ? 806  ARG C CB    1 
ATOM   3727  C  CG    . ARG B 2 289 ? -4.040  36.543 -58.090 1.00 235.12 ? 806  ARG C CG    1 
ATOM   3728  C  CD    . ARG B 2 289 ? -4.221  38.009 -58.450 1.00 236.78 ? 806  ARG C CD    1 
ATOM   3729  N  NE    . ARG B 2 289 ? -5.610  38.323 -58.797 1.00 237.92 ? 806  ARG C NE    1 
ATOM   3730  C  CZ    . ARG B 2 289 ? -6.489  38.937 -58.003 1.00 237.85 ? 806  ARG C CZ    1 
ATOM   3731  N  NH1   . ARG B 2 289 ? -6.162  39.332 -56.773 1.00 236.69 ? 806  ARG C NH1   1 
ATOM   3732  N  NH2   . ARG B 2 289 ? -7.721  39.161 -58.448 1.00 238.90 ? 806  ARG C NH2   1 
ATOM   3733  N  N     . ASP B 2 290 ? -1.651  33.720 -60.161 1.00 235.19 ? 807  ASP C N     1 
ATOM   3734  C  CA    . ASP B 2 290 ? -1.816  33.007 -61.431 1.00 235.95 ? 807  ASP C CA    1 
ATOM   3735  C  C     . ASP B 2 290 ? -2.031  31.502 -61.245 1.00 234.48 ? 807  ASP C C     1 
ATOM   3736  O  O     . ASP B 2 290 ? -2.477  30.822 -62.171 1.00 235.33 ? 807  ASP C O     1 
ATOM   3737  C  CB    . ASP B 2 290 ? -0.599  33.235 -62.336 1.00 237.58 ? 807  ASP C CB    1 
ATOM   3738  C  CG    . ASP B 2 290 ? -0.447  34.684 -62.766 1.00 238.71 ? 807  ASP C CG    1 
ATOM   3739  O  OD1   . ASP B 2 290 ? 0.248   34.933 -63.773 1.00 240.52 ? 807  ASP C OD1   1 
ATOM   3740  O  OD2   . ASP B 2 290 ? -1.021  35.574 -62.102 1.00 237.69 ? 807  ASP C OD2   1 
ATOM   3741  N  N     . SER B 2 291 ? -1.707  30.986 -60.059 1.00 232.11 ? 808  SER C N     1 
ATOM   3742  C  CA    . SER B 2 291 ? -1.849  29.559 -59.762 1.00 230.83 ? 808  SER C CA    1 
ATOM   3743  C  C     . SER B 2 291 ? -3.306  29.100 -59.847 1.00 229.79 ? 808  SER C C     1 
ATOM   3744  O  O     . SER B 2 291 ? -4.226  29.863 -59.545 1.00 229.25 ? 808  SER C O     1 
ATOM   3745  C  CB    . SER B 2 291 ? -1.292  29.245 -58.371 1.00 229.73 ? 808  SER C CB    1 
ATOM   3746  O  OG    . SER B 2 291 ? -1.208  27.847 -58.159 1.00 229.72 ? 808  SER C OG    1 
ATOM   3747  N  N     . GLU B 2 292 ? -3.498  27.848 -60.257 1.00 228.97 ? 809  GLU C N     1 
ATOM   3748  C  CA    . GLU B 2 292 ? -4.836  27.276 -60.423 1.00 228.02 ? 809  GLU C CA    1 
ATOM   3749  C  C     . GLU B 2 292 ? -5.486  26.959 -59.075 1.00 225.41 ? 809  GLU C C     1 
ATOM   3750  O  O     . GLU B 2 292 ? -6.705  27.063 -58.933 1.00 225.23 ? 809  GLU C O     1 
ATOM   3751  C  CB    . GLU B 2 292 ? -4.776  26.008 -61.285 1.00 229.22 ? 809  GLU C CB    1 
ATOM   3752  C  CG    . GLU B 2 292 ? -4.240  26.219 -62.698 1.00 230.68 ? 809  GLU C CG    1 
ATOM   3753  C  CD    . GLU B 2 292 ? -5.173  27.019 -63.595 1.00 231.64 ? 809  GLU C CD    1 
ATOM   3754  O  OE1   . GLU B 2 292 ? -4.722  27.452 -64.676 1.00 232.79 ? 809  GLU C OE1   1 
ATOM   3755  O  OE2   . GLU B 2 292 ? -6.353  27.215 -63.231 1.00 231.52 ? 809  GLU C OE2   1 
ATOM   3756  N  N     . GLU B 2 293 ? -4.672  26.568 -58.095 1.00 222.94 ? 810  GLU C N     1 
ATOM   3757  C  CA    . GLU B 2 293 ? -5.159  26.326 -56.732 1.00 220.58 ? 810  GLU C CA    1 
ATOM   3758  C  C     . GLU B 2 293 ? -5.548  27.623 -56.016 1.00 218.25 ? 810  GLU C C     1 
ATOM   3759  O  O     . GLU B 2 293 ? -6.395  27.610 -55.121 1.00 217.16 ? 810  GLU C O     1 
ATOM   3760  C  CB    . GLU B 2 293 ? -4.123  25.558 -55.897 1.00 220.25 ? 810  GLU C CB    1 
ATOM   3761  C  CG    . GLU B 2 293 ? -2.772  26.251 -55.738 1.00 220.19 ? 810  GLU C CG    1 
ATOM   3762  C  CD    . GLU B 2 293 ? -1.976  25.748 -54.546 1.00 219.79 ? 810  GLU C CD    1 
ATOM   3763  O  OE1   . GLU B 2 293 ? -2.575  25.506 -53.476 1.00 218.97 ? 810  GLU C OE1   1 
ATOM   3764  O  OE2   . GLU B 2 293 ? -0.742  25.606 -54.675 1.00 220.51 ? 810  GLU C OE2   1 
ATOM   3765  N  N     . ALA B 2 294 ? -4.922  28.733 -56.407 1.00 216.70 ? 811  ALA C N     1 
ATOM   3766  C  CA    . ALA B 2 294 ? -5.240  30.048 -55.848 1.00 214.87 ? 811  ALA C CA    1 
ATOM   3767  C  C     . ALA B 2 294 ? -6.643  30.505 -56.248 1.00 214.42 ? 811  ALA C C     1 
ATOM   3768  O  O     . ALA B 2 294 ? -7.317  31.196 -55.483 1.00 213.87 ? 811  ALA C O     1 
ATOM   3769  C  CB    . ALA B 2 294 ? -4.209  31.076 -56.291 1.00 215.20 ? 811  ALA C CB    1 
ATOM   3770  N  N     . GLU B 2 295 ? -7.070  30.120 -57.450 1.00 214.45 ? 812  GLU C N     1 
ATOM   3771  C  CA    . GLU B 2 295 ? -8.422  30.414 -57.928 1.00 214.22 ? 812  GLU C CA    1 
ATOM   3772  C  C     . GLU B 2 295 ? -9.489  29.686 -57.107 1.00 212.82 ? 812  GLU C C     1 
ATOM   3773  O  O     . GLU B 2 295 ? -10.606 30.184 -56.965 1.00 213.04 ? 812  GLU C O     1 
ATOM   3774  C  CB    . GLU B 2 295 ? -8.568  30.040 -59.407 1.00 215.57 ? 812  GLU C CB    1 
ATOM   3775  C  CG    . GLU B 2 295 ? -7.706  30.867 -60.349 1.00 216.18 ? 812  GLU C CG    1 
ATOM   3776  C  CD    . GLU B 2 295 ? -7.990  30.584 -61.814 1.00 217.63 ? 812  GLU C CD    1 
ATOM   3777  O  OE1   . GLU B 2 295 ? -8.515  29.494 -62.129 1.00 217.85 ? 812  GLU C OE1   1 
ATOM   3778  O  OE2   . GLU B 2 295 ? -7.684  31.454 -62.655 1.00 218.52 ? 812  GLU C OE2   1 
ATOM   3779  N  N     . ILE B 2 296 ? -9.139  28.517 -56.570 1.00 210.90 ? 813  ILE C N     1 
ATOM   3780  C  CA    . ILE B 2 296 ? -10.066 27.722 -55.759 1.00 209.42 ? 813  ILE C CA    1 
ATOM   3781  C  C     . ILE B 2 296 ? -10.339 28.419 -54.426 1.00 207.22 ? 813  ILE C C     1 
ATOM   3782  O  O     . ILE B 2 296 ? -11.486 28.483 -53.979 1.00 207.35 ? 813  ILE C O     1 
ATOM   3783  C  CB    . ILE B 2 296 ? -9.530  26.293 -55.489 1.00 209.13 ? 813  ILE C CB    1 
ATOM   3784  C  CG1   . ILE B 2 296 ? -9.251  25.557 -56.805 1.00 210.18 ? 813  ILE C CG1   1 
ATOM   3785  C  CG2   . ILE B 2 296 ? -10.527 25.486 -54.664 1.00 209.08 ? 813  ILE C CG2   1 
ATOM   3786  C  CD1   . ILE B 2 296 ? -8.559  24.222 -56.627 1.00 210.14 ? 813  ILE C CD1   1 
ATOM   3787  N  N     . ILE B 2 297 ? -9.284  28.932 -53.796 1.00 204.77 ? 814  ILE C N     1 
ATOM   3788  C  CA    . ILE B 2 297 ? -9.412  29.639 -52.520 1.00 202.34 ? 814  ILE C CA    1 
ATOM   3789  C  C     . ILE B 2 297 ? -10.221 30.925 -52.686 1.00 201.66 ? 814  ILE C C     1 
ATOM   3790  O  O     . ILE B 2 297 ? -11.145 31.178 -51.914 1.00 201.26 ? 814  ILE C O     1 
ATOM   3791  C  CB    . ILE B 2 297 ? -8.033  29.952 -51.896 1.00 201.15 ? 814  ILE C CB    1 
ATOM   3792  C  CG1   . ILE B 2 297 ? -7.364  28.655 -51.428 1.00 200.97 ? 814  ILE C CG1   1 
ATOM   3793  C  CG2   . ILE B 2 297 ? -8.180  30.914 -50.723 1.00 199.98 ? 814  ILE C CG2   1 
ATOM   3794  C  CD1   . ILE B 2 297 ? -5.892  28.793 -51.101 1.00 200.53 ? 814  ILE C CD1   1 
ATOM   3795  N  N     . ARG B 2 298 ? -9.875  31.730 -53.689 1.00 201.43 ? 815  ARG C N     1 
ATOM   3796  C  CA    . ARG B 2 298 ? -10.628 32.954 -53.988 1.00 201.36 ? 815  ARG C CA    1 
ATOM   3797  C  C     . ARG B 2 298 ? -12.095 32.657 -54.306 1.00 200.90 ? 815  ARG C C     1 
ATOM   3798  O  O     . ARG B 2 298 ? -12.974 33.472 -54.019 1.00 201.18 ? 815  ARG C O     1 
ATOM   3799  C  CB    . ARG B 2 298 ? -9.989  33.732 -55.143 1.00 202.78 ? 815  ARG C CB    1 
ATOM   3800  C  CG    . ARG B 2 298 ? -8.758  34.532 -54.744 1.00 202.41 ? 815  ARG C CG    1 
ATOM   3801  C  CD    . ARG B 2 298 ? -8.397  35.565 -55.800 1.00 203.77 ? 815  ARG C CD    1 
ATOM   3802  N  NE    . ARG B 2 298 ? -8.033  34.949 -57.075 1.00 205.04 ? 815  ARG C NE    1 
ATOM   3803  C  CZ    . ARG B 2 298 ? -6.857  34.382 -57.344 1.00 205.16 ? 815  ARG C CZ    1 
ATOM   3804  N  NH1   . ARG B 2 298 ? -5.895  34.330 -56.425 1.00 204.27 ? 815  ARG C NH1   1 
ATOM   3805  N  NH2   . ARG B 2 298 ? -6.640  33.855 -58.544 1.00 206.34 ? 815  ARG C NH2   1 
ATOM   3806  N  N     . LYS B 2 299 ? -12.351 31.492 -54.900 1.00 199.73 ? 816  LYS C N     1 
ATOM   3807  C  CA    . LYS B 2 299 ? -13.716 31.020 -55.117 1.00 199.53 ? 816  LYS C CA    1 
ATOM   3808  C  C     . LYS B 2 299 ? -14.350 30.640 -53.780 1.00 197.49 ? 816  LYS C C     1 
ATOM   3809  O  O     . LYS B 2 299 ? -15.491 31.002 -53.507 1.00 197.78 ? 816  LYS C O     1 
ATOM   3810  C  CB    . LYS B 2 299 ? -13.730 29.821 -56.072 1.00 200.56 ? 816  LYS C CB    1 
ATOM   3811  C  CG    . LYS B 2 299 ? -15.068 29.575 -56.749 1.00 202.22 ? 816  LYS C CG    1 
ATOM   3812  C  CD    . LYS B 2 299 ? -14.947 28.508 -57.826 1.00 203.25 ? 816  LYS C CD    1 
ATOM   3813  C  CE    . LYS B 2 299 ? -16.215 28.402 -58.656 1.00 205.11 ? 816  LYS C CE    1 
ATOM   3814  N  NZ    . LYS B 2 299 ? -16.090 27.379 -59.730 1.00 206.37 ? 816  LYS C NZ    1 
ATOM   3815  N  N     . TYR B 2 300 ? -13.592 29.924 -52.949 1.00 195.14 ? 817  TYR C N     1 
ATOM   3816  C  CA    . TYR B 2 300 ? -14.047 29.507 -51.617 1.00 193.34 ? 817  TYR C CA    1 
ATOM   3817  C  C     . TYR B 2 300 ? -14.354 30.708 -50.716 1.00 192.64 ? 817  TYR C C     1 
ATOM   3818  O  O     . TYR B 2 300 ? -15.250 30.642 -49.874 1.00 192.39 ? 817  TYR C O     1 
ATOM   3819  C  CB    . TYR B 2 300 ? -12.991 28.595 -50.965 1.00 191.63 ? 817  TYR C CB    1 
ATOM   3820  C  CG    . TYR B 2 300 ? -13.428 27.806 -49.736 1.00 190.30 ? 817  TYR C CG    1 
ATOM   3821  C  CD1   . TYR B 2 300 ? -14.766 27.475 -49.509 1.00 190.73 ? 817  TYR C CD1   1 
ATOM   3822  C  CD2   . TYR B 2 300 ? -12.482 27.348 -48.821 1.00 188.78 ? 817  TYR C CD2   1 
ATOM   3823  C  CE1   . TYR B 2 300 ? -15.144 26.741 -48.395 1.00 190.10 ? 817  TYR C CE1   1 
ATOM   3824  C  CE2   . TYR B 2 300 ? -12.853 26.612 -47.707 1.00 188.13 ? 817  TYR C CE2   1 
ATOM   3825  C  CZ    . TYR B 2 300 ? -14.184 26.310 -47.499 1.00 188.86 ? 817  TYR C CZ    1 
ATOM   3826  O  OH    . TYR B 2 300 ? -14.556 25.582 -46.392 1.00 188.67 ? 817  TYR C OH    1 
ATOM   3827  N  N     . VAL B 2 301 ? -13.611 31.799 -50.901 1.00 192.57 ? 818  VAL C N     1 
ATOM   3828  C  CA    . VAL B 2 301 ? -13.865 33.053 -50.188 1.00 192.39 ? 818  VAL C CA    1 
ATOM   3829  C  C     . VAL B 2 301 ? -15.118 33.739 -50.734 1.00 194.53 ? 818  VAL C C     1 
ATOM   3830  O  O     . VAL B 2 301 ? -16.045 34.045 -49.984 1.00 194.29 ? 818  VAL C O     1 
ATOM   3831  C  CB    . VAL B 2 301 ? -12.660 34.019 -50.298 1.00 191.48 ? 818  VAL C CB    1 
ATOM   3832  C  CG1   . VAL B 2 301 ? -13.015 35.412 -49.790 1.00 191.43 ? 818  VAL C CG1   1 
ATOM   3833  C  CG2   . VAL B 2 301 ? -11.468 33.468 -49.530 1.00 190.05 ? 818  VAL C CG2   1 
ATOM   3834  N  N     . LYS B 2 302 ? -15.129 33.976 -52.043 1.00 197.09 ? 819  LYS C N     1 
ATOM   3835  C  CA    . LYS B 2 302 ? -16.233 34.670 -52.713 1.00 199.67 ? 819  LYS C CA    1 
ATOM   3836  C  C     . LYS B 2 302 ? -17.570 33.935 -52.569 1.00 201.63 ? 819  LYS C C     1 
ATOM   3837  O  O     . LYS B 2 302 ? -18.610 34.568 -52.377 1.00 202.30 ? 819  LYS C O     1 
ATOM   3838  C  CB    . LYS B 2 302 ? -15.903 34.862 -54.199 1.00 201.05 ? 819  LYS C CB    1 
ATOM   3839  C  CG    . LYS B 2 302 ? -16.987 35.547 -55.021 1.00 202.90 ? 819  LYS C CG    1 
ATOM   3840  C  CD    . LYS B 2 302 ? -16.639 35.543 -56.502 1.00 204.16 ? 819  LYS C CD    1 
ATOM   3841  C  CE    . LYS B 2 302 ? -17.849 35.864 -57.365 1.00 206.24 ? 819  LYS C CE    1 
ATOM   3842  N  NZ    . LYS B 2 302 ? -17.576 35.634 -58.811 1.00 207.72 ? 819  LYS C NZ    1 
ATOM   3843  N  N     . ASN B 2 303 ? -17.534 32.607 -52.659 1.00 202.94 ? 820  ASN C N     1 
ATOM   3844  C  CA    . ASN B 2 303 ? -18.756 31.797 -52.664 1.00 205.06 ? 820  ASN C CA    1 
ATOM   3845  C  C     . ASN B 2 303 ? -19.397 31.690 -51.285 1.00 204.96 ? 820  ASN C C     1 
ATOM   3846  O  O     . ASN B 2 303 ? -20.600 31.908 -51.137 1.00 206.15 ? 820  ASN C O     1 
ATOM   3847  C  CB    . ASN B 2 303 ? -18.483 30.382 -53.197 1.00 205.75 ? 820  ASN C CB    1 
ATOM   3848  C  CG    . ASN B 2 303 ? -18.429 30.318 -54.716 1.00 207.59 ? 820  ASN C CG    1 
ATOM   3849  O  OD1   . ASN B 2 303 ? -19.022 29.426 -55.322 1.00 209.48 ? 820  ASN C OD1   1 
ATOM   3850  N  ND2   . ASN B 2 303 ? -17.721 31.256 -55.338 1.00 207.58 ? 820  ASN C ND2   1 
ATOM   3851  N  N     . THR B 2 304 ? -18.587 31.361 -50.281 1.00 203.91 ? 821  THR C N     1 
ATOM   3852  C  CA    . THR B 2 304 ? -19.097 31.045 -48.947 1.00 203.80 ? 821  THR C CA    1 
ATOM   3853  C  C     . THR B 2 304 ? -19.121 32.259 -48.012 1.00 203.56 ? 821  THR C C     1 
ATOM   3854  O  O     . THR B 2 304 ? -18.674 32.178 -46.866 1.00 202.25 ? 821  THR C O     1 
ATOM   3855  C  CB    . THR B 2 304 ? -18.286 29.903 -48.295 1.00 202.69 ? 821  THR C CB    1 
ATOM   3856  O  OG1   . THR B 2 304 ? -16.973 30.367 -47.955 1.00 201.19 ? 821  THR C OG1   1 
ATOM   3857  C  CG2   . THR B 2 304 ? -18.180 28.709 -49.235 1.00 203.70 ? 821  THR C CG2   1 
ATOM   3858  N  N     . HIS B 2 305 ? -19.651 33.376 -48.506 1.00 205.23 ? 822  HIS C N     1 
ATOM   3859  C  CA    . HIS B 2 305 ? -19.919 34.545 -47.673 1.00 205.35 ? 822  HIS C CA    1 
ATOM   3860  C  C     . HIS B 2 305 ? -21.358 34.451 -47.178 1.00 207.25 ? 822  HIS C C     1 
ATOM   3861  O  O     . HIS B 2 305 ? -22.261 34.107 -47.943 1.00 209.31 ? 822  HIS C O     1 
ATOM   3862  C  CB    . HIS B 2 305 ? -19.712 35.836 -48.466 1.00 205.81 ? 822  HIS C CB    1 
ATOM   3863  C  CG    . HIS B 2 305 ? -19.741 37.073 -47.622 1.00 204.95 ? 822  HIS C CG    1 
ATOM   3864  N  ND1   . HIS B 2 305 ? -18.607 37.608 -47.051 1.00 203.16 ? 822  HIS C ND1   1 
ATOM   3865  C  CD2   . HIS B 2 305 ? -20.764 37.879 -47.252 1.00 205.77 ? 822  HIS C CD2   1 
ATOM   3866  C  CE1   . HIS B 2 305 ? -18.930 38.691 -46.366 1.00 203.04 ? 822  HIS C CE1   1 
ATOM   3867  N  NE2   . HIS B 2 305 ? -20.233 38.877 -46.472 1.00 204.66 ? 822  HIS C NE2   1 
ATOM   3868  N  N     . ALA B 2 306 ? -21.568 34.762 -45.903 1.00 207.33 ? 823  ALA C N     1 
ATOM   3869  C  CA    . ALA B 2 306 ? -22.874 34.591 -45.271 1.00 209.32 ? 823  ALA C CA    1 
ATOM   3870  C  C     . ALA B 2 306 ? -23.842 35.694 -45.687 1.00 211.41 ? 823  ALA C C     1 
ATOM   3871  O  O     . ALA B 2 306 ? -23.472 36.869 -45.743 1.00 210.51 ? 823  ALA C O     1 
ATOM   3872  C  CB    . ALA B 2 306 ? -22.728 34.562 -43.758 1.00 208.14 ? 823  ALA C CB    1 
ATOM   3873  N  N     . THR B 2 307 ? -25.081 35.303 -45.978 1.00 214.30 ? 824  THR C N     1 
ATOM   3874  C  CA    . THR B 2 307 ? -26.138 36.251 -46.336 1.00 216.43 ? 824  THR C CA    1 
ATOM   3875  C  C     . THR B 2 307 ? -26.490 37.188 -45.175 1.00 215.96 ? 824  THR C C     1 
ATOM   3876  O  O     . THR B 2 307 ? -26.861 38.342 -45.396 1.00 216.56 ? 824  THR C O     1 
ATOM   3877  C  CB    . THR B 2 307 ? -27.416 35.525 -46.825 1.00 218.85 ? 824  THR C CB    1 
ATOM   3878  O  OG1   . THR B 2 307 ? -28.355 36.484 -47.328 1.00 220.82 ? 824  THR C OG1   1 
ATOM   3879  C  CG2   . THR B 2 307 ? -28.072 34.710 -45.702 1.00 219.03 ? 824  THR C CG2   1 
ATOM   3880  N  N     . THR B 2 308 ? -26.369 36.686 -43.948 1.00 215.14 ? 825  THR C N     1 
ATOM   3881  C  CA    . THR B 2 308 ? -26.676 37.468 -42.751 1.00 215.32 ? 825  THR C CA    1 
ATOM   3882  C  C     . THR B 2 308 ? -25.523 38.387 -42.340 1.00 214.23 ? 825  THR C C     1 
ATOM   3883  O  O     . THR B 2 308 ? -25.759 39.469 -41.798 1.00 214.91 ? 825  THR C O     1 
ATOM   3884  C  CB    . THR B 2 308 ? -27.040 36.556 -41.563 1.00 215.03 ? 825  THR C CB    1 
ATOM   3885  O  OG1   . THR B 2 308 ? -25.998 35.594 -41.354 1.00 213.67 ? 825  THR C OG1   1 
ATOM   3886  C  CG2   . THR B 2 308 ? -28.352 35.832 -41.831 1.00 217.32 ? 825  THR C CG2   1 
ATOM   3887  N  N     . HIS B 2 309 ? -24.286 37.962 -42.598 1.00 213.16 ? 826  HIS C N     1 
ATOM   3888  C  CA    . HIS B 2 309 ? -23.107 38.773 -42.275 1.00 211.43 ? 826  HIS C CA    1 
ATOM   3889  C  C     . HIS B 2 309 ? -22.796 39.748 -43.414 1.00 211.85 ? 826  HIS C C     1 
ATOM   3890  O  O     . HIS B 2 309 ? -21.756 39.643 -44.070 1.00 211.10 ? 826  HIS C O     1 
ATOM   3891  C  CB    . HIS B 2 309 ? -21.885 37.889 -41.998 1.00 209.96 ? 826  HIS C CB    1 
ATOM   3892  C  CG    . HIS B 2 309 ? -22.112 36.840 -40.953 1.00 209.87 ? 826  HIS C CG    1 
ATOM   3893  N  ND1   . HIS B 2 309 ? -21.468 35.622 -40.972 1.00 209.46 ? 826  HIS C ND1   1 
ATOM   3894  C  CD2   . HIS B 2 309 ? -22.918 36.822 -39.865 1.00 210.18 ? 826  HIS C CD2   1 
ATOM   3895  C  CE1   . HIS B 2 309 ? -21.861 34.901 -39.938 1.00 209.54 ? 826  HIS C CE1   1 
ATOM   3896  N  NE2   . HIS B 2 309 ? -22.742 35.606 -39.251 1.00 209.91 ? 826  HIS C NE2   1 
ATOM   3897  N  N     . ASN B 2 310 ? -23.700 40.700 -43.633 1.00 212.95 ? 827  ASN C N     1 
ATOM   3898  C  CA    . ASN B 2 310 ? -23.555 41.690 -44.706 1.00 213.43 ? 827  ASN C CA    1 
ATOM   3899  C  C     . ASN B 2 310 ? -22.957 43.018 -44.225 1.00 211.27 ? 827  ASN C C     1 
ATOM   3900  O  O     . ASN B 2 310 ? -23.006 44.021 -44.941 1.00 212.09 ? 827  ASN C O     1 
ATOM   3901  C  CB    . ASN B 2 310 ? -24.908 41.932 -45.395 1.00 216.53 ? 827  ASN C CB    1 
ATOM   3902  C  CG    . ASN B 2 310 ? -25.945 42.544 -44.466 1.00 217.56 ? 827  ASN C CG    1 
ATOM   3903  O  OD1   . ASN B 2 310 ? -25.873 42.393 -43.245 1.00 216.22 ? 827  ASN C OD1   1 
ATOM   3904  N  ND2   . ASN B 2 310 ? -26.924 43.231 -45.045 1.00 220.05 ? 827  ASN C ND2   1 
ATOM   3905  N  N     . ALA B 2 311 ? -22.390 43.017 -43.020 1.00 208.03 ? 828  ALA C N     1 
ATOM   3906  C  CA    . ALA B 2 311 ? -21.778 44.214 -42.443 1.00 205.99 ? 828  ALA C CA    1 
ATOM   3907  C  C     . ALA B 2 311 ? -20.471 44.590 -43.142 1.00 204.21 ? 828  ALA C C     1 
ATOM   3908  O  O     . ALA B 2 311 ? -20.099 45.765 -43.171 1.00 204.12 ? 828  ALA C O     1 
ATOM   3909  C  CB    . ALA B 2 311 ? -21.538 44.017 -40.953 1.00 204.34 ? 828  ALA C CB    1 
ATOM   3910  N  N     . TYR B 2 312 ? -19.780 43.595 -43.697 1.00 202.57 ? 829  TYR C N     1 
ATOM   3911  C  CA    . TYR B 2 312 ? -18.508 43.821 -44.387 1.00 201.16 ? 829  TYR C CA    1 
ATOM   3912  C  C     . TYR B 2 312 ? -18.391 43.007 -45.677 1.00 201.45 ? 829  TYR C C     1 
ATOM   3913  O  O     . TYR B 2 312 ? -19.215 42.132 -45.952 1.00 201.85 ? 829  TYR C O     1 
ATOM   3914  C  CB    . TYR B 2 312 ? -17.331 43.512 -43.452 1.00 198.87 ? 829  TYR C CB    1 
ATOM   3915  C  CG    . TYR B 2 312 ? -17.358 42.130 -42.831 1.00 197.67 ? 829  TYR C CG    1 
ATOM   3916  C  CD1   . TYR B 2 312 ? -16.934 41.015 -43.547 1.00 197.33 ? 829  TYR C CD1   1 
ATOM   3917  C  CD2   . TYR B 2 312 ? -17.794 41.942 -41.521 1.00 196.61 ? 829  TYR C CD2   1 
ATOM   3918  C  CE1   . TYR B 2 312 ? -16.951 39.751 -42.981 1.00 196.38 ? 829  TYR C CE1   1 
ATOM   3919  C  CE2   . TYR B 2 312 ? -17.814 40.680 -40.948 1.00 195.66 ? 829  TYR C CE2   1 
ATOM   3920  C  CZ    . TYR B 2 312 ? -17.391 39.589 -41.683 1.00 195.56 ? 829  TYR C CZ    1 
ATOM   3921  O  OH    . TYR B 2 312 ? -17.406 38.333 -41.127 1.00 194.54 ? 829  TYR C OH    1 
ATOM   3922  N  N     . ASP B 2 313 ? -17.357 43.314 -46.458 1.00 200.62 ? 830  ASP C N     1 
ATOM   3923  C  CA    . ASP B 2 313 ? -17.095 42.653 -47.735 1.00 200.76 ? 830  ASP C CA    1 
ATOM   3924  C  C     . ASP B 2 313 ? -15.616 42.276 -47.815 1.00 198.97 ? 830  ASP C C     1 
ATOM   3925  O  O     . ASP B 2 313 ? -14.746 43.133 -47.655 1.00 198.07 ? 830  ASP C O     1 
ATOM   3926  C  CB    . ASP B 2 313 ? -17.469 43.592 -48.888 1.00 202.86 ? 830  ASP C CB    1 
ATOM   3927  C  CG    . ASP B 2 313 ? -17.143 43.011 -50.254 1.00 204.26 ? 830  ASP C CG    1 
ATOM   3928  O  OD1   . ASP B 2 313 ? -17.348 41.796 -50.458 1.00 204.50 ? 830  ASP C OD1   1 
ATOM   3929  O  OD2   . ASP B 2 313 ? -16.690 43.779 -51.129 1.00 205.50 ? 830  ASP C OD2   1 
ATOM   3930  N  N     . LEU B 2 314 ? -15.338 40.997 -48.063 1.00 198.39 ? 831  LEU C N     1 
ATOM   3931  C  CA    . LEU B 2 314 ? -13.960 40.497 -48.081 1.00 197.37 ? 831  LEU C CA    1 
ATOM   3932  C  C     . LEU B 2 314 ? -13.223 40.860 -49.364 1.00 197.98 ? 831  LEU C C     1 
ATOM   3933  O  O     . LEU B 2 314 ? -13.832 41.222 -50.372 1.00 199.72 ? 831  LEU C O     1 
ATOM   3934  C  CB    . LEU B 2 314 ? -13.912 38.974 -47.882 1.00 196.98 ? 831  LEU C CB    1 
ATOM   3935  C  CG    . LEU B 2 314 ? -14.111 38.440 -46.460 1.00 195.83 ? 831  LEU C CG    1 
ATOM   3936  C  CD1   . LEU B 2 314 ? -13.138 39.085 -45.480 1.00 194.42 ? 831  LEU C CD1   1 
ATOM   3937  C  CD2   . LEU B 2 314 ? -15.547 38.640 -46.006 1.00 196.54 ? 831  LEU C CD2   1 
ATOM   3938  N  N     . GLU B 2 315 ? -11.900 40.751 -49.301 1.00 196.81 ? 832  GLU C N     1 
ATOM   3939  C  CA    . GLU B 2 315 ? -11.026 41.057 -50.424 1.00 197.50 ? 832  GLU C CA    1 
ATOM   3940  C  C     . GLU B 2 315 ? -9.659  40.430 -50.155 1.00 195.58 ? 832  GLU C C     1 
ATOM   3941  O  O     . GLU B 2 315 ? -8.882  40.937 -49.343 1.00 194.80 ? 832  GLU C O     1 
ATOM   3942  C  CB    . GLU B 2 315 ? -10.907 42.573 -50.599 1.00 199.12 ? 832  GLU C CB    1 
ATOM   3943  C  CG    . GLU B 2 315 ? -10.265 43.014 -51.904 1.00 201.08 ? 832  GLU C CG    1 
ATOM   3944  C  CD    . GLU B 2 315 ? -10.170 44.524 -52.021 1.00 202.47 ? 832  GLU C CD    1 
ATOM   3945  O  OE1   . GLU B 2 315 ? -11.149 45.218 -51.668 1.00 202.89 ? 832  GLU C OE1   1 
ATOM   3946  O  OE2   . GLU B 2 315 ? -9.117  45.020 -52.470 1.00 203.56 ? 832  GLU C OE2   1 
ATOM   3947  N  N     . VAL B 2 316 ? -9.378  39.317 -50.828 1.00 194.95 ? 833  VAL C N     1 
ATOM   3948  C  CA    . VAL B 2 316 ? -8.170  38.536 -50.563 1.00 193.88 ? 833  VAL C CA    1 
ATOM   3949  C  C     . VAL B 2 316 ? -6.928  39.272 -51.065 1.00 194.36 ? 833  VAL C C     1 
ATOM   3950  O  O     . VAL B 2 316 ? -6.731  39.418 -52.273 1.00 196.10 ? 833  VAL C O     1 
ATOM   3951  C  CB    . VAL B 2 316 ? -8.242  37.138 -51.220 1.00 194.03 ? 833  VAL C CB    1 
ATOM   3952  C  CG1   . VAL B 2 316 ? -6.953  36.362 -50.987 1.00 193.24 ? 833  VAL C CG1   1 
ATOM   3953  C  CG2   . VAL B 2 316 ? -9.433  36.354 -50.684 1.00 193.67 ? 833  VAL C CG2   1 
ATOM   3954  N  N     . ILE B 2 317 ? -6.097  39.730 -50.129 1.00 193.47 ? 834  ILE C N     1 
ATOM   3955  C  CA    . ILE B 2 317 ? -4.842  40.401 -50.470 1.00 194.45 ? 834  ILE C CA    1 
ATOM   3956  C  C     . ILE B 2 317 ? -3.788  39.359 -50.842 1.00 194.92 ? 834  ILE C C     1 
ATOM   3957  O  O     . ILE B 2 317 ? -3.126  39.484 -51.873 1.00 196.41 ? 834  ILE C O     1 
ATOM   3958  C  CB    . ILE B 2 317 ? -4.309  41.280 -49.312 1.00 193.85 ? 834  ILE C CB    1 
ATOM   3959  C  CG1   . ILE B 2 317 ? -5.363  42.301 -48.862 1.00 193.95 ? 834  ILE C CG1   1 
ATOM   3960  C  CG2   . ILE B 2 317 ? -3.049  42.030 -49.736 1.00 194.83 ? 834  ILE C CG2   1 
ATOM   3961  C  CD1   . ILE B 2 317 ? -4.917  43.164 -47.699 1.00 193.24 ? 834  ILE C CD1   1 
ATOM   3962  N  N     . ASP B 2 318 ? -3.640  38.336 -50.000 1.00 194.21 ? 835  ASP C N     1 
ATOM   3963  C  CA    . ASP B 2 318 ? -2.619  37.302 -50.198 1.00 194.72 ? 835  ASP C CA    1 
ATOM   3964  C  C     . ASP B 2 318 ? -3.109  35.891 -49.872 1.00 194.42 ? 835  ASP C C     1 
ATOM   3965  O  O     . ASP B 2 318 ? -4.073  35.708 -49.127 1.00 193.86 ? 835  ASP C O     1 
ATOM   3966  C  CB    . ASP B 2 318 ? -1.385  37.605 -49.341 1.00 194.36 ? 835  ASP C CB    1 
ATOM   3967  C  CG    . ASP B 2 318 ? -0.406  38.534 -50.029 1.00 195.59 ? 835  ASP C CG    1 
ATOM   3968  O  OD1   . ASP B 2 318 ? 0.617   38.039 -50.546 1.00 196.71 ? 835  ASP C OD1   1 
ATOM   3969  O  OD2   . ASP B 2 318 ? -0.658  39.755 -50.060 1.00 195.64 ? 835  ASP C OD2   1 
ATOM   3970  N  N     . ILE B 2 319 ? -2.419  34.907 -50.446 1.00 195.11 ? 836  ILE C N     1 
ATOM   3971  C  CA    . ILE B 2 319 ? -2.600  33.494 -50.118 1.00 194.63 ? 836  ILE C CA    1 
ATOM   3972  C  C     . ILE B 2 319 ? -1.239  32.929 -49.718 1.00 194.68 ? 836  ILE C C     1 
ATOM   3973  O  O     . ILE B 2 319 ? -0.290  32.994 -50.501 1.00 195.52 ? 836  ILE C O     1 
ATOM   3974  C  CB    . ILE B 2 319 ? -3.122  32.684 -51.326 1.00 195.54 ? 836  ILE C CB    1 
ATOM   3975  C  CG1   . ILE B 2 319 ? -4.455  33.249 -51.839 1.00 195.82 ? 836  ILE C CG1   1 
ATOM   3976  C  CG2   . ILE B 2 319 ? -3.263  31.209 -50.966 1.00 195.34 ? 836  ILE C CG2   1 
ATOM   3977  C  CD1   . ILE B 2 319 ? -5.611  33.131 -50.868 1.00 195.04 ? 836  ILE C CD1   1 
ATOM   3978  N  N     . PHE B 2 320 ? -1.145  32.383 -48.507 1.00 194.10 ? 837  PHE C N     1 
ATOM   3979  C  CA    . PHE B 2 320 ? 0.087   31.750 -48.036 1.00 194.74 ? 837  PHE C CA    1 
ATOM   3980  C  C     . PHE B 2 320 ? -0.134  30.263 -47.794 1.00 194.98 ? 837  PHE C C     1 
ATOM   3981  O  O     . PHE B 2 320 ? -1.045  29.885 -47.060 1.00 194.31 ? 837  PHE C O     1 
ATOM   3982  C  CB    . PHE B 2 320 ? 0.567   32.393 -46.732 1.00 194.18 ? 837  PHE C CB    1 
ATOM   3983  C  CG    . PHE B 2 320 ? 1.010   33.819 -46.880 1.00 194.54 ? 837  PHE C CG    1 
ATOM   3984  C  CD1   . PHE B 2 320 ? 2.340   34.122 -47.138 1.00 195.56 ? 837  PHE C CD1   1 
ATOM   3985  C  CD2   . PHE B 2 320 ? 0.102   34.860 -46.746 1.00 194.06 ? 837  PHE C CD2   1 
ATOM   3986  C  CE1   . PHE B 2 320 ? 2.755   35.437 -47.269 1.00 195.96 ? 837  PHE C CE1   1 
ATOM   3987  C  CE2   . PHE B 2 320 ? 0.511   36.177 -46.875 1.00 194.37 ? 837  PHE C CE2   1 
ATOM   3988  C  CZ    . PHE B 2 320 ? 1.839   36.467 -47.138 1.00 195.32 ? 837  PHE C CZ    1 
ATOM   3989  N  N     . LYS B 2 321 ? 0.697   29.424 -48.410 1.00 195.99 ? 838  LYS C N     1 
ATOM   3990  C  CA    . LYS B 2 321 ? 0.714   27.997 -48.100 1.00 196.20 ? 838  LYS C CA    1 
ATOM   3991  C  C     . LYS B 2 321 ? 1.589   27.792 -46.869 1.00 195.83 ? 838  LYS C C     1 
ATOM   3992  O  O     . LYS B 2 321 ? 2.768   28.149 -46.876 1.00 196.18 ? 838  LYS C O     1 
ATOM   3993  C  CB    . LYS B 2 321 ? 1.248   27.179 -49.278 1.00 197.72 ? 838  LYS C CB    1 
ATOM   3994  C  CG    . LYS B 2 321 ? 1.236   25.676 -49.034 1.00 198.57 ? 838  LYS C CG    1 
ATOM   3995  C  CD    . LYS B 2 321 ? 1.392   24.888 -50.325 1.00 199.79 ? 838  LYS C CD    1 
ATOM   3996  C  CE    . LYS B 2 321 ? 1.547   23.399 -50.052 1.00 200.66 ? 838  LYS C CE    1 
ATOM   3997  N  NZ    . LYS B 2 321 ? 0.380   22.822 -49.328 1.00 200.11 ? 838  LYS C NZ    1 
ATOM   3998  N  N     . ILE B 2 322 ? 1.007   27.214 -45.820 1.00 195.15 ? 839  ILE C N     1 
ATOM   3999  C  CA    . ILE B 2 322 ? 1.682   27.089 -44.524 1.00 194.99 ? 839  ILE C CA    1 
ATOM   4000  C  C     . ILE B 2 322 ? 1.959   25.629 -44.172 1.00 195.96 ? 839  ILE C C     1 
ATOM   4001  O  O     . ILE B 2 322 ? 1.123   24.752 -44.400 1.00 195.71 ? 839  ILE C O     1 
ATOM   4002  C  CB    . ILE B 2 322 ? 0.885   27.772 -43.385 1.00 193.53 ? 839  ILE C CB    1 
ATOM   4003  C  CG1   . ILE B 2 322 ? -0.599  27.380 -43.425 1.00 192.68 ? 839  ILE C CG1   1 
ATOM   4004  C  CG2   . ILE B 2 322 ? 1.026   29.286 -43.483 1.00 192.96 ? 839  ILE C CG2   1 
ATOM   4005  C  CD1   . ILE B 2 322 ? -1.385  27.800 -42.202 1.00 191.53 ? 839  ILE C CD1   1 
ATOM   4006  N  N     . GLU B 2 323 ? 3.147   25.387 -43.621 1.00 197.26 ? 840  GLU C N     1 
ATOM   4007  C  CA    . GLU B 2 323 ? 3.602   24.045 -43.268 1.00 199.11 ? 840  GLU C CA    1 
ATOM   4008  C  C     . GLU B 2 323 ? 4.335   24.103 -41.929 1.00 199.52 ? 840  GLU C C     1 
ATOM   4009  O  O     . GLU B 2 323 ? 5.478   24.559 -41.858 1.00 200.23 ? 840  GLU C O     1 
ATOM   4010  C  CB    . GLU B 2 323 ? 4.524   23.505 -44.369 1.00 200.99 ? 840  GLU C CB    1 
ATOM   4011  C  CG    . GLU B 2 323 ? 5.122   22.124 -44.115 1.00 203.01 ? 840  GLU C CG    1 
ATOM   4012  C  CD    . GLU B 2 323 ? 4.191   20.984 -44.492 1.00 203.63 ? 840  GLU C CD    1 
ATOM   4013  O  OE1   . GLU B 2 323 ? 2.960   21.130 -44.341 1.00 203.02 ? 840  GLU C OE1   1 
ATOM   4014  O  OE2   . GLU B 2 323 ? 4.698   19.934 -44.939 1.00 205.32 ? 840  GLU C OE2   1 
ATOM   4015  N  N     . ARG B 2 324 ? 3.670   23.641 -40.873 1.00 199.40 ? 841  ARG C N     1 
ATOM   4016  C  CA    . ARG B 2 324 ? 4.240   23.671 -39.523 1.00 199.98 ? 841  ARG C CA    1 
ATOM   4017  C  C     . ARG B 2 324 ? 5.320   22.608 -39.323 1.00 202.45 ? 841  ARG C C     1 
ATOM   4018  O  O     . ARG B 2 324 ? 5.395   21.632 -40.073 1.00 203.83 ? 841  ARG C O     1 
ATOM   4019  C  CB    . ARG B 2 324 ? 3.143   23.504 -38.463 1.00 198.63 ? 841  ARG C CB    1 
ATOM   4020  C  CG    . ARG B 2 324 ? 2.531   24.815 -37.987 1.00 196.35 ? 841  ARG C CG    1 
ATOM   4021  C  CD    . ARG B 2 324 ? 1.438   24.608 -36.945 1.00 195.20 ? 841  ARG C CD    1 
ATOM   4022  N  NE    . ARG B 2 324 ? 1.739   23.529 -36.002 1.00 195.88 ? 841  ARG C NE    1 
ATOM   4023  C  CZ    . ARG B 2 324 ? 2.652   23.587 -35.031 1.00 196.09 ? 841  ARG C CZ    1 
ATOM   4024  N  NH1   . ARG B 2 324 ? 3.393   24.676 -34.845 1.00 195.48 ? 841  ARG C NH1   1 
ATOM   4025  N  NH2   . ARG B 2 324 ? 2.831   22.536 -34.237 1.00 197.39 ? 841  ARG C NH2   1 
ATOM   4026  N  N     . GLU B 2 325 ? 6.151   22.813 -38.303 1.00 203.50 ? 842  GLU C N     1 
ATOM   4027  C  CA    . GLU B 2 325 ? 7.232   21.886 -37.972 1.00 205.82 ? 842  GLU C CA    1 
ATOM   4028  C  C     . GLU B 2 325 ? 6.669   20.618 -37.331 1.00 206.19 ? 842  GLU C C     1 
ATOM   4029  O  O     . GLU B 2 325 ? 6.214   20.640 -36.186 1.00 205.75 ? 842  GLU C O     1 
ATOM   4030  C  CB    . GLU B 2 325 ? 8.238   22.555 -37.025 1.00 206.88 ? 842  GLU C CB    1 
ATOM   4031  C  CG    . GLU B 2 325 ? 9.494   21.741 -36.727 1.00 209.75 ? 842  GLU C CG    1 
ATOM   4032  C  CD    . GLU B 2 325 ? 10.579  21.899 -37.779 1.00 211.23 ? 842  GLU C CD    1 
ATOM   4033  O  OE1   . GLU B 2 325 ? 10.253  22.149 -38.959 1.00 210.81 ? 842  GLU C OE1   1 
ATOM   4034  O  OE2   . GLU B 2 325 ? 11.769  21.766 -37.422 1.00 213.31 ? 842  GLU C OE2   1 
ATOM   4035  N  N     . GLY B 2 326 ? 6.697   19.520 -38.082 1.00 206.83 ? 843  GLY C N     1 
ATOM   4036  C  CA    . GLY B 2 326 ? 6.257   18.220 -37.580 1.00 207.43 ? 843  GLY C CA    1 
ATOM   4037  C  C     . GLY B 2 326 ? 4.752   18.057 -37.444 1.00 205.69 ? 843  GLY C C     1 
ATOM   4038  O  O     . GLY B 2 326 ? 4.290   17.162 -36.734 1.00 206.45 ? 843  GLY C O     1 
ATOM   4039  N  N     . GLU B 2 327 ? 3.986   18.911 -38.120 1.00 203.41 ? 844  GLU C N     1 
ATOM   4040  C  CA    . GLU B 2 327 ? 2.526   18.807 -38.113 1.00 201.98 ? 844  GLU C CA    1 
ATOM   4041  C  C     . GLU B 2 327 ? 2.051   17.696 -39.052 1.00 202.55 ? 844  GLU C C     1 
ATOM   4042  O  O     . GLU B 2 327 ? 0.952   17.170 -38.889 1.00 202.54 ? 844  GLU C O     1 
ATOM   4043  C  CB    . GLU B 2 327 ? 1.883   20.140 -38.502 1.00 200.07 ? 844  GLU C CB    1 
ATOM   4044  C  CG    . GLU B 2 327 ? 0.397   20.224 -38.189 1.00 199.11 ? 844  GLU C CG    1 
ATOM   4045  C  CD    . GLU B 2 327 ? -0.182  21.602 -38.443 1.00 197.49 ? 844  GLU C CD    1 
ATOM   4046  O  OE1   . GLU B 2 327 ? 0.043   22.152 -39.541 1.00 197.08 ? 844  GLU C OE1   1 
ATOM   4047  O  OE2   . GLU B 2 327 ? -0.874  22.132 -37.547 1.00 196.99 ? 844  GLU C OE2   1 
ATOM   4048  N  N     . CYS B 2 328 ? 2.879   17.352 -40.036 1.00 203.01 ? 845  CYS C N     1 
ATOM   4049  C  CA    . CYS B 2 328 ? 2.608   16.219 -40.920 1.00 203.72 ? 845  CYS C CA    1 
ATOM   4050  C  C     . CYS B 2 328 ? 2.974   14.897 -40.246 1.00 204.83 ? 845  CYS C C     1 
ATOM   4051  O  O     . CYS B 2 328 ? 2.384   13.857 -40.546 1.00 205.74 ? 845  CYS C O     1 
ATOM   4052  C  CB    . CYS B 2 328 ? 3.383   16.364 -42.231 1.00 204.24 ? 845  CYS C CB    1 
ATOM   4053  S  SG    . CYS B 2 328 ? 2.960   17.845 -43.175 1.00 202.47 ? 845  CYS C SG    1 
ATOM   4054  N  N     . GLN B 2 329 ? 3.950   14.945 -39.341 1.00 204.69 ? 846  GLN C N     1 
ATOM   4055  C  CA    . GLN B 2 329 ? 4.382   13.765 -38.592 1.00 206.45 ? 846  GLN C CA    1 
ATOM   4056  C  C     . GLN B 2 329 ? 3.294   13.300 -37.620 1.00 205.84 ? 846  GLN C C     1 
ATOM   4057  O  O     . GLN B 2 329 ? 3.083   12.099 -37.445 1.00 207.76 ? 846  GLN C O     1 
ATOM   4058  C  CB    . GLN B 2 329 ? 5.677   14.066 -37.826 1.00 207.56 ? 846  GLN C CB    1 
ATOM   4059  C  CG    . GLN B 2 329 ? 6.471   12.836 -37.404 1.00 210.54 ? 846  GLN C CG    1 
ATOM   4060  C  CD    . GLN B 2 329 ? 7.352   12.288 -38.518 1.00 212.17 ? 846  GLN C CD    1 
ATOM   4061  O  OE1   . GLN B 2 329 ? 6.924   12.175 -39.666 1.00 211.74 ? 846  GLN C OE1   1 
ATOM   4062  N  NE2   . GLN B 2 329 ? 8.591   11.941 -38.181 1.00 214.30 ? 846  GLN C NE2   1 
ATOM   4063  N  N     . ARG B 2 330 ? 2.610   14.258 -36.997 1.00 203.00 ? 847  ARG C N     1 
ATOM   4064  C  CA    . ARG B 2 330 ? 1.528   13.962 -36.052 1.00 202.04 ? 847  ARG C CA    1 
ATOM   4065  C  C     . ARG B 2 330 ? 0.178   13.704 -36.737 1.00 200.36 ? 847  ARG C C     1 
ATOM   4066  O  O     . ARG B 2 330 ? -0.700  13.070 -36.151 1.00 200.65 ? 847  ARG C O     1 
ATOM   4067  C  CB    . ARG B 2 330 ? 1.373   15.097 -35.029 1.00 200.76 ? 847  ARG C CB    1 
ATOM   4068  C  CG    . ARG B 2 330 ? 1.058   16.461 -35.636 1.00 198.59 ? 847  ARG C CG    1 
ATOM   4069  C  CD    . ARG B 2 330 ? -0.156  17.112 -34.995 1.00 197.15 ? 847  ARG C CD    1 
ATOM   4070  N  NE    . ARG B 2 330 ? 0.156   17.773 -33.726 1.00 196.87 ? 847  ARG C NE    1 
ATOM   4071  C  CZ    . ARG B 2 330 ? -0.003  19.074 -33.466 1.00 195.21 ? 847  ARG C CZ    1 
ATOM   4072  N  NH1   . ARG B 2 330 ? -0.491  19.913 -34.379 1.00 193.66 ? 847  ARG C NH1   1 
ATOM   4073  N  NH2   . ARG B 2 330 ? 0.323   19.545 -32.267 1.00 195.12 ? 847  ARG C NH2   1 
ATOM   4074  N  N     . TYR B 2 331 ? 0.017   14.201 -37.964 1.00 198.27 ? 848  TYR C N     1 
ATOM   4075  C  CA    . TYR B 2 331 ? -1.241  14.062 -38.708 1.00 197.10 ? 848  TYR C CA    1 
ATOM   4076  C  C     . TYR B 2 331 ? -1.301  12.773 -39.539 1.00 200.04 ? 848  TYR C C     1 
ATOM   4077  O  O     . TYR B 2 331 ? -2.383  12.350 -39.951 1.00 200.54 ? 848  TYR C O     1 
ATOM   4078  C  CB    . TYR B 2 331 ? -1.457  15.284 -39.609 1.00 193.77 ? 848  TYR C CB    1 
ATOM   4079  C  CG    . TYR B 2 331 ? -2.787  15.305 -40.332 1.00 191.61 ? 848  TYR C CG    1 
ATOM   4080  C  CD1   . TYR B 2 331 ? -3.985  15.243 -39.626 1.00 190.64 ? 848  TYR C CD1   1 
ATOM   4081  C  CD2   . TYR B 2 331 ? -2.849  15.402 -41.720 1.00 190.70 ? 848  TYR C CD2   1 
ATOM   4082  C  CE1   . TYR B 2 331 ? -5.204  15.265 -40.280 1.00 189.82 ? 848  TYR C CE1   1 
ATOM   4083  C  CE2   . TYR B 2 331 ? -4.065  15.426 -42.383 1.00 189.84 ? 848  TYR C CE2   1 
ATOM   4084  C  CZ    . TYR B 2 331 ? -5.238  15.357 -41.657 1.00 189.46 ? 848  TYR C CZ    1 
ATOM   4085  O  OH    . TYR B 2 331 ? -6.450  15.380 -42.304 1.00 188.61 ? 848  TYR C OH    1 
ATOM   4086  N  N     . LYS B 2 332 ? -0.142  12.161 -39.781 1.00 202.46 ? 849  LYS C N     1 
ATOM   4087  C  CA    . LYS B 2 332 ? -0.045  10.878 -40.495 1.00 205.10 ? 849  LYS C CA    1 
ATOM   4088  C  C     . LYS B 2 332 ? -1.111  9.853  -40.063 1.00 206.59 ? 849  LYS C C     1 
ATOM   4089  O  O     . LYS B 2 332 ? -1.747  9.238  -40.921 1.00 207.56 ? 849  LYS C O     1 
ATOM   4090  C  CB    . LYS B 2 332 ? 1.379   10.304 -40.358 1.00 207.26 ? 849  LYS C CB    1 
ATOM   4091  C  CG    . LYS B 2 332 ? 1.533   8.811  -40.625 1.00 210.06 ? 849  LYS C CG    1 
ATOM   4092  C  CD    . LYS B 2 332 ? 1.315   8.459  -42.086 1.00 210.44 ? 849  LYS C CD    1 
ATOM   4093  C  CE    . LYS B 2 332 ? 1.508   6.969  -42.314 1.00 213.31 ? 849  LYS C CE    1 
ATOM   4094  N  NZ    . LYS B 2 332 ? 1.532   6.611  -43.758 1.00 213.74 ? 849  LYS C NZ    1 
ATOM   4095  N  N     . PRO B 2 333 ? -1.301  9.658  -38.741 1.00 207.19 ? 850  PRO C N     1 
ATOM   4096  C  CA    . PRO B 2 333 ? -2.380  8.801  -38.240 1.00 208.58 ? 850  PRO C CA    1 
ATOM   4097  C  C     . PRO B 2 333 ? -3.760  9.049  -38.861 1.00 207.93 ? 850  PRO C C     1 
ATOM   4098  O  O     . PRO B 2 333 ? -4.479  8.092  -39.154 1.00 209.60 ? 850  PRO C O     1 
ATOM   4099  C  CB    . PRO B 2 333 ? -2.422  9.141  -36.749 1.00 208.23 ? 850  PRO C CB    1 
ATOM   4100  C  CG    . PRO B 2 333 ? -1.024  9.521  -36.408 1.00 208.16 ? 850  PRO C CG    1 
ATOM   4101  C  CD    . PRO B 2 333 ? -0.354  10.009 -37.664 1.00 207.20 ? 850  PRO C CD    1 
ATOM   4102  N  N     . PHE B 2 334 ? -4.117  10.317 -39.061 1.00 206.03 ? 851  PHE C N     1 
ATOM   4103  C  CA    . PHE B 2 334 ? -5.469  10.687 -39.493 1.00 205.64 ? 851  PHE C CA    1 
ATOM   4104  C  C     . PHE B 2 334 ? -5.631  10.856 -41.007 1.00 205.87 ? 851  PHE C C     1 
ATOM   4105  O  O     . PHE B 2 334 ? -6.718  11.201 -41.475 1.00 205.25 ? 851  PHE C O     1 
ATOM   4106  C  CB    . PHE B 2 334 ? -5.917  11.959 -38.770 1.00 203.62 ? 851  PHE C CB    1 
ATOM   4107  C  CG    . PHE B 2 334 ? -5.863  11.846 -37.275 1.00 203.84 ? 851  PHE C CG    1 
ATOM   4108  C  CD1   . PHE B 2 334 ? -6.917  11.283 -36.569 1.00 204.70 ? 851  PHE C CD1   1 
ATOM   4109  C  CD2   . PHE B 2 334 ? -4.749  12.286 -36.574 1.00 203.38 ? 851  PHE C CD2   1 
ATOM   4110  C  CE1   . PHE B 2 334 ? -6.866  11.169 -35.189 1.00 205.18 ? 851  PHE C CE1   1 
ATOM   4111  C  CE2   . PHE B 2 334 ? -4.692  12.176 -35.196 1.00 203.82 ? 851  PHE C CE2   1 
ATOM   4112  C  CZ    . PHE B 2 334 ? -5.751  11.618 -34.501 1.00 204.75 ? 851  PHE C CZ    1 
ATOM   4113  N  N     . LYS B 2 335 ? -4.568  10.609 -41.770 1.00 207.30 ? 852  LYS C N     1 
ATOM   4114  C  CA    . LYS B 2 335 ? -4.684  10.520 -43.228 1.00 208.15 ? 852  LYS C CA    1 
ATOM   4115  C  C     . LYS B 2 335 ? -5.331  9.192  -43.629 1.00 210.50 ? 852  LYS C C     1 
ATOM   4116  O  O     . LYS B 2 335 ? -5.838  9.052  -44.743 1.00 210.77 ? 852  LYS C O     1 
ATOM   4117  C  CB    . LYS B 2 335 ? -3.320  10.680 -43.906 1.00 208.47 ? 852  LYS C CB    1 
ATOM   4118  C  CG    . LYS B 2 335 ? -2.656  12.024 -43.635 1.00 206.98 ? 852  LYS C CG    1 
ATOM   4119  C  CD    . LYS B 2 335 ? -2.143  12.688 -44.905 1.00 206.48 ? 852  LYS C CD    1 
ATOM   4120  C  CE    . LYS B 2 335 ? -3.286  13.210 -45.764 1.00 205.84 ? 852  LYS C CE    1 
ATOM   4121  N  NZ    . LYS B 2 335 ? -2.830  14.215 -46.764 1.00 204.92 ? 852  LYS C NZ    1 
ATOM   4122  N  N     . GLN B 2 336 ? -5.308  8.225  -42.711 1.00 212.54 ? 853  GLN C N     1 
ATOM   4123  C  CA    . GLN B 2 336 ? -6.042  6.970  -42.872 1.00 214.73 ? 853  GLN C CA    1 
ATOM   4124  C  C     . GLN B 2 336 ? -7.539  7.216  -42.677 1.00 212.98 ? 853  GLN C C     1 
ATOM   4125  O  O     . GLN B 2 336 ? -8.372  6.544  -43.288 1.00 214.02 ? 853  GLN C O     1 
ATOM   4126  C  CB    . GLN B 2 336 ? -5.574  5.914  -41.857 1.00 217.98 ? 853  GLN C CB    1 
ATOM   4127  C  CG    . GLN B 2 336 ? -4.065  5.772  -41.681 1.00 219.46 ? 853  GLN C CG    1 
ATOM   4128  C  CD    . GLN B 2 336 ? -3.326  5.508  -42.980 1.00 220.75 ? 853  GLN C CD    1 
ATOM   4129  O  OE1   . GLN B 2 336 ? -3.869  4.912  -43.911 1.00 222.20 ? 853  GLN C OE1   1 
ATOM   4130  N  NE2   . GLN B 2 336 ? -2.071  5.944  -43.045 1.00 220.88 ? 853  GLN C NE2   1 
ATOM   4131  N  N     . LEU B 2 337 ? -7.864  8.180  -41.817 1.00 209.70 ? 854  LEU C N     1 
ATOM   4132  C  CA    . LEU B 2 337 ? -9.248  8.498  -41.465 1.00 207.89 ? 854  LEU C CA    1 
ATOM   4133  C  C     . LEU B 2 337 ? -10.008 9.093  -42.650 1.00 205.72 ? 854  LEU C C     1 
ATOM   4134  O  O     . LEU B 2 337 ? -9.470  9.914  -43.395 1.00 203.64 ? 854  LEU C O     1 
ATOM   4135  C  CB    . LEU B 2 337 ? -9.283  9.477  -40.285 1.00 206.16 ? 854  LEU C CB    1 
ATOM   4136  C  CG    . LEU B 2 337 ? -10.560 9.494  -39.441 1.00 206.45 ? 854  LEU C CG    1 
ATOM   4137  C  CD1   . LEU B 2 337 ? -10.637 8.258  -38.557 1.00 208.71 ? 854  LEU C CD1   1 
ATOM   4138  C  CD2   . LEU B 2 337 ? -10.622 10.757 -38.594 1.00 204.47 ? 854  LEU C CD2   1 
ATOM   4139  N  N     . HIS B 2 338 ? -11.262 8.674  -42.810 1.00 205.68 ? 855  HIS C N     1 
ATOM   4140  C  CA    . HIS B 2 338 ? -12.114 9.142  -43.905 1.00 204.49 ? 855  HIS C CA    1 
ATOM   4141  C  C     . HIS B 2 338 ? -12.712 10.515 -43.594 1.00 202.09 ? 855  HIS C C     1 
ATOM   4142  O  O     . HIS B 2 338 ? -12.491 11.064 -42.515 1.00 201.23 ? 855  HIS C O     1 
ATOM   4143  C  CB    . HIS B 2 338 ? -13.229 8.123  -44.187 1.00 206.69 ? 855  HIS C CB    1 
ATOM   4144  C  CG    . HIS B 2 338 ? -14.388 8.207  -43.240 1.00 207.13 ? 855  HIS C CG    1 
ATOM   4145  N  ND1   . HIS B 2 338 ? -14.313 7.798  -41.925 1.00 207.68 ? 855  HIS C ND1   1 
ATOM   4146  C  CD2   . HIS B 2 338 ? -15.657 8.642  -43.425 1.00 207.21 ? 855  HIS C CD2   1 
ATOM   4147  C  CE1   . HIS B 2 338 ? -15.482 7.985  -41.340 1.00 208.21 ? 855  HIS C CE1   1 
ATOM   4148  N  NE2   . HIS B 2 338 ? -16.315 8.496  -42.228 1.00 207.92 ? 855  HIS C NE2   1 
ATOM   4149  N  N     . ASN B 2 339 ? -13.458 11.062 -44.552 1.00 200.93 ? 856  ASN C N     1 
ATOM   4150  C  CA    . ASN B 2 339 ? -14.170 12.332 -44.380 1.00 198.75 ? 856  ASN C CA    1 
ATOM   4151  C  C     . ASN B 2 339 ? -13.258 13.462 -43.885 1.00 195.93 ? 856  ASN C C     1 
ATOM   4152  O  O     . ASN B 2 339 ? -13.393 13.942 -42.757 1.00 195.48 ? 856  ASN C O     1 
ATOM   4153  C  CB    . ASN B 2 339 ? -15.373 12.135 -43.441 1.00 199.75 ? 856  ASN C CB    1 
ATOM   4154  C  CG    . ASN B 2 339 ? -16.270 13.362 -43.350 1.00 198.72 ? 856  ASN C CG    1 
ATOM   4155  O  OD1   . ASN B 2 339 ? -16.910 13.592 -42.325 1.00 199.09 ? 856  ASN C OD1   1 
ATOM   4156  N  ND2   . ASN B 2 339 ? -16.324 14.150 -44.419 1.00 197.79 ? 856  ASN C ND2   1 
ATOM   4157  N  N     . ARG B 2 340 ? -12.324 13.869 -44.742 1.00 194.18 ? 857  ARG C N     1 
ATOM   4158  C  CA    . ARG B 2 340 ? -11.404 14.963 -44.438 1.00 191.77 ? 857  ARG C CA    1 
ATOM   4159  C  C     . ARG B 2 340 ? -11.850 16.217 -45.182 1.00 189.70 ? 857  ARG C C     1 
ATOM   4160  O  O     . ARG B 2 340 ? -12.085 16.173 -46.391 1.00 190.24 ? 857  ARG C O     1 
ATOM   4161  C  CB    . ARG B 2 340 ? -9.976  14.587 -44.836 1.00 192.24 ? 857  ARG C CB    1 
ATOM   4162  C  CG    . ARG B 2 340 ? -9.522  13.244 -44.282 1.00 194.27 ? 857  ARG C CG    1 
ATOM   4163  C  CD    . ARG B 2 340 ? -8.012  13.086 -44.345 1.00 194.39 ? 857  ARG C CD    1 
ATOM   4164  N  NE    . ARG B 2 340 ? -7.502  13.122 -45.714 1.00 194.43 ? 857  ARG C NE    1 
ATOM   4165  C  CZ    . ARG B 2 340 ? -7.533  12.102 -46.572 1.00 195.64 ? 857  ARG C CZ    1 
ATOM   4166  N  NH1   . ARG B 2 340 ? -8.062  10.930 -46.228 1.00 197.24 ? 857  ARG C NH1   1 
ATOM   4167  N  NH2   . ARG B 2 340 ? -7.034  12.257 -47.794 1.00 195.53 ? 857  ARG C NH2   1 
ATOM   4168  N  N     . ARG B 2 341 ? -11.963 17.328 -44.456 1.00 187.29 ? 858  ARG C N     1 
ATOM   4169  C  CA    . ARG B 2 341 ? -12.531 18.563 -44.997 1.00 185.52 ? 858  ARG C CA    1 
ATOM   4170  C  C     . ARG B 2 341 ? -11.592 19.753 -44.810 1.00 182.94 ? 858  ARG C C     1 
ATOM   4171  O  O     . ARG B 2 341 ? -10.972 19.908 -43.757 1.00 182.22 ? 858  ARG C O     1 
ATOM   4172  C  CB    . ARG B 2 341 ? -13.876 18.847 -44.323 1.00 185.89 ? 858  ARG C CB    1 
ATOM   4173  C  CG    . ARG B 2 341 ? -14.993 17.908 -44.762 1.00 187.92 ? 858  ARG C CG    1 
ATOM   4174  C  CD    . ARG B 2 341 ? -15.877 18.506 -45.850 1.00 188.40 ? 858  ARG C CD    1 
ATOM   4175  N  NE    . ARG B 2 341 ? -17.145 19.001 -45.311 1.00 188.71 ? 858  ARG C NE    1 
ATOM   4176  C  CZ    . ARG B 2 341 ? -18.218 18.246 -45.066 1.00 190.49 ? 858  ARG C CZ    1 
ATOM   4177  N  NH1   . ARG B 2 341 ? -18.206 16.935 -45.301 1.00 192.05 ? 858  ARG C NH1   1 
ATOM   4178  N  NH2   . ARG B 2 341 ? -19.319 18.807 -44.576 1.00 190.80 ? 858  ARG C NH2   1 
ATOM   4179  N  N     . LEU B 2 342 ? -11.497 20.585 -45.845 1.00 181.50 ? 859  LEU C N     1 
ATOM   4180  C  CA    . LEU B 2 342 ? -10.707 21.813 -45.807 1.00 179.26 ? 859  LEU C CA    1 
ATOM   4181  C  C     . LEU B 2 342 ? -11.623 22.945 -45.335 1.00 177.66 ? 859  LEU C C     1 
ATOM   4182  O  O     . LEU B 2 342 ? -12.479 23.413 -46.089 1.00 177.61 ? 859  LEU C O     1 
ATOM   4183  C  CB    . LEU B 2 342 ? -10.130 22.101 -47.201 1.00 179.37 ? 859  LEU C CB    1 
ATOM   4184  C  CG    . LEU B 2 342 ? -8.948  23.064 -47.378 1.00 178.11 ? 859  LEU C CG    1 
ATOM   4185  C  CD1   . LEU B 2 342 ? -9.391  24.512 -47.257 1.00 177.04 ? 859  LEU C CD1   1 
ATOM   4186  C  CD2   . LEU B 2 342 ? -7.818  22.761 -46.403 1.00 177.58 ? 859  LEU C CD2   1 
ATOM   4187  N  N     . LEU B 2 343 ? -11.442 23.373 -44.085 1.00 175.87 ? 860  LEU C N     1 
ATOM   4188  C  CA    . LEU B 2 343 ? -12.386 24.279 -43.424 1.00 174.71 ? 860  LEU C CA    1 
ATOM   4189  C  C     . LEU B 2 343 ? -11.723 25.542 -42.876 1.00 172.89 ? 860  LEU C C     1 
ATOM   4190  O  O     . LEU B 2 343 ? -10.532 25.545 -42.562 1.00 172.02 ? 860  LEU C O     1 
ATOM   4191  C  CB    . LEU B 2 343 ? -13.097 23.537 -42.290 1.00 174.97 ? 860  LEU C CB    1 
ATOM   4192  C  CG    . LEU B 2 343 ? -14.059 22.431 -42.734 1.00 176.45 ? 860  LEU C CG    1 
ATOM   4193  C  CD1   . LEU B 2 343 ? -14.352 21.470 -41.591 1.00 177.22 ? 860  LEU C CD1   1 
ATOM   4194  C  CD2   . LEU B 2 343 ? -15.346 23.026 -43.288 1.00 176.86 ? 860  LEU C CD2   1 
ATOM   4195  N  N     . TRP B 2 344 ? -12.516 26.607 -42.754 1.00 172.07 ? 861  TRP C N     1 
ATOM   4196  C  CA    . TRP B 2 344 ? -12.027 27.903 -42.280 1.00 170.76 ? 861  TRP C CA    1 
ATOM   4197  C  C     . TRP B 2 344 ? -11.846 27.933 -40.767 1.00 169.97 ? 861  TRP C C     1 
ATOM   4198  O  O     . TRP B 2 344 ? -12.549 27.236 -40.033 1.00 170.26 ? 861  TRP C O     1 
ATOM   4199  C  CB    . TRP B 2 344 ? -12.990 29.027 -42.674 1.00 170.84 ? 861  TRP C CB    1 
ATOM   4200  C  CG    . TRP B 2 344 ? -13.135 29.236 -44.146 1.00 171.59 ? 861  TRP C CG    1 
ATOM   4201  C  CD1   . TRP B 2 344 ? -14.172 28.827 -44.930 1.00 172.71 ? 861  TRP C CD1   1 
ATOM   4202  C  CD2   . TRP B 2 344 ? -12.223 29.922 -45.010 1.00 171.44 ? 861  TRP C CD2   1 
ATOM   4203  N  NE1   . TRP B 2 344 ? -13.961 29.209 -46.232 1.00 173.26 ? 861  TRP C NE1   1 
ATOM   4204  C  CE2   . TRP B 2 344 ? -12.769 29.878 -46.310 1.00 172.46 ? 861  TRP C CE2   1 
ATOM   4205  C  CE3   . TRP B 2 344 ? -10.991 30.559 -44.815 1.00 170.86 ? 861  TRP C CE3   1 
ATOM   4206  C  CZ2   . TRP B 2 344 ? -12.130 30.453 -47.410 1.00 172.91 ? 861  TRP C CZ2   1 
ATOM   4207  C  CZ3   . TRP B 2 344 ? -10.356 31.129 -45.911 1.00 171.24 ? 861  TRP C CZ3   1 
ATOM   4208  C  CH2   . TRP B 2 344 ? -10.929 31.071 -47.191 1.00 172.28 ? 861  TRP C CH2   1 
ATOM   4209  N  N     . HIS B 2 345 ? -10.903 28.755 -40.314 1.00 169.07 ? 862  HIS C N     1 
ATOM   4210  C  CA    . HIS B 2 345 ? -10.731 29.041 -38.892 1.00 168.44 ? 862  HIS C CA    1 
ATOM   4211  C  C     . HIS B 2 345 ? -10.069 30.406 -38.702 1.00 167.59 ? 862  HIS C C     1 
ATOM   4212  O  O     . HIS B 2 345 ? -8.896  30.581 -39.028 1.00 167.79 ? 862  HIS C O     1 
ATOM   4213  C  CB    . HIS B 2 345 ? -9.901  27.953 -38.206 1.00 168.50 ? 862  HIS C CB    1 
ATOM   4214  C  CG    . HIS B 2 345 ? -9.625  28.226 -36.758 1.00 167.46 ? 862  HIS C CG    1 
ATOM   4215  N  ND1   . HIS B 2 345 ? -10.594 28.124 -35.783 1.00 167.31 ? 862  HIS C ND1   1 
ATOM   4216  C  CD2   . HIS B 2 345 ? -8.490  28.600 -36.122 1.00 166.49 ? 862  HIS C CD2   1 
ATOM   4217  C  CE1   . HIS B 2 345 ? -10.069 28.426 -34.609 1.00 166.49 ? 862  HIS C CE1   1 
ATOM   4218  N  NE2   . HIS B 2 345 ? -8.792  28.717 -34.787 1.00 166.02 ? 862  HIS C NE2   1 
ATOM   4219  N  N     . GLY B 2 346 ? -10.826 31.363 -38.172 1.00 166.95 ? 863  GLY C N     1 
ATOM   4220  C  CA    . GLY B 2 346 ? -10.320 32.711 -37.934 1.00 165.89 ? 863  GLY C CA    1 
ATOM   4221  C  C     . GLY B 2 346 ? -9.984  32.963 -36.478 1.00 165.02 ? 863  GLY C C     1 
ATOM   4222  O  O     . GLY B 2 346 ? -10.555 32.347 -35.580 1.00 165.60 ? 863  GLY C O     1 
ATOM   4223  N  N     . SER B 2 347 ? -9.047  33.874 -36.250 1.00 164.09 ? 864  SER C N     1 
ATOM   4224  C  CA    . SER B 2 347 ? -8.656  34.268 -34.901 1.00 163.50 ? 864  SER C CA    1 
ATOM   4225  C  C     . SER B 2 347 ? -7.948  35.617 -34.953 1.00 163.20 ? 864  SER C C     1 
ATOM   4226  O  O     . SER B 2 347 ? -7.541  36.069 -36.025 1.00 164.02 ? 864  SER C O     1 
ATOM   4227  C  CB    . SER B 2 347 ? -7.747  33.208 -34.273 1.00 163.75 ? 864  SER C CB    1 
ATOM   4228  O  OG    . SER B 2 347 ? -7.368  33.570 -32.957 1.00 163.18 ? 864  SER C OG    1 
ATOM   4229  N  N     . ARG B 2 348 ? -7.809  36.258 -33.796 1.00 162.31 ? 865  ARG C N     1 
ATOM   4230  C  CA    . ARG B 2 348 ? -7.157  37.565 -33.716 1.00 161.69 ? 865  ARG C CA    1 
ATOM   4231  C  C     . ARG B 2 348 ? -5.749  37.530 -34.300 1.00 161.55 ? 865  ARG C C     1 
ATOM   4232  O  O     . ARG B 2 348 ? -5.027  36.547 -34.136 1.00 161.64 ? 865  ARG C O     1 
ATOM   4233  C  CB    . ARG B 2 348 ? -7.078  38.053 -32.266 1.00 161.60 ? 865  ARG C CB    1 
ATOM   4234  C  CG    . ARG B 2 348 ? -8.346  38.711 -31.746 1.00 161.62 ? 865  ARG C CG    1 
ATOM   4235  C  CD    . ARG B 2 348 ? -8.003  39.771 -30.714 1.00 161.53 ? 865  ARG C CD    1 
ATOM   4236  N  NE    . ARG B 2 348 ? -9.187  40.364 -30.100 1.00 161.91 ? 865  ARG C NE    1 
ATOM   4237  C  CZ    . ARG B 2 348 ? -9.154  41.350 -29.205 1.00 162.18 ? 865  ARG C CZ    1 
ATOM   4238  N  NH1   . ARG B 2 348 ? -7.994  41.865 -28.808 1.00 162.21 ? 865  ARG C NH1   1 
ATOM   4239  N  NH2   . ARG B 2 348 ? -10.288 41.824 -28.703 1.00 162.20 ? 865  ARG C NH2   1 
ATOM   4240  N  N     . THR B 2 349 ? -5.368  38.614 -34.973 1.00 161.22 ? 866  THR C N     1 
ATOM   4241  C  CA    . THR B 2 349 ? -4.009  38.772 -35.503 1.00 161.47 ? 866  THR C CA    1 
ATOM   4242  C  C     . THR B 2 349 ? -2.933  38.630 -34.416 1.00 161.32 ? 866  THR C C     1 
ATOM   4243  O  O     . THR B 2 349 ? -1.791  38.275 -34.711 1.00 161.52 ? 866  THR C O     1 
ATOM   4244  C  CB    . THR B 2 349 ? -3.837  40.130 -36.227 1.00 161.65 ? 866  THR C CB    1 
ATOM   4245  O  OG1   . THR B 2 349 ? -2.540  40.195 -36.831 1.00 162.23 ? 866  THR C OG1   1 
ATOM   4246  C  CG2   . THR B 2 349 ? -4.011  41.310 -35.262 1.00 161.10 ? 866  THR C CG2   1 
ATOM   4247  N  N     . THR B 2 350 ? -3.306  38.913 -33.168 1.00 160.85 ? 867  THR C N     1 
ATOM   4248  C  CA    . THR B 2 350 ? -2.406  38.761 -32.023 1.00 161.01 ? 867  THR C CA    1 
ATOM   4249  C  C     . THR B 2 350 ? -2.094  37.289 -31.730 1.00 161.96 ? 867  THR C C     1 
ATOM   4250  O  O     . THR B 2 350 ? -0.983  36.957 -31.313 1.00 162.99 ? 867  THR C O     1 
ATOM   4251  C  CB    . THR B 2 350 ? -3.000  39.397 -30.745 1.00 159.86 ? 867  THR C CB    1 
ATOM   4252  O  OG1   . THR B 2 350 ? -4.138  38.641 -30.309 1.00 159.41 ? 867  THR C OG1   1 
ATOM   4253  C  CG2   . THR B 2 350 ? -3.421  40.843 -30.996 1.00 159.31 ? 867  THR C CG2   1 
ATOM   4254  N  N     . ASN B 2 351 ? -3.079  36.419 -31.949 1.00 162.06 ? 868  ASN C N     1 
ATOM   4255  C  CA    . ASN B 2 351 ? -2.940  34.988 -31.666 1.00 162.61 ? 868  ASN C CA    1 
ATOM   4256  C  C     . ASN B 2 351 ? -2.060  34.244 -32.673 1.00 163.46 ? 868  ASN C C     1 
ATOM   4257  O  O     . ASN B 2 351 ? -1.435  33.242 -32.325 1.00 164.09 ? 868  ASN C O     1 
ATOM   4258  C  CB    . ASN B 2 351 ? -4.318  34.316 -31.617 1.00 162.36 ? 868  ASN C CB    1 
ATOM   4259  C  CG    . ASN B 2 351 ? -5.212  34.881 -30.525 1.00 161.44 ? 868  ASN C CG    1 
ATOM   4260  O  OD1   . ASN B 2 351 ? -4.732  35.429 -29.530 1.00 160.94 ? 868  ASN C OD1   1 
ATOM   4261  N  ND2   . ASN B 2 351 ? -6.522  34.744 -30.704 1.00 161.16 ? 868  ASN C ND2   1 
ATOM   4262  N  N     . PHE B 2 352 ? -2.009  34.738 -33.911 1.00 163.59 ? 869  PHE C N     1 
ATOM   4263  C  CA    . PHE B 2 352 ? -1.283  34.059 -34.996 1.00 164.60 ? 869  PHE C CA    1 
ATOM   4264  C  C     . PHE B 2 352 ? 0.225   33.929 -34.751 1.00 165.64 ? 869  PHE C C     1 
ATOM   4265  O  O     . PHE B 2 352 ? 0.882   33.098 -35.377 1.00 166.67 ? 869  PHE C O     1 
ATOM   4266  C  CB    . PHE B 2 352 ? -1.548  34.742 -36.347 1.00 164.50 ? 869  PHE C CB    1 
ATOM   4267  C  CG    . PHE B 2 352 ? -2.800  34.262 -37.034 1.00 164.19 ? 869  PHE C CG    1 
ATOM   4268  C  CD1   . PHE B 2 352 ? -4.038  34.390 -36.421 1.00 163.48 ? 869  PHE C CD1   1 
ATOM   4269  C  CD2   . PHE B 2 352 ? -2.741  33.685 -38.297 1.00 164.99 ? 869  PHE C CD2   1 
ATOM   4270  C  CE1   . PHE B 2 352 ? -5.191  33.949 -37.048 1.00 163.55 ? 869  PHE C CE1   1 
ATOM   4271  C  CE2   . PHE B 2 352 ? -3.893  33.245 -38.930 1.00 165.08 ? 869  PHE C CE2   1 
ATOM   4272  C  CZ    . PHE B 2 352 ? -5.120  33.378 -38.305 1.00 164.36 ? 869  PHE C CZ    1 
ATOM   4273  N  N     . ALA B 2 353 ? 0.769   34.749 -33.854 1.00 165.50 ? 870  ALA C N     1 
ATOM   4274  C  CA    . ALA B 2 353 ? 2.154   34.592 -33.409 1.00 166.62 ? 870  ALA C CA    1 
ATOM   4275  C  C     . ALA B 2 353 ? 2.341   33.254 -32.690 1.00 167.22 ? 870  ALA C C     1 
ATOM   4276  O  O     . ALA B 2 353 ? 3.359   32.584 -32.869 1.00 168.39 ? 870  ALA C O     1 
ATOM   4277  C  CB    . ALA B 2 353 ? 2.553   35.740 -32.494 1.00 166.46 ? 870  ALA C CB    1 
ATOM   4278  N  N     . GLY B 2 354 ? 1.351   32.879 -31.881 1.00 166.58 ? 871  GLY C N     1 
ATOM   4279  C  CA    . GLY B 2 354 ? 1.375   31.621 -31.137 1.00 167.43 ? 871  GLY C CA    1 
ATOM   4280  C  C     . GLY B 2 354 ? 0.804   30.436 -31.901 1.00 167.88 ? 871  GLY C C     1 
ATOM   4281  O  O     . GLY B 2 354 ? 1.234   29.300 -31.693 1.00 169.07 ? 871  GLY C O     1 
ATOM   4282  N  N     . ILE B 2 355 ? -0.165  30.694 -32.779 1.00 167.13 ? 872  ILE C N     1 
ATOM   4283  C  CA    . ILE B 2 355 ? -0.813  29.633 -33.562 1.00 167.72 ? 872  ILE C CA    1 
ATOM   4284  C  C     . ILE B 2 355 ? 0.170   28.977 -34.537 1.00 169.25 ? 872  ILE C C     1 
ATOM   4285  O  O     . ILE B 2 355 ? 0.095   27.773 -34.776 1.00 170.40 ? 872  ILE C O     1 
ATOM   4286  C  CB    . ILE B 2 355 ? -2.055  30.159 -34.324 1.00 166.74 ? 872  ILE C CB    1 
ATOM   4287  C  CG1   . ILE B 2 355 ? -3.145  30.592 -33.336 1.00 165.95 ? 872  ILE C CG1   1 
ATOM   4288  C  CG2   . ILE B 2 355 ? -2.617  29.091 -35.259 1.00 167.20 ? 872  ILE C CG2   1 
ATOM   4289  C  CD1   . ILE B 2 355 ? -4.174  31.535 -33.924 1.00 165.22 ? 872  ILE C CD1   1 
ATOM   4290  N  N     . LEU B 2 356 ? 1.085   29.767 -35.093 1.00 169.82 ? 873  LEU C N     1 
ATOM   4291  C  CA    . LEU B 2 356 ? 2.128   29.235 -35.977 1.00 171.45 ? 873  LEU C CA    1 
ATOM   4292  C  C     . LEU B 2 356 ? 3.155   28.393 -35.214 1.00 173.05 ? 873  LEU C C     1 
ATOM   4293  O  O     . LEU B 2 356 ? 3.573   27.337 -35.692 1.00 174.90 ? 873  LEU C O     1 
ATOM   4294  C  CB    . LEU B 2 356 ? 2.838   30.369 -36.733 1.00 171.64 ? 873  LEU C CB    1 
ATOM   4295  C  CG    . LEU B 2 356 ? 2.278   30.774 -38.104 1.00 171.43 ? 873  LEU C CG    1 
ATOM   4296  C  CD1   . LEU B 2 356 ? 2.599   29.718 -39.151 1.00 172.66 ? 873  LEU C CD1   1 
ATOM   4297  C  CD2   . LEU B 2 356 ? 0.780   31.044 -38.067 1.00 170.31 ? 873  LEU C CD2   1 
ATOM   4298  N  N     . SER B 2 357 ? 3.550   28.860 -34.031 1.00 172.99 ? 874  SER C N     1 
ATOM   4299  C  CA    . SER B 2 357 ? 4.606   28.208 -33.250 1.00 174.47 ? 874  SER C CA    1 
ATOM   4300  C  C     . SER B 2 357 ? 4.154   26.928 -32.542 1.00 175.17 ? 874  SER C C     1 
ATOM   4301  O  O     . SER B 2 357 ? 4.933   25.980 -32.427 1.00 176.69 ? 874  SER C O     1 
ATOM   4302  C  CB    . SER B 2 357 ? 5.191   29.186 -32.225 1.00 174.27 ? 874  SER C CB    1 
ATOM   4303  O  OG    . SER B 2 357 ? 4.209   29.603 -31.293 1.00 172.80 ? 874  SER C OG    1 
ATOM   4304  N  N     . GLN B 2 358 ? 2.906   26.901 -32.073 1.00 173.97 ? 875  GLN C N     1 
ATOM   4305  C  CA    . GLN B 2 358 ? 2.386   25.761 -31.308 1.00 174.50 ? 875  GLN C CA    1 
ATOM   4306  C  C     . GLN B 2 358 ? 1.216   25.028 -31.979 1.00 174.13 ? 875  GLN C C     1 
ATOM   4307  O  O     . GLN B 2 358 ? 0.707   24.049 -31.429 1.00 174.94 ? 875  GLN C O     1 
ATOM   4308  C  CB    . GLN B 2 358 ? 1.952   26.226 -29.914 1.00 173.80 ? 875  GLN C CB    1 
ATOM   4309  C  CG    . GLN B 2 358 ? 3.063   26.863 -29.092 1.00 174.23 ? 875  GLN C CG    1 
ATOM   4310  C  CD    . GLN B 2 358 ? 2.634   27.185 -27.669 1.00 173.78 ? 875  GLN C CD    1 
ATOM   4311  O  OE1   . GLN B 2 358 ? 1.880   26.433 -27.050 1.00 174.14 ? 875  GLN C OE1   1 
ATOM   4312  N  NE2   . GLN B 2 358 ? 3.121   28.304 -27.139 1.00 173.15 ? 875  GLN C NE2   1 
ATOM   4313  N  N     . GLY B 2 359 ? 0.794   25.486 -33.157 1.00 173.11 ? 876  GLY C N     1 
ATOM   4314  C  CA    . GLY B 2 359 ? -0.386  24.928 -33.823 1.00 172.56 ? 876  GLY C CA    1 
ATOM   4315  C  C     . GLY B 2 359 ? -1.662  25.402 -33.150 1.00 171.34 ? 876  GLY C C     1 
ATOM   4316  O  O     . GLY B 2 359 ? -1.621  26.253 -32.259 1.00 170.70 ? 876  GLY C O     1 
ATOM   4317  N  N     . LEU B 2 360 ? -2.801  24.859 -33.576 1.00 171.14 ? 877  LEU C N     1 
ATOM   4318  C  CA    . LEU B 2 360 ? -4.080  25.182 -32.941 1.00 170.34 ? 877  LEU C CA    1 
ATOM   4319  C  C     . LEU B 2 360 ? -4.243  24.369 -31.661 1.00 171.45 ? 877  LEU C C     1 
ATOM   4320  O  O     . LEU B 2 360 ? -4.100  23.144 -31.672 1.00 172.62 ? 877  LEU C O     1 
ATOM   4321  C  CB    . LEU B 2 360 ? -5.256  24.936 -33.893 1.00 170.00 ? 877  LEU C CB    1 
ATOM   4322  C  CG    . LEU B 2 360 ? -5.456  25.974 -35.003 1.00 168.83 ? 877  LEU C CG    1 
ATOM   4323  C  CD1   . LEU B 2 360 ? -6.603  25.565 -35.914 1.00 169.04 ? 877  LEU C CD1   1 
ATOM   4324  C  CD2   . LEU B 2 360 ? -5.713  27.364 -34.436 1.00 167.65 ? 877  LEU C CD2   1 
ATOM   4325  N  N     . ARG B 2 361 ? -4.546  25.064 -30.566 1.00 171.10 ? 878  ARG C N     1 
ATOM   4326  C  CA    . ARG B 2 361 ? -4.590  24.464 -29.236 1.00 172.24 ? 878  ARG C CA    1 
ATOM   4327  C  C     . ARG B 2 361 ? -5.998  24.514 -28.655 1.00 171.34 ? 878  ARG C C     1 
ATOM   4328  O  O     . ARG B 2 361 ? -6.774  25.422 -28.956 1.00 169.74 ? 878  ARG C O     1 
ATOM   4329  C  CB    . ARG B 2 361 ? -3.632  25.202 -28.298 1.00 172.73 ? 878  ARG C CB    1 
ATOM   4330  C  CG    . ARG B 2 361 ? -2.202  25.290 -28.811 1.00 173.86 ? 878  ARG C CG    1 
ATOM   4331  C  CD    . ARG B 2 361 ? -1.354  26.253 -27.991 1.00 174.10 ? 878  ARG C CD    1 
ATOM   4332  N  NE    . ARG B 2 361 ? -1.930  27.598 -27.910 1.00 172.96 ? 878  ARG C NE    1 
ATOM   4333  C  CZ    . ARG B 2 361 ? -1.937  28.494 -28.898 1.00 172.57 ? 878  ARG C CZ    1 
ATOM   4334  N  NH1   . ARG B 2 361 ? -1.407  28.215 -30.086 1.00 173.17 ? 878  ARG C NH1   1 
ATOM   4335  N  NH2   . ARG B 2 361 ? -2.491  29.686 -28.699 1.00 171.30 ? 878  ARG C NH2   1 
ATOM   4336  N  N     . ILE B 2 362 ? -6.317  23.528 -27.821 1.00 172.35 ? 879  ILE C N     1 
ATOM   4337  C  CA    . ILE B 2 362 ? -7.598  23.481 -27.123 1.00 171.98 ? 879  ILE C CA    1 
ATOM   4338  C  C     . ILE B 2 362 ? -7.472  24.329 -25.860 1.00 170.62 ? 879  ILE C C     1 
ATOM   4339  O  O     . ILE B 2 362 ? -6.373  24.493 -25.327 1.00 170.69 ? 879  ILE C O     1 
ATOM   4340  C  CB    . ILE B 2 362 ? -7.991  22.032 -26.749 1.00 174.11 ? 879  ILE C CB    1 
ATOM   4341  C  CG1   . ILE B 2 362 ? -7.997  21.136 -27.996 1.00 175.17 ? 879  ILE C CG1   1 
ATOM   4342  C  CG2   . ILE B 2 362 ? -9.356  22.002 -26.067 1.00 174.36 ? 879  ILE C CG2   1 
ATOM   4343  C  CD1   . ILE B 2 362 ? -8.154  19.660 -27.697 1.00 177.54 ? 879  ILE C CD1   1 
ATOM   4344  N  N     . ALA B 2 363 ? -8.592  24.871 -25.389 1.00 169.34 ? 880  ALA C N     1 
ATOM   4345  C  CA    . ALA B 2 363 ? -8.608  25.653 -24.152 1.00 168.37 ? 880  ALA C CA    1 
ATOM   4346  C  C     . ALA B 2 363 ? -8.133  24.814 -22.966 1.00 169.26 ? 880  ALA C C     1 
ATOM   4347  O  O     . ALA B 2 363 ? -8.350  23.600 -22.942 1.00 170.66 ? 880  ALA C O     1 
ATOM   4348  C  CB    . ALA B 2 363 ? -10.004 26.186 -23.882 1.00 167.99 ? 880  ALA C CB    1 
ATOM   4349  N  N     . PRO B 2 364 ? -7.485  25.459 -21.976 1.00 168.40 ? 881  PRO C N     1 
ATOM   4350  C  CA    . PRO B 2 364 ? -7.013  24.727 -20.799 1.00 169.64 ? 881  PRO C CA    1 
ATOM   4351  C  C     . PRO B 2 364 ? -8.164  24.194 -19.939 1.00 170.20 ? 881  PRO C C     1 
ATOM   4352  O  O     . PRO B 2 364 ? -9.288  24.692 -20.042 1.00 169.24 ? 881  PRO C O     1 
ATOM   4353  C  CB    . PRO B 2 364 ? -6.192  25.772 -20.031 1.00 168.88 ? 881  PRO C CB    1 
ATOM   4354  C  CG    . PRO B 2 364 ? -6.703  27.090 -20.494 1.00 166.97 ? 881  PRO C CG    1 
ATOM   4355  C  CD    . PRO B 2 364 ? -7.146  26.893 -21.912 1.00 166.72 ? 881  PRO C CD    1 
ATOM   4356  N  N     . PRO B 2 365 ? -7.887  23.187 -19.092 1.00 171.58 ? 882  PRO C N     1 
ATOM   4357  C  CA    . PRO B 2 365 ? -8.931  22.564 -18.275 1.00 172.46 ? 882  PRO C CA    1 
ATOM   4358  C  C     . PRO B 2 365 ? -9.468  23.468 -17.160 1.00 171.21 ? 882  PRO C C     1 
ATOM   4359  O  O     . PRO B 2 365 ? -10.584 23.256 -16.684 1.00 171.68 ? 882  PRO C O     1 
ATOM   4360  C  CB    . PRO B 2 365 ? -8.227  21.338 -17.685 1.00 174.88 ? 882  PRO C CB    1 
ATOM   4361  C  CG    . PRO B 2 365 ? -6.789  21.719 -17.635 1.00 174.59 ? 882  PRO C CG    1 
ATOM   4362  C  CD    . PRO B 2 365 ? -6.553  22.623 -18.811 1.00 172.67 ? 882  PRO C CD    1 
ATOM   4363  N  N     . GLU B 2 366 ? -8.681  24.465 -16.758 1.00 169.56 ? 883  GLU C N     1 
ATOM   4364  C  CA    . GLU B 2 366 ? -9.089  25.416 -15.723 1.00 168.39 ? 883  GLU C CA    1 
ATOM   4365  C  C     . GLU B 2 366 ? -10.079 26.450 -16.260 1.00 166.73 ? 883  GLU C C     1 
ATOM   4366  O  O     . GLU B 2 366 ? -10.921 26.955 -15.514 1.00 166.23 ? 883  GLU C O     1 
ATOM   4367  C  CB    . GLU B 2 366 ? -7.872  26.143 -15.137 1.00 167.63 ? 883  GLU C CB    1 
ATOM   4368  C  CG    . GLU B 2 366 ? -6.864  25.242 -14.430 1.00 169.29 ? 883  GLU C CG    1 
ATOM   4369  C  CD    . GLU B 2 366 ? -5.831  24.621 -15.358 1.00 169.72 ? 883  GLU C CD    1 
ATOM   4370  O  OE1   . GLU B 2 366 ? -5.214  23.611 -14.959 1.00 171.65 ? 883  GLU C OE1   1 
ATOM   4371  O  OE2   . GLU B 2 366 ? -5.630  25.132 -16.482 1.00 168.15 ? 883  GLU C OE2   1 
ATOM   4372  N  N     . ALA B 2 367 ? -9.969  26.762 -17.552 1.00 166.11 ? 884  ALA C N     1 
ATOM   4373  C  CA    . ALA B 2 367 ? -10.789 27.799 -18.186 1.00 164.88 ? 884  ALA C CA    1 
ATOM   4374  C  C     . ALA B 2 367 ? -12.282 27.462 -18.171 1.00 165.52 ? 884  ALA C C     1 
ATOM   4375  O  O     . ALA B 2 367 ? -12.654 26.290 -18.083 1.00 167.27 ? 884  ALA C O     1 
ATOM   4376  C  CB    . ALA B 2 367 ? -10.320 28.033 -19.619 1.00 164.16 ? 884  ALA C CB    1 
ATOM   4377  N  N     . PRO B 2 368 ? -13.143 28.493 -18.259 1.00 164.39 ? 885  PRO C N     1 
ATOM   4378  C  CA    . PRO B 2 368 ? -14.585 28.260 -18.281 1.00 165.16 ? 885  PRO C CA    1 
ATOM   4379  C  C     . PRO B 2 368 ? -15.066 27.731 -19.630 1.00 165.88 ? 885  PRO C C     1 
ATOM   4380  O  O     . PRO B 2 368 ? -14.429 27.979 -20.657 1.00 165.04 ? 885  PRO C O     1 
ATOM   4381  C  CB    . PRO B 2 368 ? -15.166 29.650 -18.012 1.00 163.72 ? 885  PRO C CB    1 
ATOM   4382  C  CG    . PRO B 2 368 ? -14.150 30.588 -18.559 1.00 162.10 ? 885  PRO C CG    1 
ATOM   4383  C  CD    . PRO B 2 368 ? -12.818 29.931 -18.332 1.00 162.59 ? 885  PRO C CD    1 
ATOM   4384  N  N     . VAL B 2 369 ? -16.187 27.015 -19.616 1.00 167.69 ? 886  VAL C N     1 
ATOM   4385  C  CA    . VAL B 2 369 ? -16.777 26.456 -20.835 1.00 168.81 ? 886  VAL C CA    1 
ATOM   4386  C  C     . VAL B 2 369 ? -17.734 27.449 -21.514 1.00 168.20 ? 886  VAL C C     1 
ATOM   4387  O  O     . VAL B 2 369 ? -18.312 27.144 -22.557 1.00 168.91 ? 886  VAL C O     1 
ATOM   4388  C  CB    . VAL B 2 369 ? -17.506 25.120 -20.532 1.00 171.14 ? 886  VAL C CB    1 
ATOM   4389  C  CG1   . VAL B 2 369 ? -18.870 25.362 -19.893 1.00 171.84 ? 886  VAL C CG1   1 
ATOM   4390  C  CG2   . VAL B 2 369 ? -17.637 24.268 -21.790 1.00 172.10 ? 886  VAL C CG2   1 
ATOM   4391  N  N     . THR B 2 370 ? -17.892 28.634 -20.925 1.00 167.34 ? 887  THR C N     1 
ATOM   4392  C  CA    . THR B 2 370 ? -18.786 29.658 -21.463 1.00 167.17 ? 887  THR C CA    1 
ATOM   4393  C  C     . THR B 2 370 ? -18.265 30.210 -22.788 1.00 166.40 ? 887  THR C C     1 
ATOM   4394  O  O     . THR B 2 370 ? -17.060 30.417 -22.949 1.00 165.26 ? 887  THR C O     1 
ATOM   4395  C  CB    . THR B 2 370 ? -18.948 30.837 -20.485 1.00 166.26 ? 887  THR C CB    1 
ATOM   4396  O  OG1   . THR B 2 370 ? -18.817 30.372 -19.137 1.00 166.84 ? 887  THR C OG1   1 
ATOM   4397  C  CG2   . THR B 2 370 ? -20.302 31.507 -20.668 1.00 166.62 ? 887  THR C CG2   1 
ATOM   4398  N  N     . GLY B 2 371 ? -19.179 30.449 -23.725 1.00 167.26 ? 888  GLY C N     1 
ATOM   4399  C  CA    . GLY B 2 371 ? -18.823 30.907 -25.068 1.00 167.09 ? 888  GLY C CA    1 
ATOM   4400  C  C     . GLY B 2 371 ? -18.796 29.767 -26.067 1.00 168.94 ? 888  GLY C C     1 
ATOM   4401  O  O     . GLY B 2 371 ? -19.247 29.921 -27.204 1.00 169.09 ? 888  GLY C O     1 
ATOM   4402  N  N     . TYR B 2 372 ? -18.258 28.625 -25.642 1.00 170.76 ? 889  TYR C N     1 
ATOM   4403  C  CA    . TYR B 2 372 ? -18.233 27.422 -26.468 1.00 172.61 ? 889  TYR C CA    1 
ATOM   4404  C  C     . TYR B 2 372 ? -19.636 26.847 -26.615 1.00 173.99 ? 889  TYR C C     1 
ATOM   4405  O  O     . TYR B 2 372 ? -20.435 26.896 -25.679 1.00 174.74 ? 889  TYR C O     1 
ATOM   4406  C  CB    . TYR B 2 372 ? -17.314 26.364 -25.854 1.00 174.18 ? 889  TYR C CB    1 
ATOM   4407  C  CG    . TYR B 2 372 ? -15.871 26.794 -25.761 1.00 174.06 ? 889  TYR C CG    1 
ATOM   4408  C  CD1   . TYR B 2 372 ? -15.311 27.179 -24.545 1.00 174.21 ? 889  TYR C CD1   1 
ATOM   4409  C  CD2   . TYR B 2 372 ? -15.067 26.826 -26.891 1.00 174.62 ? 889  TYR C CD2   1 
ATOM   4410  C  CE1   . TYR B 2 372 ? -13.988 27.577 -24.460 1.00 174.08 ? 889  TYR C CE1   1 
ATOM   4411  C  CE2   . TYR B 2 372 ? -13.744 27.218 -26.817 1.00 174.62 ? 889  TYR C CE2   1 
ATOM   4412  C  CZ    . TYR B 2 372 ? -13.210 27.595 -25.601 1.00 174.27 ? 889  TYR C CZ    1 
ATOM   4413  O  OH    . TYR B 2 372 ? -11.899 27.995 -25.529 1.00 174.34 ? 889  TYR C OH    1 
ATOM   4414  N  N     . MET B 2 373 ? -19.926 26.304 -27.793 1.00 174.44 ? 890  MET C N     1 
ATOM   4415  C  CA    . MET B 2 373 ? -21.227 25.699 -28.064 1.00 175.89 ? 890  MET C CA    1 
ATOM   4416  C  C     . MET B 2 373 ? -21.228 24.236 -27.628 1.00 176.62 ? 890  MET C C     1 
ATOM   4417  O  O     . MET B 2 373 ? -22.188 23.769 -27.012 1.00 178.01 ? 890  MET C O     1 
ATOM   4418  C  CB    . MET B 2 373 ? -21.568 25.803 -29.555 1.00 176.63 ? 890  MET C CB    1 
ATOM   4419  C  CG    . MET B 2 373 ? -23.059 25.902 -29.851 1.00 178.65 ? 890  MET C CG    1 
ATOM   4420  S  SD    . MET B 2 373 ? -23.629 27.589 -30.154 1.00 178.27 ? 890  MET C SD    1 
ATOM   4421  C  CE    . MET B 2 373 ? -23.053 28.444 -28.688 1.00 176.54 ? 890  MET C CE    1 
ATOM   4422  N  N     . PHE B 2 374 ? -20.147 23.523 -27.948 1.00 175.32 ? 891  PHE C N     1 
ATOM   4423  C  CA    . PHE B 2 374 ? -20.037 22.092 -27.655 1.00 176.30 ? 891  PHE C CA    1 
ATOM   4424  C  C     . PHE B 2 374 ? -18.751 21.752 -26.896 1.00 174.83 ? 891  PHE C C     1 
ATOM   4425  O  O     . PHE B 2 374 ? -18.084 20.762 -27.201 1.00 175.88 ? 891  PHE C O     1 
ATOM   4426  C  CB    . PHE B 2 374 ? -20.109 21.285 -28.957 1.00 177.45 ? 891  PHE C CB    1 
ATOM   4427  C  CG    . PHE B 2 374 ? -21.182 21.751 -29.902 1.00 177.88 ? 891  PHE C CG    1 
ATOM   4428  C  CD1   . PHE B 2 374 ? -22.523 21.567 -29.598 1.00 179.68 ? 891  PHE C CD1   1 
ATOM   4429  C  CD2   . PHE B 2 374 ? -20.850 22.376 -31.097 1.00 176.66 ? 891  PHE C CD2   1 
ATOM   4430  C  CE1   . PHE B 2 374 ? -23.512 21.997 -30.468 1.00 180.23 ? 891  PHE C CE1   1 
ATOM   4431  C  CE2   . PHE B 2 374 ? -21.834 22.807 -31.971 1.00 177.11 ? 891  PHE C CE2   1 
ATOM   4432  C  CZ    . PHE B 2 374 ? -23.167 22.618 -31.656 1.00 178.93 ? 891  PHE C CZ    1 
ATOM   4433  N  N     . GLY B 2 375 ? -18.409 22.574 -25.906 1.00 172.48 ? 892  GLY C N     1 
ATOM   4434  C  CA    . GLY B 2 375 ? -17.247 22.321 -25.054 1.00 171.42 ? 892  GLY C CA    1 
ATOM   4435  C  C     . GLY B 2 375 ? -15.927 22.754 -25.666 1.00 169.21 ? 892  GLY C C     1 
ATOM   4436  O  O     . GLY B 2 375 ? -15.885 23.262 -26.787 1.00 167.72 ? 892  GLY C O     1 
ATOM   4437  N  N     . LYS B 2 376 ? -14.844 22.539 -24.921 1.00 168.77 ? 893  LYS C N     1 
ATOM   4438  C  CA    . LYS B 2 376 ? -13.513 22.998 -25.321 1.00 167.16 ? 893  LYS C CA    1 
ATOM   4439  C  C     . LYS B 2 376 ? -12.932 22.126 -26.431 1.00 167.43 ? 893  LYS C C     1 
ATOM   4440  O  O     . LYS B 2 376 ? -12.924 20.901 -26.330 1.00 168.98 ? 893  LYS C O     1 
ATOM   4441  C  CB    . LYS B 2 376 ? -12.563 23.005 -24.118 1.00 167.23 ? 893  LYS C CB    1 
ATOM   4442  C  CG    . LYS B 2 376 ? -13.004 23.916 -22.980 1.00 166.44 ? 893  LYS C CG    1 
ATOM   4443  C  CD    . LYS B 2 376 ? -12.138 23.731 -21.743 1.00 166.89 ? 893  LYS C CD    1 
ATOM   4444  C  CE    . LYS B 2 376 ? -12.852 24.207 -20.488 1.00 166.88 ? 893  LYS C CE    1 
ATOM   4445  N  NZ    . LYS B 2 376 ? -12.069 23.913 -19.257 1.00 167.55 ? 893  LYS C NZ    1 
ATOM   4446  N  N     . GLY B 2 377 ? -12.443 22.774 -27.485 1.00 165.99 ? 894  GLY C N     1 
ATOM   4447  C  CA    . GLY B 2 377 ? -11.869 22.084 -28.640 1.00 166.44 ? 894  GLY C CA    1 
ATOM   4448  C  C     . GLY B 2 377 ? -11.574 23.074 -29.753 1.00 165.04 ? 894  GLY C C     1 
ATOM   4449  O  O     . GLY B 2 377 ? -11.818 24.271 -29.596 1.00 164.17 ? 894  GLY C O     1 
ATOM   4450  N  N     . ILE B 2 378 ? -11.052 22.586 -30.876 1.00 165.21 ? 895  ILE C N     1 
ATOM   4451  C  CA    . ILE B 2 378 ? -10.776 23.455 -32.023 1.00 164.03 ? 895  ILE C CA    1 
ATOM   4452  C  C     . ILE B 2 378 ? -12.043 23.547 -32.866 1.00 164.35 ? 895  ILE C C     1 
ATOM   4453  O  O     . ILE B 2 378 ? -12.575 22.526 -33.300 1.00 165.69 ? 895  ILE C O     1 
ATOM   4454  C  CB    . ILE B 2 378 ? -9.624  22.942 -32.921 1.00 164.24 ? 895  ILE C CB    1 
ATOM   4455  C  CG1   . ILE B 2 378 ? -8.464  22.358 -32.101 1.00 164.86 ? 895  ILE C CG1   1 
ATOM   4456  C  CG2   . ILE B 2 378 ? -9.122  24.062 -33.823 1.00 162.90 ? 895  ILE C CG2   1 
ATOM   4457  C  CD1   . ILE B 2 378 ? -7.884  23.290 -31.060 1.00 163.99 ? 895  ILE C CD1   1 
ATOM   4458  N  N     . TYR B 2 379 ? -12.520 24.768 -33.095 1.00 163.53 ? 896  TYR C N     1 
ATOM   4459  C  CA    . TYR B 2 379 ? -13.736 24.995 -33.876 1.00 164.11 ? 896  TYR C CA    1 
ATOM   4460  C  C     . TYR B 2 379 ? -13.409 25.422 -35.305 1.00 164.41 ? 896  TYR C C     1 
ATOM   4461  O  O     . TYR B 2 379 ? -12.452 26.162 -35.539 1.00 163.58 ? 896  TYR C O     1 
ATOM   4462  C  CB    . TYR B 2 379 ? -14.621 26.044 -33.198 1.00 163.26 ? 896  TYR C CB    1 
ATOM   4463  C  CG    . TYR B 2 379 ? -15.375 25.505 -32.004 1.00 163.83 ? 896  TYR C CG    1 
ATOM   4464  C  CD1   . TYR B 2 379 ? -14.728 25.281 -30.792 1.00 163.51 ? 896  TYR C CD1   1 
ATOM   4465  C  CD2   . TYR B 2 379 ? -16.733 25.209 -32.087 1.00 164.85 ? 896  TYR C CD2   1 
ATOM   4466  C  CE1   . TYR B 2 379 ? -15.411 24.780 -29.697 1.00 164.33 ? 896  TYR C CE1   1 
ATOM   4467  C  CE2   . TYR B 2 379 ? -17.425 24.711 -30.997 1.00 165.79 ? 896  TYR C CE2   1 
ATOM   4468  C  CZ    . TYR B 2 379 ? -16.761 24.498 -29.805 1.00 165.45 ? 896  TYR C CZ    1 
ATOM   4469  O  OH    . TYR B 2 379 ? -17.449 24.003 -28.722 1.00 166.45 ? 896  TYR C OH    1 
ATOM   4470  N  N     . PHE B 2 380 ? -14.213 24.941 -36.251 1.00 166.13 ? 897  PHE C N     1 
ATOM   4471  C  CA    . PHE B 2 380 ? -14.052 25.255 -37.670 1.00 166.39 ? 897  PHE C CA    1 
ATOM   4472  C  C     . PHE B 2 380 ? -15.407 25.547 -38.303 1.00 167.97 ? 897  PHE C C     1 
ATOM   4473  O  O     . PHE B 2 380 ? -16.445 25.148 -37.775 1.00 168.86 ? 897  PHE C O     1 
ATOM   4474  C  CB    . PHE B 2 380 ? -13.397 24.082 -38.403 1.00 166.90 ? 897  PHE C CB    1 
ATOM   4475  C  CG    . PHE B 2 380 ? -11.950 23.884 -38.062 1.00 166.07 ? 897  PHE C CG    1 
ATOM   4476  C  CD1   . PHE B 2 380 ? -11.578 23.069 -37.004 1.00 166.44 ? 897  PHE C CD1   1 
ATOM   4477  C  CD2   . PHE B 2 380 ? -10.959 24.507 -38.806 1.00 165.27 ? 897  PHE C CD2   1 
ATOM   4478  C  CE1   . PHE B 2 380 ? -10.244 22.883 -36.690 1.00 166.14 ? 897  PHE C CE1   1 
ATOM   4479  C  CE2   . PHE B 2 380 ? -9.623  24.328 -38.496 1.00 164.94 ? 897  PHE C CE2   1 
ATOM   4480  C  CZ    . PHE B 2 380 ? -9.266  23.514 -37.437 1.00 165.39 ? 897  PHE C CZ    1 
ATOM   4481  N  N     . ALA B 2 381 ? -15.386 26.251 -39.432 1.00 168.92 ? 898  ALA C N     1 
ATOM   4482  C  CA    . ALA B 2 381 ? -16.601 26.528 -40.198 1.00 170.99 ? 898  ALA C CA    1 
ATOM   4483  C  C     . ALA B 2 381 ? -16.349 26.364 -41.691 1.00 172.59 ? 898  ALA C C     1 
ATOM   4484  O  O     . ALA B 2 381 ? -15.225 26.536 -42.166 1.00 171.58 ? 898  ALA C O     1 
ATOM   4485  C  CB    . ALA B 2 381 ? -17.109 27.928 -39.902 1.00 170.52 ? 898  ALA C CB    1 
ATOM   4486  N  N     . ASP B 2 382 ? -17.411 26.034 -42.419 1.00 175.57 ? 899  ASP C N     1 
ATOM   4487  C  CA    . ASP B 2 382 ? -17.344 25.875 -43.874 1.00 177.67 ? 899  ASP C CA    1 
ATOM   4488  C  C     . ASP B 2 382 ? -17.471 27.206 -44.617 1.00 178.19 ? 899  ASP C C     1 
ATOM   4489  O  O     . ASP B 2 382 ? -17.198 27.272 -45.817 1.00 178.95 ? 899  ASP C O     1 
ATOM   4490  C  CB    . ASP B 2 382 ? -18.412 24.887 -44.372 1.00 180.05 ? 899  ASP C CB    1 
ATOM   4491  C  CG    . ASP B 2 382 ? -19.793 25.148 -43.781 1.00 181.27 ? 899  ASP C CG    1 
ATOM   4492  O  OD1   . ASP B 2 382 ? -20.021 26.239 -43.214 1.00 180.50 ? 899  ASP C OD1   1 
ATOM   4493  O  OD2   . ASP B 2 382 ? -20.652 24.248 -43.879 1.00 183.68 ? 899  ASP C OD2   1 
ATOM   4494  N  N     . MET B 2 383 ? -17.880 28.258 -43.907 1.00 178.47 ? 900  MET C N     1 
ATOM   4495  C  CA    . MET B 2 383 ? -18.046 29.582 -44.503 1.00 178.71 ? 900  MET C CA    1 
ATOM   4496  C  C     . MET B 2 383 ? -16.936 30.520 -44.038 1.00 177.11 ? 900  MET C C     1 
ATOM   4497  O  O     . MET B 2 383 ? -16.618 30.571 -42.848 1.00 176.46 ? 900  MET C O     1 
ATOM   4498  C  CB    . MET B 2 383 ? -19.416 30.164 -44.141 1.00 179.90 ? 900  MET C CB    1 
ATOM   4499  C  CG    . MET B 2 383 ? -20.564 29.170 -44.253 1.00 182.05 ? 900  MET C CG    1 
ATOM   4500  S  SD    . MET B 2 383 ? -22.068 29.890 -44.936 1.00 184.60 ? 900  MET C SD    1 
ATOM   4501  C  CE    . MET B 2 383 ? -21.649 29.924 -46.676 1.00 185.29 ? 900  MET C CE    1 
ATOM   4502  N  N     . VAL B 2 384 ? -16.350 31.256 -44.981 1.00 176.81 ? 901  VAL C N     1 
ATOM   4503  C  CA    . VAL B 2 384 ? -15.246 32.173 -44.680 1.00 175.52 ? 901  VAL C CA    1 
ATOM   4504  C  C     . VAL B 2 384 ? -15.688 33.325 -43.778 1.00 175.10 ? 901  VAL C C     1 
ATOM   4505  O  O     . VAL B 2 384 ? -14.918 33.784 -42.935 1.00 173.86 ? 901  VAL C O     1 
ATOM   4506  C  CB    . VAL B 2 384 ? -14.601 32.743 -45.971 1.00 175.72 ? 901  VAL C CB    1 
ATOM   4507  C  CG1   . VAL B 2 384 ? -15.509 33.765 -46.644 1.00 176.79 ? 901  VAL C CG1   1 
ATOM   4508  C  CG2   . VAL B 2 384 ? -13.241 33.358 -45.668 1.00 174.45 ? 901  VAL C CG2   1 
ATOM   4509  N  N     . SER B 2 385 ? -16.927 33.778 -43.957 1.00 176.42 ? 902  SER C N     1 
ATOM   4510  C  CA    . SER B 2 385 ? -17.454 34.924 -43.220 1.00 176.61 ? 902  SER C CA    1 
ATOM   4511  C  C     . SER B 2 385 ? -17.597 34.638 -41.728 1.00 175.95 ? 902  SER C C     1 
ATOM   4512  O  O     . SER B 2 385 ? -17.148 35.430 -40.899 1.00 175.16 ? 902  SER C O     1 
ATOM   4513  C  CB    . SER B 2 385 ? -18.808 35.342 -43.791 1.00 178.28 ? 902  SER C CB    1 
ATOM   4514  O  OG    . SER B 2 385 ? -19.306 36.490 -43.129 1.00 178.28 ? 902  SER C OG    1 
ATOM   4515  N  N     . LYS B 2 386 ? -18.223 33.511 -41.396 1.00 176.52 ? 903  LYS C N     1 
ATOM   4516  C  CA    . LYS B 2 386 ? -18.419 33.108 -40.001 1.00 175.86 ? 903  LYS C CA    1 
ATOM   4517  C  C     . LYS B 2 386 ? -17.089 33.038 -39.251 1.00 173.91 ? 903  LYS C C     1 
ATOM   4518  O  O     . LYS B 2 386 ? -16.986 33.497 -38.112 1.00 172.75 ? 903  LYS C O     1 
ATOM   4519  C  CB    . LYS B 2 386 ? -19.134 31.755 -39.928 1.00 177.38 ? 903  LYS C CB    1 
ATOM   4520  C  CG    . LYS B 2 386 ? -19.452 31.293 -38.513 1.00 177.49 ? 903  LYS C CG    1 
ATOM   4521  C  CD    . LYS B 2 386 ? -20.470 30.165 -38.513 1.00 179.38 ? 903  LYS C CD    1 
ATOM   4522  C  CE    . LYS B 2 386 ? -20.681 29.608 -37.115 1.00 179.56 ? 903  LYS C CE    1 
ATOM   4523  N  NZ    . LYS B 2 386 ? -21.743 28.566 -37.078 1.00 181.55 ? 903  LYS C NZ    1 
ATOM   4524  N  N     . SER B 2 387 ? -16.082 32.461 -39.901 1.00 173.38 ? 904  SER C N     1 
ATOM   4525  C  CA    . SER B 2 387 ? -14.730 32.402 -39.348 1.00 171.99 ? 904  SER C CA    1 
ATOM   4526  C  C     . SER B 2 387 ? -14.067 33.783 -39.316 1.00 170.88 ? 904  SER C C     1 
ATOM   4527  O  O     . SER B 2 387 ? -13.350 34.106 -38.369 1.00 169.68 ? 904  SER C O     1 
ATOM   4528  C  CB    . SER B 2 387 ? -13.869 31.425 -40.155 1.00 172.20 ? 904  SER C CB    1 
ATOM   4529  O  OG    . SER B 2 387 ? -14.297 30.089 -39.971 1.00 172.83 ? 904  SER C OG    1 
ATOM   4530  N  N     . ALA B 2 388 ? -14.318 34.593 -40.345 1.00 171.28 ? 905  ALA C N     1 
ATOM   4531  C  CA    . ALA B 2 388 ? -13.702 35.923 -40.472 1.00 170.71 ? 905  ALA C CA    1 
ATOM   4532  C  C     . ALA B 2 388 ? -14.088 36.907 -39.361 1.00 170.09 ? 905  ALA C C     1 
ATOM   4533  O  O     . ALA B 2 388 ? -13.364 37.873 -39.117 1.00 169.21 ? 905  ALA C O     1 
ATOM   4534  C  CB    . ALA B 2 388 ? -14.020 36.528 -41.835 1.00 171.61 ? 905  ALA C CB    1 
ATOM   4535  N  N     . ASN B 2 389 ? -15.221 36.671 -38.699 1.00 170.77 ? 906  ASN C N     1 
ATOM   4536  C  CA    . ASN B 2 389 ? -15.642 37.506 -37.568 1.00 170.63 ? 906  ASN C CA    1 
ATOM   4537  C  C     . ASN B 2 389 ? -14.698 37.415 -36.366 1.00 170.03 ? 906  ASN C C     1 
ATOM   4538  O  O     . ASN B 2 389 ? -14.626 38.345 -35.560 1.00 169.46 ? 906  ASN C O     1 
ATOM   4539  C  CB    . ASN B 2 389 ? -17.066 37.151 -37.122 1.00 171.36 ? 906  ASN C CB    1 
ATOM   4540  C  CG    . ASN B 2 389 ? -18.124 37.632 -38.096 1.00 172.63 ? 906  ASN C CG    1 
ATOM   4541  O  OD1   . ASN B 2 389 ? -18.724 38.689 -37.904 1.00 173.07 ? 906  ASN C OD1   1 
ATOM   4542  N  ND2   . ASN B 2 389 ? -18.358 36.858 -39.149 1.00 173.42 ? 906  ASN C ND2   1 
ATOM   4543  N  N     . TYR B 2 390 ? -13.979 36.300 -36.252 1.00 170.86 ? 907  TYR C N     1 
ATOM   4544  C  CA    . TYR B 2 390 ? -13.050 36.078 -35.141 1.00 170.67 ? 907  TYR C CA    1 
ATOM   4545  C  C     . TYR B 2 390 ? -11.691 36.752 -35.350 1.00 170.72 ? 907  TYR C C     1 
ATOM   4546  O  O     . TYR B 2 390 ? -10.855 36.755 -34.444 1.00 170.03 ? 907  TYR C O     1 
ATOM   4547  C  CB    . TYR B 2 390 ? -12.872 34.577 -34.894 1.00 171.04 ? 907  TYR C CB    1 
ATOM   4548  C  CG    . TYR B 2 390 ? -14.135 33.914 -34.393 1.00 171.63 ? 907  TYR C CG    1 
ATOM   4549  C  CD1   . TYR B 2 390 ? -14.352 33.728 -33.030 1.00 171.55 ? 907  TYR C CD1   1 
ATOM   4550  C  CD2   . TYR B 2 390 ? -15.121 33.487 -35.279 1.00 172.31 ? 907  TYR C CD2   1 
ATOM   4551  C  CE1   . TYR B 2 390 ? -15.510 33.126 -32.565 1.00 172.20 ? 907  TYR C CE1   1 
ATOM   4552  C  CE2   . TYR B 2 390 ? -16.283 32.886 -34.823 1.00 173.08 ? 907  TYR C CE2   1 
ATOM   4553  C  CZ    . TYR B 2 390 ? -16.473 32.708 -33.466 1.00 173.10 ? 907  TYR C CZ    1 
ATOM   4554  O  OH    . TYR B 2 390 ? -17.627 32.113 -33.010 1.00 173.76 ? 907  TYR C OH    1 
ATOM   4555  N  N     . CYS B 2 391 ? -11.475 37.322 -36.535 1.00 171.92 ? 908  CYS C N     1 
ATOM   4556  C  CA    . CYS B 2 391 ? -10.295 38.145 -36.799 1.00 172.49 ? 908  CYS C CA    1 
ATOM   4557  C  C     . CYS B 2 391 ? -10.336 39.453 -36.005 1.00 173.18 ? 908  CYS C C     1 
ATOM   4558  O  O     . CYS B 2 391 ? -9.289  40.023 -35.690 1.00 173.29 ? 908  CYS C O     1 
ATOM   4559  C  CB    . CYS B 2 391 ? -10.185 38.459 -38.293 1.00 173.00 ? 908  CYS C CB    1 
ATOM   4560  S  SG    . CYS B 2 391 ? -10.262 37.011 -39.371 1.00 173.11 ? 908  CYS C SG    1 
ATOM   4561  N  N     . HIS B 2 392 ? -11.548 39.916 -35.689 1.00 174.39 ? 909  HIS C N     1 
ATOM   4562  C  CA    . HIS B 2 392 ? -11.768 41.172 -34.964 1.00 174.84 ? 909  HIS C CA    1 
ATOM   4563  C  C     . HIS B 2 392 ? -11.115 42.355 -35.678 1.00 175.23 ? 909  HIS C C     1 
ATOM   4564  O  O     . HIS B 2 392 ? -10.115 42.909 -35.214 1.00 175.05 ? 909  HIS C O     1 
ATOM   4565  C  CB    . HIS B 2 392 ? -11.300 41.067 -33.503 1.00 174.80 ? 909  HIS C CB    1 
ATOM   4566  C  CG    . HIS B 2 392 ? -12.306 40.437 -32.590 1.00 175.70 ? 909  HIS C CG    1 
ATOM   4567  N  ND1   . HIS B 2 392 ? -12.199 39.138 -32.144 1.00 176.32 ? 909  HIS C ND1   1 
ATOM   4568  C  CD2   . HIS B 2 392 ? -13.441 40.931 -32.041 1.00 176.32 ? 909  HIS C CD2   1 
ATOM   4569  C  CE1   . HIS B 2 392 ? -13.224 38.859 -31.358 1.00 176.60 ? 909  HIS C CE1   1 
ATOM   4570  N  NE2   . HIS B 2 392 ? -13.993 39.930 -31.280 1.00 176.67 ? 909  HIS C NE2   1 
ATOM   4571  N  N     . THR B 2 393 ? -11.691 42.719 -36.821 1.00 176.20 ? 910  THR C N     1 
ATOM   4572  C  CA    . THR B 2 393 ? -11.244 43.874 -37.597 1.00 176.95 ? 910  THR C CA    1 
ATOM   4573  C  C     . THR B 2 393 ? -12.260 45.006 -37.512 1.00 177.53 ? 910  THR C C     1 
ATOM   4574  O  O     . THR B 2 393 ? -13.436 44.782 -37.219 1.00 177.81 ? 910  THR C O     1 
ATOM   4575  C  CB    . THR B 2 393 ? -11.016 43.512 -39.078 1.00 177.94 ? 910  THR C CB    1 
ATOM   4576  O  OG1   . THR B 2 393 ? -11.996 42.554 -39.502 1.00 178.30 ? 910  THR C OG1   1 
ATOM   4577  C  CG2   . THR B 2 393 ? -9.627  42.931 -39.276 1.00 177.74 ? 910  THR C CG2   1 
ATOM   4578  N  N     . SER B 2 394 ? -11.786 46.221 -37.775 1.00 177.91 ? 911  SER C N     1 
ATOM   4579  C  CA    . SER B 2 394 ? -12.616 47.420 -37.725 1.00 178.35 ? 911  SER C CA    1 
ATOM   4580  C  C     . SER B 2 394 ? -12.327 48.304 -38.938 1.00 179.54 ? 911  SER C C     1 
ATOM   4581  O  O     . SER B 2 394 ? -11.549 47.928 -39.817 1.00 179.95 ? 911  SER C O     1 
ATOM   4582  C  CB    . SER B 2 394 ? -12.349 48.181 -36.423 1.00 177.39 ? 911  SER C CB    1 
ATOM   4583  O  OG    . SER B 2 394 ? -11.004 48.626 -36.357 1.00 177.20 ? 911  SER C OG    1 
ATOM   4584  N  N     . GLN B 2 395 ? -12.961 49.473 -38.984 1.00 180.03 ? 912  GLN C N     1 
ATOM   4585  C  CA    . GLN B 2 395 ? -12.743 50.430 -40.068 1.00 180.92 ? 912  GLN C CA    1 
ATOM   4586  C  C     . GLN B 2 395 ? -11.358 51.078 -39.970 1.00 179.79 ? 912  GLN C C     1 
ATOM   4587  O  O     . GLN B 2 395 ? -10.792 51.495 -40.982 1.00 180.85 ? 912  GLN C O     1 
ATOM   4588  C  CB    . GLN B 2 395 ? -13.836 51.507 -40.074 1.00 182.48 ? 912  GLN C CB    1 
ATOM   4589  C  CG    . GLN B 2 395 ? -15.214 51.008 -40.500 1.00 183.75 ? 912  GLN C CG    1 
ATOM   4590  C  CD    . GLN B 2 395 ? -16.006 50.356 -39.376 1.00 183.18 ? 912  GLN C CD    1 
ATOM   4591  O  OE1   . GLN B 2 395 ? -15.447 49.943 -38.360 1.00 182.13 ? 912  GLN C OE1   1 
ATOM   4592  N  NE2   . GLN B 2 395 ? -17.318 50.258 -39.559 1.00 184.48 ? 912  GLN C NE2   1 
ATOM   4593  N  N     . GLY B 2 396 ? -10.822 51.155 -38.753 1.00 177.54 ? 913  GLY C N     1 
ATOM   4594  C  CA    . GLY B 2 396 ? -9.474  51.674 -38.518 1.00 176.97 ? 913  GLY C CA    1 
ATOM   4595  C  C     . GLY B 2 396 ? -8.388  50.634 -38.738 1.00 176.18 ? 913  GLY C C     1 
ATOM   4596  O  O     . GLY B 2 396 ? -7.295  50.963 -39.201 1.00 176.50 ? 913  GLY C O     1 
ATOM   4597  N  N     . ASP B 2 397 ? -8.687  49.382 -38.389 1.00 175.11 ? 914  ASP C N     1 
ATOM   4598  C  CA    . ASP B 2 397 ? -7.769  48.259 -38.588 1.00 174.38 ? 914  ASP C CA    1 
ATOM   4599  C  C     . ASP B 2 397 ? -8.379  47.283 -39.601 1.00 174.28 ? 914  ASP C C     1 
ATOM   4600  O  O     . ASP B 2 397 ? -9.102  46.360 -39.219 1.00 173.47 ? 914  ASP C O     1 
ATOM   4601  C  CB    . ASP B 2 397 ? -7.501  47.558 -37.251 1.00 173.06 ? 914  ASP C CB    1 
ATOM   4602  C  CG    . ASP B 2 397 ? -6.468  46.448 -37.363 1.00 173.02 ? 914  ASP C CG    1 
ATOM   4603  O  OD1   . ASP B 2 397 ? -6.656  45.396 -36.716 1.00 172.46 ? 914  ASP C OD1   1 
ATOM   4604  O  OD2   . ASP B 2 397 ? -5.469  46.624 -38.092 1.00 173.82 ? 914  ASP C OD2   1 
ATOM   4605  N  N     . PRO B 2 398 ? -8.089  47.486 -40.901 1.00 175.18 ? 915  PRO C N     1 
ATOM   4606  C  CA    . PRO B 2 398 ? -8.771  46.736 -41.957 1.00 175.56 ? 915  PRO C CA    1 
ATOM   4607  C  C     . PRO B 2 398 ? -8.258  45.308 -42.169 1.00 174.42 ? 915  PRO C C     1 
ATOM   4608  O  O     . PRO B 2 398 ? -9.065  44.392 -42.310 1.00 173.96 ? 915  PRO C O     1 
ATOM   4609  C  CB    . PRO B 2 398 ? -8.520  47.589 -43.203 1.00 177.42 ? 915  PRO C CB    1 
ATOM   4610  C  CG    . PRO B 2 398 ? -7.223  48.271 -42.940 1.00 177.71 ? 915  PRO C CG    1 
ATOM   4611  C  CD    . PRO B 2 398 ? -7.084  48.416 -41.448 1.00 176.33 ? 915  PRO C CD    1 
ATOM   4612  N  N     . ILE B 2 399 ? -6.939  45.124 -42.194 1.00 173.69 ? 916  ILE C N     1 
ATOM   4613  C  CA    . ILE B 2 399 ? -6.350  43.807 -42.493 1.00 172.79 ? 916  ILE C CA    1 
ATOM   4614  C  C     . ILE B 2 399 ? -6.598  42.777 -41.385 1.00 170.49 ? 916  ILE C C     1 
ATOM   4615  O  O     . ILE B 2 399 ? -6.692  43.123 -40.208 1.00 169.84 ? 916  ILE C O     1 
ATOM   4616  C  CB    . ILE B 2 399 ? -4.831  43.869 -42.835 1.00 173.63 ? 916  ILE C CB    1 
ATOM   4617  C  CG1   . ILE B 2 399 ? -4.062  44.903 -41.994 1.00 173.79 ? 916  ILE C CG1   1 
ATOM   4618  C  CG2   . ILE B 2 399 ? -4.636  44.197 -44.308 1.00 174.96 ? 916  ILE C CG2   1 
ATOM   4619  C  CD1   . ILE B 2 399 ? -4.173  44.731 -40.495 1.00 172.56 ? 916  ILE C CD1   1 
ATOM   4620  N  N     . GLY B 2 400 ? -6.714  41.512 -41.784 1.00 169.17 ? 917  GLY C N     1 
ATOM   4621  C  CA    . GLY B 2 400 ? -6.974  40.416 -40.848 1.00 167.63 ? 917  GLY C CA    1 
ATOM   4622  C  C     . GLY B 2 400 ? -6.587  39.064 -41.423 1.00 167.22 ? 917  GLY C C     1 
ATOM   4623  O  O     . GLY B 2 400 ? -6.602  38.875 -42.641 1.00 168.64 ? 917  GLY C O     1 
ATOM   4624  N  N     . LEU B 2 401 ? -6.248  38.124 -40.542 1.00 165.23 ? 918  LEU C N     1 
ATOM   4625  C  CA    . LEU B 2 401 ? -5.775  36.801 -40.951 1.00 164.55 ? 918  LEU C CA    1 
ATOM   4626  C  C     . LEU B 2 401 ? -6.790  35.704 -40.636 1.00 164.02 ? 918  LEU C C     1 
ATOM   4627  O  O     . LEU B 2 401 ? -7.407  35.708 -39.571 1.00 163.63 ? 918  LEU C O     1 
ATOM   4628  C  CB    . LEU B 2 401 ? -4.448  36.479 -40.260 1.00 164.11 ? 918  LEU C CB    1 
ATOM   4629  C  CG    . LEU B 2 401 ? -3.260  37.398 -40.559 1.00 164.39 ? 918  LEU C CG    1 
ATOM   4630  C  CD1   . LEU B 2 401 ? -2.035  36.929 -39.789 1.00 164.35 ? 918  LEU C CD1   1 
ATOM   4631  C  CD2   . LEU B 2 401 ? -2.963  37.456 -42.051 1.00 165.36 ? 918  LEU C CD2   1 
ATOM   4632  N  N     . ILE B 2 402 ? -6.943  34.765 -41.570 1.00 164.06 ? 919  ILE C N     1 
ATOM   4633  C  CA    . ILE B 2 402 ? -7.847  33.624 -41.412 1.00 163.50 ? 919  ILE C CA    1 
ATOM   4634  C  C     . ILE B 2 402 ? -7.143  32.361 -41.921 1.00 163.93 ? 919  ILE C C     1 
ATOM   4635  O  O     . ILE B 2 402 ? -6.332  32.432 -42.848 1.00 164.06 ? 919  ILE C O     1 
ATOM   4636  C  CB    . ILE B 2 402 ? -9.181  33.872 -42.161 1.00 163.81 ? 919  ILE C CB    1 
ATOM   4637  C  CG1   . ILE B 2 402 ? -10.325 33.068 -41.542 1.00 163.75 ? 919  ILE C CG1   1 
ATOM   4638  C  CG2   . ILE B 2 402 ? -9.060  33.557 -43.645 1.00 164.80 ? 919  ILE C CG2   1 
ATOM   4639  C  CD1   . ILE B 2 402 ? -11.673 33.403 -42.143 1.00 164.44 ? 919  ILE C CD1   1 
ATOM   4640  N  N     . LEU B 2 403 ? -7.446  31.214 -41.313 1.00 164.19 ? 920  LEU C N     1 
ATOM   4641  C  CA    . LEU B 2 403 ? -6.767  29.956 -41.648 1.00 164.81 ? 920  LEU C CA    1 
ATOM   4642  C  C     . LEU B 2 403 ? -7.638  29.001 -42.457 1.00 165.77 ? 920  LEU C C     1 
ATOM   4643  O  O     . LEU B 2 403 ? -8.863  29.120 -42.479 1.00 165.81 ? 920  LEU C O     1 
ATOM   4644  C  CB    . LEU B 2 403 ? -6.294  29.243 -40.376 1.00 164.61 ? 920  LEU C CB    1 
ATOM   4645  C  CG    . LEU B 2 403 ? -5.112  29.872 -39.637 1.00 164.24 ? 920  LEU C CG    1 
ATOM   4646  C  CD1   . LEU B 2 403 ? -5.007  29.323 -38.222 1.00 164.15 ? 920  LEU C CD1   1 
ATOM   4647  C  CD2   . LEU B 2 403 ? -3.816  29.640 -40.399 1.00 164.86 ? 920  LEU C CD2   1 
ATOM   4648  N  N     . LEU B 2 404 ? -6.974  28.061 -43.125 1.00 166.83 ? 921  LEU C N     1 
ATOM   4649  C  CA    . LEU B 2 404 ? -7.625  26.945 -43.802 1.00 167.94 ? 921  LEU C CA    1 
ATOM   4650  C  C     . LEU B 2 404 ? -6.863  25.670 -43.463 1.00 168.69 ? 921  LEU C C     1 
ATOM   4651  O  O     . LEU B 2 404 ? -5.713  25.505 -43.875 1.00 168.96 ? 921  LEU C O     1 
ATOM   4652  C  CB    . LEU B 2 404 ? -7.630  27.156 -45.315 1.00 168.61 ? 921  LEU C CB    1 
ATOM   4653  C  CG    . LEU B 2 404 ? -8.701  28.085 -45.888 1.00 168.74 ? 921  LEU C CG    1 
ATOM   4654  C  CD1   . LEU B 2 404 ? -8.497  28.269 -47.384 1.00 169.57 ? 921  LEU C CD1   1 
ATOM   4655  C  CD2   . LEU B 2 404 ? -10.093 27.546 -45.599 1.00 169.28 ? 921  LEU C CD2   1 
ATOM   4656  N  N     . GLY B 2 405 ? -7.501  24.776 -42.711 1.00 169.35 ? 922  GLY C N     1 
ATOM   4657  C  CA    . GLY B 2 405 ? -6.846  23.564 -42.229 1.00 170.51 ? 922  GLY C CA    1 
ATOM   4658  C  C     . GLY B 2 405 ? -7.530  22.290 -42.680 1.00 172.28 ? 922  GLY C C     1 
ATOM   4659  O  O     . GLY B 2 405 ? -8.757  22.187 -42.640 1.00 172.48 ? 922  GLY C O     1 
ATOM   4660  N  N     . GLU B 2 406 ? -6.727  21.320 -43.116 1.00 173.90 ? 923  GLU C N     1 
ATOM   4661  C  CA    . GLU B 2 406 ? -7.220  19.982 -43.419 1.00 175.58 ? 923  GLU C CA    1 
ATOM   4662  C  C     . GLU B 2 406 ? -7.527  19.275 -42.102 1.00 175.86 ? 923  GLU C C     1 
ATOM   4663  O  O     . GLU B 2 406 ? -6.655  18.636 -41.509 1.00 176.38 ? 923  GLU C O     1 
ATOM   4664  C  CB    . GLU B 2 406 ? -6.187  19.191 -44.232 1.00 176.95 ? 923  GLU C CB    1 
ATOM   4665  C  CG    . GLU B 2 406 ? -6.671  17.823 -44.697 1.00 178.90 ? 923  GLU C CG    1 
ATOM   4666  C  CD    . GLU B 2 406 ? -5.577  16.993 -45.346 1.00 180.26 ? 923  GLU C CD    1 
ATOM   4667  O  OE1   . GLU B 2 406 ? -4.557  17.569 -45.781 1.00 180.17 ? 923  GLU C OE1   1 
ATOM   4668  O  OE2   . GLU B 2 406 ? -5.743  15.757 -45.426 1.00 181.40 ? 923  GLU C OE2   1 
ATOM   4669  N  N     . VAL B 2 407 ? -8.771  19.407 -41.648 1.00 175.79 ? 924  VAL C N     1 
ATOM   4670  C  CA    . VAL B 2 407 ? -9.192  18.845 -40.366 1.00 176.70 ? 924  VAL C CA    1 
ATOM   4671  C  C     . VAL B 2 407 ? -9.896  17.504 -40.587 1.00 179.14 ? 924  VAL C C     1 
ATOM   4672  O  O     . VAL B 2 407 ? -10.937 17.433 -41.243 1.00 180.03 ? 924  VAL C O     1 
ATOM   4673  C  CB    . VAL B 2 407 ? -10.072 19.842 -39.560 1.00 175.64 ? 924  VAL C CB    1 
ATOM   4674  C  CG1   . VAL B 2 407 ? -11.398 20.138 -40.252 1.00 175.86 ? 924  VAL C CG1   1 
ATOM   4675  C  CG2   . VAL B 2 407 ? -10.312 19.332 -38.146 1.00 176.05 ? 924  VAL C CG2   1 
ATOM   4676  N  N     . ALA B 2 408 ? -9.300  16.439 -40.054 1.00 180.77 ? 925  ALA C N     1 
ATOM   4677  C  CA    . ALA B 2 408 ? -9.843  15.091 -40.198 1.00 182.91 ? 925  ALA C CA    1 
ATOM   4678  C  C     . ALA B 2 408 ? -11.056 14.911 -39.290 1.00 184.06 ? 925  ALA C C     1 
ATOM   4679  O  O     . ALA B 2 408 ? -10.916 14.646 -38.094 1.00 184.48 ? 925  ALA C O     1 
ATOM   4680  C  CB    . ALA B 2 408 ? -8.778  14.051 -39.880 1.00 184.22 ? 925  ALA C CB    1 
ATOM   4681  N  N     . LEU B 2 409 ? -12.244 15.065 -39.869 1.00 185.02 ? 926  LEU C N     1 
ATOM   4682  C  CA    . LEU B 2 409 ? -13.493 14.961 -39.121 1.00 186.46 ? 926  LEU C CA    1 
ATOM   4683  C  C     . LEU B 2 409 ? -13.822 13.499 -38.830 1.00 189.88 ? 926  LEU C C     1 
ATOM   4684  O  O     . LEU B 2 409 ? -14.059 13.128 -37.680 1.00 190.95 ? 926  LEU C O     1 
ATOM   4685  C  CB    . LEU B 2 409 ? -14.639 15.618 -39.898 1.00 185.95 ? 926  LEU C CB    1 
ATOM   4686  C  CG    . LEU B 2 409 ? -14.448 17.096 -40.264 1.00 183.99 ? 926  LEU C CG    1 
ATOM   4687  C  CD1   . LEU B 2 409 ? -15.546 17.586 -41.199 1.00 184.32 ? 926  LEU C CD1   1 
ATOM   4688  C  CD2   . LEU B 2 409 ? -14.383 17.967 -39.018 1.00 182.73 ? 926  LEU C CD2   1 
ATOM   4689  N  N     . GLY B 2 410 ? -13.827 12.677 -39.877 1.00 192.13 ? 927  GLY C N     1 
ATOM   4690  C  CA    . GLY B 2 410 ? -14.103 11.248 -39.740 1.00 195.27 ? 927  GLY C CA    1 
ATOM   4691  C  C     . GLY B 2 410 ? -15.573 10.969 -39.501 1.00 197.51 ? 927  GLY C C     1 
ATOM   4692  O  O     . GLY B 2 410 ? -16.439 11.659 -40.041 1.00 197.00 ? 927  GLY C O     1 
ATOM   4693  N  N     . ASN B 2 411 ? -15.851 9.943  -38.702 1.00 200.62 ? 928  ASN C N     1 
ATOM   4694  C  CA    . ASN B 2 411 ? -17.216 9.625  -38.291 1.00 203.23 ? 928  ASN C CA    1 
ATOM   4695  C  C     . ASN B 2 411 ? -17.740 10.715 -37.357 1.00 202.25 ? 928  ASN C C     1 
ATOM   4696  O  O     . ASN B 2 411 ? -17.268 10.856 -36.227 1.00 201.76 ? 928  ASN C O     1 
ATOM   4697  C  CB    . ASN B 2 411 ? -17.262 8.256  -37.605 1.00 206.44 ? 928  ASN C CB    1 
ATOM   4698  C  CG    . ASN B 2 411 ? -18.673 7.709  -37.472 1.00 209.29 ? 928  ASN C CG    1 
ATOM   4699  O  OD1   . ASN B 2 411 ? -19.584 8.113  -38.196 1.00 209.81 ? 928  ASN C OD1   1 
ATOM   4700  N  ND2   . ASN B 2 411 ? -18.857 6.773  -36.548 1.00 211.66 ? 928  ASN C ND2   1 
ATOM   4701  N  N     . MET B 2 412 ? -18.718 11.479 -37.838 1.00 202.38 ? 929  MET C N     1 
ATOM   4702  C  CA    . MET B 2 412 ? -19.146 12.710 -37.176 1.00 201.35 ? 929  MET C CA    1 
ATOM   4703  C  C     . MET B 2 412 ? -20.303 12.481 -36.208 1.00 203.82 ? 929  MET C C     1 
ATOM   4704  O  O     . MET B 2 412 ? -21.191 11.668 -36.473 1.00 206.28 ? 929  MET C O     1 
ATOM   4705  C  CB    . MET B 2 412 ? -19.568 13.745 -38.221 1.00 199.58 ? 929  MET C CB    1 
ATOM   4706  C  CG    . MET B 2 412 ? -18.572 13.925 -39.356 1.00 198.11 ? 929  MET C CG    1 
ATOM   4707  S  SD    . MET B 2 412 ? -18.915 15.375 -40.367 1.00 195.89 ? 929  MET C SD    1 
ATOM   4708  C  CE    . MET B 2 412 ? -18.382 16.672 -39.258 1.00 193.80 ? 929  MET C CE    1 
ATOM   4709  N  N     . TYR B 2 413 ? -20.280 13.204 -35.089 1.00 203.52 ? 930  TYR C N     1 
ATOM   4710  C  CA    . TYR B 2 413 ? -21.394 13.221 -34.144 1.00 205.43 ? 930  TYR C CA    1 
ATOM   4711  C  C     . TYR B 2 413 ? -22.206 14.494 -34.374 1.00 205.07 ? 930  TYR C C     1 
ATOM   4712  O  O     . TYR B 2 413 ? -21.777 15.589 -34.016 1.00 203.11 ? 930  TYR C O     1 
ATOM   4713  C  CB    . TYR B 2 413 ? -20.886 13.149 -32.700 1.00 205.19 ? 930  TYR C CB    1 
ATOM   4714  C  CG    . TYR B 2 413 ? -21.983 13.078 -31.653 1.00 206.66 ? 930  TYR C CG    1 
ATOM   4715  C  CD1   . TYR B 2 413 ? -23.032 12.166 -31.770 1.00 209.67 ? 930  TYR C CD1   1 
ATOM   4716  C  CD2   . TYR B 2 413 ? -21.963 13.911 -30.537 1.00 205.27 ? 930  TYR C CD2   1 
ATOM   4717  C  CE1   . TYR B 2 413 ? -24.033 12.097 -30.814 1.00 211.12 ? 930  TYR C CE1   1 
ATOM   4718  C  CE2   . TYR B 2 413 ? -22.958 13.846 -29.575 1.00 206.70 ? 930  TYR C CE2   1 
ATOM   4719  C  CZ    . TYR B 2 413 ? -23.990 12.939 -29.718 1.00 209.54 ? 930  TYR C CZ    1 
ATOM   4720  O  OH    . TYR B 2 413 ? -24.980 12.873 -28.765 1.00 211.09 ? 930  TYR C OH    1 
ATOM   4721  N  N     . GLU B 2 414 ? -23.380 14.338 -34.978 1.00 207.86 ? 931  GLU C N     1 
ATOM   4722  C  CA    . GLU B 2 414 ? -24.188 15.473 -35.418 1.00 208.11 ? 931  GLU C CA    1 
ATOM   4723  C  C     . GLU B 2 414 ? -25.116 15.968 -34.311 1.00 209.62 ? 931  GLU C C     1 
ATOM   4724  O  O     . GLU B 2 414 ? -25.865 15.185 -33.725 1.00 211.94 ? 931  GLU C O     1 
ATOM   4725  C  CB    . GLU B 2 414 ? -24.996 15.080 -36.656 1.00 209.82 ? 931  GLU C CB    1 
ATOM   4726  C  CG    . GLU B 2 414 ? -24.130 14.810 -37.881 1.00 208.94 ? 931  GLU C CG    1 
ATOM   4727  C  CD    . GLU B 2 414 ? -24.645 13.669 -38.739 1.00 211.35 ? 931  GLU C CD    1 
ATOM   4728  O  OE1   . GLU B 2 414 ? -25.870 13.593 -38.968 1.00 213.28 ? 931  GLU C OE1   1 
ATOM   4729  O  OE2   . GLU B 2 414 ? -23.818 12.848 -39.191 1.00 211.56 ? 931  GLU C OE2   1 
ATOM   4730  N  N     . LEU B 2 415 ? -25.056 17.270 -34.034 1.00 209.03 ? 932  LEU C N     1 
ATOM   4731  C  CA    . LEU B 2 415 ? -25.882 17.897 -33.001 1.00 210.59 ? 932  LEU C CA    1 
ATOM   4732  C  C     . LEU B 2 415 ? -26.646 19.092 -33.565 1.00 211.13 ? 932  LEU C C     1 
ATOM   4733  O  O     . LEU B 2 415 ? -26.157 19.789 -34.455 1.00 209.65 ? 932  LEU C O     1 
ATOM   4734  C  CB    . LEU B 2 415 ? -25.011 18.352 -31.826 1.00 208.79 ? 932  LEU C CB    1 
ATOM   4735  C  CG    . LEU B 2 415 ? -24.323 17.250 -31.016 1.00 209.67 ? 932  LEU C CG    1 
ATOM   4736  C  CD1   . LEU B 2 415 ? -23.408 17.860 -29.964 1.00 207.66 ? 932  LEU C CD1   1 
ATOM   4737  C  CD2   . LEU B 2 415 ? -25.348 16.328 -30.371 1.00 212.65 ? 932  LEU C CD2   1 
ATOM   4738  N  N     . LYS B 2 416 ? -27.845 19.319 -33.031 1.00 213.87 ? 933  LYS C N     1 
ATOM   4739  C  CA    . LYS B 2 416 ? -28.703 20.422 -33.461 1.00 214.52 ? 933  LYS C CA    1 
ATOM   4740  C  C     . LYS B 2 416 ? -28.621 21.579 -32.470 1.00 213.38 ? 933  LYS C C     1 
ATOM   4741  O  O     . LYS B 2 416 ? -28.288 22.704 -32.845 1.00 211.49 ? 933  LYS C O     1 
ATOM   4742  C  CB    . LYS B 2 416 ? -30.151 19.944 -33.593 1.00 217.65 ? 933  LYS C CB    1 
ATOM   4743  C  CG    . LYS B 2 416 ? -30.338 18.798 -34.574 1.00 219.59 ? 933  LYS C CG    1 
ATOM   4744  C  CD    . LYS B 2 416 ? -31.796 18.380 -34.673 1.00 223.09 ? 933  LYS C CD    1 
ATOM   4745  C  CE    . LYS B 2 416 ? -31.968 17.189 -35.602 1.00 225.61 ? 933  LYS C CE    1 
ATOM   4746  N  NZ    . LYS B 2 416 ? -33.381 16.723 -35.659 1.00 229.32 ? 933  LYS C NZ    1 
ATOM   4747  N  N     . HIS B 2 417 ? -28.920 21.289 -31.205 1.00 214.96 ? 934  HIS C N     1 
ATOM   4748  C  CA    . HIS B 2 417 ? -28.892 22.294 -30.140 1.00 214.04 ? 934  HIS C CA    1 
ATOM   4749  C  C     . HIS B 2 417 ? -27.559 22.282 -29.399 1.00 211.68 ? 934  HIS C C     1 
ATOM   4750  O  O     . HIS B 2 417 ? -26.801 21.314 -29.482 1.00 211.87 ? 934  HIS C O     1 
ATOM   4751  C  CB    . HIS B 2 417 ? -30.036 22.055 -29.152 1.00 216.73 ? 934  HIS C CB    1 
ATOM   4752  C  CG    . HIS B 2 417 ? -31.396 22.233 -29.750 1.00 219.34 ? 934  HIS C CG    1 
ATOM   4753  N  ND1   . HIS B 2 417 ? -32.142 21.179 -30.231 1.00 222.26 ? 934  HIS C ND1   1 
ATOM   4754  C  CD2   . HIS B 2 417 ? -32.143 23.345 -29.950 1.00 219.56 ? 934  HIS C CD2   1 
ATOM   4755  C  CE1   . HIS B 2 417 ? -33.291 21.632 -30.699 1.00 223.97 ? 934  HIS C CE1   1 
ATOM   4756  N  NE2   . HIS B 2 417 ? -33.317 22.944 -30.541 1.00 222.43 ? 934  HIS C NE2   1 
ATOM   4757  N  N     . ALA B 2 418 ? -27.287 23.364 -28.671 1.00 209.49 ? 935  ALA C N     1 
ATOM   4758  C  CA    . ALA B 2 418 ? -26.047 23.498 -27.906 1.00 207.45 ? 935  ALA C CA    1 
ATOM   4759  C  C     . ALA B 2 418 ? -26.015 22.506 -26.745 1.00 208.80 ? 935  ALA C C     1 
ATOM   4760  O  O     . ALA B 2 418 ? -27.001 22.357 -26.022 1.00 210.52 ? 935  ALA C O     1 
ATOM   4761  C  CB    . ALA B 2 418 ? -25.895 24.920 -27.389 1.00 205.39 ? 935  ALA C CB    1 
ATOM   4762  N  N     . SER B 2 419 ? -24.878 21.834 -26.576 1.00 208.25 ? 936  SER C N     1 
ATOM   4763  C  CA    . SER B 2 419 ? -24.723 20.809 -25.546 1.00 209.59 ? 936  SER C CA    1 
ATOM   4764  C  C     . SER B 2 419 ? -23.254 20.650 -25.159 1.00 208.13 ? 936  SER C C     1 
ATOM   4765  O  O     . SER B 2 419 ? -22.442 20.196 -25.967 1.00 207.44 ? 936  SER C O     1 
ATOM   4766  C  CB    . SER B 2 419 ? -25.280 19.474 -26.046 1.00 212.07 ? 936  SER C CB    1 
ATOM   4767  O  OG    . SER B 2 419 ? -25.149 18.460 -25.063 1.00 213.60 ? 936  SER C OG    1 
ATOM   4768  N  N     . HIS B 2 420 ? -22.924 21.016 -23.922 1.00 207.44 ? 937  HIS C N     1 
ATOM   4769  C  CA    . HIS B 2 420 ? -21.546 20.938 -23.433 1.00 206.19 ? 937  HIS C CA    1 
ATOM   4770  C  C     . HIS B 2 420 ? -21.163 19.483 -23.171 1.00 207.47 ? 937  HIS C C     1 
ATOM   4771  O  O     . HIS B 2 420 ? -21.583 18.892 -22.174 1.00 209.47 ? 937  HIS C O     1 
ATOM   4772  C  CB    . HIS B 2 420 ? -21.366 21.765 -22.154 1.00 205.65 ? 937  HIS C CB    1 
ATOM   4773  C  CG    . HIS B 2 420 ? -21.817 23.187 -22.280 1.00 204.62 ? 937  HIS C CG    1 
ATOM   4774  N  ND1   . HIS B 2 420 ? -21.442 23.998 -23.330 1.00 203.08 ? 937  HIS C ND1   1 
ATOM   4775  C  CD2   . HIS B 2 420 ? -22.605 23.945 -21.482 1.00 204.87 ? 937  HIS C CD2   1 
ATOM   4776  C  CE1   . HIS B 2 420 ? -21.986 25.192 -23.176 1.00 202.21 ? 937  HIS C CE1   1 
ATOM   4777  N  NE2   . HIS B 2 420 ? -22.695 25.187 -22.062 1.00 203.20 ? 937  HIS C NE2   1 
ATOM   4778  N  N     . ILE B 2 421 ? -20.367 18.912 -24.074 1.00 206.03 ? 938  ILE C N     1 
ATOM   4779  C  CA    . ILE B 2 421 ? -19.961 17.509 -23.976 1.00 206.79 ? 938  ILE C CA    1 
ATOM   4780  C  C     . ILE B 2 421 ? -18.588 17.369 -23.318 1.00 205.50 ? 938  ILE C C     1 
ATOM   4781  O  O     . ILE B 2 421 ? -17.715 18.222 -23.492 1.00 203.51 ? 938  ILE C O     1 
ATOM   4782  C  CB    . ILE B 2 421 ? -19.958 16.814 -25.360 1.00 207.16 ? 938  ILE C CB    1 
ATOM   4783  C  CG1   . ILE B 2 421 ? -18.819 17.333 -26.250 1.00 204.71 ? 938  ILE C CG1   1 
ATOM   4784  C  CG2   . ILE B 2 421 ? -21.308 17.000 -26.044 1.00 207.97 ? 938  ILE C CG2   1 
ATOM   4785  C  CD1   . ILE B 2 421 ? -18.859 16.794 -27.662 1.00 205.00 ? 938  ILE C CD1   1 
ATOM   4786  N  N     . SER B 2 422 ? -18.415 16.290 -22.558 1.00 206.70 ? 939  SER C N     1 
ATOM   4787  C  CA    . SER B 2 422 ? -17.142 15.977 -21.912 1.00 206.22 ? 939  SER C CA    1 
ATOM   4788  C  C     . SER B 2 422 ? -16.428 14.878 -22.687 1.00 206.59 ? 939  SER C C     1 
ATOM   4789  O  O     . SER B 2 422 ? -15.278 15.043 -23.099 1.00 205.20 ? 939  SER C O     1 
ATOM   4790  C  CB    . SER B 2 422 ? -17.374 15.528 -20.469 1.00 208.18 ? 939  SER C CB    1 
ATOM   4791  O  OG    . SER B 2 422 ? -17.977 16.558 -19.705 1.00 207.28 ? 939  SER C OG    1 
ATOM   4792  N  N     . LYS B 2 423 ? -17.124 13.760 -22.879 1.00 208.31 ? 940  LYS C N     1 
ATOM   4793  C  CA    . LYS B 2 423 ? -16.599 12.616 -23.617 1.00 209.05 ? 940  LYS C CA    1 
ATOM   4794  C  C     . LYS B 2 423 ? -17.443 12.375 -24.865 1.00 208.34 ? 940  LYS C C     1 
ATOM   4795  O  O     . LYS B 2 423 ? -18.664 12.542 -24.838 1.00 208.64 ? 940  LYS C O     1 
ATOM   4796  C  CB    . LYS B 2 423 ? -16.605 11.374 -22.723 1.00 212.33 ? 940  LYS C CB    1 
ATOM   4797  C  CG    . LYS B 2 423 ? -15.893 10.165 -23.313 1.00 214.34 ? 940  LYS C CG    1 
ATOM   4798  C  CD    . LYS B 2 423 ? -15.251 9.304  -22.233 1.00 216.80 ? 940  LYS C CD    1 
ATOM   4799  C  CE    . LYS B 2 423 ? -16.279 8.643  -21.324 1.00 219.55 ? 940  LYS C CE    1 
ATOM   4800  N  NZ    . LYS B 2 423 ? -16.853 7.404  -21.918 1.00 222.24 ? 940  LYS C NZ    1 
ATOM   4801  N  N     . LEU B 2 424 ? -16.787 11.983 -25.955 1.00 207.11 ? 941  LEU C N     1 
ATOM   4802  C  CA    . LEU B 2 424 ? -17.473 11.740 -27.221 1.00 206.86 ? 941  LEU C CA    1 
ATOM   4803  C  C     . LEU B 2 424 ? -18.164 10.377 -27.176 1.00 209.72 ? 941  LEU C C     1 
ATOM   4804  O  O     . LEU B 2 424 ? -17.731 9.491  -26.434 1.00 211.99 ? 941  LEU C O     1 
ATOM   4805  C  CB    . LEU B 2 424 ? -16.490 11.770 -28.399 1.00 205.31 ? 941  LEU C CB    1 
ATOM   4806  C  CG    . LEU B 2 424 ? -15.652 13.037 -28.625 1.00 202.09 ? 941  LEU C CG    1 
ATOM   4807  C  CD1   . LEU B 2 424 ? -14.327 12.987 -27.873 1.00 201.73 ? 941  LEU C CD1   1 
ATOM   4808  C  CD2   . LEU B 2 424 ? -15.401 13.240 -30.113 1.00 200.79 ? 941  LEU C CD2   1 
ATOM   4809  N  N     . PRO B 2 425 ? -19.243 10.201 -27.963 1.00 209.70 ? 942  PRO C N     1 
ATOM   4810  C  CA    . PRO B 2 425 ? -19.819 8.860  -28.109 1.00 212.18 ? 942  PRO C CA    1 
ATOM   4811  C  C     . PRO B 2 425 ? -18.854 7.898  -28.804 1.00 212.32 ? 942  PRO C C     1 
ATOM   4812  O  O     . PRO B 2 425 ? -17.915 8.339  -29.470 1.00 210.19 ? 942  PRO C O     1 
ATOM   4813  C  CB    . PRO B 2 425 ? -21.063 9.097  -28.974 1.00 212.64 ? 942  PRO C CB    1 
ATOM   4814  C  CG    . PRO B 2 425 ? -21.390 10.538 -28.800 1.00 210.37 ? 942  PRO C CG    1 
ATOM   4815  C  CD    . PRO B 2 425 ? -20.073 11.229 -28.617 1.00 208.04 ? 942  PRO C CD    1 
ATOM   4816  N  N     . LYS B 2 426 ? -19.090 6.598  -28.649 1.00 214.61 ? 943  LYS C N     1 
ATOM   4817  C  CA    . LYS B 2 426 ? -18.187 5.581  -29.191 1.00 215.14 ? 943  LYS C CA    1 
ATOM   4818  C  C     . LYS B 2 426 ? -18.096 5.650  -30.714 1.00 213.07 ? 943  LYS C C     1 
ATOM   4819  O  O     . LYS B 2 426 ? -19.106 5.814  -31.399 1.00 212.72 ? 943  LYS C O     1 
ATOM   4820  C  CB    . LYS B 2 426 ? -18.632 4.180  -28.761 1.00 219.37 ? 943  LYS C CB    1 
ATOM   4821  C  CG    . LYS B 2 426 ? -17.795 3.057  -29.362 1.00 221.28 ? 943  LYS C CG    1 
ATOM   4822  C  CD    . LYS B 2 426 ? -17.827 1.793  -28.518 1.00 225.17 ? 943  LYS C CD    1 
ATOM   4823  C  CE    . LYS B 2 426 ? -16.961 1.913  -27.271 1.00 225.42 ? 943  LYS C CE    1 
ATOM   4824  N  NZ    . LYS B 2 426 ? -15.525 2.140  -27.594 1.00 223.88 ? 943  LYS C NZ    1 
ATOM   4825  N  N     . GLY B 2 427 ? -16.873 5.534  -31.229 1.00 211.15 ? 944  GLY C N     1 
ATOM   4826  C  CA    . GLY B 2 427 ? -16.627 5.523  -32.668 1.00 209.72 ? 944  GLY C CA    1 
ATOM   4827  C  C     . GLY B 2 427 ? -16.687 6.879  -33.348 1.00 206.30 ? 944  GLY C C     1 
ATOM   4828  O  O     . GLY B 2 427 ? -16.546 6.959  -34.568 1.00 205.62 ? 944  GLY C O     1 
ATOM   4829  N  N     . LYS B 2 428 ? -16.886 7.944  -32.570 1.00 204.31 ? 945  LYS C N     1 
ATOM   4830  C  CA    . LYS B 2 428 ? -16.989 9.299  -33.107 1.00 201.09 ? 945  LYS C CA    1 
ATOM   4831  C  C     . LYS B 2 428 ? -15.681 10.047 -32.882 1.00 198.69 ? 945  LYS C C     1 
ATOM   4832  O  O     . LYS B 2 428 ? -15.185 10.113 -31.756 1.00 198.29 ? 945  LYS C O     1 
ATOM   4833  C  CB    . LYS B 2 428 ? -18.141 10.056 -32.440 1.00 200.62 ? 945  LYS C CB    1 
ATOM   4834  C  CG    . LYS B 2 428 ? -19.505 9.405  -32.619 1.00 202.91 ? 945  LYS C CG    1 
ATOM   4835  C  CD    . LYS B 2 428 ? -20.062 9.626  -34.018 1.00 202.51 ? 945  LYS C CD    1 
ATOM   4836  C  CE    . LYS B 2 428 ? -20.957 8.477  -34.449 1.00 205.49 ? 945  LYS C CE    1 
ATOM   4837  N  NZ    . LYS B 2 428 ? -22.134 8.276  -33.559 1.00 207.39 ? 945  LYS C NZ    1 
ATOM   4838  N  N     . HIS B 2 429 ? -15.130 10.606 -33.957 1.00 197.22 ? 946  HIS C N     1 
ATOM   4839  C  CA    . HIS B 2 429 ? -13.849 11.313 -33.903 1.00 195.64 ? 946  HIS C CA    1 
ATOM   4840  C  C     . HIS B 2 429 ? -14.020 12.835 -33.959 1.00 193.19 ? 946  HIS C C     1 
ATOM   4841  O  O     . HIS B 2 429 ? -13.037 13.572 -33.867 1.00 191.33 ? 946  HIS C O     1 
ATOM   4842  C  CB    . HIS B 2 429 ? -12.947 10.854 -35.053 1.00 195.89 ? 946  HIS C CB    1 
ATOM   4843  C  CG    . HIS B 2 429 ? -12.926 9.370  -35.252 1.00 198.65 ? 946  HIS C CG    1 
ATOM   4844  N  ND1   . HIS B 2 429 ? -13.864 8.711  -36.016 1.00 200.18 ? 946  HIS C ND1   1 
ATOM   4845  C  CD2   . HIS B 2 429 ? -12.083 8.417  -34.789 1.00 200.40 ? 946  HIS C CD2   1 
ATOM   4846  C  CE1   . HIS B 2 429 ? -13.602 7.416  -36.015 1.00 202.54 ? 946  HIS C CE1   1 
ATOM   4847  N  NE2   . HIS B 2 429 ? -12.525 7.211  -35.278 1.00 202.73 ? 946  HIS C NE2   1 
ATOM   4848  N  N     . SER B 2 430 ? -15.260 13.300 -34.111 1.00 193.23 ? 947  SER C N     1 
ATOM   4849  C  CA    . SER B 2 430 ? -15.548 14.732 -34.196 1.00 191.36 ? 947  SER C CA    1 
ATOM   4850  C  C     . SER B 2 430 ? -17.025 15.023 -33.932 1.00 192.65 ? 947  SER C C     1 
ATOM   4851  O  O     . SER B 2 430 ? -17.839 14.103 -33.821 1.00 194.59 ? 947  SER C O     1 
ATOM   4852  C  CB    . SER B 2 430 ? -15.159 15.270 -35.576 1.00 189.91 ? 947  SER C CB    1 
ATOM   4853  O  OG    . SER B 2 430 ? -15.923 14.655 -36.599 1.00 190.98 ? 947  SER C OG    1 
ATOM   4854  N  N     . VAL B 2 431 ? -17.355 16.309 -33.830 1.00 192.00 ? 948  VAL C N     1 
ATOM   4855  C  CA    . VAL B 2 431 ? -18.734 16.759 -33.635 1.00 193.26 ? 948  VAL C CA    1 
ATOM   4856  C  C     . VAL B 2 431 ? -19.091 17.792 -34.702 1.00 192.97 ? 948  VAL C C     1 
ATOM   4857  O  O     . VAL B 2 431 ? -18.233 18.563 -35.138 1.00 190.77 ? 948  VAL C O     1 
ATOM   4858  C  CB    . VAL B 2 431 ? -18.933 17.357 -32.224 1.00 192.62 ? 948  VAL C CB    1 
ATOM   4859  C  CG1   . VAL B 2 431 ? -20.307 18.003 -32.076 1.00 192.83 ? 948  VAL C CG1   1 
ATOM   4860  C  CG2   . VAL B 2 431 ? -18.753 16.278 -31.168 1.00 194.45 ? 948  VAL C CG2   1 
ATOM   4861  N  N     . LYS B 2 432 ? -20.355 17.792 -35.122 1.00 195.69 ? 949  LYS C N     1 
ATOM   4862  C  CA    . LYS B 2 432 ? -20.848 18.744 -36.114 1.00 196.41 ? 949  LYS C CA    1 
ATOM   4863  C  C     . LYS B 2 432 ? -22.074 19.487 -35.597 1.00 198.27 ? 949  LYS C C     1 
ATOM   4864  O  O     . LYS B 2 432 ? -23.037 18.867 -35.144 1.00 199.81 ? 949  LYS C O     1 
ATOM   4865  C  CB    . LYS B 2 432 ? -21.208 18.027 -37.415 1.00 198.07 ? 949  LYS C CB    1 
ATOM   4866  C  CG    . LYS B 2 432 ? -21.425 18.963 -38.595 1.00 197.49 ? 949  LYS C CG    1 
ATOM   4867  C  CD    . LYS B 2 432 ? -21.807 18.204 -39.854 1.00 199.39 ? 949  LYS C CD    1 
ATOM   4868  C  CE    . LYS B 2 432 ? -22.305 19.146 -40.938 1.00 199.28 ? 949  LYS C CE    1 
ATOM   4869  N  NZ    . LYS B 2 432 ? -22.746 18.417 -42.159 1.00 201.12 ? 949  LYS C NZ    1 
ATOM   4870  N  N     . GLY B 2 433 ? -22.027 20.815 -35.670 1.00 198.85 ? 950  GLY C N     1 
ATOM   4871  C  CA    . GLY B 2 433 ? -23.188 21.651 -35.384 1.00 200.94 ? 950  GLY C CA    1 
ATOM   4872  C  C     . GLY B 2 433 ? -23.965 21.877 -36.665 1.00 203.69 ? 950  GLY C C     1 
ATOM   4873  O  O     . GLY B 2 433 ? -23.493 22.573 -37.562 1.00 202.20 ? 950  GLY C O     1 
ATOM   4874  N  N     . LEU B 2 434 ? -25.152 21.282 -36.758 1.00 208.60 ? 951  LEU C N     1 
ATOM   4875  C  CA    . LEU B 2 434 ? -25.967 21.368 -37.970 1.00 212.01 ? 951  LEU C CA    1 
ATOM   4876  C  C     . LEU B 2 434 ? -26.657 22.726 -38.066 1.00 213.52 ? 951  LEU C C     1 
ATOM   4877  O  O     . LEU B 2 434 ? -27.381 23.123 -37.153 1.00 214.22 ? 951  LEU C O     1 
ATOM   4878  C  CB    . LEU B 2 434 ? -27.015 20.253 -37.993 1.00 215.00 ? 951  LEU C CB    1 
ATOM   4879  C  CG    . LEU B 2 434 ? -26.491 18.815 -37.933 1.00 216.04 ? 951  LEU C CG    1 
ATOM   4880  C  CD1   . LEU B 2 434 ? -27.654 17.843 -37.802 1.00 219.27 ? 951  LEU C CD1   1 
ATOM   4881  C  CD2   . LEU B 2 434 ? -25.644 18.485 -39.154 1.00 215.41 ? 951  LEU C CD2   1 
ATOM   4882  N  N     . GLY B 2 435 ? -26.427 23.428 -39.176 1.00 215.02 ? 952  GLY C N     1 
ATOM   4883  C  CA    . GLY B 2 435 ? -26.996 24.758 -39.397 1.00 216.44 ? 952  GLY C CA    1 
ATOM   4884  C  C     . GLY B 2 435 ? -28.113 24.766 -40.426 1.00 220.31 ? 952  GLY C C     1 
ATOM   4885  O  O     . GLY B 2 435 ? -28.374 23.756 -41.082 1.00 221.97 ? 952  GLY C O     1 
ATOM   4886  N  N     . LYS B 2 436 ? -28.773 25.915 -40.557 1.00 222.73 ? 953  LYS C N     1 
ATOM   4887  C  CA    . LYS B 2 436 ? -29.828 26.109 -41.553 1.00 226.50 ? 953  LYS C CA    1 
ATOM   4888  C  C     . LYS B 2 436 ? -29.237 26.113 -42.959 1.00 227.00 ? 953  LYS C C     1 
ATOM   4889  O  O     . LYS B 2 436 ? -29.651 25.333 -43.818 1.00 228.65 ? 953  LYS C O     1 
ATOM   4890  C  CB    . LYS B 2 436 ? -30.557 27.435 -41.312 1.00 227.48 ? 953  LYS C CB    1 
ATOM   4891  C  CG    . LYS B 2 436 ? -31.322 27.520 -39.998 1.00 228.59 ? 953  LYS C CG    1 
ATOM   4892  C  CD    . LYS B 2 436 ? -32.771 27.081 -40.142 1.00 232.10 ? 953  LYS C CD    1 
ATOM   4893  C  CE    . LYS B 2 436 ? -33.554 27.351 -38.866 1.00 232.99 ? 953  LYS C CE    1 
ATOM   4894  N  NZ    . LYS B 2 436 ? -35.027 27.253 -39.065 1.00 236.37 ? 953  LYS C NZ    1 
ATOM   4895  N  N     . THR B 2 437 ? -28.268 26.999 -43.179 1.00 226.13 ? 954  THR C N     1 
ATOM   4896  C  CA    . THR B 2 437 ? -27.599 27.127 -44.471 1.00 226.54 ? 954  THR C CA    1 
ATOM   4897  C  C     . THR B 2 437 ? -26.365 26.229 -44.524 1.00 225.91 ? 954  THR C C     1 
ATOM   4898  O  O     . THR B 2 437 ? -25.619 26.126 -43.548 1.00 224.57 ? 954  THR C O     1 
ATOM   4899  C  CB    . THR B 2 437 ? -27.170 28.585 -44.736 1.00 225.22 ? 954  THR C CB    1 
ATOM   4900  O  OG1   . THR B 2 437 ? -28.309 29.448 -44.640 1.00 226.70 ? 954  THR C OG1   1 
ATOM   4901  C  CG2   . THR B 2 437 ? -26.541 28.729 -46.121 1.00 224.95 ? 954  THR C CG2   1 
ATOM   4902  N  N     . THR B 2 438 ? -26.163 25.582 -45.669 1.00 227.26 ? 955  THR C N     1 
ATOM   4903  C  CA    . THR B 2 438 ? -24.993 24.738 -45.902 1.00 226.67 ? 955  THR C CA    1 
ATOM   4904  C  C     . THR B 2 438 ? -24.501 24.930 -47.339 1.00 227.19 ? 955  THR C C     1 
ATOM   4905  O  O     . THR B 2 438 ? -25.315 25.111 -48.248 1.00 229.03 ? 955  THR C O     1 
ATOM   4906  C  CB    . THR B 2 438 ? -25.308 23.244 -45.641 1.00 227.94 ? 955  THR C CB    1 
ATOM   4907  O  OG1   . THR B 2 438 ? -24.133 22.451 -45.851 1.00 226.70 ? 955  THR C OG1   1 
ATOM   4908  C  CG2   . THR B 2 438 ? -26.428 22.736 -46.553 1.00 230.65 ? 955  THR C CG2   1 
ATOM   4909  N  N     . PRO B 2 439 ? -23.170 24.907 -47.552 1.00 226.03 ? 956  PRO C N     1 
ATOM   4910  C  CA    . PRO B 2 439 ? -22.661 25.006 -48.921 1.00 226.44 ? 956  PRO C CA    1 
ATOM   4911  C  C     . PRO B 2 439 ? -23.074 23.792 -49.748 1.00 228.77 ? 956  PRO C C     1 
ATOM   4912  O  O     . PRO B 2 439 ? -23.037 22.667 -49.248 1.00 229.20 ? 956  PRO C O     1 
ATOM   4913  C  CB    . PRO B 2 439 ? -21.139 25.057 -48.734 1.00 224.30 ? 956  PRO C CB    1 
ATOM   4914  C  CG    . PRO B 2 439 ? -20.890 24.443 -47.404 1.00 223.60 ? 956  PRO C CG    1 
ATOM   4915  C  CD    . PRO B 2 439 ? -22.078 24.810 -46.567 1.00 224.23 ? 956  PRO C CD    1 
ATOM   4916  N  N     . ASP B 2 440 ? -23.467 24.033 -50.997 1.00 230.60 ? 957  ASP C N     1 
ATOM   4917  C  CA    . ASP B 2 440 ? -24.044 22.999 -51.861 1.00 233.11 ? 957  ASP C CA    1 
ATOM   4918  C  C     . ASP B 2 440 ? -23.199 21.718 -51.880 1.00 232.82 ? 957  ASP C C     1 
ATOM   4919  O  O     . ASP B 2 440 ? -22.071 21.732 -52.375 1.00 231.63 ? 957  ASP C O     1 
ATOM   4920  C  CB    . ASP B 2 440 ? -24.209 23.541 -53.287 1.00 234.41 ? 957  ASP C CB    1 
ATOM   4921  C  CG    . ASP B 2 440 ? -24.941 22.576 -54.207 1.00 237.11 ? 957  ASP C CG    1 
ATOM   4922  O  OD1   . ASP B 2 440 ? -25.832 21.840 -53.731 1.00 238.71 ? 957  ASP C OD1   1 
ATOM   4923  O  OD2   . ASP B 2 440 ? -24.628 22.560 -55.415 1.00 238.00 ? 957  ASP C OD2   1 
ATOM   4924  N  N     . PRO B 2 441 ? -23.740 20.607 -51.335 1.00 234.20 ? 958  PRO C N     1 
ATOM   4925  C  CA    . PRO B 2 441 ? -22.993 19.342 -51.309 1.00 234.29 ? 958  PRO C CA    1 
ATOM   4926  C  C     . PRO B 2 441 ? -22.814 18.689 -52.685 1.00 235.25 ? 958  PRO C C     1 
ATOM   4927  O  O     . PRO B 2 441 ? -21.935 17.841 -52.846 1.00 234.91 ? 958  PRO C O     1 
ATOM   4928  C  CB    . PRO B 2 441 ? -23.834 18.449 -50.389 1.00 235.91 ? 958  PRO C CB    1 
ATOM   4929  C  CG    . PRO B 2 441 ? -25.208 19.008 -50.456 1.00 237.45 ? 958  PRO C CG    1 
ATOM   4930  C  CD    . PRO B 2 441 ? -25.053 20.484 -50.674 1.00 235.94 ? 958  PRO C CD    1 
ATOM   4931  N  N     . SER B 2 442 ? -23.636 19.081 -53.659 1.00 236.42 ? 959  SER C N     1 
ATOM   4932  C  CA    . SER B 2 442 ? -23.498 18.599 -55.036 1.00 237.11 ? 959  SER C CA    1 
ATOM   4933  C  C     . SER B 2 442 ? -22.491 19.423 -55.854 1.00 234.93 ? 959  SER C C     1 
ATOM   4934  O  O     . SER B 2 442 ? -22.330 19.191 -57.054 1.00 235.66 ? 959  SER C O     1 
ATOM   4935  C  CB    . SER B 2 442 ? -24.862 18.591 -55.736 1.00 239.80 ? 959  SER C CB    1 
ATOM   4936  O  OG    . SER B 2 442 ? -25.395 19.899 -55.846 1.00 239.95 ? 959  SER C OG    1 
ATOM   4937  N  N     . ALA B 2 443 ? -21.825 20.380 -55.205 1.00 232.02 ? 960  ALA C N     1 
ATOM   4938  C  CA    . ALA B 2 443 ? -20.769 21.174 -55.834 1.00 229.65 ? 960  ALA C CA    1 
ATOM   4939  C  C     . ALA B 2 443 ? -19.511 21.197 -54.959 1.00 226.34 ? 960  ALA C C     1 
ATOM   4940  O  O     . ALA B 2 443 ? -18.819 22.214 -54.878 1.00 224.34 ? 960  ALA C O     1 
ATOM   4941  C  CB    . ALA B 2 443 ? -21.265 22.589 -56.094 1.00 229.69 ? 960  ALA C CB    1 
ATOM   4942  N  N     . ASN B 2 444 ? -19.220 20.067 -54.315 1.00 225.17 ? 961  ASN C N     1 
ATOM   4943  C  CA    . ASN B 2 444 ? -18.063 19.944 -53.424 1.00 222.59 ? 961  ASN C CA    1 
ATOM   4944  C  C     . ASN B 2 444 ? -16.809 19.543 -54.201 1.00 220.96 ? 961  ASN C C     1 
ATOM   4945  O  O     . ASN B 2 444 ? -16.621 18.369 -54.529 1.00 221.46 ? 961  ASN C O     1 
ATOM   4946  C  CB    . ASN B 2 444 ? -18.341 18.919 -52.310 1.00 223.20 ? 961  ASN C CB    1 
ATOM   4947  C  CG    . ASN B 2 444 ? -19.116 19.501 -51.130 1.00 223.31 ? 961  ASN C CG    1 
ATOM   4948  O  OD1   . ASN B 2 444 ? -19.130 18.908 -50.052 1.00 223.48 ? 961  ASN C OD1   1 
ATOM   4949  N  ND2   . ASN B 2 444 ? -19.759 20.652 -51.321 1.00 223.44 ? 961  ASN C ND2   1 
ATOM   4950  N  N     . ILE B 2 445 ? -15.958 20.525 -54.489 1.00 218.71 ? 962  ILE C N     1 
ATOM   4951  C  CA    . ILE B 2 445 ? -14.714 20.301 -55.232 1.00 217.92 ? 962  ILE C CA    1 
ATOM   4952  C  C     . ILE B 2 445 ? -13.657 19.670 -54.319 1.00 217.03 ? 962  ILE C C     1 
ATOM   4953  O  O     . ILE B 2 445 ? -13.611 19.957 -53.123 1.00 216.39 ? 962  ILE C O     1 
ATOM   4954  C  CB    . ILE B 2 445 ? -14.193 21.624 -55.859 1.00 216.97 ? 962  ILE C CB    1 
ATOM   4955  C  CG1   . ILE B 2 445 ? -14.938 21.930 -57.163 1.00 218.59 ? 962  ILE C CG1   1 
ATOM   4956  C  CG2   . ILE B 2 445 ? -12.698 21.568 -56.157 1.00 216.11 ? 962  ILE C CG2   1 
ATOM   4957  C  CD1   . ILE B 2 445 ? -16.419 22.186 -56.996 1.00 219.67 ? 962  ILE C CD1   1 
ATOM   4958  N  N     . SER B 2 446 ? -12.819 18.807 -54.894 1.00 217.55 ? 963  SER C N     1 
ATOM   4959  C  CA    . SER B 2 446 ? -11.731 18.156 -54.160 1.00 217.01 ? 963  SER C CA    1 
ATOM   4960  C  C     . SER B 2 446 ? -10.427 18.942 -54.301 1.00 216.39 ? 963  SER C C     1 
ATOM   4961  O  O     . SER B 2 446 ? -10.283 19.767 -55.205 1.00 216.34 ? 963  SER C O     1 
ATOM   4962  C  CB    . SER B 2 446 ? -11.533 16.725 -54.665 1.00 218.05 ? 963  SER C CB    1 
ATOM   4963  O  OG    . SER B 2 446 ? -10.584 16.030 -53.876 1.00 217.50 ? 963  SER C OG    1 
ATOM   4964  N  N     . LEU B 2 447 ? -9.479  18.674 -53.404 1.00 216.24 ? 964  LEU C N     1 
ATOM   4965  C  CA    . LEU B 2 447 ? -8.195  19.379 -53.388 1.00 215.77 ? 964  LEU C CA    1 
ATOM   4966  C  C     . LEU B 2 447 ? -7.137  18.555 -52.649 1.00 215.63 ? 964  LEU C C     1 
ATOM   4967  O  O     . LEU B 2 447 ? -7.151  18.484 -51.421 1.00 215.39 ? 964  LEU C O     1 
ATOM   4968  C  CB    . LEU B 2 447 ? -8.365  20.760 -52.733 1.00 214.97 ? 964  LEU C CB    1 
ATOM   4969  C  CG    . LEU B 2 447 ? -7.169  21.720 -52.599 1.00 214.17 ? 964  LEU C CG    1 
ATOM   4970  C  CD1   . LEU B 2 447 ? -6.371  21.489 -51.319 1.00 213.45 ? 964  LEU C CD1   1 
ATOM   4971  C  CD2   . LEU B 2 447 ? -6.260  21.666 -53.820 1.00 214.88 ? 964  LEU C CD2   1 
ATOM   4972  N  N     . ASP B 2 448 ? -6.235  17.930 -53.407 1.00 215.97 ? 965  ASP C N     1 
ATOM   4973  C  CA    . ASP B 2 448 ? -5.167  17.087 -52.849 1.00 216.12 ? 965  ASP C CA    1 
ATOM   4974  C  C     . ASP B 2 448 ? -5.710  15.983 -51.933 1.00 215.65 ? 965  ASP C C     1 
ATOM   4975  O  O     . ASP B 2 448 ? -5.110  15.668 -50.902 1.00 215.41 ? 965  ASP C O     1 
ATOM   4976  C  CB    . ASP B 2 448 ? -4.140  17.942 -52.090 1.00 215.80 ? 965  ASP C CB    1 
ATOM   4977  C  CG    . ASP B 2 448 ? -3.621  19.109 -52.912 1.00 215.99 ? 965  ASP C CG    1 
ATOM   4978  O  OD1   . ASP B 2 448 ? -3.108  20.075 -52.308 1.00 215.94 ? 965  ASP C OD1   1 
ATOM   4979  O  OD2   . ASP B 2 448 ? -3.723  19.066 -54.156 1.00 217.11 ? 965  ASP C OD2   1 
ATOM   4980  N  N     . GLY B 2 449 ? -6.841  15.397 -52.320 1.00 215.14 ? 966  GLY C N     1 
ATOM   4981  C  CA    . GLY B 2 449 ? -7.512  14.388 -51.503 1.00 214.86 ? 966  GLY C CA    1 
ATOM   4982  C  C     . GLY B 2 449 ? -8.191  14.971 -50.275 1.00 212.95 ? 966  GLY C C     1 
ATOM   4983  O  O     . GLY B 2 449 ? -8.250  14.325 -49.228 1.00 213.18 ? 966  GLY C O     1 
ATOM   4984  N  N     . VAL B 2 450 ? -8.699  16.197 -50.406 1.00 210.72 ? 967  VAL C N     1 
ATOM   4985  C  CA    . VAL B 2 450 ? -9.421  16.878 -49.329 1.00 208.91 ? 967  VAL C CA    1 
ATOM   4986  C  C     . VAL B 2 450 ? -10.673 17.528 -49.912 1.00 208.40 ? 967  VAL C C     1 
ATOM   4987  O  O     . VAL B 2 450 ? -10.599 18.230 -50.921 1.00 208.06 ? 967  VAL C O     1 
ATOM   4988  C  CB    . VAL B 2 450 ? -8.561  17.967 -48.648 1.00 206.90 ? 967  VAL C CB    1 
ATOM   4989  C  CG1   . VAL B 2 450 ? -9.243  18.476 -47.386 1.00 205.81 ? 967  VAL C CG1   1 
ATOM   4990  C  CG2   . VAL B 2 450 ? -7.171  17.439 -48.318 1.00 206.93 ? 967  VAL C CG2   1 
ATOM   4991  N  N     . ASP B 2 451 ? -11.815 17.300 -49.268 1.00 208.34 ? 968  ASP C N     1 
ATOM   4992  C  CA    . ASP B 2 451 ? -13.097 17.802 -49.761 1.00 208.40 ? 968  ASP C CA    1 
ATOM   4993  C  C     . ASP B 2 451 ? -13.280 19.276 -49.399 1.00 206.99 ? 968  ASP C C     1 
ATOM   4994  O  O     . ASP B 2 451 ? -13.367 19.621 -48.220 1.00 206.86 ? 968  ASP C O     1 
ATOM   4995  C  CB    . ASP B 2 451 ? -14.252 16.976 -49.188 1.00 209.52 ? 968  ASP C CB    1 
ATOM   4996  C  CG    . ASP B 2 451 ? -14.179 15.510 -49.583 1.00 211.09 ? 968  ASP C CG    1 
ATOM   4997  O  OD1   . ASP B 2 451 ? -15.240 14.918 -49.872 1.00 212.52 ? 968  ASP C OD1   1 
ATOM   4998  O  OD2   . ASP B 2 451 ? -13.061 14.949 -49.607 1.00 210.90 ? 968  ASP C OD2   1 
ATOM   4999  N  N     . VAL B 2 452 ? -13.336 20.133 -50.417 1.00 206.38 ? 969  VAL C N     1 
ATOM   5000  C  CA    . VAL B 2 452 ? -13.524 21.574 -50.232 1.00 204.87 ? 969  VAL C CA    1 
ATOM   5001  C  C     . VAL B 2 452 ? -14.970 21.953 -50.568 1.00 205.91 ? 969  VAL C C     1 
ATOM   5002  O  O     . VAL B 2 452 ? -15.343 21.978 -51.742 1.00 207.39 ? 969  VAL C O     1 
ATOM   5003  C  CB    . VAL B 2 452 ? -12.564 22.388 -51.131 1.00 203.87 ? 969  VAL C CB    1 
ATOM   5004  C  CG1   . VAL B 2 452 ? -12.717 23.882 -50.870 1.00 202.97 ? 969  VAL C CG1   1 
ATOM   5005  C  CG2   . VAL B 2 452 ? -11.122 21.950 -50.913 1.00 203.03 ? 969  VAL C CG2   1 
ATOM   5006  N  N     . PRO B 2 453 ? -15.791 22.251 -49.543 1.00 205.87 ? 970  PRO C N     1 
ATOM   5007  C  CA    . PRO B 2 453 ? -17.186 22.598 -49.790 1.00 206.95 ? 970  PRO C CA    1 
ATOM   5008  C  C     . PRO B 2 453 ? -17.353 24.084 -50.123 1.00 206.34 ? 970  PRO C C     1 
ATOM   5009  O  O     . PRO B 2 453 ? -17.783 24.868 -49.274 1.00 205.99 ? 970  PRO C O     1 
ATOM   5010  C  CB    . PRO B 2 453 ? -17.858 22.244 -48.462 1.00 207.23 ? 970  PRO C CB    1 
ATOM   5011  C  CG    . PRO B 2 453 ? -16.808 22.527 -47.441 1.00 205.58 ? 970  PRO C CG    1 
ATOM   5012  C  CD    . PRO B 2 453 ? -15.470 22.307 -48.103 1.00 205.00 ? 970  PRO C CD    1 
ATOM   5013  N  N     . LEU B 2 454 ? -17.018 24.457 -51.358 1.00 206.24 ? 971  LEU C N     1 
ATOM   5014  C  CA    . LEU B 2 454 ? -17.059 25.862 -51.785 1.00 205.78 ? 971  LEU C CA    1 
ATOM   5015  C  C     . LEU B 2 454 ? -18.322 26.230 -52.579 1.00 207.77 ? 971  LEU C C     1 
ATOM   5016  O  O     . LEU B 2 454 ? -18.330 27.212 -53.323 1.00 207.53 ? 971  LEU C O     1 
ATOM   5017  C  CB    . LEU B 2 454 ? -15.784 26.233 -52.567 1.00 204.82 ? 971  LEU C CB    1 
ATOM   5018  C  CG    . LEU B 2 454 ? -15.288 25.378 -53.739 1.00 205.65 ? 971  LEU C CG    1 
ATOM   5019  C  CD1   . LEU B 2 454 ? -16.315 25.251 -54.854 1.00 207.70 ? 971  LEU C CD1   1 
ATOM   5020  C  CD2   . LEU B 2 454 ? -13.995 25.973 -54.274 1.00 204.76 ? 971  LEU C CD2   1 
ATOM   5021  N  N     . GLY B 2 455 ? -19.389 25.451 -52.407 1.00 210.05 ? 972  GLY C N     1 
ATOM   5022  C  CA    . GLY B 2 455 ? -20.677 25.762 -53.020 1.00 212.81 ? 972  GLY C CA    1 
ATOM   5023  C  C     . GLY B 2 455 ? -21.390 26.867 -52.263 1.00 213.69 ? 972  GLY C C     1 
ATOM   5024  O  O     . GLY B 2 455 ? -21.091 27.120 -51.096 1.00 212.47 ? 972  GLY C O     1 
ATOM   5025  N  N     . THR B 2 456 ? -22.332 27.530 -52.929 1.00 216.63 ? 973  THR C N     1 
ATOM   5026  C  CA    . THR B 2 456 ? -23.120 28.591 -52.298 1.00 218.06 ? 973  THR C CA    1 
ATOM   5027  C  C     . THR B 2 456 ? -24.203 28.002 -51.394 1.00 220.03 ? 973  THR C C     1 
ATOM   5028  O  O     . THR B 2 456 ? -24.506 26.809 -51.466 1.00 221.00 ? 973  THR C O     1 
ATOM   5029  C  CB    . THR B 2 456 ? -23.760 29.527 -53.342 1.00 219.84 ? 973  THR C CB    1 
ATOM   5030  O  OG1   . THR B 2 456 ? -24.426 28.750 -54.345 1.00 222.43 ? 973  THR C OG1   1 
ATOM   5031  C  CG2   . THR B 2 456 ? -22.696 30.398 -53.997 1.00 218.86 ? 973  THR C CG2   1 
ATOM   5032  N  N     . GLY B 2 457 ? -24.782 28.850 -50.549 1.00 221.19 ? 974  GLY C N     1 
ATOM   5033  C  CA    . GLY B 2 457 ? -25.698 28.403 -49.503 1.00 222.82 ? 974  GLY C CA    1 
ATOM   5034  C  C     . GLY B 2 457 ? -27.061 27.935 -49.986 1.00 226.36 ? 974  GLY C C     1 
ATOM   5035  O  O     . GLY B 2 457 ? -27.732 28.630 -50.750 1.00 227.64 ? 974  GLY C O     1 
ATOM   5036  N  N     . ILE B 2 458 ? -27.458 26.745 -49.537 1.00 228.41 ? 975  ILE C N     1 
ATOM   5037  C  CA    . ILE B 2 458 ? -28.817 26.230 -49.731 1.00 231.98 ? 975  ILE C CA    1 
ATOM   5038  C  C     . ILE B 2 458 ? -29.343 25.666 -48.410 1.00 233.30 ? 975  ILE C C     1 
ATOM   5039  O  O     . ILE B 2 458 ? -28.590 25.533 -47.444 1.00 232.01 ? 975  ILE C O     1 
ATOM   5040  C  CB    . ILE B 2 458 ? -28.883 25.146 -50.831 1.00 233.26 ? 975  ILE C CB    1 
ATOM   5041  C  CG1   . ILE B 2 458 ? -27.867 24.028 -50.570 1.00 231.66 ? 975  ILE C CG1   1 
ATOM   5042  C  CG2   . ILE B 2 458 ? -28.638 25.767 -52.199 1.00 233.69 ? 975  ILE C CG2   1 
ATOM   5043  C  CD1   . ILE B 2 458 ? -28.101 22.793 -51.413 1.00 233.48 ? 975  ILE C CD1   1 
ATOM   5044  N  N     . SER B 2 459 ? -30.632 25.336 -48.374 1.00 236.70 ? 976  SER C N     1 
ATOM   5045  C  CA    . SER B 2 459 ? -31.271 24.836 -47.155 1.00 237.89 ? 976  SER C CA    1 
ATOM   5046  C  C     . SER B 2 459 ? -30.747 23.452 -46.766 1.00 238.18 ? 976  SER C C     1 
ATOM   5047  O  O     . SER B 2 459 ? -30.439 22.630 -47.631 1.00 238.58 ? 976  SER C O     1 
ATOM   5048  C  CB    . SER B 2 459 ? -32.791 24.785 -47.330 1.00 241.05 ? 976  SER C CB    1 
ATOM   5049  O  OG    . SER B 2 459 ? -33.436 24.440 -46.116 1.00 241.69 ? 976  SER C OG    1 
ATOM   5050  N  N     . SER B 2 460 ? -30.655 23.209 -45.461 1.00 238.28 ? 977  SER C N     1 
ATOM   5051  C  CA    . SER B 2 460 ? -30.152 21.940 -44.931 1.00 238.84 ? 977  SER C CA    1 
ATOM   5052  C  C     . SER B 2 460 ? -31.257 20.885 -44.878 1.00 242.48 ? 977  SER C C     1 
ATOM   5053  O  O     . SER B 2 460 ? -32.418 21.173 -45.175 1.00 244.79 ? 977  SER C O     1 
ATOM   5054  C  CB    . SER B 2 460 ? -29.558 22.150 -43.535 1.00 236.96 ? 977  SER C CB    1 
ATOM   5055  O  OG    . SER B 2 460 ? -30.530 22.654 -42.635 1.00 237.76 ? 977  SER C OG    1 
ATOM   5056  N  N     . GLY B 2 461 ? -30.885 19.665 -44.498 1.00 243.53 ? 978  GLY C N     1 
ATOM   5057  C  CA    . GLY B 2 461 ? -31.829 18.554 -44.405 1.00 247.07 ? 978  GLY C CA    1 
ATOM   5058  C  C     . GLY B 2 461 ? -32.830 18.676 -43.268 1.00 248.87 ? 978  GLY C C     1 
ATOM   5059  O  O     . GLY B 2 461 ? -33.979 18.253 -43.404 1.00 251.97 ? 978  GLY C O     1 
ATOM   5060  N  N     . VAL B 2 462 ? -32.393 19.251 -42.147 1.00 247.10 ? 979  VAL C N     1 
ATOM   5061  C  CA    . VAL B 2 462 ? -33.238 19.400 -40.958 1.00 248.05 ? 979  VAL C CA    1 
ATOM   5062  C  C     . VAL B 2 462 ? -33.206 20.848 -40.462 1.00 245.76 ? 979  VAL C C     1 
ATOM   5063  O  O     . VAL B 2 462 ? -32.153 21.487 -40.466 1.00 242.84 ? 979  VAL C O     1 
ATOM   5064  C  CB    . VAL B 2 462 ? -32.781 18.449 -39.828 1.00 248.00 ? 979  VAL C CB    1 
ATOM   5065  C  CG1   . VAL B 2 462 ? -33.690 18.573 -38.611 1.00 249.26 ? 979  VAL C CG1   1 
ATOM   5066  C  CG2   . VAL B 2 462 ? -32.742 17.009 -40.327 1.00 250.03 ? 979  VAL C CG2   1 
ATOM   5067  N  N     . ASN B 2 463 ? -34.365 21.351 -40.036 1.00 247.13 ? 980  ASN C N     1 
ATOM   5068  C  CA    . ASN B 2 463 ? -34.519 22.750 -39.622 1.00 245.61 ? 980  ASN C CA    1 
ATOM   5069  C  C     . ASN B 2 463 ? -34.968 22.919 -38.163 1.00 245.76 ? 980  ASN C C     1 
ATOM   5070  O  O     . ASN B 2 463 ? -35.482 23.975 -37.787 1.00 245.62 ? 980  ASN C O     1 
ATOM   5071  C  CB    . ASN B 2 463 ? -35.513 23.457 -40.553 1.00 247.13 ? 980  ASN C CB    1 
ATOM   5072  C  CG    . ASN B 2 463 ? -35.046 23.489 -41.998 1.00 246.58 ? 980  ASN C CG    1 
ATOM   5073  O  OD1   . ASN B 2 463 ? -33.851 23.400 -42.284 1.00 244.01 ? 980  ASN C OD1   1 
ATOM   5074  N  ND2   . ASN B 2 463 ? -35.992 23.627 -42.919 1.00 248.97 ? 980  ASN C ND2   1 
ATOM   5075  N  N     . ASP B 2 464 ? -34.758 21.887 -37.346 1.00 246.00 ? 981  ASP C N     1 
ATOM   5076  C  CA    . ASP B 2 464 ? -35.095 21.930 -35.920 1.00 245.96 ? 981  ASP C CA    1 
ATOM   5077  C  C     . ASP B 2 464 ? -33.846 22.209 -35.079 1.00 242.02 ? 981  ASP C C     1 
ATOM   5078  O  O     . ASP B 2 464 ? -33.660 21.614 -34.014 1.00 242.39 ? 981  ASP C O     1 
ATOM   5079  C  CB    . ASP B 2 464 ? -35.733 20.606 -35.485 1.00 249.24 ? 981  ASP C CB    1 
ATOM   5080  C  CG    . ASP B 2 464 ? -36.933 20.222 -36.335 1.00 253.09 ? 981  ASP C CG    1 
ATOM   5081  O  OD1   . ASP B 2 464 ? -37.111 19.015 -36.600 1.00 255.58 ? 981  ASP C OD1   1 
ATOM   5082  O  OD2   . ASP B 2 464 ? -37.697 21.125 -36.741 1.00 254.24 ? 981  ASP C OD2   1 
ATOM   5083  N  N     . THR B 2 465 ? -33.005 23.125 -35.558 1.00 238.14 ? 982  THR C N     1 
ATOM   5084  C  CA    . THR B 2 465 ? -31.722 23.430 -34.921 1.00 233.96 ? 982  THR C CA    1 
ATOM   5085  C  C     . THR B 2 465 ? -31.681 24.873 -34.421 1.00 230.51 ? 982  THR C C     1 
ATOM   5086  O  O     . THR B 2 465 ? -32.462 25.717 -34.866 1.00 231.10 ? 982  THR C O     1 
ATOM   5087  C  CB    . THR B 2 465 ? -30.538 23.183 -35.888 1.00 232.48 ? 982  THR C CB    1 
ATOM   5088  O  OG1   . THR B 2 465 ? -29.298 23.421 -35.208 1.00 229.93 ? 982  THR C OG1   1 
ATOM   5089  C  CG2   . THR B 2 465 ? -30.619 24.084 -37.127 1.00 232.05 ? 982  THR C CG2   1 
ATOM   5090  N  N     . SER B 2 466 ? -30.762 25.142 -33.495 1.00 226.18 ? 983  SER C N     1 
ATOM   5091  C  CA    . SER B 2 466 ? -30.535 26.494 -32.981 1.00 222.57 ? 983  SER C CA    1 
ATOM   5092  C  C     . SER B 2 466 ? -29.232 27.088 -33.532 1.00 218.44 ? 983  SER C C     1 
ATOM   5093  O  O     . SER B 2 466 ? -28.615 27.947 -32.898 1.00 216.64 ? 983  SER C O     1 
ATOM   5094  C  CB    . SER B 2 466 ? -30.514 26.480 -31.449 1.00 222.01 ? 983  SER C CB    1 
ATOM   5095  O  OG    . SER B 2 466 ? -29.412 25.740 -30.954 1.00 220.70 ? 983  SER C OG    1 
ATOM   5096  N  N     . LEU B 2 467 ? -28.825 26.621 -34.712 1.00 216.69 ? 984  LEU C N     1 
ATOM   5097  C  CA    . LEU B 2 467 ? -27.653 27.141 -35.417 1.00 213.03 ? 984  LEU C CA    1 
ATOM   5098  C  C     . LEU B 2 467 ? -28.062 27.584 -36.818 1.00 211.95 ? 984  LEU C C     1 
ATOM   5099  O  O     . LEU B 2 467 ? -28.862 26.918 -37.476 1.00 213.95 ? 984  LEU C O     1 
ATOM   5100  C  CB    . LEU B 2 467 ? -26.562 26.067 -35.510 1.00 212.66 ? 984  LEU C CB    1 
ATOM   5101  C  CG    . LEU B 2 467 ? -25.527 26.011 -34.383 1.00 211.33 ? 984  LEU C CG    1 
ATOM   5102  C  CD1   . LEU B 2 467 ? -24.761 24.696 -34.427 1.00 211.81 ? 984  LEU C CD1   1 
ATOM   5103  C  CD2   . LEU B 2 467 ? -24.568 27.191 -34.467 1.00 209.08 ? 984  LEU C CD2   1 
ATOM   5104  N  N     . LEU B 2 468 ? -27.514 28.712 -37.266 1.00 208.26 ? 985  LEU C N     1 
ATOM   5105  C  CA    . LEU B 2 468 ? -27.777 29.221 -38.613 1.00 207.27 ? 985  LEU C CA    1 
ATOM   5106  C  C     . LEU B 2 468 ? -26.777 28.669 -39.627 1.00 205.02 ? 985  LEU C C     1 
ATOM   5107  O  O     . LEU B 2 468 ? -27.120 28.474 -40.794 1.00 206.31 ? 985  LEU C O     1 
ATOM   5108  C  CB    . LEU B 2 468 ? -27.750 30.753 -38.634 1.00 206.32 ? 985  LEU C CB    1 
ATOM   5109  C  CG    . LEU B 2 468 ? -28.959 31.463 -38.017 1.00 207.65 ? 985  LEU C CG    1 
ATOM   5110  C  CD1   . LEU B 2 468 ? -28.725 32.966 -37.983 1.00 206.60 ? 985  LEU C CD1   1 
ATOM   5111  C  CD2   . LEU B 2 468 ? -30.239 31.134 -38.775 1.00 210.32 ? 985  LEU C CD2   1 
ATOM   5112  N  N     . TYR B 2 469 ? -25.545 28.426 -39.182 1.00 201.19 ? 986  TYR C N     1 
ATOM   5113  C  CA    . TYR B 2 469 ? -24.492 27.895 -40.050 1.00 198.89 ? 986  TYR C CA    1 
ATOM   5114  C  C     . TYR B 2 469 ? -23.710 26.788 -39.346 1.00 196.58 ? 986  TYR C C     1 
ATOM   5115  O  O     . TYR B 2 469 ? -23.777 26.649 -38.123 1.00 196.01 ? 986  TYR C O     1 
ATOM   5116  C  CB    . TYR B 2 469 ? -23.552 29.019 -40.489 1.00 197.33 ? 986  TYR C CB    1 
ATOM   5117  C  CG    . TYR B 2 469 ? -24.271 30.183 -41.134 1.00 198.11 ? 986  TYR C CG    1 
ATOM   5118  C  CD1   . TYR B 2 469 ? -24.557 30.181 -42.495 1.00 199.38 ? 986  TYR C CD1   1 
ATOM   5119  C  CD2   . TYR B 2 469 ? -24.681 31.279 -40.379 1.00 197.67 ? 986  TYR C CD2   1 
ATOM   5120  C  CE1   . TYR B 2 469 ? -25.221 31.241 -43.090 1.00 200.30 ? 986  TYR C CE1   1 
ATOM   5121  C  CE2   . TYR B 2 469 ? -25.346 32.344 -40.964 1.00 198.55 ? 986  TYR C CE2   1 
ATOM   5122  C  CZ    . TYR B 2 469 ? -25.613 32.321 -42.320 1.00 199.90 ? 986  TYR C CZ    1 
ATOM   5123  O  OH    . TYR B 2 469 ? -26.273 33.375 -42.908 1.00 201.21 ? 986  TYR C OH    1 
ATOM   5124  N  N     . ASN B 2 470 ? -22.967 26.010 -40.128 1.00 194.53 ? 987  ASN C N     1 
ATOM   5125  C  CA    . ASN B 2 470 ? -22.297 24.812 -39.619 1.00 192.79 ? 987  ASN C CA    1 
ATOM   5126  C  C     . ASN B 2 470 ? -21.076 25.106 -38.749 1.00 189.44 ? 987  ASN C C     1 
ATOM   5127  O  O     . ASN B 2 470 ? -20.372 26.095 -38.960 1.00 187.60 ? 987  ASN C O     1 
ATOM   5128  C  CB    . ASN B 2 470 ? -21.879 23.895 -40.774 1.00 193.09 ? 987  ASN C CB    1 
ATOM   5129  C  CG    . ASN B 2 470 ? -23.064 23.329 -41.537 1.00 195.05 ? 987  ASN C CG    1 
ATOM   5130  O  OD1   . ASN B 2 470 ? -24.221 23.603 -41.214 1.00 195.72 ? 987  ASN C OD1   1 
ATOM   5131  N  ND2   . ASN B 2 470 ? -22.777 22.531 -42.560 1.00 195.85 ? 987  ASN C ND2   1 
ATOM   5132  N  N     . GLU B 2 471 ? -20.846 24.231 -37.771 1.00 187.89 ? 988  GLU C N     1 
ATOM   5133  C  CA    . GLU B 2 471 ? -19.642 24.259 -36.944 1.00 185.10 ? 988  GLU C CA    1 
ATOM   5134  C  C     . GLU B 2 471 ? -19.009 22.872 -36.939 1.00 184.51 ? 988  GLU C C     1 
ATOM   5135  O  O     . GLU B 2 471 ? -19.711 21.868 -36.812 1.00 186.22 ? 988  GLU C O     1 
ATOM   5136  C  CB    . GLU B 2 471 ? -19.976 24.675 -35.512 1.00 184.81 ? 988  GLU C CB    1 
ATOM   5137  C  CG    . GLU B 2 471 ? -20.531 26.084 -35.387 1.00 183.99 ? 988  GLU C CG    1 
ATOM   5138  C  CD    . GLU B 2 471 ? -20.636 26.557 -33.948 1.00 183.56 ? 988  GLU C CD    1 
ATOM   5139  O  OE1   . GLU B 2 471 ? -20.720 25.706 -33.036 1.00 184.24 ? 988  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU B 2 471 ? -20.639 27.786 -33.728 1.00 183.08 ? 988  GLU C OE2   1 
ATOM   5141  N  N     . TYR B 2 472 ? -17.686 22.824 -37.080 1.00 181.92 ? 989  TYR C N     1 
ATOM   5142  C  CA    . TYR B 2 472 ? -16.942 21.567 -37.075 1.00 181.81 ? 989  TYR C CA    1 
ATOM   5143  C  C     . TYR B 2 472 ? -15.947 21.572 -35.923 1.00 179.72 ? 989  TYR C C     1 
ATOM   5144  O  O     . TYR B 2 472 ? -15.082 22.446 -35.849 1.00 178.00 ? 989  TYR C O     1 
ATOM   5145  C  CB    . TYR B 2 472 ? -16.215 21.378 -38.404 1.00 181.93 ? 989  TYR C CB    1 
ATOM   5146  C  CG    . TYR B 2 472 ? -17.142 21.332 -39.595 1.00 183.03 ? 989  TYR C CG    1 
ATOM   5147  C  CD1   . TYR B 2 472 ? -17.286 22.431 -40.436 1.00 182.23 ? 989  TYR C CD1   1 
ATOM   5148  C  CD2   . TYR B 2 472 ? -17.885 20.192 -39.873 1.00 184.93 ? 989  TYR C CD2   1 
ATOM   5149  C  CE1   . TYR B 2 472 ? -18.139 22.390 -41.527 1.00 183.32 ? 989  TYR C CE1   1 
ATOM   5150  C  CE2   . TYR B 2 472 ? -18.742 20.140 -40.960 1.00 186.07 ? 989  TYR C CE2   1 
ATOM   5151  C  CZ    . TYR B 2 472 ? -18.865 21.242 -41.785 1.00 185.32 ? 989  TYR C CZ    1 
ATOM   5152  O  OH    . TYR B 2 472 ? -19.715 21.198 -42.866 1.00 186.59 ? 989  TYR C OH    1 
ATOM   5153  N  N     . ILE B 2 473 ? -16.070 20.589 -35.033 1.00 179.46 ? 990  ILE C N     1 
ATOM   5154  C  CA    . ILE B 2 473 ? -15.325 20.579 -33.778 1.00 177.73 ? 990  ILE C CA    1 
ATOM   5155  C  C     . ILE B 2 473 ? -14.475 19.317 -33.657 1.00 177.75 ? 990  ILE C C     1 
ATOM   5156  O  O     . ILE B 2 473 ? -14.969 18.207 -33.861 1.00 179.06 ? 990  ILE C O     1 
ATOM   5157  C  CB    . ILE B 2 473 ? -16.267 20.672 -32.555 1.00 178.07 ? 990  ILE C CB    1 
ATOM   5158  C  CG1   . ILE B 2 473 ? -17.358 21.731 -32.778 1.00 177.40 ? 990  ILE C CG1   1 
ATOM   5159  C  CG2   . ILE B 2 473 ? -15.475 20.997 -31.294 1.00 177.20 ? 990  ILE C CG2   1 
ATOM   5160  C  CD1   . ILE B 2 473 ? -18.581 21.233 -33.522 1.00 179.05 ? 990  ILE C CD1   1 
ATOM   5161  N  N     . VAL B 2 474 ? -13.199 19.503 -33.324 1.00 175.87 ? 991  VAL C N     1 
ATOM   5162  C  CA    . VAL B 2 474 ? -12.283 18.395 -33.054 1.00 176.30 ? 991  VAL C CA    1 
ATOM   5163  C  C     . VAL B 2 474 ? -11.724 18.535 -31.639 1.00 175.72 ? 991  VAL C C     1 
ATOM   5164  O  O     . VAL B 2 474 ? -11.378 19.636 -31.207 1.00 174.34 ? 991  VAL C O     1 
ATOM   5165  C  CB    . VAL B 2 474 ? -11.129 18.313 -34.085 1.00 175.78 ? 991  VAL C CB    1 
ATOM   5166  C  CG1   . VAL B 2 474 ? -11.660 17.872 -35.441 1.00 176.46 ? 991  VAL C CG1   1 
ATOM   5167  C  CG2   . VAL B 2 474 ? -10.379 19.633 -34.210 1.00 173.75 ? 991  VAL C CG2   1 
ATOM   5168  N  N     . TYR B 2 475 ? -11.647 17.415 -30.924 1.00 176.96 ? 992  TYR C N     1 
ATOM   5169  C  CA    . TYR B 2 475 ? -11.219 17.407 -29.525 1.00 177.05 ? 992  TYR C CA    1 
ATOM   5170  C  C     . TYR B 2 475 ? -9.852  16.745 -29.387 1.00 178.21 ? 992  TYR C C     1 
ATOM   5171  O  O     . TYR B 2 475 ? -9.611  15.953 -28.473 1.00 180.08 ? 992  TYR C O     1 
ATOM   5172  C  CB    . TYR B 2 475 ? -12.272 16.704 -28.667 1.00 178.47 ? 992  TYR C CB    1 
ATOM   5173  C  CG    . TYR B 2 475 ? -13.635 17.341 -28.799 1.00 177.65 ? 992  TYR C CG    1 
ATOM   5174  C  CD1   . TYR B 2 475 ? -14.503 16.966 -29.818 1.00 178.29 ? 992  TYR C CD1   1 
ATOM   5175  C  CD2   . TYR B 2 475 ? -14.044 18.339 -27.923 1.00 176.67 ? 992  TYR C CD2   1 
ATOM   5176  C  CE1   . TYR B 2 475 ? -15.747 17.556 -29.952 1.00 178.07 ? 992  TYR C CE1   1 
ATOM   5177  C  CE2   . TYR B 2 475 ? -15.288 18.936 -28.047 1.00 176.48 ? 992  TYR C CE2   1 
ATOM   5178  C  CZ    . TYR B 2 475 ? -16.135 18.541 -29.064 1.00 177.18 ? 992  TYR C CZ    1 
ATOM   5179  O  OH    . TYR B 2 475 ? -17.372 19.128 -29.197 1.00 177.22 ? 992  TYR C OH    1 
ATOM   5180  N  N     . ASP B 2 476 ? -8.960  17.094 -30.310 1.00 177.68 ? 993  ASP C N     1 
ATOM   5181  C  CA    . ASP B 2 476 ? -7.599  16.583 -30.331 1.00 178.95 ? 993  ASP C CA    1 
ATOM   5182  C  C     . ASP B 2 476 ? -6.788  17.446 -31.293 1.00 177.66 ? 993  ASP C C     1 
ATOM   5183  O  O     . ASP B 2 476 ? -7.150  17.580 -32.463 1.00 177.51 ? 993  ASP C O     1 
ATOM   5184  C  CB    . ASP B 2 476 ? -7.584  15.117 -30.782 1.00 181.34 ? 993  ASP C CB    1 
ATOM   5185  C  CG    . ASP B 2 476 ? -6.189  14.509 -30.779 1.00 182.62 ? 993  ASP C CG    1 
ATOM   5186  O  OD1   . ASP B 2 476 ? -5.313  14.991 -30.029 1.00 182.41 ? 993  ASP C OD1   1 
ATOM   5187  O  OD2   . ASP B 2 476 ? -5.975  13.534 -31.530 1.00 184.25 ? 993  ASP C OD2   1 
ATOM   5188  N  N     . ILE B 2 477 ? -5.700  18.030 -30.797 1.00 177.09 ? 994  ILE C N     1 
ATOM   5189  C  CA    . ILE B 2 477 ? -4.859  18.924 -31.606 1.00 175.78 ? 994  ILE C CA    1 
ATOM   5190  C  C     . ILE B 2 477 ? -4.172  18.221 -32.783 1.00 176.54 ? 994  ILE C C     1 
ATOM   5191  O  O     . ILE B 2 477 ? -3.676  18.881 -33.697 1.00 175.64 ? 994  ILE C O     1 
ATOM   5192  C  CB    . ILE B 2 477 ? -3.785  19.645 -30.753 1.00 175.41 ? 994  ILE C CB    1 
ATOM   5193  C  CG1   . ILE B 2 477 ? -2.845  18.639 -30.072 1.00 177.46 ? 994  ILE C CG1   1 
ATOM   5194  C  CG2   . ILE B 2 477 ? -4.447  20.546 -29.719 1.00 174.24 ? 994  ILE C CG2   1 
ATOM   5195  C  CD1   . ILE B 2 477 ? -1.646  19.281 -29.408 1.00 177.39 ? 994  ILE C CD1   1 
ATOM   5196  N  N     . ALA B 2 478 ? -4.137  16.890 -32.752 1.00 178.22 ? 995  ALA C N     1 
ATOM   5197  C  CA    . ALA B 2 478 ? -3.527  16.105 -33.821 1.00 179.16 ? 995  ALA C CA    1 
ATOM   5198  C  C     . ALA B 2 478 ? -4.409  15.984 -35.067 1.00 178.63 ? 995  ALA C C     1 
ATOM   5199  O  O     . ALA B 2 478 ? -3.894  15.776 -36.166 1.00 178.92 ? 995  ALA C O     1 
ATOM   5200  C  CB    . ALA B 2 478 ? -3.151  14.723 -33.307 1.00 181.70 ? 995  ALA C CB    1 
ATOM   5201  N  N     . GLN B 2 479 ? -5.726  16.109 -34.898 1.00 177.98 ? 996  GLN C N     1 
ATOM   5202  C  CA    . GLN B 2 479 ? -6.664  15.973 -36.020 1.00 177.80 ? 996  GLN C CA    1 
ATOM   5203  C  C     . GLN B 2 479 ? -6.593  17.125 -37.027 1.00 176.42 ? 996  GLN C C     1 
ATOM   5204  O  O     . GLN B 2 479 ? -6.999  16.962 -38.178 1.00 176.87 ? 996  GLN C O     1 
ATOM   5205  C  CB    . GLN B 2 479 ? -8.105  15.815 -35.515 1.00 177.79 ? 996  GLN C CB    1 
ATOM   5206  C  CG    . GLN B 2 479 ? -8.380  14.469 -34.862 1.00 179.94 ? 996  GLN C CG    1 
ATOM   5207  C  CD    . GLN B 2 479 ? -9.847  14.082 -34.891 1.00 180.61 ? 996  GLN C CD    1 
ATOM   5208  O  OE1   . GLN B 2 479 ? -10.206 13.013 -35.383 1.00 182.62 ? 996  GLN C OE1   1 
ATOM   5209  N  NE2   . GLN B 2 479 ? -10.702 14.949 -34.365 1.00 179.30 ? 996  GLN C NE2   1 
ATOM   5210  N  N     . VAL B 2 480 ? -6.086  18.280 -36.597 1.00 175.22 ? 997  VAL C N     1 
ATOM   5211  C  CA    . VAL B 2 480 ? -5.943  19.438 -37.486 1.00 173.86 ? 997  VAL C CA    1 
ATOM   5212  C  C     . VAL B 2 480 ? -4.584  19.439 -38.193 1.00 174.23 ? 997  VAL C C     1 
ATOM   5213  O  O     . VAL B 2 480 ? -3.573  19.022 -37.625 1.00 174.44 ? 997  VAL C O     1 
ATOM   5214  C  CB    . VAL B 2 480 ? -6.166  20.783 -36.742 1.00 172.30 ? 997  VAL C CB    1 
ATOM   5215  C  CG1   . VAL B 2 480 ? -5.175  20.979 -35.600 1.00 172.16 ? 997  VAL C CG1   1 
ATOM   5216  C  CG2   . VAL B 2 480 ? -6.093  21.955 -37.713 1.00 171.17 ? 997  VAL C CG2   1 
ATOM   5217  N  N     . ASN B 2 481 ? -4.587  19.902 -39.441 1.00 174.53 ? 998  ASN C N     1 
ATOM   5218  C  CA    . ASN B 2 481 ? -3.367  20.119 -40.213 1.00 175.57 ? 998  ASN C CA    1 
ATOM   5219  C  C     . ASN B 2 481 ? -3.527  21.371 -41.072 1.00 175.02 ? 998  ASN C C     1 
ATOM   5220  O  O     . ASN B 2 481 ? -4.220  21.349 -42.091 1.00 175.07 ? 998  ASN C O     1 
ATOM   5221  C  CB    . ASN B 2 481 ? -3.065  18.901 -41.090 1.00 177.36 ? 998  ASN C CB    1 
ATOM   5222  C  CG    . ASN B 2 481 ? -1.797  19.067 -41.914 1.00 177.82 ? 998  ASN C CG    1 
ATOM   5223  O  OD1   . ASN B 2 481 ? -0.815  19.650 -41.453 1.00 177.73 ? 998  ASN C OD1   1 
ATOM   5224  N  ND2   . ASN B 2 481 ? -1.811  18.546 -43.137 1.00 178.56 ? 998  ASN C ND2   1 
ATOM   5225  N  N     . LEU B 2 482 ? -2.891  22.462 -40.649 1.00 174.95 ? 999  LEU C N     1 
ATOM   5226  C  CA    . LEU B 2 482 ? -3.052  23.758 -41.306 1.00 174.49 ? 999  LEU C CA    1 
ATOM   5227  C  C     . LEU B 2 482 ? -2.433  23.756 -42.704 1.00 175.62 ? 999  LEU C C     1 
ATOM   5228  O  O     . LEU B 2 482 ? -1.264  23.405 -42.871 1.00 176.17 ? 999  LEU C O     1 
ATOM   5229  C  CB    . LEU B 2 482 ? -2.427  24.872 -40.459 1.00 173.59 ? 999  LEU C CB    1 
ATOM   5230  C  CG    . LEU B 2 482 ? -2.950  25.051 -39.030 1.00 172.82 ? 999  LEU C CG    1 
ATOM   5231  C  CD1   . LEU B 2 482 ? -2.172  26.149 -38.322 1.00 172.10 ? 999  LEU C CD1   1 
ATOM   5232  C  CD2   . LEU B 2 482 ? -4.440  25.360 -39.023 1.00 172.19 ? 999  LEU C CD2   1 
ATOM   5233  N  N     . LYS B 2 483 ? -3.229  24.153 -43.696 1.00 176.28 ? 1000 LYS C N     1 
ATOM   5234  C  CA    . LYS B 2 483 ? -2.807  24.142 -45.098 1.00 177.69 ? 1000 LYS C CA    1 
ATOM   5235  C  C     . LYS B 2 483 ? -2.496  25.547 -45.606 1.00 177.74 ? 1000 LYS C C     1 
ATOM   5236  O  O     . LYS B 2 483 ? -1.386  25.805 -46.076 1.00 178.35 ? 1000 LYS C O     1 
ATOM   5237  C  CB    . LYS B 2 483 ? -3.884  23.494 -45.977 1.00 178.34 ? 1000 LYS C CB    1 
ATOM   5238  C  CG    . LYS B 2 483 ? -3.755  21.984 -46.115 1.00 179.77 ? 1000 LYS C CG    1 
ATOM   5239  C  CD    . LYS B 2 483 ? -2.649  21.601 -47.088 1.00 180.75 ? 1000 LYS C CD    1 
ATOM   5240  C  CE    . LYS B 2 483 ? -2.651  20.110 -47.387 1.00 182.04 ? 1000 LYS C CE    1 
ATOM   5241  N  NZ    . LYS B 2 483 ? -2.290  19.290 -46.197 1.00 182.53 ? 1000 LYS C NZ    1 
ATOM   5242  N  N     . TYR B 2 484 ? -3.474  26.447 -45.512 1.00 177.50 ? 1001 TYR C N     1 
ATOM   5243  C  CA    . TYR B 2 484 ? -3.334  27.802 -46.051 1.00 177.49 ? 1001 TYR C CA    1 
ATOM   5244  C  C     . TYR B 2 484 ? -3.614  28.886 -45.009 1.00 176.71 ? 1001 TYR C C     1 
ATOM   5245  O  O     . TYR B 2 484 ? -4.492  28.733 -44.158 1.00 175.97 ? 1001 TYR C O     1 
ATOM   5246  C  CB    . TYR B 2 484 ? -4.267  28.002 -47.251 1.00 178.00 ? 1001 TYR C CB    1 
ATOM   5247  C  CG    . TYR B 2 484 ? -4.155  26.931 -48.316 1.00 179.29 ? 1001 TYR C CG    1 
ATOM   5248  C  CD1   . TYR B 2 484 ? -5.155  25.974 -48.478 1.00 179.87 ? 1001 TYR C CD1   1 
ATOM   5249  C  CD2   . TYR B 2 484 ? -3.051  26.876 -49.161 1.00 179.99 ? 1001 TYR C CD2   1 
ATOM   5250  C  CE1   . TYR B 2 484 ? -5.057  24.994 -49.453 1.00 180.94 ? 1001 TYR C CE1   1 
ATOM   5251  C  CE2   . TYR B 2 484 ? -2.944  25.900 -50.138 1.00 181.04 ? 1001 TYR C CE2   1 
ATOM   5252  C  CZ    . TYR B 2 484 ? -3.948  24.961 -50.280 1.00 181.58 ? 1001 TYR C CZ    1 
ATOM   5253  O  OH    . TYR B 2 484 ? -3.843  23.991 -51.250 1.00 183.18 ? 1001 TYR C OH    1 
ATOM   5254  N  N     . LEU B 2 485 ? -2.850  29.976 -45.091 1.00 176.96 ? 1002 LEU C N     1 
ATOM   5255  C  CA    . LEU B 2 485 ? -3.081  31.182 -44.297 1.00 176.56 ? 1002 LEU C CA    1 
ATOM   5256  C  C     . LEU B 2 485 ? -3.408  32.319 -45.264 1.00 177.04 ? 1002 LEU C C     1 
ATOM   5257  O  O     . LEU B 2 485 ? -2.641  32.587 -46.190 1.00 177.81 ? 1002 LEU C O     1 
ATOM   5258  C  CB    . LEU B 2 485 ? -1.833  31.532 -43.477 1.00 176.49 ? 1002 LEU C CB    1 
ATOM   5259  C  CG    . LEU B 2 485 ? -1.988  32.364 -42.195 1.00 175.39 ? 1002 LEU C CG    1 
ATOM   5260  C  CD1   . LEU B 2 485 ? -0.622  32.829 -41.709 1.00 175.53 ? 1002 LEU C CD1   1 
ATOM   5261  C  CD2   . LEU B 2 485 ? -2.910  33.560 -42.375 1.00 174.66 ? 1002 LEU C CD2   1 
ATOM   5262  N  N     . LEU B 2 486 ? -4.544  32.978 -45.054 1.00 176.81 ? 1003 LEU C N     1 
ATOM   5263  C  CA    . LEU B 2 486 ? -4.975  34.073 -45.923 1.00 177.42 ? 1003 LEU C CA    1 
ATOM   5264  C  C     . LEU B 2 486 ? -4.846  35.425 -45.225 1.00 177.48 ? 1003 LEU C C     1 
ATOM   5265  O  O     . LEU B 2 486 ? -4.834  35.501 -43.996 1.00 177.00 ? 1003 LEU C O     1 
ATOM   5266  C  CB    . LEU B 2 486 ? -6.424  33.865 -46.368 1.00 177.41 ? 1003 LEU C CB    1 
ATOM   5267  C  CG    . LEU B 2 486 ? -6.714  32.766 -47.392 1.00 178.08 ? 1003 LEU C CG    1 
ATOM   5268  C  CD1   . LEU B 2 486 ? -6.625  31.376 -46.778 1.00 177.91 ? 1003 LEU C CD1   1 
ATOM   5269  C  CD2   . LEU B 2 486 ? -8.090  32.996 -47.999 1.00 178.53 ? 1003 LEU C CD2   1 
ATOM   5270  N  N     . LYS B 2 487 ? -4.748  36.483 -46.027 1.00 178.53 ? 1004 LYS C N     1 
ATOM   5271  C  CA    . LYS B 2 487 ? -4.720  37.859 -45.534 1.00 178.75 ? 1004 LYS C CA    1 
ATOM   5272  C  C     . LYS B 2 487 ? -5.842  38.640 -46.215 1.00 180.18 ? 1004 LYS C C     1 
ATOM   5273  O  O     . LYS B 2 487 ? -5.834  38.808 -47.436 1.00 182.11 ? 1004 LYS C O     1 
ATOM   5274  C  CB    . LYS B 2 487 ? -3.365  38.502 -45.829 1.00 179.21 ? 1004 LYS C CB    1 
ATOM   5275  C  CG    . LYS B 2 487 ? -3.196  39.900 -45.252 1.00 179.12 ? 1004 LYS C CG    1 
ATOM   5276  C  CD    . LYS B 2 487 ? -1.879  40.531 -45.677 1.00 180.04 ? 1004 LYS C CD    1 
ATOM   5277  C  CE    . LYS B 2 487 ? -0.691  39.889 -44.978 1.00 179.86 ? 1004 LYS C CE    1 
ATOM   5278  N  NZ    . LYS B 2 487 ? 0.581   40.599 -45.286 1.00 180.85 ? 1004 LYS C NZ    1 
ATOM   5279  N  N     . LEU B 2 488 ? -6.799  39.116 -45.420 1.00 180.41 ? 1005 LEU C N     1 
ATOM   5280  C  CA    . LEU B 2 488 ? -8.055  39.652 -45.945 1.00 181.85 ? 1005 LEU C CA    1 
ATOM   5281  C  C     . LEU B 2 488 ? -8.280  41.109 -45.551 1.00 183.01 ? 1005 LEU C C     1 
ATOM   5282  O  O     . LEU B 2 488 ? -8.143  41.468 -44.381 1.00 182.39 ? 1005 LEU C O     1 
ATOM   5283  C  CB    . LEU B 2 488 ? -9.233  38.815 -45.436 1.00 181.23 ? 1005 LEU C CB    1 
ATOM   5284  C  CG    . LEU B 2 488 ? -9.302  37.344 -45.861 1.00 181.30 ? 1005 LEU C CG    1 
ATOM   5285  C  CD1   . LEU B 2 488 ? -8.357  36.474 -45.047 1.00 180.35 ? 1005 LEU C CD1   1 
ATOM   5286  C  CD2   . LEU B 2 488 ? -10.724 36.818 -45.727 1.00 181.64 ? 1005 LEU C CD2   1 
ATOM   5287  N  N     . LYS B 2 489 ? -8.629  41.938 -46.535 1.00 185.60 ? 1006 LYS C N     1 
ATOM   5288  C  CA    . LYS B 2 489 ? -9.073  43.308 -46.281 1.00 187.10 ? 1006 LYS C CA    1 
ATOM   5289  C  C     . LYS B 2 489 ? -10.593 43.321 -46.159 1.00 188.36 ? 1006 LYS C C     1 
ATOM   5290  O  O     . LYS B 2 489 ? -11.290 42.684 -46.951 1.00 189.35 ? 1006 LYS C O     1 
ATOM   5291  C  CB    . LYS B 2 489 ? -8.644  44.246 -47.412 1.00 188.77 ? 1006 LYS C CB    1 
ATOM   5292  C  CG    . LYS B 2 489 ? -8.793  45.723 -47.073 1.00 189.55 ? 1006 LYS C CG    1 
ATOM   5293  C  CD    . LYS B 2 489 ? -8.710  46.601 -48.310 1.00 191.59 ? 1006 LYS C CD    1 
ATOM   5294  C  CE    . LYS B 2 489 ? -9.014  48.052 -47.974 1.00 192.23 ? 1006 LYS C CE    1 
ATOM   5295  N  NZ    . LYS B 2 489 ? -9.033  48.915 -49.187 1.00 194.45 ? 1006 LYS C NZ    1 
ATOM   5296  N  N     . PHE B 2 490 ? -11.097 44.053 -45.170 1.00 189.16 ? 1007 PHE C N     1 
ATOM   5297  C  CA    . PHE B 2 490 ? -12.534 44.163 -44.931 1.00 190.78 ? 1007 PHE C CA    1 
ATOM   5298  C  C     . PHE B 2 490 ? -13.041 45.522 -45.407 1.00 193.91 ? 1007 PHE C C     1 
ATOM   5299  O  O     . PHE B 2 490 ? -12.454 46.556 -45.080 1.00 193.97 ? 1007 PHE C O     1 
ATOM   5300  C  CB    . PHE B 2 490 ? -12.839 43.988 -43.441 1.00 189.09 ? 1007 PHE C CB    1 
ATOM   5301  C  CG    . PHE B 2 490 ? -12.593 42.593 -42.928 1.00 187.87 ? 1007 PHE C CG    1 
ATOM   5302  C  CD1   . PHE B 2 490 ? -11.301 42.119 -42.746 1.00 186.88 ? 1007 PHE C CD1   1 
ATOM   5303  C  CD2   . PHE B 2 490 ? -13.656 41.758 -42.613 1.00 187.70 ? 1007 PHE C CD2   1 
ATOM   5304  C  CE1   . PHE B 2 490 ? -11.073 40.838 -42.271 1.00 185.92 ? 1007 PHE C CE1   1 
ATOM   5305  C  CE2   . PHE B 2 490 ? -13.436 40.476 -42.136 1.00 186.69 ? 1007 PHE C CE2   1 
ATOM   5306  C  CZ    . PHE B 2 490 ? -12.143 40.015 -41.965 1.00 185.93 ? 1007 PHE C CZ    1 
ATOM   5307  N  N     . ASN B 2 491 ? -14.126 45.513 -46.180 1.00 197.35 ? 1008 ASN C N     1 
ATOM   5308  C  CA    . ASN B 2 491 ? -14.750 46.742 -46.670 1.00 200.51 ? 1008 ASN C CA    1 
ATOM   5309  C  C     . ASN B 2 491 ? -16.136 46.940 -46.057 1.00 202.41 ? 1008 ASN C C     1 
ATOM   5310  O  O     . ASN B 2 491 ? -17.089 46.247 -46.417 1.00 203.76 ? 1008 ASN C O     1 
ATOM   5311  C  CB    . ASN B 2 491 ? -14.842 46.728 -48.198 1.00 202.49 ? 1008 ASN C CB    1 
ATOM   5312  C  CG    . ASN B 2 491 ? -13.511 47.031 -48.863 1.00 202.74 ? 1008 ASN C CG    1 
ATOM   5313  O  OD1   . ASN B 2 491 ? -12.552 46.272 -48.728 1.00 201.42 ? 1008 ASN C OD1   1 
ATOM   5314  N  ND2   . ASN B 2 491 ? -13.448 48.143 -49.590 1.00 204.59 ? 1008 ASN C ND2   1 
ATOM   5315  N  N     . PHE B 2 492 ? -16.232 47.896 -45.136 1.00 203.83 ? 1009 PHE C N     1 
ATOM   5316  C  CA    . PHE B 2 492 ? -17.472 48.182 -44.417 1.00 205.68 ? 1009 PHE C CA    1 
ATOM   5317  C  C     . PHE B 2 492 ? -18.227 49.307 -45.125 1.00 209.01 ? 1009 PHE C C     1 
ATOM   5318  O  O     . PHE B 2 492 ? -17.807 49.766 -46.190 1.00 210.54 ? 1009 PHE C O     1 
ATOM   5319  C  CB    . PHE B 2 492 ? -17.165 48.591 -42.970 1.00 204.43 ? 1009 PHE C CB    1 
ATOM   5320  C  CG    . PHE B 2 492 ? -16.283 47.620 -42.231 1.00 202.93 ? 1009 PHE C CG    1 
ATOM   5321  C  CD1   . PHE B 2 492 ? -16.835 46.618 -41.443 1.00 202.46 ? 1009 PHE C CD1   1 
ATOM   5322  C  CD2   . PHE B 2 492 ? -14.899 47.714 -42.314 1.00 202.32 ? 1009 PHE C CD2   1 
ATOM   5323  C  CE1   . PHE B 2 492 ? -16.024 45.726 -40.759 1.00 201.10 ? 1009 PHE C CE1   1 
ATOM   5324  C  CE2   . PHE B 2 492 ? -14.083 46.825 -41.634 1.00 201.01 ? 1009 PHE C CE2   1 
ATOM   5325  C  CZ    . PHE B 2 492 ? -14.646 45.829 -40.855 1.00 200.34 ? 1009 PHE C CZ    1 
ATOM   5326  N  N     . LYS B 2 493 ? -19.343 49.738 -44.538 1.00 210.84 ? 1010 LYS C N     1 
ATOM   5327  C  CA    . LYS B 2 493 ? -20.078 50.906 -45.024 1.00 213.83 ? 1010 LYS C CA    1 
ATOM   5328  C  C     . LYS B 2 493 ? -20.444 51.826 -43.858 1.00 213.72 ? 1010 LYS C C     1 
ATOM   5329  O  O     . LYS B 2 493 ? -21.429 51.591 -43.156 1.00 213.48 ? 1010 LYS C O     1 
ATOM   5330  C  CB    . LYS B 2 493 ? -21.336 50.477 -45.792 1.00 216.22 ? 1010 LYS C CB    1 
ATOM   5331  C  CG    . LYS B 2 493 ? -22.201 51.624 -46.310 1.00 218.98 ? 1010 LYS C CG    1 
ATOM   5332  C  CD    . LYS B 2 493 ? -21.459 52.518 -47.294 1.00 220.41 ? 1010 LYS C CD    1 
ATOM   5333  C  CE    . LYS B 2 493 ? -22.272 53.752 -47.657 1.00 223.14 ? 1010 LYS C CE    1 
ATOM   5334  N  NZ    . LYS B 2 493 ? -23.483 53.430 -48.460 1.00 225.54 ? 1010 LYS C NZ    1 
ATOM   5335  N  N     . THR B 2 494 ? -19.635 52.866 -43.658 1.00 214.33 ? 1011 THR C N     1 
ATOM   5336  C  CA    . THR B 2 494 ? -19.876 53.865 -42.615 1.00 214.79 ? 1011 THR C CA    1 
ATOM   5337  C  C     . THR B 2 494 ? -19.489 55.259 -43.104 1.00 216.44 ? 1011 THR C C     1 
ATOM   5338  O  O     . THR B 2 494 ? -19.803 56.262 -42.464 1.00 217.15 ? 1011 THR C O     1 
ATOM   5339  C  CB    . THR B 2 494 ? -19.079 53.552 -41.332 1.00 212.63 ? 1011 THR C CB    1 
ATOM   5340  O  OG1   . THR B 2 494 ? -17.714 53.270 -41.668 1.00 212.00 ? 1011 THR C OG1   1 
ATOM   5341  C  CG2   . THR B 2 494 ? -19.679 52.359 -40.600 1.00 211.56 ? 1011 THR C CG2   1 
ATOM   5342  N  N     . ASP C 1 6   ? 51.704  66.350 79.392  1.00 200.08 ? 6    ASP D N     1 
ATOM   5343  C  CA    . ASP C 1 6   ? 52.943  66.175 80.206  1.00 201.82 ? 6    ASP D CA    1 
ATOM   5344  C  C     . ASP C 1 6   ? 53.567  67.528 80.544  1.00 199.94 ? 6    ASP D C     1 
ATOM   5345  O  O     . ASP C 1 6   ? 53.861  67.812 81.707  1.00 200.21 ? 6    ASP D O     1 
ATOM   5346  C  CB    . ASP C 1 6   ? 53.954  65.301 79.453  1.00 204.33 ? 6    ASP D CB    1 
ATOM   5347  C  CG    . ASP C 1 6   ? 55.132  64.881 80.319  1.00 207.34 ? 6    ASP D CG    1 
ATOM   5348  O  OD1   . ASP C 1 6   ? 54.924  64.554 81.507  1.00 208.87 ? 6    ASP D OD1   1 
ATOM   5349  O  OD2   . ASP C 1 6   ? 56.271  64.867 79.804  1.00 208.77 ? 6    ASP D OD2   1 
ATOM   5350  N  N     . LYS C 1 7   ? 53.758  68.357 79.520  1.00 197.98 ? 7    LYS D N     1 
ATOM   5351  C  CA    . LYS C 1 7   ? 54.364  69.677 79.685  1.00 197.00 ? 7    LYS D CA    1 
ATOM   5352  C  C     . LYS C 1 7   ? 53.320  70.693 80.143  1.00 195.09 ? 7    LYS D C     1 
ATOM   5353  O  O     . LYS C 1 7   ? 52.117  70.462 80.009  1.00 194.82 ? 7    LYS D O     1 
ATOM   5354  C  CB    . LYS C 1 7   ? 54.987  70.154 78.369  1.00 197.21 ? 7    LYS D CB    1 
ATOM   5355  C  CG    . LYS C 1 7   ? 55.969  69.184 77.723  1.00 199.16 ? 7    LYS D CG    1 
ATOM   5356  C  CD    . LYS C 1 7   ? 57.195  68.937 78.589  1.00 200.82 ? 7    LYS D CD    1 
ATOM   5357  C  CE    . LYS C 1 7   ? 58.427  68.654 77.742  1.00 202.51 ? 7    LYS D CE    1 
ATOM   5358  N  NZ    . LYS C 1 7   ? 58.943  69.883 77.074  1.00 201.99 ? 7    LYS D NZ    1 
ATOM   5359  N  N     . LEU C 1 8   ? 53.789  71.819 80.677  1.00 194.60 ? 8    LEU D N     1 
ATOM   5360  C  CA    . LEU C 1 8   ? 52.902  72.908 81.090  1.00 193.90 ? 8    LEU D CA    1 
ATOM   5361  C  C     . LEU C 1 8   ? 52.444  73.726 79.885  1.00 192.89 ? 8    LEU D C     1 
ATOM   5362  O  O     . LEU C 1 8   ? 51.261  74.042 79.759  1.00 192.50 ? 8    LEU D O     1 
ATOM   5363  C  CB    . LEU C 1 8   ? 53.598  73.820 82.110  1.00 195.21 ? 8    LEU D CB    1 
ATOM   5364  C  CG    . LEU C 1 8   ? 52.856  75.088 82.558  1.00 195.61 ? 8    LEU D CG    1 
ATOM   5365  C  CD1   . LEU C 1 8   ? 51.440  74.785 83.029  1.00 195.18 ? 8    LEU D CD1   1 
ATOM   5366  C  CD2   . LEU C 1 8   ? 53.638  75.794 83.655  1.00 197.61 ? 8    LEU D CD2   1 
ATOM   5367  N  N     . TYR C 1 9   ? 53.385  74.065 79.005  1.00 192.89 ? 9    TYR D N     1 
ATOM   5368  C  CA    . TYR C 1 9   ? 53.102  74.914 77.846  1.00 192.77 ? 9    TYR D CA    1 
ATOM   5369  C  C     . TYR C 1 9   ? 53.039  74.110 76.545  1.00 192.46 ? 9    TYR D C     1 
ATOM   5370  O  O     . TYR C 1 9   ? 53.413  72.935 76.511  1.00 192.57 ? 9    TYR D O     1 
ATOM   5371  C  CB    . TYR C 1 9   ? 54.145  76.028 77.748  1.00 194.12 ? 9    TYR D CB    1 
ATOM   5372  C  CG    . TYR C 1 9   ? 54.214  76.886 78.994  1.00 194.99 ? 9    TYR D CG    1 
ATOM   5373  C  CD1   . TYR C 1 9   ? 53.251  77.859 79.246  1.00 195.54 ? 9    TYR D CD1   1 
ATOM   5374  C  CD2   . TYR C 1 9   ? 55.234  76.717 79.927  1.00 195.88 ? 9    TYR D CD2   1 
ATOM   5375  C  CE1   . TYR C 1 9   ? 53.305  78.644 80.386  1.00 196.85 ? 9    TYR D CE1   1 
ATOM   5376  C  CE2   . TYR C 1 9   ? 55.297  77.498 81.071  1.00 197.15 ? 9    TYR D CE2   1 
ATOM   5377  C  CZ    . TYR C 1 9   ? 54.330  78.460 81.295  1.00 197.60 ? 9    TYR D CZ    1 
ATOM   5378  O  OH    . TYR C 1 9   ? 54.388  79.237 82.429  1.00 199.31 ? 9    TYR D OH    1 
ATOM   5379  N  N     . ARG C 1 10  ? 52.562  74.763 75.485  1.00 192.70 ? 10   ARG D N     1 
ATOM   5380  C  CA    A ARG C 1 10  ? 52.357  74.116 74.189  0.50 193.22 ? 10   ARG D CA    1 
ATOM   5381  C  CA    B ARG C 1 10  ? 52.340  74.116 74.194  0.50 192.93 ? 10   ARG D CA    1 
ATOM   5382  C  C     . ARG C 1 10  ? 52.363  75.163 73.078  1.00 194.68 ? 10   ARG D C     1 
ATOM   5383  O  O     . ARG C 1 10  ? 51.731  76.213 73.203  1.00 195.05 ? 10   ARG D O     1 
ATOM   5384  C  CB    A ARG C 1 10  ? 51.025  73.348 74.192  0.50 192.28 ? 10   ARG D CB    1 
ATOM   5385  C  CB    B ARG C 1 10  ? 50.984  73.403 74.204  0.50 191.62 ? 10   ARG D CB    1 
ATOM   5386  C  CG    A ARG C 1 10  ? 50.543  72.837 72.835  0.50 193.04 ? 10   ARG D CG    1 
ATOM   5387  C  CG    B ARG C 1 10  ? 50.945  72.087 73.448  0.50 191.61 ? 10   ARG D CG    1 
ATOM   5388  C  CD    A ARG C 1 10  ? 51.450  71.772 72.246  0.50 194.03 ? 10   ARG D CD    1 
ATOM   5389  C  CD    B ARG C 1 10  ? 49.517  71.580 73.336  0.50 190.64 ? 10   ARG D CD    1 
ATOM   5390  N  NE    A ARG C 1 10  ? 51.008  71.384 70.910  0.50 195.25 ? 10   ARG D NE    1 
ATOM   5391  N  NE    B ARG C 1 10  ? 49.421  70.140 73.554  0.50 190.51 ? 10   ARG D NE    1 
ATOM   5392  C  CZ    A ARG C 1 10  ? 51.629  70.495 70.142  0.50 196.72 ? 10   ARG D CZ    1 
ATOM   5393  C  CZ    B ARG C 1 10  ? 48.273  69.474 73.629  0.50 190.08 ? 10   ARG D CZ    1 
ATOM   5394  N  NH1   A ARG C 1 10  ? 52.726  69.893 70.577  0.50 197.21 ? 10   ARG D NH1   1 
ATOM   5395  N  NH1   B ARG C 1 10  ? 47.122  70.119 73.497  0.50 189.36 ? 10   ARG D NH1   1 
ATOM   5396  N  NH2   A ARG C 1 10  ? 51.151  70.207 68.940  0.50 198.24 ? 10   ARG D NH2   1 
ATOM   5397  N  NH2   B ARG C 1 10  ? 48.275  68.164 73.834  0.50 190.88 ? 10   ARG D NH2   1 
ATOM   5398  N  N     . VAL C 1 11  ? 53.083  74.872 71.993  1.00 196.31 ? 11   VAL D N     1 
ATOM   5399  C  CA    . VAL C 1 11  ? 53.155  75.775 70.837  1.00 198.31 ? 11   VAL D CA    1 
ATOM   5400  C  C     . VAL C 1 11  ? 52.906  75.008 69.535  1.00 199.30 ? 11   VAL D C     1 
ATOM   5401  O  O     . VAL C 1 11  ? 53.387  73.886 69.363  1.00 199.12 ? 11   VAL D O     1 
ATOM   5402  C  CB    . VAL C 1 11  ? 54.514  76.519 70.769  1.00 199.86 ? 11   VAL D CB    1 
ATOM   5403  C  CG1   . VAL C 1 11  ? 55.660  75.565 70.457  1.00 200.39 ? 11   VAL D CG1   1 
ATOM   5404  C  CG2   . VAL C 1 11  ? 54.467  77.644 69.742  1.00 202.51 ? 11   VAL D CG2   1 
ATOM   5405  N  N     . GLU C 1 12  ? 52.147  75.621 68.630  1.00 200.77 ? 12   GLU D N     1 
ATOM   5406  C  CA    . GLU C 1 12  ? 51.845  75.026 67.327  1.00 202.79 ? 12   GLU D CA    1 
ATOM   5407  C  C     . GLU C 1 12  ? 51.260  76.065 66.375  1.00 205.29 ? 12   GLU D C     1 
ATOM   5408  O  O     . GLU C 1 12  ? 50.982  77.199 66.772  1.00 205.29 ? 12   GLU D O     1 
ATOM   5409  C  CB    . GLU C 1 12  ? 50.858  73.862 67.481  1.00 201.72 ? 12   GLU D CB    1 
ATOM   5410  C  CG    . GLU C 1 12  ? 49.465  74.281 67.940  1.00 200.91 ? 12   GLU D CG    1 
ATOM   5411  C  CD    . GLU C 1 12  ? 48.587  73.111 68.348  1.00 199.59 ? 12   GLU D CD    1 
ATOM   5412  O  OE1   . GLU C 1 12  ? 49.123  72.048 68.727  1.00 199.22 ? 12   GLU D OE1   1 
ATOM   5413  O  OE2   . GLU C 1 12  ? 47.348  73.259 68.295  1.00 199.38 ? 12   GLU D OE2   1 
ATOM   5414  N  N     . TYR C 1 13  ? 51.074  75.665 65.120  1.00 207.89 ? 13   TYR D N     1 
ATOM   5415  C  CA    . TYR C 1 13  ? 50.360  76.483 64.146  1.00 211.20 ? 13   TYR D CA    1 
ATOM   5416  C  C     . TYR C 1 13  ? 48.876  76.165 64.261  1.00 210.20 ? 13   TYR D C     1 
ATOM   5417  O  O     . TYR C 1 13  ? 48.489  74.995 64.273  1.00 209.07 ? 13   TYR D O     1 
ATOM   5418  C  CB    . TYR C 1 13  ? 50.866  76.209 62.729  1.00 215.03 ? 13   TYR D CB    1 
ATOM   5419  C  CG    . TYR C 1 13  ? 52.348  76.458 62.573  1.00 216.50 ? 13   TYR D CG    1 
ATOM   5420  C  CD1   . TYR C 1 13  ? 52.877  77.735 62.740  1.00 217.99 ? 13   TYR D CD1   1 
ATOM   5421  C  CD2   . TYR C 1 13  ? 53.224  75.419 62.268  1.00 216.87 ? 13   TYR D CD2   1 
ATOM   5422  C  CE1   . TYR C 1 13  ? 54.235  77.972 62.606  1.00 219.50 ? 13   TYR D CE1   1 
ATOM   5423  C  CE2   . TYR C 1 13  ? 54.583  75.646 62.130  1.00 218.46 ? 13   TYR D CE2   1 
ATOM   5424  C  CZ    . TYR C 1 13  ? 55.083  76.924 62.300  1.00 219.66 ? 13   TYR D CZ    1 
ATOM   5425  O  OH    . TYR C 1 13  ? 56.432  77.156 62.167  1.00 221.75 ? 13   TYR D OH    1 
ATOM   5426  N  N     . ALA C 1 14  ? 48.054  77.209 64.354  1.00 210.92 ? 14   ALA D N     1 
ATOM   5427  C  CA    . ALA C 1 14  ? 46.620  77.057 64.605  1.00 209.65 ? 14   ALA D CA    1 
ATOM   5428  C  C     . ALA C 1 14  ? 45.988  76.003 63.702  1.00 210.23 ? 14   ALA D C     1 
ATOM   5429  O  O     . ALA C 1 14  ? 45.942  76.168 62.482  1.00 214.13 ? 14   ALA D O     1 
ATOM   5430  C  CB    . ALA C 1 14  ? 45.908  78.389 64.429  1.00 212.20 ? 14   ALA D CB    1 
ATOM   5431  N  N     . LYS C 1 15  ? 45.509  74.920 64.312  1.00 207.07 ? 15   LYS D N     1 
ATOM   5432  C  CA    . LYS C 1 15  ? 44.843  73.846 63.574  1.00 207.97 ? 15   LYS D CA    1 
ATOM   5433  C  C     . LYS C 1 15  ? 43.492  74.296 63.003  1.00 209.68 ? 15   LYS D C     1 
ATOM   5434  O  O     . LYS C 1 15  ? 42.962  73.666 62.086  1.00 211.69 ? 15   LYS D O     1 
ATOM   5435  C  CB    . LYS C 1 15  ? 44.674  72.603 64.456  1.00 205.23 ? 15   LYS D CB    1 
ATOM   5436  C  CG    . LYS C 1 15  ? 45.988  71.924 64.825  1.00 204.31 ? 15   LYS D CG    1 
ATOM   5437  C  CD    . LYS C 1 15  ? 45.801  70.452 65.177  1.00 203.52 ? 15   LYS D CD    1 
ATOM   5438  C  CE    . LYS C 1 15  ? 45.455  70.240 66.643  1.00 200.28 ? 15   LYS D CE    1 
ATOM   5439  N  NZ    . LYS C 1 15  ? 46.666  70.258 67.507  1.00 198.78 ? 15   LYS D NZ    1 
ATOM   5440  N  N     . SER C 1 16  ? 42.939  75.376 63.554  1.00 209.03 ? 16   SER D N     1 
ATOM   5441  C  CA    . SER C 1 16  ? 41.773  76.040 62.971  1.00 211.42 ? 16   SER D CA    1 
ATOM   5442  C  C     . SER C 1 16  ? 41.682  77.489 63.448  1.00 212.32 ? 16   SER D C     1 
ATOM   5443  O  O     . SER C 1 16  ? 42.090  77.807 64.567  1.00 209.64 ? 16   SER D O     1 
ATOM   5444  C  CB    . SER C 1 16  ? 40.489  75.291 63.333  1.00 209.76 ? 16   SER D CB    1 
ATOM   5445  O  OG    . SER C 1 16  ? 40.293  75.261 64.735  1.00 205.99 ? 16   SER D OG    1 
ATOM   5446  N  N     . GLY C 1 17  ? 41.139  78.358 62.599  1.00 216.68 ? 17   GLY D N     1 
ATOM   5447  C  CA    . GLY C 1 17  ? 40.955  79.771 62.936  1.00 218.81 ? 17   GLY D CA    1 
ATOM   5448  C  C     . GLY C 1 17  ? 39.655  79.988 63.687  1.00 218.23 ? 17   GLY D C     1 
ATOM   5449  O  O     . GLY C 1 17  ? 38.824  80.805 63.287  1.00 221.93 ? 17   GLY D O     1 
ATOM   5450  N  N     . ARG C 1 18  ? 39.498  79.257 64.788  1.00 214.31 ? 18   ARG D N     1 
ATOM   5451  C  CA    . ARG C 1 18  ? 38.235  79.169 65.517  1.00 213.72 ? 18   ARG D CA    1 
ATOM   5452  C  C     . ARG C 1 18  ? 38.404  79.555 66.985  1.00 211.87 ? 18   ARG D C     1 
ATOM   5453  O  O     . ARG C 1 18  ? 37.630  80.353 67.516  1.00 213.36 ? 18   ARG D O     1 
ATOM   5454  C  CB    . ARG C 1 18  ? 37.702  77.739 65.417  1.00 211.18 ? 18   ARG D CB    1 
ATOM   5455  C  CG    . ARG C 1 18  ? 36.255  77.553 65.849  1.00 210.47 ? 18   ARG D CG    1 
ATOM   5456  C  CD    . ARG C 1 18  ? 35.919  76.075 65.971  1.00 207.64 ? 18   ARG D CD    1 
ATOM   5457  N  NE    . ARG C 1 18  ? 36.165  75.351 64.723  1.00 208.91 ? 18   ARG D NE    1 
ATOM   5458  C  CZ    . ARG C 1 18  ? 36.202  74.024 64.604  1.00 207.27 ? 18   ARG D CZ    1 
ATOM   5459  N  NH1   . ARG C 1 18  ? 36.008  73.235 65.658  1.00 204.20 ? 18   ARG D NH1   1 
ATOM   5460  N  NH2   . ARG C 1 18  ? 36.438  73.477 63.416  1.00 209.42 ? 18   ARG D NH2   1 
ATOM   5461  N  N     . ALA C 1 19  ? 39.412  78.973 67.633  1.00 209.49 ? 19   ALA D N     1 
ATOM   5462  C  CA    . ALA C 1 19  ? 39.683  79.217 69.048  1.00 207.91 ? 19   ALA D CA    1 
ATOM   5463  C  C     . ALA C 1 19  ? 40.051  80.674 69.311  1.00 211.29 ? 19   ALA D C     1 
ATOM   5464  O  O     . ALA C 1 19  ? 40.767  81.293 68.521  1.00 213.92 ? 19   ALA D O     1 
ATOM   5465  C  CB    . ALA C 1 19  ? 40.802  78.306 69.528  1.00 204.83 ? 19   ALA D CB    1 
ATOM   5466  N  N     . SER C 1 20  ? 39.560  81.209 70.427  1.00 212.17 ? 20   SER D N     1 
ATOM   5467  C  CA    . SER C 1 20  ? 39.838  82.588 70.820  1.00 216.06 ? 20   SER D CA    1 
ATOM   5468  C  C     . SER C 1 20  ? 41.046  82.662 71.751  1.00 215.37 ? 20   SER D C     1 
ATOM   5469  O  O     . SER C 1 20  ? 41.519  81.643 72.260  1.00 212.34 ? 20   SER D O     1 
ATOM   5470  C  CB    . SER C 1 20  ? 38.613  83.210 71.495  1.00 217.75 ? 20   SER D CB    1 
ATOM   5471  O  OG    . SER C 1 20  ? 38.225  82.465 72.636  1.00 214.67 ? 20   SER D OG    1 
ATOM   5472  N  N     . CYS C 1 21  ? 41.526  83.883 71.972  1.00 219.37 ? 21   CYS D N     1 
ATOM   5473  C  CA    . CYS C 1 21  ? 42.730  84.138 72.763  1.00 219.30 ? 21   CYS D CA    1 
ATOM   5474  C  C     . CYS C 1 21  ? 42.347  84.586 74.173  1.00 219.67 ? 21   CYS D C     1 
ATOM   5475  O  O     . CYS C 1 21  ? 41.503  85.461 74.340  1.00 222.64 ? 21   CYS D O     1 
ATOM   5476  C  CB    . CYS C 1 21  ? 43.592  85.184 72.050  1.00 223.52 ? 21   CYS D CB    1 
ATOM   5477  S  SG    . CYS C 1 21  ? 44.598  86.269 73.085  1.00 226.21 ? 21   CYS D SG    1 
ATOM   5478  N  N     . LYS C 1 22  ? 42.973  83.987 75.183  1.00 217.39 ? 22   LYS D N     1 
ATOM   5479  C  CA    . LYS C 1 22  ? 42.541  84.167 76.574  1.00 218.04 ? 22   LYS D CA    1 
ATOM   5480  C  C     . LYS C 1 22  ? 42.692  85.603 77.082  1.00 222.61 ? 22   LYS D C     1 
ATOM   5481  O  O     . LYS C 1 22  ? 41.878  86.063 77.885  1.00 224.43 ? 22   LYS D O     1 
ATOM   5482  C  CB    . LYS C 1 22  ? 43.296  83.212 77.508  1.00 214.96 ? 22   LYS D CB    1 
ATOM   5483  C  CG    . LYS C 1 22  ? 42.530  82.837 78.771  1.00 214.32 ? 22   LYS D CG    1 
ATOM   5484  C  CD    . LYS C 1 22  ? 41.949  81.432 78.694  1.00 211.23 ? 22   LYS D CD    1 
ATOM   5485  C  CE    . LYS C 1 22  ? 40.895  81.278 77.608  1.00 211.60 ? 22   LYS D CE    1 
ATOM   5486  N  NZ    . LYS C 1 22  ? 40.578  79.845 77.356  1.00 208.78 ? 22   LYS D NZ    1 
ATOM   5487  N  N     . LYS C 1 23  ? 43.724  86.306 76.618  1.00 225.28 ? 23   LYS D N     1 
ATOM   5488  C  CA    . LYS C 1 23  ? 43.985  87.675 77.071  1.00 230.37 ? 23   LYS D CA    1 
ATOM   5489  C  C     . LYS C 1 23  ? 43.076  88.691 76.381  1.00 235.03 ? 23   LYS D C     1 
ATOM   5490  O  O     . LYS C 1 23  ? 42.299  89.384 77.041  1.00 238.14 ? 23   LYS D O     1 
ATOM   5491  C  CB    . LYS C 1 23  ? 45.456  88.054 76.852  1.00 231.57 ? 23   LYS D CB    1 
ATOM   5492  C  CG    . LYS C 1 23  ? 45.853  89.361 77.524  1.00 236.42 ? 23   LYS D CG    1 
ATOM   5493  C  CD    . LYS C 1 23  ? 47.362  89.519 77.633  1.00 236.74 ? 23   LYS D CD    1 
ATOM   5494  C  CE    . LYS C 1 23  ? 47.737  90.554 78.683  1.00 240.88 ? 23   LYS D CE    1 
ATOM   5495  N  NZ    . LYS C 1 23  ? 47.249  91.920 78.344  1.00 247.23 ? 23   LYS D NZ    1 
ATOM   5496  N  N     . CYS C 1 24  ? 43.172  88.769 75.055  1.00 235.93 ? 24   CYS D N     1 
ATOM   5497  C  CA    . CYS C 1 24  ? 42.476  89.802 74.280  1.00 240.91 ? 24   CYS D CA    1 
ATOM   5498  C  C     . CYS C 1 24  ? 41.085  89.375 73.792  1.00 240.02 ? 24   CYS D C     1 
ATOM   5499  O  O     . CYS C 1 24  ? 40.252  90.229 73.486  1.00 244.59 ? 24   CYS D O     1 
ATOM   5500  C  CB    . CYS C 1 24  ? 43.340  90.239 73.092  1.00 243.54 ? 24   CYS D CB    1 
ATOM   5501  S  SG    . CYS C 1 24  ? 43.376  89.077 71.710  1.00 240.22 ? 24   CYS D SG    1 
ATOM   5502  N  N     . SER C 1 25  ? 40.849  88.065 73.710  1.00 234.54 ? 25   SER D N     1 
ATOM   5503  C  CA    . SER C 1 25  ? 39.536  87.500 73.358  1.00 233.64 ? 25   SER D CA    1 
ATOM   5504  C  C     . SER C 1 25  ? 39.123  87.757 71.903  1.00 236.55 ? 25   SER D C     1 
ATOM   5505  O  O     . SER C 1 25  ? 37.980  88.131 71.629  1.00 239.85 ? 25   SER D O     1 
ATOM   5506  C  CB    . SER C 1 25  ? 38.447  87.976 74.335  1.00 235.64 ? 25   SER D CB    1 
ATOM   5507  O  OG    . SER C 1 25  ? 37.975  89.274 74.017  1.00 242.05 ? 25   SER D OG    1 
ATOM   5508  N  N     . GLU C 1 26  ? 40.060  87.543 70.981  1.00 235.76 ? 26   GLU D N     1 
ATOM   5509  C  CA    . GLU C 1 26  ? 39.774  87.570 69.545  1.00 238.15 ? 26   GLU D CA    1 
ATOM   5510  C  C     . GLU C 1 26  ? 40.194  86.243 68.922  1.00 233.72 ? 26   GLU D C     1 
ATOM   5511  O  O     . GLU C 1 26  ? 41.020  85.521 69.482  1.00 229.72 ? 26   GLU D O     1 
ATOM   5512  C  CB    . GLU C 1 26  ? 40.500  88.728 68.857  1.00 243.58 ? 26   GLU D CB    1 
ATOM   5513  C  CG    . GLU C 1 26  ? 40.037  90.107 69.307  1.00 249.25 ? 26   GLU D CG    1 
ATOM   5514  C  CD    . GLU C 1 26  ? 40.706  91.241 68.548  1.00 255.60 ? 26   GLU D CD    1 
ATOM   5515  O  OE1   . GLU C 1 26  ? 41.613  90.975 67.729  1.00 255.25 ? 26   GLU D OE1   1 
ATOM   5516  O  OE2   . GLU C 1 26  ? 40.322  92.408 68.772  1.00 261.52 ? 26   GLU D OE2   1 
ATOM   5517  N  N     . SER C 1 27  ? 39.623  85.931 67.762  1.00 235.08 ? 27   SER D N     1 
ATOM   5518  C  CA    . SER C 1 27  ? 39.862  84.650 67.100  1.00 231.76 ? 27   SER D CA    1 
ATOM   5519  C  C     . SER C 1 27  ? 41.296  84.531 66.583  1.00 231.47 ? 27   SER D C     1 
ATOM   5520  O  O     . SER C 1 27  ? 41.731  85.329 65.751  1.00 236.11 ? 27   SER D O     1 
ATOM   5521  C  CB    . SER C 1 27  ? 38.879  84.456 65.942  1.00 234.55 ? 27   SER D CB    1 
ATOM   5522  O  OG    . SER C 1 27  ? 38.994  85.501 64.991  1.00 240.61 ? 27   SER D OG    1 
ATOM   5523  N  N     . ILE C 1 28  ? 42.020  83.533 67.088  1.00 226.56 ? 28   ILE D N     1 
ATOM   5524  C  CA    . ILE C 1 28  ? 43.374  83.235 66.623  1.00 225.70 ? 28   ILE D CA    1 
ATOM   5525  C  C     . ILE C 1 28  ? 43.274  82.595 65.237  1.00 226.61 ? 28   ILE D C     1 
ATOM   5526  O  O     . ILE C 1 28  ? 42.742  81.493 65.112  1.00 224.28 ? 28   ILE D O     1 
ATOM   5527  C  CB    . ILE C 1 28  ? 44.108  82.276 67.588  1.00 220.91 ? 28   ILE D CB    1 
ATOM   5528  C  CG1   . ILE C 1 28  ? 44.304  82.938 68.958  1.00 220.04 ? 28   ILE D CG1   1 
ATOM   5529  C  CG2   . ILE C 1 28  ? 45.457  81.856 67.014  1.00 220.89 ? 28   ILE D CG2   1 
ATOM   5530  C  CD1   . ILE C 1 28  ? 44.510  81.958 70.094  1.00 215.54 ? 28   ILE D CD1   1 
ATOM   5531  N  N     . PRO C 1 29  ? 43.785  83.280 64.194  1.00 230.19 ? 29   PRO D N     1 
ATOM   5532  C  CA    . PRO C 1 29  ? 43.592  82.816 62.815  1.00 232.17 ? 29   PRO D CA    1 
ATOM   5533  C  C     . PRO C 1 29  ? 44.325  81.510 62.500  1.00 228.52 ? 29   PRO D C     1 
ATOM   5534  O  O     . PRO C 1 29  ? 45.291  81.164 63.180  1.00 225.07 ? 29   PRO D O     1 
ATOM   5535  C  CB    . PRO C 1 29  ? 44.151  83.968 61.974  1.00 238.16 ? 29   PRO D CB    1 
ATOM   5536  C  CG    . PRO C 1 29  ? 45.158  84.623 62.852  1.00 237.39 ? 29   PRO D CG    1 
ATOM   5537  C  CD    . PRO C 1 29  ? 44.649  84.474 64.257  1.00 233.26 ? 29   PRO D CD    1 
ATOM   5538  N  N     . LYS C 1 30  ? 43.862  80.805 61.470  1.00 229.37 ? 30   LYS D N     1 
ATOM   5539  C  CA    . LYS C 1 30  ? 44.394  79.485 61.119  1.00 226.86 ? 30   LYS D CA    1 
ATOM   5540  C  C     . LYS C 1 30  ? 45.837  79.554 60.617  1.00 227.94 ? 30   LYS D C     1 
ATOM   5541  O  O     . LYS C 1 30  ? 46.247  80.547 60.013  1.00 232.41 ? 30   LYS D O     1 
ATOM   5542  C  CB    . LYS C 1 30  ? 43.510  78.815 60.062  1.00 229.21 ? 30   LYS D CB    1 
ATOM   5543  C  CG    . LYS C 1 30  ? 43.892  77.374 59.760  1.00 227.43 ? 30   LYS D CG    1 
ATOM   5544  C  CD    . LYS C 1 30  ? 42.807  76.644 58.987  1.00 229.13 ? 30   LYS D CD    1 
ATOM   5545  C  CE    . LYS C 1 30  ? 43.226  75.215 58.680  1.00 228.18 ? 30   LYS D CE    1 
ATOM   5546  N  NZ    . LYS C 1 30  ? 42.151  74.445 57.996  1.00 230.07 ? 30   LYS D NZ    1 
ATOM   5547  N  N     . ASP C 1 31  ? 46.593  78.488 60.882  1.00 224.47 ? 31   ASP D N     1 
ATOM   5548  C  CA    . ASP C 1 31  ? 48.003  78.367 60.480  1.00 225.26 ? 31   ASP D CA    1 
ATOM   5549  C  C     . ASP C 1 31  ? 48.899  79.495 61.015  1.00 225.11 ? 31   ASP D C     1 
ATOM   5550  O  O     . ASP C 1 31  ? 49.938  79.801 60.425  1.00 227.46 ? 31   ASP D O     1 
ATOM   5551  C  CB    . ASP C 1 31  ? 48.126  78.268 58.950  1.00 230.49 ? 31   ASP D CB    1 
ATOM   5552  C  CG    . ASP C 1 31  ? 47.383  77.071 58.373  1.00 230.73 ? 31   ASP D CG    1 
ATOM   5553  O  OD1   . ASP C 1 31  ? 47.103  77.080 57.156  1.00 235.46 ? 31   ASP D OD1   1 
ATOM   5554  O  OD2   . ASP C 1 31  ? 47.078  76.122 59.128  1.00 226.49 ? 31   ASP D OD2   1 
ATOM   5555  N  N     . SER C 1 32  ? 48.502  80.094 62.137  1.00 222.30 ? 32   SER D N     1 
ATOM   5556  C  CA    . SER C 1 32  ? 49.280  81.153 62.774  1.00 222.37 ? 32   SER D CA    1 
ATOM   5557  C  C     . SER C 1 32  ? 49.962  80.605 64.020  1.00 217.52 ? 32   SER D C     1 
ATOM   5558  O  O     . SER C 1 32  ? 49.402  79.760 64.720  1.00 213.84 ? 32   SER D O     1 
ATOM   5559  C  CB    . SER C 1 32  ? 48.380  82.333 63.149  1.00 223.96 ? 32   SER D CB    1 
ATOM   5560  O  OG    . SER C 1 32  ? 47.519  82.003 64.226  1.00 219.90 ? 32   SER D OG    1 
ATOM   5561  N  N     . LEU C 1 33  ? 51.171  81.091 64.292  1.00 217.98 ? 33   LEU D N     1 
ATOM   5562  C  CA    . LEU C 1 33  ? 51.914  80.695 65.483  1.00 214.29 ? 33   LEU D CA    1 
ATOM   5563  C  C     . LEU C 1 33  ? 51.157  81.141 66.732  1.00 211.68 ? 33   LEU D C     1 
ATOM   5564  O  O     . LEU C 1 33  ? 50.878  82.329 66.903  1.00 214.16 ? 33   LEU D O     1 
ATOM   5565  C  CB    . LEU C 1 33  ? 53.314  81.316 65.467  1.00 216.54 ? 33   LEU D CB    1 
ATOM   5566  C  CG    . LEU C 1 33  ? 54.279  80.918 66.589  1.00 213.89 ? 33   LEU D CG    1 
ATOM   5567  C  CD1   . LEU C 1 33  ? 54.830  79.519 66.364  1.00 212.16 ? 33   LEU D CD1   1 
ATOM   5568  C  CD2   . LEU C 1 33  ? 55.416  81.923 66.690  1.00 216.76 ? 33   LEU D CD2   1 
ATOM   5569  N  N     . ARG C 1 34  ? 50.814  80.179 67.586  1.00 207.05 ? 34   ARG D N     1 
ATOM   5570  C  CA    . ARG C 1 34  ? 50.104  80.449 68.835  1.00 204.41 ? 34   ARG D CA    1 
ATOM   5571  C  C     . ARG C 1 34  ? 50.704  79.622 69.967  1.00 200.74 ? 34   ARG D C     1 
ATOM   5572  O  O     . ARG C 1 34  ? 51.228  78.532 69.734  1.00 199.20 ? 34   ARG D O     1 
ATOM   5573  C  CB    . ARG C 1 34  ? 48.614  80.124 68.684  1.00 203.57 ? 34   ARG D CB    1 
ATOM   5574  C  CG    . ARG C 1 34  ? 48.322  78.667 68.358  1.00 201.21 ? 34   ARG D CG    1 
ATOM   5575  C  CD    . ARG C 1 34  ? 46.830  78.377 68.322  1.00 200.48 ? 34   ARG D CD    1 
ATOM   5576  N  NE    . ARG C 1 34  ? 46.565  76.942 68.220  1.00 198.30 ? 34   ARG D NE    1 
ATOM   5577  C  CZ    . ARG C 1 34  ? 45.361  76.398 68.049  1.00 197.93 ? 34   ARG D CZ    1 
ATOM   5578  N  NH1   . ARG C 1 34  ? 44.274  77.160 67.953  1.00 199.27 ? 34   ARG D NH1   1 
ATOM   5579  N  NH2   . ARG C 1 34  ? 45.244  75.077 67.969  1.00 196.62 ? 34   ARG D NH2   1 
ATOM   5580  N  N     . MET C 1 35  ? 50.616  80.143 71.188  1.00 199.55 ? 35   MET D N     1 
ATOM   5581  C  CA    . MET C 1 35  ? 51.122  79.448 72.371  1.00 196.64 ? 35   MET D CA    1 
ATOM   5582  C  C     . MET C 1 35  ? 50.007  79.210 73.384  1.00 193.97 ? 35   MET D C     1 
ATOM   5583  O  O     . MET C 1 35  ? 49.036  79.967 73.444  1.00 195.07 ? 35   MET D O     1 
ATOM   5584  C  CB    . MET C 1 35  ? 52.257  80.245 73.011  1.00 198.34 ? 35   MET D CB    1 
ATOM   5585  C  CG    . MET C 1 35  ? 53.573  80.140 72.257  1.00 199.94 ? 35   MET D CG    1 
ATOM   5586  S  SD    . MET C 1 35  ? 54.960  80.879 73.139  1.00 201.90 ? 35   MET D SD    1 
ATOM   5587  C  CE    . MET C 1 35  ? 55.184  79.706 74.474  1.00 199.02 ? 35   MET D CE    1 
ATOM   5588  N  N     . ALA C 1 36  ? 50.164  78.154 74.179  1.00 190.46 ? 36   ALA D N     1 
ATOM   5589  C  CA    . ALA C 1 36  ? 49.152  77.743 75.150  1.00 188.04 ? 36   ALA D CA    1 
ATOM   5590  C  C     . ALA C 1 36  ? 49.755  77.496 76.527  1.00 186.81 ? 36   ALA D C     1 
ATOM   5591  O  O     . ALA C 1 36  ? 50.965  77.315 76.668  1.00 187.53 ? 36   ALA D O     1 
ATOM   5592  C  CB    . ALA C 1 36  ? 48.443  76.487 74.664  1.00 186.61 ? 36   ALA D CB    1 
ATOM   5593  N  N     . ILE C 1 37  ? 48.887  77.497 77.536  1.00 185.34 ? 37   ILE D N     1 
ATOM   5594  C  CA    . ILE C 1 37  ? 49.239  77.073 78.891  1.00 184.02 ? 37   ILE D CA    1 
ATOM   5595  C  C     . ILE C 1 37  ? 48.171  76.078 79.346  1.00 182.12 ? 37   ILE D C     1 
ATOM   5596  O  O     . ILE C 1 37  ? 46.979  76.385 79.336  1.00 182.33 ? 37   ILE D O     1 
ATOM   5597  C  CB    . ILE C 1 37  ? 49.393  78.276 79.863  1.00 185.65 ? 37   ILE D CB    1 
ATOM   5598  C  CG1   . ILE C 1 37  ? 49.781  77.807 81.281  1.00 185.85 ? 37   ILE D CG1   1 
ATOM   5599  C  CG2   . ILE C 1 37  ? 48.156  79.172 79.855  1.00 186.77 ? 37   ILE D CG2   1 
ATOM   5600  C  CD1   . ILE C 1 37  ? 48.636  77.438 82.210  1.00 185.66 ? 37   ILE D CD1   1 
ATOM   5601  N  N     . MET C 1 38  ? 48.605  74.881 79.728  1.00 180.66 ? 38   MET D N     1 
ATOM   5602  C  CA    . MET C 1 38  ? 47.684  73.785 80.019  1.00 179.56 ? 38   MET D CA    1 
ATOM   5603  C  C     . MET C 1 38  ? 47.142  73.901 81.442  1.00 179.54 ? 38   MET D C     1 
ATOM   5604  O  O     . MET C 1 38  ? 47.913  73.942 82.402  1.00 180.30 ? 38   MET D O     1 
ATOM   5605  C  CB    . MET C 1 38  ? 48.384  72.436 79.826  1.00 179.70 ? 38   MET D CB    1 
ATOM   5606  C  CG    . MET C 1 38  ? 48.977  72.231 78.437  1.00 179.79 ? 38   MET D CG    1 
ATOM   5607  S  SD    . MET C 1 38  ? 47.745  71.960 77.150  1.00 179.98 ? 38   MET D SD    1 
ATOM   5608  C  CE    . MET C 1 38  ? 47.501  70.191 77.285  1.00 180.28 ? 38   MET D CE    1 
ATOM   5609  N  N     . VAL C 1 39  ? 45.816  73.958 81.566  1.00 178.71 ? 39   VAL D N     1 
ATOM   5610  C  CA    . VAL C 1 39  ? 45.151  74.069 82.867  1.00 179.29 ? 39   VAL D CA    1 
ATOM   5611  C  C     . VAL C 1 39  ? 44.188  72.906 83.080  1.00 178.75 ? 39   VAL D C     1 
ATOM   5612  O  O     . VAL C 1 39  ? 43.857  72.183 82.140  1.00 177.85 ? 39   VAL D O     1 
ATOM   5613  C  CB    . VAL C 1 39  ? 44.364  75.394 83.000  1.00 180.05 ? 39   VAL D CB    1 
ATOM   5614  C  CG1   . VAL C 1 39  ? 45.243  76.578 82.628  1.00 180.66 ? 39   VAL D CG1   1 
ATOM   5615  C  CG2   . VAL C 1 39  ? 43.105  75.377 82.143  1.00 179.43 ? 39   VAL D CG2   1 
ATOM   5616  N  N     . GLN C 1 40  ? 43.727  72.751 84.318  1.00 179.37 ? 40   GLN D N     1 
ATOM   5617  C  CA    . GLN C 1 40  ? 42.755  71.715 84.657  1.00 179.30 ? 40   GLN D CA    1 
ATOM   5618  C  C     . GLN C 1 40  ? 41.362  72.224 84.290  1.00 178.80 ? 40   GLN D C     1 
ATOM   5619  O  O     . GLN C 1 40  ? 40.963  73.308 84.717  1.00 179.52 ? 40   GLN D O     1 
ATOM   5620  C  CB    . GLN C 1 40  ? 42.819  71.377 86.155  1.00 181.27 ? 40   GLN D CB    1 
ATOM   5621  C  CG    . GLN C 1 40  ? 42.868  69.887 86.481  1.00 182.28 ? 40   GLN D CG    1 
ATOM   5622  C  CD    . GLN C 1 40  ? 41.777  69.070 85.807  1.00 181.89 ? 40   GLN D CD    1 
ATOM   5623  O  OE1   . GLN C 1 40  ? 42.043  67.996 85.267  1.00 182.07 ? 40   GLN D OE1   1 
ATOM   5624  N  NE2   . GLN C 1 40  ? 40.547  69.571 85.836  1.00 181.87 ? 40   GLN D NE2   1 
ATOM   5625  N  N     . SER C 1 41  ? 40.631  71.446 83.494  1.00 177.97 ? 41   SER D N     1 
ATOM   5626  C  CA    . SER C 1 41  ? 39.279  71.818 83.080  1.00 177.69 ? 41   SER D CA    1 
ATOM   5627  C  C     . SER C 1 41  ? 38.288  71.605 84.228  1.00 178.64 ? 41   SER D C     1 
ATOM   5628  O  O     . SER C 1 41  ? 38.244  70.519 84.807  1.00 179.22 ? 41   SER D O     1 
ATOM   5629  C  CB    . SER C 1 41  ? 38.841  70.995 81.867  1.00 177.19 ? 41   SER D CB    1 
ATOM   5630  O  OG    . SER C 1 41  ? 37.539  71.368 81.443  1.00 177.74 ? 41   SER D OG    1 
ATOM   5631  N  N     . PRO C 1 42  ? 37.491  72.638 84.564  1.00 179.16 ? 42   PRO D N     1 
ATOM   5632  C  CA    . PRO C 1 42  ? 36.436  72.470 85.572  1.00 180.99 ? 42   PRO D CA    1 
ATOM   5633  C  C     . PRO C 1 42  ? 35.338  71.478 85.175  1.00 180.89 ? 42   PRO D C     1 
ATOM   5634  O  O     . PRO C 1 42  ? 34.693  70.895 86.047  1.00 182.76 ? 42   PRO D O     1 
ATOM   5635  C  CB    . PRO C 1 42  ? 35.831  73.875 85.689  1.00 182.16 ? 42   PRO D CB    1 
ATOM   5636  C  CG    . PRO C 1 42  ? 36.884  74.799 85.193  1.00 181.45 ? 42   PRO D CG    1 
ATOM   5637  C  CD    . PRO C 1 42  ? 37.613  74.041 84.128  1.00 179.15 ? 42   PRO D CD    1 
ATOM   5638  N  N     . MET C 1 43  ? 35.139  71.294 83.871  1.00 179.18 ? 43   MET D N     1 
ATOM   5639  C  CA    . MET C 1 43  ? 34.005  70.530 83.351  1.00 179.56 ? 43   MET D CA    1 
ATOM   5640  C  C     . MET C 1 43  ? 34.256  69.022 83.281  1.00 179.47 ? 43   MET D C     1 
ATOM   5641  O  O     . MET C 1 43  ? 33.305  68.240 83.311  1.00 180.67 ? 43   MET D O     1 
ATOM   5642  C  CB    . MET C 1 43  ? 33.624  71.048 81.960  1.00 178.98 ? 43   MET D CB    1 
ATOM   5643  C  CG    . MET C 1 43  ? 33.329  72.542 81.901  1.00 179.68 ? 43   MET D CG    1 
ATOM   5644  S  SD    . MET C 1 43  ? 31.874  73.029 82.850  1.00 182.40 ? 43   MET D SD    1 
ATOM   5645  C  CE    . MET C 1 43  ? 30.564  72.342 81.840  1.00 182.59 ? 43   MET D CE    1 
ATOM   5646  N  N     . PHE C 1 44  ? 35.520  68.614 83.175  1.00 178.32 ? 44   PHE D N     1 
ATOM   5647  C  CA    . PHE C 1 44  ? 35.863  67.192 83.079  1.00 178.91 ? 44   PHE D CA    1 
ATOM   5648  C  C     . PHE C 1 44  ? 37.283  66.906 83.562  1.00 178.81 ? 44   PHE D C     1 
ATOM   5649  O  O     . PHE C 1 44  ? 38.110  67.813 83.662  1.00 177.61 ? 44   PHE D O     1 
ATOM   5650  C  CB    . PHE C 1 44  ? 35.691  66.697 81.638  1.00 178.41 ? 44   PHE D CB    1 
ATOM   5651  C  CG    . PHE C 1 44  ? 36.775  67.158 80.700  1.00 177.04 ? 44   PHE D CG    1 
ATOM   5652  C  CD1   . PHE C 1 44  ? 37.736  66.268 80.236  1.00 177.65 ? 44   PHE D CD1   1 
ATOM   5653  C  CD2   . PHE C 1 44  ? 36.837  68.482 80.284  1.00 175.82 ? 44   PHE D CD2   1 
ATOM   5654  C  CE1   . PHE C 1 44  ? 38.735  66.688 79.373  1.00 176.62 ? 44   PHE D CE1   1 
ATOM   5655  C  CE2   . PHE C 1 44  ? 37.835  68.908 79.421  1.00 174.99 ? 44   PHE D CE2   1 
ATOM   5656  C  CZ    . PHE C 1 44  ? 38.786  68.010 78.965  1.00 175.20 ? 44   PHE D CZ    1 
ATOM   5657  N  N     . ASP C 1 45  ? 37.554  65.635 83.851  1.00 180.24 ? 45   ASP D N     1 
ATOM   5658  C  CA    . ASP C 1 45  ? 38.865  65.208 84.336  1.00 180.69 ? 45   ASP D CA    1 
ATOM   5659  C  C     . ASP C 1 45  ? 39.871  65.160 83.185  1.00 178.86 ? 45   ASP D C     1 
ATOM   5660  O  O     . ASP C 1 45  ? 40.068  64.119 82.556  1.00 179.71 ? 45   ASP D O     1 
ATOM   5661  C  CB    . ASP C 1 45  ? 38.760  63.840 85.023  1.00 183.96 ? 45   ASP D CB    1 
ATOM   5662  C  CG    . ASP C 1 45  ? 40.062  63.408 85.690  1.00 185.72 ? 45   ASP D CG    1 
ATOM   5663  O  OD1   . ASP C 1 45  ? 41.066  64.148 85.621  1.00 184.10 ? 45   ASP D OD1   1 
ATOM   5664  O  OD2   . ASP C 1 45  ? 40.079  62.313 86.288  1.00 189.28 ? 45   ASP D OD2   1 
ATOM   5665  N  N     . GLY C 1 46  ? 40.505  66.298 82.918  1.00 176.87 ? 46   GLY D N     1 
ATOM   5666  C  CA    . GLY C 1 46  ? 41.514  66.382 81.867  1.00 176.20 ? 46   GLY D CA    1 
ATOM   5667  C  C     . GLY C 1 46  ? 42.097  67.774 81.714  1.00 174.95 ? 46   GLY D C     1 
ATOM   5668  O  O     . GLY C 1 46  ? 41.441  68.770 82.026  1.00 174.67 ? 46   GLY D O     1 
ATOM   5669  N  N     . LYS C 1 47  ? 43.336  67.838 81.231  1.00 175.15 ? 47   LYS D N     1 
ATOM   5670  C  CA    . LYS C 1 47  ? 43.997  69.116 80.962  1.00 174.54 ? 47   LYS D CA    1 
ATOM   5671  C  C     . LYS C 1 47  ? 43.438  69.754 79.694  1.00 174.09 ? 47   LYS D C     1 
ATOM   5672  O  O     . LYS C 1 47  ? 43.052  69.053 78.757  1.00 174.05 ? 47   LYS D O     1 
ATOM   5673  C  CB    . LYS C 1 47  ? 45.519  68.944 80.838  1.00 174.93 ? 47   LYS D CB    1 
ATOM   5674  C  CG    . LYS C 1 47  ? 46.314  69.558 81.981  1.00 175.52 ? 47   LYS D CG    1 
ATOM   5675  C  CD    . LYS C 1 47  ? 46.119  68.814 83.294  1.00 177.23 ? 47   LYS D CD    1 
ATOM   5676  C  CE    . LYS C 1 47  ? 46.712  69.589 84.461  1.00 178.09 ? 47   LYS D CE    1 
ATOM   5677  N  NZ    . LYS C 1 47  ? 48.145  69.944 84.253  1.00 178.01 ? 47   LYS D NZ    1 
ATOM   5678  N  N     . VAL C 1 48  ? 43.400  71.085 79.675  1.00 174.62 ? 48   VAL D N     1 
ATOM   5679  C  CA    . VAL C 1 48  ? 42.876  71.834 78.534  1.00 175.18 ? 48   VAL D CA    1 
ATOM   5680  C  C     . VAL C 1 48  ? 43.810  73.010 78.213  1.00 176.23 ? 48   VAL D C     1 
ATOM   5681  O  O     . VAL C 1 48  ? 44.302  73.676 79.127  1.00 176.73 ? 48   VAL D O     1 
ATOM   5682  C  CB    . VAL C 1 48  ? 41.421  72.308 78.808  1.00 175.63 ? 48   VAL D CB    1 
ATOM   5683  C  CG1   . VAL C 1 48  ? 41.374  73.692 79.447  1.00 176.37 ? 48   VAL D CG1   1 
ATOM   5684  C  CG2   . VAL C 1 48  ? 40.598  72.292 77.531  1.00 175.86 ? 48   VAL D CG2   1 
ATOM   5685  N  N     . PRO C 1 49  ? 44.077  73.257 76.916  1.00 177.65 ? 49   PRO D N     1 
ATOM   5686  C  CA    . PRO C 1 49  ? 44.960  74.365 76.542  1.00 179.13 ? 49   PRO D CA    1 
ATOM   5687  C  C     . PRO C 1 49  ? 44.271  75.729 76.584  1.00 181.25 ? 49   PRO D C     1 
ATOM   5688  O  O     . PRO C 1 49  ? 43.188  75.889 76.021  1.00 181.79 ? 49   PRO D O     1 
ATOM   5689  C  CB    . PRO C 1 49  ? 45.355  74.023 75.103  1.00 179.42 ? 49   PRO D CB    1 
ATOM   5690  C  CG    . PRO C 1 49  ? 44.205  73.238 74.579  1.00 179.22 ? 49   PRO D CG    1 
ATOM   5691  C  CD    . PRO C 1 49  ? 43.692  72.445 75.746  1.00 178.11 ? 49   PRO D CD    1 
ATOM   5692  N  N     . HIS C 1 50  ? 44.903  76.694 77.251  1.00 183.68 ? 50   HIS D N     1 
ATOM   5693  C  CA    . HIS C 1 50  ? 44.472  78.091 77.199  1.00 186.97 ? 50   HIS D CA    1 
ATOM   5694  C  C     . HIS C 1 50  ? 45.251  78.802 76.098  1.00 189.57 ? 50   HIS D C     1 
ATOM   5695  O  O     . HIS C 1 50  ? 46.366  79.274 76.326  1.00 190.51 ? 50   HIS D O     1 
ATOM   5696  C  CB    . HIS C 1 50  ? 44.708  78.803 78.538  1.00 188.19 ? 50   HIS D CB    1 
ATOM   5697  C  CG    . HIS C 1 50  ? 43.618  78.596 79.545  1.00 188.38 ? 50   HIS D CG    1 
ATOM   5698  N  ND1   . HIS C 1 50  ? 43.733  79.013 80.853  1.00 189.41 ? 50   HIS D ND1   1 
ATOM   5699  C  CD2   . HIS C 1 50  ? 42.394  78.027 79.438  1.00 187.97 ? 50   HIS D CD2   1 
ATOM   5700  C  CE1   . HIS C 1 50  ? 42.626  78.714 81.508  1.00 189.65 ? 50   HIS D CE1   1 
ATOM   5701  N  NE2   . HIS C 1 50  ? 41.799  78.112 80.673  1.00 188.65 ? 50   HIS D NE2   1 
ATOM   5702  N  N     . TRP C 1 51  ? 44.659  78.877 74.908  1.00 191.58 ? 51   TRP D N     1 
ATOM   5703  C  CA    . TRP C 1 51  ? 45.346  79.434 73.743  1.00 194.20 ? 51   TRP D CA    1 
ATOM   5704  C  C     . TRP C 1 51  ? 45.503  80.950 73.825  1.00 198.35 ? 51   TRP D C     1 
ATOM   5705  O  O     . TRP C 1 51  ? 44.571  81.663 74.198  1.00 199.86 ? 51   TRP D O     1 
ATOM   5706  C  CB    . TRP C 1 51  ? 44.623  79.047 72.447  1.00 194.59 ? 51   TRP D CB    1 
ATOM   5707  C  CG    . TRP C 1 51  ? 44.795  77.604 72.107  1.00 192.43 ? 51   TRP D CG    1 
ATOM   5708  C  CD1   . TRP C 1 51  ? 43.827  76.644 72.078  1.00 191.27 ? 51   TRP D CD1   1 
ATOM   5709  C  CD2   . TRP C 1 51  ? 46.022  76.948 71.769  1.00 191.81 ? 51   TRP D CD2   1 
ATOM   5710  N  NE1   . TRP C 1 51  ? 44.373  75.431 71.733  1.00 190.18 ? 51   TRP D NE1   1 
ATOM   5711  C  CE2   . TRP C 1 51  ? 45.719  75.590 71.538  1.00 190.57 ? 51   TRP D CE2   1 
ATOM   5712  C  CE3   . TRP C 1 51  ? 47.347  77.379 71.632  1.00 192.66 ? 51   TRP D CE3   1 
ATOM   5713  C  CZ2   . TRP C 1 51  ? 46.693  74.657 71.180  1.00 190.43 ? 51   TRP D CZ2   1 
ATOM   5714  C  CZ3   . TRP C 1 51  ? 48.316  76.449 71.280  1.00 192.29 ? 51   TRP D CZ3   1 
ATOM   5715  C  CH2   . TRP C 1 51  ? 47.982  75.103 71.056  1.00 191.28 ? 51   TRP D CH2   1 
ATOM   5716  N  N     . TYR C 1 52  ? 46.702  81.418 73.487  1.00 201.18 ? 52   TYR D N     1 
ATOM   5717  C  CA    . TYR C 1 52  ? 47.011  82.839 73.397  1.00 206.05 ? 52   TYR D CA    1 
ATOM   5718  C  C     . TYR C 1 52  ? 47.506  83.153 71.992  1.00 209.82 ? 52   TYR D C     1 
ATOM   5719  O  O     . TYR C 1 52  ? 48.056  82.281 71.315  1.00 208.31 ? 52   TYR D O     1 
ATOM   5720  C  CB    . TYR C 1 52  ? 48.115  83.210 74.392  1.00 206.09 ? 52   TYR D CB    1 
ATOM   5721  C  CG    . TYR C 1 52  ? 47.676  83.294 75.837  1.00 205.45 ? 52   TYR D CG    1 
ATOM   5722  C  CD1   . TYR C 1 52  ? 46.950  84.388 76.299  1.00 208.45 ? 52   TYR D CD1   1 
ATOM   5723  C  CD2   . TYR C 1 52  ? 48.009  82.296 76.749  1.00 202.57 ? 52   TYR D CD2   1 
ATOM   5724  C  CE1   . TYR C 1 52  ? 46.555  84.477 77.622  1.00 208.33 ? 52   TYR D CE1   1 
ATOM   5725  C  CE2   . TYR C 1 52  ? 47.616  82.378 78.075  1.00 202.42 ? 52   TYR D CE2   1 
ATOM   5726  C  CZ    . TYR C 1 52  ? 46.889  83.469 78.506  1.00 205.23 ? 52   TYR D CZ    1 
ATOM   5727  O  OH    . TYR C 1 52  ? 46.496  83.555 79.822  1.00 205.37 ? 52   TYR D OH    1 
ATOM   5728  N  N     . HIS C 1 53  ? 47.309  84.394 71.551  1.00 215.78 ? 53   HIS D N     1 
ATOM   5729  C  CA    . HIS C 1 53  ? 48.045  84.909 70.400  1.00 220.35 ? 53   HIS D CA    1 
ATOM   5730  C  C     . HIS C 1 53  ? 49.515  84.940 70.799  1.00 220.54 ? 53   HIS D C     1 
ATOM   5731  O  O     . HIS C 1 53  ? 49.836  85.277 71.941  1.00 220.37 ? 53   HIS D O     1 
ATOM   5732  C  CB    . HIS C 1 53  ? 47.598  86.328 70.031  1.00 226.13 ? 53   HIS D CB    1 
ATOM   5733  C  CG    . HIS C 1 53  ? 46.272  86.396 69.339  1.00 228.47 ? 53   HIS D CG    1 
ATOM   5734  N  ND1   . HIS C 1 53  ? 45.139  86.890 69.950  1.00 230.32 ? 53   HIS D ND1   1 
ATOM   5735  C  CD2   . HIS C 1 53  ? 45.903  86.054 68.082  1.00 230.07 ? 53   HIS D CD2   1 
ATOM   5736  C  CE1   . HIS C 1 53  ? 44.127  86.840 69.102  1.00 231.71 ? 53   HIS D CE1   1 
ATOM   5737  N  NE2   . HIS C 1 53  ? 44.564  86.335 67.962  1.00 231.90 ? 53   HIS D NE2   1 
ATOM   5738  N  N     . PHE C 1 54  ? 50.405  84.580 69.878  1.00 221.78 ? 54   PHE D N     1 
ATOM   5739  C  CA    . PHE C 1 54  ? 51.841  84.579 70.170  1.00 222.26 ? 54   PHE D CA    1 
ATOM   5740  C  C     . PHE C 1 54  ? 52.305  85.940 70.694  1.00 226.66 ? 54   PHE D C     1 
ATOM   5741  O  O     . PHE C 1 54  ? 53.174  86.011 71.563  1.00 226.31 ? 54   PHE D O     1 
ATOM   5742  C  CB    . PHE C 1 54  ? 52.656  84.181 68.935  1.00 223.23 ? 54   PHE D CB    1 
ATOM   5743  C  CG    . PHE C 1 54  ? 54.143  84.218 69.156  1.00 223.39 ? 54   PHE D CG    1 
ATOM   5744  C  CD1   . PHE C 1 54  ? 54.788  83.167 69.793  1.00 219.81 ? 54   PHE D CD1   1 
ATOM   5745  C  CD2   . PHE C 1 54  ? 54.897  85.307 68.735  1.00 227.63 ? 54   PHE D CD2   1 
ATOM   5746  C  CE1   . PHE C 1 54  ? 56.156  83.199 70.004  1.00 220.23 ? 54   PHE D CE1   1 
ATOM   5747  C  CE2   . PHE C 1 54  ? 56.265  85.344 68.943  1.00 227.94 ? 54   PHE D CE2   1 
ATOM   5748  C  CZ    . PHE C 1 54  ? 56.896  84.288 69.578  1.00 224.19 ? 54   PHE D CZ    1 
ATOM   5749  N  N     . SER C 1 55  ? 51.718  87.011 70.164  1.00 231.98 ? 55   SER D N     1 
ATOM   5750  C  CA    . SER C 1 55  ? 51.998  88.367 70.632  1.00 236.98 ? 55   SER D CA    1 
ATOM   5751  C  C     . SER C 1 55  ? 51.513  88.586 72.069  1.00 236.85 ? 55   SER D C     1 
ATOM   5752  O  O     . SER C 1 55  ? 52.223  89.180 72.882  1.00 238.60 ? 55   SER D O     1 
ATOM   5753  C  CB    . SER C 1 55  ? 51.342  89.392 69.702  1.00 242.14 ? 55   SER D CB    1 
ATOM   5754  O  OG    . SER C 1 55  ? 51.701  90.715 70.061  1.00 246.75 ? 55   SER D OG    1 
ATOM   5755  N  N     . CYS C 1 56  ? 50.311  88.101 72.373  1.00 235.77 ? 56   CYS D N     1 
ATOM   5756  C  CA    . CYS C 1 56  ? 49.701  88.293 73.694  1.00 235.82 ? 56   CYS D CA    1 
ATOM   5757  C  C     . CYS C 1 56  ? 50.293  87.406 74.792  1.00 232.84 ? 56   CYS D C     1 
ATOM   5758  O  O     . CYS C 1 56  ? 50.159  87.720 75.975  1.00 233.22 ? 56   CYS D O     1 
ATOM   5759  C  CB    . CYS C 1 56  ? 48.193  88.039 73.624  1.00 234.60 ? 56   CYS D CB    1 
ATOM   5760  S  SG    . CYS C 1 56  ? 47.294  89.128 72.499  1.00 239.99 ? 56   CYS D SG    1 
ATOM   5761  N  N     . PHE C 1 57  ? 50.937  86.306 74.404  1.00 230.88 ? 57   PHE D N     1 
ATOM   5762  C  CA    . PHE C 1 57  ? 51.436  85.317 75.366  1.00 228.32 ? 57   PHE D CA    1 
ATOM   5763  C  C     . PHE C 1 57  ? 52.456  85.882 76.359  1.00 231.02 ? 57   PHE D C     1 
ATOM   5764  O  O     . PHE C 1 57  ? 52.505  85.447 77.509  1.00 229.32 ? 57   PHE D O     1 
ATOM   5765  C  CB    . PHE C 1 57  ? 52.048  84.115 74.633  1.00 225.50 ? 57   PHE D CB    1 
ATOM   5766  C  CG    . PHE C 1 57  ? 52.483  83.002 75.549  1.00 222.33 ? 57   PHE D CG    1 
ATOM   5767  C  CD1   . PHE C 1 57  ? 53.766  82.982 76.081  1.00 222.67 ? 57   PHE D CD1   1 
ATOM   5768  C  CD2   . PHE C 1 57  ? 51.608  81.977 75.884  1.00 219.59 ? 57   PHE D CD2   1 
ATOM   5769  C  CE1   . PHE C 1 57  ? 54.168  81.965 76.929  1.00 220.27 ? 57   PHE D CE1   1 
ATOM   5770  C  CE2   . PHE C 1 57  ? 52.006  80.954 76.731  1.00 217.41 ? 57   PHE D CE2   1 
ATOM   5771  C  CZ    . PHE C 1 57  ? 53.287  80.949 77.255  1.00 217.68 ? 57   PHE D CZ    1 
ATOM   5772  N  N     . TRP C 1 58  ? 53.260  86.848 75.920  1.00 236.19 ? 58   TRP D N     1 
ATOM   5773  C  CA    . TRP C 1 58  ? 54.377  87.348 76.728  1.00 239.09 ? 58   TRP D CA    1 
ATOM   5774  C  C     . TRP C 1 58  ? 54.026  88.564 77.595  1.00 244.06 ? 58   TRP D C     1 
ATOM   5775  O  O     . TRP C 1 58  ? 54.906  89.124 78.253  1.00 246.69 ? 58   TRP D O     1 
ATOM   5776  C  CB    . TRP C 1 58  ? 55.573  87.673 75.826  1.00 241.27 ? 58   TRP D CB    1 
ATOM   5777  C  CG    . TRP C 1 58  ? 55.885  86.582 74.842  1.00 238.70 ? 58   TRP D CG    1 
ATOM   5778  C  CD1   . TRP C 1 58  ? 55.516  86.536 73.530  1.00 239.67 ? 58   TRP D CD1   1 
ATOM   5779  C  CD2   . TRP C 1 58  ? 56.614  85.373 75.096  1.00 235.59 ? 58   TRP D CD2   1 
ATOM   5780  N  NE1   . TRP C 1 58  ? 55.974  85.379 72.947  1.00 237.01 ? 58   TRP D NE1   1 
ATOM   5781  C  CE2   . TRP C 1 58  ? 56.650  84.646 73.887  1.00 234.58 ? 58   TRP D CE2   1 
ATOM   5782  C  CE3   . TRP C 1 58  ? 57.241  84.836 76.227  1.00 234.13 ? 58   TRP D CE3   1 
ATOM   5783  C  CZ2   . TRP C 1 58  ? 57.293  83.411 73.774  1.00 232.05 ? 58   TRP D CZ2   1 
ATOM   5784  C  CZ3   . TRP C 1 58  ? 57.879  83.605 76.115  1.00 231.67 ? 58   TRP D CZ3   1 
ATOM   5785  C  CH2   . TRP C 1 58  ? 57.899  82.908 74.896  1.00 230.71 ? 58   TRP D CH2   1 
ATOM   5786  N  N     . LYS C 1 59  ? 52.754  88.966 77.602  1.00 246.18 ? 59   LYS D N     1 
ATOM   5787  C  CA    . LYS C 1 59  ? 52.289  90.071 78.451  1.00 250.85 ? 59   LYS D CA    1 
ATOM   5788  C  C     . LYS C 1 59  ? 51.538  89.605 79.704  1.00 249.57 ? 59   LYS D C     1 
ATOM   5789  O  O     . LYS C 1 59  ? 51.320  90.398 80.622  1.00 253.19 ? 59   LYS D O     1 
ATOM   5790  C  CB    . LYS C 1 59  ? 51.413  91.046 77.653  1.00 254.88 ? 59   LYS D CB    1 
ATOM   5791  C  CG    . LYS C 1 59  ? 52.190  92.155 76.956  1.00 259.99 ? 59   LYS D CG    1 
ATOM   5792  C  CD    . LYS C 1 59  ? 51.328  93.388 76.728  1.00 265.91 ? 59   LYS D CD    1 
ATOM   5793  C  CE    . LYS C 1 59  ? 52.165  94.586 76.307  1.00 272.16 ? 59   LYS D CE    1 
ATOM   5794  N  NZ    . LYS C 1 59  ? 51.373  95.847 76.306  1.00 279.02 ? 59   LYS D NZ    1 
ATOM   5795  N  N     . VAL C 1 60  ? 51.147  88.331 79.746  1.00 245.32 ? 60   VAL D N     1 
ATOM   5796  C  CA    . VAL C 1 60  ? 50.465  87.775 80.924  1.00 244.06 ? 60   VAL D CA    1 
ATOM   5797  C  C     . VAL C 1 60  ? 51.407  87.600 82.121  1.00 244.47 ? 60   VAL D C     1 
ATOM   5798  O  O     . VAL C 1 60  ? 50.950  87.510 83.262  1.00 245.11 ? 60   VAL D O     1 
ATOM   5799  C  CB    . VAL C 1 60  ? 49.762  86.428 80.625  1.00 239.38 ? 60   VAL D CB    1 
ATOM   5800  C  CG1   . VAL C 1 60  ? 48.711  86.604 79.541  1.00 239.75 ? 60   VAL D CG1   1 
ATOM   5801  C  CG2   . VAL C 1 60  ? 50.762  85.344 80.242  1.00 236.00 ? 60   VAL D CG2   1 
ATOM   5802  N  N     . GLY C 1 61  ? 52.713  87.547 81.855  1.00 244.78 ? 61   GLY D N     1 
ATOM   5803  C  CA    . GLY C 1 61  ? 53.726  87.459 82.908  1.00 245.69 ? 61   GLY D CA    1 
ATOM   5804  C  C     . GLY C 1 61  ? 54.478  86.140 82.967  1.00 242.12 ? 61   GLY D C     1 
ATOM   5805  O  O     . GLY C 1 61  ? 55.320  85.951 83.847  1.00 242.38 ? 61   GLY D O     1 
ATOM   5806  N  N     . HIS C 1 62  ? 54.185  85.228 82.040  1.00 239.37 ? 62   HIS D N     1 
ATOM   5807  C  CA    . HIS C 1 62  ? 54.871  83.936 81.993  1.00 236.61 ? 62   HIS D CA    1 
ATOM   5808  C  C     . HIS C 1 62  ? 56.255  84.103 81.370  1.00 236.96 ? 62   HIS D C     1 
ATOM   5809  O  O     . HIS C 1 62  ? 56.406  84.789 80.358  1.00 238.49 ? 62   HIS D O     1 
ATOM   5810  C  CB    . HIS C 1 62  ? 54.064  82.904 81.197  1.00 233.91 ? 62   HIS D CB    1 
ATOM   5811  C  CG    . HIS C 1 62  ? 52.683  82.664 81.729  1.00 233.59 ? 62   HIS D CG    1 
ATOM   5812  N  ND1   . HIS C 1 62  ? 52.365  82.771 83.066  1.00 234.85 ? 62   HIS D ND1   1 
ATOM   5813  C  CD2   . HIS C 1 62  ? 51.540  82.299 81.100  1.00 232.21 ? 62   HIS D CD2   1 
ATOM   5814  C  CE1   . HIS C 1 62  ? 51.084  82.498 83.236  1.00 233.85 ? 62   HIS D CE1   1 
ATOM   5815  N  NE2   . HIS C 1 62  ? 50.560  82.208 82.059  1.00 232.29 ? 62   HIS D NE2   1 
ATOM   5816  N  N     . SER C 1 63  ? 57.255  83.473 81.983  1.00 235.81 ? 63   SER D N     1 
ATOM   5817  C  CA    . SER C 1 63  ? 58.639  83.562 81.519  1.00 236.24 ? 63   SER D CA    1 
ATOM   5818  C  C     . SER C 1 63  ? 59.260  82.173 81.391  1.00 233.41 ? 63   SER D C     1 
ATOM   5819  O  O     . SER C 1 63  ? 59.793  81.626 82.359  1.00 233.18 ? 63   SER D O     1 
ATOM   5820  C  CB    . SER C 1 63  ? 59.465  84.424 82.475  1.00 239.36 ? 63   SER D CB    1 
ATOM   5821  O  OG    . SER C 1 63  ? 59.004  85.764 82.480  1.00 242.33 ? 63   SER D OG    1 
ATOM   5822  N  N     . ILE C 1 64  ? 59.179  81.610 80.189  1.00 231.68 ? 64   ILE D N     1 
ATOM   5823  C  CA    . ILE C 1 64  ? 59.787  80.317 79.891  1.00 230.16 ? 64   ILE D CA    1 
ATOM   5824  C  C     . ILE C 1 64  ? 61.286  80.522 79.680  1.00 232.00 ? 64   ILE D C     1 
ATOM   5825  O  O     . ILE C 1 64  ? 61.698  81.193 78.732  1.00 233.61 ? 64   ILE D O     1 
ATOM   5826  C  CB    . ILE C 1 64  ? 59.155  79.676 78.637  1.00 228.54 ? 64   ILE D CB    1 
ATOM   5827  C  CG1   . ILE C 1 64  ? 57.665  79.403 78.875  1.00 226.95 ? 64   ILE D CG1   1 
ATOM   5828  C  CG2   . ILE C 1 64  ? 59.868  78.379 78.272  1.00 227.64 ? 64   ILE D CG2   1 
ATOM   5829  C  CD1   . ILE C 1 64  ? 56.842  79.361 77.608  1.00 226.17 ? 64   ILE D CD1   1 
ATOM   5830  N  N     . ARG C 1 65  ? 62.091  79.946 80.570  1.00 232.29 ? 65   ARG D N     1 
ATOM   5831  C  CA    . ARG C 1 65  ? 63.544  80.121 80.537  1.00 234.14 ? 65   ARG D CA    1 
ATOM   5832  C  C     . ARG C 1 65  ? 64.165  79.458 79.309  1.00 233.07 ? 65   ARG D C     1 
ATOM   5833  O  O     . ARG C 1 65  ? 64.948  80.080 78.590  1.00 234.60 ? 65   ARG D O     1 
ATOM   5834  C  CB    . ARG C 1 65  ? 64.180  79.552 81.810  1.00 235.26 ? 65   ARG D CB    1 
ATOM   5835  C  CG    . ARG C 1 65  ? 63.806  80.301 83.079  1.00 236.98 ? 65   ARG D CG    1 
ATOM   5836  C  CD    . ARG C 1 65  ? 64.234  79.536 84.321  1.00 238.16 ? 65   ARG D CD    1 
ATOM   5837  N  NE    . ARG C 1 65  ? 63.995  80.296 85.548  1.00 240.67 ? 65   ARG D NE    1 
ATOM   5838  C  CZ    . ARG C 1 65  ? 64.771  81.280 86.004  1.00 243.87 ? 65   ARG D CZ    1 
ATOM   5839  N  NH1   . ARG C 1 65  ? 65.862  81.659 85.341  1.00 245.19 ? 65   ARG D NH1   1 
ATOM   5840  N  NH2   . ARG C 1 65  ? 64.451  81.897 87.136  1.00 246.12 ? 65   ARG D NH2   1 
ATOM   5841  N  N     . HIS C 1 66  ? 63.809  78.195 79.085  1.00 230.53 ? 66   HIS D N     1 
ATOM   5842  C  CA    . HIS C 1 66  ? 64.301  77.426 77.943  1.00 229.94 ? 66   HIS D CA    1 
ATOM   5843  C  C     . HIS C 1 66  ? 63.123  76.760 77.220  1.00 226.98 ? 66   HIS D C     1 
ATOM   5844  O  O     . HIS C 1 66  ? 62.643  75.712 77.654  1.00 226.15 ? 66   HIS D O     1 
ATOM   5845  C  CB    . HIS C 1 66  ? 65.312  76.377 78.414  1.00 230.96 ? 66   HIS D CB    1 
ATOM   5846  C  CG    . HIS C 1 66  ? 66.523  76.960 79.074  1.00 233.30 ? 66   HIS D CG    1 
ATOM   5847  N  ND1   . HIS C 1 66  ? 67.691  77.224 78.390  1.00 235.42 ? 66   HIS D ND1   1 
ATOM   5848  C  CD2   . HIS C 1 66  ? 66.746  77.334 80.356  1.00 234.22 ? 66   HIS D CD2   1 
ATOM   5849  C  CE1   . HIS C 1 66  ? 68.581  77.734 79.223  1.00 237.38 ? 66   HIS D CE1   1 
ATOM   5850  N  NE2   . HIS C 1 66  ? 68.032  77.811 80.422  1.00 236.80 ? 66   HIS D NE2   1 
ATOM   5851  N  N     . PRO C 1 67  ? 62.637  77.382 76.126  1.00 225.42 ? 67   PRO D N     1 
ATOM   5852  C  CA    . PRO C 1 67  ? 61.478  76.881 75.373  1.00 222.79 ? 67   PRO D CA    1 
ATOM   5853  C  C     . PRO C 1 67  ? 61.588  75.434 74.885  1.00 221.11 ? 67   PRO D C     1 
ATOM   5854  O  O     . PRO C 1 67  ? 60.617  74.682 74.983  1.00 219.26 ? 67   PRO D O     1 
ATOM   5855  C  CB    . PRO C 1 67  ? 61.405  77.831 74.174  1.00 224.53 ? 67   PRO D CB    1 
ATOM   5856  C  CG    . PRO C 1 67  ? 62.000  79.098 74.668  1.00 226.64 ? 67   PRO D CG    1 
ATOM   5857  C  CD    . PRO C 1 67  ? 63.089  78.692 75.617  1.00 227.23 ? 67   PRO D CD    1 
ATOM   5858  N  N     . ASP C 1 68  ? 62.753  75.056 74.364  1.00 221.62 ? 68   ASP D N     1 
ATOM   5859  C  CA    . ASP C 1 68  ? 62.948  73.722 73.780  1.00 221.39 ? 68   ASP D CA    1 
ATOM   5860  C  C     . ASP C 1 68  ? 62.708  72.572 74.766  1.00 220.44 ? 68   ASP D C     1 
ATOM   5861  O  O     . ASP C 1 68  ? 62.271  71.493 74.362  1.00 220.29 ? 68   ASP D O     1 
ATOM   5862  C  CB    . ASP C 1 68  ? 64.346  73.597 73.155  1.00 223.42 ? 68   ASP D CB    1 
ATOM   5863  C  CG    . ASP C 1 68  ? 65.468  73.732 74.175  1.00 223.85 ? 68   ASP D CG    1 
ATOM   5864  O  OD1   . ASP C 1 68  ? 65.297  74.476 75.164  1.00 222.56 ? 68   ASP D OD1   1 
ATOM   5865  O  OD2   . ASP C 1 68  ? 66.526  73.098 73.979  1.00 225.47 ? 68   ASP D OD2   1 
ATOM   5866  N  N     . VAL C 1 69  ? 62.988  72.806 76.048  1.00 220.25 ? 69   VAL D N     1 
ATOM   5867  C  CA    . VAL C 1 69  ? 62.795  71.784 77.086  1.00 220.26 ? 69   VAL D CA    1 
ATOM   5868  C  C     . VAL C 1 69  ? 61.480  71.943 77.859  1.00 217.76 ? 69   VAL D C     1 
ATOM   5869  O  O     . VAL C 1 69  ? 61.002  70.980 78.462  1.00 217.66 ? 69   VAL D O     1 
ATOM   5870  C  CB    . VAL C 1 69  ? 63.979  71.741 78.086  1.00 222.58 ? 69   VAL D CB    1 
ATOM   5871  C  CG1   . VAL C 1 69  ? 65.296  71.561 77.344  1.00 224.94 ? 69   VAL D CG1   1 
ATOM   5872  C  CG2   . VAL C 1 69  ? 64.026  72.988 78.961  1.00 222.32 ? 69   VAL D CG2   1 
ATOM   5873  N  N     . GLU C 1 70  ? 60.902  73.145 77.842  1.00 215.93 ? 70   GLU D N     1 
ATOM   5874  C  CA    . GLU C 1 70  ? 59.680  73.436 78.601  1.00 213.82 ? 70   GLU D CA    1 
ATOM   5875  C  C     . GLU C 1 70  ? 58.415  73.396 77.740  1.00 211.48 ? 70   GLU D C     1 
ATOM   5876  O  O     . GLU C 1 70  ? 57.408  72.813 78.144  1.00 210.25 ? 70   GLU D O     1 
ATOM   5877  C  CB    . GLU C 1 70  ? 59.794  74.797 79.296  1.00 214.41 ? 70   GLU D CB    1 
ATOM   5878  C  CG    . GLU C 1 70  ? 60.850  74.840 80.392  1.00 216.23 ? 70   GLU D CG    1 
ATOM   5879  C  CD    . GLU C 1 70  ? 60.851  76.142 81.174  1.00 217.16 ? 70   GLU D CD    1 
ATOM   5880  O  OE1   . GLU C 1 70  ? 61.950  76.631 81.510  1.00 218.81 ? 70   GLU D OE1   1 
ATOM   5881  O  OE2   . GLU C 1 70  ? 59.758  76.680 81.454  1.00 216.45 ? 70   GLU D OE2   1 
ATOM   5882  N  N     . VAL C 1 71  ? 58.469  74.014 76.562  1.00 211.11 ? 71   VAL D N     1 
ATOM   5883  C  CA    . VAL C 1 71  ? 57.306  74.095 75.673  1.00 209.80 ? 71   VAL D CA    1 
ATOM   5884  C  C     . VAL C 1 71  ? 57.194  72.849 74.796  1.00 209.73 ? 71   VAL D C     1 
ATOM   5885  O  O     . VAL C 1 71  ? 58.190  72.373 74.248  1.00 210.88 ? 71   VAL D O     1 
ATOM   5886  C  CB    . VAL C 1 71  ? 57.366  75.349 74.773  1.00 210.73 ? 71   VAL D CB    1 
ATOM   5887  C  CG1   . VAL C 1 71  ? 56.179  75.393 73.820  1.00 210.33 ? 71   VAL D CG1   1 
ATOM   5888  C  CG2   . VAL C 1 71  ? 57.404  76.608 75.624  1.00 211.24 ? 71   VAL D CG2   1 
ATOM   5889  N  N     . ASP C 1 72  ? 55.971  72.335 74.665  1.00 208.59 ? 72   ASP D N     1 
ATOM   5890  C  CA    . ASP C 1 72  ? 55.694  71.163 73.838  1.00 209.26 ? 72   ASP D CA    1 
ATOM   5891  C  C     . ASP C 1 72  ? 55.445  71.587 72.392  1.00 210.71 ? 72   ASP D C     1 
ATOM   5892  O  O     . ASP C 1 72  ? 54.884  72.654 72.142  1.00 210.06 ? 72   ASP D O     1 
ATOM   5893  C  CB    . ASP C 1 72  ? 54.473  70.412 74.383  1.00 207.84 ? 72   ASP D CB    1 
ATOM   5894  C  CG    . ASP C 1 72  ? 54.252  69.069 73.704  1.00 208.80 ? 72   ASP D CG    1 
ATOM   5895  O  OD1   . ASP C 1 72  ? 55.242  68.354 73.440  1.00 210.35 ? 72   ASP D OD1   1 
ATOM   5896  O  OD2   . ASP C 1 72  ? 53.080  68.726 73.441  1.00 208.22 ? 72   ASP D OD2   1 
ATOM   5897  N  N     . GLY C 1 73  ? 55.865  70.747 71.449  1.00 213.22 ? 73   GLY D N     1 
ATOM   5898  C  CA    . GLY C 1 73  ? 55.691  71.021 70.023  1.00 215.20 ? 73   GLY D CA    1 
ATOM   5899  C  C     . GLY C 1 73  ? 56.719  71.973 69.438  1.00 217.38 ? 73   GLY D C     1 
ATOM   5900  O  O     . GLY C 1 73  ? 56.542  72.465 68.324  1.00 218.77 ? 73   GLY D O     1 
ATOM   5901  N  N     . PHE C 1 74  ? 57.797  72.224 70.180  1.00 218.39 ? 74   PHE D N     1 
ATOM   5902  C  CA    . PHE C 1 74  ? 58.845  73.154 69.752  1.00 221.07 ? 74   PHE D CA    1 
ATOM   5903  C  C     . PHE C 1 74  ? 59.653  72.597 68.581  1.00 224.54 ? 74   PHE D C     1 
ATOM   5904  O  O     . PHE C 1 74  ? 59.943  73.317 67.626  1.00 226.68 ? 74   PHE D O     1 
ATOM   5905  C  CB    . PHE C 1 74  ? 59.777  73.476 70.928  1.00 220.79 ? 74   PHE D CB    1 
ATOM   5906  C  CG    . PHE C 1 74  ? 60.874  74.449 70.591  1.00 222.88 ? 74   PHE D CG    1 
ATOM   5907  C  CD1   . PHE C 1 74  ? 62.131  73.996 70.208  1.00 224.88 ? 74   PHE D CD1   1 
ATOM   5908  C  CD2   . PHE C 1 74  ? 60.655  75.819 70.665  1.00 223.32 ? 74   PHE D CD2   1 
ATOM   5909  C  CE1   . PHE C 1 74  ? 63.144  74.889 69.900  1.00 227.05 ? 74   PHE D CE1   1 
ATOM   5910  C  CE2   . PHE C 1 74  ? 61.665  76.717 70.359  1.00 225.54 ? 74   PHE D CE2   1 
ATOM   5911  C  CZ    . PHE C 1 74  ? 62.911  76.251 69.976  1.00 227.34 ? 74   PHE D CZ    1 
ATOM   5912  N  N     . SER C 1 75  ? 60.015  71.318 68.663  1.00 226.05 ? 75   SER D N     1 
ATOM   5913  C  CA    . SER C 1 75  ? 60.807  70.666 67.617  1.00 229.80 ? 75   SER D CA    1 
ATOM   5914  C  C     . SER C 1 75  ? 60.031  70.510 66.306  1.00 231.85 ? 75   SER D C     1 
ATOM   5915  O  O     . SER C 1 75  ? 60.627  70.509 65.228  1.00 235.32 ? 75   SER D O     1 
ATOM   5916  C  CB    . SER C 1 75  ? 61.289  69.294 68.092  1.00 230.73 ? 75   SER D CB    1 
ATOM   5917  O  OG    . SER C 1 75  ? 60.204  68.397 68.237  1.00 229.93 ? 75   SER D OG    1 
ATOM   5918  N  N     . GLU C 1 76  ? 58.709  70.377 66.407  1.00 230.19 ? 76   GLU D N     1 
ATOM   5919  C  CA    . GLU C 1 76  ? 57.853  70.216 65.228  1.00 231.86 ? 76   GLU D CA    1 
ATOM   5920  C  C     . GLU C 1 76  ? 57.702  71.509 64.419  1.00 233.09 ? 76   GLU D C     1 
ATOM   5921  O  O     . GLU C 1 76  ? 57.363  71.456 63.238  1.00 236.29 ? 76   GLU D O     1 
ATOM   5922  C  CB    . GLU C 1 76  ? 56.466  69.684 65.622  1.00 229.92 ? 76   GLU D CB    1 
ATOM   5923  C  CG    . GLU C 1 76  ? 56.412  68.181 65.881  1.00 230.62 ? 76   GLU D CG    1 
ATOM   5924  C  CD    . GLU C 1 76  ? 57.053  67.760 67.193  1.00 229.23 ? 76   GLU D CD    1 
ATOM   5925  O  OE1   . GLU C 1 76  ? 57.183  66.538 67.420  1.00 230.73 ? 76   GLU D OE1   1 
ATOM   5926  O  OE2   . GLU C 1 76  ? 57.427  68.638 68.000  1.00 227.19 ? 76   GLU D OE2   1 
ATOM   5927  N  N     . LEU C 1 77  ? 57.953  72.658 65.049  1.00 231.41 ? 77   LEU D N     1 
ATOM   5928  C  CA    . LEU C 1 77  ? 57.860  73.958 64.370  1.00 233.05 ? 77   LEU D CA    1 
ATOM   5929  C  C     . LEU C 1 77  ? 58.881  74.101 63.242  1.00 236.94 ? 77   LEU D C     1 
ATOM   5930  O  O     . LEU C 1 77  ? 59.832  73.322 63.145  1.00 237.69 ? 77   LEU D O     1 
ATOM   5931  C  CB    . LEU C 1 77  ? 58.074  75.108 65.362  1.00 231.45 ? 77   LEU D CB    1 
ATOM   5932  C  CG    . LEU C 1 77  ? 57.070  75.312 66.496  1.00 228.08 ? 77   LEU D CG    1 
ATOM   5933  C  CD1   . LEU C 1 77  ? 57.551  76.436 67.401  1.00 227.46 ? 77   LEU D CD1   1 
ATOM   5934  C  CD2   . LEU C 1 77  ? 55.677  75.610 65.961  1.00 228.37 ? 77   LEU D CD2   1 
ATOM   5935  N  N     . ARG C 1 78  ? 58.674  75.107 62.396  1.00 239.70 ? 78   ARG D N     1 
ATOM   5936  C  CA    . ARG C 1 78  ? 59.622  75.441 61.334  1.00 244.34 ? 78   ARG D CA    1 
ATOM   5937  C  C     . ARG C 1 78  ? 60.843  76.113 61.962  1.00 245.04 ? 78   ARG D C     1 
ATOM   5938  O  O     . ARG C 1 78  ? 60.714  76.833 62.952  1.00 242.50 ? 78   ARG D O     1 
ATOM   5939  C  CB    . ARG C 1 78  ? 58.975  76.368 60.299  1.00 247.25 ? 78   ARG D CB    1 
ATOM   5940  C  CG    . ARG C 1 78  ? 57.733  75.792 59.626  1.00 247.30 ? 78   ARG D CG    1 
ATOM   5941  C  CD    . ARG C 1 78  ? 57.002  76.828 58.781  1.00 250.32 ? 78   ARG D CD    1 
ATOM   5942  N  NE    . ARG C 1 78  ? 57.275  76.675 57.350  1.00 255.33 ? 78   ARG D NE    1 
ATOM   5943  C  CZ    . ARG C 1 78  ? 56.507  76.011 56.483  1.00 257.20 ? 78   ARG D CZ    1 
ATOM   5944  N  NH1   . ARG C 1 78  ? 56.868  75.947 55.206  1.00 262.46 ? 78   ARG D NH1   1 
ATOM   5945  N  NH2   . ARG C 1 78  ? 55.382  75.412 56.870  1.00 254.26 ? 78   ARG D NH2   1 
ATOM   5946  N  N     . TRP C 1 79  ? 62.020  75.876 61.384  1.00 249.05 ? 79   TRP D N     1 
ATOM   5947  C  CA    . TRP C 1 79  ? 63.290  76.293 61.997  1.00 249.89 ? 79   TRP D CA    1 
ATOM   5948  C  C     . TRP C 1 79  ? 63.341  77.782 62.338  1.00 251.46 ? 79   TRP D C     1 
ATOM   5949  O  O     . TRP C 1 79  ? 63.738  78.155 63.442  1.00 248.97 ? 79   TRP D O     1 
ATOM   5950  C  CB    . TRP C 1 79  ? 64.476  75.943 61.091  1.00 253.88 ? 79   TRP D CB    1 
ATOM   5951  C  CG    . TRP C 1 79  ? 65.800  76.109 61.773  1.00 253.38 ? 79   TRP D CG    1 
ATOM   5952  C  CD1   . TRP C 1 79  ? 66.620  77.199 61.720  1.00 255.33 ? 79   TRP D CD1   1 
ATOM   5953  C  CD2   . TRP C 1 79  ? 66.452  75.158 62.623  1.00 250.84 ? 79   TRP D CD2   1 
ATOM   5954  N  NE1   . TRP C 1 79  ? 67.745  76.984 62.479  1.00 254.33 ? 79   TRP D NE1   1 
ATOM   5955  C  CE2   . TRP C 1 79  ? 67.666  75.740 63.046  1.00 251.58 ? 79   TRP D CE2   1 
ATOM   5956  C  CE3   . TRP C 1 79  ? 66.128  73.870 63.067  1.00 248.55 ? 79   TRP D CE3   1 
ATOM   5957  C  CZ2   . TRP C 1 79  ? 68.561  75.075 63.889  1.00 250.30 ? 79   TRP D CZ2   1 
ATOM   5958  C  CZ3   . TRP C 1 79  ? 67.018  73.211 63.906  1.00 247.47 ? 79   TRP D CZ3   1 
ATOM   5959  C  CH2   . TRP C 1 79  ? 68.220  73.816 64.308  1.00 248.37 ? 79   TRP D CH2   1 
ATOM   5960  N  N     . ASP C 1 80  ? 62.950  78.624 61.386  1.00 256.54 ? 80   ASP D N     1 
ATOM   5961  C  CA    . ASP C 1 80  ? 62.946  80.076 61.591  1.00 259.11 ? 80   ASP D CA    1 
ATOM   5962  C  C     . ASP C 1 80  ? 61.954  80.510 62.675  1.00 255.59 ? 80   ASP D C     1 
ATOM   5963  O  O     . ASP C 1 80  ? 62.206  81.475 63.399  1.00 255.42 ? 80   ASP D O     1 
ATOM   5964  C  CB    . ASP C 1 80  ? 62.658  80.818 60.277  1.00 264.97 ? 80   ASP D CB    1 
ATOM   5965  C  CG    . ASP C 1 80  ? 61.305  80.463 59.678  1.00 265.46 ? 80   ASP D CG    1 
ATOM   5966  O  OD1   . ASP C 1 80  ? 60.675  81.352 59.067  1.00 269.09 ? 80   ASP D OD1   1 
ATOM   5967  O  OD2   . ASP C 1 80  ? 60.872  79.299 59.816  1.00 263.26 ? 80   ASP D OD2   1 
ATOM   5968  N  N     . ASP C 1 81  ? 60.835  79.796 62.782  1.00 253.16 ? 81   ASP D N     1 
ATOM   5969  C  CA    . ASP C 1 81  ? 59.835  80.071 63.816  1.00 250.06 ? 81   ASP D CA    1 
ATOM   5970  C  C     . ASP C 1 81  ? 60.306  79.634 65.206  1.00 246.93 ? 81   ASP D C     1 
ATOM   5971  O  O     . ASP C 1 81  ? 59.915  80.237 66.205  1.00 245.80 ? 81   ASP D O     1 
ATOM   5972  C  CB    . ASP C 1 81  ? 58.496  79.404 63.472  1.00 248.38 ? 81   ASP D CB    1 
ATOM   5973  C  CG    . ASP C 1 81  ? 57.759  80.117 62.349  1.00 251.95 ? 81   ASP D CG    1 
ATOM   5974  O  OD1   . ASP C 1 81  ? 57.415  79.458 61.345  1.00 253.68 ? 81   ASP D OD1   1 
ATOM   5975  O  OD2   . ASP C 1 81  ? 57.526  81.339 62.467  1.00 253.58 ? 81   ASP D OD2   1 
ATOM   5976  N  N     . GLN C 1 82  ? 61.135  78.592 65.268  1.00 246.60 ? 82   GLN D N     1 
ATOM   5977  C  CA    . GLN C 1 82  ? 61.735  78.155 66.534  1.00 244.27 ? 82   GLN D CA    1 
ATOM   5978  C  C     . GLN C 1 82  ? 62.640  79.240 67.118  1.00 246.55 ? 82   GLN D C     1 
ATOM   5979  O  O     . GLN C 1 82  ? 62.631  79.477 68.327  1.00 244.42 ? 82   GLN D O     1 
ATOM   5980  C  CB    . GLN C 1 82  ? 62.544  76.867 66.348  1.00 243.85 ? 82   GLN D CB    1 
ATOM   5981  C  CG    . GLN C 1 82  ? 61.709  75.636 66.042  1.00 242.26 ? 82   GLN D CG    1 
ATOM   5982  C  CD    . GLN C 1 82  ? 62.550  74.377 65.903  1.00 242.92 ? 82   GLN D CD    1 
ATOM   5983  O  OE1   . GLN C 1 82  ? 63.478  74.150 66.679  1.00 242.26 ? 82   GLN D OE1   1 
ATOM   5984  N  NE2   . GLN C 1 82  ? 62.226  73.549 64.914  1.00 244.73 ? 82   GLN D NE2   1 
ATOM   5985  N  N     . GLN C 1 83  ? 63.418  79.886 66.253  1.00 251.75 ? 83   GLN D N     1 
ATOM   5986  C  CA    . GLN C 1 83  ? 64.318  80.965 66.666  1.00 255.08 ? 83   GLN D CA    1 
ATOM   5987  C  C     . GLN C 1 83  ? 63.566  82.200 67.166  1.00 256.22 ? 83   GLN D C     1 
ATOM   5988  O  O     . GLN C 1 83  ? 64.064  82.917 68.035  1.00 256.82 ? 83   GLN D O     1 
ATOM   5989  C  CB    . GLN C 1 83  ? 65.259  81.355 65.522  1.00 260.19 ? 83   GLN D CB    1 
ATOM   5990  C  CG    . GLN C 1 83  ? 66.432  80.406 65.339  1.00 261.14 ? 83   GLN D CG    1 
ATOM   5991  C  CD    . GLN C 1 83  ? 67.198  80.668 64.057  1.00 266.71 ? 83   GLN D CD    1 
ATOM   5992  O  OE1   . GLN C 1 83  ? 66.660  80.516 62.960  1.00 269.14 ? 83   GLN D OE1   1 
ATOM   5993  N  NE2   . GLN C 1 83  ? 68.462  81.060 64.187  1.00 269.29 ? 83   GLN D NE2   1 
ATOM   5994  N  N     . LYS C 1 84  ? 62.378  82.449 66.614  1.00 257.25 ? 84   LYS D N     1 
ATOM   5995  C  CA    . LYS C 1 84  ? 61.534  83.553 67.075  1.00 258.42 ? 84   LYS D CA    1 
ATOM   5996  C  C     . LYS C 1 84  ? 61.056  83.314 68.508  1.00 255.25 ? 84   LYS D C     1 
ATOM   5997  O  O     . LYS C 1 84  ? 61.019  84.243 69.313  1.00 256.16 ? 84   LYS D O     1 
ATOM   5998  C  CB    . LYS C 1 84  ? 60.333  83.755 66.143  1.00 259.51 ? 84   LYS D CB    1 
ATOM   5999  C  CG    . LYS C 1 84  ? 59.417  84.899 66.562  1.00 260.63 ? 84   LYS D CG    1 
ATOM   6000  C  CD    . LYS C 1 84  ? 58.535  85.386 65.422  1.00 263.78 ? 84   LYS D CD    1 
ATOM   6001  C  CE    . LYS C 1 84  ? 57.607  84.295 64.916  1.00 261.04 ? 84   LYS D CE    1 
ATOM   6002  N  NZ    . LYS C 1 84  ? 56.458  84.850 64.148  1.00 263.77 ? 84   LYS D NZ    1 
ATOM   6003  N  N     . VAL C 1 85  ? 60.698  82.070 68.817  1.00 252.33 ? 85   VAL D N     1 
ATOM   6004  C  CA    . VAL C 1 85  ? 60.298  81.691 70.174  1.00 249.51 ? 85   VAL D CA    1 
ATOM   6005  C  C     . VAL C 1 85  ? 61.497  81.772 71.120  1.00 249.84 ? 85   VAL D C     1 
ATOM   6006  O  O     . VAL C 1 85  ? 61.377  82.263 72.243  1.00 249.15 ? 85   VAL D O     1 
ATOM   6007  C  CB    . VAL C 1 85  ? 59.711  80.261 70.226  1.00 246.39 ? 85   VAL D CB    1 
ATOM   6008  C  CG1   . VAL C 1 85  ? 59.397  79.853 71.662  1.00 243.59 ? 85   VAL D CG1   1 
ATOM   6009  C  CG2   . VAL C 1 85  ? 58.460  80.156 69.363  1.00 246.47 ? 85   VAL D CG2   1 
ATOM   6010  N  N     . LYS C 1 86  ? 62.646  81.290 70.652  1.00 251.40 ? 86   LYS D N     1 
ATOM   6011  C  CA    . LYS C 1 86  ? 63.867  81.236 71.460  1.00 252.16 ? 86   LYS D CA    1 
ATOM   6012  C  C     . LYS C 1 86  ? 64.375  82.630 71.840  1.00 254.94 ? 86   LYS D C     1 
ATOM   6013  O  O     . LYS C 1 86  ? 64.793  82.851 72.978  1.00 254.48 ? 86   LYS D O     1 
ATOM   6014  C  CB    . LYS C 1 86  ? 64.959  80.461 70.714  1.00 253.66 ? 86   LYS D CB    1 
ATOM   6015  C  CG    . LYS C 1 86  ? 66.101  79.979 71.597  1.00 253.57 ? 86   LYS D CG    1 
ATOM   6016  C  CD    . LYS C 1 86  ? 67.112  79.149 70.817  1.00 255.13 ? 86   LYS D CD    1 
ATOM   6017  C  CE    . LYS C 1 86  ? 66.564  77.778 70.448  1.00 253.43 ? 86   LYS D CE    1 
ATOM   6018  N  NZ    . LYS C 1 86  ? 67.604  76.904 69.837  1.00 255.37 ? 86   LYS D NZ    1 
ATOM   6019  N  N     . LYS C 1 87  ? 64.339  83.560 70.887  1.00 257.99 ? 87   LYS D N     1 
ATOM   6020  C  CA    . LYS C 1 87  ? 64.744  84.949 71.139  1.00 261.21 ? 87   LYS D CA    1 
ATOM   6021  C  C     . LYS C 1 87  ? 63.712  85.703 71.980  1.00 260.40 ? 87   LYS D C     1 
ATOM   6022  O  O     . LYS C 1 87  ? 64.074  86.417 72.917  1.00 261.76 ? 87   LYS D O     1 
ATOM   6023  C  CB    . LYS C 1 87  ? 64.993  85.703 69.824  1.00 265.69 ? 87   LYS D CB    1 
ATOM   6024  C  CG    . LYS C 1 87  ? 66.441  85.692 69.357  1.00 268.50 ? 87   LYS D CG    1 
ATOM   6025  C  CD    . LYS C 1 87  ? 67.300  86.639 70.185  1.00 271.17 ? 87   LYS D CD    1 
ATOM   6026  C  CE    . LYS C 1 87  ? 68.712  86.758 69.633  1.00 274.49 ? 87   LYS D CE    1 
ATOM   6027  N  NZ    . LYS C 1 87  ? 68.762  87.478 68.330  1.00 279.27 ? 87   LYS D NZ    1 
ATOM   6028  N  N     . THR C 1 88  ? 62.434  85.541 71.640  1.00 258.22 ? 88   THR D N     1 
ATOM   6029  C  CA    . THR C 1 88  ? 61.346  86.215 72.357  1.00 257.48 ? 88   THR D CA    1 
ATOM   6030  C  C     . THR C 1 88  ? 61.168  85.675 73.782  1.00 254.17 ? 88   THR D C     1 
ATOM   6031  O  O     . THR C 1 88  ? 60.608  86.359 74.640  1.00 254.89 ? 88   THR D O     1 
ATOM   6032  C  CB    . THR C 1 88  ? 60.009  86.100 71.591  1.00 256.62 ? 88   THR D CB    1 
ATOM   6033  O  OG1   . THR C 1 88  ? 60.204  86.479 70.223  1.00 259.58 ? 88   THR D OG1   1 
ATOM   6034  C  CG2   . THR C 1 88  ? 58.941  87.000 72.205  1.00 257.74 ? 88   THR D CG2   1 
ATOM   6035  N  N     . ALA C 1 89  ? 61.641  84.454 74.029  1.00 251.18 ? 89   ALA D N     1 
ATOM   6036  C  CA    . ALA C 1 89  ? 61.644  83.881 75.378  1.00 248.98 ? 89   ALA D CA    1 
ATOM   6037  C  C     . ALA C 1 89  ? 62.493  84.718 76.336  1.00 251.66 ? 89   ALA D C     1 
ATOM   6038  O  O     . ALA C 1 89  ? 62.116  84.922 77.491  1.00 250.98 ? 89   ALA D O     1 
ATOM   6039  C  CB    . ALA C 1 89  ? 62.149  82.446 75.345  1.00 246.23 ? 89   ALA D CB    1 
ATOM   6040  N  N     . GLU C 1 90  ? 63.635  85.198 75.848  1.00 254.84 ? 90   GLU D N     1 
ATOM   6041  C  CA    . GLU C 1 90  ? 64.527  86.045 76.641  1.00 258.15 ? 90   GLU D CA    1 
ATOM   6042  C  C     . GLU C 1 90  ? 64.019  87.486 76.734  1.00 262.00 ? 90   GLU D C     1 
ATOM   6043  O  O     . GLU C 1 90  ? 64.275  88.172 77.725  1.00 264.42 ? 90   GLU D O     1 
ATOM   6044  C  CB    . GLU C 1 90  ? 65.942  86.027 76.057  1.00 260.14 ? 90   GLU D CB    1 
ATOM   6045  C  CG    . GLU C 1 90  ? 66.589  84.649 76.052  1.00 257.46 ? 90   GLU D CG    1 
ATOM   6046  C  CD    . GLU C 1 90  ? 67.998  84.653 75.486  1.00 259.80 ? 90   GLU D CD    1 
ATOM   6047  O  OE1   . GLU C 1 90  ? 68.723  85.653 75.673  1.00 263.07 ? 90   GLU D OE1   1 
ATOM   6048  O  OE2   . GLU C 1 90  ? 68.386  83.646 74.856  1.00 258.80 ? 90   GLU D OE2   1 
ATOM   6049  N  N     . ALA C 1 91  ? 63.308  87.941 75.703  1.00 263.30 ? 91   ALA D N     1 
ATOM   6050  C  CA    . ALA C 1 91  ? 62.747  89.293 75.683  1.00 267.46 ? 91   ALA D CA    1 
ATOM   6051  C  C     . ALA C 1 91  ? 61.572  89.390 74.714  1.00 267.57 ? 91   ALA D C     1 
ATOM   6052  O  O     . ALA C 1 91  ? 60.412  89.346 75.124  1.00 266.31 ? 91   ALA D O     1 
ATOM   6053  C  CB    . ALA C 1 91  ? 63.821  90.302 75.309  1.00 272.52 ? 91   ALA D CB    1 
ATOM   6054  N  N     . SER C 1 117 ? 87.998  71.921 72.739  1.00 326.40 ? 224  SER D N     1 
ATOM   6055  C  CA    . SER C 1 117 ? 87.037  72.990 72.327  1.00 320.25 ? 224  SER D CA    1 
ATOM   6056  C  C     . SER C 1 117 ? 86.939  73.178 70.808  1.00 322.37 ? 224  SER D C     1 
ATOM   6057  O  O     . SER C 1 117 ? 85.946  73.715 70.320  1.00 317.54 ? 224  SER D O     1 
ATOM   6058  C  CB    . SER C 1 117 ? 87.407  74.320 72.989  1.00 319.40 ? 224  SER D CB    1 
ATOM   6059  O  OG    . SER C 1 117 ? 87.342  74.221 74.401  1.00 316.94 ? 224  SER D OG    1 
ATOM   6060  N  N     . LYS C 1 118 ? 87.960  72.747 70.068  1.00 330.41 ? 225  LYS D N     1 
ATOM   6061  C  CA    . LYS C 1 118 ? 87.966  72.873 68.610  1.00 333.48 ? 225  LYS D CA    1 
ATOM   6062  C  C     . LYS C 1 118 ? 87.073  71.810 67.984  1.00 331.66 ? 225  LYS D C     1 
ATOM   6063  O  O     . LYS C 1 118 ? 86.160  72.136 67.228  1.00 328.17 ? 225  LYS D O     1 
ATOM   6064  C  CB    . LYS C 1 118 ? 89.393  72.770 68.059  1.00 343.01 ? 225  LYS D CB    1 
ATOM   6065  C  CG    . LYS C 1 118 ? 89.526  73.107 66.578  1.00 346.17 ? 225  LYS D CG    1 
ATOM   6066  C  CD    . LYS C 1 118 ? 89.659  71.866 65.708  1.00 350.25 ? 225  LYS D CD    1 
ATOM   6067  C  CE    . LYS C 1 118 ? 89.910  72.237 64.254  1.00 354.47 ? 225  LYS D CE    1 
ATOM   6068  N  NZ    . LYS C 1 118 ? 90.477  71.101 63.475  1.00 361.49 ? 225  LYS D NZ    1 
ATOM   6069  N  N     . LYS C 1 119 ? 87.335  70.544 68.305  1.00 335.00 ? 226  LYS D N     1 
ATOM   6070  C  CA    . LYS C 1 119 ? 86.492  69.442 67.836  1.00 333.42 ? 226  LYS D CA    1 
ATOM   6071  C  C     . LYS C 1 119 ? 85.132  69.453 68.535  1.00 325.18 ? 226  LYS D C     1 
ATOM   6072  O  O     . LYS C 1 119 ? 84.129  69.058 67.945  1.00 321.76 ? 226  LYS D O     1 
ATOM   6073  C  CB    . LYS C 1 119 ? 87.181  68.089 68.050  1.00 339.26 ? 226  LYS D CB    1 
ATOM   6074  C  CG    . LYS C 1 119 ? 86.444  66.919 67.411  1.00 338.44 ? 226  LYS D CG    1 
ATOM   6075  C  CD    . LYS C 1 119 ? 87.264  65.640 67.436  1.00 345.79 ? 226  LYS D CD    1 
ATOM   6076  C  CE    . LYS C 1 119 ? 86.549  64.517 66.700  1.00 345.46 ? 226  LYS D CE    1 
ATOM   6077  N  NZ    . LYS C 1 119 ? 87.336  63.253 66.690  1.00 353.13 ? 226  LYS D NZ    1 
ATOM   6078  N  N     . GLU C 1 120 ? 85.103  69.907 69.786  1.00 322.63 ? 227  GLU D N     1 
ATOM   6079  C  CA    . GLU C 1 120 ? 83.857  69.984 70.551  1.00 315.08 ? 227  GLU D CA    1 
ATOM   6080  C  C     . GLU C 1 120 ? 82.883  70.980 69.924  1.00 310.44 ? 227  GLU D C     1 
ATOM   6081  O  O     . GLU C 1 120 ? 81.718  70.655 69.696  1.00 305.56 ? 227  GLU D O     1 
ATOM   6082  C  CB    . GLU C 1 120 ? 84.135  70.385 72.001  1.00 313.41 ? 227  GLU D CB    1 
ATOM   6083  C  CG    . GLU C 1 120 ? 84.938  69.364 72.793  1.00 317.57 ? 227  GLU D CG    1 
ATOM   6084  C  CD    . GLU C 1 120 ? 85.384  69.888 74.144  1.00 316.87 ? 227  GLU D CD    1 
ATOM   6085  O  OE1   . GLU C 1 120 ? 84.698  70.767 74.709  1.00 310.95 ? 227  GLU D OE1   1 
ATOM   6086  O  OE2   . GLU C 1 120 ? 86.425  69.416 74.647  1.00 322.13 ? 227  GLU D OE2   1 
ATOM   6087  N  N     . LYS C 1 121 ? 83.372  72.187 69.647  1.00 312.69 ? 228  LYS D N     1 
ATOM   6088  C  CA    . LYS C 1 121 ? 82.546  73.247 69.064  1.00 309.35 ? 228  LYS D CA    1 
ATOM   6089  C  C     . LYS C 1 121 ? 82.234  73.001 67.585  1.00 311.35 ? 228  LYS D C     1 
ATOM   6090  O  O     . LYS C 1 121 ? 81.210  73.469 67.084  1.00 307.57 ? 228  LYS D O     1 
ATOM   6091  C  CB    . LYS C 1 121 ? 83.227  74.609 69.238  1.00 311.18 ? 228  LYS D CB    1 
ATOM   6092  C  CG    . LYS C 1 121 ? 82.339  75.803 68.924  1.00 306.89 ? 228  LYS D CG    1 
ATOM   6093  C  CD    . LYS C 1 121 ? 83.013  77.111 69.307  1.00 308.91 ? 228  LYS D CD    1 
ATOM   6094  C  CE    . LYS C 1 121 ? 82.145  78.307 68.953  1.00 305.25 ? 228  LYS D CE    1 
ATOM   6095  N  NZ    . LYS C 1 121 ? 82.775  79.595 69.354  1.00 307.31 ? 228  LYS D NZ    1 
ATOM   6096  N  N     . ASP C 1 122 ? 83.109  72.271 66.891  1.00 318.03 ? 229  ASP D N     1 
ATOM   6097  C  CA    . ASP C 1 122 ? 82.909  71.965 65.472  1.00 320.47 ? 229  ASP D CA    1 
ATOM   6098  C  C     . ASP C 1 122 ? 81.754  70.982 65.287  1.00 316.81 ? 229  ASP D C     1 
ATOM   6099  O  O     . ASP C 1 122 ? 80.835  71.243 64.512  1.00 313.96 ? 229  ASP D O     1 
ATOM   6100  C  CB    . ASP C 1 122 ? 84.192  71.397 64.850  1.00 328.98 ? 229  ASP D CB    1 
ATOM   6101  C  CG    . ASP C 1 122 ? 84.148  71.348 63.326  1.00 332.30 ? 229  ASP D CG    1 
ATOM   6102  O  OD1   . ASP C 1 122 ? 83.161  71.823 62.721  1.00 328.17 ? 229  ASP D OD1   1 
ATOM   6103  O  OD2   . ASP C 1 122 ? 85.117  70.832 62.728  1.00 339.84 ? 229  ASP D OD2   1 
ATOM   6104  N  N     . LYS C 1 123 ? 81.802  69.862 66.006  1.00 317.38 ? 230  LYS D N     1 
ATOM   6105  C  CA    . LYS C 1 123 ? 80.730  68.860 65.948  1.00 313.73 ? 230  LYS D CA    1 
ATOM   6106  C  C     . LYS C 1 123 ? 79.425  69.444 66.493  1.00 305.61 ? 230  LYS D C     1 
ATOM   6107  O  O     . LYS C 1 123 ? 78.342  69.100 66.023  1.00 301.64 ? 230  LYS D O     1 
ATOM   6108  C  CB    . LYS C 1 123 ? 81.096  67.595 66.737  1.00 316.06 ? 230  LYS D CB    1 
ATOM   6109  C  CG    . LYS C 1 123 ? 82.413  66.929 66.352  1.00 324.32 ? 230  LYS D CG    1 
ATOM   6110  C  CD    . LYS C 1 123 ? 82.425  66.387 64.932  1.00 328.13 ? 230  LYS D CD    1 
ATOM   6111  C  CE    . LYS C 1 123 ? 83.794  65.814 64.599  1.00 337.00 ? 230  LYS D CE    1 
ATOM   6112  N  NZ    . LYS C 1 123 ? 83.866  65.247 63.225  1.00 341.45 ? 230  LYS D NZ    1 
ATOM   6113  N  N     . ASP C 1 124 ? 79.542  70.322 67.488  1.00 303.21 ? 231  ASP D N     1 
ATOM   6114  C  CA    . ASP C 1 124 ? 78.396  71.034 68.055  1.00 296.22 ? 231  ASP D CA    1 
ATOM   6115  C  C     . ASP C 1 124 ? 77.752  71.966 67.027  1.00 293.25 ? 231  ASP D C     1 
ATOM   6116  O  O     . ASP C 1 124 ? 76.531  71.971 66.864  1.00 289.00 ? 231  ASP D O     1 
ATOM   6117  C  CB    . ASP C 1 124 ? 78.831  71.837 69.287  1.00 295.61 ? 231  ASP D CB    1 
ATOM   6118  C  CG    . ASP C 1 124 ? 77.699  72.648 69.897  1.00 289.80 ? 231  ASP D CG    1 
ATOM   6119  O  OD1   . ASP C 1 124 ? 76.572  72.119 70.007  1.00 286.32 ? 231  ASP D OD1   1 
ATOM   6120  O  OD2   . ASP C 1 124 ? 77.941  73.813 70.276  1.00 289.56 ? 231  ASP D OD2   1 
ATOM   6121  N  N     . SER C 1 125 ? 78.580  72.751 66.340  1.00 295.65 ? 232  SER D N     1 
ATOM   6122  C  CA    . SER C 1 125 ? 78.098  73.706 65.341  1.00 293.52 ? 232  SER D CA    1 
ATOM   6123  C  C     . SER C 1 125 ? 77.635  73.013 64.058  1.00 293.58 ? 232  SER D C     1 
ATOM   6124  O  O     . SER C 1 125 ? 76.638  73.419 63.458  1.00 289.93 ? 232  SER D O     1 
ATOM   6125  C  CB    . SER C 1 125 ? 79.188  74.729 65.010  1.00 298.08 ? 232  SER D CB    1 
ATOM   6126  O  OG    . SER C 1 125 ? 78.698  75.737 64.143  1.00 297.20 ? 232  SER D OG    1 
ATOM   6127  N  N     . LYS C 1 126 ? 78.359  71.974 63.646  1.00 297.64 ? 233  LYS D N     1 
ATOM   6128  C  CA    . LYS C 1 126 ? 78.043  71.249 62.412  1.00 299.37 ? 233  LYS D CA    1 
ATOM   6129  C  C     . LYS C 1 126 ? 76.798  70.366 62.558  1.00 294.68 ? 233  LYS D C     1 
ATOM   6130  O  O     . LYS C 1 126 ? 76.153  70.037 61.562  1.00 294.53 ? 233  LYS D O     1 
ATOM   6131  C  CB    . LYS C 1 126 ? 79.245  70.407 61.960  1.00 306.71 ? 233  LYS D CB    1 
ATOM   6132  C  CG    . LYS C 1 126 ? 79.208  69.958 60.505  1.00 310.76 ? 233  LYS D CG    1 
ATOM   6133  C  CD    . LYS C 1 126 ? 79.284  71.137 59.545  1.00 312.49 ? 233  LYS D CD    1 
ATOM   6134  C  CE    . LYS C 1 126 ? 79.455  70.679 58.106  1.00 317.90 ? 233  LYS D CE    1 
ATOM   6135  N  NZ    . LYS C 1 126 ? 79.140  71.763 57.136  1.00 318.23 ? 233  LYS D NZ    1 
ATOM   6136  N  N     . LEU C 1 127 ? 76.466  69.984 63.792  1.00 291.14 ? 234  LEU D N     1 
ATOM   6137  C  CA    . LEU C 1 127 ? 75.236  69.235 64.063  1.00 286.22 ? 234  LEU D CA    1 
ATOM   6138  C  C     . LEU C 1 127 ? 74.014  70.139 63.920  1.00 279.99 ? 234  LEU D C     1 
ATOM   6139  O  O     . LEU C 1 127 ? 73.013  69.739 63.326  1.00 277.56 ? 234  LEU D O     1 
ATOM   6140  C  CB    . LEU C 1 127 ? 75.270  68.608 65.462  1.00 284.69 ? 234  LEU D CB    1 
ATOM   6141  C  CG    . LEU C 1 127 ? 74.050  67.767 65.871  1.00 280.57 ? 234  LEU D CG    1 
ATOM   6142  C  CD1   . LEU C 1 127 ? 74.477  66.558 66.693  1.00 282.46 ? 234  LEU D CD1   1 
ATOM   6143  C  CD2   . LEU C 1 127 ? 73.011  68.585 66.631  1.00 274.70 ? 234  LEU D CD2   1 
ATOM   6144  N  N     . GLU C 1 128 ? 74.103  71.351 64.466  1.00 277.12 ? 235  GLU D N     1 
ATOM   6145  C  CA    . GLU C 1 128 ? 73.026  72.340 64.348  1.00 271.65 ? 235  GLU D CA    1 
ATOM   6146  C  C     . GLU C 1 128 ? 72.788  72.731 62.888  1.00 272.07 ? 235  GLU D C     1 
ATOM   6147  O  O     . GLU C 1 128 ? 71.682  73.133 62.521  1.00 268.87 ? 235  GLU D O     1 
ATOM   6148  C  CB    . GLU C 1 128 ? 73.339  73.586 65.185  1.00 270.39 ? 235  GLU D CB    1 
ATOM   6149  C  CG    . GLU C 1 128 ? 72.153  74.522 65.373  1.00 265.52 ? 235  GLU D CG    1 
ATOM   6150  C  CD    . GLU C 1 128 ? 72.433  75.638 66.362  1.00 264.13 ? 235  GLU D CD    1 
ATOM   6151  O  OE1   . GLU C 1 128 ? 73.557  76.184 66.351  1.00 267.87 ? 235  GLU D OE1   1 
ATOM   6152  O  OE2   . GLU C 1 128 ? 71.524  75.976 67.150  1.00 259.77 ? 235  GLU D OE2   1 
ATOM   6153  N  N     . LYS C 1 129 ? 73.829  72.617 62.065  1.00 276.25 ? 236  LYS D N     1 
ATOM   6154  C  CA    . LYS C 1 129 ? 73.701  72.794 60.621  1.00 277.98 ? 236  LYS D CA    1 
ATOM   6155  C  C     . LYS C 1 129 ? 72.879  71.651 60.021  1.00 275.88 ? 236  LYS D C     1 
ATOM   6156  O  O     . LYS C 1 129 ? 71.998  71.881 59.192  1.00 274.84 ? 236  LYS D O     1 
ATOM   6157  C  CB    . LYS C 1 129 ? 75.082  72.848 59.956  1.00 285.26 ? 236  LYS D CB    1 
ATOM   6158  C  CG    . LYS C 1 129 ? 75.069  73.462 58.564  1.00 288.55 ? 236  LYS D CG    1 
ATOM   6159  C  CD    . LYS C 1 129 ? 74.963  74.981 58.621  1.00 287.22 ? 236  LYS D CD    1 
ATOM   6160  C  CE    . LYS C 1 129 ? 73.820  75.505 57.765  1.00 284.85 ? 236  LYS D CE    1 
ATOM   6161  N  NZ    . LYS C 1 129 ? 72.492  75.219 58.378  1.00 278.70 ? 236  LYS D NZ    1 
ATOM   6162  N  N     . ALA C 1 130 ? 73.177  70.425 60.449  1.00 275.37 ? 237  ALA D N     1 
ATOM   6163  C  CA    . ALA C 1 130 ? 72.455  69.236 59.991  1.00 274.02 ? 237  ALA D CA    1 
ATOM   6164  C  C     . ALA C 1 130 ? 71.058  69.121 60.608  1.00 267.35 ? 237  ALA D C     1 
ATOM   6165  O  O     . ALA C 1 130 ? 70.190  68.442 60.054  1.00 266.64 ? 237  ALA D O     1 
ATOM   6166  C  CB    . ALA C 1 130 ? 73.264  67.983 60.293  1.00 277.46 ? 237  ALA D CB    1 
ATOM   6167  N  N     . LEU C 1 131 ? 70.845  69.774 61.750  1.00 262.53 ? 238  LEU D N     1 
ATOM   6168  C  CA    . LEU C 1 131 ? 69.544  69.754 62.424  1.00 256.13 ? 238  LEU D CA    1 
ATOM   6169  C  C     . LEU C 1 131 ? 68.557  70.664 61.693  1.00 252.52 ? 238  LEU D C     1 
ATOM   6170  O  O     . LEU C 1 131 ? 67.388  70.313 61.527  1.00 249.70 ? 238  LEU D O     1 
ATOM   6171  C  CB    . LEU C 1 131 ? 69.681  70.180 63.893  1.00 253.98 ? 238  LEU D CB    1 
ATOM   6172  C  CG    . LEU C 1 131 ? 68.760  69.473 64.892  1.00 250.87 ? 238  LEU D CG    1 
ATOM   6173  C  CD1   . LEU C 1 131 ? 69.138  68.004 65.032  1.00 253.54 ? 238  LEU D CD1   1 
ATOM   6174  C  CD2   . LEU C 1 131 ? 68.815  70.166 66.245  1.00 248.50 ? 238  LEU D CD2   1 
ATOM   6175  N  N     . LYS C 1 132 ? 69.036  71.832 61.266  1.00 252.36 ? 239  LYS D N     1 
ATOM   6176  C  CA    . LYS C 1 132 ? 68.264  72.719 60.394  1.00 250.23 ? 239  LYS D CA    1 
ATOM   6177  C  C     . LYS C 1 132 ? 68.018  72.051 59.046  1.00 252.13 ? 239  LYS D C     1 
ATOM   6178  O  O     . LYS C 1 132 ? 66.916  72.129 58.502  1.00 250.66 ? 239  LYS D O     1 
ATOM   6179  C  CB    . LYS C 1 132 ? 68.994  74.051 60.184  1.00 251.75 ? 239  LYS D CB    1 
ATOM   6180  C  CG    . LYS C 1 132 ? 68.355  74.963 59.143  1.00 251.73 ? 239  LYS D CG    1 
ATOM   6181  C  CD    . LYS C 1 132 ? 69.040  76.319 59.082  1.00 253.39 ? 239  LYS D CD    1 
ATOM   6182  C  CE    . LYS C 1 132 ? 68.872  76.977 57.719  1.00 256.10 ? 239  LYS D CE    1 
ATOM   6183  N  NZ    . LYS C 1 132 ? 67.451  77.289 57.397  1.00 253.27 ? 239  LYS D NZ    1 
ATOM   6184  N  N     . ALA C 1 133 ? 69.053  71.402 58.515  1.00 255.93 ? 240  ALA D N     1 
ATOM   6185  C  CA    . ALA C 1 133 ? 68.960  70.684 57.243  1.00 258.64 ? 240  ALA D CA    1 
ATOM   6186  C  C     . ALA C 1 133 ? 67.831  69.655 57.259  1.00 255.21 ? 240  ALA D C     1 
ATOM   6187  O  O     . ALA C 1 133 ? 67.128  69.490 56.265  1.00 255.79 ? 240  ALA D O     1 
ATOM   6188  C  CB    . ALA C 1 133 ? 70.284  70.007 56.918  1.00 264.35 ? 240  ALA D CB    1 
ATOM   6189  N  N     . GLN C 1 134 ? 67.662  68.977 58.391  1.00 251.76 ? 241  GLN D N     1 
ATOM   6190  C  CA    . GLN C 1 134 ? 66.609  67.976 58.549  1.00 249.05 ? 241  GLN D CA    1 
ATOM   6191  C  C     . GLN C 1 134 ? 65.243  68.606 58.828  1.00 243.56 ? 241  GLN D C     1 
ATOM   6192  O  O     . GLN C 1 134 ? 64.223  68.116 58.341  1.00 242.94 ? 241  GLN D O     1 
ATOM   6193  C  CB    . GLN C 1 134 ? 66.971  66.999 59.669  1.00 248.97 ? 241  GLN D CB    1 
ATOM   6194  C  CG    . GLN C 1 134 ? 65.960  65.880 59.863  1.00 247.60 ? 241  GLN D CG    1 
ATOM   6195  C  CD    . GLN C 1 134 ? 66.582  64.622 60.434  1.00 249.97 ? 241  GLN D CD    1 
ATOM   6196  O  OE1   . GLN C 1 134 ? 66.316  64.248 61.576  1.00 247.74 ? 241  GLN D OE1   1 
ATOM   6197  N  NE2   . GLN C 1 134 ? 67.421  63.962 59.640  1.00 254.82 ? 241  GLN D NE2   1 
ATOM   6198  N  N     . ASN C 1 135 ? 65.226  69.682 59.614  1.00 239.39 ? 242  ASN D N     1 
ATOM   6199  C  CA    . ASN C 1 135 ? 63.979  70.366 59.968  1.00 233.95 ? 242  ASN D CA    1 
ATOM   6200  C  C     . ASN C 1 135 ? 63.224  70.870 58.742  1.00 233.80 ? 242  ASN D C     1 
ATOM   6201  O  O     . ASN C 1 135 ? 62.080  70.478 58.508  1.00 232.00 ? 242  ASN D O     1 
ATOM   6202  C  CB    . ASN C 1 135 ? 64.252  71.538 60.916  1.00 231.85 ? 242  ASN D CB    1 
ATOM   6203  C  CG    . ASN C 1 135 ? 62.981  72.247 61.348  1.00 228.05 ? 242  ASN D CG    1 
ATOM   6204  O  OD1   . ASN C 1 135 ? 62.622  73.288 60.798  1.00 227.90 ? 242  ASN D OD1   1 
ATOM   6205  N  ND2   . ASN C 1 135 ? 62.283  71.676 62.323  1.00 225.43 ? 242  ASN D ND2   1 
ATOM   6206  N  N     . ASP C 1 136 ? 63.874  71.731 57.961  1.00 236.05 ? 243  ASP D N     1 
ATOM   6207  C  CA    . ASP C 1 136 ? 63.236  72.334 56.785  1.00 237.39 ? 243  ASP D CA    1 
ATOM   6208  C  C     . ASP C 1 136 ? 63.262  71.438 55.535  1.00 240.32 ? 243  ASP D C     1 
ATOM   6209  O  O     . ASP C 1 136 ? 62.740  71.825 54.491  1.00 240.99 ? 243  ASP D O     1 
ATOM   6210  C  CB    . ASP C 1 136 ? 63.814  73.730 56.484  1.00 239.44 ? 243  ASP D CB    1 
ATOM   6211  C  CG    . ASP C 1 136 ? 65.318  73.722 56.252  1.00 243.82 ? 243  ASP D CG    1 
ATOM   6212  O  OD1   . ASP C 1 136 ? 65.958  74.755 56.540  1.00 244.79 ? 243  ASP D OD1   1 
ATOM   6213  O  OD2   . ASP C 1 136 ? 65.863  72.698 55.789  1.00 247.19 ? 243  ASP D OD2   1 
ATOM   6214  N  N     . LEU C 1 137 ? 63.869  70.255 55.640  1.00 241.76 ? 244  LEU D N     1 
ATOM   6215  C  CA    . LEU C 1 137 ? 63.737  69.228 54.603  1.00 244.87 ? 244  LEU D CA    1 
ATOM   6216  C  C     . LEU C 1 137 ? 62.342  68.622 54.676  1.00 242.13 ? 244  LEU D C     1 
ATOM   6217  O  O     . LEU C 1 137 ? 61.647  68.517 53.665  1.00 243.30 ? 244  LEU D O     1 
ATOM   6218  C  CB    . LEU C 1 137 ? 64.792  68.126 54.769  1.00 248.19 ? 244  LEU D CB    1 
ATOM   6219  C  CG    . LEU C 1 137 ? 64.605  66.838 53.955  1.00 251.28 ? 244  LEU D CG    1 
ATOM   6220  C  CD1   . LEU C 1 137 ? 64.541  67.132 52.464  1.00 254.82 ? 244  LEU D CD1   1 
ATOM   6221  C  CD2   . LEU C 1 137 ? 65.722  65.851 54.258  1.00 254.67 ? 244  LEU D CD2   1 
ATOM   6222  N  N     . ILE C 1 138 ? 61.942  68.227 55.882  1.00 239.03 ? 245  ILE D N     1 
ATOM   6223  C  CA    . ILE C 1 138 ? 60.615  67.661 56.116  1.00 236.79 ? 245  ILE D CA    1 
ATOM   6224  C  C     . ILE C 1 138 ? 59.533  68.702 55.830  1.00 235.32 ? 245  ILE D C     1 
ATOM   6225  O  O     . ILE C 1 138 ? 58.508  68.380 55.232  1.00 235.69 ? 245  ILE D O     1 
ATOM   6226  C  CB    . ILE C 1 138 ? 60.477  67.111 57.556  1.00 233.70 ? 245  ILE D CB    1 
ATOM   6227  C  CG1   . ILE C 1 138 ? 61.442  65.934 57.758  1.00 236.15 ? 245  ILE D CG1   1 
ATOM   6228  C  CG2   . ILE C 1 138 ? 59.045  66.666 57.840  1.00 231.11 ? 245  ILE D CG2   1 
ATOM   6229  C  CD1   . ILE C 1 138 ? 61.320  65.240 59.098  1.00 234.21 ? 245  ILE D CD1   1 
ATOM   6230  N  N     . TRP C 1 139 ? 59.768  69.946 56.245  1.00 234.36 ? 246  TRP D N     1 
ATOM   6231  C  CA    . TRP C 1 139 ? 58.807  71.029 56.007  1.00 233.42 ? 246  TRP D CA    1 
ATOM   6232  C  C     . TRP C 1 139 ? 58.627  71.345 54.523  1.00 236.67 ? 246  TRP D C     1 
ATOM   6233  O  O     . TRP C 1 139 ? 57.513  71.635 54.087  1.00 236.49 ? 246  TRP D O     1 
ATOM   6234  C  CB    . TRP C 1 139 ? 59.192  72.296 56.778  1.00 232.03 ? 246  TRP D CB    1 
ATOM   6235  C  CG    . TRP C 1 139 ? 58.622  72.328 58.157  1.00 228.56 ? 246  TRP D CG    1 
ATOM   6236  C  CD1   . TRP C 1 139 ? 59.309  72.281 59.334  1.00 227.16 ? 246  TRP D CD1   1 
ATOM   6237  C  CD2   . TRP C 1 139 ? 57.234  72.397 58.503  1.00 226.37 ? 246  TRP D CD2   1 
ATOM   6238  N  NE1   . TRP C 1 139 ? 58.434  72.327 60.393  1.00 224.11 ? 246  TRP D NE1   1 
ATOM   6239  C  CE2   . TRP C 1 139 ? 57.154  72.397 59.910  1.00 223.77 ? 246  TRP D CE2   1 
ATOM   6240  C  CE3   . TRP C 1 139 ? 56.050  72.462 57.758  1.00 226.79 ? 246  TRP D CE3   1 
ATOM   6241  C  CZ2   . TRP C 1 139 ? 55.934  72.461 60.590  1.00 221.82 ? 246  TRP D CZ2   1 
ATOM   6242  C  CZ3   . TRP C 1 139 ? 54.839  72.527 58.434  1.00 224.74 ? 246  TRP D CZ3   1 
ATOM   6243  C  CH2   . TRP C 1 139 ? 54.792  72.526 59.836  1.00 222.40 ? 246  TRP D CH2   1 
ATOM   6244  N  N     . ASN C 1 140 ? 59.714  71.297 53.756  1.00 240.43 ? 247  ASN D N     1 
ATOM   6245  C  CA    . ASN C 1 140 ? 59.619  71.382 52.297  1.00 244.49 ? 247  ASN D CA    1 
ATOM   6246  C  C     . ASN C 1 140 ? 58.769  70.237 51.750  1.00 244.19 ? 247  ASN D C     1 
ATOM   6247  O  O     . ASN C 1 140 ? 57.922  70.445 50.885  1.00 245.65 ? 247  ASN D O     1 
ATOM   6248  C  CB    . ASN C 1 140 ? 61.008  71.353 51.646  1.00 249.63 ? 247  ASN D CB    1 
ATOM   6249  C  CG    . ASN C 1 140 ? 61.730  72.687 51.731  1.00 251.12 ? 247  ASN D CG    1 
ATOM   6250  O  OD1   . ASN C 1 140 ? 61.359  73.565 52.511  1.00 248.70 ? 247  ASN D OD1   1 
ATOM   6251  N  ND2   . ASN C 1 140 ? 62.775  72.842 50.925  1.00 255.92 ? 247  ASN D ND2   1 
ATOM   6252  N  N     . ILE C 1 141 ? 58.997  69.037 52.277  1.00 242.54 ? 248  ILE D N     1 
ATOM   6253  C  CA    . ILE C 1 141 ? 58.252  67.842 51.874  1.00 242.37 ? 248  ILE D CA    1 
ATOM   6254  C  C     . ILE C 1 141 ? 56.791  67.887 52.343  1.00 238.65 ? 248  ILE D C     1 
ATOM   6255  O  O     . ILE C 1 141 ? 55.898  67.421 51.632  1.00 239.07 ? 248  ILE D O     1 
ATOM   6256  C  CB    . ILE C 1 141 ? 58.943  66.560 52.399  1.00 242.85 ? 248  ILE D CB    1 
ATOM   6257  C  CG1   . ILE C 1 141 ? 60.283  66.354 51.683  1.00 247.39 ? 248  ILE D CG1   1 
ATOM   6258  C  CG2   . ILE C 1 141 ? 58.063  65.335 52.194  1.00 242.90 ? 248  ILE D CG2   1 
ATOM   6259  C  CD1   . ILE C 1 141 ? 61.210  65.377 52.374  1.00 248.31 ? 248  ILE D CD1   1 
ATOM   6260  N  N     . LYS C 1 142 ? 56.554  68.443 53.531  1.00 234.96 ? 249  LYS D N     1 
ATOM   6261  C  CA    . LYS C 1 142 ? 55.201  68.516 54.098  1.00 232.10 ? 249  LYS D CA    1 
ATOM   6262  C  C     . LYS C 1 142 ? 54.255  69.342 53.227  1.00 232.88 ? 249  LYS D C     1 
ATOM   6263  O  O     . LYS C 1 142 ? 53.258  68.821 52.726  1.00 234.08 ? 249  LYS D O     1 
ATOM   6264  C  CB    . LYS C 1 142 ? 55.227  69.080 55.528  1.00 228.59 ? 249  LYS D CB    1 
ATOM   6265  C  CG    . LYS C 1 142 ? 55.558  68.046 56.595  1.00 226.89 ? 249  LYS D CG    1 
ATOM   6266  C  CD    . LYS C 1 142 ? 55.406  68.606 58.003  1.00 223.30 ? 249  LYS D CD    1 
ATOM   6267  C  CE    . LYS C 1 142 ? 53.975  68.491 58.506  1.00 221.44 ? 249  LYS D CE    1 
ATOM   6268  N  NZ    . LYS C 1 142 ? 53.827  68.946 59.916  1.00 218.76 ? 249  LYS D NZ    1 
ATOM   6269  N  N     . ASP C 1 143 ? 54.577  70.621 53.041  1.00 232.74 ? 250  ASP D N     1 
ATOM   6270  C  CA    . ASP C 1 143 ? 53.729  71.517 52.241  1.00 233.77 ? 250  ASP D CA    1 
ATOM   6271  C  C     . ASP C 1 143 ? 53.825  71.270 50.726  1.00 237.49 ? 250  ASP D C     1 
ATOM   6272  O  O     . ASP C 1 143 ? 53.057  71.850 49.957  1.00 239.14 ? 250  ASP D O     1 
ATOM   6273  C  CB    . ASP C 1 143 ? 53.985  72.998 52.580  1.00 232.95 ? 250  ASP D CB    1 
ATOM   6274  C  CG    . ASP C 1 143 ? 55.460  73.367 52.574  1.00 233.85 ? 250  ASP D CG    1 
ATOM   6275  O  OD1   . ASP C 1 143 ? 55.883  74.113 53.482  1.00 231.71 ? 250  ASP D OD1   1 
ATOM   6276  O  OD2   . ASP C 1 143 ? 56.197  72.913 51.674  1.00 236.96 ? 250  ASP D OD2   1 
ATOM   6277  N  N     . GLU C 1 144 ? 54.765  70.423 50.303  1.00 239.45 ? 251  GLU D N     1 
ATOM   6278  C  CA    . GLU C 1 144 ? 54.773  69.908 48.929  1.00 243.82 ? 251  GLU D CA    1 
ATOM   6279  C  C     . GLU C 1 144 ? 53.594  68.958 48.724  1.00 243.85 ? 251  GLU D C     1 
ATOM   6280  O  O     . GLU C 1 144 ? 52.893  69.040 47.715  1.00 246.10 ? 251  GLU D O     1 
ATOM   6281  C  CB    . GLU C 1 144 ? 56.087  69.182 48.606  1.00 246.48 ? 251  GLU D CB    1 
ATOM   6282  C  CG    . GLU C 1 144 ? 57.159  70.067 47.982  1.00 249.33 ? 251  GLU D CG    1 
ATOM   6283  C  CD    . GLU C 1 144 ? 56.976  70.274 46.487  1.00 253.67 ? 251  GLU D CD    1 
ATOM   6284  O  OE1   . GLU C 1 144 ? 55.836  70.154 45.990  1.00 253.58 ? 251  GLU D OE1   1 
ATOM   6285  O  OE2   . GLU C 1 144 ? 57.981  70.565 45.805  1.00 257.56 ? 251  GLU D OE2   1 
ATOM   6286  N  N     . LEU C 1 145 ? 53.387  68.062 49.687  1.00 241.64 ? 252  LEU D N     1 
ATOM   6287  C  CA    . LEU C 1 145 ? 52.254  67.135 49.659  1.00 241.81 ? 252  LEU D CA    1 
ATOM   6288  C  C     . LEU C 1 145 ? 50.919  67.854 49.856  1.00 241.34 ? 252  LEU D C     1 
ATOM   6289  O  O     . LEU C 1 145 ? 49.900  67.434 49.309  1.00 242.68 ? 252  LEU D O     1 
ATOM   6290  C  CB    . LEU C 1 145 ? 52.417  66.047 50.724  1.00 239.40 ? 252  LEU D CB    1 
ATOM   6291  C  CG    . LEU C 1 145 ? 53.523  65.018 50.476  1.00 241.21 ? 252  LEU D CG    1 
ATOM   6292  C  CD1   . LEU C 1 145 ? 53.781  64.215 51.740  1.00 238.90 ? 252  LEU D CD1   1 
ATOM   6293  C  CD2   . LEU C 1 145 ? 53.169  64.098 49.316  1.00 244.69 ? 252  LEU D CD2   1 
ATOM   6294  N  N     . LYS C 1 146 ? 50.930  68.931 50.639  1.00 240.04 ? 253  LYS D N     1 
ATOM   6295  C  CA    . LYS C 1 146 ? 49.733  69.748 50.849  1.00 239.95 ? 253  LYS D CA    1 
ATOM   6296  C  C     . LYS C 1 146 ? 49.332  70.492 49.572  1.00 243.81 ? 253  LYS D C     1 
ATOM   6297  O  O     . LYS C 1 146 ? 48.152  70.776 49.359  1.00 244.79 ? 253  LYS D O     1 
ATOM   6298  C  CB    . LYS C 1 146 ? 49.955  70.740 51.994  1.00 237.25 ? 253  LYS D CB    1 
ATOM   6299  C  CG    . LYS C 1 146 ? 48.699  71.487 52.424  1.00 236.90 ? 253  LYS D CG    1 
ATOM   6300  C  CD    . LYS C 1 146 ? 48.685  71.770 53.919  1.00 234.07 ? 253  LYS D CD    1 
ATOM   6301  C  CE    . LYS C 1 146 ? 48.289  70.535 54.716  1.00 232.73 ? 253  LYS D CE    1 
ATOM   6302  N  NZ    . LYS C 1 146 ? 48.188  70.809 56.176  1.00 230.21 ? 253  LYS D NZ    1 
ATOM   6303  N  N     . LYS C 1 147 ? 50.318  70.801 48.731  1.00 246.68 ? 254  LYS D N     1 
ATOM   6304  C  CA    . LYS C 1 147 ? 50.070  71.445 47.443  1.00 250.67 ? 254  LYS D CA    1 
ATOM   6305  C  C     . LYS C 1 147 ? 49.488  70.460 46.425  1.00 253.79 ? 254  LYS D C     1 
ATOM   6306  O  O     . LYS C 1 147 ? 48.557  70.801 45.693  1.00 256.34 ? 254  LYS D O     1 
ATOM   6307  C  CB    . LYS C 1 147 ? 51.367  72.050 46.890  1.00 252.68 ? 254  LYS D CB    1 
ATOM   6308  C  CG    . LYS C 1 147 ? 51.166  73.013 45.728  1.00 256.64 ? 254  LYS D CG    1 
ATOM   6309  C  CD    . LYS C 1 147 ? 52.458  73.270 44.965  1.00 259.88 ? 254  LYS D CD    1 
ATOM   6310  C  CE    . LYS C 1 147 ? 53.477  74.027 45.802  1.00 258.22 ? 254  LYS D CE    1 
ATOM   6311  N  NZ    . LYS C 1 147 ? 54.684  74.388 45.008  1.00 262.12 ? 254  LYS D NZ    1 
ATOM   6312  N  N     . VAL C 1 148 ? 50.033  69.244 46.391  1.00 253.93 ? 255  VAL D N     1 
ATOM   6313  C  CA    . VAL C 1 148 ? 49.691  68.265 45.348  1.00 256.74 ? 255  VAL D CA    1 
ATOM   6314  C  C     . VAL C 1 148 ? 48.611  67.259 45.763  1.00 255.13 ? 255  VAL D C     1 
ATOM   6315  O  O     . VAL C 1 148 ? 47.692  66.988 44.988  1.00 257.40 ? 255  VAL D O     1 
ATOM   6316  C  CB    . VAL C 1 148 ? 50.945  67.507 44.833  1.00 259.01 ? 255  VAL D CB    1 
ATOM   6317  C  CG1   . VAL C 1 148 ? 52.000  68.493 44.351  1.00 260.91 ? 255  VAL D CG1   1 
ATOM   6318  C  CG2   . VAL C 1 148 ? 51.525  66.576 45.893  1.00 256.36 ? 255  VAL D CG2   1 
ATOM   6319  N  N     . CYS C 1 149 ? 48.714  66.716 46.976  1.00 251.49 ? 256  CYS D N     1 
ATOM   6320  C  CA    . CYS C 1 149 ? 47.836  65.628 47.419  1.00 250.53 ? 256  CYS D CA    1 
ATOM   6321  C  C     . CYS C 1 149 ? 46.726  66.108 48.350  1.00 247.87 ? 256  CYS D C     1 
ATOM   6322  O  O     . CYS C 1 149 ? 46.923  67.027 49.148  1.00 245.64 ? 256  CYS D O     1 
ATOM   6323  C  CB    . CYS C 1 149 ? 48.649  64.537 48.126  1.00 249.28 ? 256  CYS D CB    1 
ATOM   6324  S  SG    . CYS C 1 149 ? 49.667  63.527 47.026  1.00 253.00 ? 256  CYS D SG    1 
ATOM   6325  N  N     . SER C 1 150 ? 45.562  65.471 48.238  1.00 248.05 ? 257  SER D N     1 
ATOM   6326  C  CA    . SER C 1 150 ? 44.464  65.674 49.180  1.00 245.57 ? 257  SER D CA    1 
ATOM   6327  C  C     . SER C 1 150 ? 44.675  64.769 50.392  1.00 242.80 ? 257  SER D C     1 
ATOM   6328  O  O     . SER C 1 150 ? 45.616  63.973 50.423  1.00 242.77 ? 257  SER D O     1 
ATOM   6329  C  CB    . SER C 1 150 ? 43.121  65.362 48.513  1.00 247.88 ? 257  SER D CB    1 
ATOM   6330  O  OG    . SER C 1 150 ? 43.057  64.008 48.097  1.00 249.22 ? 257  SER D OG    1 
ATOM   6331  N  N     . THR C 1 151 ? 43.800  64.892 51.387  1.00 240.84 ? 258  THR D N     1 
ATOM   6332  C  CA    . THR C 1 151 ? 43.910  64.096 52.611  1.00 238.56 ? 258  THR D CA    1 
ATOM   6333  C  C     . THR C 1 151 ? 43.695  62.605 52.341  1.00 239.44 ? 258  THR D C     1 
ATOM   6334  O  O     . THR C 1 151 ? 44.407  61.766 52.892  1.00 238.97 ? 258  THR D O     1 
ATOM   6335  C  CB    . THR C 1 151 ? 42.906  64.566 53.684  1.00 237.71 ? 258  THR D CB    1 
ATOM   6336  O  OG1   . THR C 1 151 ? 43.014  65.985 53.858  1.00 236.93 ? 258  THR D OG1   1 
ATOM   6337  C  CG2   . THR C 1 151 ? 43.172  63.872 55.018  1.00 235.64 ? 258  THR D CG2   1 
ATOM   6338  N  N     . ASN C 1 152 ? 42.720  62.285 51.492  1.00 241.06 ? 259  ASN D N     1 
ATOM   6339  C  CA    . ASN C 1 152 ? 42.405  60.891 51.156  1.00 242.67 ? 259  ASN D CA    1 
ATOM   6340  C  C     . ASN C 1 152 ? 43.562  60.157 50.474  1.00 243.77 ? 259  ASN D C     1 
ATOM   6341  O  O     . ASN C 1 152 ? 43.716  58.946 50.643  1.00 244.12 ? 259  ASN D O     1 
ATOM   6342  C  CB    . ASN C 1 152 ? 41.152  60.818 50.276  1.00 245.66 ? 259  ASN D CB    1 
ATOM   6343  C  CG    . ASN C 1 152 ? 39.889  61.232 51.012  1.00 245.23 ? 259  ASN D CG    1 
ATOM   6344  O  OD1   . ASN C 1 152 ? 39.901  61.458 52.223  1.00 242.36 ? 259  ASN D OD1   1 
ATOM   6345  N  ND2   . ASN C 1 152 ? 38.786  61.331 50.279  1.00 248.30 ? 259  ASN D ND2   1 
ATOM   6346  N  N     . ASP C 1 153 ? 44.364  60.889 49.704  1.00 244.63 ? 260  ASP D N     1 
ATOM   6347  C  CA    . ASP C 1 153 ? 45.576  60.334 49.098  1.00 246.53 ? 260  ASP D CA    1 
ATOM   6348  C  C     . ASP C 1 153 ? 46.619  60.025 50.171  1.00 244.03 ? 260  ASP D C     1 
ATOM   6349  O  O     . ASP C 1 153 ? 47.267  58.977 50.135  1.00 245.21 ? 260  ASP D O     1 
ATOM   6350  C  CB    . ASP C 1 153 ? 46.166  61.306 48.069  1.00 248.40 ? 260  ASP D CB    1 
ATOM   6351  C  CG    . ASP C 1 153 ? 45.253  61.524 46.873  1.00 251.96 ? 260  ASP D CG    1 
ATOM   6352  O  OD1   . ASP C 1 153 ? 44.060  61.159 46.948  1.00 253.13 ? 260  ASP D OD1   1 
ATOM   6353  O  OD2   . ASP C 1 153 ? 45.732  62.066 45.855  1.00 254.45 ? 260  ASP D OD2   1 
ATOM   6354  N  N     . LEU C 1 154 ? 46.769  60.945 51.122  1.00 240.92 ? 261  LEU D N     1 
ATOM   6355  C  CA    . LEU C 1 154 ? 47.715  60.786 52.228  1.00 238.54 ? 261  LEU D CA    1 
ATOM   6356  C  C     . LEU C 1 154 ? 47.270  59.699 53.208  1.00 238.12 ? 261  LEU D C     1 
ATOM   6357  O  O     . LEU C 1 154 ? 48.107  59.027 53.813  1.00 237.34 ? 261  LEU D O     1 
ATOM   6358  C  CB    . LEU C 1 154 ? 47.896  62.113 52.970  1.00 235.41 ? 261  LEU D CB    1 
ATOM   6359  C  CG    . LEU C 1 154 ? 48.477  63.267 52.146  1.00 236.03 ? 261  LEU D CG    1 
ATOM   6360  C  CD1   . LEU C 1 154 ? 48.228  64.601 52.833  1.00 233.64 ? 261  LEU D CD1   1 
ATOM   6361  C  CD2   . LEU C 1 154 ? 49.962  63.059 51.892  1.00 236.88 ? 261  LEU D CD2   1 
ATOM   6362  N  N     . LYS C 1 155 ? 45.957  59.541 53.369  1.00 239.00 ? 262  LYS D N     1 
ATOM   6363  C  CA    . LYS C 1 155 ? 45.403  58.462 54.189  1.00 239.41 ? 262  LYS D CA    1 
ATOM   6364  C  C     . LYS C 1 155 ? 45.708  57.100 53.567  1.00 242.23 ? 262  LYS D C     1 
ATOM   6365  O  O     . LYS C 1 155 ? 46.187  56.194 54.249  1.00 242.43 ? 262  LYS D O     1 
ATOM   6366  C  CB    . LYS C 1 155 ? 43.889  58.625 54.365  1.00 240.05 ? 262  LYS D CB    1 
ATOM   6367  C  CG    . LYS C 1 155 ? 43.487  59.687 55.376  1.00 237.48 ? 262  LYS D CG    1 
ATOM   6368  C  CD    . LYS C 1 155 ? 41.989  59.662 55.636  1.00 238.49 ? 262  LYS D CD    1 
ATOM   6369  C  CE    . LYS C 1 155 ? 41.596  60.620 56.749  1.00 236.28 ? 262  LYS D CE    1 
ATOM   6370  N  NZ    . LYS C 1 155 ? 40.161  60.484 57.122  1.00 237.71 ? 262  LYS D NZ    1 
ATOM   6371  N  N     . GLU C 1 156 ? 45.435  56.970 52.271  1.00 244.80 ? 263  GLU D N     1 
ATOM   6372  C  CA    . GLU C 1 156 ? 45.684  55.722 51.544  1.00 248.09 ? 263  GLU D CA    1 
ATOM   6373  C  C     . GLU C 1 156 ? 47.175  55.464 51.293  1.00 248.46 ? 263  GLU D C     1 
ATOM   6374  O  O     . GLU C 1 156 ? 47.566  54.331 51.004  1.00 251.31 ? 263  GLU D O     1 
ATOM   6375  C  CB    . GLU C 1 156 ? 44.905  55.705 50.224  1.00 251.43 ? 263  GLU D CB    1 
ATOM   6376  C  CG    . GLU C 1 156 ? 43.400  55.578 50.415  1.00 252.34 ? 263  GLU D CG    1 
ATOM   6377  C  CD    . GLU C 1 156 ? 42.616  55.719 49.123  1.00 256.05 ? 263  GLU D CD    1 
ATOM   6378  O  OE1   . GLU C 1 156 ? 43.219  55.617 48.033  1.00 258.97 ? 263  GLU D OE1   1 
ATOM   6379  O  OE2   . GLU C 1 156 ? 41.387  55.929 49.198  1.00 257.10 ? 263  GLU D OE2   1 
ATOM   6380  N  N     . LEU C 1 157 ? 47.999  56.507 51.398  1.00 246.04 ? 264  LEU D N     1 
ATOM   6381  C  CA    . LEU C 1 157 ? 49.457  56.347 51.371  1.00 246.34 ? 264  LEU D CA    1 
ATOM   6382  C  C     . LEU C 1 157 ? 49.931  55.556 52.589  1.00 244.74 ? 264  LEU D C     1 
ATOM   6383  O  O     . LEU C 1 157 ? 50.698  54.601 52.458  1.00 246.50 ? 264  LEU D O     1 
ATOM   6384  C  CB    . LEU C 1 157 ? 50.169  57.707 51.332  1.00 244.81 ? 264  LEU D CB    1 
ATOM   6385  C  CG    . LEU C 1 157 ? 50.527  58.270 49.954  1.00 247.71 ? 264  LEU D CG    1 
ATOM   6386  C  CD1   . LEU C 1 157 ? 50.860  59.753 50.049  1.00 245.85 ? 264  LEU D CD1   1 
ATOM   6387  C  CD2   . LEU C 1 157 ? 51.688  57.497 49.343  1.00 251.29 ? 264  LEU D CD2   1 
ATOM   6388  N  N     . LEU C 1 158 ? 49.466  55.964 53.767  1.00 241.47 ? 265  LEU D N     1 
ATOM   6389  C  CA    . LEU C 1 158 ? 49.830  55.308 55.024  1.00 240.71 ? 265  LEU D CA    1 
ATOM   6390  C  C     . LEU C 1 158 ? 49.271  53.886 55.120  1.00 243.10 ? 265  LEU D C     1 
ATOM   6391  O  O     . LEU C 1 158 ? 49.955  52.979 55.596  1.00 244.78 ? 265  LEU D O     1 
ATOM   6392  C  CB    . LEU C 1 158 ? 49.346  56.139 56.218  1.00 237.12 ? 265  LEU D CB    1 
ATOM   6393  C  CG    . LEU C 1 158 ? 49.992  57.516 56.404  1.00 234.61 ? 265  LEU D CG    1 
ATOM   6394  C  CD1   . LEU C 1 158 ? 49.203  58.345 57.406  1.00 231.55 ? 265  LEU D CD1   1 
ATOM   6395  C  CD2   . LEU C 1 158 ? 51.443  57.391 56.845  1.00 234.43 ? 265  LEU D CD2   1 
ATOM   6396  N  N     . ILE C 1 159 ? 48.033  53.698 54.663  1.00 243.87 ? 266  ILE D N     1 
ATOM   6397  C  CA    . ILE C 1 159 ? 47.380  52.384 54.700  1.00 246.40 ? 266  ILE D CA    1 
ATOM   6398  C  C     . ILE C 1 159 ? 48.134  51.375 53.831  1.00 250.45 ? 266  ILE D C     1 
ATOM   6399  O  O     . ILE C 1 159 ? 48.285  50.212 54.212  1.00 252.34 ? 266  ILE D O     1 
ATOM   6400  C  CB    . ILE C 1 159 ? 45.902  52.463 54.247  1.00 247.04 ? 266  ILE D CB    1 
ATOM   6401  C  CG1   . ILE C 1 159 ? 45.082  53.303 55.233  1.00 243.94 ? 266  ILE D CG1   1 
ATOM   6402  C  CG2   . ILE C 1 159 ? 45.290  51.069 54.135  1.00 250.29 ? 266  ILE D CG2   1 
ATOM   6403  C  CD1   . ILE C 1 159 ? 43.810  53.876 54.645  1.00 244.47 ? 266  ILE D CD1   1 
ATOM   6404  N  N     . PHE C 1 160 ? 48.603  51.827 52.669  1.00 252.25 ? 267  PHE D N     1 
ATOM   6405  C  CA    . PHE C 1 160 ? 49.404  50.992 51.771  1.00 256.62 ? 267  PHE D CA    1 
ATOM   6406  C  C     . PHE C 1 160 ? 50.709  50.539 52.432  1.00 256.94 ? 267  PHE D C     1 
ATOM   6407  O  O     . PHE C 1 160 ? 51.165  49.417 52.206  1.00 260.82 ? 267  PHE D O     1 
ATOM   6408  C  CB    . PHE C 1 160 ? 49.710  51.749 50.474  1.00 258.18 ? 267  PHE D CB    1 
ATOM   6409  C  CG    . PHE C 1 160 ? 50.446  50.930 49.450  1.00 263.17 ? 267  PHE D CG    1 
ATOM   6410  C  CD1   . PHE C 1 160 ? 49.752  50.162 48.523  1.00 266.76 ? 267  PHE D CD1   1 
ATOM   6411  C  CD2   . PHE C 1 160 ? 51.835  50.930 49.408  1.00 264.55 ? 267  PHE D CD2   1 
ATOM   6412  C  CE1   . PHE C 1 160 ? 50.429  49.408 47.578  1.00 271.46 ? 267  PHE D CE1   1 
ATOM   6413  C  CE2   . PHE C 1 160 ? 52.517  50.177 48.467  1.00 269.63 ? 267  PHE D CE2   1 
ATOM   6414  C  CZ    . PHE C 1 160 ? 51.813  49.416 47.550  1.00 273.02 ? 267  PHE D CZ    1 
ATOM   6415  N  N     . ASN C 1 161 ? 51.295  51.412 53.250  1.00 253.07 ? 268  ASN D N     1 
ATOM   6416  C  CA    . ASN C 1 161 ? 52.537  51.104 53.966  1.00 253.28 ? 268  ASN D CA    1 
ATOM   6417  C  C     . ASN C 1 161 ? 52.307  50.426 55.325  1.00 251.66 ? 268  ASN D C     1 
ATOM   6418  O  O     . ASN C 1 161 ? 53.237  50.313 56.127  1.00 251.81 ? 268  ASN D O     1 
ATOM   6419  C  CB    . ASN C 1 161 ? 53.373  52.379 54.150  1.00 251.07 ? 268  ASN D CB    1 
ATOM   6420  C  CG    . ASN C 1 161 ? 53.951  52.893 52.843  1.00 253.81 ? 268  ASN D CG    1 
ATOM   6421  O  OD1   . ASN C 1 161 ? 55.148  52.762 52.590  1.00 256.55 ? 268  ASN D OD1   1 
ATOM   6422  N  ND2   . ASN C 1 161 ? 53.101  53.475 52.005  1.00 253.76 ? 268  ASN D ND2   1 
ATOM   6423  N  N     . LYS C 1 162 ? 51.076  49.973 55.572  1.00 250.49 ? 269  LYS D N     1 
ATOM   6424  C  CA    . LYS C 1 162 ? 50.705  49.288 56.816  1.00 249.41 ? 269  LYS D CA    1 
ATOM   6425  C  C     . LYS C 1 162 ? 50.925  50.176 58.044  1.00 244.89 ? 269  LYS D C     1 
ATOM   6426  O  O     . LYS C 1 162 ? 51.478  49.735 59.054  1.00 244.71 ? 269  LYS D O     1 
ATOM   6427  C  CB    . LYS C 1 162 ? 51.463  47.958 56.960  1.00 253.23 ? 269  LYS D CB    1 
ATOM   6428  C  CG    . LYS C 1 162 ? 51.440  47.071 55.721  1.00 257.76 ? 269  LYS D CG    1 
ATOM   6429  C  CD    . LYS C 1 162 ? 50.033  46.624 55.357  1.00 258.66 ? 269  LYS D CD    1 
ATOM   6430  C  CE    . LYS C 1 162 ? 50.029  45.802 54.077  1.00 263.45 ? 269  LYS D CE    1 
ATOM   6431  N  NZ    . LYS C 1 162 ? 48.649  45.478 53.624  1.00 264.35 ? 269  LYS D NZ    1 
ATOM   6432  N  N     . GLN C 1 163 ? 50.476  51.426 57.943  1.00 241.23 ? 270  GLN D N     1 
ATOM   6433  C  CA    . GLN C 1 163 ? 50.611  52.405 59.020  1.00 237.10 ? 270  GLN D CA    1 
ATOM   6434  C  C     . GLN C 1 163 ? 49.237  52.805 59.546  1.00 235.19 ? 270  GLN D C     1 
ATOM   6435  O  O     . GLN C 1 163 ? 48.271  52.884 58.785  1.00 236.06 ? 270  GLN D O     1 
ATOM   6436  C  CB    . GLN C 1 163 ? 51.344  53.651 58.518  1.00 234.99 ? 270  GLN D CB    1 
ATOM   6437  C  CG    . GLN C 1 163 ? 52.757  53.397 58.017  1.00 236.78 ? 270  GLN D CG    1 
ATOM   6438  C  CD    . GLN C 1 163 ? 53.725  53.062 59.136  1.00 236.26 ? 270  GLN D CD    1 
ATOM   6439  O  OE1   . GLN C 1 163 ? 53.819  53.785 60.127  1.00 232.68 ? 270  GLN D OE1   1 
ATOM   6440  N  NE2   . GLN C 1 163 ? 54.453  51.963 58.979  1.00 239.82 ? 270  GLN D NE2   1 
ATOM   6441  N  N     . GLN C 1 164 ? 49.159  53.056 60.851  1.00 233.02 ? 271  GLN D N     1 
ATOM   6442  C  CA    . GLN C 1 164 ? 47.935  53.548 61.477  1.00 231.30 ? 271  GLN D CA    1 
ATOM   6443  C  C     . GLN C 1 164 ? 47.674  54.979 61.017  1.00 229.14 ? 271  GLN D C     1 
ATOM   6444  O  O     . GLN C 1 164 ? 48.550  55.838 61.126  1.00 227.59 ? 271  GLN D O     1 
ATOM   6445  C  CB    . GLN C 1 164 ? 48.059  53.510 63.004  1.00 229.83 ? 271  GLN D CB    1 
ATOM   6446  C  CG    . GLN C 1 164 ? 46.775  53.833 63.756  1.00 228.72 ? 271  GLN D CG    1 
ATOM   6447  C  CD    . GLN C 1 164 ? 47.007  54.087 65.235  1.00 227.20 ? 271  GLN D CD    1 
ATOM   6448  O  OE1   . GLN C 1 164 ? 46.485  55.049 65.798  1.00 225.58 ? 271  GLN D OE1   1 
ATOM   6449  N  NE2   . GLN C 1 164 ? 47.797  53.227 65.870  1.00 228.34 ? 271  GLN D NE2   1 
ATOM   6450  N  N     . VAL C 1 165 ? 46.471  55.228 60.506  1.00 229.57 ? 272  VAL D N     1 
ATOM   6451  C  CA    . VAL C 1 165 ? 46.088  56.557 60.035  1.00 227.81 ? 272  VAL D CA    1 
ATOM   6452  C  C     . VAL C 1 165 ? 45.673  57.415 61.232  1.00 224.84 ? 272  VAL D C     1 
ATOM   6453  O  O     . VAL C 1 165 ? 44.691  57.097 61.904  1.00 225.10 ? 272  VAL D O     1 
ATOM   6454  C  CB    . VAL C 1 165 ? 44.925  56.488 59.023  1.00 230.07 ? 272  VAL D CB    1 
ATOM   6455  C  CG1   . VAL C 1 165 ? 44.527  57.884 58.561  1.00 228.98 ? 272  VAL D CG1   1 
ATOM   6456  C  CG2   . VAL C 1 165 ? 45.309  55.622 57.832  1.00 232.86 ? 272  VAL D CG2   1 
ATOM   6457  N  N     . PRO C 1 166 ? 46.416  58.506 61.501  1.00 222.01 ? 273  PRO D N     1 
ATOM   6458  C  CA    . PRO C 1 166 ? 46.108  59.335 62.665  1.00 219.54 ? 273  PRO D CA    1 
ATOM   6459  C  C     . PRO C 1 166 ? 44.933  60.283 62.446  1.00 219.00 ? 273  PRO D C     1 
ATOM   6460  O  O     . PRO C 1 166 ? 44.562  60.569 61.305  1.00 219.71 ? 273  PRO D O     1 
ATOM   6461  C  CB    . PRO C 1 166 ? 47.394  60.136 62.863  1.00 217.69 ? 273  PRO D CB    1 
ATOM   6462  C  CG    . PRO C 1 166 ? 47.947  60.283 61.490  1.00 218.84 ? 273  PRO D CG    1 
ATOM   6463  C  CD    . PRO C 1 166 ? 47.576  59.026 60.752  1.00 221.69 ? 273  PRO D CD    1 
ATOM   6464  N  N     . SER C 1 167 ? 44.363  60.760 63.550  1.00 217.65 ? 274  SER D N     1 
ATOM   6465  C  CA    . SER C 1 167 ? 43.298  61.758 63.521  1.00 217.59 ? 274  SER D CA    1 
ATOM   6466  C  C     . SER C 1 167 ? 43.913  63.154 63.462  1.00 215.66 ? 274  SER D C     1 
ATOM   6467  O  O     . SER C 1 167 ? 44.685  63.531 64.344  1.00 213.62 ? 274  SER D O     1 
ATOM   6468  C  CB    . SER C 1 167 ? 42.414  61.624 64.764  1.00 217.91 ? 274  SER D CB    1 
ATOM   6469  O  OG    . SER C 1 167 ? 41.530  62.723 64.895  1.00 218.32 ? 274  SER D OG    1 
ATOM   6470  N  N     . GLY C 1 168 ? 43.568  63.911 62.422  1.00 216.69 ? 275  GLY D N     1 
ATOM   6471  C  CA    . GLY C 1 168 ? 44.092  65.264 62.228  1.00 215.49 ? 275  GLY D CA    1 
ATOM   6472  C  C     . GLY C 1 168 ? 44.730  65.432 60.863  1.00 216.26 ? 275  GLY D C     1 
ATOM   6473  O  O     . GLY C 1 168 ? 45.355  64.505 60.349  1.00 216.96 ? 275  GLY D O     1 
ATOM   6474  N  N     . GLU C 1 169 ? 44.573  66.617 60.277  1.00 216.89 ? 276  GLU D N     1 
ATOM   6475  C  CA    . GLU C 1 169 ? 45.174  66.919 58.980  1.00 218.27 ? 276  GLU D CA    1 
ATOM   6476  C  C     . GLU C 1 169 ? 46.684  67.068 59.126  1.00 216.64 ? 276  GLU D C     1 
ATOM   6477  O  O     . GLU C 1 169 ? 47.445  66.382 58.444  1.00 217.37 ? 276  GLU D O     1 
ATOM   6478  C  CB    . GLU C 1 169 ? 44.575  68.197 58.383  1.00 219.80 ? 276  GLU D CB    1 
ATOM   6479  C  CG    . GLU C 1 169 ? 45.032  68.492 56.958  1.00 221.89 ? 276  GLU D CG    1 
ATOM   6480  C  CD    . GLU C 1 169 ? 44.387  69.734 56.365  1.00 223.79 ? 276  GLU D CD    1 
ATOM   6481  O  OE1   . GLU C 1 169 ? 44.734  70.088 55.218  1.00 225.36 ? 276  GLU D OE1   1 
ATOM   6482  O  OE2   . GLU C 1 169 ? 43.537  70.359 57.036  1.00 224.13 ? 276  GLU D OE2   1 
ATOM   6483  N  N     . SER C 1 170 ? 47.102  67.956 60.028  1.00 214.38 ? 277  SER D N     1 
ATOM   6484  C  CA    . SER C 1 170 ? 48.521  68.230 60.274  1.00 212.44 ? 277  SER D CA    1 
ATOM   6485  C  C     . SER C 1 170 ? 49.310  66.972 60.637  1.00 212.13 ? 277  SER D C     1 
ATOM   6486  O  O     . SER C 1 170 ? 50.432  66.783 60.170  1.00 212.65 ? 277  SER D O     1 
ATOM   6487  C  CB    . SER C 1 170 ? 48.678  69.269 61.388  1.00 210.13 ? 277  SER D CB    1 
ATOM   6488  O  OG    . SER C 1 170 ? 48.121  68.802 62.604  1.00 209.01 ? 277  SER D OG    1 
ATOM   6489  N  N     . ALA C 1 171 ? 48.713  66.120 61.468  1.00 211.73 ? 278  ALA D N     1 
ATOM   6490  C  CA    . ALA C 1 171 ? 49.364  64.891 61.927  1.00 211.87 ? 278  ALA D CA    1 
ATOM   6491  C  C     . ALA C 1 171 ? 49.519  63.840 60.824  1.00 214.24 ? 278  ALA D C     1 
ATOM   6492  O  O     . ALA C 1 171 ? 50.452  63.037 60.867  1.00 214.51 ? 278  ALA D O     1 
ATOM   6493  C  CB    . ALA C 1 171 ? 48.601  64.302 63.105  1.00 211.40 ? 278  ALA D CB    1 
ATOM   6494  N  N     . ILE C 1 172 ? 48.611  63.840 59.847  1.00 216.39 ? 279  ILE D N     1 
ATOM   6495  C  CA    . ILE C 1 172 ? 48.667  62.871 58.746  1.00 219.31 ? 279  ILE D CA    1 
ATOM   6496  C  C     . ILE C 1 172 ? 49.908  63.090 57.879  1.00 221.10 ? 279  ILE D C     1 
ATOM   6497  O  O     . ILE C 1 172 ? 50.704  62.168 57.700  1.00 222.23 ? 279  ILE D O     1 
ATOM   6498  C  CB    . ILE C 1 172 ? 47.374  62.885 57.890  1.00 221.02 ? 279  ILE D CB    1 
ATOM   6499  C  CG1   . ILE C 1 172 ? 46.286  62.055 58.581  1.00 221.22 ? 279  ILE D CG1   1 
ATOM   6500  C  CG2   . ILE C 1 172 ? 47.621  62.316 56.495  1.00 223.94 ? 279  ILE D CG2   1 
ATOM   6501  C  CD1   . ILE C 1 172 ? 44.892  62.256 58.026  1.00 222.60 ? 279  ILE D CD1   1 
ATOM   6502  N  N     . LEU C 1 173 ? 50.078  64.304 57.357  1.00 222.21 ? 280  LEU D N     1 
ATOM   6503  C  CA    . LEU C 1 173 ? 51.245  64.617 56.521  1.00 224.57 ? 280  LEU D CA    1 
ATOM   6504  C  C     . LEU C 1 173 ? 52.553  64.654 57.322  1.00 223.98 ? 280  LEU D C     1 
ATOM   6505  O  O     . LEU C 1 173 ? 53.635  64.546 56.743  1.00 226.14 ? 280  LEU D O     1 
ATOM   6506  C  CB    . LEU C 1 173 ? 51.053  65.925 55.735  1.00 225.39 ? 280  LEU D CB    1 
ATOM   6507  C  CG    . LEU C 1 173 ? 51.149  67.285 56.447  1.00 223.50 ? 280  LEU D CG    1 
ATOM   6508  C  CD1   . LEU C 1 173 ? 51.718  68.340 55.511  1.00 225.11 ? 280  LEU D CD1   1 
ATOM   6509  C  CD2   . LEU C 1 173 ? 49.799  67.744 56.970  1.00 222.44 ? 280  LEU D CD2   1 
ATOM   6510  N  N     . ASP C 1 174 ? 52.452  64.810 58.641  1.00 221.64 ? 281  ASP D N     1 
ATOM   6511  C  CA    . ASP C 1 174 ? 53.621  64.746 59.520  1.00 220.93 ? 281  ASP D CA    1 
ATOM   6512  C  C     . ASP C 1 174 ? 54.183  63.322 59.555  1.00 222.40 ? 281  ASP D C     1 
ATOM   6513  O  O     . ASP C 1 174 ? 55.400  63.131 59.590  1.00 223.65 ? 281  ASP D O     1 
ATOM   6514  C  CB    . ASP C 1 174 ? 53.262  65.211 60.940  1.00 218.76 ? 281  ASP D CB    1 
ATOM   6515  C  CG    . ASP C 1 174 ? 54.431  65.867 61.661  1.00 218.27 ? 281  ASP D CG    1 
ATOM   6516  O  OD1   . ASP C 1 174 ? 55.578  65.394 61.514  1.00 220.40 ? 281  ASP D OD1   1 
ATOM   6517  O  OD2   . ASP C 1 174 ? 54.197  66.860 62.383  1.00 216.39 ? 281  ASP D OD2   1 
ATOM   6518  N  N     . ARG C 1 175 ? 53.292  62.330 59.540  1.00 222.88 ? 282  ARG D N     1 
ATOM   6519  C  CA    . ARG C 1 175 ? 53.694  60.920 59.533  1.00 225.16 ? 282  ARG D CA    1 
ATOM   6520  C  C     . ARG C 1 175 ? 54.040  60.413 58.132  1.00 229.12 ? 282  ARG D C     1 
ATOM   6521  O  O     . ARG C 1 175 ? 54.877  59.520 57.988  1.00 231.57 ? 282  ARG D O     1 
ATOM   6522  C  CB    . ARG C 1 175 ? 52.603  60.042 60.151  1.00 224.73 ? 282  ARG D CB    1 
ATOM   6523  C  CG    . ARG C 1 175 ? 52.394  60.293 61.635  1.00 222.36 ? 282  ARG D CG    1 
ATOM   6524  C  CD    . ARG C 1 175 ? 51.574  59.191 62.283  1.00 222.89 ? 282  ARG D CD    1 
ATOM   6525  N  NE    . ARG C 1 175 ? 51.114  59.569 63.619  1.00 220.89 ? 282  ARG D NE    1 
ATOM   6526  C  CZ    . ARG C 1 175 ? 50.426  58.777 64.439  1.00 221.61 ? 282  ARG D CZ    1 
ATOM   6527  N  NH1   . ARG C 1 175 ? 50.100  57.539 64.075  1.00 223.79 ? 282  ARG D NH1   1 
ATOM   6528  N  NH2   . ARG C 1 175 ? 50.055  59.228 65.632  1.00 220.49 ? 282  ARG D NH2   1 
ATOM   6529  N  N     . VAL C 1 176 ? 53.395  60.970 57.108  1.00 230.53 ? 283  VAL D N     1 
ATOM   6530  C  CA    . VAL C 1 176 ? 53.727  60.642 55.718  1.00 234.46 ? 283  VAL D CA    1 
ATOM   6531  C  C     . VAL C 1 176 ? 55.127  61.160 55.388  1.00 236.15 ? 283  VAL D C     1 
ATOM   6532  O  O     . VAL C 1 176 ? 55.927  60.447 54.783  1.00 239.64 ? 283  VAL D O     1 
ATOM   6533  C  CB    . VAL C 1 176 ? 52.699  61.223 54.718  1.00 235.28 ? 283  VAL D CB    1 
ATOM   6534  C  CG1   . VAL C 1 176 ? 53.175  61.051 53.280  1.00 238.84 ? 283  VAL D CG1   1 
ATOM   6535  C  CG2   . VAL C 1 176 ? 51.342  60.558 54.898  1.00 235.26 ? 283  VAL D CG2   1 
ATOM   6536  N  N     . ALA C 1 177 ? 55.414  62.396 55.793  1.00 234.35 ? 284  ALA D N     1 
ATOM   6537  C  CA    . ALA C 1 177 ? 56.739  62.988 55.601  1.00 235.63 ? 284  ALA D CA    1 
ATOM   6538  C  C     . ALA C 1 177 ? 57.805  62.220 56.383  1.00 236.62 ? 284  ALA D C     1 
ATOM   6539  O  O     . ALA C 1 177 ? 58.905  61.992 55.881  1.00 239.32 ? 284  ALA D O     1 
ATOM   6540  C  CB    . ALA C 1 177 ? 56.733  64.453 56.009  1.00 233.10 ? 284  ALA D CB    1 
ATOM   6541  N  N     . ASP C 1 178 ? 57.471  61.830 57.612  1.00 234.90 ? 285  ASP D N     1 
ATOM   6542  C  CA    . ASP C 1 178 ? 58.333  60.963 58.419  1.00 236.26 ? 285  ASP D CA    1 
ATOM   6543  C  C     . ASP C 1 178 ? 58.536  59.611 57.734  1.00 240.16 ? 285  ASP D C     1 
ATOM   6544  O  O     . ASP C 1 178 ? 59.647  59.079 57.711  1.00 243.47 ? 285  ASP D O     1 
ATOM   6545  C  CB    . ASP C 1 178 ? 57.726  60.751 59.811  1.00 233.50 ? 285  ASP D CB    1 
ATOM   6546  C  CG    . ASP C 1 178 ? 58.474  59.710 60.629  1.00 235.04 ? 285  ASP D CG    1 
ATOM   6547  O  OD1   . ASP C 1 178 ? 57.843  58.719 61.054  1.00 235.76 ? 285  ASP D OD1   1 
ATOM   6548  O  OD2   . ASP C 1 178 ? 59.693  59.878 60.838  1.00 236.21 ? 285  ASP D OD2   1 
ATOM   6549  N  N     . GLY C 1 179 ? 57.456  59.067 57.179  1.00 240.31 ? 286  GLY D N     1 
ATOM   6550  C  CA    . GLY C 1 179 ? 57.498  57.785 56.482  1.00 243.62 ? 286  GLY D CA    1 
ATOM   6551  C  C     . GLY C 1 179 ? 58.405  57.794 55.265  1.00 247.14 ? 286  GLY D C     1 
ATOM   6552  O  O     . GLY C 1 179 ? 59.236  56.903 55.102  1.00 250.66 ? 286  GLY D O     1 
ATOM   6553  N  N     . MET C 1 180 ? 58.251  58.809 54.418  1.00 246.68 ? 287  MET D N     1 
ATOM   6554  C  CA    . MET C 1 180 ? 59.019  58.907 53.174  1.00 250.69 ? 287  MET D CA    1 
ATOM   6555  C  C     . MET C 1 180 ? 60.512  59.132 53.412  1.00 252.87 ? 287  MET D C     1 
ATOM   6556  O  O     . MET C 1 180 ? 61.348  58.487 52.777  1.00 257.58 ? 287  MET D O     1 
ATOM   6557  C  CB    . MET C 1 180 ? 58.475  60.036 52.295  1.00 249.71 ? 287  MET D CB    1 
ATOM   6558  C  CG    . MET C 1 180 ? 57.091  59.768 51.726  1.00 249.16 ? 287  MET D CG    1 
ATOM   6559  S  SD    . MET C 1 180 ? 56.597  60.941 50.448  1.00 250.14 ? 287  MET D SD    1 
ATOM   6560  C  CE    . MET C 1 180 ? 57.007  62.499 51.225  1.00 246.30 ? 287  MET D CE    1 
ATOM   6561  N  N     . VAL C 1 181 ? 60.838  60.045 54.324  1.00 249.77 ? 288  VAL D N     1 
ATOM   6562  C  CA    . VAL C 1 181 ? 62.228  60.440 54.564  1.00 251.55 ? 288  VAL D CA    1 
ATOM   6563  C  C     . VAL C 1 181 ? 63.035  59.332 55.243  1.00 254.11 ? 288  VAL D C     1 
ATOM   6564  O  O     . VAL C 1 181 ? 64.154  59.033 54.821  1.00 258.35 ? 288  VAL D O     1 
ATOM   6565  C  CB    . VAL C 1 181 ? 62.310  61.737 55.405  1.00 247.52 ? 288  VAL D CB    1 
ATOM   6566  C  CG1   . VAL C 1 181 ? 63.749  62.046 55.806  1.00 249.38 ? 288  VAL D CG1   1 
ATOM   6567  C  CG2   . VAL C 1 181 ? 61.718  62.910 54.634  1.00 246.19 ? 288  VAL D CG2   1 
ATOM   6568  N  N     . PHE C 1 182 ? 62.466  58.725 56.282  1.00 251.92 ? 289  PHE D N     1 
ATOM   6569  C  CA    . PHE C 1 182 ? 63.194  57.759 57.109  1.00 253.99 ? 289  PHE D CA    1 
ATOM   6570  C  C     . PHE C 1 182 ? 62.780  56.315 56.834  1.00 256.37 ? 289  PHE D C     1 
ATOM   6571  O  O     . PHE C 1 182 ? 63.639  55.452 56.644  1.00 260.76 ? 289  PHE D O     1 
ATOM   6572  C  CB    . PHE C 1 182 ? 63.020  58.106 58.587  1.00 250.44 ? 289  PHE D CB    1 
ATOM   6573  C  CG    . PHE C 1 182 ? 63.413  59.518 58.918  1.00 248.69 ? 289  PHE D CG    1 
ATOM   6574  C  CD1   . PHE C 1 182 ? 62.448  60.493 59.135  1.00 244.73 ? 289  PHE D CD1   1 
ATOM   6575  C  CD2   . PHE C 1 182 ? 64.751  59.880 58.984  1.00 251.70 ? 289  PHE D CD2   1 
ATOM   6576  C  CE1   . PHE C 1 182 ? 62.810  61.797 59.430  1.00 243.14 ? 289  PHE D CE1   1 
ATOM   6577  C  CE2   . PHE C 1 182 ? 65.120  61.183 59.276  1.00 250.16 ? 289  PHE D CE2   1 
ATOM   6578  C  CZ    . PHE C 1 182 ? 64.147  62.142 59.500  1.00 245.73 ? 289  PHE D CZ    1 
ATOM   6579  N  N     . GLY C 1 183 ? 61.474  56.052 56.813  1.00 253.87 ? 290  GLY D N     1 
ATOM   6580  C  CA    . GLY C 1 183 ? 60.968  54.718 56.480  1.00 256.43 ? 290  GLY D CA    1 
ATOM   6581  C  C     . GLY C 1 183 ? 59.625  54.374 57.095  1.00 253.03 ? 290  GLY D C     1 
ATOM   6582  O  O     . GLY C 1 183 ? 59.185  55.011 58.055  1.00 248.76 ? 290  GLY D O     1 
ATOM   6583  N  N     . ALA C 1 184 ? 58.977  53.356 56.532  1.00 255.49 ? 291  ALA D N     1 
ATOM   6584  C  CA    . ALA C 1 184 ? 57.717  52.841 57.059  1.00 253.66 ? 291  ALA D CA    1 
ATOM   6585  C  C     . ALA C 1 184 ? 57.978  52.092 58.361  1.00 253.88 ? 291  ALA D C     1 
ATOM   6586  O  O     . ALA C 1 184 ? 58.689  51.086 58.372  1.00 257.24 ? 291  ALA D O     1 
ATOM   6587  C  CB    . ALA C 1 184 ? 57.053  51.922 56.044  1.00 256.91 ? 291  ALA D CB    1 
ATOM   6588  N  N     . LEU C 1 185 ? 57.398  52.587 59.452  1.00 250.71 ? 292  LEU D N     1 
ATOM   6589  C  CA    . LEU C 1 185 ? 57.656  52.045 60.785  1.00 251.27 ? 292  LEU D CA    1 
ATOM   6590  C  C     . LEU C 1 185 ? 57.052  50.654 60.963  1.00 254.16 ? 292  LEU D C     1 
ATOM   6591  O  O     . LEU C 1 185 ? 55.853  50.461 60.754  1.00 253.65 ? 292  LEU D O     1 
ATOM   6592  C  CB    . LEU C 1 185 ? 57.102  52.988 61.858  1.00 246.84 ? 292  LEU D CB    1 
ATOM   6593  C  CG    . LEU C 1 185 ? 57.724  54.388 61.910  1.00 244.48 ? 292  LEU D CG    1 
ATOM   6594  C  CD1   . LEU C 1 185 ? 56.884  55.328 62.759  1.00 240.22 ? 292  LEU D CD1   1 
ATOM   6595  C  CD2   . LEU C 1 185 ? 59.149  54.326 62.439  1.00 246.23 ? 292  LEU D CD2   1 
ATOM   6596  N  N     . LEU C 1 186 ? 57.888  49.692 61.350  1.00 257.89 ? 293  LEU D N     1 
ATOM   6597  C  CA    . LEU C 1 186 ? 57.423  48.334 61.633  1.00 260.64 ? 293  LEU D CA    1 
ATOM   6598  C  C     . LEU C 1 186 ? 56.652  48.311 62.953  1.00 257.36 ? 293  LEU D C     1 
ATOM   6599  O  O     . LEU C 1 186 ? 56.844  49.192 63.795  1.00 253.08 ? 293  LEU D O     1 
ATOM   6600  C  CB    . LEU C 1 186 ? 58.599  47.349 61.698  1.00 265.88 ? 293  LEU D CB    1 
ATOM   6601  C  CG    . LEU C 1 186 ? 59.164  46.856 60.363  1.00 270.33 ? 293  LEU D CG    1 
ATOM   6602  C  CD1   . LEU C 1 186 ? 60.518  46.193 60.566  1.00 275.12 ? 293  LEU D CD1   1 
ATOM   6603  C  CD2   . LEU C 1 186 ? 58.197  45.897 59.683  1.00 272.51 ? 293  LEU D CD2   1 
ATOM   6604  N  N     . PRO C 1 187 ? 55.773  47.308 63.139  1.00 259.06 ? 294  PRO D N     1 
ATOM   6605  C  CA    . PRO C 1 187 ? 55.034  47.178 64.398  1.00 257.58 ? 294  PRO D CA    1 
ATOM   6606  C  C     . PRO C 1 187 ? 55.931  47.028 65.630  1.00 258.92 ? 294  PRO D C     1 
ATOM   6607  O  O     . PRO C 1 187 ? 57.116  46.711 65.509  1.00 261.09 ? 294  PRO D O     1 
ATOM   6608  C  CB    . PRO C 1 187 ? 54.203  45.908 64.191  1.00 260.68 ? 294  PRO D CB    1 
ATOM   6609  C  CG    . PRO C 1 187 ? 54.039  45.800 62.717  1.00 262.26 ? 294  PRO D CG    1 
ATOM   6610  C  CD    . PRO C 1 187 ? 55.313  46.332 62.132  1.00 262.77 ? 294  PRO D CD    1 
ATOM   6611  N  N     . CYS C 1 188 ? 55.345  47.251 66.804  1.00 257.79 ? 295  CYS D N     1 
ATOM   6612  C  CA    . CYS C 1 188 ? 56.075  47.210 68.070  1.00 258.60 ? 295  CYS D CA    1 
ATOM   6613  C  C     . CYS C 1 188 ? 56.487  45.778 68.419  1.00 263.72 ? 295  CYS D C     1 
ATOM   6614  O  O     . CYS C 1 188 ? 55.862  44.816 67.968  1.00 266.75 ? 295  CYS D O     1 
ATOM   6615  C  CB    . CYS C 1 188 ? 55.206  47.797 69.186  1.00 255.63 ? 295  CYS D CB    1 
ATOM   6616  S  SG    . CYS C 1 188 ? 56.081  48.317 70.677  1.00 255.48 ? 295  CYS D SG    1 
ATOM   6617  N  N     . GLU C 1 189 ? 57.541  45.649 69.222  1.00 265.20 ? 296  GLU D N     1 
ATOM   6618  C  CA    . GLU C 1 189 ? 58.088  44.340 69.592  1.00 270.38 ? 296  GLU D CA    1 
ATOM   6619  C  C     . GLU C 1 189 ? 57.114  43.492 70.413  1.00 271.35 ? 296  GLU D C     1 
ATOM   6620  O  O     . GLU C 1 189 ? 56.880  42.327 70.087  1.00 275.62 ? 296  GLU D O     1 
ATOM   6621  C  CB    . GLU C 1 189 ? 59.404  44.506 70.363  1.00 271.85 ? 296  GLU D CB    1 
ATOM   6622  C  CG    . GLU C 1 189 ? 60.567  45.017 69.520  1.00 272.80 ? 296  GLU D CG    1 
ATOM   6623  C  CD    . GLU C 1 189 ? 61.087  43.995 68.521  1.00 278.25 ? 296  GLU D CD    1 
ATOM   6624  O  OE1   . GLU C 1 189 ? 61.858  44.389 67.621  1.00 278.85 ? 296  GLU D OE1   1 
ATOM   6625  O  OE2   . GLU C 1 189 ? 60.734  42.801 68.627  1.00 282.17 ? 296  GLU D OE2   1 
ATOM   6626  N  N     . GLU C 1 190 ? 56.547  44.077 71.467  1.00 267.80 ? 297  GLU D N     1 
ATOM   6627  C  CA    . GLU C 1 190 ? 55.674  43.338 72.384  1.00 269.25 ? 297  GLU D CA    1 
ATOM   6628  C  C     . GLU C 1 190 ? 54.195  43.522 72.045  1.00 267.28 ? 297  GLU D C     1 
ATOM   6629  O  O     . GLU C 1 190 ? 53.494  42.552 71.751  1.00 269.94 ? 297  GLU D O     1 
ATOM   6630  C  CB    . GLU C 1 190 ? 55.919  43.756 73.841  1.00 268.03 ? 297  GLU D CB    1 
ATOM   6631  C  CG    . GLU C 1 190 ? 57.384  43.816 74.258  1.00 269.69 ? 297  GLU D CG    1 
ATOM   6632  C  CD    . GLU C 1 190 ? 57.983  45.207 74.145  1.00 265.43 ? 297  GLU D CD    1 
ATOM   6633  O  OE1   . GLU C 1 190 ? 57.592  45.958 73.227  1.00 262.48 ? 297  GLU D OE1   1 
ATOM   6634  O  OE2   . GLU C 1 190 ? 58.851  45.549 74.976  1.00 265.20 ? 297  GLU D OE2   1 
ATOM   6635  N  N     . CYS C 1 191 ? 53.732  44.769 72.081  1.00 263.11 ? 298  CYS D N     1 
ATOM   6636  C  CA    . CYS C 1 191 ? 52.304  45.075 71.961  1.00 261.88 ? 298  CYS D CA    1 
ATOM   6637  C  C     . CYS C 1 191 ? 51.792  45.106 70.514  1.00 262.74 ? 298  CYS D C     1 
ATOM   6638  O  O     . CYS C 1 191 ? 50.581  45.142 70.291  1.00 262.24 ? 298  CYS D O     1 
ATOM   6639  C  CB    . CYS C 1 191 ? 51.995  46.407 72.656  1.00 257.14 ? 298  CYS D CB    1 
ATOM   6640  S  SG    . CYS C 1 191 ? 52.395  47.886 71.695  1.00 252.25 ? 298  CYS D SG    1 
ATOM   6641  N  N     . SER C 1 192 ? 52.712  45.095 69.547  1.00 264.78 ? 299  SER D N     1 
ATOM   6642  C  CA    . SER C 1 192 ? 52.374  45.111 68.116  1.00 265.84 ? 299  SER D CA    1 
ATOM   6643  C  C     . SER C 1 192 ? 51.537  46.332 67.710  1.00 262.33 ? 299  SER D C     1 
ATOM   6644  O  O     . SER C 1 192 ? 50.623  46.225 66.889  1.00 262.87 ? 299  SER D O     1 
ATOM   6645  C  CB    . SER C 1 192 ? 51.658  43.814 67.715  1.00 270.06 ? 299  SER D CB    1 
ATOM   6646  O  OG    . SER C 1 192 ? 52.372  42.677 68.167  1.00 274.53 ? 299  SER D OG    1 
ATOM   6647  N  N     . GLY C 1 193 ? 51.865  47.487 68.287  1.00 259.36 ? 300  GLY D N     1 
ATOM   6648  C  CA    . GLY C 1 193 ? 51.183  48.745 67.986  1.00 255.84 ? 300  GLY D CA    1 
ATOM   6649  C  C     . GLY C 1 193 ? 51.988  49.604 67.031  1.00 254.40 ? 300  GLY D C     1 
ATOM   6650  O  O     . GLY C 1 193 ? 52.906  49.115 66.370  1.00 257.11 ? 300  GLY D O     1 
ATOM   6651  N  N     . GLN C 1 194 ? 51.645  50.889 66.966  1.00 250.69 ? 301  GLN D N     1 
ATOM   6652  C  CA    . GLN C 1 194 ? 52.288  51.821 66.044  1.00 248.80 ? 301  GLN D CA    1 
ATOM   6653  C  C     . GLN C 1 194 ? 53.150  52.821 66.815  1.00 245.56 ? 301  GLN D C     1 
ATOM   6654  O  O     . GLN C 1 194 ? 52.646  53.553 67.668  1.00 242.65 ? 301  GLN D O     1 
ATOM   6655  C  CB    . GLN C 1 194 ? 51.226  52.570 65.227  1.00 247.41 ? 301  GLN D CB    1 
ATOM   6656  C  CG    . GLN C 1 194 ? 51.526  52.702 63.739  1.00 248.79 ? 301  GLN D CG    1 
ATOM   6657  C  CD    . GLN C 1 194 ? 52.828  53.420 63.436  1.00 248.45 ? 301  GLN D CD    1 
ATOM   6658  O  OE1   . GLN C 1 194 ? 52.836  54.619 63.158  1.00 246.56 ? 301  GLN D OE1   1 
ATOM   6659  N  NE2   . GLN C 1 194 ? 53.937  52.688 63.479  1.00 251.13 ? 301  GLN D NE2   1 
ATOM   6660  N  N     . LEU C 1 195 ? 54.448  52.840 66.517  1.00 246.00 ? 302  LEU D N     1 
ATOM   6661  C  CA    . LEU C 1 195 ? 55.354  53.833 67.093  1.00 243.52 ? 302  LEU D CA    1 
ATOM   6662  C  C     . LEU C 1 195 ? 55.150  55.175 66.395  1.00 240.58 ? 302  LEU D C     1 
ATOM   6663  O  O     . LEU C 1 195 ? 54.877  55.218 65.195  1.00 241.37 ? 302  LEU D O     1 
ATOM   6664  C  CB    . LEU C 1 195 ? 56.818  53.392 66.971  1.00 246.02 ? 302  LEU D CB    1 
ATOM   6665  C  CG    . LEU C 1 195 ? 57.279  52.278 67.919  1.00 248.60 ? 302  LEU D CG    1 
ATOM   6666  C  CD1   . LEU C 1 195 ? 56.849  50.904 67.423  1.00 251.89 ? 302  LEU D CD1   1 
ATOM   6667  C  CD2   . LEU C 1 195 ? 58.790  52.327 68.099  1.00 250.48 ? 302  LEU D CD2   1 
ATOM   6668  N  N     . VAL C 1 196 ? 55.270  56.263 67.153  1.00 237.15 ? 303  VAL D N     1 
ATOM   6669  C  CA    . VAL C 1 196 ? 55.063  57.611 66.622  1.00 234.39 ? 303  VAL D CA    1 
ATOM   6670  C  C     . VAL C 1 196 ? 56.152  58.552 67.126  1.00 232.81 ? 303  VAL D C     1 
ATOM   6671  O  O     . VAL C 1 196 ? 56.486  58.539 68.312  1.00 231.82 ? 303  VAL D O     1 
ATOM   6672  C  CB    . VAL C 1 196 ? 53.690  58.182 67.041  1.00 232.02 ? 303  VAL D CB    1 
ATOM   6673  C  CG1   . VAL C 1 196 ? 53.469  59.560 66.427  1.00 230.04 ? 303  VAL D CG1   1 
ATOM   6674  C  CG2   . VAL C 1 196 ? 52.565  57.235 66.643  1.00 233.50 ? 303  VAL D CG2   1 
ATOM   6675  N  N     . PHE C 1 197 ? 56.695  59.368 66.225  1.00 233.07 ? 304  PHE D N     1 
ATOM   6676  C  CA    . PHE C 1 197 ? 57.680  60.381 66.598  1.00 232.56 ? 304  PHE D CA    1 
ATOM   6677  C  C     . PHE C 1 197 ? 57.016  61.461 67.446  1.00 229.69 ? 304  PHE D C     1 
ATOM   6678  O  O     . PHE C 1 197 ? 56.004  62.039 67.043  1.00 228.04 ? 304  PHE D O     1 
ATOM   6679  C  CB    . PHE C 1 197 ? 58.319  61.012 65.356  1.00 234.00 ? 304  PHE D CB    1 
ATOM   6680  C  CG    . PHE C 1 197 ? 59.232  62.169 65.664  1.00 233.39 ? 304  PHE D CG    1 
ATOM   6681  C  CD1   . PHE C 1 197 ? 60.547  61.950 66.054  1.00 235.34 ? 304  PHE D CD1   1 
ATOM   6682  C  CD2   . PHE C 1 197 ? 58.775  63.478 65.566  1.00 231.23 ? 304  PHE D CD2   1 
ATOM   6683  C  CE1   . PHE C 1 197 ? 61.388  63.013 66.340  1.00 234.83 ? 304  PHE D CE1   1 
ATOM   6684  C  CE2   . PHE C 1 197 ? 59.612  64.545 65.852  1.00 230.76 ? 304  PHE D CE2   1 
ATOM   6685  C  CZ    . PHE C 1 197 ? 60.920  64.312 66.239  1.00 232.48 ? 304  PHE D CZ    1 
ATOM   6686  N  N     . LYS C 1 198 ? 57.591  61.723 68.616  1.00 229.85 ? 305  LYS D N     1 
ATOM   6687  C  CA    . LYS C 1 198 ? 57.084  62.745 69.527  1.00 228.15 ? 305  LYS D CA    1 
ATOM   6688  C  C     . LYS C 1 198 ? 58.254  63.515 70.136  1.00 227.64 ? 305  LYS D C     1 
ATOM   6689  O  O     . LYS C 1 198 ? 58.887  63.052 71.087  1.00 228.69 ? 305  LYS D O     1 
ATOM   6690  C  CB    . LYS C 1 198 ? 56.218  62.102 70.617  1.00 228.57 ? 305  LYS D CB    1 
ATOM   6691  C  CG    . LYS C 1 198 ? 55.770  63.029 71.743  1.00 227.35 ? 305  LYS D CG    1 
ATOM   6692  C  CD    . LYS C 1 198 ? 54.962  64.215 71.239  1.00 226.20 ? 305  LYS D CD    1 
ATOM   6693  C  CE    . LYS C 1 198 ? 54.501  65.092 72.392  1.00 225.27 ? 305  LYS D CE    1 
ATOM   6694  N  NZ    . LYS C 1 198 ? 53.443  66.057 71.982  1.00 224.53 ? 305  LYS D NZ    1 
ATOM   6695  N  N     . SER C 1 199 ? 58.540  64.679 69.556  1.00 226.59 ? 306  SER D N     1 
ATOM   6696  C  CA    . SER C 1 199 ? 59.557  65.610 70.056  1.00 226.22 ? 306  SER D CA    1 
ATOM   6697  C  C     . SER C 1 199 ? 60.993  65.072 69.996  1.00 228.30 ? 306  SER D C     1 
ATOM   6698  O  O     . SER C 1 199 ? 61.773  65.493 69.140  1.00 229.34 ? 306  SER D O     1 
ATOM   6699  C  CB    . SER C 1 199 ? 59.215  66.091 71.474  1.00 224.74 ? 306  SER D CB    1 
ATOM   6700  O  OG    . SER C 1 199 ? 57.929  66.687 71.510  1.00 223.16 ? 306  SER D OG    1 
ATOM   6701  N  N     . ASP C 1 200 ? 61.334  64.148 70.894  1.00 229.17 ? 307  ASP D N     1 
ATOM   6702  C  CA    . ASP C 1 200 ? 62.717  63.680 71.043  1.00 231.74 ? 307  ASP D CA    1 
ATOM   6703  C  C     . ASP C 1 200 ? 62.914  62.166 70.870  1.00 234.68 ? 307  ASP D C     1 
ATOM   6704  O  O     . ASP C 1 200 ? 64.037  61.677 71.007  1.00 238.23 ? 307  ASP D O     1 
ATOM   6705  C  CB    . ASP C 1 200 ? 63.268  64.117 72.408  1.00 230.97 ? 307  ASP D CB    1 
ATOM   6706  C  CG    . ASP C 1 200 ? 62.560  63.442 73.574  1.00 230.22 ? 307  ASP D CG    1 
ATOM   6707  O  OD1   . ASP C 1 200 ? 61.342  63.186 73.473  1.00 228.51 ? 307  ASP D OD1   1 
ATOM   6708  O  OD2   . ASP C 1 200 ? 63.226  63.174 74.596  1.00 231.72 ? 307  ASP D OD2   1 
ATOM   6709  N  N     . ALA C 1 201 ? 61.843  61.431 70.572  1.00 234.11 ? 308  ALA D N     1 
ATOM   6710  C  CA    . ALA C 1 201 ? 61.930  59.975 70.412  1.00 237.08 ? 308  ALA D CA    1 
ATOM   6711  C  C     . ALA C 1 201 ? 60.679  59.390 69.756  1.00 237.06 ? 308  ALA D C     1 
ATOM   6712  O  O     . ALA C 1 201 ? 59.678  60.085 69.574  1.00 235.03 ? 308  ALA D O     1 
ATOM   6713  C  CB    . ALA C 1 201 ? 62.167  59.310 71.763  1.00 237.80 ? 308  ALA D CB    1 
ATOM   6714  N  N     . TYR C 1 202 ? 60.757  58.109 69.401  1.00 240.06 ? 309  TYR D N     1 
ATOM   6715  C  CA    . TYR C 1 202 ? 59.615  57.367 68.865  1.00 240.13 ? 309  TYR D CA    1 
ATOM   6716  C  C     . TYR C 1 202 ? 58.918  56.602 69.990  1.00 239.43 ? 309  TYR D C     1 
ATOM   6717  O  O     . TYR C 1 202 ? 59.439  55.600 70.482  1.00 242.30 ? 309  TYR D O     1 
ATOM   6718  C  CB    . TYR C 1 202 ? 60.063  56.390 67.773  1.00 244.22 ? 309  TYR D CB    1 
ATOM   6719  C  CG    . TYR C 1 202 ? 60.387  57.047 66.450  1.00 244.96 ? 309  TYR D CG    1 
ATOM   6720  C  CD1   . TYR C 1 202 ? 61.644  57.596 66.211  1.00 246.51 ? 309  TYR D CD1   1 
ATOM   6721  C  CD2   . TYR C 1 202 ? 59.439  57.109 65.431  1.00 244.52 ? 309  TYR D CD2   1 
ATOM   6722  C  CE1   . TYR C 1 202 ? 61.945  58.194 64.997  1.00 247.34 ? 309  TYR D CE1   1 
ATOM   6723  C  CE2   . TYR C 1 202 ? 59.731  57.704 64.215  1.00 245.08 ? 309  TYR D CE2   1 
ATOM   6724  C  CZ    . TYR C 1 202 ? 60.985  58.245 64.002  1.00 246.47 ? 309  TYR D CZ    1 
ATOM   6725  O  OH    . TYR C 1 202 ? 61.280  58.838 62.796  1.00 247.28 ? 309  TYR D OH    1 
ATOM   6726  N  N     . TYR C 1 203 ? 57.741  57.082 70.387  1.00 235.59 ? 310  TYR D N     1 
ATOM   6727  C  CA    . TYR C 1 203 ? 56.968  56.476 71.471  1.00 234.63 ? 310  TYR D CA    1 
ATOM   6728  C  C     . TYR C 1 203 ? 55.930  55.508 70.908  1.00 235.11 ? 310  TYR D C     1 
ATOM   6729  O  O     . TYR C 1 203 ? 55.258  55.819 69.923  1.00 234.32 ? 310  TYR D O     1 
ATOM   6730  C  CB    . TYR C 1 203 ? 56.258  57.558 72.292  1.00 231.55 ? 310  TYR D CB    1 
ATOM   6731  C  CG    . TYR C 1 203 ? 57.182  58.461 73.083  1.00 230.47 ? 310  TYR D CG    1 
ATOM   6732  C  CD1   . TYR C 1 203 ? 57.251  58.376 74.471  1.00 230.59 ? 310  TYR D CD1   1 
ATOM   6733  C  CD2   . TYR C 1 203 ? 57.982  59.406 72.445  1.00 229.57 ? 310  TYR D CD2   1 
ATOM   6734  C  CE1   . TYR C 1 203 ? 58.090  59.204 75.200  1.00 229.76 ? 310  TYR D CE1   1 
ATOM   6735  C  CE2   . TYR C 1 203 ? 58.824  60.237 73.165  1.00 228.82 ? 310  TYR D CE2   1 
ATOM   6736  C  CZ    . TYR C 1 203 ? 58.876  60.132 74.541  1.00 228.83 ? 310  TYR D CZ    1 
ATOM   6737  O  OH    . TYR C 1 203 ? 59.712  60.955 75.259  1.00 228.42 ? 310  TYR D OH    1 
ATOM   6738  N  N     . CYS C 1 204 ? 55.797  54.341 71.537  1.00 236.63 ? 311  CYS D N     1 
ATOM   6739  C  CA    . CYS C 1 204 ? 54.778  53.366 71.146  1.00 237.89 ? 311  CYS D CA    1 
ATOM   6740  C  C     . CYS C 1 204 ? 53.408  53.818 71.641  1.00 235.59 ? 311  CYS D C     1 
ATOM   6741  O  O     . CYS C 1 204 ? 53.251  54.173 72.810  1.00 234.40 ? 311  CYS D O     1 
ATOM   6742  C  CB    . CYS C 1 204 ? 55.104  51.980 71.704  1.00 241.65 ? 311  CYS D CB    1 
ATOM   6743  S  SG    . CYS C 1 204 ? 53.877  50.707 71.314  1.00 244.36 ? 311  CYS D SG    1 
ATOM   6744  N  N     . THR C 1 205 ? 52.424  53.800 70.744  1.00 234.86 ? 312  THR D N     1 
ATOM   6745  C  CA    . THR C 1 205 ? 51.068  54.254 71.055  1.00 232.99 ? 312  THR D CA    1 
ATOM   6746  C  C     . THR C 1 205 ? 50.079  53.090 71.155  1.00 234.93 ? 312  THR D C     1 
ATOM   6747  O  O     . THR C 1 205 ? 48.868  53.306 71.240  1.00 234.65 ? 312  THR D O     1 
ATOM   6748  C  CB    . THR C 1 205 ? 50.561  55.244 69.987  1.00 231.14 ? 312  THR D CB    1 
ATOM   6749  O  OG1   . THR C 1 205 ? 50.376  54.561 68.740  1.00 232.94 ? 312  THR D OG1   1 
ATOM   6750  C  CG2   . THR C 1 205 ? 51.551  56.387 69.798  1.00 229.04 ? 312  THR D CG2   1 
ATOM   6751  N  N     . GLY C 1 206 ? 50.594  51.862 71.153  1.00 237.05 ? 313  GLY D N     1 
ATOM   6752  C  CA    . GLY C 1 206 ? 49.754  50.669 71.199  1.00 239.33 ? 313  GLY D CA    1 
ATOM   6753  C  C     . GLY C 1 206 ? 49.231  50.362 72.588  1.00 239.42 ? 313  GLY D C     1 
ATOM   6754  O  O     . GLY C 1 206 ? 49.242  51.221 73.472  1.00 237.30 ? 313  GLY D O     1 
ATOM   6755  N  N     . ASP C 1 207 ? 48.773  49.126 72.776  1.00 242.04 ? 314  ASP D N     1 
ATOM   6756  C  CA    . ASP C 1 207 ? 48.205  48.690 74.049  1.00 243.21 ? 314  ASP D CA    1 
ATOM   6757  C  C     . ASP C 1 207 ? 48.768  47.339 74.481  1.00 246.65 ? 314  ASP D C     1 
ATOM   6758  O  O     . ASP C 1 207 ? 48.396  46.297 73.936  1.00 249.81 ? 314  ASP D O     1 
ATOM   6759  C  CB    . ASP C 1 207 ? 46.680  48.615 73.951  1.00 244.07 ? 314  ASP D CB    1 
ATOM   6760  C  CG    . ASP C 1 207 ? 46.040  49.981 73.813  1.00 240.78 ? 314  ASP D CG    1 
ATOM   6761  O  OD1   . ASP C 1 207 ? 45.983  50.501 72.679  1.00 238.75 ? 314  ASP D OD1   1 
ATOM   6762  O  OD2   . ASP C 1 207 ? 45.593  50.532 74.840  1.00 240.46 ? 314  ASP D OD2   1 
ATOM   6763  N  N     . VAL C 1 208 ? 49.674  47.372 75.456  1.00 246.14 ? 315  VAL D N     1 
ATOM   6764  C  CA    . VAL C 1 208 ? 50.188  46.154 76.093  1.00 249.83 ? 315  VAL D CA    1 
ATOM   6765  C  C     . VAL C 1 208 ? 49.052  45.357 76.749  1.00 252.37 ? 315  VAL D C     1 
ATOM   6766  O  O     . VAL C 1 208 ? 49.104  44.127 76.816  1.00 256.55 ? 315  VAL D O     1 
ATOM   6767  C  CB    . VAL C 1 208 ? 51.310  46.471 77.120  1.00 249.63 ? 315  VAL D CB    1 
ATOM   6768  C  CG1   . VAL C 1 208 ? 50.839  47.453 78.190  1.00 247.32 ? 315  VAL D CG1   1 
ATOM   6769  C  CG2   . VAL C 1 208 ? 51.846  45.195 77.757  1.00 254.46 ? 315  VAL D CG2   1 
ATOM   6770  N  N     . THR C 1 209 ? 48.031  46.068 77.223  1.00 250.04 ? 316  THR D N     1 
ATOM   6771  C  CA    . THR C 1 209 ? 46.812  45.449 77.744  1.00 252.71 ? 316  THR D CA    1 
ATOM   6772  C  C     . THR C 1 209 ? 45.640  46.428 77.630  1.00 249.77 ? 316  THR D C     1 
ATOM   6773  O  O     . THR C 1 209 ? 45.828  47.591 77.274  1.00 245.63 ? 316  THR D O     1 
ATOM   6774  C  CB    . THR C 1 209 ? 46.995  44.974 79.205  1.00 255.81 ? 316  THR D CB    1 
ATOM   6775  O  OG1   . THR C 1 209 ? 45.717  44.794 79.830  1.00 258.18 ? 316  THR D OG1   1 
ATOM   6776  C  CG2   . THR C 1 209 ? 47.816  45.972 80.008  1.00 253.16 ? 316  THR D CG2   1 
ATOM   6777  N  N     . ALA C 1 210 ? 44.435  45.948 77.918  1.00 251.99 ? 317  ALA D N     1 
ATOM   6778  C  CA    . ALA C 1 210 ? 43.230  46.772 77.815  1.00 250.26 ? 317  ALA D CA    1 
ATOM   6779  C  C     . ALA C 1 210 ? 43.194  47.881 78.868  1.00 247.82 ? 317  ALA D C     1 
ATOM   6780  O  O     . ALA C 1 210 ? 42.667  48.967 78.616  1.00 245.31 ? 317  ALA D O     1 
ATOM   6781  C  CB    . ALA C 1 210 ? 41.986  45.904 77.923  1.00 254.59 ? 317  ALA D CB    1 
ATOM   6782  N  N     . TRP C 1 211 ? 43.759  47.604 80.040  1.00 248.73 ? 318  TRP D N     1 
ATOM   6783  C  CA    . TRP C 1 211 ? 43.749  48.550 81.156  1.00 247.04 ? 318  TRP D CA    1 
ATOM   6784  C  C     . TRP C 1 211 ? 44.830  49.626 81.037  1.00 243.67 ? 318  TRP D C     1 
ATOM   6785  O  O     . TRP C 1 211 ? 44.622  50.760 81.473  1.00 241.79 ? 318  TRP D O     1 
ATOM   6786  C  CB    . TRP C 1 211 ? 43.914  47.806 82.483  1.00 249.62 ? 318  TRP D CB    1 
ATOM   6787  C  CG    . TRP C 1 211 ? 42.817  46.826 82.762  1.00 253.30 ? 318  TRP D CG    1 
ATOM   6788  C  CD1   . TRP C 1 211 ? 42.771  45.516 82.382  1.00 256.47 ? 318  TRP D CD1   1 
ATOM   6789  C  CD2   . TRP C 1 211 ? 41.604  47.078 83.482  1.00 254.86 ? 318  TRP D CD2   1 
ATOM   6790  N  NE1   . TRP C 1 211 ? 41.606  44.935 82.821  1.00 260.49 ? 318  TRP D NE1   1 
ATOM   6791  C  CE2   . TRP C 1 211 ? 40.872  45.872 83.500  1.00 259.75 ? 318  TRP D CE2   1 
ATOM   6792  C  CE3   . TRP C 1 211 ? 41.068  48.204 84.117  1.00 253.36 ? 318  TRP D CE3   1 
ATOM   6793  C  CZ2   . TRP C 1 211 ? 39.629  45.761 84.126  1.00 263.41 ? 318  TRP D CZ2   1 
ATOM   6794  C  CZ3   . TRP C 1 211 ? 39.832  48.093 84.739  1.00 257.18 ? 318  TRP D CZ3   1 
ATOM   6795  C  CH2   . TRP C 1 211 ? 39.127  46.879 84.739  1.00 262.18 ? 318  TRP D CH2   1 
ATOM   6796  N  N     . THR C 1 212 ? 45.973  49.272 80.449  1.00 243.86 ? 319  THR D N     1 
ATOM   6797  C  CA    . THR C 1 212 ? 47.135  50.166 80.405  1.00 241.18 ? 319  THR D CA    1 
ATOM   6798  C  C     . THR C 1 212 ? 47.664  50.357 78.990  1.00 240.32 ? 319  THR D C     1 
ATOM   6799  O  O     . THR C 1 212 ? 47.518  49.484 78.136  1.00 241.80 ? 319  THR D O     1 
ATOM   6800  C  CB    . THR C 1 212 ? 48.302  49.632 81.264  1.00 242.38 ? 319  THR D CB    1 
ATOM   6801  O  OG1   . THR C 1 212 ? 49.200  48.863 80.454  1.00 243.08 ? 319  THR D OG1   1 
ATOM   6802  C  CG2   . THR C 1 212 ? 47.799  48.772 82.393  1.00 246.36 ? 319  THR D CG2   1 
ATOM   6803  N  N     . LYS C 1 213 ? 48.304  51.500 78.766  1.00 238.68 ? 320  LYS D N     1 
ATOM   6804  C  CA    . LYS C 1 213 ? 48.934  51.803 77.488  1.00 238.28 ? 320  LYS D CA    1 
ATOM   6805  C  C     . LYS C 1 213 ? 50.392  51.349 77.510  1.00 240.30 ? 320  LYS D C     1 
ATOM   6806  O  O     . LYS C 1 213 ? 51.014  51.288 78.573  1.00 240.66 ? 320  LYS D O     1 
ATOM   6807  C  CB    . LYS C 1 213 ? 48.858  53.305 77.213  1.00 235.07 ? 320  LYS D CB    1 
ATOM   6808  C  CG    . LYS C 1 213 ? 48.971  53.675 75.745  1.00 233.77 ? 320  LYS D CG    1 
ATOM   6809  C  CD    . LYS C 1 213 ? 48.977  55.185 75.565  1.00 230.84 ? 320  LYS D CD    1 
ATOM   6810  C  CE    . LYS C 1 213 ? 48.890  55.576 74.099  1.00 229.85 ? 320  LYS D CE    1 
ATOM   6811  N  NZ    . LYS C 1 213 ? 47.514  55.433 73.549  1.00 231.01 ? 320  LYS D NZ    1 
ATOM   6812  N  N     . CYS C 1 214 ? 50.928  51.027 76.335  1.00 242.53 ? 321  CYS D N     1 
ATOM   6813  C  CA    . CYS C 1 214 ? 52.327  50.615 76.208  1.00 245.22 ? 321  CYS D CA    1 
ATOM   6814  C  C     . CYS C 1 214 ? 53.265  51.805 76.407  1.00 243.48 ? 321  CYS D C     1 
ATOM   6815  O  O     . CYS C 1 214 ? 52.936  52.931 76.028  1.00 240.94 ? 321  CYS D O     1 
ATOM   6816  C  CB    . CYS C 1 214 ? 52.577  49.972 74.841  1.00 246.58 ? 321  CYS D CB    1 
ATOM   6817  S  SG    . CYS C 1 214 ? 54.316  49.622 74.491  1.00 248.27 ? 321  CYS D SG    1 
ATOM   6818  N  N     . MET C 1 215 ? 54.431  51.544 76.996  1.00 246.00 ? 322  MET D N     1 
ATOM   6819  C  CA    . MET C 1 215 ? 55.398  52.592 77.331  1.00 244.70 ? 322  MET D CA    1 
ATOM   6820  C  C     . MET C 1 215 ? 56.769  52.355 76.686  1.00 246.63 ? 322  MET D C     1 
ATOM   6821  O  O     . MET C 1 215 ? 57.803  52.687 77.271  1.00 247.30 ? 322  MET D O     1 
ATOM   6822  C  CB    . MET C 1 215 ? 55.541  52.692 78.854  1.00 245.51 ? 322  MET D CB    1 
ATOM   6823  C  CG    . MET C 1 215 ? 54.368  53.367 79.545  1.00 244.03 ? 322  MET D CG    1 
ATOM   6824  S  SD    . MET C 1 215 ? 54.249  52.944 81.295  1.00 247.76 ? 322  MET D SD    1 
ATOM   6825  C  CE    . MET C 1 215 ? 55.931  53.232 81.843  1.00 248.02 ? 322  MET D CE    1 
ATOM   6826  N  N     . VAL C 1 216 ? 56.777  51.790 75.480  1.00 248.29 ? 323  VAL D N     1 
ATOM   6827  C  CA    . VAL C 1 216 ? 58.021  51.607 74.729  1.00 250.69 ? 323  VAL D CA    1 
ATOM   6828  C  C     . VAL C 1 216 ? 58.464  52.947 74.140  1.00 248.39 ? 323  VAL D C     1 
ATOM   6829  O  O     . VAL C 1 216 ? 57.643  53.724 73.649  1.00 245.53 ? 323  VAL D O     1 
ATOM   6830  C  CB    . VAL C 1 216 ? 57.872  50.540 73.619  1.00 253.36 ? 323  VAL D CB    1 
ATOM   6831  C  CG1   . VAL C 1 216 ? 59.009  50.620 72.606  1.00 254.59 ? 323  VAL D CG1   1 
ATOM   6832  C  CG2   . VAL C 1 216 ? 57.813  49.150 74.233  1.00 257.36 ? 323  VAL D CG2   1 
ATOM   6833  N  N     . LYS C 1 217 ? 59.769  53.202 74.201  1.00 250.48 ? 324  LYS D N     1 
ATOM   6834  C  CA    . LYS C 1 217 ? 60.354  54.459 73.740  1.00 248.97 ? 324  LYS D CA    1 
ATOM   6835  C  C     . LYS C 1 217 ? 61.741  54.193 73.156  1.00 252.13 ? 324  LYS D C     1 
ATOM   6836  O  O     . LYS C 1 217 ? 62.517  53.422 73.723  1.00 255.36 ? 324  LYS D O     1 
ATOM   6837  C  CB    . LYS C 1 217 ? 60.447  55.442 74.910  1.00 247.07 ? 324  LYS D CB    1 
ATOM   6838  C  CG    . LYS C 1 217 ? 61.062  56.792 74.574  1.00 245.39 ? 324  LYS D CG    1 
ATOM   6839  C  CD    . LYS C 1 217 ? 61.282  57.623 75.830  1.00 244.06 ? 324  LYS D CD    1 
ATOM   6840  C  CE    . LYS C 1 217 ? 62.287  58.741 75.600  1.00 243.41 ? 324  LYS D CE    1 
ATOM   6841  N  NZ    . LYS C 1 217 ? 63.693  58.246 75.620  1.00 247.06 ? 324  LYS D NZ    1 
ATOM   6842  N  N     . THR C 1 218 ? 62.048  54.832 72.029  1.00 251.59 ? 325  THR D N     1 
ATOM   6843  C  CA    . THR C 1 218 ? 63.333  54.626 71.358  1.00 255.41 ? 325  THR D CA    1 
ATOM   6844  C  C     . THR C 1 218 ? 63.670  55.739 70.364  1.00 254.04 ? 325  THR D C     1 
ATOM   6845  O  O     . THR C 1 218 ? 62.780  56.405 69.835  1.00 251.10 ? 325  THR D O     1 
ATOM   6846  C  CB    . THR C 1 218 ? 63.368  53.269 70.617  1.00 259.61 ? 325  THR D CB    1 
ATOM   6847  O  OG1   . THR C 1 218 ? 64.632  53.105 69.962  1.00 263.34 ? 325  THR D OG1   1 
ATOM   6848  C  CG2   . THR C 1 218 ? 62.243  53.171 69.583  1.00 258.18 ? 325  THR D CG2   1 
ATOM   6849  N  N     . GLN C 1 219 ? 64.967  55.926 70.127  1.00 256.49 ? 326  GLN D N     1 
ATOM   6850  C  CA    . GLN C 1 219 ? 65.463  56.851 69.105  1.00 255.93 ? 326  GLN D CA    1 
ATOM   6851  C  C     . GLN C 1 219 ? 65.829  56.120 67.808  1.00 259.60 ? 326  GLN D C     1 
ATOM   6852  O  O     . GLN C 1 219 ? 65.952  56.748 66.756  1.00 259.93 ? 326  GLN D O     1 
ATOM   6853  C  CB    . GLN C 1 219 ? 66.679  57.623 69.628  1.00 256.74 ? 326  GLN D CB    1 
ATOM   6854  C  CG    . GLN C 1 219 ? 66.325  58.787 70.541  1.00 252.62 ? 326  GLN D CG    1 
ATOM   6855  C  CD    . GLN C 1 219 ? 67.542  59.585 70.979  1.00 253.84 ? 326  GLN D CD    1 
ATOM   6856  O  OE1   . GLN C 1 219 ? 68.659  59.066 71.018  1.00 258.20 ? 326  GLN D OE1   1 
ATOM   6857  N  NE2   . GLN C 1 219 ? 67.330  60.854 71.315  1.00 250.57 ? 326  GLN D NE2   1 
ATOM   6858  N  N     . THR C 1 220 ? 66.005  54.802 67.891  1.00 262.80 ? 327  THR D N     1 
ATOM   6859  C  CA    . THR C 1 220 ? 66.339  53.978 66.730  1.00 266.75 ? 327  THR D CA    1 
ATOM   6860  C  C     . THR C 1 220 ? 65.342  52.823 66.589  1.00 266.85 ? 327  THR D C     1 
ATOM   6861  O  O     . THR C 1 220 ? 65.650  51.686 66.953  1.00 270.79 ? 327  THR D O     1 
ATOM   6862  C  CB    . THR C 1 220 ? 67.768  53.410 66.844  1.00 272.43 ? 327  THR D CB    1 
ATOM   6863  O  OG1   . THR C 1 220 ? 67.912  52.708 68.085  1.00 273.62 ? 327  THR D OG1   1 
ATOM   6864  C  CG2   . THR C 1 220 ? 68.796  54.530 66.776  1.00 272.58 ? 327  THR D CG2   1 
ATOM   6865  N  N     . PRO C 1 221 ? 64.138  53.115 66.063  1.00 262.84 ? 328  PRO D N     1 
ATOM   6866  C  CA    . PRO C 1 221 ? 63.114  52.085 65.893  1.00 263.10 ? 328  PRO D CA    1 
ATOM   6867  C  C     . PRO C 1 221 ? 63.364  51.197 64.677  1.00 267.30 ? 328  PRO D C     1 
ATOM   6868  O  O     . PRO C 1 221 ? 64.187  51.529 63.822  1.00 269.10 ? 328  PRO D O     1 
ATOM   6869  C  CB    . PRO C 1 221 ? 61.838  52.903 65.694  1.00 258.39 ? 328  PRO D CB    1 
ATOM   6870  C  CG    . PRO C 1 221 ? 62.309  54.145 65.024  1.00 256.97 ? 328  PRO D CG    1 
ATOM   6871  C  CD    . PRO C 1 221 ? 63.661  54.437 65.614  1.00 258.67 ? 328  PRO D CD    1 
ATOM   6872  N  N     . ASN C 1 222 ? 62.646  50.078 64.610  1.00 269.14 ? 329  ASN D N     1 
ATOM   6873  C  CA    . ASN C 1 222 ? 62.737  49.157 63.478  1.00 273.96 ? 329  ASN D CA    1 
ATOM   6874  C  C     . ASN C 1 222 ? 61.796  49.602 62.364  1.00 272.87 ? 329  ASN D C     1 
ATOM   6875  O  O     . ASN C 1 222 ? 60.676  50.038 62.633  1.00 268.96 ? 329  ASN D O     1 
ATOM   6876  C  CB    . ASN C 1 222 ? 62.386  47.733 63.915  1.00 276.67 ? 329  ASN D CB    1 
ATOM   6877  C  CG    . ASN C 1 222 ? 63.238  47.248 65.075  1.00 278.84 ? 329  ASN D CG    1 
ATOM   6878  O  OD1   . ASN C 1 222 ? 62.720  46.719 66.058  1.00 277.89 ? 329  ASN D OD1   1 
ATOM   6879  N  ND2   . ASN C 1 222 ? 64.549  47.433 64.969  1.00 281.91 ? 329  ASN D ND2   1 
ATOM   6880  N  N     . ARG C 1 223 ? 62.252  49.493 61.117  1.00 277.33 ? 330  ARG D N     1 
ATOM   6881  C  CA    . ARG C 1 223 ? 61.477  49.977 59.971  1.00 276.74 ? 330  ARG D CA    1 
ATOM   6882  C  C     . ARG C 1 223 ? 62.019  49.484 58.631  1.00 282.34 ? 330  ARG D C     1 
ATOM   6883  O  O     . ARG C 1 223 ? 63.230  49.496 58.401  1.00 285.39 ? 330  ARG D O     1 
ATOM   6884  C  CB    . ARG C 1 223 ? 61.431  51.512 59.971  1.00 272.45 ? 330  ARG D CB    1 
ATOM   6885  C  CG    . ARG C 1 223 ? 62.764  52.193 60.249  1.00 273.49 ? 330  ARG D CG    1 
ATOM   6886  C  CD    . ARG C 1 223 ? 62.600  53.701 60.380  1.00 269.10 ? 330  ARG D CD    1 
ATOM   6887  N  NE    . ARG C 1 223 ? 63.619  54.295 61.245  1.00 268.82 ? 330  ARG D NE    1 
ATOM   6888  C  CZ    . ARG C 1 223 ? 63.607  55.555 61.681  1.00 264.94 ? 330  ARG D CZ    1 
ATOM   6889  N  NH1   . ARG C 1 223 ? 62.626  56.387 61.340  1.00 261.36 ? 330  ARG D NH1   1 
ATOM   6890  N  NH2   . ARG C 1 223 ? 64.586  55.988 62.467  1.00 264.88 ? 330  ARG D NH2   1 
ATOM   6891  N  N     . LYS C 1 224 ? 61.112  49.054 57.754  1.00 283.92 ? 331  LYS D N     1 
ATOM   6892  C  CA    . LYS C 1 224 ? 61.457  48.730 56.371  1.00 289.34 ? 331  LYS D CA    1 
ATOM   6893  C  C     . LYS C 1 224 ? 61.358  50.001 55.528  1.00 287.52 ? 331  LYS D C     1 
ATOM   6894  O  O     . LYS C 1 224 ? 60.942  51.050 56.025  1.00 282.95 ? 331  LYS D O     1 
ATOM   6895  C  CB    . LYS C 1 224 ? 60.546  47.623 55.819  1.00 292.06 ? 331  LYS D CB    1 
ATOM   6896  C  CG    . LYS C 1 224 ? 59.151  48.067 55.396  1.00 288.75 ? 331  LYS D CG    1 
ATOM   6897  C  CD    . LYS C 1 224 ? 58.265  46.869 55.084  1.00 291.38 ? 331  LYS D CD    1 
ATOM   6898  C  CE    . LYS C 1 224 ? 57.086  47.244 54.199  1.00 289.79 ? 331  LYS D CE    1 
ATOM   6899  N  NZ    . LYS C 1 224 ? 57.467  47.367 52.763  1.00 293.36 ? 331  LYS D NZ    1 
ATOM   6900  N  N     . GLU C 1 225 ? 61.737  49.906 54.256  1.00 291.74 ? 332  GLU D N     1 
ATOM   6901  C  CA    . GLU C 1 225 ? 61.749  51.070 53.369  1.00 290.91 ? 332  GLU D CA    1 
ATOM   6902  C  C     . GLU C 1 225 ? 60.333  51.472 52.956  1.00 286.57 ? 332  GLU D C     1 
ATOM   6903  O  O     . GLU C 1 225 ? 59.460  50.620 52.781  1.00 287.09 ? 332  GLU D O     1 
ATOM   6904  C  CB    . GLU C 1 225 ? 62.603  50.789 52.126  1.00 298.03 ? 332  GLU D CB    1 
ATOM   6905  C  CG    . GLU C 1 225 ? 62.848  51.999 51.230  1.00 298.53 ? 332  GLU D CG    1 
ATOM   6906  C  CD    . GLU C 1 225 ? 63.558  53.138 51.944  1.00 296.47 ? 332  GLU D CD    1 
ATOM   6907  O  OE1   . GLU C 1 225 ? 64.546  52.873 52.662  1.00 298.85 ? 332  GLU D OE1   1 
ATOM   6908  O  OE2   . GLU C 1 225 ? 63.130  54.300 51.781  1.00 293.48 ? 332  GLU D OE2   1 
ATOM   6909  N  N     . TRP C 1 226 ? 60.121  52.778 52.803  1.00 282.43 ? 333  TRP D N     1 
ATOM   6910  C  CA    . TRP C 1 226 ? 58.823  53.323 52.407  1.00 278.77 ? 333  TRP D CA    1 
ATOM   6911  C  C     . TRP C 1 226 ? 58.548  53.030 50.935  1.00 282.69 ? 333  TRP D C     1 
ATOM   6912  O  O     . TRP C 1 226 ? 59.347  53.387 50.067  1.00 285.60 ? 333  TRP D O     1 
ATOM   6913  C  CB    . TRP C 1 226 ? 58.785  54.833 52.663  1.00 274.13 ? 333  TRP D CB    1 
ATOM   6914  C  CG    . TRP C 1 226 ? 57.525  55.512 52.201  1.00 270.82 ? 333  TRP D CG    1 
ATOM   6915  C  CD1   . TRP C 1 226 ? 57.297  56.067 50.975  1.00 272.15 ? 333  TRP D CD1   1 
ATOM   6916  C  CD2   . TRP C 1 226 ? 56.329  55.716 52.962  1.00 266.16 ? 333  TRP D CD2   1 
ATOM   6917  N  NE1   . TRP C 1 226 ? 56.030  56.597 50.922  1.00 269.00 ? 333  TRP D NE1   1 
ATOM   6918  C  CE2   . TRP C 1 226 ? 55.415  56.397 52.129  1.00 265.34 ? 333  TRP D CE2   1 
ATOM   6919  C  CE3   . TRP C 1 226 ? 55.938  55.386 54.266  1.00 263.15 ? 333  TRP D CE3   1 
ATOM   6920  C  CZ2   . TRP C 1 226 ? 54.135  56.755 52.557  1.00 261.86 ? 333  TRP D CZ2   1 
ATOM   6921  C  CZ3   . TRP C 1 226 ? 54.663  55.743 54.690  1.00 259.70 ? 333  TRP D CZ3   1 
ATOM   6922  C  CH2   . TRP C 1 226 ? 53.778  56.421 53.836  1.00 259.22 ? 333  TRP D CH2   1 
ATOM   6923  N  N     . VAL C 1 227 ? 57.414  52.386 50.665  1.00 282.65 ? 334  VAL D N     1 
ATOM   6924  C  CA    . VAL C 1 227 ? 57.031  52.012 49.307  1.00 286.13 ? 334  VAL D CA    1 
ATOM   6925  C  C     . VAL C 1 227 ? 55.858  52.867 48.833  1.00 283.65 ? 334  VAL D C     1 
ATOM   6926  O  O     . VAL C 1 227 ? 54.717  52.660 49.252  1.00 280.87 ? 334  VAL D O     1 
ATOM   6927  C  CB    . VAL C 1 227 ? 56.648  50.518 49.221  1.00 289.04 ? 334  VAL D CB    1 
ATOM   6928  C  CG1   . VAL C 1 227 ? 56.339  50.122 47.782  1.00 293.30 ? 334  VAL D CG1   1 
ATOM   6929  C  CG2   . VAL C 1 227 ? 57.766  49.649 49.780  1.00 291.95 ? 334  VAL D CG2   1 
ATOM   6930  N  N     . THR C 1 228 ? 56.151  53.832 47.965  1.00 285.04 ? 335  THR D N     1 
ATOM   6931  C  CA    . THR C 1 228 ? 55.116  54.631 47.318  1.00 284.33 ? 335  THR D CA    1 
ATOM   6932  C  C     . THR C 1 228 ? 54.437  53.772 46.252  1.00 289.60 ? 335  THR D C     1 
ATOM   6933  O  O     . THR C 1 228 ? 55.121  53.047 45.526  1.00 295.07 ? 335  THR D O     1 
ATOM   6934  C  CB    . THR C 1 228 ? 55.710  55.886 46.644  1.00 284.27 ? 335  THR D CB    1 
ATOM   6935  O  OG1   . THR C 1 228 ? 56.542  56.588 47.576  1.00 281.32 ? 335  THR D OG1   1 
ATOM   6936  C  CG2   . THR C 1 228 ? 54.606  56.818 46.151  1.00 282.26 ? 335  THR D CG2   1 
ATOM   6937  N  N     . PRO C 1 229 ? 53.095  53.830 46.159  1.00 289.40 ? 336  PRO D N     1 
ATOM   6938  C  CA    . PRO C 1 229 ? 52.424  53.121 45.064  1.00 294.29 ? 336  PRO D CA    1 
ATOM   6939  C  C     . PRO C 1 229 ? 52.781  53.689 43.687  1.00 299.25 ? 336  PRO D C     1 
ATOM   6940  O  O     . PRO C 1 229 ? 53.284  54.810 43.592  1.00 298.11 ? 336  PRO D O     1 
ATOM   6941  C  CB    . PRO C 1 229 ? 50.933  53.336 45.358  1.00 291.04 ? 336  PRO D CB    1 
ATOM   6942  C  CG    . PRO C 1 229 ? 50.861  53.663 46.807  1.00 285.91 ? 336  PRO D CG    1 
ATOM   6943  C  CD    . PRO C 1 229 ? 52.131  54.391 47.124  1.00 284.61 ? 336  PRO D CD    1 
ATOM   6944  N  N     . LYS C 1 230 ? 52.518  52.915 42.636  1.00 305.61 ? 337  LYS D N     1 
ATOM   6945  C  CA    . LYS C 1 230 ? 52.743  53.364 41.253  1.00 311.16 ? 337  LYS D CA    1 
ATOM   6946  C  C     . LYS C 1 230 ? 52.086  54.713 40.940  1.00 310.57 ? 337  LYS D C     1 
ATOM   6947  O  O     . LYS C 1 230 ? 52.603  55.487 40.132  1.00 313.62 ? 337  LYS D O     1 
ATOM   6948  C  CB    . LYS C 1 230 ? 52.235  52.318 40.250  1.00 315.62 ? 337  LYS D CB    1 
ATOM   6949  C  CG    . LYS C 1 230 ? 53.321  51.447 39.637  1.00 320.77 ? 337  LYS D CG    1 
ATOM   6950  C  CD    . LYS C 1 230 ? 52.750  50.541 38.555  1.00 325.46 ? 337  LYS D CD    1 
ATOM   6951  C  CE    . LYS C 1 230 ? 53.784  50.203 37.492  1.00 331.71 ? 337  LYS D CE    1 
ATOM   6952  N  NZ    . LYS C 1 230 ? 53.197  49.400 36.383  1.00 336.65 ? 337  LYS D NZ    1 
ATOM   6953  N  N     . GLU C 1 231 ? 50.953  54.985 41.584  1.00 308.11 ? 338  GLU D N     1 
ATOM   6954  C  CA    . GLU C 1 231 ? 50.170  56.190 41.315  1.00 307.23 ? 338  GLU D CA    1 
ATOM   6955  C  C     . GLU C 1 231 ? 50.840  57.424 41.916  1.00 304.41 ? 338  GLU D C     1 
ATOM   6956  O  O     . GLU C 1 231 ? 50.527  57.834 43.036  1.00 299.96 ? 338  GLU D O     1 
ATOM   6957  C  CB    . GLU C 1 231 ? 48.743  56.039 41.859  1.00 305.01 ? 338  GLU D CB    1 
ATOM   6958  C  CG    . GLU C 1 231 ? 47.921  54.950 41.178  1.00 309.03 ? 338  GLU D CG    1 
ATOM   6959  C  CD    . GLU C 1 231 ? 48.285  53.541 41.624  1.00 310.72 ? 338  GLU D CD    1 
ATOM   6960  O  OE1   . GLU C 1 231 ? 48.670  53.355 42.798  1.00 307.50 ? 338  GLU D OE1   1 
ATOM   6961  O  OE2   . GLU C 1 231 ? 48.170  52.612 40.797  1.00 315.89 ? 338  GLU D OE2   1 
ATOM   6962  N  N     . PHE C 1 232 ? 51.767  58.005 41.160  1.00 307.60 ? 339  PHE D N     1 
ATOM   6963  C  CA    . PHE C 1 232 ? 52.495  59.194 41.597  1.00 305.73 ? 339  PHE D CA    1 
ATOM   6964  C  C     . PHE C 1 232 ? 53.189  59.876 40.418  1.00 310.61 ? 339  PHE D C     1 
ATOM   6965  O  O     . PHE C 1 232 ? 54.330  59.549 40.084  1.00 313.62 ? 339  PHE D O     1 
ATOM   6966  C  CB    . PHE C 1 232 ? 53.522  58.823 42.669  1.00 303.76 ? 339  PHE D CB    1 
ATOM   6967  N  N     . ARG C 1 233 ? 52.488  60.820 39.794  1.00 312.02 ? 340  ARG D N     1 
ATOM   6968  C  CA    . ARG C 1 233 ? 53.023  61.568 38.656  1.00 317.06 ? 340  ARG D CA    1 
ATOM   6969  C  C     . ARG C 1 233 ? 53.919  62.727 39.095  1.00 316.58 ? 340  ARG D C     1 
ATOM   6970  O  O     . ARG C 1 233 ? 54.636  63.302 38.272  1.00 320.56 ? 340  ARG D O     1 
ATOM   6971  C  CB    . ARG C 1 233 ? 51.885  62.101 37.782  1.00 318.33 ? 340  ARG D CB    1 
ATOM   6972  N  N     . GLU C 1 234 ? 53.869  63.070 40.382  1.00 312.67 ? 341  GLU D N     1 
ATOM   6973  C  CA    . GLU C 1 234 ? 54.718  64.115 40.955  1.00 312.00 ? 341  GLU D CA    1 
ATOM   6974  C  C     . GLU C 1 234 ? 55.653  63.559 42.034  1.00 311.38 ? 341  GLU D C     1 
ATOM   6975  O  O     . GLU C 1 234 ? 56.194  64.317 42.841  1.00 308.78 ? 341  GLU D O     1 
ATOM   6976  C  CB    . GLU C 1 234 ? 53.853  65.233 41.539  1.00 307.99 ? 341  GLU D CB    1 
ATOM   6977  N  N     . ILE C 1 235 ? 55.840  62.239 42.043  1.00 314.54 ? 342  ILE D N     1 
ATOM   6978  C  CA    . ILE C 1 235 ? 56.776  61.592 42.962  1.00 314.93 ? 342  ILE D CA    1 
ATOM   6979  C  C     . ILE C 1 235 ? 58.218  61.836 42.524  1.00 320.35 ? 342  ILE D C     1 
ATOM   6980  O  O     . ILE C 1 235 ? 59.119  61.924 43.358  1.00 318.99 ? 342  ILE D O     1 
ATOM   6981  C  CB    . ILE C 1 235 ? 56.536  60.073 43.038  1.00 316.04 ? 342  ILE D CB    1 
ATOM   6982  N  N     . SER C 1 236 ? 58.425  61.936 41.212  1.00 327.31 ? 343  SER D N     1 
ATOM   6983  C  CA    . SER C 1 236 ? 59.736  62.253 40.648  1.00 333.25 ? 343  SER D CA    1 
ATOM   6984  C  C     . SER C 1 236 ? 60.161  63.690 40.958  1.00 332.61 ? 343  SER D C     1 
ATOM   6985  O  O     . SER C 1 236 ? 61.354  63.990 40.987  1.00 335.16 ? 343  SER D O     1 
ATOM   6986  C  CB    . SER C 1 236 ? 59.733  62.031 39.133  1.00 339.27 ? 343  SER D CB    1 
ATOM   6987  N  N     . TYR C 1 237 ? 59.184  64.569 41.178  1.00 329.98 ? 344  TYR D N     1 
ATOM   6988  C  CA    . TYR C 1 237 ? 59.452  65.960 41.548  1.00 328.81 ? 344  TYR D CA    1 
ATOM   6989  C  C     . TYR C 1 237 ? 59.770  66.091 43.038  1.00 324.58 ? 344  TYR D C     1 
ATOM   6990  O  O     . TYR C 1 237 ? 60.688  66.819 43.419  1.00 324.93 ? 344  TYR D O     1 
ATOM   6991  C  CB    . TYR C 1 237 ? 58.253  66.844 41.196  1.00 327.09 ? 344  TYR D CB    1 
ATOM   6992  N  N     . LEU C 1 238 ? 59.005  65.388 43.872  1.00 321.31 ? 345  LEU D N     1 
ATOM   6993  C  CA    . LEU C 1 238 ? 59.194  65.421 45.324  1.00 317.34 ? 345  LEU D CA    1 
ATOM   6994  C  C     . LEU C 1 238 ? 60.476  64.705 45.748  1.00 319.63 ? 345  LEU D C     1 
ATOM   6995  O  O     . LEU C 1 238 ? 61.218  65.202 46.598  1.00 317.74 ? 345  LEU D O     1 
ATOM   6996  C  CB    . LEU C 1 238 ? 57.994  64.788 46.032  1.00 313.44 ? 345  LEU D CB    1 
ATOM   6997  N  N     . LYS C 1 239 ? 60.728  63.540 45.153  1.00 323.93 ? 346  LYS D N     1 
ATOM   6998  C  CA    . LYS C 1 239 ? 61.939  62.764 45.435  1.00 326.99 ? 346  LYS D CA    1 
ATOM   6999  C  C     . LYS C 1 239 ? 63.197  63.390 44.824  1.00 331.75 ? 346  LYS D C     1 
ATOM   7000  O  O     . LYS C 1 239 ? 64.314  63.060 45.230  1.00 333.47 ? 346  LYS D O     1 
ATOM   7001  C  CB    . LYS C 1 239 ? 61.783  61.328 44.926  1.00 330.15 ? 346  LYS D CB    1 
ATOM   7002  N  N     . LYS C 1 240 ? 63.014  64.289 43.857  1.00 333.94 ? 347  LYS D N     1 
ATOM   7003  C  CA    . LYS C 1 240 ? 64.132  64.997 43.227  1.00 338.57 ? 347  LYS D CA    1 
ATOM   7004  C  C     . LYS C 1 240 ? 64.711  66.120 44.094  1.00 335.68 ? 347  LYS D C     1 
ATOM   7005  O  O     . LYS C 1 240 ? 65.683  66.765 43.696  1.00 339.30 ? 347  LYS D O     1 
ATOM   7006  C  CB    . LYS C 1 240 ? 63.700  65.581 41.879  1.00 341.81 ? 347  LYS D CB    1 
ATOM   7007  N  N     . LEU C 1 241 ? 64.130  66.352 45.271  1.00 329.46 ? 348  LEU D N     1 
ATOM   7008  C  CA    . LEU C 1 241 ? 64.596  67.403 46.178  1.00 326.44 ? 348  LEU D CA    1 
ATOM   7009  C  C     . LEU C 1 241 ? 65.817  66.983 47.006  1.00 327.03 ? 348  LEU D C     1 
ATOM   7010  O  O     . LEU C 1 241 ? 65.868  67.232 48.212  1.00 323.10 ? 348  LEU D O     1 
ATOM   7011  C  CB    . LEU C 1 241 ? 63.461  67.835 47.111  1.00 319.99 ? 348  LEU D CB    1 
ATOM   7012  N  N     . LYS C 1 242 ? 66.795  66.355 46.351  1.00 332.06 ? 349  LYS D N     1 
ATOM   7013  C  CA    . LYS C 1 242 ? 68.069  66.000 46.976  1.00 333.69 ? 349  LYS D CA    1 
ATOM   7014  C  C     . LYS C 1 242 ? 67.911  65.208 48.278  1.00 328.71 ? 349  LYS D C     1 
ATOM   7015  O  O     . LYS C 1 242 ? 68.486  65.570 49.307  1.00 327.13 ? 349  LYS D O     1 
ATOM   7016  C  CB    . LYS C 1 242 ? 68.878  67.273 47.234  1.00 334.31 ? 349  LYS D CB    1 
ATOM   7017  N  N     . VAL C 1 243 ? 67.138  64.125 48.220  1.00 326.13 ? 350  VAL D N     1 
ATOM   7018  C  CA    . VAL C 1 243 ? 66.867  63.292 49.393  1.00 320.95 ? 350  VAL D CA    1 
ATOM   7019  C  C     . VAL C 1 243 ? 67.619  61.962 49.322  1.00 324.40 ? 350  VAL D C     1 
ATOM   7020  O  O     . VAL C 1 243 ? 67.312  61.114 48.482  1.00 327.74 ? 350  VAL D O     1 
ATOM   7021  C  CB    . VAL C 1 243 ? 65.362  62.997 49.528  1.00 315.61 ? 350  VAL D CB    1 
ATOM   7022  N  N     . LYS C 1 244 ? 68.601  61.793 50.207  1.00 323.60 ? 351  LYS D N     1 
ATOM   7023  C  CA    . LYS C 1 244 ? 69.378  60.555 50.300  1.00 326.73 ? 351  LYS D CA    1 
ATOM   7024  C  C     . LYS C 1 244 ? 69.024  59.797 51.579  1.00 321.59 ? 351  LYS D C     1 
ATOM   7025  O  O     . LYS C 1 244 ? 68.193  60.253 52.367  1.00 315.17 ? 351  LYS D O     1 
ATOM   7026  C  CB    . LYS C 1 244 ? 70.875  60.870 50.277  1.00 331.73 ? 351  LYS D CB    1 
ATOM   7027  N  N     . LYS C 1 245 ? 69.654  58.640 51.778  1.00 323.98 ? 352  LYS D N     1 
ATOM   7028  C  CA    . LYS C 1 245 ? 69.416  57.825 52.973  1.00 320.11 ? 352  LYS D CA    1 
ATOM   7029  C  C     . LYS C 1 245 ? 70.026  58.470 54.217  1.00 316.58 ? 352  LYS D C     1 
ATOM   7030  O  O     . LYS C 1 245 ? 71.197  58.852 54.217  1.00 320.10 ? 352  LYS D O     1 
ATOM   7031  C  CB    . LYS C 1 245 ? 69.970  56.406 52.794  1.00 325.53 ? 352  LYS D CB    1 
ATOM   7032  C  CG    . LYS C 1 245 ? 69.063  55.489 51.989  1.00 326.15 ? 352  LYS D CG    1 
ATOM   7033  C  CD    . LYS C 1 245 ? 69.536  54.044 52.039  1.00 331.07 ? 352  LYS D CD    1 
ATOM   7034  C  CE    . LYS C 1 245 ? 68.481  53.089 51.500  1.00 330.90 ? 352  LYS D CE    1 
ATOM   7035  N  NZ    . LYS C 1 245 ? 67.327  52.922 52.427  1.00 324.58 ? 352  LYS D NZ    1 
ATOM   7036  N  N     . GLN C 1 246 ? 69.220  58.583 55.270  1.00 309.60 ? 353  GLN D N     1 
ATOM   7037  C  CA    . GLN C 1 246 ? 69.650  59.201 56.524  1.00 306.01 ? 353  GLN D CA    1 
ATOM   7038  C  C     . GLN C 1 246 ? 68.701  58.844 57.667  1.00 299.99 ? 353  GLN D C     1 
ATOM   7039  O  O     . GLN C 1 246 ? 67.528  58.546 57.440  1.00 297.34 ? 353  GLN D O     1 
ATOM   7040  C  CB    . GLN C 1 246 ? 69.738  60.724 56.369  1.00 303.83 ? 353  GLN D CB    1 
ATOM   7041  C  CG    . GLN C 1 246 ? 68.476  61.379 55.825  1.00 299.73 ? 353  GLN D CG    1 
ATOM   7042  C  CD    . GLN C 1 246 ? 68.646  62.870 55.603  1.00 298.23 ? 353  GLN D CD    1 
ATOM   7043  O  OE1   . GLN C 1 246 ? 68.991  63.610 56.526  1.00 296.04 ? 353  GLN D OE1   1 
ATOM   7044  N  NE2   . GLN C 1 246 ? 68.401  63.322 54.377  1.00 299.70 ? 353  GLN D NE2   1 
ATOM   7045  N  N     . ASP C 1 247 ? 69.222  58.882 58.892  1.00 297.84 ? 354  ASP D N     1 
ATOM   7046  C  CA    . ASP C 1 247 ? 68.448  58.554 60.090  1.00 293.01 ? 354  ASP D CA    1 
ATOM   7047  C  C     . ASP C 1 247 ? 68.001  59.836 60.797  1.00 285.96 ? 354  ASP D C     1 
ATOM   7048  O  O     . ASP C 1 247 ? 68.573  60.906 60.581  1.00 286.10 ? 354  ASP D O     1 
ATOM   7049  C  CB    . ASP C 1 247 ? 69.290  57.687 61.034  1.00 296.70 ? 354  ASP D CB    1 
ATOM   7050  C  CG    . ASP C 1 247 ? 68.443  56.842 61.975  1.00 295.16 ? 354  ASP D CG    1 
ATOM   7051  O  OD1   . ASP C 1 247 ? 67.621  57.410 62.724  1.00 290.46 ? 354  ASP D OD1   1 
ATOM   7052  O  OD2   . ASP C 1 247 ? 68.612  55.604 61.973  1.00 299.59 ? 354  ASP D OD2   1 
ATOM   7053  N  N     . ARG C 1 248 ? 66.971  59.714 61.633  1.00 279.61 ? 355  ARG D N     1 
ATOM   7054  C  CA    . ARG C 1 248 ? 66.451  60.835 62.419  1.00 272.41 ? 355  ARG D CA    1 
ATOM   7055  C  C     . ARG C 1 248 ? 67.516  61.391 63.366  1.00 271.93 ? 355  ARG D C     1 
ATOM   7056  O  O     . ARG C 1 248 ? 68.111  60.647 64.148  1.00 273.26 ? 355  ARG D O     1 
ATOM   7057  C  CB    . ARG C 1 248 ? 65.219  60.389 63.220  1.00 267.74 ? 355  ARG D CB    1 
ATOM   7058  C  CG    . ARG C 1 248 ? 64.645  61.430 64.176  1.00 262.35 ? 355  ARG D CG    1 
ATOM   7059  C  CD    . ARG C 1 248 ? 63.785  62.465 63.468  1.00 259.00 ? 355  ARG D CD    1 
ATOM   7060  N  NE    . ARG C 1 248 ? 62.477  61.925 63.097  1.00 256.90 ? 355  ARG D NE    1 
ATOM   7061  C  CZ    . ARG C 1 248 ? 61.428  62.654 62.714  1.00 253.60 ? 355  ARG D CZ    1 
ATOM   7062  N  NH1   . ARG C 1 248 ? 61.503  63.981 62.644  1.00 251.69 ? 355  ARG D NH1   1 
ATOM   7063  N  NH2   . ARG C 1 248 ? 60.287  62.049 62.401  1.00 252.65 ? 355  ARG D NH2   1 
ATOM   7064  N  N     . ILE C 1 249 ? 67.744  62.700 63.282  1.00 269.63 ? 356  ILE D N     1 
ATOM   7065  C  CA    . ILE C 1 249 ? 68.638  63.406 64.198  1.00 269.23 ? 356  ILE D CA    1 
ATOM   7066  C  C     . ILE C 1 249 ? 67.779  64.028 65.294  1.00 263.74 ? 356  ILE D C     1 
ATOM   7067  O  O     . ILE C 1 249 ? 66.686  64.530 65.022  1.00 261.08 ? 356  ILE D O     1 
ATOM   7068  C  CB    . ILE C 1 249 ? 69.448  64.517 63.491  1.00 271.23 ? 356  ILE D CB    1 
ATOM   7069  C  CG1   . ILE C 1 249 ? 70.074  64.001 62.189  1.00 276.70 ? 356  ILE D CG1   1 
ATOM   7070  C  CG2   . ILE C 1 249 ? 70.543  65.044 64.410  1.00 272.32 ? 356  ILE D CG2   1 
ATOM   7071  C  CD1   . ILE C 1 249 ? 70.711  65.084 61.345  1.00 278.88 ? 356  ILE D CD1   1 
ATOM   7072  N  N     . PHE C 1 250 ? 68.281  63.999 66.526  1.00 262.80 ? 357  PHE D N     1 
ATOM   7073  C  CA    . PHE C 1 250 ? 67.528  64.467 67.689  1.00 258.23 ? 357  PHE D CA    1 
ATOM   7074  C  C     . PHE C 1 250 ? 68.220  65.662 68.346  1.00 257.50 ? 357  PHE D C     1 
ATOM   7075  O  O     . PHE C 1 250 ? 69.385  65.938 68.053  1.00 260.47 ? 357  PHE D O     1 
ATOM   7076  C  CB    . PHE C 1 250 ? 67.377  63.325 68.693  1.00 258.55 ? 357  PHE D CB    1 
ATOM   7077  C  CG    . PHE C 1 250 ? 66.687  62.116 68.130  1.00 259.72 ? 357  PHE D CG    1 
ATOM   7078  C  CD1   . PHE C 1 250 ? 67.416  61.103 67.520  1.00 264.27 ? 357  PHE D CD1   1 
ATOM   7079  C  CD2   . PHE C 1 250 ? 65.306  61.996 68.197  1.00 256.89 ? 357  PHE D CD2   1 
ATOM   7080  C  CE1   . PHE C 1 250 ? 66.781  59.991 66.994  1.00 265.62 ? 357  PHE D CE1   1 
ATOM   7081  C  CE2   . PHE C 1 250 ? 64.665  60.886 67.675  1.00 258.23 ? 357  PHE D CE2   1 
ATOM   7082  C  CZ    . PHE C 1 250 ? 65.403  59.881 67.074  1.00 262.48 ? 357  PHE D CZ    1 
ATOM   7083  N  N     . PRO C 1 251 ? 67.504  66.382 69.235  1.00 254.10 ? 358  PRO D N     1 
ATOM   7084  C  CA    . PRO C 1 251 ? 68.135  67.495 69.954  1.00 253.79 ? 358  PRO D CA    1 
ATOM   7085  C  C     . PRO C 1 251 ? 69.218  67.036 70.940  1.00 256.29 ? 358  PRO D C     1 
ATOM   7086  O  O     . PRO C 1 251 ? 69.282  65.849 71.267  1.00 257.94 ? 358  PRO D O     1 
ATOM   7087  C  CB    . PRO C 1 251 ? 66.966  68.143 70.712  1.00 249.58 ? 358  PRO D CB    1 
ATOM   7088  C  CG    . PRO C 1 251 ? 65.733  67.665 70.029  1.00 247.96 ? 358  PRO D CG    1 
ATOM   7089  C  CD    . PRO C 1 251 ? 66.061  66.295 69.523  1.00 250.76 ? 358  PRO D CD    1 
ATOM   7090  N  N     . PRO C 1 252 ? 70.066  67.971 71.414  1.00 256.77 ? 359  PRO D N     1 
ATOM   7091  C  CA    . PRO C 1 252 ? 71.119  67.610 72.370  1.00 259.02 ? 359  PRO D CA    1 
ATOM   7092  C  C     . PRO C 1 252 ? 70.567  67.161 73.723  1.00 256.38 ? 359  PRO D C     1 
ATOM   7093  O  O     . PRO C 1 252 ? 69.671  67.804 74.269  1.00 251.73 ? 359  PRO D O     1 
ATOM   7094  C  CB    . PRO C 1 252 ? 71.924  68.911 72.528  1.00 259.82 ? 359  PRO D CB    1 
ATOM   7095  C  CG    . PRO C 1 252 ? 71.537  69.770 71.374  1.00 258.96 ? 359  PRO D CG    1 
ATOM   7096  C  CD    . PRO C 1 252 ? 70.124  69.398 71.051  1.00 255.71 ? 359  PRO D CD    1 
ATOM   7097  N  N     . ALA D 2 14  ? 20.310  50.531 92.822  1.00 246.82 ? 531  ALA F N     1 
ATOM   7098  C  CA    . ALA D 2 14  ? 20.589  51.864 93.442  1.00 244.86 ? 531  ALA F CA    1 
ATOM   7099  C  C     . ALA D 2 14  ? 19.412  52.823 93.264  1.00 247.50 ? 531  ALA F C     1 
ATOM   7100  O  O     . ALA D 2 14  ? 18.457  52.523 92.545  1.00 250.98 ? 531  ALA F O     1 
ATOM   7101  C  CB    . ALA D 2 14  ? 21.855  52.468 92.850  1.00 242.18 ? 531  ALA F CB    1 
ATOM   7102  N  N     . ALA D 2 15  ? 19.494  53.975 93.927  1.00 246.10 ? 532  ALA F N     1 
ATOM   7103  C  CA    . ALA D 2 15  ? 18.458  55.006 93.848  1.00 248.44 ? 532  ALA F CA    1 
ATOM   7104  C  C     . ALA D 2 15  ? 18.883  56.127 92.897  1.00 247.92 ? 532  ALA F C     1 
ATOM   7105  O  O     . ALA D 2 15  ? 19.931  56.038 92.253  1.00 245.92 ? 532  ALA F O     1 
ATOM   7106  C  CB    . ALA D 2 15  ? 18.167  55.560 95.236  1.00 247.95 ? 532  ALA F CB    1 
ATOM   7107  N  N     . VAL D 2 16  ? 18.066  57.177 92.815  1.00 249.66 ? 533  VAL F N     1 
ATOM   7108  C  CA    . VAL D 2 16  ? 18.329  58.302 91.915  1.00 249.51 ? 533  VAL F CA    1 
ATOM   7109  C  C     . VAL D 2 16  ? 19.436  59.197 92.471  1.00 245.53 ? 533  VAL F C     1 
ATOM   7110  O  O     . VAL D 2 16  ? 19.491  59.454 93.675  1.00 244.04 ? 533  VAL F O     1 
ATOM   7111  C  CB    . VAL D 2 16  ? 17.061  59.159 91.685  1.00 253.47 ? 533  VAL F CB    1 
ATOM   7112  C  CG1   . VAL D 2 16  ? 17.363  60.332 90.756  1.00 254.14 ? 533  VAL F CG1   1 
ATOM   7113  C  CG2   . VAL D 2 16  ? 15.930  58.307 91.123  1.00 256.99 ? 533  VAL F CG2   1 
ATOM   7114  N  N     . ASP D 2 17  ? 20.312  59.666 91.584  1.00 243.41 ? 534  ASP F N     1 
ATOM   7115  C  CA    . ASP D 2 17  ? 21.374  60.597 91.950  1.00 240.14 ? 534  ASP F CA    1 
ATOM   7116  C  C     . ASP D 2 17  ? 20.765  61.986 92.171  1.00 241.88 ? 534  ASP F C     1 
ATOM   7117  O  O     . ASP D 2 17  ? 20.118  62.520 91.268  1.00 244.42 ? 534  ASP F O     1 
ATOM   7118  C  CB    . ASP D 2 17  ? 22.435  60.651 90.841  1.00 238.31 ? 534  ASP F CB    1 
ATOM   7119  C  CG    . ASP D 2 17  ? 23.668  61.462 91.231  1.00 235.10 ? 534  ASP F CG    1 
ATOM   7120  O  OD1   . ASP D 2 17  ? 24.430  61.849 90.322  1.00 234.06 ? 534  ASP F OD1   1 
ATOM   7121  O  OD2   . ASP D 2 17  ? 23.889  61.708 92.434  1.00 233.88 ? 534  ASP F OD2   1 
ATOM   7122  N  N     . PRO D 2 18  ? 20.961  62.575 93.369  1.00 240.69 ? 535  PRO F N     1 
ATOM   7123  C  CA    . PRO D 2 18  ? 20.406  63.912 93.640  1.00 242.84 ? 535  PRO F CA    1 
ATOM   7124  C  C     . PRO D 2 18  ? 20.991  65.059 92.803  1.00 243.29 ? 535  PRO F C     1 
ATOM   7125  O  O     . PRO D 2 18  ? 20.478  66.177 92.868  1.00 245.33 ? 535  PRO F O     1 
ATOM   7126  C  CB    . PRO D 2 18  ? 20.716  64.134 95.129  1.00 241.03 ? 535  PRO F CB    1 
ATOM   7127  C  CG    . PRO D 2 18  ? 21.789  63.161 95.464  1.00 237.53 ? 535  PRO F CG    1 
ATOM   7128  C  CD    . PRO D 2 18  ? 21.550  61.978 94.581  1.00 237.93 ? 535  PRO F CD    1 
ATOM   7129  N  N     . ASP D 2 19  ? 22.048  64.789 92.037  1.00 241.78 ? 536  ASP F N     1 
ATOM   7130  C  CA    . ASP D 2 19  ? 22.618  65.784 91.125  1.00 242.72 ? 536  ASP F CA    1 
ATOM   7131  C  C     . ASP D 2 19  ? 21.651  66.149 89.993  1.00 247.29 ? 536  ASP F C     1 
ATOM   7132  O  O     . ASP D 2 19  ? 21.738  67.240 89.428  1.00 249.03 ? 536  ASP F O     1 
ATOM   7133  C  CB    . ASP D 2 19  ? 23.941  65.280 90.537  1.00 239.72 ? 536  ASP F CB    1 
ATOM   7134  C  CG    . ASP D 2 19  ? 25.022  65.097 91.590  1.00 236.20 ? 536  ASP F CG    1 
ATOM   7135  O  OD1   . ASP D 2 19  ? 24.694  65.074 92.795  1.00 235.92 ? 536  ASP F OD1   1 
ATOM   7136  O  OD2   . ASP D 2 19  ? 26.205  64.970 91.210  1.00 233.81 ? 536  ASP F OD2   1 
ATOM   7137  N  N     . SER D 2 20  ? 20.741  65.232 89.664  1.00 250.04 ? 537  SER F N     1 
ATOM   7138  C  CA    . SER D 2 20  ? 19.688  65.494 88.682  1.00 254.61 ? 537  SER F CA    1 
ATOM   7139  C  C     . SER D 2 20  ? 18.710  66.561 89.172  1.00 258.08 ? 537  SER F C     1 
ATOM   7140  O  O     . SER D 2 20  ? 18.252  67.397 88.392  1.00 260.49 ? 537  SER F O     1 
ATOM   7141  C  CB    . SER D 2 20  ? 18.922  64.204 88.368  1.00 256.11 ? 537  SER F CB    1 
ATOM   7142  O  OG    . SER D 2 20  ? 18.340  63.657 89.539  1.00 256.21 ? 537  SER F OG    1 
ATOM   7143  N  N     . GLY D 2 21  ? 18.398  66.522 90.466  1.00 258.52 ? 538  GLY F N     1 
ATOM   7144  C  CA    . GLY D 2 21  ? 17.413  67.424 91.062  1.00 262.30 ? 538  GLY F CA    1 
ATOM   7145  C  C     . GLY D 2 21  ? 15.999  66.867 91.024  1.00 266.58 ? 538  GLY F C     1 
ATOM   7146  O  O     . GLY D 2 21  ? 15.064  67.511 91.503  1.00 269.34 ? 538  GLY F O     1 
ATOM   7147  N  N     . LEU D 2 22  ? 15.845  65.669 90.458  1.00 267.52 ? 539  LEU F N     1 
ATOM   7148  C  CA    . LEU D 2 22  ? 14.546  65.010 90.337  1.00 271.61 ? 539  LEU F CA    1 
ATOM   7149  C  C     . LEU D 2 22  ? 14.540  63.691 91.117  1.00 270.71 ? 539  LEU F C     1 
ATOM   7150  O  O     . LEU D 2 22  ? 13.919  62.714 90.690  1.00 272.96 ? 539  LEU F O     1 
ATOM   7151  C  CB    . LEU D 2 22  ? 14.229  64.737 88.861  1.00 273.88 ? 539  LEU F CB    1 
ATOM   7152  C  CG    . LEU D 2 22  ? 14.535  65.821 87.822  1.00 274.91 ? 539  LEU F CG    1 
ATOM   7153  C  CD1   . LEU D 2 22  ? 14.132  65.329 86.438  1.00 277.44 ? 539  LEU F CD1   1 
ATOM   7154  C  CD2   . LEU D 2 22  ? 13.841  67.135 88.148  1.00 277.69 ? 539  LEU F CD2   1 
ATOM   7155  N  N     . GLU D 2 23  ? 15.223  63.668 92.262  1.00 268.19 ? 540  GLU F N     1 
ATOM   7156  C  CA    . GLU D 2 23  ? 15.411  62.424 93.025  1.00 266.56 ? 540  GLU F CA    1 
ATOM   7157  C  C     . GLU D 2 23  ? 14.122  61.903 93.667  1.00 269.74 ? 540  GLU F C     1 
ATOM   7158  O  O     . GLU D 2 23  ? 13.816  60.713 93.562  1.00 269.84 ? 540  GLU F O     1 
ATOM   7159  C  CB    . GLU D 2 23  ? 16.520  62.565 94.085  1.00 262.77 ? 540  GLU F CB    1 
ATOM   7160  C  CG    . GLU D 2 23  ? 16.457  63.818 94.954  1.00 263.26 ? 540  GLU F CG    1 
ATOM   7161  C  CD    . GLU D 2 23  ? 17.221  63.686 96.262  1.00 260.23 ? 540  GLU F CD    1 
ATOM   7162  O  OE1   . GLU D 2 23  ? 17.815  62.616 96.520  1.00 257.78 ? 540  GLU F OE1   1 
ATOM   7163  O  OE2   . GLU D 2 23  ? 17.226  64.663 97.040  1.00 260.64 ? 540  GLU F OE2   1 
ATOM   7164  N  N     . HIS D 2 24  ? 13.376  62.791 94.321  1.00 272.59 ? 541  HIS F N     1 
ATOM   7165  C  CA    . HIS D 2 24  ? 12.095  62.436 94.932  1.00 276.32 ? 541  HIS F CA    1 
ATOM   7166  C  C     . HIS D 2 24  ? 10.963  62.958 94.051  1.00 281.80 ? 541  HIS F C     1 
ATOM   7167  O  O     . HIS D 2 24  ? 10.193  63.836 94.448  1.00 284.28 ? 541  HIS F O     1 
ATOM   7168  C  CB    . HIS D 2 24  ? 11.998  62.990 96.358  1.00 275.61 ? 541  HIS F CB    1 
ATOM   7169  C  CG    . HIS D 2 24  ? 12.815  62.230 97.357  1.00 271.69 ? 541  HIS F CG    1 
ATOM   7170  N  ND1   . HIS D 2 24  ? 14.159  62.465 97.554  1.00 267.65 ? 541  HIS F ND1   1 
ATOM   7171  C  CD2   . HIS D 2 24  ? 12.478  61.238 98.214  1.00 271.42 ? 541  HIS F CD2   1 
ATOM   7172  C  CE1   . HIS D 2 24  ? 14.614  61.650 98.489  1.00 265.10 ? 541  HIS F CE1   1 
ATOM   7173  N  NE2   . HIS D 2 24  ? 13.614  60.895 98.906  1.00 267.27 ? 541  HIS F NE2   1 
ATOM   7174  N  N     . SER D 2 25  ? 10.885  62.407 92.842  1.00 283.98 ? 542  SER F N     1 
ATOM   7175  C  CA    . SER D 2 25  ? 9.876   62.796 91.859  1.00 289.57 ? 542  SER F CA    1 
ATOM   7176  C  C     . SER D 2 25  ? 9.554   61.629 90.924  1.00 291.82 ? 542  SER F C     1 
ATOM   7177  O  O     . SER D 2 25  ? 8.408   61.183 90.854  1.00 295.65 ? 542  SER F O     1 
ATOM   7178  C  CB    . SER D 2 25  ? 10.359  64.005 91.053  1.00 289.81 ? 542  SER F CB    1 
ATOM   7179  O  OG    . SER D 2 25  ? 9.395   64.403 90.094  1.00 294.65 ? 542  SER F OG    1 
ATOM   7180  N  N     . ALA D 2 26  ? 10.572  61.145 90.213  1.00 289.99 ? 543  ALA F N     1 
ATOM   7181  C  CA    . ALA D 2 26  ? 10.432  60.005 89.308  1.00 292.05 ? 543  ALA F CA    1 
ATOM   7182  C  C     . ALA D 2 26  ? 11.444  58.915 89.660  1.00 288.92 ? 543  ALA F C     1 
ATOM   7183  O  O     . ALA D 2 26  ? 12.608  59.204 89.945  1.00 285.30 ? 543  ALA F O     1 
ATOM   7184  C  CB    . ALA D 2 26  ? 10.613  60.450 87.866  1.00 293.48 ? 543  ALA F CB    1 
ATOM   7185  N  N     . HIS D 2 27  ? 10.990  57.664 89.634  1.00 291.27 ? 544  HIS F N     1 
ATOM   7186  C  CA    . HIS D 2 27  ? 11.820  56.515 90.003  1.00 288.78 ? 544  HIS F CA    1 
ATOM   7187  C  C     . HIS D 2 27  ? 12.812  56.137 88.901  1.00 287.09 ? 544  HIS F C     1 
ATOM   7188  O  O     . HIS D 2 27  ? 12.568  56.394 87.720  1.00 289.47 ? 544  HIS F O     1 
ATOM   7189  C  CB    . HIS D 2 27  ? 10.933  55.307 90.345  1.00 291.72 ? 544  HIS F CB    1 
ATOM   7190  C  CG    . HIS D 2 27  ? 10.359  54.610 89.147  1.00 295.85 ? 544  HIS F CG    1 
ATOM   7191  N  ND1   . HIS D 2 27  ? 9.382   55.169 88.352  1.00 300.56 ? 544  HIS F ND1   1 
ATOM   7192  C  CD2   . HIS D 2 27  ? 10.624  53.393 88.615  1.00 296.26 ? 544  HIS F CD2   1 
ATOM   7193  C  CE1   . HIS D 2 27  ? 9.074   54.330 87.379  1.00 303.27 ? 544  HIS F CE1   1 
ATOM   7194  N  NE2   . HIS D 2 27  ? 9.812   53.244 87.517  1.00 300.76 ? 544  HIS F NE2   1 
ATOM   7195  N  N     . VAL D 2 28  ? 13.931  55.533 89.299  1.00 283.14 ? 545  VAL F N     1 
ATOM   7196  C  CA    . VAL D 2 28  ? 14.899  54.978 88.345  1.00 281.53 ? 545  VAL F CA    1 
ATOM   7197  C  C     . VAL D 2 28  ? 14.329  53.696 87.731  1.00 284.35 ? 545  VAL F C     1 
ATOM   7198  O  O     . VAL D 2 28  ? 13.782  52.850 88.440  1.00 285.35 ? 545  VAL F O     1 
ATOM   7199  C  CB    . VAL D 2 28  ? 16.292  54.725 88.985  1.00 276.61 ? 545  VAL F CB    1 
ATOM   7200  C  CG1   . VAL D 2 28  ? 16.215  53.764 90.170  1.00 275.44 ? 545  VAL F CG1   1 
ATOM   7201  C  CG2   . VAL D 2 28  ? 17.280  54.210 87.944  1.00 275.22 ? 545  VAL F CG2   1 
ATOM   7202  N  N     . LEU D 2 29  ? 14.462  53.561 86.414  1.00 285.92 ? 546  LEU F N     1 
ATOM   7203  C  CA    . LEU D 2 29  ? 13.771  52.510 85.664  1.00 289.55 ? 546  LEU F CA    1 
ATOM   7204  C  C     . LEU D 2 29  ? 14.609  51.241 85.499  1.00 287.41 ? 546  LEU F C     1 
ATOM   7205  O  O     . LEU D 2 29  ? 15.841  51.291 85.497  1.00 283.69 ? 546  LEU F O     1 
ATOM   7206  C  CB    . LEU D 2 29  ? 13.351  53.046 84.290  1.00 293.22 ? 546  LEU F CB    1 
ATOM   7207  C  CG    . LEU D 2 29  ? 12.406  52.169 83.456  1.00 298.21 ? 546  LEU F CG    1 
ATOM   7208  C  CD1   . LEU D 2 29  ? 11.324  53.012 82.797  1.00 302.67 ? 546  LEU F CD1   1 
ATOM   7209  C  CD2   . LEU D 2 29  ? 13.162  51.357 82.412  1.00 297.96 ? 546  LEU F CD2   1 
ATOM   7210  N  N     . GLU D 2 30  ? 13.918  50.109 85.369  1.00 289.70 ? 547  GLU F N     1 
ATOM   7211  C  CA    . GLU D 2 30  ? 14.548  48.818 85.091  1.00 288.51 ? 547  GLU F CA    1 
ATOM   7212  C  C     . GLU D 2 30  ? 13.651  47.981 84.175  1.00 293.07 ? 547  GLU F C     1 
ATOM   7213  O  O     . GLU D 2 30  ? 12.434  47.939 84.363  1.00 296.68 ? 547  GLU F O     1 
ATOM   7214  C  CB    . GLU D 2 30  ? 14.824  48.062 86.397  1.00 285.73 ? 547  GLU F CB    1 
ATOM   7215  C  CG    . GLU D 2 30  ? 13.589  47.762 87.238  1.00 288.04 ? 547  GLU F CG    1 
ATOM   7216  C  CD    . GLU D 2 30  ? 13.926  47.193 88.604  1.00 285.28 ? 547  GLU F CD    1 
ATOM   7217  O  OE1   . GLU D 2 30  ? 13.239  47.553 89.582  1.00 285.66 ? 547  GLU F OE1   1 
ATOM   7218  O  OE2   . GLU D 2 30  ? 14.876  46.387 88.702  1.00 282.81 ? 547  GLU F OE2   1 
ATOM   7219  N  N     . LYS D 2 31  ? 14.254  47.327 83.182  1.00 292.95 ? 548  LYS F N     1 
ATOM   7220  C  CA    . LYS D 2 31  ? 13.518  46.446 82.274  1.00 297.00 ? 548  LYS F CA    1 
ATOM   7221  C  C     . LYS D 2 31  ? 13.571  45.012 82.800  1.00 296.89 ? 548  LYS F C     1 
ATOM   7222  O  O     . LYS D 2 31  ? 14.454  44.233 82.431  1.00 295.80 ? 548  LYS F O     1 
ATOM   7223  C  CB    . LYS D 2 31  ? 14.093  46.529 80.852  1.00 297.45 ? 548  LYS F CB    1 
ATOM   7224  C  CG    . LYS D 2 31  ? 13.389  45.670 79.806  1.00 302.21 ? 548  LYS F CG    1 
ATOM   7225  C  CD    . LYS D 2 31  ? 11.925  46.042 79.628  1.00 306.78 ? 548  LYS F CD    1 
ATOM   7226  C  CE    . LYS D 2 31  ? 11.276  45.205 78.539  1.00 311.93 ? 548  LYS F CE    1 
ATOM   7227  N  NZ    . LYS D 2 31  ? 9.810   45.446 78.445  1.00 317.04 ? 548  LYS F NZ    1 
ATOM   7228  N  N     . GLY D 2 32  ? 12.625  44.677 83.674  1.00 297.94 ? 549  GLY F N     1 
ATOM   7229  C  CA    . GLY D 2 32  ? 12.541  43.339 84.253  1.00 297.87 ? 549  GLY F CA    1 
ATOM   7230  C  C     . GLY D 2 32  ? 13.642  43.059 85.258  1.00 292.30 ? 549  GLY F C     1 
ATOM   7231  O  O     . GLY D 2 32  ? 13.424  43.142 86.467  1.00 290.58 ? 549  GLY F O     1 
ATOM   7232  N  N     . GLY D 2 33  ? 14.829  42.730 84.749  1.00 289.19 ? 550  GLY F N     1 
ATOM   7233  C  CA    . GLY D 2 33  ? 15.975  42.371 85.585  1.00 284.04 ? 550  GLY F CA    1 
ATOM   7234  C  C     . GLY D 2 33  ? 17.059  43.433 85.611  1.00 278.86 ? 550  GLY F C     1 
ATOM   7235  O  O     . GLY D 2 33  ? 17.367  43.987 86.666  1.00 275.64 ? 550  GLY F O     1 
ATOM   7236  N  N     . LYS D 2 34  ? 17.639  43.713 84.445  1.00 277.73 ? 551  LYS F N     1 
ATOM   7237  C  CA    . LYS D 2 34  ? 18.743  44.672 84.329  1.00 272.84 ? 551  LYS F CA    1 
ATOM   7238  C  C     . LYS D 2 34  ? 18.287  46.097 84.639  1.00 271.02 ? 551  LYS F C     1 
ATOM   7239  O  O     . LYS D 2 34  ? 17.436  46.651 83.940  1.00 273.81 ? 551  LYS F O     1 
ATOM   7240  C  CB    . LYS D 2 34  ? 19.359  44.621 82.926  1.00 273.61 ? 551  LYS F CB    1 
ATOM   7241  C  CG    . LYS D 2 34  ? 20.120  43.337 82.626  1.00 273.51 ? 551  LYS F CG    1 
ATOM   7242  C  CD    . LYS D 2 34  ? 21.515  43.338 83.236  1.00 268.86 ? 551  LYS F CD    1 
ATOM   7243  C  CE    . LYS D 2 34  ? 22.513  44.084 82.362  1.00 267.08 ? 551  LYS F CE    1 
ATOM   7244  N  NZ    . LYS D 2 34  ? 23.829  44.258 83.035  1.00 262.71 ? 551  LYS F NZ    1 
ATOM   7245  N  N     . VAL D 2 35  ? 18.867  46.682 85.686  1.00 265.87 ? 552  VAL F N     1 
ATOM   7246  C  CA    . VAL D 2 35  ? 18.532  48.041 86.104  1.00 263.85 ? 552  VAL F CA    1 
ATOM   7247  C  C     . VAL D 2 35  ? 19.279  49.039 85.225  1.00 261.93 ? 552  VAL F C     1 
ATOM   7248  O  O     . VAL D 2 35  ? 20.507  48.989 85.134  1.00 259.51 ? 552  VAL F O     1 
ATOM   7249  C  CB    . VAL D 2 35  ? 18.909  48.295 87.581  1.00 259.97 ? 552  VAL F CB    1 
ATOM   7250  C  CG1   . VAL D 2 35  ? 18.523  49.709 87.999  1.00 259.22 ? 552  VAL F CG1   1 
ATOM   7251  C  CG2   . VAL D 2 35  ? 18.245  47.268 88.490  1.00 261.02 ? 552  VAL F CG2   1 
ATOM   7252  N  N     . PHE D 2 36  ? 18.540  49.947 84.590  1.00 263.08 ? 553  PHE F N     1 
ATOM   7253  C  CA    . PHE D 2 36  ? 19.139  50.952 83.707  1.00 261.23 ? 553  PHE F CA    1 
ATOM   7254  C  C     . PHE D 2 36  ? 19.856  52.027 84.525  1.00 255.80 ? 553  PHE F C     1 
ATOM   7255  O  O     . PHE D 2 36  ? 19.357  53.142 84.698  1.00 256.36 ? 553  PHE F O     1 
ATOM   7256  C  CB    . PHE D 2 36  ? 18.083  51.572 82.780  1.00 265.71 ? 553  PHE F CB    1 
ATOM   7257  C  CG    . PHE D 2 36  ? 17.754  50.722 81.583  1.00 269.64 ? 553  PHE F CG    1 
ATOM   7258  C  CD1   . PHE D 2 36  ? 18.015  51.178 80.296  1.00 271.24 ? 553  PHE F CD1   1 
ATOM   7259  C  CD2   . PHE D 2 36  ? 17.197  49.459 81.742  1.00 271.85 ? 553  PHE F CD2   1 
ATOM   7260  C  CE1   . PHE D 2 36  ? 17.718  50.395 79.192  1.00 274.67 ? 553  PHE F CE1   1 
ATOM   7261  C  CE2   . PHE D 2 36  ? 16.900  48.674 80.642  1.00 275.39 ? 553  PHE F CE2   1 
ATOM   7262  C  CZ    . PHE D 2 36  ? 17.160  49.141 79.365  1.00 276.77 ? 553  PHE F CZ    1 
ATOM   7263  N  N     . SER D 2 37  ? 21.034  51.663 85.025  1.00 249.89 ? 554  SER F N     1 
ATOM   7264  C  CA    . SER D 2 37  ? 21.861  52.544 85.842  1.00 244.17 ? 554  SER F CA    1 
ATOM   7265  C  C     . SER D 2 37  ? 23.234  51.900 86.038  1.00 239.09 ? 554  SER F C     1 
ATOM   7266  O  O     . SER D 2 37  ? 23.330  50.783 86.547  1.00 238.49 ? 554  SER F O     1 
ATOM   7267  C  CB    . SER D 2 37  ? 21.203  52.801 87.201  1.00 243.69 ? 554  SER F CB    1 
ATOM   7268  O  OG    . SER D 2 37  ? 22.080  53.492 88.073  1.00 240.15 ? 554  SER F OG    1 
ATOM   7269  N  N     . ALA D 2 38  ? 24.286  52.604 85.629  1.00 234.83 ? 555  ALA F N     1 
ATOM   7270  C  CA    . ALA D 2 38  ? 25.652  52.089 85.729  1.00 230.05 ? 555  ALA F CA    1 
ATOM   7271  C  C     . ALA D 2 38  ? 26.618  53.193 86.139  1.00 225.51 ? 555  ALA F C     1 
ATOM   7272  O  O     . ALA D 2 38  ? 26.500  54.332 85.681  1.00 226.10 ? 555  ALA F O     1 
ATOM   7273  C  CB    . ALA D 2 38  ? 26.085  51.477 84.407  1.00 231.09 ? 555  ALA F CB    1 
ATOM   7274  N  N     . THR D 2 39  ? 27.569  52.842 87.001  1.00 220.56 ? 556  THR F N     1 
ATOM   7275  C  CA    . THR D 2 39  ? 28.584  53.778 87.471  1.00 215.97 ? 556  THR F CA    1 
ATOM   7276  C  C     . THR D 2 39  ? 29.954  53.309 86.984  1.00 212.57 ? 556  THR F C     1 
ATOM   7277  O  O     . THR D 2 39  ? 30.498  52.323 87.486  1.00 211.07 ? 556  THR F O     1 
ATOM   7278  C  CB    . THR D 2 39  ? 28.570  53.882 89.006  1.00 214.02 ? 556  THR F CB    1 
ATOM   7279  O  OG1   . THR D 2 39  ? 27.218  54.028 89.466  1.00 215.96 ? 556  THR F OG1   1 
ATOM   7280  C  CG2   . THR D 2 39  ? 29.381  55.081 89.471  1.00 211.77 ? 556  THR F CG2   1 
ATOM   7281  N  N     . LEU D 2 40  ? 30.500  54.019 86.001  1.00 210.83 ? 557  LEU F N     1 
ATOM   7282  C  CA    . LEU D 2 40  ? 31.754  53.624 85.361  1.00 208.49 ? 557  LEU F CA    1 
ATOM   7283  C  C     . LEU D 2 40  ? 32.951  54.319 86.005  1.00 204.43 ? 557  LEU F C     1 
ATOM   7284  O  O     . LEU D 2 40  ? 32.792  55.283 86.756  1.00 203.59 ? 557  LEU F O     1 
ATOM   7285  C  CB    . LEU D 2 40  ? 31.714  53.935 83.861  1.00 210.35 ? 557  LEU F CB    1 
ATOM   7286  C  CG    . LEU D 2 40  ? 30.417  53.640 83.099  1.00 213.64 ? 557  LEU F CG    1 
ATOM   7287  C  CD1   . LEU D 2 40  ? 30.602  53.930 81.618  1.00 215.31 ? 557  LEU F CD1   1 
ATOM   7288  C  CD2   . LEU D 2 40  ? 29.964  52.204 83.303  1.00 214.76 ? 557  LEU F CD2   1 
ATOM   7289  N  N     . GLY D 2 41  ? 34.146  53.816 85.702  1.00 201.50 ? 558  GLY F N     1 
ATOM   7290  C  CA    . GLY D 2 41  ? 35.388  54.379 86.230  1.00 197.77 ? 558  GLY F CA    1 
ATOM   7291  C  C     . GLY D 2 41  ? 36.567  54.136 85.308  1.00 196.37 ? 558  GLY F C     1 
ATOM   7292  O  O     . GLY D 2 41  ? 36.611  53.133 84.593  1.00 197.83 ? 558  GLY F O     1 
ATOM   7293  N  N     . LEU D 2 42  ? 37.524  55.061 85.330  1.00 193.50 ? 559  LEU F N     1 
ATOM   7294  C  CA    . LEU D 2 42  ? 38.712  54.983 84.483  1.00 192.04 ? 559  LEU F CA    1 
ATOM   7295  C  C     . LEU D 2 42  ? 39.883  55.691 85.163  1.00 188.84 ? 559  LEU F C     1 
ATOM   7296  O  O     . LEU D 2 42  ? 39.758  56.844 85.576  1.00 188.73 ? 559  LEU F O     1 
ATOM   7297  C  CB    . LEU D 2 42  ? 38.419  55.612 83.115  1.00 193.98 ? 559  LEU F CB    1 
ATOM   7298  C  CG    . LEU D 2 42  ? 39.585  55.917 82.166  1.00 194.01 ? 559  LEU F CG    1 
ATOM   7299  C  CD1   . LEU D 2 42  ? 40.524  54.727 82.020  1.00 193.60 ? 559  LEU F CD1   1 
ATOM   7300  C  CD2   . LEU D 2 42  ? 39.048  56.352 80.809  1.00 196.39 ? 559  LEU F CD2   1 
ATOM   7301  N  N     . VAL D 2 43  ? 41.009  54.989 85.284  1.00 186.37 ? 560  VAL F N     1 
ATOM   7302  C  CA    . VAL D 2 43  ? 42.222  55.554 85.880  1.00 183.57 ? 560  VAL F CA    1 
ATOM   7303  C  C     . VAL D 2 43  ? 43.462  55.175 85.068  1.00 183.09 ? 560  VAL F C     1 
ATOM   7304  O  O     . VAL D 2 43  ? 43.605  54.035 84.623  1.00 183.83 ? 560  VAL F O     1 
ATOM   7305  C  CB    . VAL D 2 43  ? 42.396  55.125 87.362  1.00 181.65 ? 560  VAL F CB    1 
ATOM   7306  C  CG1   . VAL D 2 43  ? 42.188  53.628 87.531  1.00 181.93 ? 560  VAL F CG1   1 
ATOM   7307  C  CG2   . VAL D 2 43  ? 43.758  55.541 87.911  1.00 180.04 ? 560  VAL F CG2   1 
ATOM   7308  N  N     . ASP D 2 44  ? 44.340  56.154 84.870  1.00 181.96 ? 561  ASP F N     1 
ATOM   7309  C  CA    . ASP D 2 44  ? 45.649  55.934 84.266  1.00 181.60 ? 561  ASP F CA    1 
ATOM   7310  C  C     . ASP D 2 44  ? 46.680  56.615 85.163  1.00 179.54 ? 561  ASP F C     1 
ATOM   7311  O  O     . ASP D 2 44  ? 46.749  57.843 85.219  1.00 179.38 ? 561  ASP F O     1 
ATOM   7312  C  CB    . ASP D 2 44  ? 45.692  56.503 82.843  1.00 183.38 ? 561  ASP F CB    1 
ATOM   7313  C  CG    . ASP D 2 44  ? 46.911  56.039 82.056  1.00 184.09 ? 561  ASP F CG    1 
ATOM   7314  O  OD1   . ASP D 2 44  ? 47.939  55.677 82.672  1.00 183.11 ? 561  ASP F OD1   1 
ATOM   7315  O  OD2   . ASP D 2 44  ? 46.836  56.045 80.808  1.00 185.76 ? 561  ASP F OD2   1 
ATOM   7316  N  N     . ILE D 2 45  ? 47.465  55.808 85.874  1.00 178.20 ? 562  ILE F N     1 
ATOM   7317  C  CA    . ILE D 2 45  ? 48.447  56.315 86.838  1.00 177.26 ? 562  ILE F CA    1 
ATOM   7318  C  C     . ILE D 2 45  ? 49.478  57.246 86.193  1.00 177.27 ? 562  ILE F C     1 
ATOM   7319  O  O     . ILE D 2 45  ? 49.920  58.208 86.823  1.00 177.22 ? 562  ILE F O     1 
ATOM   7320  C  CB    . ILE D 2 45  ? 49.152  55.151 87.583  1.00 177.05 ? 562  ILE F CB    1 
ATOM   7321  C  CG1   . ILE D 2 45  ? 48.162  54.498 88.561  1.00 176.77 ? 562  ILE F CG1   1 
ATOM   7322  C  CG2   . ILE D 2 45  ? 50.413  55.629 88.301  1.00 176.44 ? 562  ILE F CG2   1 
ATOM   7323  C  CD1   . ILE D 2 45  ? 48.779  53.592 89.605  1.00 176.28 ? 562  ILE F CD1   1 
ATOM   7324  N  N     . VAL D 2 46  ? 49.842  56.972 84.942  1.00 177.65 ? 563  VAL F N     1 
ATOM   7325  C  CA    . VAL D 2 46  ? 50.857  57.766 84.244  1.00 177.62 ? 563  VAL F CA    1 
ATOM   7326  C  C     . VAL D 2 46  ? 50.327  59.162 83.914  1.00 177.52 ? 563  VAL F C     1 
ATOM   7327  O  O     . VAL D 2 46  ? 50.976  60.165 84.221  1.00 177.33 ? 563  VAL F O     1 
ATOM   7328  C  CB    . VAL D 2 46  ? 51.337  57.076 82.947  1.00 178.78 ? 563  VAL F CB    1 
ATOM   7329  C  CG1   . VAL D 2 46  ? 52.477  57.866 82.312  1.00 179.38 ? 563  VAL F CG1   1 
ATOM   7330  C  CG2   . VAL D 2 46  ? 51.773  55.643 83.234  1.00 178.72 ? 563  VAL F CG2   1 
ATOM   7331  N  N     . LYS D 2 47  ? 49.153  59.217 83.288  1.00 177.47 ? 564  LYS F N     1 
ATOM   7332  C  CA    . LYS D 2 47  ? 48.492  60.492 82.987  1.00 177.46 ? 564  LYS F CA    1 
ATOM   7333  C  C     . LYS D 2 47  ? 48.024  61.208 84.254  1.00 175.60 ? 564  LYS F C     1 
ATOM   7334  O  O     . LYS D 2 47  ? 48.014  62.438 84.308  1.00 176.09 ? 564  LYS F O     1 
ATOM   7335  C  CB    . LYS D 2 47  ? 47.302  60.288 82.035  1.00 179.12 ? 564  LYS F CB    1 
ATOM   7336  C  CG    . LYS D 2 47  ? 47.595  60.652 80.587  1.00 181.11 ? 564  LYS F CG    1 
ATOM   7337  C  CD    . LYS D 2 47  ? 46.524  60.138 79.632  1.00 183.06 ? 564  LYS F CD    1 
ATOM   7338  C  CE    . LYS D 2 47  ? 45.148  60.717 79.933  1.00 183.82 ? 564  LYS F CE    1 
ATOM   7339  N  NZ    . LYS D 2 47  ? 44.157  60.390 78.869  1.00 186.05 ? 564  LYS F NZ    1 
ATOM   7340  N  N     . GLY D 2 48  ? 47.633  60.433 85.264  1.00 173.41 ? 565  GLY F N     1 
ATOM   7341  C  CA    . GLY D 2 48  ? 47.108  60.982 86.512  1.00 171.78 ? 565  GLY F CA    1 
ATOM   7342  C  C     . GLY D 2 48  ? 45.592  61.001 86.555  1.00 171.55 ? 565  GLY F C     1 
ATOM   7343  O  O     . GLY D 2 48  ? 45.006  61.172 87.627  1.00 171.12 ? 565  GLY F O     1 
ATOM   7344  N  N     . THR D 2 49  ? 44.956  60.838 85.392  1.00 171.81 ? 566  THR F N     1 
ATOM   7345  C  CA    . THR D 2 49  ? 43.497  60.782 85.304  1.00 171.89 ? 566  THR F CA    1 
ATOM   7346  C  C     . THR D 2 49  ? 42.923  59.694 86.214  1.00 170.60 ? 566  THR F C     1 
ATOM   7347  O  O     . THR D 2 49  ? 43.459  58.590 86.298  1.00 169.91 ? 566  THR F O     1 
ATOM   7348  C  CB    . THR D 2 49  ? 42.997  60.584 83.848  1.00 173.44 ? 566  THR F CB    1 
ATOM   7349  O  OG1   . THR D 2 49  ? 41.566  60.519 83.833  1.00 174.64 ? 566  THR F OG1   1 
ATOM   7350  C  CG2   . THR D 2 49  ? 43.565  59.313 83.211  1.00 173.43 ? 566  THR F CG2   1 
ATOM   7351  N  N     . ASN D 2 50  ? 41.841  60.040 86.903  1.00 170.35 ? 567  ASN F N     1 
ATOM   7352  C  CA    . ASN D 2 50  ? 41.176  59.161 87.858  1.00 169.47 ? 567  ASN F CA    1 
ATOM   7353  C  C     . ASN D 2 50  ? 39.726  59.627 87.942  1.00 170.72 ? 567  ASN F C     1 
ATOM   7354  O  O     . ASN D 2 50  ? 39.373  60.445 88.793  1.00 170.64 ? 567  ASN F O     1 
ATOM   7355  C  CB    . ASN D 2 50  ? 41.883  59.240 89.219  1.00 167.53 ? 567  ASN F CB    1 
ATOM   7356  C  CG    . ASN D 2 50  ? 41.104  58.566 90.338  1.00 166.81 ? 567  ASN F CG    1 
ATOM   7357  O  OD1   . ASN D 2 50  ? 40.549  57.482 90.160  1.00 167.06 ? 567  ASN F OD1   1 
ATOM   7358  N  ND2   . ASN D 2 50  ? 41.068  59.207 91.506  1.00 165.90 ? 567  ASN F ND2   1 
ATOM   7359  N  N     . SER D 2 51  ? 38.898  59.113 87.034  1.00 172.23 ? 568  SER F N     1 
ATOM   7360  C  CA    . SER D 2 51  ? 37.590  59.704 86.755  1.00 174.25 ? 568  SER F CA    1 
ATOM   7361  C  C     . SER D 2 51  ? 36.431  58.756 87.031  1.00 176.04 ? 568  SER F C     1 
ATOM   7362  O  O     . SER D 2 51  ? 36.617  57.544 87.156  1.00 175.95 ? 568  SER F O     1 
ATOM   7363  C  CB    . SER D 2 51  ? 37.530  60.146 85.290  1.00 175.47 ? 568  SER F CB    1 
ATOM   7364  O  OG    . SER D 2 51  ? 38.784  60.630 84.848  1.00 174.15 ? 568  SER F OG    1 
ATOM   7365  N  N     . TYR D 2 52  ? 35.234  59.334 87.119  1.00 178.47 ? 569  TYR F N     1 
ATOM   7366  C  CA    . TYR D 2 52  ? 33.991  58.572 87.223  1.00 180.79 ? 569  TYR F CA    1 
ATOM   7367  C  C     . TYR D 2 52  ? 33.063  58.927 86.069  1.00 184.68 ? 569  TYR F C     1 
ATOM   7368  O  O     . TYR D 2 52  ? 33.274  59.920 85.368  1.00 185.47 ? 569  TYR F O     1 
ATOM   7369  C  CB    . TYR D 2 52  ? 33.284  58.845 88.557  1.00 180.41 ? 569  TYR F CB    1 
ATOM   7370  C  CG    . TYR D 2 52  ? 32.810  60.275 88.749  1.00 181.19 ? 569  TYR F CG    1 
ATOM   7371  C  CD1   . TYR D 2 52  ? 31.566  60.692 88.282  1.00 183.61 ? 569  TYR F CD1   1 
ATOM   7372  C  CD2   . TYR D 2 52  ? 33.601  61.204 89.409  1.00 179.77 ? 569  TYR F CD2   1 
ATOM   7373  C  CE1   . TYR D 2 52  ? 31.133  61.997 88.460  1.00 184.56 ? 569  TYR F CE1   1 
ATOM   7374  C  CE2   . TYR D 2 52  ? 33.177  62.510 89.595  1.00 180.66 ? 569  TYR F CE2   1 
ATOM   7375  C  CZ    . TYR D 2 52  ? 31.943  62.903 89.118  1.00 182.99 ? 569  TYR F CZ    1 
ATOM   7376  O  OH    . TYR D 2 52  ? 31.518  64.201 89.298  1.00 184.00 ? 569  TYR F OH    1 
ATOM   7377  N  N     . TYR D 2 53  ? 32.036  58.106 85.881  1.00 187.99 ? 570  TYR F N     1 
ATOM   7378  C  CA    . TYR D 2 53  ? 30.999  58.382 84.894  1.00 192.18 ? 570  TYR F CA    1 
ATOM   7379  C  C     . TYR D 2 53  ? 29.727  57.609 85.236  1.00 195.13 ? 570  TYR F C     1 
ATOM   7380  O  O     . TYR D 2 53  ? 29.605  56.427 84.909  1.00 195.68 ? 570  TYR F O     1 
ATOM   7381  C  CB    . TYR D 2 53  ? 31.480  58.029 83.482  1.00 193.17 ? 570  TYR F CB    1 
ATOM   7382  C  CG    . TYR D 2 53  ? 30.524  58.465 82.396  1.00 196.16 ? 570  TYR F CG    1 
ATOM   7383  C  CD1   . TYR D 2 53  ? 30.552  59.763 81.902  1.00 196.89 ? 570  TYR F CD1   1 
ATOM   7384  C  CD2   . TYR D 2 53  ? 29.585  57.582 81.868  1.00 198.47 ? 570  TYR F CD2   1 
ATOM   7385  C  CE1   . TYR D 2 53  ? 29.676  60.171 80.911  1.00 199.93 ? 570  TYR F CE1   1 
ATOM   7386  C  CE2   . TYR D 2 53  ? 28.704  57.980 80.877  1.00 201.62 ? 570  TYR F CE2   1 
ATOM   7387  C  CZ    . TYR D 2 53  ? 28.754  59.274 80.402  1.00 202.38 ? 570  TYR F CZ    1 
ATOM   7388  O  OH    . TYR D 2 53  ? 27.879  59.667 79.416  1.00 206.25 ? 570  TYR F OH    1 
ATOM   7389  N  N     . LYS D 2 54  ? 28.791  58.280 85.904  1.00 197.74 ? 571  LYS F N     1 
ATOM   7390  C  CA    . LYS D 2 54  ? 27.525  57.662 86.285  1.00 201.09 ? 571  LYS F CA    1 
ATOM   7391  C  C     . LYS D 2 54  ? 26.444  57.954 85.249  1.00 205.51 ? 571  LYS F C     1 
ATOM   7392  O  O     . LYS D 2 54  ? 26.154  59.113 84.946  1.00 206.57 ? 571  LYS F O     1 
ATOM   7393  C  CB    . LYS D 2 54  ? 27.075  58.137 87.669  1.00 200.81 ? 571  LYS F CB    1 
ATOM   7394  C  CG    . LYS D 2 54  ? 25.779  57.491 88.140  1.00 203.08 ? 571  LYS F CG    1 
ATOM   7395  C  CD    . LYS D 2 54  ? 25.717  57.341 89.653  1.00 201.77 ? 571  LYS F CD    1 
ATOM   7396  C  CE    . LYS D 2 54  ? 25.699  58.688 90.357  1.00 201.45 ? 571  LYS F CE    1 
ATOM   7397  N  NZ    . LYS D 2 54  ? 25.352  58.549 91.798  1.00 200.91 ? 571  LYS F NZ    1 
ATOM   7398  N  N     . LEU D 2 55  ? 25.860  56.885 84.712  1.00 208.76 ? 572  LEU F N     1 
ATOM   7399  C  CA    . LEU D 2 55  ? 24.784  56.974 83.735  1.00 213.71 ? 572  LEU F CA    1 
ATOM   7400  C  C     . LEU D 2 55  ? 23.515  56.396 84.352  1.00 217.12 ? 572  LEU F C     1 
ATOM   7401  O  O     . LEU D 2 55  ? 23.568  55.385 85.051  1.00 216.31 ? 572  LEU F O     1 
ATOM   7402  C  CB    . LEU D 2 55  ? 25.166  56.197 82.472  1.00 214.71 ? 572  LEU F CB    1 
ATOM   7403  C  CG    . LEU D 2 55  ? 24.180  56.188 81.300  1.00 218.67 ? 572  LEU F CG    1 
ATOM   7404  C  CD1   . LEU D 2 55  ? 23.928  57.592 80.776  1.00 219.96 ? 572  LEU F CD1   1 
ATOM   7405  C  CD2   . LEU D 2 55  ? 24.706  55.292 80.190  1.00 219.42 ? 572  LEU F CD2   1 
ATOM   7406  N  N     . GLN D 2 56  ? 22.381  57.047 84.098  1.00 221.86 ? 573  GLN F N     1 
ATOM   7407  C  CA    . GLN D 2 56  ? 21.094  56.610 84.640  1.00 225.48 ? 573  GLN F CA    1 
ATOM   7408  C  C     . GLN D 2 56  ? 19.955  56.842 83.657  1.00 231.16 ? 573  GLN F C     1 
ATOM   7409  O  O     . GLN D 2 56  ? 20.073  57.650 82.735  1.00 232.52 ? 573  GLN F O     1 
ATOM   7410  C  CB    . GLN D 2 56  ? 20.783  57.349 85.943  1.00 224.43 ? 573  GLN F CB    1 
ATOM   7411  C  CG    . GLN D 2 56  ? 21.487  56.779 87.163  1.00 221.13 ? 573  GLN F CG    1 
ATOM   7412  C  CD    . GLN D 2 56  ? 21.057  57.439 88.462  1.00 220.71 ? 573  GLN F CD    1 
ATOM   7413  O  OE1   . GLN D 2 56  ? 21.857  57.591 89.382  1.00 218.04 ? 573  GLN F OE1   1 
ATOM   7414  N  NE2   . GLN D 2 56  ? 19.790  57.831 88.543  1.00 223.70 ? 573  GLN F NE2   1 
ATOM   7415  N  N     . LEU D 2 57  ? 18.855  56.124 83.871  1.00 235.31 ? 574  LEU F N     1 
ATOM   7416  C  CA    . LEU D 2 57  ? 17.633  56.321 83.101  1.00 241.13 ? 574  LEU F CA    1 
ATOM   7417  C  C     . LEU D 2 57  ? 16.447  56.508 84.045  1.00 243.19 ? 574  LEU F C     1 
ATOM   7418  O  O     . LEU D 2 57  ? 15.884  55.537 84.555  1.00 244.09 ? 574  LEU F O     1 
ATOM   7419  C  CB    . LEU D 2 57  ? 17.394  55.137 82.156  1.00 244.21 ? 574  LEU F CB    1 
ATOM   7420  C  CG    . LEU D 2 57  ? 16.210  55.249 81.190  1.00 249.82 ? 574  LEU F CG    1 
ATOM   7421  C  CD1   . LEU D 2 57  ? 16.347  56.459 80.277  1.00 251.18 ? 574  LEU F CD1   1 
ATOM   7422  C  CD2   . LEU D 2 57  ? 16.073  53.975 80.369  1.00 252.11 ? 574  LEU F CD2   1 
ATOM   7423  N  N     . LEU D 2 58  ? 16.078  57.767 84.273  1.00 244.28 ? 575  LEU F N     1 
ATOM   7424  C  CA    . LEU D 2 58  ? 15.000  58.110 85.197  1.00 246.51 ? 575  LEU F CA    1 
ATOM   7425  C  C     . LEU D 2 58  ? 13.641  57.954 84.524  1.00 251.83 ? 575  LEU F C     1 
ATOM   7426  O  O     . LEU D 2 58  ? 13.330  58.655 83.560  1.00 254.54 ? 575  LEU F O     1 
ATOM   7427  C  CB    . LEU D 2 58  ? 15.169  59.544 85.708  1.00 245.70 ? 575  LEU F CB    1 
ATOM   7428  C  CG    . LEU D 2 58  ? 16.518  59.895 86.343  1.00 241.03 ? 575  LEU F CG    1 
ATOM   7429  C  CD1   . LEU D 2 58  ? 16.569  61.373 86.700  1.00 241.00 ? 575  LEU F CD1   1 
ATOM   7430  C  CD2   . LEU D 2 58  ? 16.785  59.037 87.570  1.00 238.42 ? 575  LEU F CD2   1 
ATOM   7431  N  N     . TRP D 2 67  ? 13.638  60.572 80.651  1.00 263.33 ? 584  TRP F N     1 
ATOM   7432  C  CA    . TRP D 2 67  ? 14.787  61.333 81.129  1.00 259.02 ? 584  TRP F CA    1 
ATOM   7433  C  C     . TRP D 2 67  ? 16.038  60.471 81.202  1.00 254.19 ? 584  TRP F C     1 
ATOM   7434  O  O     . TRP D 2 67  ? 15.998  59.361 81.734  1.00 253.31 ? 584  TRP F O     1 
ATOM   7435  C  CB    . TRP D 2 67  ? 14.507  61.901 82.520  1.00 258.13 ? 584  TRP F CB    1 
ATOM   7436  C  CG    . TRP D 2 67  ? 13.425  62.920 82.549  1.00 262.33 ? 584  TRP F CG    1 
ATOM   7437  C  CD1   . TRP D 2 67  ? 13.575  64.275 82.540  1.00 262.78 ? 584  TRP F CD1   1 
ATOM   7438  C  CD2   . TRP D 2 67  ? 12.018  62.670 82.595  1.00 266.98 ? 584  TRP F CD2   1 
ATOM   7439  N  NE1   . TRP D 2 67  ? 12.346  64.887 82.577  1.00 267.26 ? 584  TRP F NE1   1 
ATOM   7440  C  CE2   . TRP D 2 67  ? 11.372  63.924 82.611  1.00 269.96 ? 584  TRP F CE2   1 
ATOM   7441  C  CE3   . TRP D 2 67  ? 11.238  61.507 82.624  1.00 269.13 ? 584  TRP F CE3   1 
ATOM   7442  C  CZ2   . TRP D 2 67  ? 9.981   64.049 82.655  1.00 274.86 ? 584  TRP F CZ2   1 
ATOM   7443  C  CZ3   . TRP D 2 67  ? 9.855   61.632 82.667  1.00 273.98 ? 584  TRP F CZ3   1 
ATOM   7444  C  CH2   . TRP D 2 67  ? 9.242   62.895 82.682  1.00 276.73 ? 584  TRP F CH2   1 
ATOM   7445  N  N     . ILE D 2 68  ? 17.143  60.989 80.671  1.00 251.04 ? 585  ILE F N     1 
ATOM   7446  C  CA    . ILE D 2 68  ? 18.444  60.343 80.806  1.00 246.05 ? 585  ILE F CA    1 
ATOM   7447  C  C     . ILE D 2 68  ? 19.386  61.292 81.547  1.00 241.27 ? 585  ILE F C     1 
ATOM   7448  O  O     . ILE D 2 68  ? 19.379  62.501 81.301  1.00 242.10 ? 585  ILE F O     1 
ATOM   7449  C  CB    . ILE D 2 68  ? 19.014  59.920 79.429  1.00 247.01 ? 585  ILE F CB    1 
ATOM   7450  C  CG1   . ILE D 2 68  ? 19.943  58.711 79.585  1.00 244.22 ? 585  ILE F CG1   1 
ATOM   7451  C  CG2   . ILE D 2 68  ? 19.725  61.074 78.728  1.00 246.65 ? 585  ILE F CG2   1 
ATOM   7452  C  CD1   . ILE D 2 68  ? 20.143  57.921 78.312  1.00 246.18 ? 585  ILE F CD1   1 
ATOM   7453  N  N     . PHE D 2 69  ? 20.176  60.744 82.467  1.00 236.00 ? 586  PHE F N     1 
ATOM   7454  C  CA    . PHE D 2 69  ? 21.083  61.549 83.278  1.00 231.52 ? 586  PHE F CA    1 
ATOM   7455  C  C     . PHE D 2 69  ? 22.522  61.060 83.163  1.00 226.49 ? 586  PHE F C     1 
ATOM   7456  O  O     . PHE D 2 69  ? 22.810  59.886 83.403  1.00 225.02 ? 586  PHE F O     1 
ATOM   7457  C  CB    . PHE D 2 69  ? 20.648  61.540 84.743  1.00 230.76 ? 586  PHE F CB    1 
ATOM   7458  C  CG    . PHE D 2 69  ? 21.486  62.422 85.622  1.00 228.17 ? 586  PHE F CG    1 
ATOM   7459  C  CD1   . PHE D 2 69  ? 21.364  63.804 85.554  1.00 229.46 ? 586  PHE F CD1   1 
ATOM   7460  C  CD2   . PHE D 2 69  ? 22.408  61.877 86.505  1.00 224.71 ? 586  PHE F CD2   1 
ATOM   7461  C  CE1   . PHE D 2 69  ? 22.139  64.624 86.355  1.00 227.26 ? 586  PHE F CE1   1 
ATOM   7462  C  CE2   . PHE D 2 69  ? 23.184  62.692 87.309  1.00 222.47 ? 586  PHE F CE2   1 
ATOM   7463  C  CZ    . PHE D 2 69  ? 23.050  64.068 87.234  1.00 223.76 ? 586  PHE F CZ    1 
ATOM   7464  N  N     . ARG D 2 70  ? 23.415  61.977 82.798  1.00 223.44 ? 587  ARG F N     1 
ATOM   7465  C  CA    . ARG D 2 70  ? 24.844  61.702 82.708  1.00 218.69 ? 587  ARG F CA    1 
ATOM   7466  C  C     . ARG D 2 70  ? 25.597  62.550 83.723  1.00 214.47 ? 587  ARG F C     1 
ATOM   7467  O  O     . ARG D 2 70  ? 25.426  63.770 83.766  1.00 215.34 ? 587  ARG F O     1 
ATOM   7468  C  CB    . ARG D 2 70  ? 25.355  62.022 81.304  1.00 219.78 ? 587  ARG F CB    1 
ATOM   7469  C  CG    . ARG D 2 70  ? 24.967  61.003 80.248  1.00 221.95 ? 587  ARG F CG    1 
ATOM   7470  C  CD    . ARG D 2 70  ? 25.366  61.482 78.861  1.00 223.44 ? 587  ARG F CD    1 
ATOM   7471  N  NE    . ARG D 2 70  ? 24.385  62.397 78.278  1.00 226.98 ? 587  ARG F NE    1 
ATOM   7472  C  CZ    . ARG D 2 70  ? 24.527  63.016 77.107  1.00 228.94 ? 587  ARG F CZ    1 
ATOM   7473  N  NH1   . ARG D 2 70  ? 25.620  62.835 76.370  1.00 227.77 ? 587  ARG F NH1   1 
ATOM   7474  N  NH2   . ARG D 2 70  ? 23.571  63.826 76.668  1.00 232.41 ? 587  ARG F NH2   1 
ATOM   7475  N  N     . SER D 2 71  ? 26.419  61.898 84.542  1.00 209.47 ? 588  SER F N     1 
ATOM   7476  C  CA    . SER D 2 71  ? 27.304  62.588 85.475  1.00 205.22 ? 588  SER F CA    1 
ATOM   7477  C  C     . SER D 2 71  ? 28.740  62.180 85.178  1.00 201.28 ? 588  SER F C     1 
ATOM   7478  O  O     . SER D 2 71  ? 28.999  61.029 84.825  1.00 200.61 ? 588  SER F O     1 
ATOM   7479  C  CB    . SER D 2 71  ? 26.946  62.231 86.917  1.00 203.99 ? 588  SER F CB    1 
ATOM   7480  O  OG    . SER D 2 71  ? 27.578  63.110 87.831  1.00 202.13 ? 588  SER F OG    1 
ATOM   7481  N  N     . TRP D 2 72  ? 29.669  63.124 85.311  1.00 198.33 ? 589  TRP F N     1 
ATOM   7482  C  CA    . TRP D 2 72  ? 31.081  62.858 85.040  1.00 194.85 ? 589  TRP F CA    1 
ATOM   7483  C  C     . TRP D 2 72  ? 31.995  63.827 85.786  1.00 191.89 ? 589  TRP F C     1 
ATOM   7484  O  O     . TRP D 2 72  ? 31.571  64.912 86.187  1.00 192.75 ? 589  TRP F O     1 
ATOM   7485  C  CB    . TRP D 2 72  ? 31.354  62.920 83.532  1.00 196.23 ? 589  TRP F CB    1 
ATOM   7486  C  CG    . TRP D 2 72  ? 31.265  64.293 82.936  1.00 197.90 ? 589  TRP F CG    1 
ATOM   7487  C  CD1   . TRP D 2 72  ? 32.278  65.201 82.813  1.00 196.90 ? 589  TRP F CD1   1 
ATOM   7488  C  CD2   . TRP D 2 72  ? 30.103  64.909 82.366  1.00 201.22 ? 589  TRP F CD2   1 
ATOM   7489  N  NE1   . TRP D 2 72  ? 31.817  66.345 82.209  1.00 199.25 ? 589  TRP F NE1   1 
ATOM   7490  C  CE2   . TRP D 2 72  ? 30.486  66.193 81.923  1.00 201.98 ? 589  TRP F CE2   1 
ATOM   7491  C  CE3   . TRP D 2 72  ? 28.773  64.501 82.189  1.00 203.91 ? 589  TRP F CE3   1 
ATOM   7492  C  CZ2   . TRP D 2 72  ? 29.588  67.074 81.314  1.00 205.36 ? 589  TRP F CZ2   1 
ATOM   7493  C  CZ3   . TRP D 2 72  ? 27.880  65.379 81.582  1.00 207.24 ? 589  TRP F CZ3   1 
ATOM   7494  C  CH2   . TRP D 2 72  ? 28.294  66.651 81.153  1.00 207.89 ? 589  TRP F CH2   1 
ATOM   7495  N  N     . GLY D 2 73  ? 33.249  63.421 85.969  1.00 188.32 ? 590  GLY F N     1 
ATOM   7496  C  CA    . GLY D 2 73  ? 34.239  64.246 86.662  1.00 185.67 ? 590  GLY F CA    1 
ATOM   7497  C  C     . GLY D 2 73  ? 35.360  63.434 87.283  1.00 182.02 ? 590  GLY F C     1 
ATOM   7498  O  O     . GLY D 2 73  ? 35.474  62.231 87.042  1.00 181.36 ? 590  GLY F O     1 
ATOM   7499  N  N     . ARG D 2 74  ? 36.185  64.102 88.086  1.00 179.50 ? 591  ARG F N     1 
ATOM   7500  C  CA    . ARG D 2 74  ? 37.271  63.448 88.813  1.00 176.35 ? 591  ARG F CA    1 
ATOM   7501  C  C     . ARG D 2 74  ? 36.780  63.020 90.195  1.00 175.69 ? 591  ARG F C     1 
ATOM   7502  O  O     . ARG D 2 74  ? 36.374  63.860 91.000  1.00 175.98 ? 591  ARG F O     1 
ATOM   7503  C  CB    . ARG D 2 74  ? 38.467  64.392 88.946  1.00 174.82 ? 591  ARG F CB    1 
ATOM   7504  C  CG    . ARG D 2 74  ? 39.725  63.731 89.486  1.00 172.15 ? 591  ARG F CG    1 
ATOM   7505  C  CD    . ARG D 2 74  ? 40.933  64.638 89.329  1.00 171.35 ? 591  ARG F CD    1 
ATOM   7506  N  NE    . ARG D 2 74  ? 42.123  64.102 89.987  1.00 169.05 ? 591  ARG F NE    1 
ATOM   7507  C  CZ    . ARG D 2 74  ? 42.988  63.249 89.437  1.00 167.90 ? 591  ARG F CZ    1 
ATOM   7508  N  NH1   . ARG D 2 74  ? 42.822  62.799 88.196  1.00 168.55 ? 591  ARG F NH1   1 
ATOM   7509  N  NH2   . ARG D 2 74  ? 44.035  62.838 90.143  1.00 166.54 ? 591  ARG F NH2   1 
ATOM   7510  N  N     . VAL D 2 75  ? 36.815  61.713 90.454  1.00 175.03 ? 592  VAL F N     1 
ATOM   7511  C  CA    . VAL D 2 75  ? 36.320  61.140 91.718  1.00 174.88 ? 592  VAL F CA    1 
ATOM   7512  C  C     . VAL D 2 75  ? 36.897  61.828 92.959  1.00 174.11 ? 592  VAL F C     1 
ATOM   7513  O  O     . VAL D 2 75  ? 38.113  61.955 93.108  1.00 172.24 ? 592  VAL F O     1 
ATOM   7514  C  CB    . VAL D 2 75  ? 36.547  59.599 91.799  1.00 174.12 ? 592  VAL F CB    1 
ATOM   7515  C  CG1   . VAL D 2 75  ? 37.893  59.190 91.211  1.00 172.97 ? 592  VAL F CG1   1 
ATOM   7516  C  CG2   . VAL D 2 75  ? 36.410  59.085 93.231  1.00 173.30 ? 592  VAL F CG2   1 
ATOM   7517  N  N     . GLY D 2 76  ? 35.996  62.275 93.833  1.00 175.85 ? 593  GLY F N     1 
ATOM   7518  C  CA    . GLY D 2 76  ? 36.360  62.858 95.121  1.00 175.87 ? 593  GLY F CA    1 
ATOM   7519  C  C     . GLY D 2 76  ? 36.684  64.343 95.092  1.00 177.18 ? 593  GLY F C     1 
ATOM   7520  O  O     . GLY D 2 76  ? 37.359  64.843 95.992  1.00 176.43 ? 593  GLY F O     1 
ATOM   7521  N  N     . THR D 2 77  ? 36.192  65.050 94.074  1.00 179.57 ? 594  THR F N     1 
ATOM   7522  C  CA    . THR D 2 77  ? 36.454  66.486 93.918  1.00 181.09 ? 594  THR F CA    1 
ATOM   7523  C  C     . THR D 2 77  ? 35.326  67.211 93.183  1.00 184.25 ? 594  THR F C     1 
ATOM   7524  O  O     . THR D 2 77  ? 34.455  66.583 92.577  1.00 185.58 ? 594  THR F O     1 
ATOM   7525  C  CB    . THR D 2 77  ? 37.780  66.742 93.165  1.00 179.98 ? 594  THR F CB    1 
ATOM   7526  O  OG1   . THR D 2 77  ? 37.988  65.715 92.187  1.00 179.17 ? 594  THR F OG1   1 
ATOM   7527  C  CG2   . THR D 2 77  ? 38.956  66.762 94.131  1.00 178.34 ? 594  THR F CG2   1 
ATOM   7528  N  N     . VAL D 2 78  ? 35.361  68.542 93.241  1.00 186.17 ? 595  VAL F N     1 
ATOM   7529  C  CA    . VAL D 2 78  ? 34.372  69.390 92.565  1.00 189.35 ? 595  VAL F CA    1 
ATOM   7530  C  C     . VAL D 2 78  ? 34.574  69.427 91.042  1.00 190.71 ? 595  VAL F C     1 
ATOM   7531  O  O     . VAL D 2 78  ? 33.707  69.909 90.310  1.00 193.27 ? 595  VAL F O     1 
ATOM   7532  C  CB    . VAL D 2 78  ? 34.381  70.829 93.145  1.00 190.77 ? 595  VAL F CB    1 
ATOM   7533  C  CG1   . VAL D 2 78  ? 35.626  71.597 92.708  1.00 190.41 ? 595  VAL F CG1   1 
ATOM   7534  C  CG2   . VAL D 2 78  ? 33.112  71.584 92.762  1.00 193.76 ? 595  VAL F CG2   1 
ATOM   7535  N  N     . ILE D 2 79  ? 35.714  68.918 90.572  1.00 189.63 ? 596  ILE F N     1 
ATOM   7536  C  CA    . ILE D 2 79  ? 35.996  68.829 89.138  1.00 190.94 ? 596  ILE F CA    1 
ATOM   7537  C  C     . ILE D 2 79  ? 34.997  67.893 88.461  1.00 192.23 ? 596  ILE F C     1 
ATOM   7538  O  O     . ILE D 2 79  ? 34.872  66.728 88.843  1.00 190.93 ? 596  ILE F O     1 
ATOM   7539  C  CB    . ILE D 2 79  ? 37.428  68.307 88.868  1.00 189.14 ? 596  ILE F CB    1 
ATOM   7540  C  CG1   . ILE D 2 79  ? 38.481  69.281 89.416  1.00 188.79 ? 596  ILE F CG1   1 
ATOM   7541  C  CG2   . ILE D 2 79  ? 37.651  68.061 87.378  1.00 189.85 ? 596  ILE F CG2   1 
ATOM   7542  C  CD1   . ILE D 2 79  ? 38.414  70.683 88.845  1.00 191.01 ? 596  ILE F CD1   1 
ATOM   7543  N  N     . GLY D 2 80  ? 34.295  68.415 87.456  1.00 195.20 ? 597  GLY F N     1 
ATOM   7544  C  CA    . GLY D 2 80  ? 33.301  67.644 86.714  1.00 197.37 ? 597  GLY F CA    1 
ATOM   7545  C  C     . GLY D 2 80  ? 32.046  68.440 86.413  1.00 201.18 ? 597  GLY F C     1 
ATOM   7546  O  O     . GLY D 2 80  ? 31.941  69.618 86.762  1.00 202.01 ? 597  GLY F O     1 
ATOM   7547  N  N     . SER D 2 81  ? 31.094  67.784 85.758  1.00 204.19 ? 598  SER F N     1 
ATOM   7548  C  CA    . SER D 2 81  ? 29.806  68.391 85.433  1.00 208.67 ? 598  SER F CA    1 
ATOM   7549  C  C     . SER D 2 81  ? 28.773  67.302 85.146  1.00 211.40 ? 598  SER F C     1 
ATOM   7550  O  O     . SER D 2 81  ? 29.077  66.110 85.236  1.00 209.81 ? 598  SER F O     1 
ATOM   7551  C  CB    . SER D 2 81  ? 29.946  69.328 84.231  1.00 210.64 ? 598  SER F CB    1 
ATOM   7552  O  OG    . SER D 2 81  ? 28.737  70.026 83.981  1.00 214.02 ? 598  SER F OG    1 
ATOM   7553  N  N     . ASN D 2 82  ? 27.555  67.715 84.807  1.00 216.50 ? 599  ASN F N     1 
ATOM   7554  C  CA    . ASN D 2 82  ? 26.469  66.774 84.528  1.00 219.85 ? 599  ASN F CA    1 
ATOM   7555  C  C     . ASN D 2 82  ? 25.495  67.298 83.479  1.00 225.35 ? 599  ASN F C     1 
ATOM   7556  O  O     . ASN D 2 82  ? 25.479  68.494 83.176  1.00 226.97 ? 599  ASN F O     1 
ATOM   7557  C  CB    . ASN D 2 82  ? 25.718  66.422 85.821  1.00 219.67 ? 599  ASN F CB    1 
ATOM   7558  C  CG    . ASN D 2 82  ? 25.452  67.634 86.703  1.00 220.41 ? 599  ASN F CG    1 
ATOM   7559  O  OD1   . ASN D 2 82  ? 25.674  67.588 87.912  1.00 218.79 ? 599  ASN F OD1   1 
ATOM   7560  N  ND2   . ASN D 2 82  ? 24.977  68.722 86.103  1.00 223.30 ? 599  ASN F ND2   1 
ATOM   7561  N  N     . LYS D 2 83  ? 24.690  66.394 82.926  1.00 229.16 ? 600  LYS F N     1 
ATOM   7562  C  CA    . LYS D 2 83  ? 23.651  66.768 81.972  1.00 234.97 ? 600  LYS F CA    1 
ATOM   7563  C  C     . LYS D 2 83  ? 22.378  65.947 82.163  1.00 238.82 ? 600  LYS F C     1 
ATOM   7564  O  O     . LYS D 2 83  ? 22.323  64.771 81.799  1.00 238.91 ? 600  LYS F O     1 
ATOM   7565  C  CB    . LYS D 2 83  ? 24.152  66.620 80.533  1.00 235.92 ? 600  LYS F CB    1 
ATOM   7566  C  CG    . LYS D 2 83  ? 23.143  67.101 79.501  1.00 240.48 ? 600  LYS F CG    1 
ATOM   7567  C  CD    . LYS D 2 83  ? 23.671  66.993 78.085  1.00 241.35 ? 600  LYS F CD    1 
ATOM   7568  C  CE    . LYS D 2 83  ? 22.613  67.418 77.078  1.00 246.04 ? 600  LYS F CE    1 
ATOM   7569  N  NZ    . LYS D 2 83  ? 22.445  68.898 77.035  1.00 247.82 ? 600  LYS F NZ    1 
ATOM   7570  N  N     . LEU D 2 84  ? 21.364  66.582 82.744  1.00 242.94 ? 601  LEU F N     1 
ATOM   7571  C  CA    . LEU D 2 84  ? 20.014  66.034 82.766  1.00 247.52 ? 601  LEU F CA    1 
ATOM   7572  C  C     . LEU D 2 84  ? 19.337  66.414 81.453  1.00 253.38 ? 601  LEU F C     1 
ATOM   7573  O  O     . LEU D 2 84  ? 19.459  67.553 80.997  1.00 254.76 ? 601  LEU F O     1 
ATOM   7574  C  CB    . LEU D 2 84  ? 19.229  66.595 83.953  1.00 248.36 ? 601  LEU F CB    1 
ATOM   7575  C  CG    . LEU D 2 84  ? 17.772  66.150 84.111  1.00 251.93 ? 601  LEU F CG    1 
ATOM   7576  C  CD1   . LEU D 2 84  ? 17.667  64.639 84.265  1.00 250.89 ? 601  LEU F CD1   1 
ATOM   7577  C  CD2   . LEU D 2 84  ? 17.135  66.856 85.298  1.00 252.78 ? 601  LEU F CD2   1 
ATOM   7578  N  N     . GLU D 2 85  ? 18.629  65.463 80.849  1.00 257.81 ? 602  GLU F N     1 
ATOM   7579  C  CA    . GLU D 2 85  ? 18.025  65.671 79.534  1.00 263.76 ? 602  GLU F CA    1 
ATOM   7580  C  C     . GLU D 2 85  ? 16.773  64.812 79.358  1.00 269.23 ? 602  GLU F C     1 
ATOM   7581  O  O     . GLU D 2 85  ? 16.838  63.585 79.448  1.00 268.58 ? 602  GLU F O     1 
ATOM   7582  C  CB    . GLU D 2 85  ? 19.045  65.337 78.441  1.00 262.15 ? 602  GLU F CB    1 
ATOM   7583  C  CG    . GLU D 2 85  ? 18.634  65.769 77.040  1.00 265.97 ? 602  GLU F CG    1 
ATOM   7584  C  CD    . GLU D 2 85  ? 19.693  65.467 75.994  1.00 264.50 ? 602  GLU F CD    1 
ATOM   7585  O  OE1   . GLU D 2 85  ? 19.711  66.158 74.954  1.00 266.93 ? 602  GLU F OE1   1 
ATOM   7586  O  OE2   . GLU D 2 85  ? 20.509  64.544 76.207  1.00 260.98 ? 602  GLU F OE2   1 
ATOM   7587  N  N     . GLN D 2 86  ? 15.638  65.464 79.107  1.00 275.67 ? 603  GLN F N     1 
ATOM   7588  C  CA    . GLN D 2 86  ? 14.377  64.764 78.864  1.00 281.31 ? 603  GLN F CA    1 
ATOM   7589  C  C     . GLN D 2 86  ? 14.366  64.173 77.456  1.00 285.15 ? 603  GLN F C     1 
ATOM   7590  O  O     . GLN D 2 86  ? 14.870  64.787 76.514  1.00 285.80 ? 603  GLN F O     1 
ATOM   7591  C  CB    . GLN D 2 86  ? 13.188  65.713 79.045  1.00 285.85 ? 603  GLN F CB    1 
ATOM   7592  C  CG    . GLN D 2 86  ? 11.834  65.016 79.049  1.00 290.22 ? 603  GLN F CG    1 
ATOM   7593  C  CD    . GLN D 2 86  ? 10.677  65.962 79.318  1.00 294.53 ? 603  GLN F CD    1 
ATOM   7594  O  OE1   . GLN D 2 86  ? 10.853  67.179 79.388  1.00 294.93 ? 603  GLN F OE1   1 
ATOM   7595  N  NE2   . GLN D 2 86  ? 9.480   65.402 79.468  1.00 298.10 ? 603  GLN F NE2   1 
ATOM   7596  N  N     . MET D 2 87  ? 13.785  62.982 77.324  1.00 288.65 ? 604  MET F N     1 
ATOM   7597  C  CA    . MET D 2 87  ? 13.735  62.273 76.045  1.00 292.65 ? 604  MET F CA    1 
ATOM   7598  C  C     . MET D 2 87  ? 12.441  62.581 75.292  1.00 299.85 ? 604  MET F C     1 
ATOM   7599  O  O     . MET D 2 87  ? 11.456  63.003 75.902  1.00 302.10 ? 604  MET F O     1 
ATOM   7600  C  CB    . MET D 2 87  ? 13.837  60.761 76.270  1.00 291.64 ? 604  MET F CB    1 
ATOM   7601  C  CG    . MET D 2 87  ? 15.168  60.284 76.833  1.00 286.33 ? 604  MET F CG    1 
ATOM   7602  S  SD    . MET D 2 87  ? 16.486  60.207 75.603  1.00 285.17 ? 604  MET F SD    1 
ATOM   7603  C  CE    . MET D 2 87  ? 17.262  61.810 75.802  1.00 283.02 ? 604  MET F CE    1 
ATOM   7604  N  N     . PRO D 2 88  ? 12.440  62.379 73.960  1.00 304.15 ? 605  PRO F N     1 
ATOM   7605  C  CA    . PRO D 2 88  ? 11.192  62.470 73.194  1.00 311.04 ? 605  PRO F CA    1 
ATOM   7606  C  C     . PRO D 2 88  ? 10.193  61.369 73.563  1.00 314.17 ? 605  PRO F C     1 
ATOM   7607  O  O     . PRO D 2 88  ? 8.987   61.620 73.601  1.00 318.88 ? 605  PRO F O     1 
ATOM   7608  C  CB    . PRO D 2 88  ? 11.651  62.311 71.737  1.00 312.73 ? 605  PRO F CB    1 
ATOM   7609  C  CG    . PRO D 2 88  ? 13.104  62.633 71.741  1.00 307.69 ? 605  PRO F CG    1 
ATOM   7610  C  CD    . PRO D 2 88  ? 13.610  62.196 73.081  1.00 302.47 ? 605  PRO F CD    1 
ATOM   7611  N  N     . SER D 2 89  ? 10.698  60.164 73.827  1.00 312.26 ? 606  SER F N     1 
ATOM   7612  C  CA    . SER D 2 89  ? 9.858   59.031 74.221  1.00 314.89 ? 606  SER F CA    1 
ATOM   7613  C  C     . SER D 2 89  ? 10.647  58.010 75.048  1.00 310.45 ? 606  SER F C     1 
ATOM   7614  O  O     . SER D 2 89  ? 11.849  58.174 75.269  1.00 305.83 ? 606  SER F O     1 
ATOM   7615  C  CB    . SER D 2 89  ? 9.265   58.359 72.981  1.00 320.07 ? 606  SER F CB    1 
ATOM   7616  O  OG    . SER D 2 89  ? 8.316   57.368 73.340  1.00 323.05 ? 606  SER F OG    1 
ATOM   7617  N  N     . LYS D 2 90  ? 9.961   56.960 75.497  1.00 312.28 ? 607  LYS F N     1 
ATOM   7618  C  CA    . LYS D 2 90  ? 10.571  55.925 76.344  1.00 308.55 ? 607  LYS F CA    1 
ATOM   7619  C  C     . LYS D 2 90  ? 11.392  54.893 75.564  1.00 307.93 ? 607  LYS F C     1 
ATOM   7620  O  O     . LYS D 2 90  ? 12.343  54.330 76.104  1.00 303.70 ? 607  LYS F O     1 
ATOM   7621  C  CB    . LYS D 2 90  ? 9.506   55.213 77.196  1.00 310.55 ? 607  LYS F CB    1 
ATOM   7622  C  CG    . LYS D 2 90  ? 9.618   55.474 78.693  1.00 306.82 ? 607  LYS F CG    1 
ATOM   7623  C  CD    . LYS D 2 90  ? 9.385   56.931 79.061  1.00 306.66 ? 607  LYS F CD    1 
ATOM   7624  C  CE    . LYS D 2 90  ? 9.533   57.141 80.560  1.00 303.07 ? 607  LYS F CE    1 
ATOM   7625  N  NZ    . LYS D 2 90  ? 9.427   58.573 80.949  1.00 302.81 ? 607  LYS F NZ    1 
ATOM   7626  N  N     . GLU D 2 91  ? 11.024  54.633 74.311  1.00 312.52 ? 608  GLU F N     1 
ATOM   7627  C  CA    . GLU D 2 91  ? 11.811  53.735 73.457  1.00 312.30 ? 608  GLU F CA    1 
ATOM   7628  C  C     . GLU D 2 91  ? 13.065  54.428 72.918  1.00 309.31 ? 608  GLU F C     1 
ATOM   7629  O  O     . GLU D 2 91  ? 14.056  53.767 72.602  1.00 306.96 ? 608  GLU F O     1 
ATOM   7630  C  CB    . GLU D 2 91  ? 10.965  53.184 72.302  1.00 318.16 ? 608  GLU F CB    1 
ATOM   7631  C  CG    . GLU D 2 91  ? 10.081  52.004 72.688  1.00 320.80 ? 608  GLU F CG    1 
ATOM   7632  C  CD    . GLU D 2 91  ? 10.829  50.680 72.760  1.00 318.51 ? 608  GLU F CD    1 
ATOM   7633  O  OE1   . GLU D 2 91  ? 12.076  50.683 72.857  1.00 313.80 ? 608  GLU F OE1   1 
ATOM   7634  O  OE2   . GLU D 2 91  ? 10.160  49.625 72.724  1.00 321.45 ? 608  GLU F OE2   1 
ATOM   7635  N  N     . ASP D 2 92  ? 13.014  55.755 72.814  1.00 309.63 ? 609  ASP F N     1 
ATOM   7636  C  CA    . ASP D 2 92  ? 14.184  56.554 72.443  1.00 306.47 ? 609  ASP F CA    1 
ATOM   7637  C  C     . ASP D 2 92  ? 15.194  56.613 73.590  1.00 299.89 ? 609  ASP F C     1 
ATOM   7638  O  O     . ASP D 2 92  ? 16.383  56.849 73.366  1.00 296.63 ? 609  ASP F O     1 
ATOM   7639  C  CB    . ASP D 2 92  ? 13.765  57.976 72.052  1.00 309.21 ? 609  ASP F CB    1 
ATOM   7640  C  CG    . ASP D 2 92  ? 12.844  58.006 70.842  1.00 315.70 ? 609  ASP F CG    1 
ATOM   7641  O  OD1   . ASP D 2 92  ? 11.916  58.843 70.823  1.00 319.30 ? 609  ASP F OD1   1 
ATOM   7642  O  OD2   . ASP D 2 92  ? 13.042  57.196 69.912  1.00 317.76 ? 609  ASP F OD2   1 
ATOM   7643  N  N     . ALA D 2 93  ? 14.710  56.406 74.813  1.00 297.97 ? 610  ALA F N     1 
ATOM   7644  C  CA    . ALA D 2 93  ? 15.562  56.351 75.997  1.00 292.10 ? 610  ALA F CA    1 
ATOM   7645  C  C     . ALA D 2 93  ? 16.520  55.162 75.943  1.00 289.37 ? 610  ALA F C     1 
ATOM   7646  O  O     . ALA D 2 93  ? 17.715  55.314 76.194  1.00 284.80 ? 610  ALA F O     1 
ATOM   7647  C  CB    . ALA D 2 93  ? 14.708  56.275 77.251  1.00 291.84 ? 610  ALA F CB    1 
ATOM   7648  N  N     . ILE D 2 94  ? 15.985  53.986 75.619  1.00 292.26 ? 611  ILE F N     1 
ATOM   7649  C  CA    . ILE D 2 94  ? 16.795  52.777 75.439  1.00 291.01 ? 611  ILE F CA    1 
ATOM   7650  C  C     . ILE D 2 94  ? 17.842  52.987 74.342  1.00 290.45 ? 611  ILE F C     1 
ATOM   7651  O  O     . ILE D 2 94  ? 18.992  52.566 74.483  1.00 287.32 ? 611  ILE F O     1 
ATOM   7652  C  CB    . ILE D 2 94  ? 15.914  51.549 75.099  1.00 295.08 ? 611  ILE F CB    1 
ATOM   7653  C  CG1   . ILE D 2 94  ? 15.112  51.118 76.331  1.00 295.13 ? 611  ILE F CG1   1 
ATOM   7654  C  CG2   . ILE D 2 94  ? 16.763  50.383 74.599  1.00 294.35 ? 611  ILE F CG2   1 
ATOM   7655  C  CD1   . ILE D 2 94  ? 14.057  50.068 76.052  1.00 299.71 ? 611  ILE F CD1   1 
ATOM   7656  N  N     . GLU D 2 95  ? 17.433  53.641 73.257  1.00 293.78 ? 612  GLU F N     1 
ATOM   7657  C  CA    . GLU D 2 95  ? 18.330  53.936 72.139  1.00 293.23 ? 612  GLU F CA    1 
ATOM   7658  C  C     . GLU D 2 95  ? 19.465  54.867 72.569  1.00 287.58 ? 612  GLU F C     1 
ATOM   7659  O  O     . GLU D 2 95  ? 20.622  54.639 72.223  1.00 284.86 ? 612  GLU F O     1 
ATOM   7660  C  CB    . GLU D 2 95  ? 17.549  54.569 70.980  1.00 298.56 ? 612  GLU F CB    1 
ATOM   7661  C  CG    . GLU D 2 95  ? 18.263  54.527 69.634  1.00 299.98 ? 612  GLU F CG    1 
ATOM   7662  C  CD    . GLU D 2 95  ? 18.089  53.208 68.897  1.00 303.07 ? 612  GLU F CD    1 
ATOM   7663  O  OE1   . GLU D 2 95  ? 17.831  52.173 69.548  1.00 303.05 ? 612  GLU F OE1   1 
ATOM   7664  O  OE2   . GLU D 2 95  ? 18.217  53.206 67.654  1.00 305.95 ? 612  GLU F OE2   1 
ATOM   7665  N  N     . HIS D 2 96  ? 19.124  55.907 73.327  1.00 285.44 ? 613  HIS F N     1 
ATOM   7666  C  CA    . HIS D 2 96  ? 20.106  56.891 73.792  1.00 280.48 ? 613  HIS F CA    1 
ATOM   7667  C  C     . HIS D 2 96  ? 20.992  56.326 74.908  1.00 275.05 ? 613  HIS F C     1 
ATOM   7668  O  O     . HIS D 2 96  ? 22.181  56.638 74.979  1.00 271.68 ? 613  HIS F O     1 
ATOM   7669  C  CB    . HIS D 2 96  ? 19.394  58.161 74.276  1.00 281.11 ? 613  HIS F CB    1 
ATOM   7670  C  CG    . HIS D 2 96  ? 20.258  59.384 74.264  1.00 278.45 ? 613  HIS F CG    1 
ATOM   7671  N  ND1   . HIS D 2 96  ? 20.550  60.078 73.109  1.00 280.07 ? 613  HIS F ND1   1 
ATOM   7672  C  CD2   . HIS D 2 96  ? 20.880  60.047 75.267  1.00 274.52 ? 613  HIS F CD2   1 
ATOM   7673  C  CE1   . HIS D 2 96  ? 21.323  61.110 73.400  1.00 277.44 ? 613  HIS F CE1   1 
ATOM   7674  N  NE2   . HIS D 2 96  ? 21.538  61.113 74.703  1.00 274.20 ? 613  HIS F NE2   1 
ATOM   7675  N  N     . PHE D 2 97  ? 20.404  55.495 75.768  1.00 274.18 ? 614  PHE F N     1 
ATOM   7676  C  CA    . PHE D 2 97  ? 21.115  54.894 76.900  1.00 269.66 ? 614  PHE F CA    1 
ATOM   7677  C  C     . PHE D 2 97  ? 22.152  53.868 76.449  1.00 267.76 ? 614  PHE F C     1 
ATOM   7678  O  O     . PHE D 2 97  ? 23.330  53.976 76.793  1.00 264.02 ? 614  PHE F O     1 
ATOM   7679  C  CB    . PHE D 2 97  ? 20.108  54.240 77.857  1.00 270.62 ? 614  PHE F CB    1 
ATOM   7680  C  CG    . PHE D 2 97  ? 20.733  53.606 79.069  1.00 266.91 ? 614  PHE F CG    1 
ATOM   7681  C  CD1   . PHE D 2 97  ? 20.905  54.332 80.240  1.00 264.16 ? 614  PHE F CD1   1 
ATOM   7682  C  CD2   . PHE D 2 97  ? 21.132  52.276 79.045  1.00 266.33 ? 614  PHE F CD2   1 
ATOM   7683  C  CE1   . PHE D 2 97  ? 21.472  53.745 81.359  1.00 260.77 ? 614  PHE F CE1   1 
ATOM   7684  C  CE2   . PHE D 2 97  ? 21.701  51.686 80.159  1.00 263.10 ? 614  PHE F CE2   1 
ATOM   7685  C  CZ    . PHE D 2 97  ? 21.872  52.421 81.318  1.00 260.35 ? 614  PHE F CZ    1 
ATOM   7686  N  N     . MET D 2 98  ? 21.706  52.877 75.682  1.00 270.49 ? 615  MET F N     1 
ATOM   7687  C  CA    . MET D 2 98  ? 22.582  51.795 75.223  1.00 269.36 ? 615  MET F CA    1 
ATOM   7688  C  C     . MET D 2 98  ? 23.659  52.279 74.245  1.00 267.52 ? 615  MET F C     1 
ATOM   7689  O  O     . MET D 2 98  ? 24.722  51.664 74.135  1.00 265.33 ? 615  MET F O     1 
ATOM   7690  C  CB    . MET D 2 98  ? 21.756  50.673 74.584  1.00 274.07 ? 615  MET F CB    1 
ATOM   7691  C  CG    . MET D 2 98  ? 20.835  49.953 75.559  1.00 275.34 ? 615  MET F CG    1 
ATOM   7692  S  SD    . MET D 2 98  ? 19.973  48.555 74.815  1.00 280.72 ? 615  MET F SD    1 
ATOM   7693  C  CE    . MET D 2 98  ? 18.980  47.990 76.195  1.00 280.86 ? 615  MET F CE    1 
ATOM   7694  N  N     . LYS D 2 99  ? 23.383  53.376 73.542  1.00 268.08 ? 616  LYS F N     1 
ATOM   7695  C  CA    . LYS D 2 99  ? 24.357  53.989 72.637  1.00 266.44 ? 616  LYS F CA    1 
ATOM   7696  C  C     . LYS D 2 99  ? 25.434  54.736 73.423  1.00 260.75 ? 616  LYS F C     1 
ATOM   7697  O  O     . LYS D 2 99  ? 26.627  54.569 73.161  1.00 258.38 ? 616  LYS F O     1 
ATOM   7698  C  CB    . LYS D 2 99  ? 23.654  54.944 71.670  1.00 270.15 ? 616  LYS F CB    1 
ATOM   7699  C  CG    . LYS D 2 99  ? 24.534  55.485 70.555  1.00 270.43 ? 616  LYS F CG    1 
ATOM   7700  C  CD    . LYS D 2 99  ? 23.710  56.291 69.564  1.00 274.70 ? 616  LYS F CD    1 
ATOM   7701  C  CE    . LYS D 2 99  ? 24.537  56.719 68.364  1.00 275.51 ? 616  LYS F CE    1 
ATOM   7702  N  NZ    . LYS D 2 99  ? 23.719  57.471 67.373  1.00 279.98 ? 616  LYS F NZ    1 
ATOM   7703  N  N     . LEU D 2 100 ? 25.006  55.563 74.376  1.00 258.06 ? 617  LEU F N     1 
ATOM   7704  C  CA    . LEU D 2 100 ? 25.930  56.263 75.276  1.00 252.68 ? 617  LEU F CA    1 
ATOM   7705  C  C     . LEU D 2 100 ? 26.778  55.280 76.071  1.00 248.44 ? 617  LEU F C     1 
ATOM   7706  O  O     . LEU D 2 100 ? 27.981  55.486 76.241  1.00 245.43 ? 617  LEU F O     1 
ATOM   7707  C  CB    . LEU D 2 100 ? 25.171  57.166 76.252  1.00 252.10 ? 617  LEU F CB    1 
ATOM   7708  C  CG    . LEU D 2 100 ? 24.807  58.564 75.753  1.00 253.68 ? 617  LEU F CG    1 
ATOM   7709  C  CD1   . LEU D 2 100 ? 23.747  59.172 76.657  1.00 254.43 ? 617  LEU F CD1   1 
ATOM   7710  C  CD2   . LEU D 2 100 ? 26.040  59.454 75.688  1.00 250.94 ? 617  LEU F CD2   1 
ATOM   7711  N  N     . TYR D 2 101 ? 26.137  54.223 76.562  1.00 247.95 ? 618  TYR F N     1 
ATOM   7712  C  CA    . TYR D 2 101 ? 26.820  53.170 77.303  1.00 244.47 ? 618  TYR F CA    1 
ATOM   7713  C  C     . TYR D 2 101 ? 27.984  52.616 76.479  1.00 243.71 ? 618  TYR F C     1 
ATOM   7714  O  O     . TYR D 2 101 ? 29.144  52.777 76.860  1.00 240.52 ? 618  TYR F O     1 
ATOM   7715  C  CB    . TYR D 2 101 ? 25.828  52.060 77.677  1.00 245.92 ? 618  TYR F CB    1 
ATOM   7716  C  CG    . TYR D 2 101 ? 26.392  50.980 78.571  1.00 243.04 ? 618  TYR F CG    1 
ATOM   7717  C  CD1   . TYR D 2 101 ? 26.611  51.215 79.924  1.00 239.71 ? 618  TYR F CD1   1 
ATOM   7718  C  CD2   . TYR D 2 101 ? 26.687  49.716 78.068  1.00 243.93 ? 618  TYR F CD2   1 
ATOM   7719  C  CE1   . TYR D 2 101 ? 27.121  50.226 80.748  1.00 237.59 ? 618  TYR F CE1   1 
ATOM   7720  C  CE2   . TYR D 2 101 ? 27.193  48.720 78.885  1.00 241.92 ? 618  TYR F CE2   1 
ATOM   7721  C  CZ    . TYR D 2 101 ? 27.409  48.980 80.222  1.00 238.70 ? 618  TYR F CZ    1 
ATOM   7722  O  OH    . TYR D 2 101 ? 27.914  47.991 81.032  1.00 236.90 ? 618  TYR F OH    1 
ATOM   7723  N  N     . GLU D 2 102 ? 27.671  52.010 75.335  1.00 246.86 ? 619  GLU F N     1 
ATOM   7724  C  CA    . GLU D 2 102 ? 28.682  51.387 74.469  1.00 247.02 ? 619  GLU F CA    1 
ATOM   7725  C  C     . GLU D 2 102 ? 29.756  52.369 73.995  1.00 245.11 ? 619  GLU F C     1 
ATOM   7726  O  O     . GLU D 2 102 ? 30.929  52.004 73.878  1.00 242.99 ? 619  GLU F O     1 
ATOM   7727  C  CB    . GLU D 2 102 ? 28.010  50.728 73.258  1.00 251.48 ? 619  GLU F CB    1 
ATOM   7728  C  CG    . GLU D 2 102 ? 28.967  49.994 72.324  1.00 252.02 ? 619  GLU F CG    1 
ATOM   7729  C  CD    . GLU D 2 102 ? 28.262  49.331 71.155  1.00 256.40 ? 619  GLU F CD    1 
ATOM   7730  O  OE1   . GLU D 2 102 ? 27.162  48.771 71.351  1.00 258.89 ? 619  GLU F OE1   1 
ATOM   7731  O  OE2   . GLU D 2 102 ? 28.815  49.362 70.035  1.00 257.60 ? 619  GLU F OE2   1 
ATOM   7732  N  N     . GLU D 2 103 ? 29.352  53.606 73.718  1.00 245.80 ? 620  GLU F N     1 
ATOM   7733  C  CA    . GLU D 2 103 ? 30.289  54.660 73.325  1.00 244.31 ? 620  GLU F CA    1 
ATOM   7734  C  C     . GLU D 2 103 ? 31.339  54.919 74.409  1.00 239.78 ? 620  GLU F C     1 
ATOM   7735  O  O     . GLU D 2 103 ? 32.494  55.217 74.101  1.00 237.80 ? 620  GLU F O     1 
ATOM   7736  C  CB    . GLU D 2 103 ? 29.525  55.953 73.016  1.00 246.26 ? 620  GLU F CB    1 
ATOM   7737  C  CG    . GLU D 2 103 ? 30.398  57.121 72.573  1.00 245.29 ? 620  GLU F CG    1 
ATOM   7738  C  CD    . GLU D 2 103 ? 29.600  58.384 72.296  1.00 247.29 ? 620  GLU F CD    1 
ATOM   7739  O  OE1   . GLU D 2 103 ? 28.425  58.280 71.883  1.00 250.64 ? 620  GLU F OE1   1 
ATOM   7740  O  OE2   . GLU D 2 103 ? 30.154  59.487 72.490  1.00 245.66 ? 620  GLU F OE2   1 
ATOM   7741  N  N     . LYS D 2 104 ? 30.932  54.792 75.670  1.00 238.17 ? 621  LYS F N     1 
ATOM   7742  C  CA    . LYS D 2 104 ? 31.796  55.109 76.806  1.00 234.51 ? 621  LYS F CA    1 
ATOM   7743  C  C     . LYS D 2 104 ? 32.516  53.869 77.337  1.00 232.92 ? 621  LYS F C     1 
ATOM   7744  O  O     . LYS D 2 104 ? 33.719  53.917 77.609  1.00 230.43 ? 621  LYS F O     1 
ATOM   7745  C  CB    . LYS D 2 104 ? 30.972  55.762 77.926  1.00 233.70 ? 621  LYS F CB    1 
ATOM   7746  C  CG    . LYS D 2 104 ? 31.584  57.023 78.528  1.00 231.37 ? 621  LYS F CG    1 
ATOM   7747  C  CD    . LYS D 2 104 ? 31.832  58.131 77.507  1.00 232.42 ? 621  LYS F CD    1 
ATOM   7748  C  CE    . LYS D 2 104 ? 30.571  58.575 76.777  1.00 235.66 ? 621  LYS F CE    1 
ATOM   7749  N  NZ    . LYS D 2 104 ? 30.890  59.510 75.663  1.00 236.90 ? 621  LYS F NZ    1 
ATOM   7750  N  N     . THR D 2 105 ? 31.782  52.766 77.478  1.00 234.55 ? 622  THR F N     1 
ATOM   7751  C  CA    . THR D 2 105 ? 32.331  51.543 78.072  1.00 233.40 ? 622  THR F CA    1 
ATOM   7752  C  C     . THR D 2 105 ? 32.960  50.591 77.044  1.00 235.43 ? 622  THR F C     1 
ATOM   7753  O  O     . THR D 2 105 ? 33.890  49.852 77.374  1.00 233.63 ? 622  THR F O     1 
ATOM   7754  C  CB    . THR D 2 105 ? 31.271  50.802 78.924  1.00 233.93 ? 622  THR F CB    1 
ATOM   7755  O  OG1   . THR D 2 105 ? 31.919  49.835 79.753  1.00 232.01 ? 622  THR F OG1   1 
ATOM   7756  C  CG2   . THR D 2 105 ? 30.216  50.101 78.068  1.00 237.73 ? 622  THR F CG2   1 
ATOM   7757  N  N     . GLY D 2 106 ? 32.448  50.605 75.814  1.00 239.46 ? 623  GLY F N     1 
ATOM   7758  C  CA    . GLY D 2 106 ? 32.979  49.768 74.732  1.00 241.99 ? 623  GLY F CA    1 
ATOM   7759  C  C     . GLY D 2 106 ? 32.130  48.543 74.419  1.00 245.87 ? 623  GLY F C     1 
ATOM   7760  O  O     . GLY D 2 106 ? 32.042  48.126 73.265  1.00 248.76 ? 623  GLY F O     1 
ATOM   7761  N  N     . ASN D 2 107 ? 31.511  47.967 75.449  1.00 246.56 ? 624  ASN F N     1 
ATOM   7762  C  CA    . ASN D 2 107 ? 30.681  46.763 75.314  1.00 250.31 ? 624  ASN F CA    1 
ATOM   7763  C  C     . ASN D 2 107 ? 29.198  47.070 75.119  1.00 253.70 ? 624  ASN F C     1 
ATOM   7764  O  O     . ASN D 2 107 ? 28.772  48.218 75.230  1.00 253.42 ? 624  ASN F O     1 
ATOM   7765  C  CB    . ASN D 2 107 ? 30.830  45.884 76.558  1.00 248.64 ? 624  ASN F CB    1 
ATOM   7766  C  CG    . ASN D 2 107 ? 32.276  45.574 76.883  1.00 245.81 ? 624  ASN F CG    1 
ATOM   7767  O  OD1   . ASN D 2 107 ? 33.098  46.479 77.035  1.00 243.15 ? 624  ASN F OD1   1 
ATOM   7768  N  ND2   . ASN D 2 107 ? 32.594  44.293 76.996  1.00 246.59 ? 624  ASN F ND2   1 
ATOM   7769  N  N     . ALA D 2 108 ? 28.420  46.026 74.838  1.00 257.14 ? 625  ALA F N     1 
ATOM   7770  C  CA    . ALA D 2 108 ? 26.962  46.128 74.771  1.00 260.42 ? 625  ALA F CA    1 
ATOM   7771  C  C     . ALA D 2 108 ? 26.371  46.068 76.180  1.00 259.33 ? 625  ALA F C     1 
ATOM   7772  O  O     . ALA D 2 108 ? 27.064  45.708 77.132  1.00 255.92 ? 625  ALA F O     1 
ATOM   7773  C  CB    . ALA D 2 108 ? 26.391  45.012 73.911  1.00 264.63 ? 625  ALA F CB    1 
ATOM   7774  N  N     . TRP D 2 109 ? 25.090  46.413 76.301  1.00 262.49 ? 626  TRP F N     1 
ATOM   7775  C  CA    . TRP D 2 109 ? 24.411  46.464 77.603  1.00 262.04 ? 626  TRP F CA    1 
ATOM   7776  C  C     . TRP D 2 109 ? 24.211  45.084 78.232  1.00 263.80 ? 626  TRP F C     1 
ATOM   7777  O  O     . TRP D 2 109 ? 24.425  44.911 79.435  1.00 261.62 ? 626  TRP F O     1 
ATOM   7778  C  CB    . TRP D 2 109 ? 23.052  47.157 77.469  1.00 264.45 ? 626  TRP F CB    1 
ATOM   7779  C  CG    . TRP D 2 109 ? 22.278  47.234 78.758  1.00 263.37 ? 626  TRP F CG    1 
ATOM   7780  C  CD1   . TRP D 2 109 ? 21.072  46.654 79.027  1.00 266.21 ? 626  TRP F CD1   1 
ATOM   7781  C  CD2   . TRP D 2 109 ? 22.665  47.924 79.951  1.00 259.44 ? 626  TRP F CD2   1 
ATOM   7782  N  NE1   . TRP D 2 109 ? 20.678  46.946 80.312  1.00 264.45 ? 626  TRP F NE1   1 
ATOM   7783  C  CE2   . TRP D 2 109 ? 21.640  47.723 80.902  1.00 260.26 ? 626  TRP F CE2   1 
ATOM   7784  C  CE3   . TRP D 2 109 ? 23.779  48.694 80.309  1.00 255.68 ? 626  TRP F CE3   1 
ATOM   7785  C  CZ2   . TRP D 2 109 ? 21.694  48.265 82.187  1.00 257.43 ? 626  TRP F CZ2   1 
ATOM   7786  C  CZ3   . TRP D 2 109 ? 23.831  49.233 81.588  1.00 252.94 ? 626  TRP F CZ3   1 
ATOM   7787  C  CH2   . TRP D 2 109 ? 22.794  49.015 82.511  1.00 253.79 ? 626  TRP F CH2   1 
ATOM   7788  N  N     . HIS D 2 110 ? 23.805  44.110 77.418  1.00 268.64 ? 627  HIS F N     1 
ATOM   7789  C  CA    . HIS D 2 110 ? 23.530  42.761 77.904  1.00 270.72 ? 627  HIS F CA    1 
ATOM   7790  C  C     . HIS D 2 110 ? 24.776  41.921 77.684  1.00 269.52 ? 627  HIS F C     1 
ATOM   7791  O  O     . HIS D 2 110 ? 25.013  41.430 76.581  1.00 272.15 ? 627  HIS F O     1 
ATOM   7792  C  CB    . HIS D 2 110 ? 22.328  42.118 77.200  1.00 276.29 ? 627  HIS F CB    1 
ATOM   7793  C  CG    . HIS D 2 110 ? 21.000  42.623 77.673  1.00 278.50 ? 627  HIS F CG    1 
ATOM   7794  N  ND1   . HIS D 2 110 ? 20.433  42.220 78.863  1.00 278.33 ? 627  HIS F ND1   1 
ATOM   7795  C  CD2   . HIS D 2 110 ? 20.117  43.481 77.108  1.00 281.17 ? 627  HIS F CD2   1 
ATOM   7796  C  CE1   . HIS D 2 110 ? 19.264  42.816 79.016  1.00 280.50 ? 627  HIS F CE1   1 
ATOM   7797  N  NE2   . HIS D 2 110 ? 19.048  43.587 77.965  1.00 282.26 ? 627  HIS F NE2   1 
ATOM   7798  N  N     . SER D 2 111 ? 25.581  41.784 78.733  1.00 265.71 ? 628  SER F N     1 
ATOM   7799  C  CA    . SER D 2 111 ? 26.792  40.973 78.679  1.00 264.08 ? 628  SER F CA    1 
ATOM   7800  C  C     . SER D 2 111 ? 27.280  40.734 80.100  1.00 260.93 ? 628  SER F C     1 
ATOM   7801  O  O     . SER D 2 111 ? 27.560  41.692 80.813  1.00 257.97 ? 628  SER F O     1 
ATOM   7802  C  CB    . SER D 2 111 ? 27.879  41.653 77.848  1.00 262.19 ? 628  SER F CB    1 
ATOM   7803  O  OG    . SER D 2 111 ? 28.992  40.797 77.660  1.00 261.31 ? 628  SER F OG    1 
ATOM   7804  N  N     . LYS D 2 112 ? 27.347  39.469 80.513  1.00 262.08 ? 629  LYS F N     1 
ATOM   7805  C  CA    . LYS D 2 112 ? 27.846  39.101 81.841  1.00 259.57 ? 629  LYS F CA    1 
ATOM   7806  C  C     . LYS D 2 112 ? 29.378  39.124 81.843  1.00 256.61 ? 629  LYS F C     1 
ATOM   7807  O  O     . LYS D 2 112 ? 30.008  39.757 82.699  1.00 252.95 ? 629  LYS F O     1 
ATOM   7808  C  CB    . LYS D 2 112 ? 27.319  37.715 82.249  1.00 262.21 ? 629  LYS F CB    1 
ATOM   7809  C  CG    . LYS D 2 112 ? 25.810  37.531 82.096  1.00 265.96 ? 629  LYS F CG    1 
ATOM   7810  C  CD    . LYS D 2 112 ? 25.037  38.420 83.057  1.00 264.71 ? 629  LYS F CD    1 
ATOM   7811  C  CE    . LYS D 2 112 ? 23.535  38.251 82.891  1.00 268.68 ? 629  LYS F CE    1 
ATOM   7812  N  NZ    . LYS D 2 112 ? 22.780  38.806 84.049  1.00 267.61 ? 629  LYS F NZ    1 
ATOM   7813  N  N     . ASN D 2 113 ? 29.971  38.443 80.865  1.00 258.15 ? 630  ASN F N     1 
ATOM   7814  C  CA    . ASN D 2 113 ? 31.428  38.349 80.757  1.00 255.49 ? 630  ASN F CA    1 
ATOM   7815  C  C     . ASN D 2 113 ? 32.044  39.599 80.118  1.00 252.74 ? 630  ASN F C     1 
ATOM   7816  O  O     . ASN D 2 113 ? 32.184  39.690 78.896  1.00 254.44 ? 630  ASN F O     1 
ATOM   7817  C  CB    . ASN D 2 113 ? 31.815  37.089 79.979  1.00 258.72 ? 630  ASN F CB    1 
ATOM   7818  C  CG    . ASN D 2 113 ? 31.318  35.819 80.644  1.00 261.01 ? 630  ASN F CG    1 
ATOM   7819  O  OD1   . ASN D 2 113 ? 30.327  35.835 81.377  1.00 261.91 ? 630  ASN F OD1   1 
ATOM   7820  N  ND2   . ASN D 2 113 ? 31.994  34.707 80.378  1.00 262.52 ? 630  ASN F ND2   1 
ATOM   7821  N  N     . PHE D 2 114 ? 32.428  40.555 80.959  1.00 248.18 ? 631  PHE F N     1 
ATOM   7822  C  CA    . PHE D 2 114 ? 32.862  41.867 80.485  1.00 245.70 ? 631  PHE F CA    1 
ATOM   7823  C  C     . PHE D 2 114 ? 34.325  41.877 80.033  1.00 243.62 ? 631  PHE F C     1 
ATOM   7824  O  O     . PHE D 2 114 ? 35.142  41.087 80.511  1.00 242.65 ? 631  PHE F O     1 
ATOM   7825  C  CB    . PHE D 2 114 ? 32.645  42.918 81.577  1.00 242.86 ? 631  PHE F CB    1 
ATOM   7826  C  CG    . PHE D 2 114 ? 32.802  44.329 81.093  1.00 241.81 ? 631  PHE F CG    1 
ATOM   7827  C  CD1   . PHE D 2 114 ? 31.721  45.020 80.566  1.00 243.57 ? 631  PHE F CD1   1 
ATOM   7828  C  CD2   . PHE D 2 114 ? 34.038  44.959 81.149  1.00 239.21 ? 631  PHE F CD2   1 
ATOM   7829  C  CE1   . PHE D 2 114 ? 31.868  46.320 80.112  1.00 242.74 ? 631  PHE F CE1   1 
ATOM   7830  C  CE2   . PHE D 2 114 ? 34.193  46.255 80.694  1.00 238.38 ? 631  PHE F CE2   1 
ATOM   7831  C  CZ    . PHE D 2 114 ? 33.109  46.935 80.173  1.00 240.14 ? 631  PHE F CZ    1 
ATOM   7832  N  N     . THR D 2 115 ? 34.635  42.783 79.106  1.00 242.82 ? 632  THR F N     1 
ATOM   7833  C  CA    . THR D 2 115 ? 35.995  42.988 78.608  1.00 240.87 ? 632  THR F CA    1 
ATOM   7834  C  C     . THR D 2 115 ? 36.313  44.482 78.490  1.00 237.58 ? 632  THR F C     1 
ATOM   7835  O  O     . THR D 2 115 ? 35.614  45.220 77.795  1.00 238.90 ? 632  THR F O     1 
ATOM   7836  C  CB    . THR D 2 115 ? 36.194  42.333 77.228  1.00 244.25 ? 632  THR F CB    1 
ATOM   7837  O  OG1   . THR D 2 115 ? 35.167  42.773 76.329  1.00 247.20 ? 632  THR F OG1   1 
ATOM   7838  C  CG2   . THR D 2 115 ? 36.150  40.816 77.342  1.00 246.32 ? 632  THR F CG2   1 
ATOM   7839  N  N     . LYS D 2 116 ? 37.369  44.914 79.177  1.00 232.88 ? 633  LYS F N     1 
ATOM   7840  C  CA    . LYS D 2 116 ? 37.851  46.299 79.116  1.00 229.42 ? 633  LYS F CA    1 
ATOM   7841  C  C     . LYS D 2 116 ? 38.388  46.617 77.719  1.00 229.60 ? 633  LYS F C     1 
ATOM   7842  O  O     . LYS D 2 116 ? 38.901  45.731 77.032  1.00 230.80 ? 633  LYS F O     1 
ATOM   7843  C  CB    . LYS D 2 116 ? 38.934  46.512 80.191  1.00 226.11 ? 633  LYS F CB    1 
ATOM   7844  C  CG    . LYS D 2 116 ? 39.820  47.746 80.052  1.00 224.11 ? 633  LYS F CG    1 
ATOM   7845  C  CD    . LYS D 2 116 ? 39.132  49.029 80.488  1.00 222.83 ? 633  LYS F CD    1 
ATOM   7846  C  CE    . LYS D 2 116 ? 40.122  50.183 80.479  1.00 220.73 ? 633  LYS F CE    1 
ATOM   7847  N  NZ    . LYS D 2 116 ? 39.566  51.445 81.033  1.00 219.49 ? 633  LYS F NZ    1 
ATOM   7848  N  N     . TYR D 2 117 ? 38.253  47.877 77.303  1.00 228.02 ? 634  TYR F N     1 
ATOM   7849  C  CA    . TYR D 2 117 ? 38.784  48.343 76.020  1.00 228.44 ? 634  TYR F CA    1 
ATOM   7850  C  C     . TYR D 2 117 ? 39.668  49.587 76.199  1.00 225.47 ? 634  TYR F C     1 
ATOM   7851  O  O     . TYR D 2 117 ? 39.413  50.402 77.087  1.00 223.83 ? 634  TYR F O     1 
ATOM   7852  C  CB    . TYR D 2 117 ? 37.642  48.650 75.048  1.00 231.21 ? 634  TYR F CB    1 
ATOM   7853  C  CG    . TYR D 2 117 ? 36.944  47.415 74.516  1.00 234.29 ? 634  TYR F CG    1 
ATOM   7854  C  CD1   . TYR D 2 117 ? 37.567  46.589 73.585  1.00 236.04 ? 634  TYR F CD1   1 
ATOM   7855  C  CD2   . TYR D 2 117 ? 35.659  47.076 74.937  1.00 235.59 ? 634  TYR F CD2   1 
ATOM   7856  C  CE1   . TYR D 2 117 ? 36.934  45.458 73.093  1.00 238.96 ? 634  TYR F CE1   1 
ATOM   7857  C  CE2   . TYR D 2 117 ? 35.017  45.947 74.449  1.00 238.56 ? 634  TYR F CE2   1 
ATOM   7858  C  CZ    . TYR D 2 117 ? 35.659  45.142 73.528  1.00 240.23 ? 634  TYR F CZ    1 
ATOM   7859  O  OH    . TYR D 2 117 ? 35.027  44.021 73.043  1.00 243.35 ? 634  TYR F OH    1 
ATOM   7860  N  N     . PRO D 2 118 ? 40.712  49.731 75.354  1.00 224.62 ? 635  PRO F N     1 
ATOM   7861  C  CA    . PRO D 2 118 ? 41.640  50.869 75.371  1.00 221.96 ? 635  PRO F CA    1 
ATOM   7862  C  C     . PRO D 2 118 ? 40.978  52.245 75.519  1.00 220.36 ? 635  PRO F C     1 
ATOM   7863  O  O     . PRO D 2 118 ? 40.169  52.641 74.676  1.00 222.36 ? 635  PRO F O     1 
ATOM   7864  C  CB    . PRO D 2 118 ? 42.330  50.759 74.013  1.00 224.09 ? 635  PRO F CB    1 
ATOM   7865  C  CG    . PRO D 2 118 ? 42.384  49.295 73.760  1.00 225.88 ? 635  PRO F CG    1 
ATOM   7866  C  CD    . PRO D 2 118 ? 41.146  48.706 74.384  1.00 226.65 ? 635  PRO F CD    1 
ATOM   7867  N  N     . LYS D 2 119 ? 41.325  52.948 76.598  1.00 216.38 ? 636  LYS F N     1 
ATOM   7868  C  CA    . LYS D 2 119 ? 40.806  54.292 76.905  1.00 214.58 ? 636  LYS F CA    1 
ATOM   7869  C  C     . LYS D 2 119 ? 39.275  54.399 77.068  1.00 214.60 ? 636  LYS F C     1 
ATOM   7870  O  O     . LYS D 2 119 ? 38.755  55.496 77.277  1.00 214.16 ? 636  LYS F O     1 
ATOM   7871  C  CB    . LYS D 2 119 ? 41.331  55.328 75.891  1.00 215.51 ? 636  LYS F CB    1 
ATOM   7872  C  CG    . LYS D 2 119 ? 42.640  55.985 76.314  1.00 213.46 ? 636  LYS F CG    1 
ATOM   7873  C  CD    . LYS D 2 119 ? 42.440  56.928 77.497  1.00 211.63 ? 636  LYS F CD    1 
ATOM   7874  C  CE    . LYS D 2 119 ? 43.459  56.695 78.605  1.00 209.09 ? 636  LYS F CE    1 
ATOM   7875  N  NZ    . LYS D 2 119 ? 43.007  57.274 79.902  1.00 207.36 ? 636  LYS F NZ    1 
ATOM   7876  N  N     . LYS D 2 120 ? 38.566  53.271 76.990  1.00 214.65 ? 637  LYS F N     1 
ATOM   7877  C  CA    . LYS D 2 120 ? 37.143  53.223 77.327  1.00 214.88 ? 637  LYS F CA    1 
ATOM   7878  C  C     . LYS D 2 120 ? 37.004  52.975 78.824  1.00 211.95 ? 637  LYS F C     1 
ATOM   7879  O  O     . LYS D 2 120 ? 37.962  52.572 79.485  1.00 209.88 ? 637  LYS F O     1 
ATOM   7880  C  CB    . LYS D 2 120 ? 36.409  52.123 76.542  1.00 217.66 ? 637  LYS F CB    1 
ATOM   7881  C  CG    . LYS D 2 120 ? 35.649  52.605 75.312  1.00 220.67 ? 637  LYS F CG    1 
ATOM   7882  C  CD    . LYS D 2 120 ? 36.510  52.622 74.059  1.00 221.65 ? 637  LYS F CD    1 
ATOM   7883  C  CE    . LYS D 2 120 ? 35.674  52.951 72.831  1.00 225.07 ? 637  LYS F CE    1 
ATOM   7884  N  NZ    . LYS D 2 120 ? 36.379  52.629 71.560  1.00 226.88 ? 637  LYS F NZ    1 
ATOM   7885  N  N     . PHE D 2 121 ? 35.807  53.213 79.351  1.00 211.70 ? 638  PHE F N     1 
ATOM   7886  C  CA    . PHE D 2 121 ? 35.545  53.048 80.780  1.00 209.37 ? 638  PHE F CA    1 
ATOM   7887  C  C     . PHE D 2 121 ? 35.311  51.587 81.160  1.00 210.28 ? 638  PHE F C     1 
ATOM   7888  O  O     . PHE D 2 121 ? 35.183  50.716 80.297  1.00 212.24 ? 638  PHE F O     1 
ATOM   7889  C  CB    . PHE D 2 121 ? 34.333  53.886 81.198  1.00 209.46 ? 638  PHE F CB    1 
ATOM   7890  C  CG    . PHE D 2 121 ? 34.641  55.341 81.389  1.00 207.49 ? 638  PHE F CG    1 
ATOM   7891  C  CD1   . PHE D 2 121 ? 34.838  56.170 80.295  1.00 208.35 ? 638  PHE F CD1   1 
ATOM   7892  C  CD2   . PHE D 2 121 ? 34.735  55.884 82.665  1.00 204.93 ? 638  PHE F CD2   1 
ATOM   7893  C  CE1   . PHE D 2 121 ? 35.123  57.513 80.468  1.00 207.23 ? 638  PHE F CE1   1 
ATOM   7894  C  CE2   . PHE D 2 121 ? 35.019  57.227 82.845  1.00 203.98 ? 638  PHE F CE2   1 
ATOM   7895  C  CZ    . PHE D 2 121 ? 35.214  58.044 81.745  1.00 205.08 ? 638  PHE F CZ    1 
ATOM   7896  N  N     . TYR D 2 122 ? 35.268  51.340 82.467  1.00 209.17 ? 639  TYR F N     1 
ATOM   7897  C  CA    . TYR D 2 122 ? 34.932  50.031 83.020  1.00 210.20 ? 639  TYR F CA    1 
ATOM   7898  C  C     . TYR D 2 122 ? 33.828  50.207 84.067  1.00 211.28 ? 639  TYR F C     1 
ATOM   7899  O  O     . TYR D 2 122 ? 33.962  51.038 84.967  1.00 209.37 ? 639  TYR F O     1 
ATOM   7900  C  CB    . TYR D 2 122 ? 36.170  49.389 83.649  1.00 207.78 ? 639  TYR F CB    1 
ATOM   7901  C  CG    . TYR D 2 122 ? 35.900  48.084 84.363  1.00 207.84 ? 639  TYR F CG    1 
ATOM   7902  C  CD1   . TYR D 2 122 ? 35.611  48.063 85.720  1.00 206.33 ? 639  TYR F CD1   1 
ATOM   7903  C  CD2   . TYR D 2 122 ? 35.941  46.869 83.684  1.00 209.58 ? 639  TYR F CD2   1 
ATOM   7904  C  CE1   . TYR D 2 122 ? 35.367  46.872 86.378  1.00 206.53 ? 639  TYR F CE1   1 
ATOM   7905  C  CE2   . TYR D 2 122 ? 35.700  45.672 84.336  1.00 209.91 ? 639  TYR F CE2   1 
ATOM   7906  C  CZ    . TYR D 2 122 ? 35.412  45.678 85.684  1.00 208.39 ? 639  TYR F CZ    1 
ATOM   7907  O  OH    . TYR D 2 122 ? 35.171  44.488 86.332  1.00 208.83 ? 639  TYR F OH    1 
ATOM   7908  N  N     . PRO D 2 123 ? 32.735  49.426 83.958  1.00 215.03 ? 640  PRO F N     1 
ATOM   7909  C  CA    . PRO D 2 123 ? 31.607  49.553 84.877  1.00 216.39 ? 640  PRO F CA    1 
ATOM   7910  C  C     . PRO D 2 123 ? 31.877  48.909 86.227  1.00 215.95 ? 640  PRO F C     1 
ATOM   7911  O  O     . PRO D 2 123 ? 32.356  47.774 86.286  1.00 216.03 ? 640  PRO F O     1 
ATOM   7912  C  CB    . PRO D 2 123 ? 30.485  48.805 84.155  1.00 219.66 ? 640  PRO F CB    1 
ATOM   7913  C  CG    . PRO D 2 123 ? 31.191  47.763 83.367  1.00 220.23 ? 640  PRO F CG    1 
ATOM   7914  C  CD    . PRO D 2 123 ? 32.504  48.368 82.958  1.00 218.02 ? 640  PRO F CD    1 
ATOM   7915  N  N     . LEU D 2 124 ? 31.565  49.633 87.298  1.00 216.39 ? 641  LEU F N     1 
ATOM   7916  C  CA    . LEU D 2 124 ? 31.712  49.108 88.646  1.00 216.34 ? 641  LEU F CA    1 
ATOM   7917  C  C     . LEU D 2 124 ? 30.415  48.443 89.082  1.00 219.60 ? 641  LEU F C     1 
ATOM   7918  O  O     . LEU D 2 124 ? 29.327  48.984 88.874  1.00 221.45 ? 641  LEU F O     1 
ATOM   7919  C  CB    . LEU D 2 124 ? 32.101  50.221 89.618  1.00 214.16 ? 641  LEU F CB    1 
ATOM   7920  C  CG    . LEU D 2 124 ? 33.310  51.072 89.218  1.00 212.47 ? 641  LEU F CG    1 
ATOM   7921  C  CD1   . LEU D 2 124 ? 33.639  52.067 90.319  1.00 210.64 ? 641  LEU F CD1   1 
ATOM   7922  C  CD2   . LEU D 2 124 ? 34.528  50.215 88.896  1.00 211.47 ? 641  LEU F CD2   1 
ATOM   7923  N  N     . GLU D 2 125 ? 30.542  47.268 89.691  1.00 220.89 ? 642  GLU F N     1 
ATOM   7924  C  CA    . GLU D 2 125 ? 29.389  46.442 90.036  1.00 224.08 ? 642  GLU F CA    1 
ATOM   7925  C  C     . GLU D 2 125 ? 28.748  46.916 91.339  1.00 224.29 ? 642  GLU F C     1 
ATOM   7926  O  O     . GLU D 2 125 ? 29.248  46.621 92.426  1.00 222.49 ? 642  GLU F O     1 
ATOM   7927  C  CB    . GLU D 2 125 ? 29.794  44.965 90.144  1.00 224.69 ? 642  GLU F CB    1 
ATOM   7928  C  CG    . GLU D 2 125 ? 29.887  44.233 88.810  1.00 226.81 ? 642  GLU F CG    1 
ATOM   7929  C  CD    . GLU D 2 125 ? 30.891  44.845 87.849  1.00 225.77 ? 642  GLU F CD    1 
ATOM   7930  O  OE1   . GLU D 2 125 ? 31.897  45.426 88.306  1.00 222.98 ? 642  GLU F OE1   1 
ATOM   7931  O  OE2   . GLU D 2 125 ? 30.675  44.736 86.626  1.00 227.84 ? 642  GLU F OE2   1 
ATOM   7932  N  N     . ILE D 2 126 ? 27.649  47.658 91.214  1.00 227.15 ? 643  ILE F N     1 
ATOM   7933  C  CA    . ILE D 2 126 ? 26.868  48.113 92.364  1.00 228.28 ? 643  ILE F CA    1 
ATOM   7934  C  C     . ILE D 2 126 ? 25.743  47.114 92.644  1.00 231.46 ? 643  ILE F C     1 
ATOM   7935  O  O     . ILE D 2 126 ? 25.204  46.496 91.723  1.00 234.07 ? 643  ILE F O     1 
ATOM   7936  C  CB    . ILE D 2 126 ? 26.289  49.530 92.133  1.00 229.08 ? 643  ILE F CB    1 
ATOM   7937  C  CG1   . ILE D 2 126 ? 27.432  50.552 92.072  1.00 226.49 ? 643  ILE F CG1   1 
ATOM   7938  C  CG2   . ILE D 2 126 ? 25.294  49.902 93.230  1.00 229.90 ? 643  ILE F CG2   1 
ATOM   7939  C  CD1   . ILE D 2 126 ? 26.992  51.991 91.899  1.00 226.85 ? 643  ILE F CD1   1 
ATOM   7940  N  N     . ASP D 2 127 ? 25.399  46.965 93.921  1.00 231.57 ? 644  ASP F N     1 
ATOM   7941  C  CA    . ASP D 2 127 ? 24.327  46.067 94.344  1.00 234.23 ? 644  ASP F CA    1 
ATOM   7942  C  C     . ASP D 2 127 ? 22.966  46.631 93.937  1.00 237.02 ? 644  ASP F C     1 
ATOM   7943  O  O     . ASP D 2 127 ? 22.522  47.655 94.458  1.00 236.49 ? 644  ASP F O     1 
ATOM   7944  C  CB    . ASP D 2 127 ? 24.384  45.853 95.861  1.00 233.12 ? 644  ASP F CB    1 
ATOM   7945  C  CG    . ASP D 2 127 ? 23.484  44.722 96.333  1.00 235.50 ? 644  ASP F CG    1 
ATOM   7946  O  OD1   . ASP D 2 127 ? 22.249  44.825 96.172  1.00 238.00 ? 644  ASP F OD1   1 
ATOM   7947  O  OD2   . ASP D 2 127 ? 24.013  43.732 96.880  1.00 234.81 ? 644  ASP F OD2   1 
ATOM   7948  N  N     . LYS D 2 145 ? 13.416  53.601 127.402 1.00 325.86 ? 662  LYS F N     1 
ATOM   7949  C  CA    . LYS D 2 145 ? 12.534  52.464 127.652 1.00 328.01 ? 662  LYS F CA    1 
ATOM   7950  C  C     . LYS D 2 145 ? 13.202  51.114 127.351 1.00 325.56 ? 662  LYS F C     1 
ATOM   7951  O  O     . LYS D 2 145 ? 12.576  50.063 127.505 1.00 327.82 ? 662  LYS F O     1 
ATOM   7952  C  CB    . LYS D 2 145 ? 11.218  52.607 126.866 1.00 330.72 ? 662  LYS F CB    1 
ATOM   7953  C  CG    . LYS D 2 145 ? 11.347  53.219 125.473 1.00 329.27 ? 662  LYS F CG    1 
ATOM   7954  C  CD    . LYS D 2 145 ? 11.229  54.741 125.474 1.00 330.07 ? 662  LYS F CD    1 
ATOM   7955  C  CE    . LYS D 2 145 ? 9.821   55.232 125.790 1.00 334.36 ? 662  LYS F CE    1 
ATOM   7956  N  NZ    . LYS D 2 145 ? 8.795   54.730 124.834 1.00 336.15 ? 662  LYS F NZ    1 
ATOM   7957  N  N     . SER D 2 146 ? 14.468  51.144 126.936 1.00 321.24 ? 663  SER F N     1 
ATOM   7958  C  CA    . SER D 2 146 ? 15.235  49.921 126.698 1.00 318.50 ? 663  SER F CA    1 
ATOM   7959  C  C     . SER D 2 146 ? 15.666  49.299 128.025 1.00 318.44 ? 663  SER F C     1 
ATOM   7960  O  O     . SER D 2 146 ? 16.196  49.992 128.895 1.00 318.28 ? 663  SER F O     1 
ATOM   7961  C  CB    . SER D 2 146 ? 16.468  50.217 125.841 1.00 314.72 ? 663  SER F CB    1 
ATOM   7962  O  OG    . SER D 2 146 ? 17.326  51.147 126.479 1.00 313.41 ? 663  SER F OG    1 
ATOM   7963  N  N     . LYS D 2 147 ? 15.440  47.994 128.171 1.00 318.49 ? 664  LYS F N     1 
ATOM   7964  C  CA    . LYS D 2 147 ? 15.752  47.280 129.411 1.00 318.71 ? 664  LYS F CA    1 
ATOM   7965  C  C     . LYS D 2 147 ? 17.097  46.558 129.320 1.00 314.45 ? 664  LYS F C     1 
ATOM   7966  O  O     . LYS D 2 147 ? 17.147  45.338 129.148 1.00 314.59 ? 664  LYS F O     1 
ATOM   7967  C  CB    . LYS D 2 147 ? 14.637  46.284 129.746 1.00 322.53 ? 664  LYS F CB    1 
ATOM   7968  C  CG    . LYS D 2 147 ? 13.301  46.934 130.065 1.00 326.31 ? 664  LYS F CG    1 
ATOM   7969  C  CD    . LYS D 2 147 ? 12.271  45.900 130.489 1.00 330.18 ? 664  LYS F CD    1 
ATOM   7970  C  CE    . LYS D 2 147 ? 10.970  46.554 130.926 1.00 333.95 ? 664  LYS F CE    1 
ATOM   7971  N  NZ    . LYS D 2 147 ? 9.976   45.554 131.404 1.00 337.66 ? 664  LYS F NZ    1 
ATOM   7972  N  N     . LEU D 2 148 ? 18.181  47.324 129.433 1.00 310.25 ? 665  LEU F N     1 
ATOM   7973  C  CA    . LEU D 2 148 ? 19.539  46.774 129.449 1.00 306.30 ? 665  LEU F CA    1 
ATOM   7974  C  C     . LEU D 2 148 ? 20.445  47.601 130.367 1.00 304.31 ? 665  LEU F C     1 
ATOM   7975  O  O     . LEU D 2 148 ? 20.095  48.728 130.725 1.00 305.41 ? 665  LEU F O     1 
ATOM   7976  C  CB    . LEU D 2 148 ? 20.127  46.748 128.033 1.00 303.30 ? 665  LEU F CB    1 
ATOM   7977  C  CG    . LEU D 2 148 ? 19.527  45.766 127.022 1.00 303.67 ? 665  LEU F CG    1 
ATOM   7978  C  CD1   . LEU D 2 148 ? 20.122  46.013 125.645 1.00 300.90 ? 665  LEU F CD1   1 
ATOM   7979  C  CD2   . LEU D 2 148 ? 19.748  44.320 127.443 1.00 304.36 ? 665  LEU F CD2   1 
ATOM   7980  N  N     . PRO D 2 149 ? 21.610  47.044 130.758 1.00 301.32 ? 666  PRO F N     1 
ATOM   7981  C  CA    . PRO D 2 149 ? 22.570  47.812 131.561 1.00 299.75 ? 666  PRO F CA    1 
ATOM   7982  C  C     . PRO D 2 149 ? 23.179  48.991 130.800 1.00 296.42 ? 666  PRO F C     1 
ATOM   7983  O  O     . PRO D 2 149 ? 23.212  48.984 129.569 1.00 294.43 ? 666  PRO F O     1 
ATOM   7984  C  CB    . PRO D 2 149 ? 23.658  46.783 131.902 1.00 298.93 ? 666  PRO F CB    1 
ATOM   7985  C  CG    . PRO D 2 149 ? 23.023  45.452 131.699 1.00 300.28 ? 666  PRO F CG    1 
ATOM   7986  C  CD    . PRO D 2 149 ? 22.043  45.646 130.584 1.00 300.57 ? 666  PRO F CD    1 
ATOM   7987  N  N     . LYS D 2 150 ? 23.663  49.985 131.540 1.00 295.31 ? 667  LYS F N     1 
ATOM   7988  C  CA    . LYS D 2 150 ? 24.238  51.195 130.945 1.00 292.20 ? 667  LYS F CA    1 
ATOM   7989  C  C     . LYS D 2 150 ? 25.536  50.934 130.166 1.00 287.59 ? 667  LYS F C     1 
ATOM   7990  O  O     . LYS D 2 150 ? 25.737  51.528 129.106 1.00 285.59 ? 667  LYS F O     1 
ATOM   7991  C  CB    . LYS D 2 150 ? 24.465  52.271 132.016 1.00 293.77 ? 667  LYS F CB    1 
ATOM   7992  C  CG    . LYS D 2 150 ? 23.182  52.781 132.657 1.00 296.95 ? 667  LYS F CG    1 
ATOM   7993  C  CD    . LYS D 2 150 ? 23.462  53.607 133.902 1.00 298.81 ? 667  LYS F CD    1 
ATOM   7994  C  CE    . LYS D 2 150 ? 22.179  53.918 134.655 1.00 302.35 ? 667  LYS F CE    1 
ATOM   7995  N  NZ    . LYS D 2 150 ? 22.437  54.643 135.930 1.00 304.61 ? 667  LYS F NZ    1 
ATOM   7996  N  N     . PRO D 2 151 ? 26.420  50.056 130.685 1.00 285.42 ? 668  PRO F N     1 
ATOM   7997  C  CA    . PRO D 2 151 ? 27.627  49.711 129.921 1.00 281.27 ? 668  PRO F CA    1 
ATOM   7998  C  C     . PRO D 2 151 ? 27.341  48.918 128.641 1.00 278.29 ? 668  PRO F C     1 
ATOM   7999  O  O     . PRO D 2 151 ? 28.069  49.061 127.658 1.00 275.24 ? 668  PRO F O     1 
ATOM   8000  C  CB    . PRO D 2 151 ? 28.442  48.857 130.904 1.00 282.19 ? 668  PRO F CB    1 
ATOM   8001  C  CG    . PRO D 2 151 ? 27.878  49.148 132.251 1.00 285.50 ? 668  PRO F CG    1 
ATOM   8002  C  CD    . PRO D 2 151 ? 26.427  49.430 132.018 1.00 287.44 ? 668  PRO F CD    1 
ATOM   8003  N  N     . VAL D 2 152 ? 26.297  48.090 128.665 1.00 278.54 ? 669  VAL F N     1 
ATOM   8004  C  CA    . VAL D 2 152 ? 25.899  47.301 127.495 1.00 277.01 ? 669  VAL F CA    1 
ATOM   8005  C  C     . VAL D 2 152 ? 25.318  48.203 126.403 1.00 275.40 ? 669  VAL F C     1 
ATOM   8006  O  O     . VAL D 2 152 ? 25.550  47.973 125.216 1.00 273.37 ? 669  VAL F O     1 
ATOM   8007  C  CB    . VAL D 2 152 ? 24.882  46.198 127.873 1.00 279.34 ? 669  VAL F CB    1 
ATOM   8008  C  CG1   . VAL D 2 152 ? 24.356  45.486 126.631 1.00 278.80 ? 669  VAL F CG1   1 
ATOM   8009  C  CG2   . VAL D 2 152 ? 25.518  45.197 128.828 1.00 280.20 ? 669  VAL F CG2   1 
ATOM   8010  N  N     . GLN D 2 153 ? 24.561  49.221 126.810 1.00 276.00 ? 670  GLN F N     1 
ATOM   8011  C  CA    . GLN D 2 153 ? 24.048  50.226 125.876 1.00 274.82 ? 670  GLN F CA    1 
ATOM   8012  C  C     . GLN D 2 153 ? 25.190  51.021 125.244 1.00 271.12 ? 670  GLN F C     1 
ATOM   8013  O  O     . GLN D 2 153 ? 25.147  51.335 124.054 1.00 269.33 ? 670  GLN F O     1 
ATOM   8014  C  CB    . GLN D 2 153 ? 23.077  51.179 126.579 1.00 277.55 ? 670  GLN F CB    1 
ATOM   8015  C  CG    . GLN D 2 153 ? 21.752  50.541 126.966 1.00 280.56 ? 670  GLN F CG    1 
ATOM   8016  C  CD    . GLN D 2 153 ? 20.884  51.452 127.815 1.00 283.38 ? 670  GLN F CD    1 
ATOM   8017  O  OE1   . GLN D 2 153 ? 21.044  52.673 127.803 1.00 283.41 ? 670  GLN F OE1   1 
ATOM   8018  N  NE2   . GLN D 2 153 ? 19.952  50.859 128.556 1.00 286.15 ? 670  GLN F NE2   1 
ATOM   8019  N  N     . ASP D 2 154 ? 26.206  51.336 126.046 1.00 269.44 ? 671  ASP F N     1 
ATOM   8020  C  CA    . ASP D 2 154 ? 27.402  52.029 125.558 1.00 266.09 ? 671  ASP F CA    1 
ATOM   8021  C  C     . ASP D 2 154 ? 28.216  51.163 124.596 1.00 263.37 ? 671  ASP F C     1 
ATOM   8022  O  O     . ASP D 2 154 ? 28.875  51.688 123.698 1.00 261.36 ? 671  ASP F O     1 
ATOM   8023  C  CB    . ASP D 2 154 ? 28.291  52.471 126.728 1.00 265.92 ? 671  ASP F CB    1 
ATOM   8024  C  CG    . ASP D 2 154 ? 27.652  53.560 127.578 1.00 267.43 ? 671  ASP F CG    1 
ATOM   8025  O  OD1   . ASP D 2 154 ? 26.482  53.921 127.327 1.00 268.08 ? 671  ASP F OD1   1 
ATOM   8026  O  OD2   . ASP D 2 154 ? 28.326  54.056 128.505 1.00 267.59 ? 671  ASP F OD2   1 
ATOM   8027  N  N     . LEU D 2 155 ? 28.175  49.844 124.789 1.00 263.06 ? 672  LEU F N     1 
ATOM   8028  C  CA    . LEU D 2 155 ? 28.873  48.913 123.901 1.00 260.63 ? 672  LEU F CA    1 
ATOM   8029  C  C     . LEU D 2 155 ? 28.265  48.941 122.501 1.00 258.72 ? 672  LEU F C     1 
ATOM   8030  O  O     . LEU D 2 155 ? 28.993  48.998 121.512 1.00 256.56 ? 672  LEU F O     1 
ATOM   8031  C  CB    . LEU D 2 155 ? 28.840  47.488 124.466 1.00 262.10 ? 672  LEU F CB    1 
ATOM   8032  C  CG    . LEU D 2 155 ? 29.688  46.433 123.746 1.00 260.79 ? 672  LEU F CG    1 
ATOM   8033  C  CD1   . LEU D 2 155 ? 31.163  46.810 123.746 1.00 258.93 ? 672  LEU F CD1   1 
ATOM   8034  C  CD2   . LEU D 2 155 ? 29.487  45.068 124.387 1.00 262.57 ? 672  LEU F CD2   1 
ATOM   8035  N  N     . ILE D 2 156 ? 26.936  48.904 122.426 1.00 259.16 ? 673  ILE F N     1 
ATOM   8036  C  CA    . ILE D 2 156 ? 26.227  49.052 121.151 1.00 258.08 ? 673  ILE F CA    1 
ATOM   8037  C  C     . ILE D 2 156 ? 26.465  50.448 120.578 1.00 255.72 ? 673  ILE F C     1 
ATOM   8038  O  O     . ILE D 2 156 ? 26.728  50.597 119.386 1.00 254.14 ? 673  ILE F O     1 
ATOM   8039  C  CB    . ILE D 2 156 ? 24.711  48.797 121.304 1.00 260.87 ? 673  ILE F CB    1 
ATOM   8040  C  CG1   . ILE D 2 156 ? 24.464  47.316 121.600 1.00 261.87 ? 673  ILE F CG1   1 
ATOM   8041  C  CG2   . ILE D 2 156 ? 23.954  49.210 120.044 1.00 261.19 ? 673  ILE F CG2   1 
ATOM   8042  C  CD1   . ILE D 2 156 ? 23.023  46.979 121.905 1.00 264.84 ? 673  ILE F CD1   1 
ATOM   8043  N  N     . LYS D 2 157 ? 26.376  51.462 121.437 1.00 255.03 ? 674  LYS F N     1 
ATOM   8044  C  CA    . LYS D 2 157 ? 26.657  52.847 121.050 1.00 253.15 ? 674  LYS F CA    1 
ATOM   8045  C  C     . LYS D 2 157 ? 28.032  52.974 120.389 1.00 249.39 ? 674  LYS F C     1 
ATOM   8046  O  O     . LYS D 2 157 ? 28.200  53.727 119.430 1.00 248.13 ? 674  LYS F O     1 
ATOM   8047  C  CB    . LYS D 2 157 ? 26.599  53.767 122.276 1.00 254.54 ? 674  LYS F CB    1 
ATOM   8048  C  CG    . LYS D 2 157 ? 26.348  55.234 121.955 1.00 254.79 ? 674  LYS F CG    1 
ATOM   8049  C  CD    . LYS D 2 157 ? 24.868  55.584 122.021 1.00 257.16 ? 674  LYS F CD    1 
ATOM   8050  C  CE    . LYS D 2 157 ? 24.398  55.766 123.458 1.00 259.35 ? 674  LYS F CE    1 
ATOM   8051  N  NZ    . LYS D 2 157 ? 22.929  55.992 123.548 1.00 261.95 ? 674  LYS F NZ    1 
ATOM   8052  N  N     . MET D 2 158 ? 29.003  52.227 120.909 1.00 247.13 ? 675  MET F N     1 
ATOM   8053  C  CA    . MET D 2 158 ? 30.382  52.284 120.428 1.00 243.91 ? 675  MET F CA    1 
ATOM   8054  C  C     . MET D 2 158 ? 30.584  51.515 119.121 1.00 240.97 ? 675  MET F C     1 
ATOM   8055  O  O     . MET D 2 158 ? 31.260  52.005 118.214 1.00 239.61 ? 675  MET F O     1 
ATOM   8056  C  CB    . MET D 2 158 ? 31.328  51.743 121.505 1.00 244.31 ? 675  MET F CB    1 
ATOM   8057  C  CG    . MET D 2 158 ? 32.793  52.085 121.286 1.00 242.93 ? 675  MET F CG    1 
ATOM   8058  S  SD    . MET D 2 158 ? 33.799  51.806 122.757 1.00 243.99 ? 675  MET F SD    1 
ATOM   8059  C  CE    . MET D 2 158 ? 33.199  53.102 123.841 1.00 245.49 ? 675  MET F CE    1 
ATOM   8060  N  N     . ILE D 2 159 ? 30.000  50.320 119.023 1.00 239.76 ? 676  ILE F N     1 
ATOM   8061  C  CA    . ILE D 2 159 ? 30.227  49.437 117.867 1.00 237.36 ? 676  ILE F CA    1 
ATOM   8062  C  C     . ILE D 2 159 ? 29.207  49.586 116.730 1.00 235.72 ? 676  ILE F C     1 
ATOM   8063  O  O     . ILE D 2 159 ? 29.350  48.931 115.699 1.00 233.68 ? 676  ILE F O     1 
ATOM   8064  C  CB    . ILE D 2 159 ? 30.308  47.945 118.286 1.00 238.79 ? 676  ILE F CB    1 
ATOM   8065  C  CG1   . ILE D 2 159 ? 28.921  47.395 118.662 1.00 241.40 ? 676  ILE F CG1   1 
ATOM   8066  C  CG2   . ILE D 2 159 ? 31.325  47.766 119.408 1.00 238.78 ? 676  ILE F CG2   1 
ATOM   8067  C  CD1   . ILE D 2 159 ? 28.948  46.044 119.347 1.00 242.73 ? 676  ILE F CD1   1 
ATOM   8068  N  N     . PHE D 2 160 ? 28.184  50.422 116.910 1.00 235.47 ? 677  PHE F N     1 
ATOM   8069  C  CA    . PHE D 2 160 ? 27.200  50.677 115.846 1.00 235.12 ? 677  PHE F CA    1 
ATOM   8070  C  C     . PHE D 2 160 ? 27.137  52.143 115.393 1.00 232.85 ? 677  PHE F C     1 
ATOM   8071  O  O     . PHE D 2 160 ? 26.275  52.506 114.591 1.00 233.47 ? 677  PHE F O     1 
ATOM   8072  C  CB    . PHE D 2 160 ? 25.807  50.175 116.259 1.00 238.15 ? 677  PHE F CB    1 
ATOM   8073  C  CG    . PHE D 2 160 ? 25.535  48.750 115.861 1.00 239.28 ? 677  PHE F CG    1 
ATOM   8074  C  CD1   . PHE D 2 160 ? 25.213  48.436 114.548 1.00 239.47 ? 677  PHE F CD1   1 
ATOM   8075  C  CD2   . PHE D 2 160 ? 25.598  47.723 116.794 1.00 240.49 ? 677  PHE F CD2   1 
ATOM   8076  C  CE1   . PHE D 2 160 ? 24.961  47.127 114.172 1.00 240.58 ? 677  PHE F CE1   1 
ATOM   8077  C  CE2   . PHE D 2 160 ? 25.347  46.412 116.424 1.00 241.51 ? 677  PHE F CE2   1 
ATOM   8078  C  CZ    . PHE D 2 160 ? 25.028  46.113 115.111 1.00 241.47 ? 677  PHE F CZ    1 
ATOM   8079  N  N     . ASP D 2 161 ? 28.051  52.976 115.891 1.00 229.46 ? 678  ASP F N     1 
ATOM   8080  C  CA    . ASP D 2 161 ? 28.207  54.335 115.375 1.00 227.29 ? 678  ASP F CA    1 
ATOM   8081  C  C     . ASP D 2 161 ? 28.976  54.235 114.061 1.00 223.96 ? 678  ASP F C     1 
ATOM   8082  O  O     . ASP D 2 161 ? 30.194  54.044 114.057 1.00 221.98 ? 678  ASP F O     1 
ATOM   8083  C  CB    . ASP D 2 161 ? 28.950  55.224 116.381 1.00 227.14 ? 678  ASP F CB    1 
ATOM   8084  C  CG    . ASP D 2 161 ? 28.875  56.708 116.034 1.00 227.60 ? 678  ASP F CG    1 
ATOM   8085  O  OD1   . ASP D 2 161 ? 28.474  57.057 114.902 1.00 227.63 ? 678  ASP F OD1   1 
ATOM   8086  O  OD2   . ASP D 2 161 ? 29.223  57.532 116.905 1.00 228.34 ? 678  ASP F OD2   1 
ATOM   8087  N  N     . VAL D 2 162 ? 28.256  54.360 112.949 1.00 222.94 ? 679  VAL F N     1 
ATOM   8088  C  CA    . VAL D 2 162 ? 28.833  54.110 111.628 1.00 220.37 ? 679  VAL F CA    1 
ATOM   8089  C  C     . VAL D 2 162 ? 29.555  55.343 111.074 1.00 217.86 ? 679  VAL F C     1 
ATOM   8090  O  O     . VAL D 2 162 ? 30.413  55.218 110.200 1.00 216.03 ? 679  VAL F O     1 
ATOM   8091  C  CB    . VAL D 2 162 ? 27.769  53.627 110.614 1.00 221.77 ? 679  VAL F CB    1 
ATOM   8092  C  CG1   . VAL D 2 162 ? 28.442  53.086 109.359 1.00 220.70 ? 679  VAL F CG1   1 
ATOM   8093  C  CG2   . VAL D 2 162 ? 26.871  52.560 111.234 1.00 223.38 ? 679  VAL F CG2   1 
ATOM   8094  N  N     . GLU D 2 163 ? 29.216  56.527 111.582 1.00 217.22 ? 680  GLU F N     1 
ATOM   8095  C  CA    . GLU D 2 163 ? 29.926  57.754 111.208 1.00 215.20 ? 680  GLU F CA    1 
ATOM   8096  C  C     . GLU D 2 163 ? 31.360  57.739 111.746 1.00 212.48 ? 680  GLU F C     1 
ATOM   8097  O  O     . GLU D 2 163 ? 32.260  58.330 111.147 1.00 211.11 ? 680  GLU F O     1 
ATOM   8098  C  CB    . GLU D 2 163 ? 29.186  58.996 111.715 1.00 216.89 ? 680  GLU F CB    1 
ATOM   8099  C  CG    . GLU D 2 163 ? 29.566  60.278 110.987 1.00 216.62 ? 680  GLU F CG    1 
ATOM   8100  C  CD    . GLU D 2 163 ? 28.980  61.521 111.632 1.00 218.55 ? 680  GLU F CD    1 
ATOM   8101  O  OE1   . GLU D 2 163 ? 28.341  62.319 110.913 1.00 219.97 ? 680  GLU F OE1   1 
ATOM   8102  O  OE2   . GLU D 2 163 ? 29.156  61.702 112.856 1.00 218.90 ? 680  GLU F OE2   1 
ATOM   8103  N  N     . SER D 2 164 ? 31.562  57.068 112.880 1.00 211.64 ? 681  SER F N     1 
ATOM   8104  C  CA    . SER D 2 164 ? 32.903  56.825 113.411 1.00 209.84 ? 681  SER F CA    1 
ATOM   8105  C  C     . SER D 2 164 ? 33.674  55.861 112.507 1.00 207.57 ? 681  SER F C     1 
ATOM   8106  O  O     . SER D 2 164 ? 34.891  55.981 112.355 1.00 205.98 ? 681  SER F O     1 
ATOM   8107  C  CB    . SER D 2 164 ? 32.824  56.255 114.830 1.00 210.66 ? 681  SER F CB    1 
ATOM   8108  O  OG    . SER D 2 164 ? 32.099  57.119 115.688 1.00 212.36 ? 681  SER F OG    1 
ATOM   8109  N  N     . MET D 2 165 ? 32.955  54.908 111.916 1.00 207.31 ? 682  MET F N     1 
ATOM   8110  C  CA    . MET D 2 165 ? 33.538  53.972 110.954 1.00 205.88 ? 682  MET F CA    1 
ATOM   8111  C  C     . MET D 2 165 ? 33.848  54.656 109.620 1.00 203.99 ? 682  MET F C     1 
ATOM   8112  O  O     . MET D 2 165 ? 34.789  54.267 108.928 1.00 202.11 ? 682  MET F O     1 
ATOM   8113  C  CB    . MET D 2 165 ? 32.597  52.788 110.710 1.00 207.55 ? 682  MET F CB    1 
ATOM   8114  C  CG    . MET D 2 165 ? 32.265  51.960 111.942 1.00 208.92 ? 682  MET F CG    1 
ATOM   8115  S  SD    . MET D 2 165 ? 31.029  50.695 111.587 1.00 211.06 ? 682  MET F SD    1 
ATOM   8116  C  CE    . MET D 2 165 ? 30.887  49.892 113.179 1.00 212.39 ? 682  MET F CE    1 
ATOM   8117  N  N     . LYS D 2 166 ? 33.050  55.660 109.255 1.00 204.11 ? 683  LYS F N     1 
ATOM   8118  C  CA    . LYS D 2 166 ? 33.304  56.449 108.045 1.00 203.26 ? 683  LYS F CA    1 
ATOM   8119  C  C     . LYS D 2 166 ? 34.619  57.211 108.165 1.00 201.69 ? 683  LYS F C     1 
ATOM   8120  O  O     . LYS D 2 166 ? 35.471  57.132 107.278 1.00 200.45 ? 683  LYS F O     1 
ATOM   8121  C  CB    . LYS D 2 166 ? 32.169  57.442 107.778 1.00 204.83 ? 683  LYS F CB    1 
ATOM   8122  C  CG    . LYS D 2 166 ? 30.914  56.826 107.188 1.00 206.43 ? 683  LYS F CG    1 
ATOM   8123  C  CD    . LYS D 2 166 ? 29.921  57.909 106.803 1.00 208.60 ? 683  LYS F CD    1 
ATOM   8124  C  CE    . LYS D 2 166 ? 28.591  57.324 106.362 1.00 210.66 ? 683  LYS F CE    1 
ATOM   8125  N  NZ    . LYS D 2 166 ? 27.615  58.386 105.993 1.00 212.62 ? 683  LYS F NZ    1 
ATOM   8126  N  N     . LYS D 2 167 ? 34.770  57.949 109.264 1.00 201.80 ? 684  LYS F N     1 
ATOM   8127  C  CA    . LYS D 2 167 ? 36.020  58.648 109.575 1.00 200.65 ? 684  LYS F CA    1 
ATOM   8128  C  C     . LYS D 2 167 ? 37.222  57.708 109.496 1.00 198.65 ? 684  LYS F C     1 
ATOM   8129  O  O     . LYS D 2 167 ? 38.283  58.085 108.995 1.00 197.07 ? 684  LYS F O     1 
ATOM   8130  C  CB    . LYS D 2 167 ? 35.954  59.284 110.969 1.00 201.89 ? 684  LYS F CB    1 
ATOM   8131  C  CG    . LYS D 2 167 ? 37.320  59.566 111.579 1.00 201.36 ? 684  LYS F CG    1 
ATOM   8132  C  CD    . LYS D 2 167 ? 37.248  60.517 112.756 1.00 202.80 ? 684  LYS F CD    1 
ATOM   8133  C  CE    . LYS D 2 167 ? 38.576  60.540 113.492 1.00 202.30 ? 684  LYS F CE    1 
ATOM   8134  N  NZ    . LYS D 2 167 ? 38.636  59.518 114.575 1.00 202.21 ? 684  LYS F NZ    1 
ATOM   8135  N  N     . ALA D 2 168 ? 37.044  56.489 110.001 1.00 198.57 ? 685  ALA F N     1 
ATOM   8136  C  CA    . ALA D 2 168 ? 38.096  55.474 109.986 1.00 197.41 ? 685  ALA F CA    1 
ATOM   8137  C  C     . ALA D 2 168 ? 38.606  55.177 108.570 1.00 196.26 ? 685  ALA F C     1 
ATOM   8138  O  O     . ALA D 2 168 ? 39.778  54.846 108.391 1.00 195.39 ? 685  ALA F O     1 
ATOM   8139  C  CB    . ALA D 2 168 ? 37.600  54.196 110.651 1.00 197.94 ? 685  ALA F CB    1 
ATOM   8140  N  N     . MET D 2 169 ? 37.726  55.296 107.575 1.00 196.54 ? 686  MET F N     1 
ATOM   8141  C  CA    . MET D 2 169 ? 38.090  55.064 106.171 1.00 196.25 ? 686  MET F CA    1 
ATOM   8142  C  C     . MET D 2 169 ? 38.725  56.276 105.483 1.00 195.74 ? 686  MET F C     1 
ATOM   8143  O  O     . MET D 2 169 ? 39.358  56.126 104.437 1.00 194.93 ? 686  MET F O     1 
ATOM   8144  C  CB    . MET D 2 169 ? 36.861  54.627 105.368 1.00 197.48 ? 686  MET F CB    1 
ATOM   8145  C  CG    . MET D 2 169 ? 36.229  53.318 105.819 1.00 198.57 ? 686  MET F CG    1 
ATOM   8146  S  SD    . MET D 2 169 ? 37.295  51.876 105.620 1.00 198.00 ? 686  MET F SD    1 
ATOM   8147  C  CE    . MET D 2 169 ? 38.063  51.776 107.235 1.00 197.90 ? 686  MET F CE    1 
ATOM   8148  N  N     . VAL D 2 170 ? 38.556  57.465 106.060 1.00 196.39 ? 687  VAL F N     1 
ATOM   8149  C  CA    . VAL D 2 170 ? 39.075  58.702 105.456 1.00 196.24 ? 687  VAL F CA    1 
ATOM   8150  C  C     . VAL D 2 170 ? 40.596  58.651 105.290 1.00 194.83 ? 687  VAL F C     1 
ATOM   8151  O  O     . VAL D 2 170 ? 41.134  59.115 104.280 1.00 194.26 ? 687  VAL F O     1 
ATOM   8152  C  CB    . VAL D 2 170 ? 38.692  59.959 106.277 1.00 197.54 ? 687  VAL F CB    1 
ATOM   8153  C  CG1   . VAL D 2 170 ? 39.269  61.219 105.641 1.00 197.55 ? 687  VAL F CG1   1 
ATOM   8154  C  CG2   . VAL D 2 170 ? 37.179  60.092 106.404 1.00 199.03 ? 687  VAL F CG2   1 
ATOM   8155  N  N     . GLU D 2 171 ? 41.278  58.085 106.283 1.00 194.29 ? 688  GLU F N     1 
ATOM   8156  C  CA    . GLU D 2 171 ? 42.736  57.943 106.249 1.00 193.70 ? 688  GLU F CA    1 
ATOM   8157  C  C     . GLU D 2 171 ? 43.212  56.975 105.161 1.00 193.19 ? 688  GLU F C     1 
ATOM   8158  O  O     . GLU D 2 171 ? 44.313  57.130 104.630 1.00 192.75 ? 688  GLU F O     1 
ATOM   8159  C  CB    . GLU D 2 171 ? 43.262  57.502 107.620 1.00 194.04 ? 688  GLU F CB    1 
ATOM   8160  C  CG    . GLU D 2 171 ? 42.869  56.086 108.025 1.00 194.40 ? 688  GLU F CG    1 
ATOM   8161  C  CD    . GLU D 2 171 ? 42.739  55.909 109.529 1.00 195.30 ? 688  GLU F CD    1 
ATOM   8162  O  OE1   . GLU D 2 171 ? 43.300  54.929 110.063 1.00 195.62 ? 688  GLU F OE1   1 
ATOM   8163  O  OE2   . GLU D 2 171 ? 42.076  56.746 110.179 1.00 195.81 ? 688  GLU F OE2   1 
ATOM   8164  N  N     . TYR D 2 172 ? 42.383  55.985 104.833 1.00 193.80 ? 689  TYR F N     1 
ATOM   8165  C  CA    . TYR D 2 172 ? 42.693  55.034 103.761 1.00 193.95 ? 689  TYR F CA    1 
ATOM   8166  C  C     . TYR D 2 172 ? 42.538  55.638 102.356 1.00 194.80 ? 689  TYR F C     1 
ATOM   8167  O  O     . TYR D 2 172 ? 43.037  55.072 101.384 1.00 194.12 ? 689  TYR F O     1 
ATOM   8168  C  CB    . TYR D 2 172 ? 41.812  53.783 103.879 1.00 194.09 ? 689  TYR F CB    1 
ATOM   8169  C  CG    . TYR D 2 172 ? 42.185  52.852 105.013 1.00 193.54 ? 689  TYR F CG    1 
ATOM   8170  C  CD1   . TYR D 2 172 ? 43.400  52.173 105.011 1.00 192.92 ? 689  TYR F CD1   1 
ATOM   8171  C  CD2   . TYR D 2 172 ? 41.314  52.630 106.077 1.00 193.78 ? 689  TYR F CD2   1 
ATOM   8172  C  CE1   . TYR D 2 172 ? 43.744  51.314 106.043 1.00 192.99 ? 689  TYR F CE1   1 
ATOM   8173  C  CE2   . TYR D 2 172 ? 41.647  51.772 107.113 1.00 193.72 ? 689  TYR F CE2   1 
ATOM   8174  C  CZ    . TYR D 2 172 ? 42.862  51.117 107.092 1.00 193.26 ? 689  TYR F CZ    1 
ATOM   8175  O  OH    . TYR D 2 172 ? 43.196  50.264 108.120 1.00 193.22 ? 689  TYR F OH    1 
ATOM   8176  N  N     . GLU D 2 173 ? 41.847  56.775 102.262 1.00 196.88 ? 690  GLU F N     1 
ATOM   8177  C  CA    . GLU D 2 173 ? 41.592  57.474 100.991 1.00 198.65 ? 690  GLU F CA    1 
ATOM   8178  C  C     . GLU D 2 173 ? 40.562  56.757 100.109 1.00 200.98 ? 690  GLU F C     1 
ATOM   8179  O  O     . GLU D 2 173 ? 40.593  56.879 98.882  1.00 201.14 ? 690  GLU F O     1 
ATOM   8180  C  CB    . GLU D 2 173 ? 42.891  57.736 100.208 1.00 198.02 ? 690  GLU F CB    1 
ATOM   8181  C  CG    . GLU D 2 173 ? 43.950  58.496 100.993 1.00 197.66 ? 690  GLU F CG    1 
ATOM   8182  C  CD    . GLU D 2 173 ? 45.254  58.634 100.230 1.00 197.28 ? 690  GLU F CD    1 
ATOM   8183  O  OE1   . GLU D 2 173 ? 45.820  57.597 99.822  1.00 196.60 ? 690  GLU F OE1   1 
ATOM   8184  O  OE2   . GLU D 2 173 ? 45.719  59.778 100.040 1.00 198.15 ? 690  GLU F OE2   1 
ATOM   8185  N  N     . ILE D 2 174 ? 39.651  56.017 100.742 1.00 203.97 ? 691  ILE F N     1 
ATOM   8186  C  CA    . ILE D 2 174 ? 38.475  55.476 100.058 1.00 207.36 ? 691  ILE F CA    1 
ATOM   8187  C  C     . ILE D 2 174 ? 37.509  56.631 99.801  1.00 211.06 ? 691  ILE F C     1 
ATOM   8188  O  O     . ILE D 2 174 ? 37.437  57.573 100.594 1.00 211.76 ? 691  ILE F O     1 
ATOM   8189  C  CB    . ILE D 2 174 ? 37.791  54.359 100.892 1.00 207.66 ? 691  ILE F CB    1 
ATOM   8190  C  CG1   . ILE D 2 174 ? 38.521  53.023 100.700 1.00 207.18 ? 691  ILE F CG1   1 
ATOM   8191  C  CG2   . ILE D 2 174 ? 36.314  54.193 100.535 1.00 209.12 ? 691  ILE F CG2   1 
ATOM   8192  C  CD1   . ILE D 2 174 ? 38.210  52.318 99.393  1.00 207.92 ? 691  ILE F CD1   1 
ATOM   8193  N  N     . ASP D 2 175 ? 36.781  56.559 98.690  1.00 215.13 ? 692  ASP F N     1 
ATOM   8194  C  CA    . ASP D 2 175 ? 35.790  57.577 98.351  1.00 219.05 ? 692  ASP F CA    1 
ATOM   8195  C  C     . ASP D 2 175 ? 34.717  57.647 99.439  1.00 222.96 ? 692  ASP F C     1 
ATOM   8196  O  O     . ASP D 2 175 ? 34.083  56.643 99.762  1.00 224.05 ? 692  ASP F O     1 
ATOM   8197  C  CB    . ASP D 2 175 ? 35.150  57.270 96.993  1.00 219.82 ? 692  ASP F CB    1 
ATOM   8198  C  CG    . ASP D 2 175 ? 34.247  58.389 96.501  1.00 221.13 ? 692  ASP F CG    1 
ATOM   8199  O  OD1   . ASP D 2 175 ? 34.511  59.570 96.816  1.00 220.78 ? 692  ASP F OD1   1 
ATOM   8200  O  OD2   . ASP D 2 175 ? 33.273  58.082 95.787  1.00 222.61 ? 692  ASP F OD2   1 
ATOM   8201  N  N     . LEU D 2 176 ? 34.530  58.836 100.005 1.00 226.96 ? 693  LEU F N     1 
ATOM   8202  C  CA    . LEU D 2 176 ? 33.610  59.037 101.126 1.00 230.62 ? 693  LEU F CA    1 
ATOM   8203  C  C     . LEU D 2 176 ? 32.202  59.405 100.662 1.00 235.24 ? 693  LEU F C     1 
ATOM   8204  O  O     . LEU D 2 176 ? 31.230  59.200 101.392 1.00 236.74 ? 693  LEU F O     1 
ATOM   8205  C  CB    . LEU D 2 176 ? 34.135  60.145 102.042 1.00 230.58 ? 693  LEU F CB    1 
ATOM   8206  C  CG    . LEU D 2 176 ? 35.595  60.036 102.489 1.00 228.80 ? 693  LEU F CG    1 
ATOM   8207  C  CD1   . LEU D 2 176 ? 36.036  61.326 103.164 1.00 228.90 ? 693  LEU F CD1   1 
ATOM   8208  C  CD2   . LEU D 2 176 ? 35.788  58.838 103.407 1.00 227.88 ? 693  LEU F CD2   1 
ATOM   8209  N  N     . GLN D 2 177 ? 32.104  59.950 99.451  1.00 238.80 ? 694  GLN F N     1 
ATOM   8210  C  CA    . GLN D 2 177 ? 30.853  60.507 98.934  1.00 243.23 ? 694  GLN F CA    1 
ATOM   8211  C  C     . GLN D 2 177 ? 29.712  59.489 98.829  1.00 246.19 ? 694  GLN F C     1 
ATOM   8212  O  O     . GLN D 2 177 ? 28.746  59.566 99.591  1.00 247.69 ? 694  GLN F O     1 
ATOM   8213  C  CB    . GLN D 2 177 ? 31.093  61.170 97.571  1.00 244.03 ? 694  GLN F CB    1 
ATOM   8214  C  CG    . GLN D 2 177 ? 31.899  62.461 97.641  1.00 243.84 ? 694  GLN F CG    1 
ATOM   8215  C  CD    . GLN D 2 177 ? 31.064  63.662 98.060  1.00 245.93 ? 694  GLN F CD    1 
ATOM   8216  O  OE1   . GLN D 2 177 ? 29.972  63.885 97.535  1.00 248.16 ? 694  GLN F OE1   1 
ATOM   8217  N  NE2   . GLN D 2 177 ? 31.580  64.451 98.999  1.00 245.72 ? 694  GLN F NE2   1 
ATOM   8218  N  N     . LYS D 2 178 ? 29.828  58.538 97.902  1.00 247.77 ? 695  LYS F N     1 
ATOM   8219  C  CA    . LYS D 2 178 ? 28.710  57.641 97.572  1.00 250.94 ? 695  LYS F CA    1 
ATOM   8220  C  C     . LYS D 2 178 ? 28.940  56.157 97.904  1.00 251.48 ? 695  LYS F C     1 
ATOM   8221  O  O     . LYS D 2 178 ? 28.196  55.296 97.429  1.00 253.53 ? 695  LYS F O     1 
ATOM   8222  C  CB    . LYS D 2 178 ? 28.319  57.798 96.092  1.00 252.46 ? 695  LYS F CB    1 
ATOM   8223  C  CG    . LYS D 2 178 ? 29.267  57.160 95.083  1.00 251.30 ? 695  LYS F CG    1 
ATOM   8224  C  CD    . LYS D 2 178 ? 30.273  58.150 94.520  1.00 250.15 ? 695  LYS F CD    1 
ATOM   8225  C  CE    . LYS D 2 178 ? 31.198  57.471 93.523  1.00 249.16 ? 695  LYS F CE    1 
ATOM   8226  N  NZ    . LYS D 2 178 ? 32.283  58.372 93.050  1.00 247.94 ? 695  LYS F NZ    1 
ATOM   8227  N  N     . MET D 2 179 ? 29.952  55.860 98.717  1.00 250.64 ? 696  MET F N     1 
ATOM   8228  C  CA    . MET D 2 179 ? 30.196  54.484 99.166  1.00 250.74 ? 696  MET F CA    1 
ATOM   8229  C  C     . MET D 2 179 ? 29.235  53.974 100.255 1.00 252.64 ? 696  MET F C     1 
ATOM   8230  O  O     . MET D 2 179 ? 29.009  52.765 100.336 1.00 252.73 ? 696  MET F O     1 
ATOM   8231  C  CB    . MET D 2 179 ? 31.650  54.306 99.627  1.00 248.21 ? 696  MET F CB    1 
ATOM   8232  C  CG    . MET D 2 179 ? 32.684  54.343 98.507  1.00 246.86 ? 696  MET F CG    1 
ATOM   8233  S  SD    . MET D 2 179 ? 32.477  53.082 97.231  1.00 247.56 ? 696  MET F SD    1 
ATOM   8234  C  CE    . MET D 2 179 ? 31.605  54.009 95.968  1.00 249.27 ? 696  MET F CE    1 
ATOM   8235  N  N     . PRO D 2 180 ? 28.674  54.871 101.097 1.00 254.35 ? 697  PRO F N     1 
ATOM   8236  C  CA    . PRO D 2 180 ? 27.704  54.344 102.070 1.00 256.18 ? 697  PRO F CA    1 
ATOM   8237  C  C     . PRO D 2 180 ? 26.372  53.929 101.439 1.00 259.35 ? 697  PRO F C     1 
ATOM   8238  O  O     . PRO D 2 180 ? 25.842  52.866 101.772 1.00 260.45 ? 697  PRO F O     1 
ATOM   8239  C  CB    . PRO D 2 180 ? 27.504  55.507 103.049 1.00 256.27 ? 697  PRO F CB    1 
ATOM   8240  C  CG    . PRO D 2 180 ? 27.906  56.726 102.303 1.00 255.87 ? 697  PRO F CG    1 
ATOM   8241  C  CD    . PRO D 2 180 ? 28.960  56.302 101.325 1.00 254.17 ? 697  PRO F CD    1 
ATOM   8242  N  N     . LEU D 2 181 ? 25.847  54.757 100.538 1.00 261.27 ? 698  LEU F N     1 
ATOM   8243  C  CA    . LEU D 2 181 ? 24.610  54.434 99.818  1.00 264.20 ? 698  LEU F CA    1 
ATOM   8244  C  C     . LEU D 2 181 ? 24.866  53.436 98.686  1.00 264.58 ? 698  LEU F C     1 
ATOM   8245  O  O     . LEU D 2 181 ? 24.021  52.582 98.405  1.00 267.18 ? 698  LEU F O     1 
ATOM   8246  C  CB    . LEU D 2 181 ? 23.917  55.695 99.275  1.00 265.62 ? 698  LEU F CB    1 
ATOM   8247  C  CG    . LEU D 2 181 ? 24.735  56.746 98.511  1.00 264.21 ? 698  LEU F CG    1 
ATOM   8248  C  CD1   . LEU D 2 181 ? 23.997  57.219 97.267  1.00 266.30 ? 698  LEU F CD1   1 
ATOM   8249  C  CD2   . LEU D 2 181 ? 25.081  57.931 99.405  1.00 263.13 ? 698  LEU F CD2   1 
ATOM   8250  N  N     . GLY D 2 182 ? 26.029  53.548 98.046  1.00 262.22 ? 699  GLY F N     1 
ATOM   8251  C  CA    . GLY D 2 182 ? 26.416  52.642 96.968  1.00 261.38 ? 699  GLY F CA    1 
ATOM   8252  C  C     . GLY D 2 182 ? 27.180  51.428 97.464  1.00 258.98 ? 699  GLY F C     1 
ATOM   8253  O  O     . GLY D 2 182 ? 28.392  51.499 97.678  1.00 256.74 ? 699  GLY F O     1 
ATOM   8254  N  N     . LYS D 2 183 ? 26.471  50.314 97.642  1.00 259.08 ? 700  LYS F N     1 
ATOM   8255  C  CA    . LYS D 2 183 ? 27.085  49.069 98.103  1.00 256.93 ? 700  LYS F CA    1 
ATOM   8256  C  C     . LYS D 2 183 ? 27.904  48.417 96.993  1.00 254.63 ? 700  LYS F C     1 
ATOM   8257  O  O     . LYS D 2 183 ? 27.354  48.006 95.971  1.00 256.35 ? 700  LYS F O     1 
ATOM   8258  C  CB    . LYS D 2 183 ? 26.019  48.085 98.600  1.00 259.68 ? 700  LYS F CB    1 
ATOM   8259  C  CG    . LYS D 2 183 ? 25.356  48.493 99.906  1.00 260.34 ? 700  LYS F CG    1 
ATOM   8260  C  CD    . LYS D 2 183 ? 24.351  47.452 100.381 1.00 262.91 ? 700  LYS F CD    1 
ATOM   8261  C  CE    . LYS D 2 183 ? 23.019  47.562 99.653  1.00 266.22 ? 700  LYS F CE    1 
ATOM   8262  N  NZ    . LYS D 2 183 ? 22.179  48.678 100.168 1.00 267.37 ? 700  LYS F NZ    1 
ATOM   8263  N  N     . LEU D 2 184 ? 29.216  48.325 97.202  1.00 250.21 ? 701  LEU F N     1 
ATOM   8264  C  CA    . LEU D 2 184 ? 30.111  47.678 96.247  1.00 248.17 ? 701  LEU F CA    1 
ATOM   8265  C  C     . LEU D 2 184 ? 29.932  46.160 96.333  1.00 248.22 ? 701  LEU F C     1 
ATOM   8266  O  O     . LEU D 2 184 ? 29.817  45.605 97.427  1.00 248.01 ? 701  LEU F O     1 
ATOM   8267  C  CB    . LEU D 2 184 ? 31.567  48.072 96.526  1.00 245.19 ? 701  LEU F CB    1 
ATOM   8268  C  CG    . LEU D 2 184 ? 32.584  47.809 95.413  1.00 244.34 ? 701  LEU F CG    1 
ATOM   8269  C  CD1   . LEU D 2 184 ? 32.292  48.661 94.186  1.00 245.00 ? 701  LEU F CD1   1 
ATOM   8270  C  CD2   . LEU D 2 184 ? 33.999  48.064 95.912  1.00 241.89 ? 701  LEU F CD2   1 
ATOM   8271  N  N     . SER D 2 185 ? 29.909  45.499 95.177  1.00 247.96 ? 702  SER F N     1 
ATOM   8272  C  CA    . SER D 2 185 ? 29.557  44.075 95.093  1.00 248.48 ? 702  SER F CA    1 
ATOM   8273  C  C     . SER D 2 185 ? 30.565  43.152 95.778  1.00 245.76 ? 702  SER F C     1 
ATOM   8274  O  O     . SER D 2 185 ? 31.695  43.546 96.065  1.00 243.10 ? 702  SER F O     1 
ATOM   8275  C  CB    . SER D 2 185 ? 29.390  43.655 93.628  1.00 250.27 ? 702  SER F CB    1 
ATOM   8276  O  OG    . SER D 2 185 ? 29.054  42.281 93.519  1.00 252.38 ? 702  SER F OG    1 
ATOM   8277  N  N     . LYS D 2 186 ? 30.134  41.918 96.029  1.00 245.71 ? 703  LYS F N     1 
ATOM   8278  C  CA    . LYS D 2 186 ? 30.967  40.917 96.696  1.00 243.44 ? 703  LYS F CA    1 
ATOM   8279  C  C     . LYS D 2 186 ? 31.965  40.315 95.709  1.00 242.13 ? 703  LYS F C     1 
ATOM   8280  O  O     . LYS D 2 186 ? 33.128  40.096 96.049  1.00 240.19 ? 703  LYS F O     1 
ATOM   8281  C  CB    . LYS D 2 186 ? 30.096  39.811 97.307  1.00 245.49 ? 703  LYS F CB    1 
ATOM   8282  C  CG    . LYS D 2 186 ? 30.593  39.299 98.649  1.00 244.12 ? 703  LYS F CG    1 
ATOM   8283  C  CD    . LYS D 2 186 ? 30.269  40.279 99.767  1.00 242.27 ? 703  LYS F CD    1 
ATOM   8284  C  CE    . LYS D 2 186 ? 30.650  39.726 101.130 1.00 241.28 ? 703  LYS F CE    1 
ATOM   8285  N  NZ    . LYS D 2 186 ? 32.107  39.439 101.240 1.00 239.24 ? 703  LYS F NZ    1 
ATOM   8286  N  N     . ARG D 2 187 ? 31.497  40.051 94.490  1.00 242.66 ? 704  ARG F N     1 
ATOM   8287  C  CA    . ARG D 2 187 ? 32.354  39.556 93.408  1.00 241.95 ? 704  ARG F CA    1 
ATOM   8288  C  C     . ARG D 2 187 ? 33.403  40.601 93.021  1.00 237.80 ? 704  ARG F C     1 
ATOM   8289  O  O     . ARG D 2 187 ? 34.513  40.255 92.612  1.00 237.46 ? 704  ARG F O     1 
ATOM   8290  C  CB    . ARG D 2 187 ? 31.515  39.194 92.177  1.00 245.23 ? 704  ARG F CB    1 
ATOM   8291  C  CG    . ARG D 2 187 ? 30.501  38.079 92.397  1.00 248.58 ? 704  ARG F CG    1 
ATOM   8292  C  CD    . ARG D 2 187 ? 29.527  37.980 91.232  1.00 251.96 ? 704  ARG F CD    1 
ATOM   8293  N  NE    . ARG D 2 187 ? 28.377  37.129 91.535  1.00 255.35 ? 704  ARG F NE    1 
ATOM   8294  C  CZ    . ARG D 2 187 ? 27.345  36.926 90.716  1.00 258.85 ? 704  ARG F CZ    1 
ATOM   8295  N  NH1   . ARG D 2 187 ? 27.297  37.510 89.521  1.00 259.56 ? 704  ARG F NH1   1 
ATOM   8296  N  NH2   . ARG D 2 187 ? 26.350  36.131 91.094  1.00 261.81 ? 704  ARG F NH2   1 
ATOM   8297  N  N     . GLN D 2 188 ? 33.034  41.876 93.146  1.00 234.12 ? 705  GLN F N     1 
ATOM   8298  C  CA    . GLN D 2 188 ? 33.938  42.995 92.878  1.00 229.65 ? 705  GLN F CA    1 
ATOM   8299  C  C     . GLN D 2 188 ? 35.094  43.033 93.877  1.00 224.78 ? 705  GLN F C     1 
ATOM   8300  O  O     . GLN D 2 188 ? 36.258  43.121 93.485  1.00 223.76 ? 705  GLN F O     1 
ATOM   8301  C  CB    . GLN D 2 188 ? 33.161  44.317 92.936  1.00 229.50 ? 705  GLN F CB    1 
ATOM   8302  C  CG    . GLN D 2 188 ? 33.996  45.575 92.724  1.00 227.45 ? 705  GLN F CG    1 
ATOM   8303  C  CD    . GLN D 2 188 ? 33.967  46.085 91.298  1.00 228.16 ? 705  GLN F CD    1 
ATOM   8304  O  OE1   . GLN D 2 188 ? 33.939  45.307 90.344  1.00 229.66 ? 705  GLN F OE1   1 
ATOM   8305  N  NE2   . GLN D 2 188 ? 33.988  47.404 91.147  1.00 227.09 ? 705  GLN F NE2   1 
ATOM   8306  N  N     . ILE D 2 189 ? 34.763  42.972 95.165  1.00 221.04 ? 706  ILE F N     1 
ATOM   8307  C  CA    . ILE D 2 189 ? 35.766  43.071 96.231  1.00 216.74 ? 706  ILE F CA    1 
ATOM   8308  C  C     . ILE D 2 189 ? 36.710  41.863 96.224  1.00 215.36 ? 706  ILE F C     1 
ATOM   8309  O  O     . ILE D 2 189 ? 37.889  41.992 96.561  1.00 213.13 ? 706  ILE F O     1 
ATOM   8310  C  CB    . ILE D 2 189 ? 35.102  43.236 97.618  1.00 216.17 ? 706  ILE F CB    1 
ATOM   8311  C  CG1   . ILE D 2 189 ? 34.336  44.564 97.683  1.00 215.74 ? 706  ILE F CG1   1 
ATOM   8312  C  CG2   . ILE D 2 189 ? 36.145  43.206 98.729  1.00 214.36 ? 706  ILE F CG2   1 
ATOM   8313  C  CD1   . ILE D 2 189 ? 33.297  44.627 98.782  1.00 216.31 ? 706  ILE F CD1   1 
ATOM   8314  N  N     . GLN D 2 190 ? 36.190  40.698 95.838  1.00 215.92 ? 707  GLN F N     1 
ATOM   8315  C  CA    . GLN D 2 190 ? 37.017  39.499 95.665  1.00 215.64 ? 707  GLN F CA    1 
ATOM   8316  C  C     . GLN D 2 190 ? 38.054  39.686 94.556  1.00 213.94 ? 707  GLN F C     1 
ATOM   8317  O  O     . GLN D 2 190 ? 39.190  39.228 94.680  1.00 213.78 ? 707  GLN F O     1 
ATOM   8318  C  CB    . GLN D 2 190 ? 36.145  38.278 95.357  1.00 218.56 ? 707  GLN F CB    1 
ATOM   8319  C  CG    . GLN D 2 190 ? 35.409  37.724 96.568  1.00 219.29 ? 707  GLN F CG    1 
ATOM   8320  C  CD    . GLN D 2 190 ? 34.486  36.567 96.225  1.00 222.21 ? 707  GLN F CD    1 
ATOM   8321  O  OE1   . GLN D 2 190 ? 34.255  36.263 95.054  1.00 223.66 ? 707  GLN F OE1   1 
ATOM   8322  N  NE2   . GLN D 2 190 ? 33.951  35.916 97.252  1.00 223.15 ? 707  GLN F NE2   1 
ATOM   8323  N  N     . ALA D 2 191 ? 37.654  40.353 93.475  1.00 212.42 ? 708  ALA F N     1 
ATOM   8324  C  CA    . ALA D 2 191 ? 38.572  40.680 92.384  1.00 210.30 ? 708  ALA F CA    1 
ATOM   8325  C  C     . ALA D 2 191 ? 39.579  41.745 92.819  1.00 206.29 ? 708  ALA F C     1 
ATOM   8326  O  O     . ALA D 2 191 ? 40.737  41.710 92.407  1.00 205.35 ? 708  ALA F O     1 
ATOM   8327  C  CB    . ALA D 2 191 ? 37.802  41.143 91.157  1.00 211.47 ? 708  ALA F CB    1 
ATOM   8328  N  N     . ALA D 2 192 ? 39.131  42.687 93.648  1.00 203.45 ? 709  ALA F N     1 
ATOM   8329  C  CA    . ALA D 2 192 ? 40.021  43.695 94.227  1.00 199.94 ? 709  ALA F CA    1 
ATOM   8330  C  C     . ALA D 2 192 ? 41.067  43.045 95.131  1.00 198.35 ? 709  ALA F C     1 
ATOM   8331  O  O     . ALA D 2 192 ? 42.231  43.448 95.128  1.00 197.22 ? 709  ALA F O     1 
ATOM   8332  C  CB    . ALA D 2 192 ? 39.223  44.731 95.002  1.00 198.71 ? 709  ALA F CB    1 
ATOM   8333  N  N     . TYR D 2 193 ? 40.642  42.048 95.905  1.00 198.14 ? 710  TYR F N     1 
ATOM   8334  C  CA    . TYR D 2 193 ? 41.566  41.227 96.692  1.00 197.28 ? 710  TYR F CA    1 
ATOM   8335  C  C     . TYR D 2 193 ? 42.556  40.495 95.789  1.00 198.28 ? 710  TYR F C     1 
ATOM   8336  O  O     . TYR D 2 193 ? 43.753  40.448 96.078  1.00 197.08 ? 710  TYR F O     1 
ATOM   8337  C  CB    . TYR D 2 193 ? 40.808  40.191 97.533  1.00 198.16 ? 710  TYR F CB    1 
ATOM   8338  C  CG    . TYR D 2 193 ? 40.393  40.665 98.908  1.00 196.84 ? 710  TYR F CG    1 
ATOM   8339  C  CD1   . TYR D 2 193 ? 41.346  41.025 99.858  1.00 195.15 ? 710  TYR F CD1   1 
ATOM   8340  C  CD2   . TYR D 2 193 ? 39.050  40.722 99.272  1.00 197.59 ? 710  TYR F CD2   1 
ATOM   8341  C  CE1   . TYR D 2 193 ? 40.973  41.447 101.123 1.00 194.53 ? 710  TYR F CE1   1 
ATOM   8342  C  CE2   . TYR D 2 193 ? 38.668  41.142 100.535 1.00 196.95 ? 710  TYR F CE2   1 
ATOM   8343  C  CZ    . TYR D 2 193 ? 39.632  41.501 101.456 1.00 195.55 ? 710  TYR F CZ    1 
ATOM   8344  O  OH    . TYR D 2 193 ? 39.254  41.920 102.710 1.00 195.51 ? 710  TYR F OH    1 
ATOM   8345  N  N     . SER D 2 194 ? 42.044  39.920 94.702  1.00 200.75 ? 711  SER F N     1 
ATOM   8346  C  CA    . SER D 2 194 ? 42.868  39.167 93.756  1.00 202.70 ? 711  SER F CA    1 
ATOM   8347  C  C     . SER D 2 194 ? 43.943  40.037 93.112  1.00 201.87 ? 711  SER F C     1 
ATOM   8348  O  O     . SER D 2 194 ? 45.069  39.583 92.908  1.00 202.32 ? 711  SER F O     1 
ATOM   8349  C  CB    . SER D 2 194 ? 41.997  38.530 92.669  1.00 205.04 ? 711  SER F CB    1 
ATOM   8350  O  OG    . SER D 2 194 ? 41.077  37.612 93.227  1.00 206.74 ? 711  SER F OG    1 
ATOM   8351  N  N     . ILE D 2 195 ? 43.595  41.283 92.798  1.00 201.12 ? 712  ILE F N     1 
ATOM   8352  C  CA    . ILE D 2 195 ? 44.555  42.225 92.224  1.00 200.55 ? 712  ILE F CA    1 
ATOM   8353  C  C     . ILE D 2 195 ? 45.680  42.514 93.222  1.00 199.65 ? 712  ILE F C     1 
ATOM   8354  O  O     . ILE D 2 195 ? 46.848  42.544 92.842  1.00 199.59 ? 712  ILE F O     1 
ATOM   8355  C  CB    . ILE D 2 195 ? 43.878  43.541 91.774  1.00 199.83 ? 712  ILE F CB    1 
ATOM   8356  C  CG1   . ILE D 2 195 ? 42.933  43.277 90.594  1.00 201.87 ? 712  ILE F CG1   1 
ATOM   8357  C  CG2   . ILE D 2 195 ? 44.921  44.571 91.358  1.00 198.59 ? 712  ILE F CG2   1 
ATOM   8358  C  CD1   . ILE D 2 195 ? 41.887  44.353 90.385  1.00 201.71 ? 712  ILE F CD1   1 
ATOM   8359  N  N     . LEU D 2 196 ? 45.329  42.713 94.492  1.00 199.72 ? 713  LEU F N     1 
ATOM   8360  C  CA    . LEU D 2 196 ? 46.329  42.933 95.543  1.00 199.49 ? 713  LEU F CA    1 
ATOM   8361  C  C     . LEU D 2 196 ? 47.273  41.740 95.686  1.00 201.55 ? 713  LEU F C     1 
ATOM   8362  O  O     . LEU D 2 196 ? 48.483  41.917 95.833  1.00 201.62 ? 713  LEU F O     1 
ATOM   8363  C  CB    . LEU D 2 196 ? 45.663  43.216 96.895  1.00 198.66 ? 713  LEU F CB    1 
ATOM   8364  C  CG    . LEU D 2 196 ? 44.923  44.542 97.083  1.00 197.47 ? 713  LEU F CG    1 
ATOM   8365  C  CD1   . LEU D 2 196 ? 44.452  44.663 98.525  1.00 197.01 ? 713  LEU F CD1   1 
ATOM   8366  C  CD2   . LEU D 2 196 ? 45.792  45.733 96.706  1.00 196.38 ? 713  LEU F CD2   1 
ATOM   8367  N  N     . SER D 2 197 ? 46.716  40.531 95.646  1.00 203.79 ? 714  SER F N     1 
ATOM   8368  C  CA    . SER D 2 197 ? 47.517  39.309 95.736  1.00 205.85 ? 714  SER F CA    1 
ATOM   8369  C  C     . SER D 2 197 ? 48.424  39.136 94.516  1.00 207.30 ? 714  SER F C     1 
ATOM   8370  O  O     . SER D 2 197 ? 49.517  38.577 94.627  1.00 208.32 ? 714  SER F O     1 
ATOM   8371  C  CB    . SER D 2 197 ? 46.618  38.081 95.905  1.00 207.71 ? 714  SER F CB    1 
ATOM   8372  O  OG    . SER D 2 197 ? 45.822  37.863 94.755  1.00 209.14 ? 714  SER F OG    1 
ATOM   8373  N  N     . GLU D 2 198 ? 47.966  39.612 93.359  1.00 208.01 ? 715  GLU F N     1 
ATOM   8374  C  CA    . GLU D 2 198 ? 48.789  39.619 92.147  1.00 209.43 ? 715  GLU F CA    1 
ATOM   8375  C  C     . GLU D 2 198 ? 49.949  40.615 92.255  1.00 209.08 ? 715  GLU F C     1 
ATOM   8376  O  O     . GLU D 2 198 ? 51.027  40.371 91.708  1.00 209.75 ? 715  GLU F O     1 
ATOM   8377  C  CB    . GLU D 2 198 ? 47.943  39.934 90.905  1.00 209.63 ? 715  GLU F CB    1 
ATOM   8378  C  CG    . GLU D 2 198 ? 47.110  38.762 90.406  1.00 211.63 ? 715  GLU F CG    1 
ATOM   8379  C  CD    . GLU D 2 198 ? 46.401  39.057 89.096  1.00 212.23 ? 715  GLU F CD    1 
ATOM   8380  O  OE1   . GLU D 2 198 ? 47.076  39.467 88.129  1.00 212.06 ? 715  GLU F OE1   1 
ATOM   8381  O  OE2   . GLU D 2 198 ? 45.168  38.869 89.029  1.00 212.72 ? 715  GLU F OE2   1 
ATOM   8382  N  N     . VAL D 2 199 ? 49.726  41.728 92.955  1.00 208.72 ? 716  VAL F N     1 
ATOM   8383  C  CA    . VAL D 2 199 ? 50.764  42.750 93.137  1.00 208.52 ? 716  VAL F CA    1 
ATOM   8384  C  C     . VAL D 2 199 ? 51.896  42.222 94.017  1.00 210.70 ? 716  VAL F C     1 
ATOM   8385  O  O     . VAL D 2 199 ? 53.067  42.391 93.685  1.00 211.70 ? 716  VAL F O     1 
ATOM   8386  C  CB    . VAL D 2 199 ? 50.203  44.057 93.747  1.00 206.21 ? 716  VAL F CB    1 
ATOM   8387  C  CG1   . VAL D 2 199 ? 51.327  45.039 94.053  1.00 205.17 ? 716  VAL F CG1   1 
ATOM   8388  C  CG2   . VAL D 2 199 ? 49.206  44.708 92.803  1.00 205.79 ? 716  VAL F CG2   1 
ATOM   8389  N  N     . GLN D 2 200 ? 51.544  41.588 95.134  1.00 212.78 ? 717  GLN F N     1 
ATOM   8390  C  CA    . GLN D 2 200 ? 52.539  40.997 96.035  1.00 214.89 ? 717  GLN F CA    1 
ATOM   8391  C  C     . GLN D 2 200 ? 53.383  39.951 95.311  1.00 217.34 ? 717  GLN F C     1 
ATOM   8392  O  O     . GLN D 2 200 ? 54.602  39.896 95.491  1.00 217.83 ? 717  GLN F O     1 
ATOM   8393  C  CB    . GLN D 2 200 ? 51.862  40.381 97.267  1.00 215.74 ? 717  GLN F CB    1 
ATOM   8394  C  CG    . GLN D 2 200 ? 52.810  39.653 98.219  1.00 217.47 ? 717  GLN F CG    1 
ATOM   8395  C  CD    . GLN D 2 200 ? 52.770  38.137 98.084  1.00 220.57 ? 717  GLN F CD    1 
ATOM   8396  O  OE1   . GLN D 2 200 ? 52.507  37.598 97.008  1.00 222.15 ? 717  GLN F OE1   1 
ATOM   8397  N  NE2   . GLN D 2 200 ? 53.036  37.439 99.185  1.00 221.92 ? 717  GLN F NE2   1 
ATOM   8398  N  N     . GLN D 2 201 ? 52.726  39.122 94.503  1.00 219.19 ? 718  GLN F N     1 
ATOM   8399  C  CA    . GLN D 2 201 ? 53.417  38.142 93.668  1.00 221.91 ? 718  GLN F CA    1 
ATOM   8400  C  C     . GLN D 2 201 ? 54.365  38.843 92.695  1.00 222.61 ? 718  GLN F C     1 
ATOM   8401  O  O     . GLN D 2 201 ? 55.492  38.393 92.488  1.00 224.49 ? 718  GLN F O     1 
ATOM   8402  C  CB    . GLN D 2 201 ? 52.406  37.295 92.889  1.00 223.16 ? 718  GLN F CB    1 
ATOM   8403  C  CG    . GLN D 2 201 ? 53.007  36.078 92.199  1.00 225.76 ? 718  GLN F CG    1 
ATOM   8404  C  CD    . GLN D 2 201 ? 52.141  35.556 91.067  1.00 227.42 ? 718  GLN F CD    1 
ATOM   8405  O  OE1   . GLN D 2 201 ? 51.676  34.417 91.101  1.00 229.66 ? 718  GLN F OE1   1 
ATOM   8406  N  NE2   . GLN D 2 201 ? 51.919  36.391 90.057  1.00 226.75 ? 718  GLN F NE2   1 
ATOM   8407  N  N     . ALA D 2 202 ? 53.900  39.944 92.107  1.00 221.99 ? 719  ALA F N     1 
ATOM   8408  C  CA    . ALA D 2 202 ? 54.710  40.736 91.181  1.00 222.55 ? 719  ALA F CA    1 
ATOM   8409  C  C     . ALA D 2 202 ? 55.866  41.449 91.888  1.00 222.57 ? 719  ALA F C     1 
ATOM   8410  O  O     . ALA D 2 202 ? 56.962  41.559 91.335  1.00 223.41 ? 719  ALA F O     1 
ATOM   8411  C  CB    . ALA D 2 202 ? 53.836  41.744 90.448  1.00 221.24 ? 719  ALA F CB    1 
ATOM   8412  N  N     . VAL D 2 203 ? 55.614  41.931 93.104  1.00 222.21 ? 720  VAL F N     1 
ATOM   8413  C  CA    . VAL D 2 203 ? 56.636  42.611 93.907  1.00 222.37 ? 720  VAL F CA    1 
ATOM   8414  C  C     . VAL D 2 203 ? 57.701  41.634 94.416  1.00 225.28 ? 720  VAL F C     1 
ATOM   8415  O  O     . VAL D 2 203 ? 58.889  41.963 94.431  1.00 226.19 ? 720  VAL F O     1 
ATOM   8416  C  CB    . VAL D 2 203 ? 56.000  43.366 95.102  1.00 220.30 ? 720  VAL F CB    1 
ATOM   8417  C  CG1   . VAL D 2 203 ? 57.051  43.792 96.122  1.00 219.95 ? 720  VAL F CG1   1 
ATOM   8418  C  CG2   . VAL D 2 203 ? 55.226  44.581 94.610  1.00 218.61 ? 720  VAL F CG2   1 
ATOM   8419  N  N     . SER D 2 204 ? 57.271  40.442 94.827  1.00 227.63 ? 721  SER F N     1 
ATOM   8420  C  CA    . SER D 2 204 ? 58.172  39.448 95.420  1.00 230.24 ? 721  SER F CA    1 
ATOM   8421  C  C     . SER D 2 204 ? 59.288  39.008 94.470  1.00 232.60 ? 721  SER F C     1 
ATOM   8422  O  O     . SER D 2 204 ? 60.451  38.934 94.871  1.00 233.69 ? 721  SER F O     1 
ATOM   8423  C  CB    . SER D 2 204 ? 57.381  38.223 95.889  1.00 231.42 ? 721  SER F CB    1 
ATOM   8424  O  OG    . SER D 2 204 ? 56.682  37.621 94.813  1.00 232.60 ? 721  SER F OG    1 
ATOM   8425  N  N     . GLN D 2 205 ? 58.931  38.726 93.218  1.00 233.55 ? 722  GLN F N     1 
ATOM   8426  C  CA    . GLN D 2 205 ? 59.901  38.266 92.215  1.00 235.68 ? 722  GLN F CA    1 
ATOM   8427  C  C     . GLN D 2 205 ? 60.293  39.368 91.219  1.00 234.63 ? 722  GLN F C     1 
ATOM   8428  O  O     . GLN D 2 205 ? 60.633  39.082 90.068  1.00 236.32 ? 722  GLN F O     1 
ATOM   8429  C  CB    . GLN D 2 205 ? 59.373  37.017 91.488  1.00 237.74 ? 722  GLN F CB    1 
ATOM   8430  C  CG    . GLN D 2 205 ? 58.144  37.232 90.612  1.00 237.07 ? 722  GLN F CG    1 
ATOM   8431  C  CD    . GLN D 2 205 ? 57.405  35.938 90.311  1.00 239.22 ? 722  GLN F CD    1 
ATOM   8432  O  OE1   . GLN D 2 205 ? 57.997  34.858 90.299  1.00 241.46 ? 722  GLN F OE1   1 
ATOM   8433  N  NE2   . GLN D 2 205 ? 56.103  36.043 90.067  1.00 238.66 ? 722  GLN F NE2   1 
ATOM   8434  N  N     . GLY D 2 206 ? 60.259  40.619 91.680  1.00 231.83 ? 723  GLY F N     1 
ATOM   8435  C  CA    . GLY D 2 206 ? 60.697  41.774 90.892  1.00 230.31 ? 723  GLY F CA    1 
ATOM   8436  C  C     . GLY D 2 206 ? 60.223  41.778 89.452  1.00 229.87 ? 723  GLY F C     1 
ATOM   8437  O  O     . GLY D 2 206 ? 61.035  41.786 88.527  1.00 230.89 ? 723  GLY F O     1 
ATOM   8438  N  N     . SER D 2 207 ? 58.905  41.777 89.266  1.00 227.78 ? 724  SER F N     1 
ATOM   8439  C  CA    . SER D 2 207 ? 58.309  41.765 87.929  1.00 227.39 ? 724  SER F CA    1 
ATOM   8440  C  C     . SER D 2 207 ? 58.407  43.137 87.261  1.00 225.43 ? 724  SER F C     1 
ATOM   8441  O  O     . SER D 2 207 ? 58.854  44.108 87.876  1.00 223.98 ? 724  SER F O     1 
ATOM   8442  C  CB    . SER D 2 207 ? 56.848  41.310 88.003  1.00 227.08 ? 724  SER F CB    1 
ATOM   8443  O  OG    . SER D 2 207 ? 56.756  39.989 88.507  1.00 228.32 ? 724  SER F OG    1 
ATOM   8444  N  N     . SER D 2 208 ? 57.986  43.206 86.000  1.00 225.15 ? 725  SER F N     1 
ATOM   8445  C  CA    . SER D 2 208 ? 58.073  44.433 85.205  1.00 223.65 ? 725  SER F CA    1 
ATOM   8446  C  C     . SER D 2 208 ? 57.292  45.594 85.817  1.00 220.20 ? 725  SER F C     1 
ATOM   8447  O  O     . SER D 2 208 ? 56.364  45.389 86.602  1.00 219.10 ? 725  SER F O     1 
ATOM   8448  C  CB    . SER D 2 208 ? 57.561  44.178 83.784  1.00 225.36 ? 725  SER F CB    1 
ATOM   8449  O  OG    . SER D 2 208 ? 58.294  43.141 83.156  1.00 227.97 ? 725  SER F OG    1 
ATOM   8450  N  N     . ASP D 2 209 ? 57.681  46.813 85.452  1.00 218.39 ? 726  ASP F N     1 
ATOM   8451  C  CA    . ASP D 2 209 ? 56.960  48.012 85.876  1.00 216.16 ? 726  ASP F CA    1 
ATOM   8452  C  C     . ASP D 2 209 ? 55.570  48.047 85.246  1.00 215.46 ? 726  ASP F C     1 
ATOM   8453  O  O     . ASP D 2 209 ? 54.610  48.466 85.887  1.00 214.38 ? 726  ASP F O     1 
ATOM   8454  C  CB    . ASP D 2 209 ? 57.738  49.280 85.506  1.00 215.96 ? 726  ASP F CB    1 
ATOM   8455  C  CG    . ASP D 2 209 ? 59.043  49.416 86.276  1.00 216.10 ? 726  ASP F CG    1 
ATOM   8456  O  OD1   . ASP D 2 209 ? 59.109  48.970 87.441  1.00 215.87 ? 726  ASP F OD1   1 
ATOM   8457  O  OD2   . ASP D 2 209 ? 60.004  49.981 85.713  1.00 216.66 ? 726  ASP F OD2   1 
ATOM   8458  N  N     . SER D 2 210 ? 55.475  47.601 83.993  1.00 215.97 ? 727  SER F N     1 
ATOM   8459  C  CA    . SER D 2 210 ? 54.197  47.504 83.283  1.00 215.71 ? 727  SER F CA    1 
ATOM   8460  C  C     . SER D 2 210 ? 53.239  46.538 83.981  1.00 215.24 ? 727  SER F C     1 
ATOM   8461  O  O     . SER D 2 210 ? 52.057  46.843 84.155  1.00 214.88 ? 727  SER F O     1 
ATOM   8462  C  CB    . SER D 2 210 ? 54.425  47.050 81.839  1.00 217.40 ? 727  SER F CB    1 
ATOM   8463  O  OG    . SER D 2 210 ? 53.210  47.020 81.110  1.00 217.87 ? 727  SER F OG    1 
ATOM   8464  N  N     . GLN D 2 211 ? 53.759  45.374 84.365  1.00 215.38 ? 728  GLN F N     1 
ATOM   8465  C  CA    . GLN D 2 211 ? 53.007  44.392 85.153  1.00 214.76 ? 728  GLN F CA    1 
ATOM   8466  C  C     . GLN D 2 211 ? 52.434  45.034 86.420  1.00 211.30 ? 728  GLN F C     1 
ATOM   8467  O  O     . GLN D 2 211 ? 51.254  44.862 86.728  1.00 211.30 ? 728  GLN F O     1 
ATOM   8468  C  CB    . GLN D 2 211 ? 53.912  43.199 85.506  1.00 216.46 ? 728  GLN F CB    1 
ATOM   8469  C  CG    . GLN D 2 211 ? 53.381  42.240 86.568  1.00 216.84 ? 728  GLN F CG    1 
ATOM   8470  C  CD    . GLN D 2 211 ? 52.300  41.301 86.058  1.00 218.72 ? 728  GLN F CD    1 
ATOM   8471  O  OE1   . GLN D 2 211 ? 51.674  41.546 85.026  1.00 219.66 ? 728  GLN F OE1   1 
ATOM   8472  N  NE2   . GLN D 2 211 ? 52.076  40.213 86.789  1.00 219.72 ? 728  GLN F NE2   1 
ATOM   8473  N  N     . ILE D 2 212 ? 53.277  45.771 87.141  1.00 208.03 ? 729  ILE F N     1 
ATOM   8474  C  CA    . ILE D 2 212 ? 52.854  46.492 88.346  1.00 204.77 ? 729  ILE F CA    1 
ATOM   8475  C  C     . ILE D 2 212 ? 51.903  47.643 88.006  1.00 202.09 ? 729  ILE F C     1 
ATOM   8476  O  O     . ILE D 2 212 ? 50.908  47.853 88.702  1.00 201.18 ? 729  ILE F O     1 
ATOM   8477  C  CB    . ILE D 2 212 ? 54.073  47.022 89.142  1.00 204.43 ? 729  ILE F CB    1 
ATOM   8478  C  CG1   . ILE D 2 212 ? 54.785  45.858 89.839  1.00 205.42 ? 729  ILE F CG1   1 
ATOM   8479  C  CG2   . ILE D 2 212 ? 53.649  48.064 90.174  1.00 202.86 ? 729  ILE F CG2   1 
ATOM   8480  C  CD1   . ILE D 2 212 ? 56.139  46.209 90.419  1.00 205.37 ? 729  ILE F CD1   1 
ATOM   8481  N  N     . LEU D 2 213 ? 52.215  48.382 86.941  1.00 200.34 ? 730  LEU F N     1 
ATOM   8482  C  CA    . LEU D 2 213 ? 51.387  49.512 86.500  1.00 198.36 ? 730  LEU F CA    1 
ATOM   8483  C  C     . LEU D 2 213 ? 49.947  49.058 86.251  1.00 197.69 ? 730  LEU F C     1 
ATOM   8484  O  O     . LEU D 2 213 ? 48.995  49.731 86.654  1.00 196.71 ? 730  LEU F O     1 
ATOM   8485  C  CB    . LEU D 2 213 ? 51.955  50.145 85.215  1.00 199.05 ? 730  LEU F CB    1 
ATOM   8486  C  CG    . LEU D 2 213 ? 51.949  51.673 85.046  1.00 198.09 ? 730  LEU F CG    1 
ATOM   8487  C  CD1   . LEU D 2 213 ? 50.735  52.332 85.682  1.00 196.92 ? 730  LEU F CD1   1 
ATOM   8488  C  CD2   . LEU D 2 213 ? 53.229  52.280 85.604  1.00 197.48 ? 730  LEU F CD2   1 
ATOM   8489  N  N     . ASP D 2 214 ? 49.802  47.913 85.588  1.00 198.14 ? 731  ASP F N     1 
ATOM   8490  C  CA    . ASP D 2 214 ? 48.491  47.343 85.270  1.00 198.50 ? 731  ASP F CA    1 
ATOM   8491  C  C     . ASP D 2 214 ? 47.658  47.070 86.513  1.00 196.43 ? 731  ASP F C     1 
ATOM   8492  O  O     . ASP D 2 214 ? 46.502  47.482 86.593  1.00 195.93 ? 731  ASP F O     1 
ATOM   8493  C  CB    . ASP D 2 214 ? 48.658  46.058 84.446  1.00 200.94 ? 731  ASP F CB    1 
ATOM   8494  C  CG    . ASP D 2 214 ? 47.336  45.360 84.165  1.00 202.58 ? 731  ASP F CG    1 
ATOM   8495  O  OD1   . ASP D 2 214 ? 46.726  45.637 83.115  1.00 204.00 ? 731  ASP F OD1   1 
ATOM   8496  O  OD2   . ASP D 2 214 ? 46.903  44.536 84.998  1.00 202.98 ? 731  ASP F OD2   1 
ATOM   8497  N  N     . LEU D 2 215 ? 48.255  46.385 87.480  1.00 194.92 ? 732  LEU F N     1 
ATOM   8498  C  CA    . LEU D 2 215 ? 47.546  46.005 88.697  1.00 193.71 ? 732  LEU F CA    1 
ATOM   8499  C  C     . LEU D 2 215 ? 47.169  47.229 89.528  1.00 190.80 ? 732  LEU F C     1 
ATOM   8500  O  O     . LEU D 2 215 ? 46.092  47.272 90.126  1.00 190.53 ? 732  LEU F O     1 
ATOM   8501  C  CB    . LEU D 2 215 ? 48.397  45.047 89.527  1.00 194.27 ? 732  LEU F CB    1 
ATOM   8502  C  CG    . LEU D 2 215 ? 48.790  43.736 88.842  1.00 196.32 ? 732  LEU F CG    1 
ATOM   8503  C  CD1   . LEU D 2 215 ? 49.855  43.017 89.653  1.00 196.82 ? 732  LEU F CD1   1 
ATOM   8504  C  CD2   . LEU D 2 215 ? 47.575  42.847 88.626  1.00 197.60 ? 732  LEU F CD2   1 
ATOM   8505  N  N     . SER D 2 216 ? 48.057  48.220 89.557  1.00 188.14 ? 733  SER F N     1 
ATOM   8506  C  CA    . SER D 2 216 ? 47.785  49.478 90.247  1.00 185.31 ? 733  SER F CA    1 
ATOM   8507  C  C     . SER D 2 216 ? 46.630  50.220 89.574  1.00 184.40 ? 733  SER F C     1 
ATOM   8508  O  O     . SER D 2 216 ? 45.735  50.722 90.253  1.00 183.53 ? 733  SER F O     1 
ATOM   8509  C  CB    . SER D 2 216 ? 49.038  50.355 90.283  1.00 184.45 ? 733  SER F CB    1 
ATOM   8510  O  OG    . SER D 2 216 ? 50.154  49.635 90.779  1.00 184.40 ? 733  SER F OG    1 
ATOM   8511  N  N     . ASN D 2 217 ? 46.649  50.280 88.242  1.00 184.21 ? 734  ASN F N     1 
ATOM   8512  C  CA    . ASN D 2 217 ? 45.521  50.819 87.477  1.00 184.09 ? 734  ASN F CA    1 
ATOM   8513  C  C     . ASN D 2 217 ? 44.247  50.036 87.765  1.00 183.58 ? 734  ASN F C     1 
ATOM   8514  O  O     . ASN D 2 217 ? 43.230  50.613 88.148  1.00 182.84 ? 734  ASN F O     1 
ATOM   8515  C  CB    . ASN D 2 217 ? 45.799  50.780 85.969  1.00 185.90 ? 734  ASN F CB    1 
ATOM   8516  C  CG    . ASN D 2 217 ? 46.741  51.877 85.513  1.00 185.67 ? 734  ASN F CG    1 
ATOM   8517  O  OD1   . ASN D 2 217 ? 46.612  53.032 85.918  1.00 184.95 ? 734  ASN F OD1   1 
ATOM   8518  N  ND2   . ASN D 2 217 ? 47.680  51.525 84.643  1.00 186.56 ? 734  ASN F ND2   1 
ATOM   8519  N  N     . ARG D 2 218 ? 44.323  48.719 87.582  1.00 183.63 ? 735  ARG F N     1 
ATOM   8520  C  CA    . ARG D 2 218 ? 43.181  47.826 87.793  1.00 184.12 ? 735  ARG F CA    1 
ATOM   8521  C  C     . ARG D 2 218 ? 42.519  48.019 89.157  1.00 181.89 ? 735  ARG F C     1 
ATOM   8522  O  O     . ARG D 2 218 ? 41.292  48.061 89.251  1.00 182.29 ? 735  ARG F O     1 
ATOM   8523  C  CB    . ARG D 2 218 ? 43.604  46.359 87.643  1.00 185.80 ? 735  ARG F CB    1 
ATOM   8524  C  CG    . ARG D 2 218 ? 43.767  45.880 86.207  1.00 187.99 ? 735  ARG F CG    1 
ATOM   8525  C  CD    . ARG D 2 218 ? 43.363  44.421 86.071  1.00 190.11 ? 735  ARG F CD    1 
ATOM   8526  N  NE    . ARG D 2 218 ? 41.917  44.249 86.221  1.00 191.35 ? 735  ARG F NE    1 
ATOM   8527  C  CZ    . ARG D 2 218 ? 41.299  43.086 86.428  1.00 193.09 ? 735  ARG F CZ    1 
ATOM   8528  N  NH1   . ARG D 2 218 ? 41.987  41.951 86.523  1.00 193.98 ? 735  ARG F NH1   1 
ATOM   8529  N  NH2   . ARG D 2 218 ? 39.976  43.060 86.546  1.00 194.11 ? 735  ARG F NH2   1 
ATOM   8530  N  N     . PHE D 2 219 ? 43.332  48.137 90.205  1.00 179.50 ? 736  PHE F N     1 
ATOM   8531  C  CA    . PHE D 2 219 ? 42.819  48.248 91.571  1.00 178.13 ? 736  PHE F CA    1 
ATOM   8532  C  C     . PHE D 2 219 ? 42.046  49.547 91.798  1.00 177.48 ? 736  PHE F C     1 
ATOM   8533  O  O     . PHE D 2 219 ? 40.919  49.521 92.294  1.00 177.84 ? 736  PHE F O     1 
ATOM   8534  C  CB    . PHE D 2 219 ? 43.960  48.138 92.588  1.00 176.53 ? 736  PHE F CB    1 
ATOM   8535  C  CG    . PHE D 2 219 ? 43.495  48.121 94.018  1.00 175.51 ? 736  PHE F CG    1 
ATOM   8536  C  CD1   . PHE D 2 219 ? 43.111  46.931 94.622  1.00 176.30 ? 736  PHE F CD1   1 
ATOM   8537  C  CD2   . PHE D 2 219 ? 43.434  49.295 94.758  1.00 174.17 ? 736  PHE F CD2   1 
ATOM   8538  C  CE1   . PHE D 2 219 ? 42.678  46.912 95.937  1.00 175.87 ? 736  PHE F CE1   1 
ATOM   8539  C  CE2   . PHE D 2 219 ? 43.001  49.282 96.073  1.00 173.77 ? 736  PHE F CE2   1 
ATOM   8540  C  CZ    . PHE D 2 219 ? 42.623  48.089 96.664  1.00 174.54 ? 736  PHE F CZ    1 
ATOM   8541  N  N     . TYR D 2 220 ? 42.654  50.675 91.437  1.00 176.76 ? 737  TYR F N     1 
ATOM   8542  C  CA    . TYR D 2 220 ? 42.037  51.987 91.658  1.00 176.39 ? 737  TYR F CA    1 
ATOM   8543  C  C     . TYR D 2 220 ? 40.818  52.229 90.767  1.00 178.08 ? 737  TYR F C     1 
ATOM   8544  O  O     . TYR D 2 220 ? 39.951  53.033 91.115  1.00 178.50 ? 737  TYR F O     1 
ATOM   8545  C  CB    . TYR D 2 220 ? 43.052  53.117 91.462  1.00 175.42 ? 737  TYR F CB    1 
ATOM   8546  C  CG    . TYR D 2 220 ? 44.209  53.088 92.440  1.00 174.15 ? 737  TYR F CG    1 
ATOM   8547  C  CD1   . TYR D 2 220 ? 43.990  53.000 93.815  1.00 173.48 ? 737  TYR F CD1   1 
ATOM   8548  C  CD2   . TYR D 2 220 ? 45.523  53.167 91.992  1.00 173.78 ? 737  TYR F CD2   1 
ATOM   8549  C  CE1   . TYR D 2 220 ? 45.047  52.975 94.710  1.00 172.51 ? 737  TYR F CE1   1 
ATOM   8550  C  CE2   . TYR D 2 220 ? 46.586  53.145 92.879  1.00 172.81 ? 737  TYR F CE2   1 
ATOM   8551  C  CZ    . TYR D 2 220 ? 46.344  53.050 94.237  1.00 172.18 ? 737  TYR F CZ    1 
ATOM   8552  O  OH    . TYR D 2 220 ? 47.396  53.030 95.124  1.00 171.43 ? 737  TYR F OH    1 
ATOM   8553  N  N     . THR D 2 221 ? 40.758  51.551 89.621  1.00 179.69 ? 738  THR F N     1 
ATOM   8554  C  CA    . THR D 2 221 ? 39.553  51.570 88.792  1.00 181.77 ? 738  THR F CA    1 
ATOM   8555  C  C     . THR D 2 221 ? 38.441  50.832 89.528  1.00 182.67 ? 738  THR F C     1 
ATOM   8556  O  O     . THR D 2 221 ? 37.324  51.333 89.651  1.00 183.50 ? 738  THR F O     1 
ATOM   8557  C  CB    . THR D 2 221 ? 39.754  50.885 87.418  1.00 183.27 ? 738  THR F CB    1 
ATOM   8558  O  OG1   . THR D 2 221 ? 41.131  50.931 87.030  1.00 182.41 ? 738  THR F OG1   1 
ATOM   8559  C  CG2   . THR D 2 221 ? 38.896  51.561 86.353  1.00 184.93 ? 738  THR F CG2   1 
ATOM   8560  N  N     . LEU D 2 222 ? 38.777  49.648 90.036  1.00 182.78 ? 739  LEU F N     1 
ATOM   8561  C  CA    . LEU D 2 222 ? 37.805  48.752 90.661  1.00 183.93 ? 739  LEU F CA    1 
ATOM   8562  C  C     . LEU D 2 222 ? 37.295  49.294 91.998  1.00 182.57 ? 739  LEU F C     1 
ATOM   8563  O  O     . LEU D 2 222 ? 36.115  49.144 92.321  1.00 183.91 ? 739  LEU F O     1 
ATOM   8564  C  CB    . LEU D 2 222 ? 38.423  47.358 90.849  1.00 184.59 ? 739  LEU F CB    1 
ATOM   8565  C  CG    . LEU D 2 222 ? 37.482  46.157 90.767  1.00 187.02 ? 739  LEU F CG    1 
ATOM   8566  C  CD1   . LEU D 2 222 ? 36.942  45.988 89.355  1.00 189.38 ? 739  LEU F CD1   1 
ATOM   8567  C  CD2   . LEU D 2 222 ? 38.204  44.894 91.205  1.00 187.16 ? 739  LEU F CD2   1 
ATOM   8568  N  N     . ILE D 2 223 ? 38.187  49.914 92.768  1.00 180.23 ? 740  ILE F N     1 
ATOM   8569  C  CA    . ILE D 2 223 ? 37.817  50.569 94.023  1.00 178.95 ? 740  ILE F CA    1 
ATOM   8570  C  C     . ILE D 2 223 ? 38.155  52.061 93.929  1.00 177.56 ? 740  ILE F C     1 
ATOM   8571  O  O     . ILE D 2 223 ? 39.332  52.426 93.919  1.00 176.27 ? 740  ILE F O     1 
ATOM   8572  C  CB    . ILE D 2 223 ? 38.537  49.930 95.229  1.00 177.87 ? 740  ILE F CB    1 
ATOM   8573  C  CG1   . ILE D 2 223 ? 38.149  48.449 95.338  1.00 179.19 ? 740  ILE F CG1   1 
ATOM   8574  C  CG2   . ILE D 2 223 ? 38.191  50.668 96.517  1.00 177.10 ? 740  ILE F CG2   1 
ATOM   8575  C  CD1   . ILE D 2 223 ? 38.781  47.708 96.497  1.00 178.72 ? 740  ILE F CD1   1 
ATOM   8576  N  N     . PRO D 2 224 ? 37.124  52.929 93.866  1.00 177.79 ? 741  PRO F N     1 
ATOM   8577  C  CA    . PRO D 2 224 ? 37.359  54.362 93.672  1.00 177.16 ? 741  PRO F CA    1 
ATOM   8578  C  C     . PRO D 2 224 ? 37.996  55.037 94.885  1.00 175.57 ? 741  PRO F C     1 
ATOM   8579  O  O     . PRO D 2 224 ? 37.428  55.012 95.978  1.00 175.68 ? 741  PRO F O     1 
ATOM   8580  C  CB    . PRO D 2 224 ? 35.954  54.920 93.423  1.00 178.84 ? 741  PRO F CB    1 
ATOM   8581  C  CG    . PRO D 2 224 ? 35.043  53.969 94.111  1.00 179.69 ? 741  PRO F CG    1 
ATOM   8582  C  CD    . PRO D 2 224 ? 35.688  52.619 93.996  1.00 179.32 ? 741  PRO F CD    1 
ATOM   8583  N  N     . HIS D 2 225 ? 39.171  55.627 94.676  1.00 174.48 ? 742  HIS F N     1 
ATOM   8584  C  CA    . HIS D 2 225 ? 39.903  56.327 95.729  1.00 173.40 ? 742  HIS F CA    1 
ATOM   8585  C  C     . HIS D 2 225 ? 39.798  57.837 95.539  1.00 174.03 ? 742  HIS F C     1 
ATOM   8586  O  O     . HIS D 2 225 ? 39.478  58.314 94.448  1.00 174.76 ? 742  HIS F O     1 
ATOM   8587  C  CB    . HIS D 2 225 ? 41.377  55.921 95.709  1.00 172.20 ? 742  HIS F CB    1 
ATOM   8588  C  CG    . HIS D 2 225 ? 41.651  54.584 96.325  1.00 171.86 ? 742  HIS F CG    1 
ATOM   8589  N  ND1   . HIS D 2 225 ? 40.884  53.468 96.067  1.00 172.64 ? 742  HIS F ND1   1 
ATOM   8590  C  CD2   . HIS D 2 225 ? 42.627  54.180 97.172  1.00 170.98 ? 742  HIS F CD2   1 
ATOM   8591  C  CE1   . HIS D 2 225 ? 41.367  52.439 96.739  1.00 172.37 ? 742  HIS F CE1   1 
ATOM   8592  N  NE2   . HIS D 2 225 ? 42.426  52.844 97.415  1.00 171.32 ? 742  HIS F NE2   1 
ATOM   8593  N  N     . ASP D 2 226 ? 40.081  58.577 96.608  1.00 174.35 ? 743  ASP F N     1 
ATOM   8594  C  CA    . ASP D 2 226 ? 40.067  60.038 96.580  1.00 175.53 ? 743  ASP F CA    1 
ATOM   8595  C  C     . ASP D 2 226 ? 41.460  60.581 96.901  1.00 174.41 ? 743  ASP F C     1 
ATOM   8596  O  O     . ASP D 2 226 ? 41.831  60.710 98.071  1.00 173.64 ? 743  ASP F O     1 
ATOM   8597  C  CB    . ASP D 2 226 ? 39.032  60.578 97.577  1.00 176.93 ? 743  ASP F CB    1 
ATOM   8598  C  CG    . ASP D 2 226 ? 38.975  62.102 97.610  1.00 178.29 ? 743  ASP F CG    1 
ATOM   8599  O  OD1   . ASP D 2 226 ? 39.399  62.754 96.630  1.00 179.09 ? 743  ASP F OD1   1 
ATOM   8600  O  OD2   . ASP D 2 226 ? 38.494  62.651 98.622  1.00 179.31 ? 743  ASP F OD2   1 
ATOM   8601  N  N     . PHE D 2 227 ? 42.225  60.887 95.854  1.00 174.25 ? 744  PHE F N     1 
ATOM   8602  C  CA    . PHE D 2 227 ? 43.551  61.489 96.002  1.00 173.90 ? 744  PHE F CA    1 
ATOM   8603  C  C     . PHE D 2 227 ? 43.526  62.994 95.734  1.00 175.20 ? 744  PHE F C     1 
ATOM   8604  O  O     . PHE D 2 227 ? 44.557  63.659 95.833  1.00 175.24 ? 744  PHE F O     1 
ATOM   8605  C  CB    . PHE D 2 227 ? 44.551  60.824 95.054  1.00 173.31 ? 744  PHE F CB    1 
ATOM   8606  C  CG    . PHE D 2 227 ? 44.549  59.325 95.126  1.00 172.60 ? 744  PHE F CG    1 
ATOM   8607  C  CD1   . PHE D 2 227 ? 44.947  58.671 96.286  1.00 171.73 ? 744  PHE F CD1   1 
ATOM   8608  C  CD2   . PHE D 2 227 ? 44.155  58.565 94.032  1.00 172.96 ? 744  PHE F CD2   1 
ATOM   8609  C  CE1   . PHE D 2 227 ? 44.947  57.288 96.355  1.00 171.32 ? 744  PHE F CE1   1 
ATOM   8610  C  CE2   . PHE D 2 227 ? 44.155  57.182 94.095  1.00 172.54 ? 744  PHE F CE2   1 
ATOM   8611  C  CZ    . PHE D 2 227 ? 44.553  56.544 95.257  1.00 171.71 ? 744  PHE F CZ    1 
ATOM   8612  N  N     . GLY D 2 228 ? 42.353  63.527 95.397  1.00 176.70 ? 745  GLY F N     1 
ATOM   8613  C  CA    . GLY D 2 228 ? 42.212  64.945 95.084  1.00 178.26 ? 745  GLY F CA    1 
ATOM   8614  C  C     . GLY D 2 228 ? 42.789  65.284 93.721  1.00 178.85 ? 745  GLY F C     1 
ATOM   8615  O  O     . GLY D 2 228 ? 42.386  64.702 92.711  1.00 178.94 ? 745  GLY F O     1 
ATOM   8616  N  N     . MET D 2 229 ? 43.742  66.215 93.697  1.00 179.51 ? 746  MET F N     1 
ATOM   8617  C  CA    . MET D 2 229 ? 44.340  66.700 92.449  1.00 180.53 ? 746  MET F CA    1 
ATOM   8618  C  C     . MET D 2 229 ? 45.711  66.084 92.147  1.00 180.02 ? 746  MET F C     1 
ATOM   8619  O  O     . MET D 2 229 ? 46.414  66.558 91.250  1.00 180.38 ? 746  MET F O     1 
ATOM   8620  C  CB    . MET D 2 229 ? 44.474  68.229 92.493  1.00 181.97 ? 746  MET F CB    1 
ATOM   8621  C  CG    . MET D 2 229 ? 43.159  68.992 92.483  1.00 183.46 ? 746  MET F CG    1 
ATOM   8622  S  SD    . MET D 2 229 ? 42.313  68.948 90.892  1.00 184.52 ? 746  MET F SD    1 
ATOM   8623  C  CE    . MET D 2 229 ? 41.045  67.731 91.227  1.00 183.96 ? 746  MET F CE    1 
ATOM   8624  N  N     . LYS D 2 230 ? 46.092  65.035 92.877  1.00 179.56 ? 747  LYS F N     1 
ATOM   8625  C  CA    . LYS D 2 230 ? 47.383  64.375 92.651  1.00 179.42 ? 747  LYS F CA    1 
ATOM   8626  C  C     . LYS D 2 230 ? 47.216  62.939 92.156  1.00 179.03 ? 747  LYS F C     1 
ATOM   8627  O  O     . LYS D 2 230 ? 46.142  62.345 92.273  1.00 179.09 ? 747  LYS F O     1 
ATOM   8628  C  CB    . LYS D 2 230 ? 48.266  64.428 93.906  1.00 179.28 ? 747  LYS F CB    1 
ATOM   8629  C  CG    . LYS D 2 230 ? 47.613  63.944 95.192  1.00 178.95 ? 747  LYS F CG    1 
ATOM   8630  C  CD    . LYS D 2 230 ? 48.633  63.759 96.309  1.00 178.83 ? 747  LYS F CD    1 
ATOM   8631  C  CE    . LYS D 2 230 ? 49.266  65.076 96.736  1.00 180.11 ? 747  LYS F CE    1 
ATOM   8632  N  NZ    . LYS D 2 230 ? 50.214  64.901 97.872  1.00 180.29 ? 747  LYS F NZ    1 
ATOM   8633  N  N     . LYS D 2 231 ? 48.298  62.398 91.603  1.00 179.05 ? 748  LYS F N     1 
ATOM   8634  C  CA    . LYS D 2 231 ? 48.274  61.107 90.916  1.00 179.20 ? 748  LYS F CA    1 
ATOM   8635  C  C     . LYS D 2 231 ? 48.121  59.937 91.892  1.00 178.33 ? 748  LYS F C     1 
ATOM   8636  O  O     . LYS D 2 231 ? 48.701  59.963 92.979  1.00 177.32 ? 748  LYS F O     1 
ATOM   8637  C  CB    . LYS D 2 231 ? 49.559  60.918 90.103  1.00 179.81 ? 748  LYS F CB    1 
ATOM   8638  C  CG    . LYS D 2 231 ? 49.758  61.940 88.990  1.00 181.11 ? 748  LYS F CG    1 
ATOM   8639  C  CD    . LYS D 2 231 ? 51.198  61.989 88.491  1.00 181.64 ? 748  LYS F CD    1 
ATOM   8640  C  CE    . LYS D 2 231 ? 51.543  60.830 87.565  1.00 181.99 ? 748  LYS F CE    1 
ATOM   8641  N  NZ    . LYS D 2 231 ? 51.810  59.543 88.271  1.00 181.29 ? 748  LYS F NZ    1 
ATOM   8642  N  N     . PRO D 2 232 ? 47.329  58.914 91.512  1.00 178.78 ? 749  PRO F N     1 
ATOM   8643  C  CA    . PRO D 2 232 ? 47.275  57.668 92.281  1.00 178.28 ? 749  PRO F CA    1 
ATOM   8644  C  C     . PRO D 2 232 ? 48.658  57.020 92.414  1.00 178.15 ? 749  PRO F C     1 
ATOM   8645  O  O     . PRO D 2 232 ? 49.339  56.833 91.403  1.00 178.33 ? 749  PRO F O     1 
ATOM   8646  C  CB    . PRO D 2 232 ? 46.348  56.780 91.447  1.00 178.84 ? 749  PRO F CB    1 
ATOM   8647  C  CG    . PRO D 2 232 ? 45.469  57.729 90.715  1.00 179.68 ? 749  PRO F CG    1 
ATOM   8648  C  CD    . PRO D 2 232 ? 46.295  58.956 90.459  1.00 179.68 ? 749  PRO F CD    1 
ATOM   8649  N  N     . PRO D 2 233 ? 49.075  56.687 93.651  1.00 178.11 ? 750  PRO F N     1 
ATOM   8650  C  CA    . PRO D 2 233 ? 50.408  56.125 93.865  1.00 178.38 ? 750  PRO F CA    1 
ATOM   8651  C  C     . PRO D 2 233 ? 50.497  54.650 93.476  1.00 178.83 ? 750  PRO F C     1 
ATOM   8652  O  O     . PRO D 2 233 ? 49.563  53.887 93.724  1.00 178.50 ? 750  PRO F O     1 
ATOM   8653  C  CB    . PRO D 2 233 ? 50.619  56.298 95.370  1.00 178.03 ? 750  PRO F CB    1 
ATOM   8654  C  CG    . PRO D 2 233 ? 49.248  56.221 95.945  1.00 177.72 ? 750  PRO F CG    1 
ATOM   8655  C  CD    . PRO D 2 233 ? 48.318  56.798 94.912  1.00 177.85 ? 750  PRO F CD    1 
ATOM   8656  N  N     . LEU D 2 234 ? 51.622  54.262 92.882  1.00 179.64 ? 751  LEU F N     1 
ATOM   8657  C  CA    . LEU D 2 234 ? 51.830  52.893 92.411  1.00 180.76 ? 751  LEU F CA    1 
ATOM   8658  C  C     . LEU D 2 234 ? 51.977  51.912 93.571  1.00 181.28 ? 751  LEU F C     1 
ATOM   8659  O  O     . LEU D 2 234 ? 52.678  52.195 94.544  1.00 181.28 ? 751  LEU F O     1 
ATOM   8660  C  CB    . LEU D 2 234 ? 53.081  52.824 91.531  1.00 181.49 ? 751  LEU F CB    1 
ATOM   8661  C  CG    . LEU D 2 234 ? 52.997  53.587 90.204  1.00 182.12 ? 751  LEU F CG    1 
ATOM   8662  C  CD1   . LEU D 2 234 ? 54.312  54.278 89.878  1.00 182.61 ? 751  LEU F CD1   1 
ATOM   8663  C  CD2   . LEU D 2 234 ? 52.572  52.661 89.073  1.00 183.07 ? 751  LEU F CD2   1 
ATOM   8664  N  N     . LEU D 2 235 ? 51.314  50.763 93.461  1.00 182.52 ? 752  LEU F N     1 
ATOM   8665  C  CA    . LEU D 2 235 ? 51.432  49.700 94.457  1.00 183.44 ? 752  LEU F CA    1 
ATOM   8666  C  C     . LEU D 2 235 ? 52.701  48.893 94.180  1.00 185.50 ? 752  LEU F C     1 
ATOM   8667  O  O     . LEU D 2 235 ? 52.659  47.842 93.538  1.00 186.43 ? 752  LEU F O     1 
ATOM   8668  C  CB    . LEU D 2 235 ? 50.192  48.797 94.438  1.00 183.55 ? 752  LEU F CB    1 
ATOM   8669  C  CG    . LEU D 2 235 ? 48.841  49.494 94.640  1.00 182.99 ? 752  LEU F CG    1 
ATOM   8670  C  CD1   . LEU D 2 235 ? 47.706  48.483 94.571  1.00 183.64 ? 752  LEU F CD1   1 
ATOM   8671  C  CD2   . LEU D 2 235 ? 48.797  50.255 95.957  1.00 182.18 ? 752  LEU F CD2   1 
ATOM   8672  N  N     . ASN D 2 236 ? 53.828  49.411 94.664  1.00 187.20 ? 753  ASN F N     1 
ATOM   8673  C  CA    . ASN D 2 236 ? 55.145  48.804 94.433  1.00 189.40 ? 753  ASN F CA    1 
ATOM   8674  C  C     . ASN D 2 236 ? 55.801  48.213 95.689  1.00 191.05 ? 753  ASN F C     1 
ATOM   8675  O  O     . ASN D 2 236 ? 56.714  47.394 95.581  1.00 192.73 ? 753  ASN F O     1 
ATOM   8676  C  CB    . ASN D 2 236 ? 56.092  49.820 93.775  1.00 189.48 ? 753  ASN F CB    1 
ATOM   8677  C  CG    . ASN D 2 236 ? 56.210  51.120 94.558  1.00 188.70 ? 753  ASN F CG    1 
ATOM   8678  O  OD1   . ASN D 2 236 ? 55.666  51.257 95.655  1.00 188.13 ? 753  ASN F OD1   1 
ATOM   8679  N  ND2   . ASN D 2 236 ? 56.921  52.087 93.990  1.00 188.87 ? 753  ASN F ND2   1 
ATOM   8680  N  N     . ASN D 2 237 ? 55.338  48.628 96.869  1.00 191.55 ? 754  ASN F N     1 
ATOM   8681  C  CA    . ASN D 2 237 ? 55.904  48.163 98.137  1.00 192.97 ? 754  ASN F CA    1 
ATOM   8682  C  C     . ASN D 2 237 ? 55.259  46.865 98.613  1.00 194.32 ? 754  ASN F C     1 
ATOM   8683  O  O     . ASN D 2 237 ? 54.258  46.415 98.054  1.00 194.27 ? 754  ASN F O     1 
ATOM   8684  C  CB    . ASN D 2 237 ? 55.740  49.232 99.222  1.00 192.49 ? 754  ASN F CB    1 
ATOM   8685  C  CG    . ASN D 2 237 ? 56.370  50.559 98.841  1.00 192.59 ? 754  ASN F CG    1 
ATOM   8686  O  OD1   . ASN D 2 237 ? 55.727  51.606 98.916  1.00 191.92 ? 754  ASN F OD1   1 
ATOM   8687  N  ND2   . ASN D 2 237 ? 57.632  50.522 98.429  1.00 193.72 ? 754  ASN F ND2   1 
ATOM   8688  N  N     . ALA D 2 238 ? 55.843  46.274 99.653  1.00 196.38 ? 755  ALA F N     1 
ATOM   8689  C  CA    . ALA D 2 238 ? 55.293  45.074 100.285 1.00 198.27 ? 755  ALA F CA    1 
ATOM   8690  C  C     . ALA D 2 238 ? 54.219  45.430 101.313 1.00 198.25 ? 755  ALA F C     1 
ATOM   8691  O  O     . ALA D 2 238 ? 53.301  44.646 101.548 1.00 198.68 ? 755  ALA F O     1 
ATOM   8692  C  CB    . ALA D 2 238 ? 56.403  44.268 100.942 1.00 199.78 ? 755  ALA F CB    1 
ATOM   8693  N  N     . ASP D 2 239 ? 54.340  46.606 101.927 1.00 198.08 ? 756  ASP F N     1 
ATOM   8694  C  CA    . ASP D 2 239 ? 53.378  47.059 102.942 1.00 197.74 ? 756  ASP F CA    1 
ATOM   8695  C  C     . ASP D 2 239 ? 52.254  47.933 102.368 1.00 196.45 ? 756  ASP F C     1 
ATOM   8696  O  O     . ASP D 2 239 ? 51.255  48.181 103.046 1.00 196.03 ? 756  ASP F O     1 
ATOM   8697  C  CB    . ASP D 2 239 ? 54.094  47.790 104.090 1.00 198.03 ? 756  ASP F CB    1 
ATOM   8698  C  CG    . ASP D 2 239 ? 54.947  48.962 103.616 1.00 197.93 ? 756  ASP F CG    1 
ATOM   8699  O  OD1   . ASP D 2 239 ? 55.550  49.636 104.477 1.00 198.40 ? 756  ASP F OD1   1 
ATOM   8700  O  OD2   . ASP D 2 239 ? 55.023  49.209 102.393 1.00 197.65 ? 756  ASP F OD2   1 
ATOM   8701  N  N     . SER D 2 240 ? 52.420  48.397 101.129 1.00 195.69 ? 757  SER F N     1 
ATOM   8702  C  CA    . SER D 2 240 ? 51.378  49.167 100.444 1.00 194.50 ? 757  SER F CA    1 
ATOM   8703  C  C     . SER D 2 240 ? 50.185  48.274 100.110 1.00 194.43 ? 757  SER F C     1 
ATOM   8704  O  O     . SER D 2 240 ? 49.034  48.668 100.298 1.00 193.45 ? 757  SER F O     1 
ATOM   8705  C  CB    . SER D 2 240 ? 51.928  49.806 99.166  1.00 194.30 ? 757  SER F CB    1 
ATOM   8706  O  OG    . SER D 2 240 ? 52.412  48.823 98.268  1.00 195.03 ? 757  SER F OG    1 
ATOM   8707  N  N     . VAL D 2 241 ? 50.473  47.076 99.605  1.00 195.38 ? 758  VAL F N     1 
ATOM   8708  C  CA    . VAL D 2 241 ? 49.443  46.050 99.385  1.00 196.37 ? 758  VAL F CA    1 
ATOM   8709  C  C     . VAL D 2 241 ? 48.798  45.634 100.713 1.00 196.50 ? 758  VAL F C     1 
ATOM   8710  O  O     . VAL D 2 241 ? 47.582  45.453 100.780 1.00 196.78 ? 758  VAL F O     1 
ATOM   8711  C  CB    . VAL D 2 241 ? 49.977  44.810 98.603  1.00 197.80 ? 758  VAL F CB    1 
ATOM   8712  C  CG1   . VAL D 2 241 ? 51.424  44.488 98.954  1.00 198.18 ? 758  VAL F CG1   1 
ATOM   8713  C  CG2   . VAL D 2 241 ? 49.096  43.584 98.825  1.00 199.10 ? 758  VAL F CG2   1 
ATOM   8714  N  N     . GLN D 2 242 ? 49.610  45.492 101.759 1.00 196.58 ? 759  GLN F N     1 
ATOM   8715  C  CA    . GLN D 2 242 ? 49.103  45.170 103.097 1.00 196.97 ? 759  GLN F CA    1 
ATOM   8716  C  C     . GLN D 2 242 ? 48.176  46.268 103.619 1.00 195.22 ? 759  GLN F C     1 
ATOM   8717  O  O     . GLN D 2 242 ? 47.160  45.979 104.254 1.00 194.93 ? 759  GLN F O     1 
ATOM   8718  C  CB    . GLN D 2 242 ? 50.262  44.960 104.077 1.00 198.37 ? 759  GLN F CB    1 
ATOM   8719  C  CG    . GLN D 2 242 ? 49.835  44.515 105.470 1.00 199.69 ? 759  GLN F CG    1 
ATOM   8720  C  CD    . GLN D 2 242 ? 50.996  44.410 106.442 1.00 200.98 ? 759  GLN F CD    1 
ATOM   8721  O  OE1   . GLN D 2 242 ? 52.159  44.563 106.063 1.00 201.57 ? 759  GLN F OE1   1 
ATOM   8722  N  NE2   . GLN D 2 242 ? 50.685  44.146 107.707 1.00 201.95 ? 759  GLN F NE2   1 
ATOM   8723  N  N     . ALA D 2 243 ? 48.536  47.523 103.354 1.00 193.63 ? 760  ALA F N     1 
ATOM   8724  C  CA    . ALA D 2 243 ? 47.713  48.667 103.744 1.00 192.56 ? 760  ALA F CA    1 
ATOM   8725  C  C     . ALA D 2 243 ? 46.368  48.650 103.020 1.00 192.45 ? 760  ALA F C     1 
ATOM   8726  O  O     . ALA D 2 243 ? 45.327  48.910 103.627 1.00 192.17 ? 760  ALA F O     1 
ATOM   8727  C  CB    . ALA D 2 243 ? 48.446  49.970 103.460 1.00 191.79 ? 760  ALA F CB    1 
ATOM   8728  N  N     . LYS D 2 244 ? 46.400  48.342 101.725 1.00 192.61 ? 761  LYS F N     1 
ATOM   8729  C  CA    . LYS D 2 244 ? 45.181  48.237 100.923 1.00 193.03 ? 761  LYS F CA    1 
ATOM   8730  C  C     . LYS D 2 244 ? 44.419  46.941 101.210 1.00 194.39 ? 761  LYS F C     1 
ATOM   8731  O  O     . LYS D 2 244 ? 43.211  46.876 101.000 1.00 195.21 ? 761  LYS F O     1 
ATOM   8732  C  CB    . LYS D 2 244 ? 45.506  48.348 99.428  1.00 192.88 ? 761  LYS F CB    1 
ATOM   8733  C  CG    . LYS D 2 244 ? 46.112  49.687 99.022  1.00 191.92 ? 761  LYS F CG    1 
ATOM   8734  C  CD    . LYS D 2 244 ? 45.089  50.815 99.068  1.00 191.50 ? 761  LYS F CD    1 
ATOM   8735  C  CE    . LYS D 2 244 ? 45.702  52.140 99.506  1.00 190.59 ? 761  LYS F CE    1 
ATOM   8736  N  NZ    . LYS D 2 244 ? 46.493  52.799 98.431  1.00 190.38 ? 761  LYS F NZ    1 
ATOM   8737  N  N     . VAL D 2 245 ? 45.123  45.914 101.683 1.00 195.15 ? 762  VAL F N     1 
ATOM   8738  C  CA    . VAL D 2 245 ? 44.478  44.679 102.131 1.00 196.51 ? 762  VAL F CA    1 
ATOM   8739  C  C     . VAL D 2 245 ? 43.703  44.923 103.424 1.00 196.36 ? 762  VAL F C     1 
ATOM   8740  O  O     . VAL D 2 245 ? 42.580  44.443 103.582 1.00 197.37 ? 762  VAL F O     1 
ATOM   8741  C  CB    . VAL D 2 245 ? 45.509  43.578 102.333 1.00 197.43 ? 762  VAL F CB    1 
ATOM   8742  N  N     . GLU D 2 246 ? 44.314  45.672 104.341 1.00 195.31 ? 763  GLU F N     1 
ATOM   8743  C  CA    . GLU D 2 246 ? 43.670  46.055 105.600 1.00 195.17 ? 763  GLU F CA    1 
ATOM   8744  C  C     . GLU D 2 246 ? 42.446  46.936 105.348 1.00 194.20 ? 763  GLU F C     1 
ATOM   8745  O  O     . GLU D 2 246 ? 41.430  46.808 106.034 1.00 194.90 ? 763  GLU F O     1 
ATOM   8746  C  CB    . GLU D 2 246 ? 44.666  46.791 106.503 1.00 195.02 ? 763  GLU F CB    1 
ATOM   8747  C  CG    . GLU D 2 246 ? 44.181  47.007 107.931 1.00 195.86 ? 763  GLU F CG    1 
ATOM   8748  C  CD    . GLU D 2 246 ? 45.166  47.785 108.787 1.00 195.93 ? 763  GLU F CD    1 
ATOM   8749  O  OE1   . GLU D 2 246 ? 44.811  48.118 109.939 1.00 196.48 ? 763  GLU F OE1   1 
ATOM   8750  O  OE2   . GLU D 2 246 ? 46.290  48.069 108.317 1.00 195.78 ? 763  GLU F OE2   1 
ATOM   8751  N  N     . MET D 2 247 ? 42.557  47.831 104.368 1.00 192.65 ? 764  MET F N     1 
ATOM   8752  C  CA    . MET D 2 247 ? 41.447  48.690 103.950 1.00 192.43 ? 764  MET F CA    1 
ATOM   8753  C  C     . MET D 2 247 ? 40.216  47.866 103.581 1.00 193.42 ? 764  MET F C     1 
ATOM   8754  O  O     . MET D 2 247 ? 39.122  48.112 104.090 1.00 193.43 ? 764  MET F O     1 
ATOM   8755  C  CB    . MET D 2 247 ? 41.876  49.549 102.754 1.00 191.72 ? 764  MET F CB    1 
ATOM   8756  C  CG    . MET D 2 247 ? 40.748  50.259 102.020 1.00 192.04 ? 764  MET F CG    1 
ATOM   8757  S  SD    . MET D 2 247 ? 41.252  50.733 100.358 1.00 192.19 ? 764  MET F SD    1 
ATOM   8758  C  CE    . MET D 2 247 ? 42.299  52.134 100.722 1.00 190.88 ? 764  MET F CE    1 
ATOM   8759  N  N     . LEU D 2 248 ? 40.405  46.896 102.688 1.00 194.31 ? 765  LEU F N     1 
ATOM   8760  C  CA    . LEU D 2 248 ? 39.312  46.027 102.243 1.00 196.12 ? 765  LEU F CA    1 
ATOM   8761  C  C     . LEU D 2 248 ? 38.693  45.248 103.403 1.00 197.50 ? 765  LEU F C     1 
ATOM   8762  O  O     . LEU D 2 248 ? 37.474  45.093 103.463 1.00 199.00 ? 765  LEU F O     1 
ATOM   8763  C  CB    . LEU D 2 248 ? 39.785  45.059 101.150 1.00 196.61 ? 765  LEU F CB    1 
ATOM   8764  C  CG    . LEU D 2 248 ? 39.685  45.547 99.701  1.00 196.54 ? 765  LEU F CG    1 
ATOM   8765  C  CD1   . LEU D 2 248 ? 40.274  46.939 99.526  1.00 195.06 ? 765  LEU F CD1   1 
ATOM   8766  C  CD2   . LEU D 2 248 ? 40.358  44.551 98.766  1.00 197.33 ? 765  LEU F CD2   1 
ATOM   8767  N  N     . ASP D 2 249 ? 39.533  44.766 104.318 1.00 197.60 ? 766  ASP F N     1 
ATOM   8768  C  CA    . ASP D 2 249 ? 39.059  44.055 105.509 1.00 198.86 ? 766  ASP F CA    1 
ATOM   8769  C  C     . ASP D 2 249 ? 38.157  44.944 106.366 1.00 198.91 ? 766  ASP F C     1 
ATOM   8770  O  O     . ASP D 2 249 ? 37.093  44.511 106.811 1.00 199.99 ? 766  ASP F O     1 
ATOM   8771  C  CB    . ASP D 2 249 ? 40.237  43.549 106.352 1.00 198.83 ? 766  ASP F CB    1 
ATOM   8772  C  CG    . ASP D 2 249 ? 41.009  42.424 105.677 1.00 199.79 ? 766  ASP F CG    1 
ATOM   8773  O  OD1   . ASP D 2 249 ? 42.256  42.439 105.742 1.00 199.33 ? 766  ASP F OD1   1 
ATOM   8774  O  OD2   . ASP D 2 249 ? 40.375  41.522 105.088 1.00 201.25 ? 766  ASP F OD2   1 
ATOM   8775  N  N     . ASN D 2 250 ? 38.588  46.184 106.592 1.00 198.00 ? 767  ASN F N     1 
ATOM   8776  C  CA    . ASN D 2 250 ? 37.798  47.151 107.357 1.00 198.28 ? 767  ASN F CA    1 
ATOM   8777  C  C     . ASN D 2 250 ? 36.548  47.597 106.605 1.00 199.96 ? 767  ASN F C     1 
ATOM   8778  O  O     . ASN D 2 250 ? 35.455  47.623 107.172 1.00 200.76 ? 767  ASN F O     1 
ATOM   8779  C  CB    . ASN D 2 250 ? 38.641  48.378 107.717 1.00 196.54 ? 767  ASN F CB    1 
ATOM   8780  C  CG    . ASN D 2 250 ? 39.705  48.078 108.755 1.00 195.90 ? 767  ASN F CG    1 
ATOM   8781  O  OD1   . ASN D 2 250 ? 40.893  48.299 108.522 1.00 194.78 ? 767  ASN F OD1   1 
ATOM   8782  N  ND2   . ASN D 2 250 ? 39.283  47.579 109.912 1.00 196.68 ? 767  ASN F ND2   1 
ATOM   8783  N  N     . LEU D 2 251 ? 36.721  47.950 105.332 1.00 201.04 ? 768  LEU F N     1 
ATOM   8784  C  CA    . LEU D 2 251 ? 35.611  48.357 104.465 1.00 203.40 ? 768  LEU F CA    1 
ATOM   8785  C  C     . LEU D 2 251 ? 34.506  47.300 104.441 1.00 206.19 ? 768  LEU F C     1 
ATOM   8786  O  O     . LEU D 2 251 ? 33.321  47.634 104.487 1.00 207.58 ? 768  LEU F O     1 
ATOM   8787  C  CB    . LEU D 2 251 ? 36.129  48.633 103.044 1.00 203.03 ? 768  LEU F CB    1 
ATOM   8788  C  CG    . LEU D 2 251 ? 35.168  49.018 101.904 1.00 204.21 ? 768  LEU F CG    1 
ATOM   8789  C  CD1   . LEU D 2 251 ? 34.566  47.796 101.218 1.00 205.63 ? 768  LEU F CD1   1 
ATOM   8790  C  CD2   . LEU D 2 251 ? 34.074  49.976 102.363 1.00 205.04 ? 768  LEU F CD2   1 
ATOM   8791  N  N     . LEU D 2 252 ? 34.901  46.030 104.378 1.00 207.82 ? 769  LEU F N     1 
ATOM   8792  C  CA    . LEU D 2 252 ? 33.946  44.920 104.366 1.00 210.93 ? 769  LEU F CA    1 
ATOM   8793  C  C     . LEU D 2 252 ? 33.092  44.923 105.634 1.00 213.00 ? 769  LEU F C     1 
ATOM   8794  O  O     . LEU D 2 252 ? 31.868  44.816 105.563 1.00 215.01 ? 769  LEU F O     1 
ATOM   8795  C  CB    . LEU D 2 252 ? 34.676  43.573 104.225 1.00 211.48 ? 769  LEU F CB    1 
ATOM   8796  C  CG    . LEU D 2 252 ? 33.965  42.444 103.471 1.00 213.80 ? 769  LEU F CG    1 
ATOM   8797  C  CD1   . LEU D 2 252 ? 32.635  42.080 104.114 1.00 215.55 ? 769  LEU F CD1   1 
ATOM   8798  C  CD2   . LEU D 2 252 ? 33.773  42.813 102.007 1.00 214.26 ? 769  LEU F CD2   1 
ATOM   8799  N  N     . ASP D 2 253 ? 33.743  45.069 106.785 1.00 213.44 ? 770  ASP F N     1 
ATOM   8800  C  CA    . ASP D 2 253 ? 33.055  45.028 108.079 1.00 215.33 ? 770  ASP F CA    1 
ATOM   8801  C  C     . ASP D 2 253 ? 32.087  46.195 108.303 1.00 217.00 ? 770  ASP F C     1 
ATOM   8802  O  O     . ASP D 2 253 ? 31.135  46.067 109.076 1.00 218.61 ? 770  ASP F O     1 
ATOM   8803  C  CB    . ASP D 2 253 ? 34.073  44.968 109.222 1.00 214.35 ? 770  ASP F CB    1 
ATOM   8804  C  CG    . ASP D 2 253 ? 34.835  43.653 109.261 1.00 214.74 ? 770  ASP F CG    1 
ATOM   8805  O  OD1   . ASP D 2 253 ? 34.929  42.981 108.215 1.00 215.30 ? 770  ASP F OD1   1 
ATOM   8806  O  OD2   . ASP D 2 253 ? 35.344  43.290 110.339 1.00 215.12 ? 770  ASP F OD2   1 
ATOM   8807  N  N     . ILE D 2 254 ? 32.329  47.323 107.635 1.00 217.39 ? 771  ILE F N     1 
ATOM   8808  C  CA    . ILE D 2 254 ? 31.424  48.475 107.708 1.00 219.35 ? 771  ILE F CA    1 
ATOM   8809  C  C     . ILE D 2 254 ? 30.136  48.183 106.937 1.00 222.60 ? 771  ILE F C     1 
ATOM   8810  O  O     . ILE D 2 254 ? 29.040  48.495 107.405 1.00 224.51 ? 771  ILE F O     1 
ATOM   8811  C  CB    . ILE D 2 254 ? 32.081  49.764 107.162 1.00 217.91 ? 771  ILE F CB    1 
ATOM   8812  C  CG1   . ILE D 2 254 ? 33.301  50.134 108.012 1.00 216.49 ? 771  ILE F CG1   1 
ATOM   8813  C  CG2   . ILE D 2 254 ? 31.084  50.921 107.156 1.00 218.93 ? 771  ILE F CG2   1 
ATOM   8814  C  CD1   . ILE D 2 254 ? 34.098  51.308 107.484 1.00 215.47 ? 771  ILE F CD1   1 
ATOM   8815  N  N     . GLU D 2 255 ? 30.279  47.588 105.755 1.00 224.17 ? 772  GLU F N     1 
ATOM   8816  C  CA    . GLU D 2 255 ? 29.129  47.170 104.951 1.00 227.27 ? 772  GLU F CA    1 
ATOM   8817  C  C     . GLU D 2 255 ? 28.364  46.035 105.634 1.00 229.83 ? 772  GLU F C     1 
ATOM   8818  O  O     . GLU D 2 255 ? 27.151  45.906 105.458 1.00 232.28 ? 772  GLU F O     1 
ATOM   8819  C  CB    . GLU D 2 255 ? 29.575  46.733 103.550 1.00 227.20 ? 772  GLU F CB    1 
ATOM   8820  C  CG    . GLU D 2 255 ? 30.189  47.844 102.707 1.00 225.78 ? 772  GLU F CG    1 
ATOM   8821  C  CD    . GLU D 2 255 ? 29.158  48.706 101.998 1.00 226.92 ? 772  GLU F CD    1 
ATOM   8822  O  OE1   . GLU D 2 255 ? 29.460  49.199 100.895 1.00 226.00 ? 772  GLU F OE1   1 
ATOM   8823  O  OE2   . GLU D 2 255 ? 28.048  48.897 102.533 1.00 228.69 ? 772  GLU F OE2   1 
ATOM   8824  N  N     . VAL D 2 256 ? 29.080  45.218 106.405 1.00 230.08 ? 773  VAL F N     1 
ATOM   8825  C  CA    . VAL D 2 256 ? 28.457  44.191 107.240 1.00 232.71 ? 773  VAL F CA    1 
ATOM   8826  C  C     . VAL D 2 256 ? 27.695  44.855 108.388 1.00 234.55 ? 773  VAL F C     1 
ATOM   8827  O  O     . VAL D 2 256 ? 26.573  44.457 108.699 1.00 237.00 ? 773  VAL F O     1 
ATOM   8828  C  CB    . VAL D 2 256 ? 29.500  43.193 107.797 1.00 231.83 ? 773  VAL F CB    1 
ATOM   8829  C  CG1   . VAL D 2 256 ? 28.880  42.268 108.837 1.00 233.50 ? 773  VAL F CG1   1 
ATOM   8830  C  CG2   . VAL D 2 256 ? 30.106  42.371 106.667 1.00 231.76 ? 773  VAL F CG2   1 
ATOM   8831  N  N     . ALA D 2 257 ? 28.304  45.866 109.007 1.00 234.50 ? 774  ALA F N     1 
ATOM   8832  C  CA    . ALA D 2 257 ? 27.657  46.618 110.087 1.00 236.64 ? 774  ALA F CA    1 
ATOM   8833  C  C     . ALA D 2 257 ? 26.386  47.326 109.609 1.00 239.62 ? 774  ALA F C     1 
ATOM   8834  O  O     . ALA D 2 257 ? 25.421  47.451 110.364 1.00 241.37 ? 774  ALA F O     1 
ATOM   8835  C  CB    . ALA D 2 257 ? 28.627  47.623 110.693 1.00 234.70 ? 774  ALA F CB    1 
ATOM   8836  N  N     . TYR D 2 258 ? 26.397  47.792 108.361 1.00 240.88 ? 775  TYR F N     1 
ATOM   8837  C  CA    . TYR D 2 258 ? 25.193  48.331 107.722 1.00 243.87 ? 775  TYR F CA    1 
ATOM   8838  C  C     . TYR D 2 258 ? 24.139  47.241 107.526 1.00 247.69 ? 775  TYR F C     1 
ATOM   8839  O  O     . TYR D 2 258 ? 22.959  47.456 107.804 1.00 250.03 ? 775  TYR F O     1 
ATOM   8840  C  CB    . TYR D 2 258 ? 25.519  48.957 106.360 1.00 242.91 ? 775  TYR F CB    1 
ATOM   8841  C  CG    . TYR D 2 258 ? 25.998  50.393 106.409 1.00 241.39 ? 775  TYR F CG    1 
ATOM   8842  C  CD1   . TYR D 2 258 ? 25.183  51.404 106.914 1.00 242.77 ? 775  TYR F CD1   1 
ATOM   8843  C  CD2   . TYR D 2 258 ? 27.252  50.749 105.916 1.00 239.03 ? 775  TYR F CD2   1 
ATOM   8844  C  CE1   . TYR D 2 258 ? 25.611  52.722 106.949 1.00 241.87 ? 775  TYR F CE1   1 
ATOM   8845  C  CE2   . TYR D 2 258 ? 27.687  52.064 105.945 1.00 238.13 ? 775  TYR F CE2   1 
ATOM   8846  C  CZ    . TYR D 2 258 ? 26.862  53.047 106.459 1.00 239.44 ? 775  TYR F CZ    1 
ATOM   8847  O  OH    . TYR D 2 258 ? 27.291  54.355 106.492 1.00 238.20 ? 775  TYR F OH    1 
ATOM   8848  N  N     . SER D 2 259 ? 24.575  46.078 107.039 1.00 249.19 ? 776  SER F N     1 
ATOM   8849  C  CA    . SER D 2 259 ? 23.674  44.953 106.766 1.00 253.12 ? 776  SER F CA    1 
ATOM   8850  C  C     . SER D 2 259 ? 22.914  44.498 108.011 1.00 256.85 ? 776  SER F C     1 
ATOM   8851  O  O     . SER D 2 259 ? 21.746  44.116 107.922 1.00 259.78 ? 776  SER F O     1 
ATOM   8852  C  CB    . SER D 2 259 ? 24.450  43.774 106.172 1.00 252.31 ? 776  SER F CB    1 
ATOM   8853  O  OG    . SER D 2 259 ? 25.109  44.148 104.976 1.00 250.66 ? 776  SER F OG    1 
ATOM   8854  N  N     . LEU D 2 260 ? 23.581  44.534 109.164 1.00 258.09 ? 777  LEU F N     1 
ATOM   8855  C  CA    . LEU D 2 260 ? 22.926  44.256 110.442 1.00 261.95 ? 777  LEU F CA    1 
ATOM   8856  C  C     . LEU D 2 260 ? 21.949  45.379 110.794 1.00 265.41 ? 777  LEU F C     1 
ATOM   8857  O  O     . LEU D 2 260 ? 20.769  45.126 111.036 1.00 269.03 ? 777  LEU F O     1 
ATOM   8858  C  CB    . LEU D 2 260 ? 23.954  44.084 111.573 1.00 260.18 ? 777  LEU F CB    1 
ATOM   8859  C  CG    . LEU D 2 260 ? 24.609  42.711 111.790 1.00 259.98 ? 777  LEU F CG    1 
ATOM   8860  C  CD1   . LEU D 2 260 ? 23.573  41.654 112.144 1.00 262.91 ? 777  LEU F CD1   1 
ATOM   8861  C  CD2   . LEU D 2 260 ? 25.435  42.263 110.594 1.00 258.65 ? 777  LEU F CD2   1 
ATOM   8862  N  N     . LEU D 2 261 ? 22.450  46.614 110.802 1.00 265.52 ? 778  LEU F N     1 
ATOM   8863  C  CA    . LEU D 2 261 ? 21.656  47.787 111.189 1.00 267.74 ? 778  LEU F CA    1 
ATOM   8864  C  C     . LEU D 2 261 ? 20.408  47.969 110.321 1.00 271.08 ? 778  LEU F C     1 
ATOM   8865  O  O     . LEU D 2 261 ? 19.325  48.247 110.839 1.00 273.65 ? 778  LEU F O     1 
ATOM   8866  C  CB    . LEU D 2 261 ? 22.522  49.054 111.144 1.00 265.68 ? 778  LEU F CB    1 
ATOM   8867  C  CG    . LEU D 2 261 ? 21.879  50.392 111.529 1.00 266.87 ? 778  LEU F CG    1 
ATOM   8868  C  CD1   . LEU D 2 261 ? 21.158  50.308 112.867 1.00 268.72 ? 778  LEU F CD1   1 
ATOM   8869  C  CD2   . LEU D 2 261 ? 22.932  51.489 111.558 1.00 264.67 ? 778  LEU F CD2   1 
ATOM   8870  N  N     . ARG D 2 262 ? 20.562  47.805 109.010 1.00 271.64 ? 779  ARG F N     1 
ATOM   8871  C  CA    . ARG D 2 262 ? 19.436  47.900 108.081 1.00 274.78 ? 779  ARG F CA    1 
ATOM   8872  C  C     . ARG D 2 262 ? 18.711  46.559 107.973 1.00 277.66 ? 779  ARG F C     1 
ATOM   8873  O  O     . ARG D 2 262 ? 19.191  45.641 107.303 1.00 276.96 ? 779  ARG F O     1 
ATOM   8874  C  CB    . ARG D 2 262 ? 19.918  48.333 106.694 1.00 273.72 ? 779  ARG F CB    1 
ATOM   8875  C  CG    . ARG D 2 262 ? 20.666  49.655 106.664 1.00 271.57 ? 779  ARG F CG    1 
ATOM   8876  C  CD    . ARG D 2 262 ? 21.039  50.020 105.238 1.00 270.88 ? 779  ARG F CD    1 
ATOM   8877  N  NE    . ARG D 2 262 ? 22.054  51.069 105.168 1.00 268.30 ? 779  ARG F NE    1 
ATOM   8878  C  CZ    . ARG D 2 262 ? 22.581  51.534 104.036 1.00 267.03 ? 779  ARG F CZ    1 
ATOM   8879  N  NH1   . ARG D 2 262 ? 22.194  51.051 102.858 1.00 268.20 ? 779  ARG F NH1   1 
ATOM   8880  N  NH2   . ARG D 2 262 ? 23.502  52.489 104.080 1.00 264.82 ? 779  ARG F NH2   1 
ATOM   8881  N  N     . GLY D 2 263 ? 17.560  46.447 108.634 1.00 281.12 ? 780  GLY F N     1 
ATOM   8882  C  CA    . GLY D 2 263 ? 16.743  45.234 108.564 1.00 284.51 ? 780  GLY F CA    1 
ATOM   8883  C  C     . GLY D 2 263 ? 15.932  44.963 109.817 1.00 287.43 ? 780  GLY F C     1 
ATOM   8884  O  O     . GLY D 2 263 ? 15.704  45.861 110.630 1.00 287.07 ? 780  GLY F O     1 
ATOM   8885  N  N     . GLY D 2 264 ? 15.495  43.714 109.963 1.00 290.89 ? 781  GLY F N     1 
ATOM   8886  C  CA    . GLY D 2 264 ? 14.689  43.291 111.107 1.00 294.58 ? 781  GLY F CA    1 
ATOM   8887  C  C     . GLY D 2 264 ? 13.204  43.492 110.870 1.00 299.69 ? 781  GLY F C     1 
ATOM   8888  O  O     . GLY D 2 264 ? 12.750  43.537 109.724 1.00 301.27 ? 781  GLY F O     1 
ATOM   8889  N  N     . SER D 2 265 ? 12.450  43.608 111.961 1.00 303.12 ? 782  SER F N     1 
ATOM   8890  C  CA    . SER D 2 265 ? 11.005  43.826 111.904 1.00 308.17 ? 782  SER F CA    1 
ATOM   8891  C  C     . SER D 2 265 ? 10.637  45.090 112.676 1.00 309.53 ? 782  SER F C     1 
ATOM   8892  O  O     . SER D 2 265 ? 10.543  45.070 113.905 1.00 309.97 ? 782  SER F O     1 
ATOM   8893  C  CB    . SER D 2 265 ? 10.264  42.620 112.485 1.00 311.14 ? 782  SER F CB    1 
ATOM   8894  N  N     . ASP D 2 266 ? 10.434  46.186 111.948 1.00 310.75 ? 783  ASP F N     1 
ATOM   8895  C  CA    . ASP D 2 266 ? 10.128  47.480 112.556 1.00 311.88 ? 783  ASP F CA    1 
ATOM   8896  C  C     . ASP D 2 266 ? 8.694   47.527 113.080 1.00 316.94 ? 783  ASP F C     1 
ATOM   8897  O  O     . ASP D 2 266 ? 7.795   48.050 112.418 1.00 319.88 ? 783  ASP F O     1 
ATOM   8898  C  CB    . ASP D 2 266 ? 10.358  48.611 111.549 1.00 310.69 ? 783  ASP F CB    1 
ATOM   8899  N  N     . ASP D 2 267 ? 8.496   46.971 114.273 1.00 318.55 ? 784  ASP F N     1 
ATOM   8900  C  CA    . ASP D 2 267 ? 7.200   46.984 114.947 1.00 323.35 ? 784  ASP F CA    1 
ATOM   8901  C  C     . ASP D 2 267 ? 7.308   47.762 116.255 1.00 323.86 ? 784  ASP F C     1 
ATOM   8902  O  O     . ASP D 2 267 ? 8.319   47.672 116.955 1.00 321.17 ? 784  ASP F O     1 
ATOM   8903  C  CB    . ASP D 2 267 ? 6.732   45.556 115.227 1.00 325.27 ? 784  ASP F CB    1 
ATOM   8904  N  N     . SER D 2 268 ? 6.264   48.522 116.580 1.00 327.99 ? 785  SER F N     1 
ATOM   8905  C  CA    . SER D 2 268 ? 6.245   49.337 117.794 1.00 329.00 ? 785  SER F CA    1 
ATOM   8906  C  C     . SER D 2 268 ? 6.106   48.459 119.038 1.00 331.14 ? 785  SER F C     1 
ATOM   8907  O  O     . SER D 2 268 ? 4.995   48.203 119.509 1.00 335.63 ? 785  SER F O     1 
ATOM   8908  C  CB    . SER D 2 268 ? 5.105   50.357 117.737 1.00 332.23 ? 785  SER F CB    1 
ATOM   8909  N  N     . SER D 2 269 ? 7.242   47.998 119.556 1.00 328.66 ? 786  SER F N     1 
ATOM   8910  C  CA    . SER D 2 269 ? 7.271   47.155 120.753 1.00 329.64 ? 786  SER F CA    1 
ATOM   8911  C  C     . SER D 2 269 ? 8.609   47.269 121.484 1.00 326.18 ? 786  SER F C     1 
ATOM   8912  O  O     . SER D 2 269 ? 8.661   47.737 122.622 1.00 326.63 ? 786  SER F O     1 
ATOM   8913  C  CB    . SER D 2 269 ? 6.997   45.696 120.383 1.00 330.82 ? 786  SER F CB    1 
ATOM   8914  N  N     . LYS D 2 270 ? 9.682   46.840 120.822 1.00 323.00 ? 787  LYS F N     1 
ATOM   8915  C  CA    . LYS D 2 270 ? 11.027  46.891 121.398 1.00 319.55 ? 787  LYS F CA    1 
ATOM   8916  C  C     . LYS D 2 270 ? 11.647  48.277 121.230 1.00 317.14 ? 787  LYS F C     1 
ATOM   8917  O  O     . LYS D 2 270 ? 11.146  49.102 120.464 1.00 317.89 ? 787  LYS F O     1 
ATOM   8918  C  CB    . LYS D 2 270 ? 11.926  45.839 120.745 1.00 317.13 ? 787  LYS F CB    1 
ATOM   8919  N  N     . ASP D 2 271 ? 12.742  48.519 121.949 1.00 314.16 ? 788  ASP F N     1 
ATOM   8920  C  CA    . ASP D 2 271 ? 13.450  49.800 121.894 1.00 311.21 ? 788  ASP F CA    1 
ATOM   8921  C  C     . ASP D 2 271 ? 14.567  49.761 120.847 1.00 306.99 ? 788  ASP F C     1 
ATOM   8922  O  O     . ASP D 2 271 ? 15.024  48.679 120.478 1.00 305.95 ? 788  ASP F O     1 
ATOM   8923  C  CB    . ASP D 2 271 ? 14.033  50.142 123.266 1.00 310.71 ? 788  ASP F CB    1 
ATOM   8924  N  N     . PRO D 2 272 ? 15.019  50.942 120.373 1.00 304.46 ? 789  PRO F N     1 
ATOM   8925  C  CA    . PRO D 2 272 ? 16.029  51.011 119.304 1.00 300.63 ? 789  PRO F CA    1 
ATOM   8926  C  C     . PRO D 2 272 ? 17.346  50.300 119.626 1.00 297.01 ? 789  PRO F C     1 
ATOM   8927  O  O     . PRO D 2 272 ? 17.918  49.645 118.754 1.00 294.50 ? 789  PRO F O     1 
ATOM   8928  C  CB    . PRO D 2 272 ? 16.272  52.518 119.140 1.00 300.12 ? 789  PRO F CB    1 
ATOM   8929  C  CG    . PRO D 2 272 ? 15.067  53.176 119.712 1.00 303.65 ? 789  PRO F CG    1 
ATOM   8930  C  CD    . PRO D 2 272 ? 14.617  52.285 120.828 1.00 305.57 ? 789  PRO F CD    1 
ATOM   8931  N  N     . ILE D 2 273 ? 17.819  50.439 120.863 1.00 296.34 ? 790  ILE F N     1 
ATOM   8932  C  CA    . ILE D 2 273 ? 19.067  49.803 121.294 1.00 293.69 ? 790  ILE F CA    1 
ATOM   8933  C  C     . ILE D 2 273 ? 18.890  48.284 121.396 1.00 294.18 ? 790  ILE F C     1 
ATOM   8934  O  O     . ILE D 2 273 ? 19.803  47.526 121.062 1.00 292.18 ? 790  ILE F O     1 
ATOM   8935  C  CB    . ILE D 2 273 ? 19.569  50.376 122.642 1.00 293.64 ? 790  ILE F CB    1 
ATOM   8936  C  CG1   . ILE D 2 273 ? 19.861  51.877 122.508 1.00 292.71 ? 790  ILE F CG1   1 
ATOM   8937  C  CG2   . ILE D 2 273 ? 20.827  49.650 123.103 1.00 291.60 ? 790  ILE F CG2   1 
ATOM   8938  C  CD1   . ILE D 2 273 ? 20.220  52.561 123.810 1.00 293.13 ? 790  ILE F CD1   1 
ATOM   8939  N  N     . ASP D 2 274 ? 17.715  47.851 121.853 1.00 296.97 ? 791  ASP F N     1 
ATOM   8940  C  CA    . ASP D 2 274 ? 17.391  46.423 121.948 1.00 297.77 ? 791  ASP F CA    1 
ATOM   8941  C  C     . ASP D 2 274 ? 17.296  45.748 120.579 1.00 296.22 ? 791  ASP F C     1 
ATOM   8942  O  O     . ASP D 2 274 ? 17.629  44.570 120.446 1.00 295.72 ? 791  ASP F O     1 
ATOM   8943  C  CB    . ASP D 2 274 ? 16.079  46.213 122.716 1.00 301.71 ? 791  ASP F CB    1 
ATOM   8944  C  CG    . ASP D 2 274 ? 16.243  46.390 124.214 1.00 302.57 ? 791  ASP F CG    1 
ATOM   8945  O  OD1   . ASP D 2 274 ? 17.090  45.690 124.808 1.00 301.75 ? 791  ASP F OD1   1 
ATOM   8946  O  OD2   . ASP D 2 274 ? 15.515  47.217 124.801 1.00 304.30 ? 791  ASP F OD2   1 
ATOM   8947  N  N     . VAL D 2 275 ? 16.837  46.489 119.571 1.00 295.02 ? 792  VAL F N     1 
ATOM   8948  C  CA    . VAL D 2 275 ? 16.765  45.970 118.203 1.00 293.82 ? 792  VAL F CA    1 
ATOM   8949  C  C     . VAL D 2 275 ? 18.170  45.637 117.695 1.00 289.64 ? 792  VAL F C     1 
ATOM   8950  O  O     . VAL D 2 275 ? 18.384  44.575 117.108 1.00 289.18 ? 792  VAL F O     1 
ATOM   8951  C  CB    . VAL D 2 275 ? 16.073  46.968 117.243 1.00 294.60 ? 792  VAL F CB    1 
ATOM   8952  C  CG1   . VAL D 2 275 ? 16.222  46.528 115.792 1.00 293.98 ? 792  VAL F CG1   1 
ATOM   8953  C  CG2   . VAL D 2 275 ? 14.598  47.110 117.592 1.00 298.35 ? 792  VAL F CG2   1 
ATOM   8954  N  N     . ASN D 2 276 ? 19.117  46.540 117.934 1.00 286.22 ? 793  ASN F N     1 
ATOM   8955  C  CA    . ASN D 2 276 ? 20.511  46.331 117.534 1.00 282.45 ? 793  ASN F CA    1 
ATOM   8956  C  C     . ASN D 2 276 ? 21.238  45.290 118.392 1.00 281.36 ? 793  ASN F C     1 
ATOM   8957  O  O     . ASN D 2 276 ? 22.194  44.666 117.927 1.00 279.43 ? 793  ASN F O     1 
ATOM   8958  C  CB    . ASN D 2 276 ? 21.281  47.659 117.552 1.00 280.24 ? 793  ASN F CB    1 
ATOM   8959  C  CG    . ASN D 2 276 ? 20.773  48.647 116.513 1.00 280.16 ? 793  ASN F CG    1 
ATOM   8960  O  OD1   . ASN D 2 276 ? 20.230  48.257 115.479 1.00 280.62 ? 793  ASN F OD1   1 
ATOM   8961  N  ND2   . ASN D 2 276 ? 20.954  49.936 116.784 1.00 279.48 ? 793  ASN F ND2   1 
ATOM   8962  N  N     . TYR D 2 277 ? 20.791  45.107 119.635 1.00 282.41 ? 794  TYR F N     1 
ATOM   8963  C  CA    . TYR D 2 277 ? 21.353  44.079 120.518 1.00 281.94 ? 794  TYR F CA    1 
ATOM   8964  C  C     . TYR D 2 277 ? 21.006  42.678 120.022 1.00 282.22 ? 794  TYR F C     1 
ATOM   8965  O  O     . TYR D 2 277 ? 21.868  41.801 119.967 1.00 281.05 ? 794  TYR F O     1 
ATOM   8966  C  CB    . TYR D 2 277 ? 20.838  44.242 121.951 1.00 284.21 ? 794  TYR F CB    1 
ATOM   8967  C  CG    . TYR D 2 277 ? 21.464  43.269 122.932 1.00 284.86 ? 794  TYR F CG    1 
ATOM   8968  C  CD1   . TYR D 2 277 ? 22.769  43.448 123.387 1.00 282.96 ? 794  TYR F CD1   1 
ATOM   8969  C  CD2   . TYR D 2 277 ? 20.755  42.165 123.400 1.00 287.67 ? 794  TYR F CD2   1 
ATOM   8970  C  CE1   . TYR D 2 277 ? 23.346  42.560 124.280 1.00 283.74 ? 794  TYR F CE1   1 
ATOM   8971  C  CE2   . TYR D 2 277 ? 21.324  41.272 124.293 1.00 288.29 ? 794  TYR F CE2   1 
ATOM   8972  C  CZ    . TYR D 2 277 ? 22.619  41.474 124.730 1.00 286.40 ? 794  TYR F CZ    1 
ATOM   8973  O  OH    . TYR D 2 277 ? 23.188  40.589 125.617 1.00 287.20 ? 794  TYR F OH    1 
ATOM   8974  N  N     . GLU D 2 278 ? 19.737  42.477 119.675 1.00 283.69 ? 795  GLU F N     1 
ATOM   8975  C  CA    . GLU D 2 278 ? 19.259  41.190 119.167 1.00 284.67 ? 795  GLU F CA    1 
ATOM   8976  C  C     . GLU D 2 278 ? 19.881  40.838 117.813 1.00 281.73 ? 795  GLU F C     1 
ATOM   8977  O  O     . GLU D 2 278 ? 20.013  39.661 117.474 1.00 282.51 ? 795  GLU F O     1 
ATOM   8978  C  CB    . GLU D 2 278 ? 17.731  41.196 119.057 1.00 288.18 ? 795  GLU F CB    1 
ATOM   8979  C  CG    . GLU D 2 278 ? 17.017  41.247 120.402 1.00 290.51 ? 795  GLU F CG    1 
ATOM   8980  C  CD    . GLU D 2 278 ? 15.510  41.393 120.279 1.00 293.71 ? 795  GLU F CD    1 
ATOM   8981  O  OE1   . GLU D 2 278 ? 14.827  41.351 121.324 1.00 295.81 ? 795  GLU F OE1   1 
ATOM   8982  O  OE2   . GLU D 2 278 ? 15.003  41.549 119.147 1.00 294.24 ? 795  GLU F OE2   1 
ATOM   8983  N  N     . LYS D 2 279 ? 20.255  41.862 117.049 1.00 277.91 ? 796  LYS F N     1 
ATOM   8984  C  CA    . LYS D 2 279 ? 20.920  41.674 115.759 1.00 274.96 ? 796  LYS F CA    1 
ATOM   8985  C  C     . LYS D 2 279 ? 22.354  41.155 115.901 1.00 271.25 ? 796  LYS F C     1 
ATOM   8986  O  O     . LYS D 2 279 ? 22.854  40.467 115.010 1.00 269.64 ? 796  LYS F O     1 
ATOM   8987  C  CB    . LYS D 2 279 ? 20.908  42.980 114.961 1.00 274.06 ? 796  LYS F CB    1 
ATOM   8988  C  CG    . LYS D 2 279 ? 19.559  43.293 114.336 1.00 276.92 ? 796  LYS F CG    1 
ATOM   8989  C  CD    . LYS D 2 279 ? 19.452  44.755 113.936 1.00 276.39 ? 796  LYS F CD    1 
ATOM   8990  C  CE    . LYS D 2 279 ? 18.260  44.993 113.025 1.00 278.92 ? 796  LYS F CE    1 
ATOM   8991  N  NZ    . LYS D 2 279 ? 18.161  46.415 112.599 1.00 278.41 ? 796  LYS F NZ    1 
ATOM   8992  N  N     . LEU D 2 280 ? 23.010  41.483 117.014 1.00 269.27 ? 797  LEU F N     1 
ATOM   8993  C  CA    . LEU D 2 280 ? 24.359  40.977 117.295 1.00 267.13 ? 797  LEU F CA    1 
ATOM   8994  C  C     . LEU D 2 280 ? 24.384  39.459 117.492 1.00 269.21 ? 797  LEU F C     1 
ATOM   8995  O  O     . LEU D 2 280 ? 25.416  38.828 117.272 1.00 267.88 ? 797  LEU F O     1 
ATOM   8996  C  CB    . LEU D 2 280 ? 24.962  41.665 118.526 1.00 265.70 ? 797  LEU F CB    1 
ATOM   8997  C  CG    . LEU D 2 280 ? 25.411  43.118 118.350 1.00 263.20 ? 797  LEU F CG    1 
ATOM   8998  C  CD1   . LEU D 2 280 ? 25.667  43.770 119.701 1.00 263.14 ? 797  LEU F CD1   1 
ATOM   8999  C  CD2   . LEU D 2 280 ? 26.653  43.200 117.473 1.00 260.39 ? 797  LEU F CD2   1 
ATOM   9000  N  N     . LYS D 2 281 ? 23.254  38.889 117.915 1.00 272.62 ? 798  LYS F N     1 
ATOM   9001  C  CA    . LYS D 2 281 ? 23.099  37.437 118.068 1.00 274.79 ? 798  LYS F CA    1 
ATOM   9002  C  C     . LYS D 2 281 ? 24.063  36.876 119.117 1.00 274.24 ? 798  LYS F C     1 
ATOM   9003  O  O     . LYS D 2 281 ? 24.718  35.858 118.891 1.00 273.74 ? 798  LYS F O     1 
ATOM   9004  C  CB    . LYS D 2 281 ? 23.290  36.725 116.718 1.00 275.04 ? 798  LYS F CB    1 
ATOM   9005  C  CG    . LYS D 2 281 ? 22.369  37.222 115.608 1.00 275.99 ? 798  LYS F CG    1 
ATOM   9006  C  CD    . LYS D 2 281 ? 21.255  36.236 115.279 1.00 279.64 ? 798  LYS F CD    1 
ATOM   9007  C  CE    . LYS D 2 281 ? 21.649  35.289 114.153 1.00 280.33 ? 798  LYS F CE    1 
ATOM   9008  N  NZ    . LYS D 2 281 ? 22.877  34.494 114.438 1.00 279.54 ? 798  LYS F NZ    1 
ATOM   9009  N  N     . THR D 2 282 ? 24.141  37.554 120.262 1.00 274.30 ? 799  THR F N     1 
ATOM   9010  C  CA    . THR D 2 282 ? 25.032  37.164 121.356 1.00 274.33 ? 799  THR F CA    1 
ATOM   9011  C  C     . THR D 2 282 ? 24.422  37.518 122.711 1.00 276.45 ? 799  THR F C     1 
ATOM   9012  O  O     . THR D 2 282 ? 23.615  38.445 122.813 1.00 277.05 ? 799  THR F O     1 
ATOM   9013  C  CB    . THR D 2 282 ? 26.394  37.881 121.258 1.00 270.96 ? 799  THR F CB    1 
ATOM   9014  O  OG1   . THR D 2 282 ? 26.191  39.300 121.273 1.00 269.96 ? 799  THR F OG1   1 
ATOM   9015  C  CG2   . THR D 2 282 ? 27.134  37.492 119.985 1.00 268.81 ? 799  THR F CG2   1 
ATOM   9016  N  N     . ASP D 2 283 ? 24.820  36.779 123.745 1.00 277.82 ? 800  ASP F N     1 
ATOM   9017  C  CA    . ASP D 2 283 ? 24.391  37.051 125.116 1.00 279.39 ? 800  ASP F CA    1 
ATOM   9018  C  C     . ASP D 2 283 ? 25.533  37.709 125.892 1.00 278.24 ? 800  ASP F C     1 
ATOM   9019  O  O     . ASP D 2 283 ? 26.455  37.030 126.351 1.00 278.29 ? 800  ASP F O     1 
ATOM   9020  C  CB    . ASP D 2 283 ? 23.947  35.755 125.805 1.00 281.74 ? 800  ASP F CB    1 
ATOM   9021  C  CG    . ASP D 2 283 ? 23.430  35.986 127.217 1.00 283.07 ? 800  ASP F CG    1 
ATOM   9022  O  OD1   . ASP D 2 283 ? 22.663  36.949 127.428 1.00 283.03 ? 800  ASP F OD1   1 
ATOM   9023  O  OD2   . ASP D 2 283 ? 23.787  35.196 128.117 1.00 283.98 ? 800  ASP F OD2   1 
ATOM   9024  N  N     . ILE D 2 284 ? 25.464  39.032 126.026 1.00 277.52 ? 801  ILE F N     1 
ATOM   9025  C  CA    . ILE D 2 284 ? 26.493  39.807 126.720 1.00 276.52 ? 801  ILE F CA    1 
ATOM   9026  C  C     . ILE D 2 284 ? 26.053  40.092 128.156 1.00 278.98 ? 801  ILE F C     1 
ATOM   9027  O  O     . ILE D 2 284 ? 24.899  40.449 128.399 1.00 280.86 ? 801  ILE F O     1 
ATOM   9028  C  CB    . ILE D 2 284 ? 26.780  41.143 125.997 1.00 274.27 ? 801  ILE F CB    1 
ATOM   9029  C  CG1   . ILE D 2 284 ? 27.145  40.887 124.530 1.00 272.46 ? 801  ILE F CG1   1 
ATOM   9030  C  CG2   . ILE D 2 284 ? 27.904  41.904 126.694 1.00 272.99 ? 801  ILE F CG2   1 
ATOM   9031  C  CD1   . ILE D 2 284 ? 27.252  42.141 123.688 1.00 270.54 ? 801  ILE F CD1   1 
ATOM   9032  N  N     . LYS D 2 285 ? 26.982  39.929 129.096 1.00 279.44 ? 802  LYS F N     1 
ATOM   9033  C  CA    . LYS D 2 285 ? 26.737  40.218 130.508 1.00 281.76 ? 802  LYS F CA    1 
ATOM   9034  C  C     . LYS D 2 285 ? 27.867  41.074 131.070 1.00 280.39 ? 802  LYS F C     1 
ATOM   9035  O  O     . LYS D 2 285 ? 28.993  41.023 130.577 1.00 277.96 ? 802  LYS F O     1 
ATOM   9036  C  CB    . LYS D 2 285 ? 26.633  38.921 131.313 1.00 284.69 ? 802  LYS F CB    1 
ATOM   9037  C  CG    . LYS D 2 285 ? 25.470  38.021 130.925 1.00 286.78 ? 802  LYS F CG    1 
ATOM   9038  C  CD    . LYS D 2 285 ? 24.130  38.639 131.294 1.00 288.56 ? 802  LYS F CD    1 
ATOM   9039  C  CE    . LYS D 2 285 ? 22.984  37.660 131.088 1.00 290.85 ? 802  LYS F CE    1 
ATOM   9040  N  NZ    . LYS D 2 285 ? 23.000  36.542 132.072 1.00 293.26 ? 802  LYS F NZ    1 
ATOM   9041  N  N     . VAL D 2 286 ? 27.558  41.850 132.106 1.00 281.97 ? 803  VAL F N     1 
ATOM   9042  C  CA    . VAL D 2 286 ? 28.543  42.711 132.756 1.00 281.60 ? 803  VAL F CA    1 
ATOM   9043  C  C     . VAL D 2 286 ? 29.117  42.005 133.981 1.00 284.17 ? 803  VAL F C     1 
ATOM   9044  O  O     . VAL D 2 286 ? 28.400  41.752 134.951 1.00 287.15 ? 803  VAL F O     1 
ATOM   9045  C  CB    . VAL D 2 286 ? 27.924  44.058 133.193 1.00 281.91 ? 803  VAL F CB    1 
ATOM   9046  C  CG1   . VAL D 2 286 ? 29.002  45.001 133.716 1.00 281.19 ? 803  VAL F CG1   1 
ATOM   9047  C  CG2   . VAL D 2 286 ? 27.170  44.701 132.038 1.00 280.64 ? 803  VAL F CG2   1 
ATOM   9048  N  N     . VAL D 2 287 ? 30.409  41.684 133.930 1.00 283.75 ? 804  VAL F N     1 
ATOM   9049  C  CA    . VAL D 2 287 ? 31.110  41.132 135.087 1.00 285.93 ? 804  VAL F CA    1 
ATOM   9050  C  C     . VAL D 2 287 ? 31.369  42.278 136.062 1.00 287.33 ? 804  VAL F C     1 
ATOM   9051  O  O     . VAL D 2 287 ? 31.971  43.288 135.693 1.00 286.37 ? 804  VAL F O     1 
ATOM   9052  C  CB    . VAL D 2 287 ? 32.450  40.474 134.694 1.00 284.47 ? 804  VAL F CB    1 
ATOM   9053  C  CG1   . VAL D 2 287 ? 33.180  39.953 135.925 1.00 286.44 ? 804  VAL F CG1   1 
ATOM   9054  C  CG2   . VAL D 2 287 ? 32.223  39.344 133.699 1.00 284.00 ? 804  VAL F CG2   1 
ATOM   9055  N  N     . ASP D 2 288 ? 30.910  42.116 137.300 1.00 290.50 ? 805  ASP F N     1 
ATOM   9056  C  CA    . ASP D 2 288 ? 31.059  43.150 138.321 1.00 291.88 ? 805  ASP F CA    1 
ATOM   9057  C  C     . ASP D 2 288 ? 32.522  43.273 138.742 1.00 291.65 ? 805  ASP F C     1 
ATOM   9058  O  O     . ASP D 2 288 ? 33.271  42.295 138.703 1.00 291.08 ? 805  ASP F O     1 
ATOM   9059  C  CB    . ASP D 2 288 ? 30.178  42.830 139.536 1.00 295.44 ? 805  ASP F CB    1 
ATOM   9060  C  CG    . ASP D 2 288 ? 30.058  43.997 140.507 1.00 297.22 ? 805  ASP F CG    1 
ATOM   9061  O  OD1   . ASP D 2 288 ? 30.290  45.157 140.102 1.00 296.27 ? 805  ASP F OD1   1 
ATOM   9062  O  OD2   . ASP D 2 288 ? 29.722  43.750 141.684 1.00 300.01 ? 805  ASP F OD2   1 
ATOM   9063  N  N     . ARG D 2 289 ? 32.920  44.479 139.140 1.00 292.07 ? 806  ARG F N     1 
ATOM   9064  C  CA    . ARG D 2 289 ? 34.297  44.742 139.564 1.00 292.52 ? 806  ARG F CA    1 
ATOM   9065  C  C     . ARG D 2 289 ? 34.616  44.051 140.894 1.00 295.53 ? 806  ARG F C     1 
ATOM   9066  O  O     . ARG D 2 289 ? 35.772  43.721 141.165 1.00 296.59 ? 806  ARG F O     1 
ATOM   9067  C  CB    . ARG D 2 289 ? 34.544  46.249 139.677 1.00 292.61 ? 806  ARG F CB    1 
ATOM   9068  C  CG    . ARG D 2 289 ? 36.013  46.644 139.662 1.00 292.54 ? 806  ARG F CG    1 
ATOM   9069  C  CD    . ARG D 2 289 ? 36.197  48.109 140.015 1.00 293.79 ? 806  ARG F CD    1 
ATOM   9070  N  NE    . ARG D 2 289 ? 37.582  48.421 140.378 1.00 294.83 ? 806  ARG F NE    1 
ATOM   9071  C  CZ    . ARG D 2 289 ? 38.469  49.037 139.595 1.00 293.20 ? 806  ARG F CZ    1 
ATOM   9072  N  NH1   . ARG D 2 289 ? 38.155  49.431 138.363 1.00 290.50 ? 806  ARG F NH1   1 
ATOM   9073  N  NH2   . ARG D 2 289 ? 39.697  49.261 140.054 1.00 294.41 ? 806  ARG F NH2   1 
ATOM   9074  N  N     . ASP D 2 290 ? 33.587  43.831 141.712 1.00 297.33 ? 807  ASP F N     1 
ATOM   9075  C  CA    . ASP D 2 290 ? 33.734  43.116 142.983 1.00 299.43 ? 807  ASP F CA    1 
ATOM   9076  C  C     . ASP D 2 290 ? 33.944  41.609 142.797 1.00 298.95 ? 807  ASP F C     1 
ATOM   9077  O  O     . ASP D 2 290 ? 34.376  40.926 143.727 1.00 301.56 ? 807  ASP F O     1 
ATOM   9078  C  CB    . ASP D 2 290 ? 32.508  43.347 143.874 1.00 301.87 ? 807  ASP F CB    1 
ATOM   9079  C  CG    . ASP D 2 290 ? 32.357  44.797 144.304 1.00 302.46 ? 807  ASP F CG    1 
ATOM   9080  O  OD1   . ASP D 2 290 ? 31.652  45.048 145.303 1.00 305.22 ? 807  ASP F OD1   1 
ATOM   9081  O  OD2   . ASP D 2 290 ? 32.942  45.685 143.647 1.00 300.31 ? 807  ASP F OD2   1 
ATOM   9082  N  N     . SER D 2 291 ? 33.631  41.097 141.607 1.00 295.88 ? 808  SER F N     1 
ATOM   9083  C  CA    . SER D 2 291 ? 33.769  39.669 141.308 1.00 295.72 ? 808  SER F CA    1 
ATOM   9084  C  C     . SER D 2 291 ? 35.222  39.203 141.410 1.00 295.27 ? 808  SER F C     1 
ATOM   9085  O  O     . SER D 2 291 ? 36.150  39.962 141.121 1.00 294.21 ? 808  SER F O     1 
ATOM   9086  C  CB    . SER D 2 291 ? 33.227  39.361 139.909 1.00 293.19 ? 808  SER F CB    1 
ATOM   9087  O  OG    . SER D 2 291 ? 33.139  37.964 139.693 1.00 293.78 ? 808  SER F OG    1 
ATOM   9088  N  N     . GLU D 2 292 ? 35.403  37.949 141.819 1.00 295.99 ? 809  GLU F N     1 
ATOM   9089  C  CA    . GLU D 2 292 ? 36.735  37.368 142.000 1.00 295.32 ? 809  GLU F CA    1 
ATOM   9090  C  C     . GLU D 2 292 ? 37.400  37.052 140.659 1.00 290.75 ? 809  GLU F C     1 
ATOM   9091  O  O     . GLU D 2 292 ? 38.621  37.149 140.533 1.00 289.49 ? 809  GLU F O     1 
ATOM   9092  C  CB    . GLU D 2 292 ? 36.658  36.098 142.857 1.00 299.20 ? 809  GLU F CB    1 
ATOM   9093  C  CG    . GLU D 2 292 ? 36.105  36.308 144.264 1.00 302.61 ? 809  GLU F CG    1 
ATOM   9094  C  CD    . GLU D 2 292 ? 37.032  37.098 145.174 1.00 303.79 ? 809  GLU F CD    1 
ATOM   9095  O  OE1   . GLU D 2 292 ? 36.570  37.530 146.252 1.00 306.06 ? 809  GLU F OE1   1 
ATOM   9096  O  OE2   . GLU D 2 292 ? 38.217  37.290 144.826 1.00 302.83 ? 809  GLU F OE2   1 
ATOM   9097  N  N     . GLU D 2 293 ? 36.596  36.668 139.668 1.00 287.56 ? 810  GLU F N     1 
ATOM   9098  C  CA    . GLU D 2 293 ? 37.099  36.426 138.310 1.00 283.74 ? 810  GLU F CA    1 
ATOM   9099  C  C     . GLU D 2 293 ? 37.504  37.723 137.603 1.00 279.36 ? 810  GLU F C     1 
ATOM   9100  O  O     . GLU D 2 293 ? 38.361  37.708 136.718 1.00 277.15 ? 810  GLU F O     1 
ATOM   9101  C  CB    . GLU D 2 293 ? 36.069  35.666 137.460 1.00 283.55 ? 810  GLU F CB    1 
ATOM   9102  C  CG    . GLU D 2 293 ? 34.724  36.367 137.287 1.00 282.96 ? 810  GLU F CG    1 
ATOM   9103  C  CD    . GLU D 2 293 ? 33.940  35.870 136.083 1.00 281.87 ? 810  GLU F CD    1 
ATOM   9104  O  OE1   . GLU D 2 293 ? 34.550  35.628 135.020 1.00 280.11 ? 810  GLU F OE1   1 
ATOM   9105  O  OE2   . GLU D 2 293 ? 32.703  35.735 136.196 1.00 282.99 ? 810  GLU F OE2   1 
ATOM   9106  N  N     . ALA D 2 294 ? 36.879  38.835 137.990 1.00 277.74 ? 811  ALA F N     1 
ATOM   9107  C  CA    . ALA D 2 294 ? 37.212  40.151 137.438 1.00 273.90 ? 811  ALA F CA    1 
ATOM   9108  C  C     . ALA D 2 294 ? 38.611  40.599 137.857 1.00 273.16 ? 811  ALA F C     1 
ATOM   9109  O  O     . ALA D 2 294 ? 39.299  41.288 137.102 1.00 270.55 ? 811  ALA F O     1 
ATOM   9110  C  CB    . ALA D 2 294 ? 36.180  41.182 137.870 1.00 273.84 ? 811  ALA F CB    1 
ATOM   9111  N  N     . GLU D 2 295 ? 39.021  40.209 139.063 1.00 275.38 ? 812  GLU F N     1 
ATOM   9112  C  CA    . GLU D 2 295 ? 40.368  40.495 139.558 1.00 275.54 ? 812  GLU F CA    1 
ATOM   9113  C  C     . GLU D 2 295 ? 41.442  39.762 138.749 1.00 274.20 ? 812  GLU F C     1 
ATOM   9114  O  O     . GLU D 2 295 ? 42.563  40.253 138.624 1.00 273.18 ? 812  GLU F O     1 
ATOM   9115  C  CB    . GLU D 2 295 ? 40.493  40.116 141.038 1.00 279.15 ? 812  GLU F CB    1 
ATOM   9116  C  CG    . GLU D 2 295 ? 39.624  40.946 141.970 1.00 280.36 ? 812  GLU F CG    1 
ATOM   9117  C  CD    . GLU D 2 295 ? 39.888  40.660 143.438 1.00 284.10 ? 812  GLU F CD    1 
ATOM   9118  O  OE1   . GLU D 2 295 ? 40.401  39.566 143.758 1.00 286.33 ? 812  GLU F OE1   1 
ATOM   9119  O  OE2   . GLU D 2 295 ? 39.577  41.532 144.276 1.00 285.00 ? 812  GLU F OE2   1 
ATOM   9120  N  N     . ILE D 2 296 ? 41.093  38.597 138.205 1.00 273.95 ? 813  ILE F N     1 
ATOM   9121  C  CA    . ILE D 2 296 ? 42.025  37.798 137.402 1.00 272.89 ? 813  ILE F CA    1 
ATOM   9122  C  C     . ILE D 2 296 ? 42.319  38.496 136.075 1.00 269.21 ? 813  ILE F C     1 
ATOM   9123  O  O     . ILE D 2 296 ? 43.471  38.556 135.643 1.00 268.41 ? 813  ILE F O     1 
ATOM   9124  C  CB    . ILE D 2 296 ? 41.484  36.373 137.121 1.00 273.80 ? 813  ILE F CB    1 
ATOM   9125  C  CG1   . ILE D 2 296 ? 41.184  35.633 138.430 1.00 277.29 ? 813  ILE F CG1   1 
ATOM   9126  C  CG2   . ILE D 2 296 ? 42.487  35.562 136.305 1.00 273.22 ? 813  ILE F CG2   1 
ATOM   9127  C  CD1   . ILE D 2 296 ? 40.488  34.303 138.239 1.00 278.56 ? 813  ILE F CD1   1 
ATOM   9128  N  N     . ILE D 2 297 ? 41.274  39.018 135.433 1.00 266.87 ? 814  ILE F N     1 
ATOM   9129  C  CA    . ILE D 2 297 ? 41.422  39.728 134.162 1.00 263.21 ? 814  ILE F CA    1 
ATOM   9130  C  C     . ILE D 2 297 ? 42.236  41.010 134.342 1.00 261.65 ? 814  ILE F C     1 
ATOM   9131  O  O     . ILE D 2 297 ? 43.172  41.260 133.583 1.00 260.16 ? 814  ILE F O     1 
ATOM   9132  C  CB    . ILE D 2 297 ? 40.053  40.050 133.521 1.00 261.73 ? 814  ILE F CB    1 
ATOM   9133  C  CG1   . ILE D 2 297 ? 39.383  38.758 133.041 1.00 261.84 ? 814  ILE F CG1   1 
ATOM   9134  C  CG2   . ILE D 2 297 ? 40.221  41.016 132.354 1.00 258.92 ? 814  ILE F CG2   1 
ATOM   9135  C  CD1   . ILE D 2 297 ? 37.916  38.905 132.696 1.00 261.25 ? 814  ILE F CD1   1 
ATOM   9136  N  N     . ARG D 2 298 ? 41.882  41.814 135.343 1.00 261.79 ? 815  ARG F N     1 
ATOM   9137  C  CA    . ARG D 2 298 ? 42.639  43.032 135.655 1.00 261.10 ? 815  ARG F CA    1 
ATOM   9138  C  C     . ARG D 2 298 ? 44.100  42.726 135.991 1.00 260.71 ? 815  ARG F C     1 
ATOM   9139  O  O     . ARG D 2 298 ? 44.986  43.537 135.718 1.00 260.38 ? 815  ARG F O     1 
ATOM   9140  C  CB    . ARG D 2 298 ? 41.989  43.810 136.806 1.00 263.67 ? 815  ARG F CB    1 
ATOM   9141  C  CG    . ARG D 2 298 ? 40.769  44.618 136.393 1.00 262.94 ? 815  ARG F CG    1 
ATOM   9142  C  CD    . ARG D 2 298 ? 40.400  45.651 137.446 1.00 264.75 ? 815  ARG F CD    1 
ATOM   9143  N  NE    . ARG D 2 298 ? 40.015  45.034 138.715 1.00 268.10 ? 815  ARG F NE    1 
ATOM   9144  C  CZ    . ARG D 2 298 ? 38.832  44.472 138.965 1.00 269.46 ? 815  ARG F CZ    1 
ATOM   9145  N  NH1   . ARG D 2 298 ? 37.883  44.426 138.033 1.00 268.05 ? 815  ARG F NH1   1 
ATOM   9146  N  NH2   . ARG D 2 298 ? 38.596  43.943 140.160 1.00 272.50 ? 815  ARG F NH2   1 
ATOM   9147  N  N     . LYS D 2 299 ? 44.341  41.558 136.584 1.00 260.73 ? 816  LYS F N     1 
ATOM   9148  C  CA    . LYS D 2 299 ? 45.701  41.077 136.817 1.00 260.48 ? 816  LYS F CA    1 
ATOM   9149  C  C     . LYS D 2 299 ? 46.349  40.698 135.486 1.00 256.33 ? 816  LYS F C     1 
ATOM   9150  O  O     . LYS D 2 299 ? 47.496  41.054 135.230 1.00 255.61 ? 816  LYS F O     1 
ATOM   9151  C  CB    . LYS D 2 299 ? 45.696  39.875 137.768 1.00 263.85 ? 816  LYS F CB    1 
ATOM   9152  C  CG    . LYS D 2 299 ? 47.024  39.619 138.461 1.00 266.50 ? 816  LYS F CG    1 
ATOM   9153  C  CD    . LYS D 2 299 ? 46.884  38.549 139.532 1.00 270.01 ? 816  LYS F CD    1 
ATOM   9154  C  CE    . LYS D 2 299 ? 48.141  38.433 140.378 1.00 273.19 ? 816  LYS F CE    1 
ATOM   9155  N  NZ    . LYS D 2 299 ? 47.996  37.406 141.447 1.00 277.08 ? 816  LYS F NZ    1 
ATOM   9156  N  N     . TYR D 2 300 ? 45.598  39.989 134.644 1.00 252.78 ? 817  TYR F N     1 
ATOM   9157  C  CA    . TYR D 2 300 ? 46.067  39.573 133.316 1.00 249.07 ? 817  TYR F CA    1 
ATOM   9158  C  C     . TYR D 2 300 ? 46.392  40.776 132.423 1.00 245.65 ? 817  TYR F C     1 
ATOM   9159  O  O     . TYR D 2 300 ? 47.298  40.708 131.593 1.00 244.57 ? 817  TYR F O     1 
ATOM   9160  C  CB    . TYR D 2 300 ? 45.015  38.669 132.648 1.00 247.75 ? 817  TYR F CB    1 
ATOM   9161  C  CG    . TYR D 2 300 ? 45.462  37.882 131.423 1.00 246.16 ? 817  TYR F CG    1 
ATOM   9162  C  CD1   . TYR D 2 300 ? 46.801  37.545 131.210 1.00 246.73 ? 817  TYR F CD1   1 
ATOM   9163  C  CD2   . TYR D 2 300 ? 44.525  37.432 130.494 1.00 244.59 ? 817  TYR F CD2   1 
ATOM   9164  C  CE1   . TYR D 2 300 ? 47.189  36.813 130.099 1.00 245.96 ? 817  TYR F CE1   1 
ATOM   9165  C  CE2   . TYR D 2 300 ? 44.906  36.698 129.382 1.00 243.85 ? 817  TYR F CE2   1 
ATOM   9166  C  CZ    . TYR D 2 300 ? 46.238  36.391 129.189 1.00 244.48 ? 817  TYR F CZ    1 
ATOM   9167  O  OH    . TYR D 2 300 ? 46.620  35.665 128.084 1.00 243.93 ? 817  TYR F OH    1 
ATOM   9168  N  N     . VAL D 2 301 ? 45.653  41.871 132.603 1.00 243.70 ? 818  VAL F N     1 
ATOM   9169  C  CA    . VAL D 2 301 ? 45.923  43.126 131.896 1.00 240.80 ? 818  VAL F CA    1 
ATOM   9170  C  C     . VAL D 2 301 ? 47.173  43.803 132.461 1.00 241.32 ? 818  VAL F C     1 
ATOM   9171  O  O     . VAL D 2 301 ? 48.112  44.107 131.723 1.00 239.56 ? 818  VAL F O     1 
ATOM   9172  C  CB    . VAL D 2 301 ? 44.723  44.098 131.995 1.00 240.00 ? 818  VAL F CB    1 
ATOM   9173  C  CG1   . VAL D 2 301 ? 45.092  45.491 131.496 1.00 238.39 ? 818  VAL F CG1   1 
ATOM   9174  C  CG2   . VAL D 2 301 ? 43.538  43.556 131.211 1.00 238.50 ? 818  VAL F CG2   1 
ATOM   9175  N  N     . LYS D 2 302 ? 47.169  44.036 133.771 1.00 243.41 ? 819  LYS F N     1 
ATOM   9176  C  CA    . LYS D 2 302 ? 48.268  44.721 134.457 1.00 244.76 ? 819  LYS F CA    1 
ATOM   9177  C  C     . LYS D 2 302 ? 49.602  43.980 134.328 1.00 245.74 ? 819  LYS F C     1 
ATOM   9178  O  O     . LYS D 2 302 ? 50.648  44.607 134.152 1.00 245.32 ? 819  LYS F O     1 
ATOM   9179  C  CB    . LYS D 2 302 ? 47.920  44.910 135.939 1.00 247.64 ? 819  LYS F CB    1 
ATOM   9180  C  CG    . LYS D 2 302 ? 48.997  45.586 136.778 1.00 249.85 ? 819  LYS F CG    1 
ATOM   9181  C  CD    . LYS D 2 302 ? 48.630  45.579 138.254 1.00 253.06 ? 819  LYS F CD    1 
ATOM   9182  C  CE    . LYS D 2 302 ? 49.830  45.892 139.134 1.00 255.75 ? 819  LYS F CE    1 
ATOM   9183  N  NZ    . LYS D 2 302 ? 49.537  45.658 140.575 1.00 259.03 ? 819  LYS F NZ    1 
ATOM   9184  N  N     . ASN D 2 303 ? 49.558  42.651 134.412 1.00 246.89 ? 820  ASN F N     1 
ATOM   9185  C  CA    . ASN D 2 303 ? 50.775  41.835 134.430 1.00 248.33 ? 820  ASN F CA    1 
ATOM   9186  C  C     . ASN D 2 303 ? 51.432  41.729 133.059 1.00 245.68 ? 820  ASN F C     1 
ATOM   9187  O  O     . ASN D 2 303 ? 52.639  41.941 132.927 1.00 245.93 ? 820  ASN F O     1 
ATOM   9188  C  CB    . ASN D 2 303 ? 50.488  40.420 134.955 1.00 251.07 ? 820  ASN F CB    1 
ATOM   9189  C  CG    . ASN D 2 303 ? 50.414  40.351 136.473 1.00 254.76 ? 820  ASN F CG    1 
ATOM   9190  O  OD1   . ASN D 2 303 ? 50.994  39.453 137.083 1.00 258.04 ? 820  ASN F OD1   1 
ATOM   9191  N  ND2   . ASN D 2 303 ? 49.704  41.291 137.089 1.00 254.75 ? 820  ASN F ND2   1 
ATOM   9192  N  N     . THR D 2 304 ? 50.633  41.408 132.044 1.00 243.10 ? 821  THR F N     1 
ATOM   9193  C  CA    . THR D 2 304 ? 51.159  41.093 130.715 1.00 241.27 ? 821  THR F CA    1 
ATOM   9194  C  C     . THR D 2 304 ? 51.201  42.311 129.785 1.00 238.97 ? 821  THR F C     1 
ATOM   9195  O  O     . THR D 2 304 ? 50.768  42.237 128.633 1.00 236.59 ? 821  THR F O     1 
ATOM   9196  C  CB    . THR D 2 304 ? 50.350  39.958 130.048 1.00 240.34 ? 821  THR F CB    1 
ATOM   9197  O  OG1   . THR D 2 304 ? 49.044  40.430 129.694 1.00 238.49 ? 821  THR F OG1   1 
ATOM   9198  C  CG2   . THR D 2 304 ? 50.225  38.762 130.983 1.00 243.14 ? 821  THR F CG2   1 
ATOM   9199  N  N     . HIS D 2 305 ? 51.732  43.423 130.289 1.00 239.67 ? 822  HIS F N     1 
ATOM   9200  C  CA    . HIS D 2 305 ? 52.017  44.593 129.464 1.00 237.89 ? 822  HIS F CA    1 
ATOM   9201  C  C     . HIS D 2 305 ? 53.461  44.495 128.987 1.00 238.73 ? 822  HIS F C     1 
ATOM   9202  O  O     . HIS D 2 305 ? 54.353  44.143 129.762 1.00 241.26 ? 822  HIS F O     1 
ATOM   9203  C  CB    . HIS D 2 305 ? 51.807  45.883 130.258 1.00 238.49 ? 822  HIS F CB    1 
ATOM   9204  C  CG    . HIS D 2 305 ? 51.853  47.123 129.420 1.00 236.34 ? 822  HIS F CG    1 
ATOM   9205  N  ND1   . HIS D 2 305 ? 50.730  47.666 128.836 1.00 234.07 ? 822  HIS F ND1   1 
ATOM   9206  C  CD2   . HIS D 2 305 ? 52.885  47.925 129.066 1.00 236.17 ? 822  HIS F CD2   1 
ATOM   9207  C  CE1   . HIS D 2 305 ? 51.067  48.750 128.159 1.00 232.80 ? 822  HIS F CE1   1 
ATOM   9208  N  NE2   . HIS D 2 305 ? 52.370  48.928 128.282 1.00 234.03 ? 822  HIS F NE2   1 
ATOM   9209  N  N     . ALA D 2 306 ? 53.689  44.809 127.715 1.00 237.28 ? 823  ALA F N     1 
ATOM   9210  C  CA    . ALA D 2 306 ? 55.002  44.633 127.099 1.00 238.39 ? 823  ALA F CA    1 
ATOM   9211  C  C     . ALA D 2 306 ? 55.971  45.729 127.530 1.00 240.20 ? 823  ALA F C     1 
ATOM   9212  O  O     . ALA D 2 306 ? 55.607  46.905 127.586 1.00 239.52 ? 823  ALA F O     1 
ATOM   9213  C  CB    . ALA D 2 306 ? 54.875  44.609 125.585 1.00 235.97 ? 823  ALA F CB    1 
ATOM   9214  N  N     . THR D 2 307 ? 57.203  45.330 127.836 1.00 243.00 ? 824  THR F N     1 
ATOM   9215  C  CA    . THR D 2 307 ? 58.262  46.272 128.210 1.00 244.84 ? 824  THR F CA    1 
ATOM   9216  C  C     . THR D 2 307 ? 58.633  47.211 127.056 1.00 242.75 ? 824  THR F C     1 
ATOM   9217  O  O     . THR D 2 307 ? 59.007  48.363 127.285 1.00 243.15 ? 824  THR F O     1 
ATOM   9218  C  CB    . THR D 2 307 ? 59.530  45.538 128.711 1.00 248.11 ? 824  THR F CB    1 
ATOM   9219  O  OG1   . THR D 2 307 ? 60.467  46.491 129.229 1.00 250.10 ? 824  THR F OG1   1 
ATOM   9220  C  CG2   . THR D 2 307 ? 60.195  44.724 127.594 1.00 247.64 ? 824  THR F CG2   1 
ATOM   9221  N  N     . THR D 2 308 ? 58.524  46.714 125.825 1.00 240.62 ? 825  THR F N     1 
ATOM   9222  C  CA    . THR D 2 308 ? 58.850  47.498 124.634 1.00 238.72 ? 825  THR F CA    1 
ATOM   9223  C  C     . THR D 2 308 ? 57.708  48.425 124.213 1.00 236.22 ? 825  THR F C     1 
ATOM   9224  O  O     . THR D 2 308 ? 57.956  49.506 123.677 1.00 235.45 ? 825  THR F O     1 
ATOM   9225  C  CB    . THR D 2 308 ? 59.224  46.588 123.448 1.00 237.91 ? 825  THR F CB    1 
ATOM   9226  O  OG1   . THR D 2 308 ? 58.180  45.633 123.224 1.00 237.15 ? 825  THR F OG1   1 
ATOM   9227  C  CG2   . THR D 2 308 ? 60.529  45.856 123.731 1.00 240.62 ? 825  THR F CG2   1 
ATOM   9228  N  N     . HIS D 2 309 ? 56.465  48.005 124.453 1.00 235.12 ? 826  HIS F N     1 
ATOM   9229  C  CA    . HIS D 2 309 ? 55.295  48.823 124.120 1.00 233.12 ? 826  HIS F CA    1 
ATOM   9230  C  C     . HIS D 2 309 ? 54.975  49.795 125.258 1.00 234.01 ? 826  HIS F C     1 
ATOM   9231  O  O     . HIS D 2 309 ? 53.927  49.694 125.901 1.00 233.83 ? 826  HIS F O     1 
ATOM   9232  C  CB    . HIS D 2 309 ? 54.071  47.946 123.825 1.00 231.97 ? 826  HIS F CB    1 
ATOM   9233  C  CG    . HIS D 2 309 ? 54.305  46.901 122.779 1.00 231.36 ? 826  HIS F CG    1 
ATOM   9234  N  ND1   . HIS D 2 309 ? 53.655  45.685 122.786 1.00 231.55 ? 826  HIS F ND1   1 
ATOM   9235  C  CD2   . HIS D 2 309 ? 55.125  46.881 121.702 1.00 230.86 ? 826  HIS F CD2   1 
ATOM   9236  C  CE1   . HIS D 2 309 ? 54.057  44.966 121.754 1.00 231.20 ? 826  HIS F CE1   1 
ATOM   9237  N  NE2   . HIS D 2 309 ? 54.950  45.668 121.081 1.00 230.80 ? 826  HIS F NE2   1 
ATOM   9238  N  N     . ASN D 2 310 ? 55.882  50.743 125.491 1.00 234.86 ? 827  ASN F N     1 
ATOM   9239  C  CA    . ASN D 2 310 ? 55.729  51.730 126.565 1.00 235.98 ? 827  ASN F CA    1 
ATOM   9240  C  C     . ASN D 2 310 ? 55.144  53.062 126.081 1.00 233.93 ? 827  ASN F C     1 
ATOM   9241  O  O     . ASN D 2 310 ? 55.189  54.063 126.800 1.00 235.15 ? 827  ASN F O     1 
ATOM   9242  C  CB    . ASN D 2 310 ? 57.075  51.963 127.270 1.00 238.91 ? 827  ASN F CB    1 
ATOM   9243  C  CG    . ASN D 2 310 ? 58.125  52.574 126.355 1.00 238.77 ? 827  ASN F CG    1 
ATOM   9244  O  OD1   . ASN D 2 310 ? 58.068  52.426 125.134 1.00 236.57 ? 827  ASN F OD1   1 
ATOM   9245  N  ND2   . ASN D 2 310 ? 59.100  53.256 126.947 1.00 241.42 ? 827  ASN F ND2   1 
ATOM   9246  N  N     . ALA D 2 311 ? 54.592  53.068 124.869 1.00 230.79 ? 828  ALA F N     1 
ATOM   9247  C  CA    . ALA D 2 311 ? 53.994  54.270 124.289 1.00 228.88 ? 828  ALA F CA    1 
ATOM   9248  C  C     . ALA D 2 311 ? 52.680  54.651 124.972 1.00 228.14 ? 828  ALA F C     1 
ATOM   9249  O  O     . ALA D 2 311 ? 52.313  55.827 125.000 1.00 227.89 ? 828  ALA F O     1 
ATOM   9250  C  CB    . ALA D 2 311 ? 53.771  54.079 122.795 1.00 226.43 ? 828  ALA F CB    1 
ATOM   9251  N  N     . TYR D 2 312 ? 51.976  53.658 125.516 1.00 227.61 ? 829  TYR F N     1 
ATOM   9252  C  CA    . TYR D 2 312 ? 50.698  53.889 126.191 1.00 227.42 ? 829  TYR F CA    1 
ATOM   9253  C  C     . TYR D 2 312 ? 50.561  53.071 127.477 1.00 228.62 ? 829  TYR F C     1 
ATOM   9254  O  O     . TYR D 2 312 ? 51.377  52.191 127.758 1.00 229.55 ? 829  TYR F O     1 
ATOM   9255  C  CB    . TYR D 2 312 ? 49.531  53.589 125.241 1.00 225.61 ? 829  TYR F CB    1 
ATOM   9256  C  CG    . TYR D 2 312 ? 49.559  52.209 124.615 1.00 225.26 ? 829  TYR F CG    1 
ATOM   9257  C  CD1   . TYR D 2 312 ? 49.119  51.094 125.322 1.00 226.19 ? 829  TYR F CD1   1 
ATOM   9258  C  CD2   . TYR D 2 312 ? 50.009  52.022 123.310 1.00 224.07 ? 829  TYR F CD2   1 
ATOM   9259  C  CE1   . TYR D 2 312 ? 49.136  49.832 124.752 1.00 225.65 ? 829  TYR F CE1   1 
ATOM   9260  C  CE2   . TYR D 2 312 ? 50.030  50.763 122.732 1.00 223.48 ? 829  TYR F CE2   1 
ATOM   9261  C  CZ    . TYR D 2 312 ? 49.592  49.672 123.459 1.00 224.26 ? 829  TYR F CZ    1 
ATOM   9262  O  OH    . TYR D 2 312 ? 49.606  48.417 122.898 1.00 223.80 ? 829  TYR F OH    1 
ATOM   9263  N  N     . ASP D 2 313 ? 49.519  53.382 128.246 1.00 228.32 ? 830  ASP F N     1 
ATOM   9264  C  CA    . ASP D 2 313 ? 49.238  52.718 129.517 1.00 229.47 ? 830  ASP F CA    1 
ATOM   9265  C  C     . ASP D 2 313 ? 47.757  52.347 129.577 1.00 228.25 ? 830  ASP F C     1 
ATOM   9266  O  O     . ASP D 2 313 ? 46.893  53.210 129.410 1.00 227.40 ? 830  ASP F O     1 
ATOM   9267  C  CB    . ASP D 2 313 ? 49.603  53.650 130.678 1.00 231.91 ? 830  ASP F CB    1 
ATOM   9268  C  CG    . ASP D 2 313 ? 49.257  53.065 132.038 1.00 234.34 ? 830  ASP F CG    1 
ATOM   9269  O  OD1   . ASP D 2 313 ? 49.453  51.848 132.239 1.00 234.67 ? 830  ASP F OD1   1 
ATOM   9270  O  OD2   . ASP D 2 313 ? 48.797  53.831 132.910 1.00 236.40 ? 830  ASP F OD2   1 
ATOM   9271  N  N     . LEU D 2 314 ? 47.469  51.069 129.818 1.00 228.20 ? 831  LEU F N     1 
ATOM   9272  C  CA    . LEU D 2 314 ? 46.088  50.576 129.817 1.00 227.53 ? 831  LEU F CA    1 
ATOM   9273  C  C     . LEU D 2 314 ? 45.337  50.939 131.092 1.00 229.14 ? 831  LEU F C     1 
ATOM   9274  O  O     . LEU D 2 314 ? 45.935  51.294 132.109 1.00 231.16 ? 831  LEU F O     1 
ATOM   9275  C  CB    . LEU D 2 314 ? 46.034  49.055 129.613 1.00 227.49 ? 831  LEU F CB    1 
ATOM   9276  C  CG    . LEU D 2 314 ? 46.247  48.525 128.191 1.00 225.45 ? 831  LEU F CG    1 
ATOM   9277  C  CD1   . LEU D 2 314 ? 45.289  49.178 127.202 1.00 223.38 ? 831  LEU F CD1   1 
ATOM   9278  C  CD2   . LEU D 2 314 ? 47.689  48.717 127.755 1.00 225.41 ? 831  LEU F CD2   1 
ATOM   9279  N  N     . GLU D 2 315 ? 44.014  50.838 131.012 1.00 228.32 ? 832  GLU F N     1 
ATOM   9280  C  CA    . GLU D 2 315 ? 43.128  51.146 132.125 1.00 230.04 ? 832  GLU F CA    1 
ATOM   9281  C  C     . GLU D 2 315 ? 41.762  50.525 131.836 1.00 228.73 ? 832  GLU F C     1 
ATOM   9282  O  O     . GLU D 2 315 ? 40.998  51.040 131.017 1.00 227.36 ? 832  GLU F O     1 
ATOM   9283  C  CB    . GLU D 2 315 ? 43.016  52.662 132.303 1.00 231.08 ? 832  GLU F CB    1 
ATOM   9284  C  CG    . GLU D 2 315 ? 42.361  53.102 133.601 1.00 233.77 ? 832  GLU F CG    1 
ATOM   9285  C  CD    . GLU D 2 315 ? 42.276  54.612 133.721 1.00 234.38 ? 832  GLU F CD    1 
ATOM   9286  O  OE1   . GLU D 2 315 ? 43.263  55.299 133.384 1.00 233.86 ? 832  GLU F OE1   1 
ATOM   9287  O  OE2   . GLU D 2 315 ? 41.221  55.113 134.160 1.00 235.73 ? 832  GLU F OE2   1 
ATOM   9288  N  N     . VAL D 2 316 ? 41.467  49.411 132.501 1.00 229.77 ? 833  VAL F N     1 
ATOM   9289  C  CA    . VAL D 2 316 ? 40.257  48.638 132.219 1.00 229.61 ? 833  VAL F CA    1 
ATOM   9290  C  C     . VAL D 2 316 ? 39.013  49.379 132.706 1.00 231.16 ? 833  VAL F C     1 
ATOM   9291  O  O     . VAL D 2 316 ? 38.802  49.523 133.909 1.00 233.74 ? 833  VAL F O     1 
ATOM   9292  C  CB    . VAL D 2 316 ? 40.312  47.238 132.873 1.00 230.62 ? 833  VAL F CB    1 
ATOM   9293  C  CG1   . VAL D 2 316 ? 39.021  46.470 132.621 1.00 230.50 ? 833  VAL F CG1   1 
ATOM   9294  C  CG2   . VAL D 2 316 ? 41.506  46.449 132.349 1.00 229.62 ? 833  VAL F CG2   1 
ATOM   9295  N  N     . ILE D 2 317 ? 38.196  49.846 131.763 1.00 230.51 ? 834  ILE F N     1 
ATOM   9296  C  CA    . ILE D 2 317 ? 36.941  50.523 132.093 1.00 232.79 ? 834  ILE F CA    1 
ATOM   9297  C  C     . ILE D 2 317 ? 35.876  49.485 132.449 1.00 234.73 ? 834  ILE F C     1 
ATOM   9298  O  O     . ILE D 2 317 ? 35.203  49.610 133.474 1.00 237.19 ? 834  ILE F O     1 
ATOM   9299  C  CB    . ILE D 2 317 ? 36.427  51.410 130.934 1.00 231.53 ? 834  ILE F CB    1 
ATOM   9300  C  CG1   . ILE D 2 317 ? 37.492  52.426 130.501 1.00 230.71 ? 834  ILE F CG1   1 
ATOM   9301  C  CG2   . ILE D 2 317 ? 35.165  52.164 131.346 1.00 232.94 ? 834  ILE F CG2   1 
ATOM   9302  C  CD1   . ILE D 2 317 ? 37.065  53.296 129.335 1.00 229.05 ? 834  ILE F CD1   1 
ATOM   9303  N  N     . ASP D 2 318 ? 35.731  48.465 131.602 1.00 234.61 ? 835  ASP F N     1 
ATOM   9304  C  CA    . ASP D 2 318 ? 34.703  47.437 131.786 1.00 236.88 ? 835  ASP F CA    1 
ATOM   9305  C  C     . ASP D 2 318 ? 35.188  46.024 131.459 1.00 237.97 ? 835  ASP F C     1 
ATOM   9306  O  O     . ASP D 2 318 ? 36.160  45.838 130.725 1.00 236.79 ? 835  ASP F O     1 
ATOM   9307  C  CB    . ASP D 2 318 ? 33.481  47.749 130.916 1.00 235.78 ? 835  ASP F CB    1 
ATOM   9308  C  CG    . ASP D 2 318 ? 32.499  48.681 131.596 1.00 237.21 ? 835  ASP F CG    1 
ATOM   9309  O  OD1   . ASP D 2 318 ? 31.467  48.190 132.099 1.00 239.04 ? 835  ASP F OD1   1 
ATOM   9310  O  OD2   . ASP D 2 318 ? 32.758  49.901 131.634 1.00 236.74 ? 835  ASP F OD2   1 
ATOM   9311  N  N     . ILE D 2 319 ? 34.485  45.042 132.021 1.00 241.16 ? 836  ILE F N     1 
ATOM   9312  C  CA    . ILE D 2 319 ? 34.662  43.630 131.689 1.00 242.50 ? 836  ILE F CA    1 
ATOM   9313  C  C     . ILE D 2 319 ? 33.304  43.072 131.271 1.00 243.37 ? 836  ILE F C     1 
ATOM   9314  O  O     . ILE D 2 319 ? 32.345  43.139 132.042 1.00 245.27 ? 836  ILE F O     1 
ATOM   9315  C  CB    . ILE D 2 319 ? 35.165  42.812 132.900 1.00 245.49 ? 836  ILE F CB    1 
ATOM   9316  C  CG1   . ILE D 2 319 ? 36.494  43.367 133.431 1.00 245.84 ? 836  ILE F CG1   1 
ATOM   9317  C  CG2   . ILE D 2 319 ? 35.302  41.337 132.537 1.00 246.13 ? 836  ILE F CG2   1 
ATOM   9318  C  CD1   . ILE D 2 319 ? 37.662  43.247 132.475 1.00 243.98 ? 836  ILE F CD1   1 
ATOM   9319  N  N     . PHE D 2 320 ? 33.222  42.530 130.058 1.00 242.43 ? 837  PHE F N     1 
ATOM   9320  C  CA    . PHE D 2 320 ? 31.992  41.905 129.569 1.00 243.53 ? 837  PHE F CA    1 
ATOM   9321  C  C     . PHE D 2 320 ? 32.207  40.418 129.325 1.00 244.35 ? 837  PHE F C     1 
ATOM   9322  O  O     . PHE D 2 320 ? 33.125  40.038 128.601 1.00 243.06 ? 837  PHE F O     1 
ATOM   9323  C  CB    . PHE D 2 320 ? 31.531  42.557 128.263 1.00 241.87 ? 837  PHE F CB    1 
ATOM   9324  C  CG    . PHE D 2 320 ? 31.095  43.985 128.412 1.00 241.64 ? 837  PHE F CG    1 
ATOM   9325  C  CD1   . PHE D 2 320 ? 29.764  44.295 128.656 1.00 243.24 ? 837  PHE F CD1   1 
ATOM   9326  C  CD2   . PHE D 2 320 ? 32.010  45.022 128.294 1.00 239.79 ? 837  PHE F CD2   1 
ATOM   9327  C  CE1   . PHE D 2 320 ? 29.355  45.611 128.788 1.00 243.05 ? 837  PHE F CE1   1 
ATOM   9328  C  CE2   . PHE D 2 320 ? 31.608  46.341 128.423 1.00 239.67 ? 837  PHE F CE2   1 
ATOM   9329  C  CZ    . PHE D 2 320 ? 30.278  46.636 128.672 1.00 241.33 ? 837  PHE F CZ    1 
ATOM   9330  N  N     . LYS D 2 321 ? 31.364  39.582 129.927 1.00 247.09 ? 838  LYS F N     1 
ATOM   9331  C  CA    . LYS D 2 321 ? 31.344  38.156 129.612 1.00 248.52 ? 838  LYS F CA    1 
ATOM   9332  C  C     . LYS D 2 321 ? 30.483  37.960 128.369 1.00 248.24 ? 838  LYS F C     1 
ATOM   9333  O  O     . LYS D 2 321 ? 29.305  38.323 128.364 1.00 248.57 ? 838  LYS F O     1 
ATOM   9334  C  CB    . LYS D 2 321 ? 30.791  37.336 130.780 1.00 251.63 ? 838  LYS F CB    1 
ATOM   9335  C  CG    . LYS D 2 321 ? 30.797  35.834 130.531 1.00 253.06 ? 838  LYS F CG    1 
ATOM   9336  C  CD    . LYS D 2 321 ? 30.620  35.042 131.816 1.00 255.91 ? 838  LYS F CD    1 
ATOM   9337  C  CE    . LYS D 2 321 ? 30.461  33.555 131.537 1.00 257.60 ? 838  LYS F CE    1 
ATOM   9338  N  NZ    . LYS D 2 321 ? 31.634  32.974 130.825 1.00 256.47 ? 838  LYS F NZ    1 
ATOM   9339  N  N     . ILE D 2 322 ? 31.074  37.383 127.325 1.00 247.80 ? 839  ILE F N     1 
ATOM   9340  C  CA    . ILE D 2 322 ? 30.415  37.267 126.022 1.00 247.77 ? 839  ILE F CA    1 
ATOM   9341  C  C     . ILE D 2 322 ? 30.134  35.809 125.660 1.00 249.99 ? 839  ILE F C     1 
ATOM   9342  O  O     . ILE D 2 322 ? 30.962  34.927 125.895 1.00 250.46 ? 839  ILE F O     1 
ATOM   9343  C  CB    . ILE D 2 322 ? 31.230  37.950 124.895 1.00 245.15 ? 839  ILE F CB    1 
ATOM   9344  C  CG1   . ILE D 2 322 ? 32.711  37.549 124.952 1.00 244.30 ? 839  ILE F CG1   1 
ATOM   9345  C  CG2   . ILE D 2 322 ? 31.096  39.464 124.997 1.00 243.81 ? 839  ILE F CG2   1 
ATOM   9346  C  CD1   . ILE D 2 322 ? 33.514  37.969 123.740 1.00 241.86 ? 839  ILE F CD1   1 
ATOM   9347  N  N     . GLU D 2 323 ? 28.952  35.575 125.094 1.00 251.91 ? 840  GLU F N     1 
ATOM   9348  C  CA    . GLU D 2 323 ? 28.493  34.237 124.730 1.00 254.90 ? 840  GLU F CA    1 
ATOM   9349  C  C     . GLU D 2 323 ? 27.777  34.302 123.382 1.00 254.41 ? 840  GLU F C     1 
ATOM   9350  O  O     . GLU D 2 323 ? 26.638  34.766 123.299 1.00 254.88 ? 840  GLU F O     1 
ATOM   9351  C  CB    . GLU D 2 323 ? 27.556  33.696 125.817 1.00 258.80 ? 840  GLU F CB    1 
ATOM   9352  C  CG    . GLU D 2 323 ? 26.953  32.320 125.548 1.00 262.25 ? 840  GLU F CG    1 
ATOM   9353  C  CD    . GLU D 2 323 ? 27.873  31.173 125.931 1.00 263.89 ? 840  GLU F CD    1 
ATOM   9354  O  OE1   . GLU D 2 323 ? 29.107  31.312 125.796 1.00 262.85 ? 840  GLU F OE1   1 
ATOM   9355  O  OE2   . GLU D 2 323 ? 27.355  30.123 126.366 1.00 266.81 ? 840  GLU F OE2   1 
ATOM   9356  N  N     . ARG D 2 324 ? 28.453  33.841 122.332 1.00 253.68 ? 841  ARG F N     1 
ATOM   9357  C  CA    . ARG D 2 324 ? 27.900  33.880 120.976 1.00 253.65 ? 841  ARG F CA    1 
ATOM   9358  C  C     . ARG D 2 324 ? 26.817  32.824 120.758 1.00 256.73 ? 841  ARG F C     1 
ATOM   9359  O  O     . ARG D 2 324 ? 26.728  31.846 121.502 1.00 258.89 ? 841  ARG F O     1 
ATOM   9360  C  CB    . ARG D 2 324 ? 29.010  33.712 119.929 1.00 251.90 ? 841  ARG F CB    1 
ATOM   9361  C  CG    . ARG D 2 324 ? 29.635  35.021 119.468 1.00 248.85 ? 841  ARG F CG    1 
ATOM   9362  C  CD    . ARG D 2 324 ? 30.740  34.813 118.439 1.00 247.24 ? 841  ARG F CD    1 
ATOM   9363  N  NE    . ARG D 2 324 ? 30.445  33.739 117.487 1.00 248.75 ? 841  ARG F NE    1 
ATOM   9364  C  CZ    . ARG D 2 324 ? 29.545  33.806 116.505 1.00 249.16 ? 841  ARG F CZ    1 
ATOM   9365  N  NH1   . ARG D 2 324 ? 28.812  34.900 116.315 1.00 248.29 ? 841  ARG F NH1   1 
ATOM   9366  N  NH2   . ARG D 2 324 ? 29.369  32.760 115.705 1.00 250.75 ? 841  ARG F NH2   1 
ATOM   9367  N  N     . GLU D 2 325 ? 26.000  33.038 119.729 1.00 257.33 ? 842  GLU F N     1 
ATOM   9368  C  CA    . GLU D 2 325 ? 24.918  32.118 119.379 1.00 260.78 ? 842  GLU F CA    1 
ATOM   9369  C  C     . GLU D 2 325 ? 25.483  30.851 118.739 1.00 262.17 ? 842  GLU F C     1 
ATOM   9370  O  O     . GLU D 2 325 ? 25.953  30.876 117.600 1.00 260.47 ? 842  GLU F O     1 
ATOM   9371  C  CB    . GLU D 2 325 ? 23.928  32.798 118.423 1.00 260.90 ? 842  GLU F CB    1 
ATOM   9372  C  CG    . GLU D 2 325 ? 22.673  31.991 118.104 1.00 264.37 ? 842  GLU F CG    1 
ATOM   9373  C  CD    . GLU D 2 325 ? 21.574  32.150 119.142 1.00 266.65 ? 842  GLU F CD    1 
ATOM   9374  O  OE1   . GLU D 2 325 ? 21.886  32.393 120.328 1.00 266.40 ? 842  GLU F OE1   1 
ATOM   9375  O  OE2   . GLU D 2 325 ? 20.388  32.026 118.770 1.00 268.95 ? 842  GLU F OE2   1 
ATOM   9376  N  N     . GLY D 2 326 ? 25.440  29.749 119.484 1.00 265.41 ? 843  GLY F N     1 
ATOM   9377  C  CA    . GLY D 2 326 ? 25.879  28.450 118.980 1.00 267.68 ? 843  GLY F CA    1 
ATOM   9378  C  C     . GLY D 2 326 ? 27.385  28.279 118.863 1.00 266.40 ? 843  GLY F C     1 
ATOM   9379  O  O     . GLY D 2 326 ? 27.852  27.386 118.155 1.00 267.51 ? 843  GLY F O     1 
ATOM   9380  N  N     . GLU D 2 327 ? 28.147  29.126 119.555 1.00 264.67 ? 844  GLU F N     1 
ATOM   9381  C  CA    . GLU D 2 327 ? 29.606  29.013 119.567 1.00 263.64 ? 844  GLU F CA    1 
ATOM   9382  C  C     . GLU D 2 327 ? 30.062  27.894 120.506 1.00 266.17 ? 844  GLU F C     1 
ATOM   9383  O  O     . GLU D 2 327 ? 31.161  27.363 120.355 1.00 266.20 ? 844  GLU F O     1 
ATOM   9384  C  CB    . GLU D 2 327 ? 30.251  30.341 119.970 1.00 260.93 ? 844  GLU F CB    1 
ATOM   9385  C  CG    . GLU D 2 327 ? 31.742  30.418 119.676 1.00 259.17 ? 844  GLU F CG    1 
ATOM   9386  C  CD    . GLU D 2 327 ? 32.325  31.792 119.943 1.00 256.44 ? 844  GLU F CD    1 
ATOM   9387  O  OE1   . GLU D 2 327 ? 32.089  32.339 121.041 1.00 256.52 ? 844  GLU F OE1   1 
ATOM   9388  O  OE2   . GLU D 2 327 ? 33.031  32.321 119.059 1.00 254.56 ? 844  GLU F OE2   1 
ATOM   9389  N  N     . CYS D 2 328 ? 29.218  27.550 121.477 1.00 268.61 ? 845  CYS F N     1 
ATOM   9390  C  CA    . CYS D 2 328 ? 29.471  26.411 122.358 1.00 271.20 ? 845  CYS F CA    1 
ATOM   9391  C  C     . CYS D 2 328 ? 29.106  25.093 121.672 1.00 273.63 ? 845  CYS F C     1 
ATOM   9392  O  O     . CYS D 2 328 ? 29.686  24.050 121.976 1.00 275.33 ? 845  CYS F O     1 
ATOM   9393  C  CB    . CYS D 2 328 ? 28.681  26.556 123.660 1.00 272.91 ? 845  CYS F CB    1 
ATOM   9394  S  SG    . CYS D 2 328 ? 29.103  28.031 124.616 1.00 270.17 ? 845  CYS F SG    1 
ATOM   9395  N  N     . GLN D 2 329 ? 28.142  25.150 120.754 1.00 274.04 ? 846  GLN F N     1 
ATOM   9396  C  CA    . GLN D 2 329 ? 27.715  23.975 119.991 1.00 277.27 ? 846  GLN F CA    1 
ATOM   9397  C  C     . GLN D 2 329 ? 28.815  23.511 119.034 1.00 276.64 ? 846  GLN F C     1 
ATOM   9398  O  O     . GLN D 2 329 ? 29.024  22.310 118.857 1.00 279.69 ? 846  GLN F O     1 
ATOM   9399  C  CB    . GLN D 2 329 ? 26.434  24.289 119.204 1.00 277.88 ? 846  GLN F CB    1 
ATOM   9400  C  CG    . GLN D 2 329 ? 25.646  23.068 118.747 1.00 281.65 ? 846  GLN F CG    1 
ATOM   9401  C  CD    . GLN D 2 329 ? 24.735  22.511 119.830 1.00 284.48 ? 846  GLN F CD    1 
ATOM   9402  O  OE1   . GLN D 2 329 ? 25.137  22.380 120.987 1.00 284.61 ? 846  GLN F OE1   1 
ATOM   9403  N  NE2   . GLN D 2 329 ? 23.502  22.175 119.458 1.00 286.73 ? 846  GLN F NE2   1 
ATOM   9404  N  N     . ARG D 2 330 ? 29.512  24.469 118.426 1.00 273.11 ? 847  ARG F N     1 
ATOM   9405  C  CA    . ARG D 2 330 ? 30.606  24.171 117.495 1.00 272.16 ? 847  ARG F CA    1 
ATOM   9406  C  C     . ARG D 2 330 ? 31.944  23.903 118.197 1.00 271.84 ? 847  ARG F C     1 
ATOM   9407  O  O     . ARG D 2 330 ? 32.828  23.266 117.621 1.00 272.49 ? 847  ARG F O     1 
ATOM   9408  C  CB    . ARG D 2 330 ? 30.779  25.310 116.480 1.00 268.74 ? 847  ARG F CB    1 
ATOM   9409  C  CG    . ARG D 2 330 ? 31.093  26.669 117.098 1.00 265.55 ? 847  ARG F CG    1 
ATOM   9410  C  CD    . ARG D 2 330 ? 32.320  27.316 116.476 1.00 262.55 ? 847  ARG F CD    1 
ATOM   9411  N  NE    . ARG D 2 330 ? 32.026  27.984 115.206 1.00 260.82 ? 847  ARG F NE    1 
ATOM   9412  C  CZ    . ARG D 2 330 ? 32.195  29.285 114.954 1.00 257.52 ? 847  ARG F CZ    1 
ATOM   9413  N  NH1   . ARG D 2 330 ? 32.676  30.118 115.876 1.00 255.42 ? 847  ARG F NH1   1 
ATOM   9414  N  NH2   . ARG D 2 330 ? 31.886  29.762 113.753 1.00 256.49 ? 847  ARG F NH2   1 
ATOM   9415  N  N     . TYR D 2 331 ? 32.092  24.393 119.429 1.00 271.28 ? 848  TYR F N     1 
ATOM   9416  C  CA    . TYR D 2 331 ? 33.339  24.244 120.189 1.00 271.15 ? 848  TYR F CA    1 
ATOM   9417  C  C     . TYR D 2 331 ? 33.381  22.952 121.015 1.00 277.26 ? 848  TYR F C     1 
ATOM   9418  O  O     . TYR D 2 331 ? 34.455  22.521 121.440 1.00 278.81 ? 848  TYR F O     1 
ATOM   9419  C  CB    . TYR D 2 331 ? 33.549  25.461 121.098 1.00 267.16 ? 848  TYR F CB    1 
ATOM   9420  C  CG    . TYR D 2 331 ? 34.871  25.472 121.839 1.00 265.13 ? 848  TYR F CG    1 
ATOM   9421  C  CD1   . TYR D 2 331 ? 36.077  25.405 121.148 1.00 263.25 ? 848  TYR F CD1   1 
ATOM   9422  C  CD2   . TYR D 2 331 ? 34.915  25.563 123.228 1.00 265.22 ? 848  TYR F CD2   1 
ATOM   9423  C  CE1   . TYR D 2 331 ? 37.289  25.418 121.818 1.00 262.55 ? 848  TYR F CE1   1 
ATOM   9424  C  CE2   . TYR D 2 331 ? 36.123  25.578 123.906 1.00 264.55 ? 848  TYR F CE2   1 
ATOM   9425  C  CZ    . TYR D 2 331 ? 37.306  25.505 123.196 1.00 263.26 ? 848  TYR F CZ    1 
ATOM   9426  O  OH    . TYR D 2 331 ? 38.510  25.519 123.857 1.00 262.73 ? 848  TYR F OH    1 
ATOM   9427  N  N     . LYS D 2 332 ? 32.215  22.346 121.238 1.00 281.97 ? 849  LYS F N     1 
ATOM   9428  C  CA    . LYS D 2 332 ? 32.103  21.060 121.945 1.00 287.09 ? 849  LYS F CA    1 
ATOM   9429  C  C     . LYS D 2 332 ? 33.169  20.030 121.524 1.00 289.29 ? 849  LYS F C     1 
ATOM   9430  O  O     . LYS D 2 332 ? 33.790  19.410 122.388 1.00 291.63 ? 849  LYS F O     1 
ATOM   9431  C  CB    . LYS D 2 332 ? 30.677  20.495 121.785 1.00 290.25 ? 849  LYS F CB    1 
ATOM   9432  C  CG    . LYS D 2 332 ? 30.511  19.002 122.042 1.00 294.97 ? 849  LYS F CG    1 
ATOM   9433  C  CD    . LYS D 2 332 ? 30.707  18.640 123.504 1.00 297.05 ? 849  LYS F CD    1 
ATOM   9434  C  CE    . LYS D 2 332 ? 30.505  17.149 123.717 1.00 301.97 ? 849  LYS F CE    1 
ATOM   9435  N  NZ    . LYS D 2 332 ? 30.455  16.780 125.156 1.00 304.34 ? 849  LYS F NZ    1 
ATOM   9436  N  N     . PRO D 2 333 ? 33.375  19.839 120.203 1.00 289.33 ? 850  PRO F N     1 
ATOM   9437  C  CA    . PRO D 2 333 ? 34.457  18.978 119.713 1.00 291.06 ? 850  PRO F CA    1 
ATOM   9438  C  C     . PRO D 2 333 ? 35.830  19.217 120.355 1.00 290.58 ? 850  PRO F C     1 
ATOM   9439  O  O     . PRO D 2 333 ? 36.539  18.254 120.653 1.00 293.38 ? 850  PRO F O     1 
ATOM   9440  C  CB    . PRO D 2 333 ? 34.521  19.324 118.225 1.00 288.98 ? 850  PRO F CB    1 
ATOM   9441  C  CG    . PRO D 2 333 ? 33.130  19.713 117.866 1.00 288.72 ? 850  PRO F CG    1 
ATOM   9442  C  CD    . PRO D 2 333 ? 32.446  20.201 119.115 1.00 288.51 ? 850  PRO F CD    1 
ATOM   9443  N  N     . PHE D 2 334 ? 36.191  20.482 120.564 1.00 287.54 ? 851  PHE F N     1 
ATOM   9444  C  CA    . PHE D 2 334 ? 37.540  20.843 121.016 1.00 286.62 ? 851  PHE F CA    1 
ATOM   9445  C  C     . PHE D 2 334 ? 37.683  21.007 122.532 1.00 287.80 ? 851  PHE F C     1 
ATOM   9446  O  O     . PHE D 2 334 ? 38.766  21.343 123.016 1.00 286.59 ? 851  PHE F O     1 
ATOM   9447  C  CB    . PHE D 2 334 ? 38.004  22.114 120.303 1.00 282.77 ? 851  PHE F CB    1 
ATOM   9448  C  CG    . PHE D 2 334 ? 37.968  22.007 118.807 1.00 282.12 ? 851  PHE F CG    1 
ATOM   9449  C  CD1   . PHE D 2 334 ? 39.028  21.441 118.113 1.00 282.45 ? 851  PHE F CD1   1 
ATOM   9450  C  CD2   . PHE D 2 334 ? 36.866  22.457 118.094 1.00 281.39 ? 851  PHE F CD2   1 
ATOM   9451  C  CE1   . PHE D 2 334 ? 38.994  21.333 116.732 1.00 281.92 ? 851  PHE F CE1   1 
ATOM   9452  C  CE2   . PHE D 2 334 ? 36.826  22.353 116.715 1.00 280.90 ? 851  PHE F CE2   1 
ATOM   9453  C  CZ    . PHE D 2 334 ? 37.891  21.791 116.032 1.00 281.13 ? 851  PHE F CZ    1 
ATOM   9454  N  N     . LYS D 2 335 ? 36.608  20.763 123.280 1.00 290.57 ? 852  LYS F N     1 
ATOM   9455  C  CA    . LYS D 2 335 ? 36.704  20.667 124.739 1.00 293.09 ? 852  LYS F CA    1 
ATOM   9456  C  C     . LYS D 2 335 ? 37.339  19.334 125.143 1.00 297.28 ? 852  LYS F C     1 
ATOM   9457  O  O     . LYS D 2 335 ? 37.831  19.187 126.263 1.00 298.60 ? 852  LYS F O     1 
ATOM   9458  C  CB    . LYS D 2 335 ? 35.333  20.831 125.400 1.00 294.61 ? 852  LYS F CB    1 
ATOM   9459  C  CG    . LYS D 2 335 ? 34.679  22.179 125.125 1.00 292.02 ? 852  LYS F CG    1 
ATOM   9460  C  CD    . LYS D 2 335 ? 34.155  22.842 126.392 1.00 292.44 ? 852  LYS F CD    1 
ATOM   9461  C  CE    . LYS D 2 335 ? 35.290  23.355 127.268 1.00 291.62 ? 852  LYS F CE    1 
ATOM   9462  N  NZ    . LYS D 2 335 ? 34.827  24.358 128.266 1.00 290.74 ? 852  LYS F NZ    1 
ATOM   9463  N  N     . GLN D 2 336 ? 37.322  18.370 124.221 1.00 299.82 ? 853  GLN F N     1 
ATOM   9464  C  CA    . GLN D 2 336 ? 38.048  17.111 124.388 1.00 303.68 ? 853  GLN F CA    1 
ATOM   9465  C  C     . GLN D 2 336 ? 39.549  17.350 124.213 1.00 301.96 ? 853  GLN F C     1 
ATOM   9466  O  O     . GLN D 2 336 ? 40.370  16.671 124.832 1.00 304.61 ? 853  GLN F O     1 
ATOM   9467  C  CB    . GLN D 2 336 ? 37.587  16.061 123.363 1.00 306.58 ? 853  GLN F CB    1 
ATOM   9468  C  CG    . GLN D 2 336 ? 36.080  15.928 123.165 1.00 307.78 ? 853  GLN F CG    1 
ATOM   9469  C  CD    . GLN D 2 336 ? 35.320  15.664 124.453 1.00 310.16 ? 853  GLN F CD    1 
ATOM   9470  O  OE1   . GLN D 2 336 ? 35.848  15.064 125.390 1.00 312.41 ? 853  GLN F OE1   1 
ATOM   9471  N  NE2   . GLN D 2 336 ? 34.066  16.104 124.500 1.00 309.72 ? 853  GLN F NE2   1 
ATOM   9472  N  N     . LEU D 2 337 ? 39.891  18.315 123.360 1.00 297.59 ? 854  LEU F N     1 
ATOM   9473  C  CA    . LEU D 2 337 ? 41.281  18.625 123.028 1.00 295.28 ? 854  LEU F CA    1 
ATOM   9474  C  C     . LEU D 2 337 ? 42.029  19.213 124.225 1.00 293.31 ? 854  LEU F C     1 
ATOM   9475  O  O     . LEU D 2 337 ? 41.486  20.034 124.966 1.00 291.04 ? 854  LEU F O     1 
ATOM   9476  C  CB    . LEU D 2 337 ? 41.337  19.609 121.851 1.00 291.70 ? 854  LEU F CB    1 
ATOM   9477  C  CG    . LEU D 2 337 ? 42.625  19.623 121.024 1.00 291.02 ? 854  LEU F CG    1 
ATOM   9478  C  CD1   . LEU D 2 337 ? 42.708  18.389 120.136 1.00 294.10 ? 854  LEU F CD1   1 
ATOM   9479  C  CD2   . LEU D 2 337 ? 42.706  20.887 120.182 1.00 286.73 ? 854  LEU F CD2   1 
ATOM   9480  N  N     . HIS D 2 338 ? 43.278  18.786 124.399 1.00 293.37 ? 855  HIS F N     1 
ATOM   9481  C  CA    . HIS D 2 338 ? 44.119  19.245 125.506 1.00 292.04 ? 855  HIS F CA    1 
ATOM   9482  C  C     . HIS D 2 338 ? 44.728  20.616 125.208 1.00 286.32 ? 855  HIS F C     1 
ATOM   9483  O  O     . HIS D 2 338 ? 44.524  21.171 124.128 1.00 282.78 ? 855  HIS F O     1 
ATOM   9484  C  CB    . HIS D 2 338 ? 45.225  18.219 125.798 1.00 295.79 ? 855  HIS F CB    1 
ATOM   9485  C  CG    . HIS D 2 338 ? 46.397  18.300 124.867 1.00 295.03 ? 855  HIS F CG    1 
ATOM   9486  N  ND1   . HIS D 2 338 ? 46.336  17.896 123.550 1.00 294.69 ? 855  HIS F ND1   1 
ATOM   9487  C  CD2   . HIS D 2 338 ? 47.666  18.727 125.070 1.00 294.62 ? 855  HIS F CD2   1 
ATOM   9488  C  CE1   . HIS D 2 338 ? 47.514  18.079 122.980 1.00 294.05 ? 855  HIS F CE1   1 
ATOM   9489  N  NE2   . HIS D 2 338 ? 48.338  18.582 123.881 1.00 294.00 ? 855  HIS F NE2   1 
ATOM   9490  N  N     . ASN D 2 339 ? 45.465  21.155 126.178 1.00 284.83 ? 856  ASN F N     1 
ATOM   9491  C  CA    . ASN D 2 339 ? 46.186  22.422 126.019 1.00 281.14 ? 856  ASN F CA    1 
ATOM   9492  C  C     . ASN D 2 339 ? 45.287  23.559 125.517 1.00 276.22 ? 856  ASN F C     1 
ATOM   9493  O  O     . ASN D 2 339 ? 45.439  24.043 124.393 1.00 273.87 ? 856  ASN F O     1 
ATOM   9494  C  CB    . ASN D 2 339 ? 47.400  22.222 125.095 1.00 281.34 ? 856  ASN F CB    1 
ATOM   9495  C  CG    . ASN D 2 339 ? 48.305  23.445 125.021 1.00 279.10 ? 856  ASN F CG    1 
ATOM   9496  O  OD1   . ASN D 2 339 ? 48.959  23.676 124.005 1.00 278.19 ? 856  ASN F OD1   1 
ATOM   9497  N  ND2   . ASN D 2 339 ? 48.349  24.229 126.093 1.00 278.49 ? 856  ASN F ND2   1 
ATOM   9498  N  N     . ARG D 2 340 ? 44.345  23.968 126.364 1.00 274.22 ? 857  ARG F N     1 
ATOM   9499  C  CA    . ARG D 2 340 ? 43.434  25.068 126.053 1.00 269.62 ? 857  ARG F CA    1 
ATOM   9500  C  C     . ARG D 2 340 ? 43.878  26.317 126.807 1.00 266.44 ? 857  ARG F C     1 
ATOM   9501  O  O     . ARG D 2 340 ? 44.097  26.268 128.019 1.00 268.49 ? 857  ARG F O     1 
ATOM   9502  C  CB    . ARG D 2 340 ? 41.999  24.698 126.431 1.00 271.10 ? 857  ARG F CB    1 
ATOM   9503  C  CG    . ARG D 2 340 ? 41.545  23.361 125.866 1.00 274.23 ? 857  ARG F CG    1 
ATOM   9504  C  CD    . ARG D 2 340 ? 40.033  23.210 125.909 1.00 274.93 ? 857  ARG F CD    1 
ATOM   9505  N  NE    . ARG D 2 340 ? 39.506  23.245 127.272 1.00 276.37 ? 857  ARG F NE    1 
ATOM   9506  C  CZ    . ARG D 2 340 ? 39.520  22.221 128.127 1.00 279.52 ? 857  ARG F CZ    1 
ATOM   9507  N  NH1   . ARG D 2 340 ? 40.047  21.047 127.785 1.00 281.52 ? 857  ARG F NH1   1 
ATOM   9508  N  NH2   . ARG D 2 340 ? 39.006  22.375 129.342 1.00 280.78 ? 857  ARG F NH2   1 
ATOM   9509  N  N     . ARG D 2 341 ? 44.007  27.430 126.086 1.00 261.01 ? 858  ARG F N     1 
ATOM   9510  C  CA    . ARG D 2 341 ? 44.574  28.660 126.639 1.00 257.19 ? 858  ARG F CA    1 
ATOM   9511  C  C     . ARG D 2 341 ? 43.644  29.857 126.445 1.00 252.82 ? 858  ARG F C     1 
ATOM   9512  O  O     . ARG D 2 341 ? 43.039  30.019 125.385 1.00 251.24 ? 858  ARG F O     1 
ATOM   9513  C  CB    . ARG D 2 341 ? 45.929  28.940 125.984 1.00 255.97 ? 858  ARG F CB    1 
ATOM   9514  C  CG    . ARG D 2 341 ? 47.036  27.993 126.434 1.00 258.66 ? 858  ARG F CG    1 
ATOM   9515  C  CD    . ARG D 2 341 ? 47.908  28.583 127.534 1.00 259.06 ? 858  ARG F CD    1 
ATOM   9516  N  NE    . ARG D 2 341 ? 49.187  29.072 127.014 1.00 257.78 ? 858  ARG F NE    1 
ATOM   9517  C  CZ    . ARG D 2 341 ? 50.259  28.312 126.779 1.00 259.55 ? 858  ARG F CZ    1 
ATOM   9518  N  NH1   . ARG D 2 341 ? 50.236  27.001 127.009 1.00 262.48 ? 858  ARG F NH1   1 
ATOM   9519  N  NH2   . ARG D 2 341 ? 51.368  28.869 126.305 1.00 258.52 ? 858  ARG F NH2   1 
ATOM   9520  N  N     . LEU D 2 342 ? 43.541  30.686 127.482 1.00 250.47 ? 859  LEU F N     1 
ATOM   9521  C  CA    . LEU D 2 342 ? 42.758  31.918 127.438 1.00 246.06 ? 859  LEU F CA    1 
ATOM   9522  C  C     . LEU D 2 342 ? 43.686  33.047 126.981 1.00 242.06 ? 859  LEU F C     1 
ATOM   9523  O  O     . LEU D 2 342 ? 44.534  33.508 127.747 1.00 242.31 ? 859  LEU F O     1 
ATOM   9524  C  CB    . LEU D 2 342 ? 42.165  32.204 128.826 1.00 247.08 ? 859  LEU F CB    1 
ATOM   9525  C  CG    . LEU D 2 342 ? 40.986  33.172 128.992 1.00 245.26 ? 859  LEU F CG    1 
ATOM   9526  C  CD1   . LEU D 2 342 ? 41.438  34.618 128.881 1.00 242.96 ? 859  LEU F CD1   1 
ATOM   9527  C  CD2   . LEU D 2 342 ? 39.867  32.880 128.002 1.00 244.20 ? 859  LEU F CD2   1 
ATOM   9528  N  N     . LEU D 2 343 ? 43.523  33.481 125.732 1.00 237.89 ? 860  LEU F N     1 
ATOM   9529  C  CA    . LEU D 2 343 ? 44.481  34.384 125.085 1.00 234.52 ? 860  LEU F CA    1 
ATOM   9530  C  C     . LEU D 2 343 ? 43.832  35.652 124.533 1.00 231.19 ? 860  LEU F C     1 
ATOM   9531  O  O     . LEU D 2 343 ? 42.645  35.662 124.204 1.00 230.31 ? 860  LEU F O     1 
ATOM   9532  C  CB    . LEU D 2 343 ? 45.202  33.642 123.957 1.00 234.16 ? 860  LEU F CB    1 
ATOM   9533  C  CG    . LEU D 2 343 ? 46.152  32.529 124.410 1.00 236.47 ? 860  LEU F CG    1 
ATOM   9534  C  CD1   . LEU D 2 343 ? 46.454  31.570 123.267 1.00 236.88 ? 860  LEU F CD1   1 
ATOM   9535  C  CD2   . LEU D 2 343 ? 47.435  33.115 124.981 1.00 236.46 ? 860  LEU F CD2   1 
ATOM   9536  N  N     . TRP D 2 344 ? 44.632  36.713 124.425 1.00 229.00 ? 861  TRP F N     1 
ATOM   9537  C  CA    . TRP D 2 344 ? 44.156  38.014 123.949 1.00 225.91 ? 861  TRP F CA    1 
ATOM   9538  C  C     . TRP D 2 344 ? 43.995  38.051 122.434 1.00 223.74 ? 861  TRP F C     1 
ATOM   9539  O  O     . TRP D 2 344 ? 44.703  37.352 121.706 1.00 224.71 ? 861  TRP F O     1 
ATOM   9540  C  CB    . TRP D 2 344 ? 45.121  39.131 124.359 1.00 225.13 ? 861  TRP F CB    1 
ATOM   9541  C  CG    . TRP D 2 344 ? 45.248  39.333 125.833 1.00 226.92 ? 861  TRP F CG    1 
ATOM   9542  C  CD1   . TRP D 2 344 ? 46.272  38.916 126.629 1.00 228.67 ? 861  TRP F CD1   1 
ATOM   9543  C  CD2   . TRP D 2 344 ? 44.329  40.022 126.688 1.00 227.64 ? 861  TRP F CD2   1 
ATOM   9544  N  NE1   . TRP D 2 344 ? 46.047  39.295 127.929 1.00 230.35 ? 861  TRP F NE1   1 
ATOM   9545  C  CE2   . TRP D 2 344 ? 44.858  39.970 127.995 1.00 229.73 ? 861  TRP F CE2   1 
ATOM   9546  C  CE3   . TRP D 2 344 ? 43.103  40.666 126.481 1.00 227.10 ? 861  TRP F CE3   1 
ATOM   9547  C  CZ2   . TRP D 2 344 ? 44.209  40.545 129.089 1.00 231.13 ? 861  TRP F CZ2   1 
ATOM   9548  C  CZ3   . TRP D 2 344 ? 42.457  41.236 127.571 1.00 228.15 ? 861  TRP F CZ3   1 
ATOM   9549  C  CH2   . TRP D 2 344 ? 43.014  41.170 128.857 1.00 230.14 ? 861  TRP F CH2   1 
ATOM   9550  N  N     . HIS D 2 345 ? 43.063  38.881 121.971 1.00 221.21 ? 862  HIS F N     1 
ATOM   9551  C  CA    . HIS D 2 345 ? 42.912  39.173 120.547 1.00 218.82 ? 862  HIS F CA    1 
ATOM   9552  C  C     . HIS D 2 345 ? 42.258  40.539 120.353 1.00 216.73 ? 862  HIS F C     1 
ATOM   9553  O  O     . HIS D 2 345 ? 41.082  40.720 120.669 1.00 217.44 ? 862  HIS F O     1 
ATOM   9554  C  CB    . HIS D 2 345 ? 42.085  38.093 119.849 1.00 219.83 ? 862  HIS F CB    1 
ATOM   9555  C  CG    . HIS D 2 345 ? 41.829  38.373 118.400 1.00 218.38 ? 862  HIS F CG    1 
ATOM   9556  N  ND1   . HIS D 2 345 ? 42.810  38.273 117.438 1.00 217.62 ? 862  HIS F ND1   1 
ATOM   9557  C  CD2   . HIS D 2 345 ? 40.703  38.753 117.751 1.00 217.74 ? 862  HIS F CD2   1 
ATOM   9558  C  CE1   . HIS D 2 345 ? 42.300  38.578 116.258 1.00 216.49 ? 862  HIS F CE1   1 
ATOM   9559  N  NE2   . HIS D 2 345 ? 41.022  38.873 116.421 1.00 216.59 ? 862  HIS F NE2   1 
ATOM   9560  N  N     . GLY D 2 346 ? 43.027  41.494 119.837 1.00 214.32 ? 863  GLY F N     1 
ATOM   9561  C  CA    . GLY D 2 346 ? 42.531  42.846 119.599 1.00 212.07 ? 863  GLY F CA    1 
ATOM   9562  C  C     . GLY D 2 346 ? 42.217  43.104 118.140 1.00 209.88 ? 863  GLY F C     1 
ATOM   9563  O  O     . GLY D 2 346 ? 42.796  42.484 117.248 1.00 209.85 ? 863  GLY F O     1 
ATOM   9564  N  N     . SER D 2 347 ? 41.288  44.024 117.905 1.00 208.24 ? 864  SER F N     1 
ATOM   9565  C  CA    . SER D 2 347 ? 40.915  44.426 116.554 1.00 206.28 ? 864  SER F CA    1 
ATOM   9566  C  C     . SER D 2 347 ? 40.214  45.779 116.603 1.00 205.06 ? 864  SER F C     1 
ATOM   9567  O  O     . SER D 2 347 ? 39.797  46.229 117.672 1.00 205.81 ? 864  SER F O     1 
ATOM   9568  C  CB    . SER D 2 347 ? 40.007  43.374 115.912 1.00 206.99 ? 864  SER F CB    1 
ATOM   9569  O  OG    . SER D 2 347 ? 39.646  43.744 114.594 1.00 206.05 ? 864  SER F OG    1 
ATOM   9570  N  N     . ARG D 2 348 ? 40.095  46.427 115.447 1.00 203.18 ? 865  ARG F N     1 
ATOM   9571  C  CA    . ARG D 2 348 ? 39.452  47.740 115.364 1.00 202.27 ? 865  ARG F CA    1 
ATOM   9572  C  C     . ARG D 2 348 ? 38.037  47.711 115.933 1.00 202.65 ? 865  ARG F C     1 
ATOM   9573  O  O     . ARG D 2 348 ? 37.311  46.733 115.757 1.00 203.37 ? 865  ARG F O     1 
ATOM   9574  C  CB    . ARG D 2 348 ? 39.396  48.236 113.916 1.00 201.72 ? 865  ARG F CB    1 
ATOM   9575  C  CG    . ARG D 2 348 ? 40.674  48.889 113.412 1.00 201.07 ? 865  ARG F CG    1 
ATOM   9576  C  CD    . ARG D 2 348 ? 40.354  49.957 112.378 1.00 200.52 ? 865  ARG F CD    1 
ATOM   9577  N  NE    . ARG D 2 348 ? 41.549  50.547 111.777 1.00 200.05 ? 865  ARG F NE    1 
ATOM   9578  C  CZ    . ARG D 2 348 ? 41.532  51.535 110.883 1.00 200.05 ? 865  ARG F CZ    1 
ATOM   9579  N  NH1   . ARG D 2 348 ? 40.380  52.057 110.472 1.00 200.62 ? 865  ARG F NH1   1 
ATOM   9580  N  NH2   . ARG D 2 348 ? 42.673  52.006 110.392 1.00 199.63 ? 865  ARG F NH2   1 
ATOM   9581  N  N     . THR D 2 349 ? 37.653  48.794 116.605 1.00 202.41 ? 866  THR F N     1 
ATOM   9582  C  CA    . THR D 2 349 ? 36.290  48.957 117.121 1.00 203.71 ? 866  THR F CA    1 
ATOM   9583  C  C     . THR D 2 349 ? 35.226  48.827 116.022 1.00 204.19 ? 866  THR F C     1 
ATOM   9584  O  O     . THR D 2 349 ? 34.078  48.476 116.302 1.00 204.96 ? 866  THR F O     1 
ATOM   9585  C  CB    . THR D 2 349 ? 36.115  50.312 117.848 1.00 204.04 ? 866  THR F CB    1 
ATOM   9586  O  OG1   . THR D 2 349 ? 34.809  50.382 118.436 1.00 205.47 ? 866  THR F OG1   1 
ATOM   9587  C  CG2   . THR D 2 349 ? 36.309  51.496 116.891 1.00 203.09 ? 866  THR F CG2   1 
ATOM   9588  N  N     . THR D 2 350 ? 35.618  49.114 114.780 1.00 203.96 ? 867  THR F N     1 
ATOM   9589  C  CA    . THR D 2 350 ? 34.732  48.972 113.624 1.00 204.77 ? 867  THR F CA    1 
ATOM   9590  C  C     . THR D 2 350 ? 34.413  47.503 113.324 1.00 205.65 ? 867  THR F C     1 
ATOM   9591  O  O     . THR D 2 350 ? 33.304  47.178 112.895 1.00 206.40 ? 867  THR F O     1 
ATOM   9592  C  CB    . THR D 2 350 ? 35.346  49.610 112.356 1.00 203.51 ? 867  THR F CB    1 
ATOM   9593  O  OG1   . THR D 2 350 ? 36.483  48.848 111.929 1.00 203.49 ? 867  THR F OG1   1 
ATOM   9594  C  CG2   . THR D 2 350 ? 35.775  51.054 112.615 1.00 202.56 ? 867  THR F CG2   1 
ATOM   9595  N  N     . ASN D 2 351 ? 35.390  46.625 113.552 1.00 205.65 ? 868  ASN F N     1 
ATOM   9596  C  CA    . ASN D 2 351 ? 35.245  45.195 113.264 1.00 206.65 ? 868  ASN F CA    1 
ATOM   9597  C  C     . ASN D 2 351 ? 34.348  44.451 114.256 1.00 208.75 ? 868  ASN F C     1 
ATOM   9598  O  O     . ASN D 2 351 ? 33.720  43.454 113.897 1.00 209.60 ? 868  ASN F O     1 
ATOM   9599  C  CB    . ASN D 2 351 ? 36.620  44.515 113.225 1.00 205.88 ? 868  ASN F CB    1 
ATOM   9600  C  CG    . ASN D 2 351 ? 37.530  45.080 112.145 1.00 204.16 ? 868  ASN F CG    1 
ATOM   9601  O  OD1   . ASN D 2 351 ? 37.067  45.636 111.150 1.00 203.48 ? 868  ASN F OD1   1 
ATOM   9602  N  ND2   . ASN D 2 351 ? 38.837  44.934 112.338 1.00 203.49 ? 868  ASN F ND2   1 
ATOM   9603  N  N     . PHE D 2 352 ? 34.284  44.940 115.494 1.00 209.73 ? 869  PHE F N     1 
ATOM   9604  C  CA    . PHE D 2 352 ? 33.540  44.259 116.564 1.00 211.68 ? 869  PHE F CA    1 
ATOM   9605  C  C     . PHE D 2 352 ? 32.034  44.140 116.302 1.00 213.60 ? 869  PHE F C     1 
ATOM   9606  O  O     . PHE D 2 352 ? 31.364  43.309 116.915 1.00 215.17 ? 869  PHE F O     1 
ATOM   9607  C  CB    . PHE D 2 352 ? 33.792  44.936 117.920 1.00 211.64 ? 869  PHE F CB    1 
ATOM   9608  C  CG    . PHE D 2 352 ? 35.032  44.446 118.620 1.00 211.00 ? 869  PHE F CG    1 
ATOM   9609  C  CD1   . PHE D 2 352 ? 36.278  44.569 118.021 1.00 209.27 ? 869  PHE F CD1   1 
ATOM   9610  C  CD2   . PHE D 2 352 ? 34.954  43.863 119.878 1.00 212.44 ? 869  PHE F CD2   1 
ATOM   9611  C  CE1   . PHE D 2 352 ? 37.421  44.120 118.660 1.00 209.22 ? 869  PHE F CE1   1 
ATOM   9612  C  CE2   . PHE D 2 352 ? 36.095  43.413 120.522 1.00 212.47 ? 869  PHE F CE2   1 
ATOM   9613  C  CZ    . PHE D 2 352 ? 37.330  43.542 119.912 1.00 210.87 ? 869  PHE F CZ    1 
ATOM   9614  N  N     . ALA D 2 353 ? 31.506  44.966 115.401 1.00 213.80 ? 870  ALA F N     1 
ATOM   9615  C  CA    . ALA D 2 353 ? 30.125  44.819 114.939 1.00 215.50 ? 870  ALA F CA    1 
ATOM   9616  C  C     . ALA D 2 353 ? 29.938  43.486 114.211 1.00 216.19 ? 870  ALA F C     1 
ATOM   9617  O  O     . ALA D 2 353 ? 28.915  42.820 114.375 1.00 218.13 ? 870  ALA F O     1 
ATOM   9618  C  CB    . ALA D 2 353 ? 29.745  45.975 114.027 1.00 215.03 ? 870  ALA F CB    1 
ATOM   9619  N  N     . GLY D 2 354 ? 30.937  43.108 113.415 1.00 214.86 ? 871  GLY F N     1 
ATOM   9620  C  CA    . GLY D 2 354 ? 30.917  41.852 112.667 1.00 215.93 ? 871  GLY F CA    1 
ATOM   9621  C  C     . GLY D 2 354 ? 31.470  40.659 113.430 1.00 216.82 ? 871  GLY F C     1 
ATOM   9622  O  O     . GLY D 2 354 ? 31.036  39.527 113.211 1.00 218.40 ? 871  GLY F O     1 
ATOM   9623  N  N     . ILE D 2 355 ? 32.431  40.908 114.320 1.00 215.95 ? 872  ILE F N     1 
ATOM   9624  C  CA    . ILE D 2 355 ? 33.063  39.840 115.106 1.00 216.84 ? 872  ILE F CA    1 
ATOM   9625  C  C     . ILE D 2 355 ? 32.063  39.185 116.065 1.00 219.75 ? 872  ILE F C     1 
ATOM   9626  O  O     . ILE D 2 355 ? 32.127  37.979 116.300 1.00 221.65 ? 872  ILE F O     1 
ATOM   9627  C  CB    . ILE D 2 355 ? 34.298  40.356 115.885 1.00 215.15 ? 872  ILE F CB    1 
ATOM   9628  C  CG1   . ILE D 2 355 ? 35.402  40.788 114.912 1.00 213.02 ? 872  ILE F CG1   1 
ATOM   9629  C  CG2   . ILE D 2 355 ? 34.842  39.281 116.821 1.00 216.36 ? 872  ILE F CG2   1 
ATOM   9630  C  CD1   . ILE D 2 355 ? 36.429  41.722 115.517 1.00 211.75 ? 872  ILE F CD1   1 
ATOM   9631  N  N     . LEU D 2 356 ? 31.145  39.978 116.613 1.00 220.93 ? 873  LEU F N     1 
ATOM   9632  C  CA    . LEU D 2 356 ? 30.088  39.449 117.482 1.00 223.69 ? 873  LEU F CA    1 
ATOM   9633  C  C     . LEU D 2 356 ? 29.065  38.615 116.703 1.00 225.92 ? 873  LEU F C     1 
ATOM   9634  O  O     . LEU D 2 356 ? 28.636  37.559 117.171 1.00 228.25 ? 873  LEU F O     1 
ATOM   9635  C  CB    . LEU D 2 356 ? 29.374  40.584 118.233 1.00 224.01 ? 873  LEU F CB    1 
ATOM   9636  C  CG    . LEU D 2 356 ? 29.920  40.981 119.612 1.00 223.98 ? 873  LEU F CG    1 
ATOM   9637  C  CD1   . LEU D 2 356 ? 29.579  39.923 120.650 1.00 226.60 ? 873  LEU F CD1   1 
ATOM   9638  C  CD2   . LEU D 2 356 ? 31.419  41.241 119.594 1.00 222.07 ? 873  LEU F CD2   1 
ATOM   9639  N  N     . SER D 2 357 ? 28.687  39.089 115.518 1.00 225.73 ? 874  SER F N     1 
ATOM   9640  C  CA    . SER D 2 357 ? 27.637  38.447 114.721 1.00 227.87 ? 874  SER F CA    1 
ATOM   9641  C  C     . SER D 2 357 ? 28.091  37.167 114.014 1.00 228.53 ? 874  SER F C     1 
ATOM   9642  O  O     . SER D 2 357 ? 27.308  36.224 113.885 1.00 230.76 ? 874  SER F O     1 
ATOM   9643  C  CB    . SER D 2 357 ? 27.070  39.433 113.694 1.00 227.33 ? 874  SER F CB    1 
ATOM   9644  O  OG    . SER D 2 357 ? 28.066  39.851 112.778 1.00 225.11 ? 874  SER F OG    1 
ATOM   9645  N  N     . GLN D 2 358 ? 29.344  37.134 113.561 1.00 226.51 ? 875  GLN F N     1 
ATOM   9646  C  CA    . GLN D 2 358 ? 29.868  35.995 112.797 1.00 227.18 ? 875  GLN F CA    1 
ATOM   9647  C  C     . GLN D 2 358 ? 31.026  35.253 113.479 1.00 227.29 ? 875  GLN F C     1 
ATOM   9648  O  O     . GLN D 2 358 ? 31.536  34.273 112.930 1.00 228.23 ? 875  GLN F O     1 
ATOM   9649  C  CB    . GLN D 2 358 ? 30.322  36.464 111.410 1.00 225.23 ? 875  GLN F CB    1 
ATOM   9650  C  CG    . GLN D 2 358 ? 29.223  37.110 110.580 1.00 225.38 ? 875  GLN F CG    1 
ATOM   9651  C  CD    . GLN D 2 358 ? 29.669  37.439 109.164 1.00 224.20 ? 875  GLN F CD    1 
ATOM   9652  O  OE1   . GLN D 2 358 ? 30.431  36.690 108.550 1.00 223.85 ? 875  GLN F OE1   1 
ATOM   9653  N  NE2   . GLN D 2 358 ? 29.188  38.561 108.635 1.00 223.63 ? 875  GLN F NE2   1 
ATOM   9654  N  N     . GLY D 2 359 ? 31.436  35.704 114.663 1.00 226.62 ? 876  GLY F N     1 
ATOM   9655  C  CA    . GLY D 2 359 ? 32.604  35.136 115.340 1.00 226.33 ? 876  GLY F CA    1 
ATOM   9656  C  C     . GLY D 2 359 ? 33.892  35.605 114.687 1.00 224.03 ? 876  GLY F C     1 
ATOM   9657  O  O     . GLY D 2 359 ? 33.866  36.460 113.799 1.00 222.60 ? 876  GLY F O     1 
ATOM   9658  N  N     . LEU D 2 360 ? 35.022  35.054 115.124 1.00 224.14 ? 877  LEU F N     1 
ATOM   9659  C  CA    . LEU D 2 360 ? 36.310  35.371 114.507 1.00 222.56 ? 877  LEU F CA    1 
ATOM   9660  C  C     . LEU D 2 360 ? 36.485  34.560 113.226 1.00 223.20 ? 877  LEU F C     1 
ATOM   9661  O  O     . LEU D 2 360 ? 36.335  33.337 113.230 1.00 225.01 ? 877  LEU F O     1 
ATOM   9662  C  CB    . LEU D 2 360 ? 37.474  35.115 115.472 1.00 222.71 ? 877  LEU F CB    1 
ATOM   9663  C  CG    . LEU D 2 360 ? 37.666  36.148 116.588 1.00 221.68 ? 877  LEU F CG    1 
ATOM   9664  C  CD1   . LEU D 2 360 ? 38.799  35.729 117.511 1.00 222.13 ? 877  LEU F CD1   1 
ATOM   9665  C  CD2   . LEU D 2 360 ? 37.938  37.538 116.029 1.00 219.58 ? 877  LEU F CD2   1 
ATOM   9666  N  N     . ARG D 2 361 ? 36.805  35.258 112.138 1.00 221.65 ? 878  ARG F N     1 
ATOM   9667  C  CA    . ARG D 2 361 ? 36.862  34.662 110.806 1.00 222.42 ? 878  ARG F CA    1 
ATOM   9668  C  C     . ARG D 2 361 ? 38.278  34.707 110.247 1.00 220.98 ? 878  ARG F C     1 
ATOM   9669  O  O     . ARG D 2 361 ? 39.053  35.611 110.562 1.00 219.38 ? 878  ARG F O     1 
ATOM   9670  C  CB    . ARG D 2 361 ? 35.920  35.410 109.860 1.00 222.05 ? 878  ARG F CB    1 
ATOM   9671  C  CG    . ARG D 2 361 ? 34.484  35.505 110.355 1.00 223.38 ? 878  ARG F CG    1 
ATOM   9672  C  CD    . ARG D 2 361 ? 33.654  36.478 109.528 1.00 222.88 ? 878  ARG F CD    1 
ATOM   9673  N  NE    . ARG D 2 361 ? 34.242  37.818 109.462 1.00 220.72 ? 878  ARG F NE    1 
ATOM   9674  C  CZ    . ARG D 2 361 ? 34.243  38.710 110.453 1.00 219.65 ? 878  ARG F CZ    1 
ATOM   9675  N  NH1   . ARG D 2 361 ? 33.692  38.432 111.632 1.00 221.14 ? 878  ARG F NH1   1 
ATOM   9676  N  NH2   . ARG D 2 361 ? 34.810  39.898 110.268 1.00 217.13 ? 878  ARG F NH2   1 
ATOM   9677  N  N     . ILE D 2 362 ? 38.604  33.721 109.416 1.00 221.80 ? 879  ILE F N     1 
ATOM   9678  C  CA    . ILE D 2 362 ? 39.894  33.668 108.737 1.00 220.83 ? 879  ILE F CA    1 
ATOM   9679  C  C     . ILE D 2 362 ? 39.790  34.517 107.478 1.00 219.50 ? 879  ILE F C     1 
ATOM   9680  O  O     . ILE D 2 362 ? 38.698  34.689 106.930 1.00 219.81 ? 879  ILE F O     1 
ATOM   9681  C  CB    . ILE D 2 362 ? 40.285  32.220 108.360 1.00 223.11 ? 879  ILE F CB    1 
ATOM   9682  C  CG1   . ILE D 2 362 ? 40.270  31.318 109.601 1.00 225.13 ? 879  ILE F CG1   1 
ATOM   9683  C  CG2   . ILE D 2 362 ? 41.659  32.186 107.697 1.00 222.37 ? 879  ILE F CG2   1 
ATOM   9684  C  CD1   . ILE D 2 362 ? 40.424  29.842 109.297 1.00 228.12 ? 879  ILE F CD1   1 
ATOM   9685  N  N     . ALA D 2 363 ? 40.919  35.059 107.029 1.00 218.36 ? 880  ALA F N     1 
ATOM   9686  C  CA    . ALA D 2 363 ? 40.955  35.849 105.802 1.00 217.41 ? 880  ALA F CA    1 
ATOM   9687  C  C     . ALA D 2 363 ? 40.489  35.017 104.610 1.00 219.22 ? 880  ALA F C     1 
ATOM   9688  O  O     . ALA D 2 363 ? 40.702  33.803 104.578 1.00 221.08 ? 880  ALA F O     1 
ATOM   9689  C  CB    . ALA D 2 363 ? 42.356  36.377 105.552 1.00 216.04 ? 880  ALA F CB    1 
ATOM   9690  N  N     . PRO D 2 364 ? 39.851  35.668 103.623 1.00 218.65 ? 881  PRO F N     1 
ATOM   9691  C  CA    . PRO D 2 364 ? 39.386  34.935 102.445 1.00 220.16 ? 881  PRO F CA    1 
ATOM   9692  C  C     . PRO D 2 364 ? 40.544  34.394 101.596 1.00 219.93 ? 881  PRO F C     1 
ATOM   9693  O  O     . PRO D 2 364 ? 41.669  34.889 101.706 1.00 218.62 ? 881  PRO F O     1 
ATOM   9694  C  CB    . PRO D 2 364 ? 38.575  35.982 101.671 1.00 219.44 ? 881  PRO F CB    1 
ATOM   9695  C  CG    . PRO D 2 364 ? 39.088  37.299 102.137 1.00 216.98 ? 881  PRO F CG    1 
ATOM   9696  C  CD    . PRO D 2 364 ? 39.518  37.103 103.557 1.00 216.68 ? 881  PRO F CD    1 
ATOM   9697  N  N     . PRO D 2 365 ? 40.271  33.383 100.752 1.00 221.21 ? 882  PRO F N     1 
ATOM   9698  C  CA    . PRO D 2 365 ? 41.318  32.754 99.944  1.00 221.42 ? 882  PRO F CA    1 
ATOM   9699  C  C     . PRO D 2 365 ? 41.867  33.657 98.833  1.00 219.20 ? 882  PRO F C     1 
ATOM   9700  O  O     . PRO D 2 365 ? 42.985  33.440 98.363  1.00 218.70 ? 882  PRO F O     1 
ATOM   9701  C  CB    . PRO D 2 365 ? 40.614  31.531 99.350  1.00 224.67 ? 882  PRO F CB    1 
ATOM   9702  C  CG    . PRO D 2 365 ? 39.178  31.916 99.291  1.00 225.07 ? 882  PRO F CG    1 
ATOM   9703  C  CD    . PRO D 2 365 ? 38.937  32.823 100.463 1.00 223.10 ? 882  PRO F CD    1 
ATOM   9704  N  N     . GLU D 2 366 ? 41.086  34.656 98.426  1.00 217.50 ? 883  GLU F N     1 
ATOM   9705  C  CA    . GLU D 2 366 ? 41.506  35.605 97.396  1.00 215.61 ? 883  GLU F CA    1 
ATOM   9706  C  C     . GLU D 2 366 ? 42.495  36.638 97.943  1.00 212.28 ? 883  GLU F C     1 
ATOM   9707  O  O     . GLU D 2 366 ? 43.344  37.138 97.205  1.00 211.51 ? 883  GLU F O     1 
ATOM   9708  C  CB    . GLU D 2 366 ? 40.294  36.334 96.802  1.00 215.81 ? 883  GLU F CB    1 
ATOM   9709  C  CG    . GLU D 2 366 ? 39.288  35.436 96.086  1.00 218.70 ? 883  GLU F CG    1 
ATOM   9710  C  CD    . GLU D 2 366 ? 38.247  34.817 97.006  1.00 220.24 ? 883  GLU F CD    1 
ATOM   9711  O  OE1   . GLU D 2 366 ? 37.629  33.810 96.602  1.00 223.49 ? 883  GLU F OE1   1 
ATOM   9712  O  OE2   . GLU D 2 366 ? 38.040  35.327 98.128  1.00 218.79 ? 883  GLU F OE2   1 
ATOM   9713  N  N     . ALA D 2 367 ? 42.377  36.952 99.233  1.00 210.33 ? 884  ALA F N     1 
ATOM   9714  C  CA    . ALA D 2 367 ? 43.197  37.986 99.873  1.00 207.28 ? 884  ALA F CA    1 
ATOM   9715  C  C     . ALA D 2 367 ? 44.690  37.643 99.870  1.00 206.25 ? 884  ALA F C     1 
ATOM   9716  O  O     . ALA D 2 367 ? 45.058  36.471 99.783  1.00 207.91 ? 884  ALA F O     1 
ATOM   9717  C  CB    . ALA D 2 367 ? 42.718  38.224 101.300 1.00 206.73 ? 884  ALA F CB    1 
ATOM   9718  N  N     . PRO D 2 368 ? 45.555  38.671 99.967  1.00 203.45 ? 885  PRO F N     1 
ATOM   9719  C  CA    . PRO D 2 368 ? 46.996  38.432 100.001 1.00 203.03 ? 885  PRO F CA    1 
ATOM   9720  C  C     . PRO D 2 368 ? 47.464  37.903 101.353 1.00 203.03 ? 885  PRO F C     1 
ATOM   9721  O  O     . PRO D 2 368 ? 46.820  38.153 102.374 1.00 202.35 ? 885  PRO F O     1 
ATOM   9722  C  CB    . PRO D 2 368 ? 47.586  39.819 99.736  1.00 201.18 ? 885  PRO F CB    1 
ATOM   9723  C  CG    . PRO D 2 368 ? 46.569  40.761 100.273 1.00 200.03 ? 885  PRO F CG    1 
ATOM   9724  C  CD    . PRO D 2 368 ? 45.236  40.110 100.038 1.00 201.40 ? 885  PRO F CD    1 
ATOM   9725  N  N     . VAL D 2 369 ? 48.583  37.182 101.348 1.00 203.79 ? 886  VAL F N     1 
ATOM   9726  C  CA    . VAL D 2 369 ? 49.160  36.622 102.570 1.00 204.38 ? 886  VAL F CA    1 
ATOM   9727  C  C     . VAL D 2 369 ? 50.115  37.610 103.258 1.00 202.25 ? 886  VAL F C     1 
ATOM   9728  O  O     . VAL D 2 369 ? 50.682  37.302 104.307 1.00 201.82 ? 886  VAL F O     1 
ATOM   9729  C  CB    . VAL D 2 369 ? 49.886  35.283 102.272 1.00 207.41 ? 886  VAL F CB    1 
ATOM   9730  C  CG1   . VAL D 2 369 ? 51.258  35.520 101.646 1.00 207.55 ? 886  VAL F CG1   1 
ATOM   9731  C  CG2   . VAL D 2 369 ? 50.001  34.429 103.529 1.00 209.14 ? 886  VAL F CG2   1 
ATOM   9732  N  N     . THR D 2 370 ? 50.285  38.794 102.669 1.00 200.42 ? 887  THR F N     1 
ATOM   9733  C  CA    . THR D 2 370 ? 51.180  39.815 103.213 1.00 199.05 ? 887  THR F CA    1 
ATOM   9734  C  C     . THR D 2 370 ? 50.650  40.369 104.533 1.00 198.05 ? 887  THR F C     1 
ATOM   9735  O  O     . THR D 2 370 ? 49.446  40.583 104.685 1.00 196.86 ? 887  THR F O     1 
ATOM   9736  C  CB    . THR D 2 370 ? 51.355  40.993 102.234 1.00 197.57 ? 887  THR F CB    1 
ATOM   9737  O  OG1   . THR D 2 370 ? 51.232  40.527 100.886 1.00 197.66 ? 887  THR F OG1   1 
ATOM   9738  C  CG2   . THR D 2 370 ? 52.712  41.657 102.427 1.00 197.50 ? 887  THR F CG2   1 
ATOM   9739  N  N     . GLY D 2 371 ? 51.559  40.602 105.478 1.00 198.25 ? 888  GLY F N     1 
ATOM   9740  C  CA    . GLY D 2 371 ? 51.194  41.060 106.818 1.00 198.26 ? 888  GLY F CA    1 
ATOM   9741  C  C     . GLY D 2 371 ? 51.148  39.918 107.817 1.00 200.82 ? 888  GLY F C     1 
ATOM   9742  O  O     . GLY D 2 371 ? 51.591  40.067 108.957 1.00 201.49 ? 888  GLY F O     1 
ATOM   9743  N  N     . TYR D 2 372 ? 50.606  38.778 107.390 1.00 202.71 ? 889  TYR F N     1 
ATOM   9744  C  CA    . TYR D 2 372 ? 50.563  37.573 108.217 1.00 204.33 ? 889  TYR F CA    1 
ATOM   9745  C  C     . TYR D 2 372 ? 51.959  36.988 108.379 1.00 205.60 ? 889  TYR F C     1 
ATOM   9746  O  O     . TYR D 2 372 ? 52.769  37.032 107.452 1.00 205.91 ? 889  TYR F O     1 
ATOM   9747  C  CB    . TYR D 2 372 ? 49.643  36.520 107.593 1.00 205.69 ? 889  TYR F CB    1 
ATOM   9748  C  CG    . TYR D 2 372 ? 48.202  36.959 107.488 1.00 204.98 ? 889  TYR F CG    1 
ATOM   9749  C  CD1   . TYR D 2 372 ? 47.657  37.349 106.267 1.00 204.38 ? 889  TYR F CD1   1 
ATOM   9750  C  CD2   . TYR D 2 372 ? 47.386  36.992 108.612 1.00 205.32 ? 889  TYR F CD2   1 
ATOM   9751  C  CE1   . TYR D 2 372 ? 46.337  37.753 106.172 1.00 204.11 ? 889  TYR F CE1   1 
ATOM   9752  C  CE2   . TYR D 2 372 ? 46.066  37.395 108.528 1.00 205.00 ? 889  TYR F CE2   1 
ATOM   9753  C  CZ    . TYR D 2 372 ? 45.546  37.774 107.307 1.00 204.43 ? 889  TYR F CZ    1 
ATOM   9754  O  OH    . TYR D 2 372 ? 44.237  38.177 107.224 1.00 204.56 ? 889  TYR F OH    1 
ATOM   9755  N  N     . MET D 2 373 ? 52.232  36.438 109.559 1.00 206.72 ? 890  MET F N     1 
ATOM   9756  C  CA    . MET D 2 373 ? 53.524  35.821 109.843 1.00 208.56 ? 890  MET F CA    1 
ATOM   9757  C  C     . MET D 2 373 ? 53.522  34.359 109.402 1.00 210.64 ? 890  MET F C     1 
ATOM   9758  O  O     . MET D 2 373 ? 54.487  33.888 108.796 1.00 211.53 ? 890  MET F O     1 
ATOM   9759  C  CB    . MET D 2 373 ? 53.849  35.916 111.339 1.00 209.32 ? 890  MET F CB    1 
ATOM   9760  C  CG    . MET D 2 373 ? 55.336  36.004 111.654 1.00 210.41 ? 890  MET F CG    1 
ATOM   9761  S  SD    . MET D 2 373 ? 55.914  37.686 111.969 1.00 208.51 ? 890  MET F SD    1 
ATOM   9762  C  CE    . MET D 2 373 ? 55.360  38.551 110.500 1.00 206.47 ? 890  MET F CE    1 
ATOM   9763  N  N     . PHE D 2 374 ? 52.435  33.650 109.708 1.00 210.88 ? 891  PHE F N     1 
ATOM   9764  C  CA    . PHE D 2 374 ? 52.321  32.221 109.410 1.00 212.98 ? 891  PHE F CA    1 
ATOM   9765  C  C     . PHE D 2 374 ? 51.042  31.891 108.635 1.00 212.26 ? 891  PHE F C     1 
ATOM   9766  O  O     . PHE D 2 374 ? 50.366  30.902 108.928 1.00 214.91 ? 891  PHE F O     1 
ATOM   9767  C  CB    . PHE D 2 374 ? 52.372  31.408 110.708 1.00 215.17 ? 891  PHE F CB    1 
ATOM   9768  C  CG    . PHE D 2 374 ? 53.435  31.863 111.668 1.00 215.09 ? 891  PHE F CG    1 
ATOM   9769  C  CD1   . PHE D 2 374 ? 54.779  31.673 111.379 1.00 216.20 ? 891  PHE F CD1   1 
ATOM   9770  C  CD2   . PHE D 2 374 ? 53.091  32.484 112.860 1.00 214.05 ? 891  PHE F CD2   1 
ATOM   9771  C  CE1   . PHE D 2 374 ? 55.759  32.094 112.262 1.00 216.39 ? 891  PHE F CE1   1 
ATOM   9772  C  CE2   . PHE D 2 374 ? 54.066  32.906 113.748 1.00 214.33 ? 891  PHE F CE2   1 
ATOM   9773  C  CZ    . PHE D 2 374 ? 55.403  32.711 113.449 1.00 215.50 ? 891  PHE F CZ    1 
ATOM   9774  N  N     . GLY D 2 375 ? 50.716  32.719 107.646 1.00 209.06 ? 892  GLY F N     1 
ATOM   9775  C  CA    . GLY D 2 375 ? 49.564  32.475 106.780 1.00 208.43 ? 892  GLY F CA    1 
ATOM   9776  C  C     . GLY D 2 375 ? 48.240  32.913 107.378 1.00 206.94 ? 892  GLY F C     1 
ATOM   9777  O  O     . GLY D 2 375 ? 48.188  33.418 108.500 1.00 205.35 ? 892  GLY F O     1 
ATOM   9778  N  N     . LYS D 2 376 ? 47.165  32.704 106.622 1.00 207.51 ? 893  LYS F N     1 
ATOM   9779  C  CA    . LYS D 2 376 ? 45.833  33.167 107.010 1.00 207.26 ? 893  LYS F CA    1 
ATOM   9780  C  C     . LYS D 2 376 ? 45.233  32.293 108.108 1.00 209.17 ? 893  LYS F C     1 
ATOM   9781  O  O     . LYS D 2 376 ? 45.220  31.068 108.001 1.00 212.02 ? 893  LYS F O     1 
ATOM   9782  C  CB    . LYS D 2 376 ? 44.898  33.183 105.799 1.00 207.68 ? 893  LYS F CB    1 
ATOM   9783  C  CG    . LYS D 2 376 ? 45.355  34.096 104.672 1.00 206.46 ? 893  LYS F CG    1 
ATOM   9784  C  CD    . LYS D 2 376 ? 44.501  33.916 103.427 1.00 207.41 ? 893  LYS F CD    1 
ATOM   9785  C  CE    . LYS D 2 376 ? 45.230  34.389 102.180 1.00 207.01 ? 893  LYS F CE    1 
ATOM   9786  N  NZ    . LYS D 2 376 ? 44.455  34.097 100.943 1.00 208.16 ? 893  LYS F NZ    1 
ATOM   9787  N  N     . GLY D 2 377 ? 44.732  32.939 109.156 1.00 208.38 ? 894  GLY F N     1 
ATOM   9788  C  CA    . GLY D 2 377 ? 44.139  32.246 110.298 1.00 210.26 ? 894  GLY F CA    1 
ATOM   9789  C  C     . GLY D 2 377 ? 43.835  33.234 111.409 1.00 209.20 ? 894  GLY F C     1 
ATOM   9790  O  O     . GLY D 2 377 ? 44.089  34.431 111.260 1.00 207.51 ? 894  GLY F O     1 
ATOM   9791  N  N     . ILE D 2 378 ? 43.294  32.744 112.522 1.00 210.97 ? 895  ILE F N     1 
ATOM   9792  C  CA    . ILE D 2 378 ? 43.009  33.609 113.668 1.00 210.76 ? 895  ILE F CA    1 
ATOM   9793  C  C     . ILE D 2 378 ? 44.267  33.692 114.526 1.00 211.50 ? 895  ILE F C     1 
ATOM   9794  O  O     . ILE D 2 378 ? 44.788  32.665 114.963 1.00 213.78 ? 895  ILE F O     1 
ATOM   9795  C  CB    . ILE D 2 378 ? 41.843  33.099 114.549 1.00 212.39 ? 895  ILE F CB    1 
ATOM   9796  C  CG1   . ILE D 2 378 ? 40.691  32.525 113.712 1.00 213.47 ? 895  ILE F CG1   1 
ATOM   9797  C  CG2   . ILE D 2 378 ? 41.336  34.220 115.448 1.00 211.15 ? 895  ILE F CG2   1 
ATOM   9798  C  CD1   . ILE D 2 378 ? 40.129  33.464 112.667 1.00 211.73 ? 895  ILE F CD1   1 
ATOM   9799  N  N     . TYR D 2 379 ? 44.748  34.910 114.765 1.00 210.28 ? 896  TYR F N     1 
ATOM   9800  C  CA    . TYR D 2 379 ? 45.956  35.127 115.562 1.00 210.99 ? 896  TYR F CA    1 
ATOM   9801  C  C     . TYR D 2 379 ? 45.612  35.549 116.987 1.00 210.95 ? 896  TYR F C     1 
ATOM   9802  O  O     . TYR D 2 379 ? 44.656  36.294 117.211 1.00 210.61 ? 896  TYR F O     1 
ATOM   9803  C  CB    . TYR D 2 379 ? 46.856  36.174 114.900 1.00 209.85 ? 896  TYR F CB    1 
ATOM   9804  C  CG    . TYR D 2 379 ? 47.622  35.637 113.714 1.00 210.77 ? 896  TYR F CG    1 
ATOM   9805  C  CD1   . TYR D 2 379 ? 46.990  35.423 112.495 1.00 210.90 ? 896  TYR F CD1   1 
ATOM   9806  C  CD2   . TYR D 2 379 ? 48.978  35.335 113.813 1.00 212.19 ? 896  TYR F CD2   1 
ATOM   9807  C  CE1   . TYR D 2 379 ? 47.684  34.925 111.407 1.00 211.95 ? 896  TYR F CE1   1 
ATOM   9808  C  CE2   . TYR D 2 379 ? 49.682  34.840 112.729 1.00 213.20 ? 896  TYR F CE2   1 
ATOM   9809  C  CZ    . TYR D 2 379 ? 49.032  34.636 111.529 1.00 213.03 ? 896  TYR F CZ    1 
ATOM   9810  O  OH    . TYR D 2 379 ? 49.731  34.144 110.452 1.00 214.06 ? 896  TYR F OH    1 
ATOM   9811  N  N     . PHE D 2 380 ? 46.401  35.060 117.941 1.00 211.92 ? 897  PHE F N     1 
ATOM   9812  C  CA    . PHE D 2 380 ? 46.223  35.370 119.357 1.00 212.32 ? 897  PHE F CA    1 
ATOM   9813  C  C     . PHE D 2 380 ? 47.572  35.656 120.006 1.00 213.52 ? 897  PHE F C     1 
ATOM   9814  O  O     . PHE D 2 380 ? 48.615  35.251 119.490 1.00 213.78 ? 897  PHE F O     1 
ATOM   9815  C  CB    . PHE D 2 380 ? 45.553  34.199 120.078 1.00 214.14 ? 897  PHE F CB    1 
ATOM   9816  C  CG    . PHE D 2 380 ? 44.110  34.011 119.719 1.00 213.39 ? 897  PHE F CG    1 
ATOM   9817  C  CD1   . PHE D 2 380 ? 43.747  33.201 118.653 1.00 213.74 ? 897  PHE F CD1   1 
ATOM   9818  C  CD2   . PHE D 2 380 ? 43.113  34.637 120.452 1.00 212.68 ? 897  PHE F CD2   1 
ATOM   9819  C  CE1   . PHE D 2 380 ? 42.416  33.023 118.323 1.00 213.77 ? 897  PHE F CE1   1 
ATOM   9820  C  CE2   . PHE D 2 380 ? 41.780  34.466 120.125 1.00 212.74 ? 897  PHE F CE2   1 
ATOM   9821  C  CZ    . PHE D 2 380 ? 41.432  33.658 119.059 1.00 213.37 ? 897  PHE F CZ    1 
ATOM   9822  N  N     . ALA D 2 381 ? 47.542  36.354 121.137 1.00 214.78 ? 898  ALA F N     1 
ATOM   9823  C  CA    . ALA D 2 381 ? 48.747  36.623 121.918 1.00 217.00 ? 898  ALA F CA    1 
ATOM   9824  C  C     . ALA D 2 381 ? 48.477  36.455 123.407 1.00 220.40 ? 898  ALA F C     1 
ATOM   9825  O  O     . ALA D 2 381 ? 47.348  36.630 123.870 1.00 220.26 ? 898  ALA F O     1 
ATOM   9826  C  CB    . ALA D 2 381 ? 49.267  38.022 121.632 1.00 215.31 ? 898  ALA F CB    1 
ATOM   9827  N  N     . ASP D 2 382 ? 49.528  36.116 124.148 1.00 224.42 ? 899  ASP F N     1 
ATOM   9828  C  CA    . ASP D 2 382 ? 49.441  35.952 125.601 1.00 228.02 ? 899  ASP F CA    1 
ATOM   9829  C  C     . ASP D 2 382 ? 49.567  37.279 126.351 1.00 228.31 ? 899  ASP F C     1 
ATOM   9830  O  O     . ASP D 2 382 ? 49.278  37.343 127.548 1.00 230.51 ? 899  ASP F O     1 
ATOM   9831  C  CB    . ASP D 2 382 ? 50.497  34.956 126.110 1.00 231.07 ? 899  ASP F CB    1 
ATOM   9832  C  CG    . ASP D 2 382 ? 51.887  35.212 125.538 1.00 231.09 ? 899  ASP F CG    1 
ATOM   9833  O  OD1   . ASP D 2 382 ? 52.127  36.303 124.977 1.00 229.00 ? 899  ASP F OD1   1 
ATOM   9834  O  OD2   . ASP D 2 382 ? 52.740  34.308 125.643 1.00 233.97 ? 899  ASP F OD2   1 
ATOM   9835  N  N     . MET D 2 383 ? 49.990  38.331 125.650 1.00 226.79 ? 900  MET F N     1 
ATOM   9836  C  CA    . MET D 2 383 ? 50.156  39.652 126.253 1.00 226.74 ? 900  MET F CA    1 
ATOM   9837  C  C     . MET D 2 383 ? 49.057  40.598 125.777 1.00 224.57 ? 900  MET F C     1 
ATOM   9838  O  O     . MET D 2 383 ? 48.754  40.655 124.584 1.00 223.24 ? 900  MET F O     1 
ATOM   9839  C  CB    . MET D 2 383 ? 51.533  40.228 125.910 1.00 226.91 ? 900  MET F CB    1 
ATOM   9840  C  CG    . MET D 2 383 ? 52.675  39.227 126.034 1.00 229.23 ? 900  MET F CG    1 
ATOM   9841  S  SD    . MET D 2 383 ? 54.174  39.936 126.739 1.00 231.26 ? 900  MET F SD    1 
ATOM   9842  C  CE    . MET D 2 383 ? 53.733  39.967 128.473 1.00 233.40 ? 900  MET F CE    1 
ATOM   9843  N  N     . VAL D 2 384 ? 48.463  41.334 126.716 1.00 224.53 ? 901  VAL F N     1 
ATOM   9844  C  CA    . VAL D 2 384 ? 47.369  42.258 126.404 1.00 222.39 ? 901  VAL F CA    1 
ATOM   9845  C  C     . VAL D 2 384 ? 47.828  43.411 125.511 1.00 220.11 ? 901  VAL F C     1 
ATOM   9846  O  O     . VAL D 2 384 ? 47.071  43.877 124.661 1.00 218.41 ? 901  VAL F O     1 
ATOM   9847  C  CB    . VAL D 2 384 ? 46.711  42.826 127.689 1.00 223.66 ? 901  VAL F CB    1 
ATOM   9848  C  CG1   . VAL D 2 384 ? 47.616  43.841 128.377 1.00 224.37 ? 901  VAL F CG1   1 
ATOM   9849  C  CG2   . VAL D 2 384 ? 45.358  43.450 127.372 1.00 222.47 ? 901  VAL F CG2   1 
ATOM   9850  N  N     . SER D 2 385 ? 49.067  43.857 125.708 1.00 220.49 ? 902  SER F N     1 
ATOM   9851  C  CA    . SER D 2 385 ? 49.610  45.002 124.981 1.00 218.91 ? 902  SER F CA    1 
ATOM   9852  C  C     . SER D 2 385 ? 49.769  44.720 123.490 1.00 217.33 ? 902  SER F C     1 
ATOM   9853  O  O     . SER D 2 385 ? 49.335  45.516 122.658 1.00 215.59 ? 902  SER F O     1 
ATOM   9854  C  CB    . SER D 2 385 ? 50.959  45.410 125.570 1.00 220.21 ? 902  SER F CB    1 
ATOM   9855  O  OG    . SER D 2 385 ? 51.471  46.557 124.919 1.00 218.94 ? 902  SER F OG    1 
ATOM   9856  N  N     . LYS D 2 386 ? 50.393  43.590 123.163 1.00 218.23 ? 903  LYS F N     1 
ATOM   9857  C  CA    . LYS D 2 386 ? 50.604  43.192 121.768 1.00 217.27 ? 903  LYS F CA    1 
ATOM   9858  C  C     . LYS D 2 386 ? 49.284  43.130 121.002 1.00 215.45 ? 903  LYS F C     1 
ATOM   9859  O  O     . LYS D 2 386 ? 49.197  43.592 119.863 1.00 214.28 ? 903  LYS F O     1 
ATOM   9860  C  CB    . LYS D 2 386 ? 51.313  41.836 121.699 1.00 219.36 ? 903  LYS F CB    1 
ATOM   9861  C  CG    . LYS D 2 386 ? 51.646  41.378 120.287 1.00 218.86 ? 903  LYS F CG    1 
ATOM   9862  C  CD    . LYS D 2 386 ? 52.657  40.245 120.295 1.00 221.17 ? 903  LYS F CD    1 
ATOM   9863  C  CE    . LYS D 2 386 ? 52.882  39.691 118.898 1.00 220.65 ? 903  LYS F CE    1 
ATOM   9864  N  NZ    . LYS D 2 386 ? 53.940  38.645 118.872 1.00 222.69 ? 903  LYS F NZ    1 
ATOM   9865  N  N     . SER D 2 387 ? 48.265  42.557 121.637 1.00 215.37 ? 904  SER F N     1 
ATOM   9866  C  CA    . SER D 2 387 ? 46.920  42.508 121.067 1.00 213.80 ? 904  SER F CA    1 
ATOM   9867  C  C     . SER D 2 387 ? 46.265  43.892 121.033 1.00 212.18 ? 904  SER F C     1 
ATOM   9868  O  O     . SER D 2 387 ? 45.562  44.223 120.078 1.00 211.21 ? 904  SER F O     1 
ATOM   9869  C  CB    . SER D 2 387 ? 46.043  41.533 121.860 1.00 215.20 ? 904  SER F CB    1 
ATOM   9870  O  OG    . SER D 2 387 ? 46.467  40.195 121.673 1.00 216.36 ? 904  SER F OG    1 
ATOM   9871  N  N     . ALA D 2 388 ? 46.508  44.697 122.067 1.00 212.04 ? 905  ALA F N     1 
ATOM   9872  C  CA    . ALA D 2 388 ? 45.898  46.030 122.191 1.00 210.25 ? 905  ALA F CA    1 
ATOM   9873  C  C     . ALA D 2 388 ? 46.304  47.016 121.087 1.00 207.80 ? 905  ALA F C     1 
ATOM   9874  O  O     . ALA D 2 388 ? 45.590  47.988 120.838 1.00 206.46 ? 905  ALA F O     1 
ATOM   9875  C  CB    . ALA D 2 388 ? 46.202  46.629 123.559 1.00 211.82 ? 905  ALA F CB    1 
ATOM   9876  N  N     . ASN D 2 389 ? 47.444  46.775 120.439 1.00 206.99 ? 906  ASN F N     1 
ATOM   9877  C  CA    . ASN D 2 389 ? 47.884  47.611 119.315 1.00 205.39 ? 906  ASN F CA    1 
ATOM   9878  C  C     . ASN D 2 389 ? 46.955  47.528 118.100 1.00 204.10 ? 906  ASN F C     1 
ATOM   9879  O  O     . ASN D 2 389 ? 46.898  48.460 117.296 1.00 203.68 ? 906  ASN F O     1 
ATOM   9880  C  CB    . ASN D 2 389 ? 49.311  47.248 118.885 1.00 205.37 ? 906  ASN F CB    1 
ATOM   9881  C  CG    . ASN D 2 389 ? 50.360  47.720 119.874 1.00 206.48 ? 906  ASN F CG    1 
ATOM   9882  O  OD1   . ASN D 2 389 ? 50.968  48.775 119.693 1.00 206.07 ? 906  ASN F OD1   1 
ATOM   9883  N  ND2   . ASN D 2 389 ? 50.575  46.943 120.928 1.00 207.98 ? 906  ASN F ND2   1 
ATOM   9884  N  N     . TYR D 2 390 ? 46.231  46.417 117.973 1.00 204.45 ? 907  TYR F N     1 
ATOM   9885  C  CA    . TYR D 2 390 ? 45.315  46.204 116.850 1.00 203.43 ? 907  TYR F CA    1 
ATOM   9886  C  C     . TYR D 2 390 ? 43.959  46.890 117.045 1.00 203.08 ? 907  TYR F C     1 
ATOM   9887  O  O     . TYR D 2 390 ? 43.134  46.902 116.131 1.00 202.25 ? 907  TYR F O     1 
ATOM   9888  C  CB    . TYR D 2 390 ? 45.127  44.705 116.600 1.00 204.37 ? 907  TYR F CB    1 
ATOM   9889  C  CG    . TYR D 2 390 ? 46.385  44.024 116.111 1.00 204.67 ? 907  TYR F CG    1 
ATOM   9890  C  CD1   . TYR D 2 390 ? 46.607  43.821 114.752 1.00 204.00 ? 907  TYR F CD1   1 
ATOM   9891  C  CD2   . TYR D 2 390 ? 47.362  43.594 117.007 1.00 205.88 ? 907  TYR F CD2   1 
ATOM   9892  C  CE1   . TYR D 2 390 ? 47.761  43.202 114.299 1.00 204.51 ? 907  TYR F CE1   1 
ATOM   9893  C  CE2   . TYR D 2 390 ? 48.519  42.975 116.563 1.00 206.45 ? 907  TYR F CE2   1 
ATOM   9894  C  CZ    . TYR D 2 390 ? 48.714  42.781 115.209 1.00 205.76 ? 907  TYR F CZ    1 
ATOM   9895  O  OH    . TYR D 2 390 ? 49.862  42.166 114.765 1.00 206.42 ? 907  TYR F OH    1 
ATOM   9896  N  N     . CYS D 2 391 ? 43.732  47.456 118.231 1.00 203.92 ? 908  CYS F N     1 
ATOM   9897  C  CA    . CYS D 2 391 ? 42.553  48.286 118.484 1.00 204.19 ? 908  CYS F CA    1 
ATOM   9898  C  C     . CYS D 2 391 ? 42.612  49.596 117.696 1.00 203.47 ? 908  CYS F C     1 
ATOM   9899  O  O     . CYS D 2 391 ? 41.573  50.174 117.371 1.00 203.20 ? 908  CYS F O     1 
ATOM   9900  C  CB    . CYS D 2 391 ? 42.425  48.595 119.978 1.00 205.38 ? 908  CYS F CB    1 
ATOM   9901  S  SG    . CYS D 2 391 ? 42.479  47.142 121.051 1.00 206.40 ? 908  CYS F SG    1 
ATOM   9902  N  N     . HIS D 2 392 ? 43.830  50.052 117.397 1.00 203.56 ? 909  HIS F N     1 
ATOM   9903  C  CA    . HIS D 2 392 ? 44.067  51.309 116.681 1.00 203.19 ? 909  HIS F CA    1 
ATOM   9904  C  C     . HIS D 2 392 ? 43.409  52.493 117.391 1.00 204.09 ? 909  HIS F C     1 
ATOM   9905  O  O     . HIS D 2 392 ? 42.419  53.054 116.915 1.00 204.32 ? 909  HIS F O     1 
ATOM   9906  C  CB    . HIS D 2 392 ? 43.619  51.215 115.213 1.00 202.35 ? 909  HIS F CB    1 
ATOM   9907  C  CG    . HIS D 2 392 ? 44.634  50.584 114.312 1.00 202.19 ? 909  HIS F CG    1 
ATOM   9908  N  ND1   . HIS D 2 392 ? 44.525  49.287 113.856 1.00 202.77 ? 909  HIS F ND1   1 
ATOM   9909  C  CD2   . HIS D 2 392 ? 45.780  51.073 113.782 1.00 201.91 ? 909  HIS F CD2   1 
ATOM   9910  C  CE1   . HIS D 2 392 ? 45.559  49.006 113.084 1.00 202.46 ? 909  HIS F CE1   1 
ATOM   9911  N  NE2   . HIS D 2 392 ? 46.336  50.072 113.022 1.00 202.09 ? 909  HIS F NE2   1 
ATOM   9912  N  N     . THR D 2 393 ? 43.971  52.850 118.542 1.00 205.16 ? 910  THR F N     1 
ATOM   9913  C  CA    . THR D 2 393 ? 43.520  54.004 119.314 1.00 206.31 ? 910  THR F CA    1 
ATOM   9914  C  C     . THR D 2 393 ? 44.542  55.131 119.246 1.00 206.90 ? 910  THR F C     1 
ATOM   9915  O  O     . THR D 2 393 ? 45.721  54.903 118.966 1.00 206.99 ? 910  THR F O     1 
ATOM   9916  C  CB    . THR D 2 393 ? 43.271  53.639 120.792 1.00 207.62 ? 910  THR F CB    1 
ATOM   9917  O  OG1   . THR D 2 393 ? 44.240  52.674 121.223 1.00 207.85 ? 910  THR F OG1   1 
ATOM   9918  C  CG2   . THR D 2 393 ? 41.877  53.066 120.969 1.00 207.91 ? 910  THR F CG2   1 
ATOM   9919  N  N     . SER D 2 394 ? 44.071  56.347 119.506 1.00 207.64 ? 911  SER F N     1 
ATOM   9920  C  CA    . SER D 2 394 ? 44.908  57.542 119.469 1.00 208.25 ? 911  SER F CA    1 
ATOM   9921  C  C     . SER D 2 394 ? 44.609  58.423 120.680 1.00 209.95 ? 911  SER F C     1 
ATOM   9922  O  O     . SER D 2 394 ? 43.818  58.049 121.549 1.00 210.28 ? 911  SER F O     1 
ATOM   9923  C  CB    . SER D 2 394 ? 44.660  58.308 118.166 1.00 207.62 ? 911  SER F CB    1 
ATOM   9924  O  OG    . SER D 2 394 ? 43.319  58.760 118.084 1.00 208.32 ? 911  SER F OG    1 
ATOM   9925  N  N     . GLN D 2 395 ? 45.247  59.589 120.738 1.00 210.76 ? 912  GLN F N     1 
ATOM   9926  C  CA    . GLN D 2 395 ? 45.022  60.543 121.822 1.00 212.68 ? 912  GLN F CA    1 
ATOM   9927  C  C     . GLN D 2 395 ? 43.641  61.198 121.709 1.00 213.10 ? 912  GLN F C     1 
ATOM   9928  O  O     . GLN D 2 395 ? 43.066  61.616 122.715 1.00 214.83 ? 912  GLN F O     1 
ATOM   9929  C  CB    . GLN D 2 395 ? 46.120  61.614 121.845 1.00 213.58 ? 912  GLN F CB    1 
ATOM   9930  C  CG    . GLN D 2 395 ? 47.490  61.106 122.286 1.00 214.12 ? 912  GLN F CG    1 
ATOM   9931  C  CD    . GLN D 2 395 ? 48.292  60.455 121.170 1.00 212.41 ? 912  GLN F CD    1 
ATOM   9932  O  OE1   . GLN D 2 395 ? 47.743  60.049 120.145 1.00 210.52 ? 912  GLN F OE1   1 
ATOM   9933  N  NE2   . GLN D 2 395 ? 49.602  60.348 121.368 1.00 213.19 ? 912  GLN F NE2   1 
ATOM   9934  N  N     . GLY D 2 396 ? 43.121  61.282 120.485 1.00 211.90 ? 913  GLY F N     1 
ATOM   9935  C  CA    . GLY D 2 396 ? 41.779  61.809 120.236 1.00 212.43 ? 913  GLY F CA    1 
ATOM   9936  C  C     . GLY D 2 396 ? 40.684  60.774 120.438 1.00 212.23 ? 913  GLY F C     1 
ATOM   9937  O  O     . GLY D 2 396 ? 39.587  61.108 120.889 1.00 213.33 ? 913  GLY F O     1 
ATOM   9938  N  N     . ASP D 2 397 ? 40.981  59.522 120.090 1.00 211.00 ? 914  ASP F N     1 
ATOM   9939  C  CA    . ASP D 2 397 ? 40.055  58.404 120.274 1.00 211.09 ? 914  ASP F CA    1 
ATOM   9940  C  C     . ASP D 2 397 ? 40.648  57.422 121.292 1.00 212.09 ? 914  ASP F C     1 
ATOM   9941  O  O     . ASP D 2 397 ? 41.370  56.496 120.916 1.00 211.05 ? 914  ASP F O     1 
ATOM   9942  C  CB    . ASP D 2 397 ? 39.799  57.708 118.931 1.00 209.26 ? 914  ASP F CB    1 
ATOM   9943  C  CG    . ASP D 2 397 ? 38.759  56.603 119.027 1.00 209.43 ? 914  ASP F CG    1 
ATOM   9944  O  OD1   . ASP D 2 397 ? 38.950  55.552 118.380 1.00 208.71 ? 914  ASP F OD1   1 
ATOM   9945  O  OD2   . ASP D 2 397 ? 37.753  56.782 119.746 1.00 210.70 ? 914  ASP F OD2   1 
ATOM   9946  N  N     . PRO D 2 398 ? 40.343  57.621 122.589 1.00 214.73 ? 915  PRO F N     1 
ATOM   9947  C  CA    . PRO D 2 398 ? 41.008  56.865 123.651 1.00 216.18 ? 915  PRO F CA    1 
ATOM   9948  C  C     . PRO D 2 398 ? 40.485  55.441 123.853 1.00 217.06 ? 915  PRO F C     1 
ATOM   9949  O  O     . PRO D 2 398 ? 41.285  54.519 124.001 1.00 216.95 ? 915  PRO F O     1 
ATOM   9950  C  CB    . PRO D 2 398 ? 40.747  57.716 124.897 1.00 218.22 ? 915  PRO F CB    1 
ATOM   9951  C  CG    . PRO D 2 398 ? 39.457  58.406 124.620 1.00 218.47 ? 915  PRO F CG    1 
ATOM   9952  C  CD    . PRO D 2 398 ? 39.336  58.555 123.127 1.00 216.52 ? 915  PRO F CD    1 
ATOM   9953  N  N     . ILE D 2 399 ? 39.164  55.264 123.861 1.00 218.53 ? 916  ILE F N     1 
ATOM   9954  C  CA    . ILE D 2 399 ? 38.564  53.949 124.149 1.00 219.35 ? 916  ILE F CA    1 
ATOM   9955  C  C     . ILE D 2 399 ? 38.820  52.921 123.042 1.00 217.27 ? 916  ILE F C     1 
ATOM   9956  O  O     . ILE D 2 399 ? 38.930  53.270 121.866 1.00 215.95 ? 916  ILE F O     1 
ATOM   9957  C  CB    . ILE D 2 399 ? 37.042  54.018 124.474 1.00 221.14 ? 916  ILE F CB    1 
ATOM   9958  C  CG1   . ILE D 2 399 ? 36.289  55.059 123.627 1.00 221.48 ? 916  ILE F CG1   1 
ATOM   9959  C  CG2   . ILE D 2 399 ? 36.832  54.342 125.945 1.00 223.22 ? 916  ILE F CG2   1 
ATOM   9960  C  CD1   . ILE D 2 399 ? 36.417  54.891 122.129 1.00 219.74 ? 916  ILE F CD1   1 
ATOM   9961  N  N     . GLY D 2 400 ? 38.925  51.653 123.438 1.00 217.19 ? 917  GLY F N     1 
ATOM   9962  C  CA    . GLY D 2 400 ? 39.192  50.559 122.502 1.00 215.64 ? 917  GLY F CA    1 
ATOM   9963  C  C     . GLY D 2 400 ? 38.789  49.208 123.068 1.00 216.37 ? 917  GLY F C     1 
ATOM   9964  O  O     . GLY D 2 400 ? 38.787  49.015 124.285 1.00 218.53 ? 917  GLY F O     1 
ATOM   9965  N  N     . LEU D 2 401 ? 38.456  48.273 122.180 1.00 215.10 ? 918  LEU F N     1 
ATOM   9966  C  CA    . LEU D 2 401 ? 37.970  46.952 122.578 1.00 215.79 ? 918  LEU F CA    1 
ATOM   9967  C  C     . LEU D 2 401 ? 38.983  45.850 122.271 1.00 215.67 ? 918  LEU F C     1 
ATOM   9968  O  O     . LEU D 2 401 ? 39.614  45.855 121.213 1.00 214.46 ? 918  LEU F O     1 
ATOM   9969  C  CB    . LEU D 2 401 ? 36.650  46.640 121.871 1.00 215.59 ? 918  LEU F CB    1 
ATOM   9970  C  CG    . LEU D 2 401 ? 35.464  47.564 122.159 1.00 216.25 ? 918  LEU F CG    1 
ATOM   9971  C  CD1   . LEU D 2 401 ? 34.246  47.105 121.373 1.00 216.49 ? 918  LEU F CD1   1 
ATOM   9972  C  CD2   . LEU D 2 401 ? 35.149  47.618 123.647 1.00 218.12 ? 918  LEU F CD2   1 
ATOM   9973  N  N     . ILE D 2 402 ? 39.120  44.907 123.202 1.00 217.09 ? 919  ILE F N     1 
ATOM   9974  C  CA    . ILE D 2 402 ? 40.019  43.760 123.051 1.00 216.63 ? 919  ILE F CA    1 
ATOM   9975  C  C     . ILE D 2 402 ? 39.302  42.499 123.546 1.00 218.12 ? 919  ILE F C     1 
ATOM   9976  O  O     . ILE D 2 402 ? 38.480  42.571 124.463 1.00 218.67 ? 919  ILE F O     1 
ATOM   9977  C  CB    . ILE D 2 402 ? 41.345  43.998 123.816 1.00 216.88 ? 919  ILE F CB    1 
ATOM   9978  C  CG1   . ILE D 2 402 ? 42.492  43.190 123.209 1.00 216.07 ? 919  ILE F CG1   1 
ATOM   9979  C  CG2   . ILE D 2 402 ? 41.204  43.680 125.298 1.00 219.00 ? 919  ILE F CG2   1 
ATOM   9980  C  CD1   . ILE D 2 402 ? 43.834  43.516 123.828 1.00 216.52 ? 919  ILE F CD1   1 
ATOM   9981  N  N     . LEU D 2 403 ? 39.606  41.354 122.938 1.00 219.07 ? 920  LEU F N     1 
ATOM   9982  C  CA    . LEU D 2 403 ? 38.916  40.098 123.260 1.00 221.14 ? 920  LEU F CA    1 
ATOM   9983  C  C     . LEU D 2 403 ? 39.772  39.136 124.076 1.00 223.45 ? 920  LEU F C     1 
ATOM   9984  O  O     . LEU D 2 403 ? 40.997  39.247 124.114 1.00 222.44 ? 920  LEU F O     1 
ATOM   9985  C  CB    . LEU D 2 403 ? 38.456  39.392 121.980 1.00 220.28 ? 920  LEU F CB    1 
ATOM   9986  C  CG    . LEU D 2 403 ? 37.286  40.030 121.229 1.00 219.56 ? 920  LEU F CG    1 
ATOM   9987  C  CD1   . LEU D 2 403 ? 37.196  39.486 119.812 1.00 218.55 ? 920  LEU F CD1   1 
ATOM   9988  C  CD2   . LEU D 2 403 ? 35.980  39.803 121.974 1.00 221.34 ? 920  LEU F CD2   1 
ATOM   9989  N  N     . LEU D 2 404 ? 39.093  38.197 124.732 1.00 227.25 ? 921  LEU F N     1 
ATOM   9990  C  CA    . LEU D 2 404 ? 39.730  37.074 125.413 1.00 230.69 ? 921  LEU F CA    1 
ATOM   9991  C  C     . LEU D 2 404 ? 38.965  35.804 125.060 1.00 233.16 ? 921  LEU F C     1 
ATOM   9992  O  O     . LEU D 2 404 ? 37.809  35.644 125.458 1.00 234.26 ? 921  LEU F O     1 
ATOM   9993  C  CB    . LEU D 2 404 ? 39.717  37.280 126.928 1.00 232.51 ? 921  LEU F CB    1 
ATOM   9994  C  CG    . LEU D 2 404 ? 40.786  38.201 127.516 1.00 232.03 ? 921  LEU F CG    1 
ATOM   9995  C  CD1   . LEU D 2 404 ? 40.565  38.380 129.011 1.00 233.87 ? 921  LEU F CD1   1 
ATOM   9996  C  CD2   . LEU D 2 404 ? 42.178  37.655 127.243 1.00 232.34 ? 921  LEU F CD2   1 
ATOM   9997  N  N     . GLY D 2 405 ? 39.607  34.910 124.313 1.00 234.77 ? 922  GLY F N     1 
ATOM   9998  C  CA    . GLY D 2 405 ? 38.951  33.702 123.819 1.00 237.82 ? 922  GLY F CA    1 
ATOM   9999  C  C     . GLY D 2 405 ? 39.622  32.422 124.274 1.00 241.54 ? 922  GLY F C     1 
ATOM   10000 O  O     . GLY D 2 405 ? 40.850  32.313 124.248 1.00 241.42 ? 922  GLY F O     1 
ATOM   10001 N  N     . GLU D 2 406 ? 38.809  31.456 124.696 1.00 245.57 ? 923  GLU F N     1 
ATOM   10002 C  CA    . GLU D 2 406 ? 39.291  30.114 125.001 1.00 249.66 ? 923  GLU F CA    1 
ATOM   10003 C  C     . GLU D 2 406 ? 39.611  29.409 123.685 1.00 249.92 ? 923  GLU F C     1 
ATOM   10004 O  O     . GLU D 2 406 ? 38.743  28.777 123.079 1.00 250.68 ? 923  GLU F O     1 
ATOM   10005 C  CB    . GLU D 2 406 ? 38.243  29.326 125.797 1.00 253.02 ? 923  GLU F CB    1 
ATOM   10006 C  CG    . GLU D 2 406 ? 38.713  27.954 126.263 1.00 256.48 ? 923  GLU F CG    1 
ATOM   10007 C  CD    . GLU D 2 406 ? 37.607  27.127 126.895 1.00 259.66 ? 923  GLU F CD    1 
ATOM   10008 O  OE1   . GLU D 2 406 ? 36.585  27.707 127.320 1.00 259.48 ? 923  GLU F OE1   1 
ATOM   10009 O  OE2   . GLU D 2 406 ? 37.765  25.890 126.972 1.00 262.23 ? 923  GLU F OE2   1 
ATOM   10010 N  N     . VAL D 2 407 ? 40.861  29.537 123.248 1.00 249.67 ? 924  VAL F N     1 
ATOM   10011 C  CA    . VAL D 2 407 ? 41.296  28.977 121.968 1.00 250.11 ? 924  VAL F CA    1 
ATOM   10012 C  C     . VAL D 2 407 ? 41.990  27.631 122.193 1.00 253.86 ? 924  VAL F C     1 
ATOM   10013 O  O     . VAL D 2 407 ? 43.022  27.552 122.862 1.00 254.89 ? 924  VAL F O     1 
ATOM   10014 C  CB    . VAL D 2 407 ? 42.191  29.972 121.177 1.00 247.33 ? 924  VAL F CB    1 
ATOM   10015 C  CG1   . VAL D 2 407 ? 43.510  30.258 121.887 1.00 247.42 ? 924  VAL F CG1   1 
ATOM   10016 C  CG2   . VAL D 2 407 ? 42.446  29.465 119.765 1.00 246.93 ? 924  VAL F CG2   1 
ATOM   10017 N  N     . ALA D 2 408 ? 41.395  26.571 121.648 1.00 256.60 ? 925  ALA F N     1 
ATOM   10018 C  CA    . ALA D 2 408 ? 41.929  25.219 121.793 1.00 260.00 ? 925  ALA F CA    1 
ATOM   10019 C  C     . ALA D 2 408 ? 43.152  25.037 120.900 1.00 260.31 ? 925  ALA F C     1 
ATOM   10020 O  O     . ALA D 2 408 ? 43.027  24.776 119.702 1.00 259.37 ? 925  ALA F O     1 
ATOM   10021 C  CB    . ALA D 2 408 ? 40.862  24.186 121.458 1.00 262.43 ? 925  ALA F CB    1 
ATOM   10022 N  N     . LEU D 2 409 ? 44.333  25.181 121.495 1.00 261.98 ? 926  LEU F N     1 
ATOM   10023 C  CA    . LEU D 2 409 ? 45.592  25.074 120.763 1.00 263.29 ? 926  LEU F CA    1 
ATOM   10024 C  C     . LEU D 2 409 ? 45.917  23.611 120.471 1.00 268.19 ? 926  LEU F C     1 
ATOM   10025 O  O     . LEU D 2 409 ? 46.167  23.243 119.322 1.00 268.88 ? 926  LEU F O     1 
ATOM   10026 C  CB    . LEU D 2 409 ? 46.731  25.722 121.556 1.00 263.03 ? 926  LEU F CB    1 
ATOM   10027 C  CG    . LEU D 2 409 ? 46.544  27.200 121.926 1.00 260.47 ? 926  LEU F CG    1 
ATOM   10028 C  CD1   . LEU D 2 409 ? 47.632  27.681 122.876 1.00 260.79 ? 926  LEU F CD1   1 
ATOM   10029 C  CD2   . LEU D 2 409 ? 46.499  28.076 120.682 1.00 257.57 ? 926  LEU F CD2   1 
ATOM   10030 N  N     . GLY D 2 410 ? 45.903  22.785 121.514 1.00 272.53 ? 927  GLY F N     1 
ATOM   10031 C  CA    . GLY D 2 410 ? 46.174  21.355 121.375 1.00 276.71 ? 927  GLY F CA    1 
ATOM   10032 C  C     . GLY D 2 410 ? 47.646  21.070 121.155 1.00 278.39 ? 927  GLY F C     1 
ATOM   10033 O  O     . GLY D 2 410 ? 48.508  21.753 121.708 1.00 277.06 ? 927  GLY F O     1 
ATOM   10034 N  N     . ASN D 2 411 ? 47.930  20.044 120.355 1.00 281.71 ? 928  ASN F N     1 
ATOM   10035 C  CA    . ASN D 2 411 ? 49.298  19.722 119.961 1.00 283.58 ? 928  ASN F CA    1 
ATOM   10036 C  C     . ASN D 2 411 ? 49.841  20.812 119.038 1.00 279.86 ? 928  ASN F C     1 
ATOM   10037 O  O     . ASN D 2 411 ? 49.385  20.960 117.903 1.00 278.21 ? 928  ASN F O     1 
ATOM   10038 C  CB    . ASN D 2 411 ? 49.347  18.354 119.270 1.00 287.70 ? 928  ASN F CB    1 
ATOM   10039 C  CG    . ASN D 2 411 ? 50.758  17.801 119.156 1.00 290.45 ? 928  ASN F CG    1 
ATOM   10040 O  OD1   . ASN D 2 411 ? 51.660  18.198 119.896 1.00 290.86 ? 928  ASN F OD1   1 
ATOM   10041 N  ND2   . ASN D 2 411 ? 50.952  16.868 118.230 1.00 292.78 ? 928  ASN F ND2   1 
ATOM   10042 N  N     . MET D 2 412 ? 50.816  21.569 119.535 1.00 278.73 ? 929  MET F N     1 
ATOM   10043 C  CA    . MET D 2 412 ? 51.258  22.802 118.883 1.00 275.28 ? 929  MET F CA    1 
ATOM   10044 C  C     . MET D 2 412 ? 52.426  22.571 117.930 1.00 276.55 ? 929  MET F C     1 
ATOM   10045 O  O     . MET D 2 412 ? 53.309  21.755 118.204 1.00 280.05 ? 929  MET F O     1 
ATOM   10046 C  CB    . MET D 2 412 ? 51.673  23.830 119.938 1.00 272.79 ? 929  MET F CB    1 
ATOM   10047 C  CG    . MET D 2 412 ? 50.663  24.012 121.060 1.00 272.03 ? 929  MET F CG    1 
ATOM   10048 S  SD    . MET D 2 412 ? 51.000  25.456 122.080 1.00 268.48 ? 929  MET F SD    1 
ATOM   10049 C  CE    . MET D 2 412 ? 50.488  26.760 120.969 1.00 264.47 ? 929  MET F CE    1 
ATOM   10050 N  N     . TYR D 2 413 ? 52.422  23.299 116.813 1.00 273.95 ? 930  TYR F N     1 
ATOM   10051 C  CA    . TYR D 2 413 ? 53.549  23.315 115.884 1.00 273.89 ? 930  TYR F CA    1 
ATOM   10052 C  C     . TYR D 2 413 ? 54.364  24.583 116.127 1.00 271.18 ? 930  TYR F C     1 
ATOM   10053 O  O     . TYR D 2 413 ? 53.945  25.681 115.766 1.00 268.71 ? 930  TYR F O     1 
ATOM   10054 C  CB    . TYR D 2 413 ? 53.060  23.251 114.432 1.00 272.74 ? 930  TYR F CB    1 
ATOM   10055 C  CG    . TYR D 2 413 ? 54.171  23.180 113.399 1.00 273.14 ? 930  TYR F CG    1 
ATOM   10056 C  CD1   . TYR D 2 413 ? 55.214  22.265 113.527 1.00 276.81 ? 930  TYR F CD1   1 
ATOM   10057 C  CD2   . TYR D 2 413 ? 54.169  24.017 112.285 1.00 270.39 ? 930  TYR F CD2   1 
ATOM   10058 C  CE1   . TYR D 2 413 ? 56.228  22.195 112.585 1.00 277.54 ? 930  TYR F CE1   1 
ATOM   10059 C  CE2   . TYR D 2 413 ? 55.177  23.952 111.336 1.00 271.08 ? 930  TYR F CE2   1 
ATOM   10060 C  CZ    . TYR D 2 413 ? 56.203  23.040 111.491 1.00 274.61 ? 930  TYR F CZ    1 
ATOM   10061 O  OH    . TYR D 2 413 ? 57.207  22.972 110.551 1.00 275.54 ? 930  TYR F OH    1 
ATOM   10062 N  N     . GLU D 2 414 ? 55.530  24.418 116.745 1.00 272.45 ? 931  GLU F N     1 
ATOM   10063 C  CA    . GLU D 2 414 ? 56.338  25.547 117.199 1.00 270.53 ? 931  GLU F CA    1 
ATOM   10064 C  C     . GLU D 2 414 ? 57.282  26.041 116.105 1.00 269.53 ? 931  GLU F C     1 
ATOM   10065 O  O     . GLU D 2 414 ? 58.033  25.256 115.525 1.00 271.41 ? 931  GLU F O     1 
ATOM   10066 C  CB    . GLU D 2 414 ? 57.128  25.145 118.445 1.00 273.23 ? 931  GLU F CB    1 
ATOM   10067 C  CG    . GLU D 2 414 ? 56.245  24.876 119.659 1.00 274.21 ? 931  GLU F CG    1 
ATOM   10068 C  CD    . GLU D 2 414 ? 56.744  23.729 120.519 1.00 278.98 ? 931  GLU F CD    1 
ATOM   10069 O  OE1   . GLU D 2 414 ? 57.966  23.646 120.763 1.00 281.22 ? 931  GLU F OE1   1 
ATOM   10070 O  OE2   . GLU D 2 414 ? 55.907  22.911 120.958 1.00 281.29 ? 931  GLU F OE2   1 
ATOM   10071 N  N     . LEU D 2 415 ? 57.232  27.345 115.831 1.00 266.52 ? 932  LEU F N     1 
ATOM   10072 C  CA    . LEU D 2 415 ? 58.073  27.972 114.811 1.00 265.40 ? 932  LEU F CA    1 
ATOM   10073 C  C     . LEU D 2 415 ? 58.837  29.161 115.388 1.00 264.10 ? 932  LEU F C     1 
ATOM   10074 O  O     . LEU D 2 415 ? 58.341  29.857 116.276 1.00 262.84 ? 932  LEU F O     1 
ATOM   10075 C  CB    . LEU D 2 415 ? 57.220  28.437 113.628 1.00 262.81 ? 932  LEU F CB    1 
ATOM   10076 C  CG    . LEU D 2 415 ? 56.537  27.342 112.805 1.00 264.40 ? 932  LEU F CG    1 
ATOM   10077 C  CD1   . LEU D 2 415 ? 55.639  27.960 111.744 1.00 261.45 ? 932  LEU F CD1   1 
ATOM   10078 C  CD2   . LEU D 2 415 ? 57.567  26.418 112.169 1.00 267.47 ? 932  LEU F CD2   1 
ATOM   10079 N  N     . LYS D 2 416 ? 60.043  29.383 114.870 1.00 264.78 ? 933  LYS F N     1 
ATOM   10080 C  CA    . LYS D 2 416 ? 60.902  30.479 115.314 1.00 264.15 ? 933  LYS F CA    1 
ATOM   10081 C  C     . LYS D 2 416 ? 60.839  31.640 114.326 1.00 261.10 ? 933  LYS F C     1 
ATOM   10082 O  O     . LYS D 2 416 ? 60.507  32.765 114.701 1.00 258.25 ? 933  LYS F O     1 
ATOM   10083 C  CB    . LYS D 2 416 ? 62.346  29.993 115.462 1.00 267.22 ? 933  LYS F CB    1 
ATOM   10084 C  CG    . LYS D 2 416 ? 62.514  28.842 116.442 1.00 270.60 ? 933  LYS F CG    1 
ATOM   10085 C  CD    . LYS D 2 416 ? 63.969  28.416 116.558 1.00 273.86 ? 933  LYS F CD    1 
ATOM   10086 C  CE    . LYS D 2 416 ? 64.123  27.221 117.484 1.00 277.74 ? 933  LYS F CE    1 
ATOM   10087 N  NZ    . LYS D 2 416 ? 65.532  26.747 117.557 1.00 281.45 ? 933  LYS F NZ    1 
ATOM   10088 N  N     . HIS D 2 417 ? 61.153  31.353 113.064 1.00 261.65 ? 934  HIS F N     1 
ATOM   10089 C  CA    . HIS D 2 417 ? 61.144  32.362 112.003 1.00 259.24 ? 934  HIS F CA    1 
ATOM   10090 C  C     . HIS D 2 417 ? 59.820  32.360 111.245 1.00 256.89 ? 934  HIS F C     1 
ATOM   10091 O  O     . HIS D 2 417 ? 59.056  31.396 111.315 1.00 257.92 ? 934  HIS F O     1 
ATOM   10092 C  CB    . HIS D 2 417 ? 62.298  32.119 111.028 1.00 261.04 ? 934  HIS F CB    1 
ATOM   10093 C  CG    . HIS D 2 417 ? 63.651  32.287 111.645 1.00 263.29 ? 934  HIS F CG    1 
ATOM   10094 N  ND1   . HIS D 2 417 ? 64.386  31.227 112.131 1.00 266.79 ? 934  HIS F ND1   1 
ATOM   10095 C  CD2   . HIS D 2 417 ? 64.402  33.394 111.858 1.00 262.59 ? 934  HIS F CD2   1 
ATOM   10096 C  CE1   . HIS D 2 417 ? 65.531  31.673 112.614 1.00 268.13 ? 934  HIS F CE1   1 
ATOM   10097 N  NE2   . HIS D 2 417 ? 65.566  32.984 112.461 1.00 265.66 ? 934  HIS F NE2   1 
ATOM   10098 N  N     . ALA D 2 418 ? 59.563  33.445 110.518 1.00 254.05 ? 935  ALA F N     1 
ATOM   10099 C  CA    . ALA D 2 418 ? 58.334  33.589 109.738 1.00 252.33 ? 935  ALA F CA    1 
ATOM   10100 C  C     . ALA D 2 418 ? 58.311  32.603 108.573 1.00 253.90 ? 935  ALA F C     1 
ATOM   10101 O  O     . ALA D 2 418 ? 59.305  32.450 107.861 1.00 254.86 ? 935  ALA F O     1 
ATOM   10102 C  CB    . ALA D 2 418 ? 58.197  35.015 109.224 1.00 249.57 ? 935  ALA F CB    1 
ATOM   10103 N  N     . SER D 2 419 ? 57.172  31.939 108.387 1.00 254.67 ? 936  SER F N     1 
ATOM   10104 C  CA    . SER D 2 419 ? 57.025  30.919 107.351 1.00 256.98 ? 936  SER F CA    1 
ATOM   10105 C  C     . SER D 2 419 ? 55.560  30.767 106.946 1.00 256.90 ? 936  SER F C     1 
ATOM   10106 O  O     . SER D 2 419 ? 54.736  30.316 107.742 1.00 257.69 ? 936  SER F O     1 
ATOM   10107 C  CB    . SER D 2 419 ? 57.568  29.578 107.853 1.00 260.00 ? 936  SER F CB    1 
ATOM   10108 O  OG    . SER D 2 419 ? 57.443  28.569 106.865 1.00 261.40 ? 936  SER F OG    1 
ATOM   10109 N  N     . HIS D 2 420 ? 55.246  31.141 105.706 1.00 256.30 ? 937  HIS F N     1 
ATOM   10110 C  CA    . HIS D 2 420 ? 53.874  31.073 105.201 1.00 255.48 ? 937  HIS F CA    1 
ATOM   10111 C  C     . HIS D 2 420 ? 53.485  29.621 104.929 1.00 257.59 ? 937  HIS F C     1 
ATOM   10112 O  O     . HIS D 2 420 ? 53.915  29.032 103.935 1.00 259.09 ? 937  HIS F O     1 
ATOM   10113 C  CB    . HIS D 2 420 ? 53.712  31.905 103.923 1.00 253.99 ? 937  HIS F CB    1 
ATOM   10114 C  CG    . HIS D 2 420 ? 54.169  33.324 104.059 1.00 251.87 ? 937  HIS F CG    1 
ATOM   10115 N  ND1   . HIS D 2 420 ? 53.787  34.134 105.106 1.00 250.51 ? 937  HIS F ND1   1 
ATOM   10116 C  CD2   . HIS D 2 420 ? 54.969  34.081 103.271 1.00 251.22 ? 937  HIS F CD2   1 
ATOM   10117 C  CE1   . HIS D 2 420 ? 54.338  35.326 104.961 1.00 249.06 ? 937  HIS F CE1   1 
ATOM   10118 N  NE2   . HIS D 2 420 ? 55.059  35.320 103.855 1.00 249.44 ? 937  HIS F NE2   1 
ATOM   10119 N  N     . ILE D 2 421 ? 52.676  29.052 105.820 1.00 257.56 ? 938  ILE F N     1 
ATOM   10120 C  CA    . ILE D 2 421 ? 52.264  27.651 105.712 1.00 260.15 ? 938  ILE F CA    1 
ATOM   10121 C  C     . ILE D 2 421 ? 50.899  27.521 105.036 1.00 259.98 ? 938  ILE F C     1 
ATOM   10122 O  O     . ILE D 2 421 ? 50.028  28.377 105.204 1.00 257.40 ? 938  ILE F O     1 
ATOM   10123 C  CB    . ILE D 2 421 ? 52.242  26.952 107.093 1.00 261.58 ? 938  ILE F CB    1 
ATOM   10124 C  CG1   . ILE D 2 421 ? 51.094  27.472 107.972 1.00 259.37 ? 938  ILE F CG1   1 
ATOM   10125 C  CG2   . ILE D 2 421 ? 53.583  27.126 107.794 1.00 262.09 ? 938  ILE F CG2   1 
ATOM   10126 C  CD1   . ILE D 2 421 ? 51.114  26.927 109.381 1.00 260.77 ? 938  ILE F CD1   1 
ATOM   10127 N  N     . SER D 2 422 ? 50.730  26.445 104.270 1.00 262.83 ? 939  SER F N     1 
ATOM   10128 C  CA    . SER D 2 422 ? 49.464  26.139 103.609 1.00 263.63 ? 939  SER F CA    1 
ATOM   10129 C  C     . SER D 2 422 ? 48.738  25.038 104.371 1.00 266.35 ? 939  SER F C     1 
ATOM   10130 O  O     . SER D 2 422 ? 47.584  25.204 104.771 1.00 265.84 ? 939  SER F O     1 
ATOM   10131 C  CB    . SER D 2 422 ? 49.710  25.695 102.166 1.00 265.04 ? 939  SER F CB    1 
ATOM   10132 O  OG    . SER D 2 422 ? 50.324  26.726 101.414 1.00 263.05 ? 939  SER F OG    1 
ATOM   10133 N  N     . LYS D 2 423 ? 49.430  23.917 104.567 1.00 269.57 ? 940  LYS F N     1 
ATOM   10134 C  CA    . LYS D 2 423 ? 48.893  22.772 105.294 1.00 272.74 ? 940  LYS F CA    1 
ATOM   10135 C  C     . LYS D 2 423 ? 49.718  22.526 106.553 1.00 273.27 ? 940  LYS F C     1 
ATOM   10136 O  O     . LYS D 2 423 ? 50.940  22.690 106.544 1.00 272.90 ? 940  LYS F O     1 
ATOM   10137 C  CB    . LYS D 2 423 ? 48.910  21.534 104.397 1.00 276.76 ? 940  LYS F CB    1 
ATOM   10138 C  CG    . LYS D 2 423 ? 48.188  20.323 104.973 1.00 280.27 ? 940  LYS F CG    1 
ATOM   10139 C  CD    . LYS D 2 423 ? 47.563  19.466 103.880 1.00 283.14 ? 940  LYS F CD    1 
ATOM   10140 C  CE    . LYS D 2 423 ? 48.605  18.808 102.986 1.00 285.75 ? 940  LYS F CE    1 
ATOM   10141 N  NZ    . LYS D 2 423 ? 49.169  17.567 103.584 1.00 289.71 ? 940  LYS F NZ    1 
ATOM   10142 N  N     . LEU D 2 424 ? 49.047  22.129 107.632 1.00 274.02 ? 941  LEU F N     1 
ATOM   10143 C  CA    . LEU D 2 424 ? 49.715  21.877 108.906 1.00 274.94 ? 941  LEU F CA    1 
ATOM   10144 C  C     . LEU D 2 424 ? 50.403  20.511 108.866 1.00 279.77 ? 941  LEU F C     1 
ATOM   10145 O  O     . LEU D 2 424 ? 49.979  19.631 108.115 1.00 282.26 ? 941  LEU F O     1 
ATOM   10146 C  CB    . LEU D 2 424 ? 48.717  21.906 110.070 1.00 274.00 ? 941  LEU F CB    1 
ATOM   10147 C  CG    . LEU D 2 424 ? 47.881  23.176 110.290 1.00 269.77 ? 941  LEU F CG    1 
ATOM   10148 C  CD1   . LEU D 2 424 ? 46.566  23.136 109.520 1.00 269.23 ? 941  LEU F CD1   1 
ATOM   10149 C  CD2   . LEU D 2 424 ? 47.610  23.375 111.775 1.00 269.47 ? 941  LEU F CD2   1 
ATOM   10150 N  N     . PRO D 2 425 ? 51.472  20.329 109.667 1.00 281.12 ? 942  PRO F N     1 
ATOM   10151 C  CA    . PRO D 2 425 ? 52.045  18.987 109.816 1.00 285.13 ? 942  PRO F CA    1 
ATOM   10152 C  C     . PRO D 2 425 ? 51.073  18.024 110.496 1.00 287.49 ? 942  PRO F C     1 
ATOM   10153 O  O     . PRO D 2 425 ? 50.121  18.462 111.148 1.00 285.59 ? 942  PRO F O     1 
ATOM   10154 C  CB    . PRO D 2 425 ? 53.277  19.219 110.698 1.00 285.48 ? 942  PRO F CB    1 
ATOM   10155 C  CG    . PRO D 2 425 ? 53.607  20.659 110.532 1.00 281.68 ? 942  PRO F CG    1 
ATOM   10156 C  CD    . PRO D 2 425 ? 52.295  21.353 110.334 1.00 278.90 ? 942  PRO F CD    1 
ATOM   10157 N  N     . LYS D 2 426 ? 51.319  16.726 110.344 1.00 291.44 ? 943  LYS F N     1 
ATOM   10158 C  CA    . LYS D 2 426 ? 50.418  15.702 110.868 1.00 294.10 ? 943  LYS F CA    1 
ATOM   10159 C  C     . LYS D 2 426 ? 50.295  15.766 112.388 1.00 293.40 ? 943  LYS F C     1 
ATOM   10160 O  O     . LYS D 2 426 ? 51.290  15.929 113.094 1.00 292.90 ? 943  LYS F O     1 
ATOM   10161 C  CB    . LYS D 2 426 ? 50.886  14.308 110.444 1.00 299.43 ? 943  LYS F CB    1 
ATOM   10162 C  CG    . LYS D 2 426 ? 50.048  13.176 111.023 1.00 303.62 ? 943  LYS F CG    1 
ATOM   10163 C  CD    . LYS D 2 426 ? 50.115  11.918 110.172 1.00 308.35 ? 943  LYS F CD    1 
ATOM   10164 C  CE    . LYS D 2 426 ? 49.278  12.035 108.905 1.00 307.80 ? 943  LYS F CE    1 
ATOM   10165 N  NZ    . LYS D 2 426 ? 47.834  12.245 109.196 1.00 306.85 ? 943  LYS F NZ    1 
ATOM   10166 N  N     . GLY D 2 427 ? 49.064  15.645 112.878 1.00 292.91 ? 944  GLY F N     1 
ATOM   10167 C  CA    . GLY D 2 427 ? 48.789  15.634 114.313 1.00 292.95 ? 944  GLY F CA    1 
ATOM   10168 C  C     . GLY D 2 427 ? 48.834  16.990 114.998 1.00 288.64 ? 944  GLY F C     1 
ATOM   10169 O  O     . GLY D 2 427 ? 48.670  17.068 116.216 1.00 288.71 ? 944  GLY F O     1 
ATOM   10170 N  N     . LYS D 2 428 ? 49.046  18.057 114.227 1.00 285.16 ? 945  LYS F N     1 
ATOM   10171 C  CA    . LYS D 2 428 ? 49.143  19.412 114.773 1.00 281.09 ? 945  LYS F CA    1 
ATOM   10172 C  C     . LYS D 2 428 ? 47.840  20.167 114.533 1.00 277.51 ? 945  LYS F C     1 
ATOM   10173 O  O     . LYS D 2 428 ? 47.362  20.240 113.401 1.00 276.19 ? 945  LYS F O     1 
ATOM   10174 C  CB    . LYS D 2 428 ? 50.308  20.169 114.127 1.00 279.41 ? 945  LYS F CB    1 
ATOM   10175 C  CG    . LYS D 2 428 ? 51.667  19.512 114.323 1.00 282.50 ? 945  LYS F CG    1 
ATOM   10176 C  CD    . LYS D 2 428 ? 52.206  19.725 115.731 1.00 283.16 ? 945  LYS F CD    1 
ATOM   10177 C  CE    . LYS D 2 428 ? 53.090  18.570 116.172 1.00 287.72 ? 945  LYS F CE    1 
ATOM   10178 N  NZ    . LYS D 2 428 ? 54.280  18.372 115.299 1.00 288.77 ? 945  LYS F NZ    1 
ATOM   10179 N  N     . HIS D 2 429 ? 47.276  20.726 115.603 1.00 275.77 ? 946  HIS F N     1 
ATOM   10180 C  CA    . HIS D 2 429 ? 46.000  21.442 115.535 1.00 273.49 ? 946  HIS F CA    1 
ATOM   10181 C  C     . HIS D 2 429 ? 46.176  22.963 115.600 1.00 268.88 ? 946  HIS F C     1 
ATOM   10182 O  O     . HIS D 2 429 ? 45.197  23.705 115.499 1.00 266.37 ? 946  HIS F O     1 
ATOM   10183 C  CB    . HIS D 2 429 ? 45.079  20.984 116.671 1.00 275.47 ? 946  HIS F CB    1 
ATOM   10184 C  CG    . HIS D 2 429 ? 45.047  19.499 116.864 1.00 280.01 ? 946  HIS F CG    1 
ATOM   10185 N  ND1   . HIS D 2 429 ? 45.973  18.832 117.637 1.00 282.73 ? 946  HIS F ND1   1 
ATOM   10186 C  CD2   . HIS D 2 429 ? 44.204  18.553 116.387 1.00 282.72 ? 946  HIS F CD2   1 
ATOM   10187 C  CE1   . HIS D 2 429 ? 45.703  17.539 117.627 1.00 286.68 ? 946  HIS F CE1   1 
ATOM   10188 N  NE2   . HIS D 2 429 ? 44.634  17.343 116.876 1.00 286.79 ? 946  HIS F NE2   1 
ATOM   10189 N  N     . SER D 2 430 ? 47.416  23.421 115.770 1.00 267.25 ? 947  SER F N     1 
ATOM   10190 C  CA    . SER D 2 430 ? 47.710  24.852 115.864 1.00 263.06 ? 947  SER F CA    1 
ATOM   10191 C  C     . SER D 2 430 ? 49.192  25.137 115.620 1.00 262.92 ? 947  SER F C     1 
ATOM   10192 O  O     . SER D 2 430 ? 50.002  24.214 115.517 1.00 265.57 ? 947  SER F O     1 
ATOM   10193 C  CB    . SER D 2 430 ? 47.305  25.387 117.241 1.00 262.04 ? 947  SER F CB    1 
ATOM   10194 O  OG    . SER D 2 430 ? 48.053  24.764 118.271 1.00 263.79 ? 947  SER F OG    1 
ATOM   10195 N  N     . VAL D 2 431 ? 49.529  26.422 115.527 1.00 260.38 ? 948  VAL F N     1 
ATOM   10196 C  CA    . VAL D 2 431 ? 50.913  26.867 115.351 1.00 260.07 ? 948  VAL F CA    1 
ATOM   10197 C  C     . VAL D 2 431 ? 51.261  27.893 116.426 1.00 258.71 ? 948  VAL F C     1 
ATOM   10198 O  O     . VAL D 2 431 ? 50.402  28.667 116.854 1.00 256.37 ? 948  VAL F O     1 
ATOM   10199 C  CB    . VAL D 2 431 ? 51.133  27.470 113.945 1.00 258.05 ? 948  VAL F CB    1 
ATOM   10200 C  CG1   . VAL D 2 431 ? 52.512  28.109 113.816 1.00 257.24 ? 948  VAL F CG1   1 
ATOM   10201 C  CG2   . VAL D 2 431 ? 50.961  26.396 112.883 1.00 260.08 ? 948  VAL F CG2   1 
ATOM   10202 N  N     . LYS D 2 432 ? 52.520  27.886 116.862 1.00 260.38 ? 949  LYS F N     1 
ATOM   10203 C  CA    . LYS D 2 432 ? 53.005  28.832 117.864 1.00 260.30 ? 949  LYS F CA    1 
ATOM   10204 C  C     . LYS D 2 432 ? 54.241  29.571 117.365 1.00 260.02 ? 949  LYS F C     1 
ATOM   10205 O  O     . LYS D 2 432 ? 55.207  28.948 116.922 1.00 261.33 ? 949  LYS F O     1 
ATOM   10206 C  CB    . LYS D 2 432 ? 53.345  28.107 119.167 1.00 263.58 ? 949  LYS F CB    1 
ATOM   10207 C  CG    . LYS D 2 432 ? 53.552  29.039 120.352 1.00 263.21 ? 949  LYS F CG    1 
ATOM   10208 C  CD    . LYS D 2 432 ? 53.913  28.272 121.613 1.00 266.95 ? 949  LYS F CD    1 
ATOM   10209 C  CE    . LYS D 2 432 ? 54.403  29.209 122.707 1.00 267.03 ? 949  LYS F CE    1 
ATOM   10210 N  NZ    . LYS D 2 432 ? 54.825  28.473 123.930 1.00 270.69 ? 949  LYS F NZ    1 
ATOM   10211 N  N     . GLY D 2 433 ? 54.201  30.899 117.442 1.00 258.51 ? 950  GLY F N     1 
ATOM   10212 C  CA    . GLY D 2 433 ? 55.369  31.730 117.173 1.00 258.41 ? 950  GLY F CA    1 
ATOM   10213 C  C     . GLY D 2 433 ? 56.131  31.946 118.465 1.00 260.66 ? 950  GLY F C     1 
ATOM   10214 O  O     . GLY D 2 433 ? 55.652  32.641 119.358 1.00 259.12 ? 950  GLY F O     1 
ATOM   10215 N  N     . LEU D 2 434 ? 57.314  31.344 118.571 1.00 264.68 ? 951  LEU F N     1 
ATOM   10216 C  CA    . LEU D 2 434 ? 58.114  31.422 119.793 1.00 268.05 ? 951  LEU F CA    1 
ATOM   10217 C  C     . LEU D 2 434 ? 58.809  32.777 119.902 1.00 267.50 ? 951  LEU F C     1 
ATOM   10218 O  O     . LEU D 2 434 ? 59.548  33.173 118.999 1.00 266.89 ? 951  LEU F O     1 
ATOM   10219 C  CB    . LEU D 2 434 ? 59.156  30.302 119.825 1.00 271.81 ? 951  LEU F CB    1 
ATOM   10220 C  CG    . LEU D 2 434 ? 58.626  28.868 119.753 1.00 274.25 ? 951  LEU F CG    1 
ATOM   10221 C  CD1   . LEU D 2 434 ? 59.785  27.890 119.633 1.00 277.94 ? 951  LEU F CD1   1 
ATOM   10222 C  CD2   . LEU D 2 434 ? 57.762  28.538 120.963 1.00 275.34 ? 951  LEU F CD2   1 
ATOM   10223 N  N     . GLY D 2 435 ? 58.570  33.476 121.011 1.00 268.39 ? 952  GLY F N     1 
ATOM   10224 C  CA    . GLY D 2 435 ? 59.143  34.802 121.243 1.00 268.30 ? 952  GLY F CA    1 
ATOM   10225 C  C     . GLY D 2 435 ? 60.247  34.801 122.286 1.00 272.08 ? 952  GLY F C     1 
ATOM   10226 O  O     . GLY D 2 435 ? 60.495  33.787 122.942 1.00 274.58 ? 952  GLY F O     1 
ATOM   10227 N  N     . LYS D 2 436 ? 60.911  35.946 122.430 1.00 273.07 ? 953  LYS F N     1 
ATOM   10228 C  CA    . LYS D 2 436 ? 61.954  36.131 123.439 1.00 276.71 ? 953  LYS F CA    1 
ATOM   10229 C  C     . LYS D 2 436 ? 61.345  36.130 124.837 1.00 278.47 ? 953  LYS F C     1 
ATOM   10230 O  O     . LYS D 2 436 ? 61.745  35.346 125.699 1.00 281.49 ? 953  LYS F O     1 
ATOM   10231 C  CB    . LYS D 2 436 ? 62.694  37.454 123.213 1.00 276.05 ? 953  LYS F CB    1 
ATOM   10232 C  CG    . LYS D 2 436 ? 63.475  37.540 121.910 1.00 275.49 ? 953  LYS F CG    1 
ATOM   10233 C  CD    . LYS D 2 436 ? 64.920  37.092 122.070 1.00 278.84 ? 953  LYS F CD    1 
ATOM   10234 C  CE    . LYS D 2 436 ? 65.720  37.363 120.805 1.00 278.21 ? 953  LYS F CE    1 
ATOM   10235 N  NZ    . LYS D 2 436 ? 67.190  37.256 121.022 1.00 281.40 ? 953  LYS F NZ    1 
ATOM   10236 N  N     . THR D 2 437 ? 60.378  37.021 125.049 1.00 277.06 ? 954  THR F N     1 
ATOM   10237 C  CA    . THR D 2 437 ? 59.694  37.148 126.332 1.00 278.42 ? 954  THR F CA    1 
ATOM   10238 C  C     . THR D 2 437 ? 58.456  36.255 126.366 1.00 278.36 ? 954  THR F C     1 
ATOM   10239 O  O     . THR D 2 437 ? 57.721  36.161 125.381 1.00 275.98 ? 954  THR F O     1 
ATOM   10240 C  CB    . THR D 2 437 ? 59.269  38.607 126.598 1.00 276.58 ? 954  THR F CB    1 
ATOM   10241 O  OG1   . THR D 2 437 ? 60.415  39.464 126.519 1.00 277.13 ? 954  THR F OG1   1 
ATOM   10242 C  CG2   . THR D 2 437 ? 58.624  38.749 127.975 1.00 277.81 ? 954  THR F CG2   1 
ATOM   10243 N  N     . THR D 2 438 ? 58.236  35.605 127.507 1.00 281.30 ? 955  THR F N     1 
ATOM   10244 C  CA    . THR D 2 438 ? 57.057  34.767 127.721 1.00 281.87 ? 955  THR F CA    1 
ATOM   10245 C  C     . THR D 2 438 ? 56.548  34.957 129.153 1.00 283.47 ? 955  THR F C     1 
ATOM   10246 O  O     . THR D 2 438 ? 57.352  35.130 130.073 1.00 285.72 ? 955  THR F O     1 
ATOM   10247 C  CB    . THR D 2 438 ? 57.368  33.273 127.459 1.00 284.46 ? 955  THR F CB    1 
ATOM   10248 O  OG1   . THR D 2 438 ? 56.186  32.485 127.652 1.00 284.71 ? 955  THR F OG1   1 
ATOM   10249 C  CG2   . THR D 2 438 ? 58.474  32.755 128.384 1.00 288.36 ? 955  THR F CG2   1 
ATOM   10250 N  N     . PRO D 2 439 ? 55.214  34.942 129.349 1.00 282.60 ? 956  PRO F N     1 
ATOM   10251 C  CA    . PRO D 2 439 ? 54.689  35.037 130.711 1.00 284.89 ? 956  PRO F CA    1 
ATOM   10252 C  C     . PRO D 2 439 ? 55.085  33.817 131.540 1.00 290.17 ? 956  PRO F C     1 
ATOM   10253 O  O     . PRO D 2 439 ? 55.048  32.694 131.035 1.00 292.23 ? 956  PRO F O     1 
ATOM   10254 C  CB    . PRO D 2 439 ? 53.170  35.096 130.506 1.00 282.35 ? 956  PRO F CB    1 
ATOM   10255 C  CG    . PRO D 2 439 ? 52.935  34.488 129.170 1.00 280.56 ? 956  PRO F CG    1 
ATOM   10256 C  CD    . PRO D 2 439 ? 54.134  34.852 128.350 1.00 279.78 ? 956  PRO F CD    1 
ATOM   10257 N  N     . ASP D 2 440 ? 55.464  34.051 132.795 1.00 293.49 ? 957  ASP F N     1 
ATOM   10258 C  CA    . ASP D 2 440 ? 56.024  33.011 133.662 1.00 297.64 ? 957  ASP F CA    1 
ATOM   10259 C  C     . ASP D 2 440 ? 55.172  31.734 133.666 1.00 299.57 ? 957  ASP F C     1 
ATOM   10260 O  O     . ASP D 2 440 ? 54.037  31.753 134.147 1.00 299.61 ? 957  ASP F O     1 
ATOM   10261 C  CB    . ASP D 2 440 ? 56.174  33.547 135.092 1.00 299.23 ? 957  ASP F CB    1 
ATOM   10262 C  CG    . ASP D 2 440 ? 56.889  32.574 136.017 1.00 303.03 ? 957  ASP F CG    1 
ATOM   10263 O  OD1   . ASP D 2 440 ? 57.782  31.836 135.550 1.00 304.18 ? 957  ASP F OD1   1 
ATOM   10264 O  OD2   . ASP D 2 440 ? 56.560  32.556 137.222 1.00 304.65 ? 957  ASP F OD2   1 
ATOM   10265 N  N     . PRO D 2 441 ? 55.714  30.622 133.124 1.00 301.84 ? 958  PRO F N     1 
ATOM   10266 C  CA    . PRO D 2 441 ? 54.960  29.362 133.084 1.00 303.49 ? 958  PRO F CA    1 
ATOM   10267 C  C     . PRO D 2 441 ? 54.761  28.704 134.455 1.00 307.26 ? 958  PRO F C     1 
ATOM   10268 O  O     . PRO D 2 441 ? 53.875  27.861 134.602 1.00 308.32 ? 958  PRO F O     1 
ATOM   10269 C  CB    . PRO D 2 441 ? 55.807  28.467 132.171 1.00 304.60 ? 958  PRO F CB    1 
ATOM   10270 C  CG    . PRO D 2 441 ? 57.184  29.019 132.257 1.00 305.44 ? 958  PRO F CG    1 
ATOM   10271 C  CD    . PRO D 2 441 ? 57.034  30.494 132.479 1.00 302.69 ? 958  PRO F CD    1 
ATOM   10272 N  N     . SER D 2 442 ? 55.572  29.089 135.440 1.00 309.54 ? 959  SER F N     1 
ATOM   10273 C  CA    . SER D 2 442 ? 55.415  28.603 136.814 1.00 312.93 ? 959  SER F CA    1 
ATOM   10274 C  C     . SER D 2 442 ? 54.402  29.429 137.621 1.00 311.19 ? 959  SER F C     1 
ATOM   10275 O  O     . SER D 2 442 ? 54.224  29.193 138.818 1.00 314.42 ? 959  SER F O     1 
ATOM   10276 C  CB    . SER D 2 442 ? 56.770  28.584 137.530 1.00 316.50 ? 959  SER F CB    1 
ATOM   10277 O  OG    . SER D 2 442 ? 57.308  29.889 137.651 1.00 315.49 ? 959  SER F OG    1 
ATOM   10278 N  N     . ALA D 2 443 ? 53.749  30.392 136.968 1.00 306.09 ? 960  ALA F N     1 
ATOM   10279 C  CA    . ALA D 2 443 ? 52.689  31.190 137.587 1.00 303.68 ? 960  ALA F CA    1 
ATOM   10280 C  C     . ALA D 2 443 ? 51.442  31.222 136.697 1.00 299.51 ? 960  ALA F C     1 
ATOM   10281 O  O     . ALA D 2 443 ? 50.757  32.244 136.611 1.00 296.84 ? 960  ALA F O     1 
ATOM   10282 C  CB    . ALA D 2 443 ? 53.190  32.602 137.858 1.00 302.26 ? 960  ALA F CB    1 
ATOM   10283 N  N     . ASN D 2 444 ? 51.153  30.096 136.045 1.00 298.62 ? 961  ASN F N     1 
ATOM   10284 C  CA    . ASN D 2 444 ? 50.007  29.984 135.139 1.00 295.24 ? 961  ASN F CA    1 
ATOM   10285 C  C     . ASN D 2 444 ? 48.741  29.585 135.899 1.00 295.52 ? 961  ASN F C     1 
ATOM   10286 O  O     . ASN D 2 444 ? 48.543  28.412 136.220 1.00 297.63 ? 961  ASN F O     1 
ATOM   10287 C  CB    . ASN D 2 444 ? 50.293  28.961 134.025 1.00 295.21 ? 961  ASN F CB    1 
ATOM   10288 C  CG    . ASN D 2 444 ? 51.086  29.542 132.857 1.00 292.98 ? 961  ASN F CG    1 
ATOM   10289 O  OD1   . ASN D 2 444 ? 51.111  28.953 131.776 1.00 292.11 ? 961  ASN F OD1   1 
ATOM   10290 N  ND2   . ASN D 2 444 ? 51.734  30.689 133.060 1.00 292.24 ? 961  ASN F ND2   1 
ATOM   10291 N  N     . ILE D 2 445 ? 47.892  30.571 136.180 1.00 293.31 ? 962  ILE F N     1 
ATOM   10292 C  CA    . ILE D 2 445 ? 46.637  30.352 136.907 1.00 294.07 ? 962  ILE F CA    1 
ATOM   10293 C  C     . ILE D 2 445 ? 45.588  29.730 135.978 1.00 293.00 ? 962  ILE F C     1 
ATOM   10294 O  O     . ILE D 2 445 ? 45.559  30.021 134.783 1.00 290.74 ? 962  ILE F O     1 
ATOM   10295 C  CB    . ILE D 2 445 ? 46.115  31.675 137.532 1.00 292.76 ? 962  ILE F CB    1 
ATOM   10296 C  CG1   . ILE D 2 445 ? 46.846  31.973 138.847 1.00 295.23 ? 962  ILE F CG1   1 
ATOM   10297 C  CG2   . ILE D 2 445 ? 44.617  31.627 137.811 1.00 292.74 ? 962  ILE F CG2   1 
ATOM   10298 C  CD1   . ILE D 2 445 ? 48.331  32.221 138.698 1.00 295.36 ? 962  ILE F CD1   1 
ATOM   10299 N  N     . SER D 2 446 ? 44.739  28.870 136.540 1.00 295.38 ? 963  SER F N     1 
ATOM   10300 C  CA    . SER D 2 446 ? 43.656  28.227 135.790 1.00 295.06 ? 963  SER F CA    1 
ATOM   10301 C  C     . SER D 2 446 ? 42.354  29.019 135.918 1.00 293.92 ? 963  SER F C     1 
ATOM   10302 O  O     . SER D 2 446 ? 42.204  29.842 136.823 1.00 293.99 ? 963  SER F O     1 
ATOM   10303 C  CB    . SER D 2 446 ? 43.444  26.795 136.288 1.00 298.73 ? 963  SER F CB    1 
ATOM   10304 O  OG    . SER D 2 446 ? 42.500  26.108 135.484 1.00 298.30 ? 963  SER F OG    1 
ATOM   10305 N  N     . LEU D 2 447 ? 41.417  28.760 135.008 1.00 293.07 ? 964  LEU F N     1 
ATOM   10306 C  CA    . LEU D 2 447 ? 40.136  29.472 134.978 1.00 292.01 ? 964  LEU F