data_4P22
# 
_entry.id   4P22 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4P22         
WWPDB D_1000200534 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4P22 
_pdbx_database_status.recvd_initial_deposition_date   2014-02-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Xie, S.-T.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.book_id_ISBN              . 
_citation.book_publisher            ? 
_citation.book_publisher_city       . 
_citation.book_title                . 
_citation.coordinate_linkage        . 
_citation.country                   JA 
_citation.database_id_Medline       . 
_citation.details                   . 
_citation.id                        primary 
_citation.journal_abbrev            Biosci.Biotechnol.Biochem. 
_citation.journal_id_ASTM           BBBIEJ 
_citation.journal_id_CSD            2094 
_citation.journal_id_ISSN           0916-8451 
_citation.journal_full              . 
_citation.journal_issue             . 
_citation.journal_volume            78 
_citation.language                  . 
_citation.page_first                1542 
_citation.page_last                 1549 
_citation.title                     
'Expression, purification, and crystal structure of N-terminal domains of human ubiquitin-activating enzyme (E1).' 
_citation.year                      2014 
_citation.database_id_CSD           . 
_citation.pdbx_database_id_DOI      10.1080/09168451.2014.923301 
_citation.pdbx_database_id_PubMed   25209502 
_citation.unpublished_flag          . 
# 
_citation_author.citation_id        primary 
_citation_author.name               'Xie, S.T.' 
_citation_author.ordinal            1 
_citation_author.identifier_ORCID   ? 
# 
_cell.entry_id           4P22 
_cell.length_a           94.126 
_cell.length_b           186.812 
_cell.length_c           135.222 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4P22 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Ubiquitin-like modifier-activating enzyme 1' 48457.922 2   ? G197D 'UNP residues 1-439' ? 
2 water   nat water                                         18.015    109 ? ?     ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein A1S9,Ubiquitin-activating enzyme E1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPHMADLMSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTS
SVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVE
DFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVT
CLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEP
DFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNDEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGD
LAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEVL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPHMADLMSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTS
SVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVE
DFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVT
CLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEP
DFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNDEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGD
LAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEVL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   ASP n 
1 7   LEU n 
1 8   MET n 
1 9   SER n 
1 10  SER n 
1 11  SER n 
1 12  PRO n 
1 13  LEU n 
1 14  SER n 
1 15  LYS n 
1 16  LYS n 
1 17  ARG n 
1 18  ARG n 
1 19  VAL n 
1 20  SER n 
1 21  GLY n 
1 22  PRO n 
1 23  ASP n 
1 24  PRO n 
1 25  LYS n 
1 26  PRO n 
1 27  GLY n 
1 28  SER n 
1 29  ASN n 
1 30  CYS n 
1 31  SER n 
1 32  PRO n 
1 33  ALA n 
1 34  GLN n 
1 35  SER n 
1 36  VAL n 
1 37  LEU n 
1 38  SER n 
1 39  GLU n 
1 40  VAL n 
1 41  PRO n 
1 42  SER n 
1 43  VAL n 
1 44  PRO n 
1 45  THR n 
1 46  ASN n 
1 47  GLY n 
1 48  MET n 
1 49  ALA n 
1 50  LYS n 
1 51  ASN n 
1 52  GLY n 
1 53  SER n 
1 54  GLU n 
1 55  ALA n 
1 56  ASP n 
1 57  ILE n 
1 58  ASP n 
1 59  GLU n 
1 60  GLY n 
1 61  LEU n 
1 62  TYR n 
1 63  SER n 
1 64  ARG n 
1 65  GLN n 
1 66  LEU n 
1 67  TYR n 
1 68  VAL n 
1 69  LEU n 
1 70  GLY n 
1 71  HIS n 
1 72  GLU n 
1 73  ALA n 
1 74  MET n 
1 75  LYS n 
1 76  ARG n 
1 77  LEU n 
1 78  GLN n 
1 79  THR n 
1 80  SER n 
1 81  SER n 
1 82  VAL n 
1 83  LEU n 
1 84  VAL n 
1 85  SER n 
1 86  GLY n 
1 87  LEU n 
1 88  ARG n 
1 89  GLY n 
1 90  LEU n 
1 91  GLY n 
1 92  VAL n 
1 93  GLU n 
1 94  ILE n 
1 95  ALA n 
1 96  LYS n 
1 97  ASN n 
1 98  ILE n 
1 99  ILE n 
1 100 LEU n 
1 101 GLY n 
1 102 GLY n 
1 103 VAL n 
1 104 LYS n 
1 105 ALA n 
1 106 VAL n 
1 107 THR n 
1 108 LEU n 
1 109 HIS n 
1 110 ASP n 
1 111 GLN n 
1 112 GLY n 
1 113 THR n 
1 114 ALA n 
1 115 GLN n 
1 116 TRP n 
1 117 ALA n 
1 118 ASP n 
1 119 LEU n 
1 120 SER n 
1 121 SER n 
1 122 GLN n 
1 123 PHE n 
1 124 TYR n 
1 125 LEU n 
1 126 ARG n 
1 127 GLU n 
1 128 GLU n 
1 129 ASP n 
1 130 ILE n 
1 131 GLY n 
1 132 LYS n 
1 133 ASN n 
1 134 ARG n 
1 135 ALA n 
1 136 GLU n 
1 137 VAL n 
1 138 SER n 
1 139 GLN n 
1 140 PRO n 
1 141 ARG n 
1 142 LEU n 
1 143 ALA n 
1 144 GLU n 
1 145 LEU n 
1 146 ASN n 
1 147 SER n 
1 148 TYR n 
1 149 VAL n 
1 150 PRO n 
1 151 VAL n 
1 152 THR n 
1 153 ALA n 
1 154 TYR n 
1 155 THR n 
1 156 GLY n 
1 157 PRO n 
1 158 LEU n 
1 159 VAL n 
1 160 GLU n 
1 161 ASP n 
1 162 PHE n 
1 163 LEU n 
1 164 SER n 
1 165 GLY n 
1 166 PHE n 
1 167 GLN n 
1 168 VAL n 
1 169 VAL n 
1 170 VAL n 
1 171 LEU n 
1 172 THR n 
1 173 ASN n 
1 174 THR n 
1 175 PRO n 
1 176 LEU n 
1 177 GLU n 
1 178 ASP n 
1 179 GLN n 
1 180 LEU n 
1 181 ARG n 
1 182 VAL n 
1 183 GLY n 
1 184 GLU n 
1 185 PHE n 
1 186 CYS n 
1 187 HIS n 
1 188 ASN n 
1 189 ARG n 
1 190 GLY n 
1 191 ILE n 
1 192 LYS n 
1 193 LEU n 
1 194 VAL n 
1 195 VAL n 
1 196 ALA n 
1 197 ASP n 
1 198 THR n 
1 199 ARG n 
1 200 GLY n 
1 201 LEU n 
1 202 PHE n 
1 203 GLY n 
1 204 GLN n 
1 205 LEU n 
1 206 PHE n 
1 207 CYS n 
1 208 ASP n 
1 209 PHE n 
1 210 GLY n 
1 211 GLU n 
1 212 GLU n 
1 213 MET n 
1 214 ILE n 
1 215 LEU n 
1 216 THR n 
1 217 ASP n 
1 218 SER n 
1 219 ASN n 
1 220 GLY n 
1 221 GLU n 
1 222 GLN n 
1 223 PRO n 
1 224 LEU n 
1 225 SER n 
1 226 ALA n 
1 227 MET n 
1 228 VAL n 
1 229 SER n 
1 230 MET n 
1 231 VAL n 
1 232 THR n 
1 233 LYS n 
1 234 ASP n 
1 235 ASN n 
1 236 PRO n 
1 237 GLY n 
1 238 VAL n 
1 239 VAL n 
1 240 THR n 
1 241 CYS n 
1 242 LEU n 
1 243 ASP n 
1 244 GLU n 
1 245 ALA n 
1 246 ARG n 
1 247 HIS n 
1 248 GLY n 
1 249 PHE n 
1 250 GLU n 
1 251 SER n 
1 252 GLY n 
1 253 ASP n 
1 254 PHE n 
1 255 VAL n 
1 256 SER n 
1 257 PHE n 
1 258 SER n 
1 259 GLU n 
1 260 VAL n 
1 261 GLN n 
1 262 GLY n 
1 263 MET n 
1 264 VAL n 
1 265 GLU n 
1 266 LEU n 
1 267 ASN n 
1 268 GLY n 
1 269 ASN n 
1 270 GLN n 
1 271 PRO n 
1 272 MET n 
1 273 GLU n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 LEU n 
1 278 GLY n 
1 279 PRO n 
1 280 TYR n 
1 281 THR n 
1 282 PHE n 
1 283 SER n 
1 284 ILE n 
1 285 CYS n 
1 286 ASP n 
1 287 THR n 
1 288 SER n 
1 289 ASN n 
1 290 PHE n 
1 291 SER n 
1 292 ASP n 
1 293 TYR n 
1 294 ILE n 
1 295 ARG n 
1 296 GLY n 
1 297 GLY n 
1 298 ILE n 
1 299 VAL n 
1 300 SER n 
1 301 GLN n 
1 302 VAL n 
1 303 LYS n 
1 304 VAL n 
1 305 PRO n 
1 306 LYS n 
1 307 LYS n 
1 308 ILE n 
1 309 SER n 
1 310 PHE n 
1 311 LYS n 
1 312 SER n 
1 313 LEU n 
1 314 VAL n 
1 315 ALA n 
1 316 SER n 
1 317 LEU n 
1 318 ALA n 
1 319 GLU n 
1 320 PRO n 
1 321 ASP n 
1 322 PHE n 
1 323 VAL n 
1 324 VAL n 
1 325 THR n 
1 326 ASP n 
1 327 PHE n 
1 328 ALA n 
1 329 LYS n 
1 330 PHE n 
1 331 SER n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 GLN n 
1 336 LEU n 
1 337 HIS n 
1 338 ILE n 
1 339 GLY n 
1 340 PHE n 
1 341 GLN n 
1 342 ALA n 
1 343 LEU n 
1 344 HIS n 
1 345 GLN n 
1 346 PHE n 
1 347 CYS n 
1 348 ALA n 
1 349 GLN n 
1 350 HIS n 
1 351 GLY n 
1 352 ARG n 
1 353 PRO n 
1 354 PRO n 
1 355 ARG n 
1 356 PRO n 
1 357 ARG n 
1 358 ASN n 
1 359 ASP n 
1 360 GLU n 
1 361 ASP n 
1 362 ALA n 
1 363 ALA n 
1 364 GLU n 
1 365 LEU n 
1 366 VAL n 
1 367 ALA n 
1 368 LEU n 
1 369 ALA n 
1 370 GLN n 
1 371 ALA n 
1 372 VAL n 
1 373 ASN n 
1 374 ALA n 
1 375 ARG n 
1 376 ALA n 
1 377 LEU n 
1 378 PRO n 
1 379 ALA n 
1 380 VAL n 
1 381 GLN n 
1 382 GLN n 
1 383 ASN n 
1 384 ASN n 
1 385 LEU n 
1 386 ASP n 
1 387 GLU n 
1 388 ASP n 
1 389 LEU n 
1 390 ILE n 
1 391 ARG n 
1 392 LYS n 
1 393 LEU n 
1 394 ALA n 
1 395 TYR n 
1 396 VAL n 
1 397 ALA n 
1 398 ALA n 
1 399 GLY n 
1 400 ASP n 
1 401 LEU n 
1 402 ALA n 
1 403 PRO n 
1 404 ILE n 
1 405 ASN n 
1 406 ALA n 
1 407 PHE n 
1 408 ILE n 
1 409 GLY n 
1 410 GLY n 
1 411 LEU n 
1 412 ALA n 
1 413 ALA n 
1 414 GLN n 
1 415 GLU n 
1 416 VAL n 
1 417 MET n 
1 418 LYS n 
1 419 ALA n 
1 420 CYS n 
1 421 SER n 
1 422 GLY n 
1 423 LYS n 
1 424 PHE n 
1 425 MET n 
1 426 PRO n 
1 427 ILE n 
1 428 MET n 
1 429 GLN n 
1 430 TRP n 
1 431 LEU n 
1 432 TYR n 
1 433 PHE n 
1 434 ASP n 
1 435 ALA n 
1 436 LEU n 
1 437 GLU n 
1 438 CYS n 
1 439 LEU n 
1 440 PRO n 
1 441 GLU n 
1 442 ASP n 
1 443 LYS n 
1 444 GLU n 
1 445 VAL n 
1 446 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   446 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'UBA1, A1S9T, UBE1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-Duet 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    UBA1_HUMAN 
_struct_ref.pdbx_db_accession          P22314 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGL
RGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQ
VVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
GFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDF
AKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAF
IGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEVL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4P22 A 8 ? 446 ? P22314 1 ? 439 ? 1 439 
2 1 4P22 B 8 ? 446 ? P22314 1 ? 439 ? 1 439 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4P22 GLY A 1   ? UNP P22314 ?   ?   'expression tag'      -6  1  
1 4P22 PRO A 2   ? UNP P22314 ?   ?   'expression tag'      -5  2  
1 4P22 HIS A 3   ? UNP P22314 ?   ?   'expression tag'      -4  3  
1 4P22 MET A 4   ? UNP P22314 ?   ?   'expression tag'      -3  4  
1 4P22 ALA A 5   ? UNP P22314 ?   ?   'expression tag'      -2  5  
1 4P22 ASP A 6   ? UNP P22314 ?   ?   'expression tag'      -1  6  
1 4P22 LEU A 7   ? UNP P22314 ?   ?   'expression tag'      0   7  
1 4P22 ASP A 359 ? UNP P22314 GLU 352 'engineered mutation' 352 8  
2 4P22 GLY B 1   ? UNP P22314 ?   ?   'expression tag'      -6  9  
2 4P22 PRO B 2   ? UNP P22314 ?   ?   'expression tag'      -5  10 
2 4P22 HIS B 3   ? UNP P22314 ?   ?   'expression tag'      -4  11 
2 4P22 MET B 4   ? UNP P22314 ?   ?   'expression tag'      -3  12 
2 4P22 ALA B 5   ? UNP P22314 ?   ?   'expression tag'      -2  13 
2 4P22 ASP B 6   ? UNP P22314 ?   ?   'expression tag'      -1  14 
2 4P22 LEU B 7   ? UNP P22314 ?   ?   'expression tag'      0   15 
2 4P22 ASP B 359 ? UNP P22314 GLU 352 'engineered mutation' 352 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4P22 
_exptl.crystals_number            1 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            3.07 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         59.89 
_exptl_crystal.description                 . 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              . 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    '0.1 M Na3Citrate pH 5.6, 3.0 M NH4Ac' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2009-12-25 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    . 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   . 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.975 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        0.975 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            38.110 
_reflns.entry_id                         4P22 
_reflns.data_reduction_details           . 
_reflns.data_reduction_method            . 
_reflns.d_resolution_high                2.748 
_reflns.d_resolution_low                 50.0 
_reflns.details                          . 
_reflns.limit_h_max                      . 
_reflns.limit_h_min                      . 
_reflns.limit_k_max                      . 
_reflns.limit_k_min                      . 
_reflns.limit_l_max                      . 
_reflns.limit_l_min                      . 
_reflns.number_all                       . 
_reflns.number_obs                       30860 
_reflns.observed_criterion               . 
_reflns.observed_criterion_F_max         . 
_reflns.observed_criterion_F_min         . 
_reflns.observed_criterion_I_max         . 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_sigma_F       . 
_reflns.observed_criterion_sigma_I       . 
_reflns.percent_possible_obs             98.4 
_reflns.R_free_details                   . 
_reflns.Rmerge_F_all                     . 
_reflns.Rmerge_F_obs                     . 
_reflns.Friedel_coverage                 . 
_reflns.number_gt                        . 
_reflns.threshold_expression             . 
_reflns.pdbx_redundancy                  7.7 
_reflns.pdbx_Rmerge_I_obs                . 
_reflns.pdbx_Rmerge_I_all                . 
_reflns.pdbx_Rsym_value                  . 
_reflns.pdbx_netI_over_av_sigmaI         . 
_reflns.pdbx_netI_over_sigmaI            11.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.pdbx_chi_squared                 . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_res_high_opt              . 
_reflns.pdbx_d_res_low_opt               . 
_reflns.pdbx_d_res_opt_method            . 
_reflns.phase_calculation_details        . 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_Rpim_I_all                  . 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_number_measured_all         . 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4P22 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30860 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.77 
_refine.ls_d_res_high                            2.75 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.050 
_refine.ls_number_reflns_R_free                  1559 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46.77 
_refine.aniso_B[1][1]                            -3.01600 
_refine.aniso_B[2][2]                            10.31260 
_refine.aniso_B[3][3]                            -7.93160 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.33 
_refine.solvent_model_param_bsol                 28.09 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.98 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.400 
_refine.pdbx_overall_phase_error                 26.830 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        29.77 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             109 
_refine_hist.number_atoms_total               5848 
_refine_hist.pdbx_B_iso_mean_solvent          33.77 
_refine_hist.pdbx_number_atoms_protein        ? 
_refine_hist.pdbx_number_atoms_nucleic_acid   ? 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 5847 'X-RAY DIFFRACTION' ? 
f_angle_d          1.370  ? ? 7915 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.743 ? ? 2139 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.090  ? ? 894  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1040 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.75   2.8365  2283 0.2631 85.00  0.2972 . . 99  . . . . 
'X-RAY DIFFRACTION' . 2.8365 2.9378  2568 0.2707 96.00  0.3803 . . 137 . . . . 
'X-RAY DIFFRACTION' . 2.9378 3.0553  2687 0.2649 100.00 0.3370 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.0553 3.1942  2674 0.2392 100.00 0.3270 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.1942 3.3624  2689 0.2221 100.00 0.2812 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.3624 3.5727  2679 0.2107 100.00 0.2761 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.5727 3.8481  2676 0.1965 100.00 0.2555 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.8481 4.2343  2720 0.1745 100.00 0.2416 . . 150 . . . . 
'X-RAY DIFFRACTION' . 4.2343 4.8448  2703 0.1635 100.00 0.2247 . . 159 . . . . 
'X-RAY DIFFRACTION' . 4.8448 6.0953  2769 0.2122 100.00 0.2822 . . 135 . . . . 
'X-RAY DIFFRACTION' . 6.0953 29.7669 2853 0.1839 100.00 0.2029 . . 143 . . . . 
# 
_struct.entry_id                     4P22 
_struct.title                        'Crystal Structure of N-terminal Fragments of E1' 
_struct.pdbx_descriptor              'Ubiquitin-like modifier-activating enzyme 1 (E.C.6.3.2.19)' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4P22 
_struct_keywords.text            'E1, ubiquitin, LIGASE' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 61  ? GLY A 70  ? LEU A 54  GLY A 63  1 ? 10 
HELX_P HELX_P2  AA2 ARG A 88  ? GLY A 101 ? ARG A 81  GLY A 94  1 ? 14 
HELX_P HELX_P3  AA3 GLN A 115 ? SER A 120 ? GLN A 108 SER A 113 1 ? 6  
HELX_P HELX_P4  AA4 ARG A 126 ? ILE A 130 ? ARG A 119 ILE A 123 5 ? 5  
HELX_P HELX_P5  AA5 ASN A 133 ? GLU A 144 ? ASN A 126 GLU A 137 1 ? 12 
HELX_P HELX_P6  AA6 VAL A 159 ? SER A 164 ? VAL A 152 SER A 157 1 ? 6  
HELX_P HELX_P7  AA7 PRO A 175 ? ARG A 189 ? PRO A 168 ARG A 182 1 ? 15 
HELX_P HELX_P8  AA8 MET A 263 ? ASN A 267 ? MET A 256 ASN A 260 5 ? 5  
HELX_P HELX_P9  AA9 SER A 312 ? GLU A 319 ? SER A 305 GLU A 312 1 ? 8  
HELX_P HELX_P10 AB1 ARG A 332 ? GLY A 351 ? ARG A 325 GLY A 344 1 ? 20 
HELX_P HELX_P11 AB2 ASN A 358 ? ALA A 376 ? ASN A 351 ALA A 369 1 ? 19 
HELX_P HELX_P12 AB3 ASP A 386 ? VAL A 396 ? ASP A 379 VAL A 389 1 ? 11 
HELX_P HELX_P13 AB4 LEU A 401 ? SER A 421 ? LEU A 394 SER A 414 1 ? 21 
HELX_P HELX_P14 AB5 LEU B 61  ? HIS B 71  ? LEU B 54  HIS B 64  1 ? 11 
HELX_P HELX_P15 AB6 ARG B 88  ? GLY B 102 ? ARG B 81  GLY B 95  1 ? 15 
HELX_P HELX_P16 AB7 GLN B 115 ? LEU B 119 ? GLN B 108 LEU B 112 5 ? 5  
HELX_P HELX_P17 AB8 ASN B 133 ? LEU B 145 ? ASN B 126 LEU B 138 1 ? 13 
HELX_P HELX_P18 AB9 VAL B 159 ? GLY B 165 ? VAL B 152 GLY B 158 1 ? 7  
HELX_P HELX_P19 AC1 PRO B 175 ? GLY B 190 ? PRO B 168 GLY B 183 1 ? 16 
HELX_P HELX_P20 AC2 ASP B 243 ? GLY B 248 ? ASP B 236 GLY B 241 5 ? 6  
HELX_P HELX_P21 AC3 VAL B 264 ? ASN B 269 ? VAL B 257 ASN B 262 1 ? 6  
HELX_P HELX_P22 AC4 SER B 312 ? GLU B 319 ? SER B 305 GLU B 312 1 ? 8  
HELX_P HELX_P23 AC5 SER B 331 ? GLY B 351 ? SER B 324 GLY B 344 1 ? 21 
HELX_P HELX_P24 AC6 ASN B 358 ? ALA B 376 ? ASN B 351 ALA B 369 1 ? 19 
HELX_P HELX_P25 AC7 ASP B 386 ? ALA B 397 ? ASP B 379 ALA B 390 1 ? 12 
HELX_P HELX_P26 AC8 LEU B 401 ? GLY B 422 ? LEU B 394 GLY B 415 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 235 A . ? ASN 228 A PRO 236 A ? PRO 229 A 1 10.77 
2 ASN 235 B . ? ASN 228 B PRO 236 B ? PRO 229 B 1 0.87  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 8 ? 
AA3 ? 7 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 151 ? TYR A 154 ? VAL A 144 TYR A 147 
AA1 2 ALA A 105 ? HIS A 109 ? ALA A 98  HIS A 102 
AA1 3 SER A 81  ? SER A 85  ? SER A 74  SER A 78  
AA1 4 VAL A 168 ? LEU A 171 ? VAL A 161 LEU A 164 
AA1 5 LYS A 192 ? ARG A 199 ? LYS A 185 ARG A 192 
AA1 6 PHE A 202 ? ASP A 208 ? PHE A 195 ASP A 201 
AA1 7 TRP A 430 ? ASP A 434 ? TRP A 423 ASP A 427 
AA2 1 MET A 213 ? ASP A 217 ? MET A 206 ASP A 210 
AA2 2 ILE A 298 ? ILE A 308 ? ILE A 291 ILE A 301 
AA2 3 SER A 251 ? SER A 258 ? SER A 244 SER A 251 
AA2 4 MET A 272 ? VAL A 276 ? MET A 265 VAL A 269 
AA2 5 PHE A 282 ? SER A 283 ? PHE A 275 SER A 276 
AA2 6 VAL A 238 ? CYS A 241 ? VAL A 231 CYS A 234 
AA2 7 ALA A 226 ? VAL A 231 ? ALA A 219 VAL A 224 
AA2 8 ILE A 298 ? ILE A 308 ? ILE A 291 ILE A 301 
AA3 1 VAL B 151 ? TYR B 154 ? VAL B 144 TYR B 147 
AA3 2 ALA B 105 ? HIS B 109 ? ALA B 98  HIS B 102 
AA3 3 SER B 81  ? SER B 85  ? SER B 74  SER B 78  
AA3 4 VAL B 168 ? LEU B 171 ? VAL B 161 LEU B 164 
AA3 5 LYS B 192 ? ARG B 199 ? LYS B 185 ARG B 192 
AA3 6 PHE B 202 ? ASP B 208 ? PHE B 195 ASP B 201 
AA3 7 GLN B 429 ? ASP B 434 ? GLN B 422 ASP B 427 
AA4 1 MET B 213 ? ASP B 217 ? MET B 206 ASP B 210 
AA4 2 ILE B 298 ? ILE B 308 ? ILE B 291 ILE B 301 
AA4 3 SER B 225 ? MET B 227 ? SER B 218 MET B 220 
AA5 1 MET B 213 ? ASP B 217 ? MET B 206 ASP B 210 
AA5 2 ILE B 298 ? ILE B 308 ? ILE B 291 ILE B 301 
AA5 3 PHE B 254 ? SER B 258 ? PHE B 247 SER B 251 
AA5 4 MET B 272 ? GLU B 273 ? MET B 265 GLU B 266 
AA6 1 MET B 230 ? VAL B 231 ? MET B 223 VAL B 224 
AA6 2 VAL B 238 ? THR B 240 ? VAL B 231 THR B 233 
AA6 3 THR B 281 ? SER B 283 ? THR B 274 SER B 276 
AA6 4 LYS B 275 ? VAL B 276 ? LYS B 268 VAL B 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O THR A 152 ? O THR A 145 N LEU A 108 ? N LEU A 101 
AA1 2 3 O THR A 107 ? O THR A 100 N VAL A 84  ? N VAL A 77  
AA1 3 4 N LEU A 83  ? N LEU A 76  O VAL A 170 ? O VAL A 163 
AA1 4 5 N LEU A 171 ? N LEU A 164 O VAL A 194 ? O VAL A 187 
AA1 5 6 N VAL A 195 ? N VAL A 188 O PHE A 206 ? O PHE A 199 
AA1 6 7 N LEU A 205 ? N LEU A 198 O LEU A 431 ? O LEU A 424 
AA2 1 2 N LEU A 215 ? N LEU A 208 O LYS A 306 ? O LYS A 299 
AA2 2 3 O ILE A 298 ? O ILE A 291 N SER A 258 ? N SER A 251 
AA2 3 4 N ASP A 253 ? N ASP A 246 O ILE A 274 ? O ILE A 267 
AA2 4 5 N LYS A 275 ? N LYS A 268 O SER A 283 ? O SER A 276 
AA2 5 6 O PHE A 282 ? O PHE A 275 N VAL A 239 ? N VAL A 232 
AA2 6 7 O THR A 240 ? O THR A 233 N MET A 230 ? N MET A 223 
AA2 7 8 N ALA A 226 ? N ALA A 219 O VAL A 299 ? O VAL A 292 
AA3 1 2 O THR B 152 ? O THR B 145 N LEU B 108 ? N LEU B 101 
AA3 2 3 O ALA B 105 ? O ALA B 98  N VAL B 82  ? N VAL B 75  
AA3 3 4 N LEU B 83  ? N LEU B 76  O VAL B 170 ? O VAL B 163 
AA3 4 5 N LEU B 171 ? N LEU B 164 O VAL B 194 ? O VAL B 187 
AA3 5 6 N ARG B 199 ? N ARG B 192 O PHE B 202 ? O PHE B 195 
AA3 6 7 N LEU B 205 ? N LEU B 198 O LEU B 431 ? O LEU B 424 
AA4 1 2 N MET B 213 ? N MET B 206 O ILE B 308 ? O ILE B 301 
AA4 2 3 O VAL B 299 ? O VAL B 292 N ALA B 226 ? N ALA B 219 
AA5 1 2 N MET B 213 ? N MET B 206 O ILE B 308 ? O ILE B 301 
AA5 2 3 O LYS B 303 ? O LYS B 296 N PHE B 254 ? N PHE B 247 
AA5 3 4 N VAL B 255 ? N VAL B 248 O MET B 272 ? O MET B 265 
AA6 1 2 N MET B 230 ? N MET B 223 O THR B 240 ? O THR B 233 
AA6 2 3 N VAL B 239 ? N VAL B 232 O PHE B 282 ? O PHE B 275 
AA6 3 4 O SER B 283 ? O SER B 276 N LYS B 275 ? N LYS B 268 
# 
_atom_sites.entry_id                    4P22 
_atom_sites.fract_transf_matrix[1][1]   0.010624 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005353 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007395 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 57  ? -28.736 17.134  35.593  1.00 95.09  ? 50  ILE A N   1 
ATOM   2    C CA  . ILE A 1 57  ? -29.532 16.174  36.347  1.00 103.47 ? 50  ILE A CA  1 
ATOM   3    C C   . ILE A 1 57  ? -29.611 14.829  35.635  1.00 109.17 ? 50  ILE A C   1 
ATOM   4    O O   . ILE A 1 57  ? -29.770 14.768  34.417  1.00 109.09 ? 50  ILE A O   1 
ATOM   5    C CB  . ILE A 1 57  ? -30.962 16.693  36.591  1.00 92.09  ? 50  ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 57  ? -30.933 17.954  37.454  1.00 101.50 ? 50  ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 57  ? -31.815 15.617  37.243  1.00 66.14  ? 50  ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 57  ? -32.305 18.486  37.799  1.00 99.98  ? 50  ILE A CD1 1 
ATOM   9    N N   . ASP A 1 58  ? -29.503 13.754  36.407  1.00 111.98 ? 51  ASP A N   1 
ATOM   10   C CA  . ASP A 1 58  ? -29.581 12.403  35.866  1.00 107.19 ? 51  ASP A CA  1 
ATOM   11   C C   . ASP A 1 58  ? -30.948 12.145  35.249  1.00 93.63  ? 51  ASP A C   1 
ATOM   12   O O   . ASP A 1 58  ? -31.058 11.494  34.212  1.00 81.19  ? 51  ASP A O   1 
ATOM   13   C CB  . ASP A 1 58  ? -29.284 11.369  36.952  1.00 114.66 ? 51  ASP A CB  1 
ATOM   14   C CG  . ASP A 1 58  ? -27.816 11.313  37.314  1.00 122.55 ? 51  ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 58  ? -27.478 10.688  38.340  1.00 119.76 ? 51  ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 58  ? -26.998 11.893  36.568  1.00 127.06 ? 51  ASP A OD2 1 
ATOM   17   N N   . GLU A 1 59  ? -31.988 12.656  35.898  1.00 97.43  ? 52  GLU A N   1 
ATOM   18   C CA  . GLU A 1 59  ? -33.351 12.476  35.420  1.00 100.96 ? 52  GLU A CA  1 
ATOM   19   C C   . GLU A 1 59  ? -33.515 13.117  34.047  1.00 94.39  ? 52  GLU A C   1 
ATOM   20   O O   . GLU A 1 59  ? -34.163 12.555  33.165  1.00 90.06  ? 52  GLU A O   1 
ATOM   21   C CB  . GLU A 1 59  ? -34.342 13.087  36.410  1.00 111.42 ? 52  GLU A CB  1 
ATOM   22   C CG  . GLU A 1 59  ? -34.078 12.709  37.858  1.00 124.70 ? 52  GLU A CG  1 
ATOM   23   C CD  . GLU A 1 59  ? -34.938 13.491  38.832  1.00 126.28 ? 52  GLU A CD  1 
ATOM   24   O OE1 . GLU A 1 59  ? -34.424 13.874  39.903  1.00 129.13 ? 52  GLU A OE1 1 
ATOM   25   O OE2 . GLU A 1 59  ? -36.128 13.719  38.529  1.00 123.74 ? 52  GLU A OE2 1 
ATOM   26   N N   . GLY A 1 60  ? -32.920 14.291  33.867  1.00 85.36  ? 53  GLY A N   1 
ATOM   27   C CA  . GLY A 1 60  ? -32.966 14.974  32.588  1.00 73.26  ? 53  GLY A CA  1 
ATOM   28   C C   . GLY A 1 60  ? -32.235 14.147  31.551  1.00 72.02  ? 53  GLY A C   1 
ATOM   29   O O   . GLY A 1 60  ? -31.032 13.919  31.666  1.00 68.21  ? 53  GLY A O   1 
ATOM   30   N N   . LEU A 1 61  ? -32.961 13.686  30.539  1.00 78.91  ? 54  LEU A N   1 
ATOM   31   C CA  . LEU A 1 61  ? -32.371 12.824  29.524  1.00 91.20  ? 54  LEU A CA  1 
ATOM   32   C C   . LEU A 1 61  ? -31.981 13.632  28.265  1.00 62.49  ? 54  LEU A C   1 
ATOM   33   O O   . LEU A 1 61  ? -32.284 14.823  28.169  1.00 46.99  ? 54  LEU A O   1 
ATOM   34   C CB  . LEU A 1 61  ? -33.330 11.671  29.211  1.00 126.49 ? 54  LEU A CB  1 
ATOM   35   C CG  . LEU A 1 61  ? -34.004 10.975  30.412  1.00 154.79 ? 54  LEU A CG  1 
ATOM   36   C CD1 . LEU A 1 61  ? -35.437 10.561  30.086  1.00 173.82 ? 54  LEU A CD1 1 
ATOM   37   C CD2 . LEU A 1 61  ? -33.209 9.770   30.943  1.00 94.19  ? 54  LEU A CD2 1 
ATOM   38   N N   . TYR A 1 62  ? -31.298 12.996  27.315  1.00 41.00  ? 55  TYR A N   1 
ATOM   39   C CA  . TYR A 1 62  ? -30.685 13.719  26.196  1.00 32.96  ? 55  TYR A CA  1 
ATOM   40   C C   . TYR A 1 62  ? -31.636 14.582  25.363  1.00 39.58  ? 55  TYR A C   1 
ATOM   41   O O   . TYR A 1 62  ? -31.352 15.750  25.112  1.00 31.47  ? 55  TYR A O   1 
ATOM   42   C CB  . TYR A 1 62  ? -29.949 12.749  25.280  1.00 49.01  ? 55  TYR A CB  1 
ATOM   43   C CG  . TYR A 1 62  ? -29.515 13.369  23.981  1.00 66.35  ? 55  TYR A CG  1 
ATOM   44   C CD1 . TYR A 1 62  ? -28.390 14.174  23.919  1.00 77.19  ? 55  TYR A CD1 1 
ATOM   45   C CD2 . TYR A 1 62  ? -30.238 13.154  22.812  1.00 94.07  ? 55  TYR A CD2 1 
ATOM   46   C CE1 . TYR A 1 62  ? -27.988 14.747  22.723  1.00 105.62 ? 55  TYR A CE1 1 
ATOM   47   C CE2 . TYR A 1 62  ? -29.849 13.728  21.607  1.00 117.74 ? 55  TYR A CE2 1 
ATOM   48   C CZ  . TYR A 1 62  ? -28.722 14.528  21.564  1.00 124.01 ? 55  TYR A CZ  1 
ATOM   49   O OH  . TYR A 1 62  ? -28.333 15.096  20.361  1.00 131.88 ? 55  TYR A OH  1 
ATOM   50   N N   . SER A 1 63  ? -32.745 13.993  24.915  1.00 53.30  ? 56  SER A N   1 
ATOM   51   C CA  . SER A 1 63  ? -33.742 14.700  24.114  1.00 51.14  ? 56  SER A CA  1 
ATOM   52   C C   . SER A 1 63  ? -34.373 15.799  24.979  1.00 51.82  ? 56  SER A C   1 
ATOM   53   O O   . SER A 1 63  ? -34.583 16.935  24.547  1.00 51.64  ? 56  SER A O   1 
ATOM   54   C CB  . SER A 1 63  ? -34.811 13.715  23.592  1.00 50.78  ? 56  SER A CB  1 
ATOM   55   O OG  . SER A 1 63  ? -34.259 12.727  22.718  1.00 45.50  ? 56  SER A OG  1 
ATOM   56   N N   . ARG A 1 64  ? -34.638 15.450  26.228  1.00 53.51  ? 57  ARG A N   1 
ATOM   57   C CA  . ARG A 1 64  ? -35.266 16.353  27.183  1.00 41.73  ? 57  ARG A CA  1 
ATOM   58   C C   . ARG A 1 64  ? -34.392 17.604  27.515  1.00 43.28  ? 57  ARG A C   1 
ATOM   59   O O   . ARG A 1 64  ? -34.917 18.708  27.668  1.00 36.31  ? 57  ARG A O   1 
ATOM   60   C CB  . ARG A 1 64  ? -35.641 15.534  28.422  1.00 24.65  ? 57  ARG A CB  1 
ATOM   61   C CG  . ARG A 1 64  ? -36.701 16.122  29.281  1.00 40.62  ? 57  ARG A CG  1 
ATOM   62   C CD  . ARG A 1 64  ? -38.098 15.839  28.769  1.00 55.26  ? 57  ARG A CD  1 
ATOM   63   N NE  . ARG A 1 64  ? -39.091 16.493  29.621  1.00 56.88  ? 57  ARG A NE  1 
ATOM   64   C CZ  . ARG A 1 64  ? -39.660 17.661  29.345  1.00 67.88  ? 57  ARG A CZ  1 
ATOM   65   N NH1 . ARG A 1 64  ? -39.355 18.306  28.227  1.00 65.87  ? 57  ARG A NH1 1 
ATOM   66   N NH2 . ARG A 1 64  ? -40.547 18.178  30.182  1.00 81.04  ? 57  ARG A NH2 1 
ATOM   67   N N   . GLN A 1 65  ? -33.069 17.430  27.597  1.00 37.87  ? 58  GLN A N   1 
ATOM   68   C CA  . GLN A 1 65  ? -32.138 18.550  27.789  1.00 31.31  ? 58  GLN A CA  1 
ATOM   69   C C   . GLN A 1 65  ? -32.009 19.393  26.525  1.00 30.12  ? 58  GLN A C   1 
ATOM   70   O O   . GLN A 1 65  ? -31.737 20.588  26.602  1.00 34.74  ? 58  GLN A O   1 
ATOM   71   C CB  . GLN A 1 65  ? -30.736 18.062  28.213  1.00 50.83  ? 58  GLN A CB  1 
ATOM   72   C CG  . GLN A 1 65  ? -30.672 17.193  29.497  1.00 72.43  ? 58  GLN A CG  1 
ATOM   73   C CD  . GLN A 1 65  ? -29.238 16.862  29.932  1.00 90.83  ? 58  GLN A CD  1 
ATOM   74   O OE1 . GLN A 1 65  ? -28.276 17.438  29.421  1.00 106.05 ? 58  GLN A OE1 1 
ATOM   75   N NE2 . GLN A 1 65  ? -29.094 15.933  30.881  1.00 91.46  ? 58  GLN A NE2 1 
ATOM   76   N N   . LEU A 1 66  ? -32.169 18.763  25.360  1.00 40.20  ? 59  LEU A N   1 
ATOM   77   C CA  . LEU A 1 66  ? -32.165 19.475  24.075  1.00 31.52  ? 59  LEU A CA  1 
ATOM   78   C C   . LEU A 1 66  ? -33.253 20.550  24.075  1.00 32.19  ? 59  LEU A C   1 
ATOM   79   O O   . LEU A 1 66  ? -33.043 21.661  23.603  1.00 23.57  ? 59  LEU A O   1 
ATOM   80   C CB  . LEU A 1 66  ? -32.400 18.511  22.913  1.00 36.64  ? 59  LEU A CB  1 
ATOM   81   C CG  . LEU A 1 66  ? -31.255 17.705  22.296  1.00 44.30  ? 59  LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 66  ? -31.784 16.589  21.379  1.00 23.07  ? 59  LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 66  ? -30.396 18.642  21.502  1.00 55.81  ? 59  LEU A CD2 1 
ATOM   84   N N   . TYR A 1 67  ? -34.412 20.213  24.631  1.00 35.00  ? 60  TYR A N   1 
ATOM   85   C CA  . TYR A 1 67  ? -35.506 21.171  24.809  1.00 40.22  ? 60  TYR A CA  1 
ATOM   86   C C   . TYR A 1 67  ? -35.289 22.286  25.785  1.00 39.25  ? 60  TYR A C   1 
ATOM   87   O O   . TYR A 1 67  ? -35.527 23.458  25.492  1.00 30.49  ? 60  TYR A O   1 
ATOM   88   C CB  . TYR A 1 67  ? -36.738 20.438  25.268  1.00 54.76  ? 60  TYR A CB  1 
ATOM   89   C CG  . TYR A 1 67  ? -37.295 19.838  24.090  1.00 77.91  ? 60  TYR A CG  1 
ATOM   90   C CD1 . TYR A 1 67  ? -37.581 20.642  23.009  1.00 103.06 ? 60  TYR A CD1 1 
ATOM   91   C CD2 . TYR A 1 67  ? -37.431 18.482  23.982  1.00 96.32  ? 60  TYR A CD2 1 
ATOM   92   C CE1 . TYR A 1 67  ? -38.047 20.129  21.876  1.00 126.23 ? 60  TYR A CE1 1 
ATOM   93   C CE2 . TYR A 1 67  ? -37.899 17.948  22.846  1.00 119.98 ? 60  TYR A CE2 1 
ATOM   94   C CZ  . TYR A 1 67  ? -38.207 18.782  21.789  1.00 133.73 ? 60  TYR A CZ  1 
ATOM   95   O OH  . TYR A 1 67  ? -38.687 18.307  20.616  1.00 140.01 ? 60  TYR A OH  1 
ATOM   96   N N   . VAL A 1 68  ? -34.910 21.880  26.982  1.00 40.88  ? 61  VAL A N   1 
ATOM   97   C CA  . VAL A 1 68  ? -34.733 22.796  28.071  1.00 49.88  ? 61  VAL A CA  1 
ATOM   98   C C   . VAL A 1 68  ? -33.727 23.887  27.623  1.00 34.23  ? 61  VAL A C   1 
ATOM   99   O O   . VAL A 1 68  ? -33.918 25.079  27.878  1.00 28.27  ? 61  VAL A O   1 
ATOM   100  C CB  . VAL A 1 68  ? -34.333 21.986  29.319  1.00 51.42  ? 61  VAL A CB  1 
ATOM   101  C CG1 . VAL A 1 68  ? -33.273 22.713  30.093  1.00 58.68  ? 61  VAL A CG1 1 
ATOM   102  C CG2 . VAL A 1 68  ? -35.623 21.545  30.154  1.00 22.03  ? 61  VAL A CG2 1 
ATOM   103  N N   . LEU A 1 69  ? -32.705 23.471  26.881  1.00 31.61  ? 62  LEU A N   1 
ATOM   104  C CA  . LEU A 1 69  ? -31.722 24.386  26.326  1.00 36.91  ? 62  LEU A CA  1 
ATOM   105  C C   . LEU A 1 69  ? -32.357 25.316  25.307  1.00 49.72  ? 62  LEU A C   1 
ATOM   106  O O   . LEU A 1 69  ? -32.104 26.520  25.316  1.00 63.40  ? 62  LEU A O   1 
ATOM   107  C CB  . LEU A 1 69  ? -30.617 23.594  25.637  1.00 44.68  ? 62  LEU A CB  1 
ATOM   108  C CG  . LEU A 1 69  ? -29.351 24.316  25.170  1.00 60.71  ? 62  LEU A CG  1 
ATOM   109  C CD1 . LEU A 1 69  ? -28.395 23.271  24.697  1.00 78.66  ? 62  LEU A CD1 1 
ATOM   110  C CD2 . LEU A 1 69  ? -29.574 25.306  24.040  1.00 59.77  ? 62  LEU A CD2 1 
ATOM   111  N N   . GLY A 1 70  ? -33.131 24.737  24.392  1.00 44.53  ? 63  GLY A N   1 
ATOM   112  C CA  . GLY A 1 70  ? -33.801 25.475  23.331  1.00 41.42  ? 63  GLY A CA  1 
ATOM   113  C C   . GLY A 1 70  ? -35.066 26.135  23.874  1.00 41.49  ? 63  GLY A C   1 
ATOM   114  O O   . GLY A 1 70  ? -36.000 26.318  23.091  1.00 38.46  ? 63  GLY A O   1 
ATOM   115  N N   . HIS A 1 71  ? -35.019 26.618  25.113  1.00 38.87  ? 64  HIS A N   1 
ATOM   116  C CA  . HIS A 1 71  ? -35.969 27.562  25.709  1.00 48.24  ? 64  HIS A CA  1 
ATOM   117  C C   . HIS A 1 71  ? -37.266 26.939  26.230  1.00 41.32  ? 64  HIS A C   1 
ATOM   118  O O   . HIS A 1 71  ? -38.128 27.640  26.756  1.00 35.75  ? 64  HIS A O   1 
ATOM   119  C CB  . HIS A 1 71  ? -36.279 28.704  24.733  1.00 81.41  ? 64  HIS A CB  1 
ATOM   120  C CG  . HIS A 1 71  ? -37.593 28.566  24.028  1.00 90.40  ? 64  HIS A CG  1 
ATOM   121  N ND1 . HIS A 1 71  ? -38.724 29.245  24.427  1.00 95.15  ? 64  HIS A ND1 1 
ATOM   122  C CD2 . HIS A 1 71  ? -37.955 27.834  22.949  1.00 77.84  ? 64  HIS A CD2 1 
ATOM   123  C CE1 . HIS A 1 71  ? -39.727 28.935  23.626  1.00 81.33  ? 64  HIS A CE1 1 
ATOM   124  N NE2 . HIS A 1 71  ? -39.288 28.081  22.720  1.00 72.00  ? 64  HIS A NE2 1 
ATOM   125  N N   . GLU A 1 72  ? -37.390 25.624  26.104  1.00 42.39  ? 65  GLU A N   1 
ATOM   126  C CA  . GLU A 1 72  ? -38.518 24.898  26.672  1.00 31.07  ? 65  GLU A CA  1 
ATOM   127  C C   . GLU A 1 72  ? -38.349 24.905  28.186  1.00 46.99  ? 65  GLU A C   1 
ATOM   128  O O   . GLU A 1 72  ? -37.228 25.020  28.676  1.00 71.65  ? 65  GLU A O   1 
ATOM   129  C CB  . GLU A 1 72  ? -38.535 23.462  26.151  1.00 17.19  ? 65  GLU A CB  1 
ATOM   130  C CG  . GLU A 1 72  ? -39.209 22.459  27.075  1.00 28.69  ? 65  GLU A CG  1 
ATOM   131  C CD  . GLU A 1 72  ? -40.714 22.419  26.911  1.00 34.43  ? 65  GLU A CD  1 
ATOM   132  O OE1 . GLU A 1 72  ? -41.370 21.664  27.656  1.00 29.85  ? 65  GLU A OE1 1 
ATOM   133  O OE2 . GLU A 1 72  ? -41.240 23.135  26.036  1.00 41.99  ? 65  GLU A OE2 1 
ATOM   134  N N   . ALA A 1 73  ? -39.440 24.784  28.937  1.00 30.00  ? 66  ALA A N   1 
ATOM   135  C CA  . ALA A 1 73  ? -39.309 24.781  30.389  1.00 30.00  ? 66  ALA A CA  1 
ATOM   136  C C   . ALA A 1 73  ? -38.545 26.019  30.838  1.00 30.00  ? 66  ALA A C   1 
ATOM   137  O O   . ALA A 1 73  ? -37.525 25.926  31.518  1.00 30.00  ? 66  ALA A O   1 
ATOM   138  C CB  . ALA A 1 73  ? -38.606 23.520  30.857  1.00 30.00  ? 66  ALA A CB  1 
ATOM   139  N N   . MET A 1 74  ? -39.052 27.180  30.443  1.00 30.00  ? 67  MET A N   1 
ATOM   140  C CA  . MET A 1 74  ? -38.375 28.456  30.637  1.00 30.00  ? 67  MET A CA  1 
ATOM   141  C C   . MET A 1 74  ? -38.066 28.763  32.100  1.00 30.00  ? 67  MET A C   1 
ATOM   142  O O   . MET A 1 74  ? -37.031 29.355  32.397  1.00 30.00  ? 67  MET A O   1 
ATOM   143  C CB  . MET A 1 74  ? -39.208 29.593  30.038  1.00 20.00  ? 67  MET A CB  1 
ATOM   144  C CG  . MET A 1 74  ? -40.460 29.942  30.835  1.00 20.00  ? 67  MET A CG  1 
ATOM   145  S SD  . MET A 1 74  ? -41.691 28.624  30.873  1.00 20.00  ? 67  MET A SD  1 
ATOM   146  C CE  . MET A 1 74  ? -42.909 29.333  31.975  1.00 20.00  ? 67  MET A CE  1 
ATOM   147  N N   . LYS A 1 75  ? -38.948 28.372  33.012  1.00 34.36  ? 68  LYS A N   1 
ATOM   148  C CA  . LYS A 1 75  ? -38.716 28.657  34.422  1.00 35.79  ? 68  LYS A CA  1 
ATOM   149  C C   . LYS A 1 75  ? -37.753 27.630  35.010  1.00 51.24  ? 68  LYS A C   1 
ATOM   150  O O   . LYS A 1 75  ? -38.128 26.770  35.805  1.00 46.70  ? 68  LYS A O   1 
ATOM   151  C CB  . LYS A 1 75  ? -40.035 28.652  35.193  1.00 52.85  ? 68  LYS A CB  1 
ATOM   152  C CG  . LYS A 1 75  ? -40.901 27.431  34.930  1.00 56.40  ? 68  LYS A CG  1 
ATOM   153  C CD  . LYS A 1 75  ? -40.345 26.193  35.609  1.00 55.89  ? 68  LYS A CD  1 
ATOM   154  C CE  . LYS A 1 75  ? -41.029 24.935  35.101  1.00 61.95  ? 68  LYS A CE  1 
ATOM   155  N NZ  . LYS A 1 75  ? -42.511 25.071  35.092  1.00 66.06  ? 68  LYS A NZ  1 
ATOM   156  N N   . ARG A 1 76  ? -36.496 27.756  34.594  1.00 66.34  ? 69  ARG A N   1 
ATOM   157  C CA  . ARG A 1 76  ? -35.391 26.916  35.037  1.00 69.47  ? 69  ARG A CA  1 
ATOM   158  C C   . ARG A 1 76  ? -34.220 27.853  35.291  1.00 62.25  ? 69  ARG A C   1 
ATOM   159  O O   . ARG A 1 76  ? -34.210 28.973  34.783  1.00 57.59  ? 69  ARG A O   1 
ATOM   160  C CB  . ARG A 1 76  ? -35.030 25.887  33.969  1.00 74.62  ? 69  ARG A CB  1 
ATOM   161  C CG  . ARG A 1 76  ? -36.078 24.809  33.767  1.00 66.57  ? 69  ARG A CG  1 
ATOM   162  C CD  . ARG A 1 76  ? -35.760 23.952  32.555  1.00 52.18  ? 69  ARG A CD  1 
ATOM   163  N NE  . ARG A 1 76  ? -34.411 23.399  32.608  1.00 44.31  ? 69  ARG A NE  1 
ATOM   164  C CZ  . ARG A 1 76  ? -34.104 22.229  33.157  1.00 46.51  ? 69  ARG A CZ  1 
ATOM   165  N NH1 . ARG A 1 76  ? -35.050 21.485  33.708  1.00 53.80  ? 69  ARG A NH1 1 
ATOM   166  N NH2 . ARG A 1 76  ? -32.849 21.804  33.158  1.00 41.05  ? 69  ARG A NH2 1 
ATOM   167  N N   . LEU A 1 77  ? -33.243 27.430  36.086  1.00 58.79  ? 70  LEU A N   1 
ATOM   168  C CA  . LEU A 1 77  ? -32.153 28.327  36.403  1.00 59.09  ? 70  LEU A CA  1 
ATOM   169  C C   . LEU A 1 77  ? -31.514 28.775  35.099  1.00 54.02  ? 70  LEU A C   1 
ATOM   170  O O   . LEU A 1 77  ? -31.048 27.951  34.306  1.00 43.76  ? 70  LEU A O   1 
ATOM   171  C CB  . LEU A 1 77  ? -31.122 27.657  37.313  1.00 61.45  ? 70  LEU A CB  1 
ATOM   172  C CG  . LEU A 1 77  ? -30.157 28.648  37.977  1.00 61.03  ? 70  LEU A CG  1 
ATOM   173  C CD1 . LEU A 1 77  ? -30.941 29.742  38.714  1.00 51.60  ? 70  LEU A CD1 1 
ATOM   174  C CD2 . LEU A 1 77  ? -29.181 27.946  38.913  1.00 60.53  ? 70  LEU A CD2 1 
ATOM   175  N N   . GLN A 1 78  ? -31.512 30.084  34.877  1.00 53.81  ? 71  GLN A N   1 
ATOM   176  C CA  . GLN A 1 78  ? -30.900 30.664  33.689  1.00 53.99  ? 71  GLN A CA  1 
ATOM   177  C C   . GLN A 1 78  ? -29.646 31.400  34.126  1.00 50.26  ? 71  GLN A C   1 
ATOM   178  O O   . GLN A 1 78  ? -29.712 32.264  34.987  1.00 58.06  ? 71  GLN A O   1 
ATOM   179  C CB  . GLN A 1 78  ? -31.891 31.619  33.020  1.00 58.32  ? 71  GLN A CB  1 
ATOM   180  C CG  . GLN A 1 78  ? -33.280 31.007  32.811  1.00 56.19  ? 71  GLN A CG  1 
ATOM   181  C CD  . GLN A 1 78  ? -33.232 29.792  31.908  1.00 56.96  ? 71  GLN A CD  1 
ATOM   182  O OE1 . GLN A 1 78  ? -32.415 29.736  30.996  1.00 50.90  ? 71  GLN A OE1 1 
ATOM   183  N NE2 . GLN A 1 78  ? -34.087 28.811  32.164  1.00 67.62  ? 71  GLN A NE2 1 
ATOM   184  N N   . THR A 1 79  ? -28.503 31.068  33.540  1.00 50.01  ? 72  THR A N   1 
ATOM   185  C CA  . THR A 1 79  ? -27.229 31.504  34.113  1.00 52.90  ? 72  THR A CA  1 
ATOM   186  C C   . THR A 1 79  ? -26.500 32.557  33.284  1.00 57.46  ? 72  THR A C   1 
ATOM   187  O O   . THR A 1 79  ? -25.671 33.313  33.799  1.00 62.12  ? 72  THR A O   1 
ATOM   188  C CB  . THR A 1 79  ? -26.319 30.284  34.361  1.00 58.78  ? 72  THR A CB  1 
ATOM   189  O OG1 . THR A 1 79  ? -26.963 29.405  35.294  1.00 56.43  ? 72  THR A OG1 1 
ATOM   190  C CG2 . THR A 1 79  ? -24.973 30.692  34.921  1.00 62.84  ? 72  THR A CG2 1 
ATOM   191  N N   . SER A 1 80  ? -26.830 32.632  32.003  1.00 56.12  ? 73  SER A N   1 
ATOM   192  C CA  . SER A 1 80  ? -26.077 33.485  31.100  1.00 38.42  ? 73  SER A CA  1 
ATOM   193  C C   . SER A 1 80  ? -26.804 34.759  30.698  1.00 43.02  ? 73  SER A C   1 
ATOM   194  O O   . SER A 1 80  ? -27.936 34.725  30.214  1.00 45.19  ? 73  SER A O   1 
ATOM   195  C CB  . SER A 1 80  ? -25.670 32.693  29.868  1.00 37.16  ? 73  SER A CB  1 
ATOM   196  O OG  . SER A 1 80  ? -24.810 31.630  30.231  1.00 42.63  ? 73  SER A OG  1 
ATOM   197  N N   . SER A 1 81  ? -26.134 35.884  30.916  1.00 44.94  ? 74  SER A N   1 
ATOM   198  C CA  . SER A 1 81  ? -26.622 37.182  30.480  1.00 35.46  ? 74  SER A CA  1 
ATOM   199  C C   . SER A 1 81  ? -26.068 37.507  29.102  1.00 38.94  ? 74  SER A C   1 
ATOM   200  O O   . SER A 1 81  ? -24.952 37.129  28.764  1.00 45.12  ? 74  SER A O   1 
ATOM   201  C CB  . SER A 1 81  ? -26.197 38.252  31.468  1.00 22.87  ? 74  SER A CB  1 
ATOM   202  O OG  . SER A 1 81  ? -26.823 38.017  32.706  1.00 46.20  ? 74  SER A OG  1 
ATOM   203  N N   . VAL A 1 82  ? -26.849 38.227  28.312  1.00 35.95  ? 75  VAL A N   1 
ATOM   204  C CA  . VAL A 1 82  ? -26.519 38.421  26.913  1.00 34.33  ? 75  VAL A CA  1 
ATOM   205  C C   . VAL A 1 82  ? -26.558 39.888  26.498  1.00 28.02  ? 75  VAL A C   1 
ATOM   206  O O   . VAL A 1 82  ? -27.508 40.609  26.795  1.00 32.17  ? 75  VAL A O   1 
ATOM   207  C CB  . VAL A 1 82  ? -27.487 37.640  25.997  1.00 28.79  ? 75  VAL A CB  1 
ATOM   208  C CG1 . VAL A 1 82  ? -27.047 37.780  24.560  1.00 17.42  ? 75  VAL A CG1 1 
ATOM   209  C CG2 . VAL A 1 82  ? -27.555 36.169  26.397  1.00 27.46  ? 75  VAL A CG2 1 
ATOM   210  N N   . LEU A 1 83  ? -25.519 40.322  25.801  1.00 21.55  ? 76  LEU A N   1 
ATOM   211  C CA  . LEU A 1 83  ? -25.508 41.640  25.196  1.00 31.00  ? 76  LEU A CA  1 
ATOM   212  C C   . LEU A 1 83  ? -25.896 41.459  23.730  1.00 41.83  ? 76  LEU A C   1 
ATOM   213  O O   . LEU A 1 83  ? -25.251 40.709  23.003  1.00 47.36  ? 76  LEU A O   1 
ATOM   214  C CB  . LEU A 1 83  ? -24.108 42.245  25.290  1.00 30.67  ? 76  LEU A CB  1 
ATOM   215  C CG  . LEU A 1 83  ? -23.947 43.752  25.482  1.00 24.78  ? 76  LEU A CG  1 
ATOM   216  C CD1 . LEU A 1 83  ? -22.673 44.216  24.811  1.00 23.81  ? 76  LEU A CD1 1 
ATOM   217  C CD2 . LEU A 1 83  ? -25.128 44.527  24.958  1.00 24.57  ? 76  LEU A CD2 1 
ATOM   218  N N   . VAL A 1 84  ? -26.961 42.117  23.296  1.00 41.60  ? 77  VAL A N   1 
ATOM   219  C CA  . VAL A 1 84  ? -27.311 42.110  21.881  1.00 31.06  ? 77  VAL A CA  1 
ATOM   220  C C   . VAL A 1 84  ? -27.016 43.481  21.346  1.00 23.16  ? 77  VAL A C   1 
ATOM   221  O O   . VAL A 1 84  ? -27.682 44.440  21.725  1.00 23.99  ? 77  VAL A O   1 
ATOM   222  C CB  . VAL A 1 84  ? -28.800 41.819  21.655  1.00 23.54  ? 77  VAL A CB  1 
ATOM   223  C CG1 . VAL A 1 84  ? -29.135 41.920  20.175  1.00 19.83  ? 77  VAL A CG1 1 
ATOM   224  C CG2 . VAL A 1 84  ? -29.147 40.436  22.196  1.00 25.47  ? 77  VAL A CG2 1 
ATOM   225  N N   . SER A 1 85  ? -26.008 43.591  20.486  1.00 20.46  ? 78  SER A N   1 
ATOM   226  C CA  . SER A 1 85  ? -25.609 44.911  19.974  1.00 28.19  ? 78  SER A CA  1 
ATOM   227  C C   . SER A 1 85  ? -26.088 45.185  18.551  1.00 24.41  ? 78  SER A C   1 
ATOM   228  O O   . SER A 1 85  ? -25.991 44.329  17.679  1.00 22.68  ? 78  SER A O   1 
ATOM   229  C CB  . SER A 1 85  ? -24.091 45.110  20.073  1.00 26.11  ? 78  SER A CB  1 
ATOM   230  O OG  . SER A 1 85  ? -23.738 46.434  19.684  1.00 31.49  ? 78  SER A OG  1 
ATOM   231  N N   . GLY A 1 86  ? -26.591 46.386  18.312  1.00 24.02  ? 79  GLY A N   1 
ATOM   232  C CA  . GLY A 1 86  ? -27.196 46.689  17.027  1.00 27.39  ? 79  GLY A CA  1 
ATOM   233  C C   . GLY A 1 86  ? -28.683 46.353  17.007  1.00 34.91  ? 79  GLY A C   1 
ATOM   234  O O   . GLY A 1 86  ? -29.089 45.188  16.961  1.00 33.75  ? 79  GLY A O   1 
ATOM   235  N N   . LEU A 1 87  ? -29.515 47.383  17.044  1.00 23.49  ? 80  LEU A N   1 
ATOM   236  C CA  . LEU A 1 87  ? -30.951 47.155  17.035  1.00 24.68  ? 80  LEU A CA  1 
ATOM   237  C C   . LEU A 1 87  ? -31.688 47.608  15.756  1.00 29.69  ? 80  LEU A C   1 
ATOM   238  O O   . LEU A 1 87  ? -32.718 48.289  15.809  1.00 31.68  ? 80  LEU A O   1 
ATOM   239  C CB  . LEU A 1 87  ? -31.591 47.714  18.312  1.00 23.29  ? 80  LEU A CB  1 
ATOM   240  C CG  . LEU A 1 87  ? -31.600 46.614  19.369  1.00 32.62  ? 80  LEU A CG  1 
ATOM   241  C CD1 . LEU A 1 87  ? -31.640 47.239  20.677  1.00 42.39  ? 80  LEU A CD1 1 
ATOM   242  C CD2 . LEU A 1 87  ? -32.803 45.671  19.223  1.00 32.45  ? 80  LEU A CD2 1 
ATOM   243  N N   . ARG A 1 88  ? -31.147 47.213  14.607  1.00 25.15  ? 81  ARG A N   1 
ATOM   244  C CA  . ARG A 1 88  ? -31.886 47.268  13.357  1.00 22.55  ? 81  ARG A CA  1 
ATOM   245  C C   . ARG A 1 88  ? -32.705 45.981  13.283  1.00 24.52  ? 81  ARG A C   1 
ATOM   246  O O   . ARG A 1 88  ? -32.881 45.308  14.290  1.00 27.24  ? 81  ARG A O   1 
ATOM   247  C CB  . ARG A 1 88  ? -30.938 47.421  12.168  1.00 23.34  ? 81  ARG A CB  1 
ATOM   248  C CG  . ARG A 1 88  ? -29.988 48.622  12.310  1.00 21.64  ? 81  ARG A CG  1 
ATOM   249  C CD  . ARG A 1 88  ? -29.688 49.267  10.970  1.00 12.36  ? 81  ARG A CD  1 
ATOM   250  N NE  . ARG A 1 88  ? -29.359 48.265  9.958   1.00 46.89  ? 81  ARG A NE  1 
ATOM   251  C CZ  . ARG A 1 88  ? -29.914 48.206  8.745   1.00 57.15  ? 81  ARG A CZ  1 
ATOM   252  N NH1 . ARG A 1 88  ? -30.832 49.099  8.378   1.00 33.20  ? 81  ARG A NH1 1 
ATOM   253  N NH2 . ARG A 1 88  ? -29.545 47.253  7.892   1.00 63.09  ? 81  ARG A NH2 1 
ATOM   254  N N   . GLY A 1 89  ? -33.235 45.651  12.117  1.00 21.28  ? 82  GLY A N   1 
ATOM   255  C CA  . GLY A 1 89  ? -34.011 44.437  11.982  1.00 15.77  ? 82  GLY A CA  1 
ATOM   256  C C   . GLY A 1 89  ? -33.354 43.205  12.588  1.00 16.55  ? 82  GLY A C   1 
ATOM   257  O O   . GLY A 1 89  ? -33.940 42.527  13.421  1.00 23.82  ? 82  GLY A O   1 
ATOM   258  N N   . LEU A 1 90  ? -32.129 42.917  12.177  1.00 24.58  ? 83  LEU A N   1 
ATOM   259  C CA  . LEU A 1 90  ? -31.468 41.674  12.567  1.00 19.94  ? 83  LEU A CA  1 
ATOM   260  C C   . LEU A 1 90  ? -31.399 41.495  14.080  1.00 21.82  ? 83  LEU A C   1 
ATOM   261  O O   . LEU A 1 90  ? -31.715 40.433  14.581  1.00 23.94  ? 83  LEU A O   1 
ATOM   262  C CB  . LEU A 1 90  ? -30.056 41.573  11.935  1.00 15.30  ? 83  LEU A CB  1 
ATOM   263  C CG  . LEU A 1 90  ? -29.416 40.179  12.020  1.00 17.72  ? 83  LEU A CG  1 
ATOM   264  C CD1 . LEU A 1 90  ? -30.448 39.077  11.784  1.00 18.86  ? 83  LEU A CD1 1 
ATOM   265  C CD2 . LEU A 1 90  ? -28.276 40.023  11.042  1.00 10.82  ? 83  LEU A CD2 1 
ATOM   266  N N   . GLY A 1 91  ? -30.984 42.535  14.798  1.00 21.32  ? 84  GLY A N   1 
ATOM   267  C CA  . GLY A 1 91  ? -30.791 42.438  16.229  1.00 22.72  ? 84  GLY A CA  1 
ATOM   268  C C   . GLY A 1 91  ? -32.081 42.364  17.036  1.00 28.93  ? 84  GLY A C   1 
ATOM   269  O O   . GLY A 1 91  ? -32.124 41.708  18.080  1.00 34.03  ? 84  GLY A O   1 
ATOM   270  N N   . VAL A 1 92  ? -33.129 43.042  16.570  1.00 16.34  ? 85  VAL A N   1 
ATOM   271  C CA  . VAL A 1 92  ? -34.430 42.982  17.241  1.00 20.48  ? 85  VAL A CA  1 
ATOM   272  C C   . VAL A 1 92  ? -35.102 41.632  17.030  1.00 31.18  ? 85  VAL A C   1 
ATOM   273  O O   . VAL A 1 92  ? -35.829 41.160  17.896  1.00 34.97  ? 85  VAL A O   1 
ATOM   274  C CB  . VAL A 1 92  ? -35.380 44.159  16.879  1.00 21.62  ? 85  VAL A CB  1 
ATOM   275  C CG1 . VAL A 1 92  ? -35.884 44.075  15.433  1.00 12.89  ? 85  VAL A CG1 1 
ATOM   276  C CG2 . VAL A 1 92  ? -36.545 44.196  17.843  1.00 17.57  ? 85  VAL A CG2 1 
ATOM   277  N N   . GLU A 1 93  ? -34.828 40.997  15.894  1.00 39.60  ? 86  GLU A N   1 
ATOM   278  C CA  . GLU A 1 93  ? -35.270 39.626  15.678  1.00 33.91  ? 86  GLU A CA  1 
ATOM   279  C C   . GLU A 1 93  ? -34.541 38.730  16.669  1.00 30.63  ? 86  GLU A C   1 
ATOM   280  O O   . GLU A 1 93  ? -35.158 37.864  17.289  1.00 26.54  ? 86  GLU A O   1 
ATOM   281  C CB  . GLU A 1 93  ? -34.999 39.158  14.236  1.00 27.92  ? 86  GLU A CB  1 
ATOM   282  C CG  . GLU A 1 93  ? -35.863 39.829  13.156  1.00 39.31  ? 86  GLU A CG  1 
ATOM   283  C CD  . GLU A 1 93  ? -37.353 39.441  13.214  1.00 42.17  ? 86  GLU A CD  1 
ATOM   284  O OE1 . GLU A 1 93  ? -37.696 38.410  13.840  1.00 29.14  ? 86  GLU A OE1 1 
ATOM   285  O OE2 . GLU A 1 93  ? -38.183 40.181  12.628  1.00 39.58  ? 86  GLU A OE2 1 
ATOM   286  N N   . ILE A 1 94  ? -33.234 38.953  16.832  1.00 17.07  ? 87  ILE A N   1 
ATOM   287  C CA  . ILE A 1 94  ? -32.433 38.079  17.679  1.00 20.27  ? 87  ILE A CA  1 
ATOM   288  C C   . ILE A 1 94  ? -32.840 38.282  19.136  1.00 28.53  ? 87  ILE A C   1 
ATOM   289  O O   . ILE A 1 94  ? -33.051 37.323  19.880  1.00 26.73  ? 87  ILE A O   1 
ATOM   290  C CB  . ILE A 1 94  ? -30.920 38.313  17.515  1.00 17.48  ? 87  ILE A CB  1 
ATOM   291  C CG1 . ILE A 1 94  ? -30.465 37.962  16.095  1.00 20.26  ? 87  ILE A CG1 1 
ATOM   292  C CG2 . ILE A 1 94  ? -30.149 37.467  18.510  1.00 18.60  ? 87  ILE A CG2 1 
ATOM   293  C CD1 . ILE A 1 94  ? -29.050 38.446  15.741  1.00 18.42  ? 87  ILE A CD1 1 
ATOM   294  N N   . ALA A 1 95  ? -32.977 39.539  19.531  1.00 28.04  ? 88  ALA A N   1 
ATOM   295  C CA  . ALA A 1 95  ? -33.346 39.849  20.897  1.00 19.04  ? 88  ALA A CA  1 
ATOM   296  C C   . ALA A 1 95  ? -34.748 39.320  21.212  1.00 27.96  ? 88  ALA A C   1 
ATOM   297  O O   . ALA A 1 95  ? -34.964 38.732  22.262  1.00 31.15  ? 88  ALA A O   1 
ATOM   298  C CB  . ALA A 1 95  ? -33.253 41.328  21.135  1.00 12.42  ? 88  ALA A CB  1 
ATOM   299  N N   . LYS A 1 96  ? -35.696 39.504  20.301  1.00 23.47  ? 89  LYS A N   1 
ATOM   300  C CA  . LYS A 1 96  ? -37.040 38.973  20.523  1.00 20.60  ? 89  LYS A CA  1 
ATOM   301  C C   . LYS A 1 96  ? -37.026 37.460  20.772  1.00 22.56  ? 89  LYS A C   1 
ATOM   302  O O   . LYS A 1 96  ? -37.626 36.990  21.742  1.00 23.64  ? 89  LYS A O   1 
ATOM   303  C CB  . LYS A 1 96  ? -37.986 39.305  19.354  1.00 19.77  ? 89  LYS A CB  1 
ATOM   304  C CG  . LYS A 1 96  ? -39.188 38.366  19.272  1.00 17.15  ? 89  LYS A CG  1 
ATOM   305  C CD  . LYS A 1 96  ? -39.761 38.278  17.882  1.00 29.08  ? 89  LYS A CD  1 
ATOM   306  C CE  . LYS A 1 96  ? -38.817 37.579  16.945  1.00 36.49  ? 89  LYS A CE  1 
ATOM   307  N NZ  . LYS A 1 96  ? -39.521 36.930  15.808  1.00 39.32  ? 89  LYS A NZ  1 
ATOM   308  N N   . ASN A 1 97  ? -36.337 36.713  19.906  1.00 21.73  ? 90  ASN A N   1 
ATOM   309  C CA  . ASN A 1 97  ? -36.242 35.252  20.021  1.00 24.87  ? 90  ASN A CA  1 
ATOM   310  C C   . ASN A 1 97  ? -35.598 34.788  21.314  1.00 25.03  ? 90  ASN A C   1 
ATOM   311  O O   . ASN A 1 97  ? -35.931 33.735  21.865  1.00 31.96  ? 90  ASN A O   1 
ATOM   312  C CB  . ASN A 1 97  ? -35.404 34.672  18.882  1.00 27.53  ? 90  ASN A CB  1 
ATOM   313  C CG  . ASN A 1 97  ? -35.972 34.973  17.531  1.00 29.94  ? 90  ASN A CG  1 
ATOM   314  O OD1 . ASN A 1 97  ? -37.180 35.076  17.375  1.00 34.39  ? 90  ASN A OD1 1 
ATOM   315  N ND2 . ASN A 1 97  ? -35.102 35.115  16.534  1.00 33.51  ? 90  ASN A ND2 1 
ATOM   316  N N   . ILE A 1 98  ? -34.651 35.592  21.767  1.00 20.73  ? 91  ILE A N   1 
ATOM   317  C CA  . ILE A 1 98  ? -33.781 35.277  22.877  1.00 23.32  ? 91  ILE A CA  1 
ATOM   318  C C   . ILE A 1 98  ? -34.521 35.541  24.202  1.00 24.82  ? 91  ILE A C   1 
ATOM   319  O O   . ILE A 1 98  ? -34.307 34.862  25.200  1.00 25.38  ? 91  ILE A O   1 
ATOM   320  C CB  . ILE A 1 98  ? -32.540 36.159  22.731  1.00 25.39  ? 91  ILE A CB  1 
ATOM   321  C CG1 . ILE A 1 98  ? -31.269 35.406  22.901  1.00 28.29  ? 91  ILE A CG1 1 
ATOM   322  C CG2 . ILE A 1 98  ? -32.519 37.301  23.719  1.00 40.02  ? 91  ILE A CG2 1 
ATOM   323  C CD1 . ILE A 1 98  ? -30.166 36.436  23.166  1.00 43.32  ? 91  ILE A CD1 1 
ATOM   324  N N   . ILE A 1 99  ? -35.408 36.529  24.194  1.00 22.77  ? 92  ILE A N   1 
ATOM   325  C CA  . ILE A 1 99  ? -36.191 36.873  25.366  1.00 21.60  ? 92  ILE A CA  1 
ATOM   326  C C   . ILE A 1 99  ? -37.344 35.891  25.519  1.00 17.13  ? 92  ILE A C   1 
ATOM   327  O O   . ILE A 1 99  ? -37.687 35.501  26.628  1.00 22.56  ? 92  ILE A O   1 
ATOM   328  C CB  . ILE A 1 99  ? -36.728 38.316  25.262  1.00 19.87  ? 92  ILE A CB  1 
ATOM   329  C CG1 . ILE A 1 99  ? -35.573 39.319  25.385  1.00 13.00  ? 92  ILE A CG1 1 
ATOM   330  C CG2 . ILE A 1 99  ? -37.773 38.586  26.328  1.00 21.67  ? 92  ILE A CG2 1 
ATOM   331  C CD1 . ILE A 1 99  ? -35.926 40.701  24.883  1.00 8.25   ? 92  ILE A CD1 1 
ATOM   332  N N   . LEU A 1 100 ? -37.937 35.485  24.401  1.00 22.83  ? 93  LEU A N   1 
ATOM   333  C CA  . LEU A 1 100 ? -38.992 34.473  24.411  1.00 23.61  ? 93  LEU A CA  1 
ATOM   334  C C   . LEU A 1 100 ? -38.400 33.153  24.832  1.00 21.64  ? 93  LEU A C   1 
ATOM   335  O O   . LEU A 1 100 ? -39.064 32.294  25.418  1.00 32.69  ? 93  LEU A O   1 
ATOM   336  C CB  . LEU A 1 100 ? -39.596 34.329  23.030  1.00 16.94  ? 93  LEU A CB  1 
ATOM   337  C CG  . LEU A 1 100 ? -40.373 35.529  22.531  1.00 18.22  ? 93  LEU A CG  1 
ATOM   338  C CD1 . LEU A 1 100 ? -40.895 35.209  21.134  1.00 14.49  ? 93  LEU A CD1 1 
ATOM   339  C CD2 . LEU A 1 100 ? -41.498 35.839  23.519  1.00 20.59  ? 93  LEU A CD2 1 
ATOM   340  N N   . GLY A 1 101 ? -37.125 33.013  24.523  1.00 19.90  ? 94  GLY A N   1 
ATOM   341  C CA  . GLY A 1 101 ? -36.371 31.851  24.911  1.00 27.51  ? 94  GLY A CA  1 
ATOM   342  C C   . GLY A 1 101 ? -36.042 31.795  26.388  1.00 29.39  ? 94  GLY A C   1 
ATOM   343  O O   . GLY A 1 101 ? -35.674 30.747  26.910  1.00 22.74  ? 94  GLY A O   1 
ATOM   344  N N   . GLY A 1 102 ? -36.150 32.935  27.058  1.00 30.67  ? 95  GLY A N   1 
ATOM   345  C CA  . GLY A 1 102 ? -35.917 33.010  28.488  1.00 29.56  ? 95  GLY A CA  1 
ATOM   346  C C   . GLY A 1 102 ? -34.484 32.872  28.990  1.00 35.08  ? 95  GLY A C   1 
ATOM   347  O O   . GLY A 1 102 ? -34.234 32.088  29.902  1.00 38.42  ? 95  GLY A O   1 
ATOM   348  N N   . VAL A 1 103 ? -33.544 33.622  28.416  1.00 30.76  ? 96  VAL A N   1 
ATOM   349  C CA  . VAL A 1 103 ? -32.187 33.657  28.952  1.00 29.37  ? 96  VAL A CA  1 
ATOM   350  C C   . VAL A 1 103 ? -32.179 34.595  30.146  1.00 31.60  ? 96  VAL A C   1 
ATOM   351  O O   . VAL A 1 103 ? -33.086 35.409  30.270  1.00 35.38  ? 96  VAL A O   1 
ATOM   352  C CB  . VAL A 1 103 ? -31.201 34.141  27.917  1.00 26.40  ? 96  VAL A CB  1 
ATOM   353  C CG1 . VAL A 1 103 ? -31.177 33.166  26.767  1.00 28.31  ? 96  VAL A CG1 1 
ATOM   354  C CG2 . VAL A 1 103 ? -31.588 35.537  27.455  1.00 15.59  ? 96  VAL A CG2 1 
ATOM   355  N N   . LYS A 1 104 ? -31.170 34.478  31.012  1.00 27.84  ? 97  LYS A N   1 
ATOM   356  C CA  . LYS A 1 104 ? -31.200 35.124  32.332  1.00 34.57  ? 97  LYS A CA  1 
ATOM   357  C C   . LYS A 1 104 ? -31.588 36.592  32.256  1.00 26.52  ? 97  LYS A C   1 
ATOM   358  O O   . LYS A 1 104 ? -32.562 37.013  32.875  1.00 34.42  ? 97  LYS A O   1 
ATOM   359  C CB  . LYS A 1 104 ? -29.864 34.974  33.077  1.00 50.21  ? 97  LYS A CB  1 
ATOM   360  C CG  . LYS A 1 104 ? -29.745 35.885  34.314  1.00 56.46  ? 97  LYS A CG  1 
ATOM   361  C CD  . LYS A 1 104 ? -28.403 35.750  35.034  1.00 57.85  ? 97  LYS A CD  1 
ATOM   362  C CE  . LYS A 1 104 ? -28.357 36.588  36.321  1.00 63.56  ? 97  LYS A CE  1 
ATOM   363  N NZ  . LYS A 1 104 ? -28.274 38.073  36.118  1.00 66.64  ? 97  LYS A NZ  1 
ATOM   364  N N   . ALA A 1 105 ? -30.831 37.357  31.479  1.00 24.90  ? 98  ALA A N   1 
ATOM   365  C CA  . ALA A 1 105 ? -31.109 38.770  31.261  1.00 29.42  ? 98  ALA A CA  1 
ATOM   366  C C   . ALA A 1 105 ? -30.564 39.163  29.892  1.00 31.65  ? 98  ALA A C   1 
ATOM   367  O O   . ALA A 1 105 ? -29.740 38.447  29.330  1.00 37.11  ? 98  ALA A O   1 
ATOM   368  C CB  . ALA A 1 105 ? -30.475 39.615  32.350  1.00 18.25  ? 98  ALA A CB  1 
ATOM   369  N N   . VAL A 1 106 ? -31.030 40.297  29.368  1.00 18.87  ? 99  VAL A N   1 
ATOM   370  C CA  . VAL A 1 106 ? -30.650 40.775  28.052  1.00 14.95  ? 99  VAL A CA  1 
ATOM   371  C C   . VAL A 1 106 ? -30.487 42.275  28.087  1.00 24.51  ? 99  VAL A C   1 
ATOM   372  O O   . VAL A 1 106 ? -31.377 42.991  28.545  1.00 29.07  ? 99  VAL A O   1 
ATOM   373  C CB  . VAL A 1 106 ? -31.701 40.414  26.964  1.00 16.63  ? 99  VAL A CB  1 
ATOM   374  C CG1 . VAL A 1 106 ? -31.456 41.184  25.681  1.00 7.49   ? 99  VAL A CG1 1 
ATOM   375  C CG2 . VAL A 1 106 ? -31.690 38.941  26.684  1.00 16.49  ? 99  VAL A CG2 1 
ATOM   376  N N   . THR A 1 107 ? -29.340 42.739  27.597  1.00 21.80  ? 100 THR A N   1 
ATOM   377  C CA  . THR A 1 107 ? -29.071 44.155  27.428  1.00 13.00  ? 100 THR A CA  1 
ATOM   378  C C   . THR A 1 107 ? -28.985 44.480  25.920  1.00 27.20  ? 100 THR A C   1 
ATOM   379  O O   . THR A 1 107 ? -28.393 43.741  25.123  1.00 26.91  ? 100 THR A O   1 
ATOM   380  C CB  . THR A 1 107 ? -27.759 44.546  28.140  1.00 26.21  ? 100 THR A CB  1 
ATOM   381  O OG1 . THR A 1 107 ? -27.848 44.211  29.528  1.00 29.54  ? 100 THR A OG1 1 
ATOM   382  C CG2 . THR A 1 107 ? -27.468 46.029  27.985  1.00 15.51  ? 100 THR A CG2 1 
ATOM   383  N N   . LEU A 1 108 ? -29.592 45.589  25.537  1.00 27.80  ? 101 LEU A N   1 
ATOM   384  C CA  . LEU A 1 108 ? -29.668 45.988  24.155  1.00 26.84  ? 101 LEU A CA  1 
ATOM   385  C C   . LEU A 1 108 ? -28.761 47.177  23.996  1.00 36.56  ? 101 LEU A C   1 
ATOM   386  O O   . LEU A 1 108 ? -29.010 48.226  24.600  1.00 37.50  ? 101 LEU A O   1 
ATOM   387  C CB  . LEU A 1 108 ? -31.083 46.440  23.849  1.00 30.47  ? 101 LEU A CB  1 
ATOM   388  C CG  . LEU A 1 108 ? -32.247 45.592  24.345  1.00 23.74  ? 101 LEU A CG  1 
ATOM   389  C CD1 . LEU A 1 108 ? -33.535 46.327  24.070  1.00 15.35  ? 101 LEU A CD1 1 
ATOM   390  C CD2 . LEU A 1 108 ? -32.249 44.255  23.654  1.00 20.57  ? 101 LEU A CD2 1 
ATOM   391  N N   . HIS A 1 109 ? -27.712 47.032  23.191  1.00 31.94  ? 102 HIS A N   1 
ATOM   392  C CA  . HIS A 1 109 ? -26.794 48.145  22.981  1.00 21.18  ? 102 HIS A CA  1 
ATOM   393  C C   . HIS A 1 109 ? -26.955 48.782  21.604  1.00 25.26  ? 102 HIS A C   1 
ATOM   394  O O   . HIS A 1 109 ? -26.983 48.085  20.590  1.00 26.85  ? 102 HIS A O   1 
ATOM   395  C CB  . HIS A 1 109 ? -25.346 47.713  23.211  1.00 15.59  ? 102 HIS A CB  1 
ATOM   396  C CG  . HIS A 1 109 ? -24.335 48.678  22.665  1.00 24.61  ? 102 HIS A CG  1 
ATOM   397  N ND1 . HIS A 1 109 ? -23.644 48.450  21.497  1.00 20.33  ? 102 HIS A ND1 1 
ATOM   398  C CD2 . HIS A 1 109 ? -23.922 49.880  23.128  1.00 22.07  ? 102 HIS A CD2 1 
ATOM   399  C CE1 . HIS A 1 109 ? -22.836 49.473  21.265  1.00 27.38  ? 102 HIS A CE1 1 
ATOM   400  N NE2 . HIS A 1 109 ? -22.982 50.350  22.239  1.00 25.68  ? 102 HIS A NE2 1 
ATOM   401  N N   . ASP A 1 110 ? -27.067 50.105  21.577  1.00 17.58  ? 103 ASP A N   1 
ATOM   402  C CA  . ASP A 1 110 ? -27.009 50.831  20.328  1.00 19.11  ? 103 ASP A CA  1 
ATOM   403  C C   . ASP A 1 110 ? -26.692 52.293  20.550  1.00 27.54  ? 103 ASP A C   1 
ATOM   404  O O   . ASP A 1 110 ? -27.255 52.932  21.432  1.00 28.08  ? 103 ASP A O   1 
ATOM   405  C CB  . ASP A 1 110 ? -28.329 50.720  19.580  1.00 27.75  ? 103 ASP A CB  1 
ATOM   406  C CG  . ASP A 1 110 ? -28.145 50.774  18.086  1.00 33.44  ? 103 ASP A CG  1 
ATOM   407  O OD1 . ASP A 1 110 ? -28.940 50.125  17.374  1.00 28.72  ? 103 ASP A OD1 1 
ATOM   408  O OD2 . ASP A 1 110 ? -27.196 51.453  17.633  1.00 36.54  ? 103 ASP A OD2 1 
ATOM   409  N N   . GLN A 1 111 ? -25.800 52.826  19.725  1.00 37.22  ? 104 GLN A N   1 
ATOM   410  C CA  . GLN A 1 111 ? -25.463 54.246  19.777  1.00 33.84  ? 104 GLN A CA  1 
ATOM   411  C C   . GLN A 1 111 ? -26.065 54.994  18.575  1.00 39.07  ? 104 GLN A C   1 
ATOM   412  O O   . GLN A 1 111 ? -25.978 56.215  18.482  1.00 41.83  ? 104 GLN A O   1 
ATOM   413  C CB  . GLN A 1 111 ? -23.947 54.423  19.831  1.00 20.79  ? 104 GLN A CB  1 
ATOM   414  C CG  . GLN A 1 111 ? -23.219 53.256  20.501  1.00 31.15  ? 104 GLN A CG  1 
ATOM   415  C CD  . GLN A 1 111 ? -21.780 53.598  20.873  1.00 41.15  ? 104 GLN A CD  1 
ATOM   416  O OE1 . GLN A 1 111 ? -21.524 54.682  21.390  1.00 37.99  ? 104 GLN A OE1 1 
ATOM   417  N NE2 . GLN A 1 111 ? -20.836 52.675  20.611  1.00 32.73  ? 104 GLN A NE2 1 
ATOM   418  N N   . GLY A 1 112 ? -26.688 54.257  17.663  1.00 29.99  ? 105 GLY A N   1 
ATOM   419  C CA  . GLY A 1 112 ? -27.327 54.874  16.518  1.00 30.67  ? 105 GLY A CA  1 
ATOM   420  C C   . GLY A 1 112 ? -28.784 55.226  16.759  1.00 37.49  ? 105 GLY A C   1 
ATOM   421  O O   . GLY A 1 112 ? -29.459 54.619  17.597  1.00 37.90  ? 105 GLY A O   1 
ATOM   422  N N   . THR A 1 113 ? -29.275 56.218  16.024  1.00 33.32  ? 106 THR A N   1 
ATOM   423  C CA  . THR A 1 113 ? -30.673 56.604  16.136  1.00 40.10  ? 106 THR A CA  1 
ATOM   424  C C   . THR A 1 113 ? -31.477 55.925  15.049  1.00 42.01  ? 106 THR A C   1 
ATOM   425  O O   . THR A 1 113 ? -30.919 55.461  14.047  1.00 39.11  ? 106 THR A O   1 
ATOM   426  C CB  . THR A 1 113 ? -30.875 58.124  16.017  1.00 40.73  ? 106 THR A CB  1 
ATOM   427  O OG1 . THR A 1 113 ? -30.504 58.556  14.705  1.00 45.95  ? 106 THR A OG1 1 
ATOM   428  C CG2 . THR A 1 113 ? -30.038 58.852  17.035  1.00 28.14  ? 106 THR A CG2 1 
ATOM   429  N N   . ALA A 1 114 ? -32.790 55.872  15.246  1.00 41.88  ? 107 ALA A N   1 
ATOM   430  C CA  . ALA A 1 114 ? -33.667 55.261  14.259  1.00 42.18  ? 107 ALA A CA  1 
ATOM   431  C C   . ALA A 1 114 ? -33.750 56.131  13.007  1.00 41.08  ? 107 ALA A C   1 
ATOM   432  O O   . ALA A 1 114 ? -33.980 57.340  13.091  1.00 39.87  ? 107 ALA A O   1 
ATOM   433  C CB  . ALA A 1 114 ? -35.044 55.013  14.845  1.00 36.80  ? 107 ALA A CB  1 
ATOM   434  N N   . GLN A 1 115 ? -33.543 55.492  11.857  1.00 41.06  ? 108 GLN A N   1 
ATOM   435  C CA  . GLN A 1 115 ? -33.532 56.143  10.547  1.00 44.19  ? 108 GLN A CA  1 
ATOM   436  C C   . GLN A 1 115 ? -34.636 55.561  9.677   1.00 45.19  ? 108 GLN A C   1 
ATOM   437  O O   . GLN A 1 115 ? -35.116 54.453  9.937   1.00 53.36  ? 108 GLN A O   1 
ATOM   438  C CB  . GLN A 1 115 ? -32.196 55.881  9.839   1.00 47.42  ? 108 GLN A CB  1 
ATOM   439  C CG  . GLN A 1 115 ? -30.973 56.198  10.658  1.00 54.03  ? 108 GLN A CG  1 
ATOM   440  C CD  . GLN A 1 115 ? -30.720 57.679  10.745  1.00 61.48  ? 108 GLN A CD  1 
ATOM   441  O OE1 . GLN A 1 115 ? -30.223 58.285  9.795   1.00 60.75  ? 108 GLN A OE1 1 
ATOM   442  N NE2 . GLN A 1 115 ? -31.069 58.280  11.884  1.00 62.66  ? 108 GLN A NE2 1 
ATOM   443  N N   . TRP A 1 116 ? -35.014 56.287  8.628   1.00 48.72  ? 109 TRP A N   1 
ATOM   444  C CA  . TRP A 1 116 ? -36.012 55.798  7.670   1.00 49.58  ? 109 TRP A CA  1 
ATOM   445  C C   . TRP A 1 116 ? -35.643 54.428  7.084   1.00 41.26  ? 109 TRP A C   1 
ATOM   446  O O   . TRP A 1 116 ? -36.492 53.538  6.980   1.00 39.50  ? 109 TRP A O   1 
ATOM   447  C CB  . TRP A 1 116 ? -36.249 56.824  6.561   1.00 55.34  ? 109 TRP A CB  1 
ATOM   448  C CG  . TRP A 1 116 ? -36.786 58.123  7.083   1.00 73.47  ? 109 TRP A CG  1 
ATOM   449  C CD1 . TRP A 1 116 ? -36.089 59.289  7.270   1.00 77.35  ? 109 TRP A CD1 1 
ATOM   450  C CD2 . TRP A 1 116 ? -38.128 58.394  7.504   1.00 82.85  ? 109 TRP A CD2 1 
ATOM   451  N NE1 . TRP A 1 116 ? -36.919 60.265  7.773   1.00 80.29  ? 109 TRP A NE1 1 
ATOM   452  C CE2 . TRP A 1 116 ? -38.183 59.736  7.928   1.00 86.76  ? 109 TRP A CE2 1 
ATOM   453  C CE3 . TRP A 1 116 ? -39.302 57.625  7.559   1.00 82.30  ? 109 TRP A CE3 1 
ATOM   454  C CZ2 . TRP A 1 116 ? -39.348 60.334  8.401   1.00 91.34  ? 109 TRP A CZ2 1 
ATOM   455  C CZ3 . TRP A 1 116 ? -40.463 58.219  8.033   1.00 84.86  ? 109 TRP A CZ3 1 
ATOM   456  C CH2 . TRP A 1 116 ? -40.477 59.557  8.446   1.00 89.88  ? 109 TRP A CH2 1 
ATOM   457  N N   . ALA A 1 117 ? -34.369 54.254  6.744   1.00 34.84  ? 110 ALA A N   1 
ATOM   458  C CA  . ALA A 1 117 ? -33.857 52.975  6.236   1.00 38.68  ? 110 ALA A CA  1 
ATOM   459  C C   . ALA A 1 117 ? -34.023 51.813  7.214   1.00 42.96  ? 110 ALA A C   1 
ATOM   460  O O   . ALA A 1 117 ? -33.958 50.645  6.807   1.00 46.21  ? 110 ALA A O   1 
ATOM   461  C CB  . ALA A 1 117 ? -32.381 53.110  5.820   1.00 47.42  ? 110 ALA A CB  1 
ATOM   462  N N   . ASP A 1 118 ? -34.239 52.134  8.492   1.00 45.00  ? 111 ASP A N   1 
ATOM   463  C CA  . ASP A 1 118 ? -34.383 51.119  9.538   1.00 40.89  ? 111 ASP A CA  1 
ATOM   464  C C   . ASP A 1 118 ? -35.833 50.689  9.736   1.00 39.70  ? 111 ASP A C   1 
ATOM   465  O O   . ASP A 1 118 ? -36.094 49.595  10.246  1.00 39.65  ? 111 ASP A O   1 
ATOM   466  C CB  . ASP A 1 118 ? -33.808 51.608  10.875  1.00 34.21  ? 111 ASP A CB  1 
ATOM   467  C CG  . ASP A 1 118 ? -32.351 52.058  10.771  1.00 40.41  ? 111 ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 118 ? -31.597 51.553  9.907   1.00 39.41  ? 111 ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 118 ? -31.955 52.926  11.574  1.00 45.82  ? 111 ASP A OD2 1 
ATOM   470  N N   . LEU A 1 119 ? -36.772 51.542  9.329   1.00 35.70  ? 112 LEU A N   1 
ATOM   471  C CA  . LEU A 1 119 ? -38.192 51.314  9.629   1.00 26.80  ? 112 LEU A CA  1 
ATOM   472  C C   . LEU A 1 119 ? -38.786 50.075  8.997   1.00 32.58  ? 112 LEU A C   1 
ATOM   473  O O   . LEU A 1 119 ? -39.652 49.433  9.586   1.00 42.52  ? 112 LEU A O   1 
ATOM   474  C CB  . LEU A 1 119 ? -39.046 52.522  9.252   1.00 17.33  ? 112 LEU A CB  1 
ATOM   475  C CG  . LEU A 1 119 ? -38.860 53.768  10.123  1.00 45.12  ? 112 LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 119 ? -40.149 54.575  10.181  1.00 51.29  ? 112 LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 119 ? -38.373 53.410  11.534  1.00 42.71  ? 112 LEU A CD2 1 
ATOM   478  N N   . SER A 1 120 ? -38.323 49.750  7.795   1.00 42.76  ? 113 SER A N   1 
ATOM   479  C CA  . SER A 1 120 ? -38.927 48.689  7.006   1.00 36.73  ? 113 SER A CA  1 
ATOM   480  C C   . SER A 1 120 ? -38.888 47.352  7.705   1.00 35.56  ? 113 SER A C   1 
ATOM   481  O O   . SER A 1 120 ? -39.848 46.598  7.627   1.00 42.41  ? 113 SER A O   1 
ATOM   482  C CB  . SER A 1 120 ? -38.224 48.548  5.667   1.00 45.04  ? 113 SER A CB  1 
ATOM   483  O OG  . SER A 1 120 ? -38.444 47.242  5.165   1.00 57.25  ? 113 SER A OG  1 
ATOM   484  N N   . SER A 1 121 ? -37.778 47.063  8.386   1.00 38.83  ? 114 SER A N   1 
ATOM   485  C CA  . SER A 1 121 ? -37.543 45.726  8.928   1.00 36.10  ? 114 SER A CA  1 
ATOM   486  C C   . SER A 1 121 ? -37.595 45.612  10.449  1.00 30.86  ? 114 SER A C   1 
ATOM   487  O O   . SER A 1 121 ? -37.580 44.512  11.003  1.00 46.27  ? 114 SER A O   1 
ATOM   488  C CB  . SER A 1 121 ? -36.213 45.168  8.424   1.00 42.28  ? 114 SER A CB  1 
ATOM   489  O OG  . SER A 1 121 ? -36.058 43.823  8.867   1.00 53.27  ? 114 SER A OG  1 
ATOM   490  N N   . GLN A 1 122 ? -37.640 46.751  11.115  1.00 18.35  ? 115 GLN A N   1 
ATOM   491  C CA  . GLN A 1 122 ? -37.670 46.791  12.567  1.00 23.46  ? 115 GLN A CA  1 
ATOM   492  C C   . GLN A 1 122 ? -39.110 46.887  13.059  1.00 25.32  ? 115 GLN A C   1 
ATOM   493  O O   . GLN A 1 122 ? -39.691 47.971  13.047  1.00 30.83  ? 115 GLN A O   1 
ATOM   494  C CB  . GLN A 1 122 ? -36.891 48.020  13.061  1.00 28.49  ? 115 GLN A CB  1 
ATOM   495  C CG  . GLN A 1 122 ? -35.884 47.745  14.159  1.00 25.75  ? 115 GLN A CG  1 
ATOM   496  C CD  . GLN A 1 122 ? -36.522 47.494  15.509  1.00 26.81  ? 115 GLN A CD  1 
ATOM   497  O OE1 . GLN A 1 122 ? -37.730 47.316  15.615  1.00 38.93  ? 115 GLN A OE1 1 
ATOM   498  N NE2 . GLN A 1 122 ? -35.707 47.495  16.555  1.00 20.51  ? 115 GLN A NE2 1 
ATOM   499  N N   . PHE A 1 123 ? -39.677 45.777  13.522  1.00 22.15  ? 116 PHE A N   1 
ATOM   500  C CA  . PHE A 1 123 ? -41.092 45.765  13.921  1.00 22.57  ? 116 PHE A CA  1 
ATOM   501  C C   . PHE A 1 123 ? -41.488 46.550  15.199  1.00 33.28  ? 116 PHE A C   1 
ATOM   502  O O   . PHE A 1 123 ? -42.674 46.578  15.568  1.00 32.52  ? 116 PHE A O   1 
ATOM   503  C CB  . PHE A 1 123 ? -41.636 44.332  13.977  1.00 20.63  ? 116 PHE A CB  1 
ATOM   504  C CG  . PHE A 1 123 ? -40.903 43.439  14.919  1.00 38.72  ? 116 PHE A CG  1 
ATOM   505  C CD1 . PHE A 1 123 ? -41.407 43.183  16.178  1.00 53.42  ? 116 PHE A CD1 1 
ATOM   506  C CD2 . PHE A 1 123 ? -39.710 42.843  14.543  1.00 48.35  ? 116 PHE A CD2 1 
ATOM   507  C CE1 . PHE A 1 123 ? -40.731 42.353  17.056  1.00 56.47  ? 116 PHE A CE1 1 
ATOM   508  C CE2 . PHE A 1 123 ? -39.027 42.017  15.418  1.00 49.88  ? 116 PHE A CE2 1 
ATOM   509  C CZ  . PHE A 1 123 ? -39.538 41.771  16.675  1.00 47.26  ? 116 PHE A CZ  1 
ATOM   510  N N   . TYR A 1 124 ? -40.521 47.201  15.849  1.00 27.23  ? 117 TYR A N   1 
ATOM   511  C CA  . TYR A 1 124 ? -40.804 47.986  17.053  1.00 23.03  ? 117 TYR A CA  1 
ATOM   512  C C   . TYR A 1 124 ? -40.466 49.454  16.884  1.00 30.55  ? 117 TYR A C   1 
ATOM   513  O O   . TYR A 1 124 ? -40.505 50.228  17.843  1.00 45.81  ? 117 TYR A O   1 
ATOM   514  C CB  . TYR A 1 124 ? -40.035 47.460  18.252  1.00 15.19  ? 117 TYR A CB  1 
ATOM   515  C CG  . TYR A 1 124 ? -40.567 46.190  18.823  1.00 26.73  ? 117 TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 124 ? -39.717 45.282  19.431  1.00 31.97  ? 117 TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 124 ? -41.914 45.901  18.781  1.00 32.23  ? 117 TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 124 ? -40.193 44.118  19.970  1.00 29.36  ? 117 TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 124 ? -42.399 44.729  19.311  1.00 37.93  ? 117 TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 124 ? -41.530 43.844  19.904  1.00 26.70  ? 117 TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 124 ? -42.002 42.676  20.434  1.00 35.27  ? 117 TYR A OH  1 
ATOM   522  N N   . LEU A 1 125 ? -40.108 49.829  15.671  1.00 19.38  ? 118 LEU A N   1 
ATOM   523  C CA  . LEU A 1 125 ? -39.851 51.224  15.357  1.00 42.98  ? 118 LEU A CA  1 
ATOM   524  C C   . LEU A 1 125 ? -41.040 51.774  14.561  1.00 58.36  ? 118 LEU A C   1 
ATOM   525  O O   . LEU A 1 125 ? -41.659 51.046  13.786  1.00 58.12  ? 118 LEU A O   1 
ATOM   526  C CB  . LEU A 1 125 ? -38.552 51.339  14.542  1.00 45.15  ? 118 LEU A CB  1 
ATOM   527  C CG  . LEU A 1 125 ? -37.191 51.598  15.214  1.00 39.97  ? 118 LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 125 ? -36.908 50.660  16.361  1.00 31.81  ? 118 LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 125 ? -36.059 51.507  14.194  1.00 47.61  ? 118 LEU A CD2 1 
ATOM   530  N N   . ARG A 1 126 ? -41.370 53.048  14.753  1.00 65.72  ? 119 ARG A N   1 
ATOM   531  C CA  . ARG A 1 126 ? -42.380 53.694  13.914  1.00 65.42  ? 119 ARG A CA  1 
ATOM   532  C C   . ARG A 1 126 ? -41.878 55.004  13.315  1.00 63.71  ? 119 ARG A C   1 
ATOM   533  O O   . ARG A 1 126 ? -40.688 55.300  13.344  1.00 54.10  ? 119 ARG A O   1 
ATOM   534  C CB  . ARG A 1 126 ? -43.698 53.916  14.672  1.00 66.52  ? 119 ARG A CB  1 
ATOM   535  C CG  . ARG A 1 126 ? -43.650 53.610  16.160  1.00 70.35  ? 119 ARG A CG  1 
ATOM   536  C CD  . ARG A 1 126 ? -44.665 52.546  16.540  1.00 76.07  ? 119 ARG A CD  1 
ATOM   537  N NE  . ARG A 1 126 ? -44.307 51.226  16.022  1.00 79.73  ? 119 ARG A NE  1 
ATOM   538  C CZ  . ARG A 1 126 ? -45.174 50.373  15.483  1.00 77.60  ? 119 ARG A CZ  1 
ATOM   539  N NH1 . ARG A 1 126 ? -46.457 50.707  15.386  1.00 76.89  ? 119 ARG A NH1 1 
ATOM   540  N NH2 . ARG A 1 126 ? -44.761 49.188  15.044  1.00 69.48  ? 119 ARG A NH2 1 
ATOM   541  N N   . GLU A 1 127 ? -42.798 55.783  12.763  1.00 76.41  ? 120 GLU A N   1 
ATOM   542  C CA  . GLU A 1 127 ? -42.463 57.096  12.237  1.00 77.91  ? 120 GLU A CA  1 
ATOM   543  C C   . GLU A 1 127 ? -42.149 58.042  13.396  1.00 61.41  ? 120 GLU A C   1 
ATOM   544  O O   . GLU A 1 127 ? -41.299 58.915  13.277  1.00 57.86  ? 120 GLU A O   1 
ATOM   545  C CB  . GLU A 1 127 ? -43.624 57.637  11.398  1.00 94.04  ? 120 GLU A CB  1 
ATOM   546  C CG  . GLU A 1 127 ? -43.213 58.543  10.243  1.00 101.72 ? 120 GLU A CG  1 
ATOM   547  C CD  . GLU A 1 127 ? -44.383 58.915  9.339   1.00 105.38 ? 120 GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 127 ? -45.529 58.516  9.646   1.00 104.66 ? 120 GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 127 ? -44.153 59.604  8.319   1.00 103.87 ? 120 GLU A OE2 1 
ATOM   550  N N   . GLU A 1 128 ? -42.827 57.842  14.524  1.00 57.50  ? 121 GLU A N   1 
ATOM   551  C CA  . GLU A 1 128 ? -42.646 58.671  15.718  1.00 52.38  ? 121 GLU A CA  1 
ATOM   552  C C   . GLU A 1 128 ? -41.305 58.461  16.450  1.00 59.91  ? 121 GLU A C   1 
ATOM   553  O O   . GLU A 1 128 ? -41.055 59.079  17.488  1.00 65.44  ? 121 GLU A O   1 
ATOM   554  C CB  . GLU A 1 128 ? -43.795 58.421  16.702  1.00 46.04  ? 121 GLU A CB  1 
ATOM   555  C CG  . GLU A 1 128 ? -43.903 56.966  17.168  1.00 61.37  ? 121 GLU A CG  1 
ATOM   556  C CD  . GLU A 1 128 ? -44.451 56.805  18.598  1.00 75.75  ? 121 GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 128 ? -45.682 56.949  18.792  1.00 72.30  ? 121 GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 128 ? -43.651 56.515  19.522  1.00 77.43  ? 121 GLU A OE2 1 
ATOM   559  N N   . ASP A 1 129 ? -40.450 57.591  15.920  1.00 60.52  ? 122 ASP A N   1 
ATOM   560  C CA  . ASP A 1 129 ? -39.216 57.215  16.611  1.00 53.26  ? 122 ASP A CA  1 
ATOM   561  C C   . ASP A 1 129 ? -37.931 57.651  15.891  1.00 52.02  ? 122 ASP A C   1 
ATOM   562  O O   . ASP A 1 129 ? -36.852 57.645  16.492  1.00 44.07  ? 122 ASP A O   1 
ATOM   563  C CB  . ASP A 1 129 ? -39.179 55.703  16.861  1.00 47.83  ? 122 ASP A CB  1 
ATOM   564  C CG  . ASP A 1 129 ? -40.324 55.223  17.724  1.00 53.41  ? 122 ASP A CG  1 
ATOM   565  O OD1 . ASP A 1 129 ? -40.751 55.962  18.637  1.00 71.00  ? 122 ASP A OD1 1 
ATOM   566  O OD2 . ASP A 1 129 ? -40.796 54.092  17.499  1.00 47.44  ? 122 ASP A OD2 1 
ATOM   567  N N   . ILE A 1 130 ? -38.048 58.001  14.608  1.00 46.19  ? 123 ILE A N   1 
ATOM   568  C CA  . ILE A 1 130 ? -36.913 58.492  13.826  1.00 36.65  ? 123 ILE A CA  1 
ATOM   569  C C   . ILE A 1 130 ? -36.150 59.507  14.654  1.00 38.49  ? 123 ILE A C   1 
ATOM   570  O O   . ILE A 1 130 ? -36.746 60.417  15.215  1.00 41.78  ? 123 ILE A O   1 
ATOM   571  C CB  . ILE A 1 130 ? -37.376 59.198  12.538  1.00 36.97  ? 123 ILE A CB  1 
ATOM   572  C CG1 . ILE A 1 130 ? -38.324 58.310  11.726  1.00 47.52  ? 123 ILE A CG1 1 
ATOM   573  C CG2 . ILE A 1 130 ? -36.190 59.594  11.693  1.00 35.92  ? 123 ILE A CG2 1 
ATOM   574  C CD1 . ILE A 1 130 ? -37.630 57.283  10.851  1.00 45.15  ? 123 ILE A CD1 1 
ATOM   575  N N   . GLY A 1 131 ? -34.843 59.342  14.778  1.00 40.81  ? 124 GLY A N   1 
ATOM   576  C CA  . GLY A 1 131 ? -34.075 60.297  15.556  1.00 35.87  ? 124 GLY A CA  1 
ATOM   577  C C   . GLY A 1 131 ? -33.860 59.929  17.018  1.00 38.62  ? 124 GLY A C   1 
ATOM   578  O O   . GLY A 1 131 ? -32.930 60.436  17.628  1.00 45.15  ? 124 GLY A O   1 
ATOM   579  N N   . LYS A 1 132 ? -34.711 59.063  17.576  1.00 33.14  ? 125 LYS A N   1 
ATOM   580  C CA  . LYS A 1 132 ? -34.515 58.510  18.924  1.00 32.01  ? 125 LYS A CA  1 
ATOM   581  C C   . LYS A 1 132 ? -33.654 57.237  18.881  1.00 39.31  ? 125 LYS A C   1 
ATOM   582  O O   . LYS A 1 132 ? -33.636 56.529  17.874  1.00 44.19  ? 125 LYS A O   1 
ATOM   583  C CB  . LYS A 1 132 ? -35.863 58.191  19.578  1.00 28.72  ? 125 LYS A CB  1 
ATOM   584  C CG  . LYS A 1 132 ? -36.891 59.327  19.561  1.00 31.17  ? 125 LYS A CG  1 
ATOM   585  C CD  . LYS A 1 132 ? -38.314 58.782  19.721  1.00 51.27  ? 125 LYS A CD  1 
ATOM   586  C CE  . LYS A 1 132 ? -39.292 59.804  20.319  1.00 61.35  ? 125 LYS A CE  1 
ATOM   587  N NZ  . LYS A 1 132 ? -39.145 59.963  21.810  1.00 62.49  ? 125 LYS A NZ  1 
ATOM   588  N N   . ASN A 1 133 ? -32.949 56.949  19.974  1.00 38.22  ? 126 ASN A N   1 
ATOM   589  C CA  . ASN A 1 133 ? -32.002 55.832  20.037  1.00 29.27  ? 126 ASN A CA  1 
ATOM   590  C C   . ASN A 1 133 ? -32.676 54.481  19.838  1.00 34.45  ? 126 ASN A C   1 
ATOM   591  O O   . ASN A 1 133 ? -33.673 54.164  20.509  1.00 29.13  ? 126 ASN A O   1 
ATOM   592  C CB  . ASN A 1 133 ? -31.275 55.830  21.382  1.00 25.67  ? 126 ASN A CB  1 
ATOM   593  C CG  . ASN A 1 133 ? -30.059 54.895  21.403  1.00 36.87  ? 126 ASN A CG  1 
ATOM   594  O OD1 . ASN A 1 133 ? -30.166 53.724  21.767  1.00 36.98  ? 126 ASN A OD1 1 
ATOM   595  N ND2 . ASN A 1 133 ? -28.894 55.423  21.024  1.00 37.20  ? 126 ASN A ND2 1 
ATOM   596  N N   . ARG A 1 134 ? -32.125 53.678  18.930  1.00 21.44  ? 127 ARG A N   1 
ATOM   597  C CA  . ARG A 1 134 ? -32.761 52.407  18.582  1.00 24.85  ? 127 ARG A CA  1 
ATOM   598  C C   . ARG A 1 134 ? -32.968 51.462  19.769  1.00 31.50  ? 127 ARG A C   1 
ATOM   599  O O   . ARG A 1 134 ? -34.023 50.847  19.886  1.00 31.79  ? 127 ARG A O   1 
ATOM   600  C CB  . ARG A 1 134 ? -32.038 51.706  17.419  1.00 30.51  ? 127 ARG A CB  1 
ATOM   601  C CG  . ARG A 1 134 ? -32.381 52.290  16.041  1.00 33.26  ? 127 ARG A CG  1 
ATOM   602  C CD  . ARG A 1 134 ? -31.697 51.538  14.916  1.00 28.70  ? 127 ARG A CD  1 
ATOM   603  N NE  . ARG A 1 134 ? -30.261 51.519  15.144  1.00 30.75  ? 127 ARG A NE  1 
ATOM   604  C CZ  . ARG A 1 134 ? -29.356 51.900  14.257  1.00 41.20  ? 127 ARG A CZ  1 
ATOM   605  N NH1 . ARG A 1 134 ? -29.737 52.319  13.056  1.00 41.87  ? 127 ARG A NH1 1 
ATOM   606  N NH2 . ARG A 1 134 ? -28.066 51.856  14.575  1.00 43.53  ? 127 ARG A NH2 1 
ATOM   607  N N   . ALA A 1 135 ? -31.974 51.357  20.648  1.00 30.80  ? 128 ALA A N   1 
ATOM   608  C CA  . ALA A 1 135 ? -32.086 50.475  21.812  1.00 26.30  ? 128 ALA A CA  1 
ATOM   609  C C   . ALA A 1 135 ? -33.105 50.979  22.824  1.00 30.67  ? 128 ALA A C   1 
ATOM   610  O O   . ALA A 1 135 ? -33.823 50.195  23.446  1.00 35.46  ? 128 ALA A O   1 
ATOM   611  C CB  . ALA A 1 135 ? -30.717 50.265  22.482  1.00 23.32  ? 128 ALA A CB  1 
ATOM   612  N N   . GLU A 1 136 ? -33.176 52.294  22.981  1.00 32.35  ? 129 GLU A N   1 
ATOM   613  C CA  . GLU A 1 136 ? -34.050 52.872  23.989  1.00 38.01  ? 129 GLU A CA  1 
ATOM   614  C C   . GLU A 1 136 ? -35.500 52.760  23.569  1.00 39.92  ? 129 GLU A C   1 
ATOM   615  O O   . GLU A 1 136 ? -36.377 52.571  24.405  1.00 42.93  ? 129 GLU A O   1 
ATOM   616  C CB  . GLU A 1 136 ? -33.669 54.323  24.274  1.00 40.93  ? 129 GLU A CB  1 
ATOM   617  C CG  . GLU A 1 136 ? -32.223 54.475  24.722  1.00 53.72  ? 129 GLU A CG  1 
ATOM   618  C CD  . GLU A 1 136 ? -32.084 55.291  25.985  1.00 65.34  ? 129 GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 136 ? -32.712 56.366  26.063  1.00 73.22  ? 129 GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 136 ? -31.352 54.853  26.902  1.00 68.72  ? 129 GLU A OE2 1 
ATOM   621  N N   . VAL A 1 137 ? -35.741 52.855  22.266  1.00 40.76  ? 130 VAL A N   1 
ATOM   622  C CA  . VAL A 1 137 ? -37.083 52.711  21.710  1.00 30.67  ? 130 VAL A CA  1 
ATOM   623  C C   . VAL A 1 137 ? -37.563 51.246  21.731  1.00 28.79  ? 130 VAL A C   1 
ATOM   624  O O   . VAL A 1 137 ? -38.697 50.949  22.108  1.00 30.52  ? 130 VAL A O   1 
ATOM   625  C CB  . VAL A 1 137 ? -37.109 53.257  20.280  1.00 33.81  ? 130 VAL A CB  1 
ATOM   626  C CG1 . VAL A 1 137 ? -38.453 53.008  19.632  1.00 30.22  ? 130 VAL A CG1 1 
ATOM   627  C CG2 . VAL A 1 137 ? -36.760 54.743  20.291  1.00 28.89  ? 130 VAL A CG2 1 
ATOM   628  N N   . SER A 1 138 ? -36.678 50.332  21.357  1.00 26.83  ? 131 SER A N   1 
ATOM   629  C CA  . SER A 1 138 ? -37.007 48.917  21.310  1.00 19.72  ? 131 SER A CA  1 
ATOM   630  C C   . SER A 1 138 ? -37.182 48.306  22.681  1.00 21.92  ? 131 SER A C   1 
ATOM   631  O O   . SER A 1 138 ? -37.975 47.381  22.840  1.00 30.16  ? 131 SER A O   1 
ATOM   632  C CB  . SER A 1 138 ? -35.923 48.142  20.550  1.00 27.95  ? 131 SER A CB  1 
ATOM   633  O OG  . SER A 1 138 ? -35.787 48.626  19.225  1.00 28.38  ? 131 SER A OG  1 
ATOM   634  N N   . GLN A 1 139 ? -36.445 48.804  23.672  1.00 21.50  ? 132 GLN A N   1 
ATOM   635  C CA  . GLN A 1 139 ? -36.478 48.184  25.006  1.00 29.72  ? 132 GLN A CA  1 
ATOM   636  C C   . GLN A 1 139 ? -37.857 48.080  25.719  1.00 22.68  ? 132 GLN A C   1 
ATOM   637  O O   . GLN A 1 139 ? -38.160 47.030  26.282  1.00 13.49  ? 132 GLN A O   1 
ATOM   638  C CB  . GLN A 1 139 ? -35.354 48.712  25.930  1.00 16.74  ? 132 GLN A CB  1 
ATOM   639  C CG  . GLN A 1 139 ? -35.791 49.588  27.088  1.00 24.15  ? 132 GLN A CG  1 
ATOM   640  C CD  . GLN A 1 139 ? -36.353 48.805  28.254  1.00 26.83  ? 132 GLN A CD  1 
ATOM   641  O OE1 . GLN A 1 139 ? -35.841 47.758  28.606  1.00 38.72  ? 132 GLN A OE1 1 
ATOM   642  N NE2 . GLN A 1 139 ? -37.423 49.301  28.838  1.00 23.06  ? 132 GLN A NE2 1 
ATOM   643  N N   . PRO A 1 140 ? -38.683 49.147  25.718  1.00 31.04  ? 133 PRO A N   1 
ATOM   644  C CA  . PRO A 1 140 ? -39.992 48.985  26.375  1.00 28.40  ? 133 PRO A CA  1 
ATOM   645  C C   . PRO A 1 140 ? -40.821 47.871  25.753  1.00 34.53  ? 133 PRO A C   1 
ATOM   646  O O   . PRO A 1 140 ? -41.319 47.007  26.472  1.00 35.12  ? 133 PRO A O   1 
ATOM   647  C CB  . PRO A 1 140 ? -40.674 50.320  26.120  1.00 18.05  ? 133 PRO A CB  1 
ATOM   648  C CG  . PRO A 1 140 ? -39.549 51.286  25.996  1.00 19.06  ? 133 PRO A CG  1 
ATOM   649  C CD  . PRO A 1 140 ? -38.458 50.539  25.299  1.00 32.04  ? 133 PRO A CD  1 
ATOM   650  N N   . ARG A 1 141 ? -40.928 47.870  24.430  1.00 33.02  ? 134 ARG A N   1 
ATOM   651  C CA  . ARG A 1 141 ? -41.739 46.869  23.746  1.00 41.47  ? 134 ARG A CA  1 
ATOM   652  C C   . ARG A 1 141 ? -41.163 45.453  23.874  1.00 37.85  ? 134 ARG A C   1 
ATOM   653  O O   . ARG A 1 141 ? -41.911 44.482  24.004  1.00 45.86  ? 134 ARG A O   1 
ATOM   654  C CB  . ARG A 1 141 ? -41.956 47.284  22.295  1.00 50.11  ? 134 ARG A CB  1 
ATOM   655  C CG  . ARG A 1 141 ? -42.383 48.752  22.175  1.00 64.78  ? 134 ARG A CG  1 
ATOM   656  C CD  . ARG A 1 141 ? -41.940 49.380  20.856  1.00 76.74  ? 134 ARG A CD  1 
ATOM   657  N NE  . ARG A 1 141 ? -41.766 50.829  20.960  1.00 84.75  ? 134 ARG A NE  1 
ATOM   658  C CZ  . ARG A 1 141 ? -42.662 51.729  20.565  1.00 94.60  ? 134 ARG A CZ  1 
ATOM   659  N NH1 . ARG A 1 141 ? -43.813 51.341  20.029  1.00 99.35  ? 134 ARG A NH1 1 
ATOM   660  N NH2 . ARG A 1 141 ? -42.401 53.024  20.704  1.00 96.15  ? 134 ARG A NH2 1 
ATOM   661  N N   . LEU A 1 142 ? -39.839 45.338  23.865  1.00 28.73  ? 135 LEU A N   1 
ATOM   662  C CA  . LEU A 1 142 ? -39.183 44.046  24.085  1.00 35.85  ? 135 LEU A CA  1 
ATOM   663  C C   . LEU A 1 142 ? -39.291 43.559  25.545  1.00 38.23  ? 135 LEU A C   1 
ATOM   664  O O   . LEU A 1 142 ? -39.309 42.352  25.813  1.00 33.18  ? 135 LEU A O   1 
ATOM   665  C CB  . LEU A 1 142 ? -37.704 44.110  23.669  1.00 34.81  ? 135 LEU A CB  1 
ATOM   666  C CG  . LEU A 1 142 ? -37.321 43.893  22.205  1.00 33.95  ? 135 LEU A CG  1 
ATOM   667  C CD1 . LEU A 1 142 ? -35.994 44.566  21.934  1.00 30.12  ? 135 LEU A CD1 1 
ATOM   668  C CD2 . LEU A 1 142 ? -37.239 42.408  21.864  1.00 32.69  ? 135 LEU A CD2 1 
ATOM   669  N N   . ALA A 1 143 ? -39.348 44.499  26.487  1.00 34.92  ? 136 ALA A N   1 
ATOM   670  C CA  . ALA A 1 143 ? -39.476 44.151  27.900  1.00 35.69  ? 136 ALA A CA  1 
ATOM   671  C C   . ALA A 1 143 ? -40.797 43.447  28.171  1.00 37.92  ? 136 ALA A C   1 
ATOM   672  O O   . ALA A 1 143 ? -40.857 42.541  28.998  1.00 36.28  ? 136 ALA A O   1 
ATOM   673  C CB  . ALA A 1 143 ? -39.349 45.381  28.771  1.00 36.78  ? 136 ALA A CB  1 
ATOM   674  N N   . GLU A 1 144 ? -41.843 43.861  27.452  1.00 42.82  ? 137 GLU A N   1 
ATOM   675  C CA  . GLU A 1 144 ? -43.184 43.289  27.602  1.00 27.18  ? 137 GLU A CA  1 
ATOM   676  C C   . GLU A 1 144 ? -43.354 41.874  27.040  1.00 20.98  ? 137 GLU A C   1 
ATOM   677  O O   . GLU A 1 144 ? -44.414 41.295  27.202  1.00 35.79  ? 137 GLU A O   1 
ATOM   678  C CB  . GLU A 1 144 ? -44.245 44.195  26.962  1.00 31.06  ? 137 GLU A CB  1 
ATOM   679  C CG  . GLU A 1 144 ? -44.349 45.623  27.511  1.00 45.07  ? 137 GLU A CG  1 
ATOM   680  C CD  . GLU A 1 144 ? -45.033 46.582  26.515  1.00 65.55  ? 137 GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 144 ? -44.903 47.820  26.665  1.00 69.22  ? 137 GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 144 ? -45.697 46.098  25.568  1.00 70.53  ? 137 GLU A OE2 1 
ATOM   683  N N   . LEU A 1 145 ? -42.332 41.318  26.401  1.00 29.16  ? 138 LEU A N   1 
ATOM   684  C CA  . LEU A 1 145 ? -42.477 39.977  25.847  1.00 28.75  ? 138 LEU A CA  1 
ATOM   685  C C   . LEU A 1 145 ? -42.742 38.962  26.954  1.00 34.08  ? 138 LEU A C   1 
ATOM   686  O O   . LEU A 1 145 ? -43.610 38.102  26.821  1.00 42.50  ? 138 LEU A O   1 
ATOM   687  C CB  . LEU A 1 145 ? -41.236 39.581  25.046  1.00 27.10  ? 138 LEU A CB  1 
ATOM   688  C CG  . LEU A 1 145 ? -40.970 40.371  23.764  1.00 33.57  ? 138 LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 145 ? -39.769 39.807  23.026  1.00 31.87  ? 138 LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 145 ? -42.196 40.372  22.868  1.00 26.09  ? 138 LEU A CD2 1 
ATOM   691  N N   . ASN A 1 146 ? -42.000 39.071  28.051  1.00 34.55  ? 139 ASN A N   1 
ATOM   692  C CA  . ASN A 1 146 ? -42.224 38.220  29.213  1.00 55.42  ? 139 ASN A CA  1 
ATOM   693  C C   . ASN A 1 146 ? -41.802 38.907  30.510  1.00 57.46  ? 139 ASN A C   1 
ATOM   694  O O   . ASN A 1 146 ? -40.875 39.714  30.518  1.00 69.77  ? 139 ASN A O   1 
ATOM   695  C CB  . ASN A 1 146 ? -41.508 36.879  29.052  1.00 52.48  ? 139 ASN A CB  1 
ATOM   696  C CG  . ASN A 1 146 ? -40.009 37.024  29.023  1.00 36.88  ? 139 ASN A CG  1 
ATOM   697  O OD1 . ASN A 1 146 ? -39.459 37.983  29.560  1.00 50.06  ? 139 ASN A OD1 1 
ATOM   698  N ND2 . ASN A 1 146 ? -39.335 36.072  28.393  1.00 29.93  ? 139 ASN A ND2 1 
ATOM   699  N N   . SER A 1 147 ? -42.484 38.582  31.602  1.00 46.65  ? 140 SER A N   1 
ATOM   700  C CA  . SER A 1 147 ? -42.178 39.164  32.905  1.00 33.55  ? 140 SER A CA  1 
ATOM   701  C C   . SER A 1 147 ? -40.800 38.799  33.466  1.00 41.74  ? 140 SER A C   1 
ATOM   702  O O   . SER A 1 147 ? -40.110 39.641  34.037  1.00 56.36  ? 140 SER A O   1 
ATOM   703  C CB  . SER A 1 147 ? -43.263 38.788  33.915  1.00 35.25  ? 140 SER A CB  1 
ATOM   704  O OG  . SER A 1 147 ? -44.547 39.155  33.443  1.00 34.30  ? 140 SER A OG  1 
ATOM   705  N N   . TYR A 1 148 ? -40.418 37.537  33.314  1.00 37.75  ? 141 TYR A N   1 
ATOM   706  C CA  . TYR A 1 148 ? -39.176 37.011  33.889  1.00 27.80  ? 141 TYR A CA  1 
ATOM   707  C C   . TYR A 1 148 ? -37.830 37.564  33.393  1.00 35.99  ? 141 TYR A C   1 
ATOM   708  O O   . TYR A 1 148 ? -36.900 37.716  34.182  1.00 34.50  ? 141 TYR A O   1 
ATOM   709  C CB  . TYR A 1 148 ? -39.172 35.476  33.876  1.00 19.57  ? 141 TYR A CB  1 
ATOM   710  C CG  . TYR A 1 148 ? -39.464 34.851  32.534  1.00 48.98  ? 141 TYR A CG  1 
ATOM   711  C CD1 . TYR A 1 148 ? -40.743 34.878  31.997  1.00 57.18  ? 141 TYR A CD1 1 
ATOM   712  C CD2 . TYR A 1 148 ? -38.465 34.215  31.812  1.00 62.47  ? 141 TYR A CD2 1 
ATOM   713  C CE1 . TYR A 1 148 ? -41.014 34.301  30.773  1.00 66.39  ? 141 TYR A CE1 1 
ATOM   714  C CE2 . TYR A 1 148 ? -38.727 33.636  30.588  1.00 69.51  ? 141 TYR A CE2 1 
ATOM   715  C CZ  . TYR A 1 148 ? -40.002 33.681  30.073  1.00 72.38  ? 141 TYR A CZ  1 
ATOM   716  O OH  . TYR A 1 148 ? -40.263 33.102  28.853  1.00 79.58  ? 141 TYR A OH  1 
ATOM   717  N N   . VAL A 1 149 ? -37.713 37.829  32.097  1.00 30.76  ? 142 VAL A N   1 
ATOM   718  C CA  . VAL A 1 149 ? -36.435 38.224  31.515  1.00 28.62  ? 142 VAL A CA  1 
ATOM   719  C C   . VAL A 1 149 ? -36.278 39.735  31.513  1.00 30.36  ? 142 VAL A C   1 
ATOM   720  O O   . VAL A 1 149 ? -36.993 40.437  30.798  1.00 29.85  ? 142 VAL A O   1 
ATOM   721  C CB  . VAL A 1 149 ? -36.256 37.690  30.086  1.00 32.29  ? 142 VAL A CB  1 
ATOM   722  C CG1 . VAL A 1 149 ? -34.931 38.166  29.502  1.00 19.78  ? 142 VAL A CG1 1 
ATOM   723  C CG2 . VAL A 1 149 ? -36.336 36.174  30.082  1.00 30.30  ? 142 VAL A CG2 1 
ATOM   724  N N   . PRO A 1 150 ? -35.344 40.240  32.334  1.00 34.18  ? 143 PRO A N   1 
ATOM   725  C CA  . PRO A 1 150 ? -35.094 41.682  32.426  1.00 32.40  ? 143 PRO A CA  1 
ATOM   726  C C   . PRO A 1 150 ? -34.418 42.174  31.143  1.00 36.35  ? 143 PRO A C   1 
ATOM   727  O O   . PRO A 1 150 ? -33.414 41.600  30.721  1.00 31.56  ? 143 PRO A O   1 
ATOM   728  C CB  . PRO A 1 150 ? -34.126 41.803  33.620  1.00 22.58  ? 143 PRO A CB  1 
ATOM   729  C CG  . PRO A 1 150 ? -34.059 40.431  34.241  1.00 14.13  ? 143 PRO A CG  1 
ATOM   730  C CD  . PRO A 1 150 ? -34.428 39.463  33.187  1.00 26.18  ? 143 PRO A CD  1 
ATOM   731  N N   . VAL A 1 151 ? -34.976 43.205  30.521  1.00 26.95  ? 144 VAL A N   1 
ATOM   732  C CA  . VAL A 1 151 ? -34.382 43.761  29.325  1.00 15.91  ? 144 VAL A CA  1 
ATOM   733  C C   . VAL A 1 151 ? -33.958 45.168  29.614  1.00 22.59  ? 144 VAL A C   1 
ATOM   734  O O   . VAL A 1 151 ? -34.749 45.952  30.115  1.00 36.25  ? 144 VAL A O   1 
ATOM   735  C CB  . VAL A 1 151 ? -35.374 43.800  28.150  1.00 20.36  ? 144 VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 151 ? -34.663 44.294  26.871  1.00 11.07  ? 144 VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 151 ? -35.984 42.427  27.939  1.00 12.86  ? 144 VAL A CG2 1 
ATOM   738  N N   . THR A 1 152 ? -32.707 45.490  29.315  1.00 22.44  ? 145 THR A N   1 
ATOM   739  C CA  . THR A 1 152 ? -32.194 46.821  29.599  1.00 23.12  ? 145 THR A CA  1 
ATOM   740  C C   . THR A 1 152 ? -31.537 47.386  28.343  1.00 28.95  ? 145 THR A C   1 
ATOM   741  O O   . THR A 1 152 ? -31.147 46.640  27.450  1.00 31.65  ? 145 THR A O   1 
ATOM   742  C CB  . THR A 1 152 ? -31.179 46.818  30.775  1.00 24.25  ? 145 THR A CB  1 
ATOM   743  O OG1 . THR A 1 152 ? -31.433 45.711  31.644  1.00 24.05  ? 145 THR A OG1 1 
ATOM   744  C CG2 . THR A 1 152 ? -31.275 48.112  31.580  1.00 19.15  ? 145 THR A CG2 1 
ATOM   745  N N   . ALA A 1 153 ? -31.437 48.707  28.274  1.00 26.77  ? 146 ALA A N   1 
ATOM   746  C CA  . ALA A 1 153 ? -30.840 49.384  27.134  1.00 20.42  ? 146 ALA A CA  1 
ATOM   747  C C   . ALA A 1 153 ? -29.597 50.144  27.565  1.00 31.64  ? 146 ALA A C   1 
ATOM   748  O O   . ALA A 1 153 ? -29.580 50.808  28.603  1.00 37.04  ? 146 ALA A O   1 
ATOM   749  C CB  . ALA A 1 153 ? -31.831 50.331  26.487  1.00 11.60  ? 146 ALA A CB  1 
ATOM   750  N N   . TYR A 1 154 ? -28.559 50.038  26.748  1.00 33.84  ? 147 TYR A N   1 
ATOM   751  C CA  . TYR A 1 154 ? -27.308 50.708  27.013  1.00 28.69  ? 147 TYR A CA  1 
ATOM   752  C C   . TYR A 1 154 ? -26.853 51.419  25.747  1.00 27.81  ? 147 TYR A C   1 
ATOM   753  O O   . TYR A 1 154 ? -26.667 50.792  24.710  1.00 26.22  ? 147 TYR A O   1 
ATOM   754  C CB  . TYR A 1 154 ? -26.275 49.684  27.471  1.00 23.98  ? 147 TYR A CB  1 
ATOM   755  C CG  . TYR A 1 154 ? -24.894 50.249  27.629  1.00 29.82  ? 147 TYR A CG  1 
ATOM   756  C CD1 . TYR A 1 154 ? -24.567 51.029  28.738  1.00 23.49  ? 147 TYR A CD1 1 
ATOM   757  C CD2 . TYR A 1 154 ? -23.912 50.010  26.670  1.00 24.92  ? 147 TYR A CD2 1 
ATOM   758  C CE1 . TYR A 1 154 ? -23.286 51.554  28.895  1.00 25.69  ? 147 TYR A CE1 1 
ATOM   759  C CE2 . TYR A 1 154 ? -22.632 50.516  26.820  1.00 34.73  ? 147 TYR A CE2 1 
ATOM   760  C CZ  . TYR A 1 154 ? -22.321 51.292  27.930  1.00 34.97  ? 147 TYR A CZ  1 
ATOM   761  O OH  . TYR A 1 154 ? -21.058 51.814  28.076  1.00 26.10  ? 147 TYR A OH  1 
ATOM   762  N N   . THR A 1 155 ? -26.687 52.732  25.839  1.00 31.41  ? 148 THR A N   1 
ATOM   763  C CA  . THR A 1 155 ? -26.336 53.536  24.677  1.00 33.90  ? 148 THR A CA  1 
ATOM   764  C C   . THR A 1 155 ? -24.880 53.974  24.671  1.00 29.97  ? 148 THR A C   1 
ATOM   765  O O   . THR A 1 155 ? -24.498 54.834  23.874  1.00 36.69  ? 148 THR A O   1 
ATOM   766  C CB  . THR A 1 155 ? -27.182 54.799  24.607  1.00 34.29  ? 148 THR A CB  1 
ATOM   767  O OG1 . THR A 1 155 ? -26.921 55.601  25.766  1.00 34.14  ? 148 THR A OG1 1 
ATOM   768  C CG2 . THR A 1 155 ? -28.645 54.439  24.541  1.00 25.36  ? 148 THR A CG2 1 
ATOM   769  N N   . GLY A 1 156 ? -24.068 53.376  25.541  1.00 20.41  ? 149 GLY A N   1 
ATOM   770  C CA  . GLY A 1 156 ? -22.664 53.742  25.635  1.00 27.81  ? 149 GLY A CA  1 
ATOM   771  C C   . GLY A 1 156 ? -21.704 52.952  24.751  1.00 32.63  ? 149 GLY A C   1 
ATOM   772  O O   . GLY A 1 156 ? -22.115 52.200  23.872  1.00 35.74  ? 149 GLY A O   1 
ATOM   773  N N   . PRO A 1 157 ? -20.400 53.122  24.986  1.00 33.66  ? 150 PRO A N   1 
ATOM   774  C CA  . PRO A 1 157 ? -19.398 52.438  24.180  1.00 33.44  ? 150 PRO A CA  1 
ATOM   775  C C   . PRO A 1 157 ? -19.180 51.029  24.692  1.00 29.83  ? 150 PRO A C   1 
ATOM   776  O O   . PRO A 1 157 ? -19.303 50.814  25.890  1.00 27.15  ? 150 PRO A O   1 
ATOM   777  C CB  . PRO A 1 157 ? -18.148 53.284  24.414  1.00 39.55  ? 150 PRO A CB  1 
ATOM   778  C CG  . PRO A 1 157 ? -18.312 53.793  25.800  1.00 41.72  ? 150 PRO A CG  1 
ATOM   779  C CD  . PRO A 1 157 ? -19.788 53.985  26.014  1.00 44.44  ? 150 PRO A CD  1 
ATOM   780  N N   . LEU A 1 158 ? -18.868 50.085  23.803  1.00 35.13  ? 151 LEU A N   1 
ATOM   781  C CA  . LEU A 1 158 ? -18.563 48.726  24.233  1.00 30.78  ? 151 LEU A CA  1 
ATOM   782  C C   . LEU A 1 158 ? -17.139 48.654  24.766  1.00 35.33  ? 151 LEU A C   1 
ATOM   783  O O   . LEU A 1 158 ? -16.220 48.090  24.168  1.00 42.47  ? 151 LEU A O   1 
ATOM   784  C CB  . LEU A 1 158 ? -18.847 47.713  23.140  1.00 18.70  ? 151 LEU A CB  1 
ATOM   785  C CG  . LEU A 1 158 ? -20.310 47.802  22.700  1.00 33.04  ? 151 LEU A CG  1 
ATOM   786  C CD1 . LEU A 1 158 ? -20.608 46.806  21.592  1.00 40.53  ? 151 LEU A CD1 1 
ATOM   787  C CD2 . LEU A 1 158 ? -21.283 47.606  23.879  1.00 21.29  ? 151 LEU A CD2 1 
ATOM   788  N N   . VAL A 1 159 ? -16.999 49.268  25.925  1.00 34.90  ? 152 VAL A N   1 
ATOM   789  C CA  . VAL A 1 159 ? -15.753 49.372  26.640  1.00 30.89  ? 152 VAL A CA  1 
ATOM   790  C C   . VAL A 1 159 ? -15.483 48.039  27.330  1.00 27.99  ? 152 VAL A C   1 
ATOM   791  O O   . VAL A 1 159 ? -16.422 47.328  27.688  1.00 28.50  ? 152 VAL A O   1 
ATOM   792  C CB  . VAL A 1 159 ? -15.861 50.555  27.616  1.00 27.60  ? 152 VAL A CB  1 
ATOM   793  C CG1 . VAL A 1 159 ? -15.881 50.091  29.056  1.00 23.15  ? 152 VAL A CG1 1 
ATOM   794  C CG2 . VAL A 1 159 ? -14.769 51.579  27.323  1.00 25.25  ? 152 VAL A CG2 1 
ATOM   795  N N   . GLU A 1 160 ? -14.211 47.674  27.492  1.00 40.13  ? 153 GLU A N   1 
ATOM   796  C CA  . GLU A 1 160 ? -13.887 46.296  27.902  1.00 43.06  ? 153 GLU A CA  1 
ATOM   797  C C   . GLU A 1 160 ? -14.441 45.821  29.255  1.00 47.63  ? 153 GLU A C   1 
ATOM   798  O O   . GLU A 1 160 ? -14.818 44.661  29.402  1.00 53.46  ? 153 GLU A O   1 
ATOM   799  C CB  . GLU A 1 160 ? -12.396 45.974  27.741  1.00 42.63  ? 153 GLU A CB  1 
ATOM   800  C CG  . GLU A 1 160 ? -11.417 46.819  28.524  1.00 66.02  ? 153 GLU A CG  1 
ATOM   801  C CD  . GLU A 1 160 ? -9.985  46.286  28.402  1.00 66.81  ? 153 GLU A CD  1 
ATOM   802  O OE1 . GLU A 1 160 ? -9.116  46.699  29.206  1.00 73.26  ? 153 GLU A OE1 1 
ATOM   803  O OE2 . GLU A 1 160 ? -9.735  45.450  27.507  1.00 52.05  ? 153 GLU A OE2 1 
ATOM   804  N N   . ASP A 1 161 ? -14.526 46.713  30.231  1.00 42.13  ? 154 ASP A N   1 
ATOM   805  C CA  . ASP A 1 161 ? -15.110 46.335  31.512  1.00 28.04  ? 154 ASP A CA  1 
ATOM   806  C C   . ASP A 1 161 ? -16.636 46.398  31.540  1.00 30.39  ? 154 ASP A C   1 
ATOM   807  O O   . ASP A 1 161 ? -17.262 45.952  32.492  1.00 35.15  ? 154 ASP A O   1 
ATOM   808  C CB  . ASP A 1 161 ? -14.489 47.158  32.631  1.00 34.89  ? 154 ASP A CB  1 
ATOM   809  C CG  . ASP A 1 161 ? -13.113 46.650  33.007  1.00 41.75  ? 154 ASP A CG  1 
ATOM   810  O OD1 . ASP A 1 161 ? -12.187 47.472  33.187  1.00 42.32  ? 154 ASP A OD1 1 
ATOM   811  O OD2 . ASP A 1 161 ? -12.967 45.408  33.091  1.00 33.84  ? 154 ASP A OD2 1 
ATOM   812  N N   . PHE A 1 162 ? -17.239 46.954  30.496  1.00 33.86  ? 155 PHE A N   1 
ATOM   813  C CA  . PHE A 1 162 ? -18.676 46.827  30.318  1.00 30.64  ? 155 PHE A CA  1 
ATOM   814  C C   . PHE A 1 162 ? -18.962 45.431  29.761  1.00 35.18  ? 155 PHE A C   1 
ATOM   815  O O   . PHE A 1 162 ? -19.649 44.647  30.413  1.00 38.33  ? 155 PHE A O   1 
ATOM   816  C CB  . PHE A 1 162 ? -19.219 47.913  29.393  1.00 34.17  ? 155 PHE A CB  1 
ATOM   817  C CG  . PHE A 1 162 ? -20.670 47.746  29.054  1.00 33.86  ? 155 PHE A CG  1 
ATOM   818  C CD1 . PHE A 1 162 ? -21.058 47.065  27.911  1.00 34.56  ? 155 PHE A CD1 1 
ATOM   819  C CD2 . PHE A 1 162 ? -21.648 48.264  29.882  1.00 28.01  ? 155 PHE A CD2 1 
ATOM   820  C CE1 . PHE A 1 162 ? -22.400 46.899  27.607  1.00 25.67  ? 155 PHE A CE1 1 
ATOM   821  C CE2 . PHE A 1 162 ? -22.982 48.101  29.584  1.00 30.78  ? 155 PHE A CE2 1 
ATOM   822  C CZ  . PHE A 1 162 ? -23.358 47.416  28.439  1.00 27.50  ? 155 PHE A CZ  1 
ATOM   823  N N   . LEU A 1 163 ? -18.406 45.116  28.582  1.00 26.92  ? 156 LEU A N   1 
ATOM   824  C CA  . LEU A 1 163 ? -18.527 43.779  27.983  1.00 25.99  ? 156 LEU A CA  1 
ATOM   825  C C   . LEU A 1 163 ? -18.291 42.668  28.999  1.00 29.93  ? 156 LEU A C   1 
ATOM   826  O O   . LEU A 1 163 ? -18.987 41.652  28.997  1.00 36.07  ? 156 LEU A O   1 
ATOM   827  C CB  . LEU A 1 163 ? -17.519 43.589  26.848  1.00 20.33  ? 156 LEU A CB  1 
ATOM   828  C CG  . LEU A 1 163 ? -17.609 44.468  25.612  1.00 26.13  ? 156 LEU A CG  1 
ATOM   829  C CD1 . LEU A 1 163 ? -16.335 44.357  24.834  1.00 23.58  ? 156 LEU A CD1 1 
ATOM   830  C CD2 . LEU A 1 163 ? -18.790 44.057  24.765  1.00 19.45  ? 156 LEU A CD2 1 
ATOM   831  N N   . SER A 1 164 ? -17.302 42.879  29.862  1.00 30.26  ? 157 SER A N   1 
ATOM   832  C CA  . SER A 1 164 ? -16.874 41.877  30.833  1.00 40.28  ? 157 SER A CA  1 
ATOM   833  C C   . SER A 1 164 ? -17.995 41.358  31.740  1.00 43.10  ? 157 SER A C   1 
ATOM   834  O O   . SER A 1 164 ? -17.946 40.218  32.196  1.00 45.75  ? 157 SER A O   1 
ATOM   835  C CB  . SER A 1 164 ? -15.724 42.410  31.680  1.00 33.78  ? 157 SER A CB  1 
ATOM   836  O OG  . SER A 1 164 ? -14.685 41.453  31.733  1.00 50.65  ? 157 SER A OG  1 
ATOM   837  N N   . GLY A 1 165 ? -19.009 42.180  31.992  1.00 20.52  ? 158 GLY A N   1 
ATOM   838  C CA  . GLY A 1 165 ? -20.173 41.690  32.696  1.00 21.16  ? 158 GLY A CA  1 
ATOM   839  C C   . GLY A 1 165 ? -21.161 40.873  31.871  1.00 26.49  ? 158 GLY A C   1 
ATOM   840  O O   . GLY A 1 165 ? -22.362 40.996  32.066  1.00 42.39  ? 158 GLY A O   1 
ATOM   841  N N   . PHE A 1 166 ? -20.666 40.042  30.957  1.00 27.71  ? 159 PHE A N   1 
ATOM   842  C CA  . PHE A 1 166 ? -21.530 39.222  30.110  1.00 29.15  ? 159 PHE A CA  1 
ATOM   843  C C   . PHE A 1 166 ? -20.924 37.869  29.781  1.00 32.22  ? 159 PHE A C   1 
ATOM   844  O O   . PHE A 1 166 ? -19.705 37.719  29.723  1.00 28.46  ? 159 PHE A O   1 
ATOM   845  C CB  . PHE A 1 166 ? -21.876 39.937  28.808  1.00 19.57  ? 159 PHE A CB  1 
ATOM   846  C CG  . PHE A 1 166 ? -22.798 41.091  28.983  1.00 16.70  ? 159 PHE A CG  1 
ATOM   847  C CD1 . PHE A 1 166 ? -22.314 42.383  28.961  1.00 19.55  ? 159 PHE A CD1 1 
ATOM   848  C CD2 . PHE A 1 166 ? -24.154 40.885  29.183  1.00 28.05  ? 159 PHE A CD2 1 
ATOM   849  C CE1 . PHE A 1 166 ? -23.170 43.453  29.137  1.00 24.22  ? 159 PHE A CE1 1 
ATOM   850  C CE2 . PHE A 1 166 ? -25.017 41.947  29.353  1.00 6.61   ? 159 PHE A CE2 1 
ATOM   851  C CZ  . PHE A 1 166 ? -24.529 43.227  29.327  1.00 15.13  ? 159 PHE A CZ  1 
ATOM   852  N N   . GLN A 1 167 ? -21.798 36.895  29.548  1.00 26.71  ? 160 GLN A N   1 
ATOM   853  C CA  . GLN A 1 167 ? -21.386 35.536  29.248  1.00 24.55  ? 160 GLN A CA  1 
ATOM   854  C C   . GLN A 1 167 ? -21.520 35.303  27.760  1.00 31.76  ? 160 GLN A C   1 
ATOM   855  O O   . GLN A 1 167 ? -20.883 34.409  27.207  1.00 35.28  ? 160 GLN A O   1 
ATOM   856  C CB  . GLN A 1 167 ? -22.247 34.524  30.010  1.00 25.58  ? 160 GLN A CB  1 
ATOM   857  C CG  . GLN A 1 167 ? -21.967 34.453  31.509  1.00 23.14  ? 160 GLN A CG  1 
ATOM   858  C CD  . GLN A 1 167 ? -22.649 35.556  32.300  1.00 36.40  ? 160 GLN A CD  1 
ATOM   859  O OE1 . GLN A 1 167 ? -23.777 35.960  32.005  1.00 48.81  ? 160 GLN A OE1 1 
ATOM   860  N NE2 . GLN A 1 167 ? -21.968 36.043  33.316  1.00 33.15  ? 160 GLN A NE2 1 
ATOM   861  N N   . VAL A 1 168 ? -22.373 36.107  27.124  1.00 32.92  ? 161 VAL A N   1 
ATOM   862  C CA  . VAL A 1 168 ? -22.605 36.048  25.677  1.00 27.73  ? 161 VAL A CA  1 
ATOM   863  C C   . VAL A 1 168 ? -22.735 37.456  25.095  1.00 26.12  ? 161 VAL A C   1 
ATOM   864  O O   . VAL A 1 168 ? -23.356 38.340  25.697  1.00 13.58  ? 161 VAL A O   1 
ATOM   865  C CB  . VAL A 1 168 ? -23.881 35.251  25.304  1.00 36.45  ? 161 VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 168 ? -23.922 34.990  23.793  1.00 33.51  ? 161 VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 168 ? -23.960 33.934  26.071  1.00 31.54  ? 161 VAL A CG2 1 
ATOM   868  N N   . VAL A 1 169 ? -22.126 37.660  23.932  1.00 18.62  ? 162 VAL A N   1 
ATOM   869  C CA  . VAL A 1 169 ? -22.223 38.928  23.222  1.00 19.60  ? 162 VAL A CA  1 
ATOM   870  C C   . VAL A 1 169 ? -22.647 38.648  21.790  1.00 22.14  ? 162 VAL A C   1 
ATOM   871  O O   . VAL A 1 169 ? -22.016 37.846  21.109  1.00 25.14  ? 162 VAL A O   1 
ATOM   872  C CB  . VAL A 1 169 ? -20.878 39.675  23.221  1.00 23.40  ? 162 VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 169 ? -20.954 40.922  22.366  1.00 23.79  ? 162 VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 169 ? -20.480 40.034  24.628  1.00 26.79  ? 162 VAL A CG2 1 
ATOM   875  N N   . VAL A 1 170 ? -23.736 39.279  21.351  1.00 26.50  ? 163 VAL A N   1 
ATOM   876  C CA  . VAL A 1 170 ? -24.158 39.240  19.946  1.00 23.27  ? 163 VAL A CA  1 
ATOM   877  C C   . VAL A 1 170 ? -23.851 40.556  19.253  1.00 25.42  ? 163 VAL A C   1 
ATOM   878  O O   . VAL A 1 170 ? -24.258 41.629  19.723  1.00 28.48  ? 163 VAL A O   1 
ATOM   879  C CB  . VAL A 1 170 ? -25.660 38.997  19.799  1.00 23.43  ? 163 VAL A CB  1 
ATOM   880  C CG1 . VAL A 1 170 ? -26.011 38.760  18.334  1.00 18.98  ? 163 VAL A CG1 1 
ATOM   881  C CG2 . VAL A 1 170 ? -26.080 37.819  20.625  1.00 22.67  ? 163 VAL A CG2 1 
ATOM   882  N N   . LEU A 1 171 ? -23.138 40.479  18.131  1.00 28.35  ? 164 LEU A N   1 
ATOM   883  C CA  . LEU A 1 171 ? -22.817 41.675  17.349  1.00 23.58  ? 164 LEU A CA  1 
ATOM   884  C C   . LEU A 1 171 ? -23.623 41.703  16.045  1.00 25.44  ? 164 LEU A C   1 
ATOM   885  O O   . LEU A 1 171 ? -23.663 40.717  15.309  1.00 26.81  ? 164 LEU A O   1 
ATOM   886  C CB  . LEU A 1 171 ? -21.314 41.733  17.053  1.00 15.79  ? 164 LEU A CB  1 
ATOM   887  C CG  . LEU A 1 171 ? -20.360 42.051  18.198  1.00 22.72  ? 164 LEU A CG  1 
ATOM   888  C CD1 . LEU A 1 171 ? -18.947 42.304  17.657  1.00 30.54  ? 164 LEU A CD1 1 
ATOM   889  C CD2 . LEU A 1 171 ? -20.866 43.241  18.981  1.00 21.53  ? 164 LEU A CD2 1 
ATOM   890  N N   . THR A 1 172 ? -24.239 42.846  15.758  1.00 32.52  ? 165 THR A N   1 
ATOM   891  C CA  . THR A 1 172 ? -25.154 43.029  14.627  1.00 23.41  ? 165 THR A CA  1 
ATOM   892  C C   . THR A 1 172 ? -24.864 44.445  14.181  1.00 33.36  ? 165 THR A C   1 
ATOM   893  O O   . THR A 1 172 ? -24.500 45.265  15.024  1.00 31.05  ? 165 THR A O   1 
ATOM   894  C CB  . THR A 1 172 ? -26.631 42.905  15.125  1.00 17.79  ? 165 THR A CB  1 
ATOM   895  O OG1 . THR A 1 172 ? -27.167 41.627  14.770  1.00 31.68  ? 165 THR A OG1 1 
ATOM   896  C CG2 . THR A 1 172 ? -27.522 44.009  14.628  1.00 15.89  ? 165 THR A CG2 1 
ATOM   897  N N   . ASN A 1 173 ? -24.963 44.741  12.880  1.00 39.75  ? 166 ASN A N   1 
ATOM   898  C CA  . ASN A 1 173 ? -24.787 46.119  12.404  1.00 18.52  ? 166 ASN A CA  1 
ATOM   899  C C   . ASN A 1 173 ? -23.454 46.773  12.852  1.00 32.08  ? 166 ASN A C   1 
ATOM   900  O O   . ASN A 1 173 ? -23.373 47.988  13.040  1.00 20.78  ? 166 ASN A O   1 
ATOM   901  C CB  . ASN A 1 173 ? -25.954 46.966  12.909  1.00 14.43  ? 166 ASN A CB  1 
ATOM   902  C CG  . ASN A 1 173 ? -26.210 48.183  12.060  1.00 35.11  ? 166 ASN A CG  1 
ATOM   903  O OD1 . ASN A 1 173 ? -26.448 48.072  10.850  1.00 35.91  ? 166 ASN A OD1 1 
ATOM   904  N ND2 . ASN A 1 173 ? -26.209 49.356  12.695  1.00 24.18  ? 166 ASN A ND2 1 
ATOM   905  N N   . THR A 1 174 ? -22.413 45.966  13.027  1.00 29.73  ? 167 THR A N   1 
ATOM   906  C CA  . THR A 1 174 ? -21.164 46.451  13.592  1.00 21.44  ? 167 THR A CA  1 
ATOM   907  C C   . THR A 1 174 ? -20.042 46.452  12.565  1.00 21.28  ? 167 THR A C   1 
ATOM   908  O O   . THR A 1 174 ? -19.815 45.455  11.888  1.00 22.56  ? 167 THR A O   1 
ATOM   909  C CB  . THR A 1 174 ? -20.755 45.581  14.787  1.00 37.46  ? 167 THR A CB  1 
ATOM   910  O OG1 . THR A 1 174 ? -21.818 45.579  15.750  1.00 41.41  ? 167 THR A OG1 1 
ATOM   911  C CG2 . THR A 1 174 ? -19.474 46.105  15.437  1.00 32.03  ? 167 THR A CG2 1 
ATOM   912  N N   . PRO A 1 175 ? -19.337 47.581  12.441  1.00 21.06  ? 168 PRO A N   1 
ATOM   913  C CA  . PRO A 1 175 ? -18.197 47.710  11.523  1.00 7.13   ? 168 PRO A CA  1 
ATOM   914  C C   . PRO A 1 175 ? -17.141 46.664  11.796  1.00 23.50  ? 168 PRO A C   1 
ATOM   915  O O   . PRO A 1 175 ? -16.986 46.224  12.937  1.00 17.17  ? 168 PRO A O   1 
ATOM   916  C CB  . PRO A 1 175 ? -17.654 49.094  11.833  1.00 10.18  ? 168 PRO A CB  1 
ATOM   917  C CG  . PRO A 1 175 ? -18.864 49.851  12.333  1.00 17.56  ? 168 PRO A CG  1 
ATOM   918  C CD  . PRO A 1 175 ? -19.646 48.845  13.126  1.00 17.90  ? 168 PRO A CD  1 
ATOM   919  N N   . LEU A 1 176 ? -16.430 46.255  10.752  1.00 33.78  ? 169 LEU A N   1 
ATOM   920  C CA  . LEU A 1 176 ? -15.522 45.126  10.874  1.00 24.85  ? 169 LEU A CA  1 
ATOM   921  C C   . LEU A 1 176 ? -14.465 45.326  11.960  1.00 30.39  ? 169 LEU A C   1 
ATOM   922  O O   . LEU A 1 176 ? -14.201 44.409  12.744  1.00 17.93  ? 169 LEU A O   1 
ATOM   923  C CB  . LEU A 1 176 ? -14.839 44.841  9.554   1.00 18.40  ? 169 LEU A CB  1 
ATOM   924  C CG  . LEU A 1 176 ? -13.972 43.590  9.584   1.00 16.19  ? 169 LEU A CG  1 
ATOM   925  C CD1 . LEU A 1 176 ? -14.805 42.401  10.041  1.00 21.95  ? 169 LEU A CD1 1 
ATOM   926  C CD2 . LEU A 1 176 ? -13.438 43.344  8.213   1.00 13.09  ? 169 LEU A CD2 1 
ATOM   927  N N   . GLU A 1 177 ? -13.872 46.518  12.001  1.00 24.79  ? 170 GLU A N   1 
ATOM   928  C CA  . GLU A 1 177 ? -12.844 46.806  12.986  1.00 35.67  ? 170 GLU A CA  1 
ATOM   929  C C   . GLU A 1 177 ? -13.353 46.619  14.415  1.00 39.01  ? 170 GLU A C   1 
ATOM   930  O O   . GLU A 1 177 ? -12.676 46.008  15.249  1.00 37.10  ? 170 GLU A O   1 
ATOM   931  C CB  . GLU A 1 177 ? -12.263 48.206  12.794  1.00 38.85  ? 170 GLU A CB  1 
ATOM   932  C CG  . GLU A 1 177 ? -13.267 49.319  12.857  1.00 57.85  ? 170 GLU A CG  1 
ATOM   933  C CD  . GLU A 1 177 ? -12.601 50.676  12.942  1.00 76.30  ? 170 GLU A CD  1 
ATOM   934  O OE1 . GLU A 1 177 ? -13.327 51.686  13.094  1.00 86.86  ? 170 GLU A OE1 1 
ATOM   935  O OE2 . GLU A 1 177 ? -11.351 50.728  12.861  1.00 70.44  ? 170 GLU A OE2 1 
ATOM   936  N N   . ASP A 1 178 ? -14.552 47.121  14.688  1.00 29.45  ? 171 ASP A N   1 
ATOM   937  C CA  . ASP A 1 178 ? -15.156 46.942  16.002  1.00 27.38  ? 171 ASP A CA  1 
ATOM   938  C C   . ASP A 1 178 ? -15.441 45.475  16.308  1.00 25.03  ? 171 ASP A C   1 
ATOM   939  O O   . ASP A 1 178 ? -15.289 45.037  17.436  1.00 35.39  ? 171 ASP A O   1 
ATOM   940  C CB  . ASP A 1 178 ? -16.410 47.796  16.132  1.00 25.15  ? 171 ASP A CB  1 
ATOM   941  C CG  . ASP A 1 178 ? -16.126 49.260  15.895  1.00 43.56  ? 171 ASP A CG  1 
ATOM   942  O OD1 . ASP A 1 178 ? -16.794 49.868  15.038  1.00 59.21  ? 171 ASP A OD1 1 
ATOM   943  O OD2 . ASP A 1 178 ? -15.219 49.807  16.557  1.00 48.31  ? 171 ASP A OD2 1 
ATOM   944  N N   . GLN A 1 179 ? -15.849 44.718  15.304  1.00 20.84  ? 172 GLN A N   1 
ATOM   945  C CA  . GLN A 1 179 ? -15.991 43.282  15.474  1.00 26.11  ? 172 GLN A CA  1 
ATOM   946  C C   . GLN A 1 179 ? -14.653 42.659  15.898  1.00 28.02  ? 172 GLN A C   1 
ATOM   947  O O   . GLN A 1 179 ? -14.608 41.859  16.819  1.00 22.70  ? 172 GLN A O   1 
ATOM   948  C CB  . GLN A 1 179 ? -16.487 42.621  14.178  1.00 17.79  ? 172 GLN A CB  1 
ATOM   949  C CG  . GLN A 1 179 ? -17.740 43.222  13.574  1.00 12.24  ? 172 GLN A CG  1 
ATOM   950  C CD  . GLN A 1 179 ? -18.320 42.349  12.454  1.00 26.07  ? 172 GLN A CD  1 
ATOM   951  O OE1 . GLN A 1 179 ? -18.023 41.153  12.364  1.00 23.39  ? 172 GLN A OE1 1 
ATOM   952  N NE2 . GLN A 1 179 ? -19.134 42.950  11.589  1.00 26.04  ? 172 GLN A NE2 1 
ATOM   953  N N   . LEU A 1 180 ? -13.563 43.015  15.222  1.00 34.05  ? 173 LEU A N   1 
ATOM   954  C CA  . LEU A 1 180 ? -12.264 42.441  15.555  1.00 29.90  ? 173 LEU A CA  1 
ATOM   955  C C   . LEU A 1 180 ? -11.862 42.847  16.974  1.00 27.02  ? 173 LEU A C   1 
ATOM   956  O O   . LEU A 1 180 ? -11.351 42.033  17.738  1.00 18.38  ? 173 LEU A O   1 
ATOM   957  C CB  . LEU A 1 180 ? -11.196 42.902  14.575  1.00 30.40  ? 173 LEU A CB  1 
ATOM   958  C CG  . LEU A 1 180 ? -11.554 42.921  13.087  1.00 41.18  ? 173 LEU A CG  1 
ATOM   959  C CD1 . LEU A 1 180 ? -10.504 43.687  12.278  1.00 30.86  ? 173 LEU A CD1 1 
ATOM   960  C CD2 . LEU A 1 180 ? -11.725 41.518  12.548  1.00 43.47  ? 173 LEU A CD2 1 
ATOM   961  N N   . ARG A 1 181 ? -12.105 44.110  17.319  1.00 15.15  ? 174 ARG A N   1 
ATOM   962  C CA  . ARG A 1 181 ? -11.748 44.633  18.631  1.00 20.92  ? 174 ARG A CA  1 
ATOM   963  C C   . ARG A 1 181 ? -12.518 43.927  19.739  1.00 29.24  ? 174 ARG A C   1 
ATOM   964  O O   . ARG A 1 181 ? -11.936 43.377  20.672  1.00 35.60  ? 174 ARG A O   1 
ATOM   965  C CB  . ARG A 1 181 ? -12.029 46.133  18.712  1.00 18.70  ? 174 ARG A CB  1 
ATOM   966  C CG  . ARG A 1 181 ? -11.186 46.816  19.760  1.00 20.88  ? 174 ARG A CG  1 
ATOM   967  C CD  . ARG A 1 181 ? -11.892 48.001  20.400  1.00 28.61  ? 174 ARG A CD  1 
ATOM   968  N NE  . ARG A 1 181 ? -12.793 48.726  19.509  1.00 43.27  ? 174 ARG A NE  1 
ATOM   969  C CZ  . ARG A 1 181 ? -14.072 48.967  19.798  1.00 57.40  ? 174 ARG A CZ  1 
ATOM   970  N NH1 . ARG A 1 181 ? -14.592 48.529  20.945  1.00 63.69  ? 174 ARG A NH1 1 
ATOM   971  N NH2 . ARG A 1 181 ? -14.833 49.645  18.948  1.00 55.09  ? 174 ARG A NH2 1 
ATOM   972  N N   . VAL A 1 182 ? -13.837 43.956  19.619  1.00 31.79  ? 175 VAL A N   1 
ATOM   973  C CA  . VAL A 1 182 ? -14.714 43.342  20.591  1.00 27.03  ? 175 VAL A CA  1 
ATOM   974  C C   . VAL A 1 182 ? -14.420 41.856  20.645  1.00 28.31  ? 175 VAL A C   1 
ATOM   975  O O   . VAL A 1 182 ? -14.393 41.260  21.713  1.00 32.72  ? 175 VAL A O   1 
ATOM   976  C CB  . VAL A 1 182 ? -16.189 43.591  20.221  1.00 15.25  ? 175 VAL A CB  1 
ATOM   977  C CG1 . VAL A 1 182 ? -17.083 42.592  20.904  1.00 12.61  ? 175 VAL A CG1 1 
ATOM   978  C CG2 . VAL A 1 182 ? -16.596 45.035  20.556  1.00 6.68   ? 175 VAL A CG2 1 
ATOM   979  N N   . GLY A 1 183 ? -14.146 41.271  19.489  1.00 19.26  ? 176 GLY A N   1 
ATOM   980  C CA  . GLY A 1 183 ? -13.962 39.839  19.399  1.00 19.79  ? 176 GLY A CA  1 
ATOM   981  C C   . GLY A 1 183 ? -12.674 39.348  20.017  1.00 20.99  ? 176 GLY A C   1 
ATOM   982  O O   . GLY A 1 183 ? -12.628 38.245  20.560  1.00 26.28  ? 176 GLY A O   1 
ATOM   983  N N   . GLU A 1 184 ? -11.609 40.138  19.927  1.00 29.26  ? 177 GLU A N   1 
ATOM   984  C CA  . GLU A 1 184 ? -10.356 39.681  20.514  1.00 40.64  ? 177 GLU A CA  1 
ATOM   985  C C   . GLU A 1 184 ? -10.498 39.773  22.025  1.00 33.37  ? 177 GLU A C   1 
ATOM   986  O O   . GLU A 1 184 ? -10.109 38.858  22.746  1.00 33.63  ? 177 GLU A O   1 
ATOM   987  C CB  . GLU A 1 184 ? -9.117  40.414  19.974  1.00 50.39  ? 177 GLU A CB  1 
ATOM   988  C CG  . GLU A 1 184 ? -8.957  41.844  20.436  1.00 73.74  ? 177 GLU A CG  1 
ATOM   989  C CD  . GLU A 1 184 ? -7.512  42.192  20.742  1.00 90.02  ? 177 GLU A CD  1 
ATOM   990  O OE1 . GLU A 1 184 ? -6.621  41.376  20.412  1.00 99.05  ? 177 GLU A OE1 1 
ATOM   991  O OE2 . GLU A 1 184 ? -7.271  43.275  21.323  1.00 88.67  ? 177 GLU A OE2 1 
ATOM   992  N N   . PHE A 1 185 ? -11.115 40.850  22.496  1.00 25.51  ? 178 PHE A N   1 
ATOM   993  C CA  . PHE A 1 185 ? -11.437 40.941  23.907  1.00 32.28  ? 178 PHE A CA  1 
ATOM   994  C C   . PHE A 1 185 ? -12.270 39.761  24.420  1.00 41.90  ? 178 PHE A C   1 
ATOM   995  O O   . PHE A 1 185 ? -11.888 39.101  25.393  1.00 46.78  ? 178 PHE A O   1 
ATOM   996  C CB  . PHE A 1 185 ? -12.157 42.242  24.259  1.00 33.18  ? 178 PHE A CB  1 
ATOM   997  C CG  . PHE A 1 185 ? -12.371 42.390  25.725  1.00 56.26  ? 178 PHE A CG  1 
ATOM   998  C CD1 . PHE A 1 185 ? -11.293 42.677  26.565  1.00 56.25  ? 178 PHE A CD1 1 
ATOM   999  C CD2 . PHE A 1 185 ? -13.616 42.175  26.286  1.00 63.02  ? 178 PHE A CD2 1 
ATOM   1000 C CE1 . PHE A 1 185 ? -11.459 42.786  27.930  1.00 50.38  ? 178 PHE A CE1 1 
ATOM   1001 C CE2 . PHE A 1 185 ? -13.793 42.287  27.665  1.00 73.33  ? 178 PHE A CE2 1 
ATOM   1002 C CZ  . PHE A 1 185 ? -12.712 42.592  28.484  1.00 64.69  ? 178 PHE A CZ  1 
ATOM   1003 N N   . CYS A 1 186 ? -13.406 39.510  23.773  1.00 36.27  ? 179 CYS A N   1 
ATOM   1004 C CA  . CYS A 1 186 ? -14.330 38.478  24.224  1.00 32.21  ? 179 CYS A CA  1 
ATOM   1005 C C   . CYS A 1 186 ? -13.628 37.149  24.311  1.00 21.47  ? 179 CYS A C   1 
ATOM   1006 O O   . CYS A 1 186 ? -13.794 36.400  25.266  1.00 29.11  ? 179 CYS A O   1 
ATOM   1007 C CB  . CYS A 1 186 ? -15.532 38.360  23.286  1.00 29.01  ? 179 CYS A CB  1 
ATOM   1008 S SG  . CYS A 1 186 ? -16.845 39.563  23.617  1.00 29.83  ? 179 CYS A SG  1 
ATOM   1009 N N   . HIS A 1 187 ? -12.826 36.870  23.305  1.00 25.25  ? 180 HIS A N   1 
ATOM   1010 C CA  . HIS A 1 187 ? -12.137 35.604  23.231  1.00 32.78  ? 180 HIS A CA  1 
ATOM   1011 C C   . HIS A 1 187 ? -11.128 35.484  24.367  1.00 41.53  ? 180 HIS A C   1 
ATOM   1012 O O   . HIS A 1 187 ? -10.907 34.396  24.900  1.00 53.55  ? 180 HIS A O   1 
ATOM   1013 C CB  . HIS A 1 187 ? -11.434 35.483  21.886  1.00 25.76  ? 180 HIS A CB  1 
ATOM   1014 C CG  . HIS A 1 187 ? -10.804 34.153  21.673  1.00 28.11  ? 180 HIS A CG  1 
ATOM   1015 N ND1 . HIS A 1 187 ? -11.513 33.059  21.231  1.00 38.95  ? 180 HIS A ND1 1 
ATOM   1016 C CD2 . HIS A 1 187 ? -9.537  33.725  21.858  1.00 31.01  ? 180 HIS A CD2 1 
ATOM   1017 C CE1 . HIS A 1 187 ? -10.710 32.021  21.135  1.00 36.01  ? 180 HIS A CE1 1 
ATOM   1018 N NE2 . HIS A 1 187 ? -9.496  32.401  21.511  1.00 40.88  ? 180 HIS A NE2 1 
ATOM   1019 N N   . ASN A 1 188 ? -10.533 36.618  24.738  1.00 35.09  ? 181 ASN A N   1 
ATOM   1020 C CA  . ASN A 1 188 ? -9.518  36.663  25.783  1.00 36.38  ? 181 ASN A CA  1 
ATOM   1021 C C   . ASN A 1 188 ? -10.104 36.499  27.174  1.00 45.94  ? 181 ASN A C   1 
ATOM   1022 O O   . ASN A 1 188 ? -9.562  35.756  27.992  1.00 44.64  ? 181 ASN A O   1 
ATOM   1023 C CB  . ASN A 1 188 ? -8.712  37.964  25.722  1.00 35.71  ? 181 ASN A CB  1 
ATOM   1024 C CG  . ASN A 1 188 ? -7.624  37.930  24.668  1.00 49.07  ? 181 ASN A CG  1 
ATOM   1025 O OD1 . ASN A 1 188 ? -7.117  36.861  24.307  1.00 52.35  ? 181 ASN A OD1 1 
ATOM   1026 N ND2 . ASN A 1 188 ? -7.260  39.105  24.160  1.00 47.90  ? 181 ASN A ND2 1 
ATOM   1027 N N   . ARG A 1 189 ? -11.201 37.196  27.449  1.00 42.81  ? 182 ARG A N   1 
ATOM   1028 C CA  . ARG A 1 189 ? -11.804 37.091  28.766  1.00 48.92  ? 182 ARG A CA  1 
ATOM   1029 C C   . ARG A 1 189 ? -12.967 36.113  28.818  1.00 47.05  ? 182 ARG A C   1 
ATOM   1030 O O   . ARG A 1 189 ? -13.821 36.200  29.697  1.00 45.27  ? 182 ARG A O   1 
ATOM   1031 C CB  . ARG A 1 189 ? -12.105 38.469  29.377  1.00 58.95  ? 182 ARG A CB  1 
ATOM   1032 C CG  . ARG A 1 189 ? -10.881 38.981  30.187  1.00 79.35  ? 182 ARG A CG  1 
ATOM   1033 C CD  . ARG A 1 189 ? -10.853 40.489  30.449  1.00 81.33  ? 182 ARG A CD  1 
ATOM   1034 N NE  . ARG A 1 189 ? -11.626 40.888  31.626  1.00 86.91  ? 182 ARG A NE  1 
ATOM   1035 C CZ  . ARG A 1 189 ? -11.679 42.129  32.108  1.00 85.38  ? 182 ARG A CZ  1 
ATOM   1036 N NH1 . ARG A 1 189 ? -11.000 43.109  31.522  1.00 86.02  ? 182 ARG A NH1 1 
ATOM   1037 N NH2 . ARG A 1 189 ? -12.410 42.394  33.181  1.00 82.09  ? 182 ARG A NH2 1 
ATOM   1038 N N   . GLY A 1 190 ? -12.957 35.166  27.875  1.00 52.75  ? 183 GLY A N   1 
ATOM   1039 C CA  . GLY A 1 190 ? -13.859 34.022  27.874  1.00 49.66  ? 183 GLY A CA  1 
ATOM   1040 C C   . GLY A 1 190 ? -15.321 34.247  27.501  1.00 42.24  ? 183 GLY A C   1 
ATOM   1041 O O   . GLY A 1 190 ? -16.156 33.356  27.681  1.00 38.86  ? 183 GLY A O   1 
ATOM   1042 N N   . ILE A 1 191 ? -15.642 35.427  26.984  1.00 31.54  ? 184 ILE A N   1 
ATOM   1043 C CA  . ILE A 1 191 ? -17.011 35.736  26.614  1.00 33.67  ? 184 ILE A CA  1 
ATOM   1044 C C   . ILE A 1 191 ? -17.336 35.132  25.256  1.00 30.73  ? 184 ILE A C   1 
ATOM   1045 O O   . ILE A 1 191 ? -16.561 35.259  24.320  1.00 38.63  ? 184 ILE A O   1 
ATOM   1046 C CB  . ILE A 1 191 ? -17.225 37.239  26.570  1.00 30.32  ? 184 ILE A CB  1 
ATOM   1047 C CG1 . ILE A 1 191 ? -16.721 37.849  27.874  1.00 26.58  ? 184 ILE A CG1 1 
ATOM   1048 C CG2 . ILE A 1 191 ? -18.695 37.550  26.322  1.00 21.88  ? 184 ILE A CG2 1 
ATOM   1049 C CD1 . ILE A 1 191 ? -16.789 39.343  27.908  1.00 27.28  ? 184 ILE A CD1 1 
ATOM   1050 N N   . LYS A 1 192 ? -18.475 34.456  25.162  1.00 28.77  ? 185 LYS A N   1 
ATOM   1051 C CA  . LYS A 1 192 ? -18.878 33.785  23.928  1.00 29.00  ? 185 LYS A CA  1 
ATOM   1052 C C   . LYS A 1 192 ? -19.503 34.763  22.936  1.00 21.21  ? 185 LYS A C   1 
ATOM   1053 O O   . LYS A 1 192 ? -20.388 35.542  23.294  1.00 23.48  ? 185 LYS A O   1 
ATOM   1054 C CB  . LYS A 1 192 ? -19.844 32.646  24.226  1.00 31.49  ? 185 LYS A CB  1 
ATOM   1055 C CG  . LYS A 1 192 ? -19.201 31.467  24.886  1.00 29.52  ? 185 LYS A CG  1 
ATOM   1056 C CD  . LYS A 1 192 ? -20.244 30.461  25.275  1.00 37.21  ? 185 LYS A CD  1 
ATOM   1057 C CE  . LYS A 1 192 ? -19.631 29.229  25.901  1.00 40.39  ? 185 LYS A CE  1 
ATOM   1058 N NZ  . LYS A 1 192 ? -20.705 28.243  26.154  1.00 49.54  ? 185 LYS A NZ  1 
ATOM   1059 N N   . LEU A 1 193 ? -19.025 34.705  21.694  1.00 19.99  ? 186 LEU A N   1 
ATOM   1060 C CA  . LEU A 1 193 ? -19.340 35.687  20.657  1.00 25.94  ? 186 LEU A CA  1 
ATOM   1061 C C   . LEU A 1 193 ? -20.220 35.113  19.533  1.00 30.24  ? 186 LEU A C   1 
ATOM   1062 O O   . LEU A 1 193 ? -19.882 34.092  18.911  1.00 26.68  ? 186 LEU A O   1 
ATOM   1063 C CB  . LEU A 1 193 ? -18.042 36.177  20.022  1.00 24.27  ? 186 LEU A CB  1 
ATOM   1064 C CG  . LEU A 1 193 ? -17.806 37.674  19.845  1.00 25.21  ? 186 LEU A CG  1 
ATOM   1065 C CD1 . LEU A 1 193 ? -17.020 37.934  18.555  1.00 18.00  ? 186 LEU A CD1 1 
ATOM   1066 C CD2 . LEU A 1 193 ? -19.093 38.466  19.892  1.00 28.18  ? 186 LEU A CD2 1 
ATOM   1067 N N   . VAL A 1 194 ? -21.344 35.769  19.268  1.00 20.09  ? 187 VAL A N   1 
ATOM   1068 C CA  . VAL A 1 194 ? -22.070 35.501  18.036  1.00 20.77  ? 187 VAL A CA  1 
ATOM   1069 C C   . VAL A 1 194 ? -22.110 36.764  17.178  1.00 20.45  ? 187 VAL A C   1 
ATOM   1070 O O   . VAL A 1 194 ? -22.539 37.829  17.643  1.00 19.18  ? 187 VAL A O   1 
ATOM   1071 C CB  . VAL A 1 194 ? -23.479 34.947  18.316  1.00 19.76  ? 187 VAL A CB  1 
ATOM   1072 C CG1 . VAL A 1 194 ? -24.248 34.727  17.016  1.00 5.43   ? 187 VAL A CG1 1 
ATOM   1073 C CG2 . VAL A 1 194 ? -23.364 33.645  19.081  1.00 18.88  ? 187 VAL A CG2 1 
ATOM   1074 N N   . VAL A 1 195 ? -21.626 36.652  15.939  1.00 22.22  ? 188 VAL A N   1 
ATOM   1075 C CA  . VAL A 1 195 ? -21.706 37.760  14.966  1.00 21.08  ? 188 VAL A CA  1 
ATOM   1076 C C   . VAL A 1 195 ? -22.641 37.408  13.815  1.00 21.73  ? 188 VAL A C   1 
ATOM   1077 O O   . VAL A 1 195 ? -22.496 36.355  13.194  1.00 18.48  ? 188 VAL A O   1 
ATOM   1078 C CB  . VAL A 1 195 ? -20.324 38.163  14.416  1.00 20.23  ? 188 VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 195 ? -20.475 39.163  13.286  1.00 25.80  ? 188 VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 195 ? -19.478 38.764  15.524  1.00 19.60  ? 188 VAL A CG2 1 
ATOM   1081 N N   . ALA A 1 196 ? -23.612 38.276  13.547  1.00 23.28  ? 189 ALA A N   1 
ATOM   1082 C CA  . ALA A 1 196 ? -24.654 37.970  12.562  1.00 22.86  ? 189 ALA A CA  1 
ATOM   1083 C C   . ALA A 1 196 ? -24.881 39.139  11.634  1.00 24.33  ? 189 ALA A C   1 
ATOM   1084 O O   . ALA A 1 196 ? -24.832 40.296  12.058  1.00 27.30  ? 189 ALA A O   1 
ATOM   1085 C CB  . ALA A 1 196 ? -25.953 37.583  13.248  1.00 21.42  ? 189 ALA A CB  1 
ATOM   1086 N N   . ASP A 1 197 ? -25.127 38.839  10.362  1.00 22.86  ? 190 ASP A N   1 
ATOM   1087 C CA  . ASP A 1 197 ? -25.221 39.899  9.367   1.00 23.08  ? 190 ASP A CA  1 
ATOM   1088 C C   . ASP A 1 197 ? -26.056 39.506  8.155   1.00 32.89  ? 190 ASP A C   1 
ATOM   1089 O O   . ASP A 1 197 ? -26.056 38.349  7.714   1.00 36.02  ? 190 ASP A O   1 
ATOM   1090 C CB  . ASP A 1 197 ? -23.827 40.370  8.943   1.00 17.72  ? 190 ASP A CB  1 
ATOM   1091 C CG  . ASP A 1 197 ? -23.859 41.707  8.204   1.00 46.96  ? 190 ASP A CG  1 
ATOM   1092 O OD1 . ASP A 1 197 ? -24.927 42.373  8.230   1.00 52.58  ? 190 ASP A OD1 1 
ATOM   1093 O OD2 . ASP A 1 197 ? -22.816 42.094  7.606   1.00 44.59  ? 190 ASP A OD2 1 
ATOM   1094 N N   . THR A 1 198 ? -26.760 40.492  7.614   1.00 34.29  ? 191 THR A N   1 
ATOM   1095 C CA  . THR A 1 198 ? -27.634 40.295  6.464   1.00 31.96  ? 191 THR A CA  1 
ATOM   1096 C C   . THR A 1 198 ? -27.362 41.378  5.431   1.00 25.66  ? 191 THR A C   1 
ATOM   1097 O O   . THR A 1 198 ? -27.466 42.576  5.720   1.00 25.05  ? 191 THR A O   1 
ATOM   1098 C CB  . THR A 1 198 ? -29.125 40.299  6.894   1.00 32.60  ? 191 THR A CB  1 
ATOM   1099 O OG1 . THR A 1 198 ? -29.536 38.950  7.140   1.00 42.97  ? 191 THR A OG1 1 
ATOM   1100 C CG2 . THR A 1 198 ? -30.012 40.891  5.818   1.00 47.13  ? 191 THR A CG2 1 
ATOM   1101 N N   . ARG A 1 199 ? -26.983 40.971  4.226   1.00 30.49  ? 192 ARG A N   1 
ATOM   1102 C CA  . ARG A 1 199 ? -26.791 41.952  3.156   1.00 36.58  ? 192 ARG A CA  1 
ATOM   1103 C C   . ARG A 1 199 ? -27.628 41.597  1.948   1.00 27.16  ? 192 ARG A C   1 
ATOM   1104 O O   . ARG A 1 199 ? -27.225 40.789  1.106   1.00 24.44  ? 192 ARG A O   1 
ATOM   1105 C CB  . ARG A 1 199 ? -25.317 42.118  2.837   1.00 33.02  ? 192 ARG A CB  1 
ATOM   1106 C CG  . ARG A 1 199 ? -24.556 42.352  4.125   1.00 42.19  ? 192 ARG A CG  1 
ATOM   1107 C CD  . ARG A 1 199 ? -23.314 43.128  3.938   1.00 54.10  ? 192 ARG A CD  1 
ATOM   1108 N NE  . ARG A 1 199 ? -23.510 44.557  4.139   1.00 54.12  ? 192 ARG A NE  1 
ATOM   1109 C CZ  . ARG A 1 199 ? -23.100 45.205  5.223   1.00 45.70  ? 192 ARG A CZ  1 
ATOM   1110 N NH1 . ARG A 1 199 ? -22.496 44.535  6.203   1.00 33.50  ? 192 ARG A NH1 1 
ATOM   1111 N NH2 . ARG A 1 199 ? -23.291 46.518  5.325   1.00 40.40  ? 192 ARG A NH2 1 
ATOM   1112 N N   . GLY A 1 200 ? -28.816 42.198  1.910   1.00 21.63  ? 193 GLY A N   1 
ATOM   1113 C CA  . GLY A 1 200 ? -29.881 41.790  1.011   1.00 24.73  ? 193 GLY A CA  1 
ATOM   1114 C C   . GLY A 1 200 ? -30.300 40.334  1.137   1.00 23.71  ? 193 GLY A C   1 
ATOM   1115 O O   . GLY A 1 200 ? -30.845 39.905  2.154   1.00 36.34  ? 193 GLY A O   1 
ATOM   1116 N N   . LEU A 1 201 ? -30.029 39.585  0.078   1.00 22.17  ? 194 LEU A N   1 
ATOM   1117 C CA  . LEU A 1 201 ? -30.338 38.169  -0.031  1.00 34.31  ? 194 LEU A CA  1 
ATOM   1118 C C   . LEU A 1 201 ? -29.312 37.280  0.677   1.00 33.45  ? 194 LEU A C   1 
ATOM   1119 O O   . LEU A 1 201 ? -29.503 36.063  0.782   1.00 36.83  ? 194 LEU A O   1 
ATOM   1120 C CB  . LEU A 1 201 ? -30.333 37.780  -1.515  1.00 38.50  ? 194 LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 201 ? -31.562 37.908  -2.411  1.00 47.31  ? 194 LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 201 ? -32.096 39.316  -2.500  1.00 40.83  ? 194 LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 201 ? -31.195 37.407  -3.791  1.00 64.73  ? 194 LEU A CD2 1 
ATOM   1124 N N   . PHE A 1 202 ? -28.200 37.870  1.107   1.00 25.61  ? 195 PHE A N   1 
ATOM   1125 C CA  . PHE A 1 202 ? -27.120 37.087  1.707   1.00 25.39  ? 195 PHE A CA  1 
ATOM   1126 C C   . PHE A 1 202 ? -27.000 37.257  3.217   1.00 28.22  ? 195 PHE A C   1 
ATOM   1127 O O   . PHE A 1 202 ? -27.297 38.321  3.786   1.00 30.62  ? 195 PHE A O   1 
ATOM   1128 C CB  . PHE A 1 202 ? -25.788 37.437  1.075   1.00 29.55  ? 195 PHE A CB  1 
ATOM   1129 C CG  . PHE A 1 202 ? -25.711 37.135  -0.386  1.00 27.90  ? 195 PHE A CG  1 
ATOM   1130 C CD1 . PHE A 1 202 ? -26.024 38.114  -1.327  1.00 20.78  ? 195 PHE A CD1 1 
ATOM   1131 C CD2 . PHE A 1 202 ? -25.300 35.875  -0.822  1.00 26.99  ? 195 PHE A CD2 1 
ATOM   1132 C CE1 . PHE A 1 202 ? -25.936 37.846  -2.687  1.00 23.48  ? 195 PHE A CE1 1 
ATOM   1133 C CE2 . PHE A 1 202 ? -25.210 35.589  -2.172  1.00 25.87  ? 195 PHE A CE2 1 
ATOM   1134 C CZ  . PHE A 1 202 ? -25.536 36.578  -3.118  1.00 27.15  ? 195 PHE A CZ  1 
ATOM   1135 N N   . GLY A 1 203 ? -26.549 36.197  3.865   1.00 17.59  ? 196 GLY A N   1 
ATOM   1136 C CA  . GLY A 1 203 ? -26.423 36.211  5.305   1.00 24.38  ? 196 GLY A CA  1 
ATOM   1137 C C   . GLY A 1 203 ? -25.114 35.618  5.767   1.00 32.75  ? 196 GLY A C   1 
ATOM   1138 O O   . GLY A 1 203 ? -24.523 34.739  5.119   1.00 26.69  ? 196 GLY A O   1 
ATOM   1139 N N   . GLN A 1 204 ? -24.655 36.110  6.906   1.00 25.27  ? 197 GLN A N   1 
ATOM   1140 C CA  . GLN A 1 204 ? -23.425 35.620  7.477   1.00 19.64  ? 197 GLN A CA  1 
ATOM   1141 C C   . GLN A 1 204 ? -23.615 35.343  8.961   1.00 19.67  ? 197 GLN A C   1 
ATOM   1142 O O   . GLN A 1 204 ? -24.311 36.080  9.666   1.00 20.16  ? 197 GLN A O   1 
ATOM   1143 C CB  . GLN A 1 204 ? -22.325 36.652  7.243   1.00 27.15  ? 197 GLN A CB  1 
ATOM   1144 C CG  . GLN A 1 204 ? -21.151 36.594  8.205   1.00 23.73  ? 197 GLN A CG  1 
ATOM   1145 C CD  . GLN A 1 204 ? -20.375 37.881  8.168   1.00 33.41  ? 197 GLN A CD  1 
ATOM   1146 O OE1 . GLN A 1 204 ? -20.795 38.891  8.742   1.00 37.73  ? 197 GLN A OE1 1 
ATOM   1147 N NE2 . GLN A 1 204 ? -19.248 37.869  7.467   1.00 29.09  ? 197 GLN A NE2 1 
ATOM   1148 N N   . LEU A 1 205 ? -22.999 34.270  9.433   1.00 19.68  ? 198 LEU A N   1 
ATOM   1149 C CA  . LEU A 1 205 ? -23.082 33.910  10.835  1.00 15.15  ? 198 LEU A CA  1 
ATOM   1150 C C   . LEU A 1 205 ? -21.724 33.453  11.316  1.00 21.47  ? 198 LEU A C   1 
ATOM   1151 O O   . LEU A 1 205 ? -21.121 32.556  10.719  1.00 16.19  ? 198 LEU A O   1 
ATOM   1152 C CB  . LEU A 1 205 ? -24.083 32.783  11.026  1.00 28.84  ? 198 LEU A CB  1 
ATOM   1153 C CG  . LEU A 1 205 ? -25.321 33.125  11.831  1.00 45.86  ? 198 LEU A CG  1 
ATOM   1154 C CD1 . LEU A 1 205 ? -26.299 31.988  11.731  1.00 49.99  ? 198 LEU A CD1 1 
ATOM   1155 C CD2 . LEU A 1 205 ? -24.919 33.358  13.267  1.00 53.78  ? 198 LEU A CD2 1 
ATOM   1156 N N   . PHE A 1 206 ? -21.252 34.071  12.398  1.00 16.50  ? 199 PHE A N   1 
ATOM   1157 C CA  . PHE A 1 206 ? -20.020 33.655  13.038  1.00 17.62  ? 199 PHE A CA  1 
ATOM   1158 C C   . PHE A 1 206 ? -20.166 33.319  14.532  1.00 28.72  ? 199 PHE A C   1 
ATOM   1159 O O   . PHE A 1 206 ? -20.945 33.954  15.247  1.00 37.41  ? 199 PHE A O   1 
ATOM   1160 C CB  . PHE A 1 206 ? -18.908 34.694  12.845  1.00 20.64  ? 199 PHE A CB  1 
ATOM   1161 C CG  . PHE A 1 206 ? -17.647 34.342  13.586  1.00 33.05  ? 199 PHE A CG  1 
ATOM   1162 C CD1 . PHE A 1 206 ? -16.745 33.448  13.042  1.00 32.99  ? 199 PHE A CD1 1 
ATOM   1163 C CD2 . PHE A 1 206 ? -17.403 34.848  14.858  1.00 35.88  ? 199 PHE A CD2 1 
ATOM   1164 C CE1 . PHE A 1 206 ? -15.604 33.093  13.726  1.00 37.08  ? 199 PHE A CE1 1 
ATOM   1165 C CE2 . PHE A 1 206 ? -16.270 34.502  15.543  1.00 39.01  ? 199 PHE A CE2 1 
ATOM   1166 C CZ  . PHE A 1 206 ? -15.365 33.627  14.977  1.00 40.86  ? 199 PHE A CZ  1 
ATOM   1167 N N   . CYS A 1 207 ? -19.386 32.340  14.994  1.00 21.53  ? 200 CYS A N   1 
ATOM   1168 C CA  . CYS A 1 207 ? -19.386 31.927  16.397  1.00 26.31  ? 200 CYS A CA  1 
ATOM   1169 C C   . CYS A 1 207 ? -17.975 31.635  16.912  1.00 31.93  ? 200 CYS A C   1 
ATOM   1170 O O   . CYS A 1 207 ? -17.225 30.857  16.319  1.00 39.00  ? 200 CYS A O   1 
ATOM   1171 C CB  . CYS A 1 207 ? -20.229 30.662  16.608  1.00 22.07  ? 200 CYS A CB  1 
ATOM   1172 S SG  . CYS A 1 207 ? -21.993 30.814  16.408  1.00 25.10  ? 200 CYS A SG  1 
ATOM   1173 N N   . ASP A 1 208 ? -17.633 32.247  18.035  1.00 22.30  ? 201 ASP A N   1 
ATOM   1174 C CA  . ASP A 1 208 ? -16.437 31.896  18.769  1.00 21.89  ? 201 ASP A CA  1 
ATOM   1175 C C   . ASP A 1 208 ? -16.887 31.628  20.202  1.00 28.23  ? 201 ASP A C   1 
ATOM   1176 O O   . ASP A 1 208 ? -17.060 32.561  21.000  1.00 28.96  ? 201 ASP A O   1 
ATOM   1177 C CB  . ASP A 1 208 ? -15.417 33.035  18.712  1.00 19.12  ? 201 ASP A CB  1 
ATOM   1178 C CG  . ASP A 1 208 ? -14.383 32.958  19.833  1.00 35.37  ? 201 ASP A CG  1 
ATOM   1179 O OD1 . ASP A 1 208 ? -14.001 31.841  20.255  1.00 32.28  ? 201 ASP A OD1 1 
ATOM   1180 O OD2 . ASP A 1 208 ? -13.962 34.031  20.312  1.00 41.84  ? 201 ASP A OD2 1 
ATOM   1181 N N   . PHE A 1 209 ? -17.106 30.357  20.525  1.00 36.09  ? 202 PHE A N   1 
ATOM   1182 C CA  . PHE A 1 209 ? -17.484 29.985  21.892  1.00 45.54  ? 202 PHE A CA  1 
ATOM   1183 C C   . PHE A 1 209 ? -16.240 29.724  22.733  1.00 50.03  ? 202 PHE A C   1 
ATOM   1184 O O   . PHE A 1 209 ? -16.286 28.983  23.712  1.00 48.54  ? 202 PHE A O   1 
ATOM   1185 C CB  . PHE A 1 209 ? -18.412 28.767  21.930  1.00 40.22  ? 202 PHE A CB  1 
ATOM   1186 C CG  . PHE A 1 209 ? -19.807 29.028  21.406  1.00 40.17  ? 202 PHE A CG  1 
ATOM   1187 C CD1 . PHE A 1 209 ? -20.129 30.225  20.778  1.00 38.02  ? 202 PHE A CD1 1 
ATOM   1188 C CD2 . PHE A 1 209 ? -20.796 28.067  21.537  1.00 35.26  ? 202 PHE A CD2 1 
ATOM   1189 C CE1 . PHE A 1 209 ? -21.398 30.449  20.281  1.00 27.15  ? 202 PHE A CE1 1 
ATOM   1190 C CE2 . PHE A 1 209 ? -22.071 28.297  21.052  1.00 37.60  ? 202 PHE A CE2 1 
ATOM   1191 C CZ  . PHE A 1 209 ? -22.367 29.489  20.415  1.00 28.65  ? 202 PHE A CZ  1 
ATOM   1192 N N   . GLY A 1 210 ? -15.133 30.344  22.335  1.00 50.30  ? 203 GLY A N   1 
ATOM   1193 C CA  . GLY A 1 210 ? -13.909 30.296  23.099  1.00 47.38  ? 203 GLY A CA  1 
ATOM   1194 C C   . GLY A 1 210 ? -13.170 28.996  22.910  1.00 59.43  ? 203 GLY A C   1 
ATOM   1195 O O   . GLY A 1 210 ? -13.782 27.959  22.687  1.00 40.14  ? 203 GLY A O   1 
ATOM   1196 N N   . GLU A 1 211 ? -11.842 29.044  23.038  1.00 94.75  ? 204 GLU A N   1 
ATOM   1197 C CA  . GLU A 1 211 ? -10.988 27.884  22.753  1.00 110.87 ? 204 GLU A CA  1 
ATOM   1198 C C   . GLU A 1 211 ? -11.325 26.648  23.593  1.00 117.85 ? 204 GLU A C   1 
ATOM   1199 O O   . GLU A 1 211 ? -10.617 25.640  23.531  1.00 125.68 ? 204 GLU A O   1 
ATOM   1200 C CB  . GLU A 1 211 ? -9.490  28.233  22.859  1.00 111.38 ? 204 GLU A CB  1 
ATOM   1201 C CG  . GLU A 1 211 ? -9.029  29.271  21.838  1.00 115.60 ? 204 GLU A CG  1 
ATOM   1202 C CD  . GLU A 1 211 ? -7.540  29.224  21.516  1.00 113.36 ? 204 GLU A CD  1 
ATOM   1203 O OE1 . GLU A 1 211 ? -6.897  28.190  21.793  1.00 122.21 ? 204 GLU A OE1 1 
ATOM   1204 O OE2 . GLU A 1 211 ? -7.020  30.226  20.972  1.00 97.12  ? 204 GLU A OE2 1 
ATOM   1205 N N   . GLU A 1 212 ? -12.408 26.732  24.365  1.00 100.56 ? 205 GLU A N   1 
ATOM   1206 C CA  . GLU A 1 212 ? -12.926 25.590  25.090  1.00 88.90  ? 205 GLU A CA  1 
ATOM   1207 C C   . GLU A 1 212 ? -14.450 25.517  25.031  1.00 58.99  ? 205 GLU A C   1 
ATOM   1208 O O   . GLU A 1 212 ? -15.145 26.442  25.436  1.00 53.67  ? 205 GLU A O   1 
ATOM   1209 C CB  . GLU A 1 212 ? -12.450 25.611  26.546  1.00 110.53 ? 205 GLU A CB  1 
ATOM   1210 C CG  . GLU A 1 212 ? -11.173 24.807  26.813  1.00 119.82 ? 205 GLU A CG  1 
ATOM   1211 C CD  . GLU A 1 212 ? -9.924  25.466  26.256  1.00 121.56 ? 205 GLU A CD  1 
ATOM   1212 O OE1 . GLU A 1 212 ? -9.878  26.714  26.203  1.00 119.85 ? 205 GLU A OE1 1 
ATOM   1213 O OE2 . GLU A 1 212 ? -8.996  24.734  25.849  1.00 122.55 ? 205 GLU A OE2 1 
ATOM   1214 N N   . MET A 1 213 ? -14.951 24.403  24.509  1.00 46.55  ? 206 MET A N   1 
ATOM   1215 C CA  . MET A 1 213 ? -16.359 24.038  24.598  1.00 39.16  ? 206 MET A CA  1 
ATOM   1216 C C   . MET A 1 213 ? -16.455 22.516  24.573  1.00 45.30  ? 206 MET A C   1 
ATOM   1217 O O   . MET A 1 213 ? -15.938 21.878  23.659  1.00 46.68  ? 206 MET A O   1 
ATOM   1218 C CB  . MET A 1 213 ? -17.160 24.613  23.424  1.00 37.68  ? 206 MET A CB  1 
ATOM   1219 C CG  . MET A 1 213 ? -17.965 25.880  23.721  1.00 48.45  ? 206 MET A CG  1 
ATOM   1220 S SD  . MET A 1 213 ? -19.567 25.724  24.567  1.00 55.84  ? 206 MET A SD  1 
ATOM   1221 C CE  . MET A 1 213 ? -18.996 25.685  26.266  1.00 129.75 ? 206 MET A CE  1 
ATOM   1222 N N   . ILE A 1 214 ? -17.098 21.926  25.576  1.00 51.48  ? 207 ILE A N   1 
ATOM   1223 C CA  . ILE A 1 214 ? -17.279 20.473  25.596  1.00 58.23  ? 207 ILE A CA  1 
ATOM   1224 C C   . ILE A 1 214 ? -18.483 20.131  24.714  1.00 56.67  ? 207 ILE A C   1 
ATOM   1225 O O   . ILE A 1 214 ? -19.596 20.521  25.019  1.00 57.40  ? 207 ILE A O   1 
ATOM   1226 C CB  . ILE A 1 214 ? -17.452 19.921  27.053  1.00 51.97  ? 207 ILE A CB  1 
ATOM   1227 C CG1 . ILE A 1 214 ? -16.128 19.952  27.816  1.00 50.62  ? 207 ILE A CG1 1 
ATOM   1228 C CG2 . ILE A 1 214 ? -17.956 18.484  27.043  1.00 51.60  ? 207 ILE A CG2 1 
ATOM   1229 C CD1 . ILE A 1 214 ? -15.189 18.811  27.455  1.00 50.12  ? 207 ILE A CD1 1 
ATOM   1230 N N   . LEU A 1 215 ? -18.260 19.427  23.610  1.00 58.27  ? 208 LEU A N   1 
ATOM   1231 C CA  . LEU A 1 215 ? -19.344 19.156  22.658  1.00 57.23  ? 208 LEU A CA  1 
ATOM   1232 C C   . LEU A 1 215 ? -19.724 17.689  22.563  1.00 60.07  ? 208 LEU A C   1 
ATOM   1233 O O   . LEU A 1 215 ? -18.854 16.826  22.506  1.00 71.93  ? 208 LEU A O   1 
ATOM   1234 C CB  . LEU A 1 215 ? -18.985 19.672  21.260  1.00 51.77  ? 208 LEU A CB  1 
ATOM   1235 C CG  . LEU A 1 215 ? -19.372 21.132  21.046  1.00 67.78  ? 208 LEU A CG  1 
ATOM   1236 C CD1 . LEU A 1 215 ? -20.457 21.540  22.031  1.00 77.19  ? 208 LEU A CD1 1 
ATOM   1237 C CD2 . LEU A 1 215 ? -18.186 22.054  21.175  1.00 71.27  ? 208 LEU A CD2 1 
ATOM   1238 N N   . THR A 1 216 ? -21.024 17.409  22.525  1.00 53.28  ? 209 THR A N   1 
ATOM   1239 C CA  . THR A 1 216 ? -21.498 16.030  22.387  1.00 58.89  ? 209 THR A CA  1 
ATOM   1240 C C   . THR A 1 216 ? -21.546 15.637  20.903  1.00 59.71  ? 209 THR A C   1 
ATOM   1241 O O   . THR A 1 216 ? -21.966 16.435  20.068  1.00 61.30  ? 209 THR A O   1 
ATOM   1242 C CB  . THR A 1 216 ? -22.879 15.812  23.087  1.00 76.10  ? 209 THR A CB  1 
ATOM   1243 O OG1 . THR A 1 216 ? -23.611 17.039  23.086  1.00 88.09  ? 209 THR A OG1 1 
ATOM   1244 C CG2 . THR A 1 216 ? -22.712 15.372  24.539  1.00 59.90  ? 209 THR A CG2 1 
ATOM   1245 N N   . ASP A 1 217 ? -21.101 14.421  20.578  1.00 60.23  ? 210 ASP A N   1 
ATOM   1246 C CA  . ASP A 1 217 ? -21.042 13.976  19.185  1.00 62.48  ? 210 ASP A CA  1 
ATOM   1247 C C   . ASP A 1 217 ? -21.358 12.494  18.997  1.00 68.10  ? 210 ASP A C   1 
ATOM   1248 O O   . ASP A 1 217 ? -21.156 11.696  19.915  1.00 71.25  ? 210 ASP A O   1 
ATOM   1249 C CB  . ASP A 1 217 ? -19.658 14.242  18.596  1.00 70.28  ? 210 ASP A CB  1 
ATOM   1250 C CG  . ASP A 1 217 ? -18.803 12.979  18.523  1.00 94.34  ? 210 ASP A CG  1 
ATOM   1251 O OD1 . ASP A 1 217 ? -18.872 12.256  17.502  1.00 103.68 ? 210 ASP A OD1 1 
ATOM   1252 O OD2 . ASP A 1 217 ? -18.064 12.703  19.492  1.00 102.20 ? 210 ASP A OD2 1 
ATOM   1253 N N   . SER A 1 218 ? -21.859 12.180  17.794  1.00 66.32  ? 211 SER A N   1 
ATOM   1254 C CA  . SER A 1 218 ? -21.953 10.840  17.179  1.00 65.79  ? 211 SER A CA  1 
ATOM   1255 C C   . SER A 1 218 ? -23.036 10.814  16.093  1.00 67.18  ? 211 SER A C   1 
ATOM   1256 O O   . SER A 1 218 ? -24.183 11.208  16.321  1.00 62.50  ? 211 SER A O   1 
ATOM   1257 C CB  . SER A 1 218 ? -22.196 9.706   18.177  1.00 68.76  ? 211 SER A CB  1 
ATOM   1258 O OG  . SER A 1 218 ? -22.140 8.440   17.538  1.00 72.76  ? 211 SER A OG  1 
ATOM   1259 N N   . PRO A 1 223 ? -19.544 4.268   20.349  1.00 83.81  ? 216 PRO A N   1 
ATOM   1260 C CA  . PRO A 1 223 ? -20.303 3.220   19.646  1.00 87.73  ? 216 PRO A CA  1 
ATOM   1261 C C   . PRO A 1 223 ? -19.969 1.827   20.189  1.00 94.75  ? 216 PRO A C   1 
ATOM   1262 O O   . PRO A 1 223 ? -20.503 0.815   19.714  1.00 93.04  ? 216 PRO A O   1 
ATOM   1263 C CB  . PRO A 1 223 ? -19.838 3.372   18.193  1.00 20.00  ? 216 PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 223 ? -18.277 3.785   18.353  1.00 20.00  ? 216 PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 223 ? -18.202 4.497   19.764  1.00 20.00  ? 216 PRO A CD  1 
ATOM   1266 N N   . LEU A 1 224 ? -19.085 1.796   21.184  1.00 95.34  ? 217 LEU A N   1 
ATOM   1267 C CA  . LEU A 1 224 ? -18.750 0.567   21.883  1.00 89.50  ? 217 LEU A CA  1 
ATOM   1268 C C   . LEU A 1 224 ? -19.905 0.159   22.787  1.00 84.29  ? 217 LEU A C   1 
ATOM   1269 O O   . LEU A 1 224 ? -20.532 0.995   23.442  1.00 81.75  ? 217 LEU A O   1 
ATOM   1270 C CB  . LEU A 1 224 ? -17.444 0.717   22.683  1.00 89.24  ? 217 LEU A CB  1 
ATOM   1271 C CG  . LEU A 1 224 ? -17.310 1.762   23.800  1.00 90.51  ? 217 LEU A CG  1 
ATOM   1272 C CD1 . LEU A 1 224 ? -16.209 1.357   24.770  1.00 95.44  ? 217 LEU A CD1 1 
ATOM   1273 C CD2 . LEU A 1 224 ? -17.030 3.155   23.256  1.00 88.21  ? 217 LEU A CD2 1 
ATOM   1274 N N   . SER A 1 225 ? -20.183 -1.137  22.812  1.00 86.23  ? 218 SER A N   1 
ATOM   1275 C CA  . SER A 1 225 ? -21.305 -1.661  23.569  1.00 84.12  ? 218 SER A CA  1 
ATOM   1276 C C   . SER A 1 225 ? -20.827 -2.601  24.665  1.00 85.56  ? 218 SER A C   1 
ATOM   1277 O O   . SER A 1 225 ? -19.703 -3.099  24.625  1.00 81.28  ? 218 SER A O   1 
ATOM   1278 C CB  . SER A 1 225 ? -22.250 -2.400  22.624  1.00 78.77  ? 218 SER A CB  1 
ATOM   1279 O OG  . SER A 1 225 ? -22.403 -1.671  21.417  1.00 81.96  ? 218 SER A OG  1 
ATOM   1280 N N   . ALA A 1 226 ? -21.686 -2.829  25.652  1.00 88.87  ? 219 ALA A N   1 
ATOM   1281 C CA  . ALA A 1 226 ? -21.450 -3.856  26.662  1.00 89.07  ? 219 ALA A CA  1 
ATOM   1282 C C   . ALA A 1 226 ? -22.693 -4.733  26.795  1.00 87.07  ? 219 ALA A C   1 
ATOM   1283 O O   . ALA A 1 226 ? -23.702 -4.499  26.129  1.00 81.57  ? 219 ALA A O   1 
ATOM   1284 C CB  . ALA A 1 226 ? -21.085 -3.230  28.003  1.00 86.92  ? 219 ALA A CB  1 
ATOM   1285 N N   . MET A 1 227 ? -22.622 -5.742  27.653  1.00 90.62  ? 220 MET A N   1 
ATOM   1286 C CA  . MET A 1 227 ? -23.756 -6.635  27.849  1.00 93.79  ? 220 MET A CA  1 
ATOM   1287 C C   . MET A 1 227 ? -24.260 -6.605  29.288  1.00 98.64  ? 220 MET A C   1 
ATOM   1288 O O   . MET A 1 227 ? -23.587 -7.088  30.199  1.00 105.28 ? 220 MET A O   1 
ATOM   1289 C CB  . MET A 1 227 ? -23.386 -8.059  27.440  1.00 93.52  ? 220 MET A CB  1 
ATOM   1290 C CG  . MET A 1 227 ? -23.554 -8.335  25.956  1.00 93.26  ? 220 MET A CG  1 
ATOM   1291 S SD  . MET A 1 227 ? -25.285 -8.300  25.452  1.00 107.66 ? 220 MET A SD  1 
ATOM   1292 C CE  . MET A 1 227 ? -26.028 -9.248  26.790  1.00 52.96  ? 220 MET A CE  1 
ATOM   1293 N N   . VAL A 1 228 ? -25.450 -6.041  29.483  1.00 92.67  ? 221 VAL A N   1 
ATOM   1294 C CA  . VAL A 1 228 ? -25.991 -5.841  30.823  1.00 86.18  ? 221 VAL A CA  1 
ATOM   1295 C C   . VAL A 1 228 ? -26.081 -7.144  31.595  1.00 91.69  ? 221 VAL A C   1 
ATOM   1296 O O   . VAL A 1 228 ? -26.815 -8.055  31.211  1.00 92.26  ? 221 VAL A O   1 
ATOM   1297 C CB  . VAL A 1 228 ? -27.384 -5.182  30.795  1.00 71.38  ? 221 VAL A CB  1 
ATOM   1298 C CG1 . VAL A 1 228 ? -27.959 -5.099  32.199  1.00 59.71  ? 221 VAL A CG1 1 
ATOM   1299 C CG2 . VAL A 1 228 ? -27.301 -3.800  30.166  1.00 74.01  ? 221 VAL A CG2 1 
ATOM   1300 N N   . SER A 1 229 ? -25.310 -7.231  32.673  1.00 96.10  ? 222 SER A N   1 
ATOM   1301 C CA  . SER A 1 229 ? -25.408 -8.369  33.578  1.00 102.09 ? 222 SER A CA  1 
ATOM   1302 C C   . SER A 1 229 ? -26.332 -8.027  34.762  1.00 104.85 ? 222 SER A C   1 
ATOM   1303 O O   . SER A 1 229 ? -26.967 -8.918  35.341  1.00 97.19  ? 222 SER A O   1 
ATOM   1304 C CB  . SER A 1 229 ? -24.016 -8.838  34.040  1.00 88.13  ? 222 SER A CB  1 
ATOM   1305 O OG  . SER A 1 229 ? -23.249 -9.356  32.955  1.00 70.32  ? 222 SER A OG  1 
ATOM   1306 N N   . MET A 1 230 ? -26.419 -6.735  35.095  1.00 105.42 ? 223 MET A N   1 
ATOM   1307 C CA  . MET A 1 230 ? -27.329 -6.254  36.147  1.00 102.96 ? 223 MET A CA  1 
ATOM   1308 C C   . MET A 1 230 ? -27.457 -4.722  36.196  1.00 106.50 ? 223 MET A C   1 
ATOM   1309 O O   . MET A 1 230 ? -26.522 -3.996  35.847  1.00 109.28 ? 223 MET A O   1 
ATOM   1310 C CB  . MET A 1 230 ? -26.908 -6.793  37.526  1.00 89.78  ? 223 MET A CB  1 
ATOM   1311 C CG  . MET A 1 230 ? -28.016 -6.856  38.586  1.00 75.87  ? 223 MET A CG  1 
ATOM   1312 S SD  . MET A 1 230 ? -28.332 -5.324  39.504  1.00 139.46 ? 223 MET A SD  1 
ATOM   1313 C CE  . MET A 1 230 ? -26.726 -4.496  39.482  1.00 45.23  ? 223 MET A CE  1 
ATOM   1314 N N   . VAL A 1 231 ? -28.626 -4.249  36.630  1.00 100.49 ? 224 VAL A N   1 
ATOM   1315 C CA  . VAL A 1 231 ? -28.843 -2.837  36.954  1.00 90.99  ? 224 VAL A CA  1 
ATOM   1316 C C   . VAL A 1 231 ? -29.794 -2.705  38.155  1.00 86.67  ? 224 VAL A C   1 
ATOM   1317 O O   . VAL A 1 231 ? -30.836 -3.363  38.218  1.00 83.44  ? 224 VAL A O   1 
ATOM   1318 C CB  . VAL A 1 231 ? -29.354 -2.018  35.734  1.00 88.58  ? 224 VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 231 ? -30.687 -2.540  35.240  1.00 85.33  ? 224 VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 231 ? -29.461 -0.542  36.086  1.00 87.96  ? 224 VAL A CG2 1 
ATOM   1321 N N   . THR A 1 232 ? -29.417 -1.871  39.120  1.00 91.22  ? 225 THR A N   1 
ATOM   1322 C CA  . THR A 1 232 ? -30.167 -1.750  40.369  1.00 92.53  ? 225 THR A CA  1 
ATOM   1323 C C   . THR A 1 232 ? -31.422 -0.889  40.216  1.00 101.08 ? 225 THR A C   1 
ATOM   1324 O O   . THR A 1 232 ? -31.706 -0.370  39.134  1.00 104.61 ? 225 THR A O   1 
ATOM   1325 C CB  . THR A 1 232 ? -29.288 -1.173  41.511  1.00 83.08  ? 225 THR A CB  1 
ATOM   1326 O OG1 . THR A 1 232 ? -29.076 0.228   41.304  1.00 82.07  ? 225 THR A OG1 1 
ATOM   1327 C CG2 . THR A 1 232 ? -27.940 -1.883  41.571  1.00 75.30  ? 225 THR A CG2 1 
ATOM   1328 N N   . LYS A 1 233 ? -32.176 -0.756  41.305  1.00 104.35 ? 226 LYS A N   1 
ATOM   1329 C CA  . LYS A 1 233 ? -33.333 0.136   41.346  1.00 109.03 ? 226 LYS A CA  1 
ATOM   1330 C C   . LYS A 1 233 ? -33.025 1.295   42.301  1.00 114.76 ? 226 LYS A C   1 
ATOM   1331 O O   . LYS A 1 233 ? -33.875 1.740   43.076  1.00 112.92 ? 226 LYS A O   1 
ATOM   1332 C CB  . LYS A 1 233 ? -34.596 -0.624  41.773  1.00 104.42 ? 226 LYS A CB  1 
ATOM   1333 C CG  . LYS A 1 233 ? -35.894 0.124   41.501  1.00 100.19 ? 226 LYS A CG  1 
ATOM   1334 C CD  . LYS A 1 233 ? -37.113 -0.665  41.916  1.00 97.77  ? 226 LYS A CD  1 
ATOM   1335 C CE  . LYS A 1 233 ? -37.124 -2.021  41.248  1.00 102.39 ? 226 LYS A CE  1 
ATOM   1336 N NZ  . LYS A 1 233 ? -38.425 -2.719  41.444  1.00 108.52 ? 226 LYS A NZ  1 
ATOM   1337 N N   . ASP A 1 234 ? -31.790 1.781   42.223  1.00 121.14 ? 227 ASP A N   1 
ATOM   1338 C CA  . ASP A 1 234 ? -31.287 2.802   43.136  1.00 125.39 ? 227 ASP A CA  1 
ATOM   1339 C C   . ASP A 1 234 ? -31.342 4.217   42.534  1.00 126.96 ? 227 ASP A C   1 
ATOM   1340 O O   . ASP A 1 234 ? -31.703 4.401   41.366  1.00 124.38 ? 227 ASP A O   1 
ATOM   1341 C CB  . ASP A 1 234 ? -29.852 2.455   43.548  1.00 122.96 ? 227 ASP A CB  1 
ATOM   1342 C CG  . ASP A 1 234 ? -29.483 3.006   44.909  1.00 118.06 ? 227 ASP A CG  1 
ATOM   1343 O OD1 . ASP A 1 234 ? -30.391 3.178   45.748  1.00 116.95 ? 227 ASP A OD1 1 
ATOM   1344 O OD2 . ASP A 1 234 ? -28.283 3.261   45.137  1.00 115.57 ? 227 ASP A OD2 1 
ATOM   1345 N N   . ASN A 1 235 ? -30.976 5.205   43.349  1.00 122.18 ? 228 ASN A N   1 
ATOM   1346 C CA  . ASN A 1 235 ? -30.988 6.612   42.961  1.00 107.97 ? 228 ASN A CA  1 
ATOM   1347 C C   . ASN A 1 235 ? -29.613 7.204   43.236  1.00 93.34  ? 228 ASN A C   1 
ATOM   1348 O O   . ASN A 1 235 ? -29.402 7.803   44.284  1.00 83.35  ? 228 ASN A O   1 
ATOM   1349 C CB  . ASN A 1 235 ? -32.036 7.364   43.791  1.00 108.43 ? 228 ASN A CB  1 
ATOM   1350 C CG  . ASN A 1 235 ? -32.819 8.388   42.983  1.00 101.93 ? 228 ASN A CG  1 
ATOM   1351 O OD1 . ASN A 1 235 ? -33.950 8.131   42.560  1.00 98.63  ? 228 ASN A OD1 1 
ATOM   1352 N ND2 . ASN A 1 235 ? -32.232 9.561   42.786  1.00 94.12  ? 228 ASN A ND2 1 
ATOM   1353 N N   . PRO A 1 236 ? -28.676 7.076   42.284  1.00 95.88  ? 229 PRO A N   1 
ATOM   1354 C CA  . PRO A 1 236 ? -28.866 6.620   40.906  1.00 96.67  ? 229 PRO A CA  1 
ATOM   1355 C C   . PRO A 1 236 ? -28.764 5.107   40.740  1.00 100.41 ? 229 PRO A C   1 
ATOM   1356 O O   . PRO A 1 236 ? -28.075 4.442   41.519  1.00 104.33 ? 229 PRO A O   1 
ATOM   1357 C CB  . PRO A 1 236 ? -27.696 7.283   40.180  1.00 91.97  ? 229 PRO A CB  1 
ATOM   1358 C CG  . PRO A 1 236 ? -26.600 7.256   41.194  1.00 92.02  ? 229 PRO A CG  1 
ATOM   1359 C CD  . PRO A 1 236 ? -27.267 7.423   42.547  1.00 94.02  ? 229 PRO A CD  1 
ATOM   1360 N N   . GLY A 1 237 ? -29.453 4.581   39.728  1.00 95.81  ? 230 GLY A N   1 
ATOM   1361 C CA  . GLY A 1 237 ? -29.336 3.183   39.357  1.00 93.46  ? 230 GLY A CA  1 
ATOM   1362 C C   . GLY A 1 237 ? -27.917 2.881   38.922  1.00 90.16  ? 230 GLY A C   1 
ATOM   1363 O O   . GLY A 1 237 ? -27.252 3.728   38.328  1.00 90.65  ? 230 GLY A O   1 
ATOM   1364 N N   . VAL A 1 238 ? -27.442 1.680   39.231  1.00 83.05  ? 231 VAL A N   1 
ATOM   1365 C CA  . VAL A 1 238 ? -26.048 1.345   38.978  1.00 86.50  ? 231 VAL A CA  1 
ATOM   1366 C C   . VAL A 1 238 ? -25.910 0.073   38.136  1.00 92.39  ? 231 VAL A C   1 
ATOM   1367 O O   . VAL A 1 238 ? -26.177 -1.033  38.607  1.00 104.09 ? 231 VAL A O   1 
ATOM   1368 C CB  . VAL A 1 238 ? -25.251 1.204   40.301  1.00 92.25  ? 231 VAL A CB  1 
ATOM   1369 C CG1 . VAL A 1 238 ? -23.765 1.437   40.053  1.00 94.96  ? 231 VAL A CG1 1 
ATOM   1370 C CG2 . VAL A 1 238 ? -25.771 2.176   41.365  1.00 81.60  ? 231 VAL A CG2 1 
ATOM   1371 N N   . VAL A 1 239 ? -25.480 0.245   36.889  1.00 91.22  ? 232 VAL A N   1 
ATOM   1372 C CA  . VAL A 1 239 ? -25.380 -0.856  35.931  1.00 95.60  ? 232 VAL A CA  1 
ATOM   1373 C C   . VAL A 1 239 ? -24.109 -1.666  36.152  1.00 106.46 ? 232 VAL A C   1 
ATOM   1374 O O   . VAL A 1 239 ? -23.091 -1.124  36.586  1.00 110.27 ? 232 VAL A O   1 
ATOM   1375 C CB  . VAL A 1 239 ? -25.384 -0.324  34.474  1.00 94.44  ? 232 VAL A CB  1 
ATOM   1376 C CG1 . VAL A 1 239 ? -25.440 -1.464  33.461  1.00 88.54  ? 232 VAL A CG1 1 
ATOM   1377 C CG2 . VAL A 1 239 ? -26.547 0.631   34.259  1.00 97.42  ? 232 VAL A CG2 1 
ATOM   1378 N N   . THR A 1 240 ? -24.174 -2.966  35.867  1.00 108.09 ? 233 THR A N   1 
ATOM   1379 C CA  . THR A 1 240 ? -23.004 -3.833  35.935  1.00 104.01 ? 233 THR A CA  1 
ATOM   1380 C C   . THR A 1 240 ? -22.931 -4.736  34.702  1.00 97.47  ? 233 THR A C   1 
ATOM   1381 O O   . THR A 1 240 ? -23.910 -4.867  33.964  1.00 83.63  ? 233 THR A O   1 
ATOM   1382 C CB  . THR A 1 240 ? -23.032 -4.715  37.200  1.00 104.66 ? 233 THR A CB  1 
ATOM   1383 O OG1 . THR A 1 240 ? -24.018 -5.740  37.045  1.00 107.82 ? 233 THR A OG1 1 
ATOM   1384 C CG2 . THR A 1 240 ? -23.356 -3.887  38.443  1.00 96.22  ? 233 THR A CG2 1 
ATOM   1385 N N   . CYS A 1 241 ? -21.767 -5.353  34.488  1.00 109.52 ? 234 CYS A N   1 
ATOM   1386 C CA  . CYS A 1 241 ? -21.566 -6.317  33.399  1.00 116.90 ? 234 CYS A CA  1 
ATOM   1387 C C   . CYS A 1 241 ? -20.265 -7.120  33.546  1.00 125.20 ? 234 CYS A C   1 
ATOM   1388 O O   . CYS A 1 241 ? -19.423 -6.800  34.388  1.00 127.03 ? 234 CYS A O   1 
ATOM   1389 C CB  . CYS A 1 241 ? -21.608 -5.622  32.032  1.00 111.46 ? 234 CYS A CB  1 
ATOM   1390 S SG  . CYS A 1 241 ? -20.515 -4.197  31.839  1.00 140.96 ? 234 CYS A SG  1 
ATOM   1391 N N   . LEU A 1 242 ? -20.111 -8.168  32.736  1.00 128.15 ? 235 LEU A N   1 
ATOM   1392 C CA  . LEU A 1 242 ? -18.845 -8.904  32.678  1.00 125.58 ? 235 LEU A CA  1 
ATOM   1393 C C   . LEU A 1 242 ? -17.873 -8.192  31.738  1.00 128.89 ? 235 LEU A C   1 
ATOM   1394 O O   . LEU A 1 242 ? -18.209 -7.154  31.160  1.00 126.36 ? 235 LEU A O   1 
ATOM   1395 C CB  . LEU A 1 242 ? -19.051 -10.355 32.233  1.00 113.08 ? 235 LEU A CB  1 
ATOM   1396 C CG  . LEU A 1 242 ? -19.768 -11.292 33.207  1.00 105.61 ? 235 LEU A CG  1 
ATOM   1397 C CD1 . LEU A 1 242 ? -19.560 -12.752 32.805  1.00 105.75 ? 235 LEU A CD1 1 
ATOM   1398 C CD2 . LEU A 1 242 ? -19.309 -11.047 34.638  1.00 98.84  ? 235 LEU A CD2 1 
ATOM   1399 N N   . ASP A 1 243 ? -16.675 -8.751  31.588  1.00 126.80 ? 236 ASP A N   1 
ATOM   1400 C CA  . ASP A 1 243 ? -15.614 -8.099  30.822  1.00 120.06 ? 236 ASP A CA  1 
ATOM   1401 C C   . ASP A 1 243 ? -16.038 -7.788  29.388  1.00 111.55 ? 236 ASP A C   1 
ATOM   1402 O O   . ASP A 1 243 ? -16.270 -6.628  29.043  1.00 102.27 ? 236 ASP A O   1 
ATOM   1403 C CB  . ASP A 1 243 ? -14.337 -8.948  30.828  1.00 118.70 ? 236 ASP A CB  1 
ATOM   1404 C CG  . ASP A 1 243 ? -13.086 -8.129  30.528  1.00 112.75 ? 236 ASP A CG  1 
ATOM   1405 O OD1 . ASP A 1 243 ? -12.066 -8.324  31.224  1.00 103.98 ? 236 ASP A OD1 1 
ATOM   1406 O OD2 . ASP A 1 243 ? -13.121 -7.290  29.600  1.00 113.29 ? 236 ASP A OD2 1 
ATOM   1407 N N   . ARG A 1 246 ? -17.414 -1.606  27.751  1.00 106.75 ? 239 ARG A N   1 
ATOM   1408 C CA  . ARG A 1 246 ? -17.782 -1.616  29.161  1.00 104.34 ? 239 ARG A CA  1 
ATOM   1409 C C   . ARG A 1 246 ? -17.133 -0.435  29.887  1.00 110.67 ? 239 ARG A C   1 
ATOM   1410 O O   . ARG A 1 246 ? -17.744 0.216   30.747  1.00 96.50  ? 239 ARG A O   1 
ATOM   1411 C CB  . ARG A 1 246 ? -17.389 -2.953  29.809  1.00 96.04  ? 239 ARG A CB  1 
ATOM   1412 C CG  . ARG A 1 246 ? -15.980 -3.432  29.485  1.00 86.43  ? 239 ARG A CG  1 
ATOM   1413 C CD  . ARG A 1 246 ? -15.344 -4.078  30.702  1.00 90.66  ? 239 ARG A CD  1 
ATOM   1414 N NE  . ARG A 1 246 ? -13.918 -4.329  30.516  1.00 100.75 ? 239 ARG A NE  1 
ATOM   1415 C CZ  . ARG A 1 246 ? -13.079 -4.630  31.504  1.00 111.88 ? 239 ARG A CZ  1 
ATOM   1416 N NH1 . ARG A 1 246 ? -13.527 -4.714  32.750  1.00 114.68 ? 239 ARG A NH1 1 
ATOM   1417 N NH2 . ARG A 1 246 ? -11.793 -4.843  31.252  1.00 114.43 ? 239 ARG A NH2 1 
ATOM   1418 N N   . HIS A 1 247 ? -15.881 -0.169  29.531  1.00 131.13 ? 240 HIS A N   1 
ATOM   1419 C CA  . HIS A 1 247 ? -15.178 1.003   30.028  1.00 143.30 ? 240 HIS A CA  1 
ATOM   1420 C C   . HIS A 1 247 ? -14.902 1.972   28.881  1.00 140.80 ? 240 HIS A C   1 
ATOM   1421 O O   . HIS A 1 247 ? -15.226 1.688   27.726  1.00 133.42 ? 240 HIS A O   1 
ATOM   1422 C CB  . HIS A 1 247 ? -13.896 0.629   30.801  1.00 153.42 ? 240 HIS A CB  1 
ATOM   1423 C CG  . HIS A 1 247 ? -12.959 -0.285  30.054  1.00 161.63 ? 240 HIS A CG  1 
ATOM   1424 N ND1 . HIS A 1 247 ? -12.752 -1.593  30.431  1.00 164.18 ? 240 HIS A ND1 1 
ATOM   1425 C CD2 . HIS A 1 247 ? -12.163 -0.061  28.989  1.00 162.59 ? 240 HIS A CD2 1 
ATOM   1426 C CE1 . HIS A 1 247 ? -11.872 -2.146  29.609  1.00 164.24 ? 240 HIS A CE1 1 
ATOM   1427 N NE2 . HIS A 1 247 ? -11.499 -1.243  28.727  1.00 163.00 ? 240 HIS A NE2 1 
ATOM   1428 N N   . GLY A 1 248 ? -14.321 3.122   29.207  1.00 144.60 ? 241 GLY A N   1 
ATOM   1429 C CA  . GLY A 1 248 ? -14.162 4.196   28.244  1.00 144.79 ? 241 GLY A CA  1 
ATOM   1430 C C   . GLY A 1 248 ? -15.393 5.081   28.271  1.00 137.60 ? 241 GLY A C   1 
ATOM   1431 O O   . GLY A 1 248 ? -15.390 6.203   27.758  1.00 131.06 ? 241 GLY A O   1 
ATOM   1432 N N   . PHE A 1 249 ? -16.450 4.558   28.884  1.00 135.31 ? 242 PHE A N   1 
ATOM   1433 C CA  . PHE A 1 249 ? -17.707 5.274   29.028  1.00 134.10 ? 242 PHE A CA  1 
ATOM   1434 C C   . PHE A 1 249 ? -17.465 6.552   29.837  1.00 127.32 ? 242 PHE A C   1 
ATOM   1435 O O   . PHE A 1 249 ? -18.048 7.599   29.560  1.00 119.84 ? 242 PHE A O   1 
ATOM   1436 C CB  . PHE A 1 249 ? -18.756 4.372   29.702  1.00 136.12 ? 242 PHE A CB  1 
ATOM   1437 C CG  . PHE A 1 249 ? -19.351 3.310   28.785  1.00 128.00 ? 242 PHE A CG  1 
ATOM   1438 C CD1 . PHE A 1 249 ? -20.711 3.023   28.825  1.00 118.81 ? 242 PHE A CD1 1 
ATOM   1439 C CD2 . PHE A 1 249 ? -18.559 2.603   27.891  1.00 121.77 ? 242 PHE A CD2 1 
ATOM   1440 C CE1 . PHE A 1 249 ? -21.266 2.054   27.995  1.00 106.23 ? 242 PHE A CE1 1 
ATOM   1441 C CE2 . PHE A 1 249 ? -19.112 1.636   27.056  1.00 110.77 ? 242 PHE A CE2 1 
ATOM   1442 C CZ  . PHE A 1 249 ? -20.467 1.364   27.109  1.00 101.59 ? 242 PHE A CZ  1 
ATOM   1443 N N   . GLU A 1 250 ? -16.580 6.454   30.825  1.00 127.25 ? 243 GLU A N   1 
ATOM   1444 C CA  . GLU A 1 250 ? -16.191 7.600   31.640  1.00 122.15 ? 243 GLU A CA  1 
ATOM   1445 C C   . GLU A 1 250 ? -17.408 8.316   32.198  1.00 118.26 ? 243 GLU A C   1 
ATOM   1446 O O   . GLU A 1 250 ? -18.361 7.684   32.637  1.00 124.85 ? 243 GLU A O   1 
ATOM   1447 C CB  . GLU A 1 250 ? -15.339 8.564   30.823  1.00 116.92 ? 243 GLU A CB  1 
ATOM   1448 C CG  . GLU A 1 250 ? -14.165 7.890   30.153  1.00 121.49 ? 243 GLU A CG  1 
ATOM   1449 C CD  . GLU A 1 250 ? -13.215 8.877   29.525  1.00 126.93 ? 243 GLU A CD  1 
ATOM   1450 O OE1 . GLU A 1 250 ? -12.193 8.439   28.955  1.00 128.53 ? 243 GLU A OE1 1 
ATOM   1451 O OE2 . GLU A 1 250 ? -13.489 10.092  29.604  1.00 129.69 ? 243 GLU A OE2 1 
ATOM   1452 N N   . SER A 1 251 ? -17.382 9.638   32.173  1.00 107.78 ? 244 SER A N   1 
ATOM   1453 C CA  . SER A 1 251 ? -18.555 10.396  32.569  1.00 104.19 ? 244 SER A CA  1 
ATOM   1454 C C   . SER A 1 251 ? -19.070 11.179  31.367  1.00 91.89  ? 244 SER A C   1 
ATOM   1455 O O   . SER A 1 251 ? -18.431 11.198  30.316  1.00 85.87  ? 244 SER A O   1 
ATOM   1456 C CB  . SER A 1 251 ? -18.236 11.320  33.746  1.00 104.79 ? 244 SER A CB  1 
ATOM   1457 O OG  . SER A 1 251 ? -17.182 12.211  33.427  1.00 104.08 ? 244 SER A OG  1 
ATOM   1458 N N   . GLY A 1 252 ? -20.239 11.791  31.513  1.00 84.21  ? 245 GLY A N   1 
ATOM   1459 C CA  . GLY A 1 252 ? -20.777 12.661  30.483  1.00 87.31  ? 245 GLY A CA  1 
ATOM   1460 C C   . GLY A 1 252 ? -21.178 11.973  29.192  1.00 84.13  ? 245 GLY A C   1 
ATOM   1461 O O   . GLY A 1 252 ? -21.665 12.631  28.270  1.00 79.96  ? 245 GLY A O   1 
ATOM   1462 N N   . ASP A 1 253 ? -20.964 10.661  29.115  1.00 80.11  ? 246 ASP A N   1 
ATOM   1463 C CA  . ASP A 1 253 ? -21.419 9.882   27.969  1.00 74.03  ? 246 ASP A CA  1 
ATOM   1464 C C   . ASP A 1 253 ? -22.924 9.709   28.045  1.00 67.83  ? 246 ASP A C   1 
ATOM   1465 O O   . ASP A 1 253 ? -23.485 9.606   29.138  1.00 68.65  ? 246 ASP A O   1 
ATOM   1466 C CB  . ASP A 1 253 ? -20.768 8.499   27.951  1.00 76.76  ? 246 ASP A CB  1 
ATOM   1467 C CG  . ASP A 1 253 ? -19.417 8.493   27.276  1.00 79.03  ? 246 ASP A CG  1 
ATOM   1468 O OD1 . ASP A 1 253 ? -18.619 9.425   27.508  1.00 81.85  ? 246 ASP A OD1 1 
ATOM   1469 O OD2 . ASP A 1 253 ? -19.142 7.537   26.526  1.00 78.05  ? 246 ASP A OD2 1 
ATOM   1470 N N   . PHE A 1 254 ? -23.578 9.675   26.889  1.00 58.50  ? 247 PHE A N   1 
ATOM   1471 C CA  . PHE A 1 254 ? -24.991 9.330   26.844  1.00 52.09  ? 247 PHE A CA  1 
ATOM   1472 C C   . PHE A 1 254 ? -25.180 7.955   26.235  1.00 51.60  ? 247 PHE A C   1 
ATOM   1473 O O   . PHE A 1 254 ? -24.489 7.588   25.291  1.00 61.21  ? 247 PHE A O   1 
ATOM   1474 C CB  . PHE A 1 254 ? -25.798 10.384  26.102  1.00 50.31  ? 247 PHE A CB  1 
ATOM   1475 C CG  . PHE A 1 254 ? -26.010 11.643  26.890  1.00 44.92  ? 247 PHE A CG  1 
ATOM   1476 C CD1 . PHE A 1 254 ? -24.995 12.577  27.013  1.00 49.33  ? 247 PHE A CD1 1 
ATOM   1477 C CD2 . PHE A 1 254 ? -27.226 11.895  27.503  1.00 45.17  ? 247 PHE A CD2 1 
ATOM   1478 C CE1 . PHE A 1 254 ? -25.188 13.741  27.736  1.00 55.71  ? 247 PHE A CE1 1 
ATOM   1479 C CE2 . PHE A 1 254 ? -27.431 13.056  28.229  1.00 53.58  ? 247 PHE A CE2 1 
ATOM   1480 C CZ  . PHE A 1 254 ? -26.408 13.981  28.349  1.00 57.45  ? 247 PHE A CZ  1 
ATOM   1481 N N   . VAL A 1 255 ? -26.134 7.209   26.779  1.00 53.23  ? 248 VAL A N   1 
ATOM   1482 C CA  . VAL A 1 255 ? -26.196 5.762   26.604  1.00 59.35  ? 248 VAL A CA  1 
ATOM   1483 C C   . VAL A 1 255 ? -27.630 5.259   26.357  1.00 59.16  ? 248 VAL A C   1 
ATOM   1484 O O   . VAL A 1 255 ? -28.576 5.775   26.949  1.00 63.07  ? 248 VAL A O   1 
ATOM   1485 C CB  . VAL A 1 255 ? -25.595 5.094   27.874  1.00 68.61  ? 248 VAL A CB  1 
ATOM   1486 C CG1 . VAL A 1 255 ? -26.126 3.689   28.090  1.00 66.61  ? 248 VAL A CG1 1 
ATOM   1487 C CG2 . VAL A 1 255 ? -24.067 5.121   27.824  1.00 66.89  ? 248 VAL A CG2 1 
ATOM   1488 N N   . SER A 1 256 ? -27.798 4.263   25.485  1.00 60.85  ? 249 SER A N   1 
ATOM   1489 C CA  . SER A 1 256 ? -29.126 3.669   25.259  1.00 67.16  ? 249 SER A CA  1 
ATOM   1490 C C   . SER A 1 256 ? -29.202 2.164   25.553  1.00 74.60  ? 249 SER A C   1 
ATOM   1491 O O   . SER A 1 256 ? -28.189 1.463   25.529  1.00 79.28  ? 249 SER A O   1 
ATOM   1492 C CB  . SER A 1 256 ? -29.618 3.943   23.836  1.00 62.22  ? 249 SER A CB  1 
ATOM   1493 O OG  . SER A 1 256 ? -29.941 5.309   23.664  1.00 58.28  ? 249 SER A OG  1 
ATOM   1494 N N   . PHE A 1 257 ? -30.413 1.675   25.812  1.00 72.03  ? 250 PHE A N   1 
ATOM   1495 C CA  . PHE A 1 257 ? -30.620 0.283   26.200  1.00 71.61  ? 250 PHE A CA  1 
ATOM   1496 C C   . PHE A 1 257 ? -31.546 -0.433  25.225  1.00 75.66  ? 250 PHE A C   1 
ATOM   1497 O O   . PHE A 1 257 ? -32.358 0.202   24.561  1.00 85.99  ? 250 PHE A O   1 
ATOM   1498 C CB  . PHE A 1 257 ? -31.251 0.210   27.596  1.00 74.75  ? 250 PHE A CB  1 
ATOM   1499 C CG  . PHE A 1 257 ? -30.400 0.792   28.696  1.00 78.64  ? 250 PHE A CG  1 
ATOM   1500 C CD1 . PHE A 1 257 ? -30.326 2.164   28.890  1.00 80.56  ? 250 PHE A CD1 1 
ATOM   1501 C CD2 . PHE A 1 257 ? -29.703 -0.035  29.559  1.00 83.99  ? 250 PHE A CD2 1 
ATOM   1502 C CE1 . PHE A 1 257 ? -29.553 2.699   29.902  1.00 80.33  ? 250 PHE A CE1 1 
ATOM   1503 C CE2 . PHE A 1 257 ? -28.932 0.492   30.579  1.00 85.19  ? 250 PHE A CE2 1 
ATOM   1504 C CZ  . PHE A 1 257 ? -28.855 1.861   30.748  1.00 84.29  ? 250 PHE A CZ  1 
ATOM   1505 N N   . SER A 1 258 ? -31.418 -1.754  25.147  1.00 76.42  ? 251 SER A N   1 
ATOM   1506 C CA  . SER A 1 258 ? -32.413 -2.605  24.485  1.00 78.59  ? 251 SER A CA  1 
ATOM   1507 C C   . SER A 1 258 ? -32.353 -4.035  25.025  1.00 93.52  ? 251 SER A C   1 
ATOM   1508 O O   . SER A 1 258 ? -31.292 -4.499  25.448  1.00 99.40  ? 251 SER A O   1 
ATOM   1509 C CB  . SER A 1 258 ? -32.271 -2.587  22.958  1.00 72.57  ? 251 SER A CB  1 
ATOM   1510 O OG  . SER A 1 258 ? -30.915 -2.581  22.558  1.00 76.85  ? 251 SER A OG  1 
ATOM   1511 N N   . GLU A 1 259 ? -33.506 -4.705  25.021  1.00 95.98  ? 252 GLU A N   1 
ATOM   1512 C CA  . GLU A 1 259 ? -33.662 -6.093  25.490  1.00 91.54  ? 252 GLU A CA  1 
ATOM   1513 C C   . GLU A 1 259 ? -33.571 -6.287  27.011  1.00 88.40  ? 252 GLU A C   1 
ATOM   1514 O O   . GLU A 1 259 ? -33.397 -7.414  27.484  1.00 81.05  ? 252 GLU A O   1 
ATOM   1515 C CB  . GLU A 1 259 ? -32.682 -7.038  24.786  1.00 85.81  ? 252 GLU A CB  1 
ATOM   1516 C CG  . GLU A 1 259 ? -32.698 -6.942  23.281  1.00 83.77  ? 252 GLU A CG  1 
ATOM   1517 C CD  . GLU A 1 259 ? -31.445 -7.523  22.668  1.00 85.66  ? 252 GLU A CD  1 
ATOM   1518 O OE1 . GLU A 1 259 ? -30.745 -8.287  23.369  1.00 86.43  ? 252 GLU A OE1 1 
ATOM   1519 O OE2 . GLU A 1 259 ? -31.156 -7.208  21.492  1.00 83.54  ? 252 GLU A OE2 1 
ATOM   1520 N N   . VAL A 1 260 ? -33.701 -5.201  27.770  1.00 91.50  ? 253 VAL A N   1 
ATOM   1521 C CA  . VAL A 1 260 ? -33.613 -5.276  29.229  1.00 91.87  ? 253 VAL A CA  1 
ATOM   1522 C C   . VAL A 1 260 ? -34.883 -5.852  29.861  1.00 88.41  ? 253 VAL A C   1 
ATOM   1523 O O   . VAL A 1 260 ? -35.899 -5.166  29.976  1.00 82.92  ? 253 VAL A O   1 
ATOM   1524 C CB  . VAL A 1 260 ? -33.298 -3.901  29.859  1.00 90.78  ? 253 VAL A CB  1 
ATOM   1525 C CG1 . VAL A 1 260 ? -33.266 -4.007  31.381  1.00 92.54  ? 253 VAL A CG1 1 
ATOM   1526 C CG2 . VAL A 1 260 ? -31.976 -3.359  29.326  1.00 86.16  ? 253 VAL A CG2 1 
ATOM   1527 N N   . GLN A 1 261 ? -34.814 -7.116  30.272  1.00 89.41  ? 254 GLN A N   1 
ATOM   1528 C CA  . GLN A 1 261 ? -35.946 -7.788  30.899  1.00 85.46  ? 254 GLN A CA  1 
ATOM   1529 C C   . GLN A 1 261 ? -36.146 -7.295  32.327  1.00 83.45  ? 254 GLN A C   1 
ATOM   1530 O O   . GLN A 1 261 ? -35.187 -6.920  33.003  1.00 82.76  ? 254 GLN A O   1 
ATOM   1531 C CB  . GLN A 1 261 ? -35.733 -9.298  30.886  1.00 89.38  ? 254 GLN A CB  1 
ATOM   1532 C CG  . GLN A 1 261 ? -35.391 -9.846  29.517  1.00 91.69  ? 254 GLN A CG  1 
ATOM   1533 C CD  . GLN A 1 261 ? -35.211 -11.346 29.518  1.00 96.62  ? 254 GLN A CD  1 
ATOM   1534 O OE1 . GLN A 1 261 ? -35.456 -12.018 30.523  1.00 103.27 ? 254 GLN A OE1 1 
ATOM   1535 N NE2 . GLN A 1 261 ? -34.778 -11.884 28.386  1.00 91.73  ? 254 GLN A NE2 1 
ATOM   1536 N N   . GLY A 1 262 ? -37.395 -7.295  32.782  1.00 80.78  ? 255 GLY A N   1 
ATOM   1537 C CA  . GLY A 1 262 ? -37.722 -6.757  34.090  1.00 81.51  ? 255 GLY A CA  1 
ATOM   1538 C C   . GLY A 1 262 ? -38.117 -5.288  34.032  1.00 77.37  ? 255 GLY A C   1 
ATOM   1539 O O   . GLY A 1 262 ? -39.304 -4.970  33.898  1.00 62.35  ? 255 GLY A O   1 
ATOM   1540 N N   . MET A 1 263 ? -37.136 -4.387  34.145  1.00 84.60  ? 256 MET A N   1 
ATOM   1541 C CA  . MET A 1 263 ? -37.401 -2.966  33.909  1.00 88.34  ? 256 MET A CA  1 
ATOM   1542 C C   . MET A 1 263 ? -37.358 -2.644  32.419  1.00 89.43  ? 256 MET A C   1 
ATOM   1543 O O   . MET A 1 263 ? -36.353 -2.161  31.899  1.00 93.62  ? 256 MET A O   1 
ATOM   1544 C CB  . MET A 1 263 ? -36.478 -2.034  34.711  1.00 82.90  ? 256 MET A CB  1 
ATOM   1545 C CG  . MET A 1 263 ? -34.991 -2.326  34.655  1.00 80.56  ? 256 MET A CG  1 
ATOM   1546 S SD  . MET A 1 263 ? -34.038 -0.929  35.307  1.00 103.15 ? 256 MET A SD  1 
ATOM   1547 C CE  . MET A 1 263 ? -34.768 -0.676  36.923  1.00 48.53  ? 256 MET A CE  1 
ATOM   1548 N N   . VAL A 1 264 ? -38.472 -2.923  31.748  1.00 86.03  ? 257 VAL A N   1 
ATOM   1549 C CA  . VAL A 1 264 ? -38.596 -2.757  30.306  1.00 89.34  ? 257 VAL A CA  1 
ATOM   1550 C C   . VAL A 1 264 ? -38.489 -1.271  29.931  1.00 90.57  ? 257 VAL A C   1 
ATOM   1551 O O   . VAL A 1 264 ? -38.118 -0.910  28.812  1.00 94.56  ? 257 VAL A O   1 
ATOM   1552 C CB  . VAL A 1 264 ? -39.919 -3.411  29.798  1.00 103.00 ? 257 VAL A CB  1 
ATOM   1553 C CG1 . VAL A 1 264 ? -41.093 -3.009  30.686  1.00 95.28  ? 257 VAL A CG1 1 
ATOM   1554 C CG2 . VAL A 1 264 ? -40.187 -3.099  28.314  1.00 107.41 ? 257 VAL A CG2 1 
ATOM   1555 N N   . GLU A 1 265 ? -38.771 -0.420  30.908  1.00 85.60  ? 258 GLU A N   1 
ATOM   1556 C CA  . GLU A 1 265 ? -38.777 1.026   30.736  1.00 86.05  ? 258 GLU A CA  1 
ATOM   1557 C C   . GLU A 1 265 ? -37.432 1.615   30.314  1.00 88.21  ? 258 GLU A C   1 
ATOM   1558 O O   . GLU A 1 265 ? -37.368 2.746   29.831  1.00 92.96  ? 258 GLU A O   1 
ATOM   1559 C CB  . GLU A 1 265 ? -39.214 1.662   32.047  1.00 86.22  ? 258 GLU A CB  1 
ATOM   1560 C CG  . GLU A 1 265 ? -38.729 0.871   33.241  1.00 95.97  ? 258 GLU A CG  1 
ATOM   1561 C CD  . GLU A 1 265 ? -39.858 0.213   34.016  1.00 105.07 ? 258 GLU A CD  1 
ATOM   1562 O OE1 . GLU A 1 265 ? -40.948 0.009   33.440  1.00 103.26 ? 258 GLU A OE1 1 
ATOM   1563 O OE2 . GLU A 1 265 ? -39.656 -0.097  35.208  1.00 113.20 ? 258 GLU A OE2 1 
ATOM   1564 N N   . LEU A 1 266 ? -36.357 0.863   30.505  1.00 81.25  ? 259 LEU A N   1 
ATOM   1565 C CA  . LEU A 1 266 ? -35.038 1.346   30.123  1.00 73.20  ? 259 LEU A CA  1 
ATOM   1566 C C   . LEU A 1 266 ? -34.802 1.195   28.628  1.00 72.75  ? 259 LEU A C   1 
ATOM   1567 O O   . LEU A 1 266 ? -33.976 1.902   28.046  1.00 77.57  ? 259 LEU A O   1 
ATOM   1568 C CB  . LEU A 1 266 ? -33.949 0.615   30.900  1.00 68.22  ? 259 LEU A CB  1 
ATOM   1569 C CG  . LEU A 1 266 ? -33.261 1.448   31.977  1.00 63.10  ? 259 LEU A CG  1 
ATOM   1570 C CD1 . LEU A 1 266 ? -34.259 1.944   33.014  1.00 51.27  ? 259 LEU A CD1 1 
ATOM   1571 C CD2 . LEU A 1 266 ? -32.167 0.633   32.623  1.00 68.62  ? 259 LEU A CD2 1 
ATOM   1572 N N   . ASN A 1 267 ? -35.541 0.280   28.012  1.00 68.55  ? 260 ASN A N   1 
ATOM   1573 C CA  . ASN A 1 267 ? -35.356 -0.024  26.598  1.00 70.49  ? 260 ASN A CA  1 
ATOM   1574 C C   . ASN A 1 267 ? -35.551 1.166   25.661  1.00 77.37  ? 260 ASN A C   1 
ATOM   1575 O O   . ASN A 1 267 ? -34.594 1.655   25.056  1.00 86.90  ? 260 ASN A O   1 
ATOM   1576 C CB  . ASN A 1 267 ? -36.250 -1.189  26.175  1.00 65.41  ? 260 ASN A CB  1 
ATOM   1577 C CG  . ASN A 1 267 ? -35.849 -2.496  26.834  1.00 61.43  ? 260 ASN A CG  1 
ATOM   1578 O OD1 . ASN A 1 267 ? -34.808 -3.067  26.518  1.00 66.18  ? 260 ASN A OD1 1 
ATOM   1579 N ND2 . ASN A 1 267 ? -36.675 -2.975  27.750  1.00 49.76  ? 260 ASN A ND2 1 
ATOM   1580 N N   . GLY A 1 268 ? -36.784 1.640   25.541  1.00 68.02  ? 261 GLY A N   1 
ATOM   1581 C CA  . GLY A 1 268 ? -37.071 2.674   24.562  1.00 63.45  ? 261 GLY A CA  1 
ATOM   1582 C C   . GLY A 1 268 ? -36.818 4.095   25.022  1.00 58.76  ? 261 GLY A C   1 
ATOM   1583 O O   . GLY A 1 268 ? -37.430 5.020   24.513  1.00 57.80  ? 261 GLY A O   1 
ATOM   1584 N N   . ASN A 1 269 ? -35.909 4.276   25.972  1.00 66.03  ? 262 ASN A N   1 
ATOM   1585 C CA  . ASN A 1 269 ? -35.760 5.565   26.641  1.00 55.41  ? 262 ASN A CA  1 
ATOM   1586 C C   . ASN A 1 269 ? -34.887 6.545   25.875  1.00 48.03  ? 262 ASN A C   1 
ATOM   1587 O O   . ASN A 1 269 ? -34.270 6.191   24.870  1.00 39.19  ? 262 ASN A O   1 
ATOM   1588 C CB  . ASN A 1 269 ? -35.211 5.371   28.057  1.00 54.64  ? 262 ASN A CB  1 
ATOM   1589 C CG  . ASN A 1 269 ? -35.815 6.342   29.055  1.00 71.28  ? 262 ASN A CG  1 
ATOM   1590 O OD1 . ASN A 1 269 ? -35.340 7.469   29.213  1.00 86.55  ? 262 ASN A OD1 1 
ATOM   1591 N ND2 . ASN A 1 269 ? -36.868 5.907   29.740  1.00 71.03  ? 262 ASN A ND2 1 
ATOM   1592 N N   . GLN A 1 270 ? -34.852 7.787   26.342  1.00 47.58  ? 263 GLN A N   1 
ATOM   1593 C CA  . GLN A 1 270 ? -33.918 8.749   25.789  1.00 56.28  ? 263 GLN A CA  1 
ATOM   1594 C C   . GLN A 1 270 ? -32.530 8.349   26.261  1.00 62.78  ? 263 GLN A C   1 
ATOM   1595 O O   . GLN A 1 270 ? -32.393 7.709   27.311  1.00 66.86  ? 263 GLN A O   1 
ATOM   1596 C CB  . GLN A 1 270 ? -34.195 10.172  26.283  1.00 53.47  ? 263 GLN A CB  1 
ATOM   1597 C CG  . GLN A 1 270 ? -35.641 10.609  26.447  1.00 47.06  ? 263 GLN A CG  1 
ATOM   1598 C CD  . GLN A 1 270 ? -35.731 12.104  26.750  1.00 42.51  ? 263 GLN A CD  1 
ATOM   1599 O OE1 . GLN A 1 270 ? -34.747 12.830  26.618  1.00 41.39  ? 263 GLN A OE1 1 
ATOM   1600 N NE2 . GLN A 1 270 ? -36.908 12.565  27.155  1.00 41.65  ? 263 GLN A NE2 1 
ATOM   1601 N N   . PRO A 1 271 ? -31.493 8.725   25.491  1.00 55.94  ? 264 PRO A N   1 
ATOM   1602 C CA  . PRO A 1 271 ? -30.107 8.537   25.951  1.00 54.16  ? 264 PRO A CA  1 
ATOM   1603 C C   . PRO A 1 271 ? -29.864 9.206   27.313  1.00 51.40  ? 264 PRO A C   1 
ATOM   1604 O O   . PRO A 1 271 ? -30.265 10.358  27.489  1.00 43.13  ? 264 PRO A O   1 
ATOM   1605 C CB  . PRO A 1 271 ? -29.281 9.226   24.860  1.00 51.31  ? 264 PRO A CB  1 
ATOM   1606 C CG  . PRO A 1 271 ? -30.157 9.179   23.634  1.00 40.02  ? 264 PRO A CG  1 
ATOM   1607 C CD  . PRO A 1 271 ? -31.567 9.278   24.123  1.00 38.97  ? 264 PRO A CD  1 
ATOM   1608 N N   . MET A 1 272 ? -29.235 8.487   28.249  1.00 59.88  ? 265 MET A N   1 
ATOM   1609 C CA  . MET A 1 272 ? -28.984 8.983   29.610  1.00 54.16  ? 265 MET A CA  1 
ATOM   1610 C C   . MET A 1 272 ? -27.514 9.240   29.894  1.00 57.84  ? 265 MET A C   1 
ATOM   1611 O O   . MET A 1 272 ? -26.638 8.467   29.482  1.00 48.17  ? 265 MET A O   1 
ATOM   1612 C CB  . MET A 1 272 ? -29.461 7.978   30.644  1.00 54.31  ? 265 MET A CB  1 
ATOM   1613 C CG  . MET A 1 272 ? -30.740 7.312   30.287  1.00 71.13  ? 265 MET A CG  1 
ATOM   1614 S SD  . MET A 1 272 ? -31.044 5.966   31.420  1.00 66.96  ? 265 MET A SD  1 
ATOM   1615 C CE  . MET A 1 272 ? -32.591 5.355   30.755  1.00 121.46 ? 265 MET A CE  1 
ATOM   1616 N N   . GLU A 1 273 ? -27.258 10.306  30.646  1.00 64.36  ? 266 GLU A N   1 
ATOM   1617 C CA  . GLU A 1 273 ? -25.907 10.652  31.064  1.00 64.19  ? 266 GLU A CA  1 
ATOM   1618 C C   . GLU A 1 273 ? -25.326 9.616   32.038  1.00 69.96  ? 266 GLU A C   1 
ATOM   1619 O O   . GLU A 1 273 ? -26.011 9.123   32.944  1.00 53.42  ? 266 GLU A O   1 
ATOM   1620 C CB  . GLU A 1 273 ? -25.897 12.044  31.686  1.00 57.93  ? 266 GLU A CB  1 
ATOM   1621 C CG  . GLU A 1 273 ? -24.595 12.788  31.524  1.00 57.97  ? 266 GLU A CG  1 
ATOM   1622 C CD  . GLU A 1 273 ? -24.734 14.242  31.903  1.00 75.56  ? 266 GLU A CD  1 
ATOM   1623 O OE1 . GLU A 1 273 ? -23.723 14.837  32.325  1.00 71.82  ? 266 GLU A OE1 1 
ATOM   1624 O OE2 . GLU A 1 273 ? -25.858 14.789  31.774  1.00 90.00  ? 266 GLU A OE2 1 
ATOM   1625 N N   . ILE A 1 274 ? -24.047 9.312   31.844  1.00 74.21  ? 267 ILE A N   1 
ATOM   1626 C CA  . ILE A 1 274 ? -23.370 8.234   32.552  1.00 73.83  ? 267 ILE A CA  1 
ATOM   1627 C C   . ILE A 1 274 ? -22.293 8.751   33.519  1.00 73.77  ? 267 ILE A C   1 
ATOM   1628 O O   . ILE A 1 274 ? -21.721 9.824   33.316  1.00 71.06  ? 267 ILE A O   1 
ATOM   1629 C CB  . ILE A 1 274 ? -22.786 7.237   31.516  1.00 78.63  ? 267 ILE A CB  1 
ATOM   1630 C CG1 . ILE A 1 274 ? -23.620 5.963   31.496  1.00 86.42  ? 267 ILE A CG1 1 
ATOM   1631 C CG2 . ILE A 1 274 ? -21.314 6.942   31.749  1.00 78.50  ? 267 ILE A CG2 1 
ATOM   1632 C CD1 . ILE A 1 274 ? -25.086 6.225   31.242  1.00 91.65  ? 267 ILE A CD1 1 
ATOM   1633 N N   . LYS A 1 275 ? -22.039 7.999   34.586  1.00 80.20  ? 268 LYS A N   1 
ATOM   1634 C CA  . LYS A 1 275 ? -20.956 8.332   35.513  1.00 89.68  ? 268 LYS A CA  1 
ATOM   1635 C C   . LYS A 1 275 ? -20.203 7.071   35.932  1.00 88.21  ? 268 LYS A C   1 
ATOM   1636 O O   . LYS A 1 275 ? -20.623 6.374   36.861  1.00 86.01  ? 268 LYS A O   1 
ATOM   1637 C CB  . LYS A 1 275 ? -21.504 9.068   36.740  1.00 94.54  ? 268 LYS A CB  1 
ATOM   1638 C CG  . LYS A 1 275 ? -20.445 9.767   37.579  1.00 96.53  ? 268 LYS A CG  1 
ATOM   1639 C CD  . LYS A 1 275 ? -21.004 11.012  38.257  1.00 97.63  ? 268 LYS A CD  1 
ATOM   1640 C CE  . LYS A 1 275 ? -21.484 12.032  37.231  1.00 101.26 ? 268 LYS A CE  1 
ATOM   1641 N NZ  . LYS A 1 275 ? -20.454 12.300  36.183  1.00 105.17 ? 268 LYS A NZ  1 
ATOM   1642 N N   . VAL A 1 276 ? -19.099 6.784   35.238  1.00 87.61  ? 269 VAL A N   1 
ATOM   1643 C CA  . VAL A 1 276 ? -18.328 5.553   35.453  1.00 94.05  ? 269 VAL A CA  1 
ATOM   1644 C C   . VAL A 1 276 ? -17.702 5.499   36.843  1.00 93.93  ? 269 VAL A C   1 
ATOM   1645 O O   . VAL A 1 276 ? -17.121 6.480   37.315  1.00 87.62  ? 269 VAL A O   1 
ATOM   1646 C CB  . VAL A 1 276 ? -17.240 5.334   34.349  1.00 79.09  ? 269 VAL A CB  1 
ATOM   1647 C CG1 . VAL A 1 276 ? -15.951 4.783   34.932  1.00 78.64  ? 269 VAL A CG1 1 
ATOM   1648 C CG2 . VAL A 1 276 ? -17.757 4.413   33.252  1.00 78.09  ? 269 VAL A CG2 1 
ATOM   1649 N N   . LEU A 1 277 ? -17.849 4.348   37.495  1.00 97.35  ? 270 LEU A N   1 
ATOM   1650 C CA  . LEU A 1 277 ? -17.260 4.106   38.808  1.00 101.89 ? 270 LEU A CA  1 
ATOM   1651 C C   . LEU A 1 277 ? -16.045 3.180   38.687  1.00 106.61 ? 270 LEU A C   1 
ATOM   1652 O O   . LEU A 1 277 ? -15.115 3.240   39.499  1.00 105.36 ? 270 LEU A O   1 
ATOM   1653 C CB  . LEU A 1 277 ? -18.307 3.501   39.750  1.00 91.93  ? 270 LEU A CB  1 
ATOM   1654 C CG  . LEU A 1 277 ? -19.531 4.376   40.043  1.00 77.48  ? 270 LEU A CG  1 
ATOM   1655 C CD1 . LEU A 1 277 ? -20.813 3.587   39.869  1.00 66.33  ? 270 LEU A CD1 1 
ATOM   1656 C CD2 . LEU A 1 277 ? -19.448 4.956   41.449  1.00 78.44  ? 270 LEU A CD2 1 
ATOM   1657 N N   . GLY A 1 278 ? -16.069 2.335   37.657  1.00 105.82 ? 271 GLY A N   1 
ATOM   1658 C CA  . GLY A 1 278 ? -15.007 1.381   37.387  1.00 101.00 ? 271 GLY A CA  1 
ATOM   1659 C C   . GLY A 1 278 ? -15.161 0.730   36.022  1.00 100.02 ? 271 GLY A C   1 
ATOM   1660 O O   . GLY A 1 278 ? -15.997 1.144   35.222  1.00 101.60 ? 271 GLY A O   1 
ATOM   1661 N N   . PRO A 1 279 ? -14.352 -0.301  35.746  1.00 103.57 ? 272 PRO A N   1 
ATOM   1662 C CA  . PRO A 1 279 ? -14.348 -0.963  34.438  1.00 105.21 ? 272 PRO A CA  1 
ATOM   1663 C C   . PRO A 1 279 ? -15.644 -1.714  34.155  1.00 108.17 ? 272 PRO A C   1 
ATOM   1664 O O   . PRO A 1 279 ? -16.056 -1.810  32.999  1.00 109.61 ? 272 PRO A O   1 
ATOM   1665 C CB  . PRO A 1 279 ? -13.189 -1.960  34.555  1.00 107.92 ? 272 PRO A CB  1 
ATOM   1666 C CG  . PRO A 1 279 ? -12.354 -1.462  35.693  1.00 107.49 ? 272 PRO A CG  1 
ATOM   1667 C CD  . PRO A 1 279 ? -13.327 -0.854  36.645  1.00 105.87 ? 272 PRO A CD  1 
ATOM   1668 N N   . TYR A 1 280 ? -16.276 -2.239  35.199  1.00 111.19 ? 273 TYR A N   1 
ATOM   1669 C CA  . TYR A 1 280 ? -17.470 -3.061  35.032  1.00 115.40 ? 273 TYR A CA  1 
ATOM   1670 C C   . TYR A 1 280 ? -18.757 -2.287  35.302  1.00 109.84 ? 273 TYR A C   1 
ATOM   1671 O O   . TYR A 1 280 ? -19.848 -2.724  34.930  1.00 97.45  ? 273 TYR A O   1 
ATOM   1672 C CB  . TYR A 1 280 ? -17.408 -4.280  35.957  1.00 122.98 ? 273 TYR A CB  1 
ATOM   1673 C CG  . TYR A 1 280 ? -16.162 -5.123  35.786  1.00 129.50 ? 273 TYR A CG  1 
ATOM   1674 C CD1 . TYR A 1 280 ? -16.088 -6.098  34.797  1.00 130.37 ? 273 TYR A CD1 1 
ATOM   1675 C CD2 . TYR A 1 280 ? -15.061 -4.946  36.617  1.00 130.60 ? 273 TYR A CD2 1 
ATOM   1676 C CE1 . TYR A 1 280 ? -14.949 -6.873  34.639  1.00 129.44 ? 273 TYR A CE1 1 
ATOM   1677 C CE2 . TYR A 1 280 ? -13.916 -5.716  36.466  1.00 129.34 ? 273 TYR A CE2 1 
ATOM   1678 C CZ  . TYR A 1 280 ? -13.867 -6.677  35.476  1.00 126.29 ? 273 TYR A CZ  1 
ATOM   1679 O OH  . TYR A 1 280 ? -12.732 -7.443  35.324  1.00 119.01 ? 273 TYR A OH  1 
ATOM   1680 N N   . THR A 1 281 ? -18.639 -1.158  35.993  1.00 116.23 ? 274 THR A N   1 
ATOM   1681 C CA  . THR A 1 281 ? -19.824 -0.410  36.404  1.00 113.25 ? 274 THR A CA  1 
ATOM   1682 C C   . THR A 1 281 ? -19.824 1.082   36.076  1.00 101.94 ? 274 THR A C   1 
ATOM   1683 O O   . THR A 1 281 ? -18.796 1.754   36.142  1.00 92.17  ? 274 THR A O   1 
ATOM   1684 C CB  . THR A 1 281 ? -20.088 -0.582  37.914  1.00 81.60  ? 274 THR A CB  1 
ATOM   1685 O OG1 . THR A 1 281 ? -18.909 -0.233  38.650  1.00 84.02  ? 274 THR A OG1 1 
ATOM   1686 C CG2 . THR A 1 281 ? -20.468 -2.019  38.227  1.00 75.17  ? 274 THR A CG2 1 
ATOM   1687 N N   . PHE A 1 282 ? -21.005 1.581   35.726  1.00 102.27 ? 275 PHE A N   1 
ATOM   1688 C CA  . PHE A 1 282 ? -21.230 2.994   35.455  1.00 96.02  ? 275 PHE A CA  1 
ATOM   1689 C C   . PHE A 1 282 ? -22.569 3.379   36.073  1.00 86.06  ? 275 PHE A C   1 
ATOM   1690 O O   . PHE A 1 282 ? -23.420 2.517   36.290  1.00 83.73  ? 275 PHE A O   1 
ATOM   1691 C CB  . PHE A 1 282 ? -21.235 3.268   33.952  1.00 95.24  ? 275 PHE A CB  1 
ATOM   1692 C CG  . PHE A 1 282 ? -22.293 2.515   33.203  1.00 100.99 ? 275 PHE A CG  1 
ATOM   1693 C CD1 . PHE A 1 282 ? -23.594 2.985   33.158  1.00 102.96 ? 275 PHE A CD1 1 
ATOM   1694 C CD2 . PHE A 1 282 ? -21.988 1.339   32.542  1.00 105.80 ? 275 PHE A CD2 1 
ATOM   1695 C CE1 . PHE A 1 282 ? -24.571 2.295   32.469  1.00 106.08 ? 275 PHE A CE1 1 
ATOM   1696 C CE2 . PHE A 1 282 ? -22.960 0.645   31.851  1.00 108.23 ? 275 PHE A CE2 1 
ATOM   1697 C CZ  . PHE A 1 282 ? -24.253 1.123   31.814  1.00 108.32 ? 275 PHE A CZ  1 
ATOM   1698 N N   . SER A 1 283 ? -22.764 4.660   36.366  1.00 77.99  ? 276 SER A N   1 
ATOM   1699 C CA  . SER A 1 283 ? -24.017 5.089   36.977  1.00 78.70  ? 276 SER A CA  1 
ATOM   1700 C C   . SER A 1 283 ? -24.950 5.771   35.979  1.00 83.52  ? 276 SER A C   1 
ATOM   1701 O O   . SER A 1 283 ? -24.608 6.785   35.374  1.00 77.72  ? 276 SER A O   1 
ATOM   1702 C CB  . SER A 1 283 ? -23.745 6.011   38.168  1.00 70.47  ? 276 SER A CB  1 
ATOM   1703 O OG  . SER A 1 283 ? -22.877 7.070   37.807  1.00 64.64  ? 276 SER A OG  1 
ATOM   1704 N N   . ILE A 1 284 ? -26.135 5.191   35.825  1.00 88.63  ? 277 ILE A N   1 
ATOM   1705 C CA  . ILE A 1 284 ? -27.167 5.699   34.926  1.00 86.85  ? 277 ILE A CA  1 
ATOM   1706 C C   . ILE A 1 284 ? -28.137 6.644   35.628  1.00 90.14  ? 277 ILE A C   1 
ATOM   1707 O O   . ILE A 1 284 ? -27.883 7.111   36.736  1.00 101.87 ? 277 ILE A O   1 
ATOM   1708 C CB  . ILE A 1 284 ? -27.959 4.562   34.251  1.00 57.29  ? 277 ILE A CB  1 
ATOM   1709 C CG1 . ILE A 1 284 ? -28.772 3.784   35.286  1.00 63.06  ? 277 ILE A CG1 1 
ATOM   1710 C CG2 . ILE A 1 284 ? -27.021 3.635   33.496  1.00 54.46  ? 277 ILE A CG2 1 
ATOM   1711 C CD1 . ILE A 1 284 ? -29.616 2.680   34.688  1.00 61.76  ? 277 ILE A CD1 1 
ATOM   1712 N N   . CYS A 1 285 ? -29.251 6.917   34.959  1.00 85.20  ? 278 CYS A N   1 
ATOM   1713 C CA  . CYS A 1 285 ? -30.298 7.780   35.486  1.00 90.97  ? 278 CYS A CA  1 
ATOM   1714 C C   . CYS A 1 285 ? -30.989 7.083   36.646  1.00 103.54 ? 278 CYS A C   1 
ATOM   1715 O O   . CYS A 1 285 ? -30.903 5.864   36.785  1.00 110.08 ? 278 CYS A O   1 
ATOM   1716 C CB  . CYS A 1 285 ? -31.336 8.076   34.408  1.00 94.73  ? 278 CYS A CB  1 
ATOM   1717 S SG  . CYS A 1 285 ? -32.574 6.770   34.229  1.00 88.60  ? 278 CYS A SG  1 
ATOM   1718 N N   . ASP A 1 286 ? -31.668 7.858   37.484  1.00 116.26 ? 279 ASP A N   1 
ATOM   1719 C CA  . ASP A 1 286 ? -32.343 7.297   38.645  1.00 132.16 ? 279 ASP A CA  1 
ATOM   1720 C C   . ASP A 1 286 ? -33.378 6.270   38.205  1.00 127.81 ? 279 ASP A C   1 
ATOM   1721 O O   . ASP A 1 286 ? -34.105 6.472   37.233  1.00 123.07 ? 279 ASP A O   1 
ATOM   1722 C CB  . ASP A 1 286 ? -33.020 8.406   39.448  1.00 151.37 ? 279 ASP A CB  1 
ATOM   1723 C CG  . ASP A 1 286 ? -33.992 9.217   38.614  1.00 167.71 ? 279 ASP A CG  1 
ATOM   1724 O OD1 . ASP A 1 286 ? -34.346 10.340  39.030  1.00 178.05 ? 279 ASP A OD1 1 
ATOM   1725 O OD2 . ASP A 1 286 ? -34.402 8.732   37.539  1.00 166.30 ? 279 ASP A OD2 1 
ATOM   1726 N N   . THR A 1 287 ? -33.426 5.162   38.935  1.00 128.90 ? 280 THR A N   1 
ATOM   1727 C CA  . THR A 1 287 ? -34.303 4.036   38.621  1.00 124.91 ? 280 THR A CA  1 
ATOM   1728 C C   . THR A 1 287 ? -35.194 3.572   39.775  1.00 121.90 ? 280 THR A C   1 
ATOM   1729 O O   . THR A 1 287 ? -35.849 2.539   39.664  1.00 116.02 ? 280 THR A O   1 
ATOM   1730 C CB  . THR A 1 287 ? -33.506 2.822   38.085  1.00 118.17 ? 280 THR A CB  1 
ATOM   1731 O OG1 . THR A 1 287 ? -32.456 2.495   38.999  1.00 108.35 ? 280 THR A OG1 1 
ATOM   1732 C CG2 . THR A 1 287 ? -32.901 3.131   36.728  1.00 118.99 ? 280 THR A CG2 1 
ATOM   1733 N N   . SER A 1 288 ? -35.228 4.338   40.864  1.00 120.89 ? 281 SER A N   1 
ATOM   1734 C CA  . SER A 1 288 ? -35.980 3.952   42.059  1.00 115.51 ? 281 SER A CA  1 
ATOM   1735 C C   . SER A 1 288 ? -37.447 3.640   41.775  1.00 114.26 ? 281 SER A C   1 
ATOM   1736 O O   . SER A 1 288 ? -37.984 2.651   42.276  1.00 116.13 ? 281 SER A O   1 
ATOM   1737 C CB  . SER A 1 288 ? -35.868 5.024   43.149  1.00 108.10 ? 281 SER A CB  1 
ATOM   1738 O OG  . SER A 1 288 ? -34.625 4.941   43.824  1.00 100.91 ? 281 SER A OG  1 
ATOM   1739 N N   . ASN A 1 289 ? -38.088 4.476   40.963  1.00 107.92 ? 282 ASN A N   1 
ATOM   1740 C CA  . ASN A 1 289 ? -39.500 4.280   40.641  1.00 107.21 ? 282 ASN A CA  1 
ATOM   1741 C C   . ASN A 1 289 ? -39.755 3.477   39.367  1.00 101.43 ? 282 ASN A C   1 
ATOM   1742 O O   . ASN A 1 289 ? -40.712 3.741   38.639  1.00 96.65  ? 282 ASN A O   1 
ATOM   1743 C CB  . ASN A 1 289 ? -40.242 5.618   40.583  1.00 109.76 ? 282 ASN A CB  1 
ATOM   1744 C CG  . ASN A 1 289 ? -40.911 5.966   41.896  1.00 118.01 ? 282 ASN A CG  1 
ATOM   1745 O OD1 . ASN A 1 289 ? -40.567 5.415   42.943  1.00 118.22 ? 282 ASN A OD1 1 
ATOM   1746 N ND2 . ASN A 1 289 ? -41.878 6.877   41.849  1.00 121.39 ? 282 ASN A ND2 1 
ATOM   1747 N N   . PHE A 1 290 ? -38.898 2.494   39.108  1.00 103.81 ? 283 PHE A N   1 
ATOM   1748 C CA  . PHE A 1 290 ? -39.070 1.592   37.972  1.00 105.32 ? 283 PHE A CA  1 
ATOM   1749 C C   . PHE A 1 290 ? -39.446 0.190   38.443  1.00 105.38 ? 283 PHE A C   1 
ATOM   1750 O O   . PHE A 1 290 ? -39.574 -0.063  39.643  1.00 109.77 ? 283 PHE A O   1 
ATOM   1751 C CB  . PHE A 1 290 ? -37.784 1.525   37.145  1.00 106.94 ? 283 PHE A CB  1 
ATOM   1752 C CG  . PHE A 1 290 ? -37.617 2.666   36.187  1.00 101.90 ? 283 PHE A CG  1 
ATOM   1753 C CD1 . PHE A 1 290 ? -36.370 3.216   35.962  1.00 104.92 ? 283 PHE A CD1 1 
ATOM   1754 C CD2 . PHE A 1 290 ? -38.705 3.182   35.510  1.00 96.35  ? 283 PHE A CD2 1 
ATOM   1755 C CE1 . PHE A 1 290 ? -36.210 4.259   35.085  1.00 104.38 ? 283 PHE A CE1 1 
ATOM   1756 C CE2 . PHE A 1 290 ? -38.552 4.218   34.618  1.00 96.19  ? 283 PHE A CE2 1 
ATOM   1757 C CZ  . PHE A 1 290 ? -37.303 4.762   34.409  1.00 99.81  ? 283 PHE A CZ  1 
ATOM   1758 N N   . SER A 1 291 ? -39.616 -0.722  37.496  1.00 99.51  ? 284 SER A N   1 
ATOM   1759 C CA  . SER A 1 291 ? -39.882 -2.114  37.834  1.00 99.59  ? 284 SER A CA  1 
ATOM   1760 C C   . SER A 1 291 ? -38.558 -2.862  38.028  1.00 104.83 ? 284 SER A C   1 
ATOM   1761 O O   . SER A 1 291 ? -37.512 -2.395  37.580  1.00 104.37 ? 284 SER A O   1 
ATOM   1762 C CB  . SER A 1 291 ? -40.749 -2.765  36.755  1.00 88.58  ? 284 SER A CB  1 
ATOM   1763 O OG  . SER A 1 291 ? -41.977 -2.067  36.611  1.00 75.31  ? 284 SER A OG  1 
ATOM   1764 N N   . ASP A 1 292 ? -38.597 -4.009  38.707  1.00 106.84 ? 285 ASP A N   1 
ATOM   1765 C CA  . ASP A 1 292 ? -37.369 -4.741  39.044  1.00 106.37 ? 285 ASP A CA  1 
ATOM   1766 C C   . ASP A 1 292 ? -36.704 -5.433  37.847  1.00 99.37  ? 285 ASP A C   1 
ATOM   1767 O O   . ASP A 1 292 ? -37.372 -5.819  36.896  1.00 94.24  ? 285 ASP A O   1 
ATOM   1768 C CB  . ASP A 1 292 ? -37.608 -5.730  40.197  1.00 107.75 ? 285 ASP A CB  1 
ATOM   1769 C CG  . ASP A 1 292 ? -38.835 -6.598  39.982  1.00 103.22 ? 285 ASP A CG  1 
ATOM   1770 O OD1 . ASP A 1 292 ? -38.752 -7.821  40.242  1.00 94.63  ? 285 ASP A OD1 1 
ATOM   1771 O OD2 . ASP A 1 292 ? -39.880 -6.053  39.559  1.00 103.69 ? 285 ASP A OD2 1 
ATOM   1772 N N   . TYR A 1 293 ? -35.386 -5.594  37.922  1.00 93.16  ? 286 TYR A N   1 
ATOM   1773 C CA  . TYR A 1 293 ? -34.579 -6.069  36.800  1.00 91.17  ? 286 TYR A CA  1 
ATOM   1774 C C   . TYR A 1 293 ? -34.491 -7.591  36.683  1.00 97.49  ? 286 TYR A C   1 
ATOM   1775 O O   . TYR A 1 293 ? -34.594 -8.305  37.676  1.00 95.50  ? 286 TYR A O   1 
ATOM   1776 C CB  . TYR A 1 293 ? -33.171 -5.479  36.918  1.00 87.91  ? 286 TYR A CB  1 
ATOM   1777 C CG  . TYR A 1 293 ? -32.132 -6.082  35.994  1.00 87.40  ? 286 TYR A CG  1 
ATOM   1778 C CD1 . TYR A 1 293 ? -31.944 -5.585  34.709  1.00 89.85  ? 286 TYR A CD1 1 
ATOM   1779 C CD2 . TYR A 1 293 ? -31.325 -7.136  36.413  1.00 86.46  ? 286 TYR A CD2 1 
ATOM   1780 C CE1 . TYR A 1 293 ? -30.986 -6.117  33.866  1.00 92.57  ? 286 TYR A CE1 1 
ATOM   1781 C CE2 . TYR A 1 293 ? -30.372 -7.685  35.574  1.00 91.86  ? 286 TYR A CE2 1 
ATOM   1782 C CZ  . TYR A 1 293 ? -30.204 -7.170  34.301  1.00 97.50  ? 286 TYR A CZ  1 
ATOM   1783 O OH  . TYR A 1 293 ? -29.252 -7.706  33.460  1.00 99.66  ? 286 TYR A OH  1 
ATOM   1784 N N   . ILE A 1 294 ? -34.316 -8.072  35.452  1.00 107.13 ? 287 ILE A N   1 
ATOM   1785 C CA  . ILE A 1 294 ? -33.954 -9.465  35.174  1.00 117.13 ? 287 ILE A CA  1 
ATOM   1786 C C   . ILE A 1 294 ? -32.880 -9.480  34.067  1.00 127.37 ? 287 ILE A C   1 
ATOM   1787 O O   . ILE A 1 294 ? -32.804 -8.552  33.262  1.00 133.39 ? 287 ILE A O   1 
ATOM   1788 C CB  . ILE A 1 294 ? -35.177 -10.321 34.758  1.00 82.15  ? 287 ILE A CB  1 
ATOM   1789 C CG1 . ILE A 1 294 ? -36.400 -9.993  35.625  1.00 67.28  ? 287 ILE A CG1 1 
ATOM   1790 C CG2 . ILE A 1 294 ? -34.844 -11.812 34.832  1.00 88.20  ? 287 ILE A CG2 1 
ATOM   1791 C CD1 . ILE A 1 294 ? -37.727 -10.519 35.077  1.00 57.93  ? 287 ILE A CD1 1 
ATOM   1792 N N   . ARG A 1 295 ? -32.083 -10.547 34.020  1.00 130.45 ? 288 ARG A N   1 
ATOM   1793 C CA  . ARG A 1 295 ? -30.794 -10.598 33.297  1.00 134.00 ? 288 ARG A CA  1 
ATOM   1794 C C   . ARG A 1 295 ? -30.603 -9.919  31.926  1.00 129.61 ? 288 ARG A C   1 
ATOM   1795 O O   . ARG A 1 295 ? -29.676 -9.122  31.764  1.00 126.84 ? 288 ARG A O   1 
ATOM   1796 C CB  . ARG A 1 295 ? -30.286 -12.042 33.217  1.00 137.85 ? 288 ARG A CB  1 
ATOM   1797 C CG  . ARG A 1 295 ? -31.207 -13.015 32.496  1.00 137.18 ? 288 ARG A CG  1 
ATOM   1798 C CD  . ARG A 1 295 ? -30.717 -14.445 32.661  1.00 137.55 ? 288 ARG A CD  1 
ATOM   1799 N NE  . ARG A 1 295 ? -30.835 -14.905 34.044  1.00 135.54 ? 288 ARG A NE  1 
ATOM   1800 C CZ  . ARG A 1 295 ? -29.849 -14.871 34.937  1.00 134.11 ? 288 ARG A CZ  1 
ATOM   1801 N NH1 . ARG A 1 295 ? -28.657 -14.397 34.599  1.00 132.71 ? 288 ARG A NH1 1 
ATOM   1802 N NH2 . ARG A 1 295 ? -30.056 -15.312 36.172  1.00 135.06 ? 288 ARG A NH2 1 
ATOM   1803 N N   . GLY A 1 296 ? -31.442 -10.254 30.949  1.00 124.65 ? 289 GLY A N   1 
ATOM   1804 C CA  . GLY A 1 296 ? -31.225 -9.830  29.575  1.00 119.00 ? 289 GLY A CA  1 
ATOM   1805 C C   . GLY A 1 296 ? -30.977 -8.344  29.404  1.00 116.55 ? 289 GLY A C   1 
ATOM   1806 O O   . GLY A 1 296 ? -31.347 -7.547  30.263  1.00 121.29 ? 289 GLY A O   1 
ATOM   1807 N N   . GLY A 1 297 ? -30.332 -7.968  28.306  1.00 108.78 ? 290 GLY A N   1 
ATOM   1808 C CA  . GLY A 1 297 ? -30.148 -6.561  27.998  1.00 100.01 ? 290 GLY A CA  1 
ATOM   1809 C C   . GLY A 1 297 ? -28.775 -6.172  27.490  1.00 96.84  ? 290 GLY A C   1 
ATOM   1810 O O   . GLY A 1 297 ? -27.756 -6.648  27.994  1.00 98.73  ? 290 GLY A O   1 
ATOM   1811 N N   . ILE A 1 298 ? -28.756 -5.302  26.481  1.00 93.36  ? 291 ILE A N   1 
ATOM   1812 C CA  . ILE A 1 298 ? -27.516 -4.744  25.950  1.00 89.89  ? 291 ILE A CA  1 
ATOM   1813 C C   . ILE A 1 298 ? -27.507 -3.223  26.099  1.00 85.98  ? 291 ILE A C   1 
ATOM   1814 O O   . ILE A 1 298 ? -28.561 -2.585  26.122  1.00 86.24  ? 291 ILE A O   1 
ATOM   1815 C CB  . ILE A 1 298 ? -27.278 -5.141  24.463  1.00 92.01  ? 291 ILE A CB  1 
ATOM   1816 C CG1 . ILE A 1 298 ? -27.347 -3.921  23.533  1.00 82.44  ? 291 ILE A CG1 1 
ATOM   1817 C CG2 . ILE A 1 298 ? -28.264 -6.219  24.026  1.00 94.21  ? 291 ILE A CG2 1 
ATOM   1818 C CD1 . ILE A 1 298 ? -26.820 -4.181  22.135  1.00 75.01  ? 291 ILE A CD1 1 
ATOM   1819 N N   . VAL A 1 299 ? -26.311 -2.653  26.217  1.00 81.43  ? 292 VAL A N   1 
ATOM   1820 C CA  . VAL A 1 299 ? -26.142 -1.211  26.344  1.00 72.84  ? 292 VAL A CA  1 
ATOM   1821 C C   . VAL A 1 299 ? -25.282 -0.703  25.193  1.00 74.10  ? 292 VAL A C   1 
ATOM   1822 O O   . VAL A 1 299 ? -24.441 -1.432  24.672  1.00 83.13  ? 292 VAL A O   1 
ATOM   1823 C CB  . VAL A 1 299 ? -25.515 -0.835  27.710  1.00 71.12  ? 292 VAL A CB  1 
ATOM   1824 C CG1 . VAL A 1 299 ? -24.095 -0.296  27.546  1.00 81.86  ? 292 VAL A CG1 1 
ATOM   1825 C CG2 . VAL A 1 299 ? -26.376 0.172   28.425  1.00 57.29  ? 292 VAL A CG2 1 
ATOM   1826 N N   . SER A 1 300 ? -25.511 0.537   24.778  1.00 70.19  ? 293 SER A N   1 
ATOM   1827 C CA  . SER A 1 300 ? -24.746 1.121   23.689  1.00 70.95  ? 293 SER A CA  1 
ATOM   1828 C C   . SER A 1 300 ? -24.302 2.520   24.078  1.00 85.27  ? 293 SER A C   1 
ATOM   1829 O O   . SER A 1 300 ? -24.723 3.055   25.102  1.00 91.44  ? 293 SER A O   1 
ATOM   1830 C CB  . SER A 1 300 ? -25.584 1.182   22.412  1.00 64.47  ? 293 SER A CB  1 
ATOM   1831 O OG  . SER A 1 300 ? -26.162 -0.075  22.107  1.00 58.50  ? 293 SER A OG  1 
ATOM   1832 N N   . GLN A 1 301 ? -23.453 3.115   23.253  1.00 89.73  ? 294 GLN A N   1 
ATOM   1833 C CA  . GLN A 1 301 ? -22.967 4.458   23.513  1.00 92.17  ? 294 GLN A CA  1 
ATOM   1834 C C   . GLN A 1 301 ? -23.466 5.379   22.407  1.00 93.73  ? 294 GLN A C   1 
ATOM   1835 O O   . GLN A 1 301 ? -23.088 5.215   21.251  1.00 100.83 ? 294 GLN A O   1 
ATOM   1836 C CB  . GLN A 1 301 ? -21.443 4.446   23.546  1.00 95.22  ? 294 GLN A CB  1 
ATOM   1837 C CG  . GLN A 1 301 ? -20.813 5.639   24.231  1.00 96.00  ? 294 GLN A CG  1 
ATOM   1838 C CD  . GLN A 1 301 ? -19.318 5.712   23.991  1.00 97.47  ? 294 GLN A CD  1 
ATOM   1839 O OE1 . GLN A 1 301 ? -18.854 5.622   22.853  1.00 95.03  ? 294 GLN A OE1 1 
ATOM   1840 N NE2 . GLN A 1 301 ? -18.555 5.876   25.065  1.00 101.58 ? 294 GLN A NE2 1 
ATOM   1841 N N   . VAL A 1 302 ? -24.311 6.346   22.758  1.00 89.99  ? 295 VAL A N   1 
ATOM   1842 C CA  . VAL A 1 302 ? -24.984 7.176   21.756  1.00 84.75  ? 295 VAL A CA  1 
ATOM   1843 C C   . VAL A 1 302 ? -24.268 8.491   21.466  1.00 77.92  ? 295 VAL A C   1 
ATOM   1844 O O   . VAL A 1 302 ? -24.249 8.952   20.329  1.00 75.83  ? 295 VAL A O   1 
ATOM   1845 C CB  . VAL A 1 302 ? -26.431 7.493   22.167  1.00 85.60  ? 295 VAL A CB  1 
ATOM   1846 C CG1 . VAL A 1 302 ? -27.210 8.052   20.981  1.00 85.64  ? 295 VAL A CG1 1 
ATOM   1847 C CG2 . VAL A 1 302 ? -27.098 6.249   22.701  1.00 87.42  ? 295 VAL A CG2 1 
ATOM   1848 N N   . LYS A 1 303 ? -23.698 9.103   22.496  1.00 71.51  ? 296 LYS A N   1 
ATOM   1849 C CA  . LYS A 1 303 ? -22.964 10.350  22.326  1.00 65.06  ? 296 LYS A CA  1 
ATOM   1850 C C   . LYS A 1 303 ? -21.792 10.418  23.301  1.00 66.24  ? 296 LYS A C   1 
ATOM   1851 O O   . LYS A 1 303 ? -21.838 9.842   24.390  1.00 65.43  ? 296 LYS A O   1 
ATOM   1852 C CB  . LYS A 1 303 ? -23.890 11.566  22.499  1.00 56.34  ? 296 LYS A CB  1 
ATOM   1853 C CG  . LYS A 1 303 ? -24.223 12.310  21.202  1.00 52.89  ? 296 LYS A CG  1 
ATOM   1854 C CD  . LYS A 1 303 ? -25.666 12.050  20.753  1.00 66.01  ? 296 LYS A CD  1 
ATOM   1855 C CE  . LYS A 1 303 ? -25.943 12.532  19.316  1.00 73.07  ? 296 LYS A CE  1 
ATOM   1856 N NZ  . LYS A 1 303 ? -25.869 14.020  19.121  1.00 71.77  ? 296 LYS A NZ  1 
ATOM   1857 N N   . VAL A 1 304 ? -20.732 11.105  22.890  1.00 67.51  ? 297 VAL A N   1 
ATOM   1858 C CA  . VAL A 1 304 ? -19.583 11.341  23.757  1.00 67.49  ? 297 VAL A CA  1 
ATOM   1859 C C   . VAL A 1 304 ? -19.182 12.802  23.647  1.00 57.74  ? 297 VAL A C   1 
ATOM   1860 O O   . VAL A 1 304 ? -19.416 13.430  22.619  1.00 52.38  ? 297 VAL A O   1 
ATOM   1861 C CB  . VAL A 1 304 ? -18.373 10.448  23.390  1.00 68.47  ? 297 VAL A CB  1 
ATOM   1862 C CG1 . VAL A 1 304 ? -18.688 8.997   23.660  1.00 66.02  ? 297 VAL A CG1 1 
ATOM   1863 C CG2 . VAL A 1 304 ? -17.961 10.651  21.933  1.00 68.74  ? 297 VAL A CG2 1 
ATOM   1864 N N   . PRO A 1 305 ? -18.596 13.353  24.719  1.00 55.03  ? 298 PRO A N   1 
ATOM   1865 C CA  . PRO A 1 305 ? -18.134 14.747  24.744  1.00 50.46  ? 298 PRO A CA  1 
ATOM   1866 C C   . PRO A 1 305 ? -16.720 14.933  24.185  1.00 53.60  ? 298 PRO A C   1 
ATOM   1867 O O   . PRO A 1 305 ? -15.897 14.025  24.293  1.00 66.93  ? 298 PRO A O   1 
ATOM   1868 C CB  . PRO A 1 305 ? -18.162 15.087  26.234  1.00 50.30  ? 298 PRO A CB  1 
ATOM   1869 C CG  . PRO A 1 305 ? -17.917 13.785  26.913  1.00 46.50  ? 298 PRO A CG  1 
ATOM   1870 C CD  . PRO A 1 305 ? -18.549 12.728  26.053  1.00 49.44  ? 298 PRO A CD  1 
ATOM   1871 N N   . LYS A 1 306 ? -16.454 16.093  23.587  1.00 45.97  ? 299 LYS A N   1 
ATOM   1872 C CA  . LYS A 1 306 ? -15.128 16.437  23.079  1.00 45.86  ? 299 LYS A CA  1 
ATOM   1873 C C   . LYS A 1 306 ? -14.898 17.913  23.325  1.00 53.87  ? 299 LYS A C   1 
ATOM   1874 O O   . LYS A 1 306 ? -15.803 18.716  23.127  1.00 58.25  ? 299 LYS A O   1 
ATOM   1875 C CB  . LYS A 1 306 ? -15.031 16.191  21.572  1.00 50.20  ? 299 LYS A CB  1 
ATOM   1876 C CG  . LYS A 1 306 ? -15.402 14.792  21.106  1.00 62.47  ? 299 LYS A CG  1 
ATOM   1877 C CD  . LYS A 1 306 ? -15.488 14.710  19.577  1.00 72.39  ? 299 LYS A CD  1 
ATOM   1878 C CE  . LYS A 1 306 ? -14.112 14.743  18.894  1.00 76.62  ? 299 LYS A CE  1 
ATOM   1879 N NZ  . LYS A 1 306 ? -13.616 16.116  18.569  1.00 68.12  ? 299 LYS A NZ  1 
ATOM   1880 N N   . LYS A 1 307 ? -13.700 18.287  23.754  1.00 60.15  ? 300 LYS A N   1 
ATOM   1881 C CA  . LYS A 1 307 ? -13.370 19.703  23.804  1.00 60.63  ? 300 LYS A CA  1 
ATOM   1882 C C   . LYS A 1 307 ? -13.164 20.159  22.371  1.00 70.25  ? 300 LYS A C   1 
ATOM   1883 O O   . LYS A 1 307 ? -12.356 19.587  21.645  1.00 85.72  ? 300 LYS A O   1 
ATOM   1884 C CB  . LYS A 1 307 ? -12.109 19.952  24.630  1.00 59.39  ? 300 LYS A CB  1 
ATOM   1885 C CG  . LYS A 1 307 ? -12.033 19.076  25.865  1.00 82.22  ? 300 LYS A CG  1 
ATOM   1886 C CD  . LYS A 1 307 ? -10.936 19.500  26.837  1.00 89.74  ? 300 LYS A CD  1 
ATOM   1887 C CE  . LYS A 1 307 ? -10.940 18.598  28.075  1.00 85.16  ? 300 LYS A CE  1 
ATOM   1888 N NZ  . LYS A 1 307 ? -10.067 19.105  29.173  1.00 82.27  ? 300 LYS A NZ  1 
ATOM   1889 N N   . ILE A 1 308 ? -13.920 21.163  21.946  1.00 63.73  ? 301 ILE A N   1 
ATOM   1890 C CA  . ILE A 1 308 ? -13.677 21.793  20.653  1.00 56.97  ? 301 ILE A CA  1 
ATOM   1891 C C   . ILE A 1 308 ? -13.015 23.143  20.902  1.00 48.68  ? 301 ILE A C   1 
ATOM   1892 O O   . ILE A 1 308 ? -13.418 23.875  21.798  1.00 48.32  ? 301 ILE A O   1 
ATOM   1893 C CB  . ILE A 1 308 ? -14.981 21.958  19.836  1.00 62.46  ? 301 ILE A CB  1 
ATOM   1894 C CG1 . ILE A 1 308 ? -15.468 20.599  19.322  1.00 60.39  ? 301 ILE A CG1 1 
ATOM   1895 C CG2 . ILE A 1 308 ? -14.796 22.927  18.675  1.00 67.80  ? 301 ILE A CG2 1 
ATOM   1896 C CD1 . ILE A 1 308 ? -14.504 19.916  18.402  1.00 64.74  ? 301 ILE A CD1 1 
ATOM   1897 N N   . SER A 1 309 ? -11.979 23.460  20.135  1.00 51.52  ? 302 SER A N   1 
ATOM   1898 C CA  . SER A 1 309 ? -11.295 24.734  20.296  1.00 50.22  ? 302 SER A CA  1 
ATOM   1899 C C   . SER A 1 309 ? -11.697 25.733  19.208  1.00 46.31  ? 302 SER A C   1 
ATOM   1900 O O   . SER A 1 309 ? -11.643 25.420  18.018  1.00 54.59  ? 302 SER A O   1 
ATOM   1901 C CB  . SER A 1 309 ? -9.780  24.531  20.314  1.00 54.95  ? 302 SER A CB  1 
ATOM   1902 O OG  . SER A 1 309 ? -9.208  25.128  21.468  1.00 63.30  ? 302 SER A OG  1 
ATOM   1903 N N   . PHE A 1 310 ? -12.101 26.930  19.627  1.00 33.18  ? 303 PHE A N   1 
ATOM   1904 C CA  . PHE A 1 310 ? -12.582 27.957  18.712  1.00 33.54  ? 303 PHE A CA  1 
ATOM   1905 C C   . PHE A 1 310 ? -11.535 29.037  18.487  1.00 33.09  ? 303 PHE A C   1 
ATOM   1906 O O   . PHE A 1 310 ? -10.953 29.540  19.439  1.00 36.73  ? 303 PHE A O   1 
ATOM   1907 C CB  . PHE A 1 310 ? -13.854 28.607  19.277  1.00 46.78  ? 303 PHE A CB  1 
ATOM   1908 C CG  . PHE A 1 310 ? -15.121 27.858  18.958  1.00 47.91  ? 303 PHE A CG  1 
ATOM   1909 C CD1 . PHE A 1 310 ? -15.411 26.648  19.582  1.00 44.41  ? 303 PHE A CD1 1 
ATOM   1910 C CD2 . PHE A 1 310 ? -16.032 28.373  18.048  1.00 39.77  ? 303 PHE A CD2 1 
ATOM   1911 C CE1 . PHE A 1 310 ? -16.579 25.950  19.283  1.00 38.49  ? 303 PHE A CE1 1 
ATOM   1912 C CE2 . PHE A 1 310 ? -17.203 27.690  17.759  1.00 37.63  ? 303 PHE A CE2 1 
ATOM   1913 C CZ  . PHE A 1 310 ? -17.474 26.472  18.375  1.00 27.83  ? 303 PHE A CZ  1 
ATOM   1914 N N   . LYS A 1 311 ? -11.306 29.413  17.232  1.00 37.26  ? 304 LYS A N   1 
ATOM   1915 C CA  . LYS A 1 311 ? -10.418 30.534  16.941  1.00 33.50  ? 304 LYS A CA  1 
ATOM   1916 C C   . LYS A 1 311 ? -11.129 31.824  17.326  1.00 34.80  ? 304 LYS A C   1 
ATOM   1917 O O   . LYS A 1 311 ? -12.361 31.905  17.255  1.00 31.41  ? 304 LYS A O   1 
ATOM   1918 C CB  . LYS A 1 311 ? -10.025 30.579  15.457  1.00 36.37  ? 304 LYS A CB  1 
ATOM   1919 C CG  . LYS A 1 311 ? -9.237  29.361  14.922  1.00 48.48  ? 304 LYS A CG  1 
ATOM   1920 C CD  . LYS A 1 311 ? -10.150 28.296  14.264  1.00 66.25  ? 304 LYS A CD  1 
ATOM   1921 C CE  . LYS A 1 311 ? -10.910 28.840  13.032  1.00 69.08  ? 304 LYS A CE  1 
ATOM   1922 N NZ  . LYS A 1 311 ? -12.055 27.987  12.566  1.00 53.56  ? 304 LYS A NZ  1 
ATOM   1923 N N   . SER A 1 312 ? -10.364 32.829  17.744  1.00 33.49  ? 305 SER A N   1 
ATOM   1924 C CA  . SER A 1 312 ? -10.913 34.169  17.898  1.00 26.70  ? 305 SER A CA  1 
ATOM   1925 C C   . SER A 1 312 ? -11.406 34.657  16.526  1.00 33.86  ? 305 SER A C   1 
ATOM   1926 O O   . SER A 1 312 ? -11.041 34.083  15.493  1.00 28.99  ? 305 SER A O   1 
ATOM   1927 C CB  . SER A 1 312 ? -9.843  35.120  18.428  1.00 27.86  ? 305 SER A CB  1 
ATOM   1928 O OG  . SER A 1 312 ? -9.032  35.609  17.366  1.00 38.73  ? 305 SER A OG  1 
ATOM   1929 N N   . LEU A 1 313 ? -12.220 35.712  16.505  1.00 34.84  ? 306 LEU A N   1 
ATOM   1930 C CA  . LEU A 1 313 ? -12.736 36.242  15.234  1.00 35.88  ? 306 LEU A CA  1 
ATOM   1931 C C   . LEU A 1 313 ? -11.606 36.711  14.318  1.00 36.18  ? 306 LEU A C   1 
ATOM   1932 O O   . LEU A 1 313 ? -11.617 36.457  13.107  1.00 38.37  ? 306 LEU A O   1 
ATOM   1933 C CB  . LEU A 1 313 ? -13.724 37.383  15.476  1.00 28.77  ? 306 LEU A CB  1 
ATOM   1934 C CG  . LEU A 1 313 ? -14.252 38.165  14.268  1.00 25.16  ? 306 LEU A CG  1 
ATOM   1935 C CD1 . LEU A 1 313 ? -14.986 37.259  13.254  1.00 16.24  ? 306 LEU A CD1 1 
ATOM   1936 C CD2 . LEU A 1 313 ? -15.155 39.325  14.734  1.00 20.48  ? 306 LEU A CD2 1 
ATOM   1937 N N   . VAL A 1 314 ? -10.631 37.388  14.920  1.00 41.02  ? 307 VAL A N   1 
ATOM   1938 C CA  . VAL A 1 314 ? -9.467  37.911  14.211  1.00 47.85  ? 307 VAL A CA  1 
ATOM   1939 C C   . VAL A 1 314 ? -8.697  36.793  13.515  1.00 38.77  ? 307 VAL A C   1 
ATOM   1940 O O   . VAL A 1 314 ? -8.242  36.958  12.394  1.00 30.31  ? 307 VAL A O   1 
ATOM   1941 C CB  . VAL A 1 314 ? -8.521  38.667  15.177  1.00 58.78  ? 307 VAL A CB  1 
ATOM   1942 C CG1 . VAL A 1 314 ? -7.333  39.237  14.429  1.00 35.02  ? 307 VAL A CG1 1 
ATOM   1943 C CG2 . VAL A 1 314 ? -9.283  39.771  15.916  1.00 66.67  ? 307 VAL A CG2 1 
ATOM   1944 N N   . ALA A 1 315 ? -8.571  35.655  14.187  1.00 39.92  ? 308 ALA A N   1 
ATOM   1945 C CA  . ALA A 1 315 ? -7.905  34.482  13.628  1.00 32.16  ? 308 ALA A CA  1 
ATOM   1946 C C   . ALA A 1 315 ? -8.761  33.745  12.600  1.00 34.13  ? 308 ALA A C   1 
ATOM   1947 O O   . ALA A 1 315 ? -8.260  33.326  11.561  1.00 35.03  ? 308 ALA A O   1 
ATOM   1948 C CB  . ALA A 1 315 ? -7.515  33.519  14.749  1.00 21.80  ? 308 ALA A CB  1 
ATOM   1949 N N   . SER A 1 316 ? -10.045 33.569  12.912  1.00 33.74  ? 309 SER A N   1 
ATOM   1950 C CA  . SER A 1 316 ? -10.927 32.753  12.093  1.00 27.93  ? 309 SER A CA  1 
ATOM   1951 C C   . SER A 1 316 ? -11.199 33.481  10.798  1.00 39.10  ? 309 SER A C   1 
ATOM   1952 O O   . SER A 1 316 ? -11.452 32.865  9.760   1.00 36.18  ? 309 SER A O   1 
ATOM   1953 C CB  . SER A 1 316 ? -12.241 32.468  12.821  1.00 29.03  ? 309 SER A CB  1 
ATOM   1954 O OG  . SER A 1 316 ? -12.868 31.313  12.289  1.00 29.75  ? 309 SER A OG  1 
ATOM   1955 N N   . LEU A 1 317 ? -11.142 34.805  10.867  1.00 38.81  ? 310 LEU A N   1 
ATOM   1956 C CA  . LEU A 1 317 ? -11.325 35.625  9.686   1.00 35.53  ? 310 LEU A CA  1 
ATOM   1957 C C   . LEU A 1 317 ? -10.301 35.239  8.615   1.00 33.35  ? 310 LEU A C   1 
ATOM   1958 O O   . LEU A 1 317 ? -10.621 35.119  7.436   1.00 34.83  ? 310 LEU A O   1 
ATOM   1959 C CB  . LEU A 1 317 ? -11.216 37.097  10.071  1.00 37.43  ? 310 LEU A CB  1 
ATOM   1960 C CG  . LEU A 1 317 ? -11.831 38.084  9.089   1.00 40.82  ? 310 LEU A CG  1 
ATOM   1961 C CD1 . LEU A 1 317 ? -10.832 38.425  8.023   1.00 44.13  ? 310 LEU A CD1 1 
ATOM   1962 C CD2 . LEU A 1 317 ? -13.074 37.471  8.480   1.00 38.16  ? 310 LEU A CD2 1 
ATOM   1963 N N   . ALA A 1 318 ? -9.072  35.011  9.051   1.00 40.40  ? 311 ALA A N   1 
ATOM   1964 C CA  . ALA A 1 318 ? -7.992  34.622  8.157   1.00 40.17  ? 311 ALA A CA  1 
ATOM   1965 C C   . ALA A 1 318 ? -7.988  33.125  7.838   1.00 45.79  ? 311 ALA A C   1 
ATOM   1966 O O   . ALA A 1 318 ? -7.635  32.728  6.729   1.00 56.44  ? 311 ALA A O   1 
ATOM   1967 C CB  . ALA A 1 318 ? -6.652  35.044  8.756   1.00 32.67  ? 311 ALA A CB  1 
ATOM   1968 N N   . GLU A 1 319 ? -8.375  32.299  8.810   1.00 47.92  ? 312 GLU A N   1 
ATOM   1969 C CA  . GLU A 1 319 ? -8.316  30.844  8.662   1.00 50.21  ? 312 GLU A CA  1 
ATOM   1970 C C   . GLU A 1 319 ? -9.655  30.190  8.977   1.00 48.32  ? 312 GLU A C   1 
ATOM   1971 O O   . GLU A 1 319 ? -9.764  29.424  9.939   1.00 48.19  ? 312 GLU A O   1 
ATOM   1972 C CB  . GLU A 1 319 ? -7.252  30.255  9.590   1.00 59.18  ? 312 GLU A CB  1 
ATOM   1973 C CG  . GLU A 1 319 ? -5.896  30.940  9.527   1.00 63.73  ? 312 GLU A CG  1 
ATOM   1974 C CD  . GLU A 1 319 ? -4.743  29.951  9.463   1.00 60.95  ? 312 GLU A CD  1 
ATOM   1975 O OE1 . GLU A 1 319 ? -4.993  28.725  9.413   1.00 56.54  ? 312 GLU A OE1 1 
ATOM   1976 O OE2 . GLU A 1 319 ? -3.581  30.406  9.450   1.00 61.14  ? 312 GLU A OE2 1 
ATOM   1977 N N   . PRO A 1 320 ? -10.670 30.458  8.144   1.00 38.69  ? 313 PRO A N   1 
ATOM   1978 C CA  . PRO A 1 320 ? -12.066 30.175  8.485   1.00 43.53  ? 313 PRO A CA  1 
ATOM   1979 C C   . PRO A 1 320 ? -12.501 28.738  8.250   1.00 48.97  ? 313 PRO A C   1 
ATOM   1980 O O   . PRO A 1 320 ? -12.330 28.207  7.155   1.00 54.98  ? 313 PRO A O   1 
ATOM   1981 C CB  . PRO A 1 320 ? -12.833 31.111  7.549   1.00 40.51  ? 313 PRO A CB  1 
ATOM   1982 C CG  . PRO A 1 320 ? -11.971 31.204  6.339   1.00 31.90  ? 313 PRO A CG  1 
ATOM   1983 C CD  . PRO A 1 320 ? -10.543 31.050  6.806   1.00 25.29  ? 313 PRO A CD  1 
ATOM   1984 N N   . ASP A 1 321 ? -13.064 28.112  9.278   1.00 46.75  ? 314 ASP A N   1 
ATOM   1985 C CA  . ASP A 1 321 ? -13.763 26.859  9.061   1.00 39.74  ? 314 ASP A CA  1 
ATOM   1986 C C   . ASP A 1 321 ? -15.171 27.186  8.609   1.00 36.28  ? 314 ASP A C   1 
ATOM   1987 O O   . ASP A 1 321 ? -15.821 28.067  9.172   1.00 38.52  ? 314 ASP A O   1 
ATOM   1988 C CB  . ASP A 1 321 ? -13.788 26.023  10.325  1.00 48.84  ? 314 ASP A CB  1 
ATOM   1989 C CG  . ASP A 1 321 ? -12.430 25.480  10.676  1.00 71.91  ? 314 ASP A CG  1 
ATOM   1990 O OD1 . ASP A 1 321 ? -11.432 25.985  10.119  1.00 75.59  ? 314 ASP A OD1 1 
ATOM   1991 O OD2 . ASP A 1 321 ? -12.360 24.555  11.515  1.00 89.46  ? 314 ASP A OD2 1 
ATOM   1992 N N   . PHE A 1 322 ? -15.633 26.497  7.572   1.00 30.07  ? 315 PHE A N   1 
ATOM   1993 C CA  . PHE A 1 322 ? -16.974 26.733  7.068   1.00 42.78  ? 315 PHE A CA  1 
ATOM   1994 C C   . PHE A 1 322 ? -17.886 25.572  7.399   1.00 49.63  ? 315 PHE A C   1 
ATOM   1995 O O   . PHE A 1 322 ? -17.426 24.480  7.729   1.00 50.48  ? 315 PHE A O   1 
ATOM   1996 C CB  . PHE A 1 322 ? -16.969 26.968  5.555   1.00 47.39  ? 315 PHE A CB  1 
ATOM   1997 C CG  . PHE A 1 322 ? -16.316 28.245  5.145   1.00 47.09  ? 315 PHE A CG  1 
ATOM   1998 C CD1 . PHE A 1 322 ? -15.122 28.233  4.453   1.00 43.62  ? 315 PHE A CD1 1 
ATOM   1999 C CD2 . PHE A 1 322 ? -16.890 29.463  5.463   1.00 49.30  ? 315 PHE A CD2 1 
ATOM   2000 C CE1 . PHE A 1 322 ? -14.511 29.411  4.079   1.00 42.44  ? 315 PHE A CE1 1 
ATOM   2001 C CE2 . PHE A 1 322 ? -16.285 30.648  5.083   1.00 46.81  ? 315 PHE A CE2 1 
ATOM   2002 C CZ  . PHE A 1 322 ? -15.095 30.620  4.388   1.00 44.30  ? 315 PHE A CZ  1 
ATOM   2003 N N   . VAL A 1 323 ? -19.184 25.826  7.288   1.00 55.40  ? 316 VAL A N   1 
ATOM   2004 C CA  . VAL A 1 323 ? -20.212 24.836  7.558   1.00 60.20  ? 316 VAL A CA  1 
ATOM   2005 C C   . VAL A 1 323 ? -21.137 24.664  6.352   1.00 65.76  ? 316 VAL A C   1 
ATOM   2006 O O   . VAL A 1 323 ? -21.077 23.657  5.641   1.00 74.75  ? 316 VAL A O   1 
ATOM   2007 C CB  . VAL A 1 323 ? -21.049 25.256  8.767   1.00 51.39  ? 316 VAL A CB  1 
ATOM   2008 C CG1 . VAL A 1 323 ? -22.366 24.494  8.786   1.00 50.52  ? 316 VAL A CG1 1 
ATOM   2009 C CG2 . VAL A 1 323 ? -20.249 25.068  10.055  1.00 37.49  ? 316 VAL A CG2 1 
ATOM   2010 N N   . LYS A 1 329 ? -26.058 26.394  3.793   1.00 82.39  ? 322 LYS A N   1 
ATOM   2011 C CA  . LYS A 1 329 ? -26.494 25.561  2.680   1.00 76.93  ? 322 LYS A CA  1 
ATOM   2012 C C   . LYS A 1 329 ? -25.954 26.080  1.331   1.00 85.77  ? 322 LYS A C   1 
ATOM   2013 O O   . LYS A 1 329 ? -26.044 25.394  0.310   1.00 81.76  ? 322 LYS A O   1 
ATOM   2014 C CB  . LYS A 1 329 ? -28.025 25.449  2.674   1.00 53.22  ? 322 LYS A CB  1 
ATOM   2015 C CG  . LYS A 1 329 ? -28.579 24.414  1.700   1.00 48.12  ? 322 LYS A CG  1 
ATOM   2016 C CD  . LYS A 1 329 ? -30.107 24.347  1.713   1.00 56.60  ? 322 LYS A CD  1 
ATOM   2017 C CE  . LYS A 1 329 ? -30.756 25.700  2.023   1.00 56.05  ? 322 LYS A CE  1 
ATOM   2018 N NZ  . LYS A 1 329 ? -31.283 25.794  3.426   1.00 47.17  ? 322 LYS A NZ  1 
ATOM   2019 N N   . PHE A 1 330 ? -25.368 27.279  1.340   1.00 95.87  ? 323 PHE A N   1 
ATOM   2020 C CA  . PHE A 1 330 ? -24.839 27.916  0.121   1.00 95.25  ? 323 PHE A CA  1 
ATOM   2021 C C   . PHE A 1 330 ? -23.610 27.232  -0.484  1.00 99.93  ? 323 PHE A C   1 
ATOM   2022 O O   . PHE A 1 330 ? -22.687 26.842  0.229   1.00 101.02 ? 323 PHE A O   1 
ATOM   2023 C CB  . PHE A 1 330 ? -24.521 29.395  0.364   1.00 94.05  ? 323 PHE A CB  1 
ATOM   2024 C CG  . PHE A 1 330 ? -23.925 30.086  -0.831  1.00 102.56 ? 323 PHE A CG  1 
ATOM   2025 C CD1 . PHE A 1 330 ? -24.622 30.139  -2.031  1.00 114.21 ? 323 PHE A CD1 1 
ATOM   2026 C CD2 . PHE A 1 330 ? -22.674 30.675  -0.764  1.00 99.51  ? 323 PHE A CD2 1 
ATOM   2027 C CE1 . PHE A 1 330 ? -24.084 30.769  -3.141  1.00 115.76 ? 323 PHE A CE1 1 
ATOM   2028 C CE2 . PHE A 1 330 ? -22.134 31.308  -1.868  1.00 101.34 ? 323 PHE A CE2 1 
ATOM   2029 C CZ  . PHE A 1 330 ? -22.837 31.353  -3.057  1.00 110.33 ? 323 PHE A CZ  1 
ATOM   2030 N N   . SER A 1 331 ? -23.597 27.139  -1.812  1.00 106.01 ? 324 SER A N   1 
ATOM   2031 C CA  . SER A 1 331 ? -22.600 26.366  -2.560  1.00 105.10 ? 324 SER A CA  1 
ATOM   2032 C C   . SER A 1 331 ? -21.157 26.896  -2.534  1.00 97.90  ? 324 SER A C   1 
ATOM   2033 O O   . SER A 1 331 ? -20.217 26.125  -2.761  1.00 101.65 ? 324 SER A O   1 
ATOM   2034 C CB  . SER A 1 331 ? -23.059 26.177  -4.014  1.00 110.94 ? 324 SER A CB  1 
ATOM   2035 O OG  . SER A 1 331 ? -24.316 25.515  -4.076  1.00 118.02 ? 324 SER A OG  1 
ATOM   2036 N N   . ARG A 1 332 ? -20.968 28.188  -2.260  1.00 79.70  ? 325 ARG A N   1 
ATOM   2037 C CA  . ARG A 1 332 ? -19.616 28.751  -2.304  1.00 68.92  ? 325 ARG A CA  1 
ATOM   2038 C C   . ARG A 1 332 ? -19.274 29.778  -1.205  1.00 57.10  ? 325 ARG A C   1 
ATOM   2039 O O   . ARG A 1 332 ? -19.154 30.974  -1.463  1.00 54.92  ? 325 ARG A O   1 
ATOM   2040 C CB  . ARG A 1 332 ? -19.356 29.323  -3.693  1.00 79.32  ? 325 ARG A CB  1 
ATOM   2041 C CG  . ARG A 1 332 ? -17.918 29.685  -3.973  1.00 80.89  ? 325 ARG A CG  1 
ATOM   2042 C CD  . ARG A 1 332 ? -16.928 28.566  -3.714  1.00 70.44  ? 325 ARG A CD  1 
ATOM   2043 N NE  . ARG A 1 332 ? -16.535 28.481  -2.314  1.00 67.59  ? 325 ARG A NE  1 
ATOM   2044 C CZ  . ARG A 1 332 ? -16.105 27.362  -1.749  1.00 83.79  ? 325 ARG A CZ  1 
ATOM   2045 N NH1 . ARG A 1 332 ? -16.020 26.252  -2.472  1.00 91.47  ? 325 ARG A NH1 1 
ATOM   2046 N NH2 . ARG A 1 332 ? -15.767 27.344  -0.467  1.00 85.19  ? 325 ARG A NH2 1 
ATOM   2047 N N   . PRO A 1 333 ? -19.094 29.304  0.033   1.00 45.09  ? 326 PRO A N   1 
ATOM   2048 C CA  . PRO A 1 333 ? -18.909 30.210  1.167   1.00 40.44  ? 326 PRO A CA  1 
ATOM   2049 C C   . PRO A 1 333 ? -17.582 30.974  1.196   1.00 41.10  ? 326 PRO A C   1 
ATOM   2050 O O   . PRO A 1 333 ? -17.580 32.108  1.668   1.00 40.18  ? 326 PRO A O   1 
ATOM   2051 C CB  . PRO A 1 333 ? -18.999 29.271  2.369   1.00 33.74  ? 326 PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 333 ? -18.609 27.949  1.830   1.00 30.71  ? 326 PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 333 ? -19.172 27.900  0.466   1.00 34.70  ? 326 PRO A CD  1 
ATOM   2054 N N   . ALA A 1 334 ? -16.481 30.395  0.728   1.00 43.67  ? 327 ALA A N   1 
ATOM   2055 C CA  . ALA A 1 334 ? -15.207 31.123  0.769   1.00 35.19  ? 327 ALA A CA  1 
ATOM   2056 C C   . ALA A 1 334 ? -15.294 32.418  -0.031  1.00 34.11  ? 327 ALA A C   1 
ATOM   2057 O O   . ALA A 1 334 ? -14.726 33.442  0.347   1.00 33.74  ? 327 ALA A O   1 
ATOM   2058 C CB  . ALA A 1 334 ? -14.067 30.265  0.279   1.00 21.69  ? 327 ALA A CB  1 
ATOM   2059 N N   . GLN A 1 335 ? -16.050 32.375  -1.117  1.00 34.06  ? 328 GLN A N   1 
ATOM   2060 C CA  . GLN A 1 335 ? -16.251 33.554  -1.941  1.00 30.77  ? 328 GLN A CA  1 
ATOM   2061 C C   . GLN A 1 335 ? -17.170 34.606  -1.327  1.00 35.22  ? 328 GLN A C   1 
ATOM   2062 O O   . GLN A 1 335 ? -16.884 35.800  -1.409  1.00 46.06  ? 328 GLN A O   1 
ATOM   2063 C CB  . GLN A 1 335 ? -16.683 33.110  -3.317  1.00 34.07  ? 328 GLN A CB  1 
ATOM   2064 C CG  . GLN A 1 335 ? -15.708 32.052  -3.757  1.00 44.84  ? 328 GLN A CG  1 
ATOM   2065 C CD  . GLN A 1 335 ? -15.436 32.068  -5.216  1.00 46.22  ? 328 GLN A CD  1 
ATOM   2066 O OE1 . GLN A 1 335 ? -14.778 32.974  -5.724  1.00 46.49  ? 328 GLN A OE1 1 
ATOM   2067 N NE2 . GLN A 1 335 ? -15.925 31.057  -5.912  1.00 43.38  ? 328 GLN A NE2 1 
ATOM   2068 N N   . LEU A 1 336 ? -18.256 34.176  -0.700  1.00 29.12  ? 329 LEU A N   1 
ATOM   2069 C CA  . LEU A 1 336 ? -18.995 35.070  0.186   1.00 31.41  ? 329 LEU A CA  1 
ATOM   2070 C C   . LEU A 1 336 ? -18.093 35.642  1.281   1.00 24.77  ? 329 LEU A C   1 
ATOM   2071 O O   . LEU A 1 336 ? -18.161 36.834  1.592   1.00 24.62  ? 329 LEU A O   1 
ATOM   2072 C CB  . LEU A 1 336 ? -20.179 34.350  0.831   1.00 34.85  ? 329 LEU A CB  1 
ATOM   2073 C CG  . LEU A 1 336 ? -21.368 34.220  -0.099  1.00 27.65  ? 329 LEU A CG  1 
ATOM   2074 C CD1 . LEU A 1 336 ? -22.604 33.792  0.667   1.00 32.79  ? 329 LEU A CD1 1 
ATOM   2075 C CD2 . LEU A 1 336 ? -21.570 35.562  -0.732  1.00 17.42  ? 329 LEU A CD2 1 
ATOM   2076 N N   . HIS A 1 337 ? -17.256 34.794  1.870   1.00 11.75  ? 330 HIS A N   1 
ATOM   2077 C CA  . HIS A 1 337 ? -16.366 35.249  2.918   1.00 17.57  ? 330 HIS A CA  1 
ATOM   2078 C C   . HIS A 1 337 ? -15.550 36.420  2.397   1.00 30.70  ? 330 HIS A C   1 
ATOM   2079 O O   . HIS A 1 337 ? -15.556 37.501  2.999   1.00 32.82  ? 330 HIS A O   1 
ATOM   2080 C CB  . HIS A 1 337 ? -15.457 34.123  3.383   1.00 19.08  ? 330 HIS A CB  1 
ATOM   2081 C CG  . HIS A 1 337 ? -14.690 34.449  4.638   1.00 21.77  ? 330 HIS A CG  1 
ATOM   2082 N ND1 . HIS A 1 337 ? -15.309 34.770  5.807   1.00 26.87  ? 330 HIS A ND1 1 
ATOM   2083 C CD2 . HIS A 1 337 ? -13.356 34.481  4.862   1.00 23.19  ? 330 HIS A CD2 1 
ATOM   2084 C CE1 . HIS A 1 337 ? -14.376 34.990  6.744   1.00 34.46  ? 330 HIS A CE1 1 
ATOM   2085 N NE2 . HIS A 1 337 ? -13.203 34.822  6.192   1.00 33.21  ? 330 HIS A NE2 1 
ATOM   2086 N N   . ILE A 1 338 ? -14.880 36.202  1.261   1.00 28.35  ? 331 ILE A N   1 
ATOM   2087 C CA  . ILE A 1 338 ? -14.105 37.240  0.580   1.00 25.98  ? 331 ILE A CA  1 
ATOM   2088 C C   . ILE A 1 338 ? -15.003 38.420  0.255   1.00 25.13  ? 331 ILE A C   1 
ATOM   2089 O O   . ILE A 1 338 ? -14.672 39.563  0.566   1.00 21.07  ? 331 ILE A O   1 
ATOM   2090 C CB  . ILE A 1 338 ? -13.485 36.732  -0.747  1.00 26.20  ? 331 ILE A CB  1 
ATOM   2091 C CG1 . ILE A 1 338 ? -12.363 35.730  -0.487  1.00 21.62  ? 331 ILE A CG1 1 
ATOM   2092 C CG2 . ILE A 1 338 ? -12.959 37.885  -1.583  1.00 12.78  ? 331 ILE A CG2 1 
ATOM   2093 C CD1 . ILE A 1 338 ? -12.162 34.790  -1.658  1.00 17.32  ? 331 ILE A CD1 1 
ATOM   2094 N N   . GLY A 1 339 ? -16.135 38.131  -0.382  1.00 26.08  ? 332 GLY A N   1 
ATOM   2095 C CA  . GLY A 1 339 ? -17.117 39.147  -0.714  1.00 16.66  ? 332 GLY A CA  1 
ATOM   2096 C C   . GLY A 1 339 ? -17.549 39.994  0.473   1.00 20.18  ? 332 GLY A C   1 
ATOM   2097 O O   . GLY A 1 339 ? -17.679 41.209  0.352   1.00 21.41  ? 332 GLY A O   1 
ATOM   2098 N N   . PHE A 1 340 ? -17.756 39.370  1.629   1.00 15.23  ? 333 PHE A N   1 
ATOM   2099 C CA  . PHE A 1 340 ? -18.204 40.120  2.811   1.00 15.99  ? 333 PHE A CA  1 
ATOM   2100 C C   . PHE A 1 340 ? -17.106 41.032  3.368   1.00 18.38  ? 333 PHE A C   1 
ATOM   2101 O O   . PHE A 1 340 ? -17.367 42.143  3.836   1.00 16.15  ? 333 PHE A O   1 
ATOM   2102 C CB  . PHE A 1 340 ? -18.743 39.173  3.884   1.00 16.86  ? 333 PHE A CB  1 
ATOM   2103 C CG  . PHE A 1 340 ? -20.247 39.153  3.978   1.00 32.99  ? 333 PHE A CG  1 
ATOM   2104 C CD1 . PHE A 1 340 ? -21.009 38.419  3.073   1.00 22.02  ? 333 PHE A CD1 1 
ATOM   2105 C CD2 . PHE A 1 340 ? -20.901 39.873  4.977   1.00 37.57  ? 333 PHE A CD2 1 
ATOM   2106 C CE1 . PHE A 1 340 ? -22.381 38.399  3.173   1.00 29.91  ? 333 PHE A CE1 1 
ATOM   2107 C CE2 . PHE A 1 340 ? -22.278 39.865  5.079   1.00 30.92  ? 333 PHE A CE2 1 
ATOM   2108 C CZ  . PHE A 1 340 ? -23.021 39.127  4.186   1.00 33.88  ? 333 PHE A CZ  1 
ATOM   2109 N N   . GLN A 1 341 ? -15.871 40.557  3.297   1.00 22.61  ? 334 GLN A N   1 
ATOM   2110 C CA  . GLN A 1 341 ? -14.729 41.356  3.707   1.00 17.36  ? 334 GLN A CA  1 
ATOM   2111 C C   . GLN A 1 341 ? -14.678 42.623  2.874   1.00 32.89  ? 334 GLN A C   1 
ATOM   2112 O O   . GLN A 1 341 ? -14.605 43.727  3.417   1.00 26.17  ? 334 GLN A O   1 
ATOM   2113 C CB  . GLN A 1 341 ? -13.450 40.568  3.497   1.00 28.12  ? 334 GLN A CB  1 
ATOM   2114 C CG  . GLN A 1 341 ? -12.213 41.401  3.651   1.00 49.87  ? 334 GLN A CG  1 
ATOM   2115 C CD  . GLN A 1 341 ? -11.595 41.253  5.014   1.00 54.85  ? 334 GLN A CD  1 
ATOM   2116 O OE1 . GLN A 1 341 ? -11.192 40.147  5.410   1.00 48.75  ? 334 GLN A OE1 1 
ATOM   2117 N NE2 . GLN A 1 341 ? -11.512 42.366  5.748   1.00 41.49  ? 334 GLN A NE2 1 
ATOM   2118 N N   . ALA A 1 342 ? -14.731 42.446  1.551   1.00 36.62  ? 335 ALA A N   1 
ATOM   2119 C CA  . ALA A 1 342 ? -14.658 43.550  0.601   1.00 23.53  ? 335 ALA A CA  1 
ATOM   2120 C C   . ALA A 1 342 ? -15.806 44.519  0.828   1.00 25.66  ? 335 ALA A C   1 
ATOM   2121 O O   . ALA A 1 342 ? -15.646 45.733  0.700   1.00 23.27  ? 335 ALA A O   1 
ATOM   2122 C CB  . ALA A 1 342 ? -14.668 43.033  -0.825  1.00 14.40  ? 335 ALA A CB  1 
ATOM   2123 N N   . LEU A 1 343 ? -16.960 43.974  1.193   1.00 29.69  ? 336 LEU A N   1 
ATOM   2124 C CA  . LEU A 1 343 ? -18.143 44.793  1.453   1.00 23.21  ? 336 LEU A CA  1 
ATOM   2125 C C   . LEU A 1 343 ? -17.925 45.735  2.629   1.00 20.96  ? 336 LEU A C   1 
ATOM   2126 O O   . LEU A 1 343 ? -18.302 46.896  2.551   1.00 28.95  ? 336 LEU A O   1 
ATOM   2127 C CB  . LEU A 1 343 ? -19.379 43.913  1.655   1.00 26.12  ? 336 LEU A CB  1 
ATOM   2128 C CG  . LEU A 1 343 ? -20.758 44.561  1.563   1.00 24.66  ? 336 LEU A CG  1 
ATOM   2129 C CD1 . LEU A 1 343 ? -20.706 45.756  0.658   1.00 25.41  ? 336 LEU A CD1 1 
ATOM   2130 C CD2 . LEU A 1 343 ? -21.719 43.564  1.012   1.00 26.61  ? 336 LEU A CD2 1 
ATOM   2131 N N   . HIS A 1 344 ? -17.310 45.243  3.706   1.00 21.00  ? 337 HIS A N   1 
ATOM   2132 C CA  . HIS A 1 344 ? -16.926 46.107  4.827   1.00 17.14  ? 337 HIS A CA  1 
ATOM   2133 C C   . HIS A 1 344 ? -15.921 47.138  4.393   1.00 23.01  ? 337 HIS A C   1 
ATOM   2134 O O   . HIS A 1 344 ? -15.970 48.282  4.816   1.00 15.95  ? 337 HIS A O   1 
ATOM   2135 C CB  . HIS A 1 344 ? -16.322 45.311  5.983   1.00 20.40  ? 337 HIS A CB  1 
ATOM   2136 C CG  . HIS A 1 344 ? -17.342 44.627  6.834   1.00 30.01  ? 337 HIS A CG  1 
ATOM   2137 N ND1 . HIS A 1 344 ? -17.308 43.276  7.090   1.00 24.63  ? 337 HIS A ND1 1 
ATOM   2138 C CD2 . HIS A 1 344 ? -18.428 45.116  7.477   1.00 19.15  ? 337 HIS A CD2 1 
ATOM   2139 C CE1 . HIS A 1 344 ? -18.338 42.955  7.856   1.00 30.91  ? 337 HIS A CE1 1 
ATOM   2140 N NE2 . HIS A 1 344 ? -19.037 44.048  8.093   1.00 30.08  ? 337 HIS A NE2 1 
ATOM   2141 N N   . GLN A 1 345 ? -14.985 46.740  3.550   1.00 19.49  ? 338 GLN A N   1 
ATOM   2142 C CA  . GLN A 1 345 ? -14.023 47.721  3.101   1.00 23.29  ? 338 GLN A CA  1 
ATOM   2143 C C   . GLN A 1 345 ? -14.738 48.819  2.301   1.00 27.42  ? 338 GLN A C   1 
ATOM   2144 O O   . GLN A 1 345 ? -14.428 50.011  2.444   1.00 29.47  ? 338 GLN A O   1 
ATOM   2145 C CB  . GLN A 1 345 ? -12.898 47.052  2.325   1.00 21.83  ? 338 GLN A CB  1 
ATOM   2146 C CG  . GLN A 1 345 ? -11.857 47.991  1.804   1.00 32.48  ? 338 GLN A CG  1 
ATOM   2147 C CD  . GLN A 1 345 ? -10.642 47.227  1.372   1.00 43.53  ? 338 GLN A CD  1 
ATOM   2148 O OE1 . GLN A 1 345 ? -10.504 46.039  1.701   1.00 47.11  ? 338 GLN A OE1 1 
ATOM   2149 N NE2 . GLN A 1 345 ? -9.748  47.886  0.635   1.00 34.46  ? 338 GLN A NE2 1 
ATOM   2150 N N   . PHE A 1 346 ? -15.733 48.421  1.507   1.00 23.98  ? 339 PHE A N   1 
ATOM   2151 C CA  . PHE A 1 346 ? -16.483 49.382  0.696   1.00 20.38  ? 339 PHE A CA  1 
ATOM   2152 C C   . PHE A 1 346 ? -17.244 50.341  1.593   1.00 18.65  ? 339 PHE A C   1 
ATOM   2153 O O   . PHE A 1 346 ? -17.127 51.554  1.453   1.00 23.84  ? 339 PHE A O   1 
ATOM   2154 C CB  . PHE A 1 346 ? -17.414 48.663  -0.268  1.00 7.85   ? 339 PHE A CB  1 
ATOM   2155 C CG  . PHE A 1 346 ? -18.137 49.571  -1.235  1.00 24.85  ? 339 PHE A CG  1 
ATOM   2156 C CD1 . PHE A 1 346 ? -17.851 49.520  -2.589  1.00 25.25  ? 339 PHE A CD1 1 
ATOM   2157 C CD2 . PHE A 1 346 ? -19.148 50.430  -0.803  1.00 28.28  ? 339 PHE A CD2 1 
ATOM   2158 C CE1 . PHE A 1 346 ? -18.530 50.330  -3.488  1.00 25.53  ? 339 PHE A CE1 1 
ATOM   2159 C CE2 . PHE A 1 346 ? -19.827 51.245  -1.697  1.00 28.99  ? 339 PHE A CE2 1 
ATOM   2160 C CZ  . PHE A 1 346 ? -19.521 51.191  -3.044  1.00 27.27  ? 339 PHE A CZ  1 
ATOM   2161 N N   . CYS A 1 347 ? -18.010 49.793  2.522   1.00 23.48  ? 340 CYS A N   1 
ATOM   2162 C CA  . CYS A 1 347 ? -18.830 50.615  3.410   1.00 27.73  ? 340 CYS A CA  1 
ATOM   2163 C C   . CYS A 1 347 ? -17.971 51.536  4.255   1.00 23.16  ? 340 CYS A C   1 
ATOM   2164 O O   . CYS A 1 347 ? -18.318 52.681  4.487   1.00 30.51  ? 340 CYS A O   1 
ATOM   2165 C CB  . CYS A 1 347 ? -19.711 49.743  4.301   1.00 3.48   ? 340 CYS A CB  1 
ATOM   2166 S SG  . CYS A 1 347 ? -20.943 48.778  3.374   1.00 38.10  ? 340 CYS A SG  1 
ATOM   2167 N N   . ALA A 1 348 ? -16.827 51.044  4.688   1.00 18.70  ? 341 ALA A N   1 
ATOM   2168 C CA  . ALA A 1 348 ? -15.925 51.875  5.460   1.00 22.16  ? 341 ALA A CA  1 
ATOM   2169 C C   . ALA A 1 348 ? -15.361 53.020  4.625   1.00 31.90  ? 341 ALA A C   1 
ATOM   2170 O O   . ALA A 1 348 ? -15.057 54.080  5.167   1.00 35.83  ? 341 ALA A O   1 
ATOM   2171 C CB  . ALA A 1 348 ? -14.799 51.036  6.068   1.00 7.50   ? 341 ALA A CB  1 
ATOM   2172 N N   . GLN A 1 349 ? -15.215 52.813  3.314   1.00 32.55  ? 342 GLN A N   1 
ATOM   2173 C CA  . GLN A 1 349 ? -14.712 53.879  2.442   1.00 31.07  ? 342 GLN A CA  1 
ATOM   2174 C C   . GLN A 1 349 ? -15.803 54.904  2.151   1.00 34.82  ? 342 GLN A C   1 
ATOM   2175 O O   . GLN A 1 349 ? -15.617 56.103  2.342   1.00 42.80  ? 342 GLN A O   1 
ATOM   2176 C CB  . GLN A 1 349 ? -14.159 53.317  1.126   1.00 34.64  ? 342 GLN A CB  1 
ATOM   2177 C CG  . GLN A 1 349 ? -13.942 54.371  0.009   1.00 27.63  ? 342 GLN A CG  1 
ATOM   2178 C CD  . GLN A 1 349 ? -12.575 55.062  0.082   1.00 44.12  ? 342 GLN A CD  1 
ATOM   2179 O OE1 . GLN A 1 349 ? -11.549 54.411  0.273   1.00 52.57  ? 342 GLN A OE1 1 
ATOM   2180 N NE2 . GLN A 1 349 ? -12.563 56.384  -0.067  1.00 44.37  ? 342 GLN A NE2 1 
ATOM   2181 N N   . HIS A 1 350 ? -16.950 54.413  1.703   1.00 27.92  ? 343 HIS A N   1 
ATOM   2182 C CA  . HIS A 1 350 ? -17.960 55.272  1.123   1.00 32.11  ? 343 HIS A CA  1 
ATOM   2183 C C   . HIS A 1 350 ? -18.984 55.762  2.128   1.00 36.51  ? 343 HIS A C   1 
ATOM   2184 O O   . HIS A 1 350 ? -19.648 56.762  1.899   1.00 38.79  ? 343 HIS A O   1 
ATOM   2185 C CB  . HIS A 1 350 ? -18.681 54.530  0.004   1.00 36.70  ? 343 HIS A CB  1 
ATOM   2186 C CG  . HIS A 1 350 ? -17.853 54.350  -1.223  1.00 46.73  ? 343 HIS A CG  1 
ATOM   2187 N ND1 . HIS A 1 350 ? -17.518 55.396  -2.044  1.00 57.17  ? 343 HIS A ND1 1 
ATOM   2188 C CD2 . HIS A 1 350 ? -17.297 53.241  -1.767  1.00 51.48  ? 343 HIS A CD2 1 
ATOM   2189 C CE1 . HIS A 1 350 ? -16.792 54.943  -3.056  1.00 59.13  ? 343 HIS A CE1 1 
ATOM   2190 N NE2 . HIS A 1 350 ? -16.649 53.639  -2.908  1.00 51.87  ? 343 HIS A NE2 1 
ATOM   2191 N N   . GLY A 1 351 ? -19.137 55.037  3.224   1.00 29.47  ? 344 GLY A N   1 
ATOM   2192 C CA  . GLY A 1 351 ? -20.127 55.398  4.218   1.00 22.29  ? 344 GLY A CA  1 
ATOM   2193 C C   . GLY A 1 351 ? -21.510 54.843  3.929   1.00 31.12  ? 344 GLY A C   1 
ATOM   2194 O O   . GLY A 1 351 ? -22.441 55.096  4.682   1.00 29.70  ? 344 GLY A O   1 
ATOM   2195 N N   . ARG A 1 352 ? -21.633 54.089  2.841   1.00 36.82  ? 345 ARG A N   1 
ATOM   2196 C CA  . ARG A 1 352 ? -22.897 53.498  2.402   1.00 35.56  ? 345 ARG A CA  1 
ATOM   2197 C C   . ARG A 1 352 ? -22.530 52.162  1.788   1.00 41.37  ? 345 ARG A C   1 
ATOM   2198 O O   . ARG A 1 352 ? -21.359 51.920  1.514   1.00 49.01  ? 345 ARG A O   1 
ATOM   2199 C CB  . ARG A 1 352 ? -23.522 54.359  1.308   1.00 41.32  ? 345 ARG A CB  1 
ATOM   2200 C CG  . ARG A 1 352 ? -22.662 54.385  0.047   1.00 35.95  ? 345 ARG A CG  1 
ATOM   2201 C CD  . ARG A 1 352 ? -23.356 54.960  -1.170  1.00 30.32  ? 345 ARG A CD  1 
ATOM   2202 N NE  . ARG A 1 352 ? -22.750 54.437  -2.402  1.00 46.12  ? 345 ARG A NE  1 
ATOM   2203 C CZ  . ARG A 1 352 ? -21.742 55.010  -3.060  1.00 56.19  ? 345 ARG A CZ  1 
ATOM   2204 N NH1 . ARG A 1 352 ? -21.208 56.150  -2.628  1.00 54.47  ? 345 ARG A NH1 1 
ATOM   2205 N NH2 . ARG A 1 352 ? -21.263 54.439  -4.158  1.00 59.40  ? 345 ARG A NH2 1 
ATOM   2206 N N   . PRO A 1 353 ? -23.518 51.282  1.568   1.00 42.22  ? 346 PRO A N   1 
ATOM   2207 C CA  . PRO A 1 353 ? -23.217 50.061  0.811   1.00 35.08  ? 346 PRO A CA  1 
ATOM   2208 C C   . PRO A 1 353 ? -23.316 50.406  -0.660  1.00 38.61  ? 346 PRO A C   1 
ATOM   2209 O O   . PRO A 1 353 ? -23.632 51.551  -0.964  1.00 47.62  ? 346 PRO A O   1 
ATOM   2210 C CB  . PRO A 1 353 ? -24.348 49.111  1.217   1.00 43.91  ? 346 PRO A CB  1 
ATOM   2211 C CG  . PRO A 1 353 ? -25.047 49.777  2.404   1.00 39.79  ? 346 PRO A CG  1 
ATOM   2212 C CD  . PRO A 1 353 ? -24.863 51.236  2.166   1.00 38.18  ? 346 PRO A CD  1 
ATOM   2213 N N   . PRO A 1 354 ? -23.015 49.459  -1.561  1.00 48.73  ? 347 PRO A N   1 
ATOM   2214 C CA  . PRO A 1 354 ? -23.269 49.664  -3.000  1.00 36.72  ? 347 PRO A CA  1 
ATOM   2215 C C   . PRO A 1 354 ? -24.754 49.844  -3.334  1.00 36.29  ? 347 PRO A C   1 
ATOM   2216 O O   . PRO A 1 354 ? -25.626 49.118  -2.833  1.00 35.29  ? 347 PRO A O   1 
ATOM   2217 C CB  . PRO A 1 354 ? -22.756 48.369  -3.638  1.00 24.62  ? 347 PRO A CB  1 
ATOM   2218 C CG  . PRO A 1 354 ? -21.734 47.854  -2.683  1.00 28.03  ? 347 PRO A CG  1 
ATOM   2219 C CD  . PRO A 1 354 ? -22.172 48.278  -1.307  1.00 44.24  ? 347 PRO A CD  1 
ATOM   2220 N N   . ARG A 1 355 ? -25.038 50.826  -4.177  1.00 42.33  ? 348 ARG A N   1 
ATOM   2221 C CA  . ARG A 1 355 ? -26.388 51.017  -4.685  1.00 46.62  ? 348 ARG A CA  1 
ATOM   2222 C C   . ARG A 1 355 ? -26.653 49.988  -5.783  1.00 53.54  ? 348 ARG A C   1 
ATOM   2223 O O   . ARG A 1 355 ? -25.765 49.688  -6.583  1.00 56.30  ? 348 ARG A O   1 
ATOM   2224 C CB  . ARG A 1 355 ? -26.520 52.418  -5.268  1.00 49.53  ? 348 ARG A CB  1 
ATOM   2225 C CG  . ARG A 1 355 ? -26.008 53.509  -4.355  1.00 61.56  ? 348 ARG A CG  1 
ATOM   2226 C CD  . ARG A 1 355 ? -25.712 54.794  -5.135  1.00 71.77  ? 348 ARG A CD  1 
ATOM   2227 N NE  . ARG A 1 355 ? -24.342 54.851  -5.646  1.00 78.73  ? 348 ARG A NE  1 
ATOM   2228 C CZ  . ARG A 1 355 ? -23.729 55.976  -6.014  1.00 80.69  ? 348 ARG A CZ  1 
ATOM   2229 N NH1 . ARG A 1 355 ? -24.367 57.139  -5.922  1.00 84.92  ? 348 ARG A NH1 1 
ATOM   2230 N NH2 . ARG A 1 355 ? -22.477 55.945  -6.465  1.00 65.40  ? 348 ARG A NH2 1 
ATOM   2231 N N   . PRO A 1 356 ? -27.876 49.437  -5.836  1.00 56.35  ? 349 PRO A N   1 
ATOM   2232 C CA  . PRO A 1 356 ? -28.196 48.612  -7.008  1.00 51.91  ? 349 PRO A CA  1 
ATOM   2233 C C   . PRO A 1 356 ? -28.360 49.558  -8.174  1.00 48.49  ? 349 PRO A C   1 
ATOM   2234 O O   . PRO A 1 356 ? -28.332 50.770  -7.959  1.00 60.84  ? 349 PRO A O   1 
ATOM   2235 C CB  . PRO A 1 356 ? -29.551 47.990  -6.660  1.00 51.87  ? 349 PRO A CB  1 
ATOM   2236 C CG  . PRO A 1 356 ? -29.780 48.300  -5.197  1.00 61.14  ? 349 PRO A CG  1 
ATOM   2237 C CD  . PRO A 1 356 ? -29.008 49.546  -4.904  1.00 60.48  ? 349 PRO A CD  1 
ATOM   2238 N N   . ARG A 1 357 ? -28.541 49.036  -9.377  1.00 46.27  ? 350 ARG A N   1 
ATOM   2239 C CA  . ARG A 1 357 ? -28.638 49.897  -10.556 1.00 50.53  ? 350 ARG A CA  1 
ATOM   2240 C C   . ARG A 1 357 ? -27.401 50.761  -10.654 1.00 47.47  ? 350 ARG A C   1 
ATOM   2241 O O   . ARG A 1 357 ? -27.461 51.881  -11.138 1.00 55.99  ? 350 ARG A O   1 
ATOM   2242 C CB  . ARG A 1 357 ? -29.877 50.799  -10.506 1.00 45.87  ? 350 ARG A CB  1 
ATOM   2243 C CG  . ARG A 1 357 ? -31.176 50.052  -10.551 1.00 60.69  ? 350 ARG A CG  1 
ATOM   2244 C CD  . ARG A 1 357 ? -32.352 50.979  -10.789 1.00 79.46  ? 350 ARG A CD  1 
ATOM   2245 N NE  . ARG A 1 357 ? -33.551 50.223  -11.142 1.00 94.60  ? 350 ARG A NE  1 
ATOM   2246 C CZ  . ARG A 1 357 ? -33.814 49.761  -12.361 1.00 104.13 ? 350 ARG A CZ  1 
ATOM   2247 N NH1 . ARG A 1 357 ? -32.966 49.975  -13.361 1.00 105.77 ? 350 ARG A NH1 1 
ATOM   2248 N NH2 . ARG A 1 357 ? -34.933 49.084  -12.580 1.00 104.14 ? 350 ARG A NH2 1 
ATOM   2249 N N   . ASN A 1 358 ? -26.282 50.243  -10.170 1.00 47.62  ? 351 ASN A N   1 
ATOM   2250 C CA  . ASN A 1 358 ? -25.043 50.995  -10.205 1.00 48.14  ? 351 ASN A CA  1 
ATOM   2251 C C   . ASN A 1 358 ? -23.844 50.118  -10.535 1.00 42.59  ? 351 ASN A C   1 
ATOM   2252 O O   . ASN A 1 358 ? -23.143 49.684  -9.636  1.00 40.58  ? 351 ASN A O   1 
ATOM   2253 C CB  . ASN A 1 358 ? -24.825 51.697  -8.874  1.00 42.12  ? 351 ASN A CB  1 
ATOM   2254 C CG  . ASN A 1 358 ? -23.963 52.918  -9.011  1.00 50.69  ? 351 ASN A CG  1 
ATOM   2255 O OD1 . ASN A 1 358 ? -22.880 52.864  -9.598  1.00 50.73  ? 351 ASN A OD1 1 
ATOM   2256 N ND2 . ASN A 1 358 ? -24.447 54.043  -8.492  1.00 56.70  ? 351 ASN A ND2 1 
ATOM   2257 N N   . ASP A 1 359 ? -23.612 49.875  -11.825 1.00 35.35  ? 352 ASP A N   1 
ATOM   2258 C CA  . ASP A 1 359 ? -22.548 48.979  -12.263 1.00 35.82  ? 352 ASP A CA  1 
ATOM   2259 C C   . ASP A 1 359 ? -21.145 49.461  -11.872 1.00 43.20  ? 352 ASP A C   1 
ATOM   2260 O O   . ASP A 1 359 ? -20.177 48.713  -12.006 1.00 52.17  ? 352 ASP A O   1 
ATOM   2261 C CB  . ASP A 1 359 ? -22.636 48.674  -13.779 1.00 61.10  ? 352 ASP A CB  1 
ATOM   2262 C CG  . ASP A 1 359 ? -22.686 49.938  -14.655 1.00 71.41  ? 352 ASP A CG  1 
ATOM   2263 O OD1 . ASP A 1 359 ? -23.805 50.404  -14.985 1.00 77.22  ? 352 ASP A OD1 1 
ATOM   2264 O OD2 . ASP A 1 359 ? -21.607 50.452  -15.038 1.00 59.74  ? 352 ASP A OD2 1 
ATOM   2265 N N   . GLU A 1 360 ? -21.043 50.703  -11.396 1.00 34.85  ? 353 GLU A N   1 
ATOM   2266 C CA  . GLU A 1 360 ? -19.773 51.256  -10.917 1.00 35.02  ? 353 GLU A CA  1 
ATOM   2267 C C   . GLU A 1 360 ? -19.379 50.735  -9.526  1.00 43.98  ? 353 GLU A C   1 
ATOM   2268 O O   . GLU A 1 360 ? -18.247 50.264  -9.335  1.00 54.63  ? 353 GLU A O   1 
ATOM   2269 C CB  . GLU A 1 360 ? -19.822 52.787  -10.905 1.00 43.01  ? 353 GLU A CB  1 
ATOM   2270 C CG  . GLU A 1 360 ? -18.734 53.454  -11.733 1.00 57.79  ? 353 GLU A CG  1 
ATOM   2271 C CD  . GLU A 1 360 ? -18.795 53.071  -13.214 1.00 67.74  ? 353 GLU A CD  1 
ATOM   2272 O OE1 . GLU A 1 360 ? -19.495 53.778  -13.977 1.00 64.17  ? 353 GLU A OE1 1 
ATOM   2273 O OE2 . GLU A 1 360 ? -18.141 52.071  -13.615 1.00 67.83  ? 353 GLU A OE2 1 
ATOM   2274 N N   . ASP A 1 361 ? -20.309 50.833  -8.569  1.00 32.19  ? 354 ASP A N   1 
ATOM   2275 C CA  . ASP A 1 361 ? -20.096 50.341  -7.208  1.00 36.86  ? 354 ASP A CA  1 
ATOM   2276 C C   . ASP A 1 361 ? -19.810 48.857  -7.252  1.00 36.65  ? 354 ASP A C   1 
ATOM   2277 O O   . ASP A 1 361 ? -18.998 48.346  -6.484  1.00 42.47  ? 354 ASP A O   1 
ATOM   2278 C CB  . ASP A 1 361 ? -21.318 50.585  -6.314  1.00 31.30  ? 354 ASP A CB  1 
ATOM   2279 C CG  . ASP A 1 361 ? -21.631 52.056  -6.134  1.00 41.71  ? 354 ASP A CG  1 
ATOM   2280 O OD1 . ASP A 1 361 ? -21.025 52.892  -6.840  1.00 40.50  ? 354 ASP A OD1 1 
ATOM   2281 O OD2 . ASP A 1 361 ? -22.498 52.379  -5.292  1.00 49.41  ? 354 ASP A OD2 1 
ATOM   2282 N N   . ALA A 1 362 ? -20.484 48.160  -8.152  1.00 22.41  ? 355 ALA A N   1 
ATOM   2283 C CA  . ALA A 1 362 ? -20.260 46.733  -8.286  1.00 23.97  ? 355 ALA A CA  1 
ATOM   2284 C C   . ALA A 1 362 ? -18.866 46.423  -8.858  1.00 27.03  ? 355 ALA A C   1 
ATOM   2285 O O   . ALA A 1 362 ? -18.264 45.383  -8.563  1.00 24.43  ? 355 ALA A O   1 
ATOM   2286 C CB  . ALA A 1 362 ? -21.349 46.102  -9.128  1.00 18.03  ? 355 ALA A CB  1 
ATOM   2287 N N   . ALA A 1 363 ? -18.347 47.329  -9.675  1.00 32.04  ? 356 ALA A N   1 
ATOM   2288 C CA  . ALA A 1 363 ? -17.016 47.131  -10.216 1.00 28.66  ? 356 ALA A CA  1 
ATOM   2289 C C   . ALA A 1 363 ? -15.999 47.412  -9.115  1.00 30.02  ? 356 ALA A C   1 
ATOM   2290 O O   . ALA A 1 363 ? -15.018 46.681  -8.956  1.00 31.27  ? 356 ALA A O   1 
ATOM   2291 C CB  . ALA A 1 363 ? -16.781 48.015  -11.432 1.00 11.84  ? 356 ALA A CB  1 
ATOM   2292 N N   . GLU A 1 364 ? -16.251 48.458  -8.340  1.00 18.97  ? 357 GLU A N   1 
ATOM   2293 C CA  . GLU A 1 364 ? -15.428 48.725  -7.168  1.00 18.50  ? 357 GLU A CA  1 
ATOM   2294 C C   . GLU A 1 364 ? -15.354 47.514  -6.237  1.00 23.94  ? 357 GLU A C   1 
ATOM   2295 O O   . GLU A 1 364 ? -14.261 47.086  -5.851  1.00 33.27  ? 357 GLU A O   1 
ATOM   2296 C CB  . GLU A 1 364 ? -15.930 49.959  -6.422  1.00 20.73  ? 357 GLU A CB  1 
ATOM   2297 C CG  . GLU A 1 364 ? -14.943 50.483  -5.418  1.00 36.65  ? 357 GLU A CG  1 
ATOM   2298 C CD  . GLU A 1 364 ? -15.250 51.903  -4.999  1.00 54.19  ? 357 GLU A CD  1 
ATOM   2299 O OE1 . GLU A 1 364 ? -14.502 52.460  -4.150  1.00 50.38  ? 357 GLU A OE1 1 
ATOM   2300 O OE2 . GLU A 1 364 ? -16.241 52.459  -5.529  1.00 63.11  ? 357 GLU A OE2 1 
ATOM   2301 N N   . LEU A 1 365 ? -16.514 46.948  -5.902  1.00 27.48  ? 358 LEU A N   1 
ATOM   2302 C CA  . LEU A 1 365 ? -16.564 45.765  -5.048  1.00 23.21  ? 358 LEU A CA  1 
ATOM   2303 C C   . LEU A 1 365 ? -15.752 44.619  -5.622  1.00 25.19  ? 358 LEU A C   1 
ATOM   2304 O O   . LEU A 1 365 ? -15.061 43.927  -4.887  1.00 29.79  ? 358 LEU A O   1 
ATOM   2305 C CB  . LEU A 1 365 ? -18.003 45.310  -4.753  1.00 25.11  ? 358 LEU A CB  1 
ATOM   2306 C CG  . LEU A 1 365 ? -18.074 44.468  -3.463  1.00 25.78  ? 358 LEU A CG  1 
ATOM   2307 C CD1 . LEU A 1 365 ? -17.911 45.344  -2.193  1.00 15.63  ? 358 LEU A CD1 1 
ATOM   2308 C CD2 . LEU A 1 365 ? -19.327 43.597  -3.386  1.00 18.70  ? 358 LEU A CD2 1 
ATOM   2309 N N   . VAL A 1 366 ? -15.809 44.427  -6.935  1.00 29.59  ? 359 VAL A N   1 
ATOM   2310 C CA  . VAL A 1 366 ? -15.006 43.372  -7.559  1.00 33.10  ? 359 VAL A CA  1 
ATOM   2311 C C   . VAL A 1 366 ? -13.490 43.631  -7.388  1.00 34.71  ? 359 VAL A C   1 
ATOM   2312 O O   . VAL A 1 366 ? -12.723 42.712  -7.082  1.00 31.46  ? 359 VAL A O   1 
ATOM   2313 C CB  . VAL A 1 366 ? -15.391 43.146  -9.046  1.00 20.60  ? 359 VAL A CB  1 
ATOM   2314 C CG1 . VAL A 1 366 ? -14.360 42.312  -9.733  1.00 20.78  ? 359 VAL A CG1 1 
ATOM   2315 C CG2 . VAL A 1 366 ? -16.749 42.462  -9.156  1.00 9.17   ? 359 VAL A CG2 1 
ATOM   2316 N N   . ALA A 1 367 ? -13.077 44.888  -7.557  1.00 29.70  ? 360 ALA A N   1 
ATOM   2317 C CA  . ALA A 1 367 ? -11.689 45.276  -7.345  1.00 30.16  ? 360 ALA A CA  1 
ATOM   2318 C C   . ALA A 1 367 ? -11.290 44.959  -5.910  1.00 33.49  ? 360 ALA A C   1 
ATOM   2319 O O   . ALA A 1 367 ? -10.247 44.363  -5.674  1.00 25.95  ? 360 ALA A O   1 
ATOM   2320 C CB  . ALA A 1 367 ? -11.498 46.749  -7.638  1.00 7.89   ? 360 ALA A CB  1 
ATOM   2321 N N   . LEU A 1 368 ? -12.139 45.342  -4.958  1.00 24.32  ? 361 LEU A N   1 
ATOM   2322 C CA  . LEU A 1 368 ? -11.899 45.031  -3.553  1.00 25.11  ? 361 LEU A CA  1 
ATOM   2323 C C   . LEU A 1 368 ? -11.851 43.522  -3.280  1.00 31.27  ? 361 LEU A C   1 
ATOM   2324 O O   . LEU A 1 368 ? -11.001 43.035  -2.537  1.00 29.12  ? 361 LEU A O   1 
ATOM   2325 C CB  . LEU A 1 368 ? -12.959 45.685  -2.668  1.00 26.96  ? 361 LEU A CB  1 
ATOM   2326 C CG  . LEU A 1 368 ? -13.031 47.210  -2.739  1.00 29.27  ? 361 LEU A CG  1 
ATOM   2327 C CD1 . LEU A 1 368 ? -14.238 47.724  -1.962  1.00 25.27  ? 361 LEU A CD1 1 
ATOM   2328 C CD2 . LEU A 1 368 ? -11.741 47.867  -2.254  1.00 14.26  ? 361 LEU A CD2 1 
ATOM   2329 N N   . ALA A 1 369 ? -12.766 42.775  -3.878  1.00 36.21  ? 362 ALA A N   1 
ATOM   2330 C CA  . ALA A 1 369 ? -12.769 41.337  -3.683  1.00 30.69  ? 362 ALA A CA  1 
ATOM   2331 C C   . ALA A 1 369 ? -11.483 40.713  -4.216  1.00 36.41  ? 362 ALA A C   1 
ATOM   2332 O O   . ALA A 1 369 ? -10.904 39.851  -3.566  1.00 35.84  ? 362 ALA A O   1 
ATOM   2333 C CB  . ALA A 1 369 ? -13.977 40.722  -4.349  1.00 19.73  ? 362 ALA A CB  1 
ATOM   2334 N N   . GLN A 1 370 ? -11.037 41.162  -5.392  1.00 29.26  ? 363 GLN A N   1 
ATOM   2335 C CA  . GLN A 1 370 ? -9.836  40.623  -6.022  1.00 27.15  ? 363 GLN A CA  1 
ATOM   2336 C C   . GLN A 1 370 ? -8.610  40.842  -5.123  1.00 40.78  ? 363 GLN A C   1 
ATOM   2337 O O   . GLN A 1 370 ? -7.744  39.970  -4.958  1.00 25.04  ? 363 GLN A O   1 
ATOM   2338 C CB  . GLN A 1 370 ? -9.594  41.285  -7.394  1.00 27.36  ? 363 GLN A CB  1 
ATOM   2339 C CG  . GLN A 1 370 ? -10.605 40.973  -8.509  1.00 27.69  ? 363 GLN A CG  1 
ATOM   2340 C CD  . GLN A 1 370 ? -10.338 39.658  -9.266  1.00 45.84  ? 363 GLN A CD  1 
ATOM   2341 O OE1 . GLN A 1 370 ? -9.593  38.781  -8.803  1.00 50.33  ? 363 GLN A OE1 1 
ATOM   2342 N NE2 . GLN A 1 370 ? -10.975 39.512  -10.429 1.00 47.38  ? 363 GLN A NE2 1 
ATOM   2343 N N   . ALA A 1 371 ? -8.541  42.028  -4.549  1.00 20.14  ? 364 ALA A N   1 
ATOM   2344 C CA  . ALA A 1 371 ? -7.430  42.357  -3.702  1.00 19.02  ? 364 ALA A CA  1 
ATOM   2345 C C   . ALA A 1 371 ? -7.510  41.535  -2.420  1.00 27.00  ? 364 ALA A C   1 
ATOM   2346 O O   . ALA A 1 371 ? -6.493  41.006  -1.963  1.00 32.60  ? 364 ALA A O   1 
ATOM   2347 C CB  . ALA A 1 371 ? -7.421  43.832  -3.404  1.00 24.34  ? 364 ALA A CB  1 
ATOM   2348 N N   . VAL A 1 372 ? -8.717  41.422  -1.857  1.00 26.70  ? 365 VAL A N   1 
ATOM   2349 C CA  . VAL A 1 372 ? -8.964  40.586  -0.672  1.00 24.47  ? 365 VAL A CA  1 
ATOM   2350 C C   . VAL A 1 372 ? -8.534  39.145  -0.959  1.00 25.94  ? 365 VAL A C   1 
ATOM   2351 O O   . VAL A 1 372 ? -7.885  38.501  -0.131  1.00 34.21  ? 365 VAL A O   1 
ATOM   2352 C CB  . VAL A 1 372 ? -10.474 40.626  -0.189  1.00 23.08  ? 365 VAL A CB  1 
ATOM   2353 C CG1 . VAL A 1 372 ? -10.765 39.528  0.813   1.00 12.87  ? 365 VAL A CG1 1 
ATOM   2354 C CG2 . VAL A 1 372 ? -10.844 41.972  0.426   1.00 14.86  ? 365 VAL A CG2 1 
ATOM   2355 N N   . ASN A 1 373 ? -8.891  38.652  -2.142  1.00 28.32  ? 366 ASN A N   1 
ATOM   2356 C CA  . ASN A 1 373 ? -8.466  37.328  -2.583  1.00 41.38  ? 366 ASN A CA  1 
ATOM   2357 C C   . ASN A 1 373 ? -6.945  37.223  -2.727  1.00 41.84  ? 366 ASN A C   1 
ATOM   2358 O O   . ASN A 1 373 ? -6.348  36.248  -2.284  1.00 41.76  ? 366 ASN A O   1 
ATOM   2359 C CB  . ASN A 1 373 ? -9.144  36.952  -3.904  1.00 40.67  ? 366 ASN A CB  1 
ATOM   2360 C CG  . ASN A 1 373 ? -8.951  35.484  -4.268  1.00 38.22  ? 366 ASN A CG  1 
ATOM   2361 O OD1 . ASN A 1 373 ? -8.886  34.621  -3.394  1.00 40.23  ? 366 ASN A OD1 1 
ATOM   2362 N ND2 . ASN A 1 373 ? -8.861  35.197  -5.568  1.00 32.71  ? 366 ASN A ND2 1 
ATOM   2363 N N   . ALA A 1 374 ? -6.323  38.222  -3.350  1.00 35.75  ? 367 ALA A N   1 
ATOM   2364 C CA  . ALA A 1 374 ? -4.864  38.242  -3.502  1.00 28.01  ? 367 ALA A CA  1 
ATOM   2365 C C   . ALA A 1 374 ? -4.101  38.170  -2.175  1.00 24.77  ? 367 ALA A C   1 
ATOM   2366 O O   . ALA A 1 374 ? -3.032  37.567  -2.094  1.00 36.46  ? 367 ALA A O   1 
ATOM   2367 C CB  . ALA A 1 374 ? -4.422  39.475  -4.292  1.00 20.87  ? 367 ALA A CB  1 
ATOM   2368 N N   . ARG A 1 375 ? -4.658  38.788  -1.142  1.00 21.82  ? 368 ARG A N   1 
ATOM   2369 C CA  . ARG A 1 375 ? -3.992  38.893  0.148   1.00 22.27  ? 368 ARG A CA  1 
ATOM   2370 C C   . ARG A 1 375 ? -4.295  37.703  1.058   1.00 31.46  ? 368 ARG A C   1 
ATOM   2371 O O   . ARG A 1 375 ? -3.578  37.462  2.037   1.00 32.71  ? 368 ARG A O   1 
ATOM   2372 C CB  . ARG A 1 375 ? -4.382  40.211  0.833   1.00 22.71  ? 368 ARG A CB  1 
ATOM   2373 C CG  . ARG A 1 375 ? -3.845  41.449  0.121   1.00 20.36  ? 368 ARG A CG  1 
ATOM   2374 C CD  . ARG A 1 375 ? -4.163  42.745  0.866   1.00 29.53  ? 368 ARG A CD  1 
ATOM   2375 N NE  . ARG A 1 375 ? -5.217  43.534  0.222   1.00 41.15  ? 368 ARG A NE  1 
ATOM   2376 C CZ  . ARG A 1 375 ? -6.464  43.631  0.678   1.00 52.75  ? 368 ARG A CZ  1 
ATOM   2377 N NH1 . ARG A 1 375 ? -6.811  42.986  1.787   1.00 54.69  ? 368 ARG A NH1 1 
ATOM   2378 N NH2 . ARG A 1 375 ? -7.364  44.370  0.031   1.00 52.34  ? 368 ARG A NH2 1 
ATOM   2379 N N   . ALA A 1 376 ? -5.343  36.954  0.720   1.00 41.75  ? 369 ALA A N   1 
ATOM   2380 C CA  . ALA A 1 376 ? -5.810  35.826  1.539   1.00 48.58  ? 369 ALA A CA  1 
ATOM   2381 C C   . ALA A 1 376 ? -4.889  34.603  1.551   1.00 60.83  ? 369 ALA A C   1 
ATOM   2382 O O   . ALA A 1 376 ? -4.250  34.268  0.549   1.00 71.13  ? 369 ALA A O   1 
ATOM   2383 C CB  . ALA A 1 376 ? -7.225  35.417  1.131   1.00 52.63  ? 369 ALA A CB  1 
ATOM   2384 N N   . LEU A 1 377 ? -4.844  33.937  2.701   1.00 63.70  ? 370 LEU A N   1 
ATOM   2385 C CA  . LEU A 1 377 ? -4.013  32.755  2.902   1.00 62.18  ? 370 LEU A CA  1 
ATOM   2386 C C   . LEU A 1 377 ? -4.439  31.664  1.923   1.00 65.40  ? 370 LEU A C   1 
ATOM   2387 O O   . LEU A 1 377 ? -5.565  31.701  1.422   1.00 67.18  ? 370 LEU A O   1 
ATOM   2388 C CB  . LEU A 1 377 ? -4.124  32.279  4.353   1.00 57.51  ? 370 LEU A CB  1 
ATOM   2389 C CG  . LEU A 1 377 ? -3.181  32.859  5.415   1.00 52.80  ? 370 LEU A CG  1 
ATOM   2390 C CD1 . LEU A 1 377 ? -2.464  34.121  4.948   1.00 55.16  ? 370 LEU A CD1 1 
ATOM   2391 C CD2 . LEU A 1 377 ? -3.949  33.128  6.708   1.00 40.92  ? 370 LEU A CD2 1 
ATOM   2392 N N   . PRO A 1 378 ? -3.539  30.700  1.634   1.00 69.20  ? 371 PRO A N   1 
ATOM   2393 C CA  . PRO A 1 378 ? -3.784  29.722  0.563   1.00 68.82  ? 371 PRO A CA  1 
ATOM   2394 C C   . PRO A 1 378 ? -5.069  28.905  0.736   1.00 67.01  ? 371 PRO A C   1 
ATOM   2395 O O   . PRO A 1 378 ? -5.631  28.444  -0.265  1.00 65.92  ? 371 PRO A O   1 
ATOM   2396 C CB  . PRO A 1 378 ? -2.556  28.814  0.640   1.00 65.27  ? 371 PRO A CB  1 
ATOM   2397 C CG  . PRO A 1 378 ? -1.493  29.677  1.230   1.00 66.28  ? 371 PRO A CG  1 
ATOM   2398 C CD  . PRO A 1 378 ? -2.204  30.520  2.235   1.00 66.50  ? 371 PRO A CD  1 
ATOM   2399 N N   . ALA A 1 379 ? -5.521  28.744  1.979   1.00 55.77  ? 372 ALA A N   1 
ATOM   2400 C CA  . ALA A 1 379 ? -6.759  28.027  2.281   1.00 56.29  ? 372 ALA A CA  1 
ATOM   2401 C C   . ALA A 1 379 ? -7.981  28.677  1.629   1.00 67.79  ? 372 ALA A C   1 
ATOM   2402 O O   . ALA A 1 379 ? -8.641  28.072  0.775   1.00 73.36  ? 372 ALA A O   1 
ATOM   2403 C CB  . ALA A 1 379 ? -6.959  27.934  3.798   1.00 56.89  ? 372 ALA A CB  1 
ATOM   2404 N N   . VAL A 1 380 ? -8.282  29.906  2.054   1.00 66.06  ? 373 VAL A N   1 
ATOM   2405 C CA  . VAL A 1 380 ? -9.403  30.680  1.525   1.00 50.47  ? 373 VAL A CA  1 
ATOM   2406 C C   . VAL A 1 380 ? -9.213  30.980  0.060   1.00 46.31  ? 373 VAL A C   1 
ATOM   2407 O O   . VAL A 1 380 ? -10.121 30.757  -0.756  1.00 43.76  ? 373 VAL A O   1 
ATOM   2408 C CB  . VAL A 1 380 ? -9.485  32.042  2.195   1.00 45.53  ? 373 VAL A CB  1 
ATOM   2409 C CG1 . VAL A 1 380 ? -10.632 32.863  1.606   1.00 47.21  ? 373 VAL A CG1 1 
ATOM   2410 C CG2 . VAL A 1 380 ? -9.624  31.875  3.679   1.00 38.84  ? 373 VAL A CG2 1 
ATOM   2411 N N   . GLN A 1 381 ? -8.019  31.490  -0.248  1.00 38.31  ? 374 GLN A N   1 
ATOM   2412 C CA  . GLN A 1 381 ? -7.677  32.009  -1.573  1.00 33.85  ? 374 GLN A CA  1 
ATOM   2413 C C   . GLN A 1 381 ? -8.134  31.151  -2.756  1.00 33.38  ? 374 GLN A C   1 
ATOM   2414 O O   . GLN A 1 381 ? -7.830  29.952  -2.848  1.00 32.19  ? 374 GLN A O   1 
ATOM   2415 C CB  . GLN A 1 381 ? -6.178  32.275  -1.675  1.00 37.24  ? 374 GLN A CB  1 
ATOM   2416 C CG  . GLN A 1 381 ? -5.770  32.955  -2.982  1.00 40.10  ? 374 GLN A CG  1 
ATOM   2417 C CD  . GLN A 1 381 ? -4.281  33.199  -3.053  1.00 44.38  ? 374 GLN A CD  1 
ATOM   2418 O OE1 . GLN A 1 381 ? -3.489  32.260  -3.163  1.00 51.31  ? 374 GLN A OE1 1 
ATOM   2419 N NE2 . GLN A 1 381 ? -3.887  34.464  -2.972  1.00 41.64  ? 374 GLN A NE2 1 
ATOM   2420 N N   . GLN A 1 382 ? -8.861  31.797  -3.658  1.00 40.47  ? 375 GLN A N   1 
ATOM   2421 C CA  . GLN A 1 382 ? -9.436  31.144  -4.822  1.00 49.76  ? 375 GLN A CA  1 
ATOM   2422 C C   . GLN A 1 382 ? -8.583  31.386  -6.065  1.00 56.45  ? 375 GLN A C   1 
ATOM   2423 O O   . GLN A 1 382 ? -8.095  32.497  -6.280  1.00 57.42  ? 375 GLN A O   1 
ATOM   2424 C CB  . GLN A 1 382 ? -10.860 31.665  -5.033  1.00 39.65  ? 375 GLN A CB  1 
ATOM   2425 C CG  . GLN A 1 382 ? -11.759 31.372  -3.850  1.00 40.44  ? 375 GLN A CG  1 
ATOM   2426 C CD  . GLN A 1 382 ? -12.172 29.917  -3.785  1.00 44.96  ? 375 GLN A CD  1 
ATOM   2427 O OE1 . GLN A 1 382 ? -12.757 29.395  -4.738  1.00 64.62  ? 375 GLN A OE1 1 
ATOM   2428 N NE2 . GLN A 1 382 ? -11.868 29.247  -2.669  1.00 32.25  ? 375 GLN A NE2 1 
ATOM   2429 N N   . ASN A 1 383 ? -8.394  30.348  -6.875  1.00 52.88  ? 376 ASN A N   1 
ATOM   2430 C CA  . ASN A 1 383 ? -7.647  30.511  -8.115  1.00 54.47  ? 376 ASN A CA  1 
ATOM   2431 C C   . ASN A 1 383 ? -8.384  31.424  -9.065  1.00 52.70  ? 376 ASN A C   1 
ATOM   2432 O O   . ASN A 1 383 ? -7.787  32.257  -9.747  1.00 60.93  ? 376 ASN A O   1 
ATOM   2433 C CB  . ASN A 1 383 ? -7.376  29.169  -8.781  1.00 61.36  ? 376 ASN A CB  1 
ATOM   2434 C CG  . ASN A 1 383 ? -6.044  28.583  -8.371  1.00 69.95  ? 376 ASN A CG  1 
ATOM   2435 O OD1 . ASN A 1 383 ? -5.986  27.665  -7.555  1.00 73.44  ? 376 ASN A OD1 1 
ATOM   2436 N ND2 . ASN A 1 383 ? -4.958  29.123  -8.926  1.00 72.73  ? 376 ASN A ND2 1 
ATOM   2437 N N   . ASN A 1 384 ? -9.695  31.257  -9.109  1.00 48.06  ? 377 ASN A N   1 
ATOM   2438 C CA  . ASN A 1 384 ? -10.532 32.152  -9.874  1.00 56.63  ? 377 ASN A CA  1 
ATOM   2439 C C   . ASN A 1 384 ? -11.684 32.576  -9.003  1.00 59.69  ? 377 ASN A C   1 
ATOM   2440 O O   . ASN A 1 384 ? -12.485 31.733  -8.577  1.00 66.59  ? 377 ASN A O   1 
ATOM   2441 C CB  . ASN A 1 384 ? -11.067 31.451  -11.117 1.00 63.67  ? 377 ASN A CB  1 
ATOM   2442 C CG  . ASN A 1 384 ? -10.350 31.880  -12.371 1.00 73.89  ? 377 ASN A CG  1 
ATOM   2443 O OD1 . ASN A 1 384 ? -9.132  32.069  -12.367 1.00 72.18  ? 377 ASN A OD1 1 
ATOM   2444 N ND2 . ASN A 1 384 ? -11.104 32.057  -13.453 1.00 79.54  ? 377 ASN A ND2 1 
ATOM   2445 N N   . LEU A 1 385 ? -11.782 33.865  -8.706  1.00 40.48  ? 378 LEU A N   1 
ATOM   2446 C CA  . LEU A 1 385 ? -12.903 34.263  -7.883  1.00 48.79  ? 378 LEU A CA  1 
ATOM   2447 C C   . LEU A 1 385 ? -14.130 34.537  -8.755  1.00 48.76  ? 378 LEU A C   1 
ATOM   2448 O O   . LEU A 1 385 ? -14.012 35.019  -9.884  1.00 47.33  ? 378 LEU A O   1 
ATOM   2449 C CB  . LEU A 1 385 ? -12.564 35.412  -6.923  1.00 47.90  ? 378 LEU A CB  1 
ATOM   2450 C CG  . LEU A 1 385 ? -13.176 36.742  -7.312  1.00 43.89  ? 378 LEU A CG  1 
ATOM   2451 C CD1 . LEU A 1 385 ? -13.215 37.695  -6.158  1.00 21.84  ? 378 LEU A CD1 1 
ATOM   2452 C CD2 . LEU A 1 385 ? -12.331 37.281  -8.422  1.00 59.83  ? 378 LEU A CD2 1 
ATOM   2453 N N   . ASP A 1 386 ? -15.301 34.191  -8.226  1.00 40.26  ? 379 ASP A N   1 
ATOM   2454 C CA  . ASP A 1 386 ? -16.557 34.311  -8.945  1.00 35.65  ? 379 ASP A CA  1 
ATOM   2455 C C   . ASP A 1 386 ? -16.997 35.776  -8.992  1.00 41.04  ? 379 ASP A C   1 
ATOM   2456 O O   . ASP A 1 386 ? -17.758 36.234  -8.135  1.00 50.22  ? 379 ASP A O   1 
ATOM   2457 C CB  . ASP A 1 386 ? -17.603 33.457  -8.234  1.00 43.44  ? 379 ASP A CB  1 
ATOM   2458 C CG  . ASP A 1 386 ? -18.834 33.209  -9.071  1.00 58.38  ? 379 ASP A CG  1 
ATOM   2459 O OD1 . ASP A 1 386 ? -19.365 32.081  -8.983  1.00 63.81  ? 379 ASP A OD1 1 
ATOM   2460 O OD2 . ASP A 1 386 ? -19.283 34.127  -9.799  1.00 62.15  ? 379 ASP A OD2 1 
ATOM   2461 N N   . GLU A 1 387 ? -16.526 36.516  -9.988  1.00 36.50  ? 380 GLU A N   1 
ATOM   2462 C CA  . GLU A 1 387 ? -16.861 37.931  -10.076 1.00 38.78  ? 380 GLU A CA  1 
ATOM   2463 C C   . GLU A 1 387 ? -18.357 38.139  -10.254 1.00 34.74  ? 380 GLU A C   1 
ATOM   2464 O O   . GLU A 1 387 ? -18.902 39.191  -9.906  1.00 34.48  ? 380 GLU A O   1 
ATOM   2465 C CB  . GLU A 1 387 ? -16.063 38.613  -11.184 1.00 48.60  ? 380 GLU A CB  1 
ATOM   2466 C CG  . GLU A 1 387 ? -14.583 38.709  -10.856 1.00 57.45  ? 380 GLU A CG  1 
ATOM   2467 C CD  . GLU A 1 387 ? -13.753 39.326  -11.970 1.00 63.86  ? 380 GLU A CD  1 
ATOM   2468 O OE1 . GLU A 1 387 ? -14.322 40.055  -12.818 1.00 55.56  ? 380 GLU A OE1 1 
ATOM   2469 O OE2 . GLU A 1 387 ? -12.524 39.075  -11.990 1.00 63.24  ? 380 GLU A OE2 1 
ATOM   2470 N N   . ASP A 1 388 ? -19.027 37.120  -10.772 1.00 31.91  ? 381 ASP A N   1 
ATOM   2471 C CA  . ASP A 1 388 ? -20.467 37.200  -10.965 1.00 43.05  ? 381 ASP A CA  1 
ATOM   2472 C C   . ASP A 1 388 ? -21.167 37.265  -9.627  1.00 38.28  ? 381 ASP A C   1 
ATOM   2473 O O   . ASP A 1 388 ? -21.972 38.155  -9.374  1.00 38.69  ? 381 ASP A O   1 
ATOM   2474 C CB  . ASP A 1 388 ? -20.956 36.005  -11.774 1.00 58.43  ? 381 ASP A CB  1 
ATOM   2475 C CG  . ASP A 1 388 ? -20.527 36.085  -13.224 1.00 60.72  ? 381 ASP A CG  1 
ATOM   2476 O OD1 . ASP A 1 388 ? -20.768 37.149  -13.844 1.00 62.75  ? 381 ASP A OD1 1 
ATOM   2477 O OD2 . ASP A 1 388 ? -19.935 35.101  -13.729 1.00 52.95  ? 381 ASP A OD2 1 
ATOM   2478 N N   . LEU A 1 389 ? -20.826 36.316  -8.769  1.00 35.33  ? 382 LEU A N   1 
ATOM   2479 C CA  . LEU A 1 389 ? -21.252 36.315  -7.378  1.00 26.16  ? 382 LEU A CA  1 
ATOM   2480 C C   . LEU A 1 389 ? -20.957 37.613  -6.605  1.00 33.94  ? 382 LEU A C   1 
ATOM   2481 O O   . LEU A 1 389 ? -21.825 38.109  -5.873  1.00 26.23  ? 382 LEU A O   1 
ATOM   2482 C CB  . LEU A 1 389 ? -20.613 35.145  -6.644  1.00 21.88  ? 382 LEU A CB  1 
ATOM   2483 C CG  . LEU A 1 389 ? -21.106 35.154  -5.202  1.00 24.92  ? 382 LEU A CG  1 
ATOM   2484 C CD1 . LEU A 1 389 ? -22.626 35.020  -5.225  1.00 9.62   ? 382 LEU A CD1 1 
ATOM   2485 C CD2 . LEU A 1 389 ? -20.424 34.057  -4.377  1.00 21.96  ? 382 LEU A CD2 1 
ATOM   2486 N N   . ILE A 1 390 ? -19.738 38.145  -6.735  1.00 27.86  ? 383 ILE A N   1 
ATOM   2487 C CA  . ILE A 1 390 ? -19.400 39.417  -6.084  1.00 25.34  ? 383 ILE A CA  1 
ATOM   2488 C C   . ILE A 1 390 ? -20.288 40.558  -6.587  1.00 23.32  ? 383 ILE A C   1 
ATOM   2489 O O   . ILE A 1 390 ? -20.708 41.413  -5.818  1.00 29.36  ? 383 ILE A O   1 
ATOM   2490 C CB  . ILE A 1 390 ? -17.929 39.827  -6.300  1.00 27.10  ? 383 ILE A CB  1 
ATOM   2491 C CG1 . ILE A 1 390 ? -16.976 38.744  -5.807  1.00 25.74  ? 383 ILE A CG1 1 
ATOM   2492 C CG2 . ILE A 1 390 ? -17.642 41.138  -5.611  1.00 20.68  ? 383 ILE A CG2 1 
ATOM   2493 C CD1 . ILE A 1 390 ? -17.055 38.502  -4.349  1.00 26.53  ? 383 ILE A CD1 1 
ATOM   2494 N N   . ARG A 1 391 ? -20.574 40.584  -7.883  1.00 31.28  ? 384 ARG A N   1 
ATOM   2495 C CA  . ARG A 1 391 ? -21.379 41.678  -8.407  1.00 38.02  ? 384 ARG A CA  1 
ATOM   2496 C C   . ARG A 1 391 ? -22.821 41.549  -7.923  1.00 34.40  ? 384 ARG A C   1 
ATOM   2497 O O   . ARG A 1 391 ? -23.472 42.544  -7.602  1.00 31.63  ? 384 ARG A O   1 
ATOM   2498 C CB  . ARG A 1 391 ? -21.281 41.760  -9.927  1.00 48.38  ? 384 ARG A CB  1 
ATOM   2499 C CG  . ARG A 1 391 ? -19.992 42.432  -10.418 1.00 56.50  ? 384 ARG A CG  1 
ATOM   2500 C CD  . ARG A 1 391 ? -19.945 42.563  -11.947 1.00 47.72  ? 384 ARG A CD  1 
ATOM   2501 N NE  . ARG A 1 391 ? -20.543 41.382  -12.554 1.00 41.06  ? 384 ARG A NE  1 
ATOM   2502 C CZ  . ARG A 1 391 ? -19.850 40.364  -13.047 1.00 43.98  ? 384 ARG A CZ  1 
ATOM   2503 N NH1 . ARG A 1 391 ? -18.511 40.407  -13.035 1.00 26.92  ? 384 ARG A NH1 1 
ATOM   2504 N NH2 . ARG A 1 391 ? -20.500 39.321  -13.571 1.00 39.13  ? 384 ARG A NH2 1 
ATOM   2505 N N   . LYS A 1 392 ? -23.306 40.317  -7.830  1.00 24.96  ? 385 LYS A N   1 
ATOM   2506 C CA  . LYS A 1 392 ? -24.617 40.090  -7.236  1.00 29.39  ? 385 LYS A CA  1 
ATOM   2507 C C   . LYS A 1 392 ? -24.662 40.679  -5.827  1.00 31.37  ? 385 LYS A C   1 
ATOM   2508 O O   . LYS A 1 392 ? -25.621 41.359  -5.478  1.00 30.77  ? 385 LYS A O   1 
ATOM   2509 C CB  . LYS A 1 392 ? -24.979 38.601  -7.218  1.00 23.03  ? 385 LYS A CB  1 
ATOM   2510 C CG  . LYS A 1 392 ? -26.385 38.315  -6.721  1.00 29.06  ? 385 LYS A CG  1 
ATOM   2511 C CD  . LYS A 1 392 ? -26.718 36.838  -6.869  1.00 38.03  ? 385 LYS A CD  1 
ATOM   2512 C CE  . LYS A 1 392 ? -28.115 36.521  -6.357  1.00 40.57  ? 385 LYS A CE  1 
ATOM   2513 N NZ  . LYS A 1 392 ? -28.397 35.056  -6.340  1.00 42.02  ? 385 LYS A NZ  1 
ATOM   2514 N N   . LEU A 1 393 ? -23.600 40.454  -5.051  1.00 31.31  ? 386 LEU A N   1 
ATOM   2515 C CA  . LEU A 1 393 ? -23.507 40.955  -3.688  1.00 26.69  ? 386 LEU A CA  1 
ATOM   2516 C C   . LEU A 1 393 ? -23.544 42.469  -3.627  1.00 26.68  ? 386 LEU A C   1 
ATOM   2517 O O   . LEU A 1 393 ? -24.101 43.044  -2.695  1.00 34.93  ? 386 LEU A O   1 
ATOM   2518 C CB  . LEU A 1 393 ? -22.240 40.451  -2.993  1.00 27.76  ? 386 LEU A CB  1 
ATOM   2519 C CG  . LEU A 1 393 ? -21.981 41.055  -1.596  1.00 24.82  ? 386 LEU A CG  1 
ATOM   2520 C CD1 . LEU A 1 393 ? -23.129 40.779  -0.620  1.00 14.25  ? 386 LEU A CD1 1 
ATOM   2521 C CD2 . LEU A 1 393 ? -20.677 40.553  -1.016  1.00 22.17  ? 386 LEU A CD2 1 
ATOM   2522 N N   . ALA A 1 394 ? -22.952 43.125  -4.613  1.00 33.58  ? 387 ALA A N   1 
ATOM   2523 C CA  . ALA A 1 394 ? -22.934 44.579  -4.593  1.00 39.46  ? 387 ALA A CA  1 
ATOM   2524 C C   . ALA A 1 394 ? -24.332 45.124  -4.866  1.00 36.39  ? 387 ALA A C   1 
ATOM   2525 O O   . ALA A 1 394 ? -24.819 46.028  -4.183  1.00 44.30  ? 387 ALA A O   1 
ATOM   2526 C CB  . ALA A 1 394 ? -21.934 45.119  -5.614  1.00 30.79  ? 387 ALA A CB  1 
ATOM   2527 N N   . TYR A 1 395 ? -24.970 44.543  -5.875  1.00 35.62  ? 388 TYR A N   1 
ATOM   2528 C CA  . TYR A 1 395 ? -26.236 45.042  -6.409  1.00 41.14  ? 388 TYR A CA  1 
ATOM   2529 C C   . TYR A 1 395 ? -27.330 44.786  -5.406  1.00 43.07  ? 388 TYR A C   1 
ATOM   2530 O O   . TYR A 1 395 ? -28.368 45.433  -5.400  1.00 36.04  ? 388 TYR A O   1 
ATOM   2531 C CB  . TYR A 1 395 ? -26.591 44.295  -7.691  1.00 42.25  ? 388 TYR A CB  1 
ATOM   2532 C CG  . TYR A 1 395 ? -25.822 44.726  -8.911  1.00 29.41  ? 388 TYR A CG  1 
ATOM   2533 C CD1 . TYR A 1 395 ? -25.288 43.784  -9.769  1.00 28.06  ? 388 TYR A CD1 1 
ATOM   2534 C CD2 . TYR A 1 395 ? -25.674 46.073  -9.235  1.00 25.75  ? 388 TYR A CD2 1 
ATOM   2535 C CE1 . TYR A 1 395 ? -24.588 44.166  -10.907 1.00 33.72  ? 388 TYR A CE1 1 
ATOM   2536 C CE2 . TYR A 1 395 ? -24.988 46.469  -10.370 1.00 28.32  ? 388 TYR A CE2 1 
ATOM   2537 C CZ  . TYR A 1 395 ? -24.450 45.506  -11.201 1.00 35.66  ? 388 TYR A CZ  1 
ATOM   2538 O OH  . TYR A 1 395 ? -23.770 45.881  -12.329 1.00 40.94  ? 388 TYR A OH  1 
ATOM   2539 N N   . VAL A 1 396 ? -27.068 43.826  -4.536  1.00 46.17  ? 389 VAL A N   1 
ATOM   2540 C CA  . VAL A 1 396 ? -28.058 43.315  -3.611  1.00 35.25  ? 389 VAL A CA  1 
ATOM   2541 C C   . VAL A 1 396 ? -27.679 43.671  -2.175  1.00 41.12  ? 389 VAL A C   1 
ATOM   2542 O O   . VAL A 1 396 ? -28.283 43.189  -1.243  1.00 44.51  ? 389 VAL A O   1 
ATOM   2543 C CB  . VAL A 1 396 ? -28.291 41.821  -3.913  1.00 29.13  ? 389 VAL A CB  1 
ATOM   2544 C CG1 . VAL A 1 396 ? -29.323 41.124  -3.022  1.00 23.68  ? 389 VAL A CG1 1 
ATOM   2545 C CG2 . VAL A 1 396 ? -28.577 41.670  -5.375  1.00 39.20  ? 389 VAL A CG2 1 
ATOM   2546 N N   . ALA A 1 397 ? -26.741 44.595  -1.988  1.00 41.35  ? 390 ALA A N   1 
ATOM   2547 C CA  . ALA A 1 397 ? -26.327 44.940  -0.629  1.00 33.54  ? 390 ALA A CA  1 
ATOM   2548 C C   . ALA A 1 397 ? -27.235 45.938  0.084   1.00 28.87  ? 390 ALA A C   1 
ATOM   2549 O O   . ALA A 1 397 ? -27.313 45.920  1.305   1.00 27.48  ? 390 ALA A O   1 
ATOM   2550 C CB  . ALA A 1 397 ? -24.856 45.399  -0.567  1.00 33.34  ? 390 ALA A CB  1 
ATOM   2551 N N   . ALA A 1 398 ? -27.892 46.815  -0.668  1.00 36.82  ? 391 ALA A N   1 
ATOM   2552 C CA  . ALA A 1 398 ? -28.719 47.860  -0.077  1.00 26.88  ? 391 ALA A CA  1 
ATOM   2553 C C   . ALA A 1 398 ? -29.893 47.267  0.712   1.00 38.27  ? 391 ALA A C   1 
ATOM   2554 O O   . ALA A 1 398 ? -30.436 47.909  1.610   1.00 43.03  ? 391 ALA A O   1 
ATOM   2555 C CB  . ALA A 1 398 ? -29.226 48.799  -1.165  1.00 4.50   ? 391 ALA A CB  1 
ATOM   2556 N N   . GLY A 1 399 ? -30.271 46.032  0.389   1.00 34.49  ? 392 GLY A N   1 
ATOM   2557 C CA  . GLY A 1 399 ? -31.504 45.448  0.893   1.00 33.48  ? 392 GLY A CA  1 
ATOM   2558 C C   . GLY A 1 399 ? -31.574 44.984  2.328   1.00 29.97  ? 392 GLY A C   1 
ATOM   2559 O O   . GLY A 1 399 ? -30.659 44.369  2.866   1.00 34.72  ? 392 GLY A O   1 
ATOM   2560 N N   . ASP A 1 400 ? -32.716 45.279  2.929   1.00 26.19  ? 393 ASP A N   1 
ATOM   2561 C CA  . ASP A 1 400 ? -32.991 44.970  4.313   1.00 35.13  ? 393 ASP A CA  1 
ATOM   2562 C C   . ASP A 1 400 ? -34.365 44.293  4.339   1.00 36.98  ? 393 ASP A C   1 
ATOM   2563 O O   . ASP A 1 400 ? -35.395 44.963  4.334   1.00 41.90  ? 393 ASP A O   1 
ATOM   2564 C CB  . ASP A 1 400 ? -32.985 46.274  5.117   1.00 37.16  ? 393 ASP A CB  1 
ATOM   2565 C CG  . ASP A 1 400 ? -32.933 46.047  6.614   1.00 56.17  ? 393 ASP A CG  1 
ATOM   2566 O OD1 . ASP A 1 400 ? -33.643 46.775  7.347   1.00 68.79  ? 393 ASP A OD1 1 
ATOM   2567 O OD2 . ASP A 1 400 ? -32.183 45.153  7.062   1.00 56.13  ? 393 ASP A OD2 1 
ATOM   2568 N N   . LEU A 1 401 ? -34.366 42.962  4.360   1.00 29.81  ? 394 LEU A N   1 
ATOM   2569 C CA  . LEU A 1 401 ? -35.550 42.183  4.010   1.00 19.22  ? 394 LEU A CA  1 
ATOM   2570 C C   . LEU A 1 401 ? -36.013 41.286  5.134   1.00 19.38  ? 394 LEU A C   1 
ATOM   2571 O O   . LEU A 1 401 ? -35.388 40.274  5.443   1.00 23.03  ? 394 LEU A O   1 
ATOM   2572 C CB  . LEU A 1 401 ? -35.282 41.300  2.785   1.00 16.07  ? 394 LEU A CB  1 
ATOM   2573 C CG  . LEU A 1 401 ? -34.460 41.901  1.658   1.00 25.03  ? 394 LEU A CG  1 
ATOM   2574 C CD1 . LEU A 1 401 ? -34.172 40.848  0.611   1.00 25.92  ? 394 LEU A CD1 1 
ATOM   2575 C CD2 . LEU A 1 401 ? -35.186 43.089  1.067   1.00 32.58  ? 394 LEU A CD2 1 
ATOM   2576 N N   . ALA A 1 402 ? -37.153 41.648  5.693   1.00 24.76  ? 395 ALA A N   1 
ATOM   2577 C CA  . ALA A 1 402 ? -37.750 40.976  6.828   1.00 19.25  ? 395 ALA A CA  1 
ATOM   2578 C C   . ALA A 1 402 ? -37.638 39.436  6.843   1.00 20.49  ? 395 ALA A C   1 
ATOM   2579 O O   . ALA A 1 402 ? -37.222 38.858  7.850   1.00 19.76  ? 395 ALA A O   1 
ATOM   2580 C CB  . ALA A 1 402 ? -39.205 41.442  6.981   1.00 15.92  ? 395 ALA A CB  1 
ATOM   2581 N N   . PRO A 1 403 ? -37.989 38.767  5.728   1.00 23.31  ? 396 PRO A N   1 
ATOM   2582 C CA  . PRO A 1 403 ? -37.914 37.302  5.794   1.00 15.83  ? 396 PRO A CA  1 
ATOM   2583 C C   . PRO A 1 403 ? -36.500 36.782  5.981   1.00 24.61  ? 396 PRO A C   1 
ATOM   2584 O O   . PRO A 1 403 ? -36.331 35.780  6.670   1.00 35.56  ? 396 PRO A O   1 
ATOM   2585 C CB  . PRO A 1 403 ? -38.466 36.866  4.436   1.00 18.86  ? 396 PRO A CB  1 
ATOM   2586 C CG  . PRO A 1 403 ? -39.362 37.983  4.040   1.00 16.00  ? 396 PRO A CG  1 
ATOM   2587 C CD  . PRO A 1 403 ? -38.645 39.216  4.486   1.00 14.04  ? 396 PRO A CD  1 
ATOM   2588 N N   . ILE A 1 404 ? -35.509 37.453  5.392   1.00 22.47  ? 397 ILE A N   1 
ATOM   2589 C CA  . ILE A 1 404 ? -34.114 37.046  5.553   1.00 24.76  ? 397 ILE A CA  1 
ATOM   2590 C C   . ILE A 1 404 ? -33.653 37.273  6.986   1.00 24.47  ? 397 ILE A C   1 
ATOM   2591 O O   . ILE A 1 404 ? -33.133 36.357  7.611   1.00 27.77  ? 397 ILE A O   1 
ATOM   2592 C CB  . ILE A 1 404 ? -33.182 37.811  4.629   1.00 17.51  ? 397 ILE A CB  1 
ATOM   2593 C CG1 . ILE A 1 404 ? -33.736 37.814  3.204   1.00 25.31  ? 397 ILE A CG1 1 
ATOM   2594 C CG2 . ILE A 1 404 ? -31.810 37.210  4.679   1.00 3.59   ? 397 ILE A CG2 1 
ATOM   2595 C CD1 . ILE A 1 404 ? -33.961 36.447  2.635   1.00 23.16  ? 397 ILE A CD1 1 
ATOM   2596 N N   . ASN A 1 405 ? -33.836 38.501  7.479   1.00 20.23  ? 398 ASN A N   1 
ATOM   2597 C CA  . ASN A 1 405 ? -33.570 38.864  8.870   1.00 17.77  ? 398 ASN A CA  1 
ATOM   2598 C C   . ASN A 1 405 ? -34.192 37.909  9.860   1.00 17.43  ? 398 ASN A C   1 
ATOM   2599 O O   . ASN A 1 405 ? -33.554 37.511  10.833  1.00 20.63  ? 398 ASN A O   1 
ATOM   2600 C CB  . ASN A 1 405 ? -34.099 40.262  9.168   1.00 23.98  ? 398 ASN A CB  1 
ATOM   2601 C CG  . ASN A 1 405 ? -33.338 41.326  8.442   1.00 22.48  ? 398 ASN A CG  1 
ATOM   2602 O OD1 . ASN A 1 405 ? -32.216 41.101  8.011   1.00 26.92  ? 398 ASN A OD1 1 
ATOM   2603 N ND2 . ASN A 1 405 ? -33.928 42.496  8.318   1.00 23.84  ? 398 ASN A ND2 1 
ATOM   2604 N N   . ALA A 1 406 ? -35.443 37.544  9.618   1.00 22.62  ? 399 ALA A N   1 
ATOM   2605 C CA  . ALA A 1 406 ? -36.142 36.645  10.526  1.00 21.51  ? 399 ALA A CA  1 
ATOM   2606 C C   . ALA A 1 406 ? -35.478 35.278  10.474  1.00 24.64  ? 399 ALA A C   1 
ATOM   2607 O O   . ALA A 1 406 ? -35.236 34.653  11.492  1.00 32.41  ? 399 ALA A O   1 
ATOM   2608 C CB  . ALA A 1 406 ? -37.628 36.547  10.159  1.00 5.57   ? 399 ALA A CB  1 
ATOM   2609 N N   . PHE A 1 407 ? -35.164 34.829  9.269   1.00 27.24  ? 400 PHE A N   1 
ATOM   2610 C CA  . PHE A 1 407 ? -34.534 33.532  9.085   1.00 33.51  ? 400 PHE A CA  1 
ATOM   2611 C C   . PHE A 1 407 ? -33.154 33.446  9.762   1.00 28.47  ? 400 PHE A C   1 
ATOM   2612 O O   . PHE A 1 407 ? -32.921 32.566  10.586  1.00 25.02  ? 400 PHE A O   1 
ATOM   2613 C CB  . PHE A 1 407 ? -34.463 33.193  7.589   1.00 36.23  ? 400 PHE A CB  1 
ATOM   2614 C CG  . PHE A 1 407 ? -33.406 32.204  7.250   1.00 39.13  ? 400 PHE A CG  1 
ATOM   2615 C CD1 . PHE A 1 407 ? -33.536 30.885  7.616   1.00 50.81  ? 400 PHE A CD1 1 
ATOM   2616 C CD2 . PHE A 1 407 ? -32.277 32.592  6.570   1.00 42.89  ? 400 PHE A CD2 1 
ATOM   2617 C CE1 . PHE A 1 407 ? -32.551 29.969  7.311   1.00 53.47  ? 400 PHE A CE1 1 
ATOM   2618 C CE2 . PHE A 1 407 ? -31.292 31.689  6.277   1.00 46.35  ? 400 PHE A CE2 1 
ATOM   2619 C CZ  . PHE A 1 407 ? -31.430 30.368  6.642   1.00 49.00  ? 400 PHE A CZ  1 
ATOM   2620 N N   . ILE A 1 408 ? -32.252 34.366  9.425   1.00 25.10  ? 401 ILE A N   1 
ATOM   2621 C CA  . ILE A 1 408 ? -30.916 34.379  10.015  1.00 28.01  ? 401 ILE A CA  1 
ATOM   2622 C C   . ILE A 1 408 ? -30.986 34.703  11.511  1.00 26.90  ? 401 ILE A C   1 
ATOM   2623 O O   . ILE A 1 408 ? -30.226 34.135  12.313  1.00 20.29  ? 401 ILE A O   1 
ATOM   2624 C CB  . ILE A 1 408 ? -29.936 35.315  9.250   1.00 21.68  ? 401 ILE A CB  1 
ATOM   2625 C CG1 . ILE A 1 408 ? -29.227 34.539  8.142   1.00 22.54  ? 401 ILE A CG1 1 
ATOM   2626 C CG2 . ILE A 1 408 ? -28.873 35.857  10.165  1.00 14.55  ? 401 ILE A CG2 1 
ATOM   2627 C CD1 . ILE A 1 408 ? -29.655 34.933  6.752   1.00 21.70  ? 401 ILE A CD1 1 
ATOM   2628 N N   . GLY A 1 409 ? -31.923 35.581  11.880  1.00 21.94  ? 402 GLY A N   1 
ATOM   2629 C CA  . GLY A 1 409 ? -32.201 35.877  13.278  1.00 24.37  ? 402 GLY A CA  1 
ATOM   2630 C C   . GLY A 1 409 ? -32.636 34.631  14.047  1.00 31.71  ? 402 GLY A C   1 
ATOM   2631 O O   . GLY A 1 409 ? -32.403 34.495  15.253  1.00 27.02  ? 402 GLY A O   1 
ATOM   2632 N N   . GLY A 1 410 ? -33.272 33.704  13.343  1.00 22.28  ? 403 GLY A N   1 
ATOM   2633 C CA  . GLY A 1 410 ? -33.642 32.449  13.954  1.00 27.86  ? 403 GLY A CA  1 
ATOM   2634 C C   . GLY A 1 410 ? -32.405 31.647  14.295  1.00 27.69  ? 403 GLY A C   1 
ATOM   2635 O O   . GLY A 1 410 ? -32.245 31.184  15.424  1.00 36.54  ? 403 GLY A O   1 
ATOM   2636 N N   . LEU A 1 411 ? -31.524 31.500  13.310  1.00 27.26  ? 404 LEU A N   1 
ATOM   2637 C CA  . LEU A 1 411 ? -30.318 30.691  13.451  1.00 20.25  ? 404 LEU A CA  1 
ATOM   2638 C C   . LEU A 1 411 ? -29.391 31.282  14.489  1.00 22.74  ? 404 LEU A C   1 
ATOM   2639 O O   . LEU A 1 411 ? -28.791 30.557  15.289  1.00 31.27  ? 404 LEU A O   1 
ATOM   2640 C CB  . LEU A 1 411 ? -29.584 30.593  12.119  1.00 20.03  ? 404 LEU A CB  1 
ATOM   2641 C CG  . LEU A 1 411 ? -30.304 29.783  11.062  1.00 23.52  ? 404 LEU A CG  1 
ATOM   2642 C CD1 . LEU A 1 411 ? -29.415 29.644  9.829   1.00 21.92  ? 404 LEU A CD1 1 
ATOM   2643 C CD2 . LEU A 1 411 ? -30.704 28.432  11.642  1.00 14.85  ? 404 LEU A CD2 1 
ATOM   2644 N N   . ALA A 1 412 ? -29.274 32.605  14.453  1.00 15.08  ? 405 ALA A N   1 
ATOM   2645 C CA  . ALA A 1 412 ? -28.444 33.331  15.395  1.00 24.86  ? 405 ALA A CA  1 
ATOM   2646 C C   . ALA A 1 412 ? -28.907 33.078  16.852  1.00 27.30  ? 405 ALA A C   1 
ATOM   2647 O O   . ALA A 1 412 ? -28.088 32.851  17.746  1.00 27.40  ? 405 ALA A O   1 
ATOM   2648 C CB  . ALA A 1 412 ? -28.442 34.835  15.044  1.00 18.13  ? 405 ALA A CB  1 
ATOM   2649 N N   . ALA A 1 413 ? -30.219 33.082  17.069  1.00 20.24  ? 406 ALA A N   1 
ATOM   2650 C CA  . ALA A 1 413 ? -30.768 32.887  18.403  1.00 20.05  ? 406 ALA A CA  1 
ATOM   2651 C C   . ALA A 1 413 ? -30.491 31.495  18.946  1.00 27.94  ? 406 ALA A C   1 
ATOM   2652 O O   . ALA A 1 413 ? -30.229 31.351  20.133  1.00 29.36  ? 406 ALA A O   1 
ATOM   2653 C CB  . ALA A 1 413 ? -32.240 33.188  18.441  1.00 14.51  ? 406 ALA A CB  1 
ATOM   2654 N N   . GLN A 1 414 ? -30.532 30.477  18.091  1.00 29.92  ? 407 GLN A N   1 
ATOM   2655 C CA  . GLN A 1 414 ? -30.168 29.130  18.529  1.00 26.88  ? 407 GLN A CA  1 
ATOM   2656 C C   . GLN A 1 414 ? -28.683 29.096  18.858  1.00 32.69  ? 407 GLN A C   1 
ATOM   2657 O O   . GLN A 1 414 ? -28.242 28.311  19.696  1.00 35.07  ? 407 GLN A O   1 
ATOM   2658 C CB  . GLN A 1 414 ? -30.475 28.074  17.465  1.00 17.35  ? 407 GLN A CB  1 
ATOM   2659 C CG  . GLN A 1 414 ? -31.781 28.278  16.736  1.00 30.92  ? 407 GLN A CG  1 
ATOM   2660 C CD  . GLN A 1 414 ? -32.021 27.203  15.694  1.00 51.26  ? 407 GLN A CD  1 
ATOM   2661 O OE1 . GLN A 1 414 ? -31.495 26.101  15.811  1.00 58.81  ? 407 GLN A OE1 1 
ATOM   2662 N NE2 . GLN A 1 414 ? -32.814 27.519  14.667  1.00 53.21  ? 407 GLN A NE2 1 
ATOM   2663 N N   . GLU A 1 415 ? -27.900 29.938  18.192  1.00 27.55  ? 408 GLU A N   1 
ATOM   2664 C CA  . GLU A 1 415 ? -26.499 30.020  18.556  1.00 32.71  ? 408 GLU A CA  1 
ATOM   2665 C C   . GLU A 1 415 ? -26.375 30.605  19.964  1.00 31.17  ? 408 GLU A C   1 
ATOM   2666 O O   . GLU A 1 415 ? -25.670 30.057  20.819  1.00 22.22  ? 408 GLU A O   1 
ATOM   2667 C CB  . GLU A 1 415 ? -25.706 30.818  17.526  1.00 23.11  ? 408 GLU A CB  1 
ATOM   2668 C CG  . GLU A 1 415 ? -25.680 30.132  16.191  1.00 37.58  ? 408 GLU A CG  1 
ATOM   2669 C CD  . GLU A 1 415 ? -25.305 28.666  16.302  1.00 42.56  ? 408 GLU A CD  1 
ATOM   2670 O OE1 . GLU A 1 415 ? -24.226 28.375  16.869  1.00 42.15  ? 408 GLU A OE1 1 
ATOM   2671 O OE2 . GLU A 1 415 ? -26.086 27.811  15.818  1.00 33.16  ? 408 GLU A OE2 1 
ATOM   2672 N N   . VAL A 1 416 ? -27.084 31.700  20.209  1.00 19.17  ? 409 VAL A N   1 
ATOM   2673 C CA  . VAL A 1 416 ? -27.075 32.273  21.530  1.00 23.82  ? 409 VAL A CA  1 
ATOM   2674 C C   . VAL A 1 416 ? -27.503 31.243  22.572  1.00 25.75  ? 409 VAL A C   1 
ATOM   2675 O O   . VAL A 1 416 ? -26.862 31.110  23.610  1.00 31.08  ? 409 VAL A O   1 
ATOM   2676 C CB  . VAL A 1 416 ? -27.971 33.507  21.664  1.00 23.69  ? 409 VAL A CB  1 
ATOM   2677 C CG1 . VAL A 1 416 ? -27.990 33.920  23.120  1.00 23.36  ? 409 VAL A CG1 1 
ATOM   2678 C CG2 . VAL A 1 416 ? -27.454 34.651  20.803  1.00 14.73  ? 409 VAL A CG2 1 
ATOM   2679 N N   . MET A 1 417 ? -28.568 30.502  22.286  1.00 32.45  ? 410 MET A N   1 
ATOM   2680 C CA  . MET A 1 417 ? -29.089 29.524  23.244  1.00 26.36  ? 410 MET A CA  1 
ATOM   2681 C C   . MET A 1 417 ? -28.053 28.456  23.560  1.00 29.62  ? 410 MET A C   1 
ATOM   2682 O O   . MET A 1 417 ? -27.912 28.052  24.713  1.00 37.38  ? 410 MET A O   1 
ATOM   2683 C CB  . MET A 1 417 ? -30.360 28.868  22.722  1.00 26.74  ? 410 MET A CB  1 
ATOM   2684 C CG  . MET A 1 417 ? -31.490 29.847  22.471  1.00 34.80  ? 410 MET A CG  1 
ATOM   2685 S SD  . MET A 1 417 ? -32.241 30.455  23.973  1.00 35.21  ? 410 MET A SD  1 
ATOM   2686 C CE  . MET A 1 417 ? -33.162 31.832  23.324  1.00 103.25 ? 410 MET A CE  1 
ATOM   2687 N N   . LYS A 1 418 ? -27.332 28.016  22.529  1.00 26.00  ? 411 LYS A N   1 
ATOM   2688 C CA  . LYS A 1 418 ? -26.270 27.036  22.665  1.00 32.10  ? 411 LYS A CA  1 
ATOM   2689 C C   . LYS A 1 418 ? -25.145 27.598  23.539  1.00 38.20  ? 411 LYS A C   1 
ATOM   2690 O O   . LYS A 1 418 ? -24.638 26.916  24.428  1.00 46.35  ? 411 LYS A O   1 
ATOM   2691 C CB  . LYS A 1 418 ? -25.718 26.680  21.287  1.00 32.17  ? 411 LYS A CB  1 
ATOM   2692 C CG  . LYS A 1 418 ? -26.587 25.778  20.422  1.00 28.44  ? 411 LYS A CG  1 
ATOM   2693 C CD  . LYS A 1 418 ? -26.098 25.881  18.987  1.00 36.08  ? 411 LYS A CD  1 
ATOM   2694 C CE  . LYS A 1 418 ? -26.650 24.818  18.062  1.00 31.09  ? 411 LYS A CE  1 
ATOM   2695 N NZ  . LYS A 1 418 ? -26.085 25.001  16.686  1.00 29.53  ? 411 LYS A NZ  1 
ATOM   2696 N N   . ALA A 1 419 ? -24.760 28.844  23.274  1.00 33.02  ? 412 ALA A N   1 
ATOM   2697 C CA  . ALA A 1 419 ? -23.750 29.539  24.076  1.00 35.09  ? 412 ALA A CA  1 
ATOM   2698 C C   . ALA A 1 419 ? -24.180 29.752  25.539  1.00 32.10  ? 412 ALA A C   1 
ATOM   2699 O O   . ALA A 1 419 ? -23.339 29.886  26.427  1.00 36.90  ? 412 ALA A O   1 
ATOM   2700 C CB  . ALA A 1 419 ? -23.399 30.884  23.426  1.00 16.63  ? 412 ALA A CB  1 
ATOM   2701 N N   . CYS A 1 420 ? -25.490 29.784  25.771  1.00 18.33  ? 413 CYS A N   1 
ATOM   2702 C CA  . CYS A 1 420 ? -26.065 30.085  27.086  1.00 25.70  ? 413 CYS A CA  1 
ATOM   2703 C C   . CYS A 1 420 ? -26.094 28.906  28.073  1.00 30.33  ? 413 CYS A C   1 
ATOM   2704 O O   . CYS A 1 420 ? -26.033 29.098  29.288  1.00 39.62  ? 413 CYS A O   1 
ATOM   2705 C CB  . CYS A 1 420 ? -27.465 30.683  26.937  1.00 12.99  ? 413 CYS A CB  1 
ATOM   2706 S SG  . CYS A 1 420 ? -27.433 32.478  26.827  1.00 35.50  ? 413 CYS A SG  1 
ATOM   2707 N N   . SER A 1 421 ? -26.202 27.700  27.538  1.00 29.92  ? 414 SER A N   1 
ATOM   2708 C CA  . SER A 1 421 ? -26.142 26.483  28.326  1.00 30.93  ? 414 SER A CA  1 
ATOM   2709 C C   . SER A 1 421 ? -26.161 25.298  27.376  1.00 32.02  ? 414 SER A C   1 
ATOM   2710 O O   . SER A 1 421 ? -26.430 25.446  26.182  1.00 22.94  ? 414 SER A O   1 
ATOM   2711 C CB  . SER A 1 421 ? -27.317 26.382  29.322  1.00 32.66  ? 414 SER A CB  1 
ATOM   2712 O OG  . SER A 1 421 ? -28.472 25.816  28.738  1.00 32.44  ? 414 SER A OG  1 
ATOM   2713 N N   . GLY A 1 422 ? -25.853 24.129  27.917  1.00 40.84  ? 415 GLY A N   1 
ATOM   2714 C CA  . GLY A 1 422 ? -26.053 22.883  27.212  1.00 49.49  ? 415 GLY A CA  1 
ATOM   2715 C C   . GLY A 1 422 ? -24.820 22.320  26.559  1.00 48.35  ? 415 GLY A C   1 
ATOM   2716 O O   . GLY A 1 422 ? -24.594 21.111  26.581  1.00 52.95  ? 415 GLY A O   1 
ATOM   2717 N N   . LYS A 1 423 ? -24.019 23.192  25.975  1.00 61.20  ? 416 LYS A N   1 
ATOM   2718 C CA  . LYS A 1 423 ? -22.909 22.718  25.173  1.00 90.87  ? 416 LYS A CA  1 
ATOM   2719 C C   . LYS A 1 423 ? -23.377 21.633  24.166  1.00 58.34  ? 416 LYS A C   1 
ATOM   2720 O O   . LYS A 1 423 ? -23.110 20.437  24.334  1.00 35.99  ? 416 LYS A O   1 
ATOM   2721 C CB  . LYS A 1 423 ? -21.794 22.197  26.086  1.00 102.49 ? 416 LYS A CB  1 
ATOM   2722 C CG  . LYS A 1 423 ? -21.282 23.197  27.123  1.00 138.07 ? 416 LYS A CG  1 
ATOM   2723 C CD  . LYS A 1 423 ? -20.425 22.505  28.183  1.00 137.31 ? 416 LYS A CD  1 
ATOM   2724 C CE  . LYS A 1 423 ? -19.752 23.498  29.119  1.00 131.56 ? 416 LYS A CE  1 
ATOM   2725 N NZ  . LYS A 1 423 ? -18.351 23.805  28.704  1.00 123.49 ? 416 LYS A NZ  1 
ATOM   2726 N N   . PHE A 1 424 ? -24.128 22.065  23.156  1.00 62.56  ? 417 PHE A N   1 
ATOM   2727 C CA  . PHE A 1 424 ? -24.353 21.251  21.972  1.00 54.26  ? 417 PHE A CA  1 
ATOM   2728 C C   . PHE A 1 424 ? -23.578 21.922  20.870  1.00 48.13  ? 417 PHE A C   1 
ATOM   2729 O O   . PHE A 1 424 ? -23.089 23.033  21.053  1.00 54.25  ? 417 PHE A O   1 
ATOM   2730 C CB  . PHE A 1 424 ? -25.836 21.142  21.633  1.00 61.43  ? 417 PHE A CB  1 
ATOM   2731 C CG  . PHE A 1 424 ? -26.561 20.105  22.455  1.00 70.63  ? 417 PHE A CG  1 
ATOM   2732 C CD1 . PHE A 1 424 ? -26.728 18.816  21.978  1.00 65.69  ? 417 PHE A CD1 1 
ATOM   2733 C CD2 . PHE A 1 424 ? -27.040 20.406  23.722  1.00 62.69  ? 417 PHE A CD2 1 
ATOM   2734 C CE1 . PHE A 1 424 ? -27.375 17.866  22.737  1.00 56.57  ? 417 PHE A CE1 1 
ATOM   2735 C CE2 . PHE A 1 424 ? -27.692 19.457  24.482  1.00 59.98  ? 417 PHE A CE2 1 
ATOM   2736 C CZ  . PHE A 1 424 ? -27.862 18.186  23.988  1.00 59.04  ? 417 PHE A CZ  1 
ATOM   2737 N N   . MET A 1 425 ? -23.447 21.245  19.737  1.00 30.00  ? 418 MET A N   1 
ATOM   2738 C CA  . MET A 1 425 ? -22.472 21.625  18.702  1.00 30.00  ? 418 MET A CA  1 
ATOM   2739 C C   . MET A 1 425 ? -22.812 22.946  18.020  1.00 30.00  ? 418 MET A C   1 
ATOM   2740 O O   . MET A 1 425 ? -23.879 23.081  17.404  1.00 30.00  ? 418 MET A O   1 
ATOM   2741 C CB  . MET A 1 425 ? -22.411 20.537  17.651  1.00 20.00  ? 418 MET A CB  1 
ATOM   2742 C CG  . MET A 1 425 ? -21.672 20.942  16.366  1.00 20.00  ? 418 MET A CG  1 
ATOM   2743 S SD  . MET A 1 425 ? -19.858 21.040  16.648  1.00 20.00  ? 418 MET A SD  1 
ATOM   2744 C CE  . MET A 1 425 ? -19.336 21.286  14.917  1.00 20.00  ? 418 MET A CE  1 
ATOM   2745 N N   . PRO A 1 426 ? -21.954 23.937  18.220  1.00 35.60  ? 419 PRO A N   1 
ATOM   2746 C CA  . PRO A 1 426 ? -22.141 25.267  17.637  1.00 31.42  ? 419 PRO A CA  1 
ATOM   2747 C C   . PRO A 1 426 ? -21.702 25.304  16.184  1.00 35.98  ? 419 PRO A C   1 
ATOM   2748 O O   . PRO A 1 426 ? -20.978 24.415  15.740  1.00 37.75  ? 419 PRO A O   1 
ATOM   2749 C CB  . PRO A 1 426 ? -21.236 26.157  18.494  1.00 33.83  ? 419 PRO A CB  1 
ATOM   2750 C CG  . PRO A 1 426 ? -20.233 25.234  19.079  1.00 35.53  ? 419 PRO A CG  1 
ATOM   2751 C CD  . PRO A 1 426 ? -20.951 23.943  19.296  1.00 34.91  ? 419 PRO A CD  1 
ATOM   2752 N N   . ILE A 1 427 ? -22.127 26.325  15.453  1.00 23.82  ? 420 ILE A N   1 
ATOM   2753 C CA  . ILE A 1 427 ? -21.691 26.477  14.081  1.00 25.24  ? 420 ILE A CA  1 
ATOM   2754 C C   . ILE A 1 427 ? -20.186 26.635  14.170  1.00 36.64  ? 420 ILE A C   1 
ATOM   2755 O O   . ILE A 1 427 ? -19.684 27.284  15.086  1.00 30.91  ? 420 ILE A O   1 
ATOM   2756 C CB  . ILE A 1 427 ? -22.292 27.734  13.437  1.00 22.75  ? 420 ILE A CB  1 
ATOM   2757 C CG1 . ILE A 1 427 ? -23.743 27.482  13.026  1.00 19.88  ? 420 ILE A CG1 1 
ATOM   2758 C CG2 . ILE A 1 427 ? -21.457 28.177  12.248  1.00 9.81   ? 420 ILE A CG2 1 
ATOM   2759 C CD1 . ILE A 1 427 ? -24.430 28.692  12.448  1.00 13.74  ? 420 ILE A CD1 1 
ATOM   2760 N N   . MET A 1 428 ? -19.456 26.043  13.232  1.00 42.75  ? 421 MET A N   1 
ATOM   2761 C CA  . MET A 1 428 ? -18.006 26.089  13.314  1.00 47.05  ? 421 MET A CA  1 
ATOM   2762 C C   . MET A 1 428 ? -17.482 27.402  12.770  1.00 47.68  ? 421 MET A C   1 
ATOM   2763 O O   . MET A 1 428 ? -16.847 27.464  11.718  1.00 33.42  ? 421 MET A O   1 
ATOM   2764 C CB  . MET A 1 428 ? -17.371 24.907  12.584  1.00 62.65  ? 421 MET A CB  1 
ATOM   2765 C CG  . MET A 1 428 ? -17.329 23.637  13.416  1.00 83.34  ? 421 MET A CG  1 
ATOM   2766 S SD  . MET A 1 428 ? -16.621 23.913  15.054  1.00 129.16 ? 421 MET A SD  1 
ATOM   2767 C CE  . MET A 1 428 ? -15.005 24.556  14.624  1.00 38.99  ? 421 MET A CE  1 
ATOM   2768 N N   . GLN A 1 429 ? -17.763 28.450  13.533  1.00 54.02  ? 422 GLN A N   1 
ATOM   2769 C CA  . GLN A 1 429 ? -17.285 29.793  13.259  1.00 34.65  ? 422 GLN A CA  1 
ATOM   2770 C C   . GLN A 1 429 ? -17.958 30.504  12.084  1.00 28.20  ? 422 GLN A C   1 
ATOM   2771 O O   . GLN A 1 429 ? -18.509 31.587  12.262  1.00 41.59  ? 422 GLN A O   1 
ATOM   2772 C CB  . GLN A 1 429 ? -15.760 29.794  13.138  1.00 20.26  ? 422 GLN A CB  1 
ATOM   2773 C CG  . GLN A 1 429 ? -15.100 28.827  14.115  1.00 19.97  ? 422 GLN A CG  1 
ATOM   2774 C CD  . GLN A 1 429 ? -13.963 29.450  14.900  1.00 32.34  ? 422 GLN A CD  1 
ATOM   2775 O OE1 . GLN A 1 429 ? -13.000 28.775  15.259  1.00 30.57  ? 422 GLN A OE1 1 
ATOM   2776 N NE2 . GLN A 1 429 ? -14.076 30.740  15.185  1.00 35.08  ? 422 GLN A NE2 1 
ATOM   2777 N N   . TRP A 1 430 ? -17.918 29.919  10.891  1.00 20.97  ? 423 TRP A N   1 
ATOM   2778 C CA  . TRP A 1 430 ? -18.506 30.596  9.734   1.00 21.16  ? 423 TRP A CA  1 
ATOM   2779 C C   . TRP A 1 430 ? -19.594 29.839  8.977   1.00 22.76  ? 423 TRP A C   1 
ATOM   2780 O O   . TRP A 1 430 ? -19.403 28.700  8.557   1.00 28.77  ? 423 TRP A O   1 
ATOM   2781 C CB  . TRP A 1 430 ? -17.407 31.021  8.757   1.00 21.86  ? 423 TRP A CB  1 
ATOM   2782 C CG  . TRP A 1 430 ? -16.457 32.016  9.332   1.00 24.07  ? 423 TRP A CG  1 
ATOM   2783 C CD1 . TRP A 1 430 ? -15.233 31.763  9.869   1.00 11.36  ? 423 TRP A CD1 1 
ATOM   2784 C CD2 . TRP A 1 430 ? -16.657 33.429  9.436   1.00 27.16  ? 423 TRP A CD2 1 
ATOM   2785 N NE1 . TRP A 1 430 ? -14.654 32.929  10.297  1.00 15.59  ? 423 TRP A NE1 1 
ATOM   2786 C CE2 . TRP A 1 430 ? -15.509 33.968  10.043  1.00 16.18  ? 423 TRP A CE2 1 
ATOM   2787 C CE3 . TRP A 1 430 ? -17.695 34.291  9.074   1.00 26.17  ? 423 TRP A CE3 1 
ATOM   2788 C CZ2 . TRP A 1 430 ? -15.368 35.328  10.295  1.00 14.47  ? 423 TRP A CZ2 1 
ATOM   2789 C CZ3 . TRP A 1 430 ? -17.554 35.639  9.324   1.00 6.18   ? 423 TRP A CZ3 1 
ATOM   2790 C CH2 . TRP A 1 430 ? -16.400 36.145  9.929   1.00 15.38  ? 423 TRP A CH2 1 
ATOM   2791 N N   . LEU A 1 431 ? -20.735 30.498  8.798   1.00 29.68  ? 424 LEU A N   1 
ATOM   2792 C CA  . LEU A 1 431 ? -21.819 29.982  7.975   1.00 28.18  ? 424 LEU A CA  1 
ATOM   2793 C C   . LEU A 1 431 ? -22.279 31.060  6.997   1.00 30.30  ? 424 LEU A C   1 
ATOM   2794 O O   . LEU A 1 431 ? -22.589 32.175  7.408   1.00 16.57  ? 424 LEU A O   1 
ATOM   2795 C CB  . LEU A 1 431 ? -22.993 29.531  8.843   1.00 32.10  ? 424 LEU A CB  1 
ATOM   2796 C CG  . LEU A 1 431 ? -24.259 29.099  8.098   1.00 33.32  ? 424 LEU A CG  1 
ATOM   2797 C CD1 . LEU A 1 431 ? -24.020 27.815  7.323   1.00 28.12  ? 424 LEU A CD1 1 
ATOM   2798 C CD2 . LEU A 1 431 ? -25.426 28.937  9.055   1.00 26.64  ? 424 LEU A CD2 1 
ATOM   2799 N N   . TYR A 1 432 ? -22.346 30.728  5.712   1.00 32.93  ? 425 TYR A N   1 
ATOM   2800 C CA  . TYR A 1 432 ? -22.835 31.679  4.721   1.00 28.29  ? 425 TYR A CA  1 
ATOM   2801 C C   . TYR A 1 432 ? -24.084 31.187  4.026   1.00 43.28  ? 425 TYR A C   1 
ATOM   2802 O O   . TYR A 1 432 ? -24.259 29.990  3.823   1.00 59.08  ? 425 TYR A O   1 
ATOM   2803 C CB  . TYR A 1 432 ? -21.749 31.987  3.720   1.00 19.60  ? 425 TYR A CB  1 
ATOM   2804 C CG  . TYR A 1 432 ? -20.718 32.900  4.301   1.00 21.09  ? 425 TYR A CG  1 
ATOM   2805 C CD1 . TYR A 1 432 ? -19.607 32.397  4.959   1.00 16.64  ? 425 TYR A CD1 1 
ATOM   2806 C CD2 . TYR A 1 432 ? -20.871 34.271  4.223   1.00 19.91  ? 425 TYR A CD2 1 
ATOM   2807 C CE1 . TYR A 1 432 ? -18.666 33.238  5.496   1.00 17.86  ? 425 TYR A CE1 1 
ATOM   2808 C CE2 . TYR A 1 432 ? -19.936 35.119  4.760   1.00 21.26  ? 425 TYR A CE2 1 
ATOM   2809 C CZ  . TYR A 1 432 ? -18.836 34.602  5.391   1.00 19.20  ? 425 TYR A CZ  1 
ATOM   2810 O OH  . TYR A 1 432 ? -17.910 35.460  5.925   1.00 24.87  ? 425 TYR A OH  1 
ATOM   2811 N N   . PHE A 1 433 ? -24.956 32.115  3.663   1.00 45.91  ? 426 PHE A N   1 
ATOM   2812 C CA  . PHE A 1 433 ? -26.270 31.748  3.148   1.00 43.92  ? 426 PHE A CA  1 
ATOM   2813 C C   . PHE A 1 433 ? -26.646 32.599  1.932   1.00 37.88  ? 426 PHE A C   1 
ATOM   2814 O O   . PHE A 1 433 ? -26.400 33.808  1.906   1.00 40.22  ? 426 PHE A O   1 
ATOM   2815 C CB  . PHE A 1 433 ? -27.324 31.856  4.281   1.00 49.82  ? 426 PHE A CB  1 
ATOM   2816 C CG  . PHE A 1 433 ? -28.762 31.780  3.815   1.00 64.72  ? 426 PHE A CG  1 
ATOM   2817 C CD1 . PHE A 1 433 ? -29.370 30.548  3.560   1.00 72.42  ? 426 PHE A CD1 1 
ATOM   2818 C CD2 . PHE A 1 433 ? -29.521 32.946  3.653   1.00 73.11  ? 426 PHE A CD2 1 
ATOM   2819 C CE1 . PHE A 1 433 ? -30.708 30.479  3.132   1.00 75.72  ? 426 PHE A CE1 1 
ATOM   2820 C CE2 . PHE A 1 433 ? -30.861 32.892  3.225   1.00 72.79  ? 426 PHE A CE2 1 
ATOM   2821 C CZ  . PHE A 1 433 ? -31.455 31.656  2.968   1.00 74.06  ? 426 PHE A CZ  1 
ATOM   2822 N N   . ASP A 1 434 ? -27.218 31.945  0.921   1.00 39.52  ? 427 ASP A N   1 
ATOM   2823 C CA  . ASP A 1 434 ? -27.888 32.617  -0.182  1.00 45.80  ? 427 ASP A CA  1 
ATOM   2824 C C   . ASP A 1 434 ? -29.360 32.280  -0.051  1.00 56.55  ? 427 ASP A C   1 
ATOM   2825 O O   . ASP A 1 434 ? -29.711 31.113  0.115   1.00 65.32  ? 427 ASP A O   1 
ATOM   2826 C CB  . ASP A 1 434 ? -27.365 32.083  -1.519  1.00 56.29  ? 427 ASP A CB  1 
ATOM   2827 C CG  . ASP A 1 434 ? -27.908 32.849  -2.732  1.00 68.30  ? 427 ASP A CG  1 
ATOM   2828 O OD1 . ASP A 1 434 ? -28.964 33.522  -2.630  1.00 65.19  ? 427 ASP A OD1 1 
ATOM   2829 O OD2 . ASP A 1 434 ? -27.263 32.769  -3.804  1.00 73.72  ? 427 ASP A OD2 1 
ATOM   2830 N N   . ALA A 1 435 ? -30.219 33.293  -0.136  1.00 62.25  ? 428 ALA A N   1 
ATOM   2831 C CA  . ALA A 1 435 ? -31.667 33.078  -0.087  1.00 58.61  ? 428 ALA A CA  1 
ATOM   2832 C C   . ALA A 1 435 ? -32.254 32.633  -1.422  1.00 66.08  ? 428 ALA A C   1 
ATOM   2833 O O   . ALA A 1 435 ? -32.983 31.648  -1.485  1.00 72.30  ? 428 ALA A O   1 
ATOM   2834 C CB  . ALA A 1 435 ? -32.358 34.320  0.388   1.00 54.53  ? 428 ALA A CB  1 
ATOM   2835 N N   . LEU A 1 436 ? -31.939 33.369  -2.484  1.00 77.03  ? 429 LEU A N   1 
ATOM   2836 C CA  . LEU A 1 436 ? -32.395 33.016  -3.831  1.00 91.73  ? 429 LEU A CA  1 
ATOM   2837 C C   . LEU A 1 436 ? -31.249 32.525  -4.730  1.00 97.51  ? 429 LEU A C   1 
ATOM   2838 O O   . LEU A 1 436 ? -30.877 33.199  -5.696  1.00 92.29  ? 429 LEU A O   1 
ATOM   2839 C CB  . LEU A 1 436 ? -33.126 34.200  -4.493  1.00 92.64  ? 429 LEU A CB  1 
ATOM   2840 C CG  . LEU A 1 436 ? -34.640 34.350  -4.271  1.00 84.45  ? 429 LEU A CG  1 
ATOM   2841 C CD1 . LEU A 1 436 ? -35.222 35.516  -5.063  1.00 64.20  ? 429 LEU A CD1 1 
ATOM   2842 C CD2 . LEU A 1 436 ? -35.365 33.064  -4.630  1.00 91.78  ? 429 LEU A CD2 1 
ATOM   2843 N N   . GLU A 1 437 ? -30.708 31.345  -4.420  1.00 108.45 ? 430 GLU A N   1 
ATOM   2844 C CA  . GLU A 1 437 ? -29.545 30.809  -5.143  1.00 109.44 ? 430 GLU A CA  1 
ATOM   2845 C C   . GLU A 1 437 ? -29.884 30.331  -6.562  1.00 111.31 ? 430 GLU A C   1 
ATOM   2846 O O   . GLU A 1 437 ? -29.746 31.079  -7.539  1.00 104.83 ? 430 GLU A O   1 
ATOM   2847 C CB  . GLU A 1 437 ? -28.830 29.701  -4.336  1.00 94.89  ? 430 GLU A CB  1 
ATOM   2848 C CG  . GLU A 1 437 ? -29.557 28.356  -4.246  1.00 89.94  ? 430 GLU A CG  1 
ATOM   2849 C CD  . GLU A 1 437 ? -30.553 28.275  -3.089  1.00 95.54  ? 430 GLU A CD  1 
ATOM   2850 O OE1 . GLU A 1 437 ? -30.411 27.363  -2.243  1.00 91.62  ? 430 GLU A OE1 1 
ATOM   2851 O OE2 . GLU A 1 437 ? -31.486 29.107  -3.030  1.00 97.59  ? 430 GLU A OE2 1 
ATOM   2852 N N   . GLU B 1 59  ? -38.231 48.107  -16.491 1.00 96.01  ? 52  GLU B N   1 
ATOM   2853 C CA  . GLU B 1 59  ? -37.025 47.343  -16.829 1.00 98.09  ? 52  GLU B CA  1 
ATOM   2854 C C   . GLU B 1 59  ? -36.063 47.170  -15.638 1.00 92.02  ? 52  GLU B C   1 
ATOM   2855 O O   . GLU B 1 59  ? -34.880 47.537  -15.698 1.00 78.01  ? 52  GLU B O   1 
ATOM   2856 C CB  . GLU B 1 59  ? -36.301 47.959  -18.031 1.00 97.19  ? 52  GLU B CB  1 
ATOM   2857 C CG  . GLU B 1 59  ? -35.904 49.415  -17.833 1.00 97.42  ? 52  GLU B CG  1 
ATOM   2858 C CD  . GLU B 1 59  ? -34.430 49.643  -18.083 1.00 98.84  ? 52  GLU B CD  1 
ATOM   2859 O OE1 . GLU B 1 59  ? -33.832 50.509  -17.408 1.00 105.46 ? 52  GLU B OE1 1 
ATOM   2860 O OE2 . GLU B 1 59  ? -33.875 48.955  -18.961 1.00 95.08  ? 52  GLU B OE2 1 
ATOM   2861 N N   . GLY B 1 60  ? -36.591 46.612  -14.552 1.00 87.76  ? 53  GLY B N   1 
ATOM   2862 C CA  . GLY B 1 60  ? -35.763 46.191  -13.443 1.00 66.08  ? 53  GLY B CA  1 
ATOM   2863 C C   . GLY B 1 60  ? -34.836 45.086  -13.916 1.00 57.26  ? 53  GLY B C   1 
ATOM   2864 O O   . GLY B 1 60  ? -35.279 44.057  -14.420 1.00 49.09  ? 53  GLY B O   1 
ATOM   2865 N N   . LEU B 1 61  ? -33.538 45.302  -13.771 1.00 55.05  ? 54  LEU B N   1 
ATOM   2866 C CA  . LEU B 1 61  ? -32.582 44.243  -14.044 1.00 61.18  ? 54  LEU B CA  1 
ATOM   2867 C C   . LEU B 1 61  ? -32.812 43.064  -13.052 1.00 44.21  ? 54  LEU B C   1 
ATOM   2868 O O   . LEU B 1 61  ? -33.505 43.213  -12.051 1.00 49.90  ? 54  LEU B O   1 
ATOM   2869 C CB  . LEU B 1 61  ? -31.142 44.797  -13.984 1.00 77.35  ? 54  LEU B CB  1 
ATOM   2870 C CG  . LEU B 1 61  ? -30.638 46.100  -14.667 1.00 103.65 ? 54  LEU B CG  1 
ATOM   2871 C CD1 . LEU B 1 61  ? -30.974 46.240  -16.185 1.00 33.78  ? 54  LEU B CD1 1 
ATOM   2872 C CD2 . LEU B 1 61  ? -31.046 47.357  -13.883 1.00 97.79  ? 54  LEU B CD2 1 
ATOM   2873 N N   . TYR B 1 62  ? -32.231 41.902  -13.323 1.00 35.52  ? 55  TYR B N   1 
ATOM   2874 C CA  . TYR B 1 62  ? -32.534 40.665  -12.580 1.00 27.45  ? 55  TYR B CA  1 
ATOM   2875 C C   . TYR B 1 62  ? -32.365 40.640  -11.047 1.00 33.11  ? 55  TYR B C   1 
ATOM   2876 O O   . TYR B 1 62  ? -33.180 40.061  -10.327 1.00 28.58  ? 55  TYR B O   1 
ATOM   2877 C CB  . TYR B 1 62  ? -31.728 39.519  -13.188 1.00 39.76  ? 55  TYR B CB  1 
ATOM   2878 C CG  . TYR B 1 62  ? -31.853 38.184  -12.503 1.00 45.77  ? 55  TYR B CG  1 
ATOM   2879 C CD1 . TYR B 1 62  ? -33.095 37.638  -12.218 1.00 53.42  ? 55  TYR B CD1 1 
ATOM   2880 C CD2 . TYR B 1 62  ? -30.722 37.446  -12.192 1.00 51.86  ? 55  TYR B CD2 1 
ATOM   2881 C CE1 . TYR B 1 62  ? -33.207 36.406  -11.602 1.00 77.60  ? 55  TYR B CE1 1 
ATOM   2882 C CE2 . TYR B 1 62  ? -30.817 36.214  -11.584 1.00 76.30  ? 55  TYR B CE2 1 
ATOM   2883 C CZ  . TYR B 1 62  ? -32.062 35.691  -11.283 1.00 97.95  ? 55  TYR B CZ  1 
ATOM   2884 O OH  . TYR B 1 62  ? -32.157 34.452  -10.666 1.00 120.35 ? 55  TYR B OH  1 
ATOM   2885 N N   . SER B 1 63  ? -31.289 41.215  -10.537 1.00 45.32  ? 56  SER B N   1 
ATOM   2886 C CA  . SER B 1 63  ? -31.055 41.122  -9.106  1.00 30.03  ? 56  SER B CA  1 
ATOM   2887 C C   . SER B 1 63  ? -31.890 42.161  -8.350  1.00 29.37  ? 56  SER B C   1 
ATOM   2888 O O   . SER B 1 63  ? -32.346 41.909  -7.244  1.00 30.06  ? 56  SER B O   1 
ATOM   2889 C CB  . SER B 1 63  ? -29.561 41.174  -8.817  1.00 26.85  ? 56  SER B CB  1 
ATOM   2890 O OG  . SER B 1 63  ? -28.928 39.989  -9.343  1.00 19.81  ? 56  SER B OG  1 
ATOM   2891 N N   . ARG B 1 64  ? -32.130 43.309  -8.977  1.00 35.27  ? 57  ARG B N   1 
ATOM   2892 C CA  . ARG B 1 64  ? -33.175 44.238  -8.543  1.00 25.48  ? 57  ARG B CA  1 
ATOM   2893 C C   . ARG B 1 64  ? -34.549 43.568  -8.433  1.00 32.52  ? 57  ARG B C   1 
ATOM   2894 O O   . ARG B 1 64  ? -35.338 43.910  -7.556  1.00 14.68  ? 57  ARG B O   1 
ATOM   2895 C CB  . ARG B 1 64  ? -33.306 45.371  -9.550  1.00 20.54  ? 57  ARG B CB  1 
ATOM   2896 C CG  . ARG B 1 64  ? -32.362 46.516  -9.353  1.00 41.34  ? 57  ARG B CG  1 
ATOM   2897 C CD  . ARG B 1 64  ? -33.154 47.746  -8.937  1.00 53.91  ? 57  ARG B CD  1 
ATOM   2898 N NE  . ARG B 1 64  ? -34.587 47.601  -9.191  1.00 57.99  ? 57  ARG B NE  1 
ATOM   2899 C CZ  . ARG B 1 64  ? -35.523 48.311  -8.572  1.00 73.52  ? 57  ARG B CZ  1 
ATOM   2900 N NH1 . ARG B 1 64  ? -35.175 49.216  -7.665  1.00 83.49  ? 57  ARG B NH1 1 
ATOM   2901 N NH2 . ARG B 1 64  ? -36.803 48.116  -8.854  1.00 77.32  ? 57  ARG B NH2 1 
ATOM   2902 N N   . GLN B 1 65  ? -34.841 42.652  -9.360  1.00 36.84  ? 58  GLN B N   1 
ATOM   2903 C CA  . GLN B 1 65  ? -36.098 41.901  -9.355  1.00 36.85  ? 58  GLN B CA  1 
ATOM   2904 C C   . GLN B 1 65  ? -36.183 40.968  -8.127  1.00 34.50  ? 58  GLN B C   1 
ATOM   2905 O O   . GLN B 1 65  ? -37.220 40.923  -7.478  1.00 30.19  ? 58  GLN B O   1 
ATOM   2906 C CB  . GLN B 1 65  ? -36.329 41.141  -10.694 1.00 13.70  ? 58  GLN B CB  1 
ATOM   2907 C CG  . GLN B 1 65  ? -37.126 41.952  -11.794 1.00 11.63  ? 58  GLN B CG  1 
ATOM   2908 C CD  . GLN B 1 65  ? -36.827 41.543  -13.268 1.00 47.90  ? 58  GLN B CD  1 
ATOM   2909 O OE1 . GLN B 1 65  ? -35.727 41.090  -13.580 1.00 62.97  ? 58  GLN B OE1 1 
ATOM   2910 N NE2 . GLN B 1 65  ? -37.808 41.729  -14.171 1.00 29.35  ? 58  GLN B NE2 1 
ATOM   2911 N N   . LEU B 1 66  ? -35.071 40.335  -7.772  1.00 30.00  ? 59  LEU B N   1 
ATOM   2912 C CA  . LEU B 1 66  ? -35.025 39.484  -6.592  1.00 30.00  ? 59  LEU B CA  1 
ATOM   2913 C C   . LEU B 1 66  ? -35.325 40.307  -5.340  1.00 30.00  ? 59  LEU B C   1 
ATOM   2914 O O   . LEU B 1 66  ? -36.032 39.848  -4.446  1.00 30.00  ? 59  LEU B O   1 
ATOM   2915 C CB  . LEU B 1 66  ? -33.650 38.826  -6.463  1.00 20.00  ? 59  LEU B CB  1 
ATOM   2916 C CG  . LEU B 1 66  ? -33.214 37.860  -7.566  1.00 20.00  ? 59  LEU B CG  1 
ATOM   2917 C CD1 . LEU B 1 66  ? -31.749 37.496  -7.408  1.00 20.00  ? 59  LEU B CD1 1 
ATOM   2918 C CD2 . LEU B 1 66  ? -34.075 36.611  -7.553  1.00 20.00  ? 59  LEU B CD2 1 
ATOM   2919 N N   . TYR B 1 67  ? -34.785 41.521  -5.277  1.00 29.08  ? 60  TYR B N   1 
ATOM   2920 C CA  . TYR B 1 67  ? -35.036 42.410  -4.147  1.00 13.85  ? 60  TYR B CA  1 
ATOM   2921 C C   . TYR B 1 67  ? -36.510 42.792  -4.040  1.00 23.53  ? 60  TYR B C   1 
ATOM   2922 O O   . TYR B 1 67  ? -37.069 42.836  -2.947  1.00 23.29  ? 60  TYR B O   1 
ATOM   2923 C CB  . TYR B 1 67  ? -34.190 43.683  -4.253  1.00 38.35  ? 60  TYR B CB  1 
ATOM   2924 C CG  . TYR B 1 67  ? -32.884 43.516  -4.996  1.00 42.03  ? 60  TYR B CG  1 
ATOM   2925 C CD1 . TYR B 1 67  ? -32.111 42.376  -4.836  1.00 55.16  ? 60  TYR B CD1 1 
ATOM   2926 C CD2 . TYR B 1 67  ? -32.414 44.509  -5.843  1.00 41.28  ? 60  TYR B CD2 1 
ATOM   2927 C CE1 . TYR B 1 67  ? -30.912 42.223  -5.510  1.00 83.39  ? 60  TYR B CE1 1 
ATOM   2928 C CE2 . TYR B 1 67  ? -31.219 44.366  -6.524  1.00 81.06  ? 60  TYR B CE2 1 
ATOM   2929 C CZ  . TYR B 1 67  ? -30.470 43.222  -6.354  1.00 104.58 ? 60  TYR B CZ  1 
ATOM   2930 O OH  . TYR B 1 67  ? -29.277 43.077  -7.028  1.00 124.90 ? 60  TYR B OH  1 
ATOM   2931 N N   . VAL B 1 68  ? -37.133 43.070  -5.181  1.00 30.94  ? 61  VAL B N   1 
ATOM   2932 C CA  . VAL B 1 68  ? -38.538 43.466  -5.217  1.00 24.12  ? 61  VAL B CA  1 
ATOM   2933 C C   . VAL B 1 68  ? -39.448 42.356  -4.701  1.00 31.99  ? 61  VAL B C   1 
ATOM   2934 O O   . VAL B 1 68  ? -40.409 42.614  -3.981  1.00 27.92  ? 61  VAL B O   1 
ATOM   2935 C CB  . VAL B 1 68  ? -38.973 43.882  -6.633  1.00 28.25  ? 61  VAL B CB  1 
ATOM   2936 C CG1 . VAL B 1 68  ? -40.476 44.087  -6.686  1.00 48.23  ? 61  VAL B CG1 1 
ATOM   2937 C CG2 . VAL B 1 68  ? -38.249 45.148  -7.055  1.00 23.88  ? 61  VAL B CG2 1 
ATOM   2938 N N   . LEU B 1 69  ? -39.133 41.122  -5.075  1.00 22.01  ? 62  LEU B N   1 
ATOM   2939 C CA  . LEU B 1 69  ? -39.876 39.958  -4.614  1.00 32.61  ? 62  LEU B CA  1 
ATOM   2940 C C   . LEU B 1 69  ? -39.731 39.857  -3.103  1.00 37.10  ? 62  LEU B C   1 
ATOM   2941 O O   . LEU B 1 69  ? -40.668 39.502  -2.391  1.00 36.10  ? 62  LEU B O   1 
ATOM   2942 C CB  . LEU B 1 69  ? -39.343 38.689  -5.276  1.00 42.62  ? 62  LEU B CB  1 
ATOM   2943 C CG  . LEU B 1 69  ? -39.886 37.368  -4.731  1.00 56.01  ? 62  LEU B CG  1 
ATOM   2944 C CD1 . LEU B 1 69  ? -41.358 37.215  -5.067  1.00 47.67  ? 62  LEU B CD1 1 
ATOM   2945 C CD2 . LEU B 1 69  ? -39.083 36.196  -5.266  1.00 62.40  ? 62  LEU B CD2 1 
ATOM   2946 N N   . GLY B 1 70  ? -38.534 40.181  -2.633  1.00 33.57  ? 63  GLY B N   1 
ATOM   2947 C CA  . GLY B 1 70  ? -38.180 40.131  -1.229  1.00 13.08  ? 63  GLY B CA  1 
ATOM   2948 C C   . GLY B 1 70  ? -38.972 41.090  -0.365  1.00 27.14  ? 63  GLY B C   1 
ATOM   2949 O O   . GLY B 1 70  ? -39.086 40.886  0.842   1.00 34.60  ? 63  GLY B O   1 
ATOM   2950 N N   . HIS B 1 71  ? -39.512 42.144  -0.968  1.00 15.21  ? 64  HIS B N   1 
ATOM   2951 C CA  . HIS B 1 71  ? -40.211 43.163  -0.197  1.00 10.84  ? 64  HIS B CA  1 
ATOM   2952 C C   . HIS B 1 71  ? -39.353 44.408  -0.014  1.00 19.77  ? 64  HIS B C   1 
ATOM   2953 O O   . HIS B 1 71  ? -39.649 45.260  0.821   1.00 22.88  ? 64  HIS B O   1 
ATOM   2954 C CB  . HIS B 1 71  ? -40.650 42.612  1.163   1.00 55.95  ? 64  HIS B CB  1 
ATOM   2955 C CG  . HIS B 1 71  ? -39.685 42.890  2.275   1.00 68.51  ? 64  HIS B CG  1 
ATOM   2956 N ND1 . HIS B 1 71  ? -39.731 44.043  3.029   1.00 75.65  ? 64  HIS B ND1 1 
ATOM   2957 C CD2 . HIS B 1 71  ? -38.659 42.159  2.769   1.00 54.64  ? 64  HIS B CD2 1 
ATOM   2958 C CE1 . HIS B 1 71  ? -38.771 44.013  3.935   1.00 64.57  ? 64  HIS B CE1 1 
ATOM   2959 N NE2 . HIS B 1 71  ? -38.106 42.881  3.799   1.00 58.26  ? 64  HIS B NE2 1 
ATOM   2960 N N   . GLU B 1 72  ? -38.289 44.506  -0.804  1.00 24.80  ? 65  GLU B N   1 
ATOM   2961 C CA  . GLU B 1 72  ? -37.359 45.621  -0.703  1.00 32.23  ? 65  GLU B CA  1 
ATOM   2962 C C   . GLU B 1 72  ? -38.097 46.934  -0.927  1.00 41.42  ? 65  GLU B C   1 
ATOM   2963 O O   . GLU B 1 72  ? -37.869 47.905  -0.207  1.00 61.10  ? 65  GLU B O   1 
ATOM   2964 C CB  . GLU B 1 72  ? -36.251 45.456  -1.745  1.00 24.87  ? 65  GLU B CB  1 
ATOM   2965 C CG  . GLU B 1 72  ? -35.815 46.743  -2.426  1.00 29.93  ? 65  GLU B CG  1 
ATOM   2966 C CD  . GLU B 1 72  ? -34.743 47.483  -1.660  1.00 28.04  ? 65  GLU B CD  1 
ATOM   2967 O OE1 . GLU B 1 72  ? -34.093 48.365  -2.256  1.00 31.80  ? 65  GLU B OE1 1 
ATOM   2968 O OE2 . GLU B 1 72  ? -34.548 47.184  -0.466  1.00 36.95  ? 65  GLU B OE2 1 
ATOM   2969 N N   . ALA B 1 73  ? -38.996 46.967  -1.903  1.00 26.22  ? 66  ALA B N   1 
ATOM   2970 C CA  . ALA B 1 73  ? -39.846 48.135  -2.083  1.00 42.75  ? 66  ALA B CA  1 
ATOM   2971 C C   . ALA B 1 73  ? -41.299 47.704  -1.924  1.00 51.02  ? 66  ALA B C   1 
ATOM   2972 O O   . ALA B 1 73  ? -41.791 46.870  -2.682  1.00 52.07  ? 66  ALA B O   1 
ATOM   2973 C CB  . ALA B 1 73  ? -39.617 48.755  -3.446  1.00 41.08  ? 66  ALA B CB  1 
ATOM   2974 N N   . MET B 1 74  ? -41.986 48.274  -0.939  1.00 60.94  ? 67  MET B N   1 
ATOM   2975 C CA  . MET B 1 74  ? -43.384 47.936  -0.693  1.00 72.52  ? 67  MET B CA  1 
ATOM   2976 C C   . MET B 1 74  ? -44.331 48.943  -1.332  1.00 71.37  ? 67  MET B C   1 
ATOM   2977 O O   . MET B 1 74  ? -45.549 48.785  -1.287  1.00 69.07  ? 67  MET B O   1 
ATOM   2978 C CB  . MET B 1 74  ? -43.648 47.833  0.810   1.00 89.67  ? 67  MET B CB  1 
ATOM   2979 C CG  . MET B 1 74  ? -43.253 49.070  1.592   1.00 96.22  ? 67  MET B CG  1 
ATOM   2980 S SD  . MET B 1 74  ? -42.868 48.696  3.310   1.00 147.37 ? 67  MET B SD  1 
ATOM   2981 C CE  . MET B 1 74  ? -41.500 47.562  3.101   1.00 41.82  ? 67  MET B CE  1 
ATOM   2982 N N   . LYS B 1 75  ? -43.755 49.976  -1.931  1.00 76.02  ? 68  LYS B N   1 
ATOM   2983 C CA  . LYS B 1 75  ? -44.525 51.032  -2.570  1.00 73.32  ? 68  LYS B CA  1 
ATOM   2984 C C   . LYS B 1 75  ? -45.182 50.563  -3.861  1.00 77.36  ? 68  LYS B C   1 
ATOM   2985 O O   . LYS B 1 75  ? -46.307 50.950  -4.175  1.00 79.75  ? 68  LYS B O   1 
ATOM   2986 C CB  . LYS B 1 75  ? -43.635 52.244  -2.855  1.00 74.60  ? 68  LYS B CB  1 
ATOM   2987 C CG  . LYS B 1 75  ? -42.656 52.038  -3.997  1.00 66.61  ? 68  LYS B CG  1 
ATOM   2988 C CD  . LYS B 1 75  ? -41.733 53.234  -4.161  1.00 65.54  ? 68  LYS B CD  1 
ATOM   2989 C CE  . LYS B 1 75  ? -40.840 53.413  -2.945  1.00 64.99  ? 68  LYS B CE  1 
ATOM   2990 N NZ  . LYS B 1 75  ? -39.843 54.502  -3.138  1.00 55.52  ? 68  LYS B NZ  1 
ATOM   2991 N N   . ARG B 1 76  ? -44.459 49.745  -4.617  1.00 78.81  ? 69  ARG B N   1 
ATOM   2992 C CA  . ARG B 1 76  ? -44.904 49.323  -5.939  1.00 70.08  ? 69  ARG B CA  1 
ATOM   2993 C C   . ARG B 1 76  ? -46.109 48.390  -5.801  1.00 67.32  ? 69  ARG B C   1 
ATOM   2994 O O   . ARG B 1 76  ? -46.353 47.848  -4.725  1.00 71.67  ? 69  ARG B O   1 
ATOM   2995 C CB  . ARG B 1 76  ? -43.771 48.614  -6.656  1.00 62.53  ? 69  ARG B CB  1 
ATOM   2996 C CG  . ARG B 1 76  ? -43.163 47.505  -5.830  1.00 64.61  ? 69  ARG B CG  1 
ATOM   2997 C CD  . ARG B 1 76  ? -42.089 46.779  -6.594  1.00 65.78  ? 69  ARG B CD  1 
ATOM   2998 N NE  . ARG B 1 76  ? -41.330 47.705  -7.420  1.00 73.05  ? 69  ARG B NE  1 
ATOM   2999 C CZ  . ARG B 1 76  ? -40.997 47.482  -8.685  1.00 74.53  ? 69  ARG B CZ  1 
ATOM   3000 N NH1 . ARG B 1 76  ? -41.338 46.346  -9.277  1.00 72.90  ? 69  ARG B NH1 1 
ATOM   3001 N NH2 . ARG B 1 76  ? -40.313 48.398  -9.355  1.00 79.71  ? 69  ARG B NH2 1 
ATOM   3002 N N   . LEU B 1 77  ? -46.850 48.192  -6.888  1.00 65.96  ? 70  LEU B N   1 
ATOM   3003 C CA  . LEU B 1 77  ? -48.145 47.521  -6.808  1.00 75.16  ? 70  LEU B CA  1 
ATOM   3004 C C   . LEU B 1 77  ? -48.071 46.054  -6.390  1.00 67.84  ? 70  LEU B C   1 
ATOM   3005 O O   . LEU B 1 77  ? -47.142 45.335  -6.757  1.00 63.29  ? 70  LEU B O   1 
ATOM   3006 C CB  . LEU B 1 77  ? -48.947 47.699  -8.104  1.00 91.72  ? 70  LEU B CB  1 
ATOM   3007 C CG  . LEU B 1 77  ? -49.570 49.098  -8.240  1.00 106.64 ? 70  LEU B CG  1 
ATOM   3008 C CD1 . LEU B 1 77  ? -50.498 49.201  -9.455  1.00 108.58 ? 70  LEU B CD1 1 
ATOM   3009 C CD2 . LEU B 1 77  ? -50.297 49.515  -6.948  1.00 105.93 ? 70  LEU B CD2 1 
ATOM   3010 N N   . GLN B 1 78  ? -49.068 45.640  -5.609  1.00 64.14  ? 71  GLN B N   1 
ATOM   3011 C CA  . GLN B 1 78  ? -49.143 44.305  -5.013  1.00 50.14  ? 71  GLN B CA  1 
ATOM   3012 C C   . GLN B 1 78  ? -50.418 43.595  -5.444  1.00 48.98  ? 71  GLN B C   1 
ATOM   3013 O O   . GLN B 1 78  ? -51.516 44.155  -5.370  1.00 58.10  ? 71  GLN B O   1 
ATOM   3014 C CB  . GLN B 1 78  ? -49.129 44.418  -3.494  1.00 41.86  ? 71  GLN B CB  1 
ATOM   3015 C CG  . GLN B 1 78  ? -48.002 45.259  -2.971  1.00 34.74  ? 71  GLN B CG  1 
ATOM   3016 C CD  . GLN B 1 78  ? -46.686 44.617  -3.271  1.00 37.78  ? 71  GLN B CD  1 
ATOM   3017 O OE1 . GLN B 1 78  ? -46.599 43.387  -3.381  1.00 35.66  ? 71  GLN B OE1 1 
ATOM   3018 N NE2 . GLN B 1 78  ? -45.643 45.435  -3.418  1.00 43.44  ? 71  GLN B NE2 1 
ATOM   3019 N N   . THR B 1 79  ? -50.271 42.345  -5.859  1.00 34.68  ? 72  THR B N   1 
ATOM   3020 C CA  . THR B 1 79  ? -51.337 41.651  -6.566  1.00 35.63  ? 72  THR B CA  1 
ATOM   3021 C C   . THR B 1 79  ? -51.969 40.521  -5.773  1.00 33.69  ? 72  THR B C   1 
ATOM   3022 O O   . THR B 1 79  ? -53.149 40.228  -5.946  1.00 45.70  ? 72  THR B O   1 
ATOM   3023 C CB  . THR B 1 79  ? -50.806 41.063  -7.887  1.00 54.77  ? 72  THR B CB  1 
ATOM   3024 O OG1 . THR B 1 79  ? -49.810 40.059  -7.612  1.00 57.95  ? 72  THR B OG1 1 
ATOM   3025 C CG2 . THR B 1 79  ? -50.182 42.166  -8.726  1.00 60.58  ? 72  THR B CG2 1 
ATOM   3026 N N   . SER B 1 80  ? -51.186 39.877  -4.912  1.00 32.93  ? 73  SER B N   1 
ATOM   3027 C CA  . SER B 1 80  ? -51.643 38.676  -4.212  1.00 36.18  ? 73  SER B CA  1 
ATOM   3028 C C   . SER B 1 80  ? -52.104 38.920  -2.757  1.00 31.32  ? 73  SER B C   1 
ATOM   3029 O O   . SER B 1 80  ? -51.387 39.528  -1.967  1.00 34.70  ? 73  SER B O   1 
ATOM   3030 C CB  . SER B 1 80  ? -50.530 37.630  -4.234  1.00 42.44  ? 73  SER B CB  1 
ATOM   3031 O OG  . SER B 1 80  ? -50.016 37.464  -5.543  1.00 52.31  ? 73  SER B OG  1 
ATOM   3032 N N   . SER B 1 81  ? -53.297 38.443  -2.412  1.00 21.43  ? 74  SER B N   1 
ATOM   3033 C CA  . SER B 1 81  ? -53.714 38.438  -1.021  1.00 26.56  ? 74  SER B CA  1 
ATOM   3034 C C   . SER B 1 81  ? -53.455 37.064  -0.407  1.00 28.19  ? 74  SER B C   1 
ATOM   3035 O O   . SER B 1 81  ? -53.586 36.034  -1.077  1.00 31.38  ? 74  SER B O   1 
ATOM   3036 C CB  . SER B 1 81  ? -55.178 38.851  -0.871  1.00 26.47  ? 74  SER B CB  1 
ATOM   3037 O OG  . SER B 1 81  ? -56.017 37.726  -0.703  1.00 41.92  ? 74  SER B OG  1 
ATOM   3038 N N   . VAL B 1 82  ? -53.081 37.061  0.871   1.00 18.59  ? 75  VAL B N   1 
ATOM   3039 C CA  . VAL B 1 82  ? -52.634 35.844  1.542   1.00 17.95  ? 75  VAL B CA  1 
ATOM   3040 C C   . VAL B 1 82  ? -53.512 35.470  2.762   1.00 29.57  ? 75  VAL B C   1 
ATOM   3041 O O   . VAL B 1 82  ? -53.973 36.331  3.511   1.00 26.69  ? 75  VAL B O   1 
ATOM   3042 C CB  . VAL B 1 82  ? -51.135 35.960  1.972   1.00 16.19  ? 75  VAL B CB  1 
ATOM   3043 C CG1 . VAL B 1 82  ? -50.637 34.662  2.562   1.00 7.67   ? 75  VAL B CG1 1 
ATOM   3044 C CG2 . VAL B 1 82  ? -50.242 36.389  0.803   1.00 17.33  ? 75  VAL B CG2 1 
ATOM   3045 N N   . LEU B 1 83  ? -53.758 34.177  2.928   1.00 24.94  ? 76  LEU B N   1 
ATOM   3046 C CA  . LEU B 1 83  ? -54.347 33.646  4.137   1.00 24.19  ? 76  LEU B CA  1 
ATOM   3047 C C   . LEU B 1 83  ? -53.240 32.996  4.958   1.00 21.82  ? 76  LEU B C   1 
ATOM   3048 O O   . LEU B 1 83  ? -52.555 32.106  4.461   1.00 26.13  ? 76  LEU B O   1 
ATOM   3049 C CB  . LEU B 1 83  ? -55.363 32.564  3.776   1.00 30.55  ? 76  LEU B CB  1 
ATOM   3050 C CG  . LEU B 1 83  ? -56.579 32.272  4.674   1.00 29.01  ? 76  LEU B CG  1 
ATOM   3051 C CD1 . LEU B 1 83  ? -56.857 30.776  4.710   1.00 24.13  ? 76  LEU B CD1 1 
ATOM   3052 C CD2 . LEU B 1 83  ? -56.449 32.847  6.072   1.00 28.97  ? 76  LEU B CD2 1 
ATOM   3053 N N   . VAL B 1 84  ? -53.053 33.434  6.202   1.00 13.99  ? 77  VAL B N   1 
ATOM   3054 C CA  . VAL B 1 84  ? -52.238 32.672  7.154   1.00 15.57  ? 77  VAL B CA  1 
ATOM   3055 C C   . VAL B 1 84  ? -53.185 32.041  8.162   1.00 17.44  ? 77  VAL B C   1 
ATOM   3056 O O   . VAL B 1 84  ? -53.874 32.746  8.888   1.00 16.62  ? 77  VAL B O   1 
ATOM   3057 C CB  . VAL B 1 84  ? -51.202 33.550  7.904   1.00 19.88  ? 77  VAL B CB  1 
ATOM   3058 C CG1 . VAL B 1 84  ? -50.455 32.723  8.920   1.00 11.48  ? 77  VAL B CG1 1 
ATOM   3059 C CG2 . VAL B 1 84  ? -50.221 34.192  6.937   1.00 14.81  ? 77  VAL B CG2 1 
ATOM   3060 N N   . SER B 1 85  ? -53.269 30.718  8.183   1.00 18.63  ? 78  SER B N   1 
ATOM   3061 C CA  . SER B 1 85  ? -54.157 30.071  9.138   1.00 14.52  ? 78  SER B CA  1 
ATOM   3062 C C   . SER B 1 85  ? -53.350 29.459  10.267  1.00 15.43  ? 78  SER B C   1 
ATOM   3063 O O   . SER B 1 85  ? -52.301 28.874  10.034  1.00 21.72  ? 78  SER B O   1 
ATOM   3064 C CB  . SER B 1 85  ? -54.996 28.991  8.463   1.00 25.01  ? 78  SER B CB  1 
ATOM   3065 O OG  . SER B 1 85  ? -55.431 28.032  9.424   1.00 26.36  ? 78  SER B OG  1 
ATOM   3066 N N   . GLY B 1 86  ? -53.851 29.574  11.489  1.00 19.78  ? 79  GLY B N   1 
ATOM   3067 C CA  . GLY B 1 86  ? -53.103 29.140  12.653  1.00 17.84  ? 79  GLY B CA  1 
ATOM   3068 C C   . GLY B 1 86  ? -52.209 30.249  13.175  1.00 23.71  ? 79  GLY B C   1 
ATOM   3069 O O   . GLY B 1 86  ? -51.180 30.572  12.574  1.00 30.02  ? 79  GLY B O   1 
ATOM   3070 N N   . LEU B 1 87  ? -52.613 30.828  14.302  1.00 17.45  ? 80  LEU B N   1 
ATOM   3071 C CA  . LEU B 1 87  ? -51.969 32.004  14.887  1.00 10.28  ? 80  LEU B CA  1 
ATOM   3072 C C   . LEU B 1 87  ? -51.041 31.717  16.062  1.00 16.35  ? 80  LEU B C   1 
ATOM   3073 O O   . LEU B 1 87  ? -50.768 32.589  16.882  1.00 18.44  ? 80  LEU B O   1 
ATOM   3074 C CB  . LEU B 1 87  ? -52.989 33.086  15.240  1.00 9.83   ? 80  LEU B CB  1 
ATOM   3075 C CG  . LEU B 1 87  ? -53.073 34.209  14.204  1.00 23.31  ? 80  LEU B CG  1 
ATOM   3076 C CD1 . LEU B 1 87  ? -53.193 33.643  12.800  1.00 18.78  ? 80  LEU B CD1 1 
ATOM   3077 C CD2 . LEU B 1 87  ? -54.234 35.140  14.509  1.00 29.94  ? 80  LEU B CD2 1 
ATOM   3078 N N   . ARG B 1 88  ? -50.564 30.483  16.130  1.00 23.23  ? 81  ARG B N   1 
ATOM   3079 C CA  . ARG B 1 88  ? -49.613 30.076  17.148  1.00 21.92  ? 81  ARG B CA  1 
ATOM   3080 C C   . ARG B 1 88  ? -48.304 30.719  16.723  1.00 23.38  ? 81  ARG B C   1 
ATOM   3081 O O   . ARG B 1 88  ? -48.274 31.442  15.732  1.00 24.44  ? 81  ARG B O   1 
ATOM   3082 C CB  . ARG B 1 88  ? -49.500 28.555  17.231  1.00 14.09  ? 81  ARG B CB  1 
ATOM   3083 C CG  . ARG B 1 88  ? -50.822 27.871  17.545  1.00 24.91  ? 81  ARG B CG  1 
ATOM   3084 C CD  . ARG B 1 88  ? -50.638 26.459  18.075  1.00 9.35   ? 81  ARG B CD  1 
ATOM   3085 N NE  . ARG B 1 88  ? -50.151 26.446  19.450  1.00 38.24  ? 81  ARG B NE  1 
ATOM   3086 C CZ  . ARG B 1 88  ? -49.009 25.886  19.836  1.00 47.51  ? 81  ARG B CZ  1 
ATOM   3087 N NH1 . ARG B 1 88  ? -48.235 25.277  18.952  1.00 41.79  ? 81  ARG B NH1 1 
ATOM   3088 N NH2 . ARG B 1 88  ? -48.648 25.926  21.110  1.00 47.53  ? 81  ARG B NH2 1 
ATOM   3089 N N   . GLY B 1 89  ? -47.234 30.514  17.477  1.00 25.30  ? 82  GLY B N   1 
ATOM   3090 C CA  . GLY B 1 89  ? -46.019 31.270  17.246  1.00 20.71  ? 82  GLY B CA  1 
ATOM   3091 C C   . GLY B 1 89  ? -45.455 31.157  15.843  1.00 24.01  ? 82  GLY B C   1 
ATOM   3092 O O   . GLY B 1 89  ? -44.980 32.150  15.298  1.00 12.09  ? 82  GLY B O   1 
ATOM   3093 N N   . LEU B 1 90  ? -45.500 29.975  15.244  1.00 21.56  ? 83  LEU B N   1 
ATOM   3094 C CA  . LEU B 1 90  ? -45.011 29.838  13.878  1.00 25.77  ? 83  LEU B CA  1 
ATOM   3095 C C   . LEU B 1 90  ? -45.827 30.687  12.900  1.00 22.77  ? 83  LEU B C   1 
ATOM   3096 O O   . LEU B 1 90  ? -45.270 31.334  12.016  1.00 18.98  ? 83  LEU B O   1 
ATOM   3097 C CB  . LEU B 1 90  ? -45.038 28.372  13.445  1.00 30.20  ? 83  LEU B CB  1 
ATOM   3098 C CG  . LEU B 1 90  ? -44.645 28.086  11.996  1.00 23.19  ? 83  LEU B CG  1 
ATOM   3099 C CD1 . LEU B 1 90  ? -43.301 28.709  11.676  1.00 19.00  ? 83  LEU B CD1 1 
ATOM   3100 C CD2 . LEU B 1 90  ? -44.614 26.593  11.742  1.00 14.56  ? 83  LEU B CD2 1 
ATOM   3101 N N   . GLY B 1 91  ? -47.147 30.677  13.064  1.00 27.38  ? 84  GLY B N   1 
ATOM   3102 C CA  . GLY B 1 91  ? -48.044 31.448  12.219  1.00 16.10  ? 84  GLY B CA  1 
ATOM   3103 C C   . GLY B 1 91  ? -47.912 32.957  12.309  1.00 19.26  ? 84  GLY B C   1 
ATOM   3104 O O   . GLY B 1 91  ? -47.969 33.660  11.303  1.00 31.35  ? 84  GLY B O   1 
ATOM   3105 N N   . VAL B 1 92  ? -47.742 33.452  13.528  1.00 20.17  ? 85  VAL B N   1 
ATOM   3106 C CA  . VAL B 1 92  ? -47.624 34.883  13.799  1.00 24.33  ? 85  VAL B CA  1 
ATOM   3107 C C   . VAL B 1 92  ? -46.284 35.352  13.267  1.00 17.87  ? 85  VAL B C   1 
ATOM   3108 O O   . VAL B 1 92  ? -46.134 36.501  12.879  1.00 23.80  ? 85  VAL B O   1 
ATOM   3109 C CB  . VAL B 1 92  ? -47.768 35.244  15.321  1.00 17.04  ? 85  VAL B CB  1 
ATOM   3110 C CG1 . VAL B 1 92  ? -46.646 34.648  16.138  1.00 12.27  ? 85  VAL B CG1 1 
ATOM   3111 C CG2 . VAL B 1 92  ? -47.783 36.750  15.517  1.00 10.87  ? 85  VAL B CG2 1 
ATOM   3112 N N   . GLU B 1 93  ? -45.311 34.449  13.237  1.00 28.76  ? 86  GLU B N   1 
ATOM   3113 C CA  . GLU B 1 93  ? -43.977 34.785  12.753  1.00 36.27  ? 86  GLU B CA  1 
ATOM   3114 C C   . GLU B 1 93  ? -44.025 35.008  11.262  1.00 36.80  ? 86  GLU B C   1 
ATOM   3115 O O   . GLU B 1 93  ? -43.510 36.004  10.752  1.00 39.78  ? 86  GLU B O   1 
ATOM   3116 C CB  . GLU B 1 93  ? -43.003 33.654  13.050  1.00 38.33  ? 86  GLU B CB  1 
ATOM   3117 C CG  . GLU B 1 93  ? -42.552 33.592  14.489  1.00 26.37  ? 86  GLU B CG  1 
ATOM   3118 C CD  . GLU B 1 93  ? -41.575 34.694  14.840  1.00 33.84  ? 86  GLU B CD  1 
ATOM   3119 O OE1 . GLU B 1 93  ? -41.059 35.360  13.913  1.00 38.99  ? 86  GLU B OE1 1 
ATOM   3120 O OE2 . GLU B 1 93  ? -41.317 34.890  16.048  1.00 41.27  ? 86  GLU B OE2 1 
ATOM   3121 N N   . ILE B 1 94  ? -44.653 34.062  10.571  1.00 21.12  ? 87  ILE B N   1 
ATOM   3122 C CA  . ILE B 1 94  ? -44.823 34.137  9.135   1.00 12.78  ? 87  ILE B CA  1 
ATOM   3123 C C   . ILE B 1 94  ? -45.617 35.383  8.781   1.00 27.90  ? 87  ILE B C   1 
ATOM   3124 O O   . ILE B 1 94  ? -45.283 36.096  7.834   1.00 33.46  ? 87  ILE B O   1 
ATOM   3125 C CB  . ILE B 1 94  ? -45.588 32.922  8.611   1.00 15.64  ? 87  ILE B CB  1 
ATOM   3126 C CG1 . ILE B 1 94  ? -44.730 31.662  8.699   1.00 22.14  ? 87  ILE B CG1 1 
ATOM   3127 C CG2 . ILE B 1 94  ? -46.020 33.140  7.171   1.00 18.82  ? 87  ILE B CG2 1 
ATOM   3128 C CD1 . ILE B 1 94  ? -45.491 30.382  8.327   1.00 21.01  ? 87  ILE B CD1 1 
ATOM   3129 N N   . ALA B 1 95  ? -46.668 35.644  9.552   1.00 26.30  ? 88  ALA B N   1 
ATOM   3130 C CA  . ALA B 1 95  ? -47.551 36.769  9.277   1.00 26.18  ? 88  ALA B CA  1 
ATOM   3131 C C   . ALA B 1 95  ? -46.799 38.081  9.391   1.00 25.07  ? 88  ALA B C   1 
ATOM   3132 O O   . ALA B 1 95  ? -46.908 38.959  8.539   1.00 27.23  ? 88  ALA B O   1 
ATOM   3133 C CB  . ALA B 1 95  ? -48.726 36.759  10.223  1.00 14.30  ? 88  ALA B CB  1 
ATOM   3134 N N   . LYS B 1 96  ? -46.019 38.191  10.451  1.00 20.83  ? 89  LYS B N   1 
ATOM   3135 C CA  . LYS B 1 96  ? -45.308 39.415  10.752  1.00 21.19  ? 89  LYS B CA  1 
ATOM   3136 C C   . LYS B 1 96  ? -44.297 39.676  9.646   1.00 23.32  ? 89  LYS B C   1 
ATOM   3137 O O   . LYS B 1 96  ? -44.144 40.814  9.200   1.00 24.29  ? 89  LYS B O   1 
ATOM   3138 C CB  . LYS B 1 96  ? -44.659 39.314  12.140  1.00 19.44  ? 89  LYS B CB  1 
ATOM   3139 C CG  . LYS B 1 96  ? -43.711 40.432  12.469  1.00 20.20  ? 89  LYS B CG  1 
ATOM   3140 C CD  . LYS B 1 96  ? -42.262 39.996  12.316  1.00 14.38  ? 89  LYS B CD  1 
ATOM   3141 C CE  . LYS B 1 96  ? -42.012 38.690  13.033  1.00 13.83  ? 89  LYS B CE  1 
ATOM   3142 N NZ  . LYS B 1 96  ? -40.645 38.150  12.706  1.00 23.35  ? 89  LYS B NZ  1 
ATOM   3143 N N   . ASN B 1 97  ? -43.643 38.611  9.182   1.00 25.68  ? 90  ASN B N   1 
ATOM   3144 C CA  . ASN B 1 97  ? -42.650 38.706  8.108   1.00 18.17  ? 90  ASN B CA  1 
ATOM   3145 C C   . ASN B 1 97  ? -43.254 39.123  6.782   1.00 19.24  ? 90  ASN B C   1 
ATOM   3146 O O   . ASN B 1 97  ? -42.648 39.868  6.013   1.00 17.54  ? 90  ASN B O   1 
ATOM   3147 C CB  . ASN B 1 97  ? -41.925 37.374  7.930   1.00 16.16  ? 90  ASN B CB  1 
ATOM   3148 C CG  . ASN B 1 97  ? -41.033 37.031  9.112   1.00 17.95  ? 90  ASN B CG  1 
ATOM   3149 O OD1 . ASN B 1 97  ? -40.570 37.915  9.824   1.00 24.42  ? 90  ASN B OD1 1 
ATOM   3150 N ND2 . ASN B 1 97  ? -40.786 35.740  9.320   1.00 16.52  ? 90  ASN B ND2 1 
ATOM   3151 N N   . ILE B 1 98  ? -44.461 38.633  6.532   1.00 25.05  ? 91  ILE B N   1 
ATOM   3152 C CA  . ILE B 1 98  ? -45.170 38.802  5.262   1.00 11.12  ? 91  ILE B CA  1 
ATOM   3153 C C   . ILE B 1 98  ? -45.761 40.210  5.204   1.00 20.49  ? 91  ILE B C   1 
ATOM   3154 O O   . ILE B 1 98  ? -45.879 40.821  4.142   1.00 23.33  ? 91  ILE B O   1 
ATOM   3155 C CB  . ILE B 1 98  ? -46.227 37.641  5.120   1.00 16.65  ? 91  ILE B CB  1 
ATOM   3156 C CG1 . ILE B 1 98  ? -45.865 36.769  3.957   1.00 23.49  ? 91  ILE B CG1 1 
ATOM   3157 C CG2 . ILE B 1 98  ? -47.661 38.086  4.988   1.00 12.73  ? 91  ILE B CG2 1 
ATOM   3158 C CD1 . ILE B 1 98  ? -44.494 36.315  4.033   1.00 29.14  ? 91  ILE B CD1 1 
ATOM   3159 N N   . ILE B 1 99  ? -46.097 40.737  6.372   1.00 16.55  ? 92  ILE B N   1 
ATOM   3160 C CA  . ILE B 1 99  ? -46.644 42.076  6.461   1.00 20.33  ? 92  ILE B CA  1 
ATOM   3161 C C   . ILE B 1 99  ? -45.529 43.121  6.337   1.00 20.68  ? 92  ILE B C   1 
ATOM   3162 O O   . ILE B 1 99  ? -45.675 44.091  5.611   1.00 20.73  ? 92  ILE B O   1 
ATOM   3163 C CB  . ILE B 1 99  ? -47.470 42.242  7.759   1.00 15.41  ? 92  ILE B CB  1 
ATOM   3164 C CG1 . ILE B 1 99  ? -48.696 41.333  7.703   1.00 17.22  ? 92  ILE B CG1 1 
ATOM   3165 C CG2 . ILE B 1 99  ? -47.851 43.707  8.007   1.00 10.03  ? 92  ILE B CG2 1 
ATOM   3166 C CD1 . ILE B 1 99  ? -49.565 41.440  8.922   1.00 22.96  ? 92  ILE B CD1 1 
ATOM   3167 N N   . LEU B 1 100 ? -44.411 42.922  7.030   1.00 26.94  ? 93  LEU B N   1 
ATOM   3168 C CA  . LEU B 1 100 ? -43.248 43.795  6.841   1.00 29.46  ? 93  LEU B CA  1 
ATOM   3169 C C   . LEU B 1 100 ? -42.825 43.727  5.386   1.00 28.89  ? 93  LEU B C   1 
ATOM   3170 O O   . LEU B 1 100 ? -42.324 44.697  4.825   1.00 20.65  ? 93  LEU B O   1 
ATOM   3171 C CB  . LEU B 1 100 ? -42.081 43.352  7.712   1.00 24.12  ? 93  LEU B CB  1 
ATOM   3172 C CG  . LEU B 1 100 ? -42.258 43.616  9.198   1.00 29.59  ? 93  LEU B CG  1 
ATOM   3173 C CD1 . LEU B 1 100 ? -41.238 42.810  10.021  1.00 14.49  ? 93  LEU B CD1 1 
ATOM   3174 C CD2 . LEU B 1 100 ? -42.135 45.115  9.434   1.00 29.32  ? 93  LEU B CD2 1 
ATOM   3175 N N   . GLY B 1 101 ? -43.050 42.561  4.785   1.00 23.16  ? 94  GLY B N   1 
ATOM   3176 C CA  . GLY B 1 101 ? -42.731 42.318  3.399   1.00 11.41  ? 94  GLY B CA  1 
ATOM   3177 C C   . GLY B 1 101 ? -43.606 43.042  2.399   1.00 22.93  ? 94  GLY B C   1 
ATOM   3178 O O   . GLY B 1 101 ? -43.224 43.298  1.263   1.00 21.78  ? 94  GLY B O   1 
ATOM   3179 N N   . GLY B 1 102 ? -44.814 43.366  2.817   1.00 27.75  ? 95  GLY B N   1 
ATOM   3180 C CA  . GLY B 1 102 ? -45.621 44.261  2.028   1.00 24.92  ? 95  GLY B CA  1 
ATOM   3181 C C   . GLY B 1 102 ? -46.425 43.601  0.935   1.00 30.55  ? 95  GLY B C   1 
ATOM   3182 O O   . GLY B 1 102 ? -46.620 44.197  -0.120  1.00 31.62  ? 95  GLY B O   1 
ATOM   3183 N N   . VAL B 1 103 ? -46.908 42.388  1.187   1.00 29.53  ? 96  VAL B N   1 
ATOM   3184 C CA  . VAL B 1 103 ? -47.925 41.795  0.330   1.00 23.04  ? 96  VAL B CA  1 
ATOM   3185 C C   . VAL B 1 103 ? -49.197 42.640  0.321   1.00 22.14  ? 96  VAL B C   1 
ATOM   3186 O O   . VAL B 1 103 ? -49.400 43.498  1.171   1.00 29.34  ? 96  VAL B O   1 
ATOM   3187 C CB  . VAL B 1 103 ? -48.310 40.399  0.779   1.00 21.84  ? 96  VAL B CB  1 
ATOM   3188 C CG1 . VAL B 1 103 ? -47.108 39.481  0.741   1.00 16.05  ? 96  VAL B CG1 1 
ATOM   3189 C CG2 . VAL B 1 103 ? -48.920 40.460  2.154   1.00 17.67  ? 96  VAL B CG2 1 
ATOM   3190 N N   . LYS B 1 104 ? -50.046 42.383  -0.664  1.00 24.33  ? 97  LYS B N   1 
ATOM   3191 C CA  . LYS B 1 104 ? -51.240 43.178  -0.889  1.00 24.49  ? 97  LYS B CA  1 
ATOM   3192 C C   . LYS B 1 104 ? -52.193 43.185  0.299   1.00 22.98  ? 97  LYS B C   1 
ATOM   3193 O O   . LYS B 1 104 ? -52.733 44.223  0.653   1.00 28.53  ? 97  LYS B O   1 
ATOM   3194 C CB  . LYS B 1 104 ? -51.975 42.641  -2.110  1.00 27.84  ? 97  LYS B CB  1 
ATOM   3195 C CG  . LYS B 1 104 ? -53.361 43.194  -2.282  1.00 30.60  ? 97  LYS B CG  1 
ATOM   3196 C CD  . LYS B 1 104 ? -53.978 42.596  -3.492  1.00 25.36  ? 97  LYS B CD  1 
ATOM   3197 C CE  . LYS B 1 104 ? -55.250 43.285  -3.866  1.00 17.74  ? 97  LYS B CE  1 
ATOM   3198 N NZ  . LYS B 1 104 ? -55.687 42.607  -5.116  1.00 25.61  ? 97  LYS B NZ  1 
ATOM   3199 N N   . ALA B 1 105 ? -52.412 42.017  0.890   1.00 12.83  ? 98  ALA B N   1 
ATOM   3200 C CA  . ALA B 1 105 ? -53.326 41.896  2.003   1.00 15.75  ? 98  ALA B CA  1 
ATOM   3201 C C   . ALA B 1 105 ? -53.133 40.596  2.730   1.00 19.82  ? 98  ALA B C   1 
ATOM   3202 O O   . ALA B 1 105 ? -52.940 39.544  2.124   1.00 23.58  ? 98  ALA B O   1 
ATOM   3203 C CB  . ALA B 1 105 ? -54.749 41.997  1.526   1.00 29.78  ? 98  ALA B CB  1 
ATOM   3204 N N   . VAL B 1 106 ? -53.209 40.671  4.048   1.00 17.11  ? 99  VAL B N   1 
ATOM   3205 C CA  . VAL B 1 106 ? -53.154 39.482  4.871   1.00 17.37  ? 99  VAL B CA  1 
ATOM   3206 C C   . VAL B 1 106 ? -54.475 39.268  5.612   1.00 23.06  ? 99  VAL B C   1 
ATOM   3207 O O   . VAL B 1 106 ? -55.058 40.206  6.159   1.00 30.12  ? 99  VAL B O   1 
ATOM   3208 C CB  . VAL B 1 106 ? -51.981 39.572  5.867   1.00 14.98  ? 99  VAL B CB  1 
ATOM   3209 C CG1 . VAL B 1 106 ? -51.946 38.345  6.820   1.00 3.14   ? 99  VAL B CG1 1 
ATOM   3210 C CG2 . VAL B 1 106 ? -50.680 39.744  5.100   1.00 6.07   ? 99  VAL B CG2 1 
ATOM   3211 N N   . THR B 1 107 ? -54.948 38.030  5.600   1.00 12.63  ? 100 THR B N   1 
ATOM   3212 C CA  . THR B 1 107 ? -56.061 37.616  6.441   1.00 19.75  ? 100 THR B CA  1 
ATOM   3213 C C   . THR B 1 107 ? -55.581 36.546  7.417   1.00 23.64  ? 100 THR B C   1 
ATOM   3214 O O   . THR B 1 107 ? -55.029 35.526  7.001   1.00 22.13  ? 100 THR B O   1 
ATOM   3215 C CB  . THR B 1 107 ? -57.243 37.032  5.607   1.00 20.78  ? 100 THR B CB  1 
ATOM   3216 O OG1 . THR B 1 107 ? -57.854 38.070  4.834   1.00 25.22  ? 100 THR B OG1 1 
ATOM   3217 C CG2 . THR B 1 107 ? -58.285 36.399  6.522   1.00 15.18  ? 100 THR B CG2 1 
ATOM   3218 N N   . LEU B 1 108 ? -55.801 36.773  8.710   1.00 25.76  ? 101 LEU B N   1 
ATOM   3219 C CA  . LEU B 1 108 ? -55.395 35.822  9.748   1.00 13.17  ? 101 LEU B CA  1 
ATOM   3220 C C   . LEU B 1 108 ? -56.545 34.899  10.124  1.00 18.70  ? 101 LEU B C   1 
ATOM   3221 O O   . LEU B 1 108 ? -57.633 35.356  10.504  1.00 31.01  ? 101 LEU B O   1 
ATOM   3222 C CB  . LEU B 1 108 ? -54.933 36.571  10.994  1.00 15.89  ? 101 LEU B CB  1 
ATOM   3223 C CG  . LEU B 1 108 ? -54.037 37.784  10.757  1.00 14.32  ? 101 LEU B CG  1 
ATOM   3224 C CD1 . LEU B 1 108 ? -53.989 38.602  12.016  1.00 13.08  ? 101 LEU B CD1 1 
ATOM   3225 C CD2 . LEU B 1 108 ? -52.653 37.324  10.369  1.00 10.84  ? 101 LEU B CD2 1 
ATOM   3226 N N   . HIS B 1 109 ? -56.315 33.597  10.027  1.00 17.50  ? 102 HIS B N   1 
ATOM   3227 C CA  . HIS B 1 109 ? -57.345 32.646  10.416  1.00 16.83  ? 102 HIS B CA  1 
ATOM   3228 C C   . HIS B 1 109 ? -56.929 31.827  11.633  1.00 23.88  ? 102 HIS B C   1 
ATOM   3229 O O   . HIS B 1 109 ? -55.823 31.301  11.712  1.00 26.41  ? 102 HIS B O   1 
ATOM   3230 C CB  . HIS B 1 109 ? -57.699 31.718  9.255   1.00 13.39  ? 102 HIS B CB  1 
ATOM   3231 C CG  . HIS B 1 109 ? -58.660 30.638  9.625   1.00 21.67  ? 102 HIS B CG  1 
ATOM   3232 N ND1 . HIS B 1 109 ? -58.293 29.307  9.705   1.00 13.03  ? 102 HIS B ND1 1 
ATOM   3233 C CD2 . HIS B 1 109 ? -59.977 30.678  9.945   1.00 19.61  ? 102 HIS B CD2 1 
ATOM   3234 C CE1 . HIS B 1 109 ? -59.341 28.583  10.040  1.00 16.24  ? 102 HIS B CE1 1 
ATOM   3235 N NE2 . HIS B 1 109 ? -60.380 29.393  10.202  1.00 21.21  ? 102 HIS B NE2 1 
ATOM   3236 N N   . ASP B 1 110 ? -57.818 31.739  12.598  1.00 26.08  ? 103 ASP B N   1 
ATOM   3237 C CA  . ASP B 1 110 ? -57.612 30.819  13.694  1.00 31.85  ? 103 ASP B CA  1 
ATOM   3238 C C   . ASP B 1 110 ? -58.976 30.607  14.289  1.00 34.25  ? 103 ASP B C   1 
ATOM   3239 O O   . ASP B 1 110 ? -59.700 31.578  14.555  1.00 31.98  ? 103 ASP B O   1 
ATOM   3240 C CB  . ASP B 1 110 ? -56.650 31.392  14.746  1.00 31.50  ? 103 ASP B CB  1 
ATOM   3241 C CG  . ASP B 1 110 ? -55.930 30.294  15.542  1.00 29.60  ? 103 ASP B CG  1 
ATOM   3242 O OD1 . ASP B 1 110 ? -54.728 30.435  15.868  1.00 35.10  ? 103 ASP B OD1 1 
ATOM   3243 O OD2 . ASP B 1 110 ? -56.570 29.276  15.840  1.00 17.52  ? 103 ASP B OD2 1 
ATOM   3244 N N   . GLN B 1 111 ? -59.344 29.341  14.459  1.00 30.62  ? 104 GLN B N   1 
ATOM   3245 C CA  . GLN B 1 111 ? -60.571 29.011  15.166  1.00 33.98  ? 104 GLN B CA  1 
ATOM   3246 C C   . GLN B 1 111 ? -60.306 28.779  16.662  1.00 43.74  ? 104 GLN B C   1 
ATOM   3247 O O   . GLN B 1 111 ? -61.235 28.760  17.465  1.00 55.13  ? 104 GLN B O   1 
ATOM   3248 C CB  . GLN B 1 111 ? -61.238 27.797  14.527  1.00 22.54  ? 104 GLN B CB  1 
ATOM   3249 C CG  . GLN B 1 111 ? -61.793 28.081  13.143  1.00 28.88  ? 104 GLN B CG  1 
ATOM   3250 C CD  . GLN B 1 111 ? -62.381 26.852  12.471  1.00 40.09  ? 104 GLN B CD  1 
ATOM   3251 O OE1 . GLN B 1 111 ? -61.668 26.072  11.825  1.00 41.54  ? 104 GLN B OE1 1 
ATOM   3252 N NE2 . GLN B 1 111 ? -63.694 26.684  12.605  1.00 37.10  ? 104 GLN B NE2 1 
ATOM   3253 N N   . GLY B 1 112 ? -59.033 28.637  17.029  1.00 30.25  ? 105 GLY B N   1 
ATOM   3254 C CA  . GLY B 1 112 ? -58.658 28.225  18.362  1.00 24.16  ? 105 GLY B CA  1 
ATOM   3255 C C   . GLY B 1 112 ? -58.313 29.334  19.338  1.00 34.59  ? 105 GLY B C   1 
ATOM   3256 O O   . GLY B 1 112 ? -57.900 30.437  18.948  1.00 24.67  ? 105 GLY B O   1 
ATOM   3257 N N   . THR B 1 113 ? -58.465 29.036  20.628  1.00 32.08  ? 106 THR B N   1 
ATOM   3258 C CA  . THR B 1 113 ? -58.224 30.049  21.656  1.00 27.26  ? 106 THR B CA  1 
ATOM   3259 C C   . THR B 1 113 ? -56.802 29.997  22.210  1.00 26.14  ? 106 THR B C   1 
ATOM   3260 O O   . THR B 1 113 ? -56.164 28.940  22.230  1.00 31.61  ? 106 THR B O   1 
ATOM   3261 C CB  . THR B 1 113 ? -59.257 29.960  22.790  1.00 30.40  ? 106 THR B CB  1 
ATOM   3262 O OG1 . THR B 1 113 ? -59.461 28.586  23.147  1.00 31.56  ? 106 THR B OG1 1 
ATOM   3263 C CG2 . THR B 1 113 ? -60.585 30.542  22.325  1.00 19.92  ? 106 THR B CG2 1 
ATOM   3264 N N   . ALA B 1 114 ? -56.302 31.146  22.644  1.00 24.12  ? 107 ALA B N   1 
ATOM   3265 C CA  . ALA B 1 114 ? -54.941 31.215  23.146  1.00 26.48  ? 107 ALA B CA  1 
ATOM   3266 C C   . ALA B 1 114 ? -54.781 30.305  24.373  1.00 30.88  ? 107 ALA B C   1 
ATOM   3267 O O   . ALA B 1 114 ? -55.513 30.428  25.356  1.00 24.12  ? 107 ALA B O   1 
ATOM   3268 C CB  . ALA B 1 114 ? -54.556 32.661  23.455  1.00 18.20  ? 107 ALA B CB  1 
ATOM   3269 N N   . GLN B 1 115 ? -53.838 29.371  24.287  1.00 32.25  ? 108 GLN B N   1 
ATOM   3270 C CA  . GLN B 1 115 ? -53.591 28.415  25.361  1.00 21.05  ? 108 GLN B CA  1 
ATOM   3271 C C   . GLN B 1 115 ? -52.350 28.773  26.135  1.00 33.71  ? 108 GLN B C   1 
ATOM   3272 O O   . GLN B 1 115 ? -51.611 29.673  25.743  1.00 37.50  ? 108 GLN B O   1 
ATOM   3273 C CB  . GLN B 1 115 ? -53.442 26.995  24.819  1.00 25.61  ? 108 GLN B CB  1 
ATOM   3274 C CG  . GLN B 1 115 ? -54.723 26.382  24.330  1.00 36.15  ? 108 GLN B CG  1 
ATOM   3275 C CD  . GLN B 1 115 ? -55.915 26.808  25.160  1.00 52.01  ? 108 GLN B CD  1 
ATOM   3276 O OE1 . GLN B 1 115 ? -55.872 26.809  26.398  1.00 56.11  ? 108 GLN B OE1 1 
ATOM   3277 N NE2 . GLN B 1 115 ? -56.990 27.185  24.479  1.00 54.69  ? 108 GLN B NE2 1 
ATOM   3278 N N   . TRP B 1 116 ? -52.122 28.067  27.240  1.00 48.90  ? 109 TRP B N   1 
ATOM   3279 C CA  . TRP B 1 116 ? -50.943 28.326  28.057  1.00 44.74  ? 109 TRP B CA  1 
ATOM   3280 C C   . TRP B 1 116 ? -49.674 28.056  27.243  1.00 38.94  ? 109 TRP B C   1 
ATOM   3281 O O   . TRP B 1 116 ? -48.743 28.861  27.224  1.00 31.09  ? 109 TRP B O   1 
ATOM   3282 C CB  . TRP B 1 116 ? -50.942 27.509  29.367  1.00 40.55  ? 109 TRP B CB  1 
ATOM   3283 C CG  . TRP B 1 116 ? -49.709 27.798  30.157  1.00 42.09  ? 109 TRP B CG  1 
ATOM   3284 C CD1 . TRP B 1 116 ? -48.531 27.074  30.169  1.00 38.41  ? 109 TRP B CD1 1 
ATOM   3285 C CD2 . TRP B 1 116 ? -49.481 28.940  30.990  1.00 38.87  ? 109 TRP B CD2 1 
ATOM   3286 N NE1 . TRP B 1 116 ? -47.604 27.696  30.973  1.00 30.77  ? 109 TRP B NE1 1 
ATOM   3287 C CE2 . TRP B 1 116 ? -48.161 28.839  31.485  1.00 35.36  ? 109 TRP B CE2 1 
ATOM   3288 C CE3 . TRP B 1 116 ? -50.269 30.033  31.365  1.00 48.85  ? 109 TRP B CE3 1 
ATOM   3289 C CZ2 . TRP B 1 116 ? -47.617 29.792  32.333  1.00 46.34  ? 109 TRP B CZ2 1 
ATOM   3290 C CZ3 . TRP B 1 116 ? -49.725 30.977  32.221  1.00 61.56  ? 109 TRP B CZ3 1 
ATOM   3291 C CH2 . TRP B 1 116 ? -48.413 30.848  32.698  1.00 61.67  ? 109 TRP B CH2 1 
ATOM   3292 N N   . ALA B 1 117 ? -49.662 26.935  26.536  1.00 39.26  ? 110 ALA B N   1 
ATOM   3293 C CA  . ALA B 1 117 ? -48.489 26.528  25.782  1.00 35.54  ? 110 ALA B CA  1 
ATOM   3294 C C   . ALA B 1 117 ? -48.207 27.406  24.549  1.00 40.48  ? 110 ALA B C   1 
ATOM   3295 O O   . ALA B 1 117 ? -47.134 27.312  23.930  1.00 48.46  ? 110 ALA B O   1 
ATOM   3296 C CB  . ALA B 1 117 ? -48.645 25.092  25.380  1.00 30.70  ? 110 ALA B CB  1 
ATOM   3297 N N   . ASP B 1 118 ? -49.167 28.256  24.190  1.00 28.55  ? 111 ASP B N   1 
ATOM   3298 C CA  . ASP B 1 118 ? -49.005 29.110  23.018  1.00 31.01  ? 111 ASP B CA  1 
ATOM   3299 C C   . ASP B 1 118 ? -48.118 30.300  23.343  1.00 33.36  ? 111 ASP B C   1 
ATOM   3300 O O   . ASP B 1 118 ? -47.511 30.883  22.462  1.00 44.33  ? 111 ASP B O   1 
ATOM   3301 C CB  . ASP B 1 118 ? -50.358 29.642  22.513  1.00 33.87  ? 111 ASP B CB  1 
ATOM   3302 C CG  . ASP B 1 118 ? -51.320 28.541  22.092  1.00 35.44  ? 111 ASP B CG  1 
ATOM   3303 O OD1 . ASP B 1 118 ? -50.908 27.373  21.960  1.00 43.22  ? 111 ASP B OD1 1 
ATOM   3304 O OD2 . ASP B 1 118 ? -52.507 28.853  21.888  1.00 29.75  ? 111 ASP B OD2 1 
ATOM   3305 N N   . LEU B 1 119 ? -48.050 30.652  24.617  1.00 33.20  ? 112 LEU B N   1 
ATOM   3306 C CA  . LEU B 1 119 ? -47.535 31.950  25.031  1.00 31.09  ? 112 LEU B CA  1 
ATOM   3307 C C   . LEU B 1 119 ? -46.023 32.174  24.861  1.00 39.58  ? 112 LEU B C   1 
ATOM   3308 O O   . LEU B 1 119 ? -45.591 33.311  24.619  1.00 31.22  ? 112 LEU B O   1 
ATOM   3309 C CB  . LEU B 1 119 ? -47.929 32.214  26.483  1.00 23.49  ? 112 LEU B CB  1 
ATOM   3310 C CG  . LEU B 1 119 ? -49.418 32.231  26.833  1.00 30.76  ? 112 LEU B CG  1 
ATOM   3311 C CD1 . LEU B 1 119 ? -49.625 32.783  28.250  1.00 31.35  ? 112 LEU B CD1 1 
ATOM   3312 C CD2 . LEU B 1 119 ? -50.218 33.038  25.832  1.00 20.21  ? 112 LEU B CD2 1 
ATOM   3313 N N   . SER B 1 120 ? -45.215 31.128  25.014  1.00 43.68  ? 113 SER B N   1 
ATOM   3314 C CA  . SER B 1 120 ? -43.764 31.307  24.944  1.00 31.92  ? 113 SER B CA  1 
ATOM   3315 C C   . SER B 1 120 ? -43.351 31.824  23.572  1.00 40.96  ? 113 SER B C   1 
ATOM   3316 O O   . SER B 1 120 ? -42.536 32.737  23.460  1.00 53.84  ? 113 SER B O   1 
ATOM   3317 C CB  . SER B 1 120 ? -43.043 29.999  25.267  1.00 24.01  ? 113 SER B CB  1 
ATOM   3318 O OG  . SER B 1 120 ? -43.554 28.928  24.496  1.00 40.08  ? 113 SER B OG  1 
ATOM   3319 N N   . SER B 1 121 ? -43.935 31.240  22.534  1.00 41.12  ? 114 SER B N   1 
ATOM   3320 C CA  . SER B 1 121 ? -43.796 31.722  21.171  1.00 19.62  ? 114 SER B CA  1 
ATOM   3321 C C   . SER B 1 121 ? -44.990 32.647  21.009  1.00 32.71  ? 114 SER B C   1 
ATOM   3322 O O   . SER B 1 121 ? -45.651 32.957  21.996  1.00 64.14  ? 114 SER B O   1 
ATOM   3323 C CB  . SER B 1 121 ? -43.844 30.569  20.175  1.00 34.15  ? 114 SER B CB  1 
ATOM   3324 O OG  . SER B 1 121 ? -43.293 30.955  18.928  1.00 58.96  ? 114 SER B OG  1 
ATOM   3325 N N   . GLN B 1 122 ? -45.294 33.095  19.797  1.00 32.54  ? 115 GLN B N   1 
ATOM   3326 C CA  . GLN B 1 122 ? -46.470 33.942  19.661  1.00 34.86  ? 115 GLN B CA  1 
ATOM   3327 C C   . GLN B 1 122 ? -46.337 35.122  20.614  1.00 28.10  ? 115 GLN B C   1 
ATOM   3328 O O   . GLN B 1 122 ? -47.063 35.232  21.599  1.00 24.62  ? 115 GLN B O   1 
ATOM   3329 C CB  . GLN B 1 122 ? -47.742 33.153  19.966  1.00 30.85  ? 115 GLN B CB  1 
ATOM   3330 C CG  . GLN B 1 122 ? -48.911 33.474  19.049  1.00 28.87  ? 115 GLN B CG  1 
ATOM   3331 C CD  . GLN B 1 122 ? -49.069 34.956  18.791  1.00 22.88  ? 115 GLN B CD  1 
ATOM   3332 O OE1 . GLN B 1 122 ? -48.228 35.759  19.186  1.00 14.91  ? 115 GLN B OE1 1 
ATOM   3333 N NE2 . GLN B 1 122 ? -50.152 35.327  18.123  1.00 19.02  ? 115 GLN B NE2 1 
ATOM   3334 N N   . PHE B 1 123 ? -45.380 35.990  20.313  1.00 15.35  ? 116 PHE B N   1 
ATOM   3335 C CA  . PHE B 1 123 ? -44.990 37.097  21.174  1.00 19.65  ? 116 PHE B CA  1 
ATOM   3336 C C   . PHE B 1 123 ? -46.139 38.042  21.513  1.00 28.61  ? 116 PHE B C   1 
ATOM   3337 O O   . PHE B 1 123 ? -46.185 38.586  22.615  1.00 28.62  ? 116 PHE B O   1 
ATOM   3338 C CB  . PHE B 1 123 ? -43.851 37.880  20.519  1.00 20.61  ? 116 PHE B CB  1 
ATOM   3339 C CG  . PHE B 1 123 ? -43.992 38.024  19.031  1.00 27.40  ? 116 PHE B CG  1 
ATOM   3340 C CD1 . PHE B 1 123 ? -44.500 39.184  18.478  1.00 31.05  ? 116 PHE B CD1 1 
ATOM   3341 C CD2 . PHE B 1 123 ? -43.620 36.995  18.186  1.00 39.39  ? 116 PHE B CD2 1 
ATOM   3342 C CE1 . PHE B 1 123 ? -44.632 39.316  17.111  1.00 34.11  ? 116 PHE B CE1 1 
ATOM   3343 C CE2 . PHE B 1 123 ? -43.750 37.122  16.817  1.00 38.49  ? 116 PHE B CE2 1 
ATOM   3344 C CZ  . PHE B 1 123 ? -44.258 38.284  16.280  1.00 32.09  ? 116 PHE B CZ  1 
ATOM   3345 N N   . TYR B 1 124 ? -47.054 38.258  20.579  1.00 26.20  ? 117 TYR B N   1 
ATOM   3346 C CA  . TYR B 1 124 ? -48.177 39.150  20.844  1.00 30.01  ? 117 TYR B CA  1 
ATOM   3347 C C   . TYR B 1 124 ? -49.055 38.673  22.008  1.00 30.35  ? 117 TYR B C   1 
ATOM   3348 O O   . TYR B 1 124 ? -49.522 39.485  22.803  1.00 35.36  ? 117 TYR B O   1 
ATOM   3349 C CB  . TYR B 1 124 ? -49.015 39.364  19.582  1.00 23.87  ? 117 TYR B CB  1 
ATOM   3350 C CG  . TYR B 1 124 ? -48.330 40.234  18.555  1.00 24.30  ? 117 TYR B CG  1 
ATOM   3351 C CD1 . TYR B 1 124 ? -48.152 39.798  17.252  1.00 16.17  ? 117 TYR B CD1 1 
ATOM   3352 C CD2 . TYR B 1 124 ? -47.845 41.487  18.898  1.00 23.03  ? 117 TYR B CD2 1 
ATOM   3353 C CE1 . TYR B 1 124 ? -47.522 40.592  16.317  1.00 23.04  ? 117 TYR B CE1 1 
ATOM   3354 C CE2 . TYR B 1 124 ? -47.213 42.285  17.971  1.00 16.35  ? 117 TYR B CE2 1 
ATOM   3355 C CZ  . TYR B 1 124 ? -47.054 41.834  16.684  1.00 26.07  ? 117 TYR B CZ  1 
ATOM   3356 O OH  . TYR B 1 124 ? -46.423 42.632  15.760  1.00 33.76  ? 117 TYR B OH  1 
ATOM   3357 N N   . LEU B 1 125 ? -49.285 37.367  22.105  1.00 23.75  ? 118 LEU B N   1 
ATOM   3358 C CA  . LEU B 1 125 ? -50.095 36.815  23.191  1.00 26.04  ? 118 LEU B CA  1 
ATOM   3359 C C   . LEU B 1 125 ? -49.443 36.921  24.579  1.00 36.69  ? 118 LEU B C   1 
ATOM   3360 O O   . LEU B 1 125 ? -48.250 36.671  24.735  1.00 41.00  ? 118 LEU B O   1 
ATOM   3361 C CB  . LEU B 1 125 ? -50.437 35.350  22.905  1.00 18.43  ? 118 LEU B CB  1 
ATOM   3362 C CG  . LEU B 1 125 ? -51.031 34.996  21.540  1.00 18.35  ? 118 LEU B CG  1 
ATOM   3363 C CD1 . LEU B 1 125 ? -51.242 33.497  21.432  1.00 19.30  ? 118 LEU B CD1 1 
ATOM   3364 C CD2 . LEU B 1 125 ? -52.332 35.738  21.296  1.00 11.08  ? 118 LEU B CD2 1 
ATOM   3365 N N   . ARG B 1 126 ? -50.249 37.265  25.581  1.00 33.49  ? 119 ARG B N   1 
ATOM   3366 C CA  . ARG B 1 126 ? -49.821 37.328  26.972  1.00 40.86  ? 119 ARG B CA  1 
ATOM   3367 C C   . ARG B 1 126 ? -50.771 36.502  27.821  1.00 40.55  ? 119 ARG B C   1 
ATOM   3368 O O   . ARG B 1 126 ? -51.600 35.759  27.289  1.00 27.86  ? 119 ARG B O   1 
ATOM   3369 C CB  . ARG B 1 126 ? -49.785 38.777  27.476  1.00 50.70  ? 119 ARG B CB  1 
ATOM   3370 C CG  . ARG B 1 126 ? -48.696 39.649  26.852  1.00 48.28  ? 119 ARG B CG  1 
ATOM   3371 C CD  . ARG B 1 126 ? -47.332 39.277  27.379  1.00 62.87  ? 119 ARG B CD  1 
ATOM   3372 N NE  . ARG B 1 126 ? -46.905 40.163  28.465  1.00 85.79  ? 119 ARG B NE  1 
ATOM   3373 C CZ  . ARG B 1 126 ? -46.657 39.784  29.721  1.00 85.57  ? 119 ARG B CZ  1 
ATOM   3374 N NH1 . ARG B 1 126 ? -46.788 38.512  30.093  1.00 87.10  ? 119 ARG B NH1 1 
ATOM   3375 N NH2 . ARG B 1 126 ? -46.269 40.691  30.608  1.00 75.25  ? 119 ARG B NH2 1 
ATOM   3376 N N   . GLU B 1 127 ? -50.660 36.636  29.140  1.00 48.76  ? 120 GLU B N   1 
ATOM   3377 C CA  . GLU B 1 127 ? -51.464 35.817  30.038  1.00 40.08  ? 120 GLU B CA  1 
ATOM   3378 C C   . GLU B 1 127 ? -52.885 36.303  30.079  1.00 30.63  ? 120 GLU B C   1 
ATOM   3379 O O   . GLU B 1 127 ? -53.816 35.501  30.120  1.00 27.92  ? 120 GLU B O   1 
ATOM   3380 C CB  . GLU B 1 127 ? -50.862 35.805  31.421  1.00 45.74  ? 120 GLU B CB  1 
ATOM   3381 C CG  . GLU B 1 127 ? -49.435 35.343  31.395  1.00 58.46  ? 120 GLU B CG  1 
ATOM   3382 C CD  . GLU B 1 127 ? -48.844 35.264  32.768  1.00 68.11  ? 120 GLU B CD  1 
ATOM   3383 O OE1 . GLU B 1 127 ? -48.292 36.290  33.220  1.00 73.05  ? 120 GLU B OE1 1 
ATOM   3384 O OE2 . GLU B 1 127 ? -48.939 34.183  33.390  1.00 72.31  ? 120 GLU B OE2 1 
ATOM   3385 N N   . GLU B 1 128 ? -53.043 37.621  30.047  1.00 31.58  ? 121 GLU B N   1 
ATOM   3386 C CA  . GLU B 1 128 ? -54.357 38.256  29.895  1.00 31.03  ? 121 GLU B CA  1 
ATOM   3387 C C   . GLU B 1 128 ? -55.164 37.714  28.708  1.00 40.08  ? 121 GLU B C   1 
ATOM   3388 O O   . GLU B 1 128 ? -56.385 37.607  28.797  1.00 42.65  ? 121 GLU B O   1 
ATOM   3389 C CB  . GLU B 1 128 ? -54.181 39.765  29.742  1.00 32.25  ? 121 GLU B CB  1 
ATOM   3390 C CG  . GLU B 1 128 ? -52.893 40.127  29.008  1.00 49.13  ? 121 GLU B CG  1 
ATOM   3391 C CD  . GLU B 1 128 ? -52.889 41.551  28.495  1.00 63.29  ? 121 GLU B CD  1 
ATOM   3392 O OE1 . GLU B 1 128 ? -52.083 41.871  27.594  1.00 70.70  ? 121 GLU B OE1 1 
ATOM   3393 O OE2 . GLU B 1 128 ? -53.699 42.355  28.991  1.00 68.66  ? 121 GLU B OE2 1 
ATOM   3394 N N   . ASP B 1 129 ? -54.488 37.352  27.613  1.00 42.18  ? 122 ASP B N   1 
ATOM   3395 C CA  . ASP B 1 129 ? -55.172 36.880  26.394  1.00 26.48  ? 122 ASP B CA  1 
ATOM   3396 C C   . ASP B 1 129 ? -55.685 35.437  26.407  1.00 36.91  ? 122 ASP B C   1 
ATOM   3397 O O   . ASP B 1 129 ? -56.467 35.071  25.533  1.00 45.61  ? 122 ASP B O   1 
ATOM   3398 C CB  . ASP B 1 129 ? -54.310 37.097  25.159  1.00 19.06  ? 122 ASP B CB  1 
ATOM   3399 C CG  . ASP B 1 129 ? -53.893 38.531  25.008  1.00 40.54  ? 122 ASP B CG  1 
ATOM   3400 O OD1 . ASP B 1 129 ? -54.806 39.381  24.919  1.00 44.36  ? 122 ASP B OD1 1 
ATOM   3401 O OD2 . ASP B 1 129 ? -52.665 38.812  25.024  1.00 34.14  ? 122 ASP B OD2 1 
ATOM   3402 N N   . ILE B 1 130 ? -55.257 34.631  27.377  1.00 37.81  ? 123 ILE B N   1 
ATOM   3403 C CA  . ILE B 1 130 ? -55.721 33.240  27.493  1.00 40.59  ? 123 ILE B CA  1 
ATOM   3404 C C   . ILE B 1 130 ? -57.230 33.112  27.347  1.00 29.77  ? 123 ILE B C   1 
ATOM   3405 O O   . ILE B 1 130 ? -57.980 33.765  28.057  1.00 33.84  ? 123 ILE B O   1 
ATOM   3406 C CB  . ILE B 1 130 ? -55.299 32.597  28.831  1.00 33.43  ? 123 ILE B CB  1 
ATOM   3407 C CG1 . ILE B 1 130 ? -53.780 32.516  28.916  1.00 37.19  ? 123 ILE B CG1 1 
ATOM   3408 C CG2 . ILE B 1 130 ? -55.873 31.182  28.947  1.00 17.43  ? 123 ILE B CG2 1 
ATOM   3409 C CD1 . ILE B 1 130 ? -53.212 31.415  28.053  1.00 41.06  ? 123 ILE B CD1 1 
ATOM   3410 N N   . GLY B 1 131 ? -57.668 32.293  26.397  1.00 28.06  ? 124 GLY B N   1 
ATOM   3411 C CA  . GLY B 1 131 ? -59.090 32.118  26.142  1.00 29.29  ? 124 GLY B CA  1 
ATOM   3412 C C   . GLY B 1 131 ? -59.671 32.995  25.045  1.00 33.33  ? 124 GLY B C   1 
ATOM   3413 O O   . GLY B 1 131 ? -60.670 32.643  24.435  1.00 44.87  ? 124 GLY B O   1 
ATOM   3414 N N   . LYS B 1 132 ? -59.071 34.150  24.796  1.00 26.70  ? 125 LYS B N   1 
ATOM   3415 C CA  . LYS B 1 132 ? -59.431 34.936  23.621  1.00 29.27  ? 125 LYS B CA  1 
ATOM   3416 C C   . LYS B 1 132 ? -58.891 34.291  22.325  1.00 27.14  ? 125 LYS B C   1 
ATOM   3417 O O   . LYS B 1 132 ? -57.802 33.708  22.318  1.00 24.04  ? 125 LYS B O   1 
ATOM   3418 C CB  . LYS B 1 132 ? -58.893 36.359  23.757  1.00 40.29  ? 125 LYS B CB  1 
ATOM   3419 C CG  . LYS B 1 132 ? -59.180 37.049  25.083  1.00 46.03  ? 125 LYS B CG  1 
ATOM   3420 C CD  . LYS B 1 132 ? -58.473 38.402  25.149  1.00 48.61  ? 125 LYS B CD  1 
ATOM   3421 C CE  . LYS B 1 132 ? -58.687 39.077  26.489  1.00 55.39  ? 125 LYS B CE  1 
ATOM   3422 N NZ  . LYS B 1 132 ? -57.807 40.271  26.609  1.00 62.14  ? 125 LYS B NZ  1 
ATOM   3423 N N   . ASN B 1 133 ? -59.656 34.397  21.239  1.00 24.35  ? 126 ASN B N   1 
ATOM   3424 C CA  . ASN B 1 133 ? -59.278 33.803  19.948  1.00 26.93  ? 126 ASN B CA  1 
ATOM   3425 C C   . ASN B 1 133 ? -57.915 34.287  19.418  1.00 33.45  ? 126 ASN B C   1 
ATOM   3426 O O   . ASN B 1 133 ? -57.624 35.492  19.390  1.00 29.91  ? 126 ASN B O   1 
ATOM   3427 C CB  . ASN B 1 133 ? -60.380 34.057  18.914  1.00 23.12  ? 126 ASN B CB  1 
ATOM   3428 C CG  . ASN B 1 133 ? -59.953 33.728  17.500  1.00 33.25  ? 126 ASN B CG  1 
ATOM   3429 O OD1 . ASN B 1 133 ? -59.303 34.536  16.833  1.00 41.50  ? 126 ASN B OD1 1 
ATOM   3430 N ND2 . ASN B 1 133 ? -60.336 32.544  17.024  1.00 27.02  ? 126 ASN B ND2 1 
ATOM   3431 N N   . ARG B 1 134 ? -57.085 33.342  18.995  1.00 24.33  ? 127 ARG B N   1 
ATOM   3432 C CA  . ARG B 1 134 ? -55.711 33.668  18.634  1.00 24.35  ? 127 ARG B CA  1 
ATOM   3433 C C   . ARG B 1 134 ? -55.605 34.658  17.483  1.00 23.13  ? 127 ARG B C   1 
ATOM   3434 O O   . ARG B 1 134 ? -54.729 35.523  17.482  1.00 21.35  ? 127 ARG B O   1 
ATOM   3435 C CB  . ARG B 1 134 ? -54.918 32.405  18.312  1.00 22.09  ? 127 ARG B CB  1 
ATOM   3436 C CG  . ARG B 1 134 ? -54.579 31.585  19.535  1.00 27.03  ? 127 ARG B CG  1 
ATOM   3437 C CD  . ARG B 1 134 ? -53.597 30.487  19.200  1.00 22.57  ? 127 ARG B CD  1 
ATOM   3438 N NE  . ARG B 1 134 ? -54.216 29.454  18.392  1.00 19.76  ? 127 ARG B NE  1 
ATOM   3439 C CZ  . ARG B 1 134 ? -54.464 28.227  18.827  1.00 24.39  ? 127 ARG B CZ  1 
ATOM   3440 N NH1 . ARG B 1 134 ? -54.141 27.890  20.062  1.00 40.68  ? 127 ARG B NH1 1 
ATOM   3441 N NH2 . ARG B 1 134 ? -55.032 27.334  18.033  1.00 28.40  ? 127 ARG B NH2 1 
ATOM   3442 N N   . ALA B 1 135 ? -56.495 34.542  16.506  1.00 23.86  ? 128 ALA B N   1 
ATOM   3443 C CA  . ALA B 1 135 ? -56.393 35.406  15.341  1.00 25.10  ? 128 ALA B CA  1 
ATOM   3444 C C   . ALA B 1 135 ? -56.777 36.829  15.717  1.00 26.91  ? 128 ALA B C   1 
ATOM   3445 O O   . ALA B 1 135 ? -56.068 37.781  15.387  1.00 33.73  ? 128 ALA B O   1 
ATOM   3446 C CB  . ALA B 1 135 ? -57.249 34.876  14.183  1.00 18.50  ? 128 ALA B CB  1 
ATOM   3447 N N   . GLU B 1 136 ? -57.883 36.964  16.441  1.00 31.03  ? 129 GLU B N   1 
ATOM   3448 C CA  . GLU B 1 136 ? -58.370 38.282  16.869  1.00 26.72  ? 129 GLU B CA  1 
ATOM   3449 C C   . GLU B 1 136 ? -57.459 39.032  17.856  1.00 29.21  ? 129 GLU B C   1 
ATOM   3450 O O   . GLU B 1 136 ? -57.319 40.260  17.752  1.00 26.76  ? 129 GLU B O   1 
ATOM   3451 C CB  . GLU B 1 136 ? -59.808 38.196  17.377  1.00 18.72  ? 129 GLU B CB  1 
ATOM   3452 C CG  . GLU B 1 136 ? -60.829 38.306  16.240  1.00 44.43  ? 129 GLU B CG  1 
ATOM   3453 C CD  . GLU B 1 136 ? -62.111 37.542  16.524  1.00 62.53  ? 129 GLU B CD  1 
ATOM   3454 O OE1 . GLU B 1 136 ? -62.296 37.124  17.693  1.00 44.38  ? 129 GLU B OE1 1 
ATOM   3455 O OE2 . GLU B 1 136 ? -62.927 37.355  15.579  1.00 73.99  ? 129 GLU B OE2 1 
ATOM   3456 N N   . VAL B 1 137 ? -56.824 38.313  18.785  1.00 17.69  ? 130 VAL B N   1 
ATOM   3457 C CA  . VAL B 1 137 ? -55.846 38.946  19.677  1.00 18.99  ? 130 VAL B CA  1 
ATOM   3458 C C   . VAL B 1 137 ? -54.634 39.418  18.896  1.00 21.83  ? 130 VAL B C   1 
ATOM   3459 O O   . VAL B 1 137 ? -54.103 40.502  19.139  1.00 24.37  ? 130 VAL B O   1 
ATOM   3460 C CB  . VAL B 1 137 ? -55.359 38.002  20.796  1.00 18.95  ? 130 VAL B CB  1 
ATOM   3461 C CG1 . VAL B 1 137 ? -54.203 38.635  21.557  1.00 10.85  ? 130 VAL B CG1 1 
ATOM   3462 C CG2 . VAL B 1 137 ? -56.496 37.660  21.722  1.00 21.22  ? 130 VAL B CG2 1 
ATOM   3463 N N   . SER B 1 138 ? -54.202 38.597  17.945  1.00 29.37  ? 131 SER B N   1 
ATOM   3464 C CA  . SER B 1 138 ? -52.961 38.850  17.212  1.00 24.53  ? 131 SER B CA  1 
ATOM   3465 C C   . SER B 1 138 ? -53.080 40.086  16.275  1.00 25.56  ? 131 SER B C   1 
ATOM   3466 O O   . SER B 1 138 ? -52.122 40.898  16.086  1.00 21.51  ? 131 SER B O   1 
ATOM   3467 C CB  . SER B 1 138 ? -52.550 37.575  16.476  1.00 9.64   ? 131 SER B CB  1 
ATOM   3468 O OG  . SER B 1 138 ? -52.084 36.604  17.410  1.00 24.75  ? 131 SER B OG  1 
ATOM   3469 N N   . GLN B 1 139 ? -54.303 40.268  15.783  1.00 30.00  ? 132 GLN B N   1 
ATOM   3470 C CA  . GLN B 1 139 ? -54.613 41.204  14.701  1.00 30.00  ? 132 GLN B CA  1 
ATOM   3471 C C   . GLN B 1 139 ? -54.302 42.710  14.866  1.00 30.00  ? 132 GLN B C   1 
ATOM   3472 O O   . GLN B 1 139 ? -53.733 43.277  13.963  1.00 30.00  ? 132 GLN B O   1 
ATOM   3473 C CB  . GLN B 1 139 ? -56.041 40.963  14.176  1.00 20.00  ? 132 GLN B CB  1 
ATOM   3474 C CG  . GLN B 1 139 ? -56.979 42.148  14.303  1.00 20.00  ? 132 GLN B CG  1 
ATOM   3475 C CD  . GLN B 1 139 ? -56.850 43.029  13.135  1.00 20.00  ? 132 GLN B CD  1 
ATOM   3476 O OE1 . GLN B 1 139 ? -56.534 42.544  12.047  1.00 20.00  ? 132 GLN B OE1 1 
ATOM   3477 N NE2 . GLN B 1 139 ? -57.047 44.331  13.323  1.00 20.00  ? 132 GLN B NE2 1 
ATOM   3478 N N   . PRO B 1 140 ? -54.696 43.369  15.985  1.00 28.30  ? 133 PRO B N   1 
ATOM   3479 C CA  . PRO B 1 140 ? -54.375 44.808  16.040  1.00 18.78  ? 133 PRO B CA  1 
ATOM   3480 C C   . PRO B 1 140 ? -52.886 45.077  16.032  1.00 26.63  ? 133 PRO B C   1 
ATOM   3481 O O   . PRO B 1 140 ? -52.466 46.088  15.469  1.00 29.64  ? 133 PRO B O   1 
ATOM   3482 C CB  . PRO B 1 140 ? -54.906 45.237  17.404  1.00 11.64  ? 133 PRO B CB  1 
ATOM   3483 C CG  . PRO B 1 140 ? -55.932 44.262  17.726  1.00 25.30  ? 133 PRO B CG  1 
ATOM   3484 C CD  . PRO B 1 140 ? -55.484 42.953  17.163  1.00 27.36  ? 133 PRO B CD  1 
ATOM   3485 N N   . ARG B 1 141 ? -52.113 44.199  16.665  1.00 27.94  ? 134 ARG B N   1 
ATOM   3486 C CA  . ARG B 1 141 ? -50.672 44.405  16.778  1.00 27.78  ? 134 ARG B CA  1 
ATOM   3487 C C   . ARG B 1 141 ? -50.030 44.182  15.435  1.00 24.83  ? 134 ARG B C   1 
ATOM   3488 O O   . ARG B 1 141 ? -49.226 45.003  14.984  1.00 23.67  ? 134 ARG B O   1 
ATOM   3489 C CB  . ARG B 1 141 ? -50.044 43.468  17.811  1.00 42.72  ? 134 ARG B CB  1 
ATOM   3490 C CG  . ARG B 1 141 ? -50.664 43.524  19.200  1.00 59.04  ? 134 ARG B CG  1 
ATOM   3491 C CD  . ARG B 1 141 ? -50.988 44.956  19.615  1.00 71.60  ? 134 ARG B CD  1 
ATOM   3492 N NE  . ARG B 1 141 ? -49.848 45.857  19.454  1.00 75.57  ? 134 ARG B NE  1 
ATOM   3493 C CZ  . ARG B 1 141 ? -49.167 46.395  20.463  1.00 75.31  ? 134 ARG B CZ  1 
ATOM   3494 N NH1 . ARG B 1 141 ? -49.514 46.129  21.719  1.00 74.30  ? 134 ARG B NH1 1 
ATOM   3495 N NH2 . ARG B 1 141 ? -48.143 47.208  20.218  1.00 66.82  ? 134 ARG B NH2 1 
ATOM   3496 N N   . LEU B 1 142 ? -50.394 43.068  14.796  1.00 31.12  ? 135 LEU B N   1 
ATOM   3497 C CA  . LEU B 1 142 ? -49.985 42.793  13.412  1.00 25.15  ? 135 LEU B CA  1 
ATOM   3498 C C   . LEU B 1 142 ? -50.350 43.926  12.471  1.00 23.12  ? 135 LEU B C   1 
ATOM   3499 O O   . LEU B 1 142 ? -49.590 44.233  11.575  1.00 35.53  ? 135 LEU B O   1 
ATOM   3500 C CB  . LEU B 1 142 ? -50.585 41.492  12.908  1.00 13.82  ? 135 LEU B CB  1 
ATOM   3501 C CG  . LEU B 1 142 ? -49.859 40.278  13.471  1.00 14.01  ? 135 LEU B CG  1 
ATOM   3502 C CD1 . LEU B 1 142 ? -50.553 38.999  13.080  1.00 18.04  ? 135 LEU B CD1 1 
ATOM   3503 C CD2 . LEU B 1 142 ? -48.451 40.288  12.955  1.00 8.76   ? 135 LEU B CD2 1 
ATOM   3504 N N   . ALA B 1 143 ? -51.488 44.572  12.703  1.00 19.98  ? 136 ALA B N   1 
ATOM   3505 C CA  . ALA B 1 143 ? -51.948 45.673  11.862  1.00 13.80  ? 136 ALA B CA  1 
ATOM   3506 C C   . ALA B 1 143 ? -51.093 46.927  11.972  1.00 22.99  ? 136 ALA B C   1 
ATOM   3507 O O   . ALA B 1 143 ? -51.090 47.764  11.070  1.00 33.70  ? 136 ALA B O   1 
ATOM   3508 C CB  . ALA B 1 143 ? -53.392 45.993  12.161  1.00 15.14  ? 136 ALA B CB  1 
ATOM   3509 N N   . GLU B 1 144 ? -50.350 47.059  13.064  1.00 25.44  ? 137 GLU B N   1 
ATOM   3510 C CA  . GLU B 1 144 ? -49.516 48.245  13.257  1.00 21.20  ? 137 GLU B CA  1 
ATOM   3511 C C   . GLU B 1 144 ? -48.203 48.189  12.463  1.00 27.45  ? 137 GLU B C   1 
ATOM   3512 O O   . GLU B 1 144 ? -47.589 49.222  12.191  1.00 23.43  ? 137 GLU B O   1 
ATOM   3513 C CB  . GLU B 1 144 ? -49.236 48.475  14.735  1.00 32.04  ? 137 GLU B CB  1 
ATOM   3514 C CG  . GLU B 1 144 ? -50.456 48.870  15.555  1.00 53.38  ? 137 GLU B CG  1 
ATOM   3515 C CD  . GLU B 1 144 ? -50.222 48.697  17.053  1.00 74.66  ? 137 GLU B CD  1 
ATOM   3516 O OE1 . GLU B 1 144 ? -51.185 48.333  17.769  1.00 84.13  ? 137 GLU B OE1 1 
ATOM   3517 O OE2 . GLU B 1 144 ? -49.074 48.917  17.512  1.00 72.81  ? 137 GLU B OE2 1 
ATOM   3518 N N   . LEU B 1 145 ? -47.802 46.987  12.062  1.00 21.42  ? 138 LEU B N   1 
ATOM   3519 C CA  . LEU B 1 145 ? -46.528 46.780  11.382  1.00 17.66  ? 138 LEU B CA  1 
ATOM   3520 C C   . LEU B 1 145 ? -46.345 47.496  10.045  1.00 25.71  ? 138 LEU B C   1 
ATOM   3521 O O   . LEU B 1 145 ? -45.225 47.816  9.672   1.00 39.00  ? 138 LEU B O   1 
ATOM   3522 C CB  . LEU B 1 145 ? -46.293 45.294  11.152  1.00 13.71  ? 138 LEU B CB  1 
ATOM   3523 C CG  . LEU B 1 145 ? -46.260 44.362  12.350  1.00 15.45  ? 138 LEU B CG  1 
ATOM   3524 C CD1 . LEU B 1 145 ? -45.974 42.959  11.843  1.00 10.64  ? 138 LEU B CD1 1 
ATOM   3525 C CD2 . LEU B 1 145 ? -45.211 44.814  13.366  1.00 19.26  ? 138 LEU B CD2 1 
ATOM   3526 N N   . ASN B 1 146 ? -47.423 47.724  9.309   1.00 27.82  ? 139 ASN B N   1 
ATOM   3527 C CA  . ASN B 1 146 ? -47.305 48.295  7.971   1.00 17.43  ? 139 ASN B CA  1 
ATOM   3528 C C   . ASN B 1 146 ? -48.624 48.919  7.548   1.00 27.07  ? 139 ASN B C   1 
ATOM   3529 O O   . ASN B 1 146 ? -49.615 48.216  7.323   1.00 34.73  ? 139 ASN B O   1 
ATOM   3530 C CB  . ASN B 1 146 ? -46.922 47.190  6.989   1.00 18.42  ? 139 ASN B CB  1 
ATOM   3531 C CG  . ASN B 1 146 ? -46.480 47.725  5.647   1.00 17.82  ? 139 ASN B CG  1 
ATOM   3532 O OD1 . ASN B 1 146 ? -46.829 48.834  5.263   1.00 23.72  ? 139 ASN B OD1 1 
ATOM   3533 N ND2 . ASN B 1 146 ? -45.704 46.932  4.924   1.00 25.00  ? 139 ASN B ND2 1 
ATOM   3534 N N   . SER B 1 147 ? -48.646 50.238  7.430   1.00 26.23  ? 140 SER B N   1 
ATOM   3535 C CA  . SER B 1 147 ? -49.891 50.937  7.118   1.00 25.98  ? 140 SER B CA  1 
ATOM   3536 C C   . SER B 1 147 ? -50.396 50.660  5.694   1.00 24.56  ? 140 SER B C   1 
ATOM   3537 O O   . SER B 1 147 ? -51.575 50.863  5.381   1.00 30.90  ? 140 SER B O   1 
ATOM   3538 C CB  . SER B 1 147 ? -49.709 52.434  7.320   1.00 23.18  ? 140 SER B CB  1 
ATOM   3539 O OG  . SER B 1 147 ? -48.753 52.932  6.408   1.00 27.20  ? 140 SER B OG  1 
ATOM   3540 N N   . TYR B 1 148 ? -49.503 50.199  4.833   1.00 17.07  ? 141 TYR B N   1 
ATOM   3541 C CA  . TYR B 1 148 ? -49.882 49.843  3.467   1.00 20.94  ? 141 TYR B CA  1 
ATOM   3542 C C   . TYR B 1 148 ? -50.618 48.491  3.363   1.00 29.37  ? 141 TYR B C   1 
ATOM   3543 O O   . TYR B 1 148 ? -51.316 48.246  2.383   1.00 37.26  ? 141 TYR B O   1 
ATOM   3544 C CB  . TYR B 1 148 ? -48.653 49.872  2.547   1.00 22.96  ? 141 TYR B CB  1 
ATOM   3545 C CG  . TYR B 1 148 ? -48.124 51.266  2.204   1.00 36.98  ? 141 TYR B CG  1 
ATOM   3546 C CD1 . TYR B 1 148 ? -48.019 52.264  3.168   1.00 39.96  ? 141 TYR B CD1 1 
ATOM   3547 C CD2 . TYR B 1 148 ? -47.705 51.568  0.914   1.00 49.68  ? 141 TYR B CD2 1 
ATOM   3548 C CE1 . TYR B 1 148 ? -47.533 53.533  2.850   1.00 39.09  ? 141 TYR B CE1 1 
ATOM   3549 C CE2 . TYR B 1 148 ? -47.218 52.829  0.585   1.00 50.32  ? 141 TYR B CE2 1 
ATOM   3550 C CZ  . TYR B 1 148 ? -47.134 53.804  1.555   1.00 46.11  ? 141 TYR B CZ  1 
ATOM   3551 O OH  . TYR B 1 148 ? -46.647 55.048  1.223   1.00 48.24  ? 141 TYR B OH  1 
ATOM   3552 N N   . VAL B 1 149 ? -50.488 47.638  4.384   1.00 31.87  ? 142 VAL B N   1 
ATOM   3553 C CA  . VAL B 1 149 ? -51.034 46.273  4.344   1.00 33.50  ? 142 VAL B CA  1 
ATOM   3554 C C   . VAL B 1 149 ? -52.252 46.056  5.268   1.00 40.54  ? 142 VAL B C   1 
ATOM   3555 O O   . VAL B 1 149 ? -52.119 46.009  6.486   1.00 51.69  ? 142 VAL B O   1 
ATOM   3556 C CB  . VAL B 1 149 ? -49.921 45.203  4.623   1.00 19.78  ? 142 VAL B CB  1 
ATOM   3557 C CG1 . VAL B 1 149 ? -50.441 43.779  4.421   1.00 5.16   ? 142 VAL B CG1 1 
ATOM   3558 C CG2 . VAL B 1 149 ? -48.718 45.443  3.715   1.00 21.61  ? 142 VAL B CG2 1 
ATOM   3559 N N   . PRO B 1 150 ? -53.446 45.910  4.674   1.00 35.42  ? 143 PRO B N   1 
ATOM   3560 C CA  . PRO B 1 150 ? -54.677 45.608  5.411   1.00 29.16  ? 143 PRO B CA  1 
ATOM   3561 C C   . PRO B 1 150 ? -54.614 44.249  6.106   1.00 21.30  ? 143 PRO B C   1 
ATOM   3562 O O   . PRO B 1 150 ? -54.403 43.236  5.446   1.00 19.38  ? 143 PRO B O   1 
ATOM   3563 C CB  . PRO B 1 150 ? -55.742 45.543  4.308   1.00 26.11  ? 143 PRO B CB  1 
ATOM   3564 C CG  . PRO B 1 150 ? -55.097 46.069  3.068   1.00 18.12  ? 143 PRO B CG  1 
ATOM   3565 C CD  . PRO B 1 150 ? -53.651 45.914  3.213   1.00 25.08  ? 143 PRO B CD  1 
ATOM   3566 N N   . VAL B 1 151 ? -54.828 44.221  7.419   1.00 24.67  ? 144 VAL B N   1 
ATOM   3567 C CA  . VAL B 1 151 ? -54.819 42.968  8.169   1.00 17.78  ? 144 VAL B CA  1 
ATOM   3568 C C   . VAL B 1 151 ? -56.154 42.750  8.874   1.00 17.81  ? 144 VAL B C   1 
ATOM   3569 O O   . VAL B 1 151 ? -56.649 43.636  9.563   1.00 29.46  ? 144 VAL B O   1 
ATOM   3570 C CB  . VAL B 1 151 ? -53.694 42.959  9.224   1.00 23.04  ? 144 VAL B CB  1 
ATOM   3571 C CG1 . VAL B 1 151 ? -53.558 41.579  9.860   1.00 22.25  ? 144 VAL B CG1 1 
ATOM   3572 C CG2 . VAL B 1 151 ? -52.381 43.415  8.603   1.00 27.48  ? 144 VAL B CG2 1 
ATOM   3573 N N   . THR B 1 152 ? -56.744 41.575  8.712   1.00 7.92   ? 145 THR B N   1 
ATOM   3574 C CA  . THR B 1 152 ? -58.040 41.328  9.315   1.00 16.43  ? 145 THR B CA  1 
ATOM   3575 C C   . THR B 1 152 ? -58.094 39.892  9.773   1.00 28.21  ? 145 THR B C   1 
ATOM   3576 O O   . THR B 1 152 ? -57.359 39.046  9.254   1.00 27.82  ? 145 THR B O   1 
ATOM   3577 C CB  . THR B 1 152 ? -59.212 41.633  8.350   1.00 32.62  ? 145 THR B CB  1 
ATOM   3578 O OG1 . THR B 1 152 ? -58.907 41.140  7.044   1.00 21.14  ? 145 THR B OG1 1 
ATOM   3579 C CG2 . THR B 1 152 ? -59.445 43.125  8.255   1.00 52.67  ? 145 THR B CG2 1 
ATOM   3580 N N   . ALA B 1 153 ? -58.945 39.625  10.762  1.00 25.59  ? 146 ALA B N   1 
ATOM   3581 C CA  . ALA B 1 153 ? -59.074 38.278  11.319  1.00 18.79  ? 146 ALA B CA  1 
ATOM   3582 C C   . ALA B 1 153 ? -60.346 37.582  10.846  1.00 24.35  ? 146 ALA B C   1 
ATOM   3583 O O   . ALA B 1 153 ? -61.390 38.222  10.651  1.00 20.16  ? 146 ALA B O   1 
ATOM   3584 C CB  . ALA B 1 153 ? -59.035 38.323  12.856  1.00 12.48  ? 146 ALA B CB  1 
ATOM   3585 N N   . TYR B 1 154 ? -60.258 36.269  10.675  1.00 18.25  ? 147 TYR B N   1 
ATOM   3586 C CA  . TYR B 1 154 ? -61.432 35.463  10.368  1.00 18.31  ? 147 TYR B CA  1 
ATOM   3587 C C   . TYR B 1 154 ? -61.386 34.224  11.251  1.00 25.48  ? 147 TYR B C   1 
ATOM   3588 O O   . TYR B 1 154 ? -60.330 33.592  11.389  1.00 31.89  ? 147 TYR B O   1 
ATOM   3589 C CB  . TYR B 1 154 ? -61.472 35.115  8.876   1.00 8.72   ? 147 TYR B CB  1 
ATOM   3590 C CG  . TYR B 1 154 ? -62.513 34.101  8.494   1.00 12.16  ? 147 TYR B CG  1 
ATOM   3591 C CD1 . TYR B 1 154 ? -63.867 34.430  8.469   1.00 12.84  ? 147 TYR B CD1 1 
ATOM   3592 C CD2 . TYR B 1 154 ? -62.145 32.802  8.149   1.00 17.66  ? 147 TYR B CD2 1 
ATOM   3593 C CE1 . TYR B 1 154 ? -64.832 33.486  8.114   1.00 10.94  ? 147 TYR B CE1 1 
ATOM   3594 C CE2 . TYR B 1 154 ? -63.096 31.857  7.779   1.00 16.70  ? 147 TYR B CE2 1 
ATOM   3595 C CZ  . TYR B 1 154 ? -64.436 32.204  7.773   1.00 17.34  ? 147 TYR B CZ  1 
ATOM   3596 O OH  . TYR B 1 154 ? -65.364 31.255  7.419   1.00 28.38  ? 147 TYR B OH  1 
ATOM   3597 N N   . THR B 1 155 ? -62.520 33.895  11.865  1.00 23.91  ? 148 THR B N   1 
ATOM   3598 C CA  . THR B 1 155 ? -62.548 32.890  12.933  1.00 33.38  ? 148 THR B CA  1 
ATOM   3599 C C   . THR B 1 155 ? -63.464 31.742  12.579  1.00 41.68  ? 148 THR B C   1 
ATOM   3600 O O   . THR B 1 155 ? -63.640 30.804  13.361  1.00 38.75  ? 148 THR B O   1 
ATOM   3601 C CB  . THR B 1 155 ? -62.954 33.499  14.305  1.00 21.97  ? 148 THR B CB  1 
ATOM   3602 O OG1 . THR B 1 155 ? -64.183 34.222  14.178  1.00 28.97  ? 148 THR B OG1 1 
ATOM   3603 C CG2 . THR B 1 155 ? -61.886 34.459  14.780  1.00 19.69  ? 148 THR B CG2 1 
ATOM   3604 N N   . GLY B 1 156 ? -64.035 31.823  11.379  1.00 47.16  ? 149 GLY B N   1 
ATOM   3605 C CA  . GLY B 1 156 ? -64.872 30.761  10.847  1.00 33.47  ? 149 GLY B CA  1 
ATOM   3606 C C   . GLY B 1 156 ? -64.075 29.642  10.196  1.00 27.97  ? 149 GLY B C   1 
ATOM   3607 O O   . GLY B 1 156 ? -62.843 29.704  10.104  1.00 25.80  ? 149 GLY B O   1 
ATOM   3608 N N   . PRO B 1 157 ? -64.778 28.604  9.739   1.00 27.60  ? 150 PRO B N   1 
ATOM   3609 C CA  . PRO B 1 157 ? -64.153 27.442  9.105   1.00 32.59  ? 150 PRO B CA  1 
ATOM   3610 C C   . PRO B 1 157 ? -63.627 27.772  7.702   1.00 31.65  ? 150 PRO B C   1 
ATOM   3611 O O   . PRO B 1 157 ? -64.025 28.780  7.102   1.00 29.04  ? 150 PRO B O   1 
ATOM   3612 C CB  . PRO B 1 157 ? -65.307 26.441  9.025   1.00 33.51  ? 150 PRO B CB  1 
ATOM   3613 C CG  . PRO B 1 157 ? -66.536 27.315  8.878   1.00 24.13  ? 150 PRO B CG  1 
ATOM   3614 C CD  . PRO B 1 157 ? -66.251 28.522  9.727   1.00 25.48  ? 150 PRO B CD  1 
ATOM   3615 N N   . LEU B 1 158 ? -62.733 26.924  7.198   1.00 27.62  ? 151 LEU B N   1 
ATOM   3616 C CA  . LEU B 1 158 ? -62.117 27.130  5.895   1.00 28.11  ? 151 LEU B CA  1 
ATOM   3617 C C   . LEU B 1 158 ? -62.987 26.543  4.797   1.00 29.71  ? 151 LEU B C   1 
ATOM   3618 O O   . LEU B 1 158 ? -62.684 25.474  4.259   1.00 32.76  ? 151 LEU B O   1 
ATOM   3619 C CB  . LEU B 1 158 ? -60.705 26.528  5.844   1.00 21.83  ? 151 LEU B CB  1 
ATOM   3620 C CG  . LEU B 1 158 ? -59.670 27.225  6.734   1.00 28.45  ? 151 LEU B CG  1 
ATOM   3621 C CD1 . LEU B 1 158 ? -58.214 26.770  6.457   1.00 18.90  ? 151 LEU B CD1 1 
ATOM   3622 C CD2 . LEU B 1 158 ? -59.806 28.741  6.620   1.00 25.79  ? 151 LEU B CD2 1 
ATOM   3623 N N   . VAL B 1 159 ? -64.063 27.262  4.478   1.00 24.30  ? 152 VAL B N   1 
ATOM   3624 C CA  . VAL B 1 159 ? -64.997 26.903  3.404   1.00 25.94  ? 152 VAL B CA  1 
ATOM   3625 C C   . VAL B 1 159 ? -64.498 27.375  2.040   1.00 33.19  ? 152 VAL B C   1 
ATOM   3626 O O   . VAL B 1 159 ? -63.641 28.245  1.953   1.00 40.76  ? 152 VAL B O   1 
ATOM   3627 C CB  . VAL B 1 159 ? -66.428 27.488  3.662   1.00 22.75  ? 152 VAL B CB  1 
ATOM   3628 C CG1 . VAL B 1 159 ? -67.049 26.837  4.851   1.00 16.07  ? 152 VAL B CG1 1 
ATOM   3629 C CG2 . VAL B 1 159 ? -66.396 29.008  3.854   1.00 19.97  ? 152 VAL B CG2 1 
ATOM   3630 N N   . GLU B 1 160 ? -65.051 26.811  0.976   1.00 41.09  ? 153 GLU B N   1 
ATOM   3631 C CA  . GLU B 1 160 ? -64.617 27.148  -0.375  1.00 34.35  ? 153 GLU B CA  1 
ATOM   3632 C C   . GLU B 1 160 ? -64.849 28.620  -0.741  1.00 40.21  ? 153 GLU B C   1 
ATOM   3633 O O   . GLU B 1 160 ? -64.065 29.207  -1.481  1.00 45.95  ? 153 GLU B O   1 
ATOM   3634 C CB  . GLU B 1 160 ? -65.272 26.212  -1.387  1.00 34.80  ? 153 GLU B CB  1 
ATOM   3635 C CG  . GLU B 1 160 ? -64.945 24.738  -1.135  1.00 51.23  ? 153 GLU B CG  1 
ATOM   3636 C CD  . GLU B 1 160 ? -65.525 23.795  -2.185  1.00 63.69  ? 153 GLU B CD  1 
ATOM   3637 O OE1 . GLU B 1 160 ? -65.126 22.604  -2.198  1.00 58.39  ? 153 GLU B OE1 1 
ATOM   3638 O OE2 . GLU B 1 160 ? -66.374 24.243  -2.993  1.00 69.39  ? 153 GLU B OE2 1 
ATOM   3639 N N   . ASP B 1 161 ? -65.907 29.228  -0.220  1.00 39.35  ? 154 ASP B N   1 
ATOM   3640 C CA  . ASP B 1 161 ? -66.169 30.629  -0.539  1.00 44.37  ? 154 ASP B CA  1 
ATOM   3641 C C   . ASP B 1 161 ? -65.102 31.516  0.066   1.00 50.27  ? 154 ASP B C   1 
ATOM   3642 O O   . ASP B 1 161 ? -64.659 32.486  -0.554  1.00 64.28  ? 154 ASP B O   1 
ATOM   3643 C CB  . ASP B 1 161 ? -67.535 31.077  -0.023  1.00 46.88  ? 154 ASP B CB  1 
ATOM   3644 C CG  . ASP B 1 161 ? -68.678 30.434  -0.768  1.00 66.50  ? 154 ASP B CG  1 
ATOM   3645 O OD1 . ASP B 1 161 ? -69.659 30.045  -0.101  1.00 85.76  ? 154 ASP B OD1 1 
ATOM   3646 O OD2 . ASP B 1 161 ? -68.600 30.321  -2.015  1.00 60.42  ? 154 ASP B OD2 1 
ATOM   3647 N N   . PHE B 1 162 ? -64.705 31.183  1.291   1.00 39.46  ? 155 PHE B N   1 
ATOM   3648 C CA  . PHE B 1 162 ? -63.714 31.967  2.009   1.00 27.87  ? 155 PHE B CA  1 
ATOM   3649 C C   . PHE B 1 162 ? -62.371 31.852  1.287   1.00 27.34  ? 155 PHE B C   1 
ATOM   3650 O O   . PHE B 1 162 ? -61.779 32.859  0.887   1.00 32.16  ? 155 PHE B O   1 
ATOM   3651 C CB  . PHE B 1 162 ? -63.624 31.502  3.465   1.00 21.64  ? 155 PHE B CB  1 
ATOM   3652 C CG  . PHE B 1 162 ? -62.456 32.082  4.213   1.00 28.18  ? 155 PHE B CG  1 
ATOM   3653 C CD1 . PHE B 1 162 ? -61.388 31.282  4.596   1.00 27.21  ? 155 PHE B CD1 1 
ATOM   3654 C CD2 . PHE B 1 162 ? -62.421 33.428  4.530   1.00 25.81  ? 155 PHE B CD2 1 
ATOM   3655 C CE1 . PHE B 1 162 ? -60.309 31.819  5.271   1.00 22.87  ? 155 PHE B CE1 1 
ATOM   3656 C CE2 . PHE B 1 162 ? -61.337 33.968  5.198   1.00 26.51  ? 155 PHE B CE2 1 
ATOM   3657 C CZ  . PHE B 1 162 ? -60.279 33.165  5.558   1.00 25.80  ? 155 PHE B CZ  1 
ATOM   3658 N N   . LEU B 1 163 ? -61.942 30.608  1.083   1.00 23.44  ? 156 LEU B N   1 
ATOM   3659 C CA  . LEU B 1 163 ? -60.704 30.278  0.395   1.00 21.27  ? 156 LEU B CA  1 
ATOM   3660 C C   . LEU B 1 163 ? -60.558 30.918  -0.981  1.00 24.05  ? 156 LEU B C   1 
ATOM   3661 O O   . LEU B 1 163 ? -59.470 31.396  -1.322  1.00 23.11  ? 156 LEU B O   1 
ATOM   3662 C CB  . LEU B 1 163 ? -60.558 28.759  0.267   1.00 22.64  ? 156 LEU B CB  1 
ATOM   3663 C CG  . LEU B 1 163 ? -60.212 27.981  1.534   1.00 27.02  ? 156 LEU B CG  1 
ATOM   3664 C CD1 . LEU B 1 163 ? -60.254 26.501  1.283   1.00 17.52  ? 156 LEU B CD1 1 
ATOM   3665 C CD2 . LEU B 1 163 ? -58.844 28.376  2.014   1.00 30.04  ? 156 LEU B CD2 1 
ATOM   3666 N N   . SER B 1 164 ? -61.636 30.934  -1.763  1.00 30.35  ? 157 SER B N   1 
ATOM   3667 C CA  . SER B 1 164 ? -61.533 31.253  -3.201  1.00 27.16  ? 157 SER B CA  1 
ATOM   3668 C C   . SER B 1 164 ? -60.906 32.619  -3.483  1.00 23.68  ? 157 SER B C   1 
ATOM   3669 O O   . SER B 1 164 ? -60.167 32.767  -4.448  1.00 37.31  ? 157 SER B O   1 
ATOM   3670 C CB  . SER B 1 164 ? -62.879 31.133  -3.921  1.00 15.09  ? 157 SER B CB  1 
ATOM   3671 O OG  . SER B 1 164 ? -63.726 32.202  -3.545  1.00 58.34  ? 157 SER B OG  1 
ATOM   3672 N N   . GLY B 1 165 ? -61.174 33.598  -2.626  1.00 22.00  ? 158 GLY B N   1 
ATOM   3673 C CA  . GLY B 1 165 ? -60.603 34.927  -2.791  1.00 28.27  ? 158 GLY B CA  1 
ATOM   3674 C C   . GLY B 1 165 ? -59.081 35.067  -2.711  1.00 33.98  ? 158 GLY B C   1 
ATOM   3675 O O   . GLY B 1 165 ? -58.535 36.077  -3.158  1.00 35.95  ? 158 GLY B O   1 
ATOM   3676 N N   . PHE B 1 166 ? -58.390 34.068  -2.162  1.00 22.39  ? 159 PHE B N   1 
ATOM   3677 C CA  . PHE B 1 166 ? -56.948 34.176  -1.950  1.00 22.78  ? 159 PHE B CA  1 
ATOM   3678 C C   . PHE B 1 166 ? -56.088 33.708  -3.120  1.00 24.21  ? 159 PHE B C   1 
ATOM   3679 O O   . PHE B 1 166 ? -56.446 32.758  -3.818  1.00 29.98  ? 159 PHE B O   1 
ATOM   3680 C CB  . PHE B 1 166 ? -56.543 33.439  -0.667  1.00 19.97  ? 159 PHE B CB  1 
ATOM   3681 C CG  . PHE B 1 166 ? -57.178 34.004  0.558   1.00 17.55  ? 159 PHE B CG  1 
ATOM   3682 C CD1 . PHE B 1 166 ? -58.275 33.372  1.144   1.00 10.21  ? 159 PHE B CD1 1 
ATOM   3683 C CD2 . PHE B 1 166 ? -56.711 35.203  1.106   1.00 15.21  ? 159 PHE B CD2 1 
ATOM   3684 C CE1 . PHE B 1 166 ? -58.898 33.926  2.274   1.00 14.00  ? 159 PHE B CE1 1 
ATOM   3685 C CE2 . PHE B 1 166 ? -57.322 35.767  2.248   1.00 18.99  ? 159 PHE B CE2 1 
ATOM   3686 C CZ  . PHE B 1 166 ? -58.414 35.125  2.834   1.00 18.89  ? 159 PHE B CZ  1 
ATOM   3687 N N   . GLN B 1 167 ? -54.951 34.379  -3.319  1.00 18.13  ? 160 GLN B N   1 
ATOM   3688 C CA  . GLN B 1 167 ? -53.941 33.918  -4.277  1.00 22.19  ? 160 GLN B CA  1 
ATOM   3689 C C   . GLN B 1 167 ? -52.978 32.957  -3.612  1.00 27.37  ? 160 GLN B C   1 
ATOM   3690 O O   . GLN B 1 167 ? -52.496 32.018  -4.243  1.00 27.53  ? 160 GLN B O   1 
ATOM   3691 C CB  . GLN B 1 167 ? -53.135 35.073  -4.863  1.00 31.47  ? 160 GLN B CB  1 
ATOM   3692 C CG  . GLN B 1 167 ? -53.872 35.907  -5.888  1.00 21.01  ? 160 GLN B CG  1 
ATOM   3693 C CD  . GLN B 1 167 ? -55.023 36.668  -5.278  1.00 32.45  ? 160 GLN B CD  1 
ATOM   3694 O OE1 . GLN B 1 167 ? -54.840 37.542  -4.412  1.00 37.54  ? 160 GLN B OE1 1 
ATOM   3695 N NE2 . GLN B 1 167 ? -56.228 36.321  -5.702  1.00 32.66  ? 160 GLN B NE2 1 
ATOM   3696 N N   . VAL B 1 168 ? -52.700 33.203  -2.334  1.00 31.45  ? 161 VAL B N   1 
ATOM   3697 C CA  . VAL B 1 168 ? -51.809 32.348  -1.550  1.00 28.14  ? 161 VAL B CA  1 
ATOM   3698 C C   . VAL B 1 168 ? -52.393 32.001  -0.175  1.00 28.40  ? 161 VAL B C   1 
ATOM   3699 O O   . VAL B 1 168 ? -52.804 32.887  0.569   1.00 18.34  ? 161 VAL B O   1 
ATOM   3700 C CB  . VAL B 1 168 ? -50.452 33.033  -1.282  1.00 13.90  ? 161 VAL B CB  1 
ATOM   3701 C CG1 . VAL B 1 168 ? -49.464 32.007  -0.752  1.00 15.99  ? 161 VAL B CG1 1 
ATOM   3702 C CG2 . VAL B 1 168 ? -49.928 33.744  -2.522  1.00 7.23   ? 161 VAL B CG2 1 
ATOM   3703 N N   . VAL B 1 169 ? -52.383 30.718  0.172   1.00 23.07  ? 162 VAL B N   1 
ATOM   3704 C CA  . VAL B 1 169 ? -52.864 30.253  1.464   1.00 17.83  ? 162 VAL B CA  1 
ATOM   3705 C C   . VAL B 1 169 ? -51.730 29.588  2.242   1.00 28.03  ? 162 VAL B C   1 
ATOM   3706 O O   . VAL B 1 169 ? -51.059 28.695  1.712   1.00 31.55  ? 162 VAL B O   1 
ATOM   3707 C CB  . VAL B 1 169 ? -54.005 29.223  1.279   1.00 24.81  ? 162 VAL B CB  1 
ATOM   3708 C CG1 . VAL B 1 169 ? -54.190 28.404  2.540   1.00 23.74  ? 162 VAL B CG1 1 
ATOM   3709 C CG2 . VAL B 1 169 ? -55.314 29.913  0.857   1.00 20.34  ? 162 VAL B CG2 1 
ATOM   3710 N N   . VAL B 1 170 ? -51.513 30.021  3.488   1.00 25.40  ? 163 VAL B N   1 
ATOM   3711 C CA  . VAL B 1 170 ? -50.502 29.411  4.371   1.00 26.92  ? 163 VAL B CA  1 
ATOM   3712 C C   . VAL B 1 170 ? -51.158 28.634  5.507   1.00 28.75  ? 163 VAL B C   1 
ATOM   3713 O O   . VAL B 1 170 ? -51.971 29.193  6.262   1.00 28.82  ? 163 VAL B O   1 
ATOM   3714 C CB  . VAL B 1 170 ? -49.570 30.466  5.041   1.00 24.26  ? 163 VAL B CB  1 
ATOM   3715 C CG1 . VAL B 1 170 ? -48.537 29.794  5.917   1.00 12.04  ? 163 VAL B CG1 1 
ATOM   3716 C CG2 . VAL B 1 170 ? -48.886 31.314  4.028   1.00 25.58  ? 163 VAL B CG2 1 
ATOM   3717 N N   . LEU B 1 171 ? -50.793 27.361  5.652   1.00 12.28  ? 164 LEU B N   1 
ATOM   3718 C CA  . LEU B 1 171 ? -51.305 26.558  6.762   1.00 14.06  ? 164 LEU B CA  1 
ATOM   3719 C C   . LEU B 1 171 ? -50.281 26.232  7.862   1.00 23.83  ? 164 LEU B C   1 
ATOM   3720 O O   . LEU B 1 171 ? -49.327 25.493  7.641   1.00 30.29  ? 164 LEU B O   1 
ATOM   3721 C CB  . LEU B 1 171 ? -51.955 25.262  6.244   1.00 14.96  ? 164 LEU B CB  1 
ATOM   3722 C CG  . LEU B 1 171 ? -53.091 25.392  5.213   1.00 20.78  ? 164 LEU B CG  1 
ATOM   3723 C CD1 . LEU B 1 171 ? -53.545 24.037  4.766   1.00 21.63  ? 164 LEU B CD1 1 
ATOM   3724 C CD2 . LEU B 1 171 ? -54.288 26.186  5.718   1.00 22.16  ? 164 LEU B CD2 1 
ATOM   3725 N N   . THR B 1 172 ? -50.496 26.777  9.054   1.00 29.24  ? 165 THR B N   1 
ATOM   3726 C CA  . THR B 1 172 ? -49.823 26.286  10.258  1.00 26.31  ? 165 THR B CA  1 
ATOM   3727 C C   . THR B 1 172 ? -50.887 25.648  11.163  1.00 32.39  ? 165 THR B C   1 
ATOM   3728 O O   . THR B 1 172 ? -52.082 25.909  11.003  1.00 33.03  ? 165 THR B O   1 
ATOM   3729 C CB  . THR B 1 172 ? -49.150 27.427  11.040  1.00 10.19  ? 165 THR B CB  1 
ATOM   3730 O OG1 . THR B 1 172 ? -50.144 28.160  11.753  1.00 18.90  ? 165 THR B OG1 1 
ATOM   3731 C CG2 . THR B 1 172 ? -48.442 28.387  10.112  1.00 12.94  ? 165 THR B CG2 1 
ATOM   3732 N N   . ASN B 1 173 ? -50.465 24.811  12.105  1.00 31.71  ? 166 ASN B N   1 
ATOM   3733 C CA  . ASN B 1 173 ? -51.362 24.345  13.164  1.00 14.71  ? 166 ASN B CA  1 
ATOM   3734 C C   . ASN B 1 173 ? -52.619 23.629  12.657  1.00 28.08  ? 166 ASN B C   1 
ATOM   3735 O O   . ASN B 1 173 ? -53.645 23.611  13.332  1.00 36.12  ? 166 ASN B O   1 
ATOM   3736 C CB  . ASN B 1 173 ? -51.747 25.544  14.048  1.00 25.87  ? 166 ASN B CB  1 
ATOM   3737 C CG  . ASN B 1 173 ? -52.273 25.143  15.424  1.00 32.75  ? 166 ASN B CG  1 
ATOM   3738 O OD1 . ASN B 1 173 ? -51.666 24.339  16.131  1.00 40.27  ? 166 ASN B OD1 1 
ATOM   3739 N ND2 . ASN B 1 173 ? -53.407 25.720  15.809  1.00 27.30  ? 166 ASN B ND2 1 
ATOM   3740 N N   . THR B 1 174 ? -52.539 23.035  11.472  1.00 30.24  ? 167 THR B N   1 
ATOM   3741 C CA  . THR B 1 174 ? -53.705 22.429  10.830  1.00 15.52  ? 167 THR B CA  1 
ATOM   3742 C C   . THR B 1 174 ? -53.613 20.910  10.848  1.00 16.82  ? 167 THR B C   1 
ATOM   3743 O O   . THR B 1 174 ? -52.594 20.346  10.443  1.00 32.09  ? 167 THR B O   1 
ATOM   3744 C CB  . THR B 1 174 ? -53.812 22.910  9.361   1.00 25.76  ? 167 THR B CB  1 
ATOM   3745 O OG1 . THR B 1 174 ? -53.981 24.329  9.331   1.00 31.51  ? 167 THR B OG1 1 
ATOM   3746 C CG2 . THR B 1 174 ? -54.986 22.263  8.642   1.00 22.63  ? 167 THR B CG2 1 
ATOM   3747 N N   . PRO B 1 175 ? -54.681 20.234  11.308  1.00 23.57  ? 168 PRO B N   1 
ATOM   3748 C CA  . PRO B 1 175 ? -54.691 18.764  11.302  1.00 24.67  ? 168 PRO B CA  1 
ATOM   3749 C C   . PRO B 1 175 ? -54.509 18.275  9.883   1.00 38.07  ? 168 PRO B C   1 
ATOM   3750 O O   . PRO B 1 175 ? -54.851 18.985  8.939   1.00 42.88  ? 168 PRO B O   1 
ATOM   3751 C CB  . PRO B 1 175 ? -56.102 18.402  11.793  1.00 11.37  ? 168 PRO B CB  1 
ATOM   3752 C CG  . PRO B 1 175 ? -56.614 19.632  12.432  1.00 14.40  ? 168 PRO B CG  1 
ATOM   3753 C CD  . PRO B 1 175 ? -55.971 20.793  11.744  1.00 22.02  ? 168 PRO B CD  1 
ATOM   3754 N N   . LEU B 1 176 ? -53.968 17.079  9.730   1.00 43.62  ? 169 LEU B N   1 
ATOM   3755 C CA  . LEU B 1 176 ? -53.627 16.592  8.407   1.00 32.76  ? 169 LEU B CA  1 
ATOM   3756 C C   . LEU B 1 176 ? -54.841 16.473  7.482   1.00 38.45  ? 169 LEU B C   1 
ATOM   3757 O O   . LEU B 1 176 ? -54.774 16.860  6.310   1.00 36.79  ? 169 LEU B O   1 
ATOM   3758 C CB  . LEU B 1 176 ? -52.893 15.263  8.513   1.00 17.18  ? 169 LEU B CB  1 
ATOM   3759 C CG  . LEU B 1 176 ? -52.388 14.702  7.189   1.00 23.76  ? 169 LEU B CG  1 
ATOM   3760 C CD1 . LEU B 1 176 ? -51.323 15.628  6.570   1.00 13.42  ? 169 LEU B CD1 1 
ATOM   3761 C CD2 . LEU B 1 176 ? -51.861 13.306  7.413   1.00 26.32  ? 169 LEU B CD2 1 
ATOM   3762 N N   . GLU B 1 177 ? -55.947 15.955  8.009   1.00 39.42  ? 170 GLU B N   1 
ATOM   3763 C CA  . GLU B 1 177 ? -57.111 15.695  7.174   1.00 45.83  ? 170 GLU B CA  1 
ATOM   3764 C C   . GLU B 1 177 ? -57.655 17.012  6.625   1.00 38.15  ? 170 GLU B C   1 
ATOM   3765 O O   . GLU B 1 177 ? -58.175 17.060  5.515   1.00 41.47  ? 170 GLU B O   1 
ATOM   3766 C CB  . GLU B 1 177 ? -58.175 14.881  7.929   1.00 53.79  ? 170 GLU B CB  1 
ATOM   3767 C CG  . GLU B 1 177 ? -59.453 15.637  8.286   1.00 79.21  ? 170 GLU B CG  1 
ATOM   3768 C CD  . GLU B 1 177 ? -60.649 15.265  7.405   1.00 97.39  ? 170 GLU B CD  1 
ATOM   3769 O OE1 . GLU B 1 177 ? -61.104 16.122  6.606   1.00 103.33 ? 170 GLU B OE1 1 
ATOM   3770 O OE2 . GLU B 1 177 ? -61.142 14.120  7.524   1.00 99.19  ? 170 GLU B OE2 1 
ATOM   3771 N N   . ASP B 1 178 ? -57.496 18.082  7.394   1.00 24.42  ? 171 ASP B N   1 
ATOM   3772 C CA  . ASP B 1 178 ? -57.848 19.417  6.929   1.00 25.22  ? 171 ASP B CA  1 
ATOM   3773 C C   . ASP B 1 178 ? -56.820 19.973  5.942   1.00 33.57  ? 171 ASP B C   1 
ATOM   3774 O O   . ASP B 1 178 ? -57.167 20.731  5.048   1.00 43.20  ? 171 ASP B O   1 
ATOM   3775 C CB  . ASP B 1 178 ? -57.993 20.376  8.112   1.00 32.06  ? 171 ASP B CB  1 
ATOM   3776 C CG  . ASP B 1 178 ? -59.161 20.021  9.018   1.00 45.10  ? 171 ASP B CG  1 
ATOM   3777 O OD1 . ASP B 1 178 ? -60.269 19.727  8.508   1.00 52.91  ? 171 ASP B OD1 1 
ATOM   3778 O OD2 . ASP B 1 178 ? -58.964 20.034  10.248  1.00 47.43  ? 171 ASP B OD2 1 
ATOM   3779 N N   . GLN B 1 179 ? -55.554 19.610  6.113   1.00 38.52  ? 172 GLN B N   1 
ATOM   3780 C CA  . GLN B 1 179 ? -54.521 20.048  5.187   1.00 29.88  ? 172 GLN B CA  1 
ATOM   3781 C C   . GLN B 1 179 ? -54.808 19.496  3.807   1.00 29.01  ? 172 GLN B C   1 
ATOM   3782 O O   . GLN B 1 179 ? -54.698 20.213  2.825   1.00 35.07  ? 172 GLN B O   1 
ATOM   3783 C CB  . GLN B 1 179 ? -53.133 19.595  5.639   1.00 27.00  ? 172 GLN B CB  1 
ATOM   3784 C CG  . GLN B 1 179 ? -52.548 20.400  6.771   1.00 25.06  ? 172 GLN B CG  1 
ATOM   3785 C CD  . GLN B 1 179 ? -51.147 19.962  7.115   1.00 32.17  ? 172 GLN B CD  1 
ATOM   3786 O OE1 . GLN B 1 179 ? -50.467 19.333  6.302   1.00 27.39  ? 172 GLN B OE1 1 
ATOM   3787 N NE2 . GLN B 1 179 ? -50.706 20.279  8.329   1.00 39.18  ? 172 GLN B NE2 1 
ATOM   3788 N N   . LEU B 1 180 ? -55.182 18.220  3.738   1.00 31.19  ? 173 LEU B N   1 
ATOM   3789 C CA  . LEU B 1 180 ? -55.450 17.559  2.459   1.00 30.85  ? 173 LEU B CA  1 
ATOM   3790 C C   . LEU B 1 180 ? -56.734 18.047  1.771   1.00 28.48  ? 173 LEU B C   1 
ATOM   3791 O O   . LEU B 1 180 ? -56.782 18.169  0.549   1.00 27.82  ? 173 LEU B O   1 
ATOM   3792 C CB  . LEU B 1 180 ? -55.513 16.043  2.633   1.00 21.78  ? 173 LEU B CB  1 
ATOM   3793 C CG  . LEU B 1 180 ? -54.319 15.357  3.283   1.00 29.98  ? 173 LEU B CG  1 
ATOM   3794 C CD1 . LEU B 1 180 ? -54.534 13.860  3.336   1.00 21.51  ? 173 LEU B CD1 1 
ATOM   3795 C CD2 . LEU B 1 180 ? -53.066 15.676  2.521   1.00 39.94  ? 173 LEU B CD2 1 
ATOM   3796 N N   . ARG B 1 181 ? -57.775 18.314  2.548   1.00 20.75  ? 174 ARG B N   1 
ATOM   3797 C CA  . ARG B 1 181 ? -59.010 18.799  1.956   1.00 27.18  ? 174 ARG B CA  1 
ATOM   3798 C C   . ARG B 1 181 ? -58.785 20.190  1.383   1.00 33.49  ? 174 ARG B C   1 
ATOM   3799 O O   . ARG B 1 181 ? -59.192 20.478  0.262   1.00 35.54  ? 174 ARG B O   1 
ATOM   3800 C CB  . ARG B 1 181 ? -60.143 18.805  2.969   1.00 22.55  ? 174 ARG B CB  1 
ATOM   3801 C CG  . ARG B 1 181 ? -61.418 19.446  2.461   1.00 37.74  ? 174 ARG B CG  1 
ATOM   3802 C CD  . ARG B 1 181 ? -62.507 19.480  3.546   1.00 50.09  ? 174 ARG B CD  1 
ATOM   3803 N NE  . ARG B 1 181 ? -61.996 19.782  4.889   1.00 57.29  ? 174 ARG B NE  1 
ATOM   3804 C CZ  . ARG B 1 181 ? -61.819 21.011  5.378   1.00 52.57  ? 174 ARG B CZ  1 
ATOM   3805 N NH1 . ARG B 1 181 ? -62.090 22.085  4.641   1.00 56.99  ? 174 ARG B NH1 1 
ATOM   3806 N NH2 . ARG B 1 181 ? -61.356 21.170  6.609   1.00 39.14  ? 174 ARG B NH2 1 
ATOM   3807 N N   . VAL B 1 182 ? -58.117 21.040  2.152   1.00 22.98  ? 175 VAL B N   1 
ATOM   3808 C CA  . VAL B 1 182 ? -57.791 22.398  1.718   1.00 15.66  ? 175 VAL B CA  1 
ATOM   3809 C C   . VAL B 1 182 ? -56.823 22.407  0.523   1.00 31.24  ? 175 VAL B C   1 
ATOM   3810 O O   . VAL B 1 182 ? -56.906 23.264  -0.359  1.00 38.58  ? 175 VAL B O   1 
ATOM   3811 C CB  . VAL B 1 182 ? -57.209 23.221  2.908   1.00 18.76  ? 175 VAL B CB  1 
ATOM   3812 C CG1 . VAL B 1 182 ? -56.560 24.503  2.442   1.00 13.33  ? 175 VAL B CG1 1 
ATOM   3813 C CG2 . VAL B 1 182 ? -58.298 23.515  3.949   1.00 16.59  ? 175 VAL B CG2 1 
ATOM   3814 N N   . GLY B 1 183 ? -55.915 21.440  0.480   1.00 26.25  ? 176 GLY B N   1 
ATOM   3815 C CA  . GLY B 1 183 ? -54.899 21.409  -0.563  1.00 30.33  ? 176 GLY B CA  1 
ATOM   3816 C C   . GLY B 1 183 ? -55.407 20.881  -1.891  1.00 34.42  ? 176 GLY B C   1 
ATOM   3817 O O   . GLY B 1 183 ? -54.906 21.245  -2.954  1.00 40.45  ? 176 GLY B O   1 
ATOM   3818 N N   . GLU B 1 184 ? -56.397 19.999  -1.819  1.00 33.05  ? 177 GLU B N   1 
ATOM   3819 C CA  . GLU B 1 184 ? -57.099 19.520  -2.989  1.00 27.35  ? 177 GLU B CA  1 
ATOM   3820 C C   . GLU B 1 184 ? -57.808 20.719  -3.606  1.00 33.13  ? 177 GLU B C   1 
ATOM   3821 O O   . GLU B 1 184 ? -57.796 20.905  -4.828  1.00 31.33  ? 177 GLU B O   1 
ATOM   3822 C CB  . GLU B 1 184 ? -58.102 18.449  -2.567  1.00 37.54  ? 177 GLU B CB  1 
ATOM   3823 C CG  . GLU B 1 184 ? -59.028 17.921  -3.655  1.00 55.72  ? 177 GLU B CG  1 
ATOM   3824 C CD  . GLU B 1 184 ? -60.192 17.088  -3.086  1.00 68.54  ? 177 GLU B CD  1 
ATOM   3825 O OE1 . GLU B 1 184 ? -60.617 16.110  -3.748  1.00 73.56  ? 177 GLU B OE1 1 
ATOM   3826 O OE2 . GLU B 1 184 ? -60.691 17.414  -1.981  1.00 64.74  ? 177 GLU B OE2 1 
ATOM   3827 N N   . PHE B 1 185 ? -58.396 21.555  -2.753  1.00 25.82  ? 178 PHE B N   1 
ATOM   3828 C CA  . PHE B 1 185 ? -59.139 22.719  -3.225  1.00 24.84  ? 178 PHE B CA  1 
ATOM   3829 C C   . PHE B 1 185 ? -58.238 23.773  -3.865  1.00 32.69  ? 178 PHE B C   1 
ATOM   3830 O O   . PHE B 1 185 ? -58.529 24.266  -4.952  1.00 27.13  ? 178 PHE B O   1 
ATOM   3831 C CB  . PHE B 1 185 ? -59.979 23.348  -2.106  1.00 23.57  ? 178 PHE B CB  1 
ATOM   3832 C CG  . PHE B 1 185 ? -60.764 24.550  -2.551  1.00 31.23  ? 178 PHE B CG  1 
ATOM   3833 C CD1 . PHE B 1 185 ? -61.949 24.398  -3.250  1.00 39.10  ? 178 PHE B CD1 1 
ATOM   3834 C CD2 . PHE B 1 185 ? -60.304 25.829  -2.300  1.00 36.63  ? 178 PHE B CD2 1 
ATOM   3835 C CE1 . PHE B 1 185 ? -62.662 25.503  -3.681  1.00 41.97  ? 178 PHE B CE1 1 
ATOM   3836 C CE2 . PHE B 1 185 ? -61.016 26.946  -2.732  1.00 43.73  ? 178 PHE B CE2 1 
ATOM   3837 C CZ  . PHE B 1 185 ? -62.196 26.782  -3.416  1.00 42.85  ? 178 PHE B CZ  1 
ATOM   3838 N N   . CYS B 1 186 ? -57.150 24.122  -3.184  1.00 35.27  ? 179 CYS B N   1 
ATOM   3839 C CA  . CYS B 1 186 ? -56.247 25.152  -3.672  1.00 28.72  ? 179 CYS B CA  1 
ATOM   3840 C C   . CYS B 1 186 ? -55.600 24.730  -4.981  1.00 28.64  ? 179 CYS B C   1 
ATOM   3841 O O   . CYS B 1 186 ? -55.404 25.543  -5.878  1.00 27.81  ? 179 CYS B O   1 
ATOM   3842 C CB  . CYS B 1 186 ? -55.173 25.472  -2.635  1.00 31.76  ? 179 CYS B CB  1 
ATOM   3843 S SG  . CYS B 1 186 ? -55.737 26.465  -1.245  1.00 43.51  ? 179 CYS B SG  1 
ATOM   3844 N N   . HIS B 1 187 ? -55.270 23.453  -5.094  1.00 32.94  ? 180 HIS B N   1 
ATOM   3845 C CA  . HIS B 1 187 ? -54.681 22.950  -6.327  1.00 38.05  ? 180 HIS B CA  1 
ATOM   3846 C C   . HIS B 1 187 ? -55.660 23.063  -7.500  1.00 39.77  ? 180 HIS B C   1 
ATOM   3847 O O   . HIS B 1 187 ? -55.272 23.428  -8.609  1.00 39.75  ? 180 HIS B O   1 
ATOM   3848 C CB  . HIS B 1 187 ? -54.220 21.503  -6.154  1.00 35.53  ? 180 HIS B CB  1 
ATOM   3849 C CG  . HIS B 1 187 ? -53.202 21.077  -7.153  1.00 36.36  ? 180 HIS B CG  1 
ATOM   3850 N ND1 . HIS B 1 187 ? -51.863 21.402  -7.041  1.00 44.51  ? 180 HIS B ND1 1 
ATOM   3851 C CD2 . HIS B 1 187 ? -53.306 20.351  -8.290  1.00 37.34  ? 180 HIS B CD2 1 
ATOM   3852 C CE1 . HIS B 1 187 ? -51.197 20.891  -8.055  1.00 39.74  ? 180 HIS B CE1 1 
ATOM   3853 N NE2 . HIS B 1 187 ? -52.052 20.238  -8.828  1.00 37.04  ? 180 HIS B NE2 1 
ATOM   3854 N N   . ASN B 1 188 ? -56.931 22.761  -7.250  1.00 41.89  ? 181 ASN B N   1 
ATOM   3855 C CA  . ASN B 1 188 ? -57.937 22.839  -8.304  1.00 39.91  ? 181 ASN B CA  1 
ATOM   3856 C C   . ASN B 1 188 ? -58.227 24.266  -8.738  1.00 38.18  ? 181 ASN B C   1 
ATOM   3857 O O   . ASN B 1 188 ? -58.565 24.502  -9.889  1.00 41.60  ? 181 ASN B O   1 
ATOM   3858 C CB  . ASN B 1 188 ? -59.236 22.145  -7.893  1.00 37.77  ? 181 ASN B CB  1 
ATOM   3859 C CG  . ASN B 1 188 ? -59.075 20.648  -7.757  1.00 35.33  ? 181 ASN B CG  1 
ATOM   3860 O OD1 . ASN B 1 188 ? -58.216 20.054  -8.398  1.00 40.44  ? 181 ASN B OD1 1 
ATOM   3861 N ND2 . ASN B 1 188 ? -59.900 20.029  -6.910  1.00 33.69  ? 181 ASN B ND2 1 
ATOM   3862 N N   . ARG B 1 189 ? -58.087 25.215  -7.822  1.00 35.62  ? 182 ARG B N   1 
ATOM   3863 C CA  . ARG B 1 189 ? -58.335 26.616  -8.145  1.00 34.13  ? 182 ARG B CA  1 
ATOM   3864 C C   . ARG B 1 189 ? -57.077 27.380  -8.587  1.00 28.53  ? 182 ARG B C   1 
ATOM   3865 O O   . ARG B 1 189 ? -57.162 28.536  -9.006  1.00 32.72  ? 182 ARG B O   1 
ATOM   3866 C CB  . ARG B 1 189 ? -58.977 27.329  -6.957  1.00 31.41  ? 182 ARG B CB  1 
ATOM   3867 C CG  . ARG B 1 189 ? -60.251 26.695  -6.503  1.00 38.35  ? 182 ARG B CG  1 
ATOM   3868 C CD  . ARG B 1 189 ? -61.250 26.652  -7.636  1.00 44.69  ? 182 ARG B CD  1 
ATOM   3869 N NE  . ARG B 1 189 ? -62.476 27.374  -7.296  1.00 52.12  ? 182 ARG B NE  1 
ATOM   3870 C CZ  . ARG B 1 189 ? -63.600 26.793  -6.884  1.00 53.46  ? 182 ARG B CZ  1 
ATOM   3871 N NH1 . ARG B 1 189 ? -63.661 25.464  -6.760  1.00 45.11  ? 182 ARG B NH1 1 
ATOM   3872 N NH2 . ARG B 1 189 ? -64.663 27.543  -6.599  1.00 51.45  ? 182 ARG B NH2 1 
ATOM   3873 N N   . GLY B 1 190 ? -55.913 26.749  -8.491  1.00 25.29  ? 183 GLY B N   1 
ATOM   3874 C CA  . GLY B 1 190 ? -54.666 27.453  -8.739  1.00 19.70  ? 183 GLY B CA  1 
ATOM   3875 C C   . GLY B 1 190 ? -54.252 28.446  -7.661  1.00 19.51  ? 183 GLY B C   1 
ATOM   3876 O O   . GLY B 1 190 ? -53.529 29.406  -7.934  1.00 24.53  ? 183 GLY B O   1 
ATOM   3877 N N   . ILE B 1 191 ? -54.733 28.228  -6.440  1.00 27.34  ? 184 ILE B N   1 
ATOM   3878 C CA  . ILE B 1 191 ? -54.313 29.001  -5.278  1.00 19.88  ? 184 ILE B CA  1 
ATOM   3879 C C   . ILE B 1 191 ? -53.039 28.325  -4.814  1.00 20.16  ? 184 ILE B C   1 
ATOM   3880 O O   . ILE B 1 191 ? -52.986 27.098  -4.710  1.00 22.88  ? 184 ILE B O   1 
ATOM   3881 C CB  . ILE B 1 191 ? -55.395 28.964  -4.181  1.00 18.89  ? 184 ILE B CB  1 
ATOM   3882 C CG1 . ILE B 1 191 ? -56.710 29.549  -4.724  1.00 19.67  ? 184 ILE B CG1 1 
ATOM   3883 C CG2 . ILE B 1 191 ? -54.929 29.666  -2.908  1.00 6.19   ? 184 ILE B CG2 1 
ATOM   3884 C CD1 . ILE B 1 191 ? -57.905 29.378  -3.795  1.00 15.83  ? 184 ILE B CD1 1 
ATOM   3885 N N   . LYS B 1 192 ? -51.992 29.108  -4.585  1.00 16.03  ? 185 LYS B N   1 
ATOM   3886 C CA  . LYS B 1 192 ? -50.699 28.550  -4.191  1.00 19.57  ? 185 LYS B CA  1 
ATOM   3887 C C   . LYS B 1 192 ? -50.658 28.234  -2.703  1.00 13.34  ? 185 LYS B C   1 
ATOM   3888 O O   . LYS B 1 192 ? -51.008 29.078  -1.895  1.00 16.51  ? 185 LYS B O   1 
ATOM   3889 C CB  . LYS B 1 192 ? -49.584 29.526  -4.571  1.00 24.48  ? 185 LYS B CB  1 
ATOM   3890 C CG  . LYS B 1 192 ? -49.372 29.583  -6.058  1.00 23.22  ? 185 LYS B CG  1 
ATOM   3891 C CD  . LYS B 1 192 ? -48.478 30.703  -6.467  1.00 24.02  ? 185 LYS B CD  1 
ATOM   3892 C CE  . LYS B 1 192 ? -48.905 31.205  -7.822  1.00 38.31  ? 185 LYS B CE  1 
ATOM   3893 N NZ  . LYS B 1 192 ? -47.920 32.162  -8.396  1.00 60.88  ? 185 LYS B NZ  1 
ATOM   3894 N N   . LEU B 1 193 ? -50.218 27.029  -2.348  1.00 26.60  ? 186 LEU B N   1 
ATOM   3895 C CA  . LEU B 1 193 ? -50.249 26.546  -0.957  1.00 22.54  ? 186 LEU B CA  1 
ATOM   3896 C C   . LEU B 1 193 ? -48.866 26.416  -0.314  1.00 19.20  ? 186 LEU B C   1 
ATOM   3897 O O   . LEU B 1 193 ? -47.945 25.877  -0.915  1.00 33.05  ? 186 LEU B O   1 
ATOM   3898 C CB  . LEU B 1 193 ? -50.930 25.175  -0.909  1.00 20.15  ? 186 LEU B CB  1 
ATOM   3899 C CG  . LEU B 1 193 ? -51.240 24.523  0.430   1.00 18.20  ? 186 LEU B CG  1 
ATOM   3900 C CD1 . LEU B 1 193 ? -52.370 25.254  1.050   1.00 24.70  ? 186 LEU B CD1 1 
ATOM   3901 C CD2 . LEU B 1 193 ? -51.605 23.076  0.272   1.00 35.73  ? 186 LEU B CD2 1 
ATOM   3902 N N   . VAL B 1 194 ? -48.733 26.891  0.918   1.00 25.77  ? 187 VAL B N   1 
ATOM   3903 C CA  . VAL B 1 194 ? -47.549 26.613  1.747   1.00 25.17  ? 187 VAL B CA  1 
ATOM   3904 C C   . VAL B 1 194 ? -47.928 25.993  3.111   1.00 26.80  ? 187 VAL B C   1 
ATOM   3905 O O   . VAL B 1 194 ? -48.701 26.570  3.866   1.00 23.59  ? 187 VAL B O   1 
ATOM   3906 C CB  . VAL B 1 194 ? -46.712 27.893  1.990   1.00 16.13  ? 187 VAL B CB  1 
ATOM   3907 C CG1 . VAL B 1 194 ? -45.632 27.640  3.029   1.00 17.06  ? 187 VAL B CG1 1 
ATOM   3908 C CG2 . VAL B 1 194 ? -46.108 28.409  0.679   1.00 17.49  ? 187 VAL B CG2 1 
ATOM   3909 N N   . VAL B 1 195 ? -47.382 24.826  3.428   1.00 33.61  ? 188 VAL B N   1 
ATOM   3910 C CA  . VAL B 1 195 ? -47.634 24.192  4.723   1.00 27.27  ? 188 VAL B CA  1 
ATOM   3911 C C   . VAL B 1 195 ? -46.373 24.213  5.578   1.00 28.72  ? 188 VAL B C   1 
ATOM   3912 O O   . VAL B 1 195 ? -45.317 23.750  5.162   1.00 31.39  ? 188 VAL B O   1 
ATOM   3913 C CB  . VAL B 1 195 ? -48.084 22.742  4.532   1.00 19.61  ? 188 VAL B CB  1 
ATOM   3914 C CG1 . VAL B 1 195 ? -48.449 22.093  5.870   1.00 10.04  ? 188 VAL B CG1 1 
ATOM   3915 C CG2 . VAL B 1 195 ? -49.244 22.707  3.562   1.00 13.69  ? 188 VAL B CG2 1 
ATOM   3916 N N   . ALA B 1 196 ? -46.485 24.752  6.780   1.00 32.99  ? 189 ALA B N   1 
ATOM   3917 C CA  . ALA B 1 196 ? -45.323 24.923  7.633   1.00 27.41  ? 189 ALA B CA  1 
ATOM   3918 C C   . ALA B 1 196 ? -45.576 24.381  9.030   1.00 29.15  ? 189 ALA B C   1 
ATOM   3919 O O   . ALA B 1 196 ? -46.597 24.693  9.645   1.00 30.33  ? 189 ALA B O   1 
ATOM   3920 C CB  . ALA B 1 196 ? -44.960 26.379  7.708   1.00 24.12  ? 189 ALA B CB  1 
ATOM   3921 N N   . ASP B 1 197 ? -44.631 23.593  9.538   1.00 25.89  ? 190 ASP B N   1 
ATOM   3922 C CA  . ASP B 1 197 ? -44.788 23.008  10.857  1.00 32.55  ? 190 ASP B CA  1 
ATOM   3923 C C   . ASP B 1 197 ? -43.531 22.930  11.726  1.00 29.69  ? 190 ASP B C   1 
ATOM   3924 O O   . ASP B 1 197 ? -42.417 22.829  11.238  1.00 28.71  ? 190 ASP B O   1 
ATOM   3925 C CB  . ASP B 1 197 ? -45.384 21.617  10.731  1.00 53.15  ? 190 ASP B CB  1 
ATOM   3926 C CG  . ASP B 1 197 ? -46.210 21.251  11.926  1.00 65.97  ? 190 ASP B CG  1 
ATOM   3927 O OD1 . ASP B 1 197 ? -46.824 22.178  12.497  1.00 71.13  ? 190 ASP B OD1 1 
ATOM   3928 O OD2 . ASP B 1 197 ? -46.240 20.055  12.291  1.00 67.68  ? 190 ASP B OD2 1 
ATOM   3929 N N   . THR B 1 198 ? -43.743 22.935  13.034  1.00 35.12  ? 191 THR B N   1 
ATOM   3930 C CA  . THR B 1 198 ? -42.670 22.741  14.002  1.00 23.10  ? 191 THR B CA  1 
ATOM   3931 C C   . THR B 1 198 ? -43.099 21.700  15.029  1.00 25.13  ? 191 THR B C   1 
ATOM   3932 O O   . THR B 1 198 ? -44.184 21.785  15.598  1.00 40.09  ? 191 THR B O   1 
ATOM   3933 C CB  . THR B 1 198 ? -42.316 24.068  14.697  1.00 27.33  ? 191 THR B CB  1 
ATOM   3934 O OG1 . THR B 1 198 ? -41.300 24.732  13.941  1.00 34.78  ? 191 THR B OG1 1 
ATOM   3935 C CG2 . THR B 1 198 ? -41.819 23.852  16.128  1.00 47.65  ? 191 THR B CG2 1 
ATOM   3936 N N   . ARG B 1 199 ? -42.260 20.695  15.226  1.00 24.27  ? 192 ARG B N   1 
ATOM   3937 C CA  . ARG B 1 199 ? -42.420 19.745  16.318  1.00 30.04  ? 192 ARG B CA  1 
ATOM   3938 C C   . ARG B 1 199 ? -41.136 19.791  17.115  1.00 29.07  ? 192 ARG B C   1 
ATOM   3939 O O   . ARG B 1 199 ? -40.166 19.130  16.765  1.00 35.20  ? 192 ARG B O   1 
ATOM   3940 C CB  . ARG B 1 199 ? -42.628 18.335  15.778  1.00 28.25  ? 192 ARG B CB  1 
ATOM   3941 C CG  . ARG B 1 199 ? -43.894 18.191  15.003  1.00 28.15  ? 192 ARG B CG  1 
ATOM   3942 C CD  . ARG B 1 199 ? -45.068 18.670  15.829  1.00 24.06  ? 192 ARG B CD  1 
ATOM   3943 N NE  . ARG B 1 199 ? -46.223 18.911  14.972  1.00 35.66  ? 192 ARG B NE  1 
ATOM   3944 C CZ  . ARG B 1 199 ? -47.393 18.294  15.083  1.00 35.86  ? 192 ARG B CZ  1 
ATOM   3945 N NH1 . ARG B 1 199 ? -47.587 17.401  16.043  1.00 38.12  ? 192 ARG B NH1 1 
ATOM   3946 N NH2 . ARG B 1 199 ? -48.371 18.588  14.238  1.00 38.26  ? 192 ARG B NH2 1 
ATOM   3947 N N   . GLY B 1 200 ? -41.124 20.595  18.170  1.00 34.59  ? 193 GLY B N   1 
ATOM   3948 C CA  . GLY B 1 200 ? -39.905 20.850  18.918  1.00 35.01  ? 193 GLY B CA  1 
ATOM   3949 C C   . GLY B 1 200 ? -38.728 21.309  18.076  1.00 32.94  ? 193 GLY B C   1 
ATOM   3950 O O   . GLY B 1 200 ? -38.769 22.421  17.530  1.00 43.71  ? 193 GLY B O   1 
ATOM   3951 N N   . LEU B 1 201 ? -37.698 20.458  17.962  1.00 25.66  ? 194 LEU B N   1 
ATOM   3952 C CA  . LEU B 1 201 ? -36.486 20.777  17.194  1.00 26.87  ? 194 LEU B CA  1 
ATOM   3953 C C   . LEU B 1 201 ? -36.622 20.479  15.700  1.00 37.73  ? 194 LEU B C   1 
ATOM   3954 O O   . LEU B 1 201 ? -35.788 20.910  14.895  1.00 40.28  ? 194 LEU B O   1 
ATOM   3955 C CB  . LEU B 1 201 ? -35.260 20.039  17.727  1.00 29.19  ? 194 LEU B CB  1 
ATOM   3956 C CG  . LEU B 1 201 ? -35.134 19.655  19.198  1.00 37.08  ? 194 LEU B CG  1 
ATOM   3957 C CD1 . LEU B 1 201 ? -33.927 18.757  19.384  1.00 46.07  ? 194 LEU B CD1 1 
ATOM   3958 C CD2 . LEU B 1 201 ? -35.005 20.882  20.064  1.00 34.83  ? 194 LEU B CD2 1 
ATOM   3959 N N   . PHE B 1 202 ? -37.665 19.746  15.327  1.00 35.88  ? 195 PHE B N   1 
ATOM   3960 C CA  . PHE B 1 202 ? -37.884 19.419  13.922  1.00 36.45  ? 195 PHE B CA  1 
ATOM   3961 C C   . PHE B 1 202 ? -38.807 20.406  13.237  1.00 34.44  ? 195 PHE B C   1 
ATOM   3962 O O   . PHE B 1 202 ? -39.831 20.798  13.798  1.00 36.40  ? 195 PHE B O   1 
ATOM   3963 C CB  . PHE B 1 202 ? -38.430 18.000  13.774  1.00 35.20  ? 195 PHE B CB  1 
ATOM   3964 C CG  . PHE B 1 202 ? -37.537 16.959  14.366  1.00 29.62  ? 195 PHE B CG  1 
ATOM   3965 C CD1 . PHE B 1 202 ? -37.837 16.387  15.588  1.00 26.07  ? 195 PHE B CD1 1 
ATOM   3966 C CD2 . PHE B 1 202 ? -36.368 16.584  13.716  1.00 24.73  ? 195 PHE B CD2 1 
ATOM   3967 C CE1 . PHE B 1 202 ? -36.994 15.445  16.152  1.00 35.39  ? 195 PHE B CE1 1 
ATOM   3968 C CE2 . PHE B 1 202 ? -35.528 15.640  14.264  1.00 27.01  ? 195 PHE B CE2 1 
ATOM   3969 C CZ  . PHE B 1 202 ? -35.834 15.070  15.491  1.00 34.07  ? 195 PHE B CZ  1 
ATOM   3970 N N   . GLY B 1 203 ? -38.424 20.811  12.028  1.00 24.19  ? 196 GLY B N   1 
ATOM   3971 C CA  . GLY B 1 203 ? -39.252 21.659  11.189  1.00 16.00  ? 196 GLY B CA  1 
ATOM   3972 C C   . GLY B 1 203 ? -39.672 20.958  9.904   1.00 29.25  ? 196 GLY B C   1 
ATOM   3973 O O   . GLY B 1 203 ? -38.947 20.111  9.382   1.00 27.83  ? 196 GLY B O   1 
ATOM   3974 N N   . GLN B 1 204 ? -40.851 21.311  9.396   1.00 30.62  ? 197 GLN B N   1 
ATOM   3975 C CA  . GLN B 1 204 ? -41.352 20.776  8.133   1.00 26.91  ? 197 GLN B CA  1 
ATOM   3976 C C   . GLN B 1 204 ? -41.876 21.889  7.239   1.00 27.28  ? 197 GLN B C   1 
ATOM   3977 O O   . GLN B 1 204 ? -42.615 22.763  7.699   1.00 22.43  ? 197 GLN B O   1 
ATOM   3978 C CB  . GLN B 1 204 ? -42.483 19.786  8.375   1.00 28.11  ? 197 GLN B CB  1 
ATOM   3979 C CG  . GLN B 1 204 ? -43.305 19.536  7.121   1.00 29.06  ? 197 GLN B CG  1 
ATOM   3980 C CD  . GLN B 1 204 ? -44.626 18.873  7.402   1.00 34.14  ? 197 GLN B CD  1 
ATOM   3981 O OE1 . GLN B 1 204 ? -45.626 19.542  7.672   1.00 37.13  ? 197 GLN B OE1 1 
ATOM   3982 N NE2 . GLN B 1 204 ? -44.644 17.548  7.334   1.00 29.93  ? 197 GLN B NE2 1 
ATOM   3983 N N   . LEU B 1 205 ? -41.511 21.846  5.961   1.00 25.42  ? 198 LEU B N   1 
ATOM   3984 C CA  . LEU B 1 205 ? -41.892 22.899  5.031   1.00 20.43  ? 198 LEU B CA  1 
ATOM   3985 C C   . LEU B 1 205 ? -42.348 22.298  3.700   1.00 18.23  ? 198 LEU B C   1 
ATOM   3986 O O   . LEU B 1 205 ? -41.679 21.426  3.141   1.00 20.80  ? 198 LEU B O   1 
ATOM   3987 C CB  . LEU B 1 205 ? -40.720 23.858  4.844   1.00 26.71  ? 198 LEU B CB  1 
ATOM   3988 C CG  . LEU B 1 205 ? -41.025 25.348  4.773   1.00 33.28  ? 198 LEU B CG  1 
ATOM   3989 C CD1 . LEU B 1 205 ? -41.879 25.629  3.573   1.00 36.67  ? 198 LEU B CD1 1 
ATOM   3990 C CD2 . LEU B 1 205 ? -41.755 25.768  6.001   1.00 34.44  ? 198 LEU B CD2 1 
ATOM   3991 N N   . PHE B 1 206 ? -43.510 22.743  3.221   1.00 17.14  ? 199 PHE B N   1 
ATOM   3992 C CA  . PHE B 1 206 ? -44.093 22.229  1.979   1.00 16.68  ? 199 PHE B CA  1 
ATOM   3993 C C   . PHE B 1 206 ? -44.615 23.338  1.079   1.00 22.67  ? 199 PHE B C   1 
ATOM   3994 O O   . PHE B 1 206 ? -45.207 24.308  1.553   1.00 18.74  ? 199 PHE B O   1 
ATOM   3995 C CB  . PHE B 1 206 ? -45.240 21.253  2.249   1.00 22.56  ? 199 PHE B CB  1 
ATOM   3996 C CG  . PHE B 1 206 ? -45.942 20.797  0.997   1.00 26.75  ? 199 PHE B CG  1 
ATOM   3997 C CD1 . PHE B 1 206 ? -45.411 19.785  0.225   1.00 34.66  ? 199 PHE B CD1 1 
ATOM   3998 C CD2 . PHE B 1 206 ? -47.113 21.400  0.575   1.00 22.51  ? 199 PHE B CD2 1 
ATOM   3999 C CE1 . PHE B 1 206 ? -46.043 19.366  -0.941  1.00 31.93  ? 199 PHE B CE1 1 
ATOM   4000 C CE2 . PHE B 1 206 ? -47.748 20.982  -0.582  1.00 27.11  ? 199 PHE B CE2 1 
ATOM   4001 C CZ  . PHE B 1 206 ? -47.212 19.965  -1.340  1.00 30.72  ? 199 PHE B CZ  1 
ATOM   4002 N N   . CYS B 1 207 ? -44.420 23.174  -0.226  1.00 22.81  ? 200 CYS B N   1 
ATOM   4003 C CA  . CYS B 1 207 ? -44.912 24.149  -1.191  1.00 24.18  ? 200 CYS B CA  1 
ATOM   4004 C C   . CYS B 1 207 ? -45.599 23.509  -2.395  1.00 24.12  ? 200 CYS B C   1 
ATOM   4005 O O   . CYS B 1 207 ? -45.054 22.603  -3.000  1.00 31.22  ? 200 CYS B O   1 
ATOM   4006 C CB  . CYS B 1 207 ? -43.771 25.053  -1.644  1.00 22.86  ? 200 CYS B CB  1 
ATOM   4007 S SG  . CYS B 1 207 ? -43.321 26.287  -0.398  1.00 26.80  ? 200 CYS B SG  1 
ATOM   4008 N N   . ASP B 1 208 ? -46.811 23.967  -2.711  1.00 21.00  ? 201 ASP B N   1 
ATOM   4009 C CA  . ASP B 1 208 ? -47.468 23.639  -3.975  1.00 24.35  ? 201 ASP B CA  1 
ATOM   4010 C C   . ASP B 1 208 ? -47.856 24.924  -4.698  1.00 31.07  ? 201 ASP B C   1 
ATOM   4011 O O   . ASP B 1 208 ? -48.832 25.589  -4.335  1.00 30.16  ? 201 ASP B O   1 
ATOM   4012 C CB  . ASP B 1 208 ? -48.705 22.755  -3.781  1.00 27.25  ? 201 ASP B CB  1 
ATOM   4013 C CG  . ASP B 1 208 ? -49.557 22.634  -5.068  1.00 34.63  ? 201 ASP B CG  1 
ATOM   4014 O OD1 . ASP B 1 208 ? -49.051 22.928  -6.172  1.00 37.32  ? 201 ASP B OD1 1 
ATOM   4015 O OD2 . ASP B 1 208 ? -50.741 22.241  -4.989  1.00 23.82  ? 201 ASP B OD2 1 
ATOM   4016 N N   . PHE B 1 209 ? -47.101 25.255  -5.740  1.00 24.77  ? 202 PHE B N   1 
ATOM   4017 C CA  . PHE B 1 209 ? -47.319 26.506  -6.460  1.00 21.20  ? 202 PHE B CA  1 
ATOM   4018 C C   . PHE B 1 209 ? -48.062 26.228  -7.759  1.00 28.72  ? 202 PHE B C   1 
ATOM   4019 O O   . PHE B 1 209 ? -48.084 27.058  -8.665  1.00 32.47  ? 202 PHE B O   1 
ATOM   4020 C CB  . PHE B 1 209 ? -45.992 27.212  -6.765  1.00 27.32  ? 202 PHE B CB  1 
ATOM   4021 C CG  . PHE B 1 209 ? -45.364 27.911  -5.586  1.00 33.12  ? 202 PHE B CG  1 
ATOM   4022 C CD1 . PHE B 1 209 ? -45.702 27.582  -4.282  1.00 34.99  ? 202 PHE B CD1 1 
ATOM   4023 C CD2 . PHE B 1 209 ? -44.417 28.905  -5.791  1.00 37.99  ? 202 PHE B CD2 1 
ATOM   4024 C CE1 . PHE B 1 209 ? -45.108 28.226  -3.223  1.00 19.13  ? 202 PHE B CE1 1 
ATOM   4025 C CE2 . PHE B 1 209 ? -43.829 29.559  -4.723  1.00 29.11  ? 202 PHE B CE2 1 
ATOM   4026 C CZ  . PHE B 1 209 ? -44.173 29.216  -3.445  1.00 15.95  ? 202 PHE B CZ  1 
ATOM   4027 N N   . GLY B 1 210 ? -48.671 25.054  -7.852  1.00 36.39  ? 203 GLY B N   1 
ATOM   4028 C CA  . GLY B 1 210 ? -49.468 24.726  -9.011  1.00 42.12  ? 203 GLY B CA  1 
ATOM   4029 C C   . GLY B 1 210 ? -48.634 24.219  -10.167 1.00 58.24  ? 203 GLY B C   1 
ATOM   4030 O O   . GLY B 1 210 ? -47.442 24.484  -10.270 1.00 45.62  ? 203 GLY B O   1 
ATOM   4031 N N   . GLU B 1 211 ? -49.281 23.475  -11.053 1.00 102.29 ? 204 GLU B N   1 
ATOM   4032 C CA  . GLU B 1 211 ? -48.647 22.995  -12.277 1.00 127.08 ? 204 GLU B CA  1 
ATOM   4033 C C   . GLU B 1 211 ? -48.405 24.167  -13.228 1.00 128.36 ? 204 GLU B C   1 
ATOM   4034 O O   . GLU B 1 211 ? -47.897 24.001  -14.338 1.00 134.12 ? 204 GLU B O   1 
ATOM   4035 C CB  . GLU B 1 211 ? -49.535 21.934  -12.937 1.00 138.96 ? 204 GLU B CB  1 
ATOM   4036 C CG  . GLU B 1 211 ? -49.840 20.739  -12.033 1.00 145.32 ? 204 GLU B CG  1 
ATOM   4037 C CD  . GLU B 1 211 ? -50.870 19.798  -12.626 1.00 147.37 ? 204 GLU B CD  1 
ATOM   4038 O OE1 . GLU B 1 211 ? -51.464 19.009  -11.861 1.00 142.98 ? 204 GLU B OE1 1 
ATOM   4039 O OE2 . GLU B 1 211 ? -51.083 19.847  -13.857 1.00 149.76 ? 204 GLU B OE2 1 
ATOM   4040 N N   . GLU B 1 212 ? -48.775 25.352  -12.756 1.00 114.53 ? 205 GLU B N   1 
ATOM   4041 C CA  . GLU B 1 212 ? -48.707 26.576  -13.523 1.00 112.67 ? 205 GLU B CA  1 
ATOM   4042 C C   . GLU B 1 212 ? -47.439 27.340  -13.215 1.00 87.99  ? 205 GLU B C   1 
ATOM   4043 O O   . GLU B 1 212 ? -47.288 28.489  -13.629 1.00 101.28 ? 205 GLU B O   1 
ATOM   4044 C CB  . GLU B 1 212 ? -49.920 27.460  -13.199 1.00 129.51 ? 205 GLU B CB  1 
ATOM   4045 C CG  . GLU B 1 212 ? -50.362 27.437  -11.723 1.00 135.40 ? 205 GLU B CG  1 
ATOM   4046 C CD  . GLU B 1 212 ? -49.753 28.550  -10.874 1.00 131.61 ? 205 GLU B CD  1 
ATOM   4047 O OE1 . GLU B 1 212 ? -50.255 28.776  -9.752  1.00 122.87 ? 205 GLU B OE1 1 
ATOM   4048 O OE2 . GLU B 1 212 ? -48.781 29.196  -11.320 1.00 132.67 ? 205 GLU B OE2 1 
ATOM   4049 N N   . MET B 1 213 ? -46.514 26.727  -12.494 1.00 44.02  ? 206 MET B N   1 
ATOM   4050 C CA  . MET B 1 213 ? -45.374 27.521  -12.041 1.00 49.42  ? 206 MET B CA  1 
ATOM   4051 C C   . MET B 1 213 ? -44.200 27.602  -13.022 1.00 50.46  ? 206 MET B C   1 
ATOM   4052 O O   . MET B 1 213 ? -43.682 26.596  -13.513 1.00 51.07  ? 206 MET B O   1 
ATOM   4053 C CB  . MET B 1 213 ? -44.919 27.123  -10.631 1.00 52.18  ? 206 MET B CB  1 
ATOM   4054 C CG  . MET B 1 213 ? -43.927 28.094  -9.968  1.00 54.39  ? 206 MET B CG  1 
ATOM   4055 S SD  . MET B 1 213 ? -44.459 29.818  -9.753  1.00 76.24  ? 206 MET B SD  1 
ATOM   4056 C CE  . MET B 1 213 ? -46.200 29.641  -9.402  1.00 65.82  ? 206 MET B CE  1 
ATOM   4057 N N   . ILE B 1 214 ? -43.796 28.836  -13.284 1.00 48.12  ? 207 ILE B N   1 
ATOM   4058 C CA  . ILE B 1 214 ? -42.724 29.149  -14.208 1.00 42.12  ? 207 ILE B CA  1 
ATOM   4059 C C   . ILE B 1 214 ? -41.596 29.791  -13.442 1.00 39.77  ? 207 ILE B C   1 
ATOM   4060 O O   . ILE B 1 214 ? -41.828 30.705  -12.646 1.00 45.21  ? 207 ILE B O   1 
ATOM   4061 C CB  . ILE B 1 214 ? -43.215 30.168  -15.194 1.00 61.40  ? 207 ILE B CB  1 
ATOM   4062 C CG1 . ILE B 1 214 ? -42.070 31.037  -15.692 1.00 68.52  ? 207 ILE B CG1 1 
ATOM   4063 C CG2 . ILE B 1 214 ? -44.278 31.044  -14.536 1.00 83.67  ? 207 ILE B CG2 1 
ATOM   4064 C CD1 . ILE B 1 214 ? -42.539 32.169  -16.573 1.00 82.20  ? 207 ILE B CD1 1 
ATOM   4065 N N   . LEU B 1 215 ? -40.373 29.322  -13.655 1.00 37.59  ? 208 LEU B N   1 
ATOM   4066 C CA  . LEU B 1 215 ? -39.260 29.916  -12.941 1.00 40.09  ? 208 LEU B CA  1 
ATOM   4067 C C   . LEU B 1 215 ? -37.961 29.807  -13.676 1.00 44.01  ? 208 LEU B C   1 
ATOM   4068 O O   . LEU B 1 215 ? -37.759 28.886  -14.459 1.00 53.50  ? 208 LEU B O   1 
ATOM   4069 C CB  . LEU B 1 215 ? -39.115 29.279  -11.574 1.00 47.57  ? 208 LEU B CB  1 
ATOM   4070 C CG  . LEU B 1 215 ? -39.351 27.785  -11.664 1.00 41.70  ? 208 LEU B CG  1 
ATOM   4071 C CD1 . LEU B 1 215 ? -38.038 27.014  -11.815 1.00 29.68  ? 208 LEU B CD1 1 
ATOM   4072 C CD2 . LEU B 1 215 ? -40.145 27.382  -10.430 1.00 46.92  ? 208 LEU B CD2 1 
ATOM   4073 N N   . THR B 1 216 ? -37.065 30.744  -13.389 1.00 44.27  ? 209 THR B N   1 
ATOM   4074 C CA  . THR B 1 216 ? -35.797 30.832  -14.096 1.00 52.19  ? 209 THR B CA  1 
ATOM   4075 C C   . THR B 1 216 ? -34.719 29.984  -13.410 1.00 59.01  ? 209 THR B C   1 
ATOM   4076 O O   . THR B 1 216 ? -34.740 29.818  -12.191 1.00 65.97  ? 209 THR B O   1 
ATOM   4077 C CB  . THR B 1 216 ? -35.358 32.329  -14.315 1.00 49.64  ? 209 THR B CB  1 
ATOM   4078 O OG1 . THR B 1 216 ? -35.755 33.135  -13.203 1.00 49.21  ? 209 THR B OG1 1 
ATOM   4079 C CG2 . THR B 1 216 ? -36.020 32.915  -15.561 1.00 35.08  ? 209 THR B CG2 1 
ATOM   4080 N N   . ASP B 1 217 ? -33.794 29.430  -14.194 1.00 63.27  ? 210 ASP B N   1 
ATOM   4081 C CA  . ASP B 1 217 ? -32.726 28.600  -13.637 1.00 59.82  ? 210 ASP B CA  1 
ATOM   4082 C C   . ASP B 1 217 ? -31.487 28.504  -14.524 1.00 56.79  ? 210 ASP B C   1 
ATOM   4083 O O   . ASP B 1 217 ? -31.554 28.773  -15.716 1.00 63.07  ? 210 ASP B O   1 
ATOM   4084 C CB  . ASP B 1 217 ? -33.258 27.205  -13.359 1.00 55.64  ? 210 ASP B CB  1 
ATOM   4085 C CG  . ASP B 1 217 ? -34.091 26.687  -14.487 1.00 59.67  ? 210 ASP B CG  1 
ATOM   4086 O OD1 . ASP B 1 217 ? -35.164 26.104  -14.223 1.00 61.34  ? 210 ASP B OD1 1 
ATOM   4087 O OD2 . ASP B 1 217 ? -33.678 26.880  -15.646 1.00 67.37  ? 210 ASP B OD2 1 
ATOM   4088 N N   . SER B 1 218 ? -30.363 28.111  -13.923 1.00 54.45  ? 211 SER B N   1 
ATOM   4089 C CA  . SER B 1 218 ? -29.103 27.932  -14.633 1.00 43.89  ? 211 SER B CA  1 
ATOM   4090 C C   . SER B 1 218 ? -29.234 26.815  -15.649 1.00 42.84  ? 211 SER B C   1 
ATOM   4091 O O   . SER B 1 218 ? -28.897 26.995  -16.818 1.00 62.24  ? 211 SER B O   1 
ATOM   4092 C CB  . SER B 1 218 ? -27.968 27.610  -13.652 1.00 49.06  ? 211 SER B CB  1 
ATOM   4093 O OG  . SER B 1 218 ? -27.809 28.631  -12.683 1.00 48.70  ? 211 SER B OG  1 
ATOM   4094 N N   . GLN B 1 222 ? -19.733 26.053  -20.065 1.00 80.76  ? 215 GLN B N   1 
ATOM   4095 C CA  . GLN B 1 222 ? -20.995 25.343  -20.288 1.00 79.39  ? 215 GLN B CA  1 
ATOM   4096 C C   . GLN B 1 222 ? -22.281 26.199  -20.469 1.00 107.48 ? 215 GLN B C   1 
ATOM   4097 O O   . GLN B 1 222 ? -23.283 25.680  -20.972 1.00 111.26 ? 215 GLN B O   1 
ATOM   4098 C CB  . GLN B 1 222 ? -21.191 24.226  -19.244 1.00 79.44  ? 215 GLN B CB  1 
ATOM   4099 C CG  . GLN B 1 222 ? -21.012 24.660  -17.785 1.00 89.01  ? 215 GLN B CG  1 
ATOM   4100 C CD  . GLN B 1 222 ? -22.329 25.026  -17.100 1.00 95.09  ? 215 GLN B CD  1 
ATOM   4101 O OE1 . GLN B 1 222 ? -23.400 24.537  -17.473 1.00 98.16  ? 215 GLN B OE1 1 
ATOM   4102 N NE2 . GLN B 1 222 ? -22.249 25.893  -16.092 1.00 88.79  ? 215 GLN B NE2 1 
ATOM   4103 N N   . PRO B 1 223 ? -22.275 27.492  -20.055 1.00 97.77  ? 216 PRO B N   1 
ATOM   4104 C CA  . PRO B 1 223 ? -23.443 28.291  -20.469 1.00 90.60  ? 216 PRO B CA  1 
ATOM   4105 C C   . PRO B 1 223 ? -23.383 28.784  -21.930 1.00 85.34  ? 216 PRO B C   1 
ATOM   4106 O O   . PRO B 1 223 ? -22.319 29.202  -22.403 1.00 81.58  ? 216 PRO B O   1 
ATOM   4107 C CB  . PRO B 1 223 ? -23.421 29.491  -19.503 1.00 78.95  ? 216 PRO B CB  1 
ATOM   4108 C CG  . PRO B 1 223 ? -22.566 29.069  -18.366 1.00 79.72  ? 216 PRO B CG  1 
ATOM   4109 C CD  . PRO B 1 223 ? -21.538 28.153  -18.960 1.00 89.29  ? 216 PRO B CD  1 
ATOM   4110 N N   . LEU B 1 224 ? -24.528 28.727  -22.614 1.00 70.90  ? 217 LEU B N   1 
ATOM   4111 C CA  . LEU B 1 224 ? -24.685 29.192  -23.991 1.00 55.26  ? 217 LEU B CA  1 
ATOM   4112 C C   . LEU B 1 224 ? -24.080 30.576  -24.202 1.00 64.42  ? 217 LEU B C   1 
ATOM   4113 O O   . LEU B 1 224 ? -24.362 31.511  -23.456 1.00 71.88  ? 217 LEU B O   1 
ATOM   4114 C CB  . LEU B 1 224 ? -26.170 29.259  -24.334 1.00 53.93  ? 217 LEU B CB  1 
ATOM   4115 C CG  . LEU B 1 224 ? -26.669 28.684  -25.661 1.00 59.16  ? 217 LEU B CG  1 
ATOM   4116 C CD1 . LEU B 1 224 ? -27.908 29.449  -26.123 1.00 50.76  ? 217 LEU B CD1 1 
ATOM   4117 C CD2 . LEU B 1 224 ? -25.581 28.691  -26.726 1.00 61.64  ? 217 LEU B CD2 1 
ATOM   4118 N N   . SER B 1 225 ? -23.251 30.715  -25.224 1.00 63.60  ? 218 SER B N   1 
ATOM   4119 C CA  . SER B 1 225 ? -22.641 32.004  -25.501 1.00 58.75  ? 218 SER B CA  1 
ATOM   4120 C C   . SER B 1 225 ? -22.762 32.359  -26.973 1.00 60.24  ? 218 SER B C   1 
ATOM   4121 O O   . SER B 1 225 ? -22.940 31.487  -27.825 1.00 68.80  ? 218 SER B O   1 
ATOM   4122 C CB  . SER B 1 225 ? -21.176 31.998  -25.075 1.00 60.51  ? 218 SER B CB  1 
ATOM   4123 O OG  . SER B 1 225 ? -20.944 32.965  -24.073 1.00 63.53  ? 218 SER B OG  1 
ATOM   4124 N N   . ALA B 1 226 ? -22.670 33.649  -27.267 1.00 50.56  ? 219 ALA B N   1 
ATOM   4125 C CA  . ALA B 1 226 ? -22.750 34.112  -28.644 1.00 49.35  ? 219 ALA B CA  1 
ATOM   4126 C C   . ALA B 1 226 ? -22.039 35.449  -28.808 1.00 49.91  ? 219 ALA B C   1 
ATOM   4127 O O   . ALA B 1 226 ? -21.851 36.195  -27.842 1.00 48.38  ? 219 ALA B O   1 
ATOM   4128 C CB  . ALA B 1 226 ? -24.188 34.215  -29.079 1.00 48.37  ? 219 ALA B CB  1 
ATOM   4129 N N   . MET B 1 227 ? -21.625 35.751  -30.028 1.00 44.55  ? 220 MET B N   1 
ATOM   4130 C CA  . MET B 1 227 ? -20.889 36.978  -30.253 1.00 39.29  ? 220 MET B CA  1 
ATOM   4131 C C   . MET B 1 227 ? -21.848 38.051  -30.705 1.00 37.29  ? 220 MET B C   1 
ATOM   4132 O O   . MET B 1 227 ? -22.846 37.765  -31.366 1.00 39.50  ? 220 MET B O   1 
ATOM   4133 C CB  . MET B 1 227 ? -19.789 36.759  -31.280 1.00 37.43  ? 220 MET B CB  1 
ATOM   4134 C CG  . MET B 1 227 ? -19.007 35.494  -31.028 1.00 44.28  ? 220 MET B CG  1 
ATOM   4135 S SD  . MET B 1 227 ? -17.258 35.776  -30.736 1.00 105.36 ? 220 MET B SD  1 
ATOM   4136 C CE  . MET B 1 227 ? -17.301 36.784  -29.264 1.00 39.61  ? 220 MET B CE  1 
ATOM   4137 N N   . VAL B 1 228 ? -21.551 39.284  -30.326 1.00 25.20  ? 221 VAL B N   1 
ATOM   4138 C CA  . VAL B 1 228 ? -22.441 40.392  -30.616 1.00 32.24  ? 221 VAL B CA  1 
ATOM   4139 C C   . VAL B 1 228 ? -21.966 41.175  -31.824 1.00 37.17  ? 221 VAL B C   1 
ATOM   4140 O O   . VAL B 1 228 ? -20.803 41.579  -31.897 1.00 42.86  ? 221 VAL B O   1 
ATOM   4141 C CB  . VAL B 1 228 ? -22.560 41.340  -29.412 1.00 39.18  ? 221 VAL B CB  1 
ATOM   4142 C CG1 . VAL B 1 228 ? -23.368 42.580  -29.785 1.00 42.98  ? 221 VAL B CG1 1 
ATOM   4143 C CG2 . VAL B 1 228 ? -23.192 40.617  -28.258 1.00 38.07  ? 221 VAL B CG2 1 
ATOM   4144 N N   . SER B 1 229 ? -22.876 41.392  -32.767 1.00 38.45  ? 222 SER B N   1 
ATOM   4145 C CA  . SER B 1 229 ? -22.565 42.144  -33.976 1.00 25.89  ? 222 SER B CA  1 
ATOM   4146 C C   . SER B 1 229 ? -22.982 43.603  -33.862 1.00 27.77  ? 222 SER B C   1 
ATOM   4147 O O   . SER B 1 229 ? -22.321 44.482  -34.400 1.00 35.40  ? 222 SER B O   1 
ATOM   4148 C CB  . SER B 1 229 ? -23.211 41.491  -35.184 1.00 21.43  ? 222 SER B CB  1 
ATOM   4149 O OG  . SER B 1 229 ? -22.579 40.256  -35.452 1.00 28.00  ? 222 SER B OG  1 
ATOM   4150 N N   . MET B 1 230 ? -24.064 43.869  -33.144 1.00 30.60  ? 223 MET B N   1 
ATOM   4151 C CA  . MET B 1 230 ? -24.460 45.250  -32.895 1.00 31.00  ? 223 MET B CA  1 
ATOM   4152 C C   . MET B 1 230 ? -25.329 45.394  -31.665 1.00 31.80  ? 223 MET B C   1 
ATOM   4153 O O   . MET B 1 230 ? -26.076 44.482  -31.304 1.00 31.05  ? 223 MET B O   1 
ATOM   4154 C CB  . MET B 1 230 ? -25.197 45.839  -34.101 1.00 30.62  ? 223 MET B CB  1 
ATOM   4155 C CG  . MET B 1 230 ? -24.384 46.885  -34.844 1.00 66.89  ? 223 MET B CG  1 
ATOM   4156 S SD  . MET B 1 230 ? -24.421 48.468  -34.004 1.00 36.44  ? 223 MET B SD  1 
ATOM   4157 C CE  . MET B 1 230 ? -26.174 48.512  -33.686 1.00 43.84  ? 223 MET B CE  1 
ATOM   4158 N N   . VAL B 1 231 ? -25.224 46.547  -31.019 1.00 26.71  ? 224 VAL B N   1 
ATOM   4159 C CA  . VAL B 1 231 ? -26.200 46.927  -30.014 1.00 38.23  ? 224 VAL B CA  1 
ATOM   4160 C C   . VAL B 1 231 ? -26.685 48.341  -30.294 1.00 23.66  ? 224 VAL B C   1 
ATOM   4161 O O   . VAL B 1 231 ? -25.892 49.274  -30.317 1.00 31.30  ? 224 VAL B O   1 
ATOM   4162 C CB  . VAL B 1 231 ? -25.648 46.832  -28.556 1.00 36.73  ? 224 VAL B CB  1 
ATOM   4163 C CG1 . VAL B 1 231 ? -26.742 47.215  -27.559 1.00 29.05  ? 224 VAL B CG1 1 
ATOM   4164 C CG2 . VAL B 1 231 ? -25.128 45.422  -28.249 1.00 19.89  ? 224 VAL B CG2 1 
ATOM   4165 N N   . THR B 1 232 ? -27.984 48.504  -30.521 1.00 26.12  ? 225 THR B N   1 
ATOM   4166 C CA  . THR B 1 232 ? -28.518 49.843  -30.724 1.00 32.94  ? 225 THR B CA  1 
ATOM   4167 C C   . THR B 1 232 ? -28.549 50.569  -29.406 1.00 46.01  ? 225 THR B C   1 
ATOM   4168 O O   . THR B 1 232 ? -28.573 49.956  -28.331 1.00 45.87  ? 225 THR B O   1 
ATOM   4169 C CB  . THR B 1 232 ? -29.931 49.855  -31.296 1.00 34.96  ? 225 THR B CB  1 
ATOM   4170 O OG1 . THR B 1 232 ? -30.786 49.050  -30.478 1.00 46.16  ? 225 THR B OG1 1 
ATOM   4171 C CG2 . THR B 1 232 ? -29.934 49.310  -32.696 1.00 40.68  ? 225 THR B CG2 1 
ATOM   4172 N N   . LYS B 1 233 ? -28.540 51.889  -29.510 1.00 45.64  ? 226 LYS B N   1 
ATOM   4173 C CA  . LYS B 1 233 ? -28.674 52.771  -28.371 1.00 32.80  ? 226 LYS B CA  1 
ATOM   4174 C C   . LYS B 1 233 ? -30.101 53.293  -28.443 1.00 44.56  ? 226 LYS B C   1 
ATOM   4175 O O   . LYS B 1 233 ? -30.414 54.172  -29.251 1.00 49.66  ? 226 LYS B O   1 
ATOM   4176 C CB  . LYS B 1 233 ? -27.658 53.887  -28.518 1.00 20.46  ? 226 LYS B CB  1 
ATOM   4177 C CG  . LYS B 1 233 ? -27.634 54.916  -27.450 1.00 20.08  ? 226 LYS B CG  1 
ATOM   4178 C CD  . LYS B 1 233 ? -26.261 55.578  -27.463 1.00 29.71  ? 226 LYS B CD  1 
ATOM   4179 C CE  . LYS B 1 233 ? -26.383 57.075  -27.249 1.00 46.76  ? 226 LYS B CE  1 
ATOM   4180 N NZ  . LYS B 1 233 ? -25.054 57.699  -27.012 1.00 59.43  ? 226 LYS B NZ  1 
ATOM   4181 N N   . ASP B 1 234 ? -30.976 52.732  -27.615 1.00 40.52  ? 227 ASP B N   1 
ATOM   4182 C CA  . ASP B 1 234 ? -32.400 52.958  -27.783 1.00 50.90  ? 227 ASP B CA  1 
ATOM   4183 C C   . ASP B 1 234 ? -33.169 52.433  -26.567 1.00 46.88  ? 227 ASP B C   1 
ATOM   4184 O O   . ASP B 1 234 ? -32.604 51.799  -25.680 1.00 44.81  ? 227 ASP B O   1 
ATOM   4185 C CB  . ASP B 1 234 ? -32.854 52.258  -29.079 1.00 65.13  ? 227 ASP B CB  1 
ATOM   4186 C CG  . ASP B 1 234 ? -34.162 52.803  -29.638 1.00 65.57  ? 227 ASP B CG  1 
ATOM   4187 O OD1 . ASP B 1 234 ? -34.520 53.961  -29.338 1.00 67.07  ? 227 ASP B OD1 1 
ATOM   4188 O OD2 . ASP B 1 234 ? -34.830 52.061  -30.392 1.00 63.83  ? 227 ASP B OD2 1 
ATOM   4189 N N   . ASN B 1 235 ? -34.464 52.710  -26.530 1.00 49.39  ? 228 ASN B N   1 
ATOM   4190 C CA  . ASN B 1 235 ? -35.323 52.223  -25.464 1.00 40.48  ? 228 ASN B CA  1 
ATOM   4191 C C   . ASN B 1 235 ? -36.465 51.372  -26.017 1.00 38.33  ? 228 ASN B C   1 
ATOM   4192 O O   . ASN B 1 235 ? -37.459 51.897  -26.490 1.00 42.39  ? 228 ASN B O   1 
ATOM   4193 C CB  . ASN B 1 235 ? -35.898 53.396  -24.680 1.00 40.06  ? 228 ASN B CB  1 
ATOM   4194 C CG  . ASN B 1 235 ? -36.943 52.958  -23.681 1.00 55.79  ? 228 ASN B CG  1 
ATOM   4195 O OD1 . ASN B 1 235 ? -36.747 51.990  -22.942 1.00 53.58  ? 228 ASN B OD1 1 
ATOM   4196 N ND2 . ASN B 1 235 ? -38.076 53.655  -23.666 1.00 65.13  ? 228 ASN B ND2 1 
ATOM   4197 N N   . PRO B 1 236 ? -36.319 50.046  -25.986 1.00 35.51  ? 229 PRO B N   1 
ATOM   4198 C CA  . PRO B 1 236 ? -35.185 49.279  -25.462 1.00 37.75  ? 229 PRO B CA  1 
ATOM   4199 C C   . PRO B 1 236 ? -34.035 49.229  -26.468 1.00 38.08  ? 229 PRO B C   1 
ATOM   4200 O O   . PRO B 1 236 ? -34.215 49.576  -27.638 1.00 44.54  ? 229 PRO B O   1 
ATOM   4201 C CB  . PRO B 1 236 ? -35.775 47.883  -25.335 1.00 30.23  ? 229 PRO B CB  1 
ATOM   4202 C CG  . PRO B 1 236 ? -36.708 47.790  -26.538 1.00 17.55  ? 229 PRO B CG  1 
ATOM   4203 C CD  . PRO B 1 236 ? -37.270 49.193  -26.724 1.00 16.88  ? 229 PRO B CD  1 
ATOM   4204 N N   . GLY B 1 237 ? -32.867 48.789  -26.026 1.00 31.92  ? 230 GLY B N   1 
ATOM   4205 C CA  . GLY B 1 237 ? -31.757 48.609  -26.946 1.00 26.00  ? 230 GLY B CA  1 
ATOM   4206 C C   . GLY B 1 237 ? -31.980 47.293  -27.636 1.00 30.69  ? 230 GLY B C   1 
ATOM   4207 O O   . GLY B 1 237 ? -32.650 46.426  -27.068 1.00 46.82  ? 230 GLY B O   1 
ATOM   4208 N N   . VAL B 1 238 ? -31.447 47.136  -28.848 1.00 29.17  ? 231 VAL B N   1 
ATOM   4209 C CA  . VAL B 1 238 ? -31.609 45.880  -29.594 1.00 33.50  ? 231 VAL B CA  1 
ATOM   4210 C C   . VAL B 1 238 ? -30.247 45.308  -29.993 1.00 32.30  ? 231 VAL B C   1 
ATOM   4211 O O   . VAL B 1 238 ? -29.370 46.042  -30.445 1.00 35.17  ? 231 VAL B O   1 
ATOM   4212 C CB  . VAL B 1 238 ? -32.517 46.056  -30.848 1.00 21.46  ? 231 VAL B CB  1 
ATOM   4213 C CG1 . VAL B 1 238 ? -32.589 44.768  -31.655 1.00 31.75  ? 231 VAL B CG1 1 
ATOM   4214 C CG2 . VAL B 1 238 ? -33.905 46.492  -30.441 1.00 21.01  ? 231 VAL B CG2 1 
ATOM   4215 N N   . VAL B 1 239 ? -30.076 44.003  -29.814 1.00 19.63  ? 232 VAL B N   1 
ATOM   4216 C CA  . VAL B 1 239 ? -28.821 43.332  -30.111 1.00 30.89  ? 232 VAL B CA  1 
ATOM   4217 C C   . VAL B 1 239 ? -28.899 42.580  -31.446 1.00 38.13  ? 232 VAL B C   1 
ATOM   4218 O O   . VAL B 1 239 ? -29.888 41.916  -31.716 1.00 46.99  ? 232 VAL B O   1 
ATOM   4219 C CB  . VAL B 1 239 ? -28.458 42.338  -28.969 1.00 26.03  ? 232 VAL B CB  1 
ATOM   4220 C CG1 . VAL B 1 239 ? -27.304 41.420  -29.375 1.00 27.34  ? 232 VAL B CG1 1 
ATOM   4221 C CG2 . VAL B 1 239 ? -28.132 43.095  -27.683 1.00 20.40  ? 232 VAL B CG2 1 
ATOM   4222 N N   . THR B 1 240 ? -27.870 42.684  -32.284 1.00 34.86  ? 233 THR B N   1 
ATOM   4223 C CA  . THR B 1 240 ? -27.792 41.851  -33.487 1.00 33.23  ? 233 THR B CA  1 
ATOM   4224 C C   . THR B 1 240 ? -26.746 40.750  -33.285 1.00 38.42  ? 233 THR B C   1 
ATOM   4225 O O   . THR B 1 240 ? -25.623 41.025  -32.857 1.00 43.36  ? 233 THR B O   1 
ATOM   4226 C CB  . THR B 1 240 ? -27.474 42.682  -34.762 1.00 46.83  ? 233 THR B CB  1 
ATOM   4227 O OG1 . THR B 1 240 ? -28.505 43.649  -34.974 1.00 27.19  ? 233 THR B OG1 1 
ATOM   4228 C CG2 . THR B 1 240 ? -27.375 41.789  -36.009 1.00 16.64  ? 233 THR B CG2 1 
ATOM   4229 N N   . CYS B 1 241 ? -27.119 39.509  -33.601 1.00 30.16  ? 234 CYS B N   1 
ATOM   4230 C CA  . CYS B 1 241 ? -26.284 38.342  -33.315 1.00 32.05  ? 234 CYS B CA  1 
ATOM   4231 C C   . CYS B 1 241 ? -26.358 37.259  -34.411 1.00 40.42  ? 234 CYS B C   1 
ATOM   4232 O O   . CYS B 1 241 ? -27.439 36.740  -34.719 1.00 42.18  ? 234 CYS B O   1 
ATOM   4233 C CB  . CYS B 1 241 ? -26.673 37.756  -31.946 1.00 31.38  ? 234 CYS B CB  1 
ATOM   4234 S SG  . CYS B 1 241 ? -25.734 36.288  -31.485 1.00 44.36  ? 234 CYS B SG  1 
ATOM   4235 N N   . LEU B 1 242 ? -25.198 36.912  -34.972 1.00 46.15  ? 235 LEU B N   1 
ATOM   4236 C CA  . LEU B 1 242 ? -25.092 36.043  -36.155 1.00 44.88  ? 235 LEU B CA  1 
ATOM   4237 C C   . LEU B 1 242 ? -24.714 34.601  -35.847 1.00 59.53  ? 235 LEU B C   1 
ATOM   4238 O O   . LEU B 1 242 ? -24.757 33.748  -36.738 1.00 54.98  ? 235 LEU B O   1 
ATOM   4239 C CB  . LEU B 1 242 ? -24.011 36.569  -37.082 1.00 40.54  ? 235 LEU B CB  1 
ATOM   4240 C CG  . LEU B 1 242 ? -24.334 37.638  -38.106 1.00 43.61  ? 235 LEU B CG  1 
ATOM   4241 C CD1 . LEU B 1 242 ? -25.470 38.553  -37.636 1.00 43.87  ? 235 LEU B CD1 1 
ATOM   4242 C CD2 . LEU B 1 242 ? -23.038 38.397  -38.351 1.00 33.63  ? 235 LEU B CD2 1 
ATOM   4243 N N   . ASP B 1 243 ? -24.305 34.355  -34.600 1.00 64.25  ? 236 ASP B N   1 
ATOM   4244 C CA  . ASP B 1 243 ? -23.839 33.049  -34.137 1.00 53.70  ? 236 ASP B CA  1 
ATOM   4245 C C   . ASP B 1 243 ? -24.870 31.954  -34.400 1.00 58.27  ? 236 ASP B C   1 
ATOM   4246 O O   . ASP B 1 243 ? -26.070 32.223  -34.445 1.00 49.53  ? 236 ASP B O   1 
ATOM   4247 C CB  . ASP B 1 243 ? -23.575 33.133  -32.644 1.00 59.15  ? 236 ASP B CB  1 
ATOM   4248 C CG  . ASP B 1 243 ? -22.268 32.506  -32.246 1.00 63.22  ? 236 ASP B CG  1 
ATOM   4249 O OD1 . ASP B 1 243 ? -21.348 33.262  -31.861 1.00 58.90  ? 236 ASP B OD1 1 
ATOM   4250 O OD2 . ASP B 1 243 ? -22.168 31.261  -32.310 1.00 66.93  ? 236 ASP B OD2 1 
ATOM   4251 N N   . GLU B 1 244 ? -24.418 30.716  -34.580 1.00 64.59  ? 237 GLU B N   1 
ATOM   4252 C CA  . GLU B 1 244 ? -25.371 29.625  -34.750 1.00 70.46  ? 237 GLU B CA  1 
ATOM   4253 C C   . GLU B 1 244 ? -25.997 29.354  -33.396 1.00 68.30  ? 237 GLU B C   1 
ATOM   4254 O O   . GLU B 1 244 ? -27.118 28.846  -33.306 1.00 62.47  ? 237 GLU B O   1 
ATOM   4255 C CB  . GLU B 1 244 ? -24.690 28.370  -35.272 1.00 75.05  ? 237 GLU B CB  1 
ATOM   4256 C CG  . GLU B 1 244 ? -23.579 28.654  -36.245 1.00 92.22  ? 237 GLU B CG  1 
ATOM   4257 C CD  . GLU B 1 244 ? -22.290 27.976  -35.837 1.00 102.84 ? 237 GLU B CD  1 
ATOM   4258 O OE1 . GLU B 1 244 ? -21.231 28.639  -35.873 1.00 104.47 ? 237 GLU B OE1 1 
ATOM   4259 O OE2 . GLU B 1 244 ? -22.342 26.780  -35.474 1.00 105.48 ? 237 GLU B OE2 1 
ATOM   4260 N N   . ALA B 1 245 ? -25.255 29.712  -32.348 1.00 67.79  ? 238 ALA B N   1 
ATOM   4261 C CA  . ALA B 1 245 ? -25.724 29.623  -30.967 1.00 63.47  ? 238 ALA B CA  1 
ATOM   4262 C C   . ALA B 1 245 ? -26.973 30.473  -30.734 1.00 59.64  ? 238 ALA B C   1 
ATOM   4263 O O   . ALA B 1 245 ? -27.777 30.164  -29.851 1.00 49.27  ? 238 ALA B O   1 
ATOM   4264 C CB  . ALA B 1 245 ? -24.612 30.028  -29.992 1.00 55.98  ? 238 ALA B CB  1 
ATOM   4265 N N   . ARG B 1 246 ? -27.143 31.519  -31.549 1.00 60.25  ? 239 ARG B N   1 
ATOM   4266 C CA  . ARG B 1 246 ? -28.254 32.472  -31.417 1.00 59.01  ? 239 ARG B CA  1 
ATOM   4267 C C   . ARG B 1 246 ? -29.619 31.807  -31.331 1.00 64.23  ? 239 ARG B C   1 
ATOM   4268 O O   . ARG B 1 246 ? -30.590 32.430  -30.903 1.00 68.30  ? 239 ARG B O   1 
ATOM   4269 C CB  . ARG B 1 246 ? -28.265 33.469  -32.585 1.00 54.49  ? 239 ARG B CB  1 
ATOM   4270 C CG  . ARG B 1 246 ? -29.019 32.983  -33.825 1.00 49.70  ? 239 ARG B CG  1 
ATOM   4271 C CD  . ARG B 1 246 ? -28.659 33.807  -35.068 1.00 53.10  ? 239 ARG B CD  1 
ATOM   4272 N NE  . ARG B 1 246 ? -28.114 32.983  -36.143 1.00 53.80  ? 239 ARG B NE  1 
ATOM   4273 C CZ  . ARG B 1 246 ? -28.849 32.427  -37.099 1.00 63.68  ? 239 ARG B CZ  1 
ATOM   4274 N NH1 . ARG B 1 246 ? -30.160 32.611  -37.116 1.00 58.84  ? 239 ARG B NH1 1 
ATOM   4275 N NH2 . ARG B 1 246 ? -28.275 31.688  -38.041 1.00 78.98  ? 239 ARG B NH2 1 
ATOM   4276 N N   . HIS B 1 247 ? -29.689 30.546  -31.742 1.00 67.48  ? 240 HIS B N   1 
ATOM   4277 C CA  . HIS B 1 247 ? -30.954 29.835  -31.808 1.00 72.67  ? 240 HIS B CA  1 
ATOM   4278 C C   . HIS B 1 247 ? -31.435 29.403  -30.433 1.00 74.69  ? 240 HIS B C   1 
ATOM   4279 O O   . HIS B 1 247 ? -32.639 29.301  -30.194 1.00 81.06  ? 240 HIS B O   1 
ATOM   4280 C CB  . HIS B 1 247 ? -30.840 28.642  -32.755 1.00 72.31  ? 240 HIS B CB  1 
ATOM   4281 C CG  . HIS B 1 247 ? -30.661 29.037  -34.190 1.00 69.59  ? 240 HIS B CG  1 
ATOM   4282 N ND1 . HIS B 1 247 ? -29.473 28.857  -34.871 1.00 59.20  ? 240 HIS B ND1 1 
ATOM   4283 C CD2 . HIS B 1 247 ? -31.514 29.621  -35.065 1.00 60.48  ? 240 HIS B CD2 1 
ATOM   4284 C CE1 . HIS B 1 247 ? -29.610 29.301  -36.108 1.00 52.86  ? 240 HIS B CE1 1 
ATOM   4285 N NE2 . HIS B 1 247 ? -30.835 29.773  -36.251 1.00 52.14  ? 240 HIS B NE2 1 
ATOM   4286 N N   . GLY B 1 248 ? -30.487 29.168  -29.532 1.00 68.22  ? 241 GLY B N   1 
ATOM   4287 C CA  . GLY B 1 248 ? -30.800 28.748  -28.178 1.00 64.22  ? 241 GLY B CA  1 
ATOM   4288 C C   . GLY B 1 248 ? -31.464 29.808  -27.314 1.00 62.59  ? 241 GLY B C   1 
ATOM   4289 O O   . GLY B 1 248 ? -32.206 29.488  -26.380 1.00 68.70  ? 241 GLY B O   1 
ATOM   4290 N N   . PHE B 1 249 ? -31.206 31.074  -27.625 1.00 57.13  ? 242 PHE B N   1 
ATOM   4291 C CA  . PHE B 1 249 ? -31.757 32.181  -26.843 1.00 58.40  ? 242 PHE B CA  1 
ATOM   4292 C C   . PHE B 1 249 ? -33.252 32.379  -27.122 1.00 60.74  ? 242 PHE B C   1 
ATOM   4293 O O   . PHE B 1 249 ? -33.643 32.586  -28.274 1.00 74.86  ? 242 PHE B O   1 
ATOM   4294 C CB  . PHE B 1 249 ? -31.003 33.489  -27.140 1.00 48.64  ? 242 PHE B CB  1 
ATOM   4295 C CG  . PHE B 1 249 ? -29.563 33.513  -26.657 1.00 50.81  ? 242 PHE B CG  1 
ATOM   4296 C CD1 . PHE B 1 249 ? -29.199 34.263  -25.554 1.00 58.31  ? 242 PHE B CD1 1 
ATOM   4297 C CD2 . PHE B 1 249 ? -28.568 32.815  -27.331 1.00 56.93  ? 242 PHE B CD2 1 
ATOM   4298 C CE1 . PHE B 1 249 ? -27.872 34.303  -25.124 1.00 66.88  ? 242 PHE B CE1 1 
ATOM   4299 C CE2 . PHE B 1 249 ? -27.245 32.848  -26.906 1.00 61.86  ? 242 PHE B CE2 1 
ATOM   4300 C CZ  . PHE B 1 249 ? -26.897 33.592  -25.804 1.00 66.43  ? 242 PHE B CZ  1 
ATOM   4301 N N   . GLU B 1 250 ? -34.082 32.327  -26.078 1.00 42.68  ? 243 GLU B N   1 
ATOM   4302 C CA  . GLU B 1 250 ? -35.514 32.610  -26.233 1.00 42.76  ? 243 GLU B CA  1 
ATOM   4303 C C   . GLU B 1 250 ? -35.970 33.799  -25.400 1.00 36.59  ? 243 GLU B C   1 
ATOM   4304 O O   . GLU B 1 250 ? -35.292 34.180  -24.457 1.00 44.13  ? 243 GLU B O   1 
ATOM   4305 C CB  . GLU B 1 250 ? -36.349 31.391  -25.876 1.00 49.44  ? 243 GLU B CB  1 
ATOM   4306 C CG  . GLU B 1 250 ? -36.254 30.261  -26.868 1.00 67.27  ? 243 GLU B CG  1 
ATOM   4307 C CD  . GLU B 1 250 ? -36.871 28.996  -26.326 1.00 82.20  ? 243 GLU B CD  1 
ATOM   4308 O OE1 . GLU B 1 250 ? -38.096 28.992  -26.061 1.00 77.96  ? 243 GLU B OE1 1 
ATOM   4309 O OE2 . GLU B 1 250 ? -36.122 28.014  -26.141 1.00 91.74  ? 243 GLU B OE2 1 
ATOM   4310 N N   . SER B 1 251 ? -37.112 34.383  -25.762 1.00 37.40  ? 244 SER B N   1 
ATOM   4311 C CA  . SER B 1 251 ? -37.693 35.497  -25.012 1.00 31.05  ? 244 SER B CA  1 
ATOM   4312 C C   . SER B 1 251 ? -37.894 35.101  -23.572 1.00 37.28  ? 244 SER B C   1 
ATOM   4313 O O   . SER B 1 251 ? -38.458 34.052  -23.295 1.00 35.74  ? 244 SER B O   1 
ATOM   4314 C CB  . SER B 1 251 ? -39.035 35.920  -25.598 1.00 34.95  ? 244 SER B CB  1 
ATOM   4315 O OG  . SER B 1 251 ? -38.880 36.880  -26.626 1.00 44.07  ? 244 SER B OG  1 
ATOM   4316 N N   . GLY B 1 252 ? -37.409 35.935  -22.658 1.00 41.72  ? 245 GLY B N   1 
ATOM   4317 C CA  . GLY B 1 252 ? -37.505 35.651  -21.239 1.00 28.19  ? 245 GLY B CA  1 
ATOM   4318 C C   . GLY B 1 252 ? -36.269 35.018  -20.639 1.00 37.29  ? 245 GLY B C   1 
ATOM   4319 O O   . GLY B 1 252 ? -36.181 34.879  -19.420 1.00 41.70  ? 245 GLY B O   1 
ATOM   4320 N N   . ASP B 1 253 ? -35.323 34.614  -21.486 1.00 41.84  ? 246 ASP B N   1 
ATOM   4321 C CA  . ASP B 1 253 ? -33.989 34.243  -21.018 1.00 39.73  ? 246 ASP B CA  1 
ATOM   4322 C C   . ASP B 1 253 ? -33.415 35.455  -20.297 1.00 40.29  ? 246 ASP B C   1 
ATOM   4323 O O   . ASP B 1 253 ? -33.732 36.592  -20.648 1.00 42.16  ? 246 ASP B O   1 
ATOM   4324 C CB  . ASP B 1 253 ? -33.065 33.910  -22.196 1.00 46.38  ? 246 ASP B CB  1 
ATOM   4325 C CG  . ASP B 1 253 ? -33.362 32.560  -22.834 1.00 54.36  ? 246 ASP B CG  1 
ATOM   4326 O OD1 . ASP B 1 253 ? -34.505 32.073  -22.730 1.00 66.53  ? 246 ASP B OD1 1 
ATOM   4327 O OD2 . ASP B 1 253 ? -32.443 31.987  -23.457 1.00 50.50  ? 246 ASP B OD2 1 
ATOM   4328 N N   . PHE B 1 254 ? -32.581 35.238  -19.286 1.00 33.84  ? 247 PHE B N   1 
ATOM   4329 C CA  . PHE B 1 254 ? -31.830 36.358  -18.740 1.00 16.60  ? 247 PHE B CA  1 
ATOM   4330 C C   . PHE B 1 254 ? -30.410 36.264  -19.232 1.00 29.62  ? 247 PHE B C   1 
ATOM   4331 O O   . PHE B 1 254 ? -29.830 35.176  -19.322 1.00 36.19  ? 247 PHE B O   1 
ATOM   4332 C CB  . PHE B 1 254 ? -31.903 36.424  -17.222 1.00 19.20  ? 247 PHE B CB  1 
ATOM   4333 C CG  . PHE B 1 254 ? -33.052 37.244  -16.712 1.00 23.73  ? 247 PHE B CG  1 
ATOM   4334 C CD1 . PHE B 1 254 ? -34.336 36.687  -16.612 1.00 21.02  ? 247 PHE B CD1 1 
ATOM   4335 C CD2 . PHE B 1 254 ? -32.860 38.570  -16.347 1.00 16.66  ? 247 PHE B CD2 1 
ATOM   4336 C CE1 . PHE B 1 254 ? -35.402 37.442  -16.138 1.00 16.96  ? 247 PHE B CE1 1 
ATOM   4337 C CE2 . PHE B 1 254 ? -33.921 39.342  -15.876 1.00 23.42  ? 247 PHE B CE2 1 
ATOM   4338 C CZ  . PHE B 1 254 ? -35.196 38.777  -15.770 1.00 27.62  ? 247 PHE B CZ  1 
ATOM   4339 N N   . VAL B 1 255 ? -29.849 37.420  -19.546 1.00 23.99  ? 248 VAL B N   1 
ATOM   4340 C CA  . VAL B 1 255 ? -28.647 37.475  -20.352 1.00 19.23  ? 248 VAL B CA  1 
ATOM   4341 C C   . VAL B 1 255 ? -27.627 38.455  -19.749 1.00 21.29  ? 248 VAL B C   1 
ATOM   4342 O O   . VAL B 1 255 ? -28.003 39.408  -19.072 1.00 31.44  ? 248 VAL B O   1 
ATOM   4343 C CB  . VAL B 1 255 ? -29.092 37.856  -21.790 1.00 23.27  ? 248 VAL B CB  1 
ATOM   4344 C CG1 . VAL B 1 255 ? -28.242 38.945  -22.405 1.00 14.29  ? 248 VAL B CG1 1 
ATOM   4345 C CG2 . VAL B 1 255 ? -29.227 36.612  -22.662 1.00 16.59  ? 248 VAL B CG2 1 
ATOM   4346 N N   . SER B 1 256 ? -26.339 38.216  -19.953 1.00 24.36  ? 249 SER B N   1 
ATOM   4347 C CA  . SER B 1 256 ? -25.336 39.205  -19.528 1.00 32.56  ? 249 SER B CA  1 
ATOM   4348 C C   . SER B 1 256 ? -24.195 39.347  -20.540 1.00 31.75  ? 249 SER B C   1 
ATOM   4349 O O   . SER B 1 256 ? -24.009 38.482  -21.400 1.00 21.98  ? 249 SER B O   1 
ATOM   4350 C CB  . SER B 1 256 ? -24.769 38.839  -18.163 1.00 34.29  ? 249 SER B CB  1 
ATOM   4351 O OG  . SER B 1 256 ? -23.919 37.716  -18.281 1.00 34.98  ? 249 SER B OG  1 
ATOM   4352 N N   . PHE B 1 257 ? -23.419 40.426  -20.418 1.00 34.60  ? 250 PHE B N   1 
ATOM   4353 C CA  . PHE B 1 257 ? -22.343 40.708  -21.382 1.00 30.02  ? 250 PHE B CA  1 
ATOM   4354 C C   . PHE B 1 257 ? -20.943 40.873  -20.781 1.00 33.51  ? 250 PHE B C   1 
ATOM   4355 O O   . PHE B 1 257 ? -20.762 41.344  -19.651 1.00 32.84  ? 250 PHE B O   1 
ATOM   4356 C CB  . PHE B 1 257 ? -22.667 41.971  -22.185 1.00 36.07  ? 250 PHE B CB  1 
ATOM   4357 C CG  . PHE B 1 257 ? -24.015 41.944  -22.855 1.00 44.82  ? 250 PHE B CG  1 
ATOM   4358 C CD1 . PHE B 1 257 ? -25.163 42.331  -22.163 1.00 30.92  ? 250 PHE B CD1 1 
ATOM   4359 C CD2 . PHE B 1 257 ? -24.138 41.537  -24.178 1.00 42.30  ? 250 PHE B CD2 1 
ATOM   4360 C CE1 . PHE B 1 257 ? -26.400 42.308  -22.778 1.00 21.41  ? 250 PHE B CE1 1 
ATOM   4361 C CE2 . PHE B 1 257 ? -25.380 41.509  -24.798 1.00 36.88  ? 250 PHE B CE2 1 
ATOM   4362 C CZ  . PHE B 1 257 ? -26.513 41.896  -24.096 1.00 32.27  ? 250 PHE B CZ  1 
ATOM   4363 N N   . SER B 1 258 ? -19.946 40.485  -21.562 1.00 28.70  ? 251 SER B N   1 
ATOM   4364 C CA  . SER B 1 258 ? -18.582 40.930  -21.324 1.00 26.73  ? 251 SER B CA  1 
ATOM   4365 C C   . SER B 1 258 ? -17.956 41.301  -22.656 1.00 38.49  ? 251 SER B C   1 
ATOM   4366 O O   . SER B 1 258 ? -18.496 40.958  -23.712 1.00 38.07  ? 251 SER B O   1 
ATOM   4367 C CB  . SER B 1 258 ? -17.763 39.842  -20.642 1.00 33.34  ? 251 SER B CB  1 
ATOM   4368 O OG  . SER B 1 258 ? -17.710 38.691  -21.460 1.00 47.22  ? 251 SER B OG  1 
ATOM   4369 N N   . GLU B 1 259 ? -16.830 42.012  -22.595 1.00 43.55  ? 252 GLU B N   1 
ATOM   4370 C CA  . GLU B 1 259 ? -16.013 42.351  -23.771 1.00 37.27  ? 252 GLU B CA  1 
ATOM   4371 C C   . GLU B 1 259 ? -16.663 43.314  -24.775 1.00 38.96  ? 252 GLU B C   1 
ATOM   4372 O O   . GLU B 1 259 ? -16.218 43.418  -25.918 1.00 51.97  ? 252 GLU B O   1 
ATOM   4373 C CB  . GLU B 1 259 ? -15.543 41.084  -24.502 1.00 37.38  ? 252 GLU B CB  1 
ATOM   4374 C CG  . GLU B 1 259 ? -14.744 40.106  -23.656 1.00 42.62  ? 252 GLU B CG  1 
ATOM   4375 C CD  . GLU B 1 259 ? -14.266 38.911  -24.466 1.00 60.13  ? 252 GLU B CD  1 
ATOM   4376 O OE1 . GLU B 1 259 ? -14.119 39.056  -25.699 1.00 75.76  ? 252 GLU B OE1 1 
ATOM   4377 O OE2 . GLU B 1 259 ? -14.045 37.828  -23.881 1.00 57.96  ? 252 GLU B OE2 1 
ATOM   4378 N N   . VAL B 1 260 ? -17.708 44.011  -24.354 1.00 38.41  ? 253 VAL B N   1 
ATOM   4379 C CA  . VAL B 1 260 ? -18.384 44.972  -25.220 1.00 40.43  ? 253 VAL B CA  1 
ATOM   4380 C C   . VAL B 1 260 ? -17.592 46.280  -25.290 1.00 36.36  ? 253 VAL B C   1 
ATOM   4381 O O   . VAL B 1 260 ? -17.177 46.820  -24.271 1.00 44.32  ? 253 VAL B O   1 
ATOM   4382 C CB  . VAL B 1 260 ? -19.863 45.219  -24.762 1.00 34.18  ? 253 VAL B CB  1 
ATOM   4383 C CG1 . VAL B 1 260 ? -20.451 46.452  -25.415 1.00 35.30  ? 253 VAL B CG1 1 
ATOM   4384 C CG2 . VAL B 1 260 ? -20.731 44.000  -25.064 1.00 21.87  ? 253 VAL B CG2 1 
ATOM   4385 N N   . GLN B 1 261 ? -17.380 46.780  -26.501 1.00 38.08  ? 254 GLN B N   1 
ATOM   4386 C CA  . GLN B 1 261 ? -16.638 48.019  -26.711 1.00 35.12  ? 254 GLN B CA  1 
ATOM   4387 C C   . GLN B 1 261 ? -17.549 49.182  -27.075 1.00 37.56  ? 254 GLN B C   1 
ATOM   4388 O O   . GLN B 1 261 ? -18.492 49.032  -27.846 1.00 47.57  ? 254 GLN B O   1 
ATOM   4389 C CB  . GLN B 1 261 ? -15.584 47.826  -27.798 1.00 33.39  ? 254 GLN B CB  1 
ATOM   4390 C CG  . GLN B 1 261 ? -14.598 46.727  -27.479 1.00 41.39  ? 254 GLN B CG  1 
ATOM   4391 C CD  . GLN B 1 261 ? -13.464 46.664  -28.470 1.00 47.03  ? 254 GLN B CD  1 
ATOM   4392 O OE1 . GLN B 1 261 ? -12.835 47.683  -28.780 1.00 40.55  ? 254 GLN B OE1 1 
ATOM   4393 N NE2 . GLN B 1 261 ? -13.196 45.465  -28.986 1.00 43.81  ? 254 GLN B NE2 1 
ATOM   4394 N N   . GLY B 1 262 ? -17.254 50.349  -26.525 1.00 36.54  ? 255 GLY B N   1 
ATOM   4395 C CA  . GLY B 1 262 ? -18.089 51.510  -26.741 1.00 33.94  ? 255 GLY B CA  1 
ATOM   4396 C C   . GLY B 1 262 ? -19.191 51.584  -25.710 1.00 37.82  ? 255 GLY B C   1 
ATOM   4397 O O   . GLY B 1 262 ? -19.194 52.454  -24.848 1.00 40.57  ? 255 GLY B O   1 
ATOM   4398 N N   . MET B 1 263 ? -20.138 50.661  -25.796 1.00 43.79  ? 256 MET B N   1 
ATOM   4399 C CA  . MET B 1 263 ? -21.241 50.628  -24.851 1.00 38.49  ? 256 MET B CA  1 
ATOM   4400 C C   . MET B 1 263 ? -20.816 49.814  -23.625 1.00 35.42  ? 256 MET B C   1 
ATOM   4401 O O   . MET B 1 263 ? -21.413 48.788  -23.284 1.00 24.98  ? 256 MET B O   1 
ATOM   4402 C CB  . MET B 1 263 ? -22.480 50.044  -25.521 1.00 25.94  ? 256 MET B CB  1 
ATOM   4403 C CG  . MET B 1 263 ? -23.769 50.261  -24.771 1.00 24.52  ? 256 MET B CG  1 
ATOM   4404 S SD  . MET B 1 263 ? -25.173 49.767  -25.779 1.00 31.60  ? 256 MET B SD  1 
ATOM   4405 C CE  . MET B 1 263 ? -25.391 51.208  -26.827 1.00 32.09  ? 256 MET B CE  1 
ATOM   4406 N N   . VAL B 1 264 ? -19.770 50.290  -22.963 1.00 39.47  ? 257 VAL B N   1 
ATOM   4407 C CA  . VAL B 1 264 ? -19.166 49.556  -21.853 1.00 46.05  ? 257 VAL B CA  1 
ATOM   4408 C C   . VAL B 1 264 ? -20.100 49.278  -20.671 1.00 33.71  ? 257 VAL B C   1 
ATOM   4409 O O   . VAL B 1 264 ? -19.962 48.263  -19.995 1.00 41.66  ? 257 VAL B O   1 
ATOM   4410 C CB  . VAL B 1 264 ? -17.866 50.228  -21.417 1.00 43.86  ? 257 VAL B CB  1 
ATOM   4411 C CG1 . VAL B 1 264 ? -17.208 49.456  -20.270 1.00 56.49  ? 257 VAL B CG1 1 
ATOM   4412 C CG2 . VAL B 1 264 ? -16.943 50.293  -22.627 1.00 29.96  ? 257 VAL B CG2 1 
ATOM   4413 N N   . GLU B 1 265 ? -21.088 50.140  -20.466 1.00 24.24  ? 258 GLU B N   1 
ATOM   4414 C CA  . GLU B 1 265 ? -22.064 49.960  -19.386 1.00 31.26  ? 258 GLU B CA  1 
ATOM   4415 C C   . GLU B 1 265 ? -22.782 48.606  -19.381 1.00 40.00  ? 258 GLU B C   1 
ATOM   4416 O O   . GLU B 1 265 ? -23.367 48.205  -18.367 1.00 58.71  ? 258 GLU B O   1 
ATOM   4417 C CB  . GLU B 1 265 ? -23.088 51.083  -19.417 1.00 28.73  ? 258 GLU B CB  1 
ATOM   4418 C CG  . GLU B 1 265 ? -23.172 51.723  -20.756 1.00 43.43  ? 258 GLU B CG  1 
ATOM   4419 C CD  . GLU B 1 265 ? -22.236 52.886  -20.919 1.00 49.44  ? 258 GLU B CD  1 
ATOM   4420 O OE1 . GLU B 1 265 ? -21.962 53.576  -19.919 1.00 48.68  ? 258 GLU B OE1 1 
ATOM   4421 O OE2 . GLU B 1 265 ? -21.779 53.114  -22.054 1.00 59.13  ? 258 GLU B OE2 1 
ATOM   4422 N N   . LEU B 1 266 ? -22.720 47.910  -20.511 1.00 33.42  ? 259 LEU B N   1 
ATOM   4423 C CA  . LEU B 1 266 ? -23.321 46.592  -20.682 1.00 31.84  ? 259 LEU B CA  1 
ATOM   4424 C C   . LEU B 1 266 ? -22.540 45.470  -20.015 1.00 34.11  ? 259 LEU B C   1 
ATOM   4425 O O   . LEU B 1 266 ? -23.121 44.443  -19.658 1.00 42.65  ? 259 LEU B O   1 
ATOM   4426 C CB  . LEU B 1 266 ? -23.436 46.272  -22.167 1.00 34.11  ? 259 LEU B CB  1 
ATOM   4427 C CG  . LEU B 1 266 ? -24.823 46.162  -22.775 1.00 34.54  ? 259 LEU B CG  1 
ATOM   4428 C CD1 . LEU B 1 266 ? -25.774 47.054  -22.035 1.00 20.68  ? 259 LEU B CD1 1 
ATOM   4429 C CD2 . LEU B 1 266 ? -24.745 46.537  -24.252 1.00 41.68  ? 259 LEU B CD2 1 
ATOM   4430 N N   . ASN B 1 267 ? -21.229 45.653  -19.850 1.00 32.30  ? 260 ASN B N   1 
ATOM   4431 C CA  . ASN B 1 267 ? -20.387 44.621  -19.223 1.00 39.03  ? 260 ASN B CA  1 
ATOM   4432 C C   . ASN B 1 267 ? -20.580 44.507  -17.706 1.00 32.26  ? 260 ASN B C   1 
ATOM   4433 O O   . ASN B 1 267 ? -20.586 43.412  -17.119 1.00 34.69  ? 260 ASN B O   1 
ATOM   4434 C CB  . ASN B 1 267 ? -18.918 44.859  -19.563 1.00 46.51  ? 260 ASN B CB  1 
ATOM   4435 C CG  . ASN B 1 267 ? -18.688 44.992  -21.054 1.00 45.03  ? 260 ASN B CG  1 
ATOM   4436 O OD1 . ASN B 1 267 ? -19.168 44.169  -21.850 1.00 36.63  ? 260 ASN B OD1 1 
ATOM   4437 N ND2 . ASN B 1 267 ? -17.971 46.045  -21.445 1.00 29.87  ? 260 ASN B ND2 1 
ATOM   4438 N N   . GLY B 1 268 ? -20.768 45.643  -17.065 1.00 34.48  ? 261 GLY B N   1 
ATOM   4439 C CA  . GLY B 1 268 ? -21.049 45.614  -15.645 1.00 59.92  ? 261 GLY B CA  1 
ATOM   4440 C C   . GLY B 1 268 ? -22.370 44.994  -15.212 1.00 52.37  ? 261 GLY B C   1 
ATOM   4441 O O   . GLY B 1 268 ? -22.421 44.349  -14.167 1.00 42.83  ? 261 GLY B O   1 
ATOM   4442 N N   . ASN B 1 269 ? -23.417 45.165  -16.022 1.00 49.38  ? 262 ASN B N   1 
ATOM   4443 C CA  . ASN B 1 269 ? -24.807 45.106  -15.543 1.00 52.32  ? 262 ASN B CA  1 
ATOM   4444 C C   . ASN B 1 269 ? -25.357 43.780  -15.023 1.00 42.02  ? 262 ASN B C   1 
ATOM   4445 O O   . ASN B 1 269 ? -24.841 42.710  -15.351 1.00 40.11  ? 262 ASN B O   1 
ATOM   4446 C CB  . ASN B 1 269 ? -25.754 45.655  -16.610 1.00 69.95  ? 262 ASN B CB  1 
ATOM   4447 C CG  . ASN B 1 269 ? -26.303 47.018  -16.253 1.00 86.89  ? 262 ASN B CG  1 
ATOM   4448 O OD1 . ASN B 1 269 ? -25.597 47.856  -15.693 1.00 91.45  ? 262 ASN B OD1 1 
ATOM   4449 N ND2 . ASN B 1 269 ? -27.578 47.244  -16.566 1.00 96.07  ? 262 ASN B ND2 1 
ATOM   4450 N N   . GLN B 1 270 ? -26.414 43.877  -14.209 1.00 39.46  ? 263 GLN B N   1 
ATOM   4451 C CA  . GLN B 1 270 ? -27.174 42.706  -13.749 1.00 32.61  ? 263 GLN B CA  1 
ATOM   4452 C C   . GLN B 1 270 ? -27.807 42.052  -14.970 1.00 29.75  ? 263 GLN B C   1 
ATOM   4453 O O   . GLN B 1 270 ? -28.159 42.755  -15.917 1.00 29.69  ? 263 GLN B O   1 
ATOM   4454 C CB  . GLN B 1 270 ? -28.305 43.079  -12.775 1.00 25.04  ? 263 GLN B CB  1 
ATOM   4455 C CG  . GLN B 1 270 ? -28.198 44.407  -12.028 1.00 29.55  ? 263 GLN B CG  1 
ATOM   4456 C CD  . GLN B 1 270 ? -29.358 44.614  -11.036 1.00 36.58  ? 263 GLN B CD  1 
ATOM   4457 O OE1 . GLN B 1 270 ? -30.336 43.875  -11.055 1.00 21.35  ? 263 GLN B OE1 1 
ATOM   4458 N NE2 . GLN B 1 270 ? -29.233 45.611  -10.162 1.00 55.11  ? 263 GLN B NE2 1 
ATOM   4459 N N   . PRO B 1 271 ? -27.961 40.713  -14.951 1.00 25.27  ? 264 PRO B N   1 
ATOM   4460 C CA  . PRO B 1 271 ? -28.549 40.016  -16.099 1.00 28.38  ? 264 PRO B CA  1 
ATOM   4461 C C   . PRO B 1 271 ? -29.887 40.632  -16.481 1.00 31.53  ? 264 PRO B C   1 
ATOM   4462 O O   . PRO B 1 271 ? -30.702 40.875  -15.595 1.00 30.55  ? 264 PRO B O   1 
ATOM   4463 C CB  . PRO B 1 271 ? -28.742 38.590  -15.581 1.00 34.94  ? 264 PRO B CB  1 
ATOM   4464 C CG  . PRO B 1 271 ? -27.701 38.438  -14.512 1.00 27.95  ? 264 PRO B CG  1 
ATOM   4465 C CD  . PRO B 1 271 ? -27.604 39.786  -13.860 1.00 20.26  ? 264 PRO B CD  1 
ATOM   4466 N N   . MET B 1 272 ? -30.087 40.927  -17.767 1.00 31.67  ? 265 MET B N   1 
ATOM   4467 C CA  . MET B 1 272 ? -31.324 41.556  -18.219 1.00 37.84  ? 265 MET B CA  1 
ATOM   4468 C C   . MET B 1 272 ? -32.166 40.571  -19.013 1.00 43.88  ? 265 MET B C   1 
ATOM   4469 O O   . MET B 1 272 ? -31.633 39.637  -19.627 1.00 35.48  ? 265 MET B O   1 
ATOM   4470 C CB  . MET B 1 272 ? -31.048 42.774  -19.091 1.00 49.69  ? 265 MET B CB  1 
ATOM   4471 C CG  . MET B 1 272 ? -29.729 43.477  -18.832 1.00 75.32  ? 265 MET B CG  1 
ATOM   4472 S SD  . MET B 1 272 ? -28.997 43.931  -20.415 1.00 39.95  ? 265 MET B SD  1 
ATOM   4473 C CE  . MET B 1 272 ? -29.338 42.410  -21.285 1.00 76.16  ? 265 MET B CE  1 
ATOM   4474 N N   . GLU B 1 273 ? -33.481 40.796  -18.998 1.00 39.46  ? 266 GLU B N   1 
ATOM   4475 C CA  . GLU B 1 273 ? -34.424 39.937  -19.700 1.00 27.69  ? 266 GLU B CA  1 
ATOM   4476 C C   . GLU B 1 273 ? -34.408 40.228  -21.200 1.00 35.12  ? 266 GLU B C   1 
ATOM   4477 O O   . GLU B 1 273 ? -34.262 41.374  -21.628 1.00 30.63  ? 266 GLU B O   1 
ATOM   4478 C CB  . GLU B 1 273 ? -35.829 40.118  -19.141 1.00 13.03  ? 266 GLU B CB  1 
ATOM   4479 C CG  . GLU B 1 273 ? -36.810 39.062  -19.612 1.00 33.18  ? 266 GLU B CG  1 
ATOM   4480 C CD  . GLU B 1 273 ? -38.162 39.158  -18.921 1.00 41.62  ? 266 GLU B CD  1 
ATOM   4481 O OE1 . GLU B 1 273 ? -38.626 38.131  -18.388 1.00 44.18  ? 266 GLU B OE1 1 
ATOM   4482 O OE2 . GLU B 1 273 ? -38.762 40.253  -18.911 1.00 44.02  ? 266 GLU B OE2 1 
ATOM   4483 N N   . ILE B 1 274 ? -34.565 39.176  -21.992 1.00 37.93  ? 267 ILE B N   1 
ATOM   4484 C CA  . ILE B 1 274 ? -34.392 39.246  -23.436 1.00 28.65  ? 267 ILE B CA  1 
ATOM   4485 C C   . ILE B 1 274 ? -35.753 39.068  -24.090 1.00 33.56  ? 267 ILE B C   1 
ATOM   4486 O O   . ILE B 1 274 ? -36.532 38.202  -23.685 1.00 43.41  ? 267 ILE B O   1 
ATOM   4487 C CB  . ILE B 1 274 ? -33.384 38.149  -23.896 1.00 20.30  ? 267 ILE B CB  1 
ATOM   4488 C CG1 . ILE B 1 274 ? -31.961 38.689  -23.928 1.00 37.45  ? 267 ILE B CG1 1 
ATOM   4489 C CG2 . ILE B 1 274 ? -33.668 37.615  -25.260 1.00 13.32  ? 267 ILE B CG2 1 
ATOM   4490 C CD1 . ILE B 1 274 ? -31.706 39.862  -23.049 1.00 46.72  ? 267 ILE B CD1 1 
ATOM   4491 N N   . LYS B 1 275 ? -36.060 39.926  -25.059 1.00 29.01  ? 268 LYS B N   1 
ATOM   4492 C CA  . LYS B 1 275 ? -37.189 39.702  -25.963 1.00 33.67  ? 268 LYS B CA  1 
ATOM   4493 C C   . LYS B 1 275 ? -36.653 39.526  -27.395 1.00 39.65  ? 268 LYS B C   1 
ATOM   4494 O O   . LYS B 1 275 ? -35.937 40.389  -27.917 1.00 27.16  ? 268 LYS B O   1 
ATOM   4495 C CB  . LYS B 1 275 ? -38.210 40.844  -25.895 1.00 28.16  ? 268 LYS B CB  1 
ATOM   4496 C CG  . LYS B 1 275 ? -39.547 40.517  -26.558 1.00 49.75  ? 268 LYS B CG  1 
ATOM   4497 C CD  . LYS B 1 275 ? -40.362 39.562  -25.678 1.00 71.23  ? 268 LYS B CD  1 
ATOM   4498 C CE  . LYS B 1 275 ? -41.769 39.289  -26.224 1.00 70.41  ? 268 LYS B CE  1 
ATOM   4499 N NZ  . LYS B 1 275 ? -42.665 38.734  -25.154 1.00 57.23  ? 268 LYS B NZ  1 
ATOM   4500 N N   . VAL B 1 276 ? -36.986 38.399  -28.018 1.00 46.48  ? 269 VAL B N   1 
ATOM   4501 C CA  . VAL B 1 276 ? -36.504 38.083  -29.361 1.00 43.00  ? 269 VAL B CA  1 
ATOM   4502 C C   . VAL B 1 276 ? -37.412 38.687  -30.444 1.00 43.41  ? 269 VAL B C   1 
ATOM   4503 O O   . VAL B 1 276 ? -38.636 38.616  -30.350 1.00 41.59  ? 269 VAL B O   1 
ATOM   4504 C CB  . VAL B 1 276 ? -36.375 36.562  -29.538 1.00 35.94  ? 269 VAL B CB  1 
ATOM   4505 C CG1 . VAL B 1 276 ? -35.890 36.209  -30.932 1.00 27.90  ? 269 VAL B CG1 1 
ATOM   4506 C CG2 . VAL B 1 276 ? -35.432 35.991  -28.476 1.00 34.02  ? 269 VAL B CG2 1 
ATOM   4507 N N   . LEU B 1 277 ? -36.805 39.287  -31.468 1.00 42.07  ? 270 LEU B N   1 
ATOM   4508 C CA  . LEU B 1 277 ? -37.551 40.023  -32.486 1.00 34.22  ? 270 LEU B CA  1 
ATOM   4509 C C   . LEU B 1 277 ? -37.465 39.370  -33.865 1.00 35.81  ? 270 LEU B C   1 
ATOM   4510 O O   . LEU B 1 277 ? -38.329 39.563  -34.722 1.00 42.06  ? 270 LEU B O   1 
ATOM   4511 C CB  . LEU B 1 277 ? -37.042 41.461  -32.541 1.00 32.81  ? 270 LEU B CB  1 
ATOM   4512 C CG  . LEU B 1 277 ? -37.042 42.141  -31.167 1.00 33.58  ? 270 LEU B CG  1 
ATOM   4513 C CD1 . LEU B 1 277 ? -36.480 43.577  -31.200 1.00 25.10  ? 270 LEU B CD1 1 
ATOM   4514 C CD2 . LEU B 1 277 ? -38.458 42.099  -30.581 1.00 20.81  ? 270 LEU B CD2 1 
ATOM   4515 N N   . GLY B 1 278 ? -36.418 38.586  -34.069 1.00 33.90  ? 271 GLY B N   1 
ATOM   4516 C CA  . GLY B 1 278 ? -36.213 37.909  -35.330 1.00 38.69  ? 271 GLY B CA  1 
ATOM   4517 C C   . GLY B 1 278 ? -35.106 36.895  -35.178 1.00 48.26  ? 271 GLY B C   1 
ATOM   4518 O O   . GLY B 1 278 ? -34.665 36.633  -34.062 1.00 45.68  ? 271 GLY B O   1 
ATOM   4519 N N   . PRO B 1 279 ? -34.647 36.320  -36.300 1.00 51.82  ? 272 PRO B N   1 
ATOM   4520 C CA  . PRO B 1 279 ? -33.568 35.325  -36.281 1.00 45.63  ? 272 PRO B CA  1 
ATOM   4521 C C   . PRO B 1 279 ? -32.221 35.940  -35.901 1.00 45.02  ? 272 PRO B C   1 
ATOM   4522 O O   . PRO B 1 279 ? -31.350 35.220  -35.420 1.00 51.46  ? 272 PRO B O   1 
ATOM   4523 C CB  . PRO B 1 279 ? -33.517 34.826  -37.730 1.00 45.77  ? 272 PRO B CB  1 
ATOM   4524 C CG  . PRO B 1 279 ? -34.786 35.298  -38.363 1.00 46.58  ? 272 PRO B CG  1 
ATOM   4525 C CD  . PRO B 1 279 ? -35.161 36.554  -37.657 1.00 42.55  ? 272 PRO B CD  1 
ATOM   4526 N N   . TYR B 1 280 ? -32.043 37.243  -36.096 1.00 35.24  ? 273 TYR B N   1 
ATOM   4527 C CA  . TYR B 1 280 ? -30.742 37.834  -35.812 1.00 36.87  ? 273 TYR B CA  1 
ATOM   4528 C C   . TYR B 1 280 ? -30.744 38.871  -34.692 1.00 41.58  ? 273 TYR B C   1 
ATOM   4529 O O   . TYR B 1 280 ? -29.696 39.451  -34.390 1.00 37.90  ? 273 TYR B O   1 
ATOM   4530 C CB  . TYR B 1 280 ? -30.147 38.440  -37.088 1.00 28.45  ? 273 TYR B CB  1 
ATOM   4531 C CG  . TYR B 1 280 ? -29.969 37.424  -38.180 1.00 29.92  ? 273 TYR B CG  1 
ATOM   4532 C CD1 . TYR B 1 280 ? -28.925 36.506  -38.132 1.00 42.08  ? 273 TYR B CD1 1 
ATOM   4533 C CD2 . TYR B 1 280 ? -30.853 37.364  -39.251 1.00 29.31  ? 273 TYR B CD2 1 
ATOM   4534 C CE1 . TYR B 1 280 ? -28.762 35.553  -39.121 1.00 46.46  ? 273 TYR B CE1 1 
ATOM   4535 C CE2 . TYR B 1 280 ? -30.705 36.409  -40.248 1.00 36.94  ? 273 TYR B CE2 1 
ATOM   4536 C CZ  . TYR B 1 280 ? -29.653 35.506  -40.179 1.00 48.77  ? 273 TYR B CZ  1 
ATOM   4537 O OH  . TYR B 1 280 ? -29.491 34.557  -41.169 1.00 56.08  ? 273 TYR B OH  1 
ATOM   4538 N N   . THR B 1 281 ? -31.904 39.111  -34.079 1.00 33.82  ? 274 THR B N   1 
ATOM   4539 C CA  . THR B 1 281 ? -32.034 40.226  -33.136 1.00 27.36  ? 274 THR B CA  1 
ATOM   4540 C C   . THR B 1 281 ? -32.870 39.913  -31.928 1.00 31.78  ? 274 THR B C   1 
ATOM   4541 O O   . THR B 1 281 ? -33.701 39.010  -31.941 1.00 33.25  ? 274 THR B O   1 
ATOM   4542 C CB  . THR B 1 281 ? -32.655 41.488  -33.777 1.00 23.05  ? 274 THR B CB  1 
ATOM   4543 O OG1 . THR B 1 281 ? -33.878 41.138  -34.443 1.00 25.88  ? 274 THR B OG1 1 
ATOM   4544 C CG2 . THR B 1 281 ? -31.680 42.129  -34.787 1.00 26.73  ? 274 THR B CG2 1 
ATOM   4545 N N   . PHE B 1 282 ? -32.619 40.650  -30.851 1.00 32.59  ? 275 PHE B N   1 
ATOM   4546 C CA  . PHE B 1 282 ? -33.412 40.561  -29.630 1.00 26.12  ? 275 PHE B CA  1 
ATOM   4547 C C   . PHE B 1 282 ? -33.296 41.870  -28.854 1.00 24.92  ? 275 PHE B C   1 
ATOM   4548 O O   . PHE B 1 282 ? -32.347 42.625  -29.052 1.00 26.26  ? 275 PHE B O   1 
ATOM   4549 C CB  . PHE B 1 282 ? -33.023 39.348  -28.778 1.00 23.95  ? 275 PHE B CB  1 
ATOM   4550 C CG  . PHE B 1 282 ? -31.603 39.365  -28.293 1.00 33.98  ? 275 PHE B CG  1 
ATOM   4551 C CD1 . PHE B 1 282 ? -31.289 39.894  -27.054 1.00 40.69  ? 275 PHE B CD1 1 
ATOM   4552 C CD2 . PHE B 1 282 ? -30.588 38.831  -29.064 1.00 30.67  ? 275 PHE B CD2 1 
ATOM   4553 C CE1 . PHE B 1 282 ? -29.987 39.901  -26.600 1.00 29.69  ? 275 PHE B CE1 1 
ATOM   4554 C CE2 . PHE B 1 282 ? -29.285 38.836  -28.615 1.00 38.82  ? 275 PHE B CE2 1 
ATOM   4555 C CZ  . PHE B 1 282 ? -28.984 39.372  -27.381 1.00 40.07  ? 275 PHE B CZ  1 
ATOM   4556 N N   . SER B 1 283 ? -34.254 42.143  -27.975 1.00 25.59  ? 276 SER B N   1 
ATOM   4557 C CA  . SER B 1 283 ? -34.249 43.407  -27.245 1.00 28.76  ? 276 SER B CA  1 
ATOM   4558 C C   . SER B 1 283 ? -33.890 43.261  -25.772 1.00 28.67  ? 276 SER B C   1 
ATOM   4559 O O   . SER B 1 283 ? -34.482 42.468  -25.045 1.00 38.20  ? 276 SER B O   1 
ATOM   4560 C CB  . SER B 1 283 ? -35.597 44.119  -27.387 1.00 27.76  ? 276 SER B CB  1 
ATOM   4561 O OG  . SER B 1 283 ? -36.630 43.391  -26.751 1.00 30.04  ? 276 SER B OG  1 
ATOM   4562 N N   . ILE B 1 284 ? -32.898 44.038  -25.356 1.00 33.97  ? 277 ILE B N   1 
ATOM   4563 C CA  . ILE B 1 284 ? -32.429 44.078  -23.978 1.00 22.72  ? 277 ILE B CA  1 
ATOM   4564 C C   . ILE B 1 284 ? -33.006 45.271  -23.219 1.00 31.93  ? 277 ILE B C   1 
ATOM   4565 O O   . ILE B 1 284 ? -34.016 45.848  -23.614 1.00 39.95  ? 277 ILE B O   1 
ATOM   4566 C CB  . ILE B 1 284 ? -30.895 44.120  -23.905 1.00 20.17  ? 277 ILE B CB  1 
ATOM   4567 C CG1 . ILE B 1 284 ? -30.363 45.384  -24.582 1.00 28.55  ? 277 ILE B CG1 1 
ATOM   4568 C CG2 . ILE B 1 284 ? -30.304 42.880  -24.549 1.00 23.45  ? 277 ILE B CG2 1 
ATOM   4569 C CD1 . ILE B 1 284 ? -28.867 45.551  -24.472 1.00 34.28  ? 277 ILE B CD1 1 
ATOM   4570 N N   . CYS B 1 285 ? -32.347 45.624  -22.122 1.00 33.65  ? 278 CYS B N   1 
ATOM   4571 C CA  . CYS B 1 285 ? -32.725 46.764  -21.298 1.00 34.26  ? 278 CYS B CA  1 
ATOM   4572 C C   . CYS B 1 285 ? -32.449 48.046  -22.068 1.00 31.87  ? 278 CYS B C   1 
ATOM   4573 O O   . CYS B 1 285 ? -31.656 48.049  -23.004 1.00 39.88  ? 278 CYS B O   1 
ATOM   4574 C CB  . CYS B 1 285 ? -31.902 46.778  -20.013 1.00 47.38  ? 278 CYS B CB  1 
ATOM   4575 S SG  . CYS B 1 285 ? -30.188 47.305  -20.258 1.00 36.32  ? 278 CYS B SG  1 
ATOM   4576 N N   . ASP B 1 286 ? -33.115 49.132  -21.692 1.00 37.97  ? 279 ASP B N   1 
ATOM   4577 C CA  . ASP B 1 286 ? -32.916 50.392  -22.393 1.00 39.43  ? 279 ASP B CA  1 
ATOM   4578 C C   . ASP B 1 286 ? -31.465 50.850  -22.282 1.00 42.71  ? 279 ASP B C   1 
ATOM   4579 O O   . ASP B 1 286 ? -30.889 50.885  -21.196 1.00 39.65  ? 279 ASP B O   1 
ATOM   4580 C CB  . ASP B 1 286 ? -33.847 51.459  -21.815 1.00 34.09  ? 279 ASP B CB  1 
ATOM   4581 C CG  . ASP B 1 286 ? -33.411 52.865  -22.165 1.00 47.63  ? 279 ASP B CG  1 
ATOM   4582 O OD1 . ASP B 1 286 ? -34.079 53.821  -21.721 1.00 44.18  ? 279 ASP B OD1 1 
ATOM   4583 O OD2 . ASP B 1 286 ? -32.401 53.015  -22.883 1.00 65.63  ? 279 ASP B OD2 1 
ATOM   4584 N N   . THR B 1 287 ? -30.888 51.203  -23.426 1.00 39.12  ? 280 THR B N   1 
ATOM   4585 C CA  . THR B 1 287 ? -29.505 51.658  -23.516 1.00 35.54  ? 280 THR B CA  1 
ATOM   4586 C C   . THR B 1 287 ? -29.428 53.102  -23.996 1.00 48.68  ? 280 THR B C   1 
ATOM   4587 O O   . THR B 1 287 ? -28.378 53.568  -24.431 1.00 52.92  ? 280 THR B O   1 
ATOM   4588 C CB  . THR B 1 287 ? -28.698 50.769  -24.472 1.00 24.31  ? 280 THR B CB  1 
ATOM   4589 O OG1 . THR B 1 287 ? -29.375 50.683  -25.730 1.00 30.11  ? 280 THR B OG1 1 
ATOM   4590 C CG2 . THR B 1 287 ? -28.547 49.374  -23.896 1.00 24.35  ? 280 THR B CG2 1 
ATOM   4591 N N   . SER B 1 288 ? -30.558 53.793  -23.936 1.00 54.99  ? 281 SER B N   1 
ATOM   4592 C CA  . SER B 1 288 ? -30.690 55.140  -24.495 1.00 53.20  ? 281 SER B CA  1 
ATOM   4593 C C   . SER B 1 288 ? -29.650 56.101  -23.957 1.00 49.72  ? 281 SER B C   1 
ATOM   4594 O O   . SER B 1 288 ? -29.347 57.107  -24.596 1.00 55.59  ? 281 SER B O   1 
ATOM   4595 C CB  . SER B 1 288 ? -32.076 55.718  -24.201 1.00 61.23  ? 281 SER B CB  1 
ATOM   4596 O OG  . SER B 1 288 ? -33.073 54.708  -24.256 1.00 69.10  ? 281 SER B OG  1 
ATOM   4597 N N   . ASN B 1 289 ? -29.120 55.800  -22.776 1.00 46.02  ? 282 ASN B N   1 
ATOM   4598 C CA  . ASN B 1 289 ? -28.184 56.697  -22.113 1.00 55.56  ? 282 ASN B CA  1 
ATOM   4599 C C   . ASN B 1 289 ? -26.829 56.049  -21.947 1.00 57.99  ? 282 ASN B C   1 
ATOM   4600 O O   . ASN B 1 289 ? -26.032 56.431  -21.086 1.00 61.76  ? 282 ASN B O   1 
ATOM   4601 C CB  . ASN B 1 289 ? -28.727 57.141  -20.758 1.00 68.06  ? 282 ASN B CB  1 
ATOM   4602 C CG  . ASN B 1 289 ? -29.960 58.008  -20.889 1.00 84.33  ? 282 ASN B CG  1 
ATOM   4603 O OD1 . ASN B 1 289 ? -29.868 59.237  -20.900 1.00 94.50  ? 282 ASN B OD1 1 
ATOM   4604 N ND2 . ASN B 1 289 ? -31.125 57.373  -21.000 1.00 83.36  ? 282 ASN B ND2 1 
ATOM   4605 N N   . PHE B 1 290 ? -26.575 55.059  -22.787 1.00 50.13  ? 283 PHE B N   1 
ATOM   4606 C CA  . PHE B 1 290 ? -25.294 54.391  -22.781 1.00 46.48  ? 283 PHE B CA  1 
ATOM   4607 C C   . PHE B 1 290 ? -24.355 55.082  -23.760 1.00 51.80  ? 283 PHE B C   1 
ATOM   4608 O O   . PHE B 1 290 ? -24.721 56.072  -24.393 1.00 56.53  ? 283 PHE B O   1 
ATOM   4609 C CB  . PHE B 1 290 ? -25.491 52.919  -23.124 1.00 50.60  ? 283 PHE B CB  1 
ATOM   4610 C CG  . PHE B 1 290 ? -26.047 52.110  -21.982 1.00 57.96  ? 283 PHE B CG  1 
ATOM   4611 C CD1 . PHE B 1 290 ? -26.209 50.741  -22.088 1.00 55.18  ? 283 PHE B CD1 1 
ATOM   4612 C CD2 . PHE B 1 290 ? -26.374 52.723  -20.779 1.00 55.57  ? 283 PHE B CD2 1 
ATOM   4613 C CE1 . PHE B 1 290 ? -26.697 50.009  -21.021 1.00 49.65  ? 283 PHE B CE1 1 
ATOM   4614 C CE2 . PHE B 1 290 ? -26.863 51.987  -19.718 1.00 43.75  ? 283 PHE B CE2 1 
ATOM   4615 C CZ  . PHE B 1 290 ? -27.021 50.630  -19.841 1.00 40.17  ? 283 PHE B CZ  1 
ATOM   4616 N N   . SER B 1 291 ? -23.134 54.580  -23.865 1.00 51.96  ? 284 SER B N   1 
ATOM   4617 C CA  . SER B 1 291 ? -22.205 55.097  -24.857 1.00 54.48  ? 284 SER B CA  1 
ATOM   4618 C C   . SER B 1 291 ? -22.353 54.282  -26.143 1.00 59.54  ? 284 SER B C   1 
ATOM   4619 O O   . SER B 1 291 ? -22.739 53.111  -26.095 1.00 52.91  ? 284 SER B O   1 
ATOM   4620 C CB  . SER B 1 291 ? -20.772 55.038  -24.331 1.00 53.17  ? 284 SER B CB  1 
ATOM   4621 O OG  . SER B 1 291 ? -20.689 55.572  -23.017 1.00 45.24  ? 284 SER B OG  1 
ATOM   4622 N N   . ASP B 1 292 ? -22.068 54.913  -27.283 1.00 62.84  ? 285 ASP B N   1 
ATOM   4623 C CA  . ASP B 1 292 ? -22.239 54.280  -28.591 1.00 51.75  ? 285 ASP B CA  1 
ATOM   4624 C C   . ASP B 1 292 ? -21.530 52.945  -28.633 1.00 40.85  ? 285 ASP B C   1 
ATOM   4625 O O   . ASP B 1 292 ? -20.378 52.839  -28.227 1.00 40.84  ? 285 ASP B O   1 
ATOM   4626 C CB  . ASP B 1 292 ? -21.674 55.167  -29.702 1.00 60.60  ? 285 ASP B CB  1 
ATOM   4627 C CG  . ASP B 1 292 ? -22.289 56.540  -29.715 1.00 71.12  ? 285 ASP B CG  1 
ATOM   4628 O OD1 . ASP B 1 292 ? -22.733 56.983  -28.636 1.00 75.36  ? 285 ASP B OD1 1 
ATOM   4629 O OD2 . ASP B 1 292 ? -22.326 57.177  -30.793 1.00 77.26  ? 285 ASP B OD2 1 
ATOM   4630 N N   . TYR B 1 293 ? -22.213 51.920  -29.118 1.00 36.80  ? 286 TYR B N   1 
ATOM   4631 C CA  . TYR B 1 293 ? -21.562 50.634  -29.286 1.00 35.91  ? 286 TYR B CA  1 
ATOM   4632 C C   . TYR B 1 293 ? -20.554 50.748  -30.406 1.00 37.26  ? 286 TYR B C   1 
ATOM   4633 O O   . TYR B 1 293 ? -20.877 51.281  -31.458 1.00 47.31  ? 286 TYR B O   1 
ATOM   4634 C CB  . TYR B 1 293 ? -22.585 49.586  -29.662 1.00 30.59  ? 286 TYR B CB  1 
ATOM   4635 C CG  . TYR B 1 293 ? -21.980 48.294  -30.135 1.00 36.48  ? 286 TYR B CG  1 
ATOM   4636 C CD1 . TYR B 1 293 ? -21.626 47.307  -29.227 1.00 21.85  ? 286 TYR B CD1 1 
ATOM   4637 C CD2 . TYR B 1 293 ? -21.772 48.050  -31.496 1.00 39.44  ? 286 TYR B CD2 1 
ATOM   4638 C CE1 . TYR B 1 293 ? -21.082 46.113  -29.644 1.00 28.01  ? 286 TYR B CE1 1 
ATOM   4639 C CE2 . TYR B 1 293 ? -21.222 46.850  -31.926 1.00 38.16  ? 286 TYR B CE2 1 
ATOM   4640 C CZ  . TYR B 1 293 ? -20.883 45.883  -30.988 1.00 35.16  ? 286 TYR B CZ  1 
ATOM   4641 O OH  . TYR B 1 293 ? -20.351 44.681  -31.385 1.00 30.87  ? 286 TYR B OH  1 
ATOM   4642 N N   . ILE B 1 294 ? -19.348 50.236  -30.203 1.00 32.55  ? 287 ILE B N   1 
ATOM   4643 C CA  . ILE B 1 294 ? -18.359 50.256  -31.280 1.00 38.12  ? 287 ILE B CA  1 
ATOM   4644 C C   . ILE B 1 294 ? -18.138 48.899  -31.967 1.00 39.77  ? 287 ILE B C   1 
ATOM   4645 O O   . ILE B 1 294 ? -18.314 48.787  -33.190 1.00 45.42  ? 287 ILE B O   1 
ATOM   4646 C CB  . ILE B 1 294 ? -17.027 50.860  -30.835 1.00 40.99  ? 287 ILE B CB  1 
ATOM   4647 C CG1 . ILE B 1 294 ? -17.153 52.378  -30.746 1.00 43.70  ? 287 ILE B CG1 1 
ATOM   4648 C CG2 . ILE B 1 294 ? -15.950 50.510  -31.824 1.00 42.02  ? 287 ILE B CG2 1 
ATOM   4649 C CD1 . ILE B 1 294 ? -16.096 53.015  -29.873 1.00 45.58  ? 287 ILE B CD1 1 
ATOM   4650 N N   . ARG B 1 295 ? -17.769 47.877  -31.194 1.00 31.11  ? 288 ARG B N   1 
ATOM   4651 C CA  . ARG B 1 295 ? -17.535 46.545  -31.758 1.00 35.09  ? 288 ARG B CA  1 
ATOM   4652 C C   . ARG B 1 295 ? -17.415 45.495  -30.667 1.00 29.56  ? 288 ARG B C   1 
ATOM   4653 O O   . ARG B 1 295 ? -17.345 45.817  -29.485 1.00 30.75  ? 288 ARG B O   1 
ATOM   4654 C CB  . ARG B 1 295 ? -16.259 46.521  -32.624 1.00 48.63  ? 288 ARG B CB  1 
ATOM   4655 C CG  . ARG B 1 295 ? -14.957 46.188  -31.865 1.00 42.54  ? 288 ARG B CG  1 
ATOM   4656 C CD  . ARG B 1 295 ? -14.066 47.401  -31.703 1.00 48.97  ? 288 ARG B CD  1 
ATOM   4657 N NE  . ARG B 1 295 ? -13.332 47.681  -32.929 1.00 69.22  ? 288 ARG B NE  1 
ATOM   4658 C CZ  . ARG B 1 295 ? -12.153 47.150  -33.224 1.00 69.92  ? 288 ARG B CZ  1 
ATOM   4659 N NH1 . ARG B 1 295 ? -11.573 46.315  -32.373 1.00 72.85  ? 288 ARG B NH1 1 
ATOM   4660 N NH2 . ARG B 1 295 ? -11.561 47.452  -34.369 1.00 64.14  ? 288 ARG B NH2 1 
ATOM   4661 N N   . GLY B 1 296 ? -17.378 44.233  -31.073 1.00 34.70  ? 289 GLY B N   1 
ATOM   4662 C CA  . GLY B 1 296 ? -17.137 43.136  -30.151 1.00 45.79  ? 289 GLY B CA  1 
ATOM   4663 C C   . GLY B 1 296 ? -18.170 42.910  -29.059 1.00 44.12  ? 289 GLY B C   1 
ATOM   4664 O O   . GLY B 1 296 ? -19.217 43.551  -29.024 1.00 40.85  ? 289 GLY B O   1 
ATOM   4665 N N   . GLY B 1 297 ? -17.862 41.981  -28.161 1.00 40.55  ? 290 GLY B N   1 
ATOM   4666 C CA  . GLY B 1 297 ? -18.757 41.640  -27.077 1.00 38.29  ? 290 GLY B CA  1 
ATOM   4667 C C   . GLY B 1 297 ? -19.247 40.209  -27.104 1.00 31.26  ? 290 GLY B C   1 
ATOM   4668 O O   . GLY B 1 297 ? -19.261 39.574  -28.143 1.00 40.06  ? 290 GLY B O   1 
ATOM   4669 N N   . ILE B 1 298 ? -19.645 39.704  -25.941 1.00 32.37  ? 291 ILE B N   1 
ATOM   4670 C CA  . ILE B 1 298 ? -20.159 38.352  -25.824 1.00 33.69  ? 291 ILE B CA  1 
ATOM   4671 C C   . ILE B 1 298 ? -21.420 38.384  -24.999 1.00 37.41  ? 291 ILE B C   1 
ATOM   4672 O O   . ILE B 1 298 ? -21.424 38.868  -23.867 1.00 44.07  ? 291 ILE B O   1 
ATOM   4673 C CB  . ILE B 1 298 ? -19.168 37.417  -25.110 1.00 33.14  ? 291 ILE B CB  1 
ATOM   4674 C CG1 . ILE B 1 298 ? -17.849 37.356  -25.869 1.00 35.25  ? 291 ILE B CG1 1 
ATOM   4675 C CG2 . ILE B 1 298 ? -19.743 36.016  -24.971 1.00 13.95  ? 291 ILE B CG2 1 
ATOM   4676 C CD1 . ILE B 1 298 ? -16.778 36.630  -25.127 1.00 34.80  ? 291 ILE B CD1 1 
ATOM   4677 N N   . VAL B 1 299 ? -22.499 37.874  -25.571 1.00 35.22  ? 292 VAL B N   1 
ATOM   4678 C CA  . VAL B 1 299 ? -23.724 37.717  -24.815 1.00 29.04  ? 292 VAL B CA  1 
ATOM   4679 C C   . VAL B 1 299 ? -23.814 36.277  -24.313 1.00 27.64  ? 292 VAL B C   1 
ATOM   4680 O O   . VAL B 1 299 ? -23.711 35.321  -25.089 1.00 29.92  ? 292 VAL B O   1 
ATOM   4681 C CB  . VAL B 1 299 ? -24.971 38.129  -25.628 1.00 27.93  ? 292 VAL B CB  1 
ATOM   4682 C CG1 . VAL B 1 299 ? -25.035 37.397  -26.977 1.00 27.66  ? 292 VAL B CG1 1 
ATOM   4683 C CG2 . VAL B 1 299 ? -26.203 37.859  -24.833 1.00 21.97  ? 292 VAL B CG2 1 
ATOM   4684 N N   . SER B 1 300 ? -23.962 36.137  -22.998 1.00 29.78  ? 293 SER B N   1 
ATOM   4685 C CA  . SER B 1 300 ? -24.058 34.831  -22.352 1.00 40.92  ? 293 SER B CA  1 
ATOM   4686 C C   . SER B 1 300 ? -25.438 34.672  -21.754 1.00 42.02  ? 293 SER B C   1 
ATOM   4687 O O   . SER B 1 300 ? -26.057 35.645  -21.321 1.00 45.40  ? 293 SER B O   1 
ATOM   4688 C CB  . SER B 1 300 ? -23.008 34.676  -21.240 1.00 50.00  ? 293 SER B CB  1 
ATOM   4689 O OG  . SER B 1 300 ? -21.680 34.671  -21.750 1.00 51.93  ? 293 SER B OG  1 
ATOM   4690 N N   . GLN B 1 301 ? -25.905 33.432  -21.725 1.00 39.49  ? 294 GLN B N   1 
ATOM   4691 C CA  . GLN B 1 301 ? -27.198 33.091  -21.161 1.00 38.91  ? 294 GLN B CA  1 
ATOM   4692 C C   . GLN B 1 301 ? -27.062 32.728  -19.681 1.00 38.36  ? 294 GLN B C   1 
ATOM   4693 O O   . GLN B 1 301 ? -26.539 31.669  -19.345 1.00 49.07  ? 294 GLN B O   1 
ATOM   4694 C CB  . GLN B 1 301 ? -27.748 31.896  -21.924 1.00 42.32  ? 294 GLN B CB  1 
ATOM   4695 C CG  . GLN B 1 301 ? -29.210 31.592  -21.712 1.00 47.15  ? 294 GLN B CG  1 
ATOM   4696 C CD  . GLN B 1 301 ? -29.632 30.416  -22.556 1.00 49.07  ? 294 GLN B CD  1 
ATOM   4697 O OE1 . GLN B 1 301 ? -28.999 29.356  -22.511 1.00 50.30  ? 294 GLN B OE1 1 
ATOM   4698 N NE2 . GLN B 1 301 ? -30.679 30.601  -23.362 1.00 38.28  ? 294 GLN B NE2 1 
ATOM   4699 N N   . VAL B 1 302 ? -27.537 33.597  -18.799 1.00 32.35  ? 295 VAL B N   1 
ATOM   4700 C CA  . VAL B 1 302 ? -27.474 33.321  -17.364 1.00 37.44  ? 295 VAL B CA  1 
ATOM   4701 C C   . VAL B 1 302 ? -28.621 32.443  -16.862 1.00 45.09  ? 295 VAL B C   1 
ATOM   4702 O O   . VAL B 1 302 ? -28.406 31.324  -16.391 1.00 54.97  ? 295 VAL B O   1 
ATOM   4703 C CB  . VAL B 1 302 ? -27.489 34.608  -16.554 1.00 29.02  ? 295 VAL B CB  1 
ATOM   4704 C CG1 . VAL B 1 302 ? -27.554 34.287  -15.065 1.00 25.63  ? 295 VAL B CG1 1 
ATOM   4705 C CG2 . VAL B 1 302 ? -26.259 35.396  -16.865 1.00 34.54  ? 295 VAL B CG2 1 
ATOM   4706 N N   . LYS B 1 303 ? -29.837 32.961  -16.959 1.00 34.24  ? 296 LYS B N   1 
ATOM   4707 C CA  . LYS B 1 303 ? -31.006 32.254  -16.468 1.00 43.00  ? 296 LYS B CA  1 
ATOM   4708 C C   . LYS B 1 303 ? -31.964 31.902  -17.618 1.00 45.69  ? 296 LYS B C   1 
ATOM   4709 O O   . LYS B 1 303 ? -32.039 32.619  -18.621 1.00 45.33  ? 296 LYS B O   1 
ATOM   4710 C CB  . LYS B 1 303 ? -31.704 33.097  -15.395 1.00 42.31  ? 296 LYS B CB  1 
ATOM   4711 C CG  . LYS B 1 303 ? -31.748 32.457  -14.013 1.00 48.61  ? 296 LYS B CG  1 
ATOM   4712 C CD  . LYS B 1 303 ? -30.360 32.104  -13.488 1.00 63.68  ? 296 LYS B CD  1 
ATOM   4713 C CE  . LYS B 1 303 ? -30.429 31.190  -12.247 1.00 71.80  ? 296 LYS B CE  1 
ATOM   4714 N NZ  . LYS B 1 303 ? -31.095 31.817  -11.053 1.00 71.49  ? 296 LYS B NZ  1 
ATOM   4715 N N   . VAL B 1 304 ? -32.686 30.791  -17.462 1.00 42.16  ? 297 VAL B N   1 
ATOM   4716 C CA  . VAL B 1 304 ? -33.610 30.281  -18.483 1.00 42.56  ? 297 VAL B CA  1 
ATOM   4717 C C   . VAL B 1 304 ? -34.942 29.832  -17.869 1.00 47.77  ? 297 VAL B C   1 
ATOM   4718 O O   . VAL B 1 304 ? -34.960 29.039  -16.933 1.00 59.64  ? 297 VAL B O   1 
ATOM   4719 C CB  . VAL B 1 304 ? -32.996 29.087  -19.252 1.00 35.03  ? 297 VAL B CB  1 
ATOM   4720 C CG1 . VAL B 1 304 ? -34.084 28.261  -19.939 1.00 32.54  ? 297 VAL B CG1 1 
ATOM   4721 C CG2 . VAL B 1 304 ? -31.965 29.569  -20.267 1.00 27.31  ? 297 VAL B CG2 1 
ATOM   4722 N N   . PRO B 1 305 ? -36.062 30.340  -18.399 1.00 41.78  ? 298 PRO B N   1 
ATOM   4723 C CA  . PRO B 1 305 ? -37.388 30.071  -17.836 1.00 33.81  ? 298 PRO B CA  1 
ATOM   4724 C C   . PRO B 1 305 ? -37.850 28.653  -18.098 1.00 40.50  ? 298 PRO B C   1 
ATOM   4725 O O   . PRO B 1 305 ? -37.744 28.198  -19.224 1.00 50.88  ? 298 PRO B O   1 
ATOM   4726 C CB  . PRO B 1 305 ? -38.302 31.027  -18.609 1.00 41.34  ? 298 PRO B CB  1 
ATOM   4727 C CG  . PRO B 1 305 ? -37.395 32.005  -19.283 1.00 47.93  ? 298 PRO B CG  1 
ATOM   4728 C CD  . PRO B 1 305 ? -36.113 31.289  -19.523 1.00 49.10  ? 298 PRO B CD  1 
ATOM   4729 N N   . LYS B 1 306 ? -38.375 27.979  -17.080 1.00 52.01  ? 299 LYS B N   1 
ATOM   4730 C CA  . LYS B 1 306 ? -38.939 26.638  -17.218 1.00 49.09  ? 299 LYS B CA  1 
ATOM   4731 C C   . LYS B 1 306 ? -40.364 26.612  -16.660 1.00 43.34  ? 299 LYS B C   1 
ATOM   4732 O O   . LYS B 1 306 ? -40.725 27.460  -15.854 1.00 49.13  ? 299 LYS B O   1 
ATOM   4733 C CB  . LYS B 1 306 ? -38.067 25.630  -16.468 1.00 49.57  ? 299 LYS B CB  1 
ATOM   4734 C CG  . LYS B 1 306 ? -37.356 24.640  -17.369 1.00 56.76  ? 299 LYS B CG  1 
ATOM   4735 C CD  . LYS B 1 306 ? -36.621 25.350  -18.496 1.00 61.79  ? 299 LYS B CD  1 
ATOM   4736 C CE  . LYS B 1 306 ? -36.069 24.363  -19.520 1.00 73.43  ? 299 LYS B CE  1 
ATOM   4737 N NZ  . LYS B 1 306 ? -35.546 25.046  -20.742 1.00 77.21  ? 299 LYS B NZ  1 
ATOM   4738 N N   . LYS B 1 307 ? -41.190 25.667  -17.099 1.00 39.28  ? 300 LYS B N   1 
ATOM   4739 C CA  . LYS B 1 307 ? -42.492 25.489  -16.448 1.00 47.09  ? 300 LYS B CA  1 
ATOM   4740 C C   . LYS B 1 307 ? -42.447 24.198  -15.676 1.00 51.52  ? 300 LYS B C   1 
ATOM   4741 O O   . LYS B 1 307 ? -42.317 23.127  -16.265 1.00 54.06  ? 300 LYS B O   1 
ATOM   4742 C CB  . LYS B 1 307 ? -43.689 25.495  -17.417 1.00 39.23  ? 300 LYS B CB  1 
ATOM   4743 C CG  . LYS B 1 307 ? -44.244 26.886  -17.692 1.00 47.92  ? 300 LYS B CG  1 
ATOM   4744 C CD  . LYS B 1 307 ? -43.083 27.794  -18.056 1.00 43.64  ? 300 LYS B CD  1 
ATOM   4745 C CE  . LYS B 1 307 ? -43.425 29.214  -18.356 1.00 36.62  ? 300 LYS B CE  1 
ATOM   4746 N NZ  . LYS B 1 307 ? -42.088 29.871  -18.499 1.00 36.02  ? 300 LYS B NZ  1 
ATOM   4747 N N   . ILE B 1 308 ? -42.520 24.305  -14.353 1.00 44.09  ? 301 ILE B N   1 
ATOM   4748 C CA  . ILE B 1 308 ? -42.516 23.122  -13.524 1.00 49.44  ? 301 ILE B CA  1 
ATOM   4749 C C   . ILE B 1 308 ? -43.924 22.863  -12.996 1.00 45.41  ? 301 ILE B C   1 
ATOM   4750 O O   . ILE B 1 308 ? -44.684 23.795  -12.732 1.00 46.71  ? 301 ILE B O   1 
ATOM   4751 C CB  . ILE B 1 308 ? -41.450 23.201  -12.413 1.00 51.53  ? 301 ILE B CB  1 
ATOM   4752 C CG1 . ILE B 1 308 ? -41.526 21.973  -11.494 1.00 73.59  ? 301 ILE B CG1 1 
ATOM   4753 C CG2 . ILE B 1 308 ? -41.608 24.466  -11.635 1.00 54.70  ? 301 ILE B CG2 1 
ATOM   4754 C CD1 . ILE B 1 308 ? -41.277 20.624  -12.199 1.00 97.64  ? 301 ILE B CD1 1 
ATOM   4755 N N   . SER B 1 309 ? -44.284 21.587  -12.916 1.00 41.80  ? 302 SER B N   1 
ATOM   4756 C CA  . SER B 1 309 ? -45.566 21.192  -12.373 1.00 43.97  ? 302 SER B CA  1 
ATOM   4757 C C   . SER B 1 309 ? -45.442 20.593  -10.973 1.00 44.75  ? 302 SER B C   1 
ATOM   4758 O O   . SER B 1 309 ? -44.698 19.628  -10.735 1.00 43.78  ? 302 SER B O   1 
ATOM   4759 C CB  . SER B 1 309 ? -46.295 20.257  -13.332 1.00 49.41  ? 302 SER B CB  1 
ATOM   4760 O OG  . SER B 1 309 ? -47.008 21.018  -14.295 1.00 51.20  ? 302 SER B OG  1 
ATOM   4761 N N   . PHE B 1 310 ? -46.164 21.204  -10.041 1.00 38.68  ? 303 PHE B N   1 
ATOM   4762 C CA  . PHE B 1 310 ? -46.118 20.800  -8.649  1.00 24.48  ? 303 PHE B CA  1 
ATOM   4763 C C   . PHE B 1 310 ? -47.257 19.824  -8.397  1.00 26.12  ? 303 PHE B C   1 
ATOM   4764 O O   . PHE B 1 310 ? -48.394 20.089  -8.791  1.00 28.06  ? 303 PHE B O   1 
ATOM   4765 C CB  . PHE B 1 310 ? -46.313 22.019  -7.765  1.00 15.76  ? 303 PHE B CB  1 
ATOM   4766 C CG  . PHE B 1 310 ? -45.086 22.860  -7.593  1.00 29.67  ? 303 PHE B CG  1 
ATOM   4767 C CD1 . PHE B 1 310 ? -44.548 23.561  -8.660  1.00 33.84  ? 303 PHE B CD1 1 
ATOM   4768 C CD2 . PHE B 1 310 ? -44.490 22.990  -6.340  1.00 31.31  ? 303 PHE B CD2 1 
ATOM   4769 C CE1 . PHE B 1 310 ? -43.420 24.354  -8.491  1.00 27.49  ? 303 PHE B CE1 1 
ATOM   4770 C CE2 . PHE B 1 310 ? -43.375 23.784  -6.168  1.00 24.65  ? 303 PHE B CE2 1 
ATOM   4771 C CZ  . PHE B 1 310 ? -42.841 24.468  -7.249  1.00 22.51  ? 303 PHE B CZ  1 
ATOM   4772 N N   . LYS B 1 311 ? -46.959 18.694  -7.762  1.00 22.79  ? 304 LYS B N   1 
ATOM   4773 C CA  . LYS B 1 311 ? -48.010 17.804  -7.287  1.00 28.61  ? 304 LYS B CA  1 
ATOM   4774 C C   . LYS B 1 311 ? -48.810 18.501  -6.167  1.00 34.97  ? 304 LYS B C   1 
ATOM   4775 O O   . LYS B 1 311 ? -48.256 19.244  -5.349  1.00 35.77  ? 304 LYS B O   1 
ATOM   4776 C CB  . LYS B 1 311 ? -47.413 16.494  -6.763  1.00 31.75  ? 304 LYS B CB  1 
ATOM   4777 C CG  . LYS B 1 311 ? -46.668 15.628  -7.791  1.00 28.09  ? 304 LYS B CG  1 
ATOM   4778 C CD  . LYS B 1 311 ? -45.808 14.567  -7.092  1.00 29.22  ? 304 LYS B CD  1 
ATOM   4779 C CE  . LYS B 1 311 ? -45.398 13.467  -8.031  1.00 40.52  ? 304 LYS B CE  1 
ATOM   4780 N NZ  . LYS B 1 311 ? -46.604 12.692  -8.488  1.00 54.00  ? 304 LYS B NZ  1 
ATOM   4781 N N   . SER B 1 312 ? -50.115 18.276  -6.141  1.00 29.64  ? 305 SER B N   1 
ATOM   4782 C CA  . SER B 1 312 ? -50.941 18.743  -5.038  1.00 19.96  ? 305 SER B CA  1 
ATOM   4783 C C   . SER B 1 312 ? -50.459 18.038  -3.782  1.00 29.11  ? 305 SER B C   1 
ATOM   4784 O O   . SER B 1 312 ? -49.736 17.042  -3.878  1.00 31.12  ? 305 SER B O   1 
ATOM   4785 C CB  . SER B 1 312 ? -52.385 18.330  -5.270  1.00 20.86  ? 305 SER B CB  1 
ATOM   4786 O OG  . SER B 1 312 ? -52.530 16.944  -4.966  1.00 29.54  ? 305 SER B OG  1 
ATOM   4787 N N   . LEU B 1 313 ? -50.891 18.522  -2.614  1.00 24.33  ? 306 LEU B N   1 
ATOM   4788 C CA  . LEU B 1 313 ? -50.418 17.990  -1.328  1.00 25.57  ? 306 LEU B CA  1 
ATOM   4789 C C   . LEU B 1 313 ? -50.739 16.511  -1.118  1.00 24.15  ? 306 LEU B C   1 
ATOM   4790 O O   . LEU B 1 313 ? -49.910 15.742  -0.636  1.00 30.87  ? 306 LEU B O   1 
ATOM   4791 C CB  . LEU B 1 313 ? -50.969 18.808  -0.157  1.00 23.09  ? 306 LEU B CB  1 
ATOM   4792 C CG  . LEU B 1 313 ? -50.765 18.191  1.220   1.00 16.57  ? 306 LEU B CG  1 
ATOM   4793 C CD1 . LEU B 1 313 ? -49.291 18.136  1.559   1.00 17.09  ? 306 LEU B CD1 1 
ATOM   4794 C CD2 . LEU B 1 313 ? -51.542 18.970  2.256   1.00 25.65  ? 306 LEU B CD2 1 
ATOM   4795 N N   . VAL B 1 314 ? -51.953 16.129  -1.471  1.00 24.20  ? 307 VAL B N   1 
ATOM   4796 C CA  . VAL B 1 314 ? -52.364 14.735  -1.454  1.00 37.73  ? 307 VAL B CA  1 
ATOM   4797 C C   . VAL B 1 314 ? -51.347 13.822  -2.141  1.00 35.86  ? 307 VAL B C   1 
ATOM   4798 O O   . VAL B 1 314 ? -50.771 12.929  -1.513  1.00 33.54  ? 307 VAL B O   1 
ATOM   4799 C CB  . VAL B 1 314 ? -53.681 14.581  -2.205  1.00 43.15  ? 307 VAL B CB  1 
ATOM   4800 C CG1 . VAL B 1 314 ? -54.339 13.284  -1.802  1.00 20.88  ? 307 VAL B CG1 1 
ATOM   4801 C CG2 . VAL B 1 314 ? -54.592 15.815  -1.967  1.00 46.17  ? 307 VAL B CG2 1 
ATOM   4802 N N   . ALA B 1 315 ? -51.142 14.059  -3.436  1.00 27.08  ? 308 ALA B N   1 
ATOM   4803 C CA  . ALA B 1 315 ? -50.195 13.287  -4.239  1.00 28.96  ? 308 ALA B CA  1 
ATOM   4804 C C   . ALA B 1 315 ? -48.768 13.439  -3.735  1.00 30.91  ? 308 ALA B C   1 
ATOM   4805 O O   . ALA B 1 315 ? -47.993 12.485  -3.762  1.00 28.81  ? 308 ALA B O   1 
ATOM   4806 C CB  . ALA B 1 315 ? -50.273 13.714  -5.713  1.00 18.87  ? 308 ALA B CB  1 
ATOM   4807 N N   . SER B 1 316 ? -48.422 14.644  -3.292  1.00 20.03  ? 309 SER B N   1 
ATOM   4808 C CA  . SER B 1 316 ? -47.058 14.924  -2.889  1.00 22.74  ? 309 SER B CA  1 
ATOM   4809 C C   . SER B 1 316 ? -46.712 14.195  -1.581  1.00 32.40  ? 309 SER B C   1 
ATOM   4810 O O   . SER B 1 316 ? -45.585 13.723  -1.416  1.00 33.78  ? 309 SER B O   1 
ATOM   4811 C CB  . SER B 1 316 ? -46.826 16.432  -2.776  1.00 27.21  ? 309 SER B CB  1 
ATOM   4812 O OG  . SER B 1 316 ? -45.443 16.738  -2.747  1.00 29.07  ? 309 SER B OG  1 
ATOM   4813 N N   . LEU B 1 317 ? -47.685 14.103  -0.670  1.00 27.13  ? 310 LEU B N   1 
ATOM   4814 C CA  . LEU B 1 317 ? -47.546 13.323  0.556   1.00 29.46  ? 310 LEU B CA  1 
ATOM   4815 C C   . LEU B 1 317 ? -47.025 11.932  0.224   1.00 27.02  ? 310 LEU B C   1 
ATOM   4816 O O   . LEU B 1 317 ? -46.141 11.405  0.904   1.00 25.62  ? 310 LEU B O   1 
ATOM   4817 C CB  . LEU B 1 317 ? -48.899 13.161  1.258   1.00 28.53  ? 310 LEU B CB  1 
ATOM   4818 C CG  . LEU B 1 317 ? -49.150 13.723  2.657   1.00 30.77  ? 310 LEU B CG  1 
ATOM   4819 C CD1 . LEU B 1 317 ? -50.331 13.006  3.315   1.00 34.76  ? 310 LEU B CD1 1 
ATOM   4820 C CD2 . LEU B 1 317 ? -47.913 13.626  3.517   1.00 39.27  ? 310 LEU B CD2 1 
ATOM   4821 N N   . ALA B 1 318 ? -47.587 11.353  -0.834  1.00 32.85  ? 311 ALA B N   1 
ATOM   4822 C CA  . ALA B 1 318 ? -47.297 9.973   -1.233  1.00 36.25  ? 311 ALA B CA  1 
ATOM   4823 C C   . ALA B 1 318 ? -45.991 9.830   -2.014  1.00 48.22  ? 311 ALA B C   1 
ATOM   4824 O O   . ALA B 1 318 ? -45.256 8.866   -1.800  1.00 52.85  ? 311 ALA B O   1 
ATOM   4825 C CB  . ALA B 1 318 ? -48.451 9.403   -2.031  1.00 23.37  ? 311 ALA B CB  1 
ATOM   4826 N N   . GLU B 1 319 ? -45.716 10.778  -2.916  1.00 40.54  ? 312 GLU B N   1 
ATOM   4827 C CA  . GLU B 1 319 ? -44.474 10.782  -3.699  1.00 40.52  ? 312 GLU B CA  1 
ATOM   4828 C C   . GLU B 1 319 ? -43.718 12.097  -3.544  1.00 37.27  ? 312 GLU B C   1 
ATOM   4829 O O   . GLU B 1 319 ? -43.677 12.904  -4.470  1.00 46.23  ? 312 GLU B O   1 
ATOM   4830 C CB  . GLU B 1 319 ? -44.758 10.570  -5.188  1.00 48.32  ? 312 GLU B CB  1 
ATOM   4831 C CG  . GLU B 1 319 ? -45.578 9.338   -5.547  1.00 64.26  ? 312 GLU B CG  1 
ATOM   4832 C CD  . GLU B 1 319 ? -45.843 9.237   -7.046  1.00 80.63  ? 312 GLU B CD  1 
ATOM   4833 O OE1 . GLU B 1 319 ? -45.488 10.181  -7.789  1.00 89.71  ? 312 GLU B OE1 1 
ATOM   4834 O OE2 . GLU B 1 319 ? -46.406 8.212   -7.487  1.00 83.64  ? 312 GLU B OE2 1 
ATOM   4835 N N   . PRO B 1 320 ? -43.102 12.313  -2.381  1.00 34.64  ? 313 PRO B N   1 
ATOM   4836 C CA  . PRO B 1 320 ? -42.399 13.559  -2.067  1.00 33.05  ? 313 PRO B CA  1 
ATOM   4837 C C   . PRO B 1 320 ? -41.116 13.745  -2.862  1.00 35.11  ? 313 PRO B C   1 
ATOM   4838 O O   . PRO B 1 320 ? -40.367 12.792  -3.045  1.00 41.69  ? 313 PRO B O   1 
ATOM   4839 C CB  . PRO B 1 320 ? -42.004 13.380  -0.594  1.00 33.65  ? 313 PRO B CB  1 
ATOM   4840 C CG  . PRO B 1 320 ? -42.747 12.197  -0.107  1.00 39.11  ? 313 PRO B CG  1 
ATOM   4841 C CD  . PRO B 1 320 ? -43.002 11.337  -1.291  1.00 35.84  ? 313 PRO B CD  1 
ATOM   4842 N N   . ASP B 1 321 ? -40.867 14.968  -3.317  1.00 35.94  ? 314 ASP B N   1 
ATOM   4843 C CA  . ASP B 1 321 ? -39.530 15.378  -3.726  1.00 34.61  ? 314 ASP B CA  1 
ATOM   4844 C C   . ASP B 1 321 ? -38.985 16.234  -2.581  1.00 38.13  ? 314 ASP B C   1 
ATOM   4845 O O   . ASP B 1 321 ? -39.640 17.183  -2.148  1.00 47.53  ? 314 ASP B O   1 
ATOM   4846 C CB  . ASP B 1 321 ? -39.570 16.183  -5.036  1.00 42.84  ? 314 ASP B CB  1 
ATOM   4847 C CG  . ASP B 1 321 ? -40.293 15.449  -6.166  1.00 53.82  ? 314 ASP B CG  1 
ATOM   4848 O OD1 . ASP B 1 321 ? -41.263 16.026  -6.713  1.00 66.41  ? 314 ASP B OD1 1 
ATOM   4849 O OD2 . ASP B 1 321 ? -39.894 14.307  -6.512  1.00 43.42  ? 314 ASP B OD2 1 
ATOM   4850 N N   . PHE B 1 322 ? -37.804 15.891  -2.076  1.00 35.91  ? 315 PHE B N   1 
ATOM   4851 C CA  . PHE B 1 322 ? -37.209 16.626  -0.959  1.00 27.98  ? 315 PHE B CA  1 
ATOM   4852 C C   . PHE B 1 322 ? -36.174 17.659  -1.404  1.00 35.97  ? 315 PHE B C   1 
ATOM   4853 O O   . PHE B 1 322 ? -35.722 17.631  -2.530  1.00 48.93  ? 315 PHE B O   1 
ATOM   4854 C CB  . PHE B 1 322 ? -36.611 15.654  0.063   1.00 25.32  ? 315 PHE B CB  1 
ATOM   4855 C CG  . PHE B 1 322 ? -37.622 14.712  0.656   1.00 31.24  ? 315 PHE B CG  1 
ATOM   4856 C CD1 . PHE B 1 322 ? -37.625 13.367  0.315   1.00 26.73  ? 315 PHE B CD1 1 
ATOM   4857 C CD2 . PHE B 1 322 ? -38.593 15.180  1.540   1.00 39.58  ? 315 PHE B CD2 1 
ATOM   4858 C CE1 . PHE B 1 322 ? -38.566 12.498  0.854   1.00 44.49  ? 315 PHE B CE1 1 
ATOM   4859 C CE2 . PHE B 1 322 ? -39.535 14.321  2.085   1.00 42.76  ? 315 PHE B CE2 1 
ATOM   4860 C CZ  . PHE B 1 322 ? -39.522 12.977  1.743   1.00 50.78  ? 315 PHE B CZ  1 
ATOM   4861 N N   . VAL B 1 323 ? -35.809 18.565  -0.506  1.00 44.96  ? 316 VAL B N   1 
ATOM   4862 C CA  . VAL B 1 323 ? -34.904 19.667  -0.816  1.00 45.05  ? 316 VAL B CA  1 
ATOM   4863 C C   . VAL B 1 323 ? -33.743 19.673  0.196   1.00 66.51  ? 316 VAL B C   1 
ATOM   4864 O O   . VAL B 1 323 ? -33.838 19.020  1.241   1.00 71.91  ? 316 VAL B O   1 
ATOM   4865 C CB  . VAL B 1 323 ? -35.710 20.992  -0.903  1.00 34.23  ? 316 VAL B CB  1 
ATOM   4866 C CG1 . VAL B 1 323 ? -34.845 22.241  -0.809  1.00 39.30  ? 316 VAL B CG1 1 
ATOM   4867 C CG2 . VAL B 1 323 ? -36.487 21.018  -2.192  1.00 28.16  ? 316 VAL B CG2 1 
ATOM   4868 N N   . VAL B 1 324 ? -32.665 20.404  -0.128  1.00 84.51  ? 317 VAL B N   1 
ATOM   4869 C CA  . VAL B 1 324 ? -31.294 20.195  0.382   1.00 95.95  ? 317 VAL B CA  1 
ATOM   4870 C C   . VAL B 1 324 ? -30.870 18.835  -0.164  1.00 102.87 ? 317 VAL B C   1 
ATOM   4871 O O   . VAL B 1 324 ? -30.000 18.148  0.370   1.00 96.30  ? 317 VAL B O   1 
ATOM   4872 C CB  . VAL B 1 324 ? -31.128 20.320  1.926   1.00 139.95 ? 317 VAL B CB  1 
ATOM   4873 C CG1 . VAL B 1 324 ? -29.661 20.541  2.291   1.00 132.60 ? 317 VAL B CG1 1 
ATOM   4874 C CG2 . VAL B 1 324 ? -31.949 21.472  2.459   1.00 143.50 ? 317 VAL B CG2 1 
ATOM   4875 N N   . THR B 1 325 ? -31.548 18.484  -1.254  1.00 118.88 ? 318 THR B N   1 
ATOM   4876 C CA  . THR B 1 325 ? -31.303 17.317  -2.081  1.00 126.10 ? 318 THR B CA  1 
ATOM   4877 C C   . THR B 1 325 ? -31.578 17.812  -3.509  1.00 122.10 ? 318 THR B C   1 
ATOM   4878 O O   . THR B 1 325 ? -31.085 17.249  -4.490  1.00 114.58 ? 318 THR B O   1 
ATOM   4879 C CB  . THR B 1 325 ? -32.261 16.153  -1.708  1.00 98.49  ? 318 THR B CB  1 
ATOM   4880 O OG1 . THR B 1 325 ? -32.092 15.801  -0.324  1.00 88.64  ? 318 THR B OG1 1 
ATOM   4881 C CG2 . THR B 1 325 ? -32.012 14.924  -2.593  1.00 101.96 ? 318 THR B CG2 1 
ATOM   4882 N N   . ASP B 1 326 ? -32.359 18.894  -3.593  1.00 124.70 ? 319 ASP B N   1 
ATOM   4883 C CA  . ASP B 1 326 ? -32.696 19.564  -4.852  1.00 125.66 ? 319 ASP B CA  1 
ATOM   4884 C C   . ASP B 1 326 ? -32.393 21.073  -4.820  1.00 122.04 ? 319 ASP B C   1 
ATOM   4885 O O   . ASP B 1 326 ? -33.305 21.894  -4.952  1.00 118.00 ? 319 ASP B O   1 
ATOM   4886 C CB  . ASP B 1 326 ? -34.183 19.385  -5.192  1.00 128.78 ? 319 ASP B CB  1 
ATOM   4887 C CG  . ASP B 1 326 ? -34.591 17.928  -5.335  1.00 134.57 ? 319 ASP B CG  1 
ATOM   4888 O OD1 . ASP B 1 326 ? -35.812 17.656  -5.309  1.00 133.46 ? 319 ASP B OD1 1 
ATOM   4889 O OD2 . ASP B 1 326 ? -33.707 17.057  -5.471  1.00 137.90 ? 319 ASP B OD2 1 
ATOM   4890 N N   . PHE B 1 327 ? -31.125 21.437  -4.648  1.00 115.43 ? 320 PHE B N   1 
ATOM   4891 C CA  . PHE B 1 327 ? -30.719 22.841  -4.724  1.00 106.50 ? 320 PHE B CA  1 
ATOM   4892 C C   . PHE B 1 327 ? -29.291 22.972  -5.237  1.00 103.23 ? 320 PHE B C   1 
ATOM   4893 O O   . PHE B 1 327 ? -28.376 22.331  -4.723  1.00 101.49 ? 320 PHE B O   1 
ATOM   4894 C CB  . PHE B 1 327 ? -30.852 23.530  -3.364  1.00 105.43 ? 320 PHE B CB  1 
ATOM   4895 C CG  . PHE B 1 327 ? -31.917 24.595  -3.320  1.00 102.91 ? 320 PHE B CG  1 
ATOM   4896 C CD1 . PHE B 1 327 ? -32.644 24.820  -2.159  1.00 103.95 ? 320 PHE B CD1 1 
ATOM   4897 C CD2 . PHE B 1 327 ? -32.186 25.375  -4.430  1.00 97.44  ? 320 PHE B CD2 1 
ATOM   4898 C CE1 . PHE B 1 327 ? -33.630 25.796  -2.109  1.00 96.73  ? 320 PHE B CE1 1 
ATOM   4899 C CE2 . PHE B 1 327 ? -33.167 26.358  -4.384  1.00 97.72  ? 320 PHE B CE2 1 
ATOM   4900 C CZ  . PHE B 1 327 ? -33.891 26.566  -3.219  1.00 95.87  ? 320 PHE B CZ  1 
ATOM   4901 N N   . PHE B 1 330 ? -30.385 11.915  2.550   1.00 112.06 ? 323 PHE B N   1 
ATOM   4902 C CA  . PHE B 1 330 ? -31.380 11.362  1.632   1.00 118.68 ? 323 PHE B CA  1 
ATOM   4903 C C   . PHE B 1 330 ? -32.475 10.598  2.374   1.00 116.40 ? 323 PHE B C   1 
ATOM   4904 O O   . PHE B 1 330 ? -33.659 10.701  2.044   1.00 112.58 ? 323 PHE B O   1 
ATOM   4905 C CB  . PHE B 1 330 ? -30.717 10.429  0.617   1.00 128.31 ? 323 PHE B CB  1 
ATOM   4906 C CG  . PHE B 1 330 ? -29.909 11.139  -0.435  1.00 137.39 ? 323 PHE B CG  1 
ATOM   4907 C CD1 . PHE B 1 330 ? -30.437 11.365  -1.701  1.00 138.60 ? 323 PHE B CD1 1 
ATOM   4908 C CD2 . PHE B 1 330 ? -28.618 11.568  -0.164  1.00 140.26 ? 323 PHE B CD2 1 
ATOM   4909 C CE1 . PHE B 1 330 ? -29.692 12.014  -2.677  1.00 138.36 ? 323 PHE B CE1 1 
ATOM   4910 C CE2 . PHE B 1 330 ? -27.868 12.218  -1.135  1.00 139.84 ? 323 PHE B CE2 1 
ATOM   4911 C CZ  . PHE B 1 330 ? -28.406 12.441  -2.393  1.00 138.25 ? 323 PHE B CZ  1 
ATOM   4912 N N   . SER B 1 331 ? -32.066 9.824   3.373   1.00 112.67 ? 324 SER B N   1 
ATOM   4913 C CA  . SER B 1 331 ? -32.986 8.978   4.122   1.00 103.89 ? 324 SER B CA  1 
ATOM   4914 C C   . SER B 1 331 ? -33.680 9.746   5.238   1.00 92.69  ? 324 SER B C   1 
ATOM   4915 O O   . SER B 1 331 ? -34.870 9.557   5.478   1.00 88.03  ? 324 SER B O   1 
ATOM   4916 C CB  . SER B 1 331 ? -32.238 7.773   4.693   1.00 110.95 ? 324 SER B CB  1 
ATOM   4917 O OG  . SER B 1 331 ? -30.968 8.155   5.198   1.00 115.17 ? 324 SER B OG  1 
ATOM   4918 N N   . ARG B 1 332 ? -32.921 10.608  5.911   1.00 88.68  ? 325 ARG B N   1 
ATOM   4919 C CA  . ARG B 1 332 ? -33.417 11.423  7.023   1.00 71.66  ? 325 ARG B CA  1 
ATOM   4920 C C   . ARG B 1 332 ? -34.751 12.142  6.756   1.00 50.41  ? 325 ARG B C   1 
ATOM   4921 O O   . ARG B 1 332 ? -35.660 12.060  7.574   1.00 57.83  ? 325 ARG B O   1 
ATOM   4922 C CB  . ARG B 1 332 ? -32.338 12.414  7.461   1.00 74.72  ? 325 ARG B CB  1 
ATOM   4923 C CG  . ARG B 1 332 ? -30.937 11.834  7.358   1.00 86.92  ? 325 ARG B CG  1 
ATOM   4924 C CD  . ARG B 1 332 ? -29.854 12.896  7.495   1.00 91.59  ? 325 ARG B CD  1 
ATOM   4925 N NE  . ARG B 1 332 ? -30.000 13.960  6.509   1.00 91.33  ? 325 ARG B NE  1 
ATOM   4926 C CZ  . ARG B 1 332 ? -30.346 15.210  6.805   1.00 93.59  ? 325 ARG B CZ  1 
ATOM   4927 N NH1 . ARG B 1 332 ? -30.572 15.559  8.067   1.00 98.27  ? 325 ARG B NH1 1 
ATOM   4928 N NH2 . ARG B 1 332 ? -30.458 16.114  5.841   1.00 87.56  ? 325 ARG B NH2 1 
ATOM   4929 N N   . PRO B 1 333 ? -34.885 12.843  5.615   1.00 32.69  ? 326 PRO B N   1 
ATOM   4930 C CA  . PRO B 1 333 ? -36.163 13.527  5.393   1.00 34.05  ? 326 PRO B CA  1 
ATOM   4931 C C   . PRO B 1 333 ? -37.319 12.550  5.131   1.00 38.05  ? 326 PRO B C   1 
ATOM   4932 O O   . PRO B 1 333 ? -38.434 12.740  5.633   1.00 36.71  ? 326 PRO B O   1 
ATOM   4933 C CB  . PRO B 1 333 ? -35.899 14.370  4.131   1.00 37.05  ? 326 PRO B CB  1 
ATOM   4934 C CG  . PRO B 1 333 ? -34.423 14.371  3.933   1.00 24.41  ? 326 PRO B CG  1 
ATOM   4935 C CD  . PRO B 1 333 ? -33.941 13.093  4.510   1.00 34.98  ? 326 PRO B CD  1 
ATOM   4936 N N   . ALA B 1 334 ? -37.053 11.524  4.331   1.00 34.16  ? 327 ALA B N   1 
ATOM   4937 C CA  . ALA B 1 334 ? -38.024 10.469  4.116   1.00 33.04  ? 327 ALA B CA  1 
ATOM   4938 C C   . ALA B 1 334 ? -38.485 9.931   5.469   1.00 31.18  ? 327 ALA B C   1 
ATOM   4939 O O   . ALA B 1 334 ? -39.680 9.797   5.708   1.00 40.71  ? 327 ALA B O   1 
ATOM   4940 C CB  . ALA B 1 334 ? -37.439 9.361   3.256   1.00 27.62  ? 327 ALA B CB  1 
ATOM   4941 N N   . GLN B 1 335 ? -37.540 9.661   6.363   1.00 26.23  ? 328 GLN B N   1 
ATOM   4942 C CA  . GLN B 1 335 ? -37.881 9.170   7.702   1.00 36.19  ? 328 GLN B CA  1 
ATOM   4943 C C   . GLN B 1 335 ? -38.621 10.169  8.585   1.00 41.29  ? 328 GLN B C   1 
ATOM   4944 O O   . GLN B 1 335 ? -39.508 9.787   9.354   1.00 41.24  ? 328 GLN B O   1 
ATOM   4945 C CB  . GLN B 1 335 ? -36.660 8.599   8.411   1.00 34.19  ? 328 GLN B CB  1 
ATOM   4946 C CG  . GLN B 1 335 ? -36.449 7.157   8.015   1.00 44.33  ? 328 GLN B CG  1 
ATOM   4947 C CD  . GLN B 1 335 ? -35.042 6.680   8.206   1.00 41.97  ? 328 GLN B CD  1 
ATOM   4948 O OE1 . GLN B 1 335 ? -34.821 5.533   8.586   1.00 44.20  ? 328 GLN B OE1 1 
ATOM   4949 N NE2 . GLN B 1 335 ? -34.074 7.550   7.929   1.00 39.63  ? 328 GLN B NE2 1 
ATOM   4950 N N   . LEU B 1 336 ? -38.278 11.445  8.470   1.00 39.18  ? 329 LEU B N   1 
ATOM   4951 C CA  . LEU B 1 336 ? -39.050 12.460  9.165   1.00 35.62  ? 329 LEU B CA  1 
ATOM   4952 C C   . LEU B 1 336 ? -40.455 12.537  8.592   1.00 37.81  ? 329 LEU B C   1 
ATOM   4953 O O   . LEU B 1 336 ? -41.421 12.669  9.344   1.00 29.10  ? 329 LEU B O   1 
ATOM   4954 C CB  . LEU B 1 336 ? -38.374 13.812  9.067   1.00 26.80  ? 329 LEU B CB  1 
ATOM   4955 C CG  . LEU B 1 336 ? -37.346 14.022  10.158  1.00 32.98  ? 329 LEU B CG  1 
ATOM   4956 C CD1 . LEU B 1 336 ? -36.564 15.288  9.899   1.00 31.56  ? 329 LEU B CD1 1 
ATOM   4957 C CD2 . LEU B 1 336 ? -38.067 14.082  11.487  1.00 33.09  ? 329 LEU B CD2 1 
ATOM   4958 N N   . HIS B 1 337 ? -40.548 12.453  7.260   1.00 39.22  ? 330 HIS B N   1 
ATOM   4959 C CA  . HIS B 1 337 ? -41.816 12.541  6.535   1.00 35.75  ? 330 HIS B CA  1 
ATOM   4960 C C   . HIS B 1 337 ? -42.781 11.520  7.106   1.00 31.72  ? 330 HIS B C   1 
ATOM   4961 O O   . HIS B 1 337 ? -43.945 11.820  7.382   1.00 33.76  ? 330 HIS B O   1 
ATOM   4962 C CB  . HIS B 1 337 ? -41.588 12.242  5.053   1.00 30.08  ? 330 HIS B CB  1 
ATOM   4963 C CG  . HIS B 1 337 ? -42.757 12.561  4.173   1.00 27.40  ? 330 HIS B CG  1 
ATOM   4964 N ND1 . HIS B 1 337 ? -43.294 13.825  4.082   1.00 36.81  ? 330 HIS B ND1 1 
ATOM   4965 C CD2 . HIS B 1 337 ? -43.472 11.787  3.325   1.00 33.74  ? 330 HIS B CD2 1 
ATOM   4966 C CE1 . HIS B 1 337 ? -44.296 13.816  3.218   1.00 37.52  ? 330 HIS B CE1 1 
ATOM   4967 N NE2 . HIS B 1 337 ? -44.425 12.592  2.742   1.00 28.76  ? 330 HIS B NE2 1 
ATOM   4968 N N   . ILE B 1 338 ? -42.266 10.307  7.268   1.00 29.48  ? 331 ILE B N   1 
ATOM   4969 C CA  . ILE B 1 338 ? -42.985 9.219   7.896   1.00 32.00  ? 331 ILE B CA  1 
ATOM   4970 C C   . ILE B 1 338 ? -43.344 9.578   9.335   1.00 30.37  ? 331 ILE B C   1 
ATOM   4971 O O   . ILE B 1 338 ? -44.508 9.514   9.719   1.00 36.54  ? 331 ILE B O   1 
ATOM   4972 C CB  . ILE B 1 338 ? -42.139 7.937   7.890   1.00 34.93  ? 331 ILE B CB  1 
ATOM   4973 C CG1 . ILE B 1 338 ? -41.824 7.530   6.452   1.00 30.72  ? 331 ILE B CG1 1 
ATOM   4974 C CG2 . ILE B 1 338 ? -42.870 6.809   8.616   1.00 40.58  ? 331 ILE B CG2 1 
ATOM   4975 C CD1 . ILE B 1 338 ? -40.939 6.316   6.340   1.00 37.61  ? 331 ILE B CD1 1 
ATOM   4976 N N   . GLY B 1 339 ? -42.346 9.962   10.124  1.00 29.72  ? 332 GLY B N   1 
ATOM   4977 C CA  . GLY B 1 339 ? -42.579 10.374  11.495  1.00 30.52  ? 332 GLY B CA  1 
ATOM   4978 C C   . GLY B 1 339 ? -43.690 11.402  11.637  1.00 28.25  ? 332 GLY B C   1 
ATOM   4979 O O   . GLY B 1 339 ? -44.595 11.250  12.470  1.00 25.00  ? 332 GLY B O   1 
ATOM   4980 N N   . PHE B 1 340 ? -43.624 12.443  10.813  1.00 20.46  ? 333 PHE B N   1 
ATOM   4981 C CA  . PHE B 1 340 ? -44.621 13.495  10.843  1.00 22.22  ? 333 PHE B CA  1 
ATOM   4982 C C   . PHE B 1 340 ? -46.003 12.947  10.515  1.00 27.05  ? 333 PHE B C   1 
ATOM   4983 O O   . PHE B 1 340 ? -46.988 13.328  11.148  1.00 25.30  ? 333 PHE B O   1 
ATOM   4984 C CB  . PHE B 1 340 ? -44.241 14.631  9.897   1.00 18.69  ? 333 PHE B CB  1 
ATOM   4985 C CG  . PHE B 1 340 ? -43.469 15.737  10.561  1.00 28.60  ? 333 PHE B CG  1 
ATOM   4986 C CD1 . PHE B 1 340 ? -42.136 15.575  10.882  1.00 31.48  ? 333 PHE B CD1 1 
ATOM   4987 C CD2 . PHE B 1 340 ? -44.078 16.939  10.861  1.00 30.09  ? 333 PHE B CD2 1 
ATOM   4988 C CE1 . PHE B 1 340 ? -41.432 16.587  11.488  1.00 29.06  ? 333 PHE B CE1 1 
ATOM   4989 C CE2 . PHE B 1 340 ? -43.377 17.956  11.472  1.00 23.24  ? 333 PHE B CE2 1 
ATOM   4990 C CZ  . PHE B 1 340 ? -42.055 17.781  11.780  1.00 32.07  ? 333 PHE B CZ  1 
ATOM   4991 N N   . GLN B 1 341 ? -46.073 12.056  9.530   1.00 22.51  ? 334 GLN B N   1 
ATOM   4992 C CA  . GLN B 1 341 ? -47.322 11.384  9.213   1.00 27.26  ? 334 GLN B CA  1 
ATOM   4993 C C   . GLN B 1 341 ? -47.786 10.598  10.433  1.00 32.71  ? 334 GLN B C   1 
ATOM   4994 O O   . GLN B 1 341 ? -48.943 10.702  10.842  1.00 33.25  ? 334 GLN B O   1 
ATOM   4995 C CB  . GLN B 1 341 ? -47.163 10.457  8.009   1.00 29.69  ? 334 GLN B CB  1 
ATOM   4996 C CG  . GLN B 1 341 ? -47.893 10.927  6.756   1.00 47.22  ? 334 GLN B CG  1 
ATOM   4997 C CD  . GLN B 1 341 ? -47.152 10.562  5.455   1.00 61.80  ? 334 GLN B CD  1 
ATOM   4998 O OE1 . GLN B 1 341 ? -45.923 10.708  5.349   1.00 53.61  ? 334 GLN B OE1 1 
ATOM   4999 N NE2 . GLN B 1 341 ? -47.904 10.092  4.459   1.00 65.71  ? 334 GLN B NE2 1 
ATOM   5000 N N   . ALA B 1 342 ? -46.869 9.830   11.019  1.00 30.74  ? 335 ALA B N   1 
ATOM   5001 C CA  . ALA B 1 342 ? -47.158 9.040   12.214  1.00 34.52  ? 335 ALA B CA  1 
ATOM   5002 C C   . ALA B 1 342 ? -47.654 9.948   13.326  1.00 43.83  ? 335 ALA B C   1 
ATOM   5003 O O   . ALA B 1 342 ? -48.624 9.646   14.021  1.00 43.23  ? 335 ALA B O   1 
ATOM   5004 C CB  . ALA B 1 342 ? -45.915 8.309   12.667  1.00 32.56  ? 335 ALA B CB  1 
ATOM   5005 N N   . LEU B 1 343 ? -46.971 11.073  13.476  1.00 46.75  ? 336 LEU B N   1 
ATOM   5006 C CA  . LEU B 1 343 ? -47.284 12.026  14.515  1.00 38.98  ? 336 LEU B CA  1 
ATOM   5007 C C   . LEU B 1 343 ? -48.691 12.566  14.339  1.00 36.70  ? 336 LEU B C   1 
ATOM   5008 O O   . LEU B 1 343 ? -49.403 12.770  15.312  1.00 43.11  ? 336 LEU B O   1 
ATOM   5009 C CB  . LEU B 1 343 ? -46.265 13.165  14.496  1.00 34.89  ? 336 LEU B CB  1 
ATOM   5010 C CG  . LEU B 1 343 ? -46.284 14.104  15.700  1.00 30.89  ? 336 LEU B CG  1 
ATOM   5011 C CD1 . LEU B 1 343 ? -46.383 13.304  16.975  1.00 30.43  ? 336 LEU B CD1 1 
ATOM   5012 C CD2 . LEU B 1 343 ? -45.035 14.933  15.714  1.00 33.01  ? 336 LEU B CD2 1 
ATOM   5013 N N   . HIS B 1 344 ? -49.090 12.798  13.096  1.00 33.39  ? 337 HIS B N   1 
ATOM   5014 C CA  . HIS B 1 344 ? -50.431 13.305  12.828  1.00 33.13  ? 337 HIS B CA  1 
ATOM   5015 C C   . HIS B 1 344 ? -51.456 12.275  13.281  1.00 31.88  ? 337 HIS B C   1 
ATOM   5016 O O   . HIS B 1 344 ? -52.385 12.606  14.004  1.00 45.63  ? 337 HIS B O   1 
ATOM   5017 C CB  . HIS B 1 344 ? -50.624 13.667  11.340  1.00 37.68  ? 337 HIS B CB  1 
ATOM   5018 C CG  . HIS B 1 344 ? -50.130 15.035  10.974  1.00 36.18  ? 337 HIS B CG  1 
ATOM   5019 N ND1 . HIS B 1 344 ? -50.716 16.193  11.452  1.00 40.79  ? 337 HIS B ND1 1 
ATOM   5020 C CD2 . HIS B 1 344 ? -49.114 15.436  10.177  1.00 31.67  ? 337 HIS B CD2 1 
ATOM   5021 C CE1 . HIS B 1 344 ? -50.075 17.240  10.971  1.00 32.85  ? 337 HIS B CE1 1 
ATOM   5022 N NE2 . HIS B 1 344 ? -49.098 16.809  10.190  1.00 34.58  ? 337 HIS B NE2 1 
ATOM   5023 N N   . GLN B 1 345 ? -51.270 11.025  12.872  1.00 30.71  ? 338 GLN B N   1 
ATOM   5024 C CA  . GLN B 1 345 ? -52.136 9.941   13.320  1.00 38.59  ? 338 GLN B CA  1 
ATOM   5025 C C   . GLN B 1 345 ? -52.208 9.820   14.857  1.00 47.71  ? 338 GLN B C   1 
ATOM   5026 O O   . GLN B 1 345 ? -53.301 9.727   15.428  1.00 45.90  ? 338 GLN B O   1 
ATOM   5027 C CB  . GLN B 1 345 ? -51.694 8.617   12.706  1.00 30.77  ? 338 GLN B CB  1 
ATOM   5028 C CG  . GLN B 1 345 ? -51.921 8.513   11.220  1.00 42.59  ? 338 GLN B CG  1 
ATOM   5029 C CD  . GLN B 1 345 ? -51.462 7.163   10.665  1.00 60.85  ? 338 GLN B CD  1 
ATOM   5030 O OE1 . GLN B 1 345 ? -51.164 6.238   11.429  1.00 72.94  ? 338 GLN B OE1 1 
ATOM   5031 N NE2 . GLN B 1 345 ? -51.404 7.046   9.332   1.00 44.06  ? 338 GLN B NE2 1 
ATOM   5032 N N   . PHE B 1 346 ? -51.050 9.824   15.513  1.00 42.07  ? 339 PHE B N   1 
ATOM   5033 C CA  . PHE B 1 346 ? -51.002 9.794   16.970  1.00 45.62  ? 339 PHE B CA  1 
ATOM   5034 C C   . PHE B 1 346 ? -51.851 10.907  17.591  1.00 45.50  ? 339 PHE B C   1 
ATOM   5035 O O   . PHE B 1 346 ? -52.572 10.677  18.557  1.00 41.17  ? 339 PHE B O   1 
ATOM   5036 C CB  . PHE B 1 346 ? -49.555 9.894   17.473  1.00 44.87  ? 339 PHE B CB  1 
ATOM   5037 C CG  . PHE B 1 346 ? -49.412 9.731   18.968  1.00 41.59  ? 339 PHE B CG  1 
ATOM   5038 C CD1 . PHE B 1 346 ? -49.103 8.498   19.517  1.00 48.14  ? 339 PHE B CD1 1 
ATOM   5039 C CD2 . PHE B 1 346 ? -49.581 10.809  19.824  1.00 41.95  ? 339 PHE B CD2 1 
ATOM   5040 C CE1 . PHE B 1 346 ? -48.969 8.340   20.903  1.00 49.50  ? 339 PHE B CE1 1 
ATOM   5041 C CE2 . PHE B 1 346 ? -49.448 10.656  21.197  1.00 40.72  ? 339 PHE B CE2 1 
ATOM   5042 C CZ  . PHE B 1 346 ? -49.143 9.418   21.735  1.00 39.35  ? 339 PHE B CZ  1 
ATOM   5043 N N   . CYS B 1 347 ? -51.761 12.112  17.039  1.00 45.00  ? 340 CYS B N   1 
ATOM   5044 C CA  . CYS B 1 347 ? -52.440 13.258  17.636  1.00 39.82  ? 340 CYS B CA  1 
ATOM   5045 C C   . CYS B 1 347 ? -53.936 13.181  17.386  1.00 44.60  ? 340 CYS B C   1 
ATOM   5046 O O   . CYS B 1 347 ? -54.737 13.534  18.245  1.00 51.78  ? 340 CYS B O   1 
ATOM   5047 C CB  . CYS B 1 347 ? -51.878 14.590  17.114  1.00 28.16  ? 340 CYS B CB  1 
ATOM   5048 S SG  . CYS B 1 347 ? -50.159 14.987  17.624  1.00 56.97  ? 340 CYS B SG  1 
ATOM   5049 N N   . ALA B 1 348 ? -54.310 12.718  16.202  1.00 35.83  ? 341 ALA B N   1 
ATOM   5050 C CA  . ALA B 1 348 ? -55.719 12.581  15.858  1.00 37.27  ? 341 ALA B CA  1 
ATOM   5051 C C   . ALA B 1 348 ? -56.375 11.526  16.749  1.00 44.02  ? 341 ALA B C   1 
ATOM   5052 O O   . ALA B 1 348 ? -57.559 11.621  17.069  1.00 45.24  ? 341 ALA B O   1 
ATOM   5053 C CB  . ALA B 1 348 ? -55.889 12.216  14.361  1.00 11.85  ? 341 ALA B CB  1 
ATOM   5054 N N   . GLN B 1 349 ? -55.597 10.523  17.145  1.00 38.98  ? 342 GLN B N   1 
ATOM   5055 C CA  . GLN B 1 349 ? -56.111 9.458   17.994  1.00 44.14  ? 342 GLN B CA  1 
ATOM   5056 C C   . GLN B 1 349 ? -56.191 9.872   19.464  1.00 45.48  ? 342 GLN B C   1 
ATOM   5057 O O   . GLN B 1 349 ? -57.240 9.762   20.089  1.00 54.61  ? 342 GLN B O   1 
ATOM   5058 C CB  . GLN B 1 349 ? -55.278 8.181   17.831  1.00 54.50  ? 342 GLN B CB  1 
ATOM   5059 C CG  . GLN B 1 349 ? -55.436 7.529   16.456  1.00 64.61  ? 342 GLN B CG  1 
ATOM   5060 C CD  . GLN B 1 349 ? -54.626 6.251   16.287  1.00 66.34  ? 342 GLN B CD  1 
ATOM   5061 O OE1 . GLN B 1 349 ? -54.114 5.677   17.255  1.00 70.91  ? 342 GLN B OE1 1 
ATOM   5062 N NE2 . GLN B 1 349 ? -54.507 5.801   15.042  1.00 55.75  ? 342 GLN B NE2 1 
ATOM   5063 N N   . HIS B 1 350 ? -55.092 10.366  20.011  1.00 35.39  ? 343 HIS B N   1 
ATOM   5064 C CA  . HIS B 1 350 ? -55.034 10.672  21.430  1.00 42.12  ? 343 HIS B CA  1 
ATOM   5065 C C   . HIS B 1 350 ? -55.471 12.092  21.767  1.00 47.24  ? 343 HIS B C   1 
ATOM   5066 O O   . HIS B 1 350 ? -55.534 12.462  22.943  1.00 47.03  ? 343 HIS B O   1 
ATOM   5067 C CB  . HIS B 1 350 ? -53.617 10.441  21.944  1.00 57.21  ? 343 HIS B CB  1 
ATOM   5068 C CG  . HIS B 1 350 ? -53.123 9.039   21.738  1.00 67.58  ? 343 HIS B CG  1 
ATOM   5069 N ND1 . HIS B 1 350 ? -52.745 8.238   22.773  1.00 65.16  ? 343 HIS B ND1 1 
ATOM   5070 C CD2 . HIS B 1 350 ? -52.972 8.317   20.598  1.00 80.21  ? 343 HIS B CD2 1 
ATOM   5071 C CE1 . HIS B 1 350 ? -52.358 7.050   22.288  1.00 72.99  ? 343 HIS B CE1 1 
ATOM   5072 N NE2 . HIS B 1 350 ? -52.494 7.090   20.984  1.00 83.16  ? 343 HIS B NE2 1 
ATOM   5073 N N   . GLY B 1 351 ? -55.744 12.895  20.742  1.00 51.19  ? 344 GLY B N   1 
ATOM   5074 C CA  . GLY B 1 351 ? -56.096 14.293  20.936  1.00 43.12  ? 344 GLY B CA  1 
ATOM   5075 C C   . GLY B 1 351 ? -54.982 15.125  21.560  1.00 45.48  ? 344 GLY B C   1 
ATOM   5076 O O   . GLY B 1 351 ? -55.196 16.276  21.935  1.00 44.51  ? 344 GLY B O   1 
ATOM   5077 N N   . ARG B 1 352 ? -53.795 14.537  21.676  1.00 43.49  ? 345 ARG B N   1 
ATOM   5078 C CA  . ARG B 1 352 ? -52.625 15.220  22.215  1.00 42.65  ? 345 ARG B CA  1 
ATOM   5079 C C   . ARG B 1 352 ? -51.382 14.596  21.583  1.00 39.85  ? 345 ARG B C   1 
ATOM   5080 O O   . ARG B 1 352 ? -51.444 13.492  21.043  1.00 40.72  ? 345 ARG B O   1 
ATOM   5081 C CB  . ARG B 1 352 ? -52.572 15.076  23.749  1.00 45.96  ? 345 ARG B CB  1 
ATOM   5082 C CG  . ARG B 1 352 ? -52.587 13.635  24.219  1.00 43.47  ? 345 ARG B CG  1 
ATOM   5083 C CD  . ARG B 1 352 ? -51.916 13.456  25.563  1.00 48.07  ? 345 ARG B CD  1 
ATOM   5084 N NE  . ARG B 1 352 ? -50.916 12.389  25.505  1.00 60.97  ? 345 ARG B NE  1 
ATOM   5085 C CZ  . ARG B 1 352 ? -51.194 11.085  25.485  1.00 63.20  ? 345 ARG B CZ  1 
ATOM   5086 N NH1 . ARG B 1 352 ? -52.455 10.655  25.522  1.00 57.19  ? 345 ARG B NH1 1 
ATOM   5087 N NH2 . ARG B 1 352 ? -50.200 10.204  25.424  1.00 59.88  ? 345 ARG B NH2 1 
ATOM   5088 N N   . PRO B 1 353 ? -50.249 15.300  21.643  1.00 42.84  ? 346 PRO B N   1 
ATOM   5089 C CA  . PRO B 1 353 ? -48.980 14.749  21.158  1.00 50.13  ? 346 PRO B CA  1 
ATOM   5090 C C   . PRO B 1 353 ? -48.414 13.748  22.159  1.00 54.38  ? 346 PRO B C   1 
ATOM   5091 O O   . PRO B 1 353 ? -48.963 13.623  23.247  1.00 57.07  ? 346 PRO B O   1 
ATOM   5092 C CB  . PRO B 1 353 ? -48.062 15.982  21.101  1.00 48.77  ? 346 PRO B CB  1 
ATOM   5093 C CG  . PRO B 1 353 ? -48.956 17.166  21.266  1.00 50.18  ? 346 PRO B CG  1 
ATOM   5094 C CD  . PRO B 1 353 ? -50.108 16.697  22.078  1.00 46.03  ? 346 PRO B CD  1 
ATOM   5095 N N   . PRO B 1 354 ? -47.330 13.045  21.800  1.00 53.02  ? 347 PRO B N   1 
ATOM   5096 C CA  . PRO B 1 354 ? -46.606 12.217  22.769  1.00 55.08  ? 347 PRO B CA  1 
ATOM   5097 C C   . PRO B 1 354 ? -46.022 13.029  23.929  1.00 55.00  ? 347 PRO B C   1 
ATOM   5098 O O   . PRO B 1 354 ? -45.341 14.040  23.694  1.00 50.70  ? 347 PRO B O   1 
ATOM   5099 C CB  . PRO B 1 354 ? -45.471 11.623  21.934  1.00 50.47  ? 347 PRO B CB  1 
ATOM   5100 C CG  . PRO B 1 354 ? -45.989 11.633  20.554  1.00 48.44  ? 347 PRO B CG  1 
ATOM   5101 C CD  . PRO B 1 354 ? -46.808 12.868  20.437  1.00 47.48  ? 347 PRO B CD  1 
ATOM   5102 N N   . ARG B 1 355 ? -46.295 12.578  25.157  1.00 52.46  ? 348 ARG B N   1 
ATOM   5103 C CA  . ARG B 1 355 ? -45.737 13.168  26.373  1.00 49.54  ? 348 ARG B CA  1 
ATOM   5104 C C   . ARG B 1 355 ? -44.218 12.995  26.404  1.00 57.84  ? 348 ARG B C   1 
ATOM   5105 O O   . ARG B 1 355 ? -43.707 11.952  26.007  1.00 65.30  ? 348 ARG B O   1 
ATOM   5106 C CB  . ARG B 1 355 ? -46.359 12.497  27.591  1.00 56.89  ? 348 ARG B CB  1 
ATOM   5107 C CG  . ARG B 1 355 ? -47.829 12.819  27.791  1.00 68.11  ? 348 ARG B CG  1 
ATOM   5108 C CD  . ARG B 1 355 ? -48.494 11.860  28.778  1.00 72.53  ? 348 ARG B CD  1 
ATOM   5109 N NE  . ARG B 1 355 ? -48.764 10.559  28.166  1.00 84.97  ? 348 ARG B NE  1 
ATOM   5110 C CZ  . ARG B 1 355 ? -49.630 9.660   28.638  1.00 85.97  ? 348 ARG B CZ  1 
ATOM   5111 N NH1 . ARG B 1 355 ? -50.325 9.913   29.742  1.00 82.17  ? 348 ARG B NH1 1 
ATOM   5112 N NH2 . ARG B 1 355 ? -49.804 8.504   28.001  1.00 82.86  ? 348 ARG B NH2 1 
ATOM   5113 N N   . PRO B 1 356 ? -43.493 14.017  26.888  1.00 60.09  ? 349 PRO B N   1 
ATOM   5114 C CA  . PRO B 1 356 ? -42.025 14.116  26.777  1.00 65.68  ? 349 PRO B CA  1 
ATOM   5115 C C   . PRO B 1 356 ? -41.199 13.099  27.572  1.00 74.65  ? 349 PRO B C   1 
ATOM   5116 O O   . PRO B 1 356 ? -40.053 12.847  27.200  1.00 79.94  ? 349 PRO B O   1 
ATOM   5117 C CB  . PRO B 1 356 ? -41.720 15.534  27.289  1.00 61.19  ? 349 PRO B CB  1 
ATOM   5118 C CG  . PRO B 1 356 ? -43.029 16.263  27.259  1.00 63.45  ? 349 PRO B CG  1 
ATOM   5119 C CD  . PRO B 1 356 ? -44.082 15.222  27.495  1.00 59.18  ? 349 PRO B CD  1 
ATOM   5120 N N   . ARG B 1 357 ? -41.744 12.542  28.647  1.00 73.85  ? 350 ARG B N   1 
ATOM   5121 C CA  . ARG B 1 357 ? -40.972 11.614  29.465  1.00 74.20  ? 350 ARG B CA  1 
ATOM   5122 C C   . ARG B 1 357 ? -41.569 10.215  29.372  1.00 57.92  ? 350 ARG B C   1 
ATOM   5123 O O   . ARG B 1 357 ? -41.268 9.337   30.174  1.00 56.10  ? 350 ARG B O   1 
ATOM   5124 C CB  . ARG B 1 357 ? -40.956 12.071  30.926  1.00 75.06  ? 350 ARG B CB  1 
ATOM   5125 C CG  . ARG B 1 357 ? -40.628 13.544  31.162  1.00 73.67  ? 350 ARG B CG  1 
ATOM   5126 C CD  . ARG B 1 357 ? -41.298 14.034  32.454  1.00 82.70  ? 350 ARG B CD  1 
ATOM   5127 N NE  . ARG B 1 357 ? -40.990 15.425  32.783  1.00 87.25  ? 350 ARG B NE  1 
ATOM   5128 C CZ  . ARG B 1 357 ? -41.298 16.001  33.944  1.00 95.95  ? 350 ARG B CZ  1 
ATOM   5129 N NH1 . ARG B 1 357 ? -41.923 15.305  34.885  1.00 99.47  ? 350 ARG B NH1 1 
ATOM   5130 N NH2 . ARG B 1 357 ? -40.978 17.270  34.172  1.00 97.64  ? 350 ARG B NH2 1 
ATOM   5131 N N   . ASN B 1 358 ? -42.423 10.018  28.378  1.00 52.40  ? 351 ASN B N   1 
ATOM   5132 C CA  . ASN B 1 358 ? -43.206 8.796   28.264  1.00 49.18  ? 351 ASN B CA  1 
ATOM   5133 C C   . ASN B 1 358 ? -42.710 7.889   27.136  1.00 59.81  ? 351 ASN B C   1 
ATOM   5134 O O   . ASN B 1 358 ? -42.980 8.134   25.955  1.00 56.27  ? 351 ASN B O   1 
ATOM   5135 C CB  . ASN B 1 358 ? -44.681 9.155   28.061  1.00 42.36  ? 351 ASN B CB  1 
ATOM   5136 C CG  . ASN B 1 358 ? -45.604 7.954   28.163  1.00 54.41  ? 351 ASN B CG  1 
ATOM   5137 O OD1 . ASN B 1 358 ? -45.183 6.804   28.028  1.00 65.25  ? 351 ASN B OD1 1 
ATOM   5138 N ND2 . ASN B 1 358 ? -46.880 8.220   28.395  1.00 54.15  ? 351 ASN B ND2 1 
ATOM   5139 N N   . ASP B 1 359 ? -41.999 6.832   27.517  1.00 66.28  ? 352 ASP B N   1 
ATOM   5140 C CA  . ASP B 1 359 ? -41.463 5.855   26.573  1.00 63.96  ? 352 ASP B CA  1 
ATOM   5141 C C   . ASP B 1 359 ? -42.538 4.999   25.896  1.00 65.63  ? 352 ASP B C   1 
ATOM   5142 O O   . ASP B 1 359 ? -42.285 4.388   24.861  1.00 67.38  ? 352 ASP B O   1 
ATOM   5143 C CB  . ASP B 1 359 ? -40.446 4.953   27.273  1.00 68.02  ? 352 ASP B CB  1 
ATOM   5144 C CG  . ASP B 1 359 ? -40.853 4.607   28.705  1.00 84.73  ? 352 ASP B CG  1 
ATOM   5145 O OD1 . ASP B 1 359 ? -40.021 4.026   29.433  1.00 94.50  ? 352 ASP B OD1 1 
ATOM   5146 O OD2 . ASP B 1 359 ? -41.996 4.919   29.112  1.00 83.94  ? 352 ASP B OD2 1 
ATOM   5147 N N   . GLU B 1 360 ? -43.729 4.949   26.483  1.00 69.80  ? 353 GLU B N   1 
ATOM   5148 C CA  . GLU B 1 360 ? -44.833 4.193   25.900  1.00 68.83  ? 353 GLU B CA  1 
ATOM   5149 C C   . GLU B 1 360 ? -45.451 4.972   24.745  1.00 65.64  ? 353 GLU B C   1 
ATOM   5150 O O   . GLU B 1 360 ? -45.855 4.393   23.733  1.00 58.11  ? 353 GLU B O   1 
ATOM   5151 C CB  . GLU B 1 360 ? -45.881 3.846   26.964  1.00 72.57  ? 353 GLU B CB  1 
ATOM   5152 C CG  . GLU B 1 360 ? -45.333 2.930   28.067  1.00 87.13  ? 353 GLU B CG  1 
ATOM   5153 C CD  . GLU B 1 360 ? -46.386 2.491   29.084  1.00 95.00  ? 353 GLU B CD  1 
ATOM   5154 O OE1 . GLU B 1 360 ? -47.565 2.893   28.942  1.00 106.34 ? 353 GLU B OE1 1 
ATOM   5155 O OE2 . GLU B 1 360 ? -46.029 1.740   30.026  1.00 81.57  ? 353 GLU B OE2 1 
ATOM   5156 N N   . ASP B 1 361 ? -45.514 6.290   24.903  1.00 64.15  ? 354 ASP B N   1 
ATOM   5157 C CA  . ASP B 1 361 ? -45.945 7.160   23.824  1.00 56.09  ? 354 ASP B CA  1 
ATOM   5158 C C   . ASP B 1 361 ? -44.967 7.028   22.669  1.00 48.31  ? 354 ASP B C   1 
ATOM   5159 O O   . ASP B 1 361 ? -45.361 6.855   21.525  1.00 51.58  ? 354 ASP B O   1 
ATOM   5160 C CB  . ASP B 1 361 ? -45.986 8.612   24.293  1.00 56.22  ? 354 ASP B CB  1 
ATOM   5161 C CG  . ASP B 1 361 ? -47.271 8.960   25.012  1.00 57.95  ? 354 ASP B CG  1 
ATOM   5162 O OD1 . ASP B 1 361 ? -48.182 8.100   25.051  1.00 56.77  ? 354 ASP B OD1 1 
ATOM   5163 O OD2 . ASP B 1 361 ? -47.375 10.106  25.517  1.00 56.49  ? 354 ASP B OD2 1 
ATOM   5164 N N   . ALA B 1 362 ? -43.683 7.100   22.993  1.00 45.51  ? 355 ALA B N   1 
ATOM   5165 C CA  . ALA B 1 362 ? -42.620 7.036   22.001  1.00 45.71  ? 355 ALA B CA  1 
ATOM   5166 C C   . ALA B 1 362 ? -42.620 5.716   21.243  1.00 54.33  ? 355 ALA B C   1 
ATOM   5167 O O   . ALA B 1 362 ? -42.368 5.677   20.037  1.00 58.92  ? 355 ALA B O   1 
ATOM   5168 C CB  . ALA B 1 362 ? -41.262 7.271   22.664  1.00 38.68  ? 355 ALA B CB  1 
ATOM   5169 N N   . ALA B 1 363 ? -42.896 4.634   21.957  1.00 54.78  ? 356 ALA B N   1 
ATOM   5170 C CA  . ALA B 1 363 ? -42.938 3.319   21.340  1.00 50.13  ? 356 ALA B CA  1 
ATOM   5171 C C   . ALA B 1 363 ? -44.190 3.150   20.472  1.00 55.65  ? 356 ALA B C   1 
ATOM   5172 O O   . ALA B 1 363 ? -44.188 2.391   19.503  1.00 65.45  ? 356 ALA B O   1 
ATOM   5173 C CB  . ALA B 1 363 ? -42.856 2.234   22.396  1.00 35.19  ? 356 ALA B CB  1 
ATOM   5174 N N   . GLU B 1 364 ? -45.259 3.859   20.809  1.00 44.61  ? 357 GLU B N   1 
ATOM   5175 C CA  . GLU B 1 364 ? -46.448 3.798   19.975  1.00 54.34  ? 357 GLU B CA  1 
ATOM   5176 C C   . GLU B 1 364 ? -46.228 4.532   18.654  1.00 55.16  ? 357 GLU B C   1 
ATOM   5177 O O   . GLU B 1 364 ? -46.660 4.078   17.590  1.00 53.87  ? 357 GLU B O   1 
ATOM   5178 C CB  . GLU B 1 364 ? -47.666 4.379   20.685  1.00 56.71  ? 357 GLU B CB  1 
ATOM   5179 C CG  . GLU B 1 364 ? -48.923 4.256   19.846  1.00 56.81  ? 357 GLU B CG  1 
ATOM   5180 C CD  . GLU B 1 364 ? -50.146 4.849   20.503  1.00 69.18  ? 357 GLU B CD  1 
ATOM   5181 O OE1 . GLU B 1 364 ? -50.119 5.119   21.726  1.00 74.37  ? 357 GLU B OE1 1 
ATOM   5182 O OE2 . GLU B 1 364 ? -51.145 5.043   19.781  1.00 74.04  ? 357 GLU B OE2 1 
ATOM   5183 N N   . LEU B 1 365 ? -45.561 5.677   18.722  1.00 45.76  ? 358 LEU B N   1 
ATOM   5184 C CA  . LEU B 1 365 ? -45.282 6.434   17.518  1.00 40.40  ? 358 LEU B CA  1 
ATOM   5185 C C   . LEU B 1 365 ? -44.434 5.579   16.588  1.00 48.30  ? 358 LEU B C   1 
ATOM   5186 O O   . LEU B 1 365 ? -44.615 5.610   15.377  1.00 46.73  ? 358 LEU B O   1 
ATOM   5187 C CB  . LEU B 1 365 ? -44.574 7.745   17.845  1.00 34.20  ? 358 LEU B CB  1 
ATOM   5188 C CG  . LEU B 1 365 ? -44.574 8.767   16.710  1.00 29.92  ? 358 LEU B CG  1 
ATOM   5189 C CD1 . LEU B 1 365 ? -45.937 9.415   16.565  1.00 26.13  ? 358 LEU B CD1 1 
ATOM   5190 C CD2 . LEU B 1 365 ? -43.504 9.818   16.934  1.00 27.08  ? 358 LEU B CD2 1 
ATOM   5191 N N   . VAL B 1 366 ? -43.530 4.790   17.161  1.00 53.29  ? 359 VAL B N   1 
ATOM   5192 C CA  . VAL B 1 366 ? -42.685 3.921   16.355  1.00 47.78  ? 359 VAL B CA  1 
ATOM   5193 C C   . VAL B 1 366 ? -43.532 2.893   15.622  1.00 45.80  ? 359 VAL B C   1 
ATOM   5194 O O   . VAL B 1 366 ? -43.317 2.628   14.439  1.00 55.55  ? 359 VAL B O   1 
ATOM   5195 C CB  . VAL B 1 366 ? -41.594 3.238   17.193  1.00 41.49  ? 359 VAL B CB  1 
ATOM   5196 C CG1 . VAL B 1 366 ? -40.862 2.210   16.360  1.00 30.69  ? 359 VAL B CG1 1 
ATOM   5197 C CG2 . VAL B 1 366 ? -40.610 4.276   17.716  1.00 42.88  ? 359 VAL B CG2 1 
ATOM   5198 N N   . ALA B 1 367 ? -44.517 2.343   16.319  1.00 41.47  ? 360 ALA B N   1 
ATOM   5199 C CA  . ALA B 1 367 ? -45.461 1.405   15.706  1.00 46.83  ? 360 ALA B CA  1 
ATOM   5200 C C   . ALA B 1 367 ? -46.370 2.041   14.637  1.00 46.43  ? 360 ALA B C   1 
ATOM   5201 O O   . ALA B 1 367 ? -46.671 1.409   13.620  1.00 48.59  ? 360 ALA B O   1 
ATOM   5202 C CB  . ALA B 1 367 ? -46.300 0.718   16.774  1.00 35.24  ? 360 ALA B CB  1 
ATOM   5203 N N   . LEU B 1 368 ? -46.821 3.272   14.884  1.00 36.18  ? 361 LEU B N   1 
ATOM   5204 C CA  . LEU B 1 368 ? -47.593 4.028   13.907  1.00 38.65  ? 361 LEU B CA  1 
ATOM   5205 C C   . LEU B 1 368 ? -46.726 4.275   12.676  1.00 45.95  ? 361 LEU B C   1 
ATOM   5206 O O   . LEU B 1 368 ? -47.172 4.134   11.530  1.00 40.32  ? 361 LEU B O   1 
ATOM   5207 C CB  . LEU B 1 368 ? -48.001 5.377   14.493  1.00 40.54  ? 361 LEU B CB  1 
ATOM   5208 C CG  . LEU B 1 368 ? -49.421 5.625   15.003  1.00 39.01  ? 361 LEU B CG  1 
ATOM   5209 C CD1 . LEU B 1 368 ? -50.364 4.585   14.460  1.00 43.54  ? 361 LEU B CD1 1 
ATOM   5210 C CD2 . LEU B 1 368 ? -49.467 5.675   16.509  1.00 39.09  ? 361 LEU B CD2 1 
ATOM   5211 N N   . ALA B 1 369 ? -45.472 4.637   12.938  1.00 41.14  ? 362 ALA B N   1 
ATOM   5212 C CA  . ALA B 1 369 ? -44.530 5.005   11.892  1.00 39.64  ? 362 ALA B CA  1 
ATOM   5213 C C   . ALA B 1 369 ? -44.111 3.797   11.072  1.00 39.93  ? 362 ALA B C   1 
ATOM   5214 O O   . ALA B 1 369 ? -43.939 3.876   9.852   1.00 34.21  ? 362 ALA B O   1 
ATOM   5215 C CB  . ALA B 1 369 ? -43.312 5.678   12.498  1.00 23.99  ? 362 ALA B CB  1 
ATOM   5216 N N   . GLN B 1 370 ? -43.934 2.677   11.753  1.00 40.73  ? 363 GLN B N   1 
ATOM   5217 C CA  . GLN B 1 370 ? -43.527 1.465   11.087  1.00 35.48  ? 363 GLN B CA  1 
ATOM   5218 C C   . GLN B 1 370 ? -44.627 1.052   10.105  1.00 39.59  ? 363 GLN B C   1 
ATOM   5219 O O   . GLN B 1 370 ? -44.358 0.482   9.049   1.00 41.00  ? 363 GLN B O   1 
ATOM   5220 C CB  . GLN B 1 370 ? -43.252 0.379   12.119  1.00 32.55  ? 363 GLN B CB  1 
ATOM   5221 C CG  . GLN B 1 370 ? -42.329 -0.703  11.607  1.00 53.52  ? 363 GLN B CG  1 
ATOM   5222 C CD  . GLN B 1 370 ? -40.888 -0.251  11.533  1.00 57.78  ? 363 GLN B CD  1 
ATOM   5223 O OE1 . GLN B 1 370 ? -40.383 0.378   12.459  1.00 61.74  ? 363 GLN B OE1 1 
ATOM   5224 N NE2 . GLN B 1 370 ? -40.215 -0.574  10.428  1.00 56.54  ? 363 GLN B NE2 1 
ATOM   5225 N N   . ALA B 1 371 ? -45.867 1.385   10.449  1.00 43.73  ? 364 ALA B N   1 
ATOM   5226 C CA  . ALA B 1 371 ? -47.022 1.041   9.627   1.00 41.52  ? 364 ALA B CA  1 
ATOM   5227 C C   . ALA B 1 371 ? -47.176 2.001   8.451   1.00 41.25  ? 364 ALA B C   1 
ATOM   5228 O O   . ALA B 1 371 ? -47.610 1.611   7.367   1.00 43.03  ? 364 ALA B O   1 
ATOM   5229 C CB  . ALA B 1 371 ? -48.281 1.035   10.472  1.00 28.70  ? 364 ALA B CB  1 
ATOM   5230 N N   . VAL B 1 372 ? -46.834 3.262   8.681   1.00 41.35  ? 365 VAL B N   1 
ATOM   5231 C CA  . VAL B 1 372 ? -46.827 4.268   7.627   1.00 38.42  ? 365 VAL B CA  1 
ATOM   5232 C C   . VAL B 1 372 ? -45.769 3.892   6.596   1.00 46.28  ? 365 VAL B C   1 
ATOM   5233 O O   . VAL B 1 372 ? -45.942 4.086   5.382   1.00 42.50  ? 365 VAL B O   1 
ATOM   5234 C CB  . VAL B 1 372 ? -46.495 5.657   8.200   1.00 23.01  ? 365 VAL B CB  1 
ATOM   5235 C CG1 . VAL B 1 372 ? -46.214 6.642   7.095   1.00 21.24  ? 365 VAL B CG1 1 
ATOM   5236 C CG2 . VAL B 1 372 ? -47.625 6.151   9.066   1.00 24.25  ? 365 VAL B CG2 1 
ATOM   5237 N N   . ASN B 1 373 ? -44.676 3.335   7.106   1.00 46.45  ? 366 ASN B N   1 
ATOM   5238 C CA  . ASN B 1 373 ? -43.563 2.937   6.277   1.00 45.92  ? 366 ASN B CA  1 
ATOM   5239 C C   . ASN B 1 373 ? -43.963 1.798   5.355   1.00 52.12  ? 366 ASN B C   1 
ATOM   5240 O O   . ASN B 1 373 ? -43.610 1.778   4.175   1.00 45.96  ? 366 ASN B O   1 
ATOM   5241 C CB  . ASN B 1 373 ? -42.397 2.513   7.154   1.00 35.53  ? 366 ASN B CB  1 
ATOM   5242 C CG  . ASN B 1 373 ? -41.139 2.278   6.359   1.00 35.41  ? 366 ASN B CG  1 
ATOM   5243 O OD1 . ASN B 1 373 ? -40.456 3.220   5.966   1.00 32.20  ? 366 ASN B OD1 1 
ATOM   5244 N ND2 . ASN B 1 373 ? -40.822 1.016   6.119   1.00 36.05  ? 366 ASN B ND2 1 
ATOM   5245 N N   . ALA B 1 374 ? -44.705 0.851   5.912   1.00 52.84  ? 367 ALA B N   1 
ATOM   5246 C CA  . ALA B 1 374 ? -45.161 -0.307  5.167   1.00 42.56  ? 367 ALA B CA  1 
ATOM   5247 C C   . ALA B 1 374 ? -46.035 0.126   3.991   1.00 40.63  ? 367 ALA B C   1 
ATOM   5248 O O   . ALA B 1 374 ? -45.835 -0.326  2.865   1.00 44.04  ? 367 ALA B O   1 
ATOM   5249 C CB  . ALA B 1 374 ? -45.908 -1.263  6.088   1.00 32.36  ? 367 ALA B CB  1 
ATOM   5250 N N   . ARG B 1 375 ? -46.988 1.013   4.250   1.00 30.35  ? 368 ARG B N   1 
ATOM   5251 C CA  . ARG B 1 375 ? -47.815 1.565   3.184   1.00 33.50  ? 368 ARG B CA  1 
ATOM   5252 C C   . ARG B 1 375 ? -47.025 2.452   2.205   1.00 29.21  ? 368 ARG B C   1 
ATOM   5253 O O   . ARG B 1 375 ? -47.433 2.623   1.068   1.00 37.65  ? 368 ARG B O   1 
ATOM   5254 C CB  . ARG B 1 375 ? -48.979 2.373   3.761   1.00 43.70  ? 368 ARG B CB  1 
ATOM   5255 C CG  . ARG B 1 375 ? -49.977 1.603   4.618   1.00 51.71  ? 368 ARG B CG  1 
ATOM   5256 C CD  . ARG B 1 375 ? -51.166 2.489   4.993   1.00 61.10  ? 368 ARG B CD  1 
ATOM   5257 N NE  . ARG B 1 375 ? -50.804 3.601   5.884   1.00 75.82  ? 368 ARG B NE  1 
ATOM   5258 C CZ  . ARG B 1 375 ? -50.588 4.859   5.486   1.00 76.66  ? 368 ARG B CZ  1 
ATOM   5259 N NH1 . ARG B 1 375 ? -50.691 5.185   4.201   1.00 74.21  ? 368 ARG B NH1 1 
ATOM   5260 N NH2 . ARG B 1 375 ? -50.268 5.798   6.374   1.00 64.46  ? 368 ARG B NH2 1 
ATOM   5261 N N   . ALA B 1 376 ? -45.906 3.018   2.644   1.00 26.38  ? 369 ALA B N   1 
ATOM   5262 C CA  . ALA B 1 376 ? -45.161 3.981   1.820   1.00 38.10  ? 369 ALA B CA  1 
ATOM   5263 C C   . ALA B 1 376 ? -44.706 3.458   0.457   1.00 42.47  ? 369 ALA B C   1 
ATOM   5264 O O   . ALA B 1 376 ? -44.522 2.256   0.269   1.00 40.96  ? 369 ALA B O   1 
ATOM   5265 C CB  . ALA B 1 376 ? -43.961 4.529   2.582   1.00 39.64  ? 369 ALA B CB  1 
ATOM   5266 N N   . LEU B 1 377 ? -44.521 4.393   -0.476  1.00 40.87  ? 370 LEU B N   1 
ATOM   5267 C CA  . LEU B 1 377 ? -43.987 4.126   -1.815  1.00 35.05  ? 370 LEU B CA  1 
ATOM   5268 C C   . LEU B 1 377 ? -42.454 4.163   -1.792  1.00 37.23  ? 370 LEU B C   1 
ATOM   5269 O O   . LEU B 1 377 ? -41.865 4.665   -0.832  1.00 38.87  ? 370 LEU B O   1 
ATOM   5270 C CB  . LEU B 1 377 ? -44.529 5.176   -2.793  1.00 39.96  ? 370 LEU B CB  1 
ATOM   5271 C CG  . LEU B 1 377 ? -45.901 4.961   -3.446  1.00 42.81  ? 370 LEU B CG  1 
ATOM   5272 C CD1 . LEU B 1 377 ? -46.742 3.924   -2.716  1.00 48.07  ? 370 LEU B CD1 1 
ATOM   5273 C CD2 . LEU B 1 377 ? -46.648 6.265   -3.509  1.00 34.19  ? 370 LEU B CD2 1 
ATOM   5274 N N   . PRO B 1 378 ? -41.794 3.639   -2.845  1.00 39.64  ? 371 PRO B N   1 
ATOM   5275 C CA  . PRO B 1 378 ? -40.317 3.566   -2.855  1.00 38.80  ? 371 PRO B CA  1 
ATOM   5276 C C   . PRO B 1 378 ? -39.573 4.896   -2.697  1.00 42.29  ? 371 PRO B C   1 
ATOM   5277 O O   . PRO B 1 378 ? -38.448 4.901   -2.200  1.00 42.60  ? 371 PRO B O   1 
ATOM   5278 C CB  . PRO B 1 378 ? -39.995 2.925   -4.207  1.00 32.97  ? 371 PRO B CB  1 
ATOM   5279 C CG  . PRO B 1 378 ? -41.273 2.978   -5.000  1.00 28.82  ? 371 PRO B CG  1 
ATOM   5280 C CD  . PRO B 1 378 ? -42.382 2.960   -4.013  1.00 29.44  ? 371 PRO B CD  1 
ATOM   5281 N N   . ALA B 1 379 ? -40.185 6.001   -3.107  1.00 46.91  ? 372 ALA B N   1 
ATOM   5282 C CA  . ALA B 1 379 ? -39.630 7.317   -2.812  1.00 52.64  ? 372 ALA B CA  1 
ATOM   5283 C C   . ALA B 1 379 ? -39.373 7.478   -1.301  1.00 56.31  ? 372 ALA B C   1 
ATOM   5284 O O   . ALA B 1 379 ? -38.362 8.046   -0.882  1.00 58.34  ? 372 ALA B O   1 
ATOM   5285 C CB  . ALA B 1 379 ? -40.573 8.409   -3.317  1.00 45.54  ? 372 ALA B CB  1 
ATOM   5286 N N   . VAL B 1 380 ? -40.281 6.942   -0.492  1.00 41.89  ? 373 VAL B N   1 
ATOM   5287 C CA  . VAL B 1 380 ? -40.238 7.151   0.946   1.00 42.38  ? 373 VAL B CA  1 
ATOM   5288 C C   . VAL B 1 380 ? -39.813 5.930   1.753   1.00 47.12  ? 373 VAL B C   1 
ATOM   5289 O O   . VAL B 1 380 ? -38.981 6.037   2.655   1.00 44.97  ? 373 VAL B O   1 
ATOM   5290 C CB  . VAL B 1 380 ? -41.611 7.595   1.463   1.00 37.20  ? 373 VAL B CB  1 
ATOM   5291 C CG1 . VAL B 1 380 ? -41.622 7.643   2.975   1.00 31.35  ? 373 VAL B CG1 1 
ATOM   5292 C CG2 . VAL B 1 380 ? -41.967 8.922   0.880   1.00 26.62  ? 373 VAL B CG2 1 
ATOM   5293 N N   . GLN B 1 381 ? -40.398 4.779   1.438   1.00 50.10  ? 374 GLN B N   1 
ATOM   5294 C CA  . GLN B 1 381 ? -40.226 3.585   2.259   1.00 48.07  ? 374 GLN B CA  1 
ATOM   5295 C C   . GLN B 1 381 ? -38.761 3.211   2.507   1.00 54.71  ? 374 GLN B C   1 
ATOM   5296 O O   . GLN B 1 381 ? -37.901 3.359   1.631   1.00 60.70  ? 374 GLN B O   1 
ATOM   5297 C CB  . GLN B 1 381 ? -40.976 2.405   1.654   1.00 38.41  ? 374 GLN B CB  1 
ATOM   5298 C CG  . GLN B 1 381 ? -40.933 1.175   2.518   1.00 41.52  ? 374 GLN B CG  1 
ATOM   5299 C CD  . GLN B 1 381 ? -41.405 -0.053  1.790   1.00 40.72  ? 374 GLN B CD  1 
ATOM   5300 O OE1 . GLN B 1 381 ? -42.603 -0.288  1.668   1.00 43.98  ? 374 GLN B OE1 1 
ATOM   5301 N NE2 . GLN B 1 381 ? -40.463 -0.847  1.294   1.00 43.97  ? 374 GLN B NE2 1 
ATOM   5302 N N   . GLN B 1 382 ? -38.498 2.738   3.718   1.00 51.64  ? 375 GLN B N   1 
ATOM   5303 C CA  . GLN B 1 382 ? -37.164 2.354   4.150   1.00 53.89  ? 375 GLN B CA  1 
ATOM   5304 C C   . GLN B 1 382 ? -37.152 0.863   4.445   1.00 58.22  ? 375 GLN B C   1 
ATOM   5305 O O   . GLN B 1 382 ? -38.136 0.339   4.960   1.00 58.48  ? 375 GLN B O   1 
ATOM   5306 C CB  . GLN B 1 382 ? -36.812 3.111   5.432   1.00 53.58  ? 375 GLN B CB  1 
ATOM   5307 C CG  . GLN B 1 382 ? -36.860 4.611   5.293   1.00 44.59  ? 375 GLN B CG  1 
ATOM   5308 C CD  . GLN B 1 382 ? -35.837 5.108   4.301   1.00 50.47  ? 375 GLN B CD  1 
ATOM   5309 O OE1 . GLN B 1 382 ? -36.179 5.687   3.263   1.00 45.03  ? 375 GLN B OE1 1 
ATOM   5310 N NE2 . GLN B 1 382 ? -34.563 4.878   4.610   1.00 51.39  ? 375 GLN B NE2 1 
ATOM   5311 N N   . ASN B 1 383 ? -36.054 0.176   4.133   1.00 61.60  ? 376 ASN B N   1 
ATOM   5312 C CA  . ASN B 1 383 ? -35.938 -1.238  4.497   1.00 65.67  ? 376 ASN B CA  1 
ATOM   5313 C C   . ASN B 1 383 ? -35.772 -1.376  6.010   1.00 57.35  ? 376 ASN B C   1 
ATOM   5314 O O   . ASN B 1 383 ? -36.272 -2.321  6.628   1.00 44.22  ? 376 ASN B O   1 
ATOM   5315 C CB  . ASN B 1 383 ? -34.779 -1.927  3.754   1.00 74.24  ? 376 ASN B CB  1 
ATOM   5316 C CG  . ASN B 1 383 ? -35.127 -2.285  2.309   1.00 86.04  ? 376 ASN B CG  1 
ATOM   5317 O OD1 . ASN B 1 383 ? -35.022 -1.453  1.407   1.00 88.17  ? 376 ASN B OD1 1 
ATOM   5318 N ND2 . ASN B 1 383 ? -35.532 -3.532  2.086   1.00 86.97  ? 376 ASN B ND2 1 
ATOM   5319 N N   . ASN B 1 384 ? -35.074 -0.410  6.598   1.00 58.40  ? 377 ASN B N   1 
ATOM   5320 C CA  . ASN B 1 384 ? -34.795 -0.416  8.028   1.00 61.98  ? 377 ASN B CA  1 
ATOM   5321 C C   . ASN B 1 384 ? -35.076 0.963   8.622   1.00 57.03  ? 377 ASN B C   1 
ATOM   5322 O O   . ASN B 1 384 ? -34.271 1.884   8.475   1.00 62.66  ? 377 ASN B O   1 
ATOM   5323 C CB  . ASN B 1 384 ? -33.338 -0.829  8.273   1.00 70.75  ? 377 ASN B CB  1 
ATOM   5324 C CG  . ASN B 1 384 ? -33.010 -0.970  9.745   1.00 83.95  ? 377 ASN B CG  1 
ATOM   5325 O OD1 . ASN B 1 384 ? -33.253 -2.017  10.346  1.00 89.79  ? 377 ASN B OD1 1 
ATOM   5326 N ND2 . ASN B 1 384 ? -32.453 0.086   10.335  1.00 84.17  ? 377 ASN B ND2 1 
ATOM   5327 N N   . LEU B 1 385 ? -36.225 1.102   9.279   1.00 49.79  ? 378 LEU B N   1 
ATOM   5328 C CA  . LEU B 1 385 ? -36.685 2.395   9.794   1.00 44.48  ? 378 LEU B CA  1 
ATOM   5329 C C   . LEU B 1 385 ? -35.893 2.817   11.042  1.00 52.90  ? 378 LEU B C   1 
ATOM   5330 O O   . LEU B 1 385 ? -35.803 2.068   12.017  1.00 56.71  ? 378 LEU B O   1 
ATOM   5331 C CB  . LEU B 1 385 ? -38.183 2.311   10.110  1.00 38.10  ? 378 LEU B CB  1 
ATOM   5332 C CG  . LEU B 1 385 ? -39.110 3.531   10.143  1.00 40.00  ? 378 LEU B CG  1 
ATOM   5333 C CD1 . LEU B 1 385 ? -39.912 3.567   11.437  1.00 40.07  ? 378 LEU B CD1 1 
ATOM   5334 C CD2 . LEU B 1 385 ? -38.369 4.830   9.944   1.00 39.40  ? 378 LEU B CD2 1 
ATOM   5335 N N   . ASP B 1 386 ? -35.314 4.014   11.000  1.00 49.15  ? 379 ASP B N   1 
ATOM   5336 C CA  . ASP B 1 386 ? -34.526 4.536   12.114  1.00 46.03  ? 379 ASP B CA  1 
ATOM   5337 C C   . ASP B 1 386 ? -35.444 4.879   13.294  1.00 40.25  ? 379 ASP B C   1 
ATOM   5338 O O   . ASP B 1 386 ? -35.961 5.989   13.397  1.00 40.84  ? 379 ASP B O   1 
ATOM   5339 C CB  . ASP B 1 386 ? -33.741 5.777   11.663  1.00 51.29  ? 379 ASP B CB  1 
ATOM   5340 C CG  . ASP B 1 386 ? -32.560 6.101   12.571  1.00 69.04  ? 379 ASP B CG  1 
ATOM   5341 O OD1 . ASP B 1 386 ? -31.506 6.511   12.035  1.00 79.01  ? 379 ASP B OD1 1 
ATOM   5342 O OD2 . ASP B 1 386 ? -32.676 5.960   13.811  1.00 72.22  ? 379 ASP B OD2 1 
ATOM   5343 N N   . GLU B 1 387 ? -35.642 3.925   14.192  1.00 39.10  ? 380 GLU B N   1 
ATOM   5344 C CA  . GLU B 1 387 ? -36.579 4.123   15.292  1.00 35.31  ? 380 GLU B CA  1 
ATOM   5345 C C   . GLU B 1 387 ? -36.020 5.032   16.374  1.00 42.97  ? 380 GLU B C   1 
ATOM   5346 O O   . GLU B 1 387 ? -36.743 5.444   17.280  1.00 50.35  ? 380 GLU B O   1 
ATOM   5347 C CB  . GLU B 1 387 ? -37.007 2.786   15.881  1.00 33.40  ? 380 GLU B CB  1 
ATOM   5348 C CG  . GLU B 1 387 ? -37.611 1.855   14.850  1.00 51.21  ? 380 GLU B CG  1 
ATOM   5349 C CD  . GLU B 1 387 ? -38.090 0.554   15.454  1.00 73.77  ? 380 GLU B CD  1 
ATOM   5350 O OE1 . GLU B 1 387 ? -39.003 -0.070  14.870  1.00 79.70  ? 380 GLU B OE1 1 
ATOM   5351 O OE2 . GLU B 1 387 ? -37.555 0.160   16.514  1.00 81.60  ? 380 GLU B OE2 1 
ATOM   5352 N N   . ASP B 1 388 ? -34.734 5.346   16.277  1.00 45.08  ? 381 ASP B N   1 
ATOM   5353 C CA  . ASP B 1 388 ? -34.138 6.343   17.156  1.00 49.54  ? 381 ASP B CA  1 
ATOM   5354 C C   . ASP B 1 388 ? -34.709 7.698   16.782  1.00 51.47  ? 381 ASP B C   1 
ATOM   5355 O O   . ASP B 1 388 ? -35.092 8.483   17.643  1.00 52.99  ? 381 ASP B O   1 
ATOM   5356 C CB  . ASP B 1 388 ? -32.613 6.346   17.028  1.00 51.44  ? 381 ASP B CB  1 
ATOM   5357 C CG  . ASP B 1 388 ? -31.979 5.074   17.573  1.00 68.94  ? 381 ASP B CG  1 
ATOM   5358 O OD1 . ASP B 1 388 ? -32.637 4.356   18.357  1.00 74.03  ? 381 ASP B OD1 1 
ATOM   5359 O OD2 . ASP B 1 388 ? -30.814 4.794   17.226  1.00 76.51  ? 381 ASP B OD2 1 
ATOM   5360 N N   . LEU B 1 389 ? -34.784 7.951   15.481  1.00 48.97  ? 382 LEU B N   1 
ATOM   5361 C CA  . LEU B 1 389 ? -35.342 9.191   14.972  1.00 40.02  ? 382 LEU B CA  1 
ATOM   5362 C C   . LEU B 1 389 ? -36.812 9.343   15.355  1.00 45.41  ? 382 LEU B C   1 
ATOM   5363 O O   . LEU B 1 389 ? -37.253 10.435  15.695  1.00 46.10  ? 382 LEU B O   1 
ATOM   5364 C CB  . LEU B 1 389 ? -35.183 9.270   13.453  1.00 33.97  ? 382 LEU B CB  1 
ATOM   5365 C CG  . LEU B 1 389 ? -35.442 10.660  12.873  1.00 33.55  ? 382 LEU B CG  1 
ATOM   5366 C CD1 . LEU B 1 389 ? -34.751 11.688  13.750  1.00 35.12  ? 382 LEU B CD1 1 
ATOM   5367 C CD2 . LEU B 1 389 ? -34.938 10.774  11.439  1.00 30.18  ? 382 LEU B CD2 1 
ATOM   5368 N N   . ILE B 1 390 ? -37.568 8.251   15.296  1.00 47.99  ? 383 ILE B N   1 
ATOM   5369 C CA  . ILE B 1 390 ? -38.988 8.298   15.627  1.00 50.70  ? 383 ILE B CA  1 
ATOM   5370 C C   . ILE B 1 390 ? -39.171 8.489   17.133  1.00 48.96  ? 383 ILE B C   1 
ATOM   5371 O O   . ILE B 1 390 ? -39.976 9.299   17.578  1.00 32.53  ? 383 ILE B O   1 
ATOM   5372 C CB  . ILE B 1 390 ? -39.727 7.015   15.164  1.00 37.54  ? 383 ILE B CB  1 
ATOM   5373 C CG1 . ILE B 1 390 ? -39.415 6.718   13.704  1.00 31.02  ? 383 ILE B CG1 1 
ATOM   5374 C CG2 . ILE B 1 390 ? -41.235 7.139   15.364  1.00 28.10  ? 383 ILE B CG2 1 
ATOM   5375 C CD1 . ILE B 1 390 ? -39.786 7.822   12.779  1.00 26.06  ? 383 ILE B CD1 1 
ATOM   5376 N N   . ARG B 1 391 ? -38.416 7.734   17.919  1.00 58.93  ? 384 ARG B N   1 
ATOM   5377 C CA  . ARG B 1 391 ? -38.491 7.870   19.363  1.00 49.14  ? 384 ARG B CA  1 
ATOM   5378 C C   . ARG B 1 391 ? -38.086 9.278   19.759  1.00 39.10  ? 384 ARG B C   1 
ATOM   5379 O O   . ARG B 1 391 ? -38.687 9.863   20.656  1.00 35.99  ? 384 ARG B O   1 
ATOM   5380 C CB  . ARG B 1 391 ? -37.626 6.825   20.065  1.00 41.04  ? 384 ARG B CB  1 
ATOM   5381 C CG  . ARG B 1 391 ? -38.418 5.627   20.577  1.00 45.24  ? 384 ARG B CG  1 
ATOM   5382 C CD  . ARG B 1 391 ? -37.534 4.607   21.307  1.00 48.13  ? 384 ARG B CD  1 
ATOM   5383 N NE  . ARG B 1 391 ? -36.841 3.698   20.393  1.00 48.68  ? 384 ARG B NE  1 
ATOM   5384 C CZ  . ARG B 1 391 ? -35.557 3.796   20.047  1.00 46.61  ? 384 ARG B CZ  1 
ATOM   5385 N NH1 . ARG B 1 391 ? -34.791 4.769   20.541  1.00 41.78  ? 384 ARG B NH1 1 
ATOM   5386 N NH2 . ARG B 1 391 ? -35.032 2.909   19.207  1.00 44.47  ? 384 ARG B NH2 1 
ATOM   5387 N N   . LYS B 1 392 ? -37.090 9.836   19.073  1.00 30.11  ? 385 LYS B N   1 
ATOM   5388 C CA  . LYS B 1 392 ? -36.682 11.209  19.369  1.00 36.56  ? 385 LYS B CA  1 
ATOM   5389 C C   . LYS B 1 392 ? -37.830 12.159  19.091  1.00 51.48  ? 385 LYS B C   1 
ATOM   5390 O O   . LYS B 1 392 ? -38.175 12.964  19.945  1.00 65.33  ? 385 LYS B O   1 
ATOM   5391 C CB  . LYS B 1 392 ? -35.434 11.658  18.595  1.00 23.64  ? 385 LYS B CB  1 
ATOM   5392 C CG  . LYS B 1 392 ? -35.067 13.116  18.890  1.00 15.53  ? 385 LYS B CG  1 
ATOM   5393 C CD  . LYS B 1 392 ? -33.763 13.518  18.233  1.00 18.45  ? 385 LYS B CD  1 
ATOM   5394 C CE  . LYS B 1 392 ? -33.459 15.008  18.455  1.00 32.51  ? 385 LYS B CE  1 
ATOM   5395 N NZ  . LYS B 1 392 ? -32.197 15.504  17.787  1.00 33.71  ? 385 LYS B NZ  1 
ATOM   5396 N N   . LEU B 1 393 ? -38.432 12.025  17.910  1.00 50.47  ? 386 LEU B N   1 
ATOM   5397 C CA  . LEU B 1 393 ? -39.536 12.878  17.467  1.00 40.96  ? 386 LEU B CA  1 
ATOM   5398 C C   . LEU B 1 393 ? -40.736 12.844  18.419  1.00 38.98  ? 386 LEU B C   1 
ATOM   5399 O O   . LEU B 1 393 ? -41.453 13.837  18.566  1.00 38.68  ? 386 LEU B O   1 
ATOM   5400 C CB  . LEU B 1 393 ? -39.955 12.494  16.043  1.00 31.33  ? 386 LEU B CB  1 
ATOM   5401 C CG  . LEU B 1 393 ? -41.213 13.146  15.473  1.00 37.54  ? 386 LEU B CG  1 
ATOM   5402 C CD1 . LEU B 1 393 ? -41.053 14.639  15.395  1.00 34.53  ? 386 LEU B CD1 1 
ATOM   5403 C CD2 . LEU B 1 393 ? -41.511 12.566  14.112  1.00 45.37  ? 386 LEU B CD2 1 
ATOM   5404 N N   . ALA B 1 394 ? -40.936 11.706  19.078  1.00 39.10  ? 387 ALA B N   1 
ATOM   5405 C CA  . ALA B 1 394 ? -42.000 11.557  20.063  1.00 35.70  ? 387 ALA B CA  1 
ATOM   5406 C C   . ALA B 1 394 ? -41.651 12.266  21.360  1.00 39.32  ? 387 ALA B C   1 
ATOM   5407 O O   . ALA B 1 394 ? -42.490 12.948  21.949  1.00 40.32  ? 387 ALA B O   1 
ATOM   5408 C CB  . ALA B 1 394 ? -42.244 10.108  20.330  1.00 41.73  ? 387 ALA B CB  1 
ATOM   5409 N N   . TYR B 1 395 ? -40.402 12.108  21.794  1.00 43.42  ? 388 TYR B N   1 
ATOM   5410 C CA  . TYR B 1 395 ? -39.907 12.740  23.020  1.00 48.66  ? 388 TYR B CA  1 
ATOM   5411 C C   . TYR B 1 395 ? -39.883 14.227  22.828  1.00 47.23  ? 388 TYR B C   1 
ATOM   5412 O O   . TYR B 1 395 ? -39.843 15.001  23.778  1.00 45.59  ? 388 TYR B O   1 
ATOM   5413 C CB  . TYR B 1 395 ? -38.500 12.246  23.350  1.00 46.81  ? 388 TYR B CB  1 
ATOM   5414 C CG  . TYR B 1 395 ? -38.523 10.856  23.908  1.00 52.95  ? 388 TYR B CG  1 
ATOM   5415 C CD1 . TYR B 1 395 ? -37.590 9.908   23.515  1.00 55.95  ? 388 TYR B CD1 1 
ATOM   5416 C CD2 . TYR B 1 395 ? -39.507 10.478  24.818  1.00 53.46  ? 388 TYR B CD2 1 
ATOM   5417 C CE1 . TYR B 1 395 ? -37.632 8.615   24.024  1.00 53.53  ? 388 TYR B CE1 1 
ATOM   5418 C CE2 . TYR B 1 395 ? -39.554 9.195   25.330  1.00 55.09  ? 388 TYR B CE2 1 
ATOM   5419 C CZ  . TYR B 1 395 ? -38.615 8.271   24.931  1.00 52.13  ? 388 TYR B CZ  1 
ATOM   5420 O OH  . TYR B 1 395 ? -38.664 7.002   25.445  1.00 58.13  ? 388 TYR B OH  1 
ATOM   5421 N N   . VAL B 1 396 ? -39.964 14.597  21.561  1.00 51.06  ? 389 VAL B N   1 
ATOM   5422 C CA  . VAL B 1 396 ? -39.705 15.934  21.083  1.00 41.52  ? 389 VAL B CA  1 
ATOM   5423 C C   . VAL B 1 396 ? -40.983 16.748  20.800  1.00 39.93  ? 389 VAL B C   1 
ATOM   5424 O O   . VAL B 1 396 ? -40.969 17.975  20.906  1.00 34.76  ? 389 VAL B O   1 
ATOM   5425 C CB  . VAL B 1 396 ? -38.796 15.843  19.812  1.00 98.79  ? 389 VAL B CB  1 
ATOM   5426 C CG1 . VAL B 1 396 ? -39.367 16.610  18.620  1.00 98.25  ? 389 VAL B CG1 1 
ATOM   5427 C CG2 . VAL B 1 396 ? -37.350 16.220  20.132  1.00 69.29  ? 389 VAL B CG2 1 
ATOM   5428 N N   . ALA B 1 397 ? -42.081 16.071  20.466  1.00 32.75  ? 390 ALA B N   1 
ATOM   5429 C CA  . ALA B 1 397 ? -43.244 16.736  19.868  1.00 28.47  ? 390 ALA B CA  1 
ATOM   5430 C C   . ALA B 1 397 ? -43.845 17.900  20.661  1.00 27.76  ? 390 ALA B C   1 
ATOM   5431 O O   . ALA B 1 397 ? -44.314 18.856  20.048  1.00 43.06  ? 390 ALA B O   1 
ATOM   5432 C CB  . ALA B 1 397 ? -44.324 15.718  19.505  1.00 32.35  ? 390 ALA B CB  1 
ATOM   5433 N N   . ALA B 1 398 ? -43.828 17.832  21.996  1.00 43.07  ? 391 ALA B N   1 
ATOM   5434 C CA  . ALA B 1 398 ? -44.430 18.885  22.844  1.00 47.53  ? 391 ALA B CA  1 
ATOM   5435 C C   . ALA B 1 398 ? -43.834 20.269  22.584  1.00 31.01  ? 391 ALA B C   1 
ATOM   5436 O O   . ALA B 1 398 ? -44.551 21.265  22.602  1.00 25.00  ? 391 ALA B O   1 
ATOM   5437 C CB  . ALA B 1 398 ? -44.352 18.533  24.381  1.00 13.56  ? 391 ALA B CB  1 
ATOM   5438 N N   . GLY B 1 399 ? -42.529 20.320  22.325  1.00 19.91  ? 392 GLY B N   1 
ATOM   5439 C CA  . GLY B 1 399 ? -41.803 21.575  22.203  1.00 29.98  ? 392 GLY B CA  1 
ATOM   5440 C C   . GLY B 1 399 ? -42.336 22.628  21.246  1.00 30.20  ? 392 GLY B C   1 
ATOM   5441 O O   . GLY B 1 399 ? -42.800 22.316  20.147  1.00 35.68  ? 392 GLY B O   1 
ATOM   5442 N N   . ASP B 1 400 ? -42.265 23.886  21.677  1.00 30.22  ? 393 ASP B N   1 
ATOM   5443 C CA  . ASP B 1 400 ? -42.673 25.024  20.854  1.00 24.80  ? 393 ASP B CA  1 
ATOM   5444 C C   . ASP B 1 400 ? -41.620 26.140  21.009  1.00 19.06  ? 393 ASP B C   1 
ATOM   5445 O O   . ASP B 1 400 ? -41.810 27.110  21.725  1.00 20.62  ? 393 ASP B O   1 
ATOM   5446 C CB  . ASP B 1 400 ? -44.090 25.489  21.239  1.00 20.20  ? 393 ASP B CB  1 
ATOM   5447 C CG  . ASP B 1 400 ? -44.691 26.458  20.239  1.00 45.27  ? 393 ASP B CG  1 
ATOM   5448 O OD1 . ASP B 1 400 ? -45.113 27.557  20.670  1.00 56.86  ? 393 ASP B OD1 1 
ATOM   5449 O OD2 . ASP B 1 400 ? -44.762 26.118  19.032  1.00 53.85  ? 393 ASP B OD2 1 
ATOM   5450 N N   . LEU B 1 401 ? -40.506 25.994  20.307  1.00 28.43  ? 394 LEU B N   1 
ATOM   5451 C CA  . LEU B 1 401 ? -39.329 26.809  20.565  1.00 15.58  ? 394 LEU B CA  1 
ATOM   5452 C C   . LEU B 1 401 ? -39.227 28.059  19.677  1.00 21.62  ? 394 LEU B C   1 
ATOM   5453 O O   . LEU B 1 401 ? -39.232 27.973  18.450  1.00 36.78  ? 394 LEU B O   1 
ATOM   5454 C CB  . LEU B 1 401 ? -38.073 25.940  20.429  1.00 16.36  ? 394 LEU B CB  1 
ATOM   5455 C CG  . LEU B 1 401 ? -38.274 24.545  21.038  1.00 19.89  ? 394 LEU B CG  1 
ATOM   5456 C CD1 . LEU B 1 401 ? -37.075 23.660  20.798  1.00 17.67  ? 394 LEU B CD1 1 
ATOM   5457 C CD2 . LEU B 1 401 ? -38.566 24.649  22.522  1.00 23.90  ? 394 LEU B CD2 1 
ATOM   5458 N N   . ALA B 1 402 ? -39.113 29.215  20.322  1.00 20.30  ? 395 ALA B N   1 
ATOM   5459 C CA  . ALA B 1 402 ? -39.015 30.508  19.652  1.00 26.33  ? 395 ALA B CA  1 
ATOM   5460 C C   . ALA B 1 402 ? -37.949 30.624  18.547  1.00 27.62  ? 395 ALA B C   1 
ATOM   5461 O O   . ALA B 1 402 ? -38.269 31.083  17.449  1.00 22.97  ? 395 ALA B O   1 
ATOM   5462 C CB  . ALA B 1 402 ? -38.869 31.640  20.675  1.00 16.93  ? 395 ALA B CB  1 
ATOM   5463 N N   . PRO B 1 403 ? -36.694 30.202  18.816  1.00 26.77  ? 396 PRO B N   1 
ATOM   5464 C CA  . PRO B 1 403 ? -35.717 30.339  17.717  1.00 19.10  ? 396 PRO B CA  1 
ATOM   5465 C C   . PRO B 1 403 ? -36.060 29.457  16.506  1.00 30.11  ? 396 PRO B C   1 
ATOM   5466 O O   . PRO B 1 403 ? -35.820 29.873  15.363  1.00 30.54  ? 396 PRO B O   1 
ATOM   5467 C CB  . PRO B 1 403 ? -34.400 29.887  18.350  1.00 16.08  ? 396 PRO B CB  1 
ATOM   5468 C CG  . PRO B 1 403 ? -34.660 29.919  19.871  1.00 19.64  ? 396 PRO B CG  1 
ATOM   5469 C CD  . PRO B 1 403 ? -36.099 29.564  20.007  1.00 8.34   ? 396 PRO B CD  1 
ATOM   5470 N N   . ILE B 1 404 ? -36.628 28.273  16.750  1.00 24.75  ? 397 ILE B N   1 
ATOM   5471 C CA  . ILE B 1 404 ? -37.023 27.397  15.655  1.00 30.12  ? 397 ILE B CA  1 
ATOM   5472 C C   . ILE B 1 404 ? -38.171 27.998  14.856  1.00 29.83  ? 397 ILE B C   1 
ATOM   5473 O O   . ILE B 1 404 ? -38.067 28.135  13.645  1.00 27.00  ? 397 ILE B O   1 
ATOM   5474 C CB  . ILE B 1 404 ? -37.435 25.993  16.121  1.00 31.60  ? 397 ILE B CB  1 
ATOM   5475 C CG1 . ILE B 1 404 ? -36.210 25.107  16.341  1.00 26.93  ? 397 ILE B CG1 1 
ATOM   5476 C CG2 . ILE B 1 404 ? -38.284 25.333  15.056  1.00 28.23  ? 397 ILE B CG2 1 
ATOM   5477 C CD1 . ILE B 1 404 ? -35.463 25.367  17.595  1.00 15.19  ? 397 ILE B CD1 1 
ATOM   5478 N N   . ASN B 1 405 ? -39.261 28.362  15.524  1.00 19.07  ? 398 ASN B N   1 
ATOM   5479 C CA  . ASN B 1 405 ? -40.401 28.926  14.817  1.00 17.42  ? 398 ASN B CA  1 
ATOM   5480 C C   . ASN B 1 405 ? -40.004 30.167  14.039  1.00 22.72  ? 398 ASN B C   1 
ATOM   5481 O O   . ASN B 1 405 ? -40.552 30.432  12.972  1.00 31.53  ? 398 ASN B O   1 
ATOM   5482 C CB  . ASN B 1 405 ? -41.539 29.270  15.782  1.00 21.16  ? 398 ASN B CB  1 
ATOM   5483 C CG  . ASN B 1 405 ? -42.131 28.048  16.434  1.00 28.42  ? 398 ASN B CG  1 
ATOM   5484 O OD1 . ASN B 1 405 ? -42.177 26.967  15.840  1.00 22.48  ? 398 ASN B OD1 1 
ATOM   5485 N ND2 . ASN B 1 405 ? -42.581 28.205  17.673  1.00 28.41  ? 398 ASN B ND2 1 
ATOM   5486 N N   . ALA B 1 406 ? -39.054 30.925  14.582  1.00 14.88  ? 399 ALA B N   1 
ATOM   5487 C CA  . ALA B 1 406 ? -38.597 32.160  13.949  1.00 23.32  ? 399 ALA B CA  1 
ATOM   5488 C C   . ALA B 1 406 ? -37.899 31.857  12.636  1.00 26.79  ? 399 ALA B C   1 
ATOM   5489 O O   . ALA B 1 406 ? -38.181 32.467  11.607  1.00 21.07  ? 399 ALA B O   1 
ATOM   5490 C CB  . ALA B 1 406 ? -37.631 32.910  14.867  1.00 15.94  ? 399 ALA B CB  1 
ATOM   5491 N N   . PHE B 1 407 ? -36.964 30.920  12.711  1.00 21.99  ? 400 PHE B N   1 
ATOM   5492 C CA  . PHE B 1 407 ? -36.152 30.528  11.586  1.00 20.21  ? 400 PHE B CA  1 
ATOM   5493 C C   . PHE B 1 407 ? -36.992 29.794  10.514  1.00 26.81  ? 400 PHE B C   1 
ATOM   5494 O O   . PHE B 1 407 ? -36.903 30.120  9.329   1.00 34.87  ? 400 PHE B O   1 
ATOM   5495 C CB  . PHE B 1 407 ? -34.937 29.730  12.090  1.00 24.25  ? 400 PHE B CB  1 
ATOM   5496 C CG  . PHE B 1 407 ? -34.604 28.547  11.255  1.00 37.54  ? 400 PHE B CG  1 
ATOM   5497 C CD1 . PHE B 1 407 ? -33.943 28.695  10.052  1.00 47.14  ? 400 PHE B CD1 1 
ATOM   5498 C CD2 . PHE B 1 407 ? -34.946 27.281  11.668  1.00 44.48  ? 400 PHE B CD2 1 
ATOM   5499 C CE1 . PHE B 1 407 ? -33.646 27.606  9.273   1.00 43.45  ? 400 PHE B CE1 1 
ATOM   5500 C CE2 . PHE B 1 407 ? -34.656 26.191  10.893  1.00 55.08  ? 400 PHE B CE2 1 
ATOM   5501 C CZ  . PHE B 1 407 ? -34.000 26.352  9.692   1.00 53.35  ? 400 PHE B CZ  1 
ATOM   5502 N N   . ILE B 1 408 ? -37.828 28.839  10.923  1.00 23.91  ? 401 ILE B N   1 
ATOM   5503 C CA  . ILE B 1 408 ? -38.782 28.204  9.998   1.00 27.55  ? 401 ILE B CA  1 
ATOM   5504 C C   . ILE B 1 408 ? -39.797 29.229  9.478   1.00 28.89  ? 401 ILE B C   1 
ATOM   5505 O O   . ILE B 1 408 ? -40.195 29.186  8.315   1.00 29.99  ? 401 ILE B O   1 
ATOM   5506 C CB  . ILE B 1 408 ? -39.516 26.997  10.647  1.00 32.98  ? 401 ILE B CB  1 
ATOM   5507 C CG1 . ILE B 1 408 ? -38.572 25.805  10.793  1.00 37.56  ? 401 ILE B CG1 1 
ATOM   5508 C CG2 . ILE B 1 408 ? -40.686 26.558  9.814   1.00 28.35  ? 401 ILE B CG2 1 
ATOM   5509 C CD1 . ILE B 1 408 ? -38.303 25.073  9.502   1.00 39.64  ? 401 ILE B CD1 1 
ATOM   5510 N N   . GLY B 1 409 ? -40.195 30.160  10.340  1.00 24.91  ? 402 GLY B N   1 
ATOM   5511 C CA  . GLY B 1 409 ? -41.103 31.226  9.954   1.00 17.29  ? 402 GLY B CA  1 
ATOM   5512 C C   . GLY B 1 409 ? -40.479 32.234  8.996   1.00 27.10  ? 402 GLY B C   1 
ATOM   5513 O O   . GLY B 1 409 ? -41.184 32.957  8.290   1.00 29.64  ? 402 GLY B O   1 
ATOM   5514 N N   . GLY B 1 410 ? -39.154 32.305  8.975   1.00 27.87  ? 403 GLY B N   1 
ATOM   5515 C CA  . GLY B 1 410 ? -38.483 33.159  8.015   1.00 27.50  ? 403 GLY B CA  1 
ATOM   5516 C C   . GLY B 1 410 ? -38.571 32.506  6.651   1.00 31.41  ? 403 GLY B C   1 
ATOM   5517 O O   . GLY B 1 410 ? -39.013 33.114  5.678   1.00 34.46  ? 403 GLY B O   1 
ATOM   5518 N N   . LEU B 1 411 ? -38.169 31.241  6.606   1.00 25.44  ? 404 LEU B N   1 
ATOM   5519 C CA  . LEU B 1 411 ? -38.173 30.435  5.400   1.00 16.79  ? 404 LEU B CA  1 
ATOM   5520 C C   . LEU B 1 411 ? -39.518 30.336  4.707   1.00 28.27  ? 404 LEU B C   1 
ATOM   5521 O O   . LEU B 1 411 ? -39.617 30.525  3.494   1.00 34.53  ? 404 LEU B O   1 
ATOM   5522 C CB  . LEU B 1 411 ? -37.695 29.037  5.739   1.00 15.82  ? 404 LEU B CB  1 
ATOM   5523 C CG  . LEU B 1 411 ? -36.183 28.964  5.883   1.00 18.57  ? 404 LEU B CG  1 
ATOM   5524 C CD1 . LEU B 1 411 ? -35.787 27.522  6.009   1.00 22.11  ? 404 LEU B CD1 1 
ATOM   5525 C CD2 . LEU B 1 411 ? -35.526 29.604  4.667   1.00 18.41  ? 404 LEU B CD2 1 
ATOM   5526 N N   . ALA B 1 412 ? -40.546 30.020  5.486   1.00 36.77  ? 405 ALA B N   1 
ATOM   5527 C CA  . ALA B 1 412 ? -41.910 29.914  4.978   1.00 24.54  ? 405 ALA B CA  1 
ATOM   5528 C C   . ALA B 1 412 ? -42.355 31.244  4.388   1.00 26.10  ? 405 ALA B C   1 
ATOM   5529 O O   . ALA B 1 412 ? -43.046 31.282  3.375   1.00 31.43  ? 405 ALA B O   1 
ATOM   5530 C CB  . ALA B 1 412 ? -42.850 29.479  6.087   1.00 10.24  ? 405 ALA B CB  1 
ATOM   5531 N N   . ALA B 1 413 ? -41.948 32.336  5.025   1.00 19.62  ? 406 ALA B N   1 
ATOM   5532 C CA  . ALA B 1 413 ? -42.314 33.660  4.560   1.00 8.60   ? 406 ALA B CA  1 
ATOM   5533 C C   . ALA B 1 413 ? -41.663 33.950  3.216   1.00 22.14  ? 406 ALA B C   1 
ATOM   5534 O O   . ALA B 1 413 ? -42.292 34.556  2.345   1.00 21.18  ? 406 ALA B O   1 
ATOM   5535 C CB  . ALA B 1 413 ? -41.919 34.715  5.580   1.00 5.91   ? 406 ALA B CB  1 
ATOM   5536 N N   . GLN B 1 414 ? -40.404 33.533  3.049   1.00 16.57  ? 407 GLN B N   1 
ATOM   5537 C CA  . GLN B 1 414 ? -39.733 33.706  1.769   1.00 21.48  ? 407 GLN B CA  1 
ATOM   5538 C C   . GLN B 1 414 ? -40.547 33.007  0.683   1.00 26.42  ? 407 GLN B C   1 
ATOM   5539 O O   . GLN B 1 414 ? -40.744 33.548  -0.407  1.00 17.85  ? 407 GLN B O   1 
ATOM   5540 C CB  . GLN B 1 414 ? -38.327 33.126  1.805   1.00 26.30  ? 407 GLN B CB  1 
ATOM   5541 C CG  . GLN B 1 414 ? -37.454 33.676  2.917   1.00 49.52  ? 407 GLN B CG  1 
ATOM   5542 C CD  . GLN B 1 414 ? -36.008 33.189  2.838   1.00 54.08  ? 407 GLN B CD  1 
ATOM   5543 O OE1 . GLN B 1 414 ? -35.541 32.718  1.785   1.00 41.79  ? 407 GLN B OE1 1 
ATOM   5544 N NE2 . GLN B 1 414 ? -35.289 33.305  3.960   1.00 50.52  ? 407 GLN B NE2 1 
ATOM   5545 N N   . GLU B 1 415 ? -41.030 31.806  0.999   1.00 17.80  ? 408 GLU B N   1 
ATOM   5546 C CA  . GLU B 1 415 ? -41.835 31.053  0.054   1.00 13.55  ? 408 GLU B CA  1 
ATOM   5547 C C   . GLU B 1 415 ? -43.091 31.824  -0.337  1.00 10.22  ? 408 GLU B C   1 
ATOM   5548 O O   . GLU B 1 415 ? -43.418 31.929  -1.505  1.00 17.43  ? 408 GLU B O   1 
ATOM   5549 C CB  . GLU B 1 415 ? -42.203 29.674  0.603   1.00 7.13   ? 408 GLU B CB  1 
ATOM   5550 C CG  . GLU B 1 415 ? -41.009 28.800  0.894   1.00 18.78  ? 408 GLU B CG  1 
ATOM   5551 C CD  . GLU B 1 415 ? -40.084 28.641  -0.287  1.00 39.64  ? 408 GLU B CD  1 
ATOM   5552 O OE1 . GLU B 1 415 ? -40.560 28.165  -1.336  1.00 41.00  ? 408 GLU B OE1 1 
ATOM   5553 O OE2 . GLU B 1 415 ? -38.884 28.988  -0.162  1.00 47.31  ? 408 GLU B OE2 1 
ATOM   5554 N N   . VAL B 1 416 ? -43.783 32.372  0.647   1.00 13.25  ? 409 VAL B N   1 
ATOM   5555 C CA  . VAL B 1 416 ? -44.993 33.120  0.378   1.00 23.31  ? 409 VAL B CA  1 
ATOM   5556 C C   . VAL B 1 416 ? -44.658 34.221  -0.595  1.00 20.77  ? 409 VAL B C   1 
ATOM   5557 O O   . VAL B 1 416 ? -45.370 34.423  -1.578  1.00 26.03  ? 409 VAL B O   1 
ATOM   5558 C CB  . VAL B 1 416 ? -45.590 33.730  1.665   1.00 17.66  ? 409 VAL B CB  1 
ATOM   5559 C CG1 . VAL B 1 416 ? -46.736 34.659  1.327   1.00 10.25  ? 409 VAL B CG1 1 
ATOM   5560 C CG2 . VAL B 1 416 ? -46.046 32.635  2.590   1.00 7.55   ? 409 VAL B CG2 1 
ATOM   5561 N N   . MET B 1 417 ? -43.557 34.915  -0.316  1.00 24.11  ? 410 MET B N   1 
ATOM   5562 C CA  . MET B 1 417 ? -43.078 35.981  -1.191  1.00 28.25  ? 410 MET B CA  1 
ATOM   5563 C C   . MET B 1 417 ? -42.935 35.452  -2.621  1.00 32.21  ? 410 MET B C   1 
ATOM   5564 O O   . MET B 1 417 ? -43.544 36.005  -3.550  1.00 19.14  ? 410 MET B O   1 
ATOM   5565 C CB  . MET B 1 417 ? -41.754 36.564  -0.689  1.00 18.40  ? 410 MET B CB  1 
ATOM   5566 C CG  . MET B 1 417 ? -41.832 37.156  0.710   1.00 38.19  ? 410 MET B CG  1 
ATOM   5567 S SD  . MET B 1 417 ? -42.997 38.529  0.874   1.00 25.37  ? 410 MET B SD  1 
ATOM   5568 C CE  . MET B 1 417 ? -42.584 39.036  2.530   1.00 119.08 ? 410 MET B CE  1 
ATOM   5569 N N   . LYS B 1 418 ? -42.228 34.343  -2.792  1.00 14.02  ? 411 LYS B N   1 
ATOM   5570 C CA  . LYS B 1 418 ? -41.990 33.816  -4.126  1.00 14.50  ? 411 LYS B CA  1 
ATOM   5571 C C   . LYS B 1 418 ? -43.317 33.524  -4.803  1.00 33.51  ? 411 LYS B C   1 
ATOM   5572 O O   . LYS B 1 418 ? -43.481 33.778  -5.995  1.00 45.48  ? 411 LYS B O   1 
ATOM   5573 C CB  . LYS B 1 418 ? -41.177 32.525  -4.056  1.00 11.08  ? 411 LYS B CB  1 
ATOM   5574 C CG  . LYS B 1 418 ? -39.823 32.654  -3.394  1.00 9.62   ? 411 LYS B CG  1 
ATOM   5575 C CD  . LYS B 1 418 ? -39.124 31.307  -3.362  1.00 25.33  ? 411 LYS B CD  1 
ATOM   5576 C CE  . LYS B 1 418 ? -37.804 31.377  -2.620  1.00 28.74  ? 411 LYS B CE  1 
ATOM   5577 N NZ  . LYS B 1 418 ? -37.183 30.032  -2.484  1.00 29.03  ? 411 LYS B NZ  1 
ATOM   5578 N N   . ALA B 1 419 ? -44.264 32.989  -4.046  1.00 28.64  ? 412 ALA B N   1 
ATOM   5579 C CA  . ALA B 1 419 ? -45.572 32.672  -4.598  1.00 29.21  ? 412 ALA B CA  1 
ATOM   5580 C C   . ALA B 1 419 ? -46.311 33.913  -5.094  1.00 32.98  ? 412 ALA B C   1 
ATOM   5581 O O   . ALA B 1 419 ? -46.934 33.882  -6.153  1.00 32.61  ? 412 ALA B O   1 
ATOM   5582 C CB  . ALA B 1 419 ? -46.410 31.934  -3.569  1.00 29.62  ? 412 ALA B CB  1 
ATOM   5583 N N   . CYS B 1 420 ? -46.258 34.997  -4.326  1.00 23.37  ? 413 CYS B N   1 
ATOM   5584 C CA  . CYS B 1 420 ? -46.947 36.224  -4.718  1.00 21.58  ? 413 CYS B CA  1 
ATOM   5585 C C   . CYS B 1 420 ? -46.410 36.870  -5.993  1.00 30.10  ? 413 CYS B C   1 
ATOM   5586 O O   . CYS B 1 420 ? -47.178 37.286  -6.857  1.00 37.47  ? 413 CYS B O   1 
ATOM   5587 C CB  . CYS B 1 420 ? -46.888 37.250  -3.583  1.00 25.05  ? 413 CYS B CB  1 
ATOM   5588 S SG  . CYS B 1 420 ? -47.784 36.799  -2.089  1.00 32.46  ? 413 CYS B SG  1 
ATOM   5589 N N   . SER B 1 421 ? -45.089 36.964  -6.097  1.00 46.07  ? 414 SER B N   1 
ATOM   5590 C CA  . SER B 1 421 ? -44.452 37.594  -7.249  1.00 45.85  ? 414 SER B CA  1 
ATOM   5591 C C   . SER B 1 421 ? -43.246 36.833  -7.793  1.00 68.15  ? 414 SER B C   1 
ATOM   5592 O O   . SER B 1 421 ? -42.385 37.425  -8.439  1.00 88.26  ? 414 SER B O   1 
ATOM   5593 C CB  . SER B 1 421 ? -44.046 39.028  -6.902  1.00 60.20  ? 414 SER B CB  1 
ATOM   5594 O OG  . SER B 1 421 ? -43.385 39.649  -7.988  1.00 65.67  ? 414 SER B OG  1 
ATOM   5595 N N   . GLY B 1 422 ? -43.162 35.536  -7.525  1.00 55.44  ? 415 GLY B N   1 
ATOM   5596 C CA  . GLY B 1 422 ? -41.959 34.799  -7.866  1.00 63.37  ? 415 GLY B CA  1 
ATOM   5597 C C   . GLY B 1 422 ? -41.874 33.965  -9.131  1.00 63.55  ? 415 GLY B C   1 
ATOM   5598 O O   . GLY B 1 422 ? -42.709 33.101  -9.399  1.00 77.09  ? 415 GLY B O   1 
ATOM   5599 N N   . LYS B 1 423 ? -40.829 34.245  -9.903  1.00 40.86  ? 416 LYS B N   1 
ATOM   5600 C CA  . LYS B 1 423 ? -40.449 33.478  -11.079 1.00 38.29  ? 416 LYS B CA  1 
ATOM   5601 C C   . LYS B 1 423 ? -39.312 32.593  -10.591 1.00 40.40  ? 416 LYS B C   1 
ATOM   5602 O O   . LYS B 1 423 ? -38.635 31.916  -11.361 1.00 53.02  ? 416 LYS B O   1 
ATOM   5603 C CB  . LYS B 1 423 ? -39.932 34.415  -12.165 1.00 41.73  ? 416 LYS B CB  1 
ATOM   5604 C CG  . LYS B 1 423 ? -40.066 33.892  -13.581 1.00 33.83  ? 416 LYS B CG  1 
ATOM   5605 C CD  . LYS B 1 423 ? -41.308 34.456  -14.243 1.00 41.42  ? 416 LYS B CD  1 
ATOM   5606 C CE  . LYS B 1 423 ? -41.173 34.453  -15.754 1.00 47.16  ? 416 LYS B CE  1 
ATOM   5607 N NZ  . LYS B 1 423 ? -42.164 35.358  -16.395 1.00 38.54  ? 416 LYS B NZ  1 
ATOM   5608 N N   . PHE B 1 424 ? -39.115 32.646  -9.280  1.00 38.18  ? 417 PHE B N   1 
ATOM   5609 C CA  . PHE B 1 424 ? -37.992 32.027  -8.562  1.00 47.48  ? 417 PHE B CA  1 
ATOM   5610 C C   . PHE B 1 424 ? -38.304 30.652  -7.972  1.00 40.54  ? 417 PHE B C   1 
ATOM   5611 O O   . PHE B 1 424 ? -39.465 30.294  -7.792  1.00 50.66  ? 417 PHE B O   1 
ATOM   5612 C CB  . PHE B 1 424 ? -37.424 32.995  -7.517  1.00 54.55  ? 417 PHE B CB  1 
ATOM   5613 C CG  . PHE B 1 424 ? -37.146 34.362  -8.080  1.00 69.00  ? 417 PHE B CG  1 
ATOM   5614 C CD1 . PHE B 1 424 ? -36.264 34.521  -9.138  1.00 68.61  ? 417 PHE B CD1 1 
ATOM   5615 C CD2 . PHE B 1 424 ? -37.783 35.482  -7.586  1.00 73.19  ? 417 PHE B CD2 1 
ATOM   5616 C CE1 . PHE B 1 424 ? -36.023 35.773  -9.677  1.00 62.60  ? 417 PHE B CE1 1 
ATOM   5617 C CE2 . PHE B 1 424 ? -37.530 36.738  -8.119  1.00 70.83  ? 417 PHE B CE2 1 
ATOM   5618 C CZ  . PHE B 1 424 ? -36.650 36.879  -9.162  1.00 65.61  ? 417 PHE B CZ  1 
ATOM   5619 N N   . MET B 1 425 ? -37.264 29.879  -7.692  1.00 28.08  ? 418 MET B N   1 
ATOM   5620 C CA  . MET B 1 425 ? -37.467 28.487  -7.328  1.00 36.45  ? 418 MET B CA  1 
ATOM   5621 C C   . MET B 1 425 ? -37.970 28.385  -5.910  1.00 38.30  ? 418 MET B C   1 
ATOM   5622 O O   . MET B 1 425 ? -37.254 28.726  -4.970  1.00 48.07  ? 418 MET B O   1 
ATOM   5623 C CB  . MET B 1 425 ? -36.183 27.658  -7.476  1.00 37.37  ? 418 MET B CB  1 
ATOM   5624 C CG  . MET B 1 425 ? -36.227 26.595  -8.579  1.00 48.12  ? 418 MET B CG  1 
ATOM   5625 S SD  . MET B 1 425 ? -37.291 25.154  -8.286  1.00 56.26  ? 418 MET B SD  1 
ATOM   5626 C CE  . MET B 1 425 ? -36.456 24.388  -6.894  1.00 124.51 ? 418 MET B CE  1 
ATOM   5627 N N   . PRO B 1 426 ? -39.204 27.900  -5.747  1.00 28.72  ? 419 PRO B N   1 
ATOM   5628 C CA  . PRO B 1 426 ? -39.698 27.614  -4.410  1.00 21.81  ? 419 PRO B CA  1 
ATOM   5629 C C   . PRO B 1 426 ? -39.129 26.295  -3.960  1.00 20.49  ? 419 PRO B C   1 
ATOM   5630 O O   . PRO B 1 426 ? -38.388 25.641  -4.688  1.00 29.11  ? 419 PRO B O   1 
ATOM   5631 C CB  . PRO B 1 426 ? -41.203 27.464  -4.616  1.00 29.15  ? 419 PRO B CB  1 
ATOM   5632 C CG  . PRO B 1 426 ? -41.409 27.289  -6.087  1.00 30.81  ? 419 PRO B CG  1 
ATOM   5633 C CD  . PRO B 1 426 ? -40.094 27.358  -6.781  1.00 30.29  ? 419 PRO B CD  1 
ATOM   5634 N N   . ILE B 1 427 ? -39.448 25.931  -2.733  1.00 25.87  ? 420 ILE B N   1 
ATOM   5635 C CA  . ILE B 1 427 ? -39.103 24.632  -2.201  1.00 29.54  ? 420 ILE B CA  1 
ATOM   5636 C C   . ILE B 1 427 ? -39.726 23.601  -3.117  1.00 23.31  ? 420 ILE B C   1 
ATOM   5637 O O   . ILE B 1 427 ? -40.938 23.601  -3.301  1.00 21.64  ? 420 ILE B O   1 
ATOM   5638 C CB  . ILE B 1 427 ? -39.619 24.542  -0.760  1.00 26.66  ? 420 ILE B CB  1 
ATOM   5639 C CG1 . ILE B 1 427 ? -38.692 25.392  0.114   1.00 21.74  ? 420 ILE B CG1 1 
ATOM   5640 C CG2 . ILE B 1 427 ? -39.741 23.093  -0.278  1.00 19.02  ? 420 ILE B CG2 1 
ATOM   5641 C CD1 . ILE B 1 427 ? -38.995 25.357  1.589   1.00 35.90  ? 420 ILE B CD1 1 
ATOM   5642 N N   . MET B 1 428 ? -38.935 22.703  -3.685  1.00 35.15  ? 421 MET B N   1 
ATOM   5643 C CA  . MET B 1 428 ? -39.555 21.713  -4.540  1.00 29.60  ? 421 MET B CA  1 
ATOM   5644 C C   . MET B 1 428 ? -40.068 20.659  -3.588  1.00 42.13  ? 421 MET B C   1 
ATOM   5645 O O   . MET B 1 428 ? -39.299 19.901  -3.001  1.00 33.54  ? 421 MET B O   1 
ATOM   5646 C CB  . MET B 1 428 ? -38.553 21.114  -5.520  1.00 49.34  ? 421 MET B CB  1 
ATOM   5647 C CG  . MET B 1 428 ? -39.157 20.071  -6.444  1.00 66.86  ? 421 MET B CG  1 
ATOM   5648 S SD  . MET B 1 428 ? -40.628 20.665  -7.303  1.00 107.74 ? 421 MET B SD  1 
ATOM   5649 C CE  . MET B 1 428 ? -41.139 19.182  -8.164  1.00 38.54  ? 421 MET B CE  1 
ATOM   5650 N N   . GLN B 1 429 ? -41.386 20.615  -3.449  1.00 47.30  ? 422 GLN B N   1 
ATOM   5651 C CA  . GLN B 1 429 ? -42.019 19.730  -2.490  1.00 35.03  ? 422 GLN B CA  1 
ATOM   5652 C C   . GLN B 1 429 ? -41.611 20.031  -1.042  1.00 28.46  ? 422 GLN B C   1 
ATOM   5653 O O   . GLN B 1 429 ? -41.799 21.148  -0.568  1.00 38.33  ? 422 GLN B O   1 
ATOM   5654 C CB  . GLN B 1 429 ? -41.808 18.268  -2.875  1.00 41.49  ? 422 GLN B CB  1 
ATOM   5655 C CG  . GLN B 1 429 ? -42.338 17.950  -4.270  1.00 39.31  ? 422 GLN B CG  1 
ATOM   5656 C CD  . GLN B 1 429 ? -43.537 18.812  -4.657  1.00 40.91  ? 422 GLN B CD  1 
ATOM   5657 O OE1 . GLN B 1 429 ? -44.098 18.664  -5.743  1.00 41.73  ? 422 GLN B OE1 1 
ATOM   5658 N NE2 . GLN B 1 429 ? -43.929 19.716  -3.770  1.00 40.37  ? 422 GLN B NE2 1 
ATOM   5659 N N   . TRP B 1 430 ? -41.087 19.036  -0.336  1.00 23.72  ? 423 TRP B N   1 
ATOM   5660 C CA  . TRP B 1 430 ? -40.827 19.162  1.098   1.00 23.62  ? 423 TRP B CA  1 
ATOM   5661 C C   . TRP B 1 430 ? -39.392 19.438  1.558   1.00 23.62  ? 423 TRP B C   1 
ATOM   5662 O O   . TRP B 1 430 ? -38.445 18.806  1.099   1.00 23.65  ? 423 TRP B O   1 
ATOM   5663 C CB  . TRP B 1 430 ? -41.318 17.897  1.804   1.00 17.10  ? 423 TRP B CB  1 
ATOM   5664 C CG  . TRP B 1 430 ? -42.611 17.379  1.271   1.00 25.29  ? 423 TRP B CG  1 
ATOM   5665 C CD1 . TRP B 1 430 ? -42.846 16.900  0.018   1.00 29.64  ? 423 TRP B CD1 1 
ATOM   5666 C CD2 . TRP B 1 430 ? -43.849 17.276  1.979   1.00 34.83  ? 423 TRP B CD2 1 
ATOM   5667 N NE1 . TRP B 1 430 ? -44.156 16.510  -0.102  1.00 33.31  ? 423 TRP B NE1 1 
ATOM   5668 C CE2 . TRP B 1 430 ? -44.794 16.730  1.091   1.00 36.93  ? 423 TRP B CE2 1 
ATOM   5669 C CE3 . TRP B 1 430 ? -44.251 17.595  3.279   1.00 37.77  ? 423 TRP B CE3 1 
ATOM   5670 C CZ2 . TRP B 1 430 ? -46.114 16.495  1.459   1.00 43.59  ? 423 TRP B CZ2 1 
ATOM   5671 C CZ3 . TRP B 1 430 ? -45.561 17.361  3.642   1.00 29.95  ? 423 TRP B CZ3 1 
ATOM   5672 C CH2 . TRP B 1 430 ? -46.478 16.817  2.736   1.00 35.64  ? 423 TRP B CH2 1 
ATOM   5673 N N   . LEU B 1 431 ? -39.255 20.389  2.481   1.00 29.17  ? 424 LEU B N   1 
ATOM   5674 C CA  . LEU B 1 431 ? -37.992 20.644  3.172   1.00 32.82  ? 424 LEU B CA  1 
ATOM   5675 C C   . LEU B 1 431 ? -38.141 20.232  4.624   1.00 29.50  ? 424 LEU B C   1 
ATOM   5676 O O   . LEU B 1 431 ? -38.973 20.790  5.336   1.00 35.54  ? 424 LEU B O   1 
ATOM   5677 C CB  . LEU B 1 431 ? -37.642 22.131  3.101   1.00 36.89  ? 424 LEU B CB  1 
ATOM   5678 C CG  . LEU B 1 431 ? -36.176 22.592  3.132   1.00 33.66  ? 424 LEU B CG  1 
ATOM   5679 C CD1 . LEU B 1 431 ? -36.062 23.929  3.831   1.00 18.31  ? 424 LEU B CD1 1 
ATOM   5680 C CD2 . LEU B 1 431 ? -35.248 21.574  3.767   1.00 31.46  ? 424 LEU B CD2 1 
ATOM   5681 N N   . TYR B 1 432 ? -37.340 19.267  5.061   1.00 33.10  ? 425 TYR B N   1 
ATOM   5682 C CA  . TYR B 1 432 ? -37.388 18.790  6.440   1.00 37.69  ? 425 TYR B CA  1 
ATOM   5683 C C   . TYR B 1 432 ? -36.127 19.202  7.183   1.00 40.70  ? 425 TYR B C   1 
ATOM   5684 O O   . TYR B 1 432 ? -35.017 19.028  6.684   1.00 52.33  ? 425 TYR B O   1 
ATOM   5685 C CB  . TYR B 1 432 ? -37.570 17.272  6.491   1.00 40.16  ? 425 TYR B CB  1 
ATOM   5686 C CG  . TYR B 1 432 ? -39.009 16.827  6.358   1.00 35.15  ? 425 TYR B CG  1 
ATOM   5687 C CD1 . TYR B 1 432 ? -39.532 16.461  5.127   1.00 30.49  ? 425 TYR B CD1 1 
ATOM   5688 C CD2 . TYR B 1 432 ? -39.844 16.777  7.464   1.00 24.41  ? 425 TYR B CD2 1 
ATOM   5689 C CE1 . TYR B 1 432 ? -40.844 16.056  5.003   1.00 35.46  ? 425 TYR B CE1 1 
ATOM   5690 C CE2 . TYR B 1 432 ? -41.157 16.374  7.349   1.00 25.38  ? 425 TYR B CE2 1 
ATOM   5691 C CZ  . TYR B 1 432 ? -41.652 16.013  6.117   1.00 34.31  ? 425 TYR B CZ  1 
ATOM   5692 O OH  . TYR B 1 432 ? -42.960 15.610  5.997   1.00 39.14  ? 425 TYR B OH  1 
ATOM   5693 N N   . PHE B 1 433 ? -36.303 19.762  8.373   1.00 35.92  ? 426 PHE B N   1 
ATOM   5694 C CA  . PHE B 1 433 ? -35.180 20.282  9.137   1.00 35.84  ? 426 PHE B CA  1 
ATOM   5695 C C   . PHE B 1 433 ? -35.091 19.772  10.573  1.00 46.88  ? 426 PHE B C   1 
ATOM   5696 O O   . PHE B 1 433 ? -36.100 19.506  11.221  1.00 55.15  ? 426 PHE B O   1 
ATOM   5697 C CB  . PHE B 1 433 ? -35.220 21.812  9.138   1.00 48.98  ? 426 PHE B CB  1 
ATOM   5698 C CG  . PHE B 1 433 ? -34.374 22.440  10.206  1.00 78.46  ? 426 PHE B CG  1 
ATOM   5699 C CD1 . PHE B 1 433 ? -33.025 22.666  9.996   1.00 91.60  ? 426 PHE B CD1 1 
ATOM   5700 C CD2 . PHE B 1 433 ? -34.930 22.807  11.419  1.00 85.92  ? 426 PHE B CD2 1 
ATOM   5701 C CE1 . PHE B 1 433 ? -32.246 23.245  10.977  1.00 94.31  ? 426 PHE B CE1 1 
ATOM   5702 C CE2 . PHE B 1 433 ? -34.156 23.385  12.404  1.00 85.65  ? 426 PHE B CE2 1 
ATOM   5703 C CZ  . PHE B 1 433 ? -32.813 23.605  12.183  1.00 89.48  ? 426 PHE B CZ  1 
ATOM   5704 N N   . ASP B 1 434 ? -33.859 19.647  11.051  1.00 55.97  ? 427 ASP B N   1 
ATOM   5705 C CA  . ASP B 1 434 ? -33.568 19.260  12.422  1.00 51.11  ? 427 ASP B CA  1 
ATOM   5706 C C   . ASP B 1 434 ? -32.646 20.332  12.976  1.00 51.78  ? 427 ASP B C   1 
ATOM   5707 O O   . ASP B 1 434 ? -31.815 20.865  12.246  1.00 68.13  ? 427 ASP B O   1 
ATOM   5708 C CB  . ASP B 1 434 ? -32.881 17.898  12.466  1.00 61.92  ? 427 ASP B CB  1 
ATOM   5709 C CG  . ASP B 1 434 ? -32.346 17.559  13.843  1.00 73.51  ? 427 ASP B CG  1 
ATOM   5710 O OD1 . ASP B 1 434 ? -31.946 16.396  14.057  1.00 72.01  ? 427 ASP B OD1 1 
ATOM   5711 O OD2 . ASP B 1 434 ? -32.323 18.456  14.710  1.00 83.25  ? 427 ASP B OD2 1 
ATOM   5712 N N   . ALA B 1 435 ? -32.783 20.663  14.255  1.00 53.57  ? 428 ALA B N   1 
ATOM   5713 C CA  . ALA B 1 435 ? -31.971 21.734  14.814  1.00 59.08  ? 428 ALA B CA  1 
ATOM   5714 C C   . ALA B 1 435 ? -30.591 21.228  15.205  1.00 72.55  ? 428 ALA B C   1 
ATOM   5715 O O   . ALA B 1 435 ? -30.211 21.242  16.374  1.00 57.13  ? 428 ALA B O   1 
ATOM   5716 C CB  . ALA B 1 435 ? -32.665 22.361  16.009  1.00 61.05  ? 428 ALA B CB  1 
ATOM   5717 N N   . LEU B 1 436 ? -29.848 20.793  14.193  1.00 97.53  ? 429 LEU B N   1 
ATOM   5718 C CA  . LEU B 1 436 ? -28.468 20.354  14.343  1.00 98.64  ? 429 LEU B CA  1 
ATOM   5719 C C   . LEU B 1 436 ? -27.716 20.776  13.089  1.00 95.40  ? 429 LEU B C   1 
ATOM   5720 O O   . LEU B 1 436 ? -28.308 20.867  12.014  1.00 85.64  ? 429 LEU B O   1 
ATOM   5721 C CB  . LEU B 1 436 ? -28.394 18.841  14.540  1.00 92.84  ? 429 LEU B CB  1 
ATOM   5722 C CG  . LEU B 1 436 ? -28.798 18.333  15.927  1.00 77.27  ? 429 LEU B CG  1 
ATOM   5723 C CD1 . LEU B 1 436 ? -30.238 18.704  16.245  1.00 56.80  ? 429 LEU B CD1 1 
ATOM   5724 C CD2 . LEU B 1 436 ? -28.591 16.831  16.029  1.00 78.22  ? 429 LEU B CD2 1 
ATOM   5725 N N   . GLU B 1 437 ? -26.420 21.035  13.217  1.00 106.70 ? 430 GLU B N   1 
ATOM   5726 C CA  . GLU B 1 437 ? -25.637 21.484  12.070  1.00 112.62 ? 430 GLU B CA  1 
ATOM   5727 C C   . GLU B 1 437 ? -24.290 20.782  11.918  1.00 111.49 ? 430 GLU B C   1 
ATOM   5728 O O   . GLU B 1 437 ? -23.680 20.356  12.899  1.00 110.50 ? 430 GLU B O   1 
ATOM   5729 C CB  . GLU B 1 437 ? -25.444 23.004  12.117  1.00 112.87 ? 430 GLU B CB  1 
ATOM   5730 C CG  . GLU B 1 437 ? -24.817 23.519  13.401  1.00 111.27 ? 430 GLU B CG  1 
ATOM   5731 C CD  . GLU B 1 437 ? -23.355 23.150  13.520  1.00 116.85 ? 430 GLU B CD  1 
ATOM   5732 O OE1 . GLU B 1 437 ? -22.832 22.492  12.597  1.00 121.30 ? 430 GLU B OE1 1 
ATOM   5733 O OE2 . GLU B 1 437 ? -22.726 23.520  14.534  1.00 120.27 ? 430 GLU B OE2 1 
ATOM   5734 N N   . CYS B 1 438 ? -23.840 20.671  10.673  1.00 106.68 ? 431 CYS B N   1 
ATOM   5735 C CA  . CYS B 1 438 ? -22.541 20.065  10.348  1.00 98.56  ? 431 CYS B CA  1 
ATOM   5736 C C   . CYS B 1 438 ? -21.387 21.065  10.373  1.00 87.52  ? 431 CYS B C   1 
ATOM   5737 O O   . CYS B 1 438 ? -20.496 21.016  9.519   1.00 77.54  ? 431 CYS B O   1 
ATOM   5738 C CB  . CYS B 1 438 ? -22.588 19.393  8.969   1.00 96.37  ? 431 CYS B CB  1 
ATOM   5739 S SG  . CYS B 1 438 ? -22.795 17.587  8.981   1.00 95.97  ? 431 CYS B SG  1 
HETATM 5740 O O   . HOH C 2 .   ? -30.860 43.150  31.574  1.00 37.71  ? 501 HOH A O   1 
HETATM 5741 O O   . HOH C 2 .   ? -11.538 52.246  -1.285  1.00 35.42  ? 502 HOH A O   1 
HETATM 5742 O O   . HOH C 2 .   ? -8.118  44.289  -7.332  1.00 18.85  ? 503 HOH A O   1 
HETATM 5743 O O   . HOH C 2 .   ? -19.391 58.090  -1.852  1.00 51.56  ? 504 HOH A O   1 
HETATM 5744 O O   . HOH C 2 .   ? -27.493 53.905  28.441  1.00 59.52  ? 505 HOH A O   1 
HETATM 5745 O O   . HOH C 2 .   ? -9.286  49.155  31.643  1.00 35.87  ? 506 HOH A O   1 
HETATM 5746 O O   . HOH C 2 .   ? -13.722 36.388  18.971  1.00 23.32  ? 507 HOH A O   1 
HETATM 5747 O O   . HOH C 2 .   ? -22.249 43.147  11.946  1.00 27.39  ? 508 HOH A O   1 
HETATM 5748 O O   . HOH C 2 .   ? -35.986 36.141  13.892  1.00 27.90  ? 509 HOH A O   1 
HETATM 5749 O O   . HOH C 2 .   ? -8.213  41.493  3.925   1.00 13.44  ? 510 HOH A O   1 
HETATM 5750 O O   . HOH C 2 .   ? -44.840 44.992  17.042  1.00 31.13  ? 511 HOH A O   1 
HETATM 5751 O O   . HOH C 2 .   ? -23.944 47.991  -7.447  1.00 41.40  ? 512 HOH A O   1 
HETATM 5752 O O   . HOH C 2 .   ? -28.077 44.925  10.826  1.00 24.60  ? 513 HOH A O   1 
HETATM 5753 O O   . HOH C 2 .   ? -14.570 48.526  10.117  1.00 33.06  ? 514 HOH A O   1 
HETATM 5754 O O   . HOH C 2 .   ? -17.490 39.532  10.189  1.00 28.72  ? 515 HOH A O   1 
HETATM 5755 O O   . HOH C 2 .   ? -22.228 19.065  26.472  1.00 27.92  ? 516 HOH A O   1 
HETATM 5756 O O   . HOH C 2 .   ? -29.083 32.200  30.260  1.00 39.99  ? 517 HOH A O   1 
HETATM 5757 O O   . HOH C 2 .   ? -33.921 47.576  10.112  1.00 30.74  ? 518 HOH A O   1 
HETATM 5758 O O   . HOH C 2 .   ? -8.009  37.442  -6.971  1.00 24.48  ? 519 HOH A O   1 
HETATM 5759 O O   . HOH C 2 .   ? -6.905  34.292  4.815   1.00 32.34  ? 520 HOH A O   1 
HETATM 5760 O O   . HOH C 2 .   ? -17.872 51.095  21.055  1.00 29.96  ? 521 HOH A O   1 
HETATM 5761 O O   . HOH C 2 .   ? -35.419 26.554  29.572  1.00 21.94  ? 522 HOH A O   1 
HETATM 5762 O O   . HOH C 2 .   ? -33.099 24.059  36.739  1.00 30.71  ? 523 HOH A O   1 
HETATM 5763 O O   . HOH C 2 .   ? -42.325 47.592  6.039   1.00 38.08  ? 524 HOH A O   1 
HETATM 5764 O O   . HOH C 2 .   ? -11.933 32.234  24.786  1.00 37.06  ? 525 HOH A O   1 
HETATM 5765 O O   . HOH C 2 .   ? -44.243 50.394  24.504  1.00 47.42  ? 526 HOH A O   1 
HETATM 5766 O O   . HOH C 2 .   ? -29.649 52.111  -6.568  1.00 41.62  ? 527 HOH A O   1 
HETATM 5767 O O   . HOH C 2 .   ? -29.162 60.291  8.133   1.00 34.29  ? 528 HOH A O   1 
HETATM 5768 O O   . HOH C 2 .   ? -30.730 44.853  10.059  1.00 37.87  ? 529 HOH A O   1 
HETATM 5769 O O   . HOH C 2 .   ? -34.529 34.973  33.136  1.00 47.34  ? 530 HOH A O   1 
HETATM 5770 O O   . HOH C 2 .   ? -15.099 24.779  1.416   1.00 38.29  ? 531 HOH A O   1 
HETATM 5771 O O   . HOH C 2 .   ? -17.464 34.696  -12.670 1.00 36.27  ? 532 HOH A O   1 
HETATM 5772 O O   . HOH C 2 .   ? -33.608 54.307  28.758  1.00 33.40  ? 533 HOH A O   1 
HETATM 5773 O O   . HOH C 2 .   ? -19.532 45.850  -13.013 1.00 40.42  ? 534 HOH A O   1 
HETATM 5774 O O   . HOH C 2 .   ? -37.788 40.819  9.956   1.00 20.51  ? 535 HOH A O   1 
HETATM 5775 O O   . HOH C 2 .   ? -7.291  32.445  18.294  1.00 24.27  ? 536 HOH A O   1 
HETATM 5776 O O   . HOH C 2 .   ? -25.999 43.009  10.347  1.00 55.22  ? 537 HOH A O   1 
HETATM 5777 O O   . HOH C 2 .   ? -29.013 29.205  30.901  1.00 46.04  ? 538 HOH A O   1 
HETATM 5778 O O   . HOH C 2 .   ? -9.302  35.797  -9.653  1.00 49.63  ? 539 HOH A O   1 
HETATM 5779 O O   . HOH C 2 .   ? -17.502 37.208  31.590  1.00 28.02  ? 540 HOH A O   1 
HETATM 5780 O O   . HOH C 2 .   ? -14.609 35.242  -12.508 1.00 38.46  ? 541 HOH A O   1 
HETATM 5781 O O   . HOH C 2 .   ? -15.087 51.979  22.243  1.00 34.14  ? 542 HOH A O   1 
HETATM 5782 O O   . HOH C 2 .   ? -39.677 57.085  23.121  1.00 44.74  ? 543 HOH A O   1 
HETATM 5783 O O   . HOH C 2 .   ? -11.106 23.617  15.837  1.00 56.06  ? 544 HOH A O   1 
HETATM 5784 O O   . HOH D 2 .   ? -56.058 39.766  -4.221  1.00 34.58  ? 501 HOH B O   1 
HETATM 5785 O O   . HOH D 2 .   ? -53.696 46.398  -0.269  1.00 35.39  ? 502 HOH B O   1 
HETATM 5786 O O   . HOH D 2 .   ? -28.568 45.797  -33.536 1.00 27.80  ? 503 HOH B O   1 
HETATM 5787 O O   . HOH D 2 .   ? -46.541 36.388  28.638  1.00 44.54  ? 504 HOH B O   1 
HETATM 5788 O O   . HOH D 2 .   ? -35.185 43.326  -35.051 1.00 30.16  ? 505 HOH B O   1 
HETATM 5789 O O   . HOH D 2 .   ? -22.355 55.724  -33.043 1.00 33.48  ? 506 HOH B O   1 
HETATM 5790 O O   . HOH D 2 .   ? -53.096 50.425  7.618   1.00 25.58  ? 507 HOH B O   1 
HETATM 5791 O O   . HOH D 2 .   ? -46.090 0.000   0.000   0.50 43.32  ? 508 HOH B O   1 
HETATM 5792 O O   . HOH D 2 .   ? -55.101 46.590  8.828   1.00 17.80  ? 509 HOH B O   1 
HETATM 5793 O O   . HOH D 2 .   ? -52.547 48.027  8.346   1.00 20.10  ? 510 HOH B O   1 
HETATM 5794 O O   . HOH D 2 .   ? -9.713  49.040  -35.715 1.00 27.88  ? 511 HOH B O   1 
HETATM 5795 O O   . HOH D 2 .   ? -63.040 39.068  12.799  1.00 41.41  ? 512 HOH B O   1 
HETATM 5796 O O   . HOH D 2 .   ? -35.762 6.784   0.678   1.00 35.13  ? 513 HOH B O   1 
HETATM 5797 O O   . HOH D 2 .   ? -24.868 52.219  -30.211 1.00 43.40  ? 514 HOH B O   1 
HETATM 5798 O O   . HOH D 2 .   ? -64.658 36.061  11.891  1.00 18.50  ? 515 HOH B O   1 
HETATM 5799 O O   . HOH D 2 .   ? -36.481 49.595  -30.013 1.00 51.49  ? 516 HOH B O   1 
HETATM 5800 O O   . HOH D 2 .   ? -58.257 38.599  -4.835  1.00 33.53  ? 517 HOH B O   1 
HETATM 5801 O O   . HOH D 2 .   ? -57.777 42.101  4.322   1.00 15.34  ? 518 HOH B O   1 
HETATM 5802 O O   . HOH D 2 .   ? -49.782 46.946  -0.205  1.00 41.60  ? 519 HOH B O   1 
HETATM 5803 O O   . HOH D 2 .   ? -26.935 38.210  -10.529 1.00 13.24  ? 520 HOH B O   1 
HETATM 5804 O O   . HOH D 2 .   ? -45.592 36.540  24.542  1.00 16.75  ? 521 HOH B O   1 
HETATM 5805 O O   . HOH D 2 .   ? -39.721 34.306  11.463  1.00 20.72  ? 522 HOH B O   1 
HETATM 5806 O O   . HOH D 2 .   ? -52.032 21.070  -2.807  1.00 12.28  ? 523 HOH B O   1 
HETATM 5807 O O   . HOH D 2 .   ? -43.618 15.824  -4.369  1.00 29.21  ? 524 HOH B O   1 
HETATM 5808 O O   . HOH D 2 .   ? -24.107 42.272  -18.341 1.00 21.39  ? 525 HOH B O   1 
HETATM 5809 O O   . HOH D 2 .   ? -49.096 29.170  14.190  1.00 23.89  ? 526 HOH B O   1 
HETATM 5810 O O   . HOH D 2 .   ? -43.711 38.860  -3.630  1.00 27.38  ? 527 HOH B O   1 
HETATM 5811 O O   . HOH D 2 .   ? -49.806 4.310   11.138  1.00 32.63  ? 528 HOH B O   1 
HETATM 5812 O O   . HOH D 2 .   ? -46.765 29.225  20.080  1.00 18.33  ? 529 HOH B O   1 
HETATM 5813 O O   . HOH D 2 .   ? -26.914 40.599  -9.998  1.00 31.00  ? 530 HOH B O   1 
HETATM 5814 O O   . HOH D 2 .   ? -46.247 27.169  16.353  1.00 34.96  ? 531 HOH B O   1 
HETATM 5815 O O   . HOH D 2 .   ? -55.217 24.769  18.456  1.00 24.11  ? 532 HOH B O   1 
HETATM 5816 O O   . HOH D 2 .   ? -20.919 37.036  -21.288 1.00 35.35  ? 533 HOH B O   1 
HETATM 5817 O O   . HOH D 2 .   ? -51.807 24.877  -6.157  1.00 19.68  ? 534 HOH B O   1 
HETATM 5818 O O   . HOH D 2 .   ? -23.024 37.973  -34.335 1.00 38.34  ? 535 HOH B O   1 
HETATM 5819 O O   . HOH D 2 .   ? -21.022 40.268  -17.304 1.00 27.75  ? 536 HOH B O   1 
HETATM 5820 O O   . HOH D 2 .   ? -46.898 46.642  0.135   1.00 31.01  ? 537 HOH B O   1 
HETATM 5821 O O   . HOH D 2 .   ? -37.160 31.760  -22.915 1.00 40.90  ? 538 HOH B O   1 
HETATM 5822 O O   . HOH D 2 .   ? -14.037 43.501  -27.345 1.00 39.53  ? 539 HOH B O   1 
HETATM 5823 O O   . HOH D 2 .   ? -34.269 42.467  -16.606 1.00 30.45  ? 540 HOH B O   1 
HETATM 5824 O O   . HOH D 2 .   ? -20.600 35.813  -34.777 1.00 34.34  ? 541 HOH B O   1 
HETATM 5825 O O   . HOH D 2 .   ? -27.189 50.609  -15.775 1.00 49.37  ? 542 HOH B O   1 
HETATM 5826 O O   . HOH D 2 .   ? -44.684 48.019  -9.568  1.00 50.46  ? 543 HOH B O   1 
HETATM 5827 O O   . HOH D 2 .   ? -15.280 40.167  -28.077 1.00 28.16  ? 544 HOH B O   1 
HETATM 5828 O O   . HOH D 2 .   ? -34.948 29.925  -1.871  1.00 50.42  ? 545 HOH B O   1 
HETATM 5829 O O   . HOH D 2 .   ? -59.594 26.200  21.339  1.00 30.25  ? 546 HOH B O   1 
HETATM 5830 O O   . HOH D 2 .   ? -29.838 18.781  6.387   1.00 38.22  ? 547 HOH B O   1 
HETATM 5831 O O   . HOH D 2 .   ? -61.540 24.803  8.903   1.00 39.84  ? 548 HOH B O   1 
HETATM 5832 O O   . HOH D 2 .   ? -61.718 19.890  -1.168  1.00 28.42  ? 549 HOH B O   1 
HETATM 5833 O O   . HOH D 2 .   ? -57.990 46.400  14.876  1.00 38.46  ? 550 HOH B O   1 
HETATM 5834 O O   . HOH D 2 .   ? -48.098 17.882  6.137   1.00 44.31  ? 551 HOH B O   1 
HETATM 5835 O O   . HOH D 2 .   ? -47.805 19.230  9.630   1.00 27.20  ? 552 HOH B O   1 
HETATM 5836 O O   . HOH D 2 .   ? -47.575 15.781  7.432   1.00 33.74  ? 553 HOH B O   1 
HETATM 5837 O O   . HOH D 2 .   ? -34.497 46.923  1.989   1.00 26.41  ? 554 HOH B O   1 
HETATM 5838 O O   . HOH D 2 .   ? -27.200 28.423  -18.069 1.00 34.47  ? 555 HOH B O   1 
HETATM 5839 O O   . HOH D 2 .   ? -46.302 41.044  -3.344  1.00 21.43  ? 556 HOH B O   1 
HETATM 5840 O O   . HOH D 2 .   ? -28.621 16.422  10.641  1.00 36.17  ? 557 HOH B O   1 
HETATM 5841 O O   . HOH D 2 .   ? -50.625 2.403   7.926   1.00 41.05  ? 558 HOH B O   1 
HETATM 5842 O O   . HOH D 2 .   ? -52.916 24.858  -8.881  1.00 28.41  ? 559 HOH B O   1 
HETATM 5843 O O   . HOH D 2 .   ? -42.918 10.167  23.827  1.00 51.71  ? 560 HOH B O   1 
HETATM 5844 O O   . HOH D 2 .   ? -30.126 20.084  9.631   1.00 53.54  ? 561 HOH B O   1 
HETATM 5845 O O   . HOH D 2 .   ? -32.006 32.210  -39.771 1.00 48.15  ? 562 HOH B O   1 
HETATM 5846 O O   . HOH D 2 .   ? -34.742 30.015  -5.186  1.00 33.94  ? 563 HOH B O   1 
HETATM 5847 O O   . HOH D 2 .   ? -42.785 49.605  -10.408 1.00 41.33  ? 564 HOH B O   1 
HETATM 5848 O O   . HOH D 2 .   ? -43.143 48.664  7.961   1.00 23.74  ? 565 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 57  ? 1.2425 1.2376 1.1327 0.0094  -0.0407 0.1228  50  ILE A N   
2    C CA  . ILE A 57  ? 1.3563 1.3382 1.2367 0.0066  -0.0384 0.1267  50  ILE A CA  
3    C C   . ILE A 57  ? 1.4370 1.3981 1.3130 0.0127  -0.0380 0.1296  50  ILE A C   
4    O O   . ILE A 57  ? 1.4354 1.3921 1.3175 0.0158  -0.0365 0.1245  50  ILE A O   
5    C CB  . ILE A 57  ? 1.2099 1.1966 1.0925 -0.0010 -0.0333 0.1203  50  ILE A CB  
6    C CG1 . ILE A 57  ? 1.3206 1.3277 1.2083 -0.0072 -0.0338 0.1167  50  ILE A CG1 
7    C CG2 . ILE A 57  ? 0.8885 0.8631 0.7614 -0.0044 -0.0307 0.1245  50  ILE A CG2 
8    C CD1 . ILE A 57  ? 1.2990 1.3113 1.1883 -0.0151 -0.0299 0.1112  50  ILE A CD1 
9    N N   . ASP A 58  ? 1.4804 1.4287 1.3456 0.0142  -0.0391 0.1378  51  ASP A N   
10   C CA  . ASP A 58  ? 1.4286 1.3557 1.2884 0.0201  -0.0389 0.1417  51  ASP A CA  
11   C C   . ASP A 58  ? 1.2624 1.1777 1.1176 0.0163  -0.0325 0.1407  51  ASP A C   
12   O O   . ASP A 58  ? 1.1117 1.0096 0.9636 0.0203  -0.0307 0.1422  51  ASP A O   
13   C CB  . ASP A 58  ? 1.5290 1.4476 1.3798 0.0248  -0.0437 0.1519  51  ASP A CB  
14   C CG  . ASP A 58  ? 1.6246 1.5508 1.4810 0.0312  -0.0504 0.1532  51  ASP A CG  
15   O OD1 . ASP A 58  ? 1.5850 1.5142 1.4513 0.0345  -0.0509 0.1472  51  ASP A OD1 
16   O OD2 . ASP A 58  ? 1.6820 1.6120 1.5336 0.0326  -0.0550 0.1602  51  ASP A OD2 
17   N N   . GLU A 59  ? 1.3070 1.2324 1.1624 0.0083  -0.0292 0.1380  52  GLU A N   
18   C CA  . GLU A 59  ? 1.3546 1.2730 1.2083 0.0037  -0.0231 0.1359  52  GLU A CA  
19   C C   . GLU A 59  ? 1.2684 1.1869 1.1309 0.0046  -0.0198 0.1271  52  GLU A C   
20   O O   . GLU A 59  ? 1.2179 1.1243 1.0795 0.0053  -0.0153 0.1262  52  GLU A O   
21   C CB  . GLU A 59  ? 1.4829 1.4146 1.3360 -0.0055 -0.0218 0.1345  52  GLU A CB  
22   C CG  . GLU A 59  ? 1.6514 1.5890 1.4976 -0.0075 -0.0260 0.1417  52  GLU A CG  
23   C CD  . GLU A 59  ? 1.6667 1.6186 1.5129 -0.0174 -0.0250 0.1389  52  GLU A CD  
24   O OE1 . GLU A 59  ? 1.6968 1.6584 1.5510 -0.0215 -0.0226 0.1302  52  GLU A OE1 
25   O OE2 . GLU A 59  ? 1.6367 1.5901 1.4749 -0.0212 -0.0267 0.1454  52  GLU A OE2 
26   N N   . GLY A 60  ? 1.1464 1.0793 1.0177 0.0044  -0.0218 0.1208  53  GLY A N   
27   C CA  . GLY A 60  ? 0.9896 0.9245 0.8696 0.0049  -0.0193 0.1125  53  GLY A CA  
28   C C   . GLY A 60  ? 0.9785 0.8994 0.8584 0.0120  -0.0204 0.1131  53  GLY A C   
29   O O   . GLY A 60  ? 0.9295 0.8512 0.8110 0.0170  -0.0254 0.1155  53  GLY A O   
30   N N   . LEU A 61  ? 1.0701 0.9792 0.9489 0.0121  -0.0159 0.1109  54  LEU A N   
31   C CA  . LEU A 61  ? 1.2301 1.1255 1.1097 0.0172  -0.0169 0.1103  54  LEU A CA  
32   C C   . LEU A 61  ? 0.8611 0.7625 0.7508 0.0177  -0.0174 0.1021  54  LEU A C   
33   O O   . LEU A 61  ? 0.6588 0.5729 0.5536 0.0145  -0.0159 0.0972  54  LEU A O   
34   C CB  . LEU A 61  ? 1.6832 1.5641 1.5586 0.0165  -0.0115 0.1121  54  LEU A CB  
35   C CG  . LEU A 61  ? 2.0458 1.9227 1.9128 0.0146  -0.0095 0.1206  54  LEU A CG  
36   C CD1 . LEU A 61  ? 2.2877 2.1602 2.1564 0.0107  -0.0020 0.1210  54  LEU A CD1 
37   C CD2 . LEU A 61  ? 1.2847 1.1500 1.1441 0.0200  -0.0143 0.1290  54  LEU A CD2 
38   N N   . TYR A 62  ? 0.5908 0.4832 0.4838 0.0213  -0.0202 0.1012  55  TYR A N   
39   C CA  . TYR A 62  ? 0.4829 0.3826 0.3868 0.0224  -0.0220 0.0953  55  TYR A CA  
40   C C   . TYR A 62  ? 0.5627 0.4697 0.4713 0.0175  -0.0173 0.0877  55  TYR A C   
41   O O   . TYR A 62  ? 0.4534 0.3737 0.3687 0.0172  -0.0177 0.0842  55  TYR A O   
42   C CB  . TYR A 62  ? 0.6880 0.5774 0.5968 0.0261  -0.0254 0.0958  55  TYR A CB  
43   C CG  . TYR A 62  ? 0.9005 0.7986 0.8219 0.0270  -0.0256 0.0901  55  TYR A CG  
44   C CD1 . TYR A 62  ? 1.0314 0.9412 0.9603 0.0315  -0.0284 0.0897  55  TYR A CD1 
45   C CD2 . TYR A 62  ? 1.2510 1.1464 1.1768 0.0233  -0.0228 0.0853  55  TYR A CD2 
46   C CE1 . TYR A 62  ? 1.3846 1.3034 1.3251 0.0326  -0.0271 0.0842  55  TYR A CE1 
47   C CE2 . TYR A 62  ? 1.5444 1.4481 1.4812 0.0246  -0.0221 0.0805  55  TYR A CE2 
48   C CZ  . TYR A 62  ? 1.6179 1.5326 1.5614 0.0294  -0.0239 0.0799  55  TYR A CZ  
49   O OH  . TYR A 62  ? 1.7111 1.6345 1.6652 0.0307  -0.0219 0.0745  55  TYR A OH  
50   N N   . SER A 63  ? 0.7404 0.6389 0.6458 0.0140  -0.0129 0.0851  56  SER A N   
51   C CA  . SER A 63  ? 0.7091 0.6149 0.6192 0.0100  -0.0087 0.0779  56  SER A CA  
52   C C   . SER A 63  ? 0.7140 0.6314 0.6237 0.0073  -0.0049 0.0776  56  SER A C   
53   O O   . SER A 63  ? 0.7063 0.6339 0.6219 0.0051  -0.0034 0.0723  56  SER A O   
54   C CB  . SER A 63  ? 0.7085 0.6036 0.6174 0.0066  -0.0062 0.0744  56  SER A CB  
55   O OG  . SER A 63  ? 0.6495 0.5296 0.5497 0.0071  -0.0047 0.0788  56  SER A OG  
56   N N   . ARG A 64  ? 0.7378 0.6542 0.6412 0.0070  -0.0047 0.0838  57  ARG A N   
57   C CA  . ARG A 64  ? 0.5845 0.5131 0.4880 0.0028  -0.0039 0.0841  57  ARG A CA  
58   C C   . ARG A 64  ? 0.5969 0.5405 0.5072 0.0027  -0.0082 0.0813  57  ARG A C   
59   O O   . ARG A 64  ? 0.5022 0.4585 0.4188 -0.0011 -0.0075 0.0763  57  ARG A O   
60   C CB  . ARG A 64  ? 0.3721 0.2968 0.2678 0.0012  -0.0037 0.0915  57  ARG A CB  
61   C CG  . ARG A 64  ? 0.5700 0.5065 0.4669 -0.0057 -0.0030 0.0903  57  ARG A CG  
62   C CD  . ARG A 64  ? 0.7549 0.6905 0.6542 -0.0101 0.0017  0.0874  57  ARG A CD  
63   N NE  . ARG A 64  ? 0.7714 0.7185 0.6711 -0.0177 0.0008  0.0850  57  ARG A NE  
64   C CZ  . ARG A 64  ? 0.9047 0.8633 0.8111 -0.0213 0.0004  0.0776  57  ARG A CZ  
65   N NH1 . ARG A 64  ? 0.8763 0.8367 0.7898 -0.0181 0.0010  0.0723  57  ARG A NH1 
66   N NH2 . ARG A 64  ? 1.0686 1.0363 0.9744 -0.0283 -0.0006 0.0754  57  ARG A NH2 
67   N N   . GLN A 65  ? 0.5287 0.4714 0.4389 0.0071  -0.0126 0.0845  58  GLN A N   
68   C CA  . GLN A 65  ? 0.4378 0.3953 0.3564 0.0080  -0.0158 0.0823  58  GLN A CA  
69   C C   . GLN A 65  ? 0.4177 0.3810 0.3458 0.0081  -0.0145 0.0753  58  GLN A C   
70   O O   . GLN A 65  ? 0.4690 0.4462 0.4047 0.0069  -0.0150 0.0719  58  GLN A O   
71   C CB  . GLN A 65  ? 0.6860 0.6415 0.6038 0.0134  -0.0206 0.0876  58  GLN A CB  
72   C CG  . GLN A 65  ? 0.9636 0.9159 0.8726 0.0136  -0.0228 0.0951  58  GLN A CG  
73   C CD  . GLN A 65  ? 1.1967 1.1485 1.1058 0.0194  -0.0282 0.1002  58  GLN A CD  
74   O OE1 . GLN A 65  ? 1.3859 1.3408 1.3027 0.0234  -0.0302 0.0981  58  GLN A OE1 
75   N NE2 . GLN A 65  ? 1.2084 1.1572 1.1095 0.0200  -0.0306 0.1073  58  GLN A NE2 
76   N N   . LEU A 66  ? 0.5491 0.5017 0.4767 0.0094  -0.0128 0.0732  59  LEU A N   
77   C CA  . LEU A 66  ? 0.4348 0.3922 0.3708 0.0091  -0.0115 0.0670  59  LEU A CA  
78   C C   . LEU A 66  ? 0.4391 0.4057 0.3784 0.0045  -0.0084 0.0619  59  LEU A C   
79   O O   . LEU A 66  ? 0.3236 0.3006 0.2712 0.0040  -0.0082 0.0574  59  LEU A O   
80   C CB  . LEU A 66  ? 0.5047 0.4488 0.4386 0.0099  -0.0105 0.0661  59  LEU A CB  
81   C CG  . LEU A 66  ? 0.6034 0.5405 0.5393 0.0146  -0.0141 0.0695  59  LEU A CG  
82   C CD1 . LEU A 66  ? 0.3382 0.2641 0.2744 0.0134  -0.0133 0.0683  59  LEU A CD1 
83   C CD2 . LEU A 66  ? 0.7413 0.6910 0.6882 0.0176  -0.0152 0.0669  59  LEU A CD2 
84   N N   . TYR A 67  ? 0.4777 0.4409 0.4113 0.0014  -0.0061 0.0629  60  TYR A N   
85   C CA  . TYR A 67  ? 0.5395 0.5119 0.4769 -0.0033 -0.0041 0.0586  60  TYR A CA  
86   C C   . TYR A 67  ? 0.5209 0.5076 0.4628 -0.0059 -0.0064 0.0578  60  TYR A C   
87   O O   . TYR A 67  ? 0.4043 0.4007 0.3536 -0.0077 -0.0063 0.0527  60  TYR A O   
88   C CB  . TYR A 67  ? 0.7276 0.6941 0.6589 -0.0062 -0.0015 0.0608  60  TYR A CB  
89   C CG  . TYR A 67  ? 1.0236 0.9816 0.9550 -0.0050 0.0021  0.0587  60  TYR A CG  
90   C CD1 . TYR A 67  ? 1.3380 1.3016 1.2763 -0.0060 0.0031  0.0525  60  TYR A CD1 
91   C CD2 . TYR A 67  ? 1.2630 1.2079 1.1889 -0.0026 0.0043  0.0627  60  TYR A CD2 
92   C CE1 . TYR A 67  ? 1.6328 1.5907 1.5725 -0.0049 0.0064  0.0506  60  TYR A CE1 
93   C CE2 . TYR A 67  ? 1.5625 1.5035 1.4927 -0.0017 0.0076  0.0599  60  TYR A CE2 
94   C CZ  . TYR A 67  ? 1.7318 1.6801 1.6692 -0.0029 0.0086  0.0538  60  TYR A CZ  
95   O OH  . TYR A 67  ? 1.8086 1.7577 1.7536 -0.0021 0.0116  0.0519  60  TYR A OH  
96   N N   . VAL A 68  ? 0.5430 0.5304 0.4798 -0.0063 -0.0083 0.0629  61  VAL A N   
97   C CA  . VAL A 68  ? 0.6517 0.6523 0.5913 -0.0090 -0.0104 0.0630  61  VAL A CA  
98   C C   . VAL A 68  ? 0.4472 0.4574 0.3959 -0.0069 -0.0116 0.0597  61  VAL A C   
99   O O   . VAL A 68  ? 0.3658 0.3875 0.3207 -0.0100 -0.0115 0.0558  61  VAL A O   
100  C CB  . VAL A 68  ? 0.6750 0.6723 0.6065 -0.0084 -0.0125 0.0702  61  VAL A CB  
101  C CG1 . VAL A 68  ? 0.7625 0.7701 0.6971 -0.0072 -0.0156 0.0719  61  VAL A CG1 
102  C CG2 . VAL A 68  ? 0.3052 0.3016 0.2304 -0.0140 -0.0114 0.0719  61  VAL A CG2 
103  N N   . LEU A 69  ? 0.4154 0.4205 0.3652 -0.0018 -0.0123 0.0610  62  LEU A N   
104  C CA  . LEU A 69  ? 0.4768 0.4906 0.4351 0.0002  -0.0128 0.0582  62  LEU A CA  
105  C C   . LEU A 69  ? 0.6353 0.6534 0.6005 -0.0019 -0.0105 0.0517  62  LEU A C   
106  O O   . LEU A 69  ? 0.8027 0.8317 0.7746 -0.0033 -0.0104 0.0487  62  LEU A O   
107  C CB  . LEU A 69  ? 0.5774 0.5845 0.5358 0.0057  -0.0141 0.0605  62  LEU A CB  
108  C CG  . LEU A 69  ? 0.7745 0.7908 0.7413 0.0082  -0.0144 0.0582  62  LEU A CG  
109  C CD1 . LEU A 69  ? 1.0043 1.0144 0.9702 0.0136  -0.0165 0.0617  62  LEU A CD1 
110  C CD2 . LEU A 69  ? 0.7596 0.7784 0.7331 0.0072  -0.0117 0.0523  62  LEU A CD2 
111  N N   . GLY A 70  ? 0.5732 0.5821 0.5366 -0.0017 -0.0086 0.0498  63  GLY A N   
112  C CA  . GLY A 70  ? 0.5311 0.5425 0.5003 -0.0032 -0.0067 0.0441  63  GLY A CA  
113  C C   . GLY A 70  ? 0.5293 0.5469 0.5004 -0.0079 -0.0062 0.0408  63  GLY A C   
114  O O   . GLY A 70  ? 0.4891 0.5078 0.4645 -0.0089 -0.0052 0.0364  63  GLY A O   
115  N N   . HIS A 71  ? 0.4959 0.5174 0.4637 -0.0108 -0.0073 0.0431  64  HIS A N   
116  C CA  . HIS A 71  ? 0.6108 0.6410 0.5812 -0.0159 -0.0076 0.0401  64  HIS A CA  
117  C C   . HIS A 71  ? 0.5263 0.5531 0.4906 -0.0198 -0.0072 0.0407  64  HIS A C   
118  O O   . HIS A 71  ? 0.4526 0.4867 0.4189 -0.0244 -0.0077 0.0378  64  HIS A O   
119  C CB  . HIS A 71  ? 1.0263 1.0621 1.0049 -0.0168 -0.0071 0.0344  64  HIS A CB  
120  C CG  . HIS A 71  ? 1.1414 1.1735 1.1199 -0.0189 -0.0062 0.0307  64  HIS A CG  
121  N ND1 . HIS A 71  ? 1.2003 1.2366 1.1782 -0.0237 -0.0067 0.0285  64  HIS A ND1 
122  C CD2 . HIS A 71  ? 0.9840 1.0101 0.9635 -0.0171 -0.0051 0.0284  64  HIS A CD2 
123  C CE1 . HIS A 71  ? 1.0265 1.0590 1.0048 -0.0246 -0.0060 0.0252  64  HIS A CE1 
124  N NE2 . HIS A 71  ? 0.9101 0.9364 0.8893 -0.0205 -0.0050 0.0252  64  HIS A NE2 
125  N N   . GLU A 72  ? 0.5459 0.5619 0.5029 -0.0182 -0.0063 0.0445  65  GLU A N   
126  C CA  . GLU A 72  ? 0.4059 0.4171 0.3575 -0.0216 -0.0051 0.0449  65  GLU A CA  
127  C C   . GLU A 72  ? 0.6056 0.6247 0.5551 -0.0274 -0.0063 0.0452  65  GLU A C   
128  O O   . GLU A 72  ? 0.9188 0.9374 0.8660 -0.0318 -0.0055 0.0433  65  GLU A O   
129  C CB  . GLU A 72  ? 0.2371 0.2348 0.1813 -0.0184 -0.0035 0.0498  65  GLU A CB  
130  C CG  . GLU A 72  ? 0.3869 0.3798 0.3232 -0.0216 -0.0028 0.0538  65  GLU A CG  
131  C CD  . GLU A 72  ? 0.4602 0.4517 0.3961 -0.0259 -0.0009 0.0504  65  GLU A CD  
132  O OE1 . GLU A 72  ? 0.4051 0.3940 0.3349 -0.0296 -0.0004 0.0533  65  GLU A OE1 
133  O OE2 . GLU A 72  ? 0.5537 0.5466 0.4950 -0.0257 -0.0001 0.0452  65  GLU A OE2 
147  N N   . LYS A 75  ? 0.4215 0.5037 0.3803 -0.0507 -0.0125 0.0399  68  LYS A N   
148  C CA  . LYS A 75  ? 0.4407 0.5266 0.3924 -0.0544 -0.0136 0.0445  68  LYS A CA  
149  C C   . LYS A 75  ? 0.6401 0.7201 0.5866 -0.0493 -0.0149 0.0518  68  LYS A C   
150  O O   . LYS A 75  ? 0.5870 0.6625 0.5249 -0.0502 -0.0158 0.0574  68  LYS A O   
151  C CB  . LYS A 75  ? 0.6607 0.7418 0.6056 -0.0591 -0.0130 0.0447  68  LYS A CB  
152  C CG  . LYS A 75  ? 0.7130 0.7784 0.6515 -0.0555 -0.0123 0.0484  68  LYS A CG  
153  C CD  . LYS A 75  ? 0.7117 0.7720 0.6399 -0.0564 -0.0131 0.0560  68  LYS A CD  
154  C CE  . LYS A 75  ? 0.7957 0.8409 0.7171 -0.0545 -0.0116 0.0592  68  LYS A CE  
155  N NZ  . LYS A 75  ? 0.8490 0.8947 0.7664 -0.0616 -0.0106 0.0569  68  LYS A NZ  
156  N N   . ARG A 76  ? 0.8296 0.9098 0.7813 -0.0439 -0.0151 0.0517  69  ARG A N   
157  C CA  . ARG A 76  ? 0.8718 0.9482 0.8196 -0.0389 -0.0167 0.0580  69  ARG A CA  
158  C C   . ARG A 76  ? 0.7745 0.8631 0.7275 -0.0381 -0.0177 0.0578  69  ARG A C   
159  O O   . ARG A 76  ? 0.7097 0.8083 0.6703 -0.0407 -0.0166 0.0523  69  ARG A O   
160  C CB  . ARG A 76  ? 0.9416 1.0045 0.8891 -0.0323 -0.0160 0.0592  69  ARG A CB  
161  C CG  . ARG A 76  ? 0.8469 0.8977 0.7849 -0.0294 -0.0169 0.0661  69  ARG A CG  
162  C CD  . ARG A 76  ? 0.6695 0.7063 0.6067 -0.0245 -0.0154 0.0661  69  ARG A CD  
163  N NE  . ARG A 76  ? 0.5743 0.6027 0.5064 -0.0188 -0.0170 0.0724  69  ARG A NE  
164  C CZ  . ARG A 76  ? 0.6083 0.6281 0.5309 -0.0186 -0.0178 0.0788  69  ARG A CZ  
165  N NH1 . ARG A 76  ? 0.7024 0.7217 0.6200 -0.0241 -0.0167 0.0794  69  ARG A NH1 
166  N NH2 . ARG A 76  ? 0.5433 0.5549 0.4615 -0.0129 -0.0197 0.0846  69  ARG A NH2 
167  N N   . LEU A 77  ? 0.7323 0.8202 0.6813 -0.0346 -0.0198 0.0637  70  LEU A N   
168  C CA  . LEU A 77  ? 0.7307 0.8300 0.6843 -0.0334 -0.0207 0.0637  70  LEU A CA  
169  C C   . LEU A 77  ? 0.6654 0.7615 0.6256 -0.0279 -0.0198 0.0612  70  LEU A C   
170  O O   . LEU A 77  ? 0.5397 0.6254 0.4975 -0.0223 -0.0206 0.0644  70  LEU A O   
171  C CB  . LEU A 77  ? 0.7627 0.8628 0.7094 -0.0314 -0.0238 0.0711  70  LEU A CB  
172  C CG  . LEU A 77  ? 0.7514 0.8649 0.7024 -0.0305 -0.0250 0.0713  70  LEU A CG  
173  C CD1 . LEU A 77  ? 0.6254 0.7546 0.5806 -0.0375 -0.0236 0.0667  70  LEU A CD1 
174  C CD2 . LEU A 77  ? 0.7476 0.8607 0.6917 -0.0273 -0.0287 0.0791  70  LEU A CD2 
175  N N   . GLN A 78  ? 0.6570 0.7620 0.6254 -0.0298 -0.0179 0.0554  71  GLN A N   
176  C CA  . GLN A 78  ? 0.6577 0.7610 0.6325 -0.0255 -0.0166 0.0527  71  GLN A CA  
177  C C   . GLN A 78  ? 0.6052 0.7207 0.5836 -0.0252 -0.0169 0.0527  71  GLN A C   
178  O O   . GLN A 78  ? 0.6997 0.8268 0.6794 -0.0299 -0.0165 0.0511  71  GLN A O   
179  C CB  . GLN A 78  ? 0.7108 0.8136 0.6916 -0.0278 -0.0141 0.0463  71  GLN A CB  
180  C CG  . GLN A 78  ? 0.6876 0.7825 0.6649 -0.0303 -0.0138 0.0453  71  GLN A CG  
181  C CD  . GLN A 78  ? 0.7037 0.7841 0.6764 -0.0257 -0.0141 0.0482  71  GLN A CD  
182  O OE1 . GLN A 78  ? 0.6317 0.7054 0.5968 -0.0257 -0.0152 0.0525  71  GLN A OE1 
183  N NE2 . GLN A 78  ? 0.8389 0.9142 0.8160 -0.0221 -0.0129 0.0458  71  GLN A NE2 
184  N N   . THR A 79  ? 0.6023 0.7157 0.5821 -0.0198 -0.0174 0.0543  72  THR A N   
185  C CA  . THR A 79  ? 0.6348 0.7592 0.6161 -0.0189 -0.0183 0.0556  72  THR A CA  
186  C C   . THR A 79  ? 0.6887 0.8176 0.6769 -0.0175 -0.0159 0.0514  72  THR A C   
187  O O   . THR A 79  ? 0.7433 0.8835 0.7336 -0.0186 -0.0155 0.0504  72  THR A O   
188  C CB  . THR A 79  ? 0.7125 0.8326 0.6882 -0.0140 -0.0219 0.0623  72  THR A CB  
189  O OG1 . THR A 79  ? 0.6859 0.8040 0.6543 -0.0163 -0.0240 0.0667  72  THR A OG1 
190  C CG2 . THR A 79  ? 0.7596 0.8909 0.7372 -0.0122 -0.0231 0.0635  72  THR A CG2 
191  N N   . SER A 80  ? 0.6738 0.7938 0.6648 -0.0154 -0.0142 0.0487  73  SER A N   
192  C CA  . SER A 80  ? 0.4472 0.5693 0.4434 -0.0136 -0.0120 0.0454  73  SER A CA  
193  C C   . SER A 80  ? 0.5029 0.6275 0.5041 -0.0175 -0.0087 0.0397  73  SER A C   
194  O O   . SER A 80  ? 0.5324 0.6501 0.5344 -0.0188 -0.0079 0.0377  73  SER A O   
195  C CB  . SER A 80  ? 0.4349 0.5461 0.4309 -0.0082 -0.0124 0.0467  73  SER A CB  
196  O OG  . SER A 80  ? 0.5056 0.6161 0.4982 -0.0039 -0.0154 0.0516  73  SER A OG  
197  N N   . SER A 81  ? 0.5231 0.6574 0.5269 -0.0194 -0.0067 0.0370  74  SER A N   
198  C CA  . SER A 81  ? 0.4048 0.5333 0.4094 -0.0210 -0.0045 0.0306  74  SER A CA  
199  C C   . SER A 81  ? 0.4518 0.5708 0.4571 -0.0173 -0.0034 0.0284  74  SER A C   
200  O O   . SER A 81  ? 0.5279 0.6521 0.5345 -0.0148 -0.0033 0.0311  74  SER A O   
201  C CB  . SER A 81  ? 0.2437 0.3788 0.2466 -0.0234 -0.0039 0.0275  74  SER A CB  
202  O OG  . SER A 81  ? 0.5370 0.6797 0.5388 -0.0274 -0.0047 0.0286  74  SER A OG  
203  N N   . VAL A 82  ? 0.4185 0.5244 0.4229 -0.0170 -0.0026 0.0236  75  VAL A N   
204  C CA  . VAL A 82  ? 0.4011 0.4974 0.4060 -0.0141 -0.0018 0.0217  75  VAL A CA  
205  C C   . VAL A 82  ? 0.3243 0.4126 0.3276 -0.0144 -0.0007 0.0166  75  VAL A C   
206  O O   . VAL A 82  ? 0.3788 0.4623 0.3812 -0.0157 -0.0002 0.0137  75  VAL A O   
207  C CB  . VAL A 82  ? 0.3335 0.4210 0.3394 -0.0128 -0.0021 0.0221  75  VAL A CB  
208  C CG1 . VAL A 82  ? 0.1922 0.2712 0.1985 -0.0102 -0.0013 0.0204  75  VAL A CG1 
209  C CG2 . VAL A 82  ? 0.3136 0.4087 0.3211 -0.0125 -0.0032 0.0280  75  VAL A CG2 
210  N N   . LEU A 83  ? 0.2427 0.3305 0.2457 -0.0130 -0.0001 0.0159  76  LEU A N   
211  C CA  . LEU A 83  ? 0.3655 0.4454 0.3668 -0.0131 0.0008  0.0121  76  LEU A CA  
212  C C   . LEU A 83  ? 0.5063 0.5751 0.5080 -0.0110 0.0011  0.0115  76  LEU A C   
213  O O   . LEU A 83  ? 0.5758 0.6451 0.5786 -0.0094 0.0008  0.0133  76  LEU A O   
214  C CB  . LEU A 83  ? 0.3595 0.4462 0.3597 -0.0133 0.0011  0.0117  76  LEU A CB  
215  C CG  . LEU A 83  ? 0.2857 0.3721 0.2836 -0.0151 0.0017  0.0081  76  LEU A CG  
216  C CD1 . LEU A 83  ? 0.2729 0.3618 0.2701 -0.0146 0.0018  0.0075  76  LEU A CD1 
217  C CD2 . LEU A 83  ? 0.2871 0.3627 0.2837 -0.0151 0.0023  0.0057  76  LEU A CD2 
218  N N   . VAL A 84  ? 0.5039 0.5679 0.5090 -0.0114 -0.0015 0.0087  77  VAL A N   
219  C CA  . VAL A 84  ? 0.3779 0.4297 0.3726 -0.0092 -0.0016 0.0091  77  VAL A CA  
220  C C   . VAL A 84  ? 0.2737 0.3287 0.2774 -0.0108 -0.0012 0.0062  77  VAL A C   
221  O O   . VAL A 84  ? 0.2849 0.3391 0.2877 -0.0121 -0.0009 0.0044  77  VAL A O   
222  C CB  . VAL A 84  ? 0.2842 0.3309 0.2792 -0.0091 -0.0016 0.0086  77  VAL A CB  
223  C CG1 . VAL A 84  ? 0.2351 0.2795 0.2389 -0.0087 -0.0014 0.0075  77  VAL A CG1 
224  C CG2 . VAL A 84  ? 0.3033 0.3562 0.3083 -0.0098 -0.0018 0.0098  77  VAL A CG2 
225  N N   . SER A 85  ? 0.2395 0.2945 0.2435 -0.0101 -0.0011 0.0065  78  SER A N   
226  C CA  . SER A 85  ? 0.3380 0.3919 0.3411 -0.0111 -0.0009 0.0046  78  SER A CA  
227  C C   . SER A 85  ? 0.2927 0.3396 0.2953 -0.0104 -0.0009 0.0044  78  SER A C   
228  O O   . SER A 85  ? 0.2753 0.3159 0.2704 -0.0082 -0.0012 0.0061  78  SER A O   
229  C CB  . SER A 85  ? 0.3095 0.3693 0.3131 -0.0114 -0.0009 0.0046  78  SER A CB  
230  O OG  . SER A 85  ? 0.3782 0.4374 0.3810 -0.0130 -0.0005 0.0026  78  SER A OG  
231  N N   . GLY A 86  ? 0.2929 0.3332 0.2864 -0.0104 -0.0007 0.0030  79  GLY A N   
232  C CA  . GLY A 86  ? 0.3340 0.3718 0.3350 -0.0108 -0.0007 0.0027  79  GLY A CA  
233  C C   . GLY A 86  ? 0.4307 0.4643 0.4315 -0.0100 -0.0008 0.0028  79  GLY A C   
234  O O   . GLY A 86  ? 0.4160 0.4488 0.4174 -0.0089 -0.0010 0.0039  79  GLY A O   
235  N N   . LEU A 87  ? 0.2900 0.3187 0.2839 -0.0097 -0.0005 0.0015  80  LEU A N   
236  C CA  . LEU A 87  ? 0.3059 0.3317 0.3002 -0.0091 -0.0004 0.0013  80  LEU A CA  
237  C C   . LEU A 87  ? 0.3708 0.3918 0.3656 -0.0083 -0.0005 0.0014  80  LEU A C   
238  O O   . LEU A 87  ? 0.3965 0.4160 0.3912 -0.0082 -0.0001 0.0004  80  LEU A O   
239  C CB  . LEU A 87  ? 0.2877 0.3161 0.2813 -0.0101 0.0002  -0.0006 80  LEU A CB  
240  C CG  . LEU A 87  ? 0.4015 0.4362 0.4016 -0.0112 -0.0001 0.0003  80  LEU A CG  
241  C CD1 . LEU A 87  ? 0.5235 0.5636 0.5237 -0.0129 0.0004  -0.0012 80  LEU A CD1 
242  C CD2 . LEU A 87  ? 0.4032 0.4328 0.3971 -0.0096 -0.0002 0.0008  80  LEU A CD2 
243  N N   . ARG A 88  ? 0.3136 0.3329 0.3090 -0.0077 -0.0009 0.0026  81  ARG A N   
244  C CA  . ARG A 88  ? 0.2801 0.2971 0.2797 -0.0074 -0.0010 0.0028  81  ARG A CA  
245  C C   . ARG A 88  ? 0.3053 0.3211 0.3054 -0.0064 -0.0011 0.0032  81  ARG A C   
246  O O   . ARG A 88  ? 0.3389 0.3568 0.3392 -0.0065 -0.0010 0.0032  81  ARG A O   
247  C CB  . ARG A 88  ? 0.2903 0.3066 0.2899 -0.0075 -0.0013 0.0035  81  ARG A CB  
248  C CG  . ARG A 88  ? 0.2684 0.2865 0.2674 -0.0090 -0.0013 0.0031  81  ARG A CG  
249  C CD  . ARG A 88  ? 0.1533 0.1681 0.1481 -0.0085 -0.0018 0.0040  81  ARG A CD  
250  N NE  . ARG A 88  ? 0.5888 0.6046 0.5882 -0.0085 -0.0019 0.0044  81  ARG A NE  
251  C CZ  . ARG A 88  ? 0.7195 0.7329 0.7191 -0.0080 -0.0022 0.0048  81  ARG A CZ  
252  N NH1 . ARG A 88  ? 0.4184 0.4284 0.4147 -0.0073 -0.0028 0.0053  81  ARG A NH1 
253  N NH2 . ARG A 88  ? 0.7944 0.8081 0.7947 -0.0074 -0.0023 0.0051  81  ARG A NH2 
254  N N   . GLY A 89  ? 0.2664 0.2782 0.2639 -0.0050 -0.0013 0.0037  82  GLY A N   
255  C CA  . GLY A 89  ? 0.1955 0.2076 0.1962 -0.0048 -0.0012 0.0034  82  GLY A CA  
256  C C   . GLY A 89  ? 0.2058 0.2187 0.2042 -0.0043 -0.0013 0.0044  82  GLY A C   
257  O O   . GLY A 89  ? 0.2976 0.3113 0.2960 -0.0043 -0.0013 0.0044  82  GLY A O   
258  N N   . LEU A 90  ? 0.3055 0.3211 0.3073 -0.0047 -0.0013 0.0046  83  LEU A N   
259  C CA  . LEU A 90  ? 0.2458 0.2636 0.2483 -0.0043 -0.0012 0.0054  83  LEU A CA  
260  C C   . LEU A 90  ? 0.2684 0.2895 0.2711 -0.0049 -0.0013 0.0058  83  LEU A C   
261  O O   . LEU A 90  ? 0.2947 0.3169 0.2979 -0.0046 -0.0013 0.0065  83  LEU A O   
262  C CB  . LEU A 90  ? 0.1881 0.2056 0.1875 -0.0038 -0.0013 0.0065  83  LEU A CB  
263  C CG  . LEU A 90  ? 0.2179 0.2372 0.2180 -0.0030 -0.0011 0.0076  83  LEU A CG  
264  C CD1 . LEU A 90  ? 0.2329 0.2501 0.2336 -0.0025 -0.0010 0.0075  83  LEU A CD1 
265  C CD2 . LEU A 90  ? 0.1279 0.1508 0.1323 -0.0030 -0.0010 0.0074  83  LEU A CD2 
266  N N   . GLY A 91  ? 0.2615 0.2847 0.2638 -0.0057 -0.0013 0.0055  84  GLY A N   
267  C CA  . GLY A 91  ? 0.2803 0.3052 0.2777 -0.0059 -0.0014 0.0062  84  GLY A CA  
268  C C   . GLY A 91  ? 0.3592 0.3838 0.3562 -0.0063 -0.0014 0.0057  84  GLY A C   
269  O O   . GLY A 91  ? 0.4229 0.4505 0.4197 -0.0068 -0.0015 0.0064  84  GLY A O   
270  N N   . VAL A 92  ? 0.1987 0.2223 0.1999 -0.0069 -0.0011 0.0042  85  VAL A N   
271  C CA  . VAL A 92  ? 0.2535 0.2750 0.2498 -0.0067 -0.0011 0.0039  85  VAL A CA  
272  C C   . VAL A 92  ? 0.3891 0.4095 0.3860 -0.0063 -0.0013 0.0046  85  VAL A C   
273  O O   . VAL A 92  ? 0.4346 0.4586 0.4355 -0.0076 -0.0012 0.0043  85  VAL A O   
274  C CB  . VAL A 92  ? 0.2688 0.2880 0.2647 -0.0067 -0.0008 0.0024  85  VAL A CB  
275  C CG1 . VAL A 92  ? 0.1576 0.1743 0.1577 -0.0062 -0.0008 0.0024  85  VAL A CG1 
276  C CG2 . VAL A 92  ? 0.2151 0.2377 0.2149 -0.0081 -0.0004 0.0012  85  VAL A CG2 
277  N N   . GLU A 93  ? 0.4964 0.5143 0.4941 -0.0053 -0.0014 0.0051  86  GLU A N   
278  C CA  . GLU A 93  ? 0.4224 0.4415 0.4244 -0.0054 -0.0014 0.0053  86  GLU A CA  
279  C C   . GLU A 93  ? 0.3793 0.4023 0.3822 -0.0058 -0.0016 0.0067  86  GLU A C   
280  O O   . GLU A 93  ? 0.3271 0.3512 0.3302 -0.0063 -0.0018 0.0072  86  GLU A O   
281  C CB  . GLU A 93  ? 0.3474 0.3638 0.3497 -0.0044 -0.0013 0.0052  86  GLU A CB  
282  C CG  . GLU A 93  ? 0.4943 0.5060 0.4933 -0.0036 -0.0013 0.0045  86  GLU A CG  
283  C CD  . GLU A 93  ? 0.5298 0.5416 0.5309 -0.0041 -0.0011 0.0036  86  GLU A CD  
284  O OE1 . GLU A 93  ? 0.3643 0.3772 0.3655 -0.0045 -0.0013 0.0040  86  GLU A OE1 
285  O OE2 . GLU A 93  ? 0.4977 0.5078 0.4983 -0.0039 -0.0010 0.0029  86  GLU A OE2 
286  N N   . ILE A 94  ? 0.2088 0.2319 0.2077 -0.0051 -0.0017 0.0080  87  ILE A N   
287  C CA  . ILE A 94  ? 0.2452 0.2751 0.2500 -0.0056 -0.0016 0.0091  87  ILE A CA  
288  C C   . ILE A 94  ? 0.3517 0.3821 0.3501 -0.0064 -0.0020 0.0101  87  ILE A C   
289  O O   . ILE A 94  ? 0.3247 0.3609 0.3300 -0.0076 -0.0021 0.0106  87  ILE A O   
290  C CB  . ILE A 94  ? 0.2087 0.2413 0.2142 -0.0049 -0.0016 0.0098  87  ILE A CB  
291  C CG1 . ILE A 94  ? 0.2475 0.2741 0.2480 -0.0034 -0.0012 0.0106  87  ILE A CG1 
292  C CG2 . ILE A 94  ? 0.2241 0.2582 0.2243 -0.0043 -0.0015 0.0129  87  ILE A CG2 
293  C CD1 . ILE A 94  ? 0.2206 0.2527 0.2267 -0.0033 -0.0011 0.0101  87  ILE A CD1 
294  N N   . ALA A 95  ? 0.3426 0.3768 0.3461 -0.0080 -0.0018 0.0079  88  ALA A N   
295  C CA  . ALA A 95  ? 0.2309 0.2657 0.2269 -0.0088 -0.0020 0.0084  88  ALA A CA  
296  C C   . ALA A 95  ? 0.3410 0.3780 0.3433 -0.0105 -0.0019 0.0073  88  ALA A C   
297  O O   . ALA A 95  ? 0.3839 0.4210 0.3787 -0.0108 -0.0024 0.0089  88  ALA A O   
298  C CB  . ALA A 95  ? 0.1436 0.1825 0.1457 -0.0104 -0.0015 0.0059  88  ALA A CB  
299  N N   . LYS A 96  ? 0.2860 0.3182 0.2876 -0.0099 -0.0017 0.0062  89  LYS A N   
300  C CA  . LYS A 96  ? 0.2502 0.2815 0.2511 -0.0107 -0.0018 0.0058  89  LYS A CA  
301  C C   . LYS A 96  ? 0.2775 0.3070 0.2728 -0.0101 -0.0025 0.0082  89  LYS A C   
302  O O   . LYS A 96  ? 0.2872 0.3225 0.2885 -0.0130 -0.0026 0.0079  89  LYS A O   
303  C CB  . LYS A 96  ? 0.2440 0.2681 0.2391 -0.0088 -0.0016 0.0049  89  LYS A CB  
304  C CG  . LYS A 96  ? 0.2114 0.2343 0.2061 -0.0093 -0.0017 0.0048  89  LYS A CG  
305  C CD  . LYS A 96  ? 0.3615 0.3822 0.3613 -0.0088 -0.0014 0.0039  89  LYS A CD  
306  C CE  . LYS A 96  ? 0.4555 0.4747 0.4562 -0.0075 -0.0017 0.0048  89  LYS A CE  
307  N NZ  . LYS A 96  ? 0.4925 0.5085 0.4930 -0.0068 -0.0016 0.0044  89  LYS A NZ  
308  N N   . ASN A 97  ? 0.2670 0.2949 0.2639 -0.0087 -0.0027 0.0093  90  ASN A N   
309  C CA  . ASN A 97  ? 0.3030 0.3352 0.3069 -0.0097 -0.0033 0.0103  90  ASN A CA  
310  C C   . ASN A 97  ? 0.3020 0.3428 0.3061 -0.0117 -0.0040 0.0139  90  ASN A C   
311  O O   . ASN A 97  ? 0.3883 0.4341 0.3918 -0.0140 -0.0050 0.0172  90  ASN A O   
312  C CB  . ASN A 97  ? 0.3366 0.3676 0.3418 -0.0077 -0.0030 0.0114  90  ASN A CB  
313  C CG  . ASN A 97  ? 0.3694 0.3944 0.3739 -0.0067 -0.0023 0.0092  90  ASN A CG  
314  O OD1 . ASN A 97  ? 0.4292 0.4496 0.4278 -0.0066 -0.0026 0.0088  90  ASN A OD1 
315  N ND2 . ASN A 97  ? 0.4149 0.4385 0.4199 -0.0051 -0.0021 0.0090  90  ASN A ND2 
316  N N   . ILE A 98  ? 0.2467 0.2896 0.2514 -0.0112 -0.0034 0.0135  91  ILE A N   
317  C CA  . ILE A 98  ? 0.2763 0.3283 0.2814 -0.0126 -0.0039 0.0170  91  ILE A CA  
318  C C   . ILE A 98  ? 0.2945 0.3508 0.2979 -0.0158 -0.0044 0.0167  91  ILE A C   
319  O O   . ILE A 98  ? 0.2988 0.3636 0.3019 -0.0182 -0.0054 0.0204  91  ILE A O   
320  C CB  . ILE A 98  ? 0.3022 0.3544 0.3081 -0.0111 -0.0029 0.0159  91  ILE A CB  
321  C CG1 . ILE A 98  ? 0.3357 0.3964 0.3429 -0.0106 -0.0031 0.0203  91  ILE A CG1 
322  C CG2 . ILE A 98  ? 0.4876 0.5405 0.4925 -0.0123 -0.0024 0.0134  91  ILE A CG2 
323  C CD1 . ILE A 98  ? 0.5255 0.5882 0.5324 -0.0103 -0.0023 0.0189  91  ILE A CD1 
324  N N   . ILE A 99  ? 0.2707 0.3214 0.2732 -0.0158 -0.0037 0.0126  92  ILE A N   
325  C CA  . ILE A 99  ? 0.2551 0.3094 0.2562 -0.0185 -0.0037 0.0115  92  ILE A CA  
326  C C   . ILE A 99  ? 0.1990 0.2536 0.1982 -0.0209 -0.0046 0.0125  92  ILE A C   
327  O O   . ILE A 99  ? 0.2663 0.3272 0.2637 -0.0245 -0.0053 0.0139  92  ILE A O   
328  C CB  . ILE A 99  ? 0.2392 0.2854 0.2302 -0.0162 -0.0027 0.0085  92  ILE A CB  
329  C CG1 . ILE A 99  ? 0.1465 0.1996 0.1479 -0.0171 -0.0022 0.0074  92  ILE A CG1 
330  C CG2 . ILE A 99  ? 0.2566 0.3105 0.2561 -0.0205 -0.0021 0.0063  92  ILE A CG2 
331  C CD1 . ILE A 99  ? 0.0922 0.1382 0.0832 -0.0151 -0.0015 0.0051  92  ILE A CD1 
332  N N   . LEU A 100 ? 0.2734 0.3215 0.2726 -0.0192 -0.0046 0.0117  93  LEU A N   
333  C CA  . LEU A 100 ? 0.2839 0.3321 0.2809 -0.0218 -0.0055 0.0128  93  LEU A CA  
334  C C   . LEU A 100 ? 0.2569 0.3118 0.2534 -0.0246 -0.0071 0.0183  93  LEU A C   
335  O O   . LEU A 100 ? 0.3974 0.4541 0.3905 -0.0282 -0.0081 0.0204  93  LEU A O   
336  C CB  . LEU A 100 ? 0.2019 0.2425 0.1992 -0.0193 -0.0051 0.0110  93  LEU A CB  
337  C CG  . LEU A 100 ? 0.2197 0.2542 0.2183 -0.0169 -0.0029 0.0072  93  LEU A CG  
338  C CD1 . LEU A 100 ? 0.1743 0.2036 0.1725 -0.0155 -0.0027 0.0064  93  LEU A CD1 
339  C CD2 . LEU A 100 ? 0.2531 0.2874 0.2418 -0.0178 -0.0027 0.0064  93  LEU A CD2 
340  N N   . GLY A 101 ? 0.2331 0.2904 0.2325 -0.0222 -0.0072 0.0209  94  GLY A N   
341  C CA  . GLY A 101 ? 0.3315 0.3870 0.3266 -0.0205 -0.0074 0.0258  94  GLY A CA  
342  C C   . GLY A 101 ? 0.3540 0.4162 0.3466 -0.0230 -0.0082 0.0283  94  GLY A C   
343  O O   . GLY A 101 ? 0.2729 0.3316 0.2596 -0.0219 -0.0088 0.0327  94  GLY A O   
344  N N   . GLY A 102 ? 0.3655 0.4375 0.3625 -0.0264 -0.0082 0.0258  95  GLY A N   
345  C CA  . GLY A 102 ? 0.3494 0.4294 0.3444 -0.0296 -0.0088 0.0275  95  GLY A CA  
346  C C   . GLY A 102 ? 0.4179 0.5024 0.4124 -0.0274 -0.0091 0.0312  95  GLY A C   
347  O O   . GLY A 102 ? 0.4616 0.5474 0.4508 -0.0281 -0.0103 0.0351  95  GLY A O   
348  N N   . VAL A 103 ? 0.3607 0.4478 0.3602 -0.0249 -0.0081 0.0301  96  VAL A N   
349  C CA  . VAL A 103 ? 0.3412 0.4341 0.3405 -0.0232 -0.0083 0.0330  96  VAL A CA  
350  C C   . VAL A 103 ? 0.3649 0.4699 0.3658 -0.0277 -0.0080 0.0316  96  VAL A C   
351  O O   . VAL A 103 ? 0.4145 0.5157 0.4142 -0.0295 -0.0071 0.0268  96  VAL A O   
352  C CB  . VAL A 103 ? 0.3021 0.3949 0.3059 -0.0198 -0.0068 0.0318  96  VAL A CB  
353  C CG1 . VAL A 103 ? 0.3305 0.4123 0.3328 -0.0156 -0.0070 0.0329  96  VAL A CG1 
354  C CG2 . VAL A 103 ? 0.1672 0.2537 0.1714 -0.0198 -0.0053 0.0251  96  VAL A CG2 
355  N N   . LYS A 104 ? 0.3156 0.4275 0.3148 -0.0273 -0.0086 0.0345  97  LYS A N   
356  C CA  . LYS A 104 ? 0.3968 0.5206 0.3960 -0.0320 -0.0085 0.0338  97  LYS A CA  
357  C C   . LYS A 104 ? 0.2966 0.4153 0.2957 -0.0322 -0.0064 0.0265  97  LYS A C   
358  O O   . LYS A 104 ? 0.3974 0.5158 0.3945 -0.0351 -0.0061 0.0234  97  LYS A O   
359  C CB  . LYS A 104 ? 0.5930 0.7243 0.5903 -0.0306 -0.0095 0.0373  97  LYS A CB  
360  C CG  . LYS A 104 ? 0.6682 0.8124 0.6648 -0.0358 -0.0094 0.0367  97  LYS A CG  
361  C CD  . LYS A 104 ? 0.6817 0.8365 0.6797 -0.0354 -0.0088 0.0370  97  LYS A CD  
362  C CE  . LYS A 104 ? 0.7499 0.9177 0.7474 -0.0412 -0.0082 0.0352  97  LYS A CE  
363  N NZ  . LYS A 104 ? 0.7892 0.9564 0.7863 -0.0402 -0.0062 0.0294  97  LYS A NZ  
364  N N   . ALA A 105 ? 0.2775 0.3906 0.2778 -0.0286 -0.0051 0.0238  98  ALA A N   
365  C CA  . ALA A 105 ? 0.3375 0.4433 0.3372 -0.0278 -0.0034 0.0177  98  ALA A CA  
366  C C   . ALA A 105 ? 0.3683 0.4648 0.3694 -0.0237 -0.0025 0.0163  98  ALA A C   
367  O O   . ALA A 105 ? 0.4365 0.5346 0.4389 -0.0218 -0.0031 0.0195  98  ALA A O   
368  C CB  . ALA A 105 ? 0.1932 0.3081 0.1921 -0.0300 -0.0027 0.0163  98  ALA A CB  
369  N N   . VAL A 106 ? 0.2096 0.2969 0.2105 -0.0226 -0.0011 0.0118  99  VAL A N   
370  C CA  . VAL A 106 ? 0.1627 0.2411 0.1642 -0.0194 -0.0003 0.0105  99  VAL A CA  
371  C C   . VAL A 106 ? 0.2850 0.3611 0.2851 -0.0195 0.0013  0.0070  99  VAL A C   
372  O O   . VAL A 106 ? 0.3416 0.4192 0.3438 -0.0212 -0.0010 0.0038  99  VAL A O   
373  C CB  . VAL A 106 ? 0.1872 0.2551 0.1895 -0.0175 -0.0004 0.0096  99  VAL A CB  
374  C CG1 . VAL A 106 ? 0.0785 0.1357 0.0703 -0.0143 -0.0019 0.0083  99  VAL A CG1 
375  C CG2 . VAL A 106 ? 0.1845 0.2543 0.1876 -0.0172 -0.0018 0.0131  99  VAL A CG2 
376  N N   . THR A 107 ? 0.2508 0.3271 0.2504 -0.0184 0.0016  0.0070  100 THR A N   
377  C CA  . THR A 107 ? 0.1379 0.2154 0.1408 -0.0192 -0.0007 0.0031  100 THR A CA  
378  C C   . THR A 107 ? 0.3265 0.3904 0.3164 -0.0158 -0.0007 0.0030  100 THR A C   
379  O O   . THR A 107 ? 0.3231 0.3850 0.3142 -0.0141 -0.0011 0.0052  100 THR A O   
380  C CB  . THR A 107 ? 0.3053 0.3887 0.3020 -0.0200 0.0029  0.0037  100 THR A CB  
381  O OG1 . THR A 107 ? 0.3439 0.4376 0.3410 -0.0226 0.0027  0.0042  100 THR A OG1 
382  C CG2 . THR A 107 ? 0.1709 0.2529 0.1654 -0.0206 0.0039  0.0000  100 THR A CG2 
383  N N   . LEU A 108 ? 0.3353 0.3958 0.3250 -0.0162 0.0000  0.0001  101 LEU A N   
384  C CA  . LEU A 108 ? 0.3250 0.3792 0.3156 -0.0148 0.0001  -0.0003 101 LEU A CA  
385  C C   . LEU A 108 ? 0.4424 0.5030 0.4438 -0.0170 0.0005  -0.0021 101 LEU A C   
386  O O   . LEU A 108 ? 0.4592 0.5167 0.4488 -0.0171 0.0015  -0.0053 101 LEU A O   
387  C CB  . LEU A 108 ? 0.3724 0.4223 0.3631 -0.0148 0.0006  -0.0021 101 LEU A CB  
388  C CG  . LEU A 108 ? 0.2824 0.3365 0.2832 -0.0162 0.0003  -0.0012 101 LEU A CG  
389  C CD1 . LEU A 108 ? 0.1775 0.2277 0.1780 -0.0161 0.0009  -0.0032 101 LEU A CD1 
390  C CD2 . LEU A 108 ? 0.2476 0.2947 0.2392 -0.0134 -0.0005 0.0018  101 LEU A CD2 
391  N N   . HIS A 109 ? 0.3841 0.4438 0.3858 -0.0160 0.0002  -0.0009 102 HIS A N   
392  C CA  . HIS A 109 ? 0.2473 0.3086 0.2488 -0.0171 0.0007  -0.0026 102 HIS A CA  
393  C C   . HIS A 109 ? 0.3063 0.3563 0.2970 -0.0150 0.0009  -0.0033 102 HIS A C   
394  O O   . HIS A 109 ? 0.3229 0.3734 0.3238 -0.0147 0.0003  -0.0011 102 HIS A O   
395  C CB  . HIS A 109 ? 0.1789 0.2421 0.1714 -0.0161 0.0028  -0.0011 102 HIS A CB  
396  C CG  . HIS A 109 ? 0.2924 0.3584 0.2843 -0.0174 0.0029  -0.0028 102 HIS A CG  
397  N ND1 . HIS A 109 ? 0.2390 0.3024 0.2311 -0.0164 0.0023  -0.0016 102 HIS A ND1 
398  C CD2 . HIS A 109 ? 0.2586 0.3300 0.2500 -0.0202 0.0036  -0.0062 102 HIS A CD2 
399  C CE1 . HIS A 109 ? 0.3272 0.3945 0.3188 -0.0185 0.0026  -0.0038 102 HIS A CE1 
400  N NE2 . HIS A 109 ? 0.3042 0.3763 0.2954 -0.0209 0.0035  -0.0068 102 HIS A NE2 
401  N N   . ASP A 110 ? 0.2080 0.2600 0.1999 -0.0170 0.0033  -0.0058 103 ASP A N   
402  C CA  . ASP A 110 ? 0.2286 0.2770 0.2206 -0.0173 0.0032  -0.0064 103 ASP A CA  
403  C C   . ASP A 110 ? 0.3337 0.3868 0.3259 -0.0207 0.0045  -0.0106 103 ASP A C   
404  O O   . ASP A 110 ? 0.3394 0.3952 0.3322 -0.0222 0.0057  -0.0138 103 ASP A O   
405  C CB  . ASP A 110 ? 0.3401 0.3817 0.3325 -0.0157 0.0029  -0.0057 103 ASP A CB  
406  C CG  . ASP A 110 ? 0.4138 0.4507 0.4062 -0.0149 0.0022  -0.0041 103 ASP A CG  
407  O OD1 . ASP A 110 ? 0.3558 0.3868 0.3485 -0.0126 0.0016  -0.0023 103 ASP A OD1 
408  O OD2 . ASP A 110 ? 0.4523 0.4918 0.4443 -0.0167 0.0024  -0.0048 103 ASP A OD2 
409  N N   . GLN A 111 ? 0.4562 0.5100 0.4480 -0.0222 0.0046  -0.0110 104 GLN A N   
410  C CA  . GLN A 111 ? 0.4122 0.4694 0.4043 -0.0260 0.0064  -0.0155 104 GLN A CA  
411  C C   . GLN A 111 ? 0.4801 0.5320 0.4725 -0.0270 0.0070  -0.0163 104 GLN A C   
412  O O   . GLN A 111 ? 0.5143 0.5650 0.5099 -0.0296 0.0079  -0.0194 104 GLN A O   
413  C CB  . GLN A 111 ? 0.2452 0.3082 0.2365 -0.0280 0.0066  -0.0161 104 GLN A CB  
414  C CG  . GLN A 111 ? 0.3752 0.4423 0.3662 -0.0260 0.0053  -0.0134 104 GLN A CG  
415  C CD  . GLN A 111 ? 0.4992 0.5747 0.4898 -0.0286 0.0059  -0.0152 104 GLN A CD  
416  O OE1 . GLN A 111 ? 0.4577 0.5375 0.4484 -0.0320 0.0075  -0.0194 104 GLN A OE1 
417  N NE2 . GLN A 111 ? 0.3918 0.4697 0.3822 -0.0270 0.0048  -0.0124 104 GLN A NE2 
418  N N   . GLY A 112 ? 0.3672 0.4132 0.3591 -0.0242 0.0055  -0.0125 105 GLY A N   
419  C CA  . GLY A 112 ? 0.3772 0.4166 0.3717 -0.0243 0.0048  -0.0118 105 GLY A CA  
420  C C   . GLY A 112 ? 0.4634 0.4990 0.4622 -0.0231 0.0047  -0.0132 105 GLY A C   
421  O O   . GLY A 112 ? 0.4685 0.5065 0.4652 -0.0218 0.0055  -0.0140 105 GLY A O   
422  N N   . THR A 113 ? 0.4106 0.4403 0.4152 -0.0236 0.0036  -0.0134 106 THR A N   
423  C CA  . THR A 113 ? 0.4961 0.5221 0.5053 -0.0223 0.0030  -0.0146 106 THR A CA  
424  C C   . THR A 113 ? 0.5219 0.5432 0.5309 -0.0197 0.0012  -0.0106 106 THR A C   
425  O O   . THR A 113 ? 0.4866 0.5065 0.4929 -0.0193 0.0005  -0.0074 106 THR A O   
426  C CB  . THR A 113 ? 0.5033 0.5252 0.5192 -0.0244 0.0022  -0.0167 106 THR A CB  
427  O OG1 . THR A 113 ? 0.5707 0.5865 0.5886 -0.0250 -0.0001 -0.0131 106 THR A OG1 
428  C CG2 . THR A 113 ? 0.3423 0.3687 0.3583 -0.0275 0.0042  -0.0207 106 THR A CG2 
429  N N   . ALA A 114 ? 0.5200 0.5395 0.5317 -0.0180 0.0007  -0.0113 107 ALA A N   
430  C CA  . ALA A 114 ? 0.5251 0.5406 0.5369 -0.0157 -0.0010 -0.0080 107 ALA A CA  
431  C C   . ALA A 114 ? 0.5116 0.5211 0.5282 -0.0163 -0.0037 -0.0056 107 ALA A C   
432  O O   . ALA A 114 ? 0.4962 0.5029 0.5159 -0.0186 -0.0050 -0.0066 107 ALA A O   
433  C CB  . ALA A 114 ? 0.4565 0.4724 0.4692 -0.0140 -0.0005 -0.0097 107 ALA A CB  
434  N N   . GLN A 115 ? 0.5122 0.5204 0.5274 -0.0149 -0.0036 -0.0031 108 GLN A N   
435  C CA  . GLN A 115 ? 0.5525 0.5570 0.5694 -0.0157 -0.0034 -0.0026 108 GLN A CA  
436  C C   . GLN A 115 ? 0.5672 0.5697 0.5801 -0.0137 -0.0043 0.0001  108 GLN A C   
437  O O   . GLN A 115 ? 0.6711 0.6754 0.6810 -0.0116 -0.0044 0.0011  108 GLN A O   
438  C CB  . GLN A 115 ? 0.5952 0.6004 0.6061 -0.0170 -0.0037 0.0005  108 GLN A CB  
439  C CG  . GLN A 115 ? 0.6780 0.6865 0.6885 -0.0193 -0.0028 -0.0010 108 GLN A CG  
440  C CD  . GLN A 115 ? 0.7711 0.7768 0.7881 -0.0221 -0.0031 -0.0028 108 GLN A CD  
441  O OE1 . GLN A 115 ? 0.7628 0.7658 0.7796 -0.0241 -0.0030 -0.0016 108 GLN A OE1 
442  N NE2 . GLN A 115 ? 0.7848 0.7905 0.8055 -0.0229 -0.0040 -0.0051 108 GLN A NE2 
443  N N   . TRP A 116 ? 0.6132 0.6112 0.6267 -0.0140 -0.0061 0.0024  109 TRP A N   
444  C CA  . TRP A 116 ? 0.6249 0.6215 0.6374 -0.0112 -0.0087 0.0059  109 TRP A CA  
445  C C   . TRP A 116 ? 0.5206 0.5199 0.5271 -0.0097 -0.0094 0.0089  109 TRP A C   
446  O O   . TRP A 116 ? 0.4987 0.4986 0.5037 -0.0074 -0.0097 0.0096  109 TRP A O   
447  C CB  . TRP A 116 ? 0.6986 0.6910 0.7132 -0.0120 -0.0112 0.0082  109 TRP A CB  
448  C CG  . TRP A 116 ? 0.9280 0.9158 0.9479 -0.0129 -0.0111 0.0057  109 TRP A CG  
449  C CD1 . TRP A 116 ? 0.9782 0.9617 0.9990 -0.0161 -0.0100 0.0043  109 TRP A CD1 
450  C CD2 . TRP A 116 ? 1.0454 1.0323 1.0703 -0.0107 -0.0123 0.0041  109 TRP A CD2 
451  N NE1 . TRP A 116 ? 1.0155 0.9944 1.0409 -0.0157 -0.0107 0.0021  109 TRP A NE1 
452  C CE2 . TRP A 116 ? 1.0954 1.0769 1.1241 -0.0121 -0.0122 0.0017  109 TRP A CE2 
453  C CE3 . TRP A 116 ? 1.0369 1.0267 1.0635 -0.0075 -0.0134 0.0040  109 TRP A CE3 
454  C CZ2 . TRP A 116 ? 1.1520 1.1316 1.1868 -0.0099 -0.0135 -0.0008 109 TRP A CZ2 
455  C CZ3 . TRP A 116 ? 1.0675 1.0563 1.1005 -0.0057 -0.0145 0.0014  109 TRP A CZ3 
456  C CH2 . TRP A 116 ? 1.1312 1.1153 1.1686 -0.0067 -0.0147 -0.0011 109 TRP A CH2 
457  N N   . ALA A 117 ? 0.4400 0.4408 0.4428 -0.0111 -0.0093 0.0097  110 ALA A N   
458  C CA  . ALA A 117 ? 0.4892 0.4923 0.4881 -0.0092 -0.0080 0.0093  110 ALA A CA  
459  C C   . ALA A 117 ? 0.5435 0.5474 0.5414 -0.0068 -0.0052 0.0068  110 ALA A C   
460  O O   . ALA A 117 ? 0.5844 0.5891 0.5824 -0.0063 -0.0044 0.0063  110 ALA A O   
461  C CB  . ALA A 117 ? 0.6002 0.6048 0.5969 -0.0114 -0.0082 0.0099  110 ALA A CB  
462  N N   . ASP A 118 ? 0.5692 0.5740 0.5667 -0.0085 -0.0054 0.0072  111 ASP A N   
463  C CA  . ASP A 118 ? 0.5171 0.5229 0.5138 -0.0069 -0.0032 0.0051  111 ASP A CA  
464  C C   . ASP A 118 ? 0.5021 0.5067 0.4996 -0.0055 -0.0028 0.0045  111 ASP A C   
465  O O   . ASP A 118 ? 0.5004 0.5064 0.4997 -0.0053 -0.0018 0.0032  111 ASP A O   
466  C CB  . ASP A 118 ? 0.4317 0.4416 0.4266 -0.0100 -0.0026 0.0042  111 ASP A CB  
467  C CG  . ASP A 118 ? 0.5099 0.5217 0.5039 -0.0120 -0.0027 0.0042  111 ASP A CG  
468  O OD1 . ASP A 118 ? 0.4976 0.5081 0.4917 -0.0104 -0.0030 0.0050  111 ASP A OD1 
469  O OD2 . ASP A 118 ? 0.5766 0.5901 0.5743 -0.0137 -0.0018 0.0014  111 ASP A OD2 
470  N N   . LEU A 119 ? 0.4512 0.4547 0.4507 -0.0065 -0.0048 0.0063  112 LEU A N   
471  C CA  . LEU A 119 ? 0.3377 0.3409 0.3396 -0.0056 -0.0043 0.0049  112 LEU A CA  
472  C C   . LEU A 119 ? 0.4119 0.4143 0.4117 -0.0034 -0.0029 0.0041  112 LEU A C   
473  O O   . LEU A 119 ? 0.5372 0.5406 0.5376 -0.0035 -0.0019 0.0030  112 LEU A O   
474  C CB  . LEU A 119 ? 0.2162 0.2177 0.2246 -0.0053 -0.0058 0.0037  112 LEU A CB  
475  C CG  . LEU A 119 ? 0.5661 0.5690 0.5793 -0.0071 -0.0054 -0.0002 112 LEU A CG  
476  C CD1 . LEU A 119 ? 0.6430 0.6435 0.6623 -0.0056 -0.0073 -0.0013 112 LEU A CD1 
477  C CD2 . LEU A 119 ? 0.5349 0.5424 0.5453 -0.0090 -0.0037 -0.0024 112 LEU A CD2 
478  N N   . SER A 120 ? 0.5406 0.5431 0.5408 -0.0035 -0.0033 0.0046  113 SER A N   
479  C CA  . SER A 120 ? 0.4641 0.4669 0.4644 -0.0032 -0.0028 0.0043  113 SER A CA  
480  C C   . SER A 120 ? 0.4494 0.4528 0.4490 -0.0029 -0.0019 0.0034  113 SER A C   
481  O O   . SER A 120 ? 0.5356 0.5394 0.5362 -0.0029 -0.0014 0.0027  113 SER A O   
482  C CB  . SER A 120 ? 0.5692 0.5723 0.5697 -0.0037 -0.0033 0.0050  113 SER A CB  
483  O OG  . SER A 120 ? 0.7238 0.7274 0.7240 -0.0034 -0.0028 0.0046  113 SER A OG  
484  N N   . SER A 121 ? 0.4907 0.4949 0.4898 -0.0031 -0.0017 0.0033  114 SER A N   
485  C CA  . SER A 121 ? 0.4553 0.4608 0.4557 -0.0033 -0.0013 0.0027  114 SER A CA  
486  C C   . SER A 121 ? 0.3886 0.3951 0.3887 -0.0035 -0.0010 0.0024  114 SER A C   
487  O O   . SER A 121 ? 0.5842 0.5909 0.5828 -0.0032 -0.0010 0.0026  114 SER A O   
488  C CB  . SER A 121 ? 0.5339 0.5395 0.5331 -0.0031 -0.0015 0.0033  114 SER A CB  
489  O OG  . SER A 121 ? 0.6729 0.6790 0.6722 -0.0029 -0.0013 0.0032  114 SER A OG  
490  N N   . GLN A 122 ? 0.2302 0.2371 0.2300 -0.0039 -0.0010 0.0021  115 GLN A N   
491  C CA  . GLN A 122 ? 0.2943 0.3032 0.2937 -0.0046 -0.0006 0.0015  115 GLN A CA  
492  C C   . GLN A 122 ? 0.3188 0.3272 0.3161 -0.0041 -0.0003 0.0007  115 GLN A C   
493  O O   . GLN A 122 ? 0.3876 0.3968 0.3869 -0.0045 0.0001  -0.0002 115 GLN A O   
494  C CB  . GLN A 122 ? 0.3589 0.3681 0.3556 -0.0049 -0.0005 0.0012  115 GLN A CB  
495  C CG  . GLN A 122 ? 0.3234 0.3355 0.3196 -0.0058 -0.0004 0.0009  115 GLN A CG  
496  C CD  . GLN A 122 ? 0.3360 0.3507 0.3319 -0.0064 0.0001  -0.0004 115 GLN A CD  
497  O OE1 . GLN A 122 ? 0.4881 0.5036 0.4874 -0.0066 0.0003  -0.0009 115 GLN A OE1 
498  N NE2 . GLN A 122 ? 0.2535 0.2730 0.2528 -0.0080 0.0003  -0.0008 115 GLN A NE2 
499  N N   . PHE A 123 ? 0.2784 0.2876 0.2757 -0.0041 -0.0003 0.0007  116 PHE A N   
500  C CA  . PHE A 123 ? 0.2824 0.2933 0.2819 -0.0046 0.0001  -0.0004 116 PHE A CA  
501  C C   . PHE A 123 ? 0.4168 0.4310 0.4168 -0.0055 0.0008  -0.0023 116 PHE A C   
502  O O   . PHE A 123 ? 0.4064 0.4221 0.4071 -0.0057 0.0012  -0.0037 116 PHE A O   
503  C CB  . PHE A 123 ? 0.2577 0.2689 0.2572 -0.0048 0.0000  0.0001  116 PHE A CB  
504  C CG  . PHE A 123 ? 0.4874 0.4994 0.4842 -0.0051 -0.0002 0.0006  116 PHE A CG  
505  C CD1 . PHE A 123 ? 0.6714 0.6875 0.6707 -0.0067 0.0000  -0.0001 116 PHE A CD1 
506  C CD2 . PHE A 123 ? 0.6084 0.6207 0.6080 -0.0052 -0.0005 0.0015  116 PHE A CD2 
507  C CE1 . PHE A 123 ? 0.7093 0.7276 0.7086 -0.0076 -0.0002 0.0006  116 PHE A CE1 
508  C CE2 . PHE A 123 ? 0.6284 0.6417 0.6253 -0.0053 -0.0008 0.0022  116 PHE A CE2 
509  C CZ  . PHE A 123 ? 0.5945 0.6105 0.5906 -0.0064 -0.0007 0.0019  116 PHE A CZ  
510  N N   . TYR A 124 ? 0.3396 0.3554 0.3397 -0.0062 0.0010  -0.0028 117 TYR A N   
511  C CA  . TYR A 124 ? 0.2867 0.3043 0.2841 -0.0064 0.0019  -0.0058 117 TYR A CA  
512  C C   . TYR A 124 ? 0.3810 0.3993 0.3804 -0.0062 0.0031  -0.0077 117 TYR A C   
513  O O   . TYR A 124 ? 0.5722 0.5946 0.5736 -0.0073 0.0040  -0.0112 117 TYR A O   
514  C CB  . TYR A 124 ? 0.1845 0.2074 0.1854 -0.0085 0.0017  -0.0052 117 TYR A CB  
515  C CG  . TYR A 124 ? 0.3327 0.3549 0.3282 -0.0083 0.0016  -0.0048 117 TYR A CG  
516  C CD1 . TYR A 124 ? 0.3988 0.4225 0.3934 -0.0090 0.0011  -0.0032 117 TYR A CD1 
517  C CD2 . TYR A 124 ? 0.4021 0.4246 0.3980 -0.0083 0.0019  -0.0058 117 TYR A CD2 
518  C CE1 . TYR A 124 ? 0.3629 0.3904 0.3624 -0.0106 0.0008  -0.0022 117 TYR A CE1 
519  C CE2 . TYR A 124 ? 0.4716 0.4977 0.4718 -0.0100 0.0016  -0.0046 117 TYR A CE2 
520  C CZ  . TYR A 124 ? 0.3318 0.3568 0.3258 -0.0099 0.0012  -0.0033 117 TYR A CZ  
521  O OH  . TYR A 124 ? 0.4402 0.4666 0.4334 -0.0109 0.0009  -0.0026 117 TYR A OH  
522  N N   . LEU A 125 ? 0.2399 0.2567 0.2396 -0.0062 0.0026  -0.0069 118 LEU A N   
523  C CA  . LEU A 125 ? 0.5368 0.5553 0.5409 -0.0070 0.0028  -0.0101 118 LEU A CA  
524  C C   . LEU A 125 ? 0.7306 0.7462 0.7405 -0.0056 0.0010  -0.0107 118 LEU A C   
525  O O   . LEU A 125 ? 0.7288 0.7425 0.7370 -0.0047 0.0005  -0.0085 118 LEU A O   
526  C CB  . LEU A 125 ? 0.5656 0.5813 0.5686 -0.0077 0.0013  -0.0066 118 LEU A CB  
527  C CG  . LEU A 125 ? 0.4996 0.5182 0.5007 -0.0093 0.0021  -0.0073 118 LEU A CG  
528  C CD1 . LEU A 125 ? 0.3968 0.4174 0.3946 -0.0091 0.0029  -0.0068 118 LEU A CD1 
529  C CD2 . LEU A 125 ? 0.5979 0.6141 0.5969 -0.0097 0.0009  -0.0038 118 LEU A CD2 
530  N N   . ARG A 126 ? 0.8217 0.8372 0.8381 -0.0053 0.0003  -0.0137 119 ARG A N   
531  C CA  . ARG A 126 ? 0.8170 0.8296 0.8389 -0.0037 -0.0016 -0.0140 119 ARG A CA  
532  C C   . ARG A 126 ? 0.7949 0.8040 0.8218 -0.0041 -0.0036 -0.0135 119 ARG A C   
533  O O   . ARG A 126 ? 0.6739 0.6826 0.6990 -0.0063 -0.0036 -0.0123 119 ARG A O   
534  C CB  . ARG A 126 ? 0.8285 0.8443 0.8546 -0.0018 -0.0003 -0.0194 119 ARG A CB  
535  C CG  . ARG A 126 ? 0.8756 0.8975 0.8999 -0.0027 0.0029  -0.0234 119 ARG A CG  
536  C CD  . ARG A 126 ? 0.9493 0.9726 0.9686 -0.0030 0.0034  -0.0220 119 ARG A CD  
537  N NE  . ARG A 126 ? 0.9986 1.0197 1.0109 -0.0036 0.0033  -0.0173 119 ARG A NE  
538  C CZ  . ARG A 126 ? 0.9729 0.9926 0.9831 -0.0030 0.0029  -0.0153 119 ARG A CZ  
539  N NH1 . ARG A 126 ? 0.9623 0.9830 0.9761 -0.0020 0.0025  -0.0179 119 ARG A NH1 
540  N NH2 . ARG A 126 ? 0.8727 0.8897 0.8776 -0.0034 0.0027  -0.0109 119 ARG A NH2 
541  N N   . GLU A 127 ? 0.9544 0.9611 0.9878 -0.0020 -0.0055 -0.0144 120 GLU A N   
542  C CA  . GLU A 127 ? 0.9728 0.9757 1.0116 -0.0023 -0.0077 -0.0139 120 GLU A CA  
543  C C   . GLU A 127 ? 0.7617 0.7667 0.8049 -0.0035 -0.0063 -0.0188 120 GLU A C   
544  O O   . GLU A 127 ? 0.7176 0.7192 0.7615 -0.0056 -0.0068 -0.0185 120 GLU A O   
545  C CB  . GLU A 127 ? 1.1758 1.1762 1.2211 0.0005  -0.0108 -0.0134 120 GLU A CB  
546  C CG  . GLU A 127 ? 1.2743 1.2694 1.3211 -0.0004 -0.0139 -0.0094 120 GLU A CG  
547  C CD  . GLU A 127 ? 1.3183 1.3126 1.3729 0.0020  -0.0184 -0.0084 120 GLU A CD  
548  O OE1 . GLU A 127 ? 1.3080 1.3051 1.3636 0.0035  -0.0181 -0.0110 120 GLU A OE1 
549  O OE2 . GLU A 127 ? 1.3011 1.2900 1.3556 0.0007  -0.0209 -0.0051 120 GLU A OE2 
550  N N   . GLU A 128 ? 0.7096 0.7202 0.7551 -0.0023 -0.0042 -0.0237 121 GLU A N   
551  C CA  . GLU A 128 ? 0.6419 0.6561 0.6921 -0.0033 -0.0023 -0.0291 121 GLU A CA  
552  C C   . GLU A 128 ? 0.7386 0.7549 0.7829 -0.0065 -0.0001 -0.0290 121 GLU A C   
553  O O   . GLU A 128 ? 0.8064 0.8263 0.8537 -0.0078 0.0018  -0.0335 121 GLU A O   
554  C CB  . GLU A 128 ? 0.5580 0.5792 0.6123 -0.0013 -0.0001 -0.0345 121 GLU A CB  
555  C CG  . GLU A 128 ? 0.7539 0.7788 0.7992 -0.0017 0.0024  -0.0337 121 GLU A CG  
556  C CD  . GLU A 128 ? 0.9346 0.9653 0.9784 -0.0030 0.0044  -0.0369 121 GLU A CD  
557  O OE1 . GLU A 128 ? 0.8899 0.9215 0.9357 -0.0018 0.0036  -0.0382 121 GLU A OE1 
558  O OE2 . GLU A 128 ? 0.9558 0.9902 0.9960 -0.0052 0.0065  -0.0381 121 GLU A OE2 
559  N N   . ASP A 129 ? 0.7494 0.7643 0.7858 -0.0078 -0.0005 -0.0241 122 ASP A N   
560  C CA  . ASP A 129 ? 0.6582 0.6762 0.6892 -0.0102 0.0012  -0.0238 122 ASP A CA  
561  C C   . ASP A 129 ? 0.6445 0.6585 0.6735 -0.0127 -0.0004 -0.0203 122 ASP A C   
562  O O   . ASP A 129 ? 0.5437 0.5606 0.5702 -0.0146 0.0009  -0.0211 122 ASP A O   
563  C CB  . ASP A 129 ? 0.5909 0.6120 0.6145 -0.0096 0.0026  -0.0218 122 ASP A CB  
564  C CG  . ASP A 129 ? 0.6599 0.6856 0.6838 -0.0082 0.0047  -0.0254 122 ASP A CG  
565  O OD1 . ASP A 129 ? 0.8796 0.9095 0.9085 -0.0082 0.0064  -0.0308 122 ASP A OD1 
566  O OD2 . ASP A 129 ? 0.5859 0.6115 0.6051 -0.0073 0.0049  -0.0232 122 ASP A OD2 
567  N N   . ILE A 130 ? 0.5725 0.5804 0.6021 -0.0127 -0.0029 -0.0167 123 ILE A N   
568  C CA  . ILE A 130 ? 0.4539 0.4577 0.4810 -0.0156 -0.0042 -0.0136 123 ILE A CA  
569  C C   . ILE A 130 ? 0.4761 0.4805 0.5059 -0.0181 -0.0032 -0.0173 123 ILE A C   
570  O O   . ILE A 130 ? 0.5162 0.5198 0.5516 -0.0177 -0.0025 -0.0216 123 ILE A O   
571  C CB  . ILE A 130 ? 0.4597 0.4564 0.4886 -0.0154 -0.0059 -0.0115 123 ILE A CB  
572  C CG1 . ILE A 130 ? 0.5934 0.5903 0.6217 -0.0122 -0.0068 -0.0089 123 ILE A CG1 
573  C CG2 . ILE A 130 ? 0.4491 0.4418 0.4738 -0.0190 -0.0061 -0.0087 123 ILE A CG2 
574  C CD1 . ILE A 130 ? 0.5651 0.5636 0.5868 -0.0128 -0.0063 -0.0050 123 ILE A CD1 
575  N N   . GLY A 131 ? 0.5058 0.5122 0.5325 -0.0203 -0.0028 -0.0160 124 GLY A N   
576  C CA  . GLY A 131 ? 0.4421 0.4498 0.4711 -0.0229 -0.0014 -0.0199 124 GLY A CA  
577  C C   . GLY A 131 ? 0.4742 0.4904 0.5026 -0.0227 0.0019  -0.0244 124 GLY A C   
578  O O   . GLY A 131 ? 0.5560 0.5752 0.5842 -0.0252 0.0035  -0.0270 124 GLY A O   
579  N N   . LYS A 132 ? 0.4038 0.4242 0.4310 -0.0201 0.0031  -0.0255 125 LYS A N   
580  C CA  . LYS A 132 ? 0.3878 0.4165 0.4121 -0.0203 0.0062  -0.0290 125 LYS A CA  
581  C C   . LYS A 132 ? 0.4817 0.5137 0.4982 -0.0202 0.0065  -0.0253 125 LYS A C   
582  O O   . LYS A 132 ? 0.5456 0.5739 0.5595 -0.0188 0.0048  -0.0207 125 LYS A O   
583  C CB  . LYS A 132 ? 0.3445 0.3762 0.3707 -0.0181 0.0075  -0.0319 125 LYS A CB  
584  C CG  . LYS A 132 ? 0.3734 0.4027 0.4083 -0.0173 0.0072  -0.0358 125 LYS A CG  
585  C CD  . LYS A 132 ? 0.6267 0.6579 0.6633 -0.0144 0.0076  -0.0370 125 LYS A CD  
586  C CE  . LYS A 132 ? 0.7507 0.7838 0.7967 -0.0134 0.0085  -0.0430 125 LYS A CE  
587  N NZ  . LYS A 132 ? 0.7616 0.8038 0.8089 -0.0151 0.0123  -0.0490 125 LYS A NZ  
588  N N   . ASN A 133 ? 0.4669 0.5060 0.4794 -0.0218 0.0088  -0.0276 126 ASN A N   
589  C CA  . ASN A 133 ? 0.3548 0.3975 0.3598 -0.0219 0.0090  -0.0244 126 ASN A CA  
590  C C   . ASN A 133 ? 0.4223 0.4636 0.4231 -0.0194 0.0082  -0.0206 126 ASN A C   
591  O O   . ASN A 133 ? 0.3544 0.3961 0.3563 -0.0182 0.0082  -0.0212 126 ASN A O   
592  C CB  . ASN A 133 ? 0.3074 0.3582 0.3098 -0.0240 0.0109  -0.0271 126 ASN A CB  
593  C CG  . ASN A 133 ? 0.4503 0.5023 0.4484 -0.0236 0.0090  -0.0222 126 ASN A CG  
594  O OD1 . ASN A 133 ? 0.4526 0.5036 0.4488 -0.0214 0.0074  -0.0182 126 ASN A OD1 
595  N ND2 . ASN A 133 ? 0.4540 0.5082 0.4513 -0.0257 0.0094  -0.0229 126 ASN A ND2 
596  N N   . ARG A 134 ? 0.2596 0.2975 0.2574 -0.0182 0.0064  -0.0157 127 ARG A N   
597  C CA  . ARG A 134 ? 0.3048 0.3383 0.3012 -0.0153 0.0047  -0.0113 127 ARG A CA  
598  C C   . ARG A 134 ? 0.3889 0.4236 0.3844 -0.0142 0.0044  -0.0101 127 ARG A C   
599  O O   . ARG A 134 ? 0.3933 0.4257 0.3889 -0.0128 0.0042  -0.0094 127 ARG A O   
600  C CB  . ARG A 134 ? 0.3784 0.4078 0.3730 -0.0139 0.0032  -0.0070 127 ARG A CB  
601  C CG  . ARG A 134 ? 0.4142 0.4407 0.4089 -0.0145 0.0030  -0.0066 127 ARG A CG  
602  C CD  . ARG A 134 ? 0.3581 0.3805 0.3517 -0.0127 0.0013  -0.0024 127 ARG A CD  
603  N NE  . ARG A 134 ? 0.3835 0.4086 0.3764 -0.0136 0.0013  -0.0023 127 ARG A NE  
604  C CZ  . ARG A 134 ? 0.5159 0.5414 0.5081 -0.0150 0.0009  -0.0016 127 ARG A CZ  
605  N NH1 . ARG A 134 ? 0.5256 0.5481 0.5172 -0.0159 0.0002  -0.0004 127 ARG A NH1 
606  N NH2 . ARG A 134 ? 0.5445 0.5734 0.5362 -0.0159 0.0011  -0.0019 127 ARG A NH2 
607  N N   . ALA A 135 ? 0.3789 0.4178 0.3735 -0.0153 0.0045  -0.0102 128 ALA A N   
608  C CA  . ALA A 135 ? 0.3214 0.3625 0.3152 -0.0149 0.0044  -0.0091 128 ALA A CA  
609  C C   . ALA A 135 ? 0.3753 0.4197 0.3702 -0.0160 0.0056  -0.0124 128 ALA A C   
610  O O   . ALA A 135 ? 0.4373 0.4802 0.4300 -0.0154 0.0038  -0.0119 128 ALA A O   
611  C CB  . ALA A 135 ? 0.2823 0.3284 0.2753 -0.0160 0.0044  -0.0086 128 ALA A CB  
612  N N   . GLU A 136 ? 0.3949 0.4427 0.3917 -0.0180 0.0070  -0.0170 129 GLU A N   
613  C CA  . GLU A 136 ? 0.4646 0.5161 0.4634 -0.0191 0.0085  -0.0211 129 GLU A CA  
614  C C   . GLU A 136 ? 0.4896 0.5373 0.4900 -0.0174 0.0084  -0.0214 129 GLU A C   
615  O O   . GLU A 136 ? 0.5268 0.5766 0.5278 -0.0175 0.0090  -0.0227 129 GLU A O   
616  C CB  . GLU A 136 ? 0.4990 0.5551 0.5009 -0.0215 0.0104  -0.0268 129 GLU A CB  
617  C CG  . GLU A 136 ? 0.6602 0.7206 0.6603 -0.0235 0.0105  -0.0267 129 GLU A CG  
618  C CD  . GLU A 136 ? 0.8044 0.8722 0.8061 -0.0262 0.0123  -0.0315 129 GLU A CD  
619  O OE1 . GLU A 136 ? 0.9025 0.9712 0.9085 -0.0272 0.0142  -0.0368 129 GLU A OE1 
620  O OE2 . GLU A 136 ? 0.8463 0.9191 0.8456 -0.0275 0.0120  -0.0303 129 GLU A OE2 
621  N N   . VAL A 137 ? 0.5015 0.5443 0.5028 -0.0160 0.0078  -0.0203 130 VAL A N   
622  C CA  . VAL A 137 ? 0.3742 0.4137 0.3773 -0.0143 0.0076  -0.0204 130 VAL A CA  
623  C C   . VAL A 137 ? 0.3526 0.3889 0.3523 -0.0127 0.0063  -0.0158 130 VAL A C   
624  O O   . VAL A 137 ? 0.3743 0.4108 0.3746 -0.0123 0.0066  -0.0165 130 VAL A O   
625  C CB  . VAL A 137 ? 0.4145 0.4504 0.4197 -0.0135 0.0074  -0.0208 130 VAL A CB  
626  C CG1 . VAL A 137 ? 0.3697 0.4021 0.3763 -0.0115 0.0068  -0.0200 130 VAL A CG1 
627  C CG2 . VAL A 137 ? 0.3495 0.3879 0.3604 -0.0150 0.0092  -0.0266 130 VAL A CG2 
628  N N   . SER A 138 ? 0.3297 0.3631 0.3266 -0.0119 0.0051  -0.0116 131 SER A N   
629  C CA  . SER A 138 ? 0.2410 0.2728 0.2356 -0.0116 0.0030  -0.0092 131 SER A CA  
630  C C   . SER A 138 ? 0.2637 0.3040 0.2653 -0.0144 0.0028  -0.0089 131 SER A C   
631  O O   . SER A 138 ? 0.3682 0.4084 0.3693 -0.0144 0.0026  -0.0080 131 SER A O   
632  C CB  . SER A 138 ? 0.3461 0.3759 0.3400 -0.0109 0.0019  -0.0058 131 SER A CB  
633  O OG  . SER A 138 ? 0.3500 0.3782 0.3502 -0.0108 0.0016  -0.0047 131 SER A OG  
634  N N   . GLN A 139 ? 0.2609 0.3021 0.2539 -0.0146 0.0036  -0.0112 132 GLN A N   
635  C CA  . GLN A 139 ? 0.3587 0.4099 0.3605 -0.0179 0.0032  -0.0103 132 GLN A CA  
636  C C   . GLN A 139 ? 0.2686 0.3220 0.2710 -0.0189 0.0039  -0.0121 132 GLN A C   
637  O O   . GLN A 139 ? 0.1572 0.2077 0.1477 -0.0180 0.0037  -0.0116 132 GLN A O   
638  C CB  . GLN A 139 ? 0.1924 0.2493 0.1945 -0.0197 0.0035  -0.0113 132 GLN A CB  
639  C CG  . GLN A 139 ? 0.2899 0.3465 0.2810 -0.0198 0.0052  -0.0166 132 GLN A CG  
640  C CD  . GLN A 139 ? 0.3163 0.3838 0.3194 -0.0236 0.0048  -0.0153 132 GLN A CD  
641  O OE1 . GLN A 139 ? 0.4730 0.5370 0.4612 -0.0222 0.0043  -0.0137 132 GLN A OE1 
642  N NE2 . GLN A 139 ? 0.2743 0.3370 0.2650 -0.0223 0.0064  -0.0202 132 GLN A NE2 
643  N N   . PRO A 140 ? 0.3792 0.4274 0.3728 -0.0171 0.0054  -0.0170 133 PRO A N   
644  C CA  . PRO A 140 ? 0.3448 0.3955 0.3388 -0.0180 0.0061  -0.0191 133 PRO A CA  
645  C C   . PRO A 140 ? 0.4236 0.4712 0.4170 -0.0171 0.0053  -0.0165 133 PRO A C   
646  O O   . PRO A 140 ? 0.4307 0.4811 0.4227 -0.0185 0.0052  -0.0160 133 PRO A O   
647  C CB  . PRO A 140 ? 0.2072 0.2629 0.2157 -0.0193 0.0067  -0.0214 133 PRO A CB  
648  C CG  . PRO A 140 ? 0.2235 0.2761 0.2247 -0.0171 0.0099  -0.0235 133 PRO A CG  
649  C CD  . PRO A 140 ? 0.3916 0.4384 0.3874 -0.0165 0.0063  -0.0199 133 PRO A CD  
650  N N   . ARG A 141 ? 0.4014 0.4480 0.4051 -0.0166 0.0044  -0.0137 134 ARG A N   
651  C CA  . ARG A 141 ? 0.5098 0.5532 0.5126 -0.0157 0.0038  -0.0118 134 ARG A CA  
652  C C   . ARG A 141 ? 0.4647 0.5079 0.4656 -0.0162 0.0028  -0.0085 134 ARG A C   
653  O O   . ARG A 141 ? 0.5663 0.6096 0.5665 -0.0168 0.0026  -0.0077 134 ARG A O   
654  C CB  . ARG A 141 ? 0.6248 0.6589 0.6204 -0.0121 0.0039  -0.0124 134 ARG A CB  
655  C CG  . ARG A 141 ? 0.8057 0.8440 0.8118 -0.0128 0.0045  -0.0147 134 ARG A CG  
656  C CD  . ARG A 141 ? 0.9621 0.9917 0.9618 -0.0096 0.0045  -0.0150 134 ARG A CD  
657  N NE  . ARG A 141 ? 1.0611 1.0934 1.0656 -0.0093 0.0065  -0.0182 134 ARG A NE  
658  C CZ  . ARG A 141 ? 1.1841 1.2170 1.1934 -0.0085 0.0068  -0.0217 134 ARG A CZ  
659  N NH1 . ARG A 141 ? 1.2446 1.2758 1.2544 -0.0073 0.0063  -0.0212 134 ARG A NH1 
660  N NH2 . ARG A 141 ? 1.2012 1.2363 1.2158 -0.0088 0.0075  -0.0261 134 ARG A NH2 
661  N N   . LEU A 142 ? 0.3535 0.3928 0.3453 -0.0146 0.0024  -0.0074 135 LEU A N   
662  C CA  . LEU A 142 ? 0.4438 0.4839 0.4346 -0.0150 0.0014  -0.0043 135 LEU A CA  
663  C C   . LEU A 142 ? 0.4677 0.5178 0.4669 -0.0189 0.0014  -0.0041 135 LEU A C   
664  O O   . LEU A 142 ? 0.4037 0.4546 0.4025 -0.0196 0.0007  -0.0020 135 LEU A O   
665  C CB  . LEU A 142 ? 0.4307 0.4702 0.4219 -0.0141 0.0008  -0.0026 135 LEU A CB  
666  C CG  . LEU A 142 ? 0.4176 0.4551 0.4173 -0.0132 0.0003  -0.0009 135 LEU A CG  
667  C CD1 . LEU A 142 ? 0.3723 0.4071 0.3649 -0.0118 0.0002  -0.0006 135 LEU A CD1 
668  C CD2 . LEU A 142 ? 0.4055 0.4385 0.3982 -0.0116 -0.0005 0.0015  135 LEU A CD2 
669  N N   . ALA A 143 ? 0.4292 0.4795 0.4181 -0.0188 0.0024  -0.0073 136 ALA A N   
670  C CA  . ALA A 143 ? 0.4316 0.4933 0.4311 -0.0234 0.0024  -0.0070 136 ALA A CA  
671  C C   . ALA A 143 ? 0.4658 0.5228 0.4522 -0.0226 0.0028  -0.0081 136 ALA A C   
672  O O   . ALA A 143 ? 0.4380 0.5042 0.4361 -0.0270 0.0022  -0.0062 136 ALA A O   
673  C CB  . ALA A 143 ? 0.4434 0.5104 0.4438 -0.0249 0.0034  -0.0103 136 ALA A CB  
674  N N   . GLU A 144 ? 0.5229 0.5815 0.5224 -0.0234 0.0032  -0.0091 137 GLU A N   
675  C CA  . GLU A 144 ? 0.3306 0.3847 0.3176 -0.0225 0.0039  -0.0107 137 GLU A CA  
676  C C   . GLU A 144 ? 0.2479 0.3036 0.2457 -0.0244 0.0025  -0.0068 137 GLU A C   
677  O O   . GLU A 144 ? 0.4354 0.4919 0.4327 -0.0259 0.0028  -0.0072 137 GLU A O   
678  C CB  . GLU A 144 ? 0.3796 0.4318 0.3686 -0.0212 0.0049  -0.0139 137 GLU A CB  
679  C CG  . GLU A 144 ? 0.5554 0.6108 0.5461 -0.0215 0.0062  -0.0182 137 GLU A CG  
680  C CD  . GLU A 144 ? 0.8150 0.8670 0.8087 -0.0192 0.0068  -0.0205 137 GLU A CD  
681  O OE1 . GLU A 144 ? 0.8604 0.9134 0.8564 -0.0187 0.0075  -0.0237 137 GLU A OE1 
682  O OE2 . GLU A 144 ? 0.8736 0.9274 0.8787 -0.0199 0.0058  -0.0176 137 GLU A OE2 
683  N N   . LEU A 145 ? 0.3578 0.4055 0.3445 -0.0208 0.0016  -0.0043 138 LEU A N   
684  C CA  . LEU A 145 ? 0.3537 0.3982 0.3403 -0.0204 0.0007  -0.0017 138 LEU A CA  
685  C C   . LEU A 145 ? 0.4207 0.4688 0.4052 -0.0233 0.0002  -0.0004 138 LEU A C   
686  O O   . LEU A 145 ? 0.5283 0.5745 0.5121 -0.0240 -0.0002 0.0005  138 LEU A O   
687  C CB  . LEU A 145 ? 0.3292 0.3739 0.3266 -0.0199 -0.0003 0.0008  138 LEU A CB  
688  C CG  . LEU A 145 ? 0.4125 0.4524 0.4106 -0.0171 -0.0001 0.0001  138 LEU A CG  
689  C CD1 . LEU A 145 ? 0.3917 0.4291 0.3903 -0.0154 -0.0008 0.0023  138 LEU A CD1 
690  C CD2 . LEU A 145 ? 0.3227 0.3557 0.3130 -0.0149 0.0003  -0.0008 138 LEU A CD2 
691  N N   . ASN A 146 ? 0.4253 0.4788 0.4087 -0.0252 0.0001  -0.0004 139 ASN A N   
692  C CA  . ASN A 146 ? 0.6889 0.7468 0.6699 -0.0285 -0.0002 0.0004  139 ASN A CA  
693  C C   . ASN A 146 ? 0.7130 0.7777 0.6927 -0.0307 0.0004  -0.0011 139 ASN A C   
694  O O   . ASN A 146 ? 0.8612 0.9329 0.8569 -0.0324 0.0013  -0.0034 139 ASN A O   
695  C CB  . ASN A 146 ? 0.6457 0.7100 0.6382 -0.0325 -0.0027 0.0038  139 ASN A CB  
696  C CG  . ASN A 146 ? 0.4470 0.5136 0.4407 -0.0313 -0.0033 0.0063  139 ASN A CG  
697  O OD1 . ASN A 146 ? 0.6121 0.6832 0.6067 -0.0316 -0.0027 0.0057  139 ASN A OD1 
698  N ND2 . ASN A 146 ? 0.3598 0.4239 0.3536 -0.0299 -0.0043 0.0092  139 ASN A ND2 
699  N N   . SER A 147 ? 0.5674 0.6453 0.5598 -0.0378 -0.0009 0.0001  140 SER A N   
700  C CA  . SER A 147 ? 0.3988 0.4850 0.3911 -0.0407 0.0001  -0.0014 140 SER A CA  
701  C C   . SER A 147 ? 0.5004 0.5941 0.4913 -0.0429 -0.0011 0.0021  140 SER A C   
702  O O   . SER A 147 ? 0.6832 0.7838 0.6743 -0.0446 -0.0004 0.0011  140 SER A O   
703  C CB  . SER A 147 ? 0.4192 0.5106 0.4096 -0.0451 0.0006  -0.0033 140 SER A CB  
704  O OG  . SER A 147 ? 0.4087 0.4942 0.4005 -0.0433 0.0015  -0.0060 140 SER A OG  
705  N N   . TYR A 148 ? 0.4506 0.5437 0.4402 -0.0430 -0.0030 0.0064  141 TYR A N   
706  C CA  . TYR A 148 ? 0.3220 0.4239 0.3105 -0.0456 -0.0045 0.0110  141 TYR A CA  
707  C C   . TYR A 148 ? 0.4252 0.5259 0.4164 -0.0415 -0.0046 0.0127  141 TYR A C   
708  O O   . TYR A 148 ? 0.4037 0.5124 0.3947 -0.0429 -0.0059 0.0170  141 TYR A O   
709  C CB  . TYR A 148 ? 0.2178 0.3223 0.2033 -0.0494 -0.0067 0.0160  141 TYR A CB  
710  C CG  . TYR A 148 ? 0.5932 0.6884 0.5794 -0.0463 -0.0072 0.0170  141 TYR A CG  
711  C CD1 . TYR A 148 ? 0.6999 0.7875 0.6853 -0.0456 -0.0063 0.0135  141 TYR A CD1 
712  C CD2 . TYR A 148 ? 0.7636 0.8584 0.7516 -0.0440 -0.0085 0.0213  141 TYR A CD2 
713  C CE1 . TYR A 148 ? 0.8190 0.8987 0.8048 -0.0430 -0.0067 0.0142  141 TYR A CE1 
714  C CE2 . TYR A 148 ? 0.8551 0.9419 0.8439 -0.0414 -0.0089 0.0220  141 TYR A CE2 
715  C CZ  . TYR A 148 ? 0.8945 0.9737 0.8818 -0.0411 -0.0080 0.0183  141 TYR A CZ  
716  O OH  . TYR A 148 ? 0.9879 1.0599 0.9757 -0.0389 -0.0084 0.0188  141 TYR A OH  
717  N N   . VAL A 149 ? 0.3613 0.4526 0.3549 -0.0367 -0.0035 0.0098  142 VAL A N   
718  C CA  . VAL A 149 ? 0.3339 0.4239 0.3296 -0.0334 -0.0033 0.0107  142 VAL A CA  
719  C C   . VAL A 149 ? 0.3564 0.4437 0.3534 -0.0316 -0.0013 0.0065  142 VAL A C   
720  O O   . VAL A 149 ? 0.3523 0.4313 0.3504 -0.0292 -0.0002 0.0036  142 VAL A O   
721  C CB  . VAL A 149 ? 0.3827 0.4644 0.3797 -0.0297 -0.0038 0.0121  142 VAL A CB  
722  C CG1 . VAL A 149 ? 0.2240 0.3047 0.2228 -0.0266 -0.0033 0.0126  142 VAL A CG1 
723  C CG2 . VAL A 149 ? 0.3567 0.4419 0.3525 -0.0317 -0.0056 0.0168  142 VAL A CG2 
724  N N   . PRO A 150 ? 0.4023 0.4973 0.3990 -0.0330 -0.0009 0.0066  143 PRO A N   
725  C CA  . PRO A 150 ? 0.3799 0.4737 0.3773 -0.0320 0.0011  0.0030  143 PRO A CA  
726  C C   . PRO A 150 ? 0.4324 0.5177 0.4309 -0.0279 0.0016  0.0028  143 PRO A C   
727  O O   . PRO A 150 ? 0.3713 0.4576 0.3703 -0.0267 0.0006  0.0055  143 PRO A O   
728  C CB  . PRO A 150 ? 0.2519 0.3577 0.2483 -0.0350 0.0010  0.0038  143 PRO A CB  
729  C CG  . PRO A 150 ? 0.1426 0.2565 0.1379 -0.0378 -0.0011 0.0083  143 PRO A CG  
730  C CD  . PRO A 150 ? 0.2975 0.4038 0.2933 -0.0357 -0.0023 0.0107  143 PRO A CD  
731  N N   . VAL A 151 ? 0.3144 0.3953 0.3144 -0.0269 0.0003  -0.0010 144 VAL A N   
732  C CA  . VAL A 151 ? 0.1763 0.2516 0.1766 -0.0243 0.0004  -0.0012 144 VAL A CA  
733  C C   . VAL A 151 ? 0.2600 0.3379 0.2606 -0.0251 0.0013  -0.0044 144 VAL A C   
734  O O   . VAL A 151 ? 0.4397 0.5126 0.4250 -0.0243 0.0025  -0.0083 144 VAL A O   
735  C CB  . VAL A 151 ? 0.2416 0.3033 0.2287 -0.0205 0.0006  -0.0020 144 VAL A CB  
736  C CG1 . VAL A 151 ? 0.1251 0.1818 0.1136 -0.0183 0.0005  -0.0018 144 VAL A CG1 
737  C CG2 . VAL A 151 ? 0.1412 0.2064 0.1410 -0.0222 -0.0002 0.0007  144 VAL A CG2 
738  N N   . THR A 152 ? 0.2577 0.3362 0.2587 -0.0242 0.0011  -0.0038 145 THR A N   
739  C CA  . THR A 152 ? 0.2726 0.3471 0.2586 -0.0232 0.0022  -0.0076 145 THR A CA  
740  C C   . THR A 152 ? 0.3479 0.4171 0.3351 -0.0213 0.0022  -0.0077 145 THR A C   
741  O O   . THR A 152 ? 0.3765 0.4481 0.3779 -0.0213 0.0012  -0.0043 145 THR A O   
742  C CB  . THR A 152 ? 0.2846 0.3675 0.2693 -0.0251 0.0021  -0.0074 145 THR A CB  
743  O OG1 . THR A 152 ? 0.2752 0.3685 0.2702 -0.0278 0.0054  -0.0035 145 THR A OG1 
744  C CG2 . THR A 152 ? 0.2142 0.3068 0.2068 -0.0284 0.0077  -0.0107 145 THR A CG2 
745  N N   . ALA A 153 ? 0.3202 0.3893 0.3078 -0.0220 0.0033  -0.0113 146 ALA A N   
746  C CA  . ALA A 153 ? 0.2390 0.3057 0.2312 -0.0209 0.0063  -0.0107 146 ALA A CA  
747  C C   . ALA A 153 ? 0.3788 0.4525 0.3707 -0.0231 0.0068  -0.0127 146 ALA A C   
748  O O   . ALA A 153 ? 0.4449 0.5254 0.4370 -0.0256 0.0079  -0.0161 146 ALA A O   
749  C CB  . ALA A 153 ? 0.1285 0.1908 0.1214 -0.0206 0.0069  -0.0137 146 ALA A CB  
750  N N   . TYR A 154 ? 0.4072 0.4796 0.3989 -0.0222 0.0060  -0.0110 147 TYR A N   
751  C CA  . TYR A 154 ? 0.3399 0.4189 0.3314 -0.0242 0.0064  -0.0128 147 TYR A CA  
752  C C   . TYR A 154 ? 0.3301 0.4047 0.3217 -0.0239 0.0062  -0.0138 147 TYR A C   
753  O O   . TYR A 154 ? 0.3119 0.3810 0.3035 -0.0217 0.0052  -0.0107 147 TYR A O   
754  C CB  . TYR A 154 ? 0.2783 0.3631 0.2696 -0.0240 0.0056  -0.0096 147 TYR A CB  
755  C CG  . TYR A 154 ? 0.3499 0.4421 0.3410 -0.0258 0.0058  -0.0110 147 TYR A CG  
756  C CD1 . TYR A 154 ? 0.2669 0.3679 0.2577 -0.0289 0.0069  -0.0146 147 TYR A CD1 
757  C CD2 . TYR A 154 ? 0.2883 0.3792 0.2795 -0.0246 0.0051  -0.0093 147 TYR A CD2 
758  C CE1 . TYR A 154 ? 0.2923 0.4008 0.2829 -0.0308 0.0072  -0.0163 147 TYR A CE1 
759  C CE2 . TYR A 154 ? 0.4101 0.5085 0.4010 -0.0264 0.0053  -0.0109 147 TYR A CE2 
760  C CZ  . TYR A 154 ? 0.4102 0.5175 0.4009 -0.0295 0.0064  -0.0144 147 TYR A CZ  
761  O OH  . TYR A 154 ? 0.2953 0.4106 0.2857 -0.0316 0.0068  -0.0164 147 TYR A OH  
762  N N   . THR A 155 ? 0.3745 0.4521 0.3669 -0.0265 0.0076  -0.0183 148 THR A N   
763  C CA  . THR A 155 ? 0.4070 0.4811 0.3998 -0.0270 0.0079  -0.0197 148 THR A CA  
764  C C   . THR A 155 ? 0.3555 0.4355 0.3479 -0.0292 0.0082  -0.0208 148 THR A C   
765  O O   . THR A 155 ? 0.4410 0.5194 0.4338 -0.0306 0.0089  -0.0227 148 THR A O   
766  C CB  . THR A 155 ? 0.4118 0.4844 0.4068 -0.0287 0.0098  -0.0246 148 THR A CB  
767  O OG1 . THR A 155 ? 0.4070 0.4869 0.4031 -0.0318 0.0116  -0.0295 148 THR A OG1 
768  C CG2 . THR A 155 ? 0.3001 0.3677 0.2959 -0.0266 0.0095  -0.0239 148 THR A CG2 
769  N N   . GLY A 156 ? 0.2322 0.3193 0.2238 -0.0296 0.0078  -0.0198 149 GLY A N   
770  C CA  . GLY A 156 ? 0.3238 0.4179 0.3150 -0.0317 0.0081  -0.0211 149 GLY A CA  
771  C C   . GLY A 156 ? 0.3852 0.4786 0.3759 -0.0298 0.0067  -0.0173 149 GLY A C   
772  O O   . GLY A 156 ? 0.4269 0.5132 0.4177 -0.0270 0.0056  -0.0139 149 GLY A O   
773  N N   . PRO A 157 ? 0.3956 0.4974 0.3861 -0.0315 0.0069  -0.0182 150 PRO A N   
774  C CA  . PRO A 157 ? 0.3926 0.4951 0.3830 -0.0299 0.0058  -0.0154 150 PRO A CA  
775  C C   . PRO A 157 ? 0.3455 0.4516 0.3363 -0.0273 0.0047  -0.0113 150 PRO A C   
776  O O   . PRO A 157 ? 0.3094 0.4218 0.3003 -0.0280 0.0049  -0.0114 150 PRO A O   
777  C CB  . PRO A 157 ? 0.4671 0.5784 0.4573 -0.0333 0.0067  -0.0189 150 PRO A CB  
778  C CG  . PRO A 157 ? 0.4923 0.6106 0.4824 -0.0359 0.0079  -0.0221 150 PRO A CG  
779  C CD  . PRO A 157 ? 0.5289 0.6403 0.5193 -0.0352 0.0082  -0.0224 150 PRO A CD  
780  N N   . LEU A 158 ? 0.4135 0.5164 0.4049 -0.0245 0.0037  -0.0080 151 LEU A N   
781  C CA  . LEU A 158 ? 0.3565 0.4642 0.3489 -0.0222 0.0030  -0.0043 151 LEU A CA  
782  C C   . LEU A 158 ? 0.4096 0.5304 0.4022 -0.0233 0.0030  -0.0049 151 LEU A C   
783  O O   . LEU A 158 ? 0.4986 0.6233 0.4918 -0.0220 0.0025  -0.0037 151 LEU A O   
784  C CB  . LEU A 158 ? 0.2059 0.3058 0.1990 -0.0191 0.0023  -0.0011 151 LEU A CB  
785  C CG  . LEU A 158 ? 0.3915 0.4795 0.3843 -0.0182 0.0023  -0.0009 151 LEU A CG  
786  C CD1 . LEU A 158 ? 0.4886 0.5690 0.4823 -0.0154 0.0018  0.0018  151 LEU A CD1 
787  C CD2 . LEU A 158 ? 0.2425 0.3310 0.2354 -0.0186 0.0026  -0.0008 151 LEU A CD2 
788  N N   . VAL A 159 ? 0.4018 0.5304 0.3940 -0.0259 0.0036  -0.0072 152 VAL A N   
789  C CA  . VAL A 159 ? 0.3463 0.4887 0.3385 -0.0275 0.0038  -0.0084 152 VAL A CA  
790  C C   . VAL A 159 ? 0.3063 0.4573 0.2998 -0.0252 0.0029  -0.0042 152 VAL A C   
791  O O   . VAL A 159 ? 0.3140 0.4609 0.3081 -0.0238 0.0026  -0.0014 152 VAL A O   
792  C CB  . VAL A 159 ? 0.3035 0.4505 0.2948 -0.0315 0.0050  -0.0129 152 VAL A CB  
793  C CG1 . VAL A 159 ? 0.2435 0.4010 0.2350 -0.0322 0.0049  -0.0120 152 VAL A CG1 
794  C CG2 . VAL A 159 ? 0.2721 0.4244 0.2630 -0.0343 0.0058  -0.0170 152 VAL A CG2 
795  N N   . GLU A 160 ? 0.4556 0.6193 0.4497 -0.0248 0.0026  -0.0037 153 GLU A N   
796  C CA  . GLU A 160 ? 0.4893 0.6617 0.4849 -0.0218 0.0017  0.0011  153 GLU A CA  
797  C C   . GLU A 160 ? 0.5448 0.7241 0.5409 -0.0225 0.0014  0.0033  153 GLU A C   
798  O O   . GLU A 160 ? 0.6180 0.7980 0.6153 -0.0201 0.0007  0.0079  153 GLU A O   
799  C CB  . GLU A 160 ? 0.4793 0.6648 0.4757 -0.0204 0.0013  0.0014  153 GLU A CB  
800  C CG  . GLU A 160 ? 0.7712 0.9704 0.7669 -0.0235 0.0017  -0.0020 153 GLU A CG  
801  C CD  . GLU A 160 ? 0.7761 0.9897 0.7728 -0.0215 0.0012  -0.0014 153 GLU A CD  
802  O OE1 . GLU A 160 ? 0.8530 1.0811 0.8495 -0.0234 0.0014  -0.0033 153 GLU A OE1 
803  O OE2 . GLU A 160 ? 0.5896 0.8007 0.5872 -0.0179 0.0007  0.0008  153 GLU A OE2 
804  N N   . ASP A 161 ? 0.4737 0.6582 0.4687 -0.0262 0.0021  0.0000  154 ASP A N   
805  C CA  . ASP A 161 ? 0.2932 0.4838 0.2883 -0.0275 0.0019  0.0018  154 ASP A CA  
806  C C   . ASP A 161 ? 0.3275 0.5050 0.3223 -0.0279 0.0022  0.0017  154 ASP A C   
807  O O   . ASP A 161 ? 0.3864 0.5678 0.3814 -0.0289 0.0020  0.0036  154 ASP A O   
808  C CB  . ASP A 161 ? 0.3762 0.5793 0.3703 -0.0314 0.0026  -0.0017 154 ASP A CB  
809  C CG  . ASP A 161 ? 0.4569 0.6777 0.4518 -0.0306 0.0019  0.0000  154 ASP A CG  
810  O OD1 . ASP A 161 ? 0.4616 0.6904 0.4558 -0.0331 0.0026  -0.0040 154 ASP A OD1 
811  O OD2 . ASP A 161 ? 0.3541 0.5811 0.3504 -0.0274 0.0008  0.0055  154 ASP A OD2 
812  N N   . PHE A 162 ? 0.3765 0.5394 0.3707 -0.0273 0.0027  -0.0004 155 PHE A N   
813  C CA  . PHE A 162 ? 0.3397 0.4906 0.3338 -0.0268 0.0029  0.0000  155 PHE A CA  
814  C C   . PHE A 162 ? 0.3979 0.5450 0.3936 -0.0235 0.0019  0.0050  155 PHE A C   
815  O O   . PHE A 162 ? 0.4370 0.5859 0.4335 -0.0235 0.0014  0.0076  155 PHE A O   
816  C CB  . PHE A 162 ? 0.3891 0.5272 0.3820 -0.0272 0.0037  -0.0037 155 PHE A CB  
817  C CG  . PHE A 162 ? 0.3892 0.5153 0.3822 -0.0260 0.0037  -0.0030 155 PHE A CG  
818  C CD1 . PHE A 162 ? 0.4011 0.5172 0.3947 -0.0231 0.0032  -0.0005 155 PHE A CD1 
819  C CD2 . PHE A 162 ? 0.3155 0.4409 0.3078 -0.0280 0.0045  -0.0052 155 PHE A CD2 
820  C CE1 . PHE A 162 ? 0.2919 0.3977 0.2856 -0.0220 0.0032  -0.0001 155 PHE A CE1 
821  C CE2 . PHE A 162 ? 0.3539 0.4694 0.3462 -0.0268 0.0046  -0.0048 155 PHE A CE2 
822  C CZ  . PHE A 162 ? 0.3153 0.4210 0.3084 -0.0238 0.0039  -0.0022 155 PHE A CZ  
823  N N   . LEU A 163 ? 0.2945 0.4374 0.2908 -0.0209 0.0016  0.0061  156 LEU A N   
824  C CA  . LEU A 163 ? 0.2830 0.4235 0.2810 -0.0176 0.0008  0.0105  156 LEU A CA  
825  C C   . LEU A 163 ? 0.3281 0.4815 0.3276 -0.0170 0.0001  0.0150  156 LEU A C   
826  O O   . LEU A 163 ? 0.4062 0.5571 0.4071 -0.0155 -0.0005 0.0185  156 LEU A O   
827  C CB  . LEU A 163 ? 0.2112 0.3517 0.2095 -0.0153 0.0007  0.0108  156 LEU A CB  
828  C CG  . LEU A 163 ? 0.2891 0.4176 0.2863 -0.0155 0.0012  0.0077  156 LEU A CG  
829  C CD1 . LEU A 163 ? 0.2550 0.3887 0.2524 -0.0141 0.0010  0.0077  156 LEU A CD1 
830  C CD2 . LEU A 163 ? 0.2088 0.3238 0.2064 -0.0138 0.0011  0.0090  156 LEU A CD2 
831  N N   . SER A 164 ? 0.3275 0.4955 0.3267 -0.0181 -0.0001 0.0150  157 SER A N   
832  C CA  . SER A 164 ? 0.4489 0.6322 0.4494 -0.0174 -0.0010 0.0200  157 SER A CA  
833  C C   . SER A 164 ? 0.4843 0.6679 0.4853 -0.0192 -0.0015 0.0224  157 SER A C   
834  O O   . SER A 164 ? 0.5144 0.7070 0.5169 -0.0178 -0.0024 0.0282  157 SER A O   
835  C CB  . SER A 164 ? 0.3615 0.5606 0.3614 -0.0192 -0.0010 0.0186  157 SER A CB  
836  O OG  . SER A 164 ? 0.5706 0.7822 0.5718 -0.0158 -0.0015 0.0226  157 SER A OG  
837  N N   . GLY A 165 ? 0.2019 0.3763 0.2015 -0.0221 -0.0009 0.0184  158 GLY A N   
838  C CA  . GLY A 165 ? 0.2102 0.3836 0.2100 -0.0238 -0.0013 0.0202  158 GLY A CA  
839  C C   . GLY A 165 ? 0.2812 0.4430 0.2823 -0.0217 -0.0017 0.0224  158 GLY A C   
840  O O   . GLY A 165 ? 0.4852 0.6399 0.4857 -0.0235 -0.0016 0.0210  158 GLY A O   
841  N N   . PHE A 166 ? 0.2966 0.4571 0.2992 -0.0181 -0.0020 0.0258  159 PHE A N   
842  C CA  . PHE A 166 ? 0.3181 0.4676 0.3220 -0.0160 -0.0022 0.0275  159 PHE A CA  
843  C C   . PHE A 166 ? 0.3546 0.5093 0.3604 -0.0121 -0.0032 0.0336  159 PHE A C   
844  O O   . PHE A 166 ? 0.3055 0.4651 0.3108 -0.0094 -0.0045 0.0346  159 PHE A O   
845  C CB  . PHE A 166 ? 0.2022 0.3361 0.2053 -0.0149 -0.0013 0.0230  159 PHE A CB  
846  C CG  . PHE A 166 ? 0.1693 0.2944 0.1707 -0.0174 -0.0006 0.0180  159 PHE A CG  
847  C CD1 . PHE A 166 ? 0.2064 0.3305 0.2060 -0.0186 0.0003  0.0139  159 PHE A CD1 
848  C CD2 . PHE A 166 ? 0.3151 0.4340 0.3166 -0.0184 -0.0007 0.0178  159 PHE A CD2 
849  C CE1 . PHE A 166 ? 0.2683 0.3855 0.2665 -0.0205 0.0012  0.0099  159 PHE A CE1 
850  C CE2 . PHE A 166 ? 0.0464 0.1584 0.0465 -0.0201 0.0001  0.0135  159 PHE A CE2 
851  C CZ  . PHE A 166 ? 0.1551 0.2663 0.1536 -0.0210 0.0011  0.0099  159 PHE A CZ  
852  N N   . GLN A 167 ? 0.2878 0.4334 0.2936 -0.0107 -0.0047 0.0359  160 GLN A N   
853  C CA  . GLN A 167 ? 0.2629 0.4027 0.2673 -0.0055 -0.0079 0.0402  160 GLN A CA  
854  C C   . GLN A 167 ? 0.3572 0.4865 0.3630 -0.0029 -0.0066 0.0388  160 GLN A C   
855  O O   . GLN A 167 ? 0.4034 0.5284 0.4087 0.0018  -0.0084 0.0410  160 GLN A O   
856  C CB  . GLN A 167 ? 0.2780 0.4140 0.2798 -0.0057 -0.0107 0.0440  160 GLN A CB  
857  C CG  . GLN A 167 ? 0.2446 0.3909 0.2439 -0.0076 -0.0129 0.0467  160 GLN A CG  
858  C CD  . GLN A 167 ? 0.4093 0.5640 0.4098 -0.0139 -0.0105 0.0432  160 GLN A CD  
859  O OE1 . GLN A 167 ? 0.5675 0.7177 0.5694 -0.0169 -0.0084 0.0403  160 GLN A OE1 
860  N NE2 . GLN A 167 ? 0.3642 0.5313 0.3640 -0.0158 -0.0109 0.0433  160 GLN A NE2 
861  N N   . VAL A 168 ? 0.3726 0.4980 0.3802 -0.0058 -0.0036 0.0352  161 VAL A N   
862  C CA  . VAL A 168 ? 0.3096 0.4258 0.3184 -0.0042 -0.0020 0.0335  161 VAL A CA  
863  C C   . VAL A 168 ? 0.2924 0.4004 0.2995 -0.0062 -0.0009 0.0274  161 VAL A C   
864  O O   . VAL A 168 ? 0.1349 0.2405 0.1407 -0.0090 -0.0010 0.0243  161 VAL A O   
865  C CB  . VAL A 168 ? 0.4231 0.5296 0.4322 -0.0040 -0.0026 0.0342  161 VAL A CB  
866  C CG1 . VAL A 168 ? 0.3885 0.4864 0.3985 -0.0014 -0.0015 0.0332  161 VAL A CG1 
867  C CG2 . VAL A 168 ? 0.3626 0.4670 0.3686 -0.0020 -0.0060 0.0386  161 VAL A CG2 
868  N N   . VAL A 169 ? 0.1992 0.3022 0.2059 -0.0044 -0.0002 0.0257  162 VAL A N   
869  C CA  . VAL A 169 ? 0.2156 0.3089 0.2203 -0.0058 0.0003  0.0207  162 VAL A CA  
870  C C   . VAL A 169 ? 0.2514 0.3336 0.2564 -0.0043 0.0006  0.0196  162 VAL A C   
871  O O   . VAL A 169 ? 0.2884 0.3726 0.2942 -0.0019 0.0008  0.0217  162 VAL A O   
872  C CB  . VAL A 169 ? 0.2619 0.3617 0.2654 -0.0058 0.0004  0.0195  162 VAL A CB  
873  C CG1 . VAL A 169 ? 0.2708 0.3608 0.2724 -0.0070 0.0009  0.0154  162 VAL A CG1 
874  C CG2 . VAL A 169 ? 0.3010 0.4126 0.3042 -0.0075 0.0001  0.0200  162 VAL A CG2 
875  N N   . VAL A 170 ? 0.3104 0.3816 0.3147 -0.0055 0.0009  0.0165  163 VAL A N   
876  C CA  . VAL A 170 ? 0.2731 0.3338 0.2772 -0.0046 0.0012  0.0149  163 VAL A CA  
877  C C   . VAL A 170 ? 0.3000 0.3587 0.3071 -0.0051 -0.0011 0.0115  163 VAL A C   
878  O O   . VAL A 170 ? 0.3442 0.3975 0.3403 -0.0063 -0.0013 0.0108  163 VAL A O   
879  C CB  . VAL A 170 ? 0.2757 0.3306 0.2838 -0.0045 -0.0012 0.0133  163 VAL A CB  
880  C CG1 . VAL A 170 ? 0.2260 0.2699 0.2253 -0.0032 -0.0009 0.0139  163 VAL A CG1 
881  C CG2 . VAL A 170 ? 0.2653 0.3244 0.2718 -0.0048 0.0005  0.0169  163 VAL A CG2 
882  N N   . LEU A 171 ? 0.3425 0.3948 0.3398 -0.0038 -0.0008 0.0124  164 LEU A N   
883  C CA  . LEU A 171 ? 0.2781 0.3338 0.2842 -0.0054 -0.0010 0.0096  164 LEU A CA  
884  C C   . LEU A 171 ? 0.3084 0.3525 0.3057 -0.0047 -0.0010 0.0100  164 LEU A C   
885  O O   . LEU A 171 ? 0.3261 0.3683 0.3243 -0.0033 -0.0008 0.0109  164 LEU A O   
886  C CB  . LEU A 171 ? 0.1813 0.2388 0.1800 -0.0051 0.0013  0.0105  164 LEU A CB  
887  C CG  . LEU A 171 ? 0.2652 0.3340 0.2639 -0.0059 0.0012  0.0108  164 LEU A CG  
888  C CD1 . LEU A 171 ? 0.3619 0.4384 0.3602 -0.0058 0.0009  0.0104  164 LEU A CD1 
889  C CD2 . LEU A 171 ? 0.2510 0.3186 0.2483 -0.0081 0.0012  0.0088  164 LEU A CD2 
890  N N   . THR A 172 ? 0.3954 0.4403 0.3999 -0.0065 -0.0011 0.0077  165 THR A N   
891  C CA  . THR A 172 ? 0.2858 0.3208 0.2829 -0.0058 -0.0013 0.0079  165 THR A CA  
892  C C   . THR A 172 ? 0.4089 0.4467 0.4118 -0.0078 -0.0012 0.0060  165 THR A C   
893  O O   . THR A 172 ? 0.3824 0.4199 0.3776 -0.0083 -0.0012 0.0056  165 THR A O   
894  C CB  . THR A 172 ? 0.2155 0.2475 0.2129 -0.0058 -0.0013 0.0076  165 THR A CB  
895  O OG1 . THR A 172 ? 0.3918 0.4218 0.3902 -0.0046 -0.0013 0.0086  165 THR A OG1 
896  C CG2 . THR A 172 ? 0.1929 0.2210 0.1898 -0.0064 -0.0014 0.0063  165 THR A CG2 
897  N N   . ASN A 173 ? 0.4912 0.5255 0.4937 -0.0079 -0.0013 0.0058  166 ASN A N   
898  C CA  . ASN A 173 ? 0.2260 0.2565 0.2212 -0.0086 -0.0014 0.0053  166 ASN A CA  
899  C C   . ASN A 173 ? 0.3964 0.4320 0.3906 -0.0100 -0.0012 0.0045  166 ASN A C   
900  O O   . ASN A 173 ? 0.2536 0.2893 0.2465 -0.0116 -0.0009 0.0032  166 ASN A O   
901  C CB  . ASN A 173 ? 0.1752 0.2030 0.1700 -0.0091 -0.0013 0.0044  166 ASN A CB  
902  C CG  . ASN A 173 ? 0.4358 0.4629 0.4354 -0.0108 -0.0013 0.0036  166 ASN A CG  
903  O OD1 . ASN A 173 ? 0.4493 0.4713 0.4439 -0.0094 -0.0017 0.0047  166 ASN A OD1 
904  N ND2 . ASN A 173 ? 0.3002 0.3255 0.2930 -0.0113 -0.0010 0.0027  166 ASN A ND2 
905  N N   . THR A 174 ? 0.3651 0.4050 0.3595 -0.0094 -0.0011 0.0051  167 THR A N   
906  C CA  . THR A 174 ? 0.2542 0.3040 0.2566 -0.0115 -0.0008 0.0038  167 THR A CA  
907  C C   . THR A 174 ? 0.2554 0.3043 0.2488 -0.0112 -0.0004 0.0040  167 THR A C   
908  O O   . THR A 174 ? 0.2715 0.3198 0.2657 -0.0096 -0.0005 0.0050  167 THR A O   
909  C CB  . THR A 174 ? 0.4549 0.5101 0.4583 -0.0104 -0.0008 0.0045  167 THR A CB  
910  O OG1 . THR A 174 ? 0.5055 0.5592 0.5088 -0.0104 -0.0008 0.0045  167 THR A OG1 
911  C CG2 . THR A 174 ? 0.3873 0.4485 0.3813 -0.0114 0.0003  0.0040  167 THR A CG2 
912  N N   . PRO A 175 ? 0.2512 0.3049 0.2439 -0.0140 -0.0003 0.0025  168 PRO A N   
913  C CA  . PRO A 175 ? 0.0732 0.1321 0.0657 -0.0155 -0.0002 0.0018  168 PRO A CA  
914  C C   . PRO A 175 ? 0.2776 0.3441 0.2711 -0.0141 -0.0002 0.0021  168 PRO A C   
915  O O   . PRO A 175 ? 0.1959 0.2664 0.1900 -0.0131 0.0000  0.0026  168 PRO A O   
916  C CB  . PRO A 175 ? 0.1106 0.1744 0.1019 -0.0194 0.0003  -0.0005 168 PRO A CB  
917  C CG  . PRO A 175 ? 0.2061 0.2643 0.1968 -0.0199 0.0004  -0.0008 168 PRO A CG  
918  C CD  . PRO A 175 ? 0.2114 0.2658 0.2031 -0.0165 0.0001  0.0008  168 PRO A CD  
919  N N   . LEU A 176 ? 0.4067 0.4763 0.4006 -0.0140 -0.0002 0.0020  169 LEU A N   
920  C CA  . LEU A 176 ? 0.2905 0.3680 0.2856 -0.0120 -0.0002 0.0025  169 LEU A CA  
921  C C   . LEU A 176 ? 0.3568 0.4455 0.3522 -0.0128 0.0001  0.0012  169 LEU A C   
922  O O   . LEU A 176 ? 0.1969 0.2911 0.1933 -0.0103 0.0001  0.0024  169 LEU A O   
923  C CB  . LEU A 176 ? 0.2077 0.2883 0.2032 -0.0124 -0.0002 0.0017  169 LEU A CB  
924  C CG  . LEU A 176 ? 0.1760 0.2661 0.1729 -0.0097 -0.0001 0.0019  169 LEU A CG  
925  C CD1 . LEU A 176 ? 0.2502 0.3360 0.2479 -0.0060 -0.0002 0.0047  169 LEU A CD1 
926  C CD2 . LEU A 176 ? 0.1355 0.2291 0.1327 -0.0105 -0.0001 0.0003  169 LEU A CD2 
927  N N   . GLU A 177 ? 0.2849 0.3776 0.2794 -0.0163 0.0005  -0.0013 170 GLU A N   
928  C CA  . GLU A 177 ? 0.4190 0.5227 0.4136 -0.0175 0.0008  -0.0032 170 GLU A CA  
929  C C   . GLU A 177 ? 0.4611 0.5651 0.4559 -0.0163 0.0008  -0.0020 170 GLU A C   
930  O O   . GLU A 177 ? 0.4335 0.5471 0.4291 -0.0149 0.0007  -0.0017 170 GLU A O   
931  C CB  . GLU A 177 ? 0.4588 0.5652 0.4521 -0.0222 0.0015  -0.0064 170 GLU A CB  
932  C CG  . GLU A 177 ? 0.7030 0.8003 0.6948 -0.0245 0.0018  -0.0066 170 GLU A CG  
933  C CD  . GLU A 177 ? 0.9355 1.0374 0.9260 -0.0294 0.0029  -0.0100 170 GLU A CD  
934  O OE1 . GLU A 177 ? 1.0716 1.1679 1.0609 -0.0316 0.0034  -0.0107 170 GLU A OE1 
935  O OE2 . GLU A 177 ? 0.8581 0.9696 0.8488 -0.0312 0.0034  -0.0123 170 GLU A OE2 
936  N N   . ASP A 178 ? 0.3435 0.4378 0.3375 -0.0168 0.0008  -0.0013 171 ASP A N   
937  C CA  . ASP A 178 ? 0.3173 0.4115 0.3114 -0.0159 0.0008  -0.0004 171 ASP A CA  
938  C C   . ASP A 178 ? 0.2871 0.3816 0.2825 -0.0123 0.0006  0.0026  171 ASP A C   
939  O O   . ASP A 178 ? 0.4159 0.5171 0.4118 -0.0114 0.0006  0.0035  171 ASP A O   
940  C CB  . ASP A 178 ? 0.2927 0.3771 0.2858 -0.0170 0.0009  -0.0008 171 ASP A CB  
941  C CG  . ASP A 178 ? 0.5260 0.6111 0.5179 -0.0208 0.0015  -0.0037 171 ASP A CG  
942  O OD1 . ASP A 178 ? 0.7271 0.8045 0.7183 -0.0217 0.0015  -0.0038 171 ASP A OD1 
943  O OD2 . ASP A 178 ? 0.5832 0.6774 0.5749 -0.0232 0.0020  -0.0060 171 ASP A OD2 
944  N N   . GLN A 179 ? 0.2360 0.3239 0.2318 -0.0103 0.0003  0.0042  172 GLN A N   
945  C CA  . GLN A 179 ? 0.3020 0.3910 0.2991 -0.0070 0.0004  0.0069  172 GLN A CA  
946  C C   . GLN A 179 ? 0.3210 0.4244 0.3192 -0.0054 0.0003  0.0073  172 GLN A C   
947  O O   . GLN A 179 ? 0.2514 0.3606 0.2505 -0.0033 0.0004  0.0096  172 GLN A O   
948  C CB  . GLN A 179 ? 0.1991 0.2801 0.1966 -0.0056 0.0003  0.0077  172 GLN A CB  
949  C CG  . GLN A 179 ? 0.1334 0.2015 0.1300 -0.0067 0.0002  0.0073  172 GLN A CG  
950  C CD  . GLN A 179 ? 0.3108 0.3721 0.3078 -0.0050 0.0001  0.0082  172 GLN A CD  
951  O OE1 . GLN A 179 ? 0.2752 0.3403 0.2733 -0.0029 0.0003  0.0097  172 GLN A OE1 
952  N NE2 . GLN A 179 ? 0.3137 0.3659 0.3098 -0.0059 -0.0002 0.0074  172 GLN A NE2 
953  N N   . LEU A 180 ? 0.3952 0.5054 0.3933 -0.0062 0.0002  0.0053  173 LEU A N   
954  C CA  . LEU A 180 ? 0.3373 0.4625 0.3363 -0.0042 0.0001  0.0051  173 LEU A CA  
955  C C   . LEU A 180 ? 0.2978 0.4319 0.2968 -0.0051 0.0002  0.0047  173 LEU A C   
956  O O   . LEU A 180 ? 0.1844 0.3295 0.1843 -0.0023 0.0000  0.0065  173 LEU A O   
957  C CB  . LEU A 180 ? 0.3417 0.4729 0.3406 -0.0056 0.0001  0.0019  173 LEU A CB  
958  C CG  . LEU A 180 ? 0.4810 0.6040 0.4797 -0.0065 0.0001  0.0011  173 LEU A CG  
959  C CD1 . LEU A 180 ? 0.3480 0.4781 0.3465 -0.0094 0.0003  -0.0027 173 LEU A CD1 
960  C CD2 . LEU A 180 ? 0.5099 0.6323 0.5096 -0.0024 0.0000  0.0033  173 LEU A CD2 
961  N N   . ARG A 181 ? 0.1492 0.2794 0.1469 -0.0090 0.0004  0.0025  174 ARG A N   
962  C CA  . ARG A 181 ? 0.2195 0.3582 0.2170 -0.0107 0.0005  0.0014  174 ARG A CA  
963  C C   . ARG A 181 ? 0.3249 0.4633 0.3229 -0.0090 0.0005  0.0045  174 ARG A C   
964  O O   . ARG A 181 ? 0.4013 0.5515 0.4000 -0.0077 0.0003  0.0058  174 ARG A O   
965  C CB  . ARG A 181 ? 0.1936 0.3274 0.1896 -0.0152 0.0010  -0.0019 174 ARG A CB  
966  C CG  . ARG A 181 ? 0.2174 0.3628 0.2131 -0.0177 0.0014  -0.0045 174 ARG A CG  
967  C CD  . ARG A 181 ? 0.3176 0.4575 0.3120 -0.0210 0.0019  -0.0063 174 ARG A CD  
968  N NE  . ARG A 181 ? 0.5079 0.6347 0.5014 -0.0224 0.0022  -0.0071 174 ARG A NE  
969  C CZ  . ARG A 181 ? 0.6903 0.8075 0.6832 -0.0223 0.0022  -0.0063 174 ARG A CZ  
970  N NH1 . ARG A 181 ? 0.7694 0.8880 0.7626 -0.0213 0.0021  -0.0049 174 ARG A NH1 
971  N NH2 . ARG A 181 ? 0.6646 0.7717 0.6567 -0.0234 0.0024  -0.0070 174 ARG A NH2 
972  N N   . VAL A 182 ? 0.3617 0.4870 0.3593 -0.0091 0.0005  0.0057  175 VAL A N   
973  C CA  . VAL A 182 ? 0.3017 0.4256 0.2999 -0.0081 0.0006  0.0083  175 VAL A CA  
974  C C   . VAL A 182 ? 0.3150 0.4458 0.3150 -0.0041 0.0004  0.0122  175 VAL A C   
975  O O   . VAL A 182 ? 0.3676 0.5071 0.3685 -0.0030 0.0002  0.0147  175 VAL A O   
976  C CB  . VAL A 182 ? 0.1576 0.2664 0.1553 -0.0089 0.0007  0.0082  175 VAL A CB  
977  C CG1 . VAL A 182 ? 0.1243 0.2316 0.1232 -0.0074 0.0007  0.0112  175 VAL A CG1 
978  C CG2 . VAL A 182 ? 0.0509 0.1559 0.0470 -0.0123 0.0010  0.0050  175 VAL A CG2 
979  N N   . GLY A 183 ? 0.2011 0.3292 0.2015 -0.0018 0.0004  0.0128  176 GLY A N   
980  C CA  . GLY A 183 ? 0.2054 0.3391 0.2073 0.0027  0.0004  0.0165  176 GLY A CA  
981  C C   . GLY A 183 ? 0.2154 0.3618 0.2202 0.0056  -0.0015 0.0171  176 GLY A C   
982  O O   . GLY A 183 ? 0.2809 0.4289 0.2889 0.0093  -0.0035 0.0203  176 GLY A O   
983  N N   . GLU A 184 ? 0.3176 0.4722 0.3218 0.0040  -0.0015 0.0138  177 GLU A N   
984  C CA  . GLU A 184 ? 0.4564 0.6232 0.4644 0.0069  -0.0038 0.0140  177 GLU A CA  
985  C C   . GLU A 184 ? 0.3622 0.5360 0.3698 0.0061  -0.0042 0.0159  177 GLU A C   
986  O O   . GLU A 184 ? 0.3625 0.5418 0.3734 0.0098  -0.0068 0.0189  177 GLU A O   
987  C CB  . GLU A 184 ? 0.5772 0.7522 0.5853 0.0054  -0.0037 0.0097  177 GLU A CB  
988  C CG  . GLU A 184 ? 0.8729 1.0520 0.8767 -0.0002 -0.0018 0.0063  177 GLU A CG  
989  C CD  . GLU A 184 ? 1.0737 1.2674 1.0791 -0.0008 -0.0025 0.0032  177 GLU A CD  
990  O OE1 . GLU A 184 ? 1.1845 1.3843 1.1945 0.0032  -0.0044 0.0034  177 GLU A OE1 
991  O OE2 . GLU A 184 ? 1.0558 1.2550 1.0581 -0.0052 -0.0012 0.0005  177 GLU A OE2 
992  N N   . PHE A 185 ? 0.2642 0.4371 0.2679 0.0012  -0.0019 0.0142  178 PHE A N   
993  C CA  . PHE A 185 ? 0.3480 0.5271 0.3514 -0.0003 -0.0019 0.0158  178 PHE A CA  
994  C C   . PHE A 185 ? 0.4707 0.6451 0.4762 0.0025  -0.0034 0.0206  178 PHE A C   
995  O O   . PHE A 185 ? 0.5294 0.7113 0.5368 0.0046  -0.0059 0.0235  178 PHE A O   
996  C CB  . PHE A 185 ? 0.3620 0.5362 0.3624 -0.0058 -0.0001 0.0125  178 PHE A CB  
997  C CG  . PHE A 185 ? 0.6517 0.8337 0.6521 -0.0077 -0.0002 0.0134  178 PHE A CG  
998  C CD1 . PHE A 185 ? 0.6462 0.8445 0.6465 -0.0086 -0.0004 0.0124  178 PHE A CD1 
999  C CD2 . PHE A 185 ? 0.7398 0.9142 0.7404 -0.0087 -0.0002 0.0151  178 PHE A CD2 
1000 C CE1 . PHE A 185 ? 0.5691 0.7758 0.5693 -0.0106 -0.0005 0.0132  178 PHE A CE1 
1001 C CE2 . PHE A 185 ? 0.8677 1.0504 0.8682 -0.0108 -0.0004 0.0159  178 PHE A CE2 
1002 C CZ  . PHE A 185 ? 0.7529 0.9518 0.7531 -0.0118 -0.0005 0.0150  178 PHE A CZ  
1003 N N   . CYS A 186 ? 0.4038 0.5657 0.4085 0.0023  -0.0022 0.0216  179 CYS A N   
1004 C CA  . CYS A 186 ? 0.3537 0.5102 0.3599 0.0041  -0.0033 0.0256  179 CYS A CA  
1005 C C   . CYS A 186 ? 0.2161 0.3745 0.2253 0.0098  -0.0071 0.0290  179 CYS A C   
1006 O O   . CYS A 186 ? 0.3118 0.4725 0.3217 0.0114  -0.0095 0.0327  179 CYS A O   
1007 C CB  . CYS A 186 ? 0.3179 0.4611 0.3233 0.0034  -0.0014 0.0255  179 CYS A CB  
1008 S SG  . CYS A 186 ? 0.3319 0.4661 0.3354 -0.0021 0.0001  0.0222  179 CYS A SG  
1009 N N   . HIS A 187 ? 0.2636 0.4213 0.2745 0.0127  -0.0078 0.0278  180 HIS A N   
1010 C CA  . HIS A 187 ? 0.3575 0.5160 0.3720 0.0187  -0.0115 0.0306  180 HIS A CA  
1011 C C   . HIS A 187 ? 0.4635 0.6351 0.4795 0.0204  -0.0144 0.0321  180 HIS A C   
1012 O O   . HIS A 187 ? 0.6148 0.7870 0.6328 0.0249  -0.0181 0.0361  180 HIS A O   
1013 C CB  . HIS A 187 ? 0.2686 0.4250 0.2853 0.0210  -0.0113 0.0280  180 HIS A CB  
1014 C CG  . HIS A 187 ? 0.2968 0.4529 0.3182 0.0274  -0.0149 0.0304  180 HIS A CG  
1015 N ND1 . HIS A 187 ? 0.4376 0.5825 0.4600 0.0305  -0.0158 0.0327  180 HIS A ND1 
1016 C CD2 . HIS A 187 ? 0.3289 0.4946 0.3547 0.0316  -0.0181 0.0308  180 HIS A CD2 
1017 C CE1 . HIS A 187 ? 0.3980 0.5448 0.4253 0.0364  -0.0194 0.0344  180 HIS A CE1 
1018 N NE2 . HIS A 187 ? 0.4547 0.6142 0.4843 0.0374  -0.0209 0.0333  180 HIS A NE2 
1019 N N   . ASN A 188 ? 0.3789 0.5607 0.3937 0.0168  -0.0128 0.0288  181 ASN A N   
1020 C CA  . ASN A 188 ? 0.3901 0.5860 0.4062 0.0178  -0.0152 0.0295  181 ASN A CA  
1021 C C   . ASN A 188 ? 0.5107 0.7099 0.5250 0.0162  -0.0163 0.0329  181 ASN A C   
1022 O O   . ASN A 188 ? 0.4912 0.6980 0.5069 0.0193  -0.0200 0.0363  181 ASN A O   
1023 C CB  . ASN A 188 ? 0.3785 0.5847 0.3935 0.0139  -0.0130 0.0244  181 ASN A CB  
1024 C CG  . ASN A 188 ? 0.5458 0.7547 0.5638 0.0165  -0.0136 0.0216  181 ASN A CG  
1025 O OD1 . ASN A 188 ? 0.5860 0.7946 0.6084 0.0222  -0.0167 0.0237  181 ASN A OD1 
1026 N ND2 . ASN A 188 ? 0.5309 0.7423 0.5467 0.0123  -0.0108 0.0166  181 ASN A ND2 
1027 N N   . ARG A 189 ? 0.4738 0.6677 0.4850 0.0114  -0.0132 0.0321  182 ARG A N   
1028 C CA  . ARG A 189 ? 0.5503 0.7483 0.5600 0.0092  -0.0140 0.0348  182 ARG A CA  
1029 C C   . ARG A 189 ? 0.5306 0.7174 0.5396 0.0106  -0.0154 0.0389  182 ARG A C   
1030 O O   . ARG A 189 ? 0.5084 0.6960 0.5157 0.0075  -0.0152 0.0404  182 ARG A O   
1031 C CB  . ARG A 189 ? 0.6761 0.8803 0.6834 0.0026  -0.0104 0.0309  182 ARG A CB  
1032 C CG  . ARG A 189 ? 0.9289 1.1496 0.9364 0.0016  -0.0114 0.0296  182 ARG A CG  
1033 C CD  . ARG A 189 ? 0.9527 1.1797 0.9577 -0.0046 -0.0075 0.0242  182 ARG A CD  
1034 N NE  . ARG A 189 ? 1.0219 1.2548 1.0254 -0.0088 -0.0067 0.0247  182 ARG A NE  
1035 C CZ  . ARG A 189 ? 1.0010 1.2404 1.0025 -0.0144 -0.0035 0.0202  182 ARG A CZ  
1036 N NH1 . ARG A 189 ? 1.0096 1.2495 1.0094 -0.0163 -0.0011 0.0151  182 ARG A NH1 
1037 N NH2 . ARG A 189 ? 0.9578 1.2030 0.9584 -0.0181 -0.0029 0.0206  182 ARG A NH2 
1038 N N   . GLY A 190 ? 0.6056 0.7825 0.6161 0.0152  -0.0168 0.0406  183 GLY A N   
1039 C CA  . GLY A 190 ? 0.5704 0.7364 0.5801 0.0175  -0.0187 0.0447  183 GLY A CA  
1040 C C   . GLY A 190 ? 0.4804 0.6358 0.4886 0.0139  -0.0155 0.0434  183 GLY A C   
1041 O O   . GLY A 190 ? 0.4409 0.5879 0.4477 0.0149  -0.0170 0.0466  183 GLY A O   
1042 N N   . ILE A 191 ? 0.3449 0.5003 0.3530 0.0097  -0.0114 0.0389  184 ILE A N   
1043 C CA  . ILE A 191 ? 0.3752 0.5216 0.3825 0.0063  -0.0085 0.0374  184 ILE A CA  
1044 C C   . ILE A 191 ? 0.3416 0.4763 0.3497 0.0089  -0.0079 0.0371  184 ILE A C   
1045 O O   . ILE A 191 ? 0.4415 0.5760 0.4504 0.0107  -0.0074 0.0352  184 ILE A O   
1046 C CB  . ILE A 191 ? 0.3317 0.4820 0.3383 0.0011  -0.0047 0.0329  184 ILE A CB  
1047 C CG1 . ILE A 191 ? 0.2803 0.4436 0.2861 -0.0015 -0.0052 0.0326  184 ILE A CG1 
1048 C CG2 . ILE A 191 ? 0.2275 0.3697 0.2340 -0.0023 -0.0023 0.0316  184 ILE A CG2 
1049 C CD1 . ILE A 191 ? 0.2881 0.4559 0.2925 -0.0061 -0.0018 0.0279  184 ILE A CD1 
1050 N N   . LYS A 192 ? 0.3200 0.4456 0.3277 0.0089  -0.0081 0.0388  185 LYS A N   
1051 C CA  . LYS A 192 ? 0.3264 0.4410 0.3346 0.0113  -0.0076 0.0385  185 LYS A CA  
1052 C C   . LYS A 192 ? 0.2289 0.3395 0.2375 0.0078  -0.0037 0.0346  185 LYS A C   
1053 O O   . LYS A 192 ? 0.2575 0.3686 0.2660 0.0036  -0.0018 0.0330  185 LYS A O   
1054 C CB  . LYS A 192 ? 0.3611 0.4673 0.3680 0.0125  -0.0094 0.0417  185 LYS A CB  
1055 C CG  . LYS A 192 ? 0.3364 0.4433 0.3421 0.0169  -0.0137 0.0464  185 LYS A CG  
1056 C CD  . LYS A 192 ? 0.4381 0.5351 0.4408 0.0175  -0.0153 0.0495  185 LYS A CD  
1057 C CE  . LYS A 192 ? 0.4792 0.5758 0.4795 0.0217  -0.0199 0.0548  185 LYS A CE  
1058 N NZ  . LYS A 192 ? 0.6004 0.6854 0.5965 0.0220  -0.0211 0.0578  185 LYS A NZ  
1059 N N   . LEU A 193 ? 0.2147 0.3213 0.2236 0.0097  -0.0029 0.0331  186 LEU A N   
1060 C CA  . LEU A 193 ? 0.2914 0.3948 0.2995 0.0068  0.0003  0.0296  186 LEU A CA  
1061 C C   . LEU A 193 ? 0.3491 0.4422 0.3577 0.0075  0.0013  0.0293  186 LEU A C   
1062 O O   . LEU A 193 ? 0.3051 0.3944 0.3143 0.0112  -0.0001 0.0304  186 LEU A O   
1063 C CB  . LEU A 193 ? 0.2690 0.3771 0.2762 0.0079  0.0002  0.0278  186 LEU A CB  
1064 C CG  . LEU A 193 ? 0.2818 0.3893 0.2867 0.0041  0.0012  0.0236  186 LEU A CG  
1065 C CD1 . LEU A 193 ? 0.1912 0.2977 0.1951 0.0051  0.0013  0.0217  186 LEU A CD1 
1066 C CD2 . LEU A 193 ? 0.3240 0.4188 0.3281 0.0008  0.0011  0.0208  186 LEU A CD2 
1067 N N   . VAL A 194 ? 0.2237 0.3077 0.2318 0.0042  0.0018  0.0263  187 VAL A N   
1068 C CA  . VAL A 194 ? 0.2360 0.3092 0.2440 0.0044  0.0022  0.0245  187 VAL A CA  
1069 C C   . VAL A 194 ? 0.2355 0.3001 0.2414 0.0020  0.0020  0.0198  187 VAL A C   
1070 O O   . VAL A 194 ? 0.2208 0.2824 0.2256 -0.0004 0.0018  0.0174  187 VAL A O   
1071 C CB  . VAL A 194 ? 0.2245 0.2927 0.2337 0.0034  0.0020  0.0248  187 VAL A CB  
1072 C CG1 . VAL A 194 ? 0.0464 0.1043 0.0556 0.0034  0.0023  0.0224  187 VAL A CG1 
1073 C CG2 . VAL A 194 ? 0.2101 0.2860 0.2211 0.0059  0.0017  0.0303  187 VAL A CG2 
1074 N N   . VAL A 195 ? 0.2591 0.3207 0.2643 0.0030  0.0023  0.0190  188 VAL A N   
1075 C CA  . VAL A 195 ? 0.2481 0.3018 0.2512 0.0010  0.0021  0.0154  188 VAL A CA  
1076 C C   . VAL A 195 ? 0.2595 0.3035 0.2626 0.0008  0.0024  0.0139  188 VAL A C   
1077 O O   . VAL A 195 ? 0.2177 0.2627 0.2217 0.0026  0.0027  0.0154  188 VAL A O   
1078 C CB  . VAL A 195 ? 0.2355 0.2954 0.2376 0.0015  0.0018  0.0153  188 VAL A CB  
1079 C CG1 . VAL A 195 ? 0.3092 0.3616 0.3094 -0.0004 0.0014  0.0126  188 VAL A CG1 
1080 C CG2 . VAL A 195 ? 0.2243 0.2942 0.2263 0.0011  0.0016  0.0158  188 VAL A CG2 
1081 N N   . ALA A 196 ? 0.2821 0.3204 0.2822 -0.0002 -0.0001 0.0129  189 ALA A N   
1082 C CA  . ALA A 196 ? 0.2784 0.3112 0.2791 -0.0002 -0.0001 0.0122  189 ALA A CA  
1083 C C   . ALA A 196 ? 0.2949 0.3285 0.3010 -0.0015 -0.0005 0.0097  189 ALA A C   
1084 O O   . ALA A 196 ? 0.3356 0.3665 0.3351 -0.0026 -0.0007 0.0098  189 ALA A O   
1085 C CB  . ALA A 196 ? 0.2574 0.2917 0.2646 -0.0005 -0.0002 0.0112  189 ALA A CB  
1086 N N   . ASP A 197 ? 0.2801 0.3077 0.2806 -0.0011 -0.0004 0.0102  190 ASP A N   
1087 C CA  . ASP A 197 ? 0.2811 0.3097 0.2862 -0.0024 -0.0008 0.0083  190 ASP A CA  
1088 C C   . ASP A 197 ? 0.4091 0.4312 0.4095 -0.0020 -0.0007 0.0085  190 ASP A C   
1089 O O   . ASP A 197 ? 0.4463 0.4707 0.4516 -0.0011 -0.0004 0.0082  190 ASP A O   
1090 C CB  . ASP A 197 ? 0.2148 0.2441 0.2142 -0.0026 -0.0007 0.0090  190 ASP A CB  
1091 C CG  . ASP A 197 ? 0.5858 0.6139 0.5844 -0.0042 -0.0012 0.0080  190 ASP A CG  
1092 O OD1 . ASP A 197 ? 0.6556 0.6830 0.6592 -0.0052 -0.0013 0.0069  190 ASP A OD1 
1093 O OD2 . ASP A 197 ? 0.5552 0.5858 0.5531 -0.0049 -0.0012 0.0077  190 ASP A OD2 
1094 N N   . THR A 198 ? 0.4256 0.4475 0.4296 -0.0032 -0.0011 0.0070  191 THR A N   
1095 C CA  . THR A 198 ? 0.3973 0.4162 0.4010 -0.0031 -0.0011 0.0064  191 THR A CA  
1096 C C   . THR A 198 ? 0.3177 0.3364 0.3208 -0.0042 -0.0013 0.0062  191 THR A C   
1097 O O   . THR A 198 ? 0.3103 0.3287 0.3129 -0.0051 -0.0016 0.0060  191 THR A O   
1098 C CB  . THR A 198 ? 0.4064 0.4223 0.4098 -0.0029 -0.0012 0.0059  191 THR A CB  
1099 O OG1 . THR A 198 ? 0.5393 0.5532 0.5403 -0.0019 -0.0008 0.0066  191 THR A OG1 
1100 C CG2 . THR A 198 ? 0.5915 0.6050 0.5943 -0.0033 -0.0012 0.0052  191 THR A CG2 
1101 N N   . ARG A 199 ? 0.3805 0.3979 0.3800 -0.0039 -0.0014 0.0067  192 ARG A N   
1102 C CA  . ARG A 199 ? 0.4579 0.4755 0.4565 -0.0052 -0.0018 0.0066  192 ARG A CA  
1103 C C   . ARG A 199 ? 0.3373 0.3551 0.3394 -0.0057 -0.0017 0.0058  192 ARG A C   
1104 O O   . ARG A 199 ? 0.3043 0.3216 0.3028 -0.0052 -0.0017 0.0062  192 ARG A O   
1105 C CB  . ARG A 199 ? 0.4097 0.4330 0.4120 -0.0066 -0.0016 0.0062  192 ARG A CB  
1106 C CG  . ARG A 199 ? 0.5274 0.5506 0.5252 -0.0059 -0.0017 0.0070  192 ARG A CG  
1107 C CD  . ARG A 199 ? 0.6773 0.7041 0.6740 -0.0073 -0.0017 0.0067  192 ARG A CD  
1108 N NE  . ARG A 199 ? 0.6782 0.7041 0.6739 -0.0088 -0.0020 0.0066  192 ARG A NE  
1109 C CZ  . ARG A 199 ? 0.5684 0.5984 0.5695 -0.0103 -0.0018 0.0059  192 ARG A CZ  
1110 N NH1 . ARG A 199 ? 0.4156 0.4458 0.4113 -0.0084 -0.0017 0.0064  192 ARG A NH1 
1111 N NH2 . ARG A 199 ? 0.5049 0.5312 0.4990 -0.0108 -0.0022 0.0062  192 ARG A NH2 
1112 N N   . GLY A 200 ? 0.2698 0.2836 0.2685 -0.0052 -0.0020 0.0061  193 GLY A N   
1113 C CA  . GLY A 200 ? 0.3080 0.3219 0.3096 -0.0057 -0.0019 0.0053  193 GLY A CA  
1114 C C   . GLY A 200 ? 0.2952 0.3084 0.2971 -0.0045 -0.0015 0.0049  193 GLY A C   
1115 O O   . GLY A 200 ? 0.4555 0.4674 0.4577 -0.0036 -0.0013 0.0047  193 GLY A O   
1116 N N   . LEU A 201 ? 0.2769 0.2897 0.2759 -0.0043 -0.0016 0.0053  194 LEU A N   
1117 C CA  . LEU A 201 ? 0.4294 0.4430 0.4314 -0.0039 -0.0012 0.0045  194 LEU A CA  
1118 C C   . LEU A 201 ? 0.4177 0.4327 0.4204 -0.0028 -0.0010 0.0049  194 LEU A C   
1119 O O   . LEU A 201 ? 0.4620 0.4750 0.4624 -0.0017 -0.0006 0.0054  194 LEU A O   
1120 C CB  . LEU A 201 ? 0.4823 0.4968 0.4836 -0.0048 -0.0013 0.0042  194 LEU A CB  
1121 C CG  . LEU A 201 ? 0.5959 0.6081 0.5936 -0.0051 -0.0015 0.0042  194 LEU A CG  
1122 C CD1 . LEU A 201 ? 0.5140 0.5259 0.5115 -0.0058 -0.0019 0.0047  194 LEU A CD1 
1123 C CD2 . LEU A 201 ? 0.8163 0.8302 0.8129 -0.0063 -0.0014 0.0037  194 LEU A CD2 
1124 N N   . PHE A 202 ? 0.3193 0.3347 0.3192 -0.0027 -0.0009 0.0059  195 PHE A N   
1125 C CA  . PHE A 202 ? 0.3157 0.3330 0.3159 -0.0017 -0.0006 0.0066  195 PHE A CA  
1126 C C   . PHE A 202 ? 0.3495 0.3689 0.3537 -0.0013 -0.0005 0.0066  195 PHE A C   
1127 O O   . PHE A 202 ? 0.3803 0.3989 0.3842 -0.0021 -0.0008 0.0063  195 PHE A O   
1128 C CB  . PHE A 202 ? 0.3654 0.3884 0.3689 -0.0026 -0.0007 0.0060  195 PHE A CB  
1129 C CG  . PHE A 202 ? 0.3456 0.3685 0.3459 -0.0031 -0.0018 0.0054  195 PHE A CG  
1130 C CD1 . PHE A 202 ? 0.2546 0.2784 0.2566 -0.0055 -0.0010 0.0047  195 PHE A CD1 
1131 C CD2 . PHE A 202 ? 0.3321 0.3606 0.3329 -0.0027 -0.0010 0.0061  195 PHE A CD2 
1132 C CE1 . PHE A 202 ? 0.2893 0.3151 0.2878 -0.0069 -0.0020 0.0040  195 PHE A CE1 
1133 C CE2 . PHE A 202 ? 0.3166 0.3499 0.3165 -0.0048 -0.0008 0.0048  195 PHE A CE2 
1134 C CZ  . PHE A 202 ? 0.3339 0.3651 0.3325 -0.0073 -0.0012 0.0036  195 PHE A CZ  
1135 N N   . GLY A 203 ? 0.2143 0.2349 0.2191 0.0001  0.0000  0.0074  196 GLY A N   
1136 C CA  . GLY A 203 ? 0.2998 0.3212 0.3052 0.0005  0.0002  0.0080  196 GLY A CA  
1137 C C   . GLY A 203 ? 0.4044 0.4296 0.4104 0.0019  0.0008  0.0092  196 GLY A C   
1138 O O   . GLY A 203 ? 0.3298 0.3532 0.3311 0.0029  0.0012  0.0105  196 GLY A O   
1139 N N   . GLN A 204 ? 0.3088 0.3364 0.3151 0.0018  0.0007  0.0097  197 GLN A N   
1140 C CA  . GLN A 204 ? 0.2389 0.2675 0.2399 0.0029  0.0011  0.0118  197 GLN A CA  
1141 C C   . GLN A 204 ? 0.2356 0.2689 0.2430 0.0037  0.0014  0.0118  197 GLN A C   
1142 O O   . GLN A 204 ? 0.2422 0.2744 0.2495 0.0024  0.0009  0.0114  197 GLN A O   
1143 C CB  . GLN A 204 ? 0.3299 0.3656 0.3362 0.0022  0.0007  0.0101  197 GLN A CB  
1144 C CG  . GLN A 204 ? 0.2872 0.3269 0.2875 0.0030  0.0013  0.0123  197 GLN A CG  
1145 C CD  . GLN A 204 ? 0.4090 0.4521 0.4083 0.0013  0.0006  0.0111  197 GLN A CD  
1146 O OE1 . GLN A 204 ? 0.4613 0.5049 0.4673 -0.0003 -0.0001 0.0093  197 GLN A OE1 
1147 N NE2 . GLN A 204 ? 0.3511 0.4031 0.3509 0.0018  0.0004  0.0109  197 GLN A NE2 
1148 N N   . LEU A 205 ? 0.2366 0.2714 0.2398 0.0052  0.0034  0.0147  198 LEU A N   
1149 C CA  . LEU A 205 ? 0.1771 0.2165 0.1821 0.0062  0.0039  0.0168  198 LEU A CA  
1150 C C   . LEU A 205 ? 0.2532 0.3036 0.2589 0.0096  0.0044  0.0205  198 LEU A C   
1151 O O   . LEU A 205 ? 0.1850 0.2393 0.1910 0.0131  0.0053  0.0228  198 LEU A O   
1152 C CB  . LEU A 205 ? 0.3505 0.3879 0.3573 0.0073  0.0046  0.0181  198 LEU A CB  
1153 C CG  . LEU A 205 ? 0.5667 0.6013 0.5745 0.0053  0.0039  0.0166  198 LEU A CG  
1154 C CD1 . LEU A 205 ? 0.6193 0.6517 0.6284 0.0062  0.0043  0.0174  198 LEU A CD1 
1155 C CD2 . LEU A 205 ? 0.6643 0.7062 0.6730 0.0060  0.0038  0.0195  198 LEU A CD2 
1156 N N   . PHE A 206 ? 0.1884 0.2444 0.1941 0.0091  0.0039  0.0210  199 PHE A N   
1157 C CA  . PHE A 206 ? 0.1985 0.2659 0.2049 0.0126  0.0040  0.0241  199 PHE A CA  
1158 C C   . PHE A 206 ? 0.3375 0.4081 0.3457 0.0135  0.0029  0.0262  199 PHE A C   
1159 O O   . PHE A 206 ? 0.4477 0.5181 0.4555 0.0104  0.0038  0.0260  199 PHE A O   
1160 C CB  . PHE A 206 ? 0.2353 0.3089 0.2401 0.0116  0.0034  0.0222  199 PHE A CB  
1161 C CG  . PHE A 206 ? 0.3887 0.4706 0.3966 0.0147  0.0012  0.0227  199 PHE A CG  
1162 C CD1 . PHE A 206 ? 0.3858 0.4698 0.3980 0.0189  -0.0007 0.0223  199 PHE A CD1 
1163 C CD2 . PHE A 206 ? 0.4226 0.5106 0.4301 0.0136  0.0010  0.0234  199 PHE A CD2 
1164 C CE1 . PHE A 206 ? 0.4337 0.5256 0.4495 0.0222  -0.0030 0.0228  199 PHE A CE1 
1165 C CE2 . PHE A 206 ? 0.4586 0.5547 0.4689 0.0165  -0.0013 0.0241  199 PHE A CE2 
1166 C CZ  . PHE A 206 ? 0.4800 0.5781 0.4945 0.0209  -0.0034 0.0239  199 PHE A CZ  
1167 N N   . CYS A 207 ? 0.2449 0.3177 0.2554 0.0178  0.0003  0.0280  200 CYS A N   
1168 C CA  . CYS A 207 ? 0.3043 0.3800 0.3154 0.0189  -0.0016 0.0306  200 CYS A CA  
1169 C C   . CYS A 207 ? 0.3723 0.4554 0.3855 0.0227  -0.0046 0.0317  200 CYS A C   
1170 O O   . CYS A 207 ? 0.4611 0.5437 0.4772 0.0268  -0.0063 0.0317  200 CYS A O   
1171 C CB  . CYS A 207 ? 0.2532 0.3211 0.2644 0.0210  -0.0029 0.0331  200 CYS A CB  
1172 S SG  . CYS A 207 ? 0.2943 0.3552 0.3043 0.0169  -0.0004 0.0321  200 CYS A SG  
1173 N N   . ASP A 208 ? 0.2480 0.3388 0.2606 0.0214  -0.0052 0.0324  201 ASP A N   
1174 C CA  . ASP A 208 ? 0.2394 0.3380 0.2542 0.0249  -0.0083 0.0340  201 ASP A CA  
1175 C C   . ASP A 208 ? 0.3198 0.4199 0.3331 0.0245  -0.0100 0.0374  201 ASP A C   
1176 O O   . ASP A 208 ? 0.3274 0.4335 0.3393 0.0207  -0.0088 0.0367  201 ASP A O   
1177 C CB  . ASP A 208 ? 0.2010 0.3094 0.2160 0.0232  -0.0076 0.0312  201 ASP A CB  
1178 C CG  . ASP A 208 ? 0.4028 0.5216 0.4195 0.0254  -0.0104 0.0327  201 ASP A CG  
1179 O OD1 . ASP A 208 ? 0.3629 0.4816 0.3821 0.0302  -0.0139 0.0359  201 ASP A OD1 
1180 O OD2 . ASP A 208 ? 0.4823 0.6096 0.4977 0.0223  -0.0094 0.0309  201 ASP A OD2 
1181 N N   . PHE A 209 ? 0.4212 0.5155 0.4346 0.0281  -0.0128 0.0409  202 PHE A N   
1182 C CA  . PHE A 209 ? 0.5413 0.6365 0.5525 0.0279  -0.0150 0.0446  202 PHE A CA  
1183 C C   . PHE A 209 ? 0.5948 0.6988 0.6075 0.0315  -0.0187 0.0471  202 PHE A C   
1184 O O   . PHE A 209 ? 0.5767 0.6799 0.5878 0.0336  -0.0221 0.0514  202 PHE A O   
1185 C CB  . PHE A 209 ? 0.4785 0.5621 0.4875 0.0296  -0.0164 0.0477  202 PHE A CB  
1186 C CG  . PHE A 209 ? 0.4809 0.5572 0.4882 0.0255  -0.0130 0.0456  202 PHE A CG  
1187 C CD1 . PHE A 209 ? 0.4524 0.5313 0.4609 0.0215  -0.0093 0.0413  202 PHE A CD1 
1188 C CD2 . PHE A 209 ? 0.4229 0.4895 0.4272 0.0256  -0.0139 0.0479  202 PHE A CD2 
1189 C CE1 . PHE A 209 ? 0.3170 0.3898 0.3248 0.0182  -0.0067 0.0394  202 PHE A CE1 
1190 C CE2 . PHE A 209 ? 0.4549 0.5158 0.4581 0.0220  -0.0111 0.0456  202 PHE A CE2 
1191 C CZ  . PHE A 209 ? 0.3395 0.4039 0.3451 0.0185  -0.0076 0.0413  202 PHE A CZ  
1192 N N   . GLY A 210 ? 0.5942 0.7069 0.6099 0.0322  -0.0183 0.0444  203 GLY A N   
1193 C CA  . GLY A 210 ? 0.5530 0.6764 0.5708 0.0351  -0.0216 0.0458  203 GLY A CA  
1194 C C   . GLY A 210 ? 0.7053 0.8260 0.7268 0.0421  -0.0258 0.0486  203 GLY A C   
1195 O O   . GLY A 210 ? 0.4649 0.5746 0.4856 0.0446  -0.0272 0.0511  203 GLY A O   
1196 N N   . GLU A 211 ? 1.1477 1.2788 1.1734 0.0453  -0.0281 0.0480  204 GLU A N   
1197 C CA  . GLU A 211 ? 1.3503 1.4805 1.3817 0.0525  -0.0323 0.0498  204 GLU A CA  
1198 C C   . GLU A 211 ? 1.4417 1.5644 1.4716 0.0566  -0.0367 0.0559  204 GLU A C   
1199 O O   . GLU A 211 ? 1.5399 1.6608 1.5747 0.0631  -0.0407 0.0580  204 GLU A O   
1200 C CB  . GLU A 211 ? 1.3502 1.4950 1.3869 0.0549  -0.0341 0.0480  204 GLU A CB  
1201 C CG  . GLU A 211 ? 1.4011 1.5516 1.4396 0.0518  -0.0302 0.0419  204 GLU A CG  
1202 C CD  . GLU A 211 ? 1.3665 1.5284 1.4122 0.0558  -0.0321 0.0396  204 GLU A CD  
1203 O OE1 . GLU A 211 ? 1.4762 1.6398 1.5273 0.0622  -0.0367 0.0425  204 GLU A OE1 
1204 O OE2 . GLU A 211 ? 1.1582 1.3274 1.2044 0.0526  -0.0293 0.0347  204 GLU A OE2 
1205 N N   . GLU A 212 ? 1.2265 1.3447 1.2497 0.0528  -0.0361 0.0586  205 GLU A N   
1206 C CA  . GLU A 212 ? 1.0831 1.1918 1.1028 0.0556  -0.0398 0.0643  205 GLU A CA  
1207 C C   . GLU A 212 ? 0.7102 0.8075 0.7238 0.0510  -0.0368 0.0647  205 GLU A C   
1208 O O   . GLU A 212 ? 0.6426 0.7437 0.6529 0.0450  -0.0336 0.0629  205 GLU A O   
1209 C CB  . GLU A 212 ? 1.3549 1.4722 1.3724 0.0565  -0.0439 0.0688  205 GLU A CB  
1210 C CG  . GLU A 212 ? 1.4689 1.5919 1.4920 0.0638  -0.0494 0.0714  205 GLU A CG  
1211 C CD  . GLU A 212 ? 1.4842 1.6204 1.5142 0.0645  -0.0481 0.0664  205 GLU A CD  
1212 O OE1 . GLU A 212 ? 1.4601 1.6049 1.4887 0.0588  -0.0441 0.0624  205 GLU A OE1 
1213 O OE2 . GLU A 212 ? 1.4938 1.6315 1.5310 0.0707  -0.0511 0.0663  205 GLU A OE2 
1214 N N   . MET A 213 ? 0.5574 0.6412 0.5702 0.0540  -0.0379 0.0666  206 MET A N   
1215 C CA  . MET A 213 ? 0.4698 0.5417 0.4763 0.0506  -0.0362 0.0680  206 MET A CA  
1216 C C   . MET A 213 ? 0.5524 0.6113 0.5575 0.0560  -0.0401 0.0726  206 MET A C   
1217 O O   . MET A 213 ? 0.5695 0.6242 0.5800 0.0609  -0.0412 0.0716  206 MET A O   
1218 C CB  . MET A 213 ? 0.4521 0.5198 0.4596 0.0469  -0.0310 0.0628  206 MET A CB  
1219 C CG  . MET A 213 ? 0.5877 0.6606 0.5927 0.0398  -0.0268 0.0597  206 MET A CG  
1220 S SD  . MET A 213 ? 0.6854 0.7533 0.6831 0.0348  -0.0263 0.0623  206 MET A SD  
1221 C CE  . MET A 213 ? 1.6182 1.6974 1.6143 0.0355  -0.0302 0.0665  206 MET A CE  
1222 N N   . ILE A 214 ? 0.6353 0.6876 0.6331 0.0551  -0.0422 0.0776  207 ILE A N   
1223 C CA  . ILE A 214 ? 0.7266 0.7643 0.7215 0.0596  -0.0457 0.0823  207 ILE A CA  
1224 C C   . ILE A 214 ? 0.7121 0.7371 0.7040 0.0566  -0.0419 0.0801  207 ILE A C   
1225 O O   . ILE A 214 ? 0.7240 0.7469 0.7099 0.0509  -0.0391 0.0797  207 ILE A O   
1226 C CB  . ILE A 214 ? 0.6508 0.6861 0.6378 0.0600  -0.0499 0.0892  207 ILE A CB  
1227 C CG1 . ILE A 214 ? 0.6288 0.6752 0.6195 0.0646  -0.0548 0.0921  207 ILE A CG1 
1228 C CG2 . ILE A 214 ? 0.6539 0.6712 0.6353 0.0630  -0.0524 0.0940  207 ILE A CG2 
1229 C CD1 . ILE A 214 ? 0.6231 0.6628 0.6186 0.0732  -0.0599 0.0951  207 ILE A CD1 
1230 N N   . LEU A 215 ? 0.7332 0.7508 0.7299 0.0604  -0.0416 0.0782  208 LEU A N   
1231 C CA  . LEU A 215 ? 0.7243 0.7310 0.7190 0.0575  -0.0378 0.0756  208 LEU A CA  
1232 C C   . LEU A 215 ? 0.7670 0.7571 0.7584 0.0610  -0.0402 0.0795  208 LEU A C   
1233 O O   . LEU A 215 ? 0.9169 0.9037 0.9124 0.0676  -0.0443 0.0820  208 LEU A O   
1234 C CB  . LEU A 215 ? 0.6511 0.6623 0.6535 0.0576  -0.0342 0.0694  208 LEU A CB  
1235 C CG  . LEU A 215 ? 0.8502 0.8723 0.8529 0.0517  -0.0299 0.0649  208 LEU A CG  
1236 C CD1 . LEU A 215 ? 0.9716 0.9942 0.9669 0.0462  -0.0291 0.0667  208 LEU A CD1 
1237 C CD2 . LEU A 215 ? 0.8877 0.9240 0.8963 0.0533  -0.0307 0.0630  208 LEU A CD2 
1238 N N   . THR A 216 ? 0.6868 0.6665 0.6711 0.0566  -0.0377 0.0799  209 THR A N   
1239 C CA  . THR A 216 ? 0.7649 0.7275 0.7451 0.0590  -0.0394 0.0834  209 THR A CA  
1240 C C   . THR A 216 ? 0.7748 0.7320 0.7618 0.0606  -0.0368 0.0789  209 THR A C   
1241 O O   . THR A 216 ? 0.7924 0.7548 0.7818 0.0567  -0.0323 0.0736  209 THR A O   
1242 C CB  . THR A 216 ? 0.9899 0.9431 0.9583 0.0532  -0.0381 0.0862  209 THR A CB  
1243 O OG1 . THR A 216 ? 1.1392 1.1013 1.1067 0.0466  -0.0337 0.0818  209 THR A OG1 
1244 C CG2 . THR A 216 ? 0.7879 0.7394 0.7486 0.0544  -0.0424 0.0930  209 THR A CG2 
1245 N N   . ASP A 217 ? 0.7838 0.7306 0.7739 0.0666  -0.0398 0.0810  210 ASP A N   
1246 C CA  . ASP A 217 ? 0.8114 0.7537 0.8090 0.0688  -0.0374 0.0765  210 ASP A CA  
1247 C C   . ASP A 217 ? 0.8893 0.8134 0.8846 0.0714  -0.0388 0.0793  210 ASP A C   
1248 O O   . ASP A 217 ? 0.9338 0.8492 0.9243 0.0743  -0.0433 0.0854  210 ASP A O   
1249 C CB  . ASP A 217 ? 0.9030 0.8552 0.9122 0.0751  -0.0389 0.0733  210 ASP A CB  
1250 C CG  . ASP A 217 ? 1.2090 1.1518 1.2238 0.0834  -0.0433 0.0755  210 ASP A CG  
1251 O OD1 . ASP A 217 ? 1.3286 1.2630 1.3479 0.0855  -0.0416 0.0724  210 ASP A OD1 
1252 O OD2 . ASP A 217 ? 1.3081 1.2522 1.3230 0.0879  -0.0486 0.0803  210 ASP A OD2 
1253 N N   . SER A 218 ? 0.8676 0.7863 0.8661 0.0699  -0.0348 0.0748  211 SER A N   
1254 C CA  . SER A 218 ? 0.8651 0.7686 0.8659 0.0733  -0.0351 0.0748  211 SER A CA  
1255 C C   . SER A 218 ? 0.8843 0.7839 0.8844 0.0678  -0.0293 0.0701  211 SER A C   
1256 O O   . SER A 218 ? 0.8264 0.7283 0.8200 0.0604  -0.0263 0.0699  211 SER A O   
1257 C CB  . SER A 218 ? 0.9105 0.7984 0.9035 0.0746  -0.0393 0.0822  211 SER A CB  
1258 O OG  . SER A 218 ? 0.9632 0.8394 0.9619 0.0812  -0.0413 0.0822  211 SER A OG  
1259 N N   . PRO A 223 ? 1.1155 0.9506 1.1184 0.1108  -0.0620 0.1005  216 PRO A N   
1260 C CA  . PRO A 223 ? 1.1737 0.9905 1.1691 0.1059  -0.0594 0.1021  216 PRO A CA  
1261 C C   . PRO A 223 ? 1.2702 1.0686 1.2613 0.1115  -0.0644 0.1088  216 PRO A C   
1262 O O   . PRO A 223 ? 1.2544 1.0362 1.2444 0.1110  -0.0630 0.1087  216 PRO A O   
1266 N N   . LEU A 224 ? 1.2775 1.0790 1.2661 0.1168  -0.0704 0.1148  217 LEU A N   
1267 C CA  . LEU A 224 ? 1.2110 0.9954 1.1941 0.1226  -0.0758 0.1221  217 LEU A CA  
1268 C C   . LEU A 224 ? 1.1556 0.9254 1.1216 0.1148  -0.0752 0.1292  217 LEU A C   
1269 O O   . LEU A 224 ? 1.1240 0.9016 1.0807 0.1073  -0.0735 0.1311  217 LEU A O   
1270 C CB  . LEU A 224 ? 1.2037 0.9970 1.1899 0.1312  -0.0827 0.1262  217 LEU A CB  
1271 C CG  . LEU A 224 ? 1.2138 1.0272 1.1980 0.1285  -0.0839 0.1275  217 LEU A CG  
1272 C CD1 . LEU A 224 ? 1.2803 1.0905 1.2554 0.1326  -0.0906 0.1368  217 LEU A CD1 
1273 C CD2 . LEU A 224 ? 1.1725 1.0060 1.1731 0.1329  -0.0839 0.1202  217 LEU A CD2 
1274 N N   . SER A 225 ? 1.1885 0.9372 1.1506 0.1167  -0.0765 0.1327  218 SER A N   
1275 C CA  . SER A 225 ? 1.1722 0.9052 1.1186 0.1088  -0.0757 0.1391  218 SER A CA  
1276 C C   . SER A 225 ? 1.1990 0.9165 1.1353 0.1153  -0.0816 0.1484  218 SER A C   
1277 O O   . SER A 225 ? 1.1435 0.8574 1.0873 0.1261  -0.0862 0.1491  218 SER A O   
1278 C CB  . SER A 225 ? 1.1076 0.8278 1.0574 0.1034  -0.0713 0.1353  218 SER A CB  
1279 O OG  . SER A 225 ? 1.1396 0.8735 1.1011 0.1009  -0.0660 0.1260  218 SER A OG  
1280 N N   . ALA A 226 ? 1.2500 0.9582 1.1685 0.1089  -0.0812 0.1553  219 ALA A N   
1281 C CA  . ALA A 226 ? 1.2629 0.9529 1.1683 0.1141  -0.0854 0.1648  219 ALA A CA  
1282 C C   . ALA A 226 ? 1.2491 0.9178 1.1414 0.1058  -0.0824 0.1682  219 ALA A C   
1283 O O   . ALA A 226 ? 1.1776 0.8479 1.0737 0.0960  -0.0780 0.1630  219 ALA A O   
1284 C CB  . ALA A 226 ? 1.2363 0.9362 1.1302 0.1160  -0.0875 0.1712  219 ALA A CB  
1285 N N   . MET A 227 ? 1.3054 0.9548 1.1830 0.1097  -0.0847 0.1770  220 MET A N   
1286 C CA  . MET A 227 ? 1.3574 0.9849 1.2214 0.1022  -0.0818 0.1807  220 MET A CA  
1287 C C   . MET A 227 ? 1.4294 1.0502 1.2682 0.1007  -0.0772 0.1894  220 MET A C   
1288 O O   . MET A 227 ? 1.5193 1.1320 1.3490 0.1098  -0.0793 0.1981  220 MET A O   
1289 C CB  . MET A 227 ? 1.3598 0.9651 1.2286 0.1088  -0.0861 0.1832  220 MET A CB  
1290 C CG  . MET A 227 ? 1.3492 0.9548 1.2393 0.1057  -0.0857 0.1749  220 MET A CG  
1291 S SD  . MET A 227 ? 1.5315 1.1360 1.4232 0.0872  -0.0811 0.1729  220 MET A SD  
1292 C CE  . MET A 227 ? 0.8561 0.4346 0.7215 0.0830  -0.0826 0.1841  220 MET A CE  
1293 N N   . VAL A 228 ? 1.3556 0.9812 1.1844 0.0900  -0.0694 0.1872  221 VAL A N   
1294 C CA  . VAL A 228 ? 1.2800 0.9057 1.0886 0.0901  -0.0598 0.1951  221 VAL A CA  
1295 C C   . VAL A 228 ? 1.3624 0.9647 1.1566 0.0957  -0.0558 0.2063  221 VAL A C   
1296 O O   . VAL A 228 ? 1.3782 0.9609 1.1662 0.0922  -0.0504 0.2060  221 VAL A O   
1297 C CB  . VAL A 228 ? 1.0919 0.7257 0.8945 0.0797  -0.0477 0.1907  221 VAL A CB  
1298 C CG1 . VAL A 228 ? 0.9449 0.5860 0.7379 0.0808  -0.0354 0.2018  221 VAL A CG1 
1299 C CG2 . VAL A 228 ? 1.1128 0.7704 0.9288 0.0745  -0.0514 0.1809  221 VAL A CG2 
1300 N N   . SER A 229 ? 1.4187 1.0237 1.2088 0.1040  -0.0591 0.2163  222 SER A N   
1301 C CA  . SER A 229 ? 1.5048 1.0913 1.2828 0.1093  -0.0550 0.2293  222 SER A CA  
1302 C C   . SER A 229 ? 1.5385 1.1362 1.3093 0.1040  -0.0443 0.2387  222 SER A C   
1303 O O   . SER A 229 ? 1.4473 1.0331 1.2125 0.1036  -0.0360 0.2494  222 SER A O   
1304 C CB  . SER A 229 ? 1.3290 0.9109 1.1086 0.1212  -0.0671 0.2359  222 SER A CB  
1305 O OG  . SER A 229 ? 1.1027 0.6750 0.8940 0.1267  -0.0760 0.2290  222 SER A OG  
1306 N N   . MET A 230 ? 1.5364 1.1584 1.3105 0.0990  -0.0456 0.2352  223 MET A N   
1307 C CA  . MET A 230 ? 1.5021 1.1381 1.2720 0.0917  -0.0387 0.2422  223 MET A CA  
1308 C C   . MET A 230 ? 1.5365 1.1985 1.3114 0.0857  -0.0406 0.2343  223 MET A C   
1309 O O   . MET A 230 ? 1.5666 1.2386 1.3471 0.0893  -0.0496 0.2279  223 MET A O   
1310 C CB  . MET A 230 ? 1.3404 0.9710 1.1000 0.0960  -0.0438 0.2568  223 MET A CB  
1311 C CG  . MET A 230 ? 1.1647 0.7998 0.9181 0.0875  -0.0368 0.2667  223 MET A CG  
1312 S SD  . MET A 230 ? 1.9611 1.6251 1.7126 0.0786  -0.0394 0.2646  223 MET A SD  
1313 C CE  . MET A 230 ? 0.7630 0.4384 0.5173 0.0874  -0.0530 0.2597  223 MET A CE  
1314 N N   . VAL A 231 ? 1.4564 1.1304 1.2315 0.0762  -0.0322 0.2352  224 VAL A N   
1315 C CA  . VAL A 231 ? 1.3272 1.0251 1.1048 0.0700  -0.0338 0.2301  224 VAL A CA  
1316 C C   . VAL A 231 ? 1.2722 0.9779 1.0431 0.0617  -0.0299 0.2385  224 VAL A C   
1317 O O   . VAL A 231 ? 1.2336 0.9323 1.0044 0.0563  -0.0219 0.2431  224 VAL A O   
1318 C CB  . VAL A 231 ? 1.2897 0.9980 1.0781 0.0653  -0.0289 0.2164  224 VAL A CB  
1319 C CG1 . VAL A 231 ? 1.2479 0.9528 1.0415 0.0588  -0.0165 0.2161  224 VAL A CG1 
1320 C CG2 . VAL A 231 ? 1.2730 1.0051 1.0641 0.0601  -0.0317 0.2112  224 VAL A CG2 
1321 N N   . THR A 232 ? 1.3265 1.0471 1.0924 0.0602  -0.0364 0.2408  225 THR A N   
1322 C CA  . THR A 232 ? 1.3439 1.0712 1.1007 0.0524  -0.0351 0.2490  225 THR A CA  
1323 C C   . THR A 232 ? 1.4455 1.1881 1.2070 0.0413  -0.0285 0.2421  225 THR A C   
1324 O O   . THR A 232 ? 1.4846 1.2332 1.2568 0.0400  -0.0247 0.2312  225 THR A O   
1325 C CB  . THR A 232 ? 1.2228 0.9614 0.9723 0.0548  -0.0447 0.2542  225 THR A CB  
1326 O OG1 . THR A 232 ? 1.2007 0.9600 0.9575 0.0528  -0.0474 0.2442  225 THR A OG1 
1327 C CG2 . THR A 232 ? 1.1294 0.8554 0.8761 0.0665  -0.0528 0.2603  225 THR A CG2 
1328 N N   . LYS A 233 ? 1.4879 1.2364 1.2407 0.0332  -0.0276 0.2486  226 LYS A N   
1329 C CA  . LYS A 233 ? 1.5409 1.3051 1.2965 0.0222  -0.0230 0.2424  226 LYS A CA  
1330 C C   . LYS A 233 ? 1.6068 1.3930 1.3605 0.0180  -0.0295 0.2401  226 LYS A C   
1331 O O   . LYS A 233 ? 1.5803 1.3789 1.3314 0.0076  -0.0286 0.2398  226 LYS A O   
1332 C CB  . LYS A 233 ? 1.4862 1.2437 1.2377 0.0131  -0.0172 0.2485  226 LYS A CB  
1333 C CG  . LYS A 233 ? 1.4254 1.1974 1.1841 0.0017  -0.0122 0.2392  226 LYS A CG  
1334 C CD  . LYS A 233 ? 1.3986 1.1635 1.1529 -0.0078 -0.0077 0.2449  226 LYS A CD  
1335 C CE  . LYS A 233 ? 1.4641 1.2061 1.2201 -0.0024 -0.0031 0.2521  226 LYS A CE  
1336 N NZ  . LYS A 233 ? 1.5440 1.2804 1.2989 -0.0131 0.0018  0.2553  226 LYS A NZ  
1337 N N   . ASP A 234 ? 1.6851 1.4766 1.4409 0.0257  -0.0362 0.2380  227 ASP A N   
1338 C CA  . ASP A 234 ? 1.7320 1.5446 1.4878 0.0228  -0.0426 0.2365  227 ASP A CA  
1339 C C   . ASP A 234 ? 1.7413 1.5733 1.5093 0.0196  -0.0417 0.2233  227 ASP A C   
1340 O O   . ASP A 234 ? 1.7073 1.5356 1.4829 0.0205  -0.0370 0.2155  227 ASP A O   
1341 C CB  . ASP A 234 ? 1.7037 1.5125 1.4557 0.0328  -0.0512 0.2433  227 ASP A CB  
1342 C CG  . ASP A 234 ? 1.6359 1.4645 1.3853 0.0290  -0.0575 0.2459  227 ASP A CG  
1343 O OD1 . ASP A 234 ? 1.6204 1.4581 1.3649 0.0190  -0.0556 0.2480  227 ASP A OD1 
1344 O OD2 . ASP A 234 ? 1.6007 1.4367 1.3537 0.0356  -0.0645 0.2456  227 ASP A OD2 
1345 N N   . ASN A 235 ? 1.6733 1.5260 1.4430 0.0156  -0.0462 0.2212  228 ASN A N   
1346 C CA  . ASN A 235 ? 1.4828 1.3556 1.2638 0.0118  -0.0458 0.2096  228 ASN A CA  
1347 C C   . ASN A 235 ? 1.2922 1.1767 1.0777 0.0177  -0.0531 0.2091  228 ASN A C   
1348 O O   . ASN A 235 ? 1.1604 1.0616 0.9449 0.0133  -0.0566 0.2104  228 ASN A O   
1349 C CB  . ASN A 235 ? 1.4835 1.3729 1.2635 -0.0003 -0.0436 0.2071  228 ASN A CB  
1350 C CG  . ASN A 235 ? 1.3937 1.2948 1.1844 -0.0059 -0.0390 0.1948  228 ASN A CG  
1351 O OD1 . ASN A 235 ? 1.3536 1.2491 1.1447 -0.0108 -0.0333 0.1919  228 ASN A OD1 
1352 N ND2 . ASN A 235 ? 1.2861 1.2041 1.0858 -0.0055 -0.0415 0.1876  228 ASN A ND2 
1353 N N   . PRO A 236 ? 1.3248 1.2021 1.1160 0.0269  -0.0555 0.2066  229 PRO A N   
1354 C CA  . PRO A 236 ? 1.3386 1.2004 1.1339 0.0316  -0.0515 0.2019  229 PRO A CA  
1355 C C   . PRO A 236 ? 1.3974 1.2338 1.1839 0.0382  -0.0512 0.2105  229 PRO A C   
1356 O O   . PRO A 236 ? 1.4515 1.2819 1.2307 0.0430  -0.0566 0.2199  229 PRO A O   
1357 C CB  . PRO A 236 ? 1.2729 1.1428 1.0788 0.0380  -0.0563 0.1957  229 PRO A CB  
1358 C CG  . PRO A 236 ? 1.2720 1.1495 1.0750 0.0418  -0.0641 0.2029  229 PRO A CG  
1359 C CD  . PRO A 236 ? 1.2970 1.1834 1.0918 0.0334  -0.0633 0.2081  229 PRO A CD  
1360 N N   . GLY A 237 ? 1.3435 1.1655 1.1312 0.0385  -0.0447 0.2074  230 GLY A N   
1361 C CA  . GLY A 237 ? 1.3230 1.1219 1.1062 0.0445  -0.0434 0.2133  230 GLY A CA  
1362 C C   . GLY A 237 ? 1.2817 1.0747 1.0691 0.0549  -0.0509 0.2131  230 GLY A C   
1363 O O   . GLY A 237 ? 1.2811 1.0850 1.0782 0.0570  -0.0541 0.2050  230 GLY A O   
1364 N N   . VAL A 238 ? 1.1995 0.9757 0.9802 0.0613  -0.0539 0.2222  231 VAL A N   
1365 C CA  . VAL A 238 ? 1.2436 1.0150 1.0281 0.0715  -0.0625 0.2233  231 VAL A CA  
1366 C C   . VAL A 238 ? 1.3256 1.0739 1.1109 0.0777  -0.0613 0.2241  231 VAL A C   
1367 O O   . VAL A 238 ? 1.4824 1.2141 1.2586 0.0797  -0.0598 0.2334  231 VAL A O   
1368 C CB  . VAL A 238 ? 1.3179 1.0929 1.0943 0.0756  -0.0706 0.2341  231 VAL A CB  
1369 C CG1 . VAL A 238 ? 1.3471 1.1288 1.1322 0.0845  -0.0802 0.2322  231 VAL A CG1 
1370 C CG2 . VAL A 238 ? 1.1788 0.9720 0.9496 0.0672  -0.0698 0.2360  231 VAL A CG2 
1371 N N   . VAL A 239 ? 1.3074 1.0550 1.1037 0.0805  -0.0623 0.2144  232 VAL A N   
1372 C CA  . VAL A 239 ? 1.3692 1.0958 1.1675 0.0853  -0.0615 0.2129  232 VAL A CA  
1373 C C   . VAL A 239 ? 1.5099 1.2265 1.3085 0.0962  -0.0710 0.2193  232 VAL A C   
1374 O O   . VAL A 239 ? 1.5521 1.2822 1.3554 0.1008  -0.0791 0.2206  232 VAL A O   
1375 C CB  . VAL A 239 ? 1.3488 1.0797 1.1598 0.0834  -0.0605 0.2000  232 VAL A CB  
1376 C CG1 . VAL A 239 ? 1.2811 0.9899 1.0933 0.0862  -0.0596 0.1978  232 VAL A CG1 
1377 C CG2 . VAL A 239 ? 1.3819 1.1256 1.1941 0.0735  -0.0522 0.1932  232 VAL A CG2 
1378 N N   . THR A 240 ? 1.5399 1.2331 1.3339 0.1004  -0.0697 0.2233  233 THR A N   
1379 C CA  . THR A 240 ? 1.4916 1.1731 1.2872 0.1114  -0.0786 0.2286  233 THR A CA  
1380 C C   . THR A 240 ? 1.4134 1.0756 1.2146 0.1146  -0.0783 0.2234  233 THR A C   
1381 O O   . THR A 240 ? 1.2410 0.8955 1.0410 0.1078  -0.0705 0.2179  233 THR A O   
1382 C CB  . THR A 240 ? 1.5085 1.1782 1.2898 0.1148  -0.0792 0.2430  233 THR A CB  
1383 O OG1 . THR A 240 ? 1.5582 1.2075 1.3309 0.1116  -0.0698 0.2468  233 THR A OG1 
1384 C CG2 . THR A 240 ? 1.3978 1.0858 1.1724 0.1095  -0.0792 0.2484  233 THR A CG2 
1385 N N   . CYS A 241 ? 1.5658 1.2213 1.3742 0.1250  -0.0872 0.2250  234 CYS A N   
1386 C CA  . CYS A 241 ? 1.6631 1.3001 1.4784 0.1291  -0.0888 0.2208  234 CYS A CA  
1387 C C   . CYS A 241 ? 1.7690 1.3981 1.5900 0.1424  -0.0984 0.2259  234 CYS A C   
1388 O O   . CYS A 241 ? 1.7876 1.4293 1.6098 0.1484  -0.1047 0.2310  234 CYS A O   
1389 C CB  . CYS A 241 ? 1.5846 1.2334 1.4169 0.1244  -0.0887 0.2075  234 CYS A CB  
1390 S SG  . CYS A 241 ? 1.9417 1.6212 1.7931 0.1286  -0.0953 0.2014  234 CYS A SG  
1391 N N   . LEU A 242 ? 1.8119 1.4205 1.6366 0.1471  -0.0997 0.2246  235 LEU A N   
1392 C CA  . LEU A 242 ? 1.7786 1.3808 1.6120 0.1606  -0.1085 0.2275  235 LEU A CA  
1393 C C   . LEU A 242 ? 1.8060 1.4281 1.6630 0.1648  -0.1135 0.2170  235 LEU A C   
1394 O O   . LEU A 242 ? 1.7657 1.4040 1.6313 0.1567  -0.1099 0.2081  235 LEU A O   
1395 C CB  . LEU A 242 ? 1.6320 1.2039 1.4605 0.1647  -0.1076 0.2303  235 LEU A CB  
1396 C CG  . LEU A 242 ? 1.5523 1.1021 1.3582 0.1633  -0.1019 0.2423  235 LEU A CG  
1397 C CD1 . LEU A 242 ? 1.5648 1.0850 1.3683 0.1701  -0.1028 0.2454  235 LEU A CD1 
1398 C CD2 . LEU A 242 ? 1.4668 1.0254 1.2634 0.1682  -0.1052 0.2539  235 LEU A CD2 
1399 N N   . ASP A 243 ? 1.7764 1.3976 1.6439 0.1776  -0.1211 0.2182  236 ASP A N   
1400 C CA  . ASP A 243 ? 1.6763 1.3190 1.5663 0.1832  -0.1254 0.2094  236 ASP A CA  
1401 C C   . ASP A 243 ? 1.5623 1.2097 1.4665 0.1775  -0.1202 0.1972  236 ASP A C   
1402 O O   . ASP A 243 ? 1.4361 1.1035 1.3463 0.1698  -0.1168 0.1908  236 ASP A O   
1403 C CB  . ASP A 243 ? 1.6581 1.2950 1.5570 0.1987  -0.1335 0.2121  236 ASP A CB  
1404 C CG  . ASP A 243 ? 1.5669 1.2304 1.4866 0.2050  -0.1387 0.2055  236 ASP A CG  
1405 O OD1 . ASP A 243 ? 1.4535 1.1208 1.3765 0.2156  -0.1466 0.2105  236 ASP A OD1 
1406 O OD2 . ASP A 243 ? 1.5637 1.2444 1.4963 0.1994  -0.1349 0.1955  236 ASP A OD2 
1407 N N   . ARG A 246 ? 1.4585 1.2051 1.3924 0.1401  -0.1008 0.1644  239 ARG A N   
1408 C CA  . ARG A 246 ? 1.4350 1.1786 1.3510 0.1378  -0.1025 0.1736  239 ARG A CA  
1409 C C   . ARG A 246 ? 1.5059 1.2738 1.4251 0.1380  -0.1051 0.1738  239 ARG A C   
1410 O O   . ARG A 246 ? 1.3281 1.1028 1.2356 0.1310  -0.1027 0.1766  239 ARG A O   
1411 C CB  . ARG A 246 ? 1.3391 1.0630 1.2470 0.1464  -0.1080 0.1828  239 ARG A CB  
1412 C CG  . ARG A 246 ? 1.2112 0.9388 1.1340 0.1594  -0.1154 0.1823  239 ARG A CG  
1413 C CD  . ARG A 246 ? 1.2709 0.9906 1.1832 0.1670  -0.1222 0.1933  239 ARG A CD  
1414 N NE  . ARG A 246 ? 1.3915 1.1178 1.3187 0.1795  -0.1298 0.1929  239 ARG A NE  
1415 C CZ  . ARG A 246 ? 1.5340 1.2599 1.4569 0.1875  -0.1373 0.2013  239 ARG A CZ  
1416 N NH1 . ARG A 246 ? 1.5782 1.2973 1.4818 0.1844  -0.1377 0.2113  239 ARG A NH1 
1417 N NH2 . ARG A 246 ? 1.5588 1.2919 1.4970 0.1988  -0.1442 0.1998  239 ARG A NH2 
1418 N N   . HIS A 247 ? 1.7551 1.5365 1.6907 0.1460  -0.1098 0.1703  240 HIS A N   
1419 C CA  . HIS A 247 ? 1.8995 1.7047 1.8404 0.1464  -0.1127 0.1697  240 HIS A CA  
1420 C C   . HIS A 247 ? 1.8561 1.6800 1.8137 0.1445  -0.1092 0.1592  240 HIS A C   
1421 O O   . HIS A 247 ? 1.7612 1.5802 1.7278 0.1446  -0.1055 0.1526  240 HIS A O   
1422 C CB  . HIS A 247 ? 2.0258 1.8338 1.9698 0.1570  -0.1218 0.1761  240 HIS A CB  
1423 C CG  . HIS A 247 ? 2.1270 1.9286 2.0855 0.1678  -0.1259 0.1737  240 HIS A CG  
1424 N ND1 . HIS A 247 ? 2.1679 1.9491 2.1210 0.1754  -0.1303 0.1803  240 HIS A ND1 
1425 C CD2 . HIS A 247 ? 2.1284 1.9420 2.1071 0.1725  -0.1260 0.1651  240 HIS A CD2 
1426 C CE1 . HIS A 247 ? 2.1635 1.9439 2.1329 0.1847  -0.1332 0.1756  240 HIS A CE1 
1427 N NE2 . HIS A 247 ? 2.1358 1.9364 2.1210 0.1828  -0.1304 0.1663  240 HIS A NE2 
1428 N N   . GLY A 248 ? 1.8959 1.7413 1.8571 0.1426  -0.1102 0.1579  241 GLY A N   
1429 C CA  . GLY A 248 ? 1.8881 1.7515 1.8617 0.1391  -0.1059 0.1486  241 GLY A CA  
1430 C C   . GLY A 248 ? 1.7998 1.6656 1.7628 0.1277  -0.0991 0.1466  241 GLY A C   
1431 O O   . GLY A 248 ? 1.7097 1.5911 1.6790 0.1232  -0.0953 0.1402  241 GLY A O   
1432 N N   . PHE A 249 ? 1.7814 1.6315 1.7283 0.1232  -0.0975 0.1522  242 PHE A N   
1433 C CA  . PHE A 249 ? 1.7694 1.6206 1.7052 0.1126  -0.0912 0.1510  242 PHE A CA  
1434 C C   . PHE A 249 ? 1.6772 1.5489 1.6116 0.1093  -0.0918 0.1510  242 PHE A C   
1435 O O   . PHE A 249 ? 1.5791 1.4607 1.5134 0.1020  -0.0866 0.1457  242 PHE A O   
1436 C CB  . PHE A 249 ? 1.8074 1.6387 1.7258 0.1094  -0.0900 0.1580  242 PHE A CB  
1437 C CG  . PHE A 249 ? 1.7113 1.5230 1.6293 0.1083  -0.0867 0.1561  242 PHE A CG  
1438 C CD1 . PHE A 249 ? 1.6031 1.4029 1.5082 0.0999  -0.0810 0.1569  242 PHE A CD1 
1439 C CD2 . PHE A 249 ? 1.6299 1.4358 1.5610 0.1155  -0.0890 0.1530  242 PHE A CD2 
1440 C CE1 . PHE A 249 ? 1.4495 1.2320 1.3546 0.0981  -0.0783 0.1551  242 PHE A CE1 
1441 C CE2 . PHE A 249 ? 1.4964 1.2847 1.4276 0.1140  -0.0860 0.1511  242 PHE A CE2 
1442 C CZ  . PHE A 249 ? 1.3883 1.1650 1.3066 0.1050  -0.0810 0.1523  242 PHE A CZ  
1443 N N   . GLU A 250 ? 1.6745 1.5524 1.6080 0.1149  -0.0984 0.1569  243 GLU A N   
1444 C CA  . GLU A 250 ? 1.6030 1.5015 1.5365 0.1123  -0.0997 0.1570  243 GLU A CA  
1445 C C   . GLU A 250 ? 1.5566 1.4584 1.4784 0.1018  -0.0936 0.1566  243 GLU A C   
1446 O O   . GLU A 250 ? 1.6499 1.5362 1.5578 0.0988  -0.0918 0.1613  243 GLU A O   
1447 C CB  . GLU A 250 ? 1.5246 1.4425 1.4755 0.1134  -0.0986 0.1487  243 GLU A CB  
1448 C CG  . GLU A 250 ? 1.5785 1.4947 1.5428 0.1238  -0.1041 0.1481  243 GLU A CG  
1449 C CD  . GLU A 250 ? 1.6356 1.5706 1.6166 0.1245  -0.1020 0.1396  243 GLU A CD  
1450 O OE1 . GLU A 250 ? 1.6515 1.5865 1.6455 0.1324  -0.1053 0.1375  243 GLU A OE1 
1451 O OE2 . GLU A 250 ? 1.6656 1.6154 1.6468 0.1173  -0.0970 0.1351  243 GLU A OE2 
1452 N N   . SER A 251 ? 1.4152 1.3371 1.3428 0.0964  -0.0902 0.1509  244 SER A N   
1453 C CA  . SER A 251 ? 1.3712 1.2972 1.2904 0.0867  -0.0840 0.1490  244 SER A CA  
1454 C C   . SER A 251 ? 1.2118 1.1411 1.1385 0.0819  -0.0775 0.1398  244 SER A C   
1455 O O   . SER A 251 ? 1.1317 1.0614 1.0697 0.0860  -0.0778 0.1353  244 SER A O   
1456 C CB  . SER A 251 ? 1.3723 1.3184 1.2909 0.0833  -0.0850 0.1502  244 SER A CB  
1457 O OG  . SER A 251 ? 1.3526 1.3172 1.2847 0.0849  -0.0854 0.1444  244 SER A OG  
1458 N N   . GLY A 252 ? 1.1158 1.0474 1.0363 0.0734  -0.0717 0.1372  245 GLY A N   
1459 C CA  . GLY A 252 ? 1.1510 1.0882 1.0782 0.0685  -0.0657 0.1286  245 GLY A CA  
1460 C C   . GLY A 252 ? 1.1148 1.0371 1.0445 0.0696  -0.0634 0.1255  245 GLY A C   
1461 O O   . GLY A 252 ? 1.0593 0.9854 0.9936 0.0651  -0.0584 0.1187  245 GLY A O   
1462 N N   . ASP A 253 ? 1.0703 0.9761 0.9975 0.0754  -0.0673 0.1302  246 ASP A N   
1463 C CA  . ASP A 253 ? 0.9977 0.8882 0.9268 0.0760  -0.0653 0.1277  246 ASP A CA  
1464 C C   . ASP A 253 ? 0.9264 0.8066 0.8443 0.0680  -0.0597 0.1275  246 ASP A C   
1465 O O   . ASP A 253 ? 0.9423 0.8183 0.8478 0.0654  -0.0595 0.1328  246 ASP A O   
1466 C CB  . ASP A 253 ? 1.0366 0.9129 0.9671 0.0838  -0.0702 0.1326  246 ASP A CB  
1467 C CG  . ASP A 253 ? 1.0574 0.9423 1.0032 0.0920  -0.0743 0.1301  246 ASP A CG  
1468 O OD1 . ASP A 253 ? 1.0853 0.9878 1.0368 0.0932  -0.0761 0.1288  246 ASP A OD1 
1469 O OD2 . ASP A 253 ? 1.0460 0.9207 0.9987 0.0970  -0.0753 0.1291  246 ASP A OD2 
1470 N N   . PHE A 254 ? 0.8077 0.6849 0.7301 0.0642  -0.0551 0.1214  247 PHE A N   
1471 C CA  . PHE A 254 ? 0.7332 0.5995 0.6463 0.0570  -0.0500 0.1208  247 PHE A CA  
1472 C C   . PHE A 254 ? 0.7332 0.5810 0.6464 0.0588  -0.0506 0.1222  247 PHE A C   
1473 O O   . PHE A 254 ? 0.8514 0.6981 0.7761 0.0638  -0.0526 0.1199  247 PHE A O   
1474 C CB  . PHE A 254 ? 0.7063 0.5821 0.6231 0.0504  -0.0445 0.1132  247 PHE A CB  
1475 C CG  . PHE A 254 ? 0.6341 0.5248 0.5478 0.0468  -0.0429 0.1122  247 PHE A CG  
1476 C CD1 . PHE A 254 ? 0.6815 0.5890 0.6040 0.0497  -0.0452 0.1105  247 PHE A CD1 
1477 C CD2 . PHE A 254 ? 0.6409 0.5305 0.5448 0.0404  -0.0385 0.1123  247 PHE A CD2 
1478 C CE1 . PHE A 254 ? 0.7573 0.6802 0.6793 0.0455  -0.0434 0.1089  247 PHE A CE1 
1479 C CE2 . PHE A 254 ? 0.7427 0.6472 0.6459 0.0370  -0.0370 0.1110  247 PHE A CE2 
1480 C CZ  . PHE A 254 ? 0.7828 0.7044 0.6957 0.0392  -0.0396 0.1091  247 PHE A CZ  
1481 N N   . VAL A 255 ? 0.7627 0.5964 0.6633 0.0548  -0.0485 0.1258  248 VAL A N   
1482 C CA  . VAL A 255 ? 0.8479 0.6619 0.7454 0.0569  -0.0504 0.1298  248 VAL A CA  
1483 C C   . VAL A 255 ? 0.8522 0.6543 0.7415 0.0485  -0.0454 0.1283  248 VAL A C   
1484 O O   . VAL A 255 ? 0.9039 0.7094 0.7831 0.0429  -0.0400 0.1275  248 VAL A O   
1485 C CB  . VAL A 255 ? 0.9709 0.7775 0.8583 0.0627  -0.0545 0.1388  248 VAL A CB  
1486 C CG1 . VAL A 255 ? 0.9570 0.7412 0.8328 0.0618  -0.0535 0.1441  248 VAL A CG1 
1487 C CG2 . VAL A 255 ? 0.9436 0.7559 0.8420 0.0724  -0.0613 0.1405  248 VAL A CG2 
1488 N N   . SER A 256 ? 0.8758 0.6654 0.7710 0.0477  -0.0467 0.1279  249 SER A N   
1489 C CA  . SER A 256 ? 0.9609 0.7401 0.8508 0.0384  -0.0438 0.1274  249 SER A CA  
1490 C C   . SER A 256 ? 1.0642 0.8222 0.9481 0.0392  -0.0469 0.1339  249 SER A C   
1491 O O   . SER A 256 ? 1.1247 0.8750 1.0124 0.0477  -0.0514 0.1377  249 SER A O   
1492 C CB  . SER A 256 ? 0.8895 0.6777 0.7970 0.0331  -0.0420 0.1212  249 SER A CB  
1493 O OG  . SER A 256 ? 0.8334 0.6385 0.7424 0.0303  -0.0383 0.1152  249 SER A OG  
1494 N N   . PHE A 257 ? 1.0373 0.7866 0.9129 0.0299  -0.0449 0.1353  250 PHE A N   
1495 C CA  . PHE A 257 ? 1.0407 0.7701 0.9100 0.0286  -0.0481 0.1421  250 PHE A CA  
1496 C C   . PHE A 257 ? 1.0762 0.8179 0.9807 0.0168  -0.0507 0.1465  250 PHE A C   
1497 O O   . PHE A 257 ? 1.1931 0.9569 1.1173 0.0105  -0.0449 0.1447  250 PHE A O   
1498 C CB  . PHE A 257 ? 1.0976 0.8117 0.9308 0.0350  -0.0318 0.1444  250 PHE A CB  
1499 C CG  . PHE A 257 ? 1.1437 0.8697 0.9746 0.0455  -0.0285 0.1506  250 PHE A CG  
1500 C CD1 . PHE A 257 ? 1.1587 0.9070 0.9953 0.0443  -0.0271 0.1473  250 PHE A CD1 
1501 C CD2 . PHE A 257 ? 1.2168 0.9325 1.0419 0.0531  -0.0315 0.1601  250 PHE A CD2 
1502 C CE1 . PHE A 257 ? 1.1519 0.9119 0.9885 0.0487  -0.0309 0.1528  250 PHE A CE1 
1503 C CE2 . PHE A 257 ? 1.2280 0.9558 1.0530 0.0580  -0.0353 0.1660  250 PHE A CE2 
1504 C CZ  . PHE A 257 ? 1.2074 0.9574 1.0380 0.0553  -0.0355 0.1621  250 PHE A CZ  
1505 N N   . SER A 258 ? 1.0870 0.8159 1.0006 0.0186  -0.0531 0.1532  251 SER A N   
1506 C CA  . SER A 258 ? 1.1034 0.8388 1.0438 0.0139  -0.0459 0.1583  251 SER A CA  
1507 C C   . SER A 258 ? 1.2961 1.0167 1.2407 0.0144  -0.0483 0.1692  251 SER A C   
1508 O O   . SER A 258 ? 1.3841 1.0832 1.3095 0.0206  -0.0582 0.1693  251 SER A O   
1509 C CB  . SER A 258 ? 1.0278 0.7570 0.9726 0.0189  -0.0423 0.1476  251 SER A CB  
1510 O OG  . SER A 258 ? 1.0871 0.8080 1.0249 0.0295  -0.0472 0.1422  251 SER A OG  
1511 N N   . GLU A 259 ? 1.3202 1.0460 1.2805 0.0105  -0.0367 0.1762  252 GLU A N   
1512 C CA  . GLU A 259 ? 1.2669 0.9786 1.2327 0.0114  -0.0347 0.1870  252 GLU A CA  
1513 C C   . GLU A 259 ? 1.2198 0.9455 1.1934 0.0159  -0.0255 0.2039  252 GLU A C   
1514 O O   . GLU A 259 ? 1.1301 0.8428 1.1067 0.0194  -0.0229 0.2139  252 GLU A O   
1515 C CB  . GLU A 259 ? 1.2064 0.8894 1.1647 0.0169  -0.0463 0.1820  252 GLU A CB  
1516 C CG  . GLU A 259 ? 1.1836 0.8579 1.1414 0.0193  -0.0433 0.1686  252 GLU A CG  
1517 C CD  . GLU A 259 ? 1.2156 0.8706 1.1684 0.0300  -0.0503 0.1630  252 GLU A CD  
1518 O OE1 . GLU A 259 ? 1.2323 0.8713 1.1802 0.0345  -0.0573 0.1698  252 GLU A OE1 
1519 O OE2 . GLU A 259 ? 1.1874 0.8447 1.1420 0.0349  -0.0478 0.1521  252 GLU A OE2 
1520 N N   . VAL A 260 ? 1.2526 1.0010 1.2228 0.0230  -0.0096 0.2063  253 VAL A N   
1521 C CA  . VAL A 260 ? 1.2750 1.0080 1.2075 0.0406  0.0146  0.2118  253 VAL A CA  
1522 C C   . VAL A 260 ? 1.2380 0.9603 1.1607 0.0306  0.0160  0.2168  253 VAL A C   
1523 O O   . VAL A 260 ? 1.1684 0.8980 1.0842 0.0219  0.0170  0.2118  253 VAL A O   
1524 C CB  . VAL A 260 ? 1.2793 1.0039 1.1661 0.0492  0.0199  0.1999  253 VAL A CB  
1525 C CG1 . VAL A 260 ? 1.3175 1.0258 1.1727 0.0498  0.0162  0.2058  253 VAL A CG1 
1526 C CG2 . VAL A 260 ? 1.2482 0.9388 1.0866 0.0589  0.0109  0.1802  253 VAL A CG2 
1527 N N   . GLN A 261 ? 1.2572 0.9615 1.1786 0.0324  0.0166  0.2266  254 GLN A N   
1528 C CA  . GLN A 261 ? 1.2148 0.9064 1.1258 0.0234  0.0184  0.2325  254 GLN A CA  
1529 C C   . GLN A 261 ? 1.2005 0.8887 1.0814 0.0242  0.0213  0.2359  254 GLN A C   
1530 O O   . GLN A 261 ? 1.1992 0.8830 1.0622 0.0341  0.0204  0.2372  254 GLN A O   
1531 C CB  . GLN A 261 ? 1.2684 0.9405 1.1873 0.0252  0.0172  0.2423  254 GLN A CB  
1532 C CG  . GLN A 261 ? 1.2877 0.9599 1.2362 0.0223  0.0073  0.2389  254 GLN A CG  
1533 C CD  . GLN A 261 ? 1.3553 1.0055 1.3102 0.0225  0.0046  0.2476  254 GLN A CD  
1534 O OE1 . GLN A 261 ? 1.4496 1.0856 1.3885 0.0238  0.0121  0.2571  254 GLN A OE1 
1535 N NE2 . GLN A 261 ? 1.2898 0.9323 1.2631 0.0199  -0.0092 0.2430  254 GLN A NE2 
1536 N N   . GLY A 262 ? 1.1689 0.8576 1.0426 0.0125  0.0224  0.2366  255 GLY A N   
1537 C CA  . GLY A 262 ? 1.1852 0.8755 1.0362 0.0094  0.0222  0.2398  255 GLY A CA  
1538 C C   . GLY A 262 ? 1.1272 0.8374 0.9752 0.0052  0.0215  0.2294  255 GLY A C   
1539 O O   . GLY A 262 ? 0.9346 0.6513 0.7831 -0.0055 0.0230  0.2253  255 GLY A O   
1540 N N   . MET A 263 ? 1.2178 0.9361 1.0607 0.0135  0.0188  0.2249  256 MET A N   
1541 C CA  . MET A 263 ? 1.2585 0.9957 1.1022 0.0104  0.0180  0.2141  256 MET A CA  
1542 C C   . MET A 263 ? 1.2625 1.0087 1.1266 0.0116  0.0196  0.2048  256 MET A C   
1543 O O   . MET A 263 ? 1.3130 1.0640 1.1803 0.0200  0.0184  0.1992  256 MET A O   
1544 C CB  . MET A 263 ? 1.1927 0.9355 1.0216 0.0160  0.0130  0.2127  256 MET A CB  
1545 C CG  . MET A 263 ? 1.1684 0.9008 0.9919 0.0285  0.0091  0.2141  256 MET A CG  
1546 S SD  . MET A 263 ? 1.4545 1.1992 1.2657 0.0315  0.0006  0.2087  256 MET A SD  
1547 C CE  . MET A 263 ? 0.7650 0.5158 0.5633 0.0225  -0.0013 0.2176  256 MET A CE  
1548 N N   . VAL A 264 ? 1.2153 0.9625 1.0910 0.0024  0.0213  0.2028  257 VAL A N   
1549 C CA  . VAL A 264 ? 1.2480 1.0031 1.1434 0.0004  0.0204  0.1946  257 VAL A CA  
1550 C C   . VAL A 264 ? 1.2572 1.0307 1.1533 0.0011  0.0199  0.1843  257 VAL A C   
1551 O O   . VAL A 264 ? 1.2997 1.0822 1.2111 0.0034  0.0177  0.1781  257 VAL A O   
1552 C CB  . VAL A 264 ? 1.4226 1.1705 1.3205 -0.0112 0.0214  0.1933  257 VAL A CB  
1553 C CG1 . VAL A 264 ? 1.3298 1.0797 1.2107 -0.0196 0.0242  0.1934  257 VAL A CG1 
1554 C CG2 . VAL A 264 ? 1.4717 1.2260 1.3834 -0.0150 0.0193  0.1827  257 VAL A CG2 
1555 N N   . GLU A 265 ? 1.1978 0.9768 1.0779 -0.0017 0.0205  0.1831  258 GLU A N   
1556 C CA  . GLU A 265 ? 1.1990 0.9938 1.0768 -0.0020 0.0197  0.1739  258 GLU A CA  
1557 C C   . GLU A 265 ? 1.2245 1.0235 1.1036 0.0087  0.0180  0.1700  258 GLU A C   
1558 O O   . GLU A 265 ? 1.2801 1.0913 1.1605 0.0090  0.0172  0.1614  258 GLU A O   
1559 C CB  . GLU A 265 ? 1.2063 1.0033 1.0665 -0.0068 0.0188  0.1765  258 GLU A CB  
1560 C CG  . GLU A 265 ? 1.3383 1.1213 1.1870 -0.0036 0.0176  0.1879  258 GLU A CG  
1561 C CD  . GLU A 265 ? 1.4587 1.2369 1.2965 -0.0132 0.0188  0.1943  258 GLU A CD  
1562 O OE1 . GLU A 265 ? 1.4344 1.2128 1.2763 -0.0218 0.0217  0.1917  258 GLU A OE1 
1563 O OE2 . GLU A 265 ? 1.5677 1.3416 1.3919 -0.0124 0.0164  0.2020  258 GLU A OE2 
1564 N N   . LEU A 266 ? 1.1418 0.9281 1.0174 0.0174  0.0173  0.1757  259 LEU A N   
1565 C CA  . LEU A 266 ? 1.0436 0.8261 0.9115 0.0277  0.0147  0.1702  259 LEU A CA  
1566 C C   . LEU A 266 ? 1.0293 0.8172 0.9176 0.0312  0.0175  0.1650  259 LEU A C   
1567 O O   . LEU A 266 ? 1.0982 0.8783 0.9709 0.0370  0.0147  0.1537  259 LEU A O   
1568 C CB  . LEU A 266 ? 0.9928 0.7555 0.8436 0.0351  0.0105  0.1773  259 LEU A CB  
1569 C CG  . LEU A 266 ? 0.9346 0.6950 0.7678 0.0393  0.0002  0.1747  259 LEU A CG  
1570 C CD1 . LEU A 266 ? 0.7806 0.5572 0.6104 0.0325  -0.0015 0.1769  259 LEU A CD1 
1571 C CD2 . LEU A 266 ? 1.0145 0.7563 0.8364 0.0464  -0.0057 0.1828  259 LEU A CD2 
1572 N N   . ASN A 267 ? 0.9631 0.7597 0.8818 0.0232  0.0165  0.1715  260 ASN A N   
1573 C CA  . ASN A 267 ? 0.9722 0.7810 0.9251 0.0153  0.0036  0.1706  260 ASN A CA  
1574 C C   . ASN A 267 ? 1.0524 0.8760 1.0112 0.0091  -0.0027 0.1597  260 ASN A C   
1575 O O   . ASN A 267 ? 1.1703 0.9993 1.1321 0.0049  -0.0194 0.1550  260 ASN A O   
1576 C CB  . ASN A 267 ? 0.9130 0.7046 0.8677 0.0065  -0.0001 0.1716  260 ASN A CB  
1577 C CG  . ASN A 267 ? 0.8677 0.6440 0.8224 0.0106  0.0007  0.1828  260 ASN A CG  
1578 O OD1 . ASN A 267 ? 0.9249 0.7009 0.8888 0.0156  -0.0067 0.1878  260 ASN A OD1 
1579 N ND2 . ASN A 267 ? 0.7279 0.4909 0.6719 0.0066  0.0069  0.1867  260 ASN A ND2 
1580 N N   . GLY A 268 ? 0.9365 0.7593 0.8886 0.0032  0.0025  0.1534  261 GLY A N   
1581 C CA  . GLY A 268 ? 0.8746 0.7071 0.8293 -0.0009 -0.0007 0.1425  261 GLY A CA  
1582 C C   . GLY A 268 ? 0.8103 0.6609 0.7616 0.0034  0.0047  0.1391  261 GLY A C   
1583 O O   . GLY A 268 ? 0.7962 0.6541 0.7459 -0.0004 0.0060  0.1310  261 GLY A O   
1584 N N   . ASN A 269 ? 0.9069 0.7559 0.8462 0.0153  0.0123  0.1421  262 ASN A N   
1585 C CA  . ASN A 269 ? 0.7846 0.6274 0.6933 0.0202  0.0169  0.1322  262 ASN A CA  
1586 C C   . ASN A 269 ? 0.7017 0.5328 0.5905 0.0247  0.0138  0.1174  262 ASN A C   
1587 O O   . ASN A 269 ? 0.6035 0.4083 0.4772 0.0028  -0.0233 0.1074  262 ASN A O   
1588 C CB  . ASN A 269 ? 0.7894 0.6156 0.6709 0.0223  0.0131  0.1357  262 ASN A CB  
1589 C CG  . ASN A 269 ? 0.9984 0.8364 0.8734 0.0162  0.0103  0.1343  262 ASN A CG  
1590 O OD1 . ASN A 269 ? 1.1940 1.0343 1.0601 0.0177  0.0042  0.1318  262 ASN A OD1 
1591 N ND2 . ASN A 269 ? 0.9907 0.8370 0.8711 0.0080  0.0133  0.1358  262 ASN A ND2 
1592 N N   . GLN A 270 ? 0.6962 0.5346 0.5772 0.0208  0.0083  0.1123  263 GLN A N   
1593 C CA  . GLN A 270 ? 0.8090 0.6454 0.6838 0.0178  -0.0043 0.1031  263 GLN A CA  
1594 C C   . GLN A 270 ? 0.8939 0.7247 0.7668 0.0215  -0.0151 0.1085  263 GLN A C   
1595 O O   . GLN A 270 ? 0.9498 0.7752 0.8155 0.0252  -0.0137 0.1164  263 GLN A O   
1596 C CB  . GLN A 270 ? 0.7644 0.6218 0.6456 0.0163  -0.0022 0.1012  263 GLN A CB  
1597 C CG  . GLN A 270 ? 0.6752 0.5474 0.5653 0.0125  0.0066  0.1018  263 GLN A CG  
1598 C CD  . GLN A 270 ? 0.6119 0.4992 0.5041 0.0090  0.0039  0.0970  263 GLN A CD  
1599 O OE1 . GLN A 270 ? 0.5969 0.4872 0.4884 0.0106  -0.0020 0.0942  263 GLN A OE1 
1600 N NE2 . GLN A 270 ? 0.5959 0.4940 0.4927 0.0035  0.0073  0.0964  263 GLN A NE2 
1601 N N   . PRO A 271 ? 0.8013 0.6381 0.6861 0.0226  -0.0234 0.1061  264 PRO A N   
1602 C CA  . PRO A 271 ? 0.7774 0.6151 0.6654 0.0301  -0.0296 0.1114  264 PRO A CA  
1603 C C   . PRO A 271 ? 0.7411 0.5887 0.6231 0.0323  -0.0291 0.1156  264 PRO A C   
1604 O O   . PRO A 271 ? 0.6309 0.4928 0.5151 0.0292  -0.0262 0.1119  264 PRO A O   
1605 C CB  . PRO A 271 ? 0.7319 0.5816 0.6360 0.0325  -0.0324 0.1065  264 PRO A CB  
1606 C CG  . PRO A 271 ? 0.5867 0.4365 0.4973 0.0263  -0.0295 0.1007  264 PRO A CG  
1607 C CD  . PRO A 271 ? 0.5785 0.4250 0.4773 0.0190  -0.0246 0.0993  264 PRO A CD  
1608 N N   . MET A 272 ? 0.8530 0.6936 0.7286 0.0371  -0.0326 0.1235  265 MET A N   
1609 C CA  . MET A 272 ? 0.7791 0.6293 0.6495 0.0381  -0.0338 0.1291  265 MET A CA  
1610 C C   . MET A 272 ? 0.8213 0.6790 0.6973 0.0446  -0.0415 0.1320  265 MET A C   
1611 O O   . MET A 272 ? 0.7006 0.5496 0.5801 0.0507  -0.0463 0.1344  265 MET A O   
1612 C CB  . MET A 272 ? 0.7891 0.6274 0.6471 0.0383  -0.0316 0.1374  265 MET A CB  
1613 C CG  . MET A 272 ? 1.0075 0.8341 0.8611 0.0345  -0.0236 0.1364  265 MET A CG  
1614 S SD  . MET A 272 ? 0.9635 0.7750 0.8055 0.0367  -0.0217 0.1482  265 MET A SD  
1615 C CE  . MET A 272 ? 1.6541 1.4624 1.4983 0.0311  -0.0092 0.1469  265 MET A CE  
1616 N N   . GLU A 273 ? 0.8979 0.7722 0.7752 0.0434  -0.0427 0.1320  266 GLU A N   
1617 C CA  . GLU A 273 ? 0.8908 0.7751 0.7730 0.0491  -0.0494 0.1347  266 GLU A CA  
1618 C C   . GLU A 273 ? 0.9697 0.8445 0.8441 0.0544  -0.0545 0.1442  266 GLU A C   
1619 O O   . GLU A 273 ? 0.7663 0.6345 0.6290 0.0518  -0.0526 0.1501  266 GLU A O   
1620 C CB  . GLU A 273 ? 0.8027 0.7091 0.6893 0.0445  -0.0483 0.1317  266 GLU A CB  
1621 C CG  . GLU A 273 ? 0.7941 0.7164 0.6922 0.0485  -0.0526 0.1297  266 GLU A CG  
1622 C CD  . GLU A 273 ? 1.0082 0.9511 0.9117 0.0429  -0.0502 0.1248  266 GLU A CD  
1623 O OE1 . GLU A 273 ? 0.9546 0.9115 0.8628 0.0448  -0.0536 0.1258  266 GLU A OE1 
1624 O OE2 . GLU A 273 ? 1.1904 1.1354 1.0936 0.0367  -0.0449 0.1198  266 GLU A OE2 
1625 N N   . ILE A 274 ? 1.0210 0.8962 0.9024 0.0620  -0.0607 0.1459  267 ILE A N   
1626 C CA  . ILE A 274 ? 1.0215 0.8864 0.8974 0.0685  -0.0663 0.1546  267 ILE A CA  
1627 C C   . ILE A 274 ? 1.0148 0.8951 0.8929 0.0721  -0.0724 0.1586  267 ILE A C   
1628 O O   . ILE A 274 ? 0.9705 0.8698 0.8597 0.0715  -0.0729 0.1532  267 ILE A O   
1629 C CB  . ILE A 274 ? 1.0841 0.9359 0.9676 0.0750  -0.0690 0.1536  267 ILE A CB  
1630 C CG1 . ILE A 274 ? 1.1937 1.0231 1.0668 0.0741  -0.0663 0.1576  267 ILE A CG1 
1631 C CG2 . ILE A 274 ? 1.0787 0.9347 0.9693 0.0844  -0.0771 0.1573  267 ILE A CG2 
1632 C CD1 . ILE A 274 ? 1.2631 1.0892 1.1299 0.0651  -0.0580 0.1536  267 ILE A CD1 
1633 N N   . LYS A 275 ? 1.1019 0.9752 0.9700 0.0753  -0.0764 0.1678  268 LYS A N   
1634 C CA  . LYS A 275 ? 1.2163 1.1041 1.0872 0.0790  -0.0827 0.1720  268 LYS A CA  
1635 C C   . LYS A 275 ? 1.2041 1.0774 1.0699 0.0880  -0.0896 0.1809  268 LYS A C   
1636 O O   . LYS A 275 ? 1.1844 1.0467 1.0367 0.0877  -0.0901 0.1892  268 LYS A O   
1637 C CB  . LYS A 275 ? 1.2758 1.1768 1.1394 0.0716  -0.0806 0.1744  268 LYS A CB  
1638 C CG  . LYS A 275 ? 1.2927 1.2138 1.1613 0.0733  -0.0860 0.1763  268 LYS A CG  
1639 C CD  . LYS A 275 ? 1.2994 1.2407 1.1695 0.0642  -0.0819 0.1719  268 LYS A CD  
1640 C CE  . LYS A 275 ? 1.3396 1.2881 1.2199 0.0601  -0.0762 0.1612  268 LYS A CE  
1641 N NZ  . LYS A 275 ? 1.3835 1.3356 1.2767 0.0665  -0.0787 0.1567  268 LYS A NZ  
1642 N N   . VAL A 276 ? 1.1925 1.0662 1.0699 0.0962  -0.0949 0.1792  269 VAL A N   
1643 C CA  . VAL A 276 ? 1.2792 1.1392 1.1550 0.1057  -0.1016 0.1864  269 VAL A CA  
1644 C C   . VAL A 276 ? 1.2777 1.1447 1.1466 0.1088  -0.1080 0.1953  269 VAL A C   
1645 O O   . VAL A 276 ? 1.1883 1.0774 1.0635 0.1070  -0.1097 0.1934  269 VAL A O   
1646 C CB  . VAL A 276 ? 1.0835 0.9450 0.9766 0.1137  -0.1054 0.1813  269 VAL A CB  
1647 C CG1 . VAL A 276 ? 1.0761 0.9391 0.9726 0.1238  -0.1145 0.1877  269 VAL A CG1 
1648 C CG2 . VAL A 276 ? 1.0766 0.9189 0.9717 0.1144  -0.1017 0.1783  269 VAL A CG2 
1649 N N   . LEU A 277 ? 1.3310 1.1802 1.1878 0.1125  -0.1106 0.2047  270 LEU A N   
1650 C CA  . LEU A 277 ? 1.3898 1.2428 1.2389 0.1163  -0.1173 0.2145  270 LEU A CA  
1651 C C   . LEU A 277 ? 1.4500 1.2952 1.3054 0.1284  -0.1257 0.2187  270 LEU A C   
1652 O O   . LEU A 277 ? 1.4312 1.2853 1.2866 0.1337  -0.1334 0.2245  270 LEU A O   
1653 C CB  . LEU A 277 ? 1.2744 1.1139 1.1045 0.1116  -0.1140 0.2231  270 LEU A CB  
1654 C CG  . LEU A 277 ? 1.0898 0.9390 0.9151 0.0992  -0.1055 0.2191  270 LEU A CG  
1655 C CD1 . LEU A 277 ? 0.9600 0.7877 0.7725 0.0953  -0.0986 0.2221  270 LEU A CD1 
1656 C CD2 . LEU A 277 ? 1.0973 0.9651 0.9179 0.0945  -0.1076 0.2237  270 LEU A CD2 
1657 N N   . GLY A 278 ? 1.4432 1.2726 1.3049 0.1324  -0.1242 0.2152  271 GLY A N   
1658 C CA  . GLY A 278 ? 1.3826 1.2029 1.2521 0.1439  -0.1313 0.2180  271 GLY A CA  
1659 C C   . GLY A 278 ? 1.3721 1.1777 1.2504 0.1461  -0.1279 0.2115  271 GLY A C   
1660 O O   . GLY A 278 ? 1.3917 1.1970 1.2717 0.1387  -0.1204 0.2042  271 GLY A O   
1661 N N   . PRO A 279 ? 1.4191 1.2128 1.3034 0.1565  -0.1335 0.2141  272 PRO A N   
1662 C CA  . PRO A 279 ? 1.4409 1.2213 1.3352 0.1597  -0.1313 0.2078  272 PRO A CA  
1663 C C   . PRO A 279 ? 1.4902 1.2482 1.3717 0.1535  -0.1239 0.2087  272 PRO A C   
1664 O O   . PRO A 279 ? 1.5074 1.2615 1.3959 0.1498  -0.1186 0.2006  272 PRO A O   
1665 C CB  . PRO A 279 ? 1.4764 1.2477 1.3762 0.1728  -0.1398 0.2130  272 PRO A CB  
1666 C CG  . PRO A 279 ? 1.4655 1.2538 1.3649 0.1764  -0.1471 0.2187  272 PRO A CG  
1667 C CD  . PRO A 279 ? 1.4487 1.2423 1.3317 0.1662  -0.1429 0.2228  272 PRO A CD  
1668 N N   . TYR A 280 ? 1.5393 1.2833 1.4022 0.1522  -0.1232 0.2186  273 TYR A N   
1669 C CA  . TYR A 280 ? 1.6045 1.3260 1.4542 0.1469  -0.1160 0.2207  273 TYR A CA  
1670 C C   . TYR A 280 ? 1.5354 1.2633 1.3748 0.1343  -0.1075 0.2190  273 TYR A C   
1671 O O   . TYR A 280 ? 1.3859 1.0994 1.2174 0.1282  -0.1000 0.2179  273 TYR A O   
1672 C CB  . TYR A 280 ? 1.7122 1.4132 1.5474 0.1530  -0.1189 0.2330  273 TYR A CB  
1673 C CG  . TYR A 280 ? 1.7942 1.4879 1.6384 0.1664  -0.1277 0.2357  273 TYR A CG  
1674 C CD1 . TYR A 280 ? 1.8100 1.4841 1.6594 0.1715  -0.1272 0.2330  273 TYR A CD1 
1675 C CD2 . TYR A 280 ? 1.8024 1.5094 1.6504 0.1740  -0.1366 0.2408  273 TYR A CD2 
1676 C CE1 . TYR A 280 ? 1.7974 1.4651 1.6558 0.1844  -0.1351 0.2351  273 TYR A CE1 
1677 C CE2 . TYR A 280 ? 1.7854 1.4866 1.6424 0.1868  -0.1448 0.2430  273 TYR A CE2 
1678 C CZ  . TYR A 280 ? 1.7516 1.4330 1.6139 0.1922  -0.1438 0.2401  273 TYR A CZ  
1679 O OH  . TYR A 280 ? 1.6581 1.3339 1.5300 0.2055  -0.1518 0.2419  273 TYR A OH  
1680 N N   . THR A 281 ? 1.6085 1.3587 1.4489 0.1306  -0.1085 0.2183  274 THR A N   
1681 C CA  . THR A 281 ? 1.5721 1.3291 1.4016 0.1198  -0.1014 0.2186  274 THR A CA  
1682 C C   . THR A 281 ? 1.4181 1.1980 1.2573 0.1130  -0.0986 0.2089  274 THR A C   
1683 O O   . THR A 281 ? 1.2847 1.0790 1.1384 0.1168  -0.1030 0.2033  274 THR A O   
1684 C CB  . THR A 281 ? 1.1750 0.9347 0.9907 0.1200  -0.1044 0.2300  274 THR A CB  
1685 O OG1 . THR A 281 ? 1.2005 0.9693 1.0225 0.1290  -0.1145 0.2338  274 THR A OG1 
1686 C CG2 . THR A 281 ? 1.1066 0.8423 0.9074 0.1208  -0.1013 0.2396  274 THR A CG2 
1687 N N   . PHE A 282 ? 1.4239 1.2067 1.2551 0.1031  -0.0908 0.2070  275 PHE A N   
1688 C CA  . PHE A 282 ? 1.3357 1.1397 1.1729 0.0959  -0.0876 0.1993  275 PHE A CA  
1689 C C   . PHE A 282 ? 1.2132 1.0173 1.0392 0.0858  -0.0793 0.1998  275 PHE A C   
1690 O O   . PHE A 282 ? 1.1928 0.9801 1.0084 0.0840  -0.0748 0.2048  275 PHE A O   
1691 C CB  . PHE A 282 ? 1.3189 1.1282 1.1716 0.0957  -0.0861 0.1882  275 PHE A CB  
1692 C CG  . PHE A 282 ? 1.3980 1.1884 1.2508 0.0945  -0.0814 0.1847  275 PHE A CG  
1693 C CD1 . PHE A 282 ? 1.4259 1.2128 1.2732 0.0855  -0.0728 0.1806  275 PHE A CD1 
1694 C CD2 . PHE A 282 ? 1.4612 1.2383 1.3206 0.1023  -0.0857 0.1852  275 PHE A CD2 
1695 C CE1 . PHE A 282 ? 1.4710 1.2412 1.3185 0.0838  -0.0688 0.1772  275 PHE A CE1 
1696 C CE2 . PHE A 282 ? 1.4974 1.2575 1.3574 0.1005  -0.0819 0.1818  275 PHE A CE2 
1697 C CZ  . PHE A 282 ? 1.5019 1.2584 1.3555 0.0910  -0.0736 0.1778  275 PHE A CZ  
1698 N N   . SER A 283 ? 1.1036 0.9269 0.9326 0.0794  -0.0771 0.1948  276 SER A N   
1699 C CA  . SER A 283 ? 1.1143 0.9406 0.9354 0.0699  -0.0695 0.1942  276 SER A CA  
1700 C C   . SER A 283 ? 1.1711 1.0019 1.0002 0.0641  -0.0628 0.1832  276 SER A C   
1701 O O   . SER A 283 ? 1.0897 0.9331 0.9302 0.0647  -0.0645 0.1757  276 SER A O   
1702 C CB  . SER A 283 ? 1.0046 0.8503 0.8226 0.0657  -0.0717 0.1972  276 SER A CB  
1703 O OG  . SER A 283 ? 0.9207 0.7849 0.7505 0.0685  -0.0770 0.1928  276 SER A OG  
1704 N N   . ILE A 284 ? 1.2410 1.0619 1.0645 0.0585  -0.0549 0.1825  277 ILE A N   
1705 C CA  . ILE A 284 ? 1.2154 1.0387 1.0458 0.0533  -0.0484 0.1726  277 ILE A CA  
1706 C C   . ILE A 284 ? 1.2518 1.0912 1.0818 0.0449  -0.0437 0.1691  277 ILE A C   
1707 O O   . ILE A 284 ? 1.3925 1.2485 1.2295 0.0436  -0.0458 0.1637  277 ILE A O   
1708 C CB  . ILE A 284 ? 0.8486 0.6521 0.6759 0.0527  -0.0423 0.1722  277 ILE A CB  
1709 C CG1 . ILE A 284 ? 0.9297 0.7213 0.7450 0.0519  -0.0391 0.1826  277 ILE A CG1 
1710 C CG2 . ILE A 284 ? 0.8152 0.6061 0.6481 0.0596  -0.0472 0.1702  277 ILE A CG2 
1711 C CD1 . ILE A 284 ? 0.9195 0.6941 0.7331 0.0505  -0.0312 0.1826  277 ILE A CD1 
1712 N N   . CYS A 285 ? 1.1932 1.0281 1.0161 0.0392  -0.0374 0.1722  278 CYS A N   
1713 C CA  . CYS A 285 ? 1.2614 1.1110 1.0841 0.0309  -0.0334 0.1692  278 CYS A CA  
1714 C C   . CYS A 285 ? 1.4241 1.2726 1.2373 0.0264  -0.0324 0.1780  278 CYS A C   
1715 O O   . CYS A 285 ? 1.5146 1.3486 1.3192 0.0308  -0.0342 0.1872  278 CYS A O   
1716 C CB  . CYS A 285 ? 1.3067 1.1563 1.1362 0.0263  -0.0259 0.1609  278 CYS A CB  
1717 S SG  . CYS A 285 ? 1.2359 1.0689 1.0617 0.0237  -0.0178 0.1653  278 CYS A SG  
1718 N N   . ASP A 286 ? 1.5797 1.4434 1.3944 0.0174  -0.0298 0.1751  279 ASP A N   
1719 C CA  . ASP A 286 ? 1.7829 1.6492 1.5892 0.0112  -0.0299 0.1824  279 ASP A CA  
1720 C C   . ASP A 286 ? 1.7340 1.5867 1.5354 0.0072  -0.0235 0.1862  279 ASP A C   
1721 O O   . ASP A 286 ? 1.6704 1.5307 1.4749 -0.0011 -0.0191 0.1815  279 ASP A O   
1722 C CB  . ASP A 286 ? 2.0173 1.9065 1.8276 0.0027  -0.0309 0.1770  279 ASP A CB  
1723 C CG  . ASP A 286 ? 2.2180 2.1160 2.0381 -0.0020 -0.0262 0.1658  279 ASP A CG  
1724 O OD1 . ASP A 286 ? 2.3435 2.2561 2.1656 -0.0105 -0.0252 0.1618  279 ASP A OD1 
1725 O OD2 . ASP A 286 ? 2.2008 2.0912 2.0266 0.0028  -0.0237 0.1611  279 ASP A OD2 
1726 N N   . THR A 287 ? 1.7567 1.5898 1.5513 0.0131  -0.0232 0.1949  280 THR A N   
1727 C CA  . THR A 287 ? 1.7116 1.5302 1.5043 0.0106  -0.0164 0.1986  280 THR A CA  
1728 C C   . THR A 287 ? 1.6769 1.4939 1.4607 0.0028  -0.0155 0.2068  280 THR A C   
1729 O O   . THR A 287 ? 1.6081 1.4106 1.3896 0.0016  -0.0109 0.2124  280 THR A O   
1730 C CB  . THR A 287 ? 1.6328 1.4309 1.4261 0.0199  -0.0156 0.2023  280 THR A CB  
1731 O OG1 . THR A 287 ? 1.5139 1.3044 1.2985 0.0266  -0.0223 0.2110  280 THR A OG1 
1732 C CG2 . THR A 287 ? 1.6389 1.4387 1.4434 0.0249  -0.0154 0.1917  280 THR A CG2 
1733 N N   . SER A 288 ? 1.6605 1.4928 1.4401 -0.0032 -0.0197 0.2075  281 SER A N   
1734 C CA  . SER A 288 ? 1.5959 1.4274 1.3656 -0.0111 -0.0198 0.2154  281 SER A CA  
1735 C C   . SER A 288 ? 1.5804 1.4094 1.3515 -0.0203 -0.0134 0.2131  281 SER A C   
1736 O O   . SER A 288 ? 1.6105 1.4282 1.3738 -0.0241 -0.0116 0.2214  281 SER A O   
1737 C CB  . SER A 288 ? 1.4961 1.3481 1.2631 -0.0174 -0.0247 0.2141  281 SER A CB  
1738 O OG  . SER A 288 ? 1.4054 1.2594 1.1694 -0.0100 -0.0314 0.2188  281 SER A OG  
1739 N N   . ASN A 289 ? 1.4932 1.3329 1.2742 -0.0242 -0.0103 0.2018  282 ASN A N   
1740 C CA  . ASN A 289 ? 1.4835 1.3231 1.2669 -0.0333 -0.0052 0.1978  282 ASN A CA  
1741 C C   . ASN A 289 ? 1.4125 1.2380 1.2033 -0.0292 0.0002  0.1967  282 ASN A C   
1742 O O   . ASN A 289 ? 1.3476 1.1782 1.1463 -0.0339 0.0038  0.1884  282 ASN A O   
1743 C CB  . ASN A 289 ? 1.5069 1.3669 1.2964 -0.0410 -0.0053 0.1862  282 ASN A CB  
1744 C CG  . ASN A 289 ? 1.6104 1.4817 1.3919 -0.0517 -0.0075 0.1874  282 ASN A CG  
1745 O OD1 . ASN A 289 ? 1.6174 1.4853 1.3890 -0.0520 -0.0105 0.1968  282 ASN A OD1 
1746 N ND2 . ASN A 289 ? 1.6472 1.5321 1.4328 -0.0605 -0.0062 0.1779  282 ASN A ND2 
1747 N N   . PHE A 290 ? 1.4492 1.2574 1.2378 -0.0205 0.0006  0.2053  283 PHE A N   
1748 C CA  . PHE A 290 ? 1.4703 1.2645 1.2670 -0.0163 0.0058  0.2057  283 PHE A CA  
1749 C C   . PHE A 290 ? 1.4792 1.2554 1.2695 -0.0177 0.0079  0.2172  283 PHE A C   
1750 O O   . PHE A 290 ? 1.5395 1.3132 1.3179 -0.0204 0.0050  0.2252  283 PHE A O   
1751 C CB  . PHE A 290 ? 1.4908 1.2796 1.2930 -0.0038 0.0047  0.2043  283 PHE A CB  
1752 C CG  . PHE A 290 ? 1.4188 1.2216 1.2312 -0.0027 0.0047  0.1920  283 PHE A CG  
1753 C CD1 . PHE A 290 ? 1.4541 1.2683 1.2640 0.0002  -0.0003 0.1880  283 PHE A CD1 
1754 C CD2 . PHE A 290 ? 1.3435 1.1486 1.1686 -0.0051 0.0094  0.1848  283 PHE A CD2 
1755 C CE1 . PHE A 290 ? 1.4402 1.2663 1.2593 0.0009  -0.0003 0.1771  283 PHE A CE1 
1756 C CE2 . PHE A 290 ? 1.3345 1.1518 1.1685 -0.0041 0.0094  0.1741  283 PHE A CE2 
1757 C CZ  . PHE A 290 ? 1.3782 1.2054 1.2088 -0.0010 0.0048  0.1702  283 PHE A CZ  
1758 N N   . SER A 291 ? 1.4059 1.1700 1.2049 -0.0163 0.0128  0.2184  284 SER A N   
1759 C CA  . SER A 291 ? 1.4144 1.1602 1.2095 -0.0175 0.0151  0.2293  284 SER A CA  
1760 C C   . SER A 291 ? 1.4861 1.2183 1.2785 -0.0058 0.0122  0.2371  284 SER A C   
1761 O O   . SER A 291 ? 1.4777 1.2132 1.2747 0.0034  0.0096  0.2322  284 SER A O   
1762 C CB  . SER A 291 ? 1.2725 1.0127 1.0804 -0.0221 0.0200  0.2258  284 SER A CB  
1763 O OG  . SER A 291 ? 1.1001 0.8528 0.9086 -0.0335 0.0211  0.2167  284 SER A OG  
1764 N N   . ASP A 292 ? 1.5198 1.2362 1.3036 -0.0063 0.0124  0.2490  285 ASP A N   
1765 C CA  . ASP A 292 ? 1.5201 1.2226 1.2989 0.0048  0.0090  0.2572  285 ASP A CA  
1766 C C   . ASP A 292 ? 1.4301 1.1225 1.2231 0.0138  0.0112  0.2545  285 ASP A C   
1767 O O   . ASP A 292 ? 1.3607 1.0519 1.1681 0.0098  0.0159  0.2508  285 ASP A O   
1768 C CB  . ASP A 292 ? 1.5470 1.2350 1.3119 0.0017  0.0084  0.2714  285 ASP A CB  
1769 C CG  . ASP A 292 ? 1.4916 1.1694 1.2610 -0.0073 0.0142  0.2749  285 ASP A CG  
1770 O OD1 . ASP A 292 ? 1.3900 1.0491 1.1565 -0.0052 0.0150  0.2853  285 ASP A OD1 
1771 O OD2 . ASP A 292 ? 1.4922 1.1801 1.2674 -0.0167 0.0174  0.2671  285 ASP A OD2 
1772 N N   . TYR A 293 ? 1.3551 1.0405 1.1439 0.0256  0.0069  0.2563  286 TYR A N   
1773 C CA  . TYR A 293 ? 1.3289 1.0062 1.1289 0.0355  0.0082  0.2520  286 TYR A CA  
1774 C C   . TYR A 293 ? 1.4146 1.0710 1.2187 0.0390  0.0112  0.2614  286 TYR A C   
1775 O O   . TYR A 293 ? 1.3972 1.0415 1.1899 0.0378  0.0100  0.2729  286 TYR A O   
1776 C CB  . TYR A 293 ? 1.2906 0.9683 1.0811 0.0460  0.0005  0.2483  286 TYR A CB  
1777 C CG  . TYR A 293 ? 1.2878 0.9512 1.0818 0.0574  -0.0006 0.2449  286 TYR A CG  
1778 C CD1 . TYR A 293 ? 1.3135 0.9827 1.1178 0.0595  0.0013  0.2322  286 TYR A CD1 
1779 C CD2 . TYR A 293 ? 1.2857 0.9287 1.0706 0.0658  -0.0044 0.2537  286 TYR A CD2 
1780 C CE1 . TYR A 293 ? 1.3541 1.0070 1.1563 0.0689  -0.0016 0.2272  286 TYR A CE1 
1781 C CE2 . TYR A 293 ? 1.3594 0.9868 1.1442 0.0758  -0.0071 0.2492  286 TYR A CE2 
1782 C CZ  . TYR A 293 ? 1.4271 1.0584 1.2189 0.0769  -0.0064 0.2353  286 TYR A CZ  
1783 O OH  . TYR A 293 ? 1.4630 1.0746 1.2492 0.0848  -0.0133 0.2286  286 TYR A OH  
1784 N N   . ILE A 294 ? 1.5319 1.1850 1.3537 0.0431  0.0151  0.2566  287 ILE A N   
1785 C CA  . ILE A 294 ? 1.6624 1.2964 1.4916 0.0487  0.0175  0.2641  287 ILE A CA  
1786 C C   . ILE A 294 ? 1.7910 1.4216 1.6267 0.0604  0.0174  0.2559  287 ILE A C   
1787 O O   . ILE A 294 ? 1.8600 1.5055 1.7027 0.0603  0.0177  0.2445  287 ILE A O   
1788 C CB  . ILE A 294 ? 1.2131 0.8460 1.0621 0.0372  0.0218  0.2678  287 ILE A CB  
1789 C CG1 . ILE A 294 ? 1.0290 0.6631 0.8643 0.0250  0.0219  0.2724  287 ILE A CG1 
1790 C CG2 . ILE A 294 ? 1.2936 0.9062 1.1514 0.0420  0.0230  0.2769  287 ILE A CG2 
1791 C CD1 . ILE A 294 ? 0.9064 0.5405 0.7541 0.0116  0.0246  0.2708  287 ILE A CD1 
1792 N N   . ARG A 295 ? 1.8392 1.4479 1.6695 0.0704  0.0169  0.2610  288 ARG A N   
1793 C CA  . ARG A 295 ? 1.8946 1.4867 1.7102 0.0832  0.0121  0.2511  288 ARG A CA  
1794 C C   . ARG A 295 ? 1.8349 1.4326 1.6569 0.0841  0.0137  0.2351  288 ARG A C   
1795 O O   . ARG A 295 ? 1.8139 1.3988 1.6067 0.0862  -0.0034 0.2205  288 ARG A O   
1796 C CB  . ARG A 295 ? 1.9548 1.5185 1.7644 0.0918  0.0118  0.2579  288 ARG A CB  
1797 C CG  . ARG A 295 ? 1.9282 1.5018 1.7821 0.0860  0.0237  0.2664  288 ARG A CG  
1798 C CD  . ARG A 295 ? 1.9461 1.4893 1.7907 0.0953  0.0241  0.2737  288 ARG A CD  
1799 N NE  . ARG A 295 ? 1.9310 1.4611 1.7577 0.0945  0.0205  0.2870  288 ARG A NE  
1800 C CZ  . ARG A 295 ? 1.9297 1.4432 1.7226 0.1031  0.0096  0.2889  288 ARG A CZ  
1801 N NH1 . ARG A 295 ? 1.9211 1.4275 1.6939 0.1113  -0.0034 0.2773  288 ARG A NH1 
1802 N NH2 . ARG A 295 ? 1.9465 1.4537 1.7314 0.1013  0.0079  0.3035  288 ARG A NH2 
1803 N N   . GLY A 296 ? 1.7415 1.3711 1.6237 0.0758  0.0241  0.2424  289 GLY A N   
1804 C CA  . GLY A 296 ? 1.6277 1.3061 1.5876 0.0631  0.0104  0.2444  289 GLY A CA  
1805 C C   . GLY A 296 ? 1.6350 1.2817 1.5118 0.0778  0.0247  0.2163  289 GLY A C   
1806 O O   . GLY A 296 ? 1.6995 1.3508 1.5583 0.0727  0.0209  0.2153  289 GLY A O   
1807 N N   . GLY A 297 ? 1.5519 1.1664 1.4150 0.0286  -0.0771 0.1916  290 GLY A N   
1808 C CA  . GLY A 297 ? 1.4411 1.0673 1.2914 0.0333  -0.0697 0.1798  290 GLY A CA  
1809 C C   . GLY A 297 ? 1.4000 1.0279 1.2517 0.0494  -0.0686 0.1746  290 GLY A C   
1810 O O   . GLY A 297 ? 1.4331 1.0469 1.2713 0.0633  -0.0683 0.1784  290 GLY A O   
1811 N N   . ILE A 298 ? 1.3398 0.9913 1.2161 0.0469  -0.0681 0.1679  291 ILE A N   
1812 C CA  . ILE A 298 ? 1.2906 0.9505 1.1742 0.0592  -0.0684 0.1628  291 ILE A CA  
1813 C C   . ILE A 298 ? 1.2347 0.9164 1.1156 0.0581  -0.0644 0.1574  291 ILE A C   
1814 O O   . ILE A 298 ? 1.2353 0.9267 1.1147 0.0474  -0.0607 0.1547  291 ILE A O   
1815 C CB  . ILE A 298 ? 1.3085 0.9704 1.2171 0.0620  -0.0679 0.1573  291 ILE A CB  
1816 C CG1 . ILE A 298 ? 1.1758 0.8597 1.0968 0.0597  -0.0626 0.1481  291 ILE A CG1 
1817 C CG2 . ILE A 298 ? 1.3371 0.9868 1.2556 0.0547  -0.0671 0.1605  291 ILE A CG2 
1818 C CD1 . ILE A 298 ? 1.0763 0.7597 1.0139 0.0657  -0.0600 0.1407  291 ILE A CD1 
1819 N N   . VAL A 299 ? 1.1732 0.8643 1.0565 0.0686  -0.0660 0.1564  292 VAL A N   
1820 C CA  . VAL A 299 ? 1.0568 0.7698 0.9409 0.0681  -0.0633 0.1522  292 VAL A CA  
1821 C C   . VAL A 299 ? 1.0609 0.7884 0.9660 0.0735  -0.0643 0.1453  292 VAL A C   
1822 O O   . VAL A 299 ? 1.1742 0.8946 1.0897 0.0814  -0.0674 0.1449  292 VAL A O   
1823 C CB  . VAL A 299 ? 1.0384 0.7549 0.9089 0.0746  -0.0643 0.1585  292 VAL A CB  
1824 C CG1 . VAL A 299 ? 1.1658 0.8947 1.0498 0.0849  -0.0700 0.1580  292 VAL A CG1 
1825 C CG2 . VAL A 299 ? 0.8621 0.5921 0.7226 0.0681  -0.0581 0.1571  292 VAL A CG2 
1826 N N   . SER A 300 ? 1.0033 0.7501 0.9135 0.0698  -0.0609 0.1394  293 SER A N   
1827 C CA  . SER A 300 ? 1.0026 0.7631 0.9300 0.0745  -0.0602 0.1322  293 SER A CA  
1828 C C   . SER A 300 ? 1.1769 0.9580 1.1049 0.0754  -0.0599 0.1300  293 SER A C   
1829 O O   . SER A 300 ? 1.2578 1.0431 1.1735 0.0713  -0.0592 0.1331  293 SER A O   
1830 C CB  . SER A 300 ? 0.9168 0.6792 0.8534 0.0679  -0.0548 0.1255  293 SER A CB  
1831 O OG  . SER A 300 ? 0.8466 0.5914 0.7848 0.0664  -0.0548 0.1274  293 SER A OG  
1832 N N   . GLN A 301 ? 1.2245 1.0183 1.1667 0.0807  -0.0599 0.1244  294 GLN A N   
1833 C CA  . GLN A 301 ? 1.2477 1.0617 1.1928 0.0812  -0.0598 0.1218  294 GLN A CA  
1834 C C   . GLN A 301 ? 1.2611 1.0865 1.2137 0.0759  -0.0541 0.1136  294 GLN A C   
1835 O O   . GLN A 301 ? 1.3465 1.1735 1.3110 0.0795  -0.0527 0.1082  294 GLN A O   
1836 C CB  . GLN A 301 ? 1.2806 1.1013 1.2359 0.0918  -0.0649 0.1221  294 GLN A CB  
1837 C CG  . GLN A 301 ? 1.2831 1.1238 1.2405 0.0926  -0.0663 0.1214  294 GLN A CG  
1838 C CD  . GLN A 301 ? 1.2953 1.1437 1.2646 0.1027  -0.0715 0.1212  294 GLN A CD  
1839 O OE1 . GLN A 301 ? 1.2608 1.1077 1.2421 0.1080  -0.0713 0.1166  294 GLN A OE1 
1840 N NE2 . GLN A 301 ? 1.3454 1.2026 1.3117 0.1055  -0.0761 0.1258  294 GLN A NE2 
1841 N N   . VAL A 302 ? 1.2135 1.0468 1.1588 0.0678  -0.0507 0.1125  295 VAL A N   
1842 C CA  . VAL A 302 ? 1.1425 0.9847 1.0929 0.0620  -0.0452 0.1053  295 VAL A CA  
1843 C C   . VAL A 302 ? 1.0473 0.9084 1.0048 0.0637  -0.0444 0.1007  295 VAL A C   
1844 O O   . VAL A 302 ? 1.0159 0.8837 0.9816 0.0629  -0.0409 0.0944  295 VAL A O   
1845 C CB  . VAL A 302 ? 1.1576 0.9977 1.0970 0.0519  -0.0415 0.1056  295 VAL A CB  
1846 C CG1 . VAL A 302 ? 1.1538 1.0008 1.0994 0.0463  -0.0362 0.0986  295 VAL A CG1 
1847 C CG2 . VAL A 302 ? 1.1894 1.0114 1.1206 0.0494  -0.0427 0.1110  295 VAL A CG2 
1848 N N   . LYS A 303 ? 0.9645 0.8342 0.9185 0.0659  -0.0476 0.1039  296 LYS A N   
1849 C CA  . LYS A 303 ? 0.8744 0.7623 0.8353 0.0671  -0.0474 0.1000  296 LYS A CA  
1850 C C   . LYS A 303 ? 0.8868 0.7816 0.8484 0.0731  -0.0529 0.1045  296 LYS A C   
1851 O O   . LYS A 303 ? 0.8819 0.7699 0.8341 0.0737  -0.0561 0.1110  296 LYS A O   
1852 C CB  . LYS A 303 ? 0.7625 0.6599 0.7182 0.0588  -0.0428 0.0969  296 LYS A CB  
1853 C CG  . LYS A 303 ? 0.7129 0.6195 0.6772 0.0560  -0.0377 0.0891  296 LYS A CG  
1854 C CD  . LYS A 303 ? 0.8833 0.7825 0.8423 0.0487  -0.0334 0.0869  296 LYS A CD  
1855 C CE  . LYS A 303 ? 0.9677 0.8731 0.9354 0.0471  -0.0287 0.0797  296 LYS A CE  
1856 N NZ  . LYS A 303 ? 0.9442 0.8667 0.9159 0.0452  -0.0262 0.0750  296 LYS A NZ  
1857 N N   . VAL A 304 ? 0.8942 0.8034 0.8674 0.0772  -0.0536 0.1007  297 VAL A N   
1858 C CA  . VAL A 304 ? 0.8899 0.8090 0.8655 0.0823  -0.0586 0.1040  297 VAL A CA  
1859 C C   . VAL A 304 ? 0.7576 0.6971 0.7392 0.0795  -0.0559 0.0989  297 VAL A C   
1860 O O   . VAL A 304 ? 0.6862 0.6310 0.6731 0.0765  -0.0511 0.0926  297 VAL A O   
1861 C CB  . VAL A 304 ? 0.9003 0.8154 0.8857 0.0921  -0.0635 0.1051  297 VAL A CB  
1862 C CG1 . VAL A 304 ? 0.8783 0.7723 0.8577 0.0949  -0.0660 0.1101  297 VAL A CG1 
1863 C CG2 . VAL A 304 ? 0.8970 0.8189 0.8960 0.0943  -0.0605 0.0972  297 VAL A CG2 
1864 N N   . PRO A 305 ? 0.7199 0.6708 0.7000 0.0801  -0.0589 0.1019  298 PRO A N   
1865 C CA  . PRO A 305 ? 0.6539 0.6241 0.6392 0.0772  -0.0566 0.0975  298 PRO A CA  
1866 C C   . PRO A 305 ? 0.6857 0.6670 0.6838 0.0834  -0.0588 0.0945  298 PRO A C   
1867 O O   . PRO A 305 ? 0.8545 0.8316 0.8568 0.0907  -0.0639 0.0978  298 PRO A O   
1868 C CB  . PRO A 305 ? 0.6527 0.6288 0.6298 0.0749  -0.0591 0.1025  298 PRO A CB  
1869 C CG  . PRO A 305 ? 0.6105 0.5739 0.5824 0.0805  -0.0649 0.1100  298 PRO A CG  
1870 C CD  . PRO A 305 ? 0.6541 0.5991 0.6254 0.0823  -0.0641 0.1098  298 PRO A CD  
1871 N N   . LYS A 306 ? 0.5825 0.5774 0.5867 0.0805  -0.0549 0.0884  299 LYS A N   
1872 C CA  . LYS A 306 ? 0.5732 0.5803 0.5890 0.0852  -0.0562 0.0850  299 LYS A CA  
1873 C C   . LYS A 306 ? 0.6688 0.6929 0.6853 0.0802  -0.0533 0.0817  299 LYS A C   
1874 O O   . LYS A 306 ? 0.7252 0.7507 0.7373 0.0735  -0.0485 0.0788  299 LYS A O   
1875 C CB  . LYS A 306 ? 0.6265 0.6300 0.6509 0.0873  -0.0532 0.0794  299 LYS A CB  
1876 C CG  . LYS A 306 ? 0.7877 0.7737 0.8123 0.0915  -0.0548 0.0812  299 LYS A CG  
1877 C CD  . LYS A 306 ? 0.9113 0.8952 0.9441 0.0923  -0.0508 0.0746  299 LYS A CD  
1878 C CE  . LYS A 306 ? 0.9565 0.9514 1.0032 0.0984  -0.0524 0.0706  299 LYS A CE  
1879 N NZ  . LYS A 306 ? 0.8423 0.8534 0.8927 0.0942  -0.0485 0.0653  299 LYS A NZ  
1880 N N   . LYS A 307 ? 0.7420 0.7792 0.7643 0.0835  -0.0563 0.0819  300 LYS A N   
1881 C CA  . LYS A 307 ? 0.7422 0.7954 0.7661 0.0790  -0.0532 0.0779  300 LYS A CA  
1882 C C   . LYS A 307 ? 0.8607 0.9169 0.8917 0.0782  -0.0488 0.0710  300 LYS A C   
1883 O O   . LYS A 307 ? 1.0534 1.1100 1.0934 0.0838  -0.0504 0.0692  300 LYS A O   
1884 C CB  . LYS A 307 ? 0.7206 0.7875 0.7486 0.0825  -0.0575 0.0799  300 LYS A CB  
1885 C CG  . LYS A 307 ? 1.0131 1.0754 1.0356 0.0858  -0.0634 0.0874  300 LYS A CG  
1886 C CD  . LYS A 307 ? 1.1023 1.1804 1.1269 0.0874  -0.0671 0.0895  300 LYS A CD  
1887 C CE  . LYS A 307 ? 1.0483 1.1210 1.0665 0.0906  -0.0732 0.0976  300 LYS A CE  
1888 N NZ  . LYS A 307 ? 1.0060 1.0947 1.0253 0.0917  -0.0768 0.0999  300 LYS A NZ  
1889 N N   . ILE A 308 ? 0.7787 0.8368 0.8061 0.0714  -0.0434 0.0671  301 ILE A N   
1890 C CA  . ILE A 308 ? 0.6897 0.7522 0.7226 0.0699  -0.0393 0.0608  301 ILE A CA  
1891 C C   . ILE A 308 ? 0.5792 0.6572 0.6132 0.0665  -0.0376 0.0579  301 ILE A C   
1892 O O   . ILE A 308 ? 0.5751 0.6575 0.6032 0.0620  -0.0367 0.0591  301 ILE A O   
1893 C CB  . ILE A 308 ? 0.7639 0.8169 0.7924 0.0650  -0.0345 0.0582  301 ILE A CB  
1894 C CG1 . ILE A 308 ? 0.7421 0.7808 0.7717 0.0688  -0.0355 0.0594  301 ILE A CG1 
1895 C CG2 . ILE A 308 ? 0.8282 0.8881 0.8598 0.0615  -0.0299 0.0521  301 ILE A CG2 
1896 C CD1 . ILE A 308 ? 0.7933 0.8332 0.8333 0.0756  -0.0375 0.0575  301 ILE A CD1 
1897 N N   . SER A 309 ? 0.6099 0.6963 0.6514 0.0687  -0.0371 0.0539  302 SER A N   
1898 C CA  . SER A 309 ? 0.5883 0.6891 0.6306 0.0655  -0.0354 0.0509  302 SER A CA  
1899 C C   . SER A 309 ? 0.5389 0.6405 0.5801 0.0601  -0.0300 0.0454  302 SER A C   
1900 O O   . SER A 309 ? 0.6434 0.7415 0.6891 0.0616  -0.0285 0.0423  302 SER A O   
1901 C CB  . SER A 309 ? 0.6419 0.7533 0.6928 0.0711  -0.0388 0.0503  302 SER A CB  
1902 O OG  . SER A 309 ? 0.7434 0.8687 0.7931 0.0687  -0.0390 0.0497  302 SER A OG  
1903 N N   . PHE A 310 ? 0.3730 0.4791 0.4085 0.0539  -0.0271 0.0443  303 PHE A N   
1904 C CA  . PHE A 310 ? 0.3784 0.4842 0.4117 0.0485  -0.0223 0.0398  303 PHE A CA  
1905 C C   . PHE A 310 ? 0.3678 0.4861 0.4032 0.0468  -0.0212 0.0360  303 PHE A C   
1906 O O   . PHE A 310 ? 0.4109 0.5389 0.4458 0.0464  -0.0226 0.0368  303 PHE A O   
1907 C CB  . PHE A 310 ? 0.5498 0.6517 0.5759 0.0426  -0.0196 0.0406  303 PHE A CB  
1908 C CG  . PHE A 310 ? 0.5693 0.6582 0.5927 0.0422  -0.0188 0.0422  303 PHE A CG  
1909 C CD1 . PHE A 310 ? 0.5277 0.6098 0.5500 0.0455  -0.0220 0.0467  303 PHE A CD1 
1910 C CD2 . PHE A 310 ? 0.4689 0.5521 0.4902 0.0382  -0.0149 0.0393  303 PHE A CD2 
1911 C CE1 . PHE A 310 ? 0.4578 0.5278 0.4770 0.0448  -0.0211 0.0479  303 PHE A CE1 
1912 C CE2 . PHE A 310 ? 0.4462 0.5184 0.4651 0.0376  -0.0141 0.0404  303 PHE A CE2 
1913 C CZ  . PHE A 310 ? 0.3247 0.3902 0.3424 0.0408  -0.0170 0.0446  303 PHE A CZ  
1914 N N   . LYS A 311 ? 0.4200 0.5383 0.4574 0.0455  -0.0187 0.0318  304 LYS A N   
1915 C CA  . LYS A 311 ? 0.3686 0.4975 0.4066 0.0429  -0.0172 0.0278  304 LYS A CA  
1916 C C   . LYS A 311 ? 0.3876 0.5165 0.4183 0.0362  -0.0142 0.0270  304 LYS A C   
1917 O O   . LYS A 311 ? 0.3491 0.4688 0.3755 0.0334  -0.0123 0.0280  304 LYS A O   
1918 C CB  . LYS A 311 ? 0.4039 0.5323 0.4458 0.0431  -0.0155 0.0236  304 LYS A CB  
1919 C CG  . LYS A 311 ? 0.5538 0.6832 0.6049 0.0497  -0.0179 0.0233  304 LYS A CG  
1920 C CD  . LYS A 311 ? 0.7826 0.8992 0.8353 0.0519  -0.0175 0.0243  304 LYS A CD  
1921 C CE  . LYS A 311 ? 0.8215 0.9323 0.8710 0.0473  -0.0136 0.0211  304 LYS A CE  
1922 N NZ  . LYS A 311 ? 0.6293 0.7275 0.6781 0.0481  -0.0129 0.0224  304 LYS A NZ  
1923 N N   . SER A 312 ? 0.3678 0.5072 0.3974 0.0337  -0.0138 0.0250  305 SER A N   
1924 C CA  . SER A 312 ? 0.2838 0.4234 0.3074 0.0273  -0.0107 0.0232  305 SER A CA  
1925 C C   . SER A 312 ? 0.3776 0.5099 0.3991 0.0244  -0.0080 0.0203  305 SER A C   
1926 O O   . SER A 312 ? 0.3152 0.4459 0.3405 0.0269  -0.0084 0.0189  305 SER A O   
1927 C CB  . SER A 312 ? 0.2942 0.4467 0.3177 0.0254  -0.0108 0.0208  305 SER A CB  
1928 O OG  . SER A 312 ? 0.4300 0.5863 0.4553 0.0249  -0.0100 0.0167  305 SER A OG  
1929 N N   . LEU A 313 ? 0.3932 0.5214 0.4091 0.0192  -0.0054 0.0194  306 LEU A N   
1930 C CA  . LEU A 313 ? 0.4097 0.5307 0.4228 0.0162  -0.0034 0.0171  306 LEU A CA  
1931 C C   . LEU A 313 ? 0.4108 0.5380 0.4257 0.0158  -0.0036 0.0134  306 LEU A C   
1932 O O   . LEU A 313 ? 0.4395 0.5628 0.4557 0.0161  -0.0032 0.0119  306 LEU A O   
1933 C CB  . LEU A 313 ? 0.3231 0.4395 0.3304 0.0111  -0.0011 0.0168  306 LEU A CB  
1934 C CG  . LEU A 313 ? 0.2811 0.3904 0.2844 0.0077  0.0003  0.0147  306 LEU A CG  
1935 C CD1 . LEU A 313 ? 0.1707 0.2711 0.1751 0.0095  0.0005  0.0158  306 LEU A CD1 
1936 C CD2 . LEU A 313 ? 0.2252 0.3267 0.2262 0.0033  0.0007  0.0137  306 LEU A CD2 
1937 N N   . VAL A 314 ? 0.4687 0.6063 0.4837 0.0146  -0.0040 0.0116  307 VAL A N   
1938 C CA  . VAL A 314 ? 0.5518 0.6974 0.5687 0.0137  -0.0041 0.0077  307 VAL A CA  
1939 C C   . VAL A 314 ? 0.4335 0.5821 0.4576 0.0186  -0.0056 0.0070  307 VAL A C   
1940 O O   . VAL A 314 ? 0.3256 0.4750 0.3512 0.0176  -0.0049 0.0039  307 VAL A O   
1941 C CB  . VAL A 314 ? 0.6864 0.8441 0.7030 0.0122  -0.0046 0.0061  307 VAL A CB  
1942 C CG1 . VAL A 314 ? 0.3817 0.5484 0.4005 0.0111  -0.0046 0.0017  307 VAL A CG1 
1943 C CG2 . VAL A 314 ? 0.7893 0.9443 0.7994 0.0072  -0.0029 0.0060  307 VAL A CG2 
1944 N N   . ALA A 315 ? 0.4459 0.5960 0.4747 0.0239  -0.0076 0.0099  308 ALA A N   
1945 C CA  . ALA A 315 ? 0.3443 0.4967 0.3811 0.0293  -0.0092 0.0094  308 ALA A CA  
1946 C C   . ALA A 315 ? 0.3726 0.5136 0.4104 0.0304  -0.0083 0.0099  308 ALA A C   
1947 O O   . ALA A 315 ? 0.3818 0.5241 0.4249 0.0322  -0.0079 0.0074  308 ALA A O   
1948 C CB  . ALA A 315 ? 0.2100 0.3668 0.2514 0.0349  -0.0123 0.0127  308 ALA A CB  
1949 N N   . SER A 316 ? 0.3727 0.5034 0.4059 0.0292  -0.0076 0.0130  309 SER A N   
1950 C CA  . SER A 316 ? 0.3024 0.4225 0.3365 0.0305  -0.0070 0.0138  309 SER A CA  
1951 C C   . SER A 316 ? 0.4458 0.5628 0.4772 0.0263  -0.0046 0.0107  309 SER A C   
1952 O O   . SER A 316 ? 0.4095 0.5215 0.4436 0.0274  -0.0039 0.0097  309 SER A O   
1953 C CB  . SER A 316 ? 0.3209 0.4318 0.3502 0.0298  -0.0068 0.0177  309 SER A CB  
1954 O OG  . SER A 316 ? 0.3321 0.4343 0.3639 0.0327  -0.0069 0.0189  309 SER A OG  
1955 N N   . LEU A 317 ? 0.4430 0.5628 0.4688 0.0214  -0.0036 0.0092  310 LEU A N   
1956 C CA  . LEU A 317 ? 0.4033 0.5205 0.4260 0.0171  -0.0021 0.0065  310 LEU A CA  
1957 C C   . LEU A 317 ? 0.3716 0.4950 0.4006 0.0186  -0.0020 0.0029  310 LEU A C   
1958 O O   . LEU A 317 ? 0.3915 0.5107 0.4211 0.0175  -0.0008 0.0013  310 LEU A O   
1959 C CB  . LEU A 317 ? 0.4285 0.5486 0.4452 0.0121  -0.0016 0.0053  310 LEU A CB  
1960 C CG  . LEU A 317 ? 0.4752 0.5890 0.4866 0.0073  -0.0006 0.0040  310 LEU A CG  
1961 C CD1 . LEU A 317 ? 0.5144 0.6343 0.5280 0.0055  -0.0003 0.0000  310 LEU A CD1 
1962 C CD2 . LEU A 317 ? 0.4456 0.5486 0.4558 0.0080  -0.0002 0.0060  310 LEU A CD2 
1963 N N   . ALA A 318 ? 0.4556 0.5897 0.4898 0.0213  -0.0030 0.0015  311 ALA A N   
1964 C CA  . ALA A 318 ? 0.4478 0.5895 0.4889 0.0230  -0.0027 -0.0022 311 ALA A CA  
1965 C C   . ALA A 318 ? 0.5172 0.6563 0.5665 0.0290  -0.0031 -0.0016 311 ALA A C   
1966 O O   . ALA A 318 ? 0.6499 0.7906 0.7041 0.0296  -0.0017 -0.0046 311 ALA A O   
1967 C CB  . ALA A 318 ? 0.3476 0.5027 0.3912 0.0235  -0.0037 -0.0044 311 ALA A CB  
1968 N N   . GLU A 319 ? 0.5448 0.6800 0.5958 0.0332  -0.0049 0.0023  312 GLU A N   
1969 C CA  . GLU A 319 ? 0.5721 0.7044 0.6314 0.0394  -0.0057 0.0032  312 GLU A CA  
1970 C C   . GLU A 319 ? 0.5534 0.6730 0.6095 0.0402  -0.0060 0.0070  312 GLU A C   
1971 O O   . GLU A 319 ? 0.5519 0.6694 0.6097 0.0442  -0.0083 0.0105  312 GLU A O   
1972 C CB  . GLU A 319 ? 0.6805 0.8214 0.7466 0.0450  -0.0086 0.0043  312 GLU A CB  
1973 C CG  . GLU A 319 ? 0.7327 0.8878 0.8011 0.0441  -0.0087 0.0008  312 GLU A CG  
1974 C CD  . GLU A 319 ? 0.6909 0.8543 0.7708 0.0507  -0.0101 -0.0007 312 GLU A CD  
1975 O OE1 . GLU A 319 ? 0.6348 0.7924 0.7210 0.0562  -0.0113 0.0015  312 GLU A OE1 
1976 O OE2 . GLU A 319 ? 0.6882 0.8640 0.7708 0.0502  -0.0100 -0.0043 312 GLU A OE2 
1977 N N   . PRO A 320 ? 0.4356 0.5472 0.4871 0.0363  -0.0038 0.0064  313 PRO A N   
1978 C CA  . PRO A 320 ? 0.5025 0.6028 0.5485 0.0355  -0.0037 0.0098  313 PRO A CA  
1979 C C   . PRO A 320 ? 0.5720 0.6651 0.6235 0.0402  -0.0041 0.0108  313 PRO A C   
1980 O O   . PRO A 320 ? 0.6462 0.7390 0.7039 0.0416  -0.0025 0.0078  313 PRO A O   
1981 C CB  . PRO A 320 ? 0.4678 0.5638 0.5075 0.0297  -0.0014 0.0083  313 PRO A CB  
1982 C CG  . PRO A 320 ? 0.3552 0.4571 0.3996 0.0290  0.0001  0.0039  313 PRO A CG  
1983 C CD  . PRO A 320 ? 0.2658 0.3786 0.3166 0.0324  -0.0013 0.0025  313 PRO A CD  
1984 N N   . ASP A 321 ? 0.5466 0.6339 0.5959 0.0425  -0.0059 0.0148  314 ASP A N   
1985 C CA  . ASP A 321 ? 0.4601 0.5379 0.5120 0.0457  -0.0061 0.0159  314 ASP A CA  
1986 C C   . ASP A 321 ? 0.4216 0.4909 0.4660 0.0410  -0.0038 0.0162  314 ASP A C   
1987 O O   . ASP A 321 ? 0.4528 0.5213 0.4895 0.0368  -0.0033 0.0181  314 ASP A O   
1988 C CB  . ASP A 321 ? 0.5763 0.6510 0.6284 0.0499  -0.0094 0.0203  314 ASP A CB  
1989 C CG  . ASP A 321 ? 0.8631 0.9449 0.9242 0.0558  -0.0122 0.0201  314 ASP A CG  
1990 O OD1 . ASP A 321 ? 0.9048 0.9959 0.9712 0.0559  -0.0112 0.0166  314 ASP A OD1 
1991 O OD2 . ASP A 321 ? 1.0862 1.1642 1.1488 0.0604  -0.0154 0.0237  314 ASP A OD2 
1992 N N   . PHE A 322 ? 0.3439 0.4074 0.3912 0.0417  -0.0021 0.0141  315 PHE A N   
1993 C CA  . PHE A 322 ? 0.5096 0.5656 0.5503 0.0375  0.0000  0.0144  315 PHE A CA  
1994 C C   . PHE A 322 ? 0.6000 0.6460 0.6396 0.0400  -0.0005 0.0167  315 PHE A C   
1995 O O   . PHE A 322 ? 0.6096 0.6534 0.6551 0.0452  -0.0021 0.0168  315 PHE A O   
1996 C CB  . PHE A 322 ? 0.5667 0.6240 0.6099 0.0350  0.0028  0.0099  315 PHE A CB  
1997 C CG  . PHE A 322 ? 0.5606 0.6260 0.6026 0.0314  0.0034  0.0080  315 PHE A CG  
1998 C CD1 . PHE A 322 ? 0.5116 0.5848 0.5610 0.0328  0.0042  0.0045  315 PHE A CD1 
1999 C CD2 . PHE A 322 ? 0.5916 0.6565 0.6250 0.0265  0.0032  0.0097  315 PHE A CD2 
2000 C CE1 . PHE A 322 ? 0.4950 0.5754 0.5421 0.0292  0.0046  0.0028  315 PHE A CE1 
2001 C CE2 . PHE A 322 ? 0.5586 0.6298 0.5901 0.0232  0.0034  0.0078  315 PHE A CE2 
2002 C CZ  . PHE A 322 ? 0.5220 0.6011 0.5600 0.0244  0.0040  0.0044  315 PHE A CZ  
2003 N N   . VAL A 323 ? 0.6776 0.7174 0.7098 0.0361  0.0009  0.0185  316 VAL A N   
2004 C CA  . VAL A 323 ? 0.7425 0.7724 0.7723 0.0372  0.0011  0.0206  316 VAL A CA  
2005 C C   . VAL A 323 ? 0.8149 0.8396 0.8440 0.0351  0.0039  0.0179  316 VAL A C   
2006 O O   . VAL A 323 ? 0.9280 0.9497 0.9623 0.0383  0.0045  0.0152  316 VAL A O   
2007 C CB  . VAL A 323 ? 0.6342 0.6616 0.6568 0.0341  0.0008  0.0245  316 VAL A CB  
2008 C CG1 . VAL A 323 ? 0.6277 0.6452 0.6468 0.0331  0.0020  0.0258  316 VAL A CG1 
2009 C CG2 . VAL A 323 ? 0.4568 0.4875 0.4803 0.0369  -0.0022 0.0274  316 VAL A CG2 
2010 N N   . LYS A 329 ? 1.0354 1.0481 1.0469 0.0184  0.0127  0.0169  322 LYS A N   
2011 C CA  . LYS A 329 ? 0.9674 0.9754 0.9802 0.0185  0.0154  0.0146  322 LYS A CA  
2012 C C   . LYS A 329 ? 1.0767 1.0902 1.0919 0.0160  0.0152  0.0091  322 LYS A C   
2013 O O   . LYS A 329 ? 1.0255 1.0383 1.0426 0.0155  0.0175  0.0052  322 LYS A O   
2014 C CB  . LYS A 329 ? 0.6711 0.6723 0.6787 0.0157  0.0173  0.0171  322 LYS A CB  
2015 C CG  . LYS A 329 ? 0.6085 0.6030 0.6169 0.0155  0.0207  0.0145  322 LYS A CG  
2016 C CD  . LYS A 329 ? 0.7189 0.7086 0.7230 0.0123  0.0208  0.0142  322 LYS A CD  
2017 C CE  . LYS A 329 ? 0.7104 0.7049 0.7142 0.0102  0.0145  0.0112  322 LYS A CE  
2018 N NZ  . LYS A 329 ? 0.5986 0.5925 0.6013 0.0098  0.0144  0.0105  322 LYS A NZ  
2019 N N   . PHE A 330 ? 1.2030 1.2222 1.2176 0.0140  0.0131  0.0088  323 PHE A N   
2020 C CA  . PHE A 330 ? 1.1927 1.2173 1.2090 0.0110  0.0137  0.0045  323 PHE A CA  
2021 C C   . PHE A 330 ? 1.2475 1.2778 1.2715 0.0131  0.0159  -0.0004 323 PHE A C   
2022 O O   . PHE A 330 ? 1.2590 1.2918 1.2875 0.0172  0.0151  0.0000  323 PHE A O   
2023 C CB  . PHE A 330 ? 1.1774 1.2052 1.1907 0.0091  0.0109  0.0064  323 PHE A CB  
2024 C CG  . PHE A 330 ? 1.2839 1.3152 1.2978 0.0058  0.0116  0.0033  323 PHE A CG  
2025 C CD1 . PHE A 330 ? 1.4332 1.4613 1.4450 0.0027  0.0127  0.0017  323 PHE A CD1 
2026 C CD2 . PHE A 330 ? 1.2424 1.2801 1.2583 0.0060  0.0112  0.0025  323 PHE A CD2 
2027 C CE1 . PHE A 330 ? 1.4520 1.4832 1.4630 0.0004  0.0127  0.0004  323 PHE A CE1 
2028 C CE2 . PHE A 330 ? 1.2648 1.3058 1.2799 0.0031  0.0115  0.0005  323 PHE A CE2 
2029 C CZ  . PHE A 330 ? 1.3806 1.4185 1.3929 0.0003  0.0120  -0.0003 323 PHE A CZ  
2030 N N   . SER A 331 ? 1.3234 1.3557 1.3489 0.0100  0.0185  -0.0053 324 SER A N   
2031 C CA  . SER A 331 ? 1.3089 1.3439 1.3405 0.0112  0.0206  -0.0099 324 SER A CA  
2032 C C   . SER A 331 ? 1.2146 1.2533 1.2517 0.0134  0.0221  -0.0072 324 SER A C   
2033 O O   . SER A 331 ? 1.2592 1.3000 1.3029 0.0173  0.0239  -0.0082 324 SER A O   
2034 C CB  . SER A 331 ? 1.3860 1.4199 1.4092 0.0134  0.0237  -0.0028 324 SER A CB  
2035 O OG  . SER A 331 ? 1.4768 1.5112 1.4962 0.0122  0.0221  -0.0062 324 SER A OG  
2036 N N   . ARG A 332 ? 0.9843 1.0267 1.0171 0.0112  0.0198  -0.0048 325 ARG A N   
2037 C CA  . ARG A 332 ? 0.8445 0.8950 0.8793 0.0120  0.0187  -0.0051 325 ARG A CA  
2038 C C   . ARG A 332 ? 0.6951 0.7483 0.7262 0.0117  0.0145  -0.0025 325 ARG A C   
2039 O O   . ARG A 332 ? 0.6687 0.7239 0.6942 0.0082  0.0126  -0.0018 325 ARG A O   
2040 C CB  . ARG A 332 ? 0.9758 1.0307 1.0074 0.0085  0.0194  -0.0070 325 ARG A CB  
2041 C CG  . ARG A 332 ? 0.9915 1.0560 1.0260 0.0086  0.0189  -0.0093 325 ARG A CG  
2042 C CD  . ARG A 332 ? 0.8549 0.9234 0.8982 0.0139  0.0212  -0.0111 325 ARG A CD  
2043 N NE  . ARG A 332 ? 0.8178 0.8849 0.8654 0.0181  0.0196  -0.0088 325 ARG A NE  
2044 C CZ  . ARG A 332 ? 1.0198 1.0878 1.0759 0.0236  0.0207  -0.0094 325 ARG A CZ  
2045 N NH1 . ARG A 332 ? 1.1147 1.1853 1.1755 0.0260  0.0242  -0.0120 325 ARG A NH1 
2046 N NH2 . ARG A 332 ? 1.0370 1.1040 1.0960 0.0270  0.0178  -0.0075 325 ARG A NH2 
2047 N N   . PRO A 333 ? 0.5423 0.5953 0.5758 0.0156  0.0130  -0.0008 326 PRO A N   
2048 C CA  . PRO A 333 ? 0.4843 0.5393 0.5130 0.0154  0.0097  0.0025  326 PRO A CA  
2049 C C   . PRO A 333 ? 0.4892 0.5530 0.5193 0.0149  0.0090  0.0012  326 PRO A C   
2050 O O   . PRO A 333 ? 0.4792 0.5442 0.5034 0.0124  0.0070  0.0027  326 PRO A O   
2051 C CB  . PRO A 333 ? 0.3996 0.4520 0.4303 0.0200  0.0086  0.0049  326 PRO A CB  
2052 C CG  . PRO A 333 ? 0.3585 0.4105 0.3978 0.0237  0.0105  0.0018  326 PRO A CG  
2053 C CD  . PRO A 333 ? 0.4098 0.4597 0.4491 0.0203  0.0137  -0.0014 326 PRO A CD  
2054 N N   . ALA A 334 ? 0.5173 0.5870 0.5549 0.0173  0.0105  -0.0018 327 ALA A N   
2055 C CA  . ALA A 334 ? 0.4065 0.4855 0.4450 0.0166  0.0097  -0.0034 327 ALA A CA  
2056 C C   . ALA A 334 ? 0.3946 0.4750 0.4264 0.0108  0.0094  -0.0045 327 ALA A C   
2057 O O   . ALA A 334 ? 0.3894 0.4746 0.4180 0.0087  0.0078  -0.0045 327 ALA A O   
2058 C CB  . ALA A 334 ? 0.2304 0.3160 0.2779 0.0200  0.0117  -0.0067 327 ALA A CB  
2059 N N   . GLN A 335 ? 0.3963 0.4721 0.4258 0.0081  0.0108  -0.0053 328 GLN A N   
2060 C CA  . GLN A 335 ? 0.3564 0.4329 0.3797 0.0028  0.0098  -0.0062 328 GLN A CA  
2061 C C   . GLN A 335 ? 0.4170 0.4880 0.4331 0.0004  0.0071  -0.0031 328 GLN A C   
2062 O O   . GLN A 335 ? 0.5549 0.6283 0.5668 -0.0029 0.0055  -0.0034 328 GLN A O   
2063 C CB  . GLN A 335 ? 0.3987 0.4737 0.4221 0.0008  0.0119  -0.0086 328 GLN A CB  
2064 C CG  . GLN A 335 ? 0.5304 0.6119 0.5613 0.0036  0.0146  -0.0120 328 GLN A CG  
2065 C CD  . GLN A 335 ? 0.5470 0.6319 0.5773 0.0002  0.0163  -0.0159 328 GLN A CD  
2066 O OE1 . GLN A 335 ? 0.5494 0.6402 0.5768 -0.0038 0.0154  -0.0181 328 GLN A OE1 
2067 N NE2 . GLN A 335 ? 0.5113 0.5929 0.5439 0.0016  0.0188  -0.0171 328 GLN A NE2 
2068 N N   . LEU A 336 ? 0.3427 0.4065 0.3574 0.0021  0.0065  -0.0002 329 LEU A N   
2069 C CA  . LEU A 336 ? 0.3749 0.4346 0.3838 0.0011  0.0038  0.0028  329 LEU A CA  
2070 C C   . LEU A 336 ? 0.2893 0.3541 0.2976 0.0018  0.0028  0.0035  329 LEU A C   
2071 O O   . LEU A 336 ? 0.2891 0.3538 0.2927 -0.0007 0.0011  0.0042  329 LEU A O   
2072 C CB  . LEU A 336 ? 0.4213 0.4737 0.4292 0.0032  0.0035  0.0057  329 LEU A CB  
2073 C CG  . LEU A 336 ? 0.3324 0.3790 0.3391 0.0016  0.0037  0.0053  329 LEU A CG  
2074 C CD1 . LEU A 336 ? 0.4004 0.4405 0.4050 0.0031  0.0025  0.0083  329 LEU A CD1 
2075 C CD2 . LEU A 336 ? 0.2039 0.2511 0.2069 -0.0022 0.0017  0.0045  329 LEU A CD2 
2076 N N   . HIS A 337 ? 0.1213 0.1905 0.1346 0.0053  0.0038  0.0032  330 HIS A N   
2077 C CA  . HIS A 337 ? 0.1931 0.2681 0.2063 0.0061  0.0029  0.0036  330 HIS A CA  
2078 C C   . HIS A 337 ? 0.3581 0.4390 0.3694 0.0025  0.0025  0.0011  330 HIS A C   
2079 O O   . HIS A 337 ? 0.3863 0.4677 0.3931 0.0003  0.0013  0.0020  330 HIS A O   
2080 C CB  . HIS A 337 ? 0.2081 0.2883 0.2286 0.0109  0.0036  0.0031  330 HIS A CB  
2081 C CG  . HIS A 337 ? 0.2402 0.3261 0.2607 0.0122  0.0024  0.0041  330 HIS A CG  
2082 N ND1 . HIS A 337 ? 0.3075 0.3900 0.3233 0.0122  0.0015  0.0074  330 HIS A ND1 
2083 C CD2 . HIS A 337 ? 0.2537 0.3492 0.2783 0.0136  0.0021  0.0021  330 HIS A CD2 
2084 C CE1 . HIS A 337 ? 0.4009 0.4906 0.4180 0.0134  0.0008  0.0073  330 HIS A CE1 
2085 N NE2 . HIS A 337 ? 0.3805 0.4782 0.4030 0.0144  0.0009  0.0042  330 HIS A NE2 
2086 N N   . ILE A 338 ? 0.3256 0.4111 0.3404 0.0015  0.0039  -0.0022 331 ILE A N   
2087 C CA  . ILE A 338 ? 0.2944 0.3857 0.3072 -0.0027 0.0038  -0.0049 331 ILE A CA  
2088 C C   . ILE A 338 ? 0.2879 0.3731 0.2938 -0.0069 0.0024  -0.0036 331 ILE A C   
2089 O O   . ILE A 338 ? 0.2370 0.3241 0.2393 -0.0098 0.0015  -0.0038 331 ILE A O   
2090 C CB  . ILE A 338 ? 0.2942 0.3902 0.3109 -0.0036 0.0057  -0.0086 331 ILE A CB  
2091 C CG1 . ILE A 338 ? 0.2310 0.3348 0.2556 0.0007  0.0070  -0.0108 331 ILE A CG1 
2092 C CG2 . ILE A 338 ? 0.1242 0.2243 0.1369 -0.0091 0.0055  -0.0111 331 ILE A CG2 
2093 C CD1 . ILE A 338 ? 0.1743 0.2800 0.2039 0.0015  0.0093  -0.0138 331 ILE A CD1 
2094 N N   . GLY A 339 ? 0.3028 0.3808 0.3074 -0.0072 0.0022  -0.0024 332 GLY A N   
2095 C CA  . GLY A 339 ? 0.1873 0.2593 0.1865 -0.0103 0.0005  -0.0011 332 GLY A CA  
2096 C C   . GLY A 339 ? 0.2344 0.3001 0.2324 -0.0099 -0.0004 0.0014  332 GLY A C   
2097 O O   . GLY A 339 ? 0.2517 0.3135 0.2483 -0.0124 -0.0007 0.0014  332 GLY A O   
2098 N N   . PHE A 340 ? 0.1719 0.2362 0.1707 -0.0066 -0.0005 0.0032  333 PHE A N   
2099 C CA  . PHE A 340 ? 0.1838 0.2416 0.1821 -0.0064 -0.0009 0.0047  333 PHE A CA  
2100 C C   . PHE A 340 ? 0.2122 0.2764 0.2099 -0.0081 -0.0008 0.0035  333 PHE A C   
2101 O O   . PHE A 340 ? 0.1856 0.2457 0.1823 -0.0097 -0.0011 0.0037  333 PHE A O   
2102 C CB  . PHE A 340 ? 0.1957 0.2501 0.1947 -0.0032 -0.0008 0.0066  333 PHE A CB  
2103 C CG  . PHE A 340 ? 0.4039 0.4468 0.4027 -0.0028 -0.0011 0.0073  333 PHE A CG  
2104 C CD1 . PHE A 340 ? 0.2658 0.3056 0.2651 -0.0022 -0.0011 0.0074  333 PHE A CD1 
2105 C CD2 . PHE A 340 ? 0.4645 0.5008 0.4621 -0.0032 -0.0006 0.0075  333 PHE A CD2 
2106 C CE1 . PHE A 340 ? 0.3692 0.3997 0.3677 -0.0021 -0.0005 0.0075  333 PHE A CE1 
2107 C CE2 . PHE A 340 ? 0.3787 0.4131 0.3831 -0.0034 -0.0008 0.0072  333 PHE A CE2 
2108 C CZ  . PHE A 340 ? 0.4172 0.4486 0.4215 -0.0028 -0.0007 0.0071  333 PHE A CZ  
2109 N N   . GLN A 341 ? 0.2617 0.3372 0.2602 -0.0077 -0.0004 0.0019  334 GLN A N   
2110 C CA  . GLN A 341 ? 0.1928 0.2760 0.1909 -0.0097 -0.0001 0.0000  334 GLN A CA  
2111 C C   . GLN A 341 ? 0.3907 0.4716 0.3873 -0.0141 0.0000  -0.0013 334 GLN A C   
2112 O O   . GLN A 341 ? 0.3067 0.3857 0.3021 -0.0161 -0.0001 -0.0012 334 GLN A O   
2113 C CB  . GLN A 341 ? 0.3240 0.4197 0.3246 -0.0082 0.0004  -0.0025 334 GLN A CB  
2114 C CG  . GLN A 341 ? 0.5966 0.7011 0.5971 -0.0109 0.0008  -0.0053 334 GLN A CG  
2115 C CD  . GLN A 341 ? 0.6570 0.7677 0.6592 -0.0085 0.0007  -0.0050 334 GLN A CD  
2116 O OE1 . GLN A 341 ? 0.5766 0.6918 0.5840 -0.0042 0.0008  -0.0048 334 GLN A OE1 
2117 N NE2 . GLN A 341 ? 0.4889 0.5996 0.4879 -0.0111 0.0005  -0.0049 334 GLN A NE2 
2118 N N   . ALA A 342 ? 0.4379 0.5192 0.4342 -0.0157 0.0002  -0.0025 335 ALA A N   
2119 C CA  . ALA A 342 ? 0.2734 0.3530 0.2677 -0.0201 0.0004  -0.0034 335 ALA A CA  
2120 C C   . ALA A 342 ? 0.3044 0.3735 0.2971 -0.0206 -0.0003 -0.0010 335 ALA A C   
2121 O O   . ALA A 342 ? 0.2749 0.3434 0.2657 -0.0238 -0.0002 -0.0013 335 ALA A O   
2122 C CB  . ALA A 342 ? 0.1573 0.2384 0.1514 -0.0214 0.0009  -0.0048 335 ALA A CB  
2123 N N   . LEU A 343 ? 0.3577 0.4192 0.3513 -0.0173 -0.0009 0.0010  336 LEU A N   
2124 C CA  . LEU A 343 ? 0.2789 0.3313 0.2718 -0.0171 -0.0016 0.0026  336 LEU A CA  
2125 C C   . LEU A 343 ? 0.2506 0.3028 0.2428 -0.0177 -0.0016 0.0027  336 LEU A C   
2126 O O   . LEU A 343 ? 0.3533 0.4025 0.3440 -0.0198 -0.0018 0.0029  336 LEU A O   
2127 C CB  . LEU A 343 ? 0.3176 0.3629 0.3119 -0.0135 -0.0021 0.0039  336 LEU A CB  
2128 C CG  . LEU A 343 ? 0.3020 0.3389 0.2960 -0.0129 -0.0027 0.0047  336 LEU A CG  
2129 C CD1 . LEU A 343 ? 0.3120 0.3494 0.3041 -0.0162 -0.0030 0.0047  336 LEU A CD1 
2130 C CD2 . LEU A 343 ? 0.3251 0.3601 0.3258 -0.0117 -0.0015 0.0050  336 LEU A CD2 
2131 N N   . HIS A 344 ? 0.2493 0.3059 0.2426 -0.0162 -0.0013 0.0024  337 HIS A N   
2132 C CA  . HIS A 344 ? 0.1999 0.2587 0.1926 -0.0173 -0.0011 0.0019  337 HIS A CA  
2133 C C   . HIS A 344 ? 0.2728 0.3376 0.2638 -0.0216 -0.0005 0.0000  337 HIS A C   
2134 O O   . HIS A 344 ? 0.1842 0.2482 0.1738 -0.0240 -0.0003 -0.0004 337 HIS A O   
2135 C CB  . HIS A 344 ? 0.2389 0.3034 0.2329 -0.0151 -0.0008 0.0019  337 HIS A CB  
2136 C CG  . HIS A 344 ? 0.3625 0.4206 0.3572 -0.0119 -0.0011 0.0037  337 HIS A CG  
2137 N ND1 . HIS A 344 ? 0.2935 0.3530 0.2895 -0.0090 -0.0010 0.0047  337 HIS A ND1 
2138 C CD2 . HIS A 344 ? 0.2275 0.2784 0.2218 -0.0114 -0.0013 0.0043  337 HIS A CD2 
2139 C CE1 . HIS A 344 ? 0.3752 0.4279 0.3713 -0.0073 -0.0010 0.0059  337 HIS A CE1 
2140 N NE2 . HIS A 344 ? 0.3667 0.4142 0.3619 -0.0086 -0.0012 0.0055  337 HIS A NE2 
2141 N N   . GLN A 345 ? 0.2260 0.2975 0.2171 -0.0230 0.0000  -0.0015 338 GLN A N   
2142 C CA  . GLN A 345 ? 0.2728 0.3501 0.2621 -0.0277 0.0007  -0.0036 338 GLN A CA  
2143 C C   . GLN A 345 ? 0.3283 0.3987 0.3148 -0.0309 0.0005  -0.0026 338 GLN A C   
2144 O O   . GLN A 345 ? 0.3547 0.4260 0.3390 -0.0349 0.0010  -0.0034 338 GLN A O   
2145 C CB  . GLN A 345 ? 0.2510 0.3374 0.2410 -0.0287 0.0014  -0.0060 338 GLN A CB  
2146 C CG  . GLN A 345 ? 0.3844 0.4771 0.3725 -0.0340 0.0025  -0.0087 338 GLN A CG  
2147 C CD  . GLN A 345 ? 0.5202 0.6240 0.5098 -0.0346 0.0033  -0.0118 338 GLN A CD  
2148 O OE1 . GLN A 345 ? 0.5633 0.6710 0.5555 -0.0306 0.0030  -0.0121 338 GLN A OE1 
2149 N NE2 . GLN A 345 ? 0.4041 0.5134 0.3918 -0.0396 0.0044  -0.0145 338 GLN A NE2 
2150 N N   . PHE A 346 ? 0.2869 0.3508 0.2736 -0.0292 -0.0003 -0.0008 339 PHE A N   
2151 C CA  . PHE A 346 ? 0.2440 0.3022 0.2281 -0.0319 -0.0008 0.0005  339 PHE A CA  
2152 C C   . PHE A 346 ? 0.2240 0.2773 0.2073 -0.0321 -0.0012 0.0015  339 PHE A C   
2153 O O   . PHE A 346 ? 0.2910 0.3438 0.2712 -0.0365 -0.0011 0.0014  339 PHE A O   
2154 C CB  . PHE A 346 ? 0.0867 0.1400 0.0717 -0.0296 -0.0016 0.0019  339 PHE A CB  
2155 C CG  . PHE A 346 ? 0.3042 0.3533 0.2865 -0.0326 -0.0024 0.0032  339 PHE A CG  
2156 C CD1 . PHE A 346 ? 0.3092 0.3607 0.2896 -0.0357 -0.0023 0.0029  339 PHE A CD1 
2157 C CD2 . PHE A 346 ? 0.3500 0.3930 0.3314 -0.0325 -0.0034 0.0049  339 PHE A CD2 
2158 C CE1 . PHE A 346 ? 0.3150 0.3628 0.2924 -0.0387 -0.0033 0.0046  339 PHE A CE1 
2159 C CE2 . PHE A 346 ? 0.3611 0.4006 0.3399 -0.0354 -0.0045 0.0066  339 PHE A CE2 
2160 C CZ  . PHE A 346 ? 0.3393 0.3811 0.3159 -0.0385 -0.0046 0.0066  339 PHE A CZ  
2161 N N   . CYS A 347 ? 0.2856 0.3353 0.2713 -0.0277 -0.0016 0.0023  340 CYS A N   
2162 C CA  . CYS A 347 ? 0.3411 0.3864 0.3263 -0.0276 -0.0019 0.0030  340 CYS A CA  
2163 C C   . CYS A 347 ? 0.2821 0.3323 0.2657 -0.0312 -0.0009 0.0012  340 CYS A C   
2164 O O   . CYS A 347 ? 0.3767 0.4247 0.3579 -0.0343 -0.0008 0.0012  340 CYS A O   
2165 C CB  . CYS A 347 ? 0.0343 0.0757 0.0223 -0.0225 -0.0022 0.0037  340 CYS A CB  
2166 S SG  . CYS A 347 ? 0.4744 0.5092 0.4640 -0.0190 -0.0030 0.0050  340 CYS A SG  
2167 N N   . ALA A 348 ? 0.2229 0.2802 0.2076 -0.0310 -0.0001 -0.0005 341 ALA A N   
2168 C CA  . ALA A 348 ? 0.2650 0.3283 0.2485 -0.0345 0.0010  -0.0028 341 ALA A CA  
2169 C C   . ALA A 348 ? 0.3892 0.4540 0.3690 -0.0407 0.0018  -0.0040 341 ALA A C   
2170 O O   . ALA A 348 ? 0.4390 0.5056 0.4166 -0.0447 0.0028  -0.0058 341 ALA A O   
2171 C CB  . ALA A 348 ? 0.0758 0.1477 0.0615 -0.0329 0.0015  -0.0043 341 ALA A CB  
2172 N N   . GLN A 349 ? 0.3981 0.4620 0.3767 -0.0418 0.0014  -0.0032 342 GLN A N   
2173 C CA  . GLN A 349 ? 0.3805 0.4453 0.3546 -0.0483 0.0021  -0.0040 342 GLN A CA  
2174 C C   . GLN A 349 ? 0.4317 0.4873 0.4040 -0.0502 0.0014  -0.0016 342 GLN A C   
2175 O O   . GLN A 349 ? 0.5336 0.5867 0.5058 -0.0542 0.0025  -0.0020 342 GLN A O   
2176 C CB  . GLN A 349 ? 0.4247 0.4929 0.3985 -0.0492 0.0021  -0.0043 342 GLN A CB  
2177 C CG  . GLN A 349 ? 0.3382 0.4050 0.3066 -0.0559 0.0023  -0.0041 342 GLN A CG  
2178 C CD  . GLN A 349 ? 0.5453 0.6188 0.5121 -0.0614 0.0043  -0.0071 342 GLN A CD  
2179 O OE1 . GLN A 349 ? 0.6489 0.7314 0.6173 -0.0608 0.0053  -0.0100 342 GLN A OE1 
2180 N NE2 . GLN A 349 ? 0.5508 0.6192 0.5157 -0.0663 0.0052  -0.0063 342 GLN A NE2 
2181 N N   . HIS A 350 ? 0.3461 0.3962 0.3187 -0.0468 -0.0004 0.0010  343 HIS A N   
2182 C CA  . HIS A 350 ? 0.4020 0.4435 0.3746 -0.0478 -0.0013 0.0037  343 HIS A CA  
2183 C C   . HIS A 350 ? 0.4586 0.4944 0.4341 -0.0453 -0.0014 0.0044  343 HIS A C   
2184 O O   . HIS A 350 ? 0.4894 0.5184 0.4660 -0.0468 -0.0016 0.0061  343 HIS A O   
2185 C CB  . HIS A 350 ? 0.4611 0.5008 0.4327 -0.0458 -0.0032 0.0056  343 HIS A CB  
2186 C CG  . HIS A 350 ? 0.5876 0.6314 0.5564 -0.0494 -0.0030 0.0051  343 HIS A CG  
2187 N ND1 . HIS A 350 ? 0.7215 0.7628 0.6879 -0.0545 -0.0027 0.0062  343 HIS A ND1 
2188 C CD2 . HIS A 350 ? 0.6454 0.6946 0.6160 -0.0477 -0.0024 0.0037  343 HIS A CD2 
2189 C CE1 . HIS A 350 ? 0.7454 0.7920 0.7094 -0.0572 -0.0025 0.0051  343 HIS A CE1 
2190 N NE2 . HIS A 350 ? 0.6509 0.7025 0.6176 -0.0531 -0.0023 0.0034  343 HIS A NE2 
2191 N N   . GLY A 351 ? 0.3681 0.4067 0.3450 -0.0416 -0.0014 0.0033  344 GLY A N   
2192 C CA  . GLY A 351 ? 0.2777 0.3118 0.2573 -0.0395 -0.0014 0.0036  344 GLY A CA  
2193 C C   . GLY A 351 ? 0.3911 0.4202 0.3713 -0.0356 -0.0032 0.0059  344 GLY A C   
2194 O O   . GLY A 351 ? 0.3734 0.3990 0.3561 -0.0337 -0.0032 0.0061  344 GLY A O   
2195 N N   . ARG A 352 ? 0.4637 0.4932 0.4420 -0.0347 -0.0047 0.0073  345 ARG A N   
2196 C CA  . ARG A 352 ? 0.4484 0.4736 0.4293 -0.0306 -0.0061 0.0089  345 ARG A CA  
2197 C C   . ARG A 352 ? 0.5203 0.5477 0.5038 -0.0273 -0.0055 0.0081  345 ARG A C   
2198 O O   . ARG A 352 ? 0.6159 0.6480 0.5984 -0.0292 -0.0047 0.0071  345 ARG A O   
2199 C CB  . ARG A 352 ? 0.5233 0.5443 0.5024 -0.0335 -0.0078 0.0111  345 ARG A CB  
2200 C CG  . ARG A 352 ? 0.4554 0.4789 0.4316 -0.0371 -0.0079 0.0114  345 ARG A CG  
2201 C CD  . ARG A 352 ? 0.3856 0.4049 0.3614 -0.0388 -0.0096 0.0139  345 ARG A CD  
2202 N NE  . ARG A 352 ? 0.5853 0.6086 0.5583 -0.0411 -0.0101 0.0139  345 ARG A NE  
2203 C CZ  . ARG A 352 ? 0.7132 0.7382 0.6834 -0.0459 -0.0091 0.0137  345 ARG A CZ  
2204 N NH1 . ARG A 352 ? 0.6924 0.7151 0.6623 -0.0490 -0.0074 0.0137  345 ARG A NH1 
2205 N NH2 . ARG A 352 ? 0.7533 0.7824 0.7211 -0.0479 -0.0095 0.0133  345 ARG A NH2 
2206 N N   . PRO A 353 ? 0.5312 0.5554 0.5176 -0.0229 -0.0058 0.0084  346 PRO A N   
2207 C CA  . PRO A 353 ? 0.4398 0.4655 0.4277 -0.0209 -0.0054 0.0077  346 PRO A CA  
2208 C C   . PRO A 353 ? 0.4850 0.5109 0.4712 -0.0237 -0.0063 0.0087  346 PRO A C   
2209 O O   . PRO A 353 ? 0.6004 0.6246 0.5843 -0.0269 -0.0074 0.0102  346 PRO A O   
2210 C CB  . PRO A 353 ? 0.5519 0.5735 0.5428 -0.0160 -0.0052 0.0072  346 PRO A CB  
2211 C CG  . PRO A 353 ? 0.5005 0.5196 0.4917 -0.0151 -0.0052 0.0073  346 PRO A CG  
2212 C CD  . PRO A 353 ? 0.4808 0.5007 0.4693 -0.0197 -0.0061 0.0086  346 PRO A CD  
2213 N N   . PRO A 354 ? 0.6122 0.6402 0.5990 -0.0233 -0.0059 0.0081  347 PRO A N   
2214 C CA  . PRO A 354 ? 0.4607 0.4888 0.4457 -0.0259 -0.0067 0.0090  347 PRO A CA  
2215 C C   . PRO A 354 ? 0.4563 0.4801 0.4426 -0.0242 -0.0078 0.0101  347 PRO A C   
2216 O O   . PRO A 354 ? 0.4434 0.4647 0.4327 -0.0200 -0.0074 0.0093  347 PRO A O   
2217 C CB  . PRO A 354 ? 0.3060 0.3373 0.2921 -0.0249 -0.0057 0.0077  347 PRO A CB  
2218 C CG  . PRO A 354 ? 0.3478 0.3824 0.3347 -0.0239 -0.0046 0.0064  347 PRO A CG  
2219 C CD  . PRO A 354 ? 0.5538 0.5851 0.5419 -0.0217 -0.0048 0.0067  347 PRO A CD  
2220 N N   . ARG A 355 ? 0.5338 0.5571 0.5176 -0.0280 -0.0094 0.0121  348 ARG A N   
2221 C CA  . ARG A 355 ? 0.5887 0.6091 0.5737 -0.0273 -0.0107 0.0134  348 ARG A CA  
2222 C C   . ARG A 355 ? 0.6755 0.6975 0.6613 -0.0265 -0.0102 0.0127  348 ARG A C   
2223 O O   . ARG A 355 ? 0.7100 0.7354 0.6937 -0.0291 -0.0098 0.0123  348 ARG A O   
2224 C CB  . ARG A 355 ? 0.6271 0.6462 0.6085 -0.0325 -0.0132 0.0163  348 ARG A CB  
2225 C CG  . ARG A 355 ? 0.7807 0.7986 0.7597 -0.0350 -0.0138 0.0171  348 ARG A CG  
2226 C CD  . ARG A 355 ? 0.9124 0.9281 0.8866 -0.0413 -0.0160 0.0201  348 ARG A CD  
2227 N NE  . ARG A 355 ? 1.0006 1.0196 0.9710 -0.0456 -0.0146 0.0194  348 ARG A NE  
2228 C CZ  . ARG A 355 ? 1.0273 1.0433 0.9952 -0.0502 -0.0139 0.0210  348 ARG A CZ  
2229 N NH1 . ARG A 355 ? 1.0829 1.0917 1.0519 -0.0507 -0.0145 0.0237  348 ARG A NH1 
2230 N NH2 . ARG A 355 ? 0.8335 0.8535 0.7978 -0.0543 -0.0125 0.0198  348 ARG A NH2 
2231 N N   . PRO A 356 ? 0.7109 0.7308 0.6993 -0.0234 -0.0102 0.0123  349 PRO A N   
2232 C CA  . PRO A 356 ? 0.6541 0.6757 0.6425 -0.0239 -0.0100 0.0120  349 PRO A CA  
2233 C C   . PRO A 356 ? 0.6114 0.6341 0.5970 -0.0287 -0.0119 0.0146  349 PRO A C   
2234 O O   . PRO A 356 ? 0.7688 0.7901 0.7527 -0.0314 -0.0136 0.0167  349 PRO A O   
2235 C CB  . PRO A 356 ? 0.6534 0.6724 0.6450 -0.0199 -0.0094 0.0109  349 PRO A CB  
2236 C CG  . PRO A 356 ? 0.7702 0.7866 0.7662 -0.0189 -0.0072 0.0109  349 PRO A CG  
2237 C CD  . PRO A 356 ? 0.7634 0.7801 0.7546 -0.0201 -0.0101 0.0119  349 PRO A CD  
2238 N N   . ARG A 357 ? 0.5829 0.6077 0.5676 -0.0304 -0.0120 0.0147  350 ARG A N   
2239 C CA  . ARG A 357 ? 0.6374 0.6637 0.6189 -0.0358 -0.0142 0.0176  350 ARG A CA  
2240 C C   . ARG A 357 ? 0.5995 0.6273 0.5769 -0.0405 -0.0148 0.0186  350 ARG A C   
2241 O O   . ARG A 357 ? 0.7087 0.7361 0.6827 -0.0454 -0.0172 0.0216  350 ARG A O   
2242 C CB  . ARG A 357 ? 0.5790 0.6023 0.5617 -0.0361 -0.0165 0.0203  350 ARG A CB  
2243 C CG  . ARG A 357 ? 0.7657 0.7887 0.7516 -0.0330 -0.0159 0.0195  350 ARG A CG  
2244 C CD  . ARG A 357 ? 1.0037 1.0245 0.9909 -0.0340 -0.0184 0.0225  350 ARG A CD  
2245 N NE  . ARG A 357 ? 1.1944 1.2159 1.1841 -0.0319 -0.0176 0.0218  350 ARG A NE  
2246 C CZ  . ARG A 357 ? 1.3145 1.3390 1.3029 -0.0345 -0.0181 0.0230  350 ARG A CZ  
2247 N NH1 . ARG A 357 ? 1.3356 1.3628 1.3203 -0.0395 -0.0195 0.0249  350 ARG A NH1 
2248 N NH2 . ARG A 357 ? 1.3138 1.3388 1.3043 -0.0326 -0.0173 0.0222  350 ARG A NH2 
2249 N N   . ASN A 358 ? 0.6009 0.6304 0.5782 -0.0393 -0.0129 0.0162  351 ASN A N   
2250 C CA  . ASN A 358 ? 0.6082 0.6396 0.5814 -0.0439 -0.0130 0.0166  351 ASN A CA  
2251 C C   . ASN A 358 ? 0.5364 0.5730 0.5089 -0.0447 -0.0107 0.0138  351 ASN A C   
2252 O O   . ASN A 358 ? 0.5100 0.5476 0.4841 -0.0422 -0.0091 0.0118  351 ASN A O   
2253 C CB  . ASN A 358 ? 0.5326 0.5613 0.5064 -0.0426 -0.0131 0.0167  351 ASN A CB  
2254 C CG  . ASN A 358 ? 0.6428 0.6717 0.6113 -0.0488 -0.0143 0.0184  351 ASN A CG  
2255 O OD1 . ASN A 358 ? 0.6432 0.6761 0.6083 -0.0528 -0.0134 0.0174  351 ASN A OD1 
2256 N ND2 . ASN A 358 ? 0.7209 0.7452 0.6882 -0.0501 -0.0165 0.0207  351 ASN A ND2 
2257 N N   . ASP A 359 ? 0.4443 0.4846 0.4141 -0.0486 -0.0108 0.0139  352 ASP A N   
2258 C CA  . ASP A 359 ? 0.4487 0.4945 0.4179 -0.0496 -0.0086 0.0109  352 ASP A CA  
2259 C C   . ASP A 359 ? 0.5418 0.5910 0.5087 -0.0526 -0.0075 0.0096  352 ASP A C   
2260 O O   . ASP A 359 ? 0.6535 0.7080 0.6209 -0.0530 -0.0055 0.0067  352 ASP A O   
2261 C CB  . ASP A 359 ? 0.7684 0.8180 0.7352 -0.0536 -0.0087 0.0109  352 ASP A CB  
2262 C CG  . ASP A 359 ? 0.9005 0.9505 0.8621 -0.0603 -0.0108 0.0140  352 ASP A CG  
2263 O OD1 . ASP A 359 ? 0.9752 1.0223 0.9365 -0.0610 -0.0131 0.0170  352 ASP A OD1 
2264 O OD2 . ASP A 359 ? 0.7530 0.8065 0.7105 -0.0654 -0.0104 0.0134  352 ASP A OD2 
2265 N N   . GLU A 360 ? 0.4377 0.4842 0.4023 -0.0550 -0.0088 0.0116  353 GLU A N   
2266 C CA  . GLU A 360 ? 0.4397 0.4891 0.4017 -0.0582 -0.0077 0.0103  353 GLU A CA  
2267 C C   . GLU A 360 ? 0.5518 0.6014 0.5179 -0.0533 -0.0062 0.0082  353 GLU A C   
2268 O O   . GLU A 360 ? 0.6848 0.7399 0.6511 -0.0540 -0.0043 0.0055  353 GLU A O   
2269 C CB  . GLU A 360 ? 0.5438 0.5896 0.5009 -0.0635 -0.0098 0.0132  353 GLU A CB  
2270 C CG  . GLU A 360 ? 0.7316 0.7815 0.6825 -0.0713 -0.0094 0.0129  353 GLU A CG  
2271 C CD  . GLU A 360 ? 0.8572 0.9107 0.8059 -0.0748 -0.0097 0.0132  353 GLU A CD  
2272 O OE1 . GLU A 360 ? 0.8143 0.8646 0.7594 -0.0787 -0.0125 0.0168  353 GLU A OE1 
2273 O OE2 . GLU A 360 ? 0.8557 0.9153 0.8061 -0.0740 -0.0074 0.0099  353 GLU A OE2 
2274 N N   . ASP A 361 ? 0.4032 0.4474 0.3723 -0.0485 -0.0071 0.0095  354 ASP A N   
2275 C CA  . ASP A 361 ? 0.4612 0.5053 0.4340 -0.0439 -0.0060 0.0080  354 ASP A CA  
2276 C C   . ASP A 361 ? 0.4564 0.5038 0.4325 -0.0404 -0.0045 0.0057  354 ASP A C   
2277 O O   . ASP A 361 ? 0.5284 0.5789 0.5064 -0.0386 -0.0033 0.0040  354 ASP A O   
2278 C CB  . ASP A 361 ? 0.3920 0.4298 0.3674 -0.0398 -0.0071 0.0096  354 ASP A CB  
2279 C CG  . ASP A 361 ? 0.5261 0.5603 0.4983 -0.0432 -0.0088 0.0119  354 ASP A CG  
2280 O OD1 . ASP A 361 ? 0.5120 0.5476 0.4793 -0.0492 -0.0093 0.0127  354 ASP A OD1 
2281 O OD2 . ASP A 361 ? 0.6244 0.6542 0.5986 -0.0403 -0.0097 0.0129  354 ASP A OD2 
2282 N N   . ALA A 362 ? 0.2758 0.3229 0.2526 -0.0397 -0.0047 0.0058  355 ALA A N   
2283 C CA  . ALA A 362 ? 0.2938 0.3437 0.2732 -0.0370 -0.0034 0.0037  355 ALA A CA  
2284 C C   . ALA A 362 ? 0.3304 0.3882 0.3083 -0.0405 -0.0018 0.0010  355 ALA A C   
2285 O O   . ALA A 362 ? 0.2953 0.3573 0.2757 -0.0385 -0.0006 -0.0013 355 ALA A O   
2286 C CB  . ALA A 362 ? 0.2192 0.2666 0.1992 -0.0358 -0.0039 0.0043  355 ALA A CB  
2287 N N   . ALA A 363 ? 0.3942 0.4547 0.3683 -0.0460 -0.0019 0.0011  356 ALA A N   
2288 C CA  . ALA A 363 ? 0.3492 0.4178 0.3218 -0.0498 -0.0002 -0.0019 356 ALA A CA  
2289 C C   . ALA A 363 ? 0.3649 0.4368 0.3388 -0.0492 0.0006  -0.0033 356 ALA A C   
2290 O O   . ALA A 363 ? 0.3778 0.4567 0.3538 -0.0487 0.0021  -0.0065 356 ALA A O   
2291 C CB  . ALA A 363 ? 0.1373 0.2078 0.1049 -0.0564 -0.0006 -0.0012 356 ALA A CB  
2292 N N   . GLU A 364 ? 0.2269 0.2943 0.1996 -0.0494 -0.0004 -0.0012 357 GLU A N   
2293 C CA  . GLU A 364 ? 0.2196 0.2898 0.1934 -0.0488 0.0004  -0.0024 357 GLU A CA  
2294 C C   . GLU A 364 ? 0.2865 0.3581 0.2651 -0.0431 0.0008  -0.0036 357 GLU A C   
2295 O O   . GLU A 364 ? 0.4017 0.4805 0.3819 -0.0430 0.0020  -0.0062 357 GLU A O   
2296 C CB  . GLU A 364 ? 0.2505 0.3148 0.2222 -0.0498 -0.0008 0.0000  357 GLU A CB  
2297 C CG  . GLU A 364 ? 0.4510 0.5187 0.4229 -0.0506 0.0002  -0.0015 357 GLU A CG  
2298 C CD  . GLU A 364 ? 0.6759 0.7391 0.6441 -0.0540 -0.0006 0.0002  357 GLU A CD  
2299 O OE1 . GLU A 364 ? 0.6269 0.6930 0.5944 -0.0557 0.0004  -0.0013 357 GLU A OE1 
2300 O OE2 . GLU A 364 ? 0.7917 0.8487 0.7575 -0.0552 -0.0022 0.0030  357 GLU A OE2 
2301 N N   . LEU A 365 ? 0.3326 0.3979 0.3135 -0.0385 -0.0002 -0.0017 358 LEU A N   
2302 C CA  . LEU A 365 ? 0.2771 0.3432 0.2617 -0.0336 0.0001  -0.0023 358 LEU A CA  
2303 C C   . LEU A 365 ? 0.2990 0.3731 0.2851 -0.0338 0.0014  -0.0054 358 LEU A C   
2304 O O   . LEU A 365 ? 0.3546 0.4342 0.3431 -0.0318 0.0019  -0.0071 358 LEU A O   
2305 C CB  . LEU A 365 ? 0.3033 0.3613 0.2896 -0.0294 -0.0010 -0.0001 358 LEU A CB  
2306 C CG  . LEU A 365 ? 0.3110 0.3681 0.3003 -0.0249 -0.0010 0.0002  358 LEU A CG  
2307 C CD1 . LEU A 365 ? 0.1831 0.2386 0.1722 -0.0245 -0.0013 0.0010  358 LEU A CD1 
2308 C CD2 . LEU A 365 ? 0.2229 0.2736 0.2139 -0.0212 -0.0016 0.0016  358 LEU A CD2 
2309 N N   . VAL A 366 ? 0.3547 0.4303 0.3393 -0.0365 0.0018  -0.0064 359 VAL A N   
2310 C CA  . VAL A 366 ? 0.3958 0.4799 0.3819 -0.0373 0.0033  -0.0102 359 VAL A CA  
2311 C C   . VAL A 366 ? 0.4129 0.5068 0.3993 -0.0398 0.0045  -0.0136 359 VAL A C   
2312 O O   . VAL A 366 ? 0.3681 0.4698 0.3576 -0.0379 0.0054  -0.0168 359 VAL A O   
2313 C CB  . VAL A 366 ? 0.2382 0.3221 0.2223 -0.0403 0.0037  -0.0109 359 VAL A CB  
2314 C CG1 . VAL A 366 ? 0.2366 0.3307 0.2221 -0.0423 0.0056  -0.0158 359 VAL A CG1 
2315 C CG2 . VAL A 366 ? 0.0955 0.1725 0.0806 -0.0371 0.0029  -0.0090 359 VAL A CG2 
2316 N N   . ALA A 367 ? 0.3504 0.4444 0.3335 -0.0441 0.0046  -0.0131 360 ALA A N   
2317 C CA  . ALA A 367 ? 0.3533 0.4562 0.3364 -0.0469 0.0057  -0.0162 360 ALA A CA  
2318 C C   . ALA A 367 ? 0.3935 0.4991 0.3798 -0.0428 0.0055  -0.0166 360 ALA A C   
2319 O O   . ALA A 367 ? 0.2938 0.4094 0.2828 -0.0422 0.0064  -0.0203 360 ALA A O   
2320 C CB  . ALA A 367 ? 0.0735 0.1742 0.0520 -0.0522 0.0056  -0.0148 360 ALA A CB  
2321 N N   . LEU A 368 ? 0.2802 0.3775 0.2665 -0.0399 0.0042  -0.0129 361 LEU A N   
2322 C CA  . LEU A 368 ? 0.2886 0.3878 0.2775 -0.0361 0.0038  -0.0128 361 LEU A CA  
2323 C C   . LEU A 368 ? 0.3640 0.4675 0.3566 -0.0314 0.0038  -0.0140 361 LEU A C   
2324 O O   . LEU A 368 ? 0.3332 0.4449 0.3283 -0.0293 0.0040  -0.0161 361 LEU A O   
2325 C CB  . LEU A 368 ? 0.3157 0.4048 0.3038 -0.0343 0.0026  -0.0089 361 LEU A CB  
2326 C CG  . LEU A 368 ? 0.3475 0.4328 0.3320 -0.0385 0.0024  -0.0078 361 LEU A CG  
2327 C CD1 . LEU A 368 ? 0.3000 0.3756 0.2844 -0.0360 0.0012  -0.0045 361 LEU A CD1 
2328 C CD2 . LEU A 368 ? 0.1548 0.2484 0.1388 -0.0415 0.0035  -0.0105 361 LEU A CD2 
2329 N N   . ALA A 369 ? 0.4281 0.5267 0.4212 -0.0297 0.0035  -0.0129 362 ALA A N   
2330 C CA  . ALA A 369 ? 0.3558 0.4568 0.3533 -0.0251 0.0040  -0.0138 362 ALA A CA  
2331 C C   . ALA A 369 ? 0.4234 0.5347 0.4254 -0.0252 0.0060  -0.0181 362 ALA A C   
2332 O O   . ALA A 369 ? 0.4128 0.5286 0.4205 -0.0208 0.0068  -0.0190 362 ALA A O   
2333 C CB  . ALA A 369 ? 0.2196 0.3132 0.2168 -0.0241 0.0037  -0.0121 362 ALA A CB  
2334 N N   . GLN A 370 ? 0.3324 0.4477 0.3318 -0.0303 0.0068  -0.0209 363 GLN A N   
2335 C CA  . GLN A 370 ? 0.3008 0.4265 0.3041 -0.0311 0.0088  -0.0258 363 GLN A CA  
2336 C C   . GLN A 370 ? 0.4696 0.6042 0.4758 -0.0300 0.0090  -0.0278 363 GLN A C   
2337 O O   . GLN A 370 ? 0.2653 0.4080 0.2780 -0.0267 0.0102  -0.0308 363 GLN A O   
2338 C CB  . GLN A 370 ? 0.3041 0.4327 0.3026 -0.0379 0.0093  -0.0282 363 GLN A CB  
2339 C CG  . GLN A 370 ? 0.3111 0.4339 0.3071 -0.0395 0.0093  -0.0275 363 GLN A CG  
2340 C CD  . GLN A 370 ? 0.5375 0.6654 0.5388 -0.0379 0.0115  -0.0314 363 GLN A CD  
2341 O OE1 . GLN A 370 ? 0.5900 0.7242 0.5980 -0.0339 0.0129  -0.0340 363 GLN A OE1 
2342 N NE2 . GLN A 370 ? 0.5588 0.6841 0.5574 -0.0408 0.0117  -0.0319 363 GLN A NE2 
2343 N N   . ALA A 371 ? 0.2101 0.3435 0.2118 -0.0327 0.0079  -0.0263 364 ALA A N   
2344 C CA  . ALA A 371 ? 0.1923 0.3344 0.1959 -0.0325 0.0081  -0.0283 364 ALA A CA  
2345 C C   . ALA A 371 ? 0.2919 0.4336 0.3004 -0.0259 0.0074  -0.0263 364 ALA A C   
2346 O O   . ALA A 371 ? 0.3579 0.5090 0.3716 -0.0232 0.0078  -0.0287 364 ALA A O   
2347 C CB  . ALA A 371 ? 0.2623 0.4028 0.2596 -0.0378 0.0076  -0.0276 364 ALA A CB  
2348 N N   . VAL A 372 ? 0.2920 0.4235 0.2990 -0.0233 0.0061  -0.0219 365 VAL A N   
2349 C CA  . VAL A 372 ? 0.2630 0.3929 0.2738 -0.0172 0.0054  -0.0194 365 VAL A CA  
2350 C C   . VAL A 372 ? 0.2775 0.4120 0.2961 -0.0125 0.0066  -0.0212 365 VAL A C   
2351 O O   . VAL A 372 ? 0.3785 0.5188 0.4024 -0.0080 0.0064  -0.0215 365 VAL A O   
2352 C CB  . VAL A 372 ? 0.2506 0.3682 0.2581 -0.0157 0.0041  -0.0146 365 VAL A CB  
2353 C CG1 . VAL A 372 ? 0.1204 0.2363 0.1322 -0.0096 0.0038  -0.0123 365 VAL A CG1 
2354 C CG2 . VAL A 372 ? 0.1499 0.2634 0.1514 -0.0190 0.0030  -0.0128 365 VAL A CG2 
2355 N N   . ASN A 373 ? 0.3083 0.4403 0.3275 -0.0134 0.0078  -0.0224 366 ASN A N   
2356 C CA  . ASN A 373 ? 0.4698 0.6059 0.4966 -0.0093 0.0094  -0.0247 366 ASN A CA  
2357 C C   . ASN A 373 ? 0.4695 0.6189 0.5014 -0.0091 0.0103  -0.0296 366 ASN A C   
2358 O O   . ASN A 373 ? 0.4643 0.6187 0.5038 -0.0035 0.0107  -0.0305 366 ASN A O   
2359 C CB  . ASN A 373 ? 0.4628 0.5940 0.4885 -0.0113 0.0107  -0.0256 366 ASN A CB  
2360 C CG  . ASN A 373 ? 0.4283 0.5618 0.4620 -0.0066 0.0127  -0.0277 366 ASN A CG  
2361 O OD1 . ASN A 373 ? 0.4518 0.5853 0.4915 -0.0006 0.0126  -0.0263 366 ASN A OD1 
2362 N ND2 . ASN A 373 ? 0.3579 0.4933 0.3918 -0.0093 0.0145  -0.0312 366 ASN A ND2 
2363 N N   . ALA A 374 ? 0.3918 0.5471 0.4196 -0.0151 0.0107  -0.0328 367 ALA A N   
2364 C CA  . ALA A 374 ? 0.2879 0.4567 0.3197 -0.0157 0.0116  -0.0379 367 ALA A CA  
2365 C C   . ALA A 374 ? 0.2434 0.4186 0.2791 -0.0116 0.0104  -0.0373 367 ALA A C   
2366 O O   . ALA A 374 ? 0.3856 0.5714 0.4283 -0.0085 0.0109  -0.0408 367 ALA A O   
2367 C CB  . ALA A 374 ? 0.1982 0.3712 0.2235 -0.0236 0.0120  -0.0407 367 ALA A CB  
2368 N N   . ARG A 375 ? 0.2096 0.3786 0.2408 -0.0116 0.0087  -0.0331 368 ARG A N   
2369 C CA  . ARG A 375 ? 0.2126 0.3878 0.2458 -0.0089 0.0075  -0.0326 368 ARG A CA  
2370 C C   . ARG A 375 ? 0.3276 0.5006 0.3671 -0.0012 0.0065  -0.0294 368 ARG A C   
2371 O O   . ARG A 375 ? 0.3396 0.5201 0.3831 0.0023  0.0054  -0.0295 368 ARG A O   
2372 C CB  . ARG A 375 ? 0.2223 0.3930 0.2476 -0.0133 0.0065  -0.0302 368 ARG A CB  
2373 C CG  . ARG A 375 ? 0.1928 0.3681 0.2128 -0.0207 0.0074  -0.0336 368 ARG A CG  
2374 C CD  . ARG A 375 ? 0.3126 0.4835 0.3258 -0.0245 0.0066  -0.0314 368 ARG A CD  
2375 N NE  . ARG A 375 ? 0.4658 0.6255 0.4724 -0.0289 0.0066  -0.0292 368 ARG A NE  
2376 C CZ  . ARG A 375 ? 0.6174 0.7657 0.6211 -0.0275 0.0055  -0.0247 368 ARG A CZ  
2377 N NH1 . ARG A 375 ? 0.6417 0.7882 0.6479 -0.0223 0.0045  -0.0220 368 ARG A NH1 
2378 N NH2 . ARG A 375 ? 0.6171 0.7562 0.6155 -0.0312 0.0053  -0.0229 368 ARG A NH2 
2379 N N   . ALA A 376 ? 0.4609 0.6240 0.5013 0.0013  0.0068  -0.0267 369 ALA A N   
2380 C CA  . ALA A 376 ? 0.5473 0.7058 0.5928 0.0081  0.0059  -0.0232 369 ALA A CA  
2381 C C   . ALA A 376 ? 0.6963 0.8628 0.7523 0.0143  0.0063  -0.0253 369 ALA A C   
2382 O O   . ALA A 376 ? 0.8232 0.9961 0.8834 0.0139  0.0080  -0.0298 369 ALA A O   
2383 C CB  . ALA A 376 ? 0.6037 0.7493 0.6468 0.0082  0.0065  -0.0200 369 ALA A CB  
2384 N N   . LEU A 377 ? 0.7313 0.8973 0.7917 0.0201  0.0046  -0.0221 370 LEU A N   
2385 C CA  . LEU A 377 ? 0.7063 0.8789 0.7773 0.0270  0.0043  -0.0233 370 LEU A CA  
2386 C C   . LEU A 377 ? 0.7472 0.9142 0.8235 0.0295  0.0065  -0.0243 370 LEU A C   
2387 O O   . LEU A 377 ? 0.7749 0.9314 0.8463 0.0268  0.0076  -0.0226 370 LEU A O   
2388 C CB  . LEU A 377 ? 0.6469 0.8180 0.7203 0.0322  0.0015  -0.0187 370 LEU A CB  
2389 C CG  . LEU A 377 ? 0.5838 0.7655 0.6569 0.0326  -0.0006 -0.0188 370 LEU A CG  
2390 C CD1 . LEU A 377 ? 0.6122 0.8029 0.6807 0.0263  0.0005  -0.0233 370 LEU A CD1 
2391 C CD2 . LEU A 377 ? 0.4374 0.6127 0.5045 0.0325  -0.0026 -0.0137 370 LEU A CD2 
2392 N N   . PRO A 378 ? 0.7896 0.9637 0.8760 0.0347  0.0073  -0.0272 371 PRO A N   
2393 C CA  . PRO A 378 ? 0.7845 0.9548 0.8757 0.0365  0.0101  -0.0295 371 PRO A CA  
2394 C C   . PRO A 378 ? 0.7661 0.9224 0.8576 0.0392  0.0106  -0.0250 371 PRO A C   
2395 O O   . PRO A 378 ? 0.7540 0.9050 0.8457 0.0383  0.0135  -0.0266 371 PRO A O   
2396 C CB  . PRO A 378 ? 0.7321 0.9129 0.8349 0.0429  0.0103  -0.0326 371 PRO A CB  
2397 C CG  . PRO A 378 ? 0.7411 0.9342 0.8429 0.0414  0.0082  -0.0344 371 PRO A CG  
2398 C CD  . PRO A 378 ? 0.7488 0.9357 0.8423 0.0388  0.0057  -0.0292 371 PRO A CD  
2399 N N   . ALA A 379 ? 0.6258 0.7766 0.7166 0.0420  0.0079  -0.0199 372 ALA A N   
2400 C CA  . ALA A 379 ? 0.6370 0.7745 0.7272 0.0440  0.0080  -0.0158 372 ALA A CA  
2401 C C   . ALA A 379 ? 0.7888 0.9176 0.8692 0.0375  0.0094  -0.0152 372 ALA A C   
2402 O O   . ALA A 379 ? 0.8612 0.9836 0.9424 0.0372  0.0122  -0.0160 372 ALA A O   
2403 C CB  . ALA A 379 ? 0.6457 0.7804 0.7355 0.0473  0.0042  -0.0109 372 ALA A CB  
2404 N N   . VAL A 380 ? 0.7698 0.8986 0.8414 0.0327  0.0077  -0.0136 373 VAL A N   
2405 C CA  . VAL A 380 ? 0.5781 0.6993 0.6404 0.0267  0.0085  -0.0127 373 VAL A CA  
2406 C C   . VAL A 380 ? 0.5248 0.6488 0.5859 0.0226  0.0110  -0.0169 373 VAL A C   
2407 O O   . VAL A 380 ? 0.4957 0.6125 0.5543 0.0206  0.0128  -0.0169 373 VAL A O   
2408 C CB  . VAL A 380 ? 0.5179 0.6405 0.5717 0.0223  0.0064  -0.0111 373 VAL A CB  
2409 C CG1 . VAL A 380 ? 0.5446 0.6597 0.5896 0.0164  0.0070  -0.0104 373 VAL A CG1 
2410 C CG2 . VAL A 380 ? 0.4340 0.5544 0.4873 0.0255  0.0039  -0.0070 373 VAL A CG2 
2411 N N   . GLN A 381 ? 0.4194 0.5544 0.4819 0.0211  0.0110  -0.0207 374 GLN A N   
2412 C CA  . GLN A 381 ? 0.3623 0.5019 0.4221 0.0159  0.0128  -0.0251 374 GLN A CA  
2413 C C   . GLN A 381 ? 0.3567 0.4926 0.4191 0.0161  0.0157  -0.0273 374 GLN A C   
2414 O O   . GLN A 381 ? 0.3382 0.4758 0.4089 0.0214  0.0173  -0.0288 374 GLN A O   
2415 C CB  . GLN A 381 ? 0.3993 0.5527 0.4631 0.0157  0.0128  -0.0297 374 GLN A CB  
2416 C CG  . GLN A 381 ? 0.4347 0.5938 0.4952 0.0095  0.0144  -0.0347 374 GLN A CG  
2417 C CD  . GLN A 381 ? 0.4830 0.6563 0.5471 0.0090  0.0145  -0.0396 374 GLN A CD  
2418 O OE1 . GLN A 381 ? 0.5653 0.7458 0.6384 0.0141  0.0152  -0.0423 374 GLN A OE1 
2419 N NE2 . GLN A 381 ? 0.4492 0.6266 0.5065 0.0028  0.0137  -0.0408 374 GLN A NE2 
2420 N N   . GLN A 382 ? 0.4507 0.5814 0.5057 0.0105  0.0162  -0.0273 375 GLN A N   
2421 C CA  . GLN A 382 ? 0.5693 0.6964 0.6248 0.0095  0.0188  -0.0295 375 GLN A CA  
2422 C C   . GLN A 382 ? 0.6508 0.7875 0.7065 0.0053  0.0202  -0.0356 375 GLN A C   
2423 O O   . GLN A 382 ? 0.6630 0.8050 0.7138 0.0002  0.0190  -0.0370 375 GLN A O   
2424 C CB  . GLN A 382 ? 0.4476 0.5640 0.4951 0.0057  0.0181  -0.0261 375 GLN A CB  
2425 C CG  . GLN A 382 ? 0.4606 0.5681 0.5079 0.0094  0.0168  -0.0207 375 GLN A CG  
2426 C CD  . GLN A 382 ? 0.5173 0.6197 0.5711 0.0149  0.0191  -0.0200 375 GLN A CD  
2427 O OE1 . GLN A 382 ? 0.7680 0.8663 0.8210 0.0139  0.0213  -0.0213 375 GLN A OE1 
2428 N NE2 . GLN A 382 ? 0.3542 0.4568 0.4143 0.0207  0.0184  -0.0181 375 GLN A NE2 
2429 N N   . ASN A 383 ? 0.6030 0.7419 0.6642 0.0073  0.0229  -0.0395 376 ASN A N   
2430 C CA  . ASN A 383 ? 0.6202 0.7682 0.6814 0.0028  0.0244  -0.0458 376 ASN A CA  
2431 C C   . ASN A 383 ? 0.6021 0.7468 0.6536 -0.0052 0.0239  -0.0459 376 ASN A C   
2432 O O   . ASN A 383 ? 0.7052 0.8570 0.7529 -0.0110 0.0235  -0.0490 376 ASN A O   
2433 C CB  . ASN A 383 ? 0.7041 0.8543 0.7730 0.0066  0.0275  -0.0502 376 ASN A CB  
2434 C CG  . ASN A 383 ? 0.8062 0.9666 0.8849 0.0121  0.0282  -0.0538 376 ASN A CG  
2435 O OD1 . ASN A 383 ? 0.8491 1.0070 0.9341 0.0195  0.0278  -0.0508 376 ASN A OD1 
2436 N ND2 . ASN A 383 ? 0.8370 1.0092 0.9171 0.0086  0.0290  -0.0602 376 ASN A ND2 
2437 N N   . ASN A 384 ? 0.5481 0.6821 0.5958 -0.0056 0.0238  -0.0423 377 ASN A N   
2438 C CA  . ASN A 384 ? 0.6612 0.7908 0.6997 -0.0124 0.0226  -0.0412 377 ASN A CA  
2439 C C   . ASN A 384 ? 0.7051 0.8240 0.7390 -0.0114 0.0205  -0.0348 377 ASN A C   
2440 O O   . ASN A 384 ? 0.7943 0.9056 0.8303 -0.0074 0.0212  -0.0323 377 ASN A O   
2441 C CB  . ASN A 384 ? 0.7509 0.8792 0.7889 -0.0148 0.0247  -0.0445 377 ASN A CB  
2442 C CG  . ASN A 384 ? 0.8775 1.0158 0.9143 -0.0207 0.0257  -0.0505 377 ASN A CG  
2443 O OD1 . ASN A 384 ? 0.8515 0.9995 0.8915 -0.0208 0.0259  -0.0538 377 ASN A OD1 
2444 N ND2 . ASN A 384 ? 0.9511 1.0879 0.9831 -0.0259 0.0261  -0.0522 377 ASN A ND2 
2445 N N   . LEU A 385 ? 0.4642 0.5820 0.4918 -0.0149 0.0179  -0.0322 378 LEU A N   
2446 C CA  . LEU A 385 ? 0.5741 0.6820 0.5977 -0.0138 0.0159  -0.0267 378 LEU A CA  
2447 C C   . LEU A 385 ? 0.5779 0.6790 0.5956 -0.0176 0.0153  -0.0256 378 LEU A C   
2448 O O   . LEU A 385 ? 0.5600 0.6644 0.5740 -0.0229 0.0154  -0.0283 378 LEU A O   
2449 C CB  . LEU A 385 ? 0.5638 0.6721 0.5839 -0.0147 0.0134  -0.0240 378 LEU A CB  
2450 C CG  . LEU A 385 ? 0.5168 0.6220 0.5287 -0.0205 0.0113  -0.0225 378 LEU A CG  
2451 C CD1 . LEU A 385 ? 0.2394 0.3421 0.2484 -0.0201 0.0091  -0.0191 378 LEU A CD1 
2452 C CD2 . LEU A 385 ? 0.7164 0.8301 0.7267 -0.0256 0.0122  -0.0268 378 LEU A CD2 
2453 N N   . ASP A 386 ? 0.4736 0.5656 0.4906 -0.0150 0.0148  -0.0219 379 ASP A N   
2454 C CA  . ASP A 386 ? 0.4188 0.5045 0.4311 -0.0178 0.0141  -0.0208 379 ASP A CA  
2455 C C   . ASP A 386 ? 0.4903 0.5736 0.4955 -0.0219 0.0108  -0.0183 379 ASP A C   
2456 O O   . ASP A 386 ? 0.6093 0.6865 0.6125 -0.0203 0.0088  -0.0145 379 ASP A O   
2457 C CB  . ASP A 386 ? 0.5197 0.5970 0.5338 -0.0135 0.0146  -0.0178 379 ASP A CB  
2458 C CG  . ASP A 386 ? 0.7120 0.7837 0.7225 -0.0158 0.0144  -0.0176 379 ASP A CG  
2459 O OD1 . ASP A 386 ? 0.7813 0.8487 0.7946 -0.0129 0.0164  -0.0174 379 ASP A OD1 
2460 O OD2 . ASP A 386 ? 0.7616 0.8334 0.7666 -0.0205 0.0123  -0.0176 379 ASP A OD2 
2461 N N   . GLU A 387 ? 0.4323 0.5207 0.4339 -0.0271 0.0104  -0.0206 380 GLU A N   
2462 C CA  . GLU A 387 ? 0.4639 0.5503 0.4591 -0.0310 0.0076  -0.0181 380 GLU A CA  
2463 C C   . GLU A 387 ? 0.4166 0.4950 0.4084 -0.0314 0.0056  -0.0151 380 GLU A C   
2464 O O   . GLU A 387 ? 0.4160 0.4884 0.4056 -0.0313 0.0038  -0.0111 380 GLU A O   
2465 C CB  . GLU A 387 ? 0.5871 0.6806 0.5790 -0.0369 0.0079  -0.0211 380 GLU A CB  
2466 C CG  . GLU A 387 ? 0.6953 0.7973 0.6901 -0.0370 0.0093  -0.0240 380 GLU A CG  
2467 C CD  . GLU A 387 ? 0.7751 0.8849 0.7665 -0.0433 0.0099  -0.0275 380 GLU A CD  
2468 O OE1 . GLU A 387 ? 0.6727 0.7786 0.6597 -0.0469 0.0093  -0.0253 380 GLU A OE1 
2469 O OE2 . GLU A 387 ? 0.7631 0.8816 0.7580 -0.0434 0.0117  -0.0314 380 GLU A OE2 
2470 N N   . ASP A 388 ? 0.3809 0.4571 0.3743 -0.0304 0.0069  -0.0162 381 ASP A N   
2471 C CA  . ASP A 388 ? 0.5252 0.5946 0.5160 -0.0304 0.0051  -0.0137 381 ASP A CA  
2472 C C   . ASP A 388 ? 0.4665 0.5295 0.4585 -0.0262 0.0037  -0.0101 381 ASP A C   
2473 O O   . ASP A 388 ? 0.4744 0.5306 0.4651 -0.0253 0.0021  -0.0065 381 ASP A O   
2474 C CB  . ASP A 388 ? 0.7195 0.7886 0.7119 -0.0305 0.0072  -0.0163 381 ASP A CB  
2475 C CG  . ASP A 388 ? 0.7471 0.8227 0.7373 -0.0358 0.0080  -0.0199 381 ASP A CG  
2476 O OD1 . ASP A 388 ? 0.7746 0.8484 0.7614 -0.0382 0.0068  -0.0171 381 ASP A OD1 
2477 O OD2 . ASP A 388 ? 0.6462 0.7260 0.6398 -0.0358 0.0110  -0.0240 381 ASP A OD2 
2478 N N   . LEU A 389 ? 0.4277 0.4903 0.4242 -0.0219 0.0057  -0.0102 382 LEU A N   
2479 C CA  . LEU A 389 ? 0.3129 0.3704 0.3106 -0.0180 0.0046  -0.0070 382 LEU A CA  
2480 C C   . LEU A 389 ? 0.4121 0.4702 0.4074 -0.0186 0.0020  -0.0050 382 LEU A C   
2481 O O   . LEU A 389 ? 0.3168 0.3683 0.3117 -0.0169 0.0004  -0.0020 382 LEU A O   
2482 C CB  . LEU A 389 ? 0.2566 0.3151 0.2598 -0.0136 0.0073  -0.0074 382 LEU A CB  
2483 C CG  . LEU A 389 ? 0.2966 0.3502 0.3002 -0.0102 0.0060  -0.0040 382 LEU A CG  
2484 C CD1 . LEU A 389 ? 0.1058 0.1524 0.1073 -0.0101 0.0048  -0.0023 382 LEU A CD1 
2485 C CD2 . LEU A 389 ? 0.2567 0.3116 0.2659 -0.0059 0.0085  -0.0040 382 LEU A CD2 
2486 N N   . ILE A 390 ? 0.3330 0.3973 0.3281 -0.0206 0.0025  -0.0066 383 ILE A N   
2487 C CA  . ILE A 390 ? 0.3020 0.3650 0.2957 -0.0211 0.0012  -0.0046 383 ILE A CA  
2488 C C   . ILE A 390 ? 0.2797 0.3354 0.2711 -0.0226 0.0002  -0.0023 383 ILE A C   
2489 O O   . ILE A 390 ? 0.3580 0.4083 0.3494 -0.0212 -0.0009 0.0000  383 ILE A O   
2490 C CB  . ILE A 390 ? 0.3216 0.3931 0.3148 -0.0239 0.0021  -0.0072 383 ILE A CB  
2491 C CG1 . ILE A 390 ? 0.3007 0.3785 0.2987 -0.0209 0.0039  -0.0095 383 ILE A CG1 
2492 C CG2 . ILE A 390 ? 0.2417 0.3106 0.2336 -0.0246 0.0012  -0.0052 383 ILE A CG2 
2493 C CD1 . ILE A 390 ? 0.3109 0.3865 0.3108 -0.0167 0.0033  -0.0071 383 ILE A CD1 
2494 N N   . ARG A 391 ? 0.3808 0.4371 0.3705 -0.0255 0.0004  -0.0031 384 ARG A N   
2495 C CA  . ARG A 391 ? 0.4686 0.5196 0.4564 -0.0268 -0.0008 -0.0009 384 ARG A CA  
2496 C C   . ARG A 391 ? 0.4248 0.4683 0.4139 -0.0233 -0.0018 0.0011  384 ARG A C   
2497 O O   . ARG A 391 ? 0.3913 0.4303 0.3803 -0.0226 -0.0029 0.0029  384 ARG A O   
2498 C CB  . ARG A 391 ? 0.5995 0.6538 0.5848 -0.0309 -0.0003 -0.0020 384 ARG A CB  
2499 C CG  . ARG A 391 ? 0.7008 0.7618 0.6841 -0.0352 0.0005  -0.0036 384 ARG A CG  
2500 C CD  . ARG A 391 ? 0.5896 0.6536 0.5700 -0.0397 0.0008  -0.0044 384 ARG A CD  
2501 N NE  . ARG A 391 ? 0.5046 0.5695 0.4860 -0.0391 0.0017  -0.0063 384 ARG A NE  
2502 C CZ  . ARG A 391 ? 0.5390 0.6108 0.5212 -0.0406 0.0036  -0.0104 384 ARG A CZ  
2503 N NH1 . ARG A 391 ? 0.3206 0.3993 0.3029 -0.0428 0.0048  -0.0130 384 ARG A NH1 
2504 N NH2 . ARG A 391 ? 0.4771 0.5492 0.4603 -0.0402 0.0045  -0.0123 384 ARG A NH2 
2505 N N   . LYS A 392 ? 0.3049 0.3479 0.2955 -0.0214 -0.0012 0.0002  385 LYS A N   
2506 C CA  . LYS A 392 ? 0.3627 0.3992 0.3547 -0.0182 -0.0019 0.0016  385 LYS A CA  
2507 C C   . LYS A 392 ? 0.3886 0.4214 0.3820 -0.0154 -0.0026 0.0029  385 LYS A C   
2508 O O   . LYS A 392 ? 0.3824 0.4102 0.3764 -0.0140 -0.0033 0.0039  385 LYS A O   
2509 C CB  . LYS A 392 ? 0.2816 0.3188 0.2746 -0.0170 -0.0011 0.0004  385 LYS A CB  
2510 C CG  . LYS A 392 ? 0.3598 0.3907 0.3538 -0.0144 -0.0016 0.0015  385 LYS A CG  
2511 C CD  . LYS A 392 ? 0.4727 0.5050 0.4671 -0.0143 -0.0006 0.0001  385 LYS A CD  
2512 C CE  . LYS A 392 ? 0.5065 0.5332 0.5018 -0.0120 -0.0011 0.0011  385 LYS A CE  
2513 N NZ  . LYS A 392 ? 0.5245 0.5525 0.5196 -0.0126 0.0000  -0.0005 385 LYS A NZ  
2514 N N   . LEU A 393 ? 0.3865 0.4227 0.3805 -0.0149 -0.0021 0.0026  386 LEU A N   
2515 C CA  . LEU A 393 ? 0.3286 0.3620 0.3236 -0.0128 -0.0025 0.0036  386 LEU A CA  
2516 C C   . LEU A 393 ? 0.3295 0.3610 0.3234 -0.0141 -0.0032 0.0043  386 LEU A C   
2517 O O   . LEU A 393 ? 0.4330 0.4621 0.4319 -0.0136 -0.0020 0.0052  386 LEU A O   
2518 C CB  . LEU A 393 ? 0.3400 0.3790 0.3356 -0.0125 -0.0019 0.0032  386 LEU A CB  
2519 C CG  . LEU A 393 ? 0.3033 0.3402 0.2994 -0.0109 -0.0023 0.0041  386 LEU A CG  
2520 C CD1 . LEU A 393 ? 0.1695 0.2010 0.1711 -0.0086 -0.0012 0.0048  386 LEU A CD1 
2521 C CD2 . LEU A 393 ? 0.2671 0.3114 0.2637 -0.0107 -0.0017 0.0036  386 LEU A CD2 
2522 N N   . ALA A 394 ? 0.4162 0.4516 0.4081 -0.0176 -0.0032 0.0040  387 ALA A N   
2523 C CA  . ALA A 394 ? 0.4915 0.5258 0.4819 -0.0196 -0.0039 0.0049  387 ALA A CA  
2524 C C   . ALA A 394 ? 0.4542 0.4835 0.4448 -0.0188 -0.0048 0.0060  387 ALA A C   
2525 O O   . ALA A 394 ? 0.5554 0.5816 0.5463 -0.0180 -0.0054 0.0067  387 ALA A O   
2526 C CB  . ALA A 394 ? 0.3808 0.4207 0.3684 -0.0243 -0.0036 0.0044  387 ALA A CB  
2527 N N   . TYR A 395 ? 0.4446 0.4738 0.4351 -0.0191 -0.0049 0.0058  388 TYR A N   
2528 C CA  . TYR A 395 ? 0.5155 0.5415 0.5061 -0.0190 -0.0058 0.0068  388 TYR A CA  
2529 C C   . TYR A 395 ? 0.5417 0.5628 0.5318 -0.0156 -0.0042 0.0080  388 TYR A C   
2530 O O   . TYR A 395 ? 0.4506 0.4716 0.4470 -0.0170 -0.0046 0.0082  388 TYR A O   
2531 C CB  . TYR A 395 ? 0.5292 0.5570 0.5191 -0.0204 -0.0056 0.0064  388 TYR A CB  
2532 C CG  . TYR A 395 ? 0.3662 0.3984 0.3530 -0.0251 -0.0058 0.0067  388 TYR A CG  
2533 C CD1 . TYR A 395 ? 0.3481 0.3843 0.3338 -0.0269 -0.0048 0.0052  388 TYR A CD1 
2534 C CD2 . TYR A 395 ? 0.3205 0.3530 0.3050 -0.0284 -0.0070 0.0084  388 TYR A CD2 
2535 C CE1 . TYR A 395 ? 0.4192 0.4601 0.4019 -0.0317 -0.0048 0.0050  388 TYR A CE1 
2536 C CE2 . TYR A 395 ? 0.3527 0.3894 0.3339 -0.0334 -0.0072 0.0088  388 TYR A CE2 
2537 C CZ  . TYR A 395 ? 0.4445 0.4855 0.4248 -0.0349 -0.0060 0.0069  388 TYR A CZ  
2538 O OH  . TYR A 395 ? 0.5111 0.5566 0.4878 -0.0402 -0.0060 0.0069  388 TYR A OH  
2539 N N   . VAL A 396 ? 0.5804 0.6015 0.5722 -0.0135 -0.0035 0.0071  389 VAL A N   
2540 C CA  . VAL A 396 ? 0.4401 0.4605 0.4388 -0.0124 -0.0030 0.0064  389 VAL A CA  
2541 C C   . VAL A 396 ? 0.5166 0.5344 0.5114 -0.0101 -0.0032 0.0070  389 VAL A C   
2542 O O   . VAL A 396 ? 0.5596 0.5756 0.5558 -0.0084 -0.0029 0.0067  389 VAL A O   
2543 C CB  . VAL A 396 ? 0.3645 0.3833 0.3589 -0.0101 -0.0027 0.0061  389 VAL A CB  
2544 C CG1 . VAL A 396 ? 0.2952 0.3136 0.2911 -0.0082 -0.0022 0.0057  389 VAL A CG1 
2545 C CG2 . VAL A 396 ? 0.4927 0.5098 0.4871 -0.0100 -0.0028 0.0061  389 VAL A CG2 
2546 N N   . ALA A 397 ? 0.5170 0.5382 0.5159 -0.0125 -0.0031 0.0067  390 ALA A N   
2547 C CA  . ALA A 397 ? 0.4180 0.4391 0.4174 -0.0117 -0.0029 0.0066  390 ALA A CA  
2548 C C   . ALA A 397 ? 0.3618 0.3784 0.3566 -0.0104 -0.0037 0.0076  390 ALA A C   
2549 O O   . ALA A 397 ? 0.3422 0.3600 0.3420 -0.0105 -0.0031 0.0068  390 ALA A O   
2550 C CB  . ALA A 397 ? 0.4145 0.4390 0.4133 -0.0133 -0.0028 0.0065  390 ALA A CB  
2551 N N   . ALA A 398 ? 0.4632 0.4785 0.4572 -0.0114 -0.0044 0.0083  391 ALA A N   
2552 C CA  . ALA A 398 ? 0.3379 0.3511 0.3322 -0.0113 -0.0050 0.0088  391 ALA A CA  
2553 C C   . ALA A 398 ? 0.4821 0.4936 0.4782 -0.0093 -0.0045 0.0081  391 ALA A C   
2554 O O   . ALA A 398 ? 0.5428 0.5529 0.5392 -0.0089 -0.0046 0.0080  391 ALA A O   
2555 C CB  . ALA A 398 ? 0.0551 0.0674 0.0484 -0.0129 -0.0062 0.0099  391 ALA A CB  
2556 N N   . GLY A 399 ? 0.4324 0.4453 0.4326 -0.0092 -0.0036 0.0069  392 GLY A N   
2557 C CA  . GLY A 399 ? 0.4200 0.4312 0.4208 -0.0077 -0.0032 0.0063  392 GLY A CA  
2558 C C   . GLY A 399 ? 0.3756 0.3862 0.3768 -0.0064 -0.0026 0.0056  392 GLY A C   
2559 O O   . GLY A 399 ? 0.4353 0.4472 0.4367 -0.0061 -0.0023 0.0055  392 GLY A O   
2560 N N   . ASP A 400 ? 0.3293 0.3374 0.3283 -0.0051 -0.0028 0.0058  393 ASP A N   
2561 C CA  . ASP A 400 ? 0.4427 0.4503 0.4419 -0.0044 -0.0024 0.0052  393 ASP A CA  
2562 C C   . ASP A 400 ? 0.4655 0.4728 0.4668 -0.0041 -0.0019 0.0042  393 ASP A C   
2563 O O   . ASP A 400 ? 0.5290 0.5346 0.5285 -0.0036 -0.0022 0.0044  393 ASP A O   
2564 C CB  . ASP A 400 ? 0.4675 0.4758 0.4686 -0.0054 -0.0024 0.0049  393 ASP A CB  
2565 C CG  . ASP A 400 ? 0.7082 0.7168 0.7092 -0.0050 -0.0020 0.0045  393 ASP A CG  
2566 O OD1 . ASP A 400 ? 0.8693 0.8763 0.8680 -0.0045 -0.0022 0.0046  393 ASP A OD1 
2567 O OD2 . ASP A 400 ? 0.7083 0.7171 0.7072 -0.0043 -0.0020 0.0049  393 ASP A OD2 
2568 N N   . LEU A 401 ? 0.3746 0.3820 0.3760 -0.0036 -0.0016 0.0038  394 LEU A N   
2569 C CA  . LEU A 401 ? 0.2415 0.2473 0.2413 -0.0028 -0.0015 0.0037  394 LEU A CA  
2570 C C   . LEU A 401 ? 0.2437 0.2490 0.2435 -0.0023 -0.0012 0.0032  394 LEU A C   
2571 O O   . LEU A 401 ? 0.2891 0.2956 0.2905 -0.0024 -0.0010 0.0030  394 LEU A O   
2572 C CB  . LEU A 401 ? 0.2016 0.2077 0.2013 -0.0029 -0.0015 0.0038  394 LEU A CB  
2573 C CG  . LEU A 401 ? 0.3148 0.3220 0.3142 -0.0037 -0.0019 0.0045  394 LEU A CG  
2574 C CD1 . LEU A 401 ? 0.3250 0.3337 0.3261 -0.0043 -0.0017 0.0040  394 LEU A CD1 
2575 C CD2 . LEU A 401 ? 0.4106 0.4176 0.4098 -0.0043 -0.0024 0.0050  394 LEU A CD2 
2576 N N   . ALA A 402 ? 0.3115 0.3168 0.3125 -0.0025 -0.0010 0.0026  395 ALA A N   
2577 C CA  . ALA A 402 ? 0.2418 0.2469 0.2426 -0.0023 -0.0009 0.0023  395 ALA A CA  
2578 C C   . ALA A 402 ? 0.2575 0.2628 0.2584 -0.0021 -0.0008 0.0023  395 ALA A C   
2579 O O   . ALA A 402 ? 0.2485 0.2539 0.2484 -0.0020 -0.0009 0.0028  395 ALA A O   
2580 C CB  . ALA A 402 ? 0.2005 0.2044 0.2000 -0.0020 -0.0009 0.0022  395 ALA A CB  
2581 N N   . PRO A 403 ? 0.2934 0.2982 0.2942 -0.0020 -0.0008 0.0022  396 PRO A N   
2582 C CA  . PRO A 403 ? 0.1986 0.2035 0.1995 -0.0019 -0.0007 0.0022  396 PRO A CA  
2583 C C   . PRO A 403 ? 0.3092 0.3151 0.3106 -0.0018 -0.0007 0.0027  396 PRO A C   
2584 O O   . PRO A 403 ? 0.4483 0.4540 0.4488 -0.0014 -0.0007 0.0033  396 PRO A O   
2585 C CB  . PRO A 403 ? 0.2377 0.2416 0.2373 -0.0018 -0.0008 0.0021  396 PRO A CB  
2586 C CG  . PRO A 403 ? 0.2011 0.2052 0.2015 -0.0021 -0.0008 0.0018  396 PRO A CG  
2587 C CD  . PRO A 403 ? 0.1766 0.1806 0.1762 -0.0019 -0.0009 0.0023  396 PRO A CD  
2588 N N   . ILE A 404 ? 0.2819 0.2883 0.2835 -0.0018 -0.0008 0.0029  397 ILE A N   
2589 C CA  . ILE A 404 ? 0.3110 0.3179 0.3117 -0.0015 -0.0007 0.0039  397 ILE A CA  
2590 C C   . ILE A 404 ? 0.3070 0.3150 0.3079 -0.0015 -0.0007 0.0045  397 ILE A C   
2591 O O   . ILE A 404 ? 0.3471 0.3577 0.3505 -0.0012 -0.0006 0.0049  397 ILE A O   
2592 C CB  . ILE A 404 ? 0.2190 0.2266 0.2197 -0.0017 -0.0008 0.0042  397 ILE A CB  
2593 C CG1 . ILE A 404 ? 0.3173 0.3252 0.3192 -0.0021 -0.0009 0.0034  397 ILE A CG1 
2594 C CG2 . ILE A 404 ? 0.0420 0.0513 0.0431 -0.0014 -0.0006 0.0050  397 ILE A CG2 
2595 C CD1 . ILE A 404 ? 0.2901 0.2977 0.2920 -0.0018 -0.0008 0.0032  397 ILE A CD1 
2596 N N   . ASN A 405 ? 0.2525 0.2615 0.2548 -0.0020 -0.0009 0.0039  398 ASN A N   
2597 C CA  . ASN A 405 ? 0.2207 0.2311 0.2232 -0.0023 -0.0010 0.0043  398 ASN A CA  
2598 C C   . ASN A 405 ? 0.2173 0.2270 0.2180 -0.0020 -0.0009 0.0050  398 ASN A C   
2599 O O   . ASN A 405 ? 0.2571 0.2687 0.2580 -0.0021 -0.0009 0.0060  398 ASN A O   
2600 C CB  . ASN A 405 ? 0.2999 0.3096 0.3018 -0.0028 -0.0010 0.0039  398 ASN A CB  
2601 C CG  . ASN A 405 ? 0.2808 0.2906 0.2827 -0.0030 -0.0011 0.0040  398 ASN A CG  
2602 O OD1 . ASN A 405 ? 0.3376 0.3476 0.3377 -0.0027 -0.0013 0.0049  398 ASN A OD1 
2603 N ND2 . ASN A 405 ? 0.2985 0.3073 0.3000 -0.0033 -0.0012 0.0037  398 ASN A ND2 
2604 N N   . ALA A 406 ? 0.2836 0.2918 0.2840 -0.0021 -0.0009 0.0043  399 ALA A N   
2605 C CA  . ALA A 406 ? 0.2694 0.2782 0.2698 -0.0022 -0.0010 0.0046  399 ALA A CA  
2606 C C   . ALA A 406 ? 0.3084 0.3182 0.3096 -0.0018 -0.0009 0.0056  399 ALA A C   
2607 O O   . ALA A 406 ? 0.4060 0.4177 0.4077 -0.0018 -0.0009 0.0067  399 ALA A O   
2608 C CB  . ALA A 406 ? 0.0681 0.0754 0.0681 -0.0024 -0.0011 0.0037  399 ALA A CB  
2609 N N   . PHE A 407 ? 0.3404 0.3506 0.3439 -0.0014 -0.0007 0.0049  400 PHE A N   
2610 C CA  . PHE A 407 ? 0.4191 0.4303 0.4237 -0.0006 -0.0003 0.0058  400 PHE A CA  
2611 C C   . PHE A 407 ? 0.3555 0.3675 0.3586 0.0001  0.0001  0.0079  400 PHE A C   
2612 O O   . PHE A 407 ? 0.3111 0.3246 0.3150 0.0008  0.0005  0.0094  400 PHE A O   
2613 C CB  . PHE A 407 ? 0.4542 0.4639 0.4585 -0.0001 -0.0001 0.0052  400 PHE A CB  
2614 C CG  . PHE A 407 ? 0.4902 0.5009 0.4955 0.0012  0.0008  0.0063  400 PHE A CG  
2615 C CD1 . PHE A 407 ? 0.6376 0.6489 0.6439 0.0027  0.0018  0.0081  400 PHE A CD1 
2616 C CD2 . PHE A 407 ? 0.5377 0.5489 0.5430 0.0014  0.0009  0.0065  400 PHE A CD2 
2617 C CE1 . PHE A 407 ? 0.6709 0.6827 0.6780 0.0047  0.0035  0.0100  400 PHE A CE1 
2618 C CE2 . PHE A 407 ? 0.5825 0.5926 0.5861 0.0026  0.0017  0.0083  400 PHE A CE2 
2619 C CZ  . PHE A 407 ? 0.6145 0.6260 0.6212 0.0045  0.0030  0.0087  400 PHE A CZ  
2620 N N   . ILE A 408 ? 0.3113 0.3256 0.3168 0.0000  0.0000  0.0071  401 ILE A N   
2621 C CA  . ILE A 408 ? 0.3486 0.3637 0.3518 0.0005  0.0003  0.0092  401 ILE A CA  
2622 C C   . ILE A 408 ? 0.3319 0.3516 0.3387 0.0000  0.0000  0.0091  401 ILE A C   
2623 O O   . ILE A 408 ? 0.2467 0.2695 0.2546 0.0007  0.0004  0.0107  401 ILE A O   
2624 C CB  . ILE A 408 ? 0.2685 0.2839 0.2712 0.0003  0.0001  0.0088  401 ILE A CB  
2625 C CG1 . ILE A 408 ? 0.2793 0.2947 0.2823 0.0012  0.0006  0.0092  401 ILE A CG1 
2626 C CG2 . ILE A 408 ? 0.1772 0.1957 0.1798 0.0002  0.0001  0.0098  401 ILE A CG2 
2627 C CD1 . ILE A 408 ? 0.2695 0.2830 0.2721 0.0006  0.0003  0.0079  401 ILE A CD1 
2628 N N   . GLY A 409 ? 0.2717 0.2878 0.2741 -0.0011 -0.0005 0.0088  402 GLY A N   
2629 C CA  . GLY A 409 ? 0.3019 0.3200 0.3040 -0.0017 -0.0008 0.0093  402 GLY A CA  
2630 C C   . GLY A 409 ? 0.3919 0.4140 0.3988 -0.0017 -0.0008 0.0097  402 GLY A C   
2631 O O   . GLY A 409 ? 0.3338 0.3562 0.3367 -0.0019 -0.0009 0.0119  402 GLY A O   
2632 N N   . GLY A 410 ? 0.2753 0.2928 0.2786 -0.0011 -0.0006 0.0104  403 GLY A N   
2633 C CA  . GLY A 410 ? 0.3422 0.3657 0.3505 -0.0011 -0.0007 0.0124  403 GLY A CA  
2634 C C   . GLY A 410 ? 0.3376 0.3664 0.3480 0.0006  0.0004  0.0166  403 GLY A C   
2635 O O   . GLY A 410 ? 0.4484 0.4812 0.4589 0.0006  0.0002  0.0201  403 GLY A O   
2636 N N   . LEU A 411 ? 0.3328 0.3598 0.3432 0.0022  0.0014  0.0161  404 LEU A N   
2637 C CA  . LEU A 411 ? 0.2420 0.2733 0.2540 0.0048  0.0030  0.0200  404 LEU A CA  
2638 C C   . LEU A 411 ? 0.2718 0.3082 0.2841 0.0044  0.0027  0.0213  404 LEU A C   
2639 O O   . LEU A 411 ? 0.3797 0.4179 0.3907 0.0063  0.0026  0.0250  404 LEU A O   
2640 C CB  . LEU A 411 ? 0.2407 0.2686 0.2518 0.0059  0.0039  0.0182  404 LEU A CB  
2641 C CG  . LEU A 411 ? 0.2862 0.3103 0.2972 0.0070  0.0049  0.0180  404 LEU A CG  
2642 C CD1 . LEU A 411 ? 0.2670 0.2889 0.2770 0.0079  0.0058  0.0168  404 LEU A CD1 
2643 C CD2 . LEU A 411 ? 0.1796 0.1982 0.1866 0.0083  0.0050  0.0209  404 LEU A CD2 
2644 N N   . ALA A 412 ? 0.1763 0.2097 0.1869 0.0023  0.0017  0.0172  405 ALA A N   
2645 C CA  . ALA A 412 ? 0.2988 0.3365 0.3092 0.0017  0.0015  0.0179  405 ALA A CA  
2646 C C   . ALA A 412 ? 0.3275 0.3711 0.3388 0.0009  0.0009  0.0208  405 ALA A C   
2647 O O   . ALA A 412 ? 0.3257 0.3772 0.3380 0.0017  0.0010  0.0246  405 ALA A O   
2648 C CB  . ALA A 412 ? 0.2187 0.2480 0.2221 0.0004  0.0002  0.0148  405 ALA A CB  
2649 N N   . ALA A 413 ? 0.2392 0.2800 0.2500 -0.0007 0.0000  0.0194  406 ALA A N   
2650 C CA  . ALA A 413 ? 0.2349 0.2810 0.2460 -0.0024 -0.0010 0.0219  406 ALA A CA  
2651 C C   . ALA A 413 ? 0.3355 0.3818 0.3442 -0.0005 -0.0015 0.0267  406 ALA A C   
2652 O O   . ALA A 413 ? 0.3534 0.4025 0.3598 -0.0010 -0.0026 0.0292  406 ALA A O   
2653 C CB  . ALA A 413 ? 0.1669 0.2081 0.1765 -0.0043 -0.0019 0.0191  406 ALA A CB  
2654 N N   . GLN A 414 ? 0.3639 0.4028 0.3702 0.0019  -0.0011 0.0273  407 GLN A N   
2655 C CA  . GLN A 414 ? 0.3293 0.3622 0.3300 0.0044  -0.0021 0.0312  407 GLN A CA  
2656 C C   . GLN A 414 ? 0.4010 0.4384 0.4025 0.0070  -0.0026 0.0337  407 GLN A C   
2657 O O   . GLN A 414 ? 0.4331 0.4685 0.4309 0.0088  -0.0045 0.0375  407 GLN A O   
2658 C CB  . GLN A 414 ? 0.2126 0.2360 0.2105 0.0062  -0.0014 0.0311  407 GLN A CB  
2659 C CG  . GLN A 414 ? 0.3856 0.4057 0.3836 0.0041  -0.0005 0.0277  407 GLN A CG  
2660 C CD  . GLN A 414 ? 0.6473 0.6583 0.6419 0.0055  0.0004  0.0279  407 GLN A CD  
2661 O OE1 . GLN A 414 ? 0.7460 0.7515 0.7371 0.0077  -0.0001 0.0311  407 GLN A OE1 
2662 N NE2 . GLN A 414 ? 0.6722 0.6816 0.6680 0.0044  0.0015  0.0246  407 GLN A NE2 
2663 N N   . GLU A 415 ? 0.3326 0.3756 0.3384 0.0073  -0.0011 0.0318  408 GLU A N   
2664 C CA  . GLU A 415 ? 0.3961 0.4444 0.4023 0.0095  -0.0017 0.0337  408 GLU A CA  
2665 C C   . GLU A 415 ? 0.3743 0.4298 0.3802 0.0076  -0.0029 0.0350  408 GLU A C   
2666 O O   . GLU A 415 ? 0.2612 0.3182 0.2648 0.0097  -0.0051 0.0384  408 GLU A O   
2667 C CB  . GLU A 415 ? 0.2722 0.3243 0.2815 0.0097  0.0004  0.0313  408 GLU A CB  
2668 C CG  . GLU A 415 ? 0.4577 0.5034 0.4667 0.0116  0.0014  0.0305  408 GLU A CG  
2669 C CD  . GLU A 415 ? 0.5238 0.5631 0.5301 0.0157  -0.0007 0.0336  408 GLU A CD  
2670 O OE1 . GLU A 415 ? 0.5177 0.5600 0.5237 0.0185  -0.0026 0.0360  408 GLU A OE1 
2671 O OE2 . GLU A 415 ? 0.4081 0.4394 0.4126 0.0161  -0.0005 0.0336  408 GLU A OE2 
2672 N N   . VAL A 416 ? 0.2199 0.2800 0.2285 0.0037  -0.0018 0.0323  409 VAL A N   
2673 C CA  . VAL A 416 ? 0.2765 0.3437 0.2850 0.0013  -0.0026 0.0331  409 VAL A CA  
2674 C C   . VAL A 416 ? 0.3036 0.3674 0.3073 0.0017  -0.0051 0.0366  409 VAL A C   
2675 O O   . VAL A 416 ? 0.3701 0.4388 0.3719 0.0020  -0.0067 0.0393  409 VAL A O   
2676 C CB  . VAL A 416 ? 0.2725 0.3434 0.2844 -0.0030 -0.0014 0.0297  409 VAL A CB  
2677 C CG1 . VAL A 416 ? 0.2661 0.3443 0.2772 -0.0056 -0.0023 0.0306  409 VAL A CG1 
2678 C CG2 . VAL A 416 ? 0.1615 0.2261 0.1721 -0.0027 -0.0005 0.0248  409 VAL A CG2 
2679 N N   . MET A 417 ? 0.3922 0.4475 0.3933 0.0015  -0.0054 0.0365  410 MET A N   
2680 C CA  . MET A 417 ? 0.3187 0.3691 0.3137 0.0013  -0.0073 0.0399  410 MET A CA  
2681 C C   . MET A 417 ? 0.3623 0.4098 0.3535 0.0054  -0.0094 0.0446  410 MET A C   
2682 O O   . MET A 417 ? 0.4612 0.5103 0.4486 0.0052  -0.0114 0.0483  410 MET A O   
2683 C CB  . MET A 417 ? 0.3277 0.3685 0.3197 0.0005  -0.0068 0.0389  410 MET A CB  
2684 C CG  . MET A 417 ? 0.4278 0.4714 0.4230 -0.0034 -0.0058 0.0346  410 MET A CG  
2685 S SD  . MET A 417 ? 0.4310 0.4819 0.4251 -0.0080 -0.0069 0.0348  410 MET A SD  
2686 C CE  . MET A 417 ? 1.2889 1.3444 1.2898 -0.0112 -0.0059 0.0290  410 MET A CE  
2687 N N   . LYS A 418 ? 0.3172 0.3609 0.3099 0.0090  -0.0090 0.0446  411 LYS A N   
2688 C CA  . LYS A 418 ? 0.3961 0.4368 0.3866 0.0136  -0.0114 0.0487  411 LYS A CA  
2689 C C   . LYS A 418 ? 0.4692 0.5207 0.4615 0.0144  -0.0129 0.0502  411 LYS A C   
2690 O O   . LYS A 418 ? 0.5736 0.6250 0.5625 0.0165  -0.0159 0.0546  411 LYS A O   
2691 C CB  . LYS A 418 ? 0.3975 0.4340 0.3907 0.0170  -0.0104 0.0473  411 LYS A CB  
2692 C CG  . LYS A 418 ? 0.3550 0.3800 0.3457 0.0172  -0.0094 0.0467  411 LYS A CG  
2693 C CD  . LYS A 418 ? 0.4506 0.4747 0.4454 0.0196  -0.0079 0.0443  411 LYS A CD  
2694 C CE  . LYS A 418 ? 0.3916 0.4051 0.3846 0.0202  -0.0069 0.0437  411 LYS A CE  
2695 N NZ  . LYS A 418 ? 0.3699 0.3847 0.3673 0.0219  -0.0051 0.0410  411 LYS A NZ  
2696 N N   . ALA A 419 ? 0.3990 0.4596 0.3961 0.0125  -0.0108 0.0467  412 ALA A N   
2697 C CA  . ALA A 419 ? 0.4209 0.4926 0.4196 0.0124  -0.0117 0.0474  412 ALA A CA  
2698 C C   . ALA A 419 ? 0.3822 0.4593 0.3782 0.0093  -0.0131 0.0494  412 ALA A C   
2699 O O   . ALA A 419 ? 0.4406 0.5254 0.4361 0.0102  -0.0151 0.0517  412 ALA A O   
2700 C CB  . ALA A 419 ? 0.1833 0.2620 0.1865 0.0102  -0.0086 0.0429  412 ALA A CB  
2701 N N   . CYS A 420 ? 0.2095 0.2832 0.2039 0.0057  -0.0123 0.0484  413 CYS A N   
2702 C CA  . CYS A 420 ? 0.3017 0.3809 0.2938 0.0019  -0.0133 0.0496  413 CYS A CA  
2703 C C   . CYS A 420 ? 0.3640 0.4390 0.3493 0.0033  -0.0165 0.0552  413 CYS A C   
2704 O O   . CYS A 420 ? 0.4799 0.5624 0.4631 0.0012  -0.0180 0.0574  413 CYS A O   
2705 C CB  . CYS A 420 ? 0.1407 0.2186 0.1341 -0.0027 -0.0113 0.0459  413 CYS A CB  
2706 S SG  . CYS A 420 ? 0.4200 0.5083 0.4204 -0.0065 -0.0084 0.0404  413 CYS A SG  
2707 N N   . SER A 421 ? 0.3642 0.4271 0.3457 0.0065  -0.0175 0.0577  414 SER A N   
2708 C CA  . SER A 421 ? 0.3815 0.4380 0.3558 0.0088  -0.0207 0.0637  414 SER A CA  
2709 C C   . SER A 421 ? 0.4008 0.4434 0.3726 0.0130  -0.0211 0.0653  414 SER A C   
2710 O O   . SER A 421 ? 0.2858 0.3246 0.2612 0.0135  -0.0188 0.0615  414 SER A O   
2711 C CB  . SER A 421 ? 0.4054 0.4614 0.3741 0.0041  -0.0209 0.0653  414 SER A CB  
2712 O OG  . SER A 421 ? 0.4069 0.4527 0.3728 0.0025  -0.0190 0.0637  414 SER A OG  
2713 N N   . GLY A 422 ? 0.5171 0.5521 0.4825 0.0159  -0.0242 0.0710  415 GLY A N   
2714 C CA  . GLY A 422 ? 0.6329 0.6529 0.5946 0.0194  -0.0248 0.0731  415 GLY A CA  
2715 C C   . GLY A 422 ? 0.6179 0.6359 0.5831 0.0256  -0.0272 0.0748  415 GLY A C   
2716 O O   . GLY A 422 ? 0.6812 0.6885 0.6421 0.0295  -0.0300 0.0793  415 GLY A O   
2717 N N   . LYS A 423 ? 0.7748 0.8029 0.7477 0.0267  -0.0263 0.0712  416 LYS A N   
2718 C CA  . LYS A 423 ? 1.1494 1.1765 1.1269 0.0325  -0.0282 0.0718  416 LYS A CA  
2719 C C   . LYS A 423 ? 0.7425 0.7551 0.7189 0.0347  -0.0276 0.0716  416 LYS A C   
2720 O O   . LYS A 423 ? 0.4636 0.4665 0.4372 0.0389  -0.0307 0.0759  416 LYS A O   
2721 C CB  . LYS A 423 ? 1.2962 1.3258 1.2721 0.0369  -0.0332 0.0774  416 LYS A CB  
2722 C CG  . LYS A 423 ? 1.7400 1.7861 1.7198 0.0363  -0.0341 0.0768  416 LYS A CG  
2723 C CD  . LYS A 423 ? 1.7286 1.7828 1.7058 0.0297  -0.0320 0.0755  416 LYS A CD  
2724 C CE  . LYS A 423 ? 1.6510 1.7135 1.6342 0.0259  -0.0275 0.0688  416 LYS A CE  
2725 N NZ  . LYS A 423 ? 1.5484 1.6134 1.5301 0.0195  -0.0246 0.0663  416 LYS A NZ  
2726 N N   . PHE A 424 ? 0.7957 0.8069 0.7743 0.0316  -0.0236 0.0667  417 PHE A N   
2727 C CA  . PHE A 424 ? 0.6938 0.6944 0.6733 0.0334  -0.0224 0.0654  417 PHE A CA  
2728 C C   . PHE A 424 ? 0.6111 0.6188 0.5987 0.0350  -0.0205 0.0609  417 PHE A C   
2729 O O   . PHE A 424 ? 0.6836 0.7030 0.6747 0.0338  -0.0197 0.0587  417 PHE A O   
2730 C CB  . PHE A 424 ? 0.7888 0.7818 0.7636 0.0287  -0.0194 0.0635  417 PHE A CB  
2731 C CG  . PHE A 424 ? 0.9120 0.8938 0.8777 0.0279  -0.0212 0.0682  417 PHE A CG  
2732 C CD1 . PHE A 424 ? 0.8552 0.8231 0.8178 0.0307  -0.0226 0.0711  417 PHE A CD1 
2733 C CD2 . PHE A 424 ? 0.8123 0.7973 0.7725 0.0244  -0.0214 0.0700  417 PHE A CD2 
2734 C CE1 . PHE A 424 ? 0.7466 0.7031 0.6997 0.0297  -0.0240 0.0758  417 PHE A CE1 
2735 C CE2 . PHE A 424 ? 0.7845 0.7592 0.7354 0.0235  -0.0225 0.0746  417 PHE A CE2 
2736 C CZ  . PHE A 424 ? 0.7790 0.7387 0.7255 0.0262  -0.0237 0.0776  417 PHE A CZ  
2745 N N   . PRO A 426 ? 0.4413 0.4665 0.4447 0.0354  -0.0141 0.0490  419 PRO A N   
2746 C CA  . PRO A 426 ? 0.3857 0.4173 0.3907 0.0311  -0.0104 0.0445  419 PRO A CA  
2747 C C   . PRO A 426 ? 0.4419 0.4743 0.4509 0.0328  -0.0087 0.0413  419 PRO A C   
2748 O O   . PRO A 426 ? 0.4642 0.4940 0.4763 0.0376  -0.0106 0.0420  419 PRO A O   
2749 C CB  . PRO A 426 ? 0.4122 0.4550 0.4180 0.0299  -0.0110 0.0447  419 PRO A CB  
2750 C CG  . PRO A 426 ? 0.4328 0.4774 0.4399 0.0350  -0.0150 0.0480  419 PRO A CG  
2751 C CD  . PRO A 426 ? 0.4295 0.4624 0.4344 0.0383  -0.0173 0.0515  419 PRO A CD  
2752 N N   . ILE A 427 ? 0.2867 0.3224 0.2961 0.0288  -0.0054 0.0377  420 ILE A N   
2753 C CA  . ILE A 427 ? 0.3030 0.3406 0.3153 0.0295  -0.0039 0.0346  420 ILE A CA  
2754 C C   . ILE A 427 ? 0.4438 0.4886 0.4599 0.0333  -0.0062 0.0348  420 ILE A C   
2755 O O   . ILE A 427 ? 0.3687 0.4213 0.3845 0.0322  -0.0068 0.0351  420 ILE A O   
2756 C CB  . ILE A 427 ? 0.2708 0.3118 0.2819 0.0243  -0.0005 0.0315  420 ILE A CB  
2757 C CG1 . ILE A 427 ? 0.2373 0.2712 0.2468 0.0218  0.0015  0.0306  420 ILE A CG1 
2758 C CG2 . ILE A 427 ? 0.1050 0.1500 0.1179 0.0247  0.0003  0.0290  420 ILE A CG2 
2759 C CD1 . ILE A 427 ? 0.1586 0.1954 0.1680 0.0170  0.0042  0.0279  420 ILE A CD1 
2760 N N   . MET A 428 ? 0.5205 0.5630 0.5409 0.0378  -0.0075 0.0342  421 MET A N   
2761 C CA  . MET A 428 ? 0.5705 0.6208 0.5965 0.0418  -0.0097 0.0334  421 MET A CA  
2762 C C   . MET A 428 ? 0.5755 0.6341 0.6022 0.0387  -0.0076 0.0298  421 MET A C   
2763 O O   . MET A 428 ? 0.3926 0.4534 0.4238 0.0400  -0.0070 0.0266  421 MET A O   
2764 C CB  . MET A 428 ? 0.7672 0.8135 0.7996 0.0476  -0.0114 0.0328  421 MET A CB  
2765 C CG  . MET A 428 ? 1.0295 1.0734 1.0636 0.0528  -0.0156 0.0370  421 MET A CG  
2766 S SD  . MET A 428 ? 1.6062 1.6615 1.6397 0.0531  -0.0185 0.0396  421 MET A SD  
2767 C CE  . MET A 428 ? 0.4572 0.5240 0.5002 0.0566  -0.0192 0.0357  421 MET A CE  
2768 N N   . GLN A 429 ? 0.6558 0.7187 0.6781 0.0345  -0.0066 0.0302  422 GLN A N   
2769 C CA  . GLN A 429 ? 0.4084 0.4785 0.4295 0.0308  -0.0049 0.0275  422 GLN A CA  
2770 C C   . GLN A 429 ? 0.3291 0.3953 0.3472 0.0267  -0.0019 0.0250  422 GLN A C   
2771 O O   . GLN A 429 ? 0.4998 0.5667 0.5137 0.0222  -0.0001 0.0246  422 GLN A O   
2772 C CB  . GLN A 429 ? 0.2214 0.3010 0.2472 0.0337  -0.0068 0.0261  422 GLN A CB  
2773 C CG  . GLN A 429 ? 0.2158 0.2983 0.2445 0.0384  -0.0103 0.0294  422 GLN A CG  
2774 C CD  . GLN A 429 ? 0.3682 0.4624 0.3980 0.0385  -0.0118 0.0292  422 GLN A CD  
2775 O OE1 . GLN A 429 ? 0.3422 0.4420 0.3775 0.0432  -0.0146 0.0297  422 GLN A OE1 
2776 N NE2 . GLN A 429 ? 0.4033 0.5013 0.4283 0.0335  -0.0098 0.0284  422 GLN A NE2 
2777 N N   . TRP A 430 ? 0.2382 0.2999 0.2586 0.0280  -0.0014 0.0234  423 TRP A N   
2778 C CA  . TRP A 430 ? 0.2427 0.3015 0.2596 0.0237  0.0010  0.0214  423 TRP A CA  
2779 C C   . TRP A 430 ? 0.2662 0.3163 0.2822 0.0234  0.0023  0.0215  423 TRP A C   
2780 O O   . TRP A 430 ? 0.3420 0.3889 0.3621 0.0271  0.0017  0.0212  423 TRP A O   
2781 C CB  . TRP A 430 ? 0.2489 0.3132 0.2683 0.0234  0.0009  0.0180  423 TRP A CB  
2782 C CG  . TRP A 430 ? 0.2742 0.3472 0.2933 0.0226  0.0000  0.0173  423 TRP A CG  
2783 C CD1 . TRP A 430 ? 0.1088 0.1895 0.1332 0.0261  -0.0017 0.0170  423 TRP A CD1 
2784 C CD2 . TRP A 430 ? 0.3144 0.3895 0.3280 0.0179  0.0008  0.0167  423 TRP A CD2 
2785 N NE1 . TRP A 430 ? 0.1608 0.2487 0.1828 0.0236  -0.0019 0.0160  423 TRP A NE1 
2786 C CE2 . TRP A 430 ? 0.1717 0.2559 0.1871 0.0186  -0.0003 0.0157  423 TRP A CE2 
2787 C CE3 . TRP A 430 ? 0.3058 0.3756 0.3131 0.0135  0.0020  0.0168  423 TRP A CE3 
2788 C CZ2 . TRP A 430 ? 0.1502 0.2382 0.1613 0.0148  0.0001  0.0147  423 TRP A CZ2 
2789 C CZ3 . TRP A 430 ? 0.0530 0.1258 0.0562 0.0102  0.0020  0.0160  423 TRP A CZ3 
2790 C CH2 . TRP A 430 ? 0.1658 0.2475 0.1709 0.0106  0.0012  0.0148  423 TRP A CH2 
2791 N N   . LEU A 431 ? 0.3567 0.4033 0.3676 0.0190  0.0043  0.0218  424 LEU A N   
2792 C CA  . LEU A 431 ? 0.3405 0.3802 0.3502 0.0178  0.0058  0.0214  424 LEU A CA  
2793 C C   . LEU A 431 ? 0.3691 0.4079 0.3743 0.0137  0.0065  0.0203  424 LEU A C   
2794 O O   . LEU A 431 ? 0.1967 0.2320 0.2008 0.0098  0.0049  0.0175  424 LEU A O   
2795 C CB  . LEU A 431 ? 0.3918 0.4273 0.4006 0.0169  0.0069  0.0231  424 LEU A CB  
2796 C CG  . LEU A 431 ? 0.4094 0.4395 0.4171 0.0147  0.0090  0.0222  424 LEU A CG  
2797 C CD1 . LEU A 431 ? 0.3449 0.3694 0.3540 0.0178  0.0088  0.0218  424 LEU A CD1 
2798 C CD2 . LEU A 431 ? 0.3251 0.3530 0.3340 0.0130  0.0087  0.0215  424 LEU A CD2 
2799 N N   . TYR A 432 ? 0.4024 0.4396 0.4091 0.0142  0.0060  0.0182  425 TYR A N   
2800 C CA  . TYR A 432 ? 0.3454 0.3802 0.3492 0.0108  0.0047  0.0165  425 TYR A CA  
2801 C C   . TYR A 432 ? 0.5377 0.5652 0.5416 0.0098  0.0048  0.0155  425 TYR A C   
2802 O O   . TYR A 432 ? 0.7376 0.7640 0.7433 0.0124  0.0070  0.0168  425 TYR A O   
2803 C CB  . TYR A 432 ? 0.2321 0.2733 0.2394 0.0109  0.0045  0.0135  425 TYR A CB  
2804 C CG  . TYR A 432 ? 0.2491 0.2967 0.2557 0.0104  0.0035  0.0133  425 TYR A CG  
2805 C CD1 . TYR A 432 ? 0.1892 0.2426 0.2006 0.0135  0.0038  0.0128  425 TYR A CD1 
2806 C CD2 . TYR A 432 ? 0.2357 0.2827 0.2380 0.0070  0.0019  0.0130  425 TYR A CD2 
2807 C CE1 . TYR A 432 ? 0.2026 0.2626 0.2134 0.0128  0.0029  0.0124  425 TYR A CE1 
2808 C CE2 . TYR A 432 ? 0.2512 0.3036 0.2530 0.0062  0.0014  0.0123  425 TYR A CE2 
2809 C CZ  . TYR A 432 ? 0.2214 0.2814 0.2266 0.0090  0.0021  0.0123  425 TYR A CZ  
2810 O OH  . TYR A 432 ? 0.2913 0.3579 0.2958 0.0080  0.0015  0.0115  425 TYR A OH  
2811 N N   . PHE A 433 ? 0.5729 0.5956 0.5760 0.0066  0.0026  0.0124  426 PHE A N   
2812 C CA  . PHE A 433 ? 0.5491 0.5670 0.5528 0.0059  0.0024  0.0111  426 PHE A CA  
2813 C C   . PHE A 433 ? 0.4721 0.4914 0.4757 0.0042  0.0014  0.0098  426 PHE A C   
2814 O O   . PHE A 433 ? 0.5020 0.5212 0.5048 0.0024  0.0001  0.0083  426 PHE A O   
2815 C CB  . PHE A 433 ? 0.6252 0.6397 0.6279 0.0045  0.0027  0.0105  426 PHE A CB  
2816 C CG  . PHE A 433 ? 0.8131 0.8270 0.8189 0.0040  0.0025  0.0083  426 PHE A CG  
2817 C CD1 . PHE A 433 ? 0.9130 0.9223 0.9162 0.0046  0.0033  0.0093  426 PHE A CD1 
2818 C CD2 . PHE A 433 ? 0.9212 0.9328 0.9238 0.0020  0.0012  0.0077  426 PHE A CD2 
2819 C CE1 . PHE A 433 ? 0.9543 0.9633 0.9593 0.0047  0.0030  0.0079  426 PHE A CE1 
2820 C CE2 . PHE A 433 ? 0.9178 0.9275 0.9202 0.0013  0.0008  0.0065  426 PHE A CE2 
2821 C CZ  . PHE A 433 ? 0.9333 0.9428 0.9380 0.0024  0.0016  0.0060  426 PHE A CZ  
2822 N N   . ASP A 434 ? 0.4922 0.5129 0.4964 0.0047  0.0024  0.0106  427 ASP A N   
2823 C CA  . ASP A 434 ? 0.5722 0.5926 0.5754 0.0017  0.0016  0.0082  427 ASP A CA  
2824 C C   . ASP A 434 ? 0.7096 0.7260 0.7129 0.0016  0.0015  0.0077  427 ASP A C   
2825 O O   . ASP A 434 ? 0.8220 0.8345 0.8252 0.0027  0.0039  0.0079  427 ASP A O   
2826 C CB  . ASP A 434 ? 0.7050 0.7258 0.7080 -0.0003 0.0050  0.0055  427 ASP A CB  
2827 C CG  . ASP A 434 ? 0.8574 0.8790 0.8585 -0.0033 0.0036  0.0039  427 ASP A CG  
2828 O OD1 . ASP A 434 ? 0.8188 0.8392 0.8190 -0.0040 0.0008  0.0042  427 ASP A OD1 
2829 O OD2 . ASP A 434 ? 0.9253 0.9497 0.9262 -0.0051 0.0049  0.0021  427 ASP A OD2 
2830 N N   . ALA A 435 ? 0.7827 0.7974 0.7852 -0.0002 -0.0003 0.0059  428 ALA A N   
2831 C CA  . ALA A 435 ? 0.7376 0.7497 0.7398 -0.0006 -0.0005 0.0050  428 ALA A CA  
2832 C C   . ALA A 435 ? 0.8330 0.8447 0.8331 -0.0027 0.0005  0.0040  428 ALA A C   
2833 O O   . ALA A 435 ? 0.9136 0.9209 0.9124 -0.0028 0.0029  0.0033  428 ALA A O   
2834 C CB  . ALA A 435 ? 0.6876 0.6964 0.6880 -0.0014 -0.0006 0.0040  428 ALA A CB  
2835 N N   . LEU A 436 ? 0.9710 0.9857 0.9701 -0.0048 -0.0007 0.0031  429 LEU A N   
2836 C CA  . LEU A 436 ? 1.1581 1.1723 1.1551 -0.0073 0.0001  0.0012  429 LEU A CA  
2837 C C   . LEU A 436 ? 1.2311 1.2463 1.2276 -0.0083 0.0029  0.0002  429 LEU A C   
2838 O O   . LEU A 436 ? 1.1646 1.1825 1.1594 -0.0111 0.0021  -0.0015 429 LEU A O   
2839 C CB  . LEU A 436 ? 1.1701 1.1826 1.1671 -0.0070 -0.0012 0.0012  429 LEU A CB  
2840 C CG  . LEU A 436 ? 1.0667 1.0772 1.0649 -0.0068 -0.0007 0.0014  429 LEU A CG  
2841 C CD1 . LEU A 436 ? 0.8099 0.8214 0.8081 -0.0076 -0.0011 0.0021  429 LEU A CD1 
2842 C CD2 . LEU A 436 ? 1.1607 1.1700 1.1564 -0.0078 -0.0007 -0.0002 429 LEU A CD2 
2843 N N   . GLU A 437 ? 1.3695 1.3832 1.3678 -0.0059 0.0062  0.0011  430 GLU A N   
2844 C CA  . GLU A 437 ? 1.3807 1.3971 1.3803 -0.0062 0.0091  -0.0001 430 GLU A CA  
2845 C C   . GLU A 437 ? 1.4046 1.4219 1.4028 -0.0092 0.0102  -0.0032 430 GLU A C   
2846 O O   . GLU A 437 ? 1.3216 1.3429 1.3184 -0.0123 0.0089  -0.0051 430 GLU A O   
2847 C CB  . GLU A 437 ? 1.1959 1.2108 1.1987 -0.0025 0.0130  0.0015  430 GLU A CB  
2848 C CG  . GLU A 437 ? 1.1333 1.1483 1.1359 -0.0016 0.0140  0.0013  430 GLU A CG  
2849 C CD  . GLU A 437 ? 1.2062 1.2170 1.2070 -0.0022 0.0120  0.0020  430 GLU A CD  
2850 O OE1 . GLU A 437 ? 1.1582 1.1635 1.1596 -0.0004 0.0139  0.0023  430 GLU A OE1 
2851 O OE2 . GLU A 437 ? 1.2330 1.2423 1.2326 -0.0024 0.0096  0.0032  430 GLU A OE2 
2852 N N   . GLU B 59  ? 1.2072 1.2450 1.1958 -0.0420 -0.0201 0.0288  52  GLU B N   
2853 C CA  . GLU B 59  ? 1.2339 1.2731 1.2201 -0.0422 -0.0182 0.0256  52  GLU B CA  
2854 C C   . GLU B 59  ? 1.1580 1.1931 1.1452 -0.0379 -0.0163 0.0222  52  GLU B C   
2855 O O   . GLU B 59  ? 0.9812 1.0166 0.9662 -0.0395 -0.0164 0.0219  52  GLU B O   
2856 C CB  . GLU B 59  ? 1.2225 1.2654 1.2047 -0.0484 -0.0202 0.0285  52  GLU B CB  
2857 C CG  . GLU B 59  ? 1.2267 1.2670 1.2078 -0.0508 -0.0230 0.0318  52  GLU B CG  
2858 C CD  . GLU B 59  ? 1.2454 1.2880 1.2221 -0.0551 -0.0233 0.0319  52  GLU B CD  
2859 O OE1 . GLU B 59  ? 1.3306 1.3704 1.3059 -0.0562 -0.0245 0.0330  52  GLU B OE1 
2860 O OE2 . GLU B 59  ? 1.1970 1.2444 1.1713 -0.0577 -0.0222 0.0307  52  GLU B OE2 
2861 N N   . GLY B 60  ? 1.1042 1.1359 1.0944 -0.0330 -0.0147 0.0198  53  GLY B N   
2862 C CA  . GLY B 60  ? 0.8303 0.8588 0.8215 -0.0290 -0.0129 0.0166  53  GLY B CA  
2863 C C   . GLY B 60  ? 0.7187 0.7489 0.7081 -0.0291 -0.0114 0.0141  53  GLY B C   
2864 O O   . GLY B 60  ? 0.6149 0.6461 0.6043 -0.0285 -0.0103 0.0126  53  GLY B O   
2865 N N   . LEU B 61  ? 0.6910 0.7218 0.6788 -0.0303 -0.0113 0.0139  54  LEU B N   
2866 C CA  . LEU B 61  ? 0.7685 0.8010 0.7549 -0.0303 -0.0097 0.0115  54  LEU B CA  
2867 C C   . LEU B 61  ? 0.5539 0.5832 0.5426 -0.0256 -0.0081 0.0089  54  LEU B C   
2868 O O   . LEU B 61  ? 0.6290 0.6528 0.6143 -0.0217 -0.0064 0.0108  54  LEU B O   
2869 C CB  . LEU B 61  ? 0.9736 1.0074 0.9581 -0.0323 -0.0099 0.0118  54  LEU B CB  
2870 C CG  . LEU B 61  ? 1.3069 1.3429 1.2883 -0.0375 -0.0117 0.0145  54  LEU B CG  
2871 C CD1 . LEU B 61  ? 0.4214 0.4620 0.4000 -0.0425 -0.0127 0.0160  54  LEU B CD1 
2872 C CD2 . LEU B 61  ? 1.2334 1.2661 1.2159 -0.0370 -0.0135 0.0171  54  LEU B CD2 
2873 N N   . TYR B 62  ? 0.4437 0.4746 0.4314 -0.0259 -0.0068 0.0069  55  TYR B N   
2874 C CA  . TYR B 62  ? 0.3441 0.3707 0.3282 -0.0218 -0.0037 0.0065  55  TYR B CA  
2875 C C   . TYR B 62  ? 0.4160 0.4396 0.4026 -0.0187 -0.0035 0.0063  55  TYR B C   
2876 O O   . TYR B 62  ? 0.3559 0.3794 0.3505 -0.0183 -0.0029 0.0054  55  TYR B O   
2877 C CB  . TYR B 62  ? 0.4973 0.5288 0.4847 -0.0245 -0.0042 0.0030  55  TYR B CB  
2878 C CG  . TYR B 62  ? 0.5736 0.6033 0.5620 -0.0224 -0.0029 0.0011  55  TYR B CG  
2879 C CD1 . TYR B 62  ? 0.6712 0.6981 0.6606 -0.0206 -0.0029 0.0010  55  TYR B CD1 
2880 C CD2 . TYR B 62  ? 0.6503 0.6818 0.6384 -0.0229 -0.0017 -0.0006 55  TYR B CD2 
2881 C CE1 . TYR B 62  ? 0.9778 1.0031 0.9675 -0.0195 -0.0018 -0.0006 55  TYR B CE1 
2882 C CE2 . TYR B 62  ? 0.9600 0.9902 0.9488 -0.0217 -0.0004 -0.0022 55  TYR B CE2 
2883 C CZ  . TYR B 62  ? 1.2351 1.2621 1.2246 -0.0201 -0.0005 -0.0022 55  TYR B CZ  
2884 O OH  . TYR B 62  ? 1.5190 1.5447 1.5089 -0.0196 0.0008  -0.0038 55  TYR B OH  
2885 N N   . SER B 63  ? 0.5705 0.5942 0.5572 -0.0187 -0.0036 0.0065  56  SER B N   
2886 C CA  . SER B 63  ? 0.3769 0.3984 0.3658 -0.0161 -0.0033 0.0062  56  SER B CA  
2887 C C   . SER B 63  ? 0.3663 0.3874 0.3624 -0.0165 -0.0038 0.0070  56  SER B C   
2888 O O   . SER B 63  ? 0.3777 0.3948 0.3697 -0.0129 -0.0039 0.0072  56  SER B O   
2889 C CB  . SER B 63  ? 0.3361 0.3593 0.3248 -0.0164 -0.0029 0.0056  56  SER B CB  
2890 O OG  . SER B 63  ? 0.2447 0.2718 0.2360 -0.0179 -0.0035 0.0029  56  SER B OG  
2891 N N   . ARG B 64  ? 0.4410 0.4626 0.4365 -0.0185 -0.0048 0.0084  57  ARG B N   
2892 C CA  . ARG B 64  ? 0.3201 0.3378 0.3104 -0.0162 -0.0062 0.0104  57  ARG B CA  
2893 C C   . ARG B 64  ? 0.4067 0.4253 0.4038 -0.0165 -0.0053 0.0091  57  ARG B C   
2894 O O   . ARG B 64  ? 0.1833 0.1982 0.1763 -0.0134 -0.0059 0.0101  57  ARG B O   
2895 C CB  . ARG B 64  ? 0.2547 0.2754 0.2502 -0.0208 -0.0070 0.0113  57  ARG B CB  
2896 C CG  . ARG B 64  ? 0.5214 0.5399 0.5093 -0.0200 -0.0085 0.0133  57  ARG B CG  
2897 C CD  . ARG B 64  ? 0.6786 0.6976 0.6722 -0.0212 -0.0113 0.0132  57  ARG B CD  
2898 N NE  . ARG B 64  ? 0.7301 0.7461 0.7272 -0.0196 -0.0086 0.0128  57  ARG B NE  
2899 C CZ  . ARG B 64  ? 0.9298 0.9422 0.9216 -0.0173 -0.0105 0.0149  57  ARG B CZ  
2900 N NH1 . ARG B 64  ? 1.0542 1.0693 1.0489 -0.0220 -0.0140 0.0164  57  ARG B NH1 
2901 N NH2 . ARG B 64  ? 0.9778 0.9887 0.9712 -0.0153 -0.0097 0.0138  57  ARG B NH2 
2902 N N   . GLN B 65  ? 0.4637 0.4819 0.4540 -0.0157 -0.0054 0.0094  58  GLN B N   
2903 C CA  . GLN B 65  ? 0.4639 0.4815 0.4548 -0.0148 -0.0050 0.0088  58  GLN B CA  
2904 C C   . GLN B 65  ? 0.4322 0.4494 0.4294 -0.0137 -0.0037 0.0067  58  GLN B C   
2905 O O   . GLN B 65  ? 0.3798 0.3940 0.3732 -0.0112 -0.0039 0.0071  58  GLN B O   
2906 C CB  . GLN B 65  ? 0.1677 0.1898 0.1630 -0.0184 -0.0044 0.0078  58  GLN B CB  
2907 C CG  . GLN B 65  ? 0.1440 0.1660 0.1319 -0.0190 -0.0060 0.0105  58  GLN B CG  
2908 C CD  . GLN B 65  ? 0.5995 0.6275 0.5929 -0.0240 -0.0054 0.0095  58  GLN B CD  
2909 O OE1 . GLN B 65  ? 0.7903 0.8195 0.7828 -0.0248 -0.0047 0.0082  58  GLN B OE1 
2910 N NE2 . GLN B 65  ? 0.3678 0.3953 0.3522 -0.0234 -0.0067 0.0116  58  GLN B NE2 
2919 N N   . TYR B 67  ? 0.3657 0.3783 0.3609 -0.0091 -0.0034 0.0064  60  TYR B N   
2920 C CA  . TYR B 67  ? 0.1729 0.1841 0.1691 -0.0083 -0.0036 0.0068  60  TYR B CA  
2921 C C   . TYR B 67  ? 0.2943 0.3057 0.2942 -0.0089 -0.0035 0.0065  60  TYR B C   
2922 O O   . TYR B 67  ? 0.2915 0.3015 0.2919 -0.0075 -0.0031 0.0058  60  TYR B O   
2923 C CB  . TYR B 67  ? 0.4814 0.4949 0.4808 -0.0108 -0.0041 0.0073  60  TYR B CB  
2924 C CG  . TYR B 67  ? 0.5297 0.5417 0.5256 -0.0093 -0.0042 0.0078  60  TYR B CG  
2925 C CD1 . TYR B 67  ? 0.6944 0.7068 0.6946 -0.0085 -0.0032 0.0062  60  TYR B CD1 
2926 C CD2 . TYR B 67  ? 0.5183 0.5329 0.5174 -0.0120 -0.0044 0.0079  60  TYR B CD2 
2927 C CE1 . TYR B 67  ? 1.0518 1.0645 1.0522 -0.0083 -0.0030 0.0062  60  TYR B CE1 
2928 C CE2 . TYR B 67  ? 1.0238 1.0372 1.0188 -0.0106 -0.0046 0.0084  60  TYR B CE2 
2929 C CZ  . TYR B 67  ? 1.3199 1.3339 1.3198 -0.0098 -0.0035 0.0069  60  TYR B CZ  
2930 O OH  . TYR B 67  ? 1.5769 1.5917 1.5769 -0.0098 -0.0034 0.0068  60  TYR B OH  
2931 N N   . VAL B 68  ? 0.3877 0.4002 0.3875 -0.0104 -0.0043 0.0075  61  VAL B N   
2932 C CA  . VAL B 68  ? 0.3014 0.3135 0.3017 -0.0104 -0.0046 0.0080  61  VAL B CA  
2933 C C   . VAL B 68  ? 0.4013 0.4126 0.4015 -0.0090 -0.0038 0.0068  61  VAL B C   
2934 O O   . VAL B 68  ? 0.3513 0.3604 0.3490 -0.0072 -0.0040 0.0072  61  VAL B O   
2935 C CB  . VAL B 68  ? 0.3551 0.3675 0.3508 -0.0112 -0.0061 0.0103  61  VAL B CB  
2936 C CG1 . VAL B 68  ? 0.6079 0.6206 0.6040 -0.0111 -0.0062 0.0107  61  VAL B CG1 
2937 C CG2 . VAL B 68  ? 0.2977 0.3117 0.2980 -0.0142 -0.0069 0.0111  61  VAL B CG2 
2938 N N   . LEU B 69  ? 0.2750 0.2867 0.2746 -0.0090 -0.0033 0.0060  62  LEU B N   
2939 C CA  . LEU B 69  ? 0.4097 0.4205 0.4090 -0.0080 -0.0027 0.0050  62  LEU B CA  
2940 C C   . LEU B 69  ? 0.4681 0.4761 0.4654 -0.0057 -0.0024 0.0046  62  LEU B C   
2941 O O   . LEU B 69  ? 0.4555 0.4628 0.4532 -0.0051 -0.0021 0.0041  62  LEU B O   
2942 C CB  . LEU B 69  ? 0.5378 0.5484 0.5331 -0.0079 -0.0026 0.0048  62  LEU B CB  
2943 C CG  . LEU B 69  ? 0.7077 0.7169 0.7034 -0.0069 -0.0019 0.0036  62  LEU B CG  
2944 C CD1 . LEU B 69  ? 0.6013 0.6107 0.5994 -0.0074 -0.0016 0.0028  62  LEU B CD1 
2945 C CD2 . LEU B 69  ? 0.7888 0.7984 0.7837 -0.0074 -0.0016 0.0029  62  LEU B CD2 
2946 N N   . GLY B 70  ? 0.4223 0.4309 0.4222 -0.0059 -0.0020 0.0040  63  GLY B N   
2947 C CA  . GLY B 70  ? 0.1631 0.1705 0.1633 -0.0046 -0.0017 0.0034  63  GLY B CA  
2948 C C   . GLY B 70  ? 0.3414 0.3480 0.3419 -0.0042 -0.0017 0.0035  63  GLY B C   
2949 O O   . GLY B 70  ? 0.4361 0.4419 0.4367 -0.0035 -0.0014 0.0030  63  GLY B O   
2950 N N   . HIS B 71  ? 0.1900 0.1971 0.1907 -0.0049 -0.0021 0.0042  64  HIS B N   
2951 C CA  . HIS B 71  ? 0.1356 0.1414 0.1348 -0.0042 -0.0025 0.0048  64  HIS B CA  
2952 C C   . HIS B 71  ? 0.2476 0.2544 0.2491 -0.0055 -0.0029 0.0053  64  HIS B C   
2953 O O   . HIS B 71  ? 0.2880 0.2934 0.2879 -0.0048 -0.0036 0.0061  64  HIS B O   
2954 C CB  . HIS B 71  ? 0.7072 0.7121 0.7066 -0.0033 -0.0019 0.0039  64  HIS B CB  
2955 C CG  . HIS B 71  ? 0.8657 0.8708 0.8667 -0.0034 -0.0017 0.0033  64  HIS B CG  
2956 N ND1 . HIS B 71  ? 0.9560 0.9610 0.9573 -0.0037 -0.0020 0.0038  64  HIS B ND1 
2957 C CD2 . HIS B 71  ? 0.6907 0.6950 0.6903 -0.0026 -0.0015 0.0032  64  HIS B CD2 
2958 C CE1 . HIS B 71  ? 0.8158 0.8206 0.8170 -0.0034 -0.0018 0.0035  64  HIS B CE1 
2959 N NE2 . HIS B 71  ? 0.7365 0.7408 0.7362 -0.0026 -0.0016 0.0033  64  HIS B NE2 
2960 N N   . GLU B 72  ? 0.3121 0.3188 0.3112 -0.0054 -0.0035 0.0062  65  GLU B N   
2961 C CA  . GLU B 72  ? 0.4051 0.4129 0.4066 -0.0070 -0.0038 0.0065  65  GLU B CA  
2962 C C   . GLU B 72  ? 0.5226 0.5289 0.5222 -0.0067 -0.0053 0.0083  65  GLU B C   
2963 O O   . GLU B 72  ? 0.7709 0.7774 0.7734 -0.0077 -0.0051 0.0077  65  GLU B O   
2964 C CB  . GLU B 72  ? 0.3115 0.3208 0.3127 -0.0081 -0.0041 0.0070  65  GLU B CB  
2965 C CG  . GLU B 72  ? 0.3754 0.3853 0.3764 -0.0100 -0.0053 0.0085  65  GLU B CG  
2966 C CD  . GLU B 72  ? 0.3532 0.3615 0.3508 -0.0092 -0.0062 0.0096  65  GLU B CD  
2967 O OE1 . GLU B 72  ? 0.4010 0.4096 0.3977 -0.0108 -0.0074 0.0110  65  GLU B OE1 
2968 O OE2 . GLU B 72  ? 0.4647 0.4736 0.4658 -0.0092 -0.0050 0.0080  65  GLU B OE2 
2969 N N   . ALA B 73  ? 0.3300 0.3366 0.3298 -0.0074 -0.0061 0.0093  66  ALA B N   
2970 C CA  . ALA B 73  ? 0.5380 0.5447 0.5417 -0.0094 -0.0068 0.0097  66  ALA B CA  
2971 C C   . ALA B 73  ? 0.6425 0.6491 0.6470 -0.0092 -0.0070 0.0100  66  ALA B C   
2972 O O   . ALA B 73  ? 0.6553 0.6627 0.6604 -0.0105 -0.0080 0.0113  66  ALA B O   
2973 C CB  . ALA B 73  ? 0.5167 0.5237 0.5206 -0.0114 -0.0084 0.0114  66  ALA B CB  
2974 N N   . MET B 74  ? 0.7684 0.7742 0.7730 -0.0078 -0.0061 0.0089  67  MET B N   
2975 C CA  . MET B 74  ? 0.9149 0.9208 0.9199 -0.0074 -0.0060 0.0088  67  MET B CA  
2976 C C   . MET B 74  ? 0.9010 0.9053 0.9054 -0.0069 -0.0084 0.0114  67  MET B C   
2977 O O   . MET B 74  ? 0.8716 0.8762 0.8765 -0.0068 -0.0083 0.0116  67  MET B O   
2978 C CB  . MET B 74  ? 1.1326 1.1375 1.1371 -0.0060 -0.0049 0.0074  67  MET B CB  
2979 C CG  . MET B 74  ? 1.2154 1.2195 1.2210 -0.0051 -0.0066 0.0077  67  MET B CG  
2980 S SD  . MET B 74  ? 1.8638 1.8669 1.8685 -0.0040 -0.0053 0.0061  67  MET B SD  
2981 C CE  . MET B 74  ? 0.5280 0.5306 0.5304 -0.0038 -0.0045 0.0063  67  MET B CE  
2982 N N   . LYS B 75  ? 0.9586 0.9630 0.9670 -0.0095 -0.0093 0.0117  68  LYS B N   
2983 C CA  . LYS B 75  ? 0.9234 0.9275 0.9349 -0.0111 -0.0128 0.0144  68  LYS B CA  
2984 C C   . LYS B 75  ? 0.9738 0.9799 0.9855 -0.0131 -0.0142 0.0173  68  LYS B C   
2985 O O   . LYS B 75  ? 1.0033 1.0089 1.0179 -0.0155 -0.0184 0.0217  68  LYS B O   
2986 C CB  . LYS B 75  ? 0.9395 0.9422 0.9528 -0.0124 -0.0160 0.0165  68  LYS B CB  
2987 C CG  . LYS B 75  ? 0.8382 0.8423 0.8502 -0.0147 -0.0175 0.0187  68  LYS B CG  
2988 C CD  . LYS B 75  ? 0.8251 0.8271 0.8382 -0.0164 -0.0210 0.0213  68  LYS B CD  
2989 C CE  . LYS B 75  ? 0.8187 0.8208 0.8298 -0.0146 -0.0186 0.0183  68  LYS B CE  
2990 N NZ  . LYS B 75  ? 0.6994 0.7006 0.7094 -0.0170 -0.0212 0.0208  68  LYS B NZ  
2991 N N   . ARG B 76  ? 0.9924 1.0006 1.0016 -0.0123 -0.0113 0.0150  69  ARG B N   
2992 C CA  . ARG B 76  ? 0.8809 0.8918 0.8899 -0.0142 -0.0122 0.0174  69  ARG B CA  
2993 C C   . ARG B 76  ? 0.8459 0.8576 0.8543 -0.0132 -0.0105 0.0165  69  ARG B C   
2994 O O   . ARG B 76  ? 0.9019 0.9119 0.9094 -0.0109 -0.0081 0.0136  69  ARG B O   
2995 C CB  . ARG B 76  ? 0.7854 0.7979 0.7924 -0.0144 -0.0109 0.0157  69  ARG B CB  
2996 C CG  . ARG B 76  ? 0.8147 0.8246 0.8155 -0.0107 -0.0092 0.0144  69  ARG B CG  
2997 C CD  . ARG B 76  ? 0.8297 0.8411 0.8287 -0.0116 -0.0088 0.0141  69  ARG B CD  
2998 N NE  . ARG B 76  ? 0.9195 0.9329 0.9230 -0.0153 -0.0094 0.0144  69  ARG B NE  
2999 C CZ  . ARG B 76  ? 0.9378 0.9533 0.9408 -0.0176 -0.0103 0.0158  69  ARG B CZ  
3000 N NH1 . ARG B 76  ? 0.9165 0.9343 0.9190 -0.0182 -0.0099 0.0159  69  ARG B NH1 
3001 N NH2 . ARG B 76  ? 1.0031 1.0201 1.0054 -0.0194 -0.0133 0.0175  69  ARG B NH2 
3002 N N   . LEU B 77  ? 0.8275 0.8426 0.8362 -0.0151 -0.0117 0.0194  70  LEU B N   
3003 C CA  . LEU B 77  ? 0.9434 0.9605 0.9517 -0.0147 -0.0108 0.0197  70  LEU B CA  
3004 C C   . LEU B 77  ? 0.8520 0.8681 0.8575 -0.0122 -0.0069 0.0147  70  LEU B C   
3005 O O   . LEU B 77  ? 0.7966 0.8112 0.7968 -0.0104 -0.0073 0.0140  70  LEU B O   
3006 C CB  . LEU B 77  ? 1.1511 1.1734 1.1606 -0.0176 -0.0134 0.0246  70  LEU B CB  
3007 C CG  . LEU B 77  ? 1.3408 1.3600 1.3509 -0.0151 -0.0179 0.0273  70  LEU B CG  
3008 C CD1 . LEU B 77  ? 1.3649 1.3875 1.3731 -0.0139 -0.0206 0.0298  70  LEU B CD1 
3009 C CD2 . LEU B 77  ? 1.3327 1.3486 1.3436 -0.0109 -0.0183 0.0246  70  LEU B CD2 
3010 N N   . GLN B 78  ? 0.8053 0.8217 0.8101 -0.0111 -0.0060 0.0140  71  GLN B N   
3011 C CA  . GLN B 78  ? 0.6302 0.6449 0.6300 -0.0083 -0.0051 0.0112  71  GLN B CA  
3012 C C   . GLN B 78  ? 0.6148 0.6327 0.6137 -0.0087 -0.0045 0.0110  71  GLN B C   
3013 O O   . GLN B 78  ? 0.7271 0.7507 0.7296 -0.0108 -0.0043 0.0133  71  GLN B O   
3014 C CB  . GLN B 78  ? 0.5260 0.5384 0.5262 -0.0069 -0.0043 0.0097  71  GLN B CB  
3015 C CG  . GLN B 78  ? 0.4363 0.4462 0.4374 -0.0066 -0.0049 0.0099  71  GLN B CG  
3016 C CD  . GLN B 78  ? 0.4737 0.4849 0.4770 -0.0078 -0.0043 0.0084  71  GLN B CD  
3017 O OE1 . GLN B 78  ? 0.4486 0.4588 0.4476 -0.0066 -0.0039 0.0080  71  GLN B OE1 
3018 N NE2 . GLN B 78  ? 0.5469 0.5558 0.5477 -0.0071 -0.0055 0.0100  71  GLN B NE2 
3019 N N   . THR B 79  ? 0.4337 0.4528 0.4310 -0.0091 -0.0039 0.0096  72  THR B N   
3020 C CA  . THR B 79  ? 0.4449 0.4677 0.4411 -0.0100 -0.0035 0.0094  72  THR B CA  
3021 C C   . THR B 79  ? 0.4206 0.4436 0.4159 -0.0096 -0.0025 0.0069  72  THR B C   
3022 O O   . THR B 79  ? 0.5689 0.5980 0.5694 -0.0111 -0.0020 0.0058  72  THR B O   
3023 C CB  . THR B 79  ? 0.6872 0.7118 0.6822 -0.0116 -0.0039 0.0098  72  THR B CB  
3024 O OG1 . THR B 79  ? 0.7258 0.7504 0.7255 -0.0127 -0.0031 0.0074  72  THR B OG1 
3025 C CG2 . THR B 79  ? 0.7603 0.7853 0.7561 -0.0125 -0.0052 0.0125  72  THR B CG2 
3026 N N   . SER B 80  ? 0.4121 0.4319 0.4073 -0.0090 -0.0021 0.0056  73  SER B N   
3027 C CA  . SER B 80  ? 0.4514 0.4728 0.4504 -0.0100 -0.0013 0.0033  73  SER B CA  
3028 C C   . SER B 80  ? 0.3922 0.4106 0.3872 -0.0080 -0.0010 0.0028  73  SER B C   
3029 O O   . SER B 80  ? 0.4339 0.4512 0.4334 -0.0077 -0.0011 0.0028  73  SER B O   
3030 C CB  . SER B 80  ? 0.5339 0.5510 0.5278 -0.0094 -0.0012 0.0028  73  SER B CB  
3031 O OG  . SER B 80  ? 0.6566 0.6767 0.6544 -0.0114 -0.0014 0.0031  73  SER B OG  
3032 N N   . SER B 81  ? 0.2662 0.2871 0.2608 -0.0085 -0.0005 0.0015  74  SER B N   
3033 C CA  . SER B 81  ? 0.3292 0.3515 0.3286 -0.0087 -0.0001 0.0003  74  SER B CA  
3034 C C   . SER B 81  ? 0.3527 0.3715 0.3469 -0.0088 0.0003  -0.0008 74  SER B C   
3035 O O   . SER B 81  ? 0.3932 0.4127 0.3863 -0.0102 0.0006  -0.0015 74  SER B O   
3036 C CB  . SER B 81  ? 0.3262 0.3531 0.3263 -0.0086 0.0002  -0.0007 74  SER B CB  
3037 O OG  . SER B 81  ? 0.5213 0.5502 0.5213 -0.0100 0.0008  -0.0026 74  SER B OG  
3038 N N   . VAL B 82  ? 0.2299 0.2480 0.2284 -0.0089 0.0004  -0.0010 75  VAL B N   
3039 C CA  . VAL B 82  ? 0.2245 0.2392 0.2183 -0.0089 0.0008  -0.0016 75  VAL B CA  
3040 C C   . VAL B 82  ? 0.3714 0.3875 0.3648 -0.0098 0.0014  -0.0029 75  VAL B C   
3041 O O   . VAL B 82  ? 0.3342 0.3516 0.3284 -0.0092 0.0014  -0.0032 75  VAL B O   
3042 C CB  . VAL B 82  ? 0.2017 0.2142 0.1992 -0.0084 0.0003  -0.0006 75  VAL B CB  
3043 C CG1 . VAL B 82  ? 0.0947 0.1055 0.0913 -0.0092 0.0006  -0.0011 75  VAL B CG1 
3044 C CG2 . VAL B 82  ? 0.2164 0.2280 0.2142 -0.0077 -0.0001 0.0002  75  VAL B CG2 
3045 N N   . LEU B 83  ? 0.3112 0.3285 0.3078 -0.0125 0.0018  -0.0035 76  LEU B N   
3046 C CA  . LEU B 83  ? 0.3017 0.3196 0.2978 -0.0139 0.0025  -0.0045 76  LEU B CA  
3047 C C   . LEU B 83  ? 0.2732 0.2874 0.2683 -0.0136 0.0023  -0.0038 76  LEU B C   
3048 O O   . LEU B 83  ? 0.3290 0.3407 0.3230 -0.0140 0.0024  -0.0036 76  LEU B O   
3049 C CB  . LEU B 83  ? 0.3844 0.4024 0.3740 -0.0150 0.0037  -0.0065 76  LEU B CB  
3050 C CG  . LEU B 83  ? 0.3642 0.3851 0.3531 -0.0169 0.0047  -0.0084 76  LEU B CG  
3051 C CD1 . LEU B 83  ? 0.3035 0.3233 0.2899 -0.0195 0.0059  -0.0095 76  LEU B CD1 
3052 C CD2 . LEU B 83  ? 0.3635 0.3844 0.3529 -0.0164 0.0045  -0.0083 76  LEU B CD2 
3053 N N   . VAL B 84  ? 0.1740 0.1882 0.1693 -0.0132 0.0022  -0.0037 77  VAL B N   
3054 C CA  . VAL B 84  ? 0.1970 0.2076 0.1869 -0.0124 0.0024  -0.0036 77  VAL B CA  
3055 C C   . VAL B 84  ? 0.2208 0.2328 0.2090 -0.0147 0.0033  -0.0048 77  VAL B C   
3056 O O   . VAL B 84  ? 0.2094 0.2241 0.1981 -0.0150 0.0035  -0.0056 77  VAL B O   
3057 C CB  . VAL B 84  ? 0.2514 0.2612 0.2427 -0.0107 0.0016  -0.0025 77  VAL B CB  
3058 C CG1 . VAL B 84  ? 0.1460 0.1542 0.1361 -0.0113 0.0015  -0.0022 77  VAL B CG1 
3059 C CG2 . VAL B 84  ? 0.1858 0.1951 0.1817 -0.0096 0.0009  -0.0014 77  VAL B CG2 
3060 N N   . SER B 85  ? 0.2353 0.2463 0.2263 -0.0181 0.0036  -0.0049 78  SER B N   
3061 C CA  . SER B 85  ? 0.1858 0.1967 0.1692 -0.0191 0.0049  -0.0066 78  SER B CA  
3062 C C   . SER B 85  ? 0.1988 0.2071 0.1803 -0.0198 0.0047  -0.0058 78  SER B C   
3063 O O   . SER B 85  ? 0.2779 0.2833 0.2641 -0.0208 0.0040  -0.0046 78  SER B O   
3064 C CB  . SER B 85  ? 0.3169 0.3286 0.3047 -0.0234 0.0057  -0.0073 78  SER B CB  
3065 O OG  . SER B 85  ? 0.3379 0.3478 0.3160 -0.0241 0.0073  -0.0089 78  SER B OG  
3066 N N   . GLY B 86  ? 0.2536 0.2639 0.2341 -0.0213 0.0050  -0.0063 79  GLY B N   
3067 C CA  . GLY B 86  ? 0.2279 0.2371 0.2130 -0.0242 0.0042  -0.0051 79  GLY B CA  
3068 C C   . GLY B 86  ? 0.3010 0.3117 0.2883 -0.0218 0.0031  -0.0040 79  GLY B C   
3069 O O   . GLY B 86  ? 0.3811 0.3901 0.3696 -0.0192 0.0024  -0.0030 79  GLY B O   
3070 N N   . LEU B 87  ? 0.2203 0.2344 0.2083 -0.0228 0.0032  -0.0044 80  LEU B N   
3071 C CA  . LEU B 87  ? 0.1284 0.1440 0.1182 -0.0208 0.0025  -0.0036 80  LEU B CA  
3072 C C   . LEU B 87  ? 0.2058 0.2214 0.1942 -0.0222 0.0020  -0.0028 80  LEU B C   
3073 O O   . LEU B 87  ? 0.2337 0.2511 0.2160 -0.0208 0.0023  -0.0035 80  LEU B O   
3074 C CB  . LEU B 87  ? 0.1234 0.1413 0.1089 -0.0184 0.0033  -0.0052 80  LEU B CB  
3075 C CG  . LEU B 87  ? 0.2937 0.3103 0.2817 -0.0157 0.0028  -0.0047 80  LEU B CG  
3076 C CD1 . LEU B 87  ? 0.2361 0.2533 0.2243 -0.0160 0.0034  -0.0057 80  LEU B CD1 
3077 C CD2 . LEU B 87  ? 0.3764 0.3946 0.3666 -0.0140 0.0026  -0.0049 80  LEU B CD2 
3078 N N   . ARG B 88  ? 0.2972 0.3082 0.2771 -0.0211 0.0016  -0.0021 81  ARG B N   
3079 C CA  . ARG B 88  ? 0.2795 0.2915 0.2619 -0.0241 -0.0008 -0.0018 81  ARG B CA  
3080 C C   . ARG B 88  ? 0.2970 0.3089 0.2826 -0.0207 -0.0016 -0.0005 81  ARG B C   
3081 O O   . ARG B 88  ? 0.3108 0.3223 0.2955 -0.0169 -0.0001 0.0001  81  ARG B O   
3082 C CB  . ARG B 88  ? 0.1837 0.1925 0.1591 -0.0293 -0.0005 -0.0011 81  ARG B CB  
3083 C CG  . ARG B 88  ? 0.3223 0.3303 0.2939 -0.0330 0.0008  -0.0028 81  ARG B CG  
3084 C CD  . ARG B 88  ? 0.1297 0.1334 0.0923 -0.0395 0.0010  -0.0018 81  ARG B CD  
3085 N NE  . ARG B 88  ? 0.4952 0.5019 0.4560 -0.0425 -0.0005 0.0003  81  ARG B NE  
3086 C CZ  . ARG B 88  ? 0.6151 0.6175 0.5727 -0.0414 0.0005  0.0052  81  ARG B CZ  
3087 N NH1 . ARG B 88  ? 0.5462 0.5406 0.5011 -0.0388 0.0026  0.0076  81  ARG B NH1 
3088 N NH2 . ARG B 88  ? 0.6141 0.6202 0.5716 -0.0422 -0.0003 0.0079  81  ARG B NH2 
3089 N N   . GLY B 89  ? 0.3217 0.3343 0.3051 -0.0230 -0.0024 0.0015  82  GLY B N   
3090 C CA  . GLY B 89  ? 0.2621 0.2757 0.2490 -0.0200 -0.0030 0.0028  82  GLY B CA  
3091 C C   . GLY B 89  ? 0.3043 0.3149 0.2932 -0.0167 -0.0028 0.0023  82  GLY B C   
3092 O O   . GLY B 89  ? 0.1517 0.1624 0.1453 -0.0135 -0.0016 0.0024  82  GLY B O   
3093 N N   . LEU B 90  ? 0.2756 0.2830 0.2607 -0.0189 -0.0026 0.0025  83  LEU B N   
3094 C CA  . LEU B 90  ? 0.3294 0.3342 0.3155 -0.0166 -0.0023 0.0021  83  LEU B CA  
3095 C C   . LEU B 90  ? 0.2900 0.2948 0.2803 -0.0125 -0.0017 0.0004  83  LEU B C   
3096 O O   . LEU B 90  ? 0.2420 0.2466 0.2325 -0.0098 -0.0010 0.0013  83  LEU B O   
3097 C CB  . LEU B 90  ? 0.3892 0.3883 0.3699 -0.0184 -0.0007 0.0025  83  LEU B CB  
3098 C CG  . LEU B 90  ? 0.3012 0.2972 0.2826 -0.0157 0.0005  0.0024  83  LEU B CG  
3099 C CD1 . LEU B 90  ? 0.2457 0.2445 0.2317 -0.0124 0.0000  0.0039  83  LEU B CD1 
3100 C CD2 . LEU B 90  ? 0.1953 0.1852 0.1728 -0.0153 0.0035  0.0044  83  LEU B CD2 
3101 N N   . GLY B 91  ? 0.3495 0.3546 0.3362 -0.0132 -0.0002 0.0003  84  GLY B N   
3102 C CA  . GLY B 91  ? 0.2045 0.2111 0.1961 -0.0136 0.0004  -0.0005 84  GLY B CA  
3103 C C   . GLY B 91  ? 0.2445 0.2526 0.2346 -0.0111 0.0002  -0.0003 84  GLY B C   
3104 O O   . GLY B 91  ? 0.3959 0.4047 0.3907 -0.0106 0.0003  -0.0004 84  GLY B O   
3105 N N   . VAL B 92  ? 0.2555 0.2653 0.2455 -0.0116 0.0001  -0.0001 85  VAL B N   
3106 C CA  . VAL B 92  ? 0.3072 0.3185 0.2988 -0.0105 0.0001  -0.0002 85  VAL B CA  
3107 C C   . VAL B 92  ? 0.2239 0.2347 0.2204 -0.0093 -0.0004 0.0006  85  VAL B C   
3108 O O   . VAL B 92  ? 0.2999 0.3098 0.2945 -0.0073 -0.0003 0.0006  85  VAL B O   
3109 C CB  . VAL B 92  ? 0.2123 0.2276 0.2075 -0.0130 0.0003  -0.0005 85  VAL B CB  
3110 C CG1 . VAL B 92  ? 0.1539 0.1680 0.1442 -0.0124 -0.0004 0.0007  85  VAL B CG1 
3111 C CG2 . VAL B 92  ? 0.1333 0.1501 0.1297 -0.0118 0.0006  -0.0011 85  VAL B CG2 
3112 N N   . GLU B 93  ? 0.3635 0.3725 0.3569 -0.0084 -0.0009 0.0015  86  GLU B N   
3113 C CA  . GLU B 93  ? 0.4571 0.4662 0.4547 -0.0075 -0.0011 0.0019  86  GLU B CA  
3114 C C   . GLU B 93  ? 0.4643 0.4717 0.4623 -0.0062 -0.0009 0.0016  86  GLU B C   
3115 O O   . GLU B 93  ? 0.5019 0.5088 0.5006 -0.0050 -0.0008 0.0016  86  GLU B O   
3116 C CB  . GLU B 93  ? 0.4832 0.4924 0.4809 -0.0078 -0.0016 0.0027  86  GLU B CB  
3117 C CG  . GLU B 93  ? 0.3309 0.3424 0.3287 -0.0089 -0.0019 0.0035  86  GLU B CG  
3118 C CD  . GLU B 93  ? 0.4246 0.4375 0.4236 -0.0079 -0.0018 0.0039  86  GLU B CD  
3119 O OE1 . GLU B 93  ? 0.4913 0.5017 0.4883 -0.0058 -0.0017 0.0039  86  GLU B OE1 
3120 O OE2 . GLU B 93  ? 0.5196 0.5336 0.5150 -0.0081 -0.0022 0.0048  86  GLU B OE2 
3121 N N   . ILE B 94  ? 0.2663 0.2727 0.2634 -0.0067 -0.0008 0.0013  87  ILE B N   
3122 C CA  . ILE B 94  ? 0.1617 0.1666 0.1572 -0.0054 -0.0007 0.0011  87  ILE B CA  
3123 C C   . ILE B 94  ? 0.3528 0.3583 0.3489 -0.0050 -0.0005 0.0009  87  ILE B C   
3124 O O   . ILE B 94  ? 0.4231 0.4281 0.4200 -0.0041 -0.0006 0.0010  87  ILE B O   
3125 C CB  . ILE B 94  ? 0.1988 0.2029 0.1927 -0.0066 -0.0004 0.0006  87  ILE B CB  
3126 C CG1 . ILE B 94  ? 0.2811 0.2840 0.2762 -0.0076 -0.0005 0.0006  87  ILE B CG1 
3127 C CG2 . ILE B 94  ? 0.2382 0.2425 0.2345 -0.0067 -0.0002 0.0003  87  ILE B CG2 
3128 C CD1 . ILE B 94  ? 0.2683 0.2690 0.2610 -0.0092 0.0001  -0.0002 87  ILE B CD1 
3129 N N   . ALA B 95  ? 0.3315 0.3389 0.3290 -0.0065 -0.0002 0.0004  88  ALA B N   
3130 C CA  . ALA B 95  ? 0.3304 0.3381 0.3261 -0.0057 -0.0001 0.0001  88  ALA B CA  
3131 C C   . ALA B 95  ? 0.3163 0.3234 0.3130 -0.0046 -0.0002 0.0004  88  ALA B C   
3132 O O   . ALA B 95  ? 0.3436 0.3502 0.3408 -0.0039 -0.0003 0.0005  88  ALA B O   
3133 C CB  . ALA B 95  ? 0.1796 0.1893 0.1744 -0.0071 0.0004  -0.0008 88  ALA B CB  
3134 N N   . LYS B 96  ? 0.2625 0.2699 0.2592 -0.0047 -0.0003 0.0006  89  LYS B N   
3135 C CA  . LYS B 96  ? 0.2669 0.2741 0.2641 -0.0041 -0.0003 0.0008  89  LYS B CA  
3136 C C   . LYS B 96  ? 0.2935 0.2996 0.2929 -0.0034 -0.0005 0.0011  89  LYS B C   
3137 O O   . LYS B 96  ? 0.3059 0.3114 0.3055 -0.0029 -0.0005 0.0011  89  LYS B O   
3138 C CB  . LYS B 96  ? 0.2435 0.2527 0.2425 -0.0051 -0.0004 0.0008  89  LYS B CB  
3139 C CG  . LYS B 96  ? 0.2530 0.2622 0.2522 -0.0046 -0.0004 0.0009  89  LYS B CG  
3140 C CD  . LYS B 96  ? 0.1804 0.1881 0.1780 -0.0039 -0.0007 0.0017  89  LYS B CD  
3141 C CE  . LYS B 96  ? 0.1720 0.1818 0.1715 -0.0050 -0.0008 0.0020  89  LYS B CE  
3142 N NZ  . LYS B 96  ? 0.2936 0.3021 0.2915 -0.0041 -0.0011 0.0028  89  LYS B NZ  
3143 N N   . ASN B 97  ? 0.3242 0.3292 0.3223 -0.0030 -0.0007 0.0014  90  ASN B N   
3144 C CA  . ASN B 97  ? 0.2287 0.2333 0.2284 -0.0027 -0.0006 0.0014  90  ASN B CA  
3145 C C   . ASN B 97  ? 0.2429 0.2467 0.2416 -0.0023 -0.0007 0.0015  90  ASN B C   
3146 O O   . ASN B 97  ? 0.2213 0.2249 0.2204 -0.0021 -0.0007 0.0016  90  ASN B O   
3147 C CB  . ASN B 97  ? 0.2037 0.2079 0.2024 -0.0025 -0.0008 0.0017  90  ASN B CB  
3148 C CG  . ASN B 97  ? 0.2261 0.2311 0.2249 -0.0027 -0.0009 0.0021  90  ASN B CG  
3149 O OD1 . ASN B 97  ? 0.3078 0.3133 0.3066 -0.0027 -0.0009 0.0022  90  ASN B OD1 
3150 N ND2 . ASN B 97  ? 0.2079 0.2131 0.2065 -0.0029 -0.0011 0.0024  90  ASN B ND2 
3151 N N   . ILE B 98  ? 0.3164 0.3205 0.3147 -0.0026 -0.0006 0.0013  91  ILE B N   
3152 C CA  . ILE B 98  ? 0.1400 0.1443 0.1383 -0.0028 -0.0007 0.0013  91  ILE B CA  
3153 C C   . ILE B 98  ? 0.2580 0.2630 0.2576 -0.0029 -0.0006 0.0013  91  ILE B C   
3154 O O   . ILE B 98  ? 0.2938 0.2991 0.2937 -0.0029 -0.0007 0.0017  91  ILE B O   
3155 C CB  . ILE B 98  ? 0.2101 0.2150 0.2076 -0.0035 -0.0006 0.0011  91  ILE B CB  
3156 C CG1 . ILE B 98  ? 0.2968 0.3016 0.2941 -0.0037 -0.0006 0.0011  91  ILE B CG1 
3157 C CG2 . ILE B 98  ? 0.1601 0.1663 0.1572 -0.0040 -0.0004 0.0008  91  ILE B CG2 
3158 C CD1 . ILE B 98  ? 0.3686 0.3725 0.3662 -0.0033 -0.0007 0.0012  91  ILE B CD1 
3159 N N   . ILE B 99  ? 0.2080 0.2133 0.2076 -0.0028 -0.0005 0.0011  92  ILE B N   
3160 C CA  . ILE B 99  ? 0.2557 0.2612 0.2555 -0.0027 -0.0005 0.0012  92  ILE B CA  
3161 C C   . ILE B 99  ? 0.2608 0.2649 0.2599 -0.0021 -0.0007 0.0017  92  ILE B C   
3162 O O   . ILE B 99  ? 0.2610 0.2654 0.2614 -0.0024 -0.0009 0.0020  92  ILE B O   
3163 C CB  . ILE B 99  ? 0.1936 0.2001 0.1918 -0.0028 -0.0002 0.0006  92  ILE B CB  
3164 C CG1 . ILE B 99  ? 0.2161 0.2242 0.2139 -0.0034 0.0000  0.0000  92  ILE B CG1 
3165 C CG2 . ILE B 99  ? 0.1252 0.1322 0.1237 -0.0025 -0.0001 0.0002  92  ILE B CG2 
3166 C CD1 . ILE B 99  ? 0.2870 0.2985 0.2868 -0.0045 0.0004  -0.0012 92  ILE B CD1 
3167 N N   . LEU B 100 ? 0.3398 0.3440 0.3398 -0.0022 -0.0006 0.0014  93  LEU B N   
3168 C CA  . LEU B 100 ? 0.3718 0.3756 0.3720 -0.0022 -0.0008 0.0017  93  LEU B CA  
3169 C C   . LEU B 100 ? 0.3649 0.3682 0.3644 -0.0021 -0.0011 0.0023  93  LEU B C   
3170 O O   . LEU B 100 ? 0.2600 0.2638 0.2608 -0.0027 -0.0014 0.0027  93  LEU B O   
3171 C CB  . LEU B 100 ? 0.3045 0.3081 0.3038 -0.0020 -0.0008 0.0018  93  LEU B CB  
3172 C CG  . LEU B 100 ? 0.3738 0.3779 0.3727 -0.0022 -0.0007 0.0015  93  LEU B CG  
3173 C CD1 . LEU B 100 ? 0.1817 0.1870 0.1817 -0.0027 -0.0006 0.0015  93  LEU B CD1 
3174 C CD2 . LEU B 100 ? 0.3699 0.3744 0.3698 -0.0024 -0.0006 0.0014  93  LEU B CD2 
3175 N N   . GLY B 101 ? 0.2919 0.2959 0.2923 -0.0024 -0.0009 0.0020  94  GLY B N   
3176 C CA  . GLY B 101 ? 0.1435 0.1473 0.1429 -0.0024 -0.0013 0.0026  94  GLY B CA  
3177 C C   . GLY B 101 ? 0.2885 0.2934 0.2893 -0.0032 -0.0015 0.0030  94  GLY B C   
3178 O O   . GLY B 101 ? 0.2744 0.2793 0.2740 -0.0034 -0.0021 0.0041  94  GLY B O   
3179 N N   . GLY B 102 ? 0.3501 0.3546 0.3497 -0.0028 -0.0016 0.0032  95  GLY B N   
3180 C CA  . GLY B 102 ? 0.3140 0.3189 0.3140 -0.0032 -0.0021 0.0042  95  GLY B CA  
3181 C C   . GLY B 102 ? 0.3842 0.3911 0.3856 -0.0042 -0.0020 0.0042  95  GLY B C   
3182 O O   . GLY B 102 ? 0.3983 0.4050 0.3983 -0.0043 -0.0029 0.0059  95  GLY B O   
3183 N N   . VAL B 103 ? 0.3714 0.3786 0.3721 -0.0040 -0.0015 0.0034  96  VAL B N   
3184 C CA  . VAL B 103 ? 0.2897 0.2977 0.2881 -0.0042 -0.0017 0.0039  96  VAL B CA  
3185 C C   . VAL B 103 ? 0.2767 0.2871 0.2776 -0.0048 -0.0016 0.0041  96  VAL B C   
3186 O O   . VAL B 103 ? 0.3690 0.3777 0.3681 -0.0039 -0.0017 0.0045  96  VAL B O   
3187 C CB  . VAL B 103 ? 0.2737 0.2827 0.2734 -0.0048 -0.0011 0.0026  96  VAL B CB  
3188 C CG1 . VAL B 103 ? 0.2009 0.2087 0.2003 -0.0047 -0.0011 0.0023  96  VAL B CG1 
3189 C CG2 . VAL B 103 ? 0.2218 0.2299 0.2195 -0.0040 -0.0008 0.0021  96  VAL B CG2 
3190 N N   . LYS B 104 ? 0.3036 0.3164 0.3046 -0.0055 -0.0017 0.0045  97  LYS B N   
3191 C CA  . LYS B 104 ? 0.3046 0.3198 0.3062 -0.0056 -0.0017 0.0053  97  LYS B CA  
3192 C C   . LYS B 104 ? 0.2860 0.3020 0.2851 -0.0048 -0.0005 0.0043  97  LYS B C   
3193 O O   . LYS B 104 ? 0.3540 0.3750 0.3551 -0.0049 -0.0021 0.0050  97  LYS B O   
3194 C CB  . LYS B 104 ? 0.3458 0.3645 0.3475 -0.0066 -0.0018 0.0056  97  LYS B CB  
3195 C CG  . LYS B 104 ? 0.3787 0.4051 0.3787 -0.0076 -0.0018 0.0079  97  LYS B CG  
3196 C CD  . LYS B 104 ? 0.3113 0.3415 0.3106 -0.0085 -0.0014 0.0075  97  LYS B CD  
3197 C CE  . LYS B 104 ? 0.2115 0.2497 0.2129 -0.0079 -0.0042 0.0082  97  LYS B CE  
3198 N NZ  . LYS B 104 ? 0.3096 0.3538 0.3095 -0.0102 -0.0029 0.0091  97  LYS B NZ  
3199 N N   . ALA B 105 ? 0.1566 0.1735 0.1572 -0.0049 -0.0006 0.0021  98  ALA B N   
3200 C CA  . ALA B 105 ? 0.1946 0.2119 0.1919 -0.0042 -0.0001 0.0002  98  ALA B CA  
3201 C C   . ALA B 105 ? 0.2450 0.2629 0.2453 -0.0054 0.0002  -0.0006 98  ALA B C   
3202 O O   . ALA B 105 ? 0.2944 0.3106 0.2908 -0.0058 0.0001  -0.0004 98  ALA B O   
3203 C CB  . ALA B 105 ? 0.3696 0.3939 0.3680 -0.0044 0.0009  -0.0011 98  ALA B CB  
3204 N N   . VAL B 106 ? 0.2122 0.2286 0.2093 -0.0048 0.0005  -0.0018 99  VAL B N   
3205 C CA  . VAL B 106 ? 0.2141 0.2317 0.2141 -0.0064 0.0007  -0.0022 99  VAL B CA  
3206 C C   . VAL B 106 ? 0.2846 0.3063 0.2854 -0.0074 0.0013  -0.0042 99  VAL B C   
3207 O O   . VAL B 106 ? 0.3750 0.3969 0.3724 -0.0060 0.0016  -0.0060 99  VAL B O   
3208 C CB  . VAL B 106 ? 0.1849 0.1996 0.1846 -0.0059 0.0006  -0.0016 99  VAL B CB  
3209 C CG1 . VAL B 106 ? 0.0352 0.0499 0.0342 -0.0072 0.0008  -0.0020 99  VAL B CG1 
3210 C CG2 . VAL B 106 ? 0.0743 0.0849 0.0713 -0.0046 0.0001  -0.0002 99  VAL B CG2 
3211 N N   . THR B 107 ? 0.1523 0.1750 0.1526 -0.0091 0.0016  -0.0047 100 THR B N   
3212 C CA  . THR B 107 ? 0.2437 0.2676 0.2391 -0.0096 0.0026  -0.0073 100 THR B CA  
3213 C C   . THR B 107 ? 0.2940 0.3161 0.2881 -0.0110 0.0029  -0.0070 100 THR B C   
3214 O O   . THR B 107 ? 0.2737 0.2953 0.2719 -0.0128 0.0026  -0.0055 100 THR B O   
3215 C CB  . THR B 107 ? 0.2528 0.2829 0.2540 -0.0120 0.0028  -0.0079 100 THR B CB  
3216 O OG1 . THR B 107 ? 0.3075 0.3406 0.3101 -0.0105 0.0025  -0.0085 100 THR B OG1 
3217 C CG2 . THR B 107 ? 0.1839 0.2145 0.1785 -0.0128 0.0040  -0.0110 100 THR B CG2 
3218 N N   . LEU B 108 ? 0.3176 0.3435 0.3175 -0.0128 0.0030  -0.0074 101 LEU B N   
3219 C CA  . LEU B 108 ? 0.1618 0.1841 0.1544 -0.0131 0.0036  -0.0078 101 LEU B CA  
3220 C C   . LEU B 108 ? 0.2284 0.2559 0.2263 -0.0172 0.0043  -0.0089 101 LEU B C   
3221 O O   . LEU B 108 ? 0.3822 0.4144 0.3817 -0.0180 0.0048  -0.0108 101 LEU B O   
3222 C CB  . LEU B 108 ? 0.1932 0.2183 0.1922 -0.0139 0.0032  -0.0073 101 LEU B CB  
3223 C CG  . LEU B 108 ? 0.1762 0.1971 0.1708 -0.0103 0.0028  -0.0068 101 LEU B CG  
3224 C CD1 . LEU B 108 ? 0.1571 0.1821 0.1576 -0.0113 0.0028  -0.0073 101 LEU B CD1 
3225 C CD2 . LEU B 108 ? 0.1316 0.1501 0.1300 -0.0106 0.0019  -0.0042 101 LEU B CD2 
3226 N N   . HIS B 109 ? 0.2147 0.2396 0.2106 -0.0190 0.0045  -0.0084 102 HIS B N   
3227 C CA  . HIS B 109 ? 0.2092 0.2338 0.1963 -0.0202 0.0061  -0.0109 102 HIS B CA  
3228 C C   . HIS B 109 ? 0.3000 0.3227 0.2846 -0.0221 0.0064  -0.0105 102 HIS B C   
3229 O O   . HIS B 109 ? 0.3307 0.3512 0.3216 -0.0236 0.0053  -0.0081 102 HIS B O   
3230 C CB  . HIS B 109 ? 0.1663 0.1900 0.1523 -0.0212 0.0065  -0.0112 102 HIS B CB  
3231 C CG  . HIS B 109 ? 0.2717 0.2966 0.2551 -0.0245 0.0080  -0.0130 102 HIS B CG  
3232 N ND1 . HIS B 109 ? 0.1646 0.1855 0.1448 -0.0264 0.0086  -0.0126 102 HIS B ND1 
3233 C CD2 . HIS B 109 ? 0.2440 0.2737 0.2273 -0.0265 0.0090  -0.0154 102 HIS B CD2 
3234 C CE1 . HIS B 109 ? 0.2014 0.2264 0.1892 -0.0326 0.0092  -0.0133 102 HIS B CE1 
3235 N NE2 . HIS B 109 ? 0.2614 0.2927 0.2518 -0.0328 0.0094  -0.0149 102 HIS B NE2 
3236 N N   . ASP B 110 ? 0.3233 0.3519 0.3156 -0.0269 0.0068  -0.0113 103 ASP B N   
3237 C CA  . ASP B 110 ? 0.4019 0.4262 0.3820 -0.0270 0.0078  -0.0121 103 ASP B CA  
3238 C C   . ASP B 110 ? 0.4312 0.4600 0.4100 -0.0300 0.0092  -0.0147 103 ASP B C   
3239 O O   . ASP B 110 ? 0.4001 0.4339 0.3812 -0.0296 0.0096  -0.0165 103 ASP B O   
3240 C CB  . ASP B 110 ? 0.3937 0.4200 0.3833 -0.0285 0.0064  -0.0099 103 ASP B CB  
3241 C CG  . ASP B 110 ? 0.3757 0.3963 0.3528 -0.0279 0.0067  -0.0096 103 ASP B CG  
3242 O OD1 . ASP B 110 ? 0.4424 0.4626 0.4285 -0.0290 0.0051  -0.0072 103 ASP B OD1 
3243 O OD2 . ASP B 110 ? 0.2240 0.2441 0.1976 -0.0310 0.0076  -0.0105 103 ASP B OD2 
3244 N N   . GLN B 111 ? 0.3825 0.4123 0.3688 -0.0365 0.0093  -0.0139 104 GLN B N   
3245 C CA  . GLN B 111 ? 0.4237 0.4581 0.4093 -0.0405 0.0107  -0.0162 104 GLN B CA  
3246 C C   . GLN B 111 ? 0.5536 0.5847 0.5238 -0.0390 0.0117  -0.0173 104 GLN B C   
3247 O O   . GLN B 111 ? 0.6909 0.7298 0.6739 -0.0463 0.0118  -0.0178 104 GLN B O   
3248 C CB  . GLN B 111 ? 0.2856 0.3151 0.2556 -0.0395 0.0130  -0.0187 104 GLN B CB  
3249 C CG  . GLN B 111 ? 0.3642 0.3959 0.3371 -0.0379 0.0131  -0.0197 104 GLN B CG  
3250 C CD  . GLN B 111 ? 0.5079 0.5376 0.4777 -0.0406 0.0145  -0.0207 104 GLN B CD  
3251 O OE1 . GLN B 111 ? 0.5234 0.5504 0.5047 -0.0441 0.0131  -0.0177 104 GLN B OE1 
3252 N NE2 . GLN B 111 ? 0.4689 0.5032 0.4376 -0.0438 0.0160  -0.0235 104 GLN B NE2 
3253 N N   . GLY B 112 ? 0.3792 0.4089 0.3611 -0.0414 0.0095  -0.0136 105 GLY B N   
3254 C CA  . GLY B 112 ? 0.3034 0.3323 0.2824 -0.0441 0.0093  -0.0129 105 GLY B CA  
3255 C C   . GLY B 112 ? 0.4332 0.4665 0.4145 -0.0430 0.0088  -0.0129 105 GLY B C   
3256 O O   . GLY B 112 ? 0.3062 0.3404 0.2907 -0.0392 0.0082  -0.0125 105 GLY B O   
3257 N N   . THR B 113 ? 0.4070 0.4396 0.3723 -0.0426 0.0100  -0.0146 106 THR B N   
3258 C CA  . THR B 113 ? 0.3380 0.3786 0.3193 -0.0464 0.0090  -0.0137 106 THR B CA  
3259 C C   . THR B 113 ? 0.3311 0.3650 0.2972 -0.0413 0.0081  -0.0121 106 THR B C   
3260 O O   . THR B 113 ? 0.3999 0.4307 0.3704 -0.0464 0.0041  -0.0117 106 THR B O   
3261 C CB  . THR B 113 ? 0.3760 0.4227 0.3564 -0.0511 0.0103  -0.0160 106 THR B CB  
3262 O OG1 . THR B 113 ? 0.3966 0.4376 0.3651 -0.0547 0.0071  -0.0184 106 THR B OG1 
3263 C CG2 . THR B 113 ? 0.2403 0.2927 0.2239 -0.0512 0.0118  -0.0192 106 THR B CG2 
3264 N N   . ALA B 114 ? 0.3035 0.3404 0.2726 -0.0393 0.0077  -0.0121 107 ALA B N   
3265 C CA  . ALA B 114 ? 0.3287 0.3668 0.3108 -0.0418 0.0056  -0.0087 107 ALA B CA  
3266 C C   . ALA B 114 ? 0.3873 0.4259 0.3601 -0.0469 0.0028  -0.0100 107 ALA B C   
3267 O O   . ALA B 114 ? 0.3002 0.3440 0.2722 -0.0504 0.0035  -0.0118 107 ALA B O   
3268 C CB  . ALA B 114 ? 0.2269 0.2651 0.1996 -0.0357 0.0061  -0.0102 107 ALA B CB  
3269 N N   . GLN B 115 ? 0.4074 0.4424 0.3757 -0.0492 0.0020  -0.0073 108 GLN B N   
3270 C CA  . GLN B 115 ? 0.2674 0.3038 0.2287 -0.0563 0.0016  -0.0056 108 GLN B CA  
3271 C C   . GLN B 115 ? 0.4266 0.4660 0.3883 -0.0565 0.0001  -0.0029 108 GLN B C   
3272 O O   . GLN B 115 ? 0.4727 0.5122 0.4398 -0.0510 -0.0004 -0.0025 108 GLN B O   
3273 C CB  . GLN B 115 ? 0.3299 0.3593 0.2837 -0.0603 0.0014  -0.0039 108 GLN B CB  
3274 C CG  . GLN B 115 ? 0.4649 0.4920 0.4167 -0.0619 0.0032  -0.0066 108 GLN B CG  
3275 C CD  . GLN B 115 ? 0.6631 0.6970 0.6159 -0.0645 0.0044  -0.0094 108 GLN B CD  
3276 O OE1 . GLN B 115 ? 0.7145 0.7531 0.6645 -0.0691 0.0040  -0.0089 108 GLN B OE1 
3277 N NE2 . GLN B 115 ? 0.6954 0.7305 0.6520 -0.0620 0.0056  -0.0124 108 GLN B NE2 
3278 N N   . TRP B 116 ? 0.6202 0.6622 0.5757 -0.0633 -0.0008 -0.0008 109 TRP B N   
3279 C CA  . TRP B 116 ? 0.5659 0.6122 0.5219 -0.0642 -0.0026 0.0023  109 TRP B CA  
3280 C C   . TRP B 116 ? 0.4938 0.5355 0.4504 -0.0615 -0.0044 0.0058  109 TRP B C   
3281 O O   . TRP B 116 ? 0.3917 0.4362 0.3534 -0.0573 -0.0050 0.0068  109 TRP B O   
3282 C CB  . TRP B 116 ? 0.5139 0.5643 0.4626 -0.0729 -0.0038 0.0048  109 TRP B CB  
3283 C CG  . TRP B 116 ? 0.5315 0.5867 0.4812 -0.0729 -0.0056 0.0088  109 TRP B CG  
3284 C CD1 . TRP B 116 ? 0.4884 0.5364 0.4345 -0.0685 -0.0054 0.0156  109 TRP B CD1 
3285 C CD2 . TRP B 116 ? 0.4861 0.5498 0.4410 -0.0714 -0.0052 0.0073  109 TRP B CD2 
3286 N NE1 . TRP B 116 ? 0.3884 0.4434 0.3373 -0.0677 -0.0065 0.0177  109 TRP B NE1 
3287 C CE2 . TRP B 116 ? 0.4407 0.5075 0.3953 -0.0717 -0.0072 0.0123  109 TRP B CE2 
3288 C CE3 . TRP B 116 ? 0.6095 0.6774 0.5690 -0.0687 -0.0030 0.0026  109 TRP B CE3 
3289 C CZ2 . TRP B 116 ? 0.5755 0.6510 0.5343 -0.0712 -0.0074 0.0120  109 TRP B CZ2 
3290 C CZ3 . TRP B 116 ? 0.7672 0.8418 0.7301 -0.0676 -0.0029 0.0023  109 TRP B CZ3 
3291 C CH2 . TRP B 116 ? 0.7675 0.8458 0.7298 -0.0688 -0.0049 0.0067  109 TRP B CH2 
3292 N N   . ALA B 117 ? 0.5026 0.5350 0.4542 -0.0608 -0.0036 0.0080  110 ALA B N   
3293 C CA  . ALA B 117 ? 0.4577 0.4826 0.4099 -0.0542 -0.0030 0.0122  110 ALA B CA  
3294 C C   . ALA B 117 ? 0.5179 0.5432 0.4770 -0.0497 -0.0037 0.0093  110 ALA B C   
3295 O O   . ALA B 117 ? 0.6197 0.6408 0.5807 -0.0443 -0.0034 0.0120  110 ALA B O   
3296 C CB  . ALA B 117 ? 0.4023 0.4166 0.3477 -0.0537 -0.0009 0.0154  110 ALA B CB  
3297 N N   . ASP B 118 ? 0.3641 0.3932 0.3274 -0.0498 -0.0035 0.0042  111 ASP B N   
3298 C CA  . ASP B 118 ? 0.3939 0.4207 0.3635 -0.0426 -0.0028 0.0025  111 ASP B CA  
3299 C C   . ASP B 118 ? 0.4206 0.4512 0.3959 -0.0385 -0.0032 0.0030  111 ASP B C   
3300 O O   . ASP B 118 ? 0.5589 0.5872 0.5381 -0.0337 -0.0033 0.0031  111 ASP B O   
3301 C CB  . ASP B 118 ? 0.4293 0.4559 0.4018 -0.0402 -0.0011 -0.0011 111 ASP B CB  
3302 C CG  . ASP B 118 ? 0.4520 0.4747 0.4198 -0.0434 -0.0001 -0.0021 111 ASP B CG  
3303 O OD1 . ASP B 118 ? 0.5542 0.5724 0.5157 -0.0473 -0.0007 -0.0002 111 ASP B OD1 
3304 O OD2 . ASP B 118 ? 0.3790 0.4027 0.3488 -0.0422 0.0010  -0.0047 111 ASP B OD2 
3305 N N   . LEU B 119 ? 0.4167 0.4530 0.3919 -0.0408 -0.0034 0.0032  112 LEU B N   
3306 C CA  . LEU B 119 ? 0.3872 0.4268 0.3674 -0.0372 -0.0031 0.0025  112 LEU B CA  
3307 C C   . LEU B 119 ? 0.4939 0.5339 0.4762 -0.0349 -0.0042 0.0051  112 LEU B C   
3308 O O   . LEU B 119 ? 0.3868 0.4261 0.3734 -0.0304 -0.0037 0.0038  112 LEU B O   
3309 C CB  . LEU B 119 ? 0.2891 0.3353 0.2680 -0.0411 -0.0028 0.0017  112 LEU B CB  
3310 C CG  . LEU B 119 ? 0.3812 0.4289 0.3585 -0.0438 -0.0016 -0.0011 112 LEU B CG  
3311 C CD1 . LEU B 119 ? 0.3863 0.4413 0.3634 -0.0469 -0.0011 -0.0022 112 LEU B CD1 
3312 C CD2 . LEU B 119 ? 0.2475 0.2913 0.2289 -0.0390 -0.0006 -0.0040 112 LEU B CD2 
3313 N N   . SER B 120 ? 0.5463 0.5875 0.5257 -0.0381 -0.0059 0.0090  113 SER B N   
3314 C CA  . SER B 120 ? 0.3955 0.4397 0.3775 -0.0366 -0.0071 0.0122  113 SER B CA  
3315 C C   . SER B 120 ? 0.5103 0.5498 0.4963 -0.0309 -0.0066 0.0114  113 SER B C   
3316 O O   . SER B 120 ? 0.6716 0.7128 0.6611 -0.0278 -0.0063 0.0116  113 SER B O   
3317 C CB  . SER B 120 ? 0.2982 0.3395 0.2745 -0.0370 -0.0071 0.0177  113 SER B CB  
3318 O OG  . SER B 120 ? 0.5067 0.5378 0.4784 -0.0348 -0.0057 0.0192  113 SER B OG  
3319 N N   . SER B 121 ? 0.5146 0.5484 0.4995 -0.0302 -0.0063 0.0104  114 SER B N   
3320 C CA  . SER B 121 ? 0.2427 0.2717 0.2310 -0.0249 -0.0054 0.0084  114 SER B CA  
3321 C C   . SER B 121 ? 0.4091 0.4355 0.3983 -0.0229 -0.0040 0.0046  114 SER B C   
3322 O O   . SER B 121 ? 0.8066 0.8357 0.7946 -0.0253 -0.0036 0.0037  114 SER B O   
3323 C CB  . SER B 121 ? 0.4288 0.4538 0.4148 -0.0257 -0.0059 0.0097  114 SER B CB  
3324 O OG  . SER B 121 ? 0.7427 0.7653 0.7324 -0.0213 -0.0055 0.0089  114 SER B OG  
3325 N N   . GLN B 122 ? 0.4076 0.4295 0.3992 -0.0189 -0.0033 0.0029  115 GLN B N   
3326 C CA  . GLN B 122 ? 0.4391 0.4599 0.4255 -0.0176 -0.0010 0.0018  115 GLN B CA  
3327 C C   . GLN B 122 ? 0.3522 0.3764 0.3390 -0.0177 -0.0005 0.0010  115 GLN B C   
3328 O O   . GLN B 122 ? 0.3075 0.3351 0.2927 -0.0199 -0.0001 0.0001  115 GLN B O   
3329 C CB  . GLN B 122 ? 0.3861 0.4091 0.3770 -0.0220 -0.0004 0.0006  115 GLN B CB  
3330 C CG  . GLN B 122 ? 0.3615 0.3830 0.3525 -0.0212 0.0005  -0.0008 115 GLN B CG  
3331 C CD  . GLN B 122 ? 0.2843 0.3077 0.2772 -0.0195 0.0012  -0.0021 115 GLN B CD  
3332 O OE1 . GLN B 122 ? 0.1827 0.2071 0.1769 -0.0181 0.0011  -0.0020 115 GLN B OE1 
3333 N NE2 . GLN B 122 ? 0.2352 0.2590 0.2284 -0.0197 0.0020  -0.0035 115 GLN B NE2 
3334 N N   . PHE B 123 ? 0.1874 0.2131 0.1826 -0.0169 -0.0005 0.0009  116 PHE B N   
3335 C CA  . PHE B 123 ? 0.2437 0.2701 0.2328 -0.0155 -0.0001 0.0002  116 PHE B CA  
3336 C C   . PHE B 123 ? 0.3565 0.3848 0.3456 -0.0160 0.0011  -0.0023 116 PHE B C   
3337 O O   . PHE B 123 ? 0.3523 0.3858 0.3492 -0.0175 0.0014  -0.0034 116 PHE B O   
3338 C CB  . PHE B 123 ? 0.2530 0.2799 0.2500 -0.0145 -0.0004 0.0008  116 PHE B CB  
3339 C CG  . PHE B 123 ? 0.3403 0.3629 0.3377 -0.0123 -0.0003 0.0008  116 PHE B CG  
3340 C CD1 . PHE B 123 ? 0.3867 0.4086 0.3845 -0.0114 0.0002  -0.0005 116 PHE B CD1 
3341 C CD2 . PHE B 123 ? 0.4952 0.5133 0.4880 -0.0105 -0.0009 0.0020  116 PHE B CD2 
3342 C CE1 . PHE B 123 ? 0.4265 0.4450 0.4246 -0.0097 0.0001  -0.0003 116 PHE B CE1 
3343 C CE2 . PHE B 123 ? 0.4845 0.4997 0.4783 -0.0089 -0.0008 0.0018  116 PHE B CE2 
3344 C CZ  . PHE B 123 ? 0.4017 0.4177 0.3998 -0.0089 -0.0003 0.0007  116 PHE B CZ  
3345 N N   . TYR B 124 ? 0.3264 0.3540 0.3152 -0.0163 0.0015  -0.0033 117 TYR B N   
3346 C CA  . TYR B 124 ? 0.3702 0.4031 0.3671 -0.0181 0.0024  -0.0055 117 TYR B CA  
3347 C C   . TYR B 124 ? 0.3773 0.4111 0.3649 -0.0194 0.0034  -0.0075 117 TYR B C   
3348 O O   . TYR B 124 ? 0.4396 0.4763 0.4278 -0.0200 0.0045  -0.0102 117 TYR B O   
3349 C CB  . TYR B 124 ? 0.2963 0.3236 0.2872 -0.0147 0.0027  -0.0063 117 TYR B CB  
3350 C CG  . TYR B 124 ? 0.3019 0.3267 0.2946 -0.0122 0.0024  -0.0057 117 TYR B CG  
3351 C CD1 . TYR B 124 ? 0.1998 0.2210 0.1934 -0.0106 0.0019  -0.0045 117 TYR B CD1 
3352 C CD2 . TYR B 124 ? 0.2852 0.3113 0.2785 -0.0119 0.0026  -0.0066 117 TYR B CD2 
3353 C CE1 . TYR B 124 ? 0.2852 0.3059 0.2844 -0.0096 0.0014  -0.0036 117 TYR B CE1 
3354 C CE2 . TYR B 124 ? 0.1985 0.2244 0.1985 -0.0110 0.0021  -0.0056 117 TYR B CE2 
3355 C CZ  . TYR B 124 ? 0.3230 0.3449 0.3228 -0.0094 0.0016  -0.0043 117 TYR B CZ  
3356 O OH  . TYR B 124 ? 0.4229 0.4406 0.4191 -0.0071 0.0015  -0.0042 117 TYR B OH  
3357 N N   . LEU B 125 ? 0.2904 0.3273 0.2847 -0.0234 0.0026  -0.0053 118 LEU B N   
3358 C CA  . LEU B 125 ? 0.3185 0.3593 0.3116 -0.0270 0.0032  -0.0064 118 LEU B CA  
3359 C C   . LEU B 125 ? 0.4522 0.4971 0.4446 -0.0293 0.0030  -0.0060 118 LEU B C   
3360 O O   . LEU B 125 ? 0.5123 0.5522 0.4932 -0.0266 0.0020  -0.0041 118 LEU B O   
3361 C CB  . LEU B 125 ? 0.2283 0.2629 0.2090 -0.0262 0.0030  -0.0056 118 LEU B CB  
3362 C CG  . LEU B 125 ? 0.2242 0.2580 0.2151 -0.0271 0.0029  -0.0052 118 LEU B CG  
3363 C CD1 . LEU B 125 ? 0.2421 0.2708 0.2206 -0.0271 0.0028  -0.0047 118 LEU B CD1 
3364 C CD2 . LEU B 125 ? 0.1306 0.1671 0.1233 -0.0267 0.0041  -0.0077 118 LEU B CD2 
3365 N N   . ARG B 126 ? 0.4097 0.4602 0.4026 -0.0315 0.0041  -0.0085 119 ARG B N   
3366 C CA  . ARG B 126 ? 0.5076 0.5584 0.4864 -0.0313 0.0044  -0.0093 119 ARG B CA  
3367 C C   . ARG B 126 ? 0.4970 0.5562 0.4874 -0.0386 0.0046  -0.0093 119 ARG B C   
3368 O O   . ARG B 126 ? 0.3373 0.3945 0.3268 -0.0394 0.0049  -0.0096 119 ARG B O   
3369 C CB  . ARG B 126 ? 0.6239 0.6838 0.6185 -0.0335 0.0050  -0.0113 119 ARG B CB  
3370 C CG  . ARG B 126 ? 0.5998 0.6516 0.5831 -0.0272 0.0050  -0.0116 119 ARG B CG  
3371 C CD  . ARG B 126 ? 0.7848 0.8367 0.7672 -0.0274 0.0038  -0.0088 119 ARG B CD  
3372 N NE  . ARG B 126 ? 1.0672 1.1295 1.0630 -0.0313 0.0040  -0.0097 119 ARG B NE  
3373 C CZ  . ARG B 126 ? 1.0699 1.1318 1.0497 -0.0317 0.0042  -0.0100 119 ARG B CZ  
3374 N NH1 . ARG B 126 ? 1.0900 1.1522 1.0673 -0.0340 0.0033  -0.0076 119 ARG B NH1 
3375 N NH2 . ARG B 126 ? 0.9302 1.0032 0.9258 -0.0357 0.0045  -0.0110 119 ARG B NH2 
3376 N N   . GLU B 127 ? 0.5993 0.6642 0.5890 -0.0418 0.0048  -0.0098 120 GLU B N   
3377 C CA  . GLU B 127 ? 0.4966 0.5594 0.4668 -0.0426 0.0057  -0.0112 120 GLU B CA  
3378 C C   . GLU B 127 ? 0.3675 0.4400 0.3564 -0.0476 0.0071  -0.0143 120 GLU B C   
3379 O O   . GLU B 127 ? 0.3336 0.4063 0.3208 -0.0504 0.0075  -0.0147 120 GLU B O   
3380 C CB  . GLU B 127 ? 0.5600 0.6343 0.5437 -0.0503 0.0024  -0.0112 120 GLU B CB  
3381 C CG  . GLU B 127 ? 0.7219 0.7953 0.7041 -0.0499 0.0009  -0.0073 120 GLU B CG  
3382 C CD  . GLU B 127 ? 0.8421 0.9239 0.8219 -0.0547 0.0006  -0.0062 120 GLU B CD  
3383 O OE1 . GLU B 127 ? 0.9026 0.9875 0.8854 -0.0531 0.0011  -0.0073 120 GLU B OE1 
3384 O OE2 . GLU B 127 ? 0.8958 0.9813 0.8704 -0.0606 -0.0002 -0.0041 120 GLU B OE2 
3385 N N   . GLU B 128 ? 0.3857 0.4545 0.3597 -0.0415 0.0088  -0.0188 121 GLU B N   
3386 C CA  . GLU B 128 ? 0.3683 0.4477 0.3631 -0.0455 0.0097  -0.0214 121 GLU B CA  
3387 C C   . GLU B 128 ? 0.4843 0.5594 0.4790 -0.0442 0.0097  -0.0211 121 GLU B C   
3388 O O   . GLU B 128 ? 0.5241 0.5957 0.5006 -0.0421 0.0119  -0.0257 121 GLU B O   
3389 C CB  . GLU B 128 ? 0.3905 0.4640 0.3708 -0.0384 0.0112  -0.0263 121 GLU B CB  
3390 C CG  . GLU B 128 ? 0.6056 0.6737 0.5874 -0.0349 0.0098  -0.0232 121 GLU B CG  
3391 C CD  . GLU B 128 ? 0.7836 0.8516 0.7696 -0.0318 0.0103  -0.0261 121 GLU B CD  
3392 O OE1 . GLU B 128 ? 0.8786 0.9415 0.8662 -0.0287 0.0093  -0.0240 121 GLU B OE1 
3393 O OE2 . GLU B 128 ? 0.8409 0.9219 0.8461 -0.0360 0.0107  -0.0280 121 GLU B OE2 
3394 N N   . ASP B 129 ? 0.5211 0.5828 0.4988 -0.0373 0.0093  -0.0198 122 ASP B N   
3395 C CA  . ASP B 129 ? 0.3162 0.3799 0.3102 -0.0396 0.0085  -0.0178 122 ASP B CA  
3396 C C   . ASP B 129 ? 0.4498 0.5119 0.4406 -0.0429 0.0084  -0.0165 122 ASP B C   
3397 O O   . ASP B 129 ? 0.5606 0.6209 0.5515 -0.0425 0.0088  -0.0171 122 ASP B O   
3398 C CB  . ASP B 129 ? 0.2241 0.2813 0.2187 -0.0353 0.0073  -0.0154 122 ASP B CB  
3399 C CG  . ASP B 129 ? 0.4949 0.5529 0.4925 -0.0321 0.0074  -0.0167 122 ASP B CG  
3400 O OD1 . ASP B 129 ? 0.5411 0.6028 0.5416 -0.0315 0.0084  -0.0200 122 ASP B OD1 
3401 O OD2 . ASP B 129 ? 0.4208 0.4711 0.4052 -0.0276 0.0071  -0.0161 122 ASP B OD2 
3402 N N   . ILE B 130 ? 0.4621 0.5247 0.4498 -0.0464 0.0079  -0.0148 123 ILE B N   
3403 C CA  . ILE B 130 ? 0.5067 0.5621 0.4734 -0.0458 0.0085  -0.0151 123 ILE B CA  
3404 C C   . ILE B 130 ? 0.3607 0.4250 0.3453 -0.0523 0.0095  -0.0169 123 ILE B C   
3405 O O   . ILE B 130 ? 0.4093 0.4806 0.3958 -0.0540 0.0108  -0.0200 123 ILE B O   
3406 C CB  . ILE B 130 ? 0.4107 0.4731 0.3863 -0.0552 0.0041  -0.0149 123 ILE B CB  
3407 C CG1 . ILE B 130 ? 0.4592 0.5200 0.4338 -0.0543 0.0028  -0.0114 123 ILE B CG1 
3408 C CG2 . ILE B 130 ? 0.2106 0.2720 0.1796 -0.0611 0.0045  -0.0144 123 ILE B CG2 
3409 C CD1 . ILE B 130 ? 0.5115 0.5657 0.4829 -0.0540 0.0017  -0.0083 123 ILE B CD1 
3410 N N   . GLY B 131 ? 0.3486 0.4033 0.3143 -0.0476 0.0104  -0.0179 124 GLY B N   
3411 C CA  . GLY B 131 ? 0.3550 0.4186 0.3391 -0.0543 0.0111  -0.0194 124 GLY B CA  
3412 C C   . GLY B 131 ? 0.4046 0.4690 0.3929 -0.0502 0.0116  -0.0212 124 GLY B C   
3413 O O   . GLY B 131 ? 0.5583 0.6175 0.5289 -0.0464 0.0136  -0.0248 124 GLY B O   
3414 N N   . LYS B 132 ? 0.3272 0.3856 0.3016 -0.0418 0.0120  -0.0231 125 LYS B N   
3415 C CA  . LYS B 132 ? 0.3584 0.4165 0.3372 -0.0381 0.0121  -0.0243 125 LYS B CA  
3416 C C   . LYS B 132 ? 0.3270 0.3836 0.3205 -0.0397 0.0100  -0.0194 125 LYS B C   
3417 O O   . LYS B 132 ? 0.2905 0.3417 0.2814 -0.0394 0.0089  -0.0165 125 LYS B O   
3418 C CB  . LYS B 132 ? 0.4890 0.5546 0.4871 -0.0387 0.0107  -0.0231 125 LYS B CB  
3419 C CG  . LYS B 132 ? 0.5668 0.6327 0.5495 -0.0369 0.0128  -0.0285 125 LYS B CG  
3420 C CD  . LYS B 132 ? 0.5902 0.6637 0.5929 -0.0375 0.0113  -0.0269 125 LYS B CD  
3421 C CE  . LYS B 132 ? 0.6819 0.7546 0.6680 -0.0360 0.0135  -0.0328 125 LYS B CE  
3422 N NZ  . LYS B 132 ? 0.7667 0.8390 0.7552 -0.0335 0.0130  -0.0331 125 LYS B NZ  
3423 N N   . ASN B 133 ? 0.2910 0.3479 0.2862 -0.0383 0.0103  -0.0205 126 ASN B N   
3424 C CA  . ASN B 133 ? 0.3261 0.3768 0.3202 -0.0364 0.0096  -0.0183 126 ASN B CA  
3425 C C   . ASN B 133 ? 0.4104 0.4560 0.4047 -0.0326 0.0082  -0.0157 126 ASN B C   
3426 O O   . ASN B 133 ? 0.3641 0.4112 0.3610 -0.0299 0.0079  -0.0162 126 ASN B O   
3427 C CB  . ASN B 133 ? 0.2761 0.3296 0.2728 -0.0353 0.0101  -0.0203 126 ASN B CB  
3428 C CG  . ASN B 133 ? 0.4065 0.4544 0.4025 -0.0331 0.0093  -0.0182 126 ASN B CG  
3429 O OD1 . ASN B 133 ? 0.5167 0.5576 0.5026 -0.0267 0.0090  -0.0183 126 ASN B OD1 
3430 N ND2 . ASN B 133 ? 0.3345 0.3766 0.3157 -0.0321 0.0107  -0.0198 126 ASN B ND2 
3431 N N   . ARG B 134 ? 0.2977 0.3374 0.2894 -0.0324 0.0073  -0.0131 127 ARG B N   
3432 C CA  . ARG B 134 ? 0.2993 0.3346 0.2911 -0.0293 0.0061  -0.0107 127 ARG B CA  
3433 C C   . ARG B 134 ? 0.2832 0.3178 0.2777 -0.0255 0.0057  -0.0107 127 ARG B C   
3434 O O   . ARG B 134 ? 0.2645 0.2951 0.2515 -0.0210 0.0055  -0.0109 127 ARG B O   
3435 C CB  . ARG B 134 ? 0.2777 0.3047 0.2570 -0.0272 0.0058  -0.0093 127 ARG B CB  
3436 C CG  . ARG B 134 ? 0.3373 0.3665 0.3233 -0.0329 0.0050  -0.0077 127 ARG B CG  
3437 C CD  . ARG B 134 ? 0.2836 0.3067 0.2671 -0.0327 0.0040  -0.0057 127 ARG B CD  
3438 N NE  . ARG B 134 ? 0.2498 0.2698 0.2313 -0.0340 0.0046  -0.0062 127 ARG B NE  
3439 C CZ  . ARG B 134 ? 0.3125 0.3295 0.2848 -0.0377 0.0031  -0.0084 127 ARG B CZ  
3440 N NH1 . ARG B 134 ? 0.5196 0.5380 0.4879 -0.0420 0.0030  -0.0077 127 ARG B NH1 
3441 N NH2 . ARG B 134 ? 0.3652 0.3790 0.3347 -0.0392 0.0041  -0.0093 127 ARG B NH2 
3442 N N   . ALA B 135 ? 0.2920 0.3272 0.2873 -0.0253 0.0061  -0.0116 128 ALA B N   
3443 C CA  . ALA B 135 ? 0.3074 0.3417 0.3047 -0.0220 0.0056  -0.0114 128 ALA B CA  
3444 C C   . ALA B 135 ? 0.3279 0.3664 0.3281 -0.0206 0.0058  -0.0133 128 ALA B C   
3445 O O   . ALA B 135 ? 0.4185 0.4516 0.4116 -0.0162 0.0056  -0.0137 128 ALA B O   
3446 C CB  . ALA B 135 ? 0.2277 0.2587 0.2165 -0.0202 0.0064  -0.0129 128 ALA B CB  
3447 N N   . GLU B 136 ? 0.3778 0.4218 0.3793 -0.0225 0.0068  -0.0160 129 GLU B N   
3448 C CA  . GLU B 136 ? 0.3258 0.3695 0.3201 -0.0191 0.0077  -0.0203 129 GLU B CA  
3449 C C   . GLU B 136 ? 0.3572 0.4008 0.3517 -0.0187 0.0075  -0.0202 129 GLU B C   
3450 O O   . GLU B 136 ? 0.3250 0.3695 0.3221 -0.0167 0.0073  -0.0218 129 GLU B O   
3451 C CB  . GLU B 136 ? 0.2222 0.2719 0.2170 -0.0210 0.0088  -0.0242 129 GLU B CB  
3452 C CG  . GLU B 136 ? 0.5407 0.5981 0.5493 -0.0223 0.0080  -0.0235 129 GLU B CG  
3453 C CD  . GLU B 136 ? 0.7748 0.8307 0.7703 -0.0228 0.0100  -0.0281 129 GLU B CD  
3454 O OE1 . GLU B 136 ? 0.5377 0.6030 0.5456 -0.0285 0.0101  -0.0269 129 GLU B OE1 
3455 O OE2 . GLU B 136 ? 0.9193 0.9765 0.9155 -0.0225 0.0100  -0.0289 129 GLU B OE2 
3456 N N   . VAL B 137 ? 0.2127 0.2551 0.2045 -0.0206 0.0075  -0.0185 130 VAL B N   
3457 C CA  . VAL B 137 ? 0.2291 0.2716 0.2210 -0.0202 0.0073  -0.0182 130 VAL B CA  
3458 C C   . VAL B 137 ? 0.2662 0.3040 0.2592 -0.0175 0.0061  -0.0157 130 VAL B C   
3459 O O   . VAL B 137 ? 0.2934 0.3357 0.2970 -0.0178 0.0055  -0.0150 130 VAL B O   
3460 C CB  . VAL B 137 ? 0.2243 0.2717 0.2239 -0.0254 0.0067  -0.0155 130 VAL B CB  
3461 C CG1 . VAL B 137 ? 0.1268 0.1697 0.1156 -0.0225 0.0069  -0.0162 130 VAL B CG1 
3462 C CG2 . VAL B 137 ? 0.2569 0.3050 0.2442 -0.0262 0.0086  -0.0196 130 VAL B CG2 
3463 N N   . SER B 138 ? 0.3633 0.3970 0.3555 -0.0168 0.0054  -0.0130 131 SER B N   
3464 C CA  . SER B 138 ? 0.2999 0.3323 0.2999 -0.0161 0.0040  -0.0097 131 SER B CA  
3465 C C   . SER B 138 ? 0.3157 0.3445 0.3110 -0.0122 0.0042  -0.0114 131 SER B C   
3466 O O   . SER B 138 ? 0.2648 0.2916 0.2609 -0.0107 0.0037  -0.0105 131 SER B O   
3467 C CB  . SER B 138 ? 0.1164 0.1420 0.1079 -0.0147 0.0037  -0.0081 131 SER B CB  
3468 O OG  . SER B 138 ? 0.3053 0.3336 0.3016 -0.0184 0.0033  -0.0068 131 SER B OG  
3478 N N   . PRO B 140 ? 0.3425 0.3809 0.3518 -0.0098 0.0044  -0.0166 133 PRO B N   
3479 C CA  . PRO B 140 ? 0.2250 0.2589 0.2295 -0.0074 0.0038  -0.0202 133 PRO B CA  
3480 C C   . PRO B 140 ? 0.3224 0.3569 0.3326 -0.0075 0.0037  -0.0161 133 PRO B C   
3481 O O   . PRO B 140 ? 0.3608 0.3930 0.3723 -0.0056 0.0031  -0.0162 133 PRO B O   
3482 C CB  . PRO B 140 ? 0.1326 0.1714 0.1382 -0.0088 0.0046  -0.0239 133 PRO B CB  
3483 C CG  . PRO B 140 ? 0.2998 0.3478 0.3135 -0.0116 0.0057  -0.0224 133 PRO B CG  
3484 C CD  . PRO B 140 ? 0.3287 0.3722 0.3386 -0.0125 0.0050  -0.0188 133 PRO B CD  
3485 N N   . ARG B 141 ? 0.3402 0.3737 0.3477 -0.0092 0.0036  -0.0142 134 ARG B N   
3486 C CA  . ARG B 141 ? 0.3398 0.3701 0.3458 -0.0088 0.0033  -0.0122 134 ARG B CA  
3487 C C   . ARG B 141 ? 0.3046 0.3298 0.3090 -0.0073 0.0025  -0.0094 134 ARG B C   
3488 O O   . ARG B 141 ? 0.2907 0.3134 0.2951 -0.0062 0.0022  -0.0088 134 ARG B O   
3489 C CB  . ARG B 141 ? 0.5293 0.5606 0.5334 -0.0107 0.0034  -0.0111 134 ARG B CB  
3490 C CG  . ARG B 141 ? 0.7337 0.7705 0.7390 -0.0127 0.0043  -0.0138 134 ARG B CG  
3491 C CD  . ARG B 141 ? 0.8907 0.9304 0.8994 -0.0119 0.0047  -0.0170 134 ARG B CD  
3492 N NE  . ARG B 141 ? 0.9458 0.9786 0.9471 -0.0094 0.0047  -0.0178 134 ARG B NE  
3493 C CZ  . ARG B 141 ? 0.9416 0.9766 0.9431 -0.0102 0.0052  -0.0192 134 ARG B CZ  
3494 N NH1 . ARG B 141 ? 0.9227 0.9675 0.9327 -0.0137 0.0055  -0.0196 134 ARG B NH1 
3495 N NH2 . ARG B 141 ? 0.8347 0.8675 0.8368 -0.0093 0.0049  -0.0185 134 ARG B NH2 
3496 N N   . LEU B 142 ? 0.3852 0.4091 0.3883 -0.0077 0.0023  -0.0080 135 LEU B N   
3497 C CA  . LEU B 142 ? 0.3113 0.3310 0.3132 -0.0065 0.0017  -0.0058 135 LEU B CA  
3498 C C   . LEU B 142 ? 0.2854 0.3045 0.2885 -0.0049 0.0016  -0.0065 135 LEU B C   
3499 O O   . LEU B 142 ? 0.4454 0.4597 0.4447 -0.0036 0.0013  -0.0054 135 LEU B O   
3500 C CB  . LEU B 142 ? 0.1683 0.1875 0.1692 -0.0073 0.0017  -0.0050 135 LEU B CB  
3501 C CG  . LEU B 142 ? 0.1715 0.1896 0.1711 -0.0083 0.0015  -0.0037 135 LEU B CG  
3502 C CD1 . LEU B 142 ? 0.2247 0.2413 0.2195 -0.0086 0.0017  -0.0040 135 LEU B CD1 
3503 C CD2 . LEU B 142 ? 0.1063 0.1210 0.1055 -0.0071 0.0008  -0.0021 135 LEU B CD2 
3504 N N   . ALA B 143 ? 0.2437 0.2663 0.2491 -0.0046 0.0020  -0.0092 136 ALA B N   
3505 C CA  . ALA B 143 ? 0.1648 0.1871 0.1723 -0.0028 0.0015  -0.0105 136 ALA B CA  
3506 C C   . ALA B 143 ? 0.2829 0.3016 0.2889 -0.0012 0.0016  -0.0122 136 ALA B C   
3507 O O   . ALA B 143 ? 0.4173 0.4363 0.4269 0.0002  0.0003  -0.0142 136 ALA B O   
3508 C CB  . ALA B 143 ? 0.1793 0.2061 0.1900 -0.0025 0.0014  -0.0139 136 ALA B CB  
3509 N N   . GLU B 144 ? 0.3147 0.3326 0.3193 -0.0022 0.0013  -0.0122 137 GLU B N   
3510 C CA  . GLU B 144 ? 0.2597 0.2780 0.2678 -0.0011 0.0017  -0.0136 137 GLU B CA  
3511 C C   . GLU B 144 ? 0.3404 0.3558 0.3468 -0.0012 0.0013  -0.0108 137 GLU B C   
3512 O O   . GLU B 144 ? 0.2884 0.3033 0.2987 -0.0004 0.0005  -0.0125 137 GLU B O   
3513 C CB  . GLU B 144 ? 0.3963 0.4166 0.4044 -0.0019 0.0026  -0.0148 137 GLU B CB  
3514 C CG  . GLU B 144 ? 0.6644 0.6885 0.6754 -0.0019 0.0030  -0.0186 137 GLU B CG  
3515 C CD  . GLU B 144 ? 0.9299 0.9615 0.9455 -0.0047 0.0031  -0.0188 137 GLU B CD  
3516 O OE1 . GLU B 144 ? 1.0478 1.0839 1.0649 -0.0056 0.0037  -0.0212 137 GLU B OE1 
3517 O OE2 . GLU B 144 ? 0.9108 0.9368 0.9188 -0.0048 0.0031  -0.0195 137 GLU B OE2 
3518 N N   . LEU B 145 ? 0.2653 0.2791 0.2694 -0.0023 0.0011  -0.0061 138 LEU B N   
3519 C CA  . LEU B 145 ? 0.2207 0.2300 0.2204 -0.0022 0.0008  -0.0037 138 LEU B CA  
3520 C C   . LEU B 145 ? 0.3218 0.3314 0.3236 -0.0021 0.0001  -0.0031 138 LEU B C   
3521 O O   . LEU B 145 ? 0.4911 0.4981 0.4927 -0.0024 -0.0008 -0.0006 138 LEU B O   
3522 C CB  . LEU B 145 ? 0.1704 0.1798 0.1707 -0.0030 0.0005  -0.0016 138 LEU B CB  
3523 C CG  . LEU B 145 ? 0.1928 0.2033 0.1909 -0.0037 0.0007  -0.0021 138 LEU B CG  
3524 C CD1 . LEU B 145 ? 0.1316 0.1416 0.1312 -0.0042 0.0003  -0.0007 138 LEU B CD1 
3525 C CD2 . LEU B 145 ? 0.2409 0.2521 0.2387 -0.0040 0.0008  -0.0024 138 LEU B CD2 
3526 N N   . ASN B 146 ? 0.3473 0.3570 0.3526 -0.0016 -0.0014 -0.0036 139 ASN B N   
3527 C CA  . ASN B 146 ? 0.2156 0.2239 0.2226 -0.0020 -0.0034 -0.0007 139 ASN B CA  
3528 C C   . ASN B 146 ? 0.3360 0.3448 0.3476 -0.0007 -0.0052 -0.0026 139 ASN B C   
3529 O O   . ASN B 146 ? 0.4326 0.4436 0.4433 -0.0008 -0.0049 -0.0028 139 ASN B O   
3530 C CB  . ASN B 146 ? 0.2309 0.2359 0.2329 -0.0025 -0.0020 0.0024  139 ASN B CB  
3531 C CG  . ASN B 146 ? 0.2244 0.2259 0.2268 -0.0025 -0.0026 0.0042  139 ASN B CG  
3532 O OD1 . ASN B 146 ? 0.2983 0.2980 0.3051 -0.0028 -0.0053 0.0053  139 ASN B OD1 
3533 N ND2 . ASN B 146 ? 0.3154 0.3181 0.3165 -0.0024 -0.0023 0.0039  139 ASN B ND2 
3534 N N   . SER B 147 ? 0.3247 0.3304 0.3415 0.0006  -0.0075 -0.0040 140 SER B N   
3535 C CA  . SER B 147 ? 0.3196 0.3260 0.3414 0.0021  -0.0098 -0.0064 140 SER B CA  
3536 C C   . SER B 147 ? 0.3018 0.3088 0.3227 0.0018  -0.0111 -0.0032 140 SER B C   
3537 O O   . SER B 147 ? 0.3801 0.3900 0.4040 0.0032  -0.0127 -0.0045 140 SER B O   
3538 C CB  . SER B 147 ? 0.2835 0.2858 0.3116 0.0032  -0.0124 -0.0082 140 SER B CB  
3539 O OG  . SER B 147 ? 0.3362 0.3332 0.3642 0.0019  -0.0140 -0.0040 140 SER B OG  
3540 N N   . TYR B 148 ? 0.2091 0.2135 0.2260 0.0001  -0.0103 0.0008  141 TYR B N   
3541 C CA  . TYR B 148 ? 0.2582 0.2634 0.2739 -0.0005 -0.0110 0.0034  141 TYR B CA  
3542 C C   . TYR B 148 ? 0.3642 0.3753 0.3766 -0.0004 -0.0089 0.0020  141 TYR B C   
3543 O O   . TYR B 148 ? 0.4631 0.4768 0.4757 0.0000  -0.0098 0.0025  141 TYR B O   
3544 C CB  . TYR B 148 ? 0.2861 0.2862 0.2999 -0.0036 -0.0105 0.0077  141 TYR B CB  
3545 C CG  . TYR B 148 ? 0.4635 0.4599 0.4815 -0.0046 -0.0135 0.0090  141 TYR B CG  
3546 C CD1 . TYR B 148 ? 0.5007 0.4949 0.5227 -0.0032 -0.0152 0.0066  141 TYR B CD1 
3547 C CD2 . TYR B 148 ? 0.6242 0.6213 0.6420 -0.0066 -0.0143 0.0115  141 TYR B CD2 
3548 C CE1 . TYR B 148 ? 0.4890 0.4814 0.5148 -0.0039 -0.0179 0.0075  141 TYR B CE1 
3549 C CE2 . TYR B 148 ? 0.6317 0.6271 0.6532 -0.0073 -0.0174 0.0127  141 TYR B CE2 
3550 C CZ  . TYR B 148 ? 0.5778 0.5707 0.6033 -0.0060 -0.0193 0.0109  141 TYR B CZ  
3551 O OH  . TYR B 148 ? 0.6041 0.5953 0.6335 -0.0065 -0.0228 0.0125  141 TYR B OH  
3552 N N   . VAL B 149 ? 0.3960 0.4090 0.4059 -0.0006 -0.0065 -0.0003 142 VAL B N   
3553 C CA  . VAL B 149 ? 0.4177 0.4306 0.4247 -0.0016 -0.0047 0.0001  142 VAL B CA  
3554 C C   . VAL B 149 ? 0.5050 0.5225 0.5127 -0.0010 -0.0038 -0.0035 142 VAL B C   
3555 O O   . VAL B 149 ? 0.6464 0.6646 0.6529 -0.0006 -0.0022 -0.0062 142 VAL B O   
3556 C CB  . VAL B 149 ? 0.2470 0.2580 0.2466 -0.0032 -0.0006 0.0026  142 VAL B CB  
3557 C CG1 . VAL B 149 ? 0.0626 0.0724 0.0609 -0.0027 -0.0003 0.0012  142 VAL B CG1 
3558 C CG2 . VAL B 149 ? 0.2717 0.2776 0.2717 -0.0028 -0.0015 0.0038  142 VAL B CG2 
3559 N N   . PRO B 150 ? 0.4385 0.4599 0.4475 -0.0005 -0.0045 -0.0046 143 PRO B N   
3560 C CA  . PRO B 150 ? 0.3576 0.3842 0.3663 0.0002  -0.0029 -0.0096 143 PRO B CA  
3561 C C   . PRO B 150 ? 0.2602 0.2862 0.2630 -0.0014 0.0008  -0.0094 143 PRO B C   
3562 O O   . PRO B 150 ? 0.2380 0.2601 0.2383 -0.0026 0.0013  -0.0060 143 PRO B O   
3563 C CB  . PRO B 150 ? 0.3169 0.3473 0.3277 0.0007  -0.0046 -0.0094 143 PRO B CB  
3564 C CG  . PRO B 150 ? 0.2162 0.2431 0.2292 0.0003  -0.0077 -0.0044 143 PRO B CG  
3565 C CD  . PRO B 150 ? 0.3071 0.3286 0.3171 -0.0009 -0.0064 -0.0020 143 PRO B CD  
3566 N N   . VAL B 151 ? 0.3030 0.3279 0.3063 -0.0016 0.0013  -0.0107 144 VAL B N   
3567 C CA  . VAL B 151 ? 0.2151 0.2402 0.2201 -0.0038 0.0014  -0.0085 144 VAL B CA  
3568 C C   . VAL B 151 ? 0.2161 0.2432 0.2175 -0.0041 0.0017  -0.0125 144 VAL B C   
3569 O O   . VAL B 151 ? 0.3622 0.3914 0.3656 -0.0033 0.0015  -0.0154 144 VAL B O   
3570 C CB  . VAL B 151 ? 0.2851 0.3054 0.2851 -0.0039 0.0014  -0.0083 144 VAL B CB  
3571 C CG1 . VAL B 151 ? 0.2755 0.2959 0.2740 -0.0056 0.0019  -0.0074 144 VAL B CG1 
3572 C CG2 . VAL B 151 ? 0.3427 0.3591 0.3422 -0.0031 0.0011  -0.0057 144 VAL B CG2 
3573 N N   . THR B 152 ? 0.0907 0.1193 0.0910 -0.0057 0.0021  -0.0122 145 THR B N   
3574 C CA  . THR B 152 ? 0.1929 0.2304 0.2009 -0.0074 0.0030  -0.0140 145 THR B CA  
3575 C C   . THR B 152 ? 0.3465 0.3800 0.3455 -0.0092 0.0037  -0.0145 145 THR B C   
3576 O O   . THR B 152 ? 0.3399 0.3733 0.3439 -0.0109 0.0033  -0.0109 145 THR B O   
3577 C CB  . THR B 152 ? 0.3960 0.4377 0.4058 -0.0065 0.0027  -0.0159 145 THR B CB  
3578 O OG1 . THR B 152 ? 0.2558 0.2909 0.2567 -0.0056 0.0021  -0.0150 145 THR B OG1 
3579 C CG2 . THR B 152 ? 0.6515 0.6918 0.6578 -0.0031 0.0031  -0.0204 145 THR B CG2 
3580 N N   . ALA B 153 ? 0.3077 0.3496 0.3151 -0.0120 0.0042  -0.0157 146 ALA B N   
3581 C CA  . ALA B 153 ? 0.2264 0.2642 0.2235 -0.0135 0.0054  -0.0169 146 ALA B CA  
3582 C C   . ALA B 153 ? 0.2955 0.3372 0.2923 -0.0150 0.0061  -0.0189 146 ALA B C   
3583 O O   . ALA B 153 ? 0.2404 0.2866 0.2390 -0.0144 0.0062  -0.0217 146 ALA B O   
3584 C CB  . ALA B 153 ? 0.1459 0.1855 0.1427 -0.0148 0.0061  -0.0183 146 ALA B CB  
3585 N N   . TYR B 154 ? 0.2198 0.2595 0.2142 -0.0171 0.0065  -0.0176 147 TYR B N   
3586 C CA  . TYR B 154 ? 0.2196 0.2629 0.2132 -0.0193 0.0075  -0.0196 147 TYR B CA  
3587 C C   . TYR B 154 ? 0.3118 0.3538 0.3025 -0.0225 0.0085  -0.0195 147 TYR B C   
3588 O O   . TYR B 154 ? 0.3906 0.4316 0.3896 -0.0251 0.0074  -0.0156 147 TYR B O   
3589 C CB  . TYR B 154 ? 0.0986 0.1406 0.0920 -0.0189 0.0071  -0.0185 147 TYR B CB  
3590 C CG  . TYR B 154 ? 0.1416 0.1867 0.1337 -0.0215 0.0082  -0.0203 147 TYR B CG  
3591 C CD1 . TYR B 154 ? 0.1416 0.1990 0.1473 -0.0245 0.0080  -0.0217 147 TYR B CD1 
3592 C CD2 . TYR B 154 ? 0.2133 0.2550 0.2028 -0.0236 0.0087  -0.0192 147 TYR B CD2 
3593 C CE1 . TYR B 154 ? 0.1164 0.1775 0.1219 -0.0274 0.0090  -0.0234 147 TYR B CE1 
3594 C CE2 . TYR B 154 ? 0.1951 0.2443 0.1950 -0.0292 0.0090  -0.0194 147 TYR B CE2 
3595 C CZ  . TYR B 154 ? 0.2061 0.2572 0.1955 -0.0270 0.0104  -0.0243 147 TYR B CZ  
3596 O OH  . TYR B 154 ? 0.3454 0.3995 0.3333 -0.0299 0.0117  -0.0264 147 TYR B OH  
3597 N N   . THR B 155 ? 0.2906 0.3373 0.2807 -0.0250 0.0097  -0.0223 148 THR B N   
3598 C CA  . THR B 155 ? 0.4118 0.4578 0.3988 -0.0283 0.0107  -0.0225 148 THR B CA  
3599 C C   . THR B 155 ? 0.5110 0.5636 0.5091 -0.0350 0.0110  -0.0221 148 THR B C   
3600 O O   . THR B 155 ? 0.4748 0.5271 0.4705 -0.0387 0.0120  -0.0226 148 THR B O   
3601 C CB  . THR B 155 ? 0.2594 0.3152 0.2603 -0.0325 0.0104  -0.0226 148 THR B CB  
3602 O OG1 . THR B 155 ? 0.3443 0.4076 0.3489 -0.0321 0.0109  -0.0259 148 THR B OG1 
3603 C CG2 . THR B 155 ? 0.2312 0.2844 0.2327 -0.0296 0.0094  -0.0211 148 THR B CG2 
3604 N N   . GLY B 156 ? 0.5793 0.6339 0.5788 -0.0342 0.0110  -0.0228 149 GLY B N   
3605 C CA  . GLY B 156 ? 0.4057 0.4619 0.4040 -0.0376 0.0121  -0.0242 149 GLY B CA  
3606 C C   . GLY B 156 ? 0.3458 0.3900 0.3270 -0.0346 0.0132  -0.0241 149 GLY B C   
3607 O O   . GLY B 156 ? 0.3144 0.3576 0.3081 -0.0361 0.0111  -0.0195 149 GLY B O   
3608 N N   . PRO B 157 ? 0.3417 0.3865 0.3206 -0.0376 0.0146  -0.0256 150 PRO B N   
3609 C CA  . PRO B 157 ? 0.4017 0.4449 0.3917 -0.0429 0.0137  -0.0222 150 PRO B CA  
3610 C C   . PRO B 157 ? 0.3898 0.4317 0.3812 -0.0397 0.0126  -0.0209 150 PRO B C   
3611 O O   . PRO B 157 ? 0.3540 0.4008 0.3487 -0.0374 0.0118  -0.0214 150 PRO B O   
3612 C CB  . PRO B 157 ? 0.4194 0.4611 0.3928 -0.0429 0.0170  -0.0271 150 PRO B CB  
3613 C CG  . PRO B 157 ? 0.2966 0.3469 0.2733 -0.0425 0.0170  -0.0298 150 PRO B CG  
3614 C CD  . PRO B 157 ? 0.3052 0.3627 0.3003 -0.0445 0.0146  -0.0268 150 PRO B CD  
3615 N N   . LEU B 158 ? 0.3418 0.3772 0.3306 -0.0398 0.0127  -0.0195 151 LEU B N   
3616 C CA  . LEU B 158 ? 0.3482 0.3819 0.3378 -0.0374 0.0118  -0.0183 151 LEU B CA  
3617 C C   . LEU B 158 ? 0.3728 0.4061 0.3498 -0.0359 0.0140  -0.0220 151 LEU B C   
3618 O O   . LEU B 158 ? 0.4083 0.4410 0.3955 -0.0415 0.0138  -0.0203 151 LEU B O   
3619 C CB  . LEU B 158 ? 0.2722 0.2980 0.2592 -0.0363 0.0115  -0.0163 151 LEU B CB  
3620 C CG  . LEU B 158 ? 0.3610 0.3818 0.3382 -0.0303 0.0111  -0.0156 151 LEU B CG  
3621 C CD1 . LEU B 158 ? 0.2422 0.2571 0.2187 -0.0288 0.0105  -0.0136 151 LEU B CD1 
3622 C CD2 . LEU B 158 ? 0.3205 0.3481 0.3112 -0.0305 0.0089  -0.0138 151 LEU B CD2 
3623 N N   . VAL B 159 ? 0.2953 0.3399 0.2880 -0.0398 0.0128  -0.0218 152 VAL B N   
3624 C CA  . VAL B 159 ? 0.3141 0.3637 0.3077 -0.0418 0.0136  -0.0238 152 VAL B CA  
3625 C C   . VAL B 159 ? 0.4056 0.4553 0.4002 -0.0393 0.0124  -0.0226 152 VAL B C   
3626 O O   . VAL B 159 ? 0.5079 0.5506 0.4903 -0.0323 0.0119  -0.0222 152 VAL B O   
3627 C CB  . VAL B 159 ? 0.2770 0.3299 0.2576 -0.0385 0.0152  -0.0289 152 VAL B CB  
3628 C CG1 . VAL B 159 ? 0.1930 0.2462 0.1714 -0.0416 0.0168  -0.0306 152 VAL B CG1 
3629 C CG2 . VAL B 159 ? 0.2395 0.2956 0.2237 -0.0347 0.0134  -0.0281 152 VAL B CG2 
3630 N N   . GLU B 160 ? 0.5111 0.5589 0.4911 -0.0373 0.0144  -0.0262 153 GLU B N   
3631 C CA  . GLU B 160 ? 0.4189 0.4721 0.4142 -0.0396 0.0122  -0.0230 153 GLU B CA  
3632 C C   . GLU B 160 ? 0.4904 0.5488 0.4887 -0.0360 0.0105  -0.0221 153 GLU B C   
3633 O O   . GLU B 160 ? 0.5637 0.6200 0.5621 -0.0334 0.0093  -0.0200 153 GLU B O   
3634 C CB  . GLU B 160 ? 0.4238 0.4801 0.4185 -0.0431 0.0136  -0.0251 153 GLU B CB  
3635 C CG  . GLU B 160 ? 0.6420 0.6870 0.6176 -0.0420 0.0170  -0.0283 153 GLU B CG  
3636 C CD  . GLU B 160 ? 0.7923 0.8449 0.7828 -0.0503 0.0172  -0.0283 153 GLU B CD  
3637 O OE1 . GLU B 160 ? 0.7353 0.7771 0.7061 -0.0476 0.0206  -0.0316 153 GLU B OE1 
3638 O OE2 . GLU B 160 ? 0.8688 0.9236 0.8440 -0.0457 0.0183  -0.0323 153 GLU B OE2 
3639 N N   . ASP B 161 ? 0.4837 0.5425 0.4690 -0.0323 0.0115  -0.0260 154 ASP B N   
3640 C CA  . ASP B 161 ? 0.5376 0.6076 0.5408 -0.0322 0.0091  -0.0233 154 ASP B CA  
3641 C C   . ASP B 161 ? 0.6209 0.6791 0.6102 -0.0260 0.0086  -0.0226 154 ASP B C   
3642 O O   . ASP B 161 ? 0.7915 0.8556 0.7952 -0.0258 0.0067  -0.0190 154 ASP B O   
3643 C CB  . ASP B 161 ? 0.5658 0.6439 0.5716 -0.0325 0.0095  -0.0262 154 ASP B CB  
3644 C CG  . ASP B 161 ? 0.8114 0.8972 0.8181 -0.0351 0.0103  -0.0288 154 ASP B CG  
3645 O OD1 . ASP B 161 ? 1.0624 1.1446 1.0513 -0.0336 0.0123  -0.0345 154 ASP B OD1 
3646 O OD2 . ASP B 161 ? 0.7430 0.8216 0.7312 -0.0318 0.0108  -0.0307 154 ASP B OD2 
3647 N N   . PHE B 162 ? 0.4854 0.5398 0.4741 -0.0265 0.0091  -0.0225 155 PHE B N   
3648 C CA  . PHE B 162 ? 0.3339 0.3891 0.3358 -0.0265 0.0074  -0.0185 155 PHE B CA  
3649 C C   . PHE B 162 ? 0.3300 0.3788 0.3301 -0.0253 0.0067  -0.0158 155 PHE B C   
3650 O O   . PHE B 162 ? 0.3961 0.4394 0.3865 -0.0203 0.0061  -0.0154 155 PHE B O   
3651 C CB  . PHE B 162 ? 0.2561 0.3089 0.2571 -0.0280 0.0082  -0.0190 155 PHE B CB  
3652 C CG  . PHE B 162 ? 0.3410 0.3884 0.3414 -0.0255 0.0073  -0.0168 155 PHE B CG  
3653 C CD1 . PHE B 162 ? 0.3317 0.3724 0.3296 -0.0261 0.0074  -0.0151 155 PHE B CD1 
3654 C CD2 . PHE B 162 ? 0.3096 0.3590 0.3121 -0.0226 0.0065  -0.0167 155 PHE B CD2 
3655 C CE1 . PHE B 162 ? 0.2783 0.3149 0.2759 -0.0239 0.0066  -0.0133 155 PHE B CE1 
3656 C CE2 . PHE B 162 ? 0.3202 0.3649 0.3222 -0.0207 0.0058  -0.0149 155 PHE B CE2 
3657 C CZ  . PHE B 162 ? 0.3182 0.3532 0.3089 -0.0193 0.0064  -0.0143 155 PHE B CZ  
3658 N N   . LEU B 163 ? 0.2826 0.3276 0.2805 -0.0276 0.0075  -0.0158 156 LEU B N   
3659 C CA  . LEU B 163 ? 0.2575 0.2969 0.2539 -0.0268 0.0071  -0.0139 156 LEU B CA  
3660 C C   . LEU B 163 ? 0.2916 0.3333 0.2888 -0.0254 0.0062  -0.0131 156 LEU B C   
3661 O O   . LEU B 163 ? 0.2853 0.3199 0.2729 -0.0213 0.0058  -0.0121 156 LEU B O   
3662 C CB  . LEU B 163 ? 0.2768 0.3127 0.2707 -0.0299 0.0084  -0.0149 156 LEU B CB  
3663 C CG  . LEU B 163 ? 0.3346 0.3655 0.3264 -0.0310 0.0092  -0.0148 156 LEU B CG  
3664 C CD1 . LEU B 163 ? 0.2207 0.2457 0.1993 -0.0310 0.0119  -0.0176 156 LEU B CD1 
3665 C CD2 . LEU B 163 ? 0.3748 0.4005 0.3662 -0.0281 0.0081  -0.0126 156 LEU B CD2 
3666 N N   . SER B 164 ? 0.3741 0.4177 0.3612 -0.0242 0.0071  -0.0159 157 SER B N   
3667 C CA  . SER B 164 ? 0.3329 0.3790 0.3201 -0.0238 0.0064  -0.0152 157 SER B CA  
3668 C C   . SER B 164 ? 0.2834 0.3334 0.2829 -0.0228 0.0045  -0.0116 157 SER B C   
3669 O O   . SER B 164 ? 0.4615 0.5060 0.4500 -0.0204 0.0043  -0.0110 157 SER B O   
3670 C CB  . SER B 164 ? 0.1715 0.2304 0.1714 -0.0280 0.0064  -0.0160 157 SER B CB  
3671 O OG  . SER B 164 ? 0.7232 0.7814 0.7121 -0.0235 0.0063  -0.0179 157 SER B OG  
3672 N N   . GLY B 165 ? 0.2665 0.3127 0.2568 -0.0188 0.0044  -0.0124 158 GLY B N   
3673 C CA  . GLY B 165 ? 0.3458 0.3910 0.3374 -0.0161 0.0033  -0.0102 158 GLY B CA  
3674 C C   . GLY B 165 ? 0.4202 0.4592 0.4117 -0.0151 0.0026  -0.0077 158 GLY B C   
3675 O O   . GLY B 165 ? 0.4412 0.4831 0.4415 -0.0147 0.0017  -0.0053 158 GLY B O   
3676 N N   . PHE B 166 ? 0.2713 0.3092 0.2701 -0.0176 0.0028  -0.0072 159 PHE B N   
3677 C CA  . PHE B 166 ? 0.2818 0.3111 0.2727 -0.0149 0.0025  -0.0060 159 PHE B CA  
3678 C C   . PHE B 166 ? 0.3007 0.3285 0.2907 -0.0155 0.0023  -0.0052 159 PHE B C   
3679 O O   . PHE B 166 ? 0.3738 0.4030 0.3624 -0.0175 0.0031  -0.0065 159 PHE B O   
3680 C CB  . PHE B 166 ? 0.2445 0.2727 0.2416 -0.0166 0.0028  -0.0059 159 PHE B CB  
3681 C CG  . PHE B 166 ? 0.2162 0.2433 0.2075 -0.0146 0.0031  -0.0072 159 PHE B CG  
3682 C CD1 . PHE B 166 ? 0.1190 0.1517 0.1172 -0.0181 0.0038  -0.0085 159 PHE B CD1 
3683 C CD2 . PHE B 166 ? 0.1865 0.2125 0.1791 -0.0125 0.0024  -0.0061 159 PHE B CD2 
3684 C CE1 . PHE B 166 ? 0.1660 0.2009 0.1652 -0.0177 0.0040  -0.0095 159 PHE B CE1 
3685 C CE2 . PHE B 166 ? 0.2304 0.2609 0.2302 -0.0133 0.0025  -0.0066 159 PHE B CE2 
3686 C CZ  . PHE B 166 ? 0.2314 0.2622 0.2243 -0.0139 0.0036  -0.0094 159 PHE B CZ  
3687 N N   . GLN B 167 ? 0.2214 0.2489 0.2184 -0.0153 0.0014  -0.0031 160 GLN B N   
3688 C CA  . GLN B 167 ? 0.2766 0.3001 0.2665 -0.0145 0.0014  -0.0029 160 GLN B CA  
3689 C C   . GLN B 167 ? 0.3413 0.3624 0.3364 -0.0158 0.0016  -0.0031 160 GLN B C   
3690 O O   . GLN B 167 ? 0.3440 0.3639 0.3381 -0.0170 0.0021  -0.0037 160 GLN B O   
3691 C CB  . GLN B 167 ? 0.3913 0.4166 0.3880 -0.0143 0.0004  -0.0008 160 GLN B CB  
3692 C CG  . GLN B 167 ? 0.2569 0.2871 0.2544 -0.0148 0.0000  0.0000  160 GLN B CG  
3693 C CD  . GLN B 167 ? 0.4005 0.4334 0.3990 -0.0138 0.0000  0.0000  160 GLN B CD  
3694 O OE1 . GLN B 167 ? 0.4684 0.4966 0.4613 -0.0110 -0.0003 0.0008  160 GLN B OE1 
3695 N NE2 . GLN B 167 ? 0.4049 0.4398 0.3962 -0.0137 0.0004  -0.0012 160 GLN B NE2 
3696 N N   . VAL B 168 ? 0.3959 0.4129 0.3862 -0.0131 0.0016  -0.0030 161 VAL B N   
3697 C CA  . VAL B 168 ? 0.3553 0.3686 0.3452 -0.0129 0.0019  -0.0032 161 VAL B CA  
3698 C C   . VAL B 168 ? 0.3569 0.3709 0.3512 -0.0145 0.0022  -0.0035 161 VAL B C   
3699 O O   . VAL B 168 ? 0.2307 0.2446 0.2214 -0.0123 0.0020  -0.0035 161 VAL B O   
3700 C CB  . VAL B 168 ? 0.1736 0.1858 0.1687 -0.0119 0.0010  -0.0016 161 VAL B CB  
3701 C CG1 . VAL B 168 ? 0.2015 0.2104 0.1957 -0.0118 0.0013  -0.0019 161 VAL B CG1 
3702 C CG2 . VAL B 168 ? 0.0887 0.1020 0.0841 -0.0117 0.0005  -0.0009 161 VAL B CG2 
3703 N N   . VAL B 169 ? 0.2906 0.3027 0.2834 -0.0161 0.0031  -0.0045 162 VAL B N   
3704 C CA  . VAL B 169 ? 0.2248 0.2360 0.2168 -0.0170 0.0037  -0.0051 162 VAL B CA  
3705 C C   . VAL B 169 ? 0.3557 0.3628 0.3466 -0.0163 0.0037  -0.0046 162 VAL B C   
3706 O O   . VAL B 169 ? 0.4015 0.4059 0.3912 -0.0166 0.0042  -0.0048 162 VAL B O   
3707 C CB  . VAL B 169 ? 0.3132 0.3255 0.3039 -0.0200 0.0050  -0.0068 162 VAL B CB  
3708 C CG1 . VAL B 169 ? 0.3031 0.3124 0.2864 -0.0193 0.0063  -0.0080 162 VAL B CG1 
3709 C CG2 . VAL B 169 ? 0.2570 0.2730 0.2428 -0.0188 0.0054  -0.0082 162 VAL B CG2 
3710 N N   . VAL B 170 ? 0.3239 0.3301 0.3109 -0.0140 0.0035  -0.0044 163 VAL B N   
3711 C CA  . VAL B 170 ? 0.3444 0.3477 0.3307 -0.0136 0.0035  -0.0039 163 VAL B CA  
3712 C C   . VAL B 170 ? 0.3672 0.3698 0.3555 -0.0170 0.0040  -0.0043 163 VAL B C   
3713 O O   . VAL B 170 ? 0.3687 0.3734 0.3530 -0.0160 0.0042  -0.0049 163 VAL B O   
3714 C CB  . VAL B 170 ? 0.3099 0.3135 0.2984 -0.0114 0.0022  -0.0026 163 VAL B CB  
3715 C CG1 . VAL B 170 ? 0.1550 0.1564 0.1459 -0.0122 0.0020  -0.0021 163 VAL B CG1 
3716 C CG2 . VAL B 170 ? 0.3257 0.3299 0.3162 -0.0098 0.0015  -0.0019 163 VAL B CG2 
3717 N N   . LEU B 171 ? 0.1622 0.1610 0.1433 -0.0166 0.0054  -0.0052 164 LEU B N   
3718 C CA  . LEU B 171 ? 0.1849 0.1816 0.1679 -0.0205 0.0058  -0.0054 164 LEU B CA  
3719 C C   . LEU B 171 ? 0.3115 0.3057 0.2883 -0.0181 0.0058  -0.0050 164 LEU B C   
3720 O O   . LEU B 171 ? 0.3952 0.3842 0.3713 -0.0192 0.0056  -0.0059 164 LEU B O   
3721 C CB  . LEU B 171 ? 0.1981 0.1921 0.1783 -0.0231 0.0077  -0.0067 164 LEU B CB  
3722 C CG  . LEU B 171 ? 0.2702 0.2677 0.2515 -0.0247 0.0083  -0.0079 164 LEU B CG  
3723 C CD1 . LEU B 171 ? 0.2851 0.2800 0.2569 -0.0248 0.0113  -0.0102 164 LEU B CD1 
3724 C CD2 . LEU B 171 ? 0.2877 0.2900 0.2641 -0.0233 0.0087  -0.0091 164 LEU B CD2 
3725 N N   . THR B 172 ? 0.3778 0.3735 0.3597 -0.0203 0.0046  -0.0042 165 THR B N   
3726 C CA  . THR B 172 ? 0.3440 0.3364 0.3192 -0.0218 0.0040  -0.0050 165 THR B CA  
3727 C C   . THR B 172 ? 0.4225 0.4144 0.3936 -0.0257 0.0050  -0.0060 165 THR B C   
3728 O O   . THR B 172 ? 0.4286 0.4241 0.4022 -0.0256 0.0048  -0.0070 165 THR B O   
3729 C CB  . THR B 172 ? 0.1374 0.1335 0.1164 -0.0197 0.0022  -0.0037 165 THR B CB  
3730 O OG1 . THR B 172 ? 0.2445 0.2451 0.2284 -0.0202 0.0027  -0.0027 165 THR B OG1 
3731 C CG2 . THR B 172 ? 0.1704 0.1688 0.1525 -0.0147 0.0022  -0.0021 165 THR B CG2 
3732 N N   . ASN B 173 ? 0.4180 0.4049 0.3821 -0.0297 0.0059  -0.0056 166 ASN B N   
3733 C CA  . ASN B 173 ? 0.2040 0.1910 0.1640 -0.0341 0.0064  -0.0063 166 ASN B CA  
3734 C C   . ASN B 173 ? 0.3741 0.3605 0.3324 -0.0361 0.0083  -0.0083 166 ASN B C   
3735 O O   . ASN B 173 ? 0.4749 0.4646 0.4330 -0.0384 0.0084  -0.0094 166 ASN B O   
3736 C CB  . ASN B 173 ? 0.3409 0.3356 0.3065 -0.0327 0.0046  -0.0058 166 ASN B CB  
3737 C CG  . ASN B 173 ? 0.4293 0.4247 0.3903 -0.0377 0.0049  -0.0060 166 ASN B CG  
3738 O OD1 . ASN B 173 ? 0.5287 0.5191 0.4823 -0.0420 0.0050  -0.0049 166 ASN B OD1 
3739 N ND2 . ASN B 173 ? 0.3572 0.3583 0.3218 -0.0374 0.0048  -0.0074 166 ASN B ND2 
3740 N N   . THR B 174 ? 0.4031 0.3856 0.3603 -0.0353 0.0098  -0.0091 167 THR B N   
3741 C CA  . THR B 174 ? 0.2167 0.1996 0.1733 -0.0369 0.0113  -0.0111 167 THR B CA  
3742 C C   . THR B 174 ? 0.2395 0.2130 0.1867 -0.0413 0.0147  -0.0121 167 THR B C   
3743 O O   . THR B 174 ? 0.4365 0.4027 0.3799 -0.0407 0.0163  -0.0115 167 THR B O   
3744 C CB  . THR B 174 ? 0.3432 0.3296 0.3060 -0.0328 0.0105  -0.0114 167 THR B CB  
3745 O OG1 . THR B 174 ? 0.4114 0.4043 0.3814 -0.0288 0.0078  -0.0103 167 THR B OG1 
3746 C CG2 . THR B 174 ? 0.3033 0.2909 0.2657 -0.0346 0.0118  -0.0134 167 THR B CG2 
3747 N N   . PRO B 175 ? 0.3267 0.2994 0.2695 -0.0459 0.0163  -0.0138 168 PRO B N   
3748 C CA  . PRO B 175 ? 0.3475 0.3098 0.2802 -0.0504 0.0202  -0.0149 168 PRO B CA  
3749 C C   . PRO B 175 ? 0.5174 0.4774 0.4518 -0.0482 0.0222  -0.0159 168 PRO B C   
3750 O O   . PRO B 175 ? 0.5728 0.5407 0.5156 -0.0445 0.0203  -0.0162 168 PRO B O   
3751 C CB  . PRO B 175 ? 0.1790 0.1439 0.1092 -0.0552 0.0212  -0.0169 168 PRO B CB  
3752 C CG  . PRO B 175 ? 0.2118 0.1866 0.1486 -0.0539 0.0180  -0.0163 168 PRO B CG  
3753 C CD  . PRO B 175 ? 0.3033 0.2838 0.2494 -0.0472 0.0152  -0.0148 168 PRO B CD  
3754 N N   . LEU B 176 ? 0.5944 0.5428 0.5201 -0.0505 0.0262  -0.0163 169 LEU B N   
3755 C CA  . LEU B 176 ? 0.4571 0.4031 0.3845 -0.0482 0.0285  -0.0172 169 LEU B CA  
3756 C C   . LEU B 176 ? 0.5254 0.4783 0.4572 -0.0492 0.0287  -0.0195 169 LEU B C   
3757 O O   . LEU B 176 ? 0.5003 0.4587 0.4388 -0.0459 0.0276  -0.0198 169 LEU B O   
3758 C CB  . LEU B 176 ? 0.2658 0.1997 0.1872 -0.0489 0.0330  -0.0150 169 LEU B CB  
3759 C CG  . LEU B 176 ? 0.3497 0.2805 0.2724 -0.0468 0.0361  -0.0164 169 LEU B CG  
3760 C CD1 . LEU B 176 ? 0.2151 0.1503 0.1444 -0.0413 0.0336  -0.0152 169 LEU B CD1 
3761 C CD2 . LEU B 176 ? 0.3862 0.3068 0.3072 -0.0473 0.0399  -0.0126 169 LEU B CD2 
3762 N N   . GLU B 177 ? 0.5393 0.4919 0.4667 -0.0540 0.0301  -0.0212 170 GLU B N   
3763 C CA  . GLU B 177 ? 0.6178 0.5758 0.5479 -0.0555 0.0308  -0.0237 170 GLU B CA  
3764 C C   . GLU B 177 ? 0.5129 0.4833 0.4533 -0.0514 0.0262  -0.0233 170 GLU B C   
3765 O O   . GLU B 177 ? 0.5522 0.5271 0.4964 -0.0504 0.0258  -0.0245 170 GLU B O   
3766 C CB  . GLU B 177 ? 0.7220 0.6770 0.6448 -0.0620 0.0335  -0.0258 170 GLU B CB  
3767 C CG  . GLU B 177 ? 1.0391 1.0042 0.9663 -0.0628 0.0305  -0.0264 170 GLU B CG  
3768 C CD  . GLU B 177 ? 1.2669 1.2376 1.1960 -0.0648 0.0315  -0.0293 170 GLU B CD  
3769 O OE1 . GLU B 177 ? 1.3367 1.3155 1.2737 -0.0609 0.0289  -0.0294 170 GLU B OE1 
3770 O OE2 . GLU B 177 ? 1.2934 1.2599 1.2154 -0.0708 0.0350  -0.0316 170 GLU B OE2 
3771 N N   . ASP B 178 ? 0.3364 0.3111 0.2804 -0.0491 0.0229  -0.0214 171 ASP B N   
3772 C CA  . ASP B 178 ? 0.3404 0.3245 0.2933 -0.0447 0.0190  -0.0206 171 ASP B CA  
3773 C C   . ASP B 178 ? 0.4445 0.4290 0.4019 -0.0400 0.0174  -0.0189 171 ASP B C   
3774 O O   . ASP B 178 ? 0.5631 0.5555 0.5228 -0.0367 0.0187  -0.0169 171 ASP B O   
3775 C CB  . ASP B 178 ? 0.4250 0.4131 0.3802 -0.0440 0.0166  -0.0193 171 ASP B CB  
3776 C CG  . ASP B 178 ? 0.5908 0.5804 0.5425 -0.0487 0.0178  -0.0211 171 ASP B CG  
3777 O OD1 . ASP B 178 ? 0.6887 0.6812 0.6404 -0.0507 0.0188  -0.0233 171 ASP B OD1 
3778 O OD2 . ASP B 178 ? 0.6219 0.6100 0.5704 -0.0507 0.0178  -0.0204 171 ASP B OD2 
3779 N N   . GLN B 179 ? 0.5102 0.4885 0.4648 -0.0393 0.0186  -0.0178 172 GLN B N   
3780 C CA  . GLN B 179 ? 0.3994 0.3781 0.3579 -0.0353 0.0174  -0.0165 172 GLN B CA  
3781 C C   . GLN B 179 ? 0.3880 0.3670 0.3472 -0.0356 0.0188  -0.0181 172 GLN B C   
3782 O O   . GLN B 179 ? 0.4595 0.4435 0.4296 -0.0356 0.0178  -0.0142 172 GLN B O   
3783 C CB  . GLN B 179 ? 0.3667 0.3380 0.3212 -0.0348 0.0191  -0.0153 172 GLN B CB  
3784 C CG  . GLN B 179 ? 0.3415 0.3138 0.2970 -0.0333 0.0168  -0.0133 172 GLN B CG  
3785 C CD  . GLN B 179 ? 0.4358 0.4000 0.3866 -0.0328 0.0187  -0.0121 172 GLN B CD  
3786 O OE1 . GLN B 179 ? 0.3773 0.3367 0.3267 -0.0319 0.0212  -0.0124 172 GLN B OE1 
3787 N NE2 . GLN B 179 ? 0.5261 0.4884 0.4741 -0.0335 0.0176  -0.0108 172 GLN B NE2 
3788 N N   . LEU B 180 ? 0.4190 0.3932 0.3727 -0.0395 0.0226  -0.0202 173 LEU B N   
3789 C CA  . LEU B 180 ? 0.4147 0.3888 0.3685 -0.0404 0.0245  -0.0220 173 LEU B CA  
3790 C C   . LEU B 180 ? 0.3777 0.3609 0.3437 -0.0444 0.0233  -0.0193 173 LEU B C   
3791 O O   . LEU B 180 ? 0.3704 0.3583 0.3283 -0.0399 0.0255  -0.0219 173 LEU B O   
3792 C CB  . LEU B 180 ? 0.3052 0.2709 0.2514 -0.0448 0.0300  -0.0241 173 LEU B CB  
3793 C CG  . LEU B 180 ? 0.4145 0.3697 0.3550 -0.0450 0.0334  -0.0230 173 LEU B CG  
3794 C CD1 . LEU B 180 ? 0.3133 0.2587 0.2453 -0.0500 0.0395  -0.0252 173 LEU B CD1 
3795 C CD2 . LEU B 180 ? 0.5395 0.4943 0.4838 -0.0411 0.0331  -0.0218 173 LEU B CD2 
3796 N N   . ARG B 181 ? 0.2818 0.2698 0.2367 -0.0416 0.0249  -0.0216 174 ARG B N   
3797 C CA  . ARG B 181 ? 0.3602 0.3554 0.3173 -0.0434 0.0245  -0.0232 174 ARG B CA  
3798 C C   . ARG B 181 ? 0.4328 0.4335 0.4061 -0.0449 0.0198  -0.0199 174 ARG B C   
3799 O O   . ARG B 181 ? 0.4565 0.4618 0.4322 -0.0452 0.0196  -0.0208 174 ARG B O   
3800 C CB  . ARG B 181 ? 0.3013 0.2990 0.2566 -0.0459 0.0248  -0.0242 174 ARG B CB  
3801 C CG  . ARG B 181 ? 0.4901 0.4960 0.4479 -0.0474 0.0244  -0.0259 174 ARG B CG  
3802 C CD  . ARG B 181 ? 0.6410 0.6507 0.6115 -0.0556 0.0228  -0.0249 174 ARG B CD  
3803 N NE  . ARG B 181 ? 0.7338 0.7401 0.7028 -0.0542 0.0218  -0.0231 174 ARG B NE  
3804 C CZ  . ARG B 181 ? 0.6765 0.6856 0.6354 -0.0461 0.0214  -0.0236 174 ARG B CZ  
3805 N NH1 . ARG B 181 ? 0.7241 0.7407 0.7007 -0.0487 0.0181  -0.0214 174 ARG B NH1 
3806 N NH2 . ARG B 181 ? 0.5077 0.5141 0.4652 -0.0455 0.0206  -0.0221 174 ARG B NH2 
3807 N N   . VAL B 182 ? 0.3029 0.3033 0.2670 -0.0375 0.0193  -0.0195 175 VAL B N   
3808 C CA  . VAL B 182 ? 0.2039 0.2090 0.1822 -0.0384 0.0153  -0.0164 175 VAL B CA  
3809 C C   . VAL B 182 ? 0.4047 0.4078 0.3744 -0.0330 0.0165  -0.0173 175 VAL B C   
3810 O O   . VAL B 182 ? 0.4954 0.5027 0.4678 -0.0319 0.0151  -0.0170 175 VAL B O   
3811 C CB  . VAL B 182 ? 0.2432 0.2474 0.2222 -0.0355 0.0136  -0.0144 175 VAL B CB  
3812 C CG1 . VAL B 182 ? 0.1724 0.1794 0.1547 -0.0318 0.0114  -0.0128 175 VAL B CG1 
3813 C CG2 . VAL B 182 ? 0.2144 0.2222 0.1937 -0.0372 0.0136  -0.0151 175 VAL B CG2 
3814 N N   . GLY B 183 ? 0.3442 0.3415 0.3117 -0.0330 0.0180  -0.0173 176 GLY B N   
3815 C CA  . GLY B 183 ? 0.3932 0.3888 0.3704 -0.0352 0.0165  -0.0155 176 GLY B CA  
3816 C C   . GLY B 183 ? 0.4442 0.4420 0.4216 -0.0378 0.0181  -0.0175 176 GLY B C   
3817 O O   . GLY B 183 ? 0.5195 0.5190 0.4984 -0.0369 0.0175  -0.0174 176 GLY B O   
3818 N N   . GLU B 184 ? 0.4307 0.4287 0.3963 -0.0371 0.0219  -0.0213 177 GLU B N   
3819 C CA  . GLU B 184 ? 0.3541 0.3551 0.3301 -0.0445 0.0216  -0.0218 177 GLU B CA  
3820 C C   . GLU B 184 ? 0.4233 0.4328 0.4027 -0.0439 0.0194  -0.0216 177 GLU B C   
3821 O O   . GLU B 184 ? 0.3989 0.4120 0.3796 -0.0444 0.0192  -0.0223 177 GLU B O   
3822 C CB  . GLU B 184 ? 0.4885 0.4880 0.4499 -0.0434 0.0263  -0.0262 177 GLU B CB  
3823 C CG  . GLU B 184 ? 0.7177 0.7211 0.6784 -0.0469 0.0282  -0.0292 177 GLU B CG  
3824 C CD  . GLU B 184 ? 0.8765 0.8798 0.8480 -0.0568 0.0281  -0.0289 177 GLU B CD  
3825 O OE1 . GLU B 184 ? 0.9459 0.9482 0.9010 -0.0538 0.0336  -0.0343 177 GLU B OE1 
3826 O OE2 . GLU B 184 ? 0.8282 0.8323 0.7993 -0.0567 0.0273  -0.0283 177 GLU B OE2 
3827 N N   . PHE B 185 ? 0.3335 0.3449 0.3028 -0.0383 0.0193  -0.0224 178 PHE B N   
3828 C CA  . PHE B 185 ? 0.3132 0.3338 0.2969 -0.0418 0.0159  -0.0203 178 PHE B CA  
3829 C C   . PHE B 185 ? 0.4160 0.4356 0.3906 -0.0345 0.0151  -0.0199 178 PHE B C   
3830 O O   . PHE B 185 ? 0.3437 0.3678 0.3192 -0.0347 0.0144  -0.0203 178 PHE B O   
3831 C CB  . PHE B 185 ? 0.2957 0.3193 0.2804 -0.0414 0.0151  -0.0200 178 PHE B CB  
3832 C CG  . PHE B 185 ? 0.3942 0.4227 0.3697 -0.0363 0.0148  -0.0218 178 PHE B CG  
3833 C CD1 . PHE B 185 ? 0.4862 0.5244 0.4750 -0.0429 0.0144  -0.0221 178 PHE B CD1 
3834 C CD2 . PHE B 185 ? 0.4614 0.4909 0.4396 -0.0330 0.0126  -0.0194 178 PHE B CD2 
3835 C CE1 . PHE B 185 ? 0.5191 0.5648 0.5106 -0.0416 0.0130  -0.0221 178 PHE B CE1 
3836 C CE2 . PHE B 185 ? 0.5432 0.5828 0.5355 -0.0353 0.0104  -0.0177 178 PHE B CE2 
3837 C CZ  . PHE B 185 ? 0.5355 0.5772 0.5155 -0.0341 0.0121  -0.0216 178 PHE B CZ  
3838 N N   . CYS B 186 ? 0.4459 0.4631 0.4312 -0.0354 0.0128  -0.0163 179 CYS B N   
3839 C CA  . CYS B 186 ? 0.3659 0.3819 0.3435 -0.0291 0.0119  -0.0156 179 CYS B CA  
3840 C C   . CYS B 186 ? 0.3652 0.3808 0.3423 -0.0298 0.0126  -0.0163 179 CYS B C   
3841 O O   . CYS B 186 ? 0.3531 0.3720 0.3314 -0.0290 0.0113  -0.0155 179 CYS B O   
3842 C CB  . CYS B 186 ? 0.4057 0.4172 0.3840 -0.0265 0.0110  -0.0136 179 CYS B CB  
3843 S SG  . CYS B 186 ? 0.5504 0.5649 0.5380 -0.0278 0.0088  -0.0114 179 CYS B SG  
3844 N N   . HIS B 187 ? 0.4181 0.4309 0.4025 -0.0350 0.0136  -0.0163 180 HIS B N   
3845 C CA  . HIS B 187 ? 0.4867 0.4979 0.4611 -0.0324 0.0160  -0.0190 180 HIS B CA  
3846 C C   . HIS B 187 ? 0.5066 0.5238 0.4807 -0.0348 0.0162  -0.0207 180 HIS B C   
3847 O O   . HIS B 187 ? 0.5009 0.5229 0.4866 -0.0389 0.0144  -0.0190 180 HIS B O   
3848 C CB  . HIS B 187 ? 0.4575 0.4629 0.4297 -0.0338 0.0189  -0.0205 180 HIS B CB  
3849 C CG  . HIS B 187 ? 0.4651 0.4696 0.4470 -0.0380 0.0184  -0.0195 180 HIS B CG  
3850 N ND1 . HIS B 187 ? 0.5689 0.5708 0.5513 -0.0351 0.0175  -0.0180 180 HIS B ND1 
3851 C CD2 . HIS B 187 ? 0.4809 0.4859 0.4521 -0.0365 0.0223  -0.0239 180 HIS B CD2 
3852 C CE1 . HIS B 187 ? 0.5086 0.5101 0.4911 -0.0364 0.0189  -0.0193 180 HIS B CE1 
3853 N NE2 . HIS B 187 ? 0.4740 0.4775 0.4560 -0.0399 0.0208  -0.0217 180 HIS B NE2 
3854 N N   . ASN B 188 ? 0.5328 0.5528 0.5061 -0.0369 0.0170  -0.0222 181 ASN B N   
3855 C CA  . ASN B 188 ? 0.5056 0.5322 0.4787 -0.0392 0.0173  -0.0241 181 ASN B CA  
3856 C C   . ASN B 188 ? 0.4810 0.5134 0.4562 -0.0374 0.0146  -0.0222 181 ASN B C   
3857 O O   . ASN B 188 ? 0.5168 0.5583 0.5057 -0.0427 0.0131  -0.0209 181 ASN B O   
3858 C CB  . ASN B 188 ? 0.4783 0.5067 0.4499 -0.0420 0.0189  -0.0264 181 ASN B CB  
3859 C CG  . ASN B 188 ? 0.4443 0.4706 0.4274 -0.0499 0.0204  -0.0265 181 ASN B CG  
3860 O OD1 . ASN B 188 ? 0.5104 0.5336 0.4927 -0.0505 0.0216  -0.0272 181 ASN B OD1 
3861 N ND2 . ASN B 188 ? 0.4244 0.4494 0.4062 -0.0521 0.0219  -0.0277 181 ASN B ND2 
3862 N N   . ARG B 189 ? 0.4431 0.4781 0.4321 -0.0382 0.0117  -0.0182 182 ARG B N   
3863 C CA  . ARG B 189 ? 0.4272 0.4636 0.4060 -0.0326 0.0105  -0.0179 182 ARG B CA  
3864 C C   . ARG B 189 ? 0.3516 0.3896 0.3428 -0.0334 0.0082  -0.0141 182 ARG B C   
3865 O O   . ARG B 189 ? 0.4031 0.4447 0.3955 -0.0316 0.0067  -0.0125 182 ARG B O   
3866 C CB  . ARG B 189 ? 0.3867 0.4280 0.3788 -0.0342 0.0088  -0.0157 182 ARG B CB  
3867 C CG  . ARG B 189 ? 0.4793 0.5193 0.4587 -0.0334 0.0111  -0.0196 182 ARG B CG  
3868 C CD  . ARG B 189 ? 0.5573 0.6046 0.5363 -0.0354 0.0114  -0.0214 182 ARG B CD  
3869 N NE  . ARG B 189 ? 0.6490 0.7022 0.6293 -0.0349 0.0108  -0.0219 182 ARG B NE  
3870 C CZ  . ARG B 189 ? 0.6579 0.7201 0.6533 -0.0411 0.0112  -0.0225 182 ARG B CZ  
3871 N NH1 . ARG B 189 ? 0.5610 0.6146 0.5383 -0.0404 0.0144  -0.0268 182 ARG B NH1 
3872 N NH2 . ARG B 189 ? 0.6296 0.6981 0.6271 -0.0402 0.0106  -0.0230 182 ARG B NH2 
3873 N N   . GLY B 190 ? 0.3175 0.3466 0.2967 -0.0300 0.0096  -0.0154 183 GLY B N   
3874 C CA  . GLY B 190 ? 0.2428 0.2728 0.2329 -0.0307 0.0076  -0.0121 183 GLY B CA  
3875 C C   . GLY B 190 ? 0.2448 0.2696 0.2268 -0.0249 0.0067  -0.0109 183 GLY B C   
3876 O O   . GLY B 190 ? 0.3046 0.3315 0.2960 -0.0254 0.0049  -0.0082 183 GLY B O   
3877 N N   . ILE B 191 ? 0.3408 0.3665 0.3316 -0.0270 0.0064  -0.0102 184 ILE B N   
3878 C CA  . ILE B 191 ? 0.2503 0.2711 0.2341 -0.0220 0.0059  -0.0094 184 ILE B CA  
3879 C C   . ILE B 191 ? 0.2529 0.2700 0.2432 -0.0235 0.0059  -0.0084 184 ILE B C   
3880 O O   . ILE B 191 ? 0.2917 0.3046 0.2732 -0.0229 0.0081  -0.0107 184 ILE B O   
3881 C CB  . ILE B 191 ? 0.2373 0.2591 0.2212 -0.0223 0.0063  -0.0101 184 ILE B CB  
3882 C CG1 . ILE B 191 ? 0.2451 0.2728 0.2295 -0.0231 0.0060  -0.0107 184 ILE B CG1 
3883 C CG2 . ILE B 191 ? 0.0739 0.0951 0.0662 -0.0220 0.0049  -0.0078 184 ILE B CG2 
3884 C CD1 . ILE B 191 ? 0.1917 0.2246 0.1852 -0.0266 0.0063  -0.0112 184 ILE B CD1 
3885 N N   . LYS B 192 ? 0.2035 0.2174 0.1881 -0.0190 0.0051  -0.0074 185 LYS B N   
3886 C CA  . LYS B 192 ? 0.2476 0.2582 0.2377 -0.0199 0.0050  -0.0065 185 LYS B CA  
3887 C C   . LYS B 192 ? 0.1698 0.1774 0.1595 -0.0190 0.0051  -0.0063 185 LYS B C   
3888 O O   . LYS B 192 ? 0.2112 0.2192 0.1969 -0.0162 0.0046  -0.0059 185 LYS B O   
3889 C CB  . LYS B 192 ? 0.3093 0.3202 0.3005 -0.0178 0.0037  -0.0050 185 LYS B CB  
3890 C CG  . LYS B 192 ? 0.2950 0.3069 0.2804 -0.0173 0.0042  -0.0058 185 LYS B CG  
3891 C CD  . LYS B 192 ? 0.3045 0.3171 0.2912 -0.0159 0.0028  -0.0042 185 LYS B CD  
3892 C CE  . LYS B 192 ? 0.4817 0.4999 0.4740 -0.0188 0.0022  -0.0036 185 LYS B CE  
3893 N NZ  . LYS B 192 ? 0.7697 0.7869 0.7566 -0.0164 0.0015  -0.0025 185 LYS B NZ  
3894 N N   . LEU B 193 ? 0.3397 0.3432 0.3277 -0.0198 0.0064  -0.0071 186 LEU B N   
3895 C CA  . LEU B 193 ? 0.2895 0.2903 0.2765 -0.0195 0.0068  -0.0069 186 LEU B CA  
3896 C C   . LEU B 193 ? 0.2500 0.2472 0.2322 -0.0159 0.0073  -0.0067 186 LEU B C   
3897 O O   . LEU B 193 ? 0.4263 0.4213 0.4081 -0.0157 0.0082  -0.0070 186 LEU B O   
3898 C CB  . LEU B 193 ? 0.2606 0.2596 0.2454 -0.0224 0.0088  -0.0086 186 LEU B CB  
3899 C CG  . LEU B 193 ? 0.2394 0.2354 0.2167 -0.0208 0.0105  -0.0096 186 LEU B CG  
3900 C CD1 . LEU B 193 ? 0.3216 0.3195 0.2975 -0.0233 0.0115  -0.0110 186 LEU B CD1 
3901 C CD2 . LEU B 193 ? 0.4624 0.4524 0.4428 -0.0236 0.0116  -0.0094 186 LEU B CD2 
3902 N N   . VAL B 194 ? 0.3319 0.3286 0.3188 -0.0163 0.0058  -0.0052 187 VAL B N   
3903 C CA  . VAL B 194 ? 0.3264 0.3206 0.3093 -0.0133 0.0062  -0.0050 187 VAL B CA  
3904 C C   . VAL B 194 ? 0.3475 0.3388 0.3320 -0.0155 0.0062  -0.0047 187 VAL B C   
3905 O O   . VAL B 194 ? 0.3069 0.3012 0.2883 -0.0145 0.0060  -0.0049 187 VAL B O   
3906 C CB  . VAL B 194 ? 0.2101 0.2065 0.1961 -0.0112 0.0042  -0.0036 187 VAL B CB  
3907 C CG1 . VAL B 194 ? 0.2220 0.2157 0.2106 -0.0109 0.0037  -0.0028 187 VAL B CG1 
3908 C CG2 . VAL B 194 ? 0.2255 0.2232 0.2157 -0.0116 0.0034  -0.0031 187 VAL B CG2 
3909 N N   . VAL B 195 ? 0.4373 0.4233 0.4164 -0.0153 0.0076  -0.0066 188 VAL B N   
3910 C CA  . VAL B 195 ? 0.3598 0.3420 0.3345 -0.0173 0.0090  -0.0068 188 VAL B CA  
3911 C C   . VAL B 195 ? 0.3802 0.3585 0.3526 -0.0166 0.0096  -0.0058 188 VAL B C   
3912 O O   . VAL B 195 ? 0.4160 0.3899 0.3868 -0.0155 0.0117  -0.0056 188 VAL B O   
3913 C CB  . VAL B 195 ? 0.2665 0.2428 0.2358 -0.0200 0.0124  -0.0084 188 VAL B CB  
3914 C CG1 . VAL B 195 ? 0.1487 0.1204 0.1123 -0.0229 0.0138  -0.0086 188 VAL B CG1 
3915 C CG2 . VAL B 195 ? 0.1894 0.1696 0.1610 -0.0208 0.0119  -0.0096 188 VAL B CG2 
3916 N N   . ALA B 196 ? 0.4337 0.4137 0.4060 -0.0172 0.0080  -0.0050 189 ALA B N   
3917 C CA  . ALA B 196 ? 0.3631 0.3424 0.3358 -0.0156 0.0079  -0.0023 189 ALA B CA  
3918 C C   . ALA B 196 ? 0.3864 0.3643 0.3567 -0.0170 0.0085  -0.0002 189 ALA B C   
3919 O O   . ALA B 196 ? 0.4015 0.3810 0.3699 -0.0200 0.0072  -0.0020 189 ALA B O   
3920 C CB  . ALA B 196 ? 0.3178 0.3033 0.2953 -0.0142 0.0048  -0.0021 189 ALA B CB  
3921 N N   . ASP B 197 ? 0.3460 0.3213 0.3164 -0.0152 0.0100  0.0039  190 ASP B N   
3922 C CA  . ASP B 197 ? 0.4316 0.4054 0.3996 -0.0166 0.0104  0.0069  190 ASP B CA  
3923 C C   . ASP B 197 ? 0.3940 0.3693 0.3649 -0.0139 0.0100  0.0123  190 ASP B C   
3924 O O   . ASP B 197 ? 0.3802 0.3561 0.3544 -0.0110 0.0101  0.0142  190 ASP B O   
3925 C CB  . ASP B 197 ? 0.6967 0.6632 0.6594 -0.0190 0.0132  0.0069  190 ASP B CB  
3926 C CG  . ASP B 197 ? 0.8609 0.8262 0.8194 -0.0225 0.0131  0.0077  190 ASP B CG  
3927 O OD1 . ASP B 197 ? 0.9245 0.8949 0.8833 -0.0244 0.0110  0.0053  190 ASP B OD1 
3928 O OD2 . ASP B 197 ? 0.8857 0.8450 0.8408 -0.0237 0.0150  0.0106  190 ASP B OD2 
3929 N N   . THR B 198 ? 0.4630 0.4392 0.4322 -0.0152 0.0095  0.0146  191 THR B N   
3930 C CA  . THR B 198 ? 0.3098 0.2871 0.2807 -0.0127 0.0094  0.0201  191 THR B CA  
3931 C C   . THR B 198 ? 0.3388 0.3112 0.3047 -0.0150 0.0105  0.0236  191 THR B C   
3932 O O   . THR B 198 ? 0.5298 0.5019 0.4916 -0.0188 0.0102  0.0213  191 THR B O   
3933 C CB  . THR B 198 ? 0.3606 0.3441 0.3337 -0.0117 0.0077  0.0191  191 THR B CB  
3934 O OG1 . THR B 198 ? 0.4525 0.4387 0.4301 -0.0080 0.0076  0.0189  191 THR B OG1 
3935 C CG2 . THR B 198 ? 0.6190 0.6021 0.5892 -0.0116 0.0076  0.0228  191 THR B CG2 
3936 N N   . ARG B 199 ? 0.3289 0.2977 0.2955 -0.0131 0.0111  0.0293  192 ARG B N   
3937 C CA  . ARG B 199 ? 0.4050 0.3691 0.3673 -0.0145 0.0119  0.0341  192 ARG B CA  
3938 C C   . ARG B 199 ? 0.3914 0.3573 0.3560 -0.0103 0.0114  0.0396  192 ARG B C   
3939 O O   . ARG B 199 ? 0.4679 0.4329 0.4368 -0.0087 0.0095  0.0426  192 ARG B O   
3940 C CB  . ARG B 199 ? 0.3861 0.3410 0.3461 -0.0163 0.0132  0.0357  192 ARG B CB  
3941 C CG  . ARG B 199 ? 0.3871 0.3391 0.3432 -0.0198 0.0148  0.0295  192 ARG B CG  
3942 C CD  . ARG B 199 ? 0.3361 0.2906 0.2876 -0.0239 0.0146  0.0268  192 ARG B CD  
3943 N NE  . ARG B 199 ? 0.4837 0.4381 0.4330 -0.0268 0.0153  0.0201  192 ARG B NE  
3944 C CZ  . ARG B 199 ? 0.4895 0.4400 0.4331 -0.0315 0.0168  0.0177  192 ARG B CZ  
3945 N NH1 . ARG B 199 ? 0.5211 0.4670 0.4602 -0.0342 0.0176  0.0216  192 ARG B NH1 
3946 N NH2 . ARG B 199 ? 0.5201 0.4715 0.4622 -0.0337 0.0173  0.0115  192 ARG B NH2 
3947 N N   . GLY B 200 ? 0.4622 0.4297 0.4222 -0.0099 0.0115  0.0394  193 GLY B N   
3948 C CA  . GLY B 200 ? 0.4695 0.4348 0.4261 -0.0060 0.0109  0.0410  193 GLY B CA  
3949 C C   . GLY B 200 ? 0.4439 0.4070 0.4008 -0.0026 0.0101  0.0369  193 GLY B C   
3950 O O   . GLY B 200 ? 0.5770 0.5462 0.5376 -0.0037 0.0090  0.0327  193 GLY B O   
3951 N N   . LEU B 201 ? 0.3590 0.3092 0.3066 -0.0036 0.0063  0.0371  194 LEU B N   
3952 C CA  . LEU B 201 ? 0.3703 0.3259 0.3247 -0.0041 0.0011  0.0374  194 LEU B CA  
3953 C C   . LEU B 201 ? 0.5040 0.4626 0.4669 -0.0052 0.0006  0.0368  194 LEU B C   
3954 O O   . LEU B 201 ? 0.5342 0.4951 0.5012 -0.0017 0.0012  0.0357  194 LEU B O   
3955 C CB  . LEU B 201 ? 0.4009 0.3535 0.3547 -0.0003 -0.0014 0.0429  194 LEU B CB  
3956 C CG  . LEU B 201 ? 0.5057 0.4519 0.4514 0.0005  -0.0020 0.0476  194 LEU B CG  
3957 C CD1 . LEU B 201 ? 0.6209 0.5620 0.5675 0.0043  -0.0055 0.0529  194 LEU B CD1 
3958 C CD2 . LEU B 201 ? 0.4744 0.4293 0.4197 0.0012  -0.0013 0.0481  194 LEU B CD2 
3959 N N   . PHE B 202 ? 0.4785 0.4388 0.4460 -0.0078 0.0017  0.0384  195 PHE B N   
3960 C CA  . PHE B 202 ? 0.4854 0.4433 0.4561 -0.0064 0.0047  0.0364  195 PHE B CA  
3961 C C   . PHE B 202 ? 0.4564 0.4221 0.4302 -0.0075 0.0066  0.0316  195 PHE B C   
3962 O O   . PHE B 202 ? 0.4791 0.4501 0.4538 -0.0087 0.0076  0.0310  195 PHE B O   
3963 C CB  . PHE B 202 ? 0.4730 0.4219 0.4424 -0.0070 0.0070  0.0389  195 PHE B CB  
3964 C CG  . PHE B 202 ? 0.4061 0.3460 0.3733 -0.0053 0.0047  0.0444  195 PHE B CG  
3965 C CD1 . PHE B 202 ? 0.3623 0.3007 0.3274 -0.0073 0.0032  0.0495  195 PHE B CD1 
3966 C CD2 . PHE B 202 ? 0.3456 0.2801 0.3141 -0.0008 0.0046  0.0438  195 PHE B CD2 
3967 C CE1 . PHE B 202 ? 0.4844 0.4135 0.4468 -0.0054 0.0005  0.0544  195 PHE B CE1 
3968 C CE2 . PHE B 202 ? 0.3778 0.3035 0.3448 0.0020  0.0022  0.0487  195 PHE B CE2 
3969 C CZ  . PHE B 202 ? 0.4700 0.3915 0.4329 -0.0006 -0.0004 0.0542  195 PHE B CZ  
3970 N N   . GLY B 203 ? 0.3259 0.2919 0.3014 -0.0056 0.0079  0.0273  196 GLY B N   
3971 C CA  . GLY B 203 ? 0.2197 0.1910 0.1972 -0.0062 0.0091  0.0224  196 GLY B CA  
3972 C C   . GLY B 203 ? 0.3898 0.3556 0.3659 -0.0060 0.0123  0.0190  196 GLY B C   
3973 O O   . GLY B 203 ? 0.3736 0.3340 0.3497 -0.0042 0.0139  0.0198  196 GLY B O   
3974 N N   . GLN B 204 ? 0.4072 0.3743 0.3819 -0.0079 0.0133  0.0150  197 GLN B N   
3975 C CA  . GLN B 204 ? 0.3624 0.3251 0.3350 -0.0085 0.0161  0.0111  197 GLN B CA  
3976 C C   . GLN B 204 ? 0.3650 0.3327 0.3388 -0.0089 0.0152  0.0066  197 GLN B C   
3977 O O   . GLN B 204 ? 0.3020 0.2740 0.2762 -0.0101 0.0129  0.0055  197 GLN B O   
3978 C CB  . GLN B 204 ? 0.3814 0.3379 0.3488 -0.0116 0.0182  0.0105  197 GLN B CB  
3979 C CG  . GLN B 204 ? 0.3953 0.3490 0.3600 -0.0133 0.0209  0.0055  197 GLN B CG  
3980 C CD  . GLN B 204 ? 0.4628 0.4126 0.4219 -0.0173 0.0222  0.0036  197 GLN B CD  
3981 O OE1 . GLN B 204 ? 0.4998 0.4534 0.4575 -0.0196 0.0205  0.0012  197 GLN B OE1 
3982 N NE2 . GLN B 204 ? 0.4130 0.3550 0.3693 -0.0186 0.0253  0.0047  197 GLN B NE2 
3983 N N   . LEU B 205 ? 0.3416 0.3082 0.3160 -0.0079 0.0168  0.0042  198 LEU B N   
3984 C CA  . LEU B 205 ? 0.2766 0.2473 0.2523 -0.0083 0.0152  0.0007  198 LEU B CA  
3985 C C   . LEU B 205 ? 0.2509 0.2177 0.2239 -0.0098 0.0179  -0.0031 198 LEU B C   
3986 O O   . LEU B 205 ? 0.2849 0.2478 0.2577 -0.0088 0.0211  -0.0029 198 LEU B O   
3987 C CB  . LEU B 205 ? 0.3529 0.3285 0.3335 -0.0057 0.0135  0.0021  198 LEU B CB  
3988 C CG  . LEU B 205 ? 0.4332 0.4149 0.4164 -0.0061 0.0099  0.0012  198 LEU B CG  
3989 C CD1 . LEU B 205 ? 0.4769 0.4580 0.4585 -0.0082 0.0094  -0.0024 198 LEU B CD1 
3990 C CD2 . LEU B 205 ? 0.4472 0.4311 0.4302 -0.0072 0.0082  0.0022  198 LEU B CD2 
3991 N N   . PHE B 206 ? 0.2365 0.2058 0.2088 -0.0123 0.0160  -0.0058 199 PHE B N   
3992 C CA  . PHE B 206 ? 0.2299 0.2007 0.2033 -0.0137 0.0165  -0.0073 199 PHE B CA  
3993 C C   . PHE B 206 ? 0.3017 0.2802 0.2796 -0.0136 0.0126  -0.0074 199 PHE B C   
3994 O O   . PHE B 206 ? 0.2498 0.2326 0.2297 -0.0133 0.0097  -0.0067 199 PHE B O   
3995 C CB  . PHE B 206 ? 0.3067 0.2744 0.2761 -0.0164 0.0184  -0.0086 199 PHE B CB  
3996 C CG  . PHE B 206 ? 0.3586 0.3284 0.3292 -0.0180 0.0189  -0.0104 199 PHE B CG  
3997 C CD1 . PHE B 206 ? 0.4604 0.4264 0.4301 -0.0182 0.0225  -0.0113 199 PHE B CD1 
3998 C CD2 . PHE B 206 ? 0.3023 0.2779 0.2750 -0.0190 0.0160  -0.0109 199 PHE B CD2 
3999 C CE1 . PHE B 206 ? 0.4249 0.3929 0.3954 -0.0200 0.0229  -0.0132 199 PHE B CE1 
4000 C CE2 . PHE B 206 ? 0.3599 0.3371 0.3332 -0.0205 0.0166  -0.0125 199 PHE B CE2 
4001 C CZ  . PHE B 206 ? 0.4073 0.3808 0.3793 -0.0212 0.0199  -0.0139 199 PHE B CZ  
4002 N N   . CYS B 207 ? 0.3025 0.2822 0.2819 -0.0138 0.0130  -0.0082 200 CYS B N   
4003 C CA  . CYS B 207 ? 0.3168 0.3040 0.2979 -0.0133 0.0114  -0.0072 200 CYS B CA  
4004 C C   . CYS B 207 ? 0.3156 0.3016 0.2994 -0.0177 0.0120  -0.0082 200 CYS B C   
4005 O O   . CYS B 207 ? 0.4066 0.3897 0.3899 -0.0183 0.0142  -0.0091 200 CYS B O   
4006 C CB  . CYS B 207 ? 0.2988 0.2862 0.2834 -0.0124 0.0087  -0.0071 200 CYS B CB  
4007 S SG  . CYS B 207 ? 0.3474 0.3370 0.3338 -0.0103 0.0064  -0.0052 200 CYS B SG  
4008 N N   . ASP B 208 ? 0.2758 0.2666 0.2556 -0.0172 0.0122  -0.0094 201 ASP B N   
4009 C CA  . ASP B 208 ? 0.3164 0.3082 0.3005 -0.0219 0.0122  -0.0101 201 ASP B CA  
4010 C C   . ASP B 208 ? 0.4007 0.3986 0.3813 -0.0195 0.0109  -0.0104 201 ASP B C   
4011 O O   . ASP B 208 ? 0.3863 0.3868 0.3727 -0.0217 0.0088  -0.0089 201 ASP B O   
4012 C CB  . ASP B 208 ? 0.3555 0.3474 0.3323 -0.0219 0.0151  -0.0126 201 ASP B CB  
4013 C CG  . ASP B 208 ? 0.4460 0.4409 0.4289 -0.0275 0.0145  -0.0132 201 ASP B CG  
4014 O OD1 . ASP B 208 ? 0.4790 0.4761 0.4628 -0.0277 0.0143  -0.0136 201 ASP B OD1 
4015 O OD2 . ASP B 208 ? 0.3112 0.3078 0.2861 -0.0266 0.0167  -0.0156 201 ASP B OD2 
4016 N N   . PHE B 209 ? 0.3201 0.3195 0.3014 -0.0195 0.0107  -0.0105 202 PHE B N   
4017 C CA  . PHE B 209 ? 0.2711 0.2754 0.2591 -0.0214 0.0079  -0.0087 202 PHE B CA  
4018 C C   . PHE B 209 ? 0.3651 0.3731 0.3529 -0.0242 0.0086  -0.0101 202 PHE B C   
4019 O O   . PHE B 209 ? 0.4111 0.4230 0.3996 -0.0244 0.0075  -0.0096 202 PHE B O   
4020 C CB  . PHE B 209 ? 0.3501 0.3541 0.3339 -0.0178 0.0075  -0.0084 202 PHE B CB  
4021 C CG  . PHE B 209 ? 0.4235 0.4260 0.4088 -0.0153 0.0060  -0.0065 202 PHE B CG  
4022 C CD1 . PHE B 209 ? 0.4480 0.4483 0.4333 -0.0144 0.0062  -0.0063 202 PHE B CD1 
4023 C CD2 . PHE B 209 ? 0.4828 0.4871 0.4736 -0.0154 0.0042  -0.0048 202 PHE B CD2 
4024 C CE1 . PHE B 209 ? 0.2457 0.2453 0.2358 -0.0137 0.0045  -0.0044 202 PHE B CE1 
4025 C CE2 . PHE B 209 ? 0.3716 0.3746 0.3599 -0.0119 0.0034  -0.0039 202 PHE B CE2 
4026 C CZ  . PHE B 209 ? 0.2055 0.2066 0.1939 -0.0111 0.0035  -0.0037 202 PHE B CZ  
4027 N N   . GLY B 210 ? 0.4631 0.4698 0.4498 -0.0266 0.0106  -0.0120 203 GLY B N   
4028 C CA  . GLY B 210 ? 0.5343 0.5451 0.5210 -0.0296 0.0115  -0.0137 203 GLY B CA  
4029 C C   . GLY B 210 ? 0.7416 0.7515 0.7197 -0.0280 0.0139  -0.0166 203 GLY B C   
4030 O O   . GLY B 210 ? 0.5790 0.5885 0.5659 -0.0297 0.0123  -0.0145 203 GLY B O   
4031 N N   . GLU B 211 ? 1.2992 1.3113 1.2761 -0.0309 0.0157  -0.0191 204 GLU B N   
4032 C CA  . GLU B 211 ? 1.6090 1.6240 1.5954 -0.0366 0.0158  -0.0194 204 GLU B CA  
4033 C C   . GLU B 211 ? 1.6233 1.6435 1.6104 -0.0361 0.0137  -0.0180 204 GLU B C   
4034 O O   . GLU B 211 ? 1.6957 1.7174 1.6829 -0.0373 0.0143  -0.0191 204 GLU B O   
4035 C CB  . GLU B 211 ? 1.7588 1.7763 1.7449 -0.0405 0.0180  -0.0223 204 GLU B CB  
4036 C CG  . GLU B 211 ? 1.8455 1.8562 1.8197 -0.0370 0.0225  -0.0259 204 GLU B CG  
4037 C CD  . GLU B 211 ? 1.8711 1.8845 1.8436 -0.0406 0.0246  -0.0290 204 GLU B CD  
4038 O OE1 . GLU B 211 ? 1.8124 1.8238 1.7962 -0.0468 0.0245  -0.0277 204 GLU B OE1 
4039 O OE2 . GLU B 211 ? 1.8997 1.9187 1.8718 -0.0426 0.0243  -0.0304 204 GLU B OE2 
4040 N N   . GLU B 212 ? 1.4471 1.4700 1.4345 -0.0344 0.0114  -0.0157 205 GLU B N   
4041 C CA  . GLU B 212 ? 1.4261 1.4513 1.4035 -0.0308 0.0103  -0.0153 205 GLU B CA  
4042 C C   . GLU B 212 ? 1.1099 1.1352 1.0981 -0.0316 0.0083  -0.0123 205 GLU B C   
4043 O O   . GLU B 212 ? 1.2770 1.3058 1.2655 -0.0314 0.0070  -0.0109 205 GLU B O   
4044 C CB  . GLU B 212 ? 1.6382 1.6665 1.6162 -0.0300 0.0084  -0.0133 205 GLU B CB  
4045 C CG  . GLU B 212 ? 1.7095 1.7366 1.6983 -0.0306 0.0073  -0.0112 205 GLU B CG  
4046 C CD  . GLU B 212 ? 1.6657 1.6881 1.6467 -0.0248 0.0062  -0.0096 205 GLU B CD  
4047 O OE1 . GLU B 212 ? 1.5522 1.5742 1.5421 -0.0254 0.0052  -0.0080 205 GLU B OE1 
4048 O OE2 . GLU B 212 ? 1.6788 1.7019 1.6600 -0.0244 0.0054  -0.0085 205 GLU B OE2 
4049 N N   . MET B 213 ? 0.5584 0.5763 0.5379 -0.0270 0.0098  -0.0136 206 MET B N   
4050 C CA  . MET B 213 ? 0.6237 0.6417 0.6125 -0.0272 0.0077  -0.0107 206 MET B CA  
4051 C C   . MET B 213 ? 0.6397 0.6574 0.6201 -0.0256 0.0088  -0.0124 206 MET B C   
4052 O O   . MET B 213 ? 0.6444 0.6631 0.6331 -0.0299 0.0101  -0.0137 206 MET B O   
4053 C CB  . MET B 213 ? 0.6632 0.6743 0.6450 -0.0224 0.0088  -0.0112 206 MET B CB  
4054 C CG  . MET B 213 ? 0.6910 0.7010 0.6744 -0.0199 0.0071  -0.0091 206 MET B CG  
4055 S SD  . MET B 213 ? 0.9640 0.9781 0.9545 -0.0202 0.0040  -0.0056 206 MET B SD  
4056 C CE  . MET B 213 ? 0.8317 0.8470 0.8221 -0.0210 0.0041  -0.0058 206 MET B CE  
4057 N N   . ILE B 214 ? 0.6057 0.6277 0.5949 -0.0272 0.0063  -0.0094 207 ILE B N   
4058 C CA  . ILE B 214 ? 0.5289 0.5534 0.5180 -0.0284 0.0064  -0.0097 207 ILE B CA  
4059 C C   . ILE B 214 ? 0.4997 0.5218 0.4894 -0.0258 0.0054  -0.0082 207 ILE B C   
4060 O O   . ILE B 214 ? 0.5719 0.5911 0.5548 -0.0215 0.0043  -0.0066 207 ILE B O   
4061 C CB  . ILE B 214 ? 0.7714 0.8014 0.7602 -0.0300 0.0052  -0.0084 207 ILE B CB  
4062 C CG1 . ILE B 214 ? 0.8651 0.8940 0.8442 -0.0271 0.0044  -0.0074 207 ILE B CG1 
4063 C CG2 . ILE B 214 ? 1.0571 1.0851 1.0368 -0.0263 0.0043  -0.0072 207 ILE B CG2 
4064 C CD1 . ILE B 214 ? 1.0373 1.0706 1.0155 -0.0284 0.0029  -0.0051 207 ILE B CD1 
4065 N N   . LEU B 215 ? 0.4740 0.4941 0.4602 -0.0258 0.0048  -0.0112 208 LEU B N   
4066 C CA  . LEU B 215 ? 0.5058 0.5248 0.4927 -0.0239 0.0042  -0.0098 208 LEU B CA  
4067 C C   . LEU B 215 ? 0.5547 0.5765 0.5410 -0.0262 0.0054  -0.0115 208 LEU B C   
4068 O O   . LEU B 215 ? 0.6745 0.6981 0.6602 -0.0291 0.0075  -0.0146 208 LEU B O   
4069 C CB  . LEU B 215 ? 0.6019 0.6160 0.5895 -0.0218 0.0051  -0.0099 208 LEU B CB  
4070 C CG  . LEU B 215 ? 0.5286 0.5403 0.5156 -0.0237 0.0079  -0.0128 208 LEU B CG  
4071 C CD1 . LEU B 215 ? 0.3765 0.3873 0.3639 -0.0252 0.0108  -0.0154 208 LEU B CD1 
4072 C CD2 . LEU B 215 ? 0.5961 0.6034 0.5834 -0.0215 0.0077  -0.0117 208 LEU B CD2 
4073 N N   . THR B 216 ? 0.5576 0.5801 0.5444 -0.0249 0.0044  -0.0099 209 THR B N   
4074 C CA  . THR B 216 ? 0.6569 0.6831 0.6431 -0.0271 0.0053  -0.0114 209 THR B CA  
4075 C C   . THR B 216 ? 0.7434 0.7681 0.7305 -0.0271 0.0076  -0.0138 209 THR B C   
4076 O O   . THR B 216 ? 0.8326 0.8532 0.8206 -0.0247 0.0077  -0.0130 209 THR B O   
4077 C CB  . THR B 216 ? 0.6238 0.6524 0.6098 -0.0265 0.0030  -0.0085 209 THR B CB  
4078 O OG1 . THR B 216 ? 0.6191 0.6442 0.6066 -0.0230 0.0012  -0.0056 209 THR B OG1 
4079 C CG2 . THR B 216 ? 0.4385 0.4710 0.4234 -0.0289 0.0020  -0.0078 209 THR B CG2 
4080 N N   . ASP B 217 ? 0.7961 0.8245 0.7834 -0.0299 0.0097  -0.0171 210 ASP B N   
4081 C CA  . ASP B 217 ? 0.7520 0.7796 0.7414 -0.0301 0.0126  -0.0203 210 ASP B CA  
4082 C C   . ASP B 217 ? 0.7112 0.7449 0.7016 -0.0330 0.0143  -0.0238 210 ASP B C   
4083 O O   . ASP B 217 ? 0.7897 0.8279 0.7786 -0.0356 0.0140  -0.0246 210 ASP B O   
4084 C CB  . ASP B 217 ? 0.7002 0.7228 0.6911 -0.0304 0.0157  -0.0229 210 ASP B CB  
4085 C CG  . ASP B 217 ? 0.7510 0.7751 0.7409 -0.0330 0.0164  -0.0247 210 ASP B CG  
4086 O OD1 . ASP B 217 ? 0.7736 0.7938 0.7631 -0.0324 0.0167  -0.0241 210 ASP B OD1 
4087 O OD2 . ASP B 217 ? 0.8468 0.8767 0.8363 -0.0358 0.0168  -0.0267 210 ASP B OD2 
4088 N N   . SER B 218 ? 0.6805 0.7142 0.6740 -0.0310 0.0165  -0.0249 211 SER B N   
4089 C CA  . SER B 218 ? 0.5440 0.5838 0.5397 -0.0324 0.0187  -0.0282 211 SER B CA  
4090 C C   . SER B 218 ? 0.5297 0.5710 0.5271 -0.0357 0.0219  -0.0334 211 SER B C   
4091 O O   . SER B 218 ? 0.7735 0.8215 0.7698 -0.0402 0.0219  -0.0369 211 SER B O   
4092 C CB  . SER B 218 ? 0.6083 0.6474 0.6084 -0.0274 0.0210  -0.0270 211 SER B CB  
4093 O OG  . SER B 218 ? 0.6047 0.6418 0.6038 -0.0243 0.0183  -0.0222 211 SER B OG  
4094 N N   . GLN B 222 ? 0.9820 1.0836 1.0030 -0.0443 0.0361  -0.0657 215 GLN B N   
4095 C CA  . GLN B 222 ? 0.9672 1.0620 0.9873 -0.0449 0.0368  -0.0655 215 GLN B CA  
4096 C C   . GLN B 222 ? 1.3270 1.4177 1.3390 -0.0487 0.0329  -0.0610 215 GLN B C   
4097 O O   . GLN B 222 ? 1.3763 1.4642 1.3870 -0.0513 0.0334  -0.0622 215 GLN B O   
4098 C CB  . GLN B 222 ? 0.9688 1.0552 0.9945 -0.0373 0.0393  -0.0639 215 GLN B CB  
4099 C CG  . GLN B 222 ? 1.0917 1.1728 1.1174 -0.0311 0.0374  -0.0573 215 GLN B CG  
4100 C CD  . GLN B 222 ? 1.1735 1.2450 1.1946 -0.0300 0.0352  -0.0513 215 GLN B CD  
4101 O OE1 . GLN B 222 ? 1.2142 1.2813 1.2342 -0.0318 0.0360  -0.0523 215 GLN B OE1 
4102 N NE2 . GLN B 222 ? 1.0954 1.1640 1.1141 -0.0273 0.0324  -0.0455 215 GLN B NE2 
4103 N N   . PRO B 223 ? 1.2060 1.2963 1.2127 -0.0490 0.0291  -0.0558 216 PRO B N   
4104 C CA  . PRO B 223 ? 1.1182 1.2064 1.1177 -0.0531 0.0254  -0.0525 216 PRO B CA  
4105 C C   . PRO B 223 ? 1.0506 1.1458 1.0460 -0.0586 0.0250  -0.0535 216 PRO B C   
4106 O O   . PRO B 223 ? 1.0005 1.1032 0.9958 -0.0611 0.0254  -0.0558 216 PRO B O   
4107 C CB  . PRO B 223 ? 0.9729 1.0577 0.9692 -0.0503 0.0218  -0.0461 216 PRO B CB  
4108 C CG  . PRO B 223 ? 0.9816 1.0638 0.9835 -0.0440 0.0239  -0.0453 216 PRO B CG  
4109 C CD  . PRO B 223 ? 1.0987 1.1876 1.1063 -0.0444 0.0278  -0.0517 216 PRO B CD  
4110 N N   . LEU B 224 ? 0.8698 0.9624 0.8618 -0.0601 0.0243  -0.0514 217 LEU B N   
4111 C CA  . LEU B 224 ? 0.6710 0.7695 0.6590 -0.0649 0.0238  -0.0513 217 LEU B CA  
4112 C C   . LEU B 224 ? 0.7874 0.8890 0.7713 -0.0663 0.0214  -0.0472 217 LEU B C   
4113 O O   . LEU B 224 ? 0.8844 0.9807 0.8661 -0.0635 0.0185  -0.0412 217 LEU B O   
4114 C CB  . LEU B 224 ? 0.6568 0.7508 0.6416 -0.0650 0.0223  -0.0476 217 LEU B CB  
4115 C CG  . LEU B 224 ? 0.7215 0.8211 0.7054 -0.0698 0.0239  -0.0512 217 LEU B CG  
4116 C CD1 . LEU B 224 ? 0.6171 0.7151 0.5963 -0.0706 0.0208  -0.0456 217 LEU B CD1 
4117 C CD2 . LEU B 224 ? 0.7495 0.8592 0.7335 -0.0746 0.0258  -0.0560 217 LEU B CD2 
4118 N N   . SER B 225 ? 0.7744 0.8848 0.7574 -0.0710 0.0227  -0.0507 218 SER B N   
4119 C CA  . SER B 225 ? 0.7131 0.8269 0.6923 -0.0732 0.0208  -0.0474 218 SER B CA  
4120 C C   . SER B 225 ? 0.7310 0.8517 0.7061 -0.0793 0.0208  -0.0478 218 SER B C   
4121 O O   . SER B 225 ? 0.8376 0.9627 0.8137 -0.0821 0.0229  -0.0524 218 SER B O   
4122 C CB  . SER B 225 ? 0.7327 0.8515 0.7149 -0.0730 0.0224  -0.0513 218 SER B CB  
4123 O OG  . SER B 225 ? 0.7728 0.8871 0.7538 -0.0699 0.0200  -0.0462 218 SER B OG  
4124 N N   . ALA B 226 ? 0.6095 0.7314 0.5801 -0.0816 0.0184  -0.0431 219 ALA B N   
4125 C CA  . ALA B 226 ? 0.5933 0.7223 0.5596 -0.0879 0.0180  -0.0428 219 ALA B CA  
4126 C C   . ALA B 226 ? 0.6008 0.7323 0.5632 -0.0909 0.0162  -0.0392 219 ALA B C   
4127 O O   . ALA B 226 ? 0.5833 0.7091 0.5457 -0.0876 0.0145  -0.0352 219 ALA B O   
4128 C CB  . ALA B 226 ? 0.5826 0.7086 0.5468 -0.0882 0.0162  -0.0390 219 ALA B CB  
4129 N N   . MET B 227 ? 0.5312 0.6714 0.4902 -0.0976 0.0168  -0.0406 220 MET B N   
4130 C CA  . MET B 227 ? 0.4649 0.6081 0.4199 -0.1015 0.0153  -0.0376 220 MET B CA  
4131 C C   . MET B 227 ? 0.4419 0.5826 0.3924 -0.1038 0.0119  -0.0306 220 MET B C   
4132 O O   . MET B 227 ? 0.4700 0.6112 0.4198 -0.1049 0.0113  -0.0297 220 MET B O   
4133 C CB  . MET B 227 ? 0.4379 0.5926 0.3915 -0.1081 0.0179  -0.0432 220 MET B CB  
4134 C CG  . MET B 227 ? 0.5215 0.6804 0.4807 -0.1064 0.0216  -0.0515 220 MET B CG  
4135 S SD  . MET B 227 ? 1.2923 1.4580 1.2528 -0.1081 0.0234  -0.0556 220 MET B SD  
4136 C CE  . MET B 227 ? 0.4630 0.6179 0.4240 -0.1017 0.0207  -0.0493 220 MET B CE  
4137 N N   . VAL B 228 ? 0.2905 0.4287 0.2382 -0.1048 0.0096  -0.0258 221 VAL B N   
4138 C CA  . VAL B 228 ? 0.3818 0.5173 0.3259 -0.1070 0.0061  -0.0188 221 VAL B CA  
4139 C C   . VAL B 228 ? 0.4434 0.5871 0.3818 -0.1158 0.0054  -0.0176 221 VAL B C   
4140 O O   . VAL B 228 ? 0.5148 0.6623 0.4513 -0.1190 0.0063  -0.0192 221 VAL B O   
4141 C CB  . VAL B 228 ? 0.4725 0.5988 0.4172 -0.1025 0.0036  -0.0137 221 VAL B CB  
4142 C CG1 . VAL B 228 ? 0.5225 0.6470 0.4637 -0.1057 -0.0001 -0.0067 221 VAL B CG1 
4143 C CG2 . VAL B 228 ? 0.4595 0.5778 0.4093 -0.0943 0.0040  -0.0142 221 VAL B CG2 
4144 N N   . SER B 229 ? 0.4594 0.6064 0.3950 -0.1200 0.0037  -0.0147 222 SER B N   
4145 C CA  . SER B 229 ? 0.2996 0.4549 0.2293 -0.1291 0.0027  -0.0128 222 SER B CA  
4146 C C   . SER B 229 ? 0.3259 0.4771 0.2520 -0.1316 -0.0014 -0.0049 222 SER B C   
4147 O O   . SER B 229 ? 0.4229 0.5783 0.3438 -0.1386 -0.0024 -0.0029 222 SER B O   
4148 C CB  . SER B 229 ? 0.2409 0.4039 0.1693 -0.1336 0.0033  -0.0145 222 SER B CB  
4149 O OG  . SER B 229 ? 0.3215 0.4897 0.2527 -0.1329 0.0073  -0.0224 222 SER B OG  
4150 N N   . MET B 230 ? 0.3638 0.5066 0.2924 -0.1263 -0.0038 -0.0004 223 MET B N   
4151 C CA  . MET B 230 ? 0.3713 0.5094 0.2973 -0.1281 -0.0078 0.0071  223 MET B CA  
4152 C C   . MET B 230 ? 0.3832 0.5110 0.3139 -0.1200 -0.0093 0.0099  223 MET B C   
4153 O O   . MET B 230 ? 0.3732 0.4984 0.3082 -0.1142 -0.0081 0.0078  223 MET B O   
4154 C CB  . MET B 230 ? 0.3660 0.5101 0.2875 -0.1358 -0.0106 0.0120  223 MET B CB  
4155 C CG  . MET B 230 ? 0.8258 0.9751 0.7405 -0.1452 -0.0123 0.0149  223 MET B CG  
4156 S SD  . MET B 230 ? 0.4440 0.5840 0.3566 -0.1456 -0.0168 0.0227  223 MET B SD  
4157 C CE  . MET B 230 ? 0.5377 0.6729 0.4550 -0.1404 -0.0195 0.0273  223 MET B CE  
4158 N N   . VAL B 231 ? 0.3211 0.4430 0.2506 -0.1200 -0.0120 0.0146  224 VAL B N   
4159 C CA  . VAL B 231 ? 0.4688 0.5819 0.4020 -0.1138 -0.0141 0.0183  224 VAL B CA  
4160 C C   . VAL B 231 ? 0.2858 0.3976 0.2154 -0.1192 -0.0187 0.0259  224 VAL B C   
4161 O O   . VAL B 231 ? 0.3841 0.4957 0.3093 -0.1241 -0.0201 0.0280  224 VAL B O   
4162 C CB  . VAL B 231 ? 0.4511 0.5566 0.3879 -0.1068 -0.0128 0.0161  224 VAL B CB  
4163 C CG1 . VAL B 231 ? 0.3552 0.4523 0.2961 -0.1007 -0.0149 0.0196  224 VAL B CG1 
4164 C CG2 . VAL B 231 ? 0.2362 0.3432 0.1764 -0.1022 -0.0087 0.0092  224 VAL B CG2 
4165 N N   . THR B 232 ? 0.3168 0.4278 0.2480 -0.1188 -0.0212 0.0301  225 THR B N   
4166 C CA  . THR B 232 ? 0.4047 0.5138 0.3331 -0.1238 -0.0261 0.0379  225 THR B CA  
4167 C C   . THR B 232 ? 0.5727 0.6719 0.5035 -0.1189 -0.0277 0.0400  225 THR B C   
4168 O O   . THR B 232 ? 0.5709 0.6650 0.5068 -0.1107 -0.0253 0.0362  225 THR B O   
4169 C CB  . THR B 232 ? 0.4289 0.5407 0.3586 -0.1250 -0.0287 0.0425  225 THR B CB  
4170 O OG1 . THR B 232 ? 0.5701 0.6773 0.5063 -0.1163 -0.0271 0.0403  225 THR B OG1 
4171 C CG2 . THR B 232 ? 0.4989 0.6213 0.4255 -0.1310 -0.0276 0.0412  225 THR B CG2 
4172 N N   . LYS B 233 ? 0.5701 0.6668 0.4971 -0.1245 -0.0321 0.0463  226 LYS B N   
4173 C CA  . LYS B 233 ? 0.4101 0.4973 0.3389 -0.1211 -0.0344 0.0493  226 LYS B CA  
4174 C C   . LYS B 233 ? 0.5600 0.6421 0.4910 -0.1182 -0.0367 0.0557  226 LYS B C   
4175 O O   . LYS B 233 ? 0.6265 0.7072 0.5530 -0.1224 -0.0389 0.0622  226 LYS B O   
4176 C CB  . LYS B 233 ? 0.2574 0.3405 0.1795 -0.1257 -0.0348 0.0523  226 LYS B CB  
4177 C CG  . LYS B 233 ? 0.2562 0.3275 0.1791 -0.1211 -0.0354 0.0552  226 LYS B CG  
4178 C CD  . LYS B 233 ? 0.3807 0.4506 0.2974 -0.1261 -0.0345 0.0550  226 LYS B CD  
4179 C CE  . LYS B 233 ? 0.6016 0.6598 0.5154 -0.1259 -0.0362 0.0618  226 LYS B CE  
4180 N NZ  . LYS B 233 ? 0.7645 0.8211 0.6726 -0.1307 -0.0348 0.0612  226 LYS B NZ  
4181 N N   . ASP B 234 ? 0.5074 0.5870 0.4452 -0.1112 -0.0362 0.0538  227 ASP B N   
4182 C CA  . ASP B 234 ? 0.6387 0.7160 0.5791 -0.1087 -0.0379 0.0586  227 ASP B CA  
4183 C C   . ASP B 234 ? 0.5866 0.6600 0.5345 -0.1006 -0.0368 0.0557  227 ASP B C   
4184 O O   . ASP B 234 ? 0.5597 0.6324 0.5104 -0.0969 -0.0347 0.0500  227 ASP B O   
4185 C CB  . ASP B 234 ? 0.8157 0.9039 0.7549 -0.1138 -0.0380 0.0588  227 ASP B CB  
4186 C CG  . ASP B 234 ? 0.8220 0.9087 0.7605 -0.1137 -0.0404 0.0659  227 ASP B CG  
4187 O OD1 . ASP B 234 ? 0.8450 0.9223 0.7810 -0.1122 -0.0426 0.0722  227 ASP B OD1 
4188 O OD2 . ASP B 234 ? 0.7968 0.8916 0.7369 -0.1150 -0.0400 0.0653  227 ASP B OD2 
4189 N N   . ASN B 235 ? 0.6186 0.6891 0.5690 -0.0975 -0.0381 0.0596  228 ASN B N   
4190 C CA  . ASN B 235 ? 0.5045 0.5720 0.4616 -0.0905 -0.0370 0.0571  228 ASN B CA  
4191 C C   . ASN B 235 ? 0.4739 0.5484 0.4339 -0.0904 -0.0365 0.0568  228 ASN B C   
4192 O O   . ASN B 235 ? 0.5260 0.5995 0.4850 -0.0903 -0.0382 0.0622  228 ASN B O   
4193 C CB  . ASN B 235 ? 0.5026 0.5590 0.4605 -0.0858 -0.0387 0.0616  228 ASN B CB  
4194 C CG  . ASN B 235 ? 0.7005 0.7543 0.6651 -0.0791 -0.0376 0.0593  228 ASN B CG  
4195 O OD1 . ASN B 235 ? 0.6704 0.7263 0.6390 -0.0765 -0.0354 0.0534  228 ASN B OD1 
4196 N ND2 . ASN B 235 ? 0.8201 0.8692 0.7854 -0.0762 -0.0393 0.0640  228 ASN B ND2 
4197 N N   . PRO B 236 ? 0.4361 0.5152 0.3980 -0.0884 -0.0329 0.0503  229 PRO B N   
4198 C CA  . PRO B 236 ? 0.4655 0.5422 0.4268 -0.0848 -0.0290 0.0436  229 PRO B CA  
4199 C C   . PRO B 236 ? 0.4696 0.5517 0.4254 -0.0910 -0.0285 0.0427  229 PRO B C   
4200 O O   . PRO B 236 ? 0.5505 0.6390 0.5028 -0.0979 -0.0307 0.0465  229 PRO B O   
4201 C CB  . PRO B 236 ? 0.3687 0.4469 0.3329 -0.0798 -0.0252 0.0385  229 PRO B CB  
4202 C CG  . PRO B 236 ? 0.2060 0.2918 0.1690 -0.0846 -0.0266 0.0417  229 PRO B CG  
4203 C CD  . PRO B 236 ? 0.1977 0.2833 0.1605 -0.0886 -0.0316 0.0496  229 PRO B CD  
4204 N N   . GLY B 237 ? 0.3926 0.4727 0.3475 -0.0888 -0.0258 0.0378  230 GLY B N   
4205 C CA  . GLY B 237 ? 0.3173 0.4033 0.2673 -0.0943 -0.0245 0.0358  230 GLY B CA  
4206 C C   . GLY B 237 ? 0.3746 0.4662 0.3253 -0.0936 -0.0215 0.0314  230 GLY B C   
4207 O O   . GLY B 237 ? 0.5784 0.6674 0.5333 -0.0875 -0.0197 0.0286  230 GLY B O   
4208 N N   . VAL B 238 ? 0.3541 0.4536 0.3005 -0.1001 -0.0211 0.0307  231 VAL B N   
4209 C CA  . VAL B 238 ? 0.4069 0.5125 0.3536 -0.1004 -0.0182 0.0262  231 VAL B CA  
4210 C C   . VAL B 238 ? 0.3912 0.5007 0.3352 -0.1027 -0.0153 0.0209  231 VAL B C   
4211 O O   . VAL B 238 ? 0.4281 0.5404 0.3679 -0.1083 -0.0163 0.0224  231 VAL B O   
4212 C CB  . VAL B 238 ? 0.2524 0.3660 0.1968 -0.1066 -0.0202 0.0300  231 VAL B CB  
4213 C CG1 . VAL B 238 ? 0.3806 0.5007 0.3250 -0.1072 -0.0171 0.0248  231 VAL B CG1 
4214 C CG2 . VAL B 238 ? 0.2467 0.3572 0.1942 -0.1043 -0.0229 0.0351  231 VAL B CG2 
4215 N N   . VAL B 239 ? 0.2298 0.3397 0.1762 -0.0988 -0.0119 0.0148  232 VAL B N   
4216 C CA  . VAL B 239 ? 0.3717 0.4856 0.3164 -0.1007 -0.0090 0.0094  232 VAL B CA  
4217 C C   . VAL B 239 ? 0.4609 0.5842 0.4035 -0.1059 -0.0074 0.0065  232 VAL B C   
4218 O O   . VAL B 239 ? 0.5722 0.6965 0.5167 -0.1045 -0.0070 0.0057  232 VAL B O   
4219 C CB  . VAL B 239 ? 0.3107 0.4188 0.2596 -0.0933 -0.0062 0.0045  232 VAL B CB  
4220 C CG1 . VAL B 239 ? 0.3256 0.4393 0.2738 -0.0953 -0.0029 -0.0017 232 VAL B CG1 
4221 C CG2 . VAL B 239 ? 0.2414 0.3417 0.1919 -0.0890 -0.0074 0.0067  232 VAL B CG2 
4222 N N   . THR B 240 ? 0.4184 0.5490 0.3571 -0.1123 -0.0065 0.0046  233 THR B N   
4223 C CA  . THR B 240 ? 0.3952 0.5352 0.3322 -0.1171 -0.0043 0.0004  233 THR B CA  
4224 C C   . THR B 240 ? 0.4598 0.6011 0.3988 -0.1151 -0.0004 -0.0073 233 THR B C   
4225 O O   . THR B 240 ? 0.5229 0.6632 0.4614 -0.1149 0.0005  -0.0088 233 THR B O   
4226 C CB  . THR B 240 ? 0.5664 0.7156 0.4975 -0.1269 -0.0059 0.0031  233 THR B CB  
4227 O OG1 . THR B 240 ? 0.3183 0.4670 0.2479 -0.1293 -0.0098 0.0106  233 THR B OG1 
4228 C CG2 . THR B 240 ? 0.1809 0.3406 0.1106 -0.1320 -0.0034 -0.0018 233 THR B CG2 
4229 N N   . CYS B 241 ? 0.3537 0.4975 0.2949 -0.1139 0.0020  -0.0121 234 CYS B N   
4230 C CA  . CYS B 241 ? 0.3765 0.5207 0.3206 -0.1113 0.0057  -0.0194 234 CYS B CA  
4231 C C   . CYS B 241 ? 0.4796 0.6324 0.4237 -0.1153 0.0084  -0.0251 234 CYS B C   
4232 O O   . CYS B 241 ? 0.5016 0.6543 0.4468 -0.1144 0.0084  -0.0253 234 CYS B O   
4233 C CB  . CYS B 241 ? 0.3698 0.5038 0.3187 -0.1027 0.0061  -0.0198 234 CYS B CB  
4234 S SG  . CYS B 241 ? 0.5327 0.6668 0.4859 -0.0995 0.0103  -0.0281 234 CYS B SG  
4235 N N   . LEU B 242 ? 0.5500 0.7103 0.4931 -0.1197 0.0109  -0.0303 235 LEU B N   
4236 C CA  . LEU B 242 ? 0.5308 0.7009 0.4734 -0.1249 0.0137  -0.0363 235 LEU B CA  
4237 C C   . LEU B 242 ? 0.7148 0.8846 0.6625 -0.1216 0.0175  -0.0443 235 LEU B C   
4238 O O   . LEU B 242 ? 0.6544 0.8318 0.6026 -0.1255 0.0200  -0.0498 235 LEU B O   
4239 C CB  . LEU B 242 ? 0.4739 0.6541 0.4125 -0.1327 0.0144  -0.0379 235 LEU B CB  
4240 C CG  . LEU B 242 ? 0.5127 0.6991 0.4453 -0.1400 0.0116  -0.0323 235 LEU B CG  
4241 C CD1 . LEU B 242 ? 0.5188 0.6975 0.4507 -0.1371 0.0075  -0.0239 235 LEU B CD1 
4242 C CD2 . LEU B 242 ? 0.3859 0.5771 0.3148 -0.1453 0.0116  -0.0322 235 LEU B CD2 
4243 N N   . ASP B 243 ? 0.7760 0.9377 0.7275 -0.1151 0.0181  -0.0450 236 ASP B N   
4244 C CA  . ASP B 243 ? 0.6408 0.8018 0.5978 -0.1118 0.0216  -0.0522 236 ASP B CA  
4245 C C   . ASP B 243 ? 0.6982 0.8585 0.6574 -0.1112 0.0230  -0.0550 236 ASP B C   
4246 O O   . ASP B 243 ? 0.5891 0.7462 0.5465 -0.1105 0.0207  -0.0503 236 ASP B O   
4247 C CB  . ASP B 243 ? 0.7119 0.8633 0.6722 -0.1046 0.0211  -0.0504 236 ASP B CB  
4248 C CG  . ASP B 243 ? 0.7611 0.9156 0.7255 -0.1038 0.0241  -0.0569 236 ASP B CG  
4249 O OD1 . ASP B 243 ? 0.7064 0.8617 0.6698 -0.1039 0.0235  -0.0555 236 ASP B OD1 
4250 O OD2 . ASP B 243 ? 0.8059 0.9623 0.7750 -0.1031 0.0273  -0.0635 236 ASP B OD2 
4251 N N   . GLU B 244 ? 0.7756 0.9394 0.7392 -0.1116 0.0268  -0.0630 237 GLU B N   
4252 C CA  . GLU B 244 ? 0.8495 1.0120 0.8156 -0.1110 0.0284  -0.0661 237 GLU B CA  
4253 C C   . GLU B 244 ? 0.8252 0.9757 0.7940 -0.1036 0.0273  -0.0630 237 GLU B C   
4254 O O   . GLU B 244 ? 0.7526 0.8991 0.7219 -0.1021 0.0269  -0.0620 237 GLU B O   
4255 C CB  . GLU B 244 ? 0.9039 1.0730 0.8748 -0.1135 0.0330  -0.0760 237 GLU B CB  
4256 C CG  . GLU B 244 ? 1.1180 1.2985 1.0876 -0.1195 0.0346  -0.0801 237 GLU B CG  
4257 C CD  . GLU B 244 ? 1.2491 1.4330 1.2252 -0.1187 0.0384  -0.0886 237 GLU B CD  
4258 O OE1 . GLU B 244 ? 1.2677 1.4583 1.2433 -0.1214 0.0391  -0.0907 237 GLU B OE1 
4259 O OE2 . GLU B 244 ? 1.2817 1.4619 1.2640 -0.1156 0.0409  -0.0933 237 GLU B OE2 
4260 N N   . ALA B 245 ? 0.8199 0.9654 0.7904 -0.0994 0.0268  -0.0616 238 ALA B N   
4261 C CA  . ALA B 245 ? 0.7680 0.9025 0.7409 -0.0925 0.0256  -0.0582 238 ALA B CA  
4262 C C   . ALA B 245 ? 0.7228 0.8512 0.6921 -0.0904 0.0217  -0.0503 238 ALA B C   
4263 O O   . ALA B 245 ? 0.5936 0.7139 0.5647 -0.0856 0.0209  -0.0481 238 ALA B O   
4264 C CB  . ALA B 245 ? 0.6733 0.8056 0.6481 -0.0894 0.0255  -0.0580 238 ALA B CB  
4265 N N   . ARG B 246 ? 0.7305 0.8636 0.6952 -0.0944 0.0194  -0.0462 239 ARG B N   
4266 C CA  . ARG B 246 ? 0.7171 0.8461 0.6790 -0.0931 0.0156  -0.0388 239 ARG B CA  
4267 C C   . ARG B 246 ? 0.7839 0.9093 0.7472 -0.0911 0.0155  -0.0385 239 ARG B C   
4268 O O   . ARG B 246 ? 0.8374 0.9576 0.8001 -0.0882 0.0128  -0.0330 239 ARG B O   
4269 C CB  . ARG B 246 ? 0.6587 0.7957 0.6161 -0.0994 0.0139  -0.0359 239 ARG B CB  
4270 C CG  . ARG B 246 ? 0.5958 0.7406 0.5518 -0.1046 0.0148  -0.0382 239 ARG B CG  
4271 C CD  . ARG B 246 ? 0.6372 0.7918 0.5885 -0.1119 0.0137  -0.0365 239 ARG B CD  
4272 N NE  . ARG B 246 ? 0.6429 0.8074 0.5939 -0.1177 0.0169  -0.0433 239 ARG B NE  
4273 C CZ  . ARG B 246 ? 0.7662 0.9372 0.7163 -0.1217 0.0177  -0.0453 239 ARG B CZ  
4274 N NH1 . ARG B 246 ? 0.7057 0.8746 0.6553 -0.1206 0.0154  -0.0408 239 ARG B NH1 
4275 N NH2 . ARG B 246 ? 0.9567 1.1371 0.9069 -0.1271 0.0208  -0.0520 239 ARG B NH2 
4276 N N   . HIS B 247 ? 0.8234 0.9518 0.7887 -0.0928 0.0186  -0.0447 240 HIS B N   
4277 C CA  . HIS B 247 ? 0.8895 1.0157 0.8558 -0.0920 0.0189  -0.0451 240 HIS B CA  
4278 C C   . HIS B 247 ? 0.9176 1.0333 0.8869 -0.0855 0.0187  -0.0439 240 HIS B C   
4279 O O   . HIS B 247 ? 0.9995 1.1115 0.9690 -0.0836 0.0176  -0.0417 240 HIS B O   
4280 C CB  . HIS B 247 ? 0.8821 1.0153 0.8499 -0.0965 0.0225  -0.0525 240 HIS B CB  
4281 C CG  . HIS B 247 ? 0.8451 0.9895 0.8095 -0.1034 0.0225  -0.0535 240 HIS B CG  
4282 N ND1 . HIS B 247 ? 0.7110 0.8628 0.6755 -0.1075 0.0250  -0.0587 240 HIS B ND1 
4283 C CD2 . HIS B 247 ? 0.7290 0.8791 0.6898 -0.1073 0.0205  -0.0500 240 HIS B CD2 
4284 C CE1 . HIS B 247 ? 0.6287 0.7902 0.5896 -0.1138 0.0244  -0.0583 240 HIS B CE1 
4285 N NE2 . HIS B 247 ? 0.6206 0.7813 0.5792 -0.1139 0.0216  -0.0529 240 HIS B NE2 
4286 N N   . GLY B 248 ? 0.8362 0.9478 0.8080 -0.0823 0.0198  -0.0455 241 GLY B N   
4287 C CA  . GLY B 248 ? 0.7877 0.8899 0.7625 -0.0766 0.0200  -0.0447 241 GLY B CA  
4288 C C   . GLY B 248 ? 0.7698 0.8651 0.7432 -0.0722 0.0163  -0.0375 241 GLY B C   
4289 O O   . GLY B 248 ? 0.8490 0.9370 0.8242 -0.0679 0.0160  -0.0362 241 GLY B O   
4290 N N   . PHE B 249 ? 0.7007 0.7987 0.6712 -0.0735 0.0137  -0.0332 242 PHE B N   
4291 C CA  . PHE B 249 ? 0.7189 0.8111 0.6888 -0.0697 0.0104  -0.0267 242 PHE B CA  
4292 C C   . PHE B 249 ? 0.7490 0.8408 0.7182 -0.0698 0.0086  -0.0237 242 PHE B C   
4293 O O   . PHE B 249 ? 0.9261 1.0248 0.8933 -0.0744 0.0083  -0.0237 242 PHE B O   
4294 C CB  . PHE B 249 ? 0.5951 0.6903 0.5627 -0.0716 0.0085  -0.0233 242 PHE B CB  
4295 C CG  . PHE B 249 ? 0.6222 0.7177 0.5905 -0.0712 0.0098  -0.0256 242 PHE B CG  
4296 C CD1 . PHE B 249 ? 0.7189 0.8086 0.6881 -0.0671 0.0085  -0.0225 242 PHE B CD1 
4297 C CD2 . PHE B 249 ? 0.6974 0.7999 0.6657 -0.0751 0.0126  -0.0311 242 PHE B CD2 
4298 C CE1 . PHE B 249 ? 0.8267 0.9177 0.7968 -0.0669 0.0097  -0.0246 242 PHE B CE1 
4299 C CE2 . PHE B 249 ? 0.7590 0.8629 0.7285 -0.0749 0.0139  -0.0335 242 PHE B CE2 
4300 C CZ  . PHE B 249 ? 0.8185 0.9167 0.7887 -0.0708 0.0124  -0.0301 242 PHE B CZ  
4301 N N   . GLU B 250 ? 0.5220 0.6065 0.4930 -0.0650 0.0075  -0.0213 243 GLU B N   
4302 C CA  . GLU B 250 ? 0.5231 0.6074 0.4940 -0.0646 0.0057  -0.0183 243 GLU B CA  
4303 C C   . GLU B 250 ? 0.4464 0.5260 0.4180 -0.0610 0.0028  -0.0127 243 GLU B C   
4304 O O   . GLU B 250 ? 0.5431 0.6180 0.5155 -0.0579 0.0024  -0.0115 243 GLU B O   
4305 C CB  . GLU B 250 ? 0.6084 0.6891 0.5810 -0.0628 0.0074  -0.0212 243 GLU B CB  
4306 C CG  . GLU B 250 ? 0.8325 0.9186 0.8049 -0.0670 0.0103  -0.0267 243 GLU B CG  
4307 C CD  . GLU B 250 ? 1.0225 1.1038 0.9969 -0.0652 0.0122  -0.0298 243 GLU B CD  
4308 O OE1 . GLU B 250 ? 0.9695 1.0486 0.9442 -0.0637 0.0110  -0.0276 243 GLU B OE1 
4309 O OE2 . GLU B 250 ? 1.1432 1.2232 1.1193 -0.0656 0.0152  -0.0345 243 GLU B OE2 
4310 N N   . SER B 251 ? 0.4559 0.5374 0.4276 -0.0616 0.0010  -0.0095 244 SER B N   
4311 C CA  . SER B 251 ? 0.3764 0.4540 0.3495 -0.0585 -0.0014 -0.0046 244 SER B CA  
4312 C C   . SER B 251 ? 0.4573 0.5264 0.4329 -0.0527 -0.0011 -0.0050 244 SER B C   
4313 O O   . SER B 251 ? 0.4381 0.5051 0.4146 -0.0513 0.0001  -0.0074 244 SER B O   
4314 C CB  . SER B 251 ? 0.4243 0.5061 0.3976 -0.0603 -0.0028 -0.0017 244 SER B CB  
4315 O OG  . SER B 251 ? 0.5382 0.6267 0.5095 -0.0650 -0.0043 0.0015  244 SER B OG  
4316 N N   . GLY B 252 ? 0.5147 0.5792 0.4913 -0.0497 -0.0022 -0.0028 245 GLY B N   
4317 C CA  . GLY B 252 ? 0.3451 0.4021 0.3239 -0.0444 -0.0020 -0.0030 245 GLY B CA  
4318 C C   . GLY B 252 ? 0.4613 0.5156 0.4401 -0.0431 -0.0004 -0.0056 245 GLY B C   
4319 O O   . GLY B 252 ? 0.5185 0.5671 0.4989 -0.0392 -0.0003 -0.0054 245 GLY B O   
4320 N N   . ASP B 253 ? 0.5179 0.5769 0.4948 -0.0468 0.0009  -0.0081 246 ASP B N   
4321 C CA  . ASP B 253 ? 0.4914 0.5495 0.4685 -0.0462 0.0024  -0.0104 246 ASP B CA  
4322 C C   . ASP B 253 ? 0.4993 0.5549 0.4768 -0.0441 0.0007  -0.0071 246 ASP B C   
4323 O O   . ASP B 253 ? 0.5226 0.5797 0.4995 -0.0453 -0.0012 -0.0039 246 ASP B O   
4324 C CB  . ASP B 253 ? 0.5740 0.6391 0.5493 -0.0511 0.0041  -0.0136 246 ASP B CB  
4325 C CG  . ASP B 253 ? 0.6742 0.7417 0.6496 -0.0533 0.0066  -0.0182 246 ASP B CG  
4326 O OD1 . ASP B 253 ? 0.8289 0.8939 0.8051 -0.0521 0.0066  -0.0181 246 ASP B OD1 
4327 O OD2 . ASP B 253 ? 0.6238 0.6960 0.5989 -0.0564 0.0088  -0.0222 246 ASP B OD2 
4328 N N   . PHE B 254 ? 0.4182 0.4705 0.3971 -0.0414 0.0015  -0.0080 247 PHE B N   
4329 C CA  . PHE B 254 ? 0.2001 0.2515 0.1791 -0.0404 0.0002  -0.0056 247 PHE B CA  
4330 C C   . PHE B 254 ? 0.3639 0.4201 0.3415 -0.0435 0.0016  -0.0079 247 PHE B C   
4331 O O   . PHE B 254 ? 0.4462 0.5045 0.4244 -0.0443 0.0039  -0.0119 247 PHE B O   
4332 C CB  . PHE B 254 ? 0.2343 0.2795 0.2157 -0.0355 -0.0002 -0.0044 247 PHE B CB  
4333 C CG  . PHE B 254 ? 0.2925 0.3338 0.2753 -0.0329 -0.0021 -0.0013 247 PHE B CG  
4334 C CD1 . PHE B 254 ? 0.2586 0.2978 0.2423 -0.0315 -0.0021 -0.0014 247 PHE B CD1 
4335 C CD2 . PHE B 254 ? 0.2032 0.2433 0.1864 -0.0322 -0.0037 0.0015  247 PHE B CD2 
4336 C CE1 . PHE B 254 ? 0.2076 0.2439 0.1929 -0.0292 -0.0036 0.0009  247 PHE B CE1 
4337 C CE2 . PHE B 254 ? 0.2892 0.3263 0.2743 -0.0301 -0.0051 0.0037  247 PHE B CE2 
4338 C CZ  . PHE B 254 ? 0.3426 0.3780 0.3288 -0.0285 -0.0049 0.0034  247 PHE B CZ  
4339 N N   . VAL B 255 ? 0.2923 0.3507 0.2685 -0.0454 0.0003  -0.0058 248 VAL B N   
4340 C CA  . VAL B 255 ? 0.2306 0.2953 0.2048 -0.0497 0.0015  -0.0079 248 VAL B CA  
4341 C C   . VAL B 255 ? 0.2569 0.3213 0.2308 -0.0494 0.0007  -0.0063 248 VAL B C   
4342 O O   . VAL B 255 ? 0.3867 0.4469 0.3611 -0.0474 -0.0012 -0.0028 248 VAL B O   
4343 C CB  . VAL B 255 ? 0.2809 0.3508 0.2523 -0.0546 0.0008  -0.0071 248 VAL B CB  
4344 C CG1 . VAL B 255 ? 0.1665 0.2412 0.1351 -0.0591 0.0001  -0.0059 248 VAL B CG1 
4345 C CG2 . VAL B 255 ? 0.1951 0.2690 0.1663 -0.0568 0.0029  -0.0113 248 VAL B CG2 
4346 N N   . SER B 256 ? 0.2943 0.3634 0.2677 -0.0516 0.0024  -0.0093 249 SER B N   
4347 C CA  . SER B 256 ? 0.3983 0.4681 0.3709 -0.0522 0.0018  -0.0080 249 SER B CA  
4348 C C   . SER B 256 ? 0.3862 0.4639 0.3563 -0.0577 0.0030  -0.0105 249 SER B C   
4349 O O   . SER B 256 ? 0.2608 0.3436 0.2306 -0.0604 0.0048  -0.0141 249 SER B O   
4350 C CB  . SER B 256 ? 0.4202 0.4871 0.3957 -0.0480 0.0026  -0.0090 249 SER B CB  
4351 O OG  . SER B 256 ? 0.4269 0.4982 0.4040 -0.0484 0.0051  -0.0139 249 SER B OG  
4352 N N   . PHE B 257 ? 0.4224 0.5014 0.3908 -0.0597 0.0022  -0.0089 250 PHE B N   
4353 C CA  . PHE B 257 ? 0.3628 0.4496 0.3282 -0.0656 0.0032  -0.0109 250 PHE B CA  
4354 C C   . PHE B 257 ? 0.4057 0.4957 0.3717 -0.0659 0.0045  -0.0132 250 PHE B C   
4355 O O   . PHE B 257 ? 0.3981 0.4839 0.3657 -0.0625 0.0038  -0.0115 250 PHE B O   
4356 C CB  . PHE B 257 ? 0.4407 0.5280 0.4019 -0.0703 0.0009  -0.0068 250 PHE B CB  
4357 C CG  . PHE B 257 ? 0.5521 0.6381 0.5126 -0.0709 -0.0005 -0.0044 250 PHE B CG  
4358 C CD1 . PHE B 257 ? 0.3779 0.4568 0.3403 -0.0667 -0.0025 -0.0009 250 PHE B CD1 
4359 C CD2 . PHE B 257 ? 0.5189 0.6114 0.4769 -0.0760 0.0001  -0.0060 250 PHE B CD2 
4360 C CE1 . PHE B 257 ? 0.2576 0.3362 0.2197 -0.0675 -0.0037 0.0011  250 PHE B CE1 
4361 C CE2 . PHE B 257 ? 0.4506 0.5427 0.4080 -0.0768 -0.0012 -0.0038 250 PHE B CE2 
4362 C CZ  . PHE B 257 ? 0.3938 0.4791 0.3534 -0.0725 -0.0032 -0.0002 250 PHE B CZ  
4363 N N   . SER B 258 ? 0.3424 0.4407 0.3073 -0.0703 0.0065  -0.0173 251 SER B N   
4364 C CA  . SER B 258 ? 0.3160 0.4191 0.2806 -0.0723 0.0076  -0.0193 251 SER B CA  
4365 C C   . SER B 258 ? 0.4634 0.5748 0.4242 -0.0795 0.0085  -0.0214 251 SER B C   
4366 O O   . SER B 258 ? 0.4577 0.5718 0.4170 -0.0823 0.0088  -0.0222 251 SER B O   
4367 C CB  . SER B 258 ? 0.3970 0.5032 0.3665 -0.0688 0.0099  -0.0243 251 SER B CB  
4368 O OG  . SER B 258 ? 0.5703 0.6823 0.5415 -0.0704 0.0122  -0.0294 251 SER B OG  
4369 N N   . GLU B 259 ? 0.5267 0.6424 0.4857 -0.0828 0.0090  -0.0221 252 GLU B N   
4370 C CA  . GLU B 259 ? 0.4455 0.5700 0.4007 -0.0901 0.0101  -0.0245 252 GLU B CA  
4371 C C   . GLU B 259 ? 0.4691 0.5927 0.4184 -0.0957 0.0079  -0.0199 252 GLU B C   
4372 O O   . GLU B 259 ? 0.6326 0.7636 0.5784 -0.1023 0.0087  -0.0217 252 GLU B O   
4373 C CB  . GLU B 259 ? 0.4432 0.5760 0.4011 -0.0913 0.0131  -0.0312 252 GLU B CB  
4374 C CG  . GLU B 259 ? 0.5065 0.6423 0.4706 -0.0868 0.0153  -0.0365 252 GLU B CG  
4375 C CD  . GLU B 259 ? 0.7242 0.8692 0.6912 -0.0888 0.0184  -0.0439 252 GLU B CD  
4376 O OE1 . GLU B 259 ? 0.9211 1.0727 0.8847 -0.0950 0.0192  -0.0456 252 GLU B OE1 
4377 O OE2 . GLU B 259 ? 0.6945 0.8405 0.6674 -0.0845 0.0200  -0.0482 252 GLU B OE2 
4378 N N   . VAL B 260 ? 0.4653 0.5804 0.4137 -0.0934 0.0050  -0.0141 253 VAL B N   
4379 C CA  . VAL B 260 ? 0.4928 0.6071 0.4361 -0.0987 0.0024  -0.0093 253 VAL B CA  
4380 C C   . VAL B 260 ? 0.4426 0.5582 0.3809 -0.1044 0.0013  -0.0071 253 VAL B C   
4381 O O   . VAL B 260 ? 0.5443 0.6561 0.4834 -0.1021 0.0011  -0.0063 253 VAL B O   
4382 C CB  . VAL B 260 ? 0.4161 0.5216 0.3608 -0.0943 -0.0004 -0.0043 253 VAL B CB  
4383 C CG1 . VAL B 260 ? 0.4324 0.5369 0.3721 -0.0998 -0.0036 0.0013  253 VAL B CG1 
4384 C CG2 . VAL B 260 ? 0.2591 0.3646 0.2072 -0.0907 0.0006  -0.0064 253 VAL B CG2 
4385 N N   . GLN B 261 ? 0.4643 0.5856 0.3971 -0.1124 0.0008  -0.0062 254 GLN B N   
4386 C CA  . GLN B 261 ? 0.4282 0.5512 0.3551 -0.1194 -0.0002 -0.0042 254 GLN B CA  
4387 C C   . GLN B 261 ? 0.4623 0.5805 0.3843 -0.1237 -0.0043 0.0029  254 GLN B C   
4388 O O   . GLN B 261 ? 0.5892 0.7081 0.5102 -0.1253 -0.0059 0.0053  254 GLN B O   
4389 C CB  . GLN B 261 ? 0.4036 0.5377 0.3272 -0.1267 0.0022  -0.0086 254 GLN B CB  
4390 C CG  . GLN B 261 ? 0.5013 0.6414 0.4299 -0.1234 0.0061  -0.0159 254 GLN B CG  
4391 C CD  . GLN B 261 ? 0.5701 0.7215 0.4954 -0.1310 0.0085  -0.0205 254 GLN B CD  
4392 O OE1 . GLN B 261 ? 0.4890 0.6428 0.4088 -0.1378 0.0079  -0.0190 254 GLN B OE1 
4393 N NE2 . GLN B 261 ? 0.5257 0.6845 0.4545 -0.1304 0.0112  -0.0264 254 GLN B NE2 
4394 N N   . GLY B 262 ? 0.4520 0.5656 0.3706 -0.1261 -0.0062 0.0062  255 GLY B N   
4395 C CA  . GLY B 262 ? 0.4225 0.5304 0.3368 -0.1299 -0.0105 0.0132  255 GLY B CA  
4396 C C   . GLY B 262 ? 0.4731 0.5717 0.3923 -0.1220 -0.0124 0.0162  255 GLY B C   
4397 O O   . GLY B 262 ? 0.5102 0.6023 0.4289 -0.1209 -0.0140 0.0186  255 GLY B O   
4398 N N   . MET B 263 ? 0.5472 0.6453 0.4712 -0.1168 -0.0122 0.0157  256 MET B N   
4399 C CA  . MET B 263 ? 0.4811 0.5712 0.4102 -0.1092 -0.0137 0.0179  256 MET B CA  
4400 C C   . MET B 263 ? 0.4410 0.5289 0.3759 -0.1012 -0.0107 0.0134  256 MET B C   
4401 O O   . MET B 263 ? 0.3075 0.3941 0.2476 -0.0948 -0.0094 0.0113  256 MET B O   
4402 C CB  . MET B 263 ? 0.3211 0.4120 0.2524 -0.1078 -0.0147 0.0193  256 MET B CB  
4403 C CG  . MET B 263 ? 0.3043 0.3876 0.2397 -0.1020 -0.0170 0.0227  256 MET B CG  
4404 S SD  . MET B 263 ? 0.3927 0.4788 0.3293 -0.1028 -0.0185 0.0251  256 MET B SD  
4405 C CE  . MET B 263 ? 0.4005 0.4891 0.3297 -0.1136 -0.0229 0.0317  256 MET B CE  
4406 N N   . VAL B 264 ? 0.4928 0.5806 0.4263 -0.1022 -0.0097 0.0120  257 VAL B N   
4407 C CA  . VAL B 264 ? 0.5747 0.6618 0.5132 -0.0958 -0.0070 0.0079  257 VAL B CA  
4408 C C   . VAL B 264 ? 0.4191 0.4986 0.3631 -0.0875 -0.0078 0.0092  257 VAL B C   
4409 O O   . VAL B 264 ? 0.5182 0.5977 0.4670 -0.0816 -0.0057 0.0059  257 VAL B O   
4410 C CB  . VAL B 264 ? 0.5472 0.6362 0.4829 -0.0992 -0.0060 0.0066  257 VAL B CB  
4411 C CG1 . VAL B 264 ? 0.7054 0.7946 0.6464 -0.0928 -0.0034 0.0026  257 VAL B CG1 
4412 C CG2 . VAL B 264 ? 0.3698 0.4676 0.3008 -0.1069 -0.0046 0.0043  257 VAL B CG2 
4413 N N   . GLU B 265 ? 0.3015 0.3748 0.2447 -0.0874 -0.0109 0.0139  258 GLU B N   
4414 C CA  . GLU B 265 ? 0.3910 0.4574 0.3393 -0.0802 -0.0117 0.0151  258 GLU B CA  
4415 C C   . GLU B 265 ? 0.5000 0.5666 0.4532 -0.0744 -0.0102 0.0128  258 GLU B C   
4416 O O   . GLU B 265 ? 0.7370 0.7989 0.6947 -0.0680 -0.0100 0.0125  258 GLU B O   
4417 C CB  . GLU B 265 ? 0.3612 0.4224 0.3080 -0.0820 -0.0155 0.0205  258 GLU B CB  
4418 C CG  . GLU B 265 ? 0.5482 0.6126 0.4894 -0.0900 -0.0177 0.0236  258 GLU B CG  
4419 C CD  . GLU B 265 ? 0.6265 0.6909 0.5612 -0.0972 -0.0191 0.0256  258 GLU B CD  
4420 O OE1 . GLU B 265 ? 0.6184 0.6781 0.5530 -0.0960 -0.0196 0.0262  258 GLU B OE1 
4421 O OE2 . GLU B 265 ? 0.7494 0.8186 0.6787 -0.1046 -0.0197 0.0266  258 GLU B OE2 
4422 N N   . LEU B 266 ? 0.4152 0.4875 0.3672 -0.0772 -0.0091 0.0109  259 LEU B N   
4423 C CA  . LEU B 266 ? 0.3937 0.4668 0.3492 -0.0732 -0.0076 0.0084  259 LEU B CA  
4424 C C   . LEU B 266 ? 0.4209 0.4955 0.3798 -0.0690 -0.0047 0.0037  259 LEU B C   
4425 O O   . LEU B 266 ? 0.5286 0.6009 0.4911 -0.0641 -0.0038 0.0022  259 LEU B O   
4426 C CB  . LEU B 266 ? 0.4214 0.5008 0.3739 -0.0786 -0.0075 0.0080  259 LEU B CB  
4427 C CG  . LEU B 266 ? 0.4269 0.5052 0.3802 -0.0781 -0.0090 0.0102  259 LEU B CG  
4428 C CD1 . LEU B 266 ? 0.2530 0.3242 0.2085 -0.0746 -0.0115 0.0143  259 LEU B CD1 
4429 C CD2 . LEU B 266 ? 0.5169 0.6014 0.4653 -0.0860 -0.0101 0.0120  259 LEU B CD2 
4430 N N   . ASN B 267 ? 0.3970 0.4756 0.3545 -0.0713 -0.0032 0.0014  260 ASN B N   
4431 C CA  . ASN B 267 ? 0.4803 0.5614 0.4412 -0.0680 -0.0006 -0.0030 260 ASN B CA  
4432 C C   . ASN B 267 ? 0.3953 0.4704 0.3600 -0.0617 -0.0009 -0.0022 260 ASN B C   
4433 O O   . ASN B 267 ? 0.4250 0.4996 0.3935 -0.0573 0.0004  -0.0046 260 ASN B O   
4434 C CB  . ASN B 267 ? 0.5733 0.6617 0.5320 -0.0727 0.0011  -0.0059 260 ASN B CB  
4435 C CG  . ASN B 267 ? 0.5540 0.6487 0.5084 -0.0795 0.0014  -0.0067 260 ASN B CG  
4436 O OD1 . ASN B 267 ? 0.4467 0.5436 0.4015 -0.0799 0.0019  -0.0080 260 ASN B OD1 
4437 N ND2 . ASN B 267 ? 0.3623 0.4603 0.3122 -0.0855 0.0010  -0.0058 260 ASN B ND2 
4438 N N   . GLY B 268 ? 0.4252 0.4958 0.3889 -0.0616 -0.0027 0.0012  261 GLY B N   
4439 C CA  . GLY B 268 ? 0.7482 0.8132 0.7154 -0.0559 -0.0031 0.0020  261 GLY B CA  
4440 C C   . GLY B 268 ? 0.6533 0.7128 0.6239 -0.0506 -0.0037 0.0029  261 GLY B C   
4441 O O   . GLY B 268 ? 0.5320 0.5892 0.5060 -0.0458 -0.0030 0.0019  261 GLY B O   
4442 N N   . ASN B 269 ? 0.6161 0.6742 0.5858 -0.0517 -0.0050 0.0048  262 ASN B N   
4443 C CA  . ASN B 269 ? 0.6545 0.7067 0.6269 -0.0475 -0.0062 0.0067  262 ASN B CA  
4444 C C   . ASN B 269 ? 0.5235 0.5737 0.4995 -0.0424 -0.0050 0.0047  262 ASN B C   
4445 O O   . ASN B 269 ? 0.4981 0.5518 0.4742 -0.0427 -0.0032 0.0018  262 ASN B O   
4446 C CB  . ASN B 269 ? 0.8783 0.9309 0.8487 -0.0506 -0.0080 0.0092  262 ASN B CB  
4447 C CG  . ASN B 269 ? 1.0942 1.1438 1.0633 -0.0525 -0.0105 0.0130  262 ASN B CG  
4448 O OD1 . ASN B 269 ? 1.1526 1.2019 1.1202 -0.0541 -0.0109 0.0136  262 ASN B OD1 
4449 N ND2 . ASN B 269 ? 1.2109 1.2586 1.1807 -0.0525 -0.0123 0.0156  262 ASN B ND2 
4450 N N   . GLN B 270 ? 0.4920 0.5366 0.4706 -0.0383 -0.0059 0.0062  263 GLN B N   
4451 C CA  . GLN B 270 ? 0.4053 0.4472 0.3866 -0.0341 -0.0051 0.0049  263 GLN B CA  
4452 C C   . GLN B 270 ? 0.3686 0.4131 0.3487 -0.0364 -0.0048 0.0041  263 GLN B C   
4453 O O   . GLN B 270 ? 0.3678 0.4143 0.3459 -0.0399 -0.0060 0.0058  263 GLN B O   
4454 C CB  . GLN B 270 ? 0.3104 0.3467 0.2944 -0.0302 -0.0062 0.0065  263 GLN B CB  
4455 C CG  . GLN B 270 ? 0.3681 0.4020 0.3525 -0.0298 -0.0073 0.0083  263 GLN B CG  
4456 C CD  . GLN B 270 ? 0.4578 0.4868 0.4452 -0.0257 -0.0078 0.0088  263 GLN B CD  
4457 O OE1 . GLN B 270 ? 0.2650 0.2923 0.2539 -0.0234 -0.0073 0.0081  263 GLN B OE1 
4458 N NE2 . GLN B 270 ? 0.6930 0.7199 0.6810 -0.0250 -0.0085 0.0099  263 GLN B NE2 
4459 N N   . PRO B 271 ? 0.3114 0.3561 0.2926 -0.0348 -0.0033 0.0017  264 PRO B N   
4460 C CA  . PRO B 271 ? 0.3504 0.3978 0.3303 -0.0371 -0.0028 0.0006  264 PRO B CA  
4461 C C   . PRO B 271 ? 0.3908 0.4363 0.3708 -0.0372 -0.0045 0.0031  264 PRO B C   
4462 O O   . PRO B 271 ? 0.3792 0.4200 0.3615 -0.0336 -0.0053 0.0045  264 PRO B O   
4463 C CB  . PRO B 271 ? 0.4333 0.4791 0.4150 -0.0345 -0.0012 -0.0020 264 PRO B CB  
4464 C CG  . PRO B 271 ? 0.3446 0.3897 0.3278 -0.0323 -0.0005 -0.0027 264 PRO B CG  
4465 C CD  . PRO B 271 ? 0.2480 0.2905 0.2314 -0.0312 -0.0022 0.0001  264 PRO B CD  
4466 N N   . MET B 272 ? 0.3920 0.4418 0.3697 -0.0415 -0.0050 0.0038  265 MET B N   
4467 C CA  . MET B 272 ? 0.4702 0.5196 0.4480 -0.0423 -0.0067 0.0065  265 MET B CA  
4468 C C   . MET B 272 ? 0.5461 0.5976 0.5236 -0.0432 -0.0059 0.0050  265 MET B C   
4469 O O   . MET B 272 ? 0.4390 0.4940 0.4151 -0.0452 -0.0043 0.0021  265 MET B O   
4470 C CB  . MET B 272 ? 0.6200 0.6731 0.5950 -0.0474 -0.0084 0.0093  265 MET B CB  
4471 C CG  . MET B 272 ? 0.9450 0.9986 0.9183 -0.0491 -0.0086 0.0096  265 MET B CG  
4472 S SD  . MET B 272 ? 0.4962 0.5573 0.4646 -0.0570 -0.0090 0.0103  265 MET B SD  
4473 C CE  . MET B 272 ? 0.9534 1.0186 0.9218 -0.0575 -0.0070 0.0067  265 MET B CE  
4474 N N   . GLU B 273 ? 0.4901 0.5400 0.4691 -0.0419 -0.0070 0.0068  266 GLU B N   
4475 C CA  . GLU B 273 ? 0.3404 0.3926 0.3192 -0.0429 -0.0064 0.0057  266 GLU B CA  
4476 C C   . GLU B 273 ? 0.4331 0.4923 0.4090 -0.0488 -0.0070 0.0067  266 GLU B C   
4477 O O   . GLU B 273 ? 0.3759 0.4373 0.3505 -0.0519 -0.0088 0.0098  266 GLU B O   
4478 C CB  . GLU B 273 ? 0.1549 0.2039 0.1364 -0.0399 -0.0073 0.0072  266 GLU B CB  
4479 C CG  . GLU B 273 ? 0.4095 0.4599 0.3911 -0.0401 -0.0063 0.0055  266 GLU B CG  
4480 C CD  . GLU B 273 ? 0.5167 0.5638 0.5008 -0.0370 -0.0068 0.0066  266 GLU B CD  
4481 O OE1 . GLU B 273 ? 0.5497 0.5938 0.5350 -0.0342 -0.0057 0.0044  266 GLU B OE1 
4482 O OE2 . GLU B 273 ? 0.5464 0.5945 0.5315 -0.0377 -0.0083 0.0097  266 GLU B OE2 
4483 N N   . ILE B 274 ? 0.4678 0.5307 0.4426 -0.0507 -0.0056 0.0040  267 ILE B N   
4484 C CA  . ILE B 274 ? 0.3487 0.4191 0.3206 -0.0567 -0.0057 0.0040  267 ILE B CA  
4485 C C   . ILE B 274 ? 0.4098 0.4832 0.3820 -0.0580 -0.0063 0.0051  267 ILE B C   
4486 O O   . ILE B 274 ? 0.5349 0.6055 0.5091 -0.0549 -0.0054 0.0035  267 ILE B O   
4487 C CB  . ILE B 274 ? 0.2424 0.3160 0.2128 -0.0585 -0.0031 -0.0009 267 ILE B CB  
4488 C CG1 . ILE B 274 ? 0.4596 0.5353 0.4281 -0.0608 -0.0030 -0.0010 267 ILE B CG1 
4489 C CG2 . ILE B 274 ? 0.1523 0.2330 0.1207 -0.0633 -0.0023 -0.0028 267 ILE B CG2 
4490 C CD1 . ILE B 274 ? 0.5783 0.6491 0.5478 -0.0582 -0.0046 0.0021  267 ILE B CD1 
4491 N N   . LYS B 275 ? 0.3509 0.4302 0.3211 -0.0629 -0.0079 0.0083  268 LYS B N   
4492 C CA  . LYS B 275 ? 0.4082 0.4930 0.3781 -0.0657 -0.0082 0.0092  268 LYS B CA  
4493 C C   . LYS B 275 ? 0.4822 0.5757 0.4485 -0.0722 -0.0077 0.0081  268 LYS B C   
4494 O O   . LYS B 275 ? 0.3238 0.4206 0.2875 -0.0764 -0.0090 0.0105  268 LYS B O   
4495 C CB  . LYS B 275 ? 0.3379 0.4231 0.3090 -0.0661 -0.0108 0.0148  268 LYS B CB  
4496 C CG  . LYS B 275 ? 0.6095 0.6997 0.5811 -0.0677 -0.0109 0.0158  268 LYS B CG  
4497 C CD  . LYS B 275 ? 0.8823 0.9668 0.8572 -0.0619 -0.0097 0.0136  268 LYS B CD  
4498 C CE  . LYS B 275 ? 0.8700 0.9601 0.8453 -0.0635 -0.0094 0.0138  268 LYS B CE  
4499 N NZ  . LYS B 275 ? 0.7039 0.7884 0.6823 -0.0583 -0.0086 0.0127  268 LYS B NZ  
4500 N N   . VAL B 276 ? 0.5675 0.6649 0.5335 -0.0736 -0.0059 0.0044  269 VAL B N   
4501 C CA  . VAL B 276 ? 0.5216 0.6279 0.4844 -0.0799 -0.0049 0.0024  269 VAL B CA  
4502 C C   . VAL B 276 ? 0.5246 0.6390 0.4858 -0.0850 -0.0068 0.0064  269 VAL B C   
4503 O O   . VAL B 276 ? 0.5010 0.6155 0.4639 -0.0836 -0.0074 0.0081  269 VAL B O   
4504 C CB  . VAL B 276 ? 0.4318 0.5389 0.3950 -0.0795 -0.0019 -0.0040 269 VAL B CB  
4505 C CG1 . VAL B 276 ? 0.3276 0.4445 0.2878 -0.0862 -0.0006 -0.0067 269 VAL B CG1 
4506 C CG2 . VAL B 276 ? 0.4093 0.5093 0.3739 -0.0751 -0.0002 -0.0074 269 VAL B CG2 
4507 N N   . LEU B 277 ? 0.5064 0.6280 0.4640 -0.0914 -0.0076 0.0081  270 LEU B N   
4508 C CA  . LEU B 277 ? 0.4050 0.5349 0.3604 -0.0972 -0.0099 0.0132  270 LEU B CA  
4509 C C   . LEU B 277 ? 0.4225 0.5632 0.3750 -0.1036 -0.0085 0.0103  270 LEU B C   
4510 O O   . LEU B 277 ? 0.4993 0.6482 0.4504 -0.1082 -0.0099 0.0135  270 LEU B O   
4511 C CB  . LEU B 277 ? 0.3878 0.5177 0.3411 -0.1003 -0.0129 0.0189  270 LEU B CB  
4512 C CG  . LEU B 277 ? 0.4000 0.5195 0.3562 -0.0943 -0.0142 0.0212  270 LEU B CG  
4513 C CD1 . LEU B 277 ? 0.2937 0.4127 0.2474 -0.0980 -0.0173 0.0268  270 LEU B CD1 
4514 C CD2 . LEU B 277 ? 0.2381 0.3546 0.1980 -0.0900 -0.0149 0.0233  270 LEU B CD2 
4515 N N   . GLY B 278 ? 0.3984 0.5395 0.3500 -0.1041 -0.0058 0.0043  271 GLY B N   
4516 C CA  . GLY B 278 ? 0.4566 0.6078 0.4057 -0.1102 -0.0040 0.0004  271 GLY B CA  
4517 C C   . GLY B 278 ? 0.5783 0.7277 0.5277 -0.1092 -0.0008 -0.0067 271 GLY B C   
4518 O O   . GLY B 278 ? 0.5478 0.6883 0.4996 -0.1034 0.0001  -0.0084 271 GLY B O   
4519 N N   . PRO B 279 ? 0.6211 0.7797 0.5681 -0.1152 0.0012  -0.0109 272 PRO B N   
4520 C CA  . PRO B 279 ? 0.5425 0.7012 0.4901 -0.1151 0.0046  -0.0182 272 PRO B CA  
4521 C C   . PRO B 279 ? 0.5360 0.6920 0.4825 -0.1148 0.0045  -0.0179 272 PRO B C   
4522 O O   . PRO B 279 ? 0.6181 0.7705 0.5665 -0.1120 0.0070  -0.0229 272 PRO B O   
4523 C CB  . PRO B 279 ? 0.5409 0.7121 0.4859 -0.1229 0.0062  -0.0217 272 PRO B CB  
4524 C CG  . PRO B 279 ? 0.5498 0.7263 0.4936 -0.1256 0.0040  -0.0169 272 PRO B CG  
4525 C CD  . PRO B 279 ? 0.5007 0.6712 0.4447 -0.1226 0.0004  -0.0092 272 PRO B CD  
4526 N N   . TYR B 280 ? 0.4126 0.5704 0.3561 -0.1180 0.0017  -0.0121 273 TYR B N   
4527 C CA  . TYR B 280 ? 0.4342 0.5905 0.3762 -0.1186 0.0018  -0.0122 273 TYR B CA  
4528 C C   . TYR B 280 ? 0.4966 0.6437 0.4395 -0.1141 -0.0009 -0.0067 273 TYR B C   
4529 O O   . TYR B 280 ? 0.4509 0.5966 0.3925 -0.1146 -0.0010 -0.0064 273 TYR B O   
4530 C CB  . TYR B 280 ? 0.3256 0.4926 0.2626 -0.1276 0.0013  -0.0114 273 TYR B CB  
4531 C CG  . TYR B 280 ? 0.3413 0.5180 0.2775 -0.1325 0.0042  -0.0176 273 TYR B CG  
4532 C CD1 . TYR B 280 ? 0.4944 0.6726 0.4320 -0.1322 0.0079  -0.0251 273 TYR B CD1 
4533 C CD2 . TYR B 280 ? 0.3315 0.5164 0.2659 -0.1374 0.0035  -0.0163 273 TYR B CD2 
4534 C CE1 . TYR B 280 ? 0.5468 0.7342 0.4842 -0.1368 0.0108  -0.0315 273 TYR B CE1 
4535 C CE2 . TYR B 280 ? 0.4252 0.6193 0.3591 -0.1420 0.0064  -0.0224 273 TYR B CE2 
4536 C CZ  . TYR B 280 ? 0.5742 0.7694 0.5096 -0.1417 0.0100  -0.0302 273 TYR B CZ  
4537 O OH  . TYR B 280 ? 0.6637 0.8683 0.5989 -0.1466 0.0131  -0.0368 273 TYR B OH  
4538 N N   . THR B 281 ? 0.3994 0.5409 0.3447 -0.1098 -0.0028 -0.0027 274 THR B N   
4539 C CA  . THR B 281 ? 0.3199 0.4538 0.2660 -0.1064 -0.0056 0.0029  274 THR B CA  
4540 C C   . THR B 281 ? 0.3774 0.5021 0.3280 -0.0985 -0.0057 0.0034  274 THR B C   
4541 O O   . THR B 281 ? 0.3953 0.5200 0.3481 -0.0964 -0.0046 0.0013  274 THR B O   
4542 C CB  . THR B 281 ? 0.2649 0.4029 0.2081 -0.1117 -0.0093 0.0102  274 THR B CB  
4543 O OG1 . THR B 281 ? 0.2989 0.4417 0.2428 -0.1130 -0.0098 0.0116  274 THR B OG1 
4544 C CG2 . THR B 281 ? 0.3106 0.4567 0.2485 -0.1201 -0.0098 0.0111  274 THR B CG2 
4545 N N   . PHE B 282 ? 0.3897 0.5068 0.3417 -0.0946 -0.0071 0.0062  275 PHE B N   
4546 C CA  . PHE B 282 ? 0.3093 0.4179 0.2654 -0.0875 -0.0076 0.0073  275 PHE B CA  
4547 C C   . PHE B 282 ? 0.2958 0.3987 0.2522 -0.0859 -0.0101 0.0121  275 PHE B C   
4548 O O   . PHE B 282 ? 0.3133 0.4169 0.2674 -0.0885 -0.0105 0.0127  275 PHE B O   
4549 C CB  . PHE B 282 ? 0.2825 0.3861 0.2413 -0.0821 -0.0048 0.0017  275 PHE B CB  
4550 C CG  . PHE B 282 ? 0.4104 0.5119 0.3689 -0.0811 -0.0034 -0.0009 275 PHE B CG  
4551 C CD1 . PHE B 282 ? 0.4972 0.5910 0.4577 -0.0761 -0.0040 0.0005  275 PHE B CD1 
4552 C CD2 . PHE B 282 ? 0.3671 0.4749 0.3234 -0.0853 -0.0013 -0.0051 275 PHE B CD2 
4553 C CE1 . PHE B 282 ? 0.3583 0.4509 0.3187 -0.0752 -0.0027 -0.0019 275 PHE B CE1 
4554 C CE2 . PHE B 282 ? 0.4706 0.5773 0.4269 -0.0845 0.0002  -0.0077 275 PHE B CE2 
4555 C CZ  . PHE B 282 ? 0.4883 0.5875 0.4467 -0.0794 -0.0006 -0.0059 275 PHE B CZ  
4556 N N   . SER B 283 ? 0.3050 0.4030 0.2644 -0.0820 -0.0117 0.0153  276 SER B N   
4557 C CA  . SER B 283 ? 0.3467 0.4394 0.3068 -0.0807 -0.0141 0.0197  276 SER B CA  
4558 C C   . SER B 283 ? 0.3473 0.4317 0.3105 -0.0738 -0.0127 0.0170  276 SER B C   
4559 O O   . SER B 283 ? 0.4680 0.5498 0.4336 -0.0693 -0.0106 0.0131  276 SER B O   
4560 C CB  . SER B 283 ? 0.3336 0.4261 0.2951 -0.0810 -0.0169 0.0252  276 SER B CB  
4561 O OG  . SER B 283 ? 0.3623 0.4515 0.3277 -0.0756 -0.0157 0.0235  276 SER B OG  
4562 N N   . ILE B 284 ? 0.4157 0.4964 0.3785 -0.0735 -0.0141 0.0192  277 ILE B N   
4563 C CA  . ILE B 284 ? 0.2747 0.3483 0.2401 -0.0676 -0.0130 0.0171  277 ILE B CA  
4564 C C   . ILE B 284 ? 0.3925 0.4609 0.3599 -0.0656 -0.0154 0.0213  277 ILE B C   
4565 O O   . ILE B 284 ? 0.4936 0.5622 0.4623 -0.0660 -0.0172 0.0246  277 ILE B O   
4566 C CB  . ILE B 284 ? 0.2428 0.3176 0.2060 -0.0691 -0.0117 0.0146  277 ILE B CB  
4567 C CG1 . ILE B 284 ? 0.3491 0.4279 0.3079 -0.0760 -0.0137 0.0180  277 ILE B CG1 
4568 C CG2 . ILE B 284 ? 0.2832 0.3624 0.2455 -0.0701 -0.0089 0.0097  277 ILE B CG2 
4569 C CD1 . ILE B 284 ? 0.4225 0.5004 0.3796 -0.0768 -0.0130 0.0167  277 ILE B CD1 
4570 N N   . CYS B 285 ? 0.4155 0.4798 0.3832 -0.0638 -0.0155 0.0211  278 CYS B N   
4571 C CA  . CYS B 285 ? 0.4244 0.4836 0.3936 -0.0623 -0.0178 0.0246  278 CYS B CA  
4572 C C   . CYS B 285 ? 0.3945 0.4562 0.3602 -0.0691 -0.0212 0.0299  278 CYS B C   
4573 O O   . CYS B 285 ? 0.4953 0.5628 0.4572 -0.0749 -0.0216 0.0307  278 CYS B O   
4574 C CB  . CYS B 285 ? 0.5918 0.6462 0.5623 -0.0583 -0.0165 0.0224  278 CYS B CB  
4575 S SG  . CYS B 285 ? 0.4524 0.5090 0.4185 -0.0628 -0.0164 0.0219  278 CYS B SG  
4576 N N   . ASP B 286 ? 0.4729 0.5301 0.4398 -0.0687 -0.0238 0.0336  279 ASP B N   
4577 C CA  . ASP B 286 ? 0.4923 0.5501 0.4557 -0.0754 -0.0279 0.0393  279 ASP B CA  
4578 C C   . ASP B 286 ? 0.5352 0.5934 0.4940 -0.0789 -0.0274 0.0382  279 ASP B C   
4579 O O   . ASP B 286 ? 0.4974 0.5518 0.4572 -0.0753 -0.0259 0.0355  279 ASP B O   
4580 C CB  . ASP B 286 ? 0.4258 0.4775 0.3921 -0.0735 -0.0309 0.0431  279 ASP B CB  
4581 C CG  . ASP B 286 ? 0.5996 0.6484 0.5618 -0.0787 -0.0346 0.0497  279 ASP B CG  
4582 O OD1 . ASP B 286 ? 0.5573 0.6005 0.5209 -0.0763 -0.0361 0.0539  279 ASP B OD1 
4583 O OD2 . ASP B 286 ? 0.8289 0.8788 0.7858 -0.0836 -0.0349 0.0505  279 ASP B OD2 
4584 N N   . THR B 287 ? 0.4896 0.5532 0.4434 -0.0862 -0.0288 0.0403  280 THR B N   
4585 C CA  . THR B 287 ? 0.4456 0.5105 0.3943 -0.0908 -0.0284 0.0394  280 THR B CA  
4586 C C   . THR B 287 ? 0.6141 0.6776 0.5579 -0.0981 -0.0329 0.0459  280 THR B C   
4587 O O   . THR B 287 ? 0.6690 0.7346 0.6071 -0.1037 -0.0327 0.0462  280 THR B O   
4588 C CB  . THR B 287 ? 0.3017 0.3743 0.2477 -0.0938 -0.0255 0.0356  280 THR B CB  
4589 O OG1 . THR B 287 ? 0.3739 0.4518 0.3185 -0.0982 -0.0271 0.0385  280 THR B OG1 
4590 C CG2 . THR B 287 ? 0.3008 0.3734 0.2510 -0.0868 -0.0212 0.0294  280 THR B CG2 
4591 N N   . SER B 288 ? 0.6957 0.7525 0.6413 -0.0954 -0.0348 0.0510  281 SER B N   
4592 C CA  . SER B 288 ? 0.6766 0.7276 0.6173 -0.0989 -0.0370 0.0581  281 SER B CA  
4593 C C   . SER B 288 ? 0.6360 0.6800 0.5731 -0.0998 -0.0366 0.0590  281 SER B C   
4594 O O   . SER B 288 ? 0.7136 0.7535 0.6451 -0.1042 -0.0380 0.0642  281 SER B O   
4595 C CB  . SER B 288 ? 0.7794 0.8237 0.7233 -0.0944 -0.0389 0.0630  281 SER B CB  
4596 O OG  . SER B 288 ? 0.8755 0.9251 0.8247 -0.0913 -0.0383 0.0605  281 SER B OG  
4597 N N   . ASN B 289 ? 0.5886 0.6312 0.5287 -0.0957 -0.0347 0.0541  282 ASN B N   
4598 C CA  . ASN B 289 ? 0.7125 0.7486 0.6498 -0.0962 -0.0339 0.0546  282 ASN B CA  
4599 C C   . ASN B 289 ? 0.7419 0.7841 0.6775 -0.0980 -0.0314 0.0487  282 ASN B C   
4600 O O   . ASN B 289 ? 0.7910 0.8294 0.7263 -0.0966 -0.0300 0.0470  282 ASN B O   
4601 C CB  . ASN B 289 ? 0.8722 0.8994 0.8143 -0.0894 -0.0340 0.0551  282 ASN B CB  
4602 C CG  . ASN B 289 ? 1.0805 1.1003 1.0233 -0.0879 -0.0365 0.0615  282 ASN B CG  
4603 O OD1 . ASN B 289 ? 1.2132 1.2252 1.1520 -0.0902 -0.0376 0.0666  282 ASN B OD1 
4604 N ND2 . ASN B 289 ? 1.0660 1.0878 1.0136 -0.0841 -0.0373 0.0613  282 ASN B ND2 
4605 N N   . PHE B 290 ? 0.6395 0.6913 0.5740 -0.1013 -0.0307 0.0455  283 PHE B N   
4606 C CA  . PHE B 290 ? 0.5917 0.6502 0.5241 -0.1036 -0.0283 0.0399  283 PHE B CA  
4607 C C   . PHE B 290 ? 0.6607 0.7219 0.5856 -0.1120 -0.0283 0.0419  283 PHE B C   
4608 O O   . PHE B 290 ? 0.7231 0.7804 0.6443 -0.1158 -0.0304 0.0479  283 PHE B O   
4609 C CB  . PHE B 290 ? 0.6403 0.7059 0.5763 -0.1007 -0.0259 0.0351  283 PHE B CB  
4610 C CG  . PHE B 290 ? 0.7324 0.7942 0.6756 -0.0910 -0.0237 0.0320  283 PHE B CG  
4611 C CD1 . PHE B 290 ? 0.6949 0.7601 0.6417 -0.0865 -0.0204 0.0275  283 PHE B CD1 
4612 C CD2 . PHE B 290 ? 0.7036 0.7584 0.6495 -0.0870 -0.0251 0.0336  283 PHE B CD2 
4613 C CE1 . PHE B 290 ? 0.6242 0.6854 0.5769 -0.0784 -0.0187 0.0250  283 PHE B CE1 
4614 C CE2 . PHE B 290 ? 0.5528 0.6045 0.5049 -0.0787 -0.0231 0.0307  283 PHE B CE2 
4615 C CZ  . PHE B 290 ? 0.5054 0.5602 0.4607 -0.0745 -0.0200 0.0266  283 PHE B CZ  
4616 N N   . SER B 291 ? 0.6615 0.7289 0.5837 -0.1150 -0.0260 0.0369  284 SER B N   
4617 C CA  . SER B 291 ? 0.6944 0.7663 0.6094 -0.1237 -0.0257 0.0378  284 SER B CA  
4618 C C   . SER B 291 ? 0.7556 0.8375 0.6691 -0.1284 -0.0261 0.0362  284 SER B C   
4619 O O   . SER B 291 ? 0.6688 0.7535 0.5880 -0.1224 -0.0237 0.0326  284 SER B O   
4620 C CB  . SER B 291 ? 0.6775 0.7524 0.5904 -0.1253 -0.0228 0.0328  284 SER B CB  
4621 O OG  . SER B 291 ? 0.5785 0.6458 0.4945 -0.1195 -0.0220 0.0327  284 SER B OG  
4622 N N   . ASP B 292 ? 0.7986 0.8837 0.7055 -0.1368 -0.0270 0.0393  285 ASP B N   
4623 C CA  . ASP B 292 ? 0.6554 0.7505 0.5604 -0.1421 -0.0275 0.0383  285 ASP B CA  
4624 C C   . ASP B 292 ? 0.5139 0.6158 0.4226 -0.1381 -0.0220 0.0304  285 ASP B C   
4625 O O   . ASP B 292 ? 0.5135 0.6169 0.4215 -0.1381 -0.0191 0.0261  285 ASP B O   
4626 C CB  . ASP B 292 ? 0.7694 0.8672 0.6660 -0.1521 -0.0284 0.0422  285 ASP B CB  
4627 C CG  . ASP B 292 ? 0.9073 0.9940 0.8009 -0.1528 -0.0310 0.0511  285 ASP B CG  
4628 O OD1 . ASP B 292 ? 0.9630 1.0397 0.8606 -0.1459 -0.0314 0.0530  285 ASP B OD1 
4629 O OD2 . ASP B 292 ? 0.9869 1.0748 0.8740 -0.1603 -0.0326 0.0561  285 ASP B OD2 
4630 N N   . TYR B 293 ? 0.4600 0.5659 0.3725 -0.1351 -0.0206 0.0284  286 TYR B N   
4631 C CA  . TYR B 293 ? 0.4456 0.5579 0.3609 -0.1323 -0.0159 0.0211  286 TYR B CA  
4632 C C   . TYR B 293 ? 0.4617 0.5832 0.3709 -0.1415 -0.0147 0.0193  286 TYR B C   
4633 O O   . TYR B 293 ? 0.5895 0.7146 0.4934 -0.1492 -0.0173 0.0234  286 TYR B O   
4634 C CB  . TYR B 293 ? 0.3761 0.4903 0.2959 -0.1281 -0.0151 0.0198  286 TYR B CB  
4635 C CG  . TYR B 293 ? 0.4476 0.5691 0.3694 -0.1271 -0.0108 0.0127  286 TYR B CG  
4636 C CD1 . TYR B 293 ? 0.2613 0.3802 0.1888 -0.1192 -0.0077 0.0076  286 TYR B CD1 
4637 C CD2 . TYR B 293 ? 0.4833 0.6143 0.4011 -0.1344 -0.0100 0.0112  286 TYR B CD2 
4638 C CE1 . TYR B 293 ? 0.3365 0.4617 0.2660 -0.1185 -0.0041 0.0012  286 TYR B CE1 
4639 C CE2 . TYR B 293 ? 0.4641 0.6018 0.3839 -0.1337 -0.0061 0.0044  286 TYR B CE2 
4640 C CZ  . TYR B 293 ? 0.4252 0.5598 0.3509 -0.1257 -0.0032 -0.0006 286 TYR B CZ  
4641 O OH  . TYR B 293 ? 0.3679 0.5091 0.2959 -0.1253 0.0004  -0.0074 286 TYR B OH  
4642 N N   . ILE B 294 ? 0.4004 0.5261 0.3102 -0.1410 -0.0109 0.0133  287 ILE B N   
4643 C CA  . ILE B 294 ? 0.4694 0.6049 0.3739 -0.1496 -0.0092 0.0105  287 ILE B CA  
4644 C C   . ILE B 294 ? 0.4864 0.6305 0.3941 -0.1485 -0.0055 0.0039  287 ILE B C   
4645 O O   . ILE B 294 ? 0.5567 0.7082 0.4609 -0.1548 -0.0057 0.0041  287 ILE B O   
4646 C CB  . ILE B 294 ? 0.5066 0.6428 0.4080 -0.1527 -0.0078 0.0085  287 ILE B CB  
4647 C CG1 . ILE B 294 ? 0.5451 0.6752 0.4401 -0.1584 -0.0120 0.0154  287 ILE B CG1 
4648 C CG2 . ILE B 294 ? 0.5170 0.6646 0.4150 -0.1598 -0.0049 0.0035  287 ILE B CG2 
4649 C CD1 . ILE B 294 ? 0.5704 0.6968 0.4646 -0.1577 -0.0110 0.0140  287 ILE B CD1 
4650 N N   . ARG B 295 ? 0.3748 0.5182 0.2889 -0.1409 -0.0022 -0.0017 288 ARG B N   
4651 C CA  . ARG B 295 ? 0.4217 0.5725 0.3390 -0.1397 0.0013  -0.0083 288 ARG B CA  
4652 C C   . ARG B 295 ? 0.3505 0.4975 0.2753 -0.1302 0.0037  -0.0127 288 ARG B C   
4653 O O   . ARG B 295 ? 0.3671 0.5069 0.2944 -0.1250 0.0030  -0.0112 288 ARG B O   
4654 C CB  . ARG B 295 ? 0.5907 0.7525 0.5046 -0.1472 0.0039  -0.0132 288 ARG B CB  
4655 C CG  . ARG B 295 ? 0.5118 0.6754 0.4290 -0.1443 0.0070  -0.0188 288 ARG B CG  
4656 C CD  . ARG B 295 ? 0.5948 0.7594 0.5065 -0.1503 0.0063  -0.0169 288 ARG B CD  
4657 N NE  . ARG B 295 ? 0.8496 1.0247 0.7556 -0.1603 0.0073  -0.0189 288 ARG B NE  
4658 C CZ  . ARG B 295 ? 0.8548 1.0397 0.7620 -0.1628 0.0110  -0.0261 288 ARG B CZ  
4659 N NH1 . ARG B 295 ? 0.8895 1.0749 0.8036 -0.1559 0.0137  -0.0315 288 ARG B NH1 
4660 N NH2 . ARG B 295 ? 0.7802 0.9749 0.6818 -0.1723 0.0118  -0.0278 288 ARG B NH2 
4661 N N   . GLY B 296 ? 0.4127 0.5647 0.3409 -0.1286 0.0064  -0.0182 289 GLY B N   
4662 C CA  . GLY B 296 ? 0.5517 0.7016 0.4867 -0.1209 0.0088  -0.0231 289 GLY B CA  
4663 C C   . GLY B 296 ? 0.5326 0.6719 0.4717 -0.1126 0.0073  -0.0199 289 GLY B C   
4664 O O   . GLY B 296 ? 0.4938 0.6272 0.4312 -0.1121 0.0043  -0.0141 289 GLY B O   
4665 N N   . GLY B 297 ? 0.4863 0.6236 0.4310 -0.1063 0.0093  -0.0239 290 GLY B N   
4666 C CA  . GLY B 297 ? 0.4593 0.5873 0.4081 -0.0986 0.0082  -0.0216 290 GLY B CA  
4667 C C   . GLY B 297 ? 0.3689 0.4970 0.3220 -0.0948 0.0101  -0.0256 290 GLY B C   
4668 O O   . GLY B 297 ? 0.4784 0.6129 0.4307 -0.0985 0.0116  -0.0290 290 GLY B O   
4669 N N   . ILE B 298 ? 0.3838 0.5050 0.3412 -0.0878 0.0101  -0.0255 291 ILE B N   
4670 C CA  . ILE B 298 ? 0.3995 0.5195 0.3609 -0.0842 0.0118  -0.0290 291 ILE B CA  
4671 C C   . ILE B 298 ? 0.4495 0.5597 0.4122 -0.0787 0.0096  -0.0243 291 ILE B C   
4672 O O   . ILE B 298 ? 0.5355 0.6397 0.4992 -0.0749 0.0082  -0.0212 291 ILE B O   
4673 C CB  . ILE B 298 ? 0.3901 0.5127 0.3565 -0.0812 0.0145  -0.0347 291 ILE B CB  
4674 C CG1 . ILE B 298 ? 0.4134 0.5467 0.3794 -0.0864 0.0168  -0.0401 291 ILE B CG1 
4675 C CG2 . ILE B 298 ? 0.1462 0.2670 0.1168 -0.0779 0.0162  -0.0383 291 ILE B CG2 
4676 C CD1 . ILE B 298 ? 0.4048 0.5416 0.3758 -0.0837 0.0189  -0.0451 291 ILE B CD1 
4677 N N   . VAL B 299 ? 0.4222 0.5313 0.3848 -0.0787 0.0094  -0.0241 292 VAL B N   
4678 C CA  . VAL B 299 ? 0.3461 0.4468 0.3105 -0.0736 0.0078  -0.0207 292 VAL B CA  
4679 C C   . VAL B 299 ? 0.3275 0.4266 0.2960 -0.0699 0.0101  -0.0252 292 VAL B C   
4680 O O   . VAL B 299 ? 0.3544 0.4587 0.3238 -0.0724 0.0124  -0.0301 292 VAL B O   
4681 C CB  . VAL B 299 ? 0.3330 0.4333 0.2949 -0.0758 0.0058  -0.0171 292 VAL B CB  
4682 C CG1 . VAL B 299 ? 0.3274 0.4358 0.2878 -0.0810 0.0075  -0.0209 292 VAL B CG1 
4683 C CG2 . VAL B 299 ? 0.2592 0.3520 0.2236 -0.0705 0.0047  -0.0150 292 VAL B CG2 
4684 N N   . SER B 300 ? 0.3560 0.4483 0.3273 -0.0644 0.0096  -0.0238 293 SER B N   
4685 C CA  . SER B 300 ? 0.4965 0.5865 0.4718 -0.0609 0.0116  -0.0275 293 SER B CA  
4686 C C   . SER B 300 ? 0.5128 0.5950 0.4887 -0.0571 0.0101  -0.0242 293 SER B C   
4687 O O   . SER B 300 ? 0.5576 0.6350 0.5323 -0.0551 0.0075  -0.0191 293 SER B O   
4688 C CB  . SER B 300 ? 0.6105 0.7004 0.5889 -0.0580 0.0124  -0.0291 293 SER B CB  
4689 O OG  . SER B 300 ? 0.6321 0.7303 0.6108 -0.0614 0.0142  -0.0331 293 SER B OG  
4690 N N   . GLN B 301 ? 0.4803 0.5616 0.4584 -0.0562 0.0119  -0.0276 294 GLN B N   
4691 C CA  . GLN B 301 ? 0.4751 0.5494 0.4539 -0.0529 0.0110  -0.0253 294 GLN B CA  
4692 C C   . GLN B 301 ? 0.4690 0.5377 0.4508 -0.0481 0.0112  -0.0250 294 GLN B C   
4693 O O   . GLN B 301 ? 0.6033 0.6728 0.5882 -0.0477 0.0137  -0.0294 294 GLN B O   
4694 C CB  . GLN B 301 ? 0.5174 0.5937 0.4969 -0.0551 0.0132  -0.0294 294 GLN B CB  
4695 C CG  . GLN B 301 ? 0.5804 0.6511 0.5600 -0.0529 0.0123  -0.0275 294 GLN B CG  
4696 C CD  . GLN B 301 ? 0.6035 0.6769 0.5840 -0.0557 0.0149  -0.0322 294 GLN B CD  
4697 O OE1 . GLN B 301 ? 0.6176 0.6925 0.6011 -0.0563 0.0180  -0.0375 294 GLN B OE1 
4698 N NE2 . GLN B 301 ? 0.4671 0.5419 0.4453 -0.0576 0.0138  -0.0306 294 GLN B NE2 
4699 N N   . VAL B 302 ? 0.3949 0.4581 0.3761 -0.0448 0.0087  -0.0200 295 VAL B N   
4700 C CA  . VAL B 302 ? 0.4602 0.5184 0.4439 -0.0406 0.0086  -0.0192 295 VAL B CA  
4701 C C   . VAL B 302 ? 0.5585 0.6112 0.5434 -0.0383 0.0089  -0.0193 295 VAL B C   
4702 O O   . VAL B 302 ? 0.6832 0.7348 0.6706 -0.0373 0.0111  -0.0224 295 VAL B O   
4703 C CB  . VAL B 302 ? 0.3549 0.4098 0.3380 -0.0381 0.0059  -0.0143 295 VAL B CB  
4704 C CG1 . VAL B 302 ? 0.3129 0.3627 0.2983 -0.0338 0.0056  -0.0133 295 VAL B CG1 
4705 C CG2 . VAL B 302 ? 0.4234 0.4832 0.4057 -0.0402 0.0059  -0.0147 295 VAL B CG2 
4706 N N   . LYS B 303 ? 0.4227 0.4722 0.4062 -0.0375 0.0070  -0.0160 296 LYS B N   
4707 C CA  . LYS B 303 ? 0.5350 0.5795 0.5193 -0.0354 0.0071  -0.0157 296 LYS B CA  
4708 C C   . LYS B 303 ? 0.5689 0.6152 0.5519 -0.0380 0.0074  -0.0167 296 LYS B C   
4709 O O   . LYS B 303 ? 0.5636 0.6141 0.5447 -0.0406 0.0064  -0.0158 296 LYS B O   
4710 C CB  . LYS B 303 ? 0.5279 0.5671 0.5127 -0.0315 0.0046  -0.0113 296 LYS B CB  
4711 C CG  . LYS B 303 ? 0.6085 0.6432 0.5952 -0.0284 0.0052  -0.0115 296 LYS B CG  
4712 C CD  . LYS B 303 ? 0.7983 0.8352 0.7862 -0.0284 0.0066  -0.0134 296 LYS B CD  
4713 C CE  . LYS B 303 ? 0.9017 0.9348 0.8915 -0.0265 0.0080  -0.0146 296 LYS B CE  
4714 N NZ  . LYS B 303 ? 0.8994 0.9276 0.8893 -0.0230 0.0059  -0.0108 296 LYS B NZ  
4715 N N   . VAL B 304 ? 0.5249 0.5684 0.5087 -0.0376 0.0089  -0.0187 297 VAL B N   
4716 C CA  . VAL B 304 ? 0.5296 0.5751 0.5124 -0.0403 0.0095  -0.0202 297 VAL B CA  
4717 C C   . VAL B 304 ? 0.5971 0.6376 0.5804 -0.0381 0.0091  -0.0191 297 VAL B C   
4718 O O   . VAL B 304 ? 0.7486 0.7843 0.7333 -0.0362 0.0104  -0.0200 297 VAL B O   
4719 C CB  . VAL B 304 ? 0.4327 0.4819 0.4165 -0.0438 0.0130  -0.0259 297 VAL B CB  
4720 C CG1 . VAL B 304 ? 0.4012 0.4507 0.3846 -0.0458 0.0142  -0.0279 297 VAL B CG1 
4721 C CG2 . VAL B 304 ? 0.3328 0.3892 0.3155 -0.0471 0.0133  -0.0273 297 VAL B CG2 
4722 N N   . PRO B 305 ? 0.5211 0.5629 0.5033 -0.0386 0.0074  -0.0170 298 PRO B N   
4723 C CA  . PRO B 305 ? 0.4213 0.4591 0.4041 -0.0365 0.0067  -0.0157 298 PRO B CA  
4724 C C   . PRO B 305 ? 0.5063 0.5434 0.4893 -0.0384 0.0092  -0.0194 298 PRO B C   
4725 O O   . PRO B 305 ? 0.6363 0.6782 0.6186 -0.0421 0.0106  -0.0222 298 PRO B O   
4726 C CB  . PRO B 305 ? 0.5159 0.5569 0.4980 -0.0371 0.0043  -0.0129 298 PRO B CB  
4727 C CG  . PRO B 305 ? 0.5982 0.6437 0.5793 -0.0390 0.0034  -0.0118 298 PRO B CG  
4728 C CD  . PRO B 305 ? 0.6125 0.6598 0.5931 -0.0412 0.0058  -0.0155 298 PRO B CD  
4729 N N   . LYS B 306 ? 0.6535 0.6851 0.6375 -0.0363 0.0100  -0.0196 299 LYS B N   
4730 C CA  . LYS B 306 ? 0.6169 0.6469 0.6013 -0.0381 0.0127  -0.0229 299 LYS B CA  
4731 C C   . LYS B 306 ? 0.5451 0.5723 0.5293 -0.0364 0.0113  -0.0210 299 LYS B C   
4732 O O   . LYS B 306 ? 0.6191 0.6442 0.6036 -0.0332 0.0090  -0.0176 299 LYS B O   
4733 C CB  . LYS B 306 ? 0.6239 0.6493 0.6101 -0.0376 0.0158  -0.0255 299 LYS B CB  
4734 C CG  . LYS B 306 ? 0.7136 0.7418 0.7012 -0.0413 0.0195  -0.0305 299 LYS B CG  
4735 C CD  . LYS B 306 ? 0.7753 0.8107 0.7618 -0.0436 0.0185  -0.0311 299 LYS B CD  
4736 C CE  . LYS B 306 ? 0.9208 0.9604 0.9089 -0.0478 0.0222  -0.0367 299 LYS B CE  
4737 N NZ  . LYS B 306 ? 0.9666 1.0141 0.9531 -0.0505 0.0211  -0.0372 299 LYS B NZ  
4738 N N   . LYS B 307 ? 0.4935 0.5213 0.4777 -0.0387 0.0129  -0.0233 300 LYS B N   
4739 C CA  . LYS B 307 ? 0.5933 0.6183 0.5775 -0.0372 0.0121  -0.0220 300 LYS B CA  
4740 C C   . LYS B 307 ? 0.6512 0.6703 0.6361 -0.0371 0.0150  -0.0241 300 LYS B C   
4741 O O   . LYS B 307 ? 0.6832 0.7025 0.6685 -0.0401 0.0180  -0.0276 300 LYS B O   
4742 C CB  . LYS B 307 ? 0.4923 0.5223 0.4759 -0.0397 0.0114  -0.0225 300 LYS B CB  
4743 C CG  . LYS B 307 ? 0.6041 0.6372 0.5794 -0.0355 0.0116  -0.0183 300 LYS B CG  
4744 C CD  . LYS B 307 ? 0.5461 0.5828 0.5292 -0.0386 0.0073  -0.0179 300 LYS B CD  
4745 C CE  . LYS B 307 ? 0.4596 0.4975 0.4343 -0.0347 0.0079  -0.0132 300 LYS B CE  
4746 N NZ  . LYS B 307 ? 0.4487 0.4880 0.4319 -0.0366 0.0040  -0.0131 300 LYS B NZ  
4747 N N   . ILE B 308 ? 0.5587 0.5727 0.5438 -0.0337 0.0143  -0.0219 301 ILE B N   
4748 C CA  . ILE B 308 ? 0.6283 0.6362 0.6139 -0.0334 0.0170  -0.0231 301 ILE B CA  
4749 C C   . ILE B 308 ? 0.5779 0.5844 0.5629 -0.0330 0.0163  -0.0223 301 ILE B C   
4750 O O   . ILE B 308 ? 0.5951 0.6050 0.5746 -0.0289 0.0164  -0.0195 301 ILE B O   
4751 C CB  . ILE B 308 ? 0.6560 0.6594 0.6424 -0.0305 0.0175  -0.0217 301 ILE B CB  
4752 C CG1 . ILE B 308 ? 0.9376 0.9342 0.9243 -0.0296 0.0201  -0.0220 301 ILE B CG1 
4753 C CG2 . ILE B 308 ? 0.6959 0.7003 0.6820 -0.0273 0.0138  -0.0181 301 ILE B CG2 
4754 C CD1 . ILE B 308 ? 1.2424 1.2369 1.2305 -0.0325 0.0248  -0.0255 301 ILE B CD1 
4755 N N   . SER B 309 ? 0.5334 0.5365 0.5184 -0.0347 0.0193  -0.0246 302 SER B N   
4756 C CA  . SER B 309 ? 0.5596 0.5638 0.5472 -0.0357 0.0207  -0.0219 302 SER B CA  
4757 C C   . SER B 309 ? 0.5720 0.5693 0.5589 -0.0336 0.0217  -0.0209 302 SER B C   
4758 O O   . SER B 309 ? 0.5632 0.5531 0.5473 -0.0327 0.0235  -0.0243 302 SER B O   
4759 C CB  . SER B 309 ? 0.6315 0.6371 0.6088 -0.0351 0.0253  -0.0274 302 SER B CB  
4760 O OG  . SER B 309 ? 0.6481 0.6617 0.6354 -0.0415 0.0214  -0.0252 302 SER B OG  
4761 N N   . PHE B 310 ? 0.4955 0.4928 0.4815 -0.0320 0.0197  -0.0189 303 PHE B N   
4762 C CA  . PHE B 310 ? 0.3198 0.3125 0.2978 -0.0264 0.0221  -0.0193 303 PHE B CA  
4763 C C   . PHE B 310 ? 0.3418 0.3329 0.3177 -0.0285 0.0244  -0.0209 303 PHE B C   
4764 O O   . PHE B 310 ? 0.3654 0.3602 0.3404 -0.0305 0.0237  -0.0217 303 PHE B O   
4765 C CB  . PHE B 310 ? 0.2069 0.2002 0.1918 -0.0274 0.0171  -0.0151 303 PHE B CB  
4766 C CG  . PHE B 310 ? 0.3825 0.3761 0.3686 -0.0247 0.0153  -0.0135 303 PHE B CG  
4767 C CD1 . PHE B 310 ? 0.4356 0.4334 0.4167 -0.0223 0.0157  -0.0149 303 PHE B CD1 
4768 C CD2 . PHE B 310 ? 0.4058 0.3972 0.3868 -0.0193 0.0160  -0.0128 303 PHE B CD2 
4769 C CE1 . PHE B 310 ? 0.3546 0.3528 0.3372 -0.0204 0.0140  -0.0134 303 PHE B CE1 
4770 C CE2 . PHE B 310 ? 0.3206 0.3125 0.3033 -0.0173 0.0143  -0.0114 303 PHE B CE2 
4771 C CZ  . PHE B 310 ? 0.2921 0.2854 0.2778 -0.0193 0.0116  -0.0124 303 PHE B CZ  
4772 N N   . LYS B 311 ? 0.3017 0.2873 0.2769 -0.0282 0.0274  -0.0213 304 LYS B N   
4773 C CA  . LYS B 311 ? 0.3770 0.3603 0.3497 -0.0301 0.0295  -0.0225 304 LYS B CA  
4774 C C   . LYS B 311 ? 0.4576 0.4417 0.4293 -0.0292 0.0269  -0.0205 304 LYS B C   
4775 O O   . LYS B 311 ? 0.4676 0.4512 0.4403 -0.0265 0.0246  -0.0181 304 LYS B O   
4776 C CB  . LYS B 311 ? 0.4191 0.3960 0.3911 -0.0296 0.0335  -0.0229 304 LYS B CB  
4777 C CG  . LYS B 311 ? 0.3715 0.3435 0.3524 -0.0357 0.0339  -0.0231 304 LYS B CG  
4778 C CD  . LYS B 311 ? 0.3897 0.3574 0.3631 -0.0307 0.0421  -0.0254 304 LYS B CD  
4779 C CE  . LYS B 311 ? 0.5322 0.4985 0.5088 -0.0354 0.0489  -0.0274 304 LYS B CE  
4780 N NZ  . LYS B 311 ? 0.7038 0.6702 0.6778 -0.0394 0.0515  -0.0303 304 LYS B NZ  
4781 N N   . SER B 312 ? 0.3880 0.3720 0.3661 -0.0359 0.0250  -0.0200 305 SER B N   
4782 C CA  . SER B 312 ? 0.2677 0.2540 0.2368 -0.0312 0.0255  -0.0205 305 SER B CA  
4783 C C   . SER B 312 ? 0.3846 0.3621 0.3592 -0.0339 0.0247  -0.0178 305 SER B C   
4784 O O   . SER B 312 ? 0.4147 0.3865 0.3814 -0.0305 0.0280  -0.0221 305 SER B O   
4785 C CB  . SER B 312 ? 0.2763 0.2636 0.2526 -0.0390 0.0244  -0.0207 305 SER B CB  
4786 O OG  . SER B 312 ? 0.3915 0.3750 0.3558 -0.0363 0.0304  -0.0243 305 SER B OG  
4787 N N   . LEU B 313 ? 0.3259 0.3061 0.2924 -0.0291 0.0251  -0.0180 306 LEU B N   
4788 C CA  . LEU B 313 ? 0.3455 0.3164 0.3098 -0.0293 0.0248  -0.0190 306 LEU B CA  
4789 C C   . LEU B 313 ? 0.3316 0.2958 0.2903 -0.0327 0.0303  -0.0210 306 LEU B C   
4790 O O   . LEU B 313 ? 0.4204 0.3768 0.3757 -0.0328 0.0344  -0.0207 306 LEU B O   
4791 C CB  . LEU B 313 ? 0.3131 0.2864 0.2777 -0.0288 0.0219  -0.0175 306 LEU B CB  
4792 C CG  . LEU B 313 ? 0.2345 0.2012 0.1939 -0.0300 0.0244  -0.0170 306 LEU B CG  
4793 C CD1 . LEU B 313 ? 0.2430 0.2047 0.2017 -0.0276 0.0257  -0.0154 306 LEU B CD1 
4794 C CD2 . LEU B 313 ? 0.3480 0.3184 0.3081 -0.0303 0.0214  -0.0162 306 LEU B CD2 
4795 N N   . VAL B 314 ? 0.3318 0.2982 0.2894 -0.0357 0.0309  -0.0231 307 VAL B N   
4796 C CA  . VAL B 314 ? 0.5069 0.4673 0.4592 -0.0397 0.0366  -0.0256 307 VAL B CA  
4797 C C   . VAL B 314 ? 0.4853 0.4401 0.4370 -0.0399 0.0415  -0.0264 307 VAL B C   
4798 O O   . VAL B 314 ? 0.4607 0.4058 0.4079 -0.0411 0.0467  -0.0264 307 VAL B O   
4799 C CB  . VAL B 314 ? 0.5736 0.5395 0.5264 -0.0424 0.0361  -0.0280 307 VAL B CB  
4800 C CG1 . VAL B 314 ? 0.2957 0.2553 0.2423 -0.0474 0.0417  -0.0305 307 VAL B CG1 
4801 C CG2 . VAL B 314 ? 0.6083 0.5817 0.5644 -0.0412 0.0305  -0.0270 307 VAL B CG2 
4802 N N   . ALA B 315 ? 0.3709 0.3313 0.3269 -0.0388 0.0402  -0.0272 308 ALA B N   
4803 C CA  . ALA B 315 ? 0.3954 0.3526 0.3525 -0.0391 0.0448  -0.0282 308 ALA B CA  
4804 C C   . ALA B 315 ? 0.4210 0.3739 0.3794 -0.0358 0.0454  -0.0257 308 ALA B C   
4805 O O   . ALA B 315 ? 0.3972 0.3427 0.3547 -0.0366 0.0513  -0.0263 308 ALA B O   
4806 C CB  . ALA B 315 ? 0.2636 0.2287 0.2248 -0.0388 0.0425  -0.0295 308 ALA B CB  
4807 N N   . SER B 316 ? 0.2810 0.2381 0.2418 -0.0323 0.0397  -0.0233 309 SER B N   
4808 C CA  . SER B 316 ? 0.3158 0.2701 0.2782 -0.0290 0.0399  -0.0210 309 SER B CA  
4809 C C   . SER B 316 ? 0.4434 0.3871 0.4006 -0.0293 0.0446  -0.0199 309 SER B C   
4810 O O   . SER B 316 ? 0.4629 0.4002 0.4203 -0.0278 0.0488  -0.0189 309 SER B O   
4811 C CB  . SER B 316 ? 0.3689 0.3299 0.3350 -0.0259 0.0332  -0.0189 309 SER B CB  
4812 O OG  . SER B 316 ? 0.3918 0.3521 0.3605 -0.0230 0.0331  -0.0173 309 SER B OG  
4813 N N   . LEU B 317 ? 0.3790 0.3203 0.3314 -0.0313 0.0442  -0.0200 310 LEU B N   
4814 C CA  . LEU B 317 ? 0.4151 0.3443 0.3599 -0.0323 0.0490  -0.0192 310 LEU B CA  
4815 C C   . LEU B 317 ? 0.3877 0.3072 0.3317 -0.0335 0.0556  -0.0194 310 LEU B C   
4816 O O   . LEU B 317 ? 0.3711 0.2838 0.3185 -0.0310 0.0546  -0.0146 310 LEU B O   
4817 C CB  . LEU B 317 ? 0.4054 0.3337 0.3448 -0.0363 0.0484  -0.0205 310 LEU B CB  
4818 C CG  . LEU B 317 ? 0.4358 0.3625 0.3710 -0.0364 0.0456  -0.0188 310 LEU B CG  
4819 C CD1 . LEU B 317 ? 0.4900 0.4122 0.4186 -0.0414 0.0475  -0.0202 310 LEU B CD1 
4820 C CD2 . LEU B 317 ? 0.5433 0.4661 0.4825 -0.0325 0.0438  -0.0125 310 LEU B CD2 
4821 N N   . ALA B 318 ? 0.4612 0.3820 0.4048 -0.0369 0.0595  -0.0235 311 ALA B N   
4822 C CA  . ALA B 318 ? 0.5069 0.4188 0.4516 -0.0388 0.0651  -0.0241 311 ALA B CA  
4823 C C   . ALA B 318 ? 0.6558 0.5681 0.6082 -0.0360 0.0662  -0.0235 311 ALA B C   
4824 O O   . ALA B 318 ? 0.7165 0.6190 0.6727 -0.0346 0.0668  -0.0215 311 ALA B O   
4825 C CB  . ALA B 318 ? 0.3446 0.2581 0.2854 -0.0444 0.0697  -0.0294 311 ALA B CB  
4826 N N   . GLU B 319 ? 0.5539 0.4770 0.5093 -0.0350 0.0648  -0.0251 312 GLU B N   
4827 C CA  . GLU B 319 ? 0.5509 0.4756 0.5131 -0.0332 0.0664  -0.0251 312 GLU B CA  
4828 C C   . GLU B 319 ? 0.5058 0.4384 0.4720 -0.0287 0.0596  -0.0219 312 GLU B C   
4829 O O   . GLU B 319 ? 0.6143 0.5573 0.5849 -0.0284 0.0545  -0.0222 312 GLU B O   
4830 C CB  . GLU B 319 ? 0.6457 0.5777 0.6124 -0.0366 0.0666  -0.0286 312 GLU B CB  
4831 C CG  . GLU B 319 ? 0.8507 0.7767 0.8143 -0.0417 0.0732  -0.0326 312 GLU B CG  
4832 C CD  . GLU B 319 ? 1.0536 0.9880 1.0219 -0.0451 0.0731  -0.0362 312 GLU B CD  
4833 O OE1 . GLU B 319 ? 1.1637 1.1080 1.1367 -0.0436 0.0677  -0.0353 312 GLU B OE1 
4834 O OE2 . GLU B 319 ? 1.0935 1.0241 1.0603 -0.0496 0.0787  -0.0401 312 GLU B OE2 
4835 N N   . PRO B 320 ? 0.4747 0.4020 0.4396 -0.0251 0.0585  -0.0183 313 PRO B N   
4836 C CA  . PRO B 320 ? 0.4516 0.3854 0.4188 -0.0213 0.0537  -0.0158 313 PRO B CA  
4837 C C   . PRO B 320 ? 0.4746 0.4111 0.4485 -0.0196 0.0547  -0.0155 313 PRO B C   
4838 O O   . PRO B 320 ? 0.5590 0.4881 0.5369 -0.0190 0.0575  -0.0155 313 PRO B O   
4839 C CB  . PRO B 320 ? 0.4615 0.3888 0.4283 -0.0184 0.0503  -0.0108 313 PRO B CB  
4840 C CG  . PRO B 320 ? 0.5348 0.4528 0.4983 -0.0210 0.0522  -0.0105 313 PRO B CG  
4841 C CD  . PRO B 320 ? 0.4937 0.4096 0.4583 -0.0240 0.0574  -0.0148 313 PRO B CD  
4842 N N   . ASP B 321 ? 0.4806 0.4271 0.4579 -0.0182 0.0480  -0.0147 314 ASP B N   
4843 C CA  . ASP B 321 ? 0.4615 0.4097 0.4440 -0.0165 0.0486  -0.0138 314 ASP B CA  
4844 C C   . ASP B 321 ? 0.5060 0.4550 0.4878 -0.0123 0.0449  -0.0102 314 ASP B C   
4845 O O   . ASP B 321 ? 0.6241 0.5781 0.6039 -0.0116 0.0387  -0.0096 314 ASP B O   
4846 C CB  . ASP B 321 ? 0.5612 0.5196 0.5471 -0.0185 0.0440  -0.0152 314 ASP B CB  
4847 C CG  . ASP B 321 ? 0.6998 0.6592 0.6860 -0.0231 0.0463  -0.0185 314 ASP B CG  
4848 O OD1 . ASP B 321 ? 0.8571 0.8239 0.8424 -0.0242 0.0413  -0.0181 314 ASP B OD1 
4849 O OD2 . ASP B 321 ? 0.5696 0.5225 0.5577 -0.0254 0.0534  -0.0216 314 ASP B OD2 
4850 N N   . PHE B 322 ? 0.4786 0.4224 0.4633 -0.0092 0.0483  -0.0078 315 PHE B N   
4851 C CA  . PHE B 322 ? 0.3775 0.3229 0.3626 -0.0052 0.0433  -0.0038 315 PHE B CA  
4852 C C   . PHE B 322 ? 0.4753 0.4272 0.4643 -0.0037 0.0427  -0.0033 315 PHE B C   
4853 O O   . PHE B 322 ? 0.6376 0.5909 0.6305 -0.0058 0.0442  -0.0052 315 PHE B O   
4854 C CB  . PHE B 322 ? 0.3463 0.2828 0.3331 -0.0018 0.0412  0.0001  315 PHE B CB  
4855 C CG  . PHE B 322 ? 0.4247 0.3545 0.4077 -0.0038 0.0408  0.0006  315 PHE B CG  
4856 C CD1 . PHE B 322 ? 0.3705 0.2908 0.3545 -0.0042 0.0438  -0.0008 315 PHE B CD1 
4857 C CD2 . PHE B 322 ? 0.5312 0.4632 0.5095 -0.0054 0.0385  0.0019  315 PHE B CD2 
4858 C CE1 . PHE B 322 ? 0.5991 0.5123 0.5792 -0.0066 0.0439  -0.0002 315 PHE B CE1 
4859 C CE2 . PHE B 322 ? 0.5751 0.5001 0.5493 -0.0079 0.0394  0.0023  315 PHE B CE2 
4860 C CZ  . PHE B 322 ? 0.6796 0.5952 0.6545 -0.0086 0.0423  0.0015  315 PHE B CZ  
4861 N N   . VAL B 323 ? 0.5879 0.5436 0.5768 -0.0008 0.0384  -0.0007 316 VAL B N   
4862 C CA  . VAL B 323 ? 0.5856 0.5479 0.5783 0.0004  0.0348  0.0001  316 VAL B CA  
4863 C C   . VAL B 323 ? 0.8570 0.8180 0.8522 0.0049  0.0355  0.0047  316 VAL B C   
4864 O O   . VAL B 323 ? 0.9271 0.8841 0.9211 0.0065  0.0324  0.0073  316 VAL B O   
4865 C CB  . VAL B 323 ? 0.4470 0.4154 0.4383 -0.0009 0.0269  -0.0016 316 VAL B CB  
4866 C CG1 . VAL B 323 ? 0.5089 0.4816 0.5026 0.0008  0.0235  0.0002  316 VAL B CG1 
4867 C CG2 . VAL B 323 ? 0.3699 0.3393 0.3607 -0.0048 0.0256  -0.0048 316 VAL B CG2 
4868 N N   . VAL B 324 ? 1.0824 1.0472 1.0815 0.0061  0.0356  0.0060  317 VAL B N   
4869 C CA  . VAL B 324 ? 1.2256 1.1904 1.2295 0.0115  0.0328  0.0079  317 VAL B CA  
4870 C C   . VAL B 324 ? 1.3142 1.2726 1.3217 0.0136  0.0345  0.0047  317 VAL B C   
4871 O O   . VAL B 324 ? 1.2305 1.1866 1.2417 0.0188  0.0324  0.0054  317 VAL B O   
4872 C CB  . VAL B 324 ? 1.7831 1.7490 1.7855 0.0142  0.0283  0.0121  317 VAL B CB  
4873 C CG1 . VAL B 324 ? 1.6873 1.6564 1.6945 0.0191  0.0255  0.0137  317 VAL B CG1 
4874 C CG2 . VAL B 324 ? 1.8265 1.7997 1.8260 0.0117  0.0261  0.0124  317 VAL B CG2 
4875 N N   . THR B 325 ? 1.5182 1.4743 1.5245 0.0093  0.0380  0.0009  318 THR B N   
4876 C CA  . THR B 325 ? 1.6098 1.5618 1.6196 0.0099  0.0404  -0.0038 318 THR B CA  
4877 C C   . THR B 325 ? 1.5568 1.5154 1.5670 0.0046  0.0421  -0.0085 318 THR B C   
4878 O O   . THR B 325 ? 1.4598 1.4201 1.4738 0.0048  0.0435  -0.0135 318 THR B O   
4879 C CB  . THR B 325 ? 1.2644 1.2067 1.2710 0.0085  0.0422  -0.0036 318 THR B CB  
4880 O OG1 . THR B 325 ? 1.1419 1.0788 1.1472 0.0125  0.0387  0.0012  318 THR B OG1 
4881 C CG2 . THR B 325 ? 1.3087 1.2463 1.3191 0.0089  0.0451  -0.0088 318 THR B CG2 
4882 N N   . ASP B 326 ? 1.5898 1.5522 1.5959 -0.0001 0.0408  -0.0067 319 ASP B N   
4883 C CA  . ASP B 326 ? 1.6001 1.5689 1.6055 -0.0049 0.0388  -0.0103 319 ASP B CA  
4884 C C   . ASP B 326 ? 1.5519 1.5291 1.5560 -0.0041 0.0330  -0.0086 319 ASP B C   
4885 O O   . ASP B 326 ? 1.5018 1.4796 1.5020 -0.0063 0.0291  -0.0076 319 ASP B O   
4886 C CB  . ASP B 326 ? 1.6424 1.6071 1.6437 -0.0108 0.0391  -0.0111 319 ASP B CB  
4887 C CG  . ASP B 326 ? 1.7173 1.6766 1.7193 -0.0124 0.0452  -0.0127 319 ASP B CG  
4888 O OD1 . ASP B 326 ? 1.7046 1.6643 1.7021 -0.0140 0.0432  -0.0127 319 ASP B OD1 
4889 O OD2 . ASP B 326 ? 1.7586 1.7162 1.7646 -0.0084 0.0474  -0.0151 319 ASP B OD2 
4890 N N   . PHE B 327 ? 1.4648 1.4489 1.4722 -0.0006 0.0320  -0.0090 320 PHE B N   
4891 C CA  . PHE B 327 ? 1.3490 1.3419 1.3555 -0.0007 0.0277  -0.0075 320 PHE B CA  
4892 C C   . PHE B 327 ? 1.3036 1.3047 1.3140 0.0018  0.0281  -0.0098 320 PHE B C   
4893 O O   . PHE B 327 ? 1.2801 1.2815 1.2944 0.0065  0.0292  -0.0103 320 PHE B O   
4894 C CB  . PHE B 327 ? 1.3363 1.3280 1.3414 0.0013  0.0250  -0.0030 320 PHE B CB  
4895 C CG  . PHE B 327 ? 1.3059 1.2972 1.3070 -0.0014 0.0215  -0.0018 320 PHE B CG  
4896 C CD1 . PHE B 327 ? 1.3212 1.3081 1.3203 -0.0001 0.0198  0.0008  320 PHE B CD1 
4897 C CD2 . PHE B 327 ? 1.2355 1.2314 1.2353 -0.0044 0.0197  -0.0037 320 PHE B CD2 
4898 C CE1 . PHE B 327 ? 1.2299 1.2186 1.2267 -0.0017 0.0164  0.0006  320 PHE B CE1 
4899 C CE2 . PHE B 327 ? 1.2398 1.2362 1.2369 -0.0059 0.0163  -0.0031 320 PHE B CE2 
4900 C CZ  . PHE B 327 ? 1.2178 1.2111 1.2138 -0.0045 0.0146  -0.0012 320 PHE B CZ  
4901 N N   . PHE B 330 ? 1.4475 1.3532 1.4571 0.0277  0.0293  0.0099  323 PHE B N   
4902 C CA  . PHE B 330 ? 1.5338 1.4341 1.5413 0.0230  0.0339  0.0060  323 PHE B CA  
4903 C C   . PHE B 330 ? 1.5099 1.4010 1.5117 0.0200  0.0329  0.0094  323 PHE B C   
4904 O O   . PHE B 330 ? 1.4627 1.3553 1.4597 0.0141  0.0352  0.0085  323 PHE B O   
4905 C CB  . PHE B 330 ? 1.6556 1.5508 1.6688 0.0262  0.0366  0.0007  323 PHE B CB  
4906 C CG  . PHE B 330 ? 1.7653 1.6709 1.7840 0.0278  0.0382  -0.0041 323 PHE B CG  
4907 C CD1 . PHE B 330 ? 1.7788 1.6899 1.7975 0.0227  0.0428  -0.0094 323 PHE B CD1 
4908 C CD2 . PHE B 330 ? 1.7983 1.7090 1.8219 0.0341  0.0349  -0.0033 323 PHE B CD2 
4909 C CE1 . PHE B 330 ? 1.7708 1.6921 1.7942 0.0235  0.0438  -0.0136 323 PHE B CE1 
4910 C CE2 . PHE B 330 ? 1.7878 1.7091 1.8162 0.0352  0.0362  -0.0079 323 PHE B CE2 
4911 C CZ  . PHE B 330 ? 1.7662 1.6925 1.7942 0.0298  0.0406  -0.0130 323 PHE B CZ  
4912 N N   . SER B 331 ? 1.4656 1.3473 1.4682 0.0240  0.0293  0.0132  324 SER B N   
4913 C CA  . SER B 331 ? 1.3593 1.2309 1.3571 0.0212  0.0280  0.0167  324 SER B CA  
4914 C C   . SER B 331 ? 1.2173 1.0947 1.2097 0.0176  0.0251  0.0216  324 SER B C   
4915 O O   . SER B 331 ? 1.1608 1.0357 1.1482 0.0125  0.0267  0.0223  324 SER B O   
4916 C CB  . SER B 331 ? 1.4520 1.3112 1.4525 0.0269  0.0246  0.0196  324 SER B CB  
4917 O OG  . SER B 331 ? 1.5026 1.3666 1.5067 0.0330  0.0203  0.0221  324 SER B OG  
4918 N N   . ARG B 332 ? 1.1635 1.0489 1.1571 0.0204  0.0216  0.0244  325 ARG B N   
4919 C CA  . ARG B 332 ? 0.9475 0.8387 0.9365 0.0177  0.0191  0.0288  325 ARG B CA  
4920 C C   . ARG B 332 ? 0.6775 0.5757 0.6622 0.0115  0.0220  0.0264  325 ARG B C   
4921 O O   . ARG B 332 ? 0.7734 0.6702 0.7535 0.0080  0.0212  0.0291  325 ARG B O   
4922 C CB  . ARG B 332 ? 0.9825 0.8827 0.9740 0.0215  0.0156  0.0306  325 ARG B CB  
4923 C CG  . ARG B 332 ? 1.1368 1.0322 1.1336 0.0284  0.0130  0.0315  325 ARG B CG  
4924 C CD  . ARG B 332 ? 1.1911 1.0975 1.1913 0.0321  0.0106  0.0317  325 ARG B CD  
4925 N NE  . ARG B 332 ? 1.1837 1.1003 1.1861 0.0304  0.0136  0.0267  325 ARG B NE  
4926 C CZ  . ARG B 332 ? 1.2098 1.1364 1.2098 0.0268  0.0140  0.0267  325 ARG B CZ  
4927 N NH1 . ARG B 332 ? 1.2699 1.1985 1.2654 0.0245  0.0118  0.0306  325 ARG B NH1 
4928 N NH2 . ARG B 332 ? 1.1302 1.0644 1.1321 0.0255  0.0169  0.0228  325 ARG B NH2 
4929 N N   . PRO B 333 ? 0.4499 0.3558 0.4362 0.0102  0.0250  0.0214  326 PRO B N   
4930 C CA  . PRO B 333 ? 0.4664 0.3788 0.4485 0.0051  0.0271  0.0191  326 PRO B CA  
4931 C C   . PRO B 333 ? 0.5207 0.4257 0.4992 0.0011  0.0303  0.0172  326 PRO B C   
4932 O O   . PRO B 333 ? 0.5047 0.4114 0.4786 -0.0026 0.0305  0.0175  326 PRO B O   
4933 C CB  . PRO B 333 ? 0.5006 0.4215 0.4855 0.0052  0.0294  0.0145  326 PRO B CB  
4934 C CG  . PRO B 333 ? 0.3386 0.2597 0.3290 0.0102  0.0278  0.0151  326 PRO B CG  
4935 C CD  . PRO B 333 ? 0.4759 0.3856 0.4675 0.0133  0.0263  0.0177  326 PRO B CD  
4936 N N   . ALA B 334 ? 0.4734 0.3703 0.4542 0.0019  0.0329  0.0149  327 ALA B N   
4937 C CA  . ALA B 334 ? 0.4630 0.3518 0.4406 -0.0018 0.0361  0.0131  327 ALA B CA  
4938 C C   . ALA B 334 ? 0.4432 0.3248 0.4168 -0.0031 0.0337  0.0184  327 ALA B C   
4939 O O   . ALA B 334 ? 0.5656 0.4468 0.5344 -0.0077 0.0354  0.0177  327 ALA B O   
4940 C CB  . ALA B 334 ? 0.3959 0.2759 0.3775 0.0001  0.0385  0.0102  327 ALA B CB  
4941 N N   . GLN B 335 ? 0.3814 0.2581 0.3571 0.0009  0.0296  0.0236  328 GLN B N   
4942 C CA  . GLN B 335 ? 0.5109 0.3812 0.4831 -0.0005 0.0269  0.0295  328 GLN B CA  
4943 C C   . GLN B 335 ? 0.5735 0.4535 0.5419 -0.0035 0.0252  0.0315  328 GLN B C   
4944 O O   . GLN B 335 ? 0.5753 0.4522 0.5396 -0.0072 0.0251  0.0342  328 GLN B O   
4945 C CB  . GLN B 335 ? 0.4871 0.3497 0.4623 0.0048  0.0225  0.0348  328 GLN B CB  
4946 C CG  . GLN B 335 ? 0.6196 0.4678 0.5969 0.0066  0.0238  0.0341  328 GLN B CG  
4947 C CD  . GLN B 335 ? 0.5902 0.4323 0.5720 0.0136  0.0196  0.0370  328 GLN B CD  
4948 O OE1 . GLN B 335 ? 0.6229 0.4516 0.6050 0.0154  0.0178  0.0404  328 GLN B OE1 
4949 N NE2 . GLN B 335 ? 0.5562 0.4079 0.5417 0.0178  0.0180  0.0357  328 GLN B NE2 
4950 N N   . LEU B 336 ? 0.5422 0.4341 0.5124 -0.0021 0.0240  0.0299  329 LEU B N   
4951 C CA  . LEU B 336 ? 0.4949 0.3963 0.4623 -0.0050 0.0227  0.0304  329 LEU B CA  
4952 C C   . LEU B 336 ? 0.5233 0.4265 0.4868 -0.0096 0.0264  0.0256  329 LEU B C   
4953 O O   . LEU B 336 ? 0.4140 0.3181 0.3737 -0.0131 0.0261  0.0267  329 LEU B O   
4954 C CB  . LEU B 336 ? 0.3784 0.2913 0.3487 -0.0026 0.0208  0.0292  329 LEU B CB  
4955 C CG  . LEU B 336 ? 0.4558 0.3699 0.4273 0.0002  0.0162  0.0345  329 LEU B CG  
4956 C CD1 . LEU B 336 ? 0.4333 0.3577 0.4080 0.0027  0.0150  0.0326  329 LEU B CD1 
4957 C CD2 . LEU B 336 ? 0.4579 0.3736 0.4259 -0.0033 0.0142  0.0384  329 LEU B CD2 
4958 N N   . HIS B 337 ? 0.5406 0.4446 0.5051 -0.0097 0.0298  0.0202  330 HIS B N   
4959 C CA  . HIS B 337 ? 0.4973 0.4033 0.4579 -0.0139 0.0334  0.0148  330 HIS B CA  
4960 C C   . HIS B 337 ? 0.4506 0.3482 0.4065 -0.0178 0.0348  0.0160  330 HIS B C   
4961 O O   . HIS B 337 ? 0.4769 0.3777 0.4282 -0.0215 0.0354  0.0140  330 HIS B O   
4962 C CB  . HIS B 337 ? 0.4249 0.3302 0.3877 -0.0135 0.0372  0.0100  330 HIS B CB  
4963 C CG  . HIS B 337 ? 0.3905 0.3007 0.3497 -0.0172 0.0403  0.0041  330 HIS B CG  
4964 N ND1 . HIS B 337 ? 0.5069 0.4271 0.4648 -0.0178 0.0387  0.0015  330 HIS B ND1 
4965 C CD2 . HIS B 337 ? 0.4728 0.3793 0.4297 -0.0205 0.0447  0.0000  330 HIS B CD2 
4966 C CE1 . HIS B 337 ? 0.5163 0.4384 0.4708 -0.0210 0.0416  -0.0038 330 HIS B CE1 
4967 N NE2 . HIS B 337 ? 0.4081 0.3228 0.3618 -0.0230 0.0456  -0.0048 330 HIS B NE2 
4968 N N   . ILE B 338 ? 0.4256 0.3118 0.3826 -0.0168 0.0352  0.0192  331 ILE B N   
4969 C CA  . ILE B 338 ? 0.4623 0.3385 0.4152 -0.0204 0.0363  0.0214  331 ILE B CA  
4970 C C   . ILE B 338 ? 0.4417 0.3203 0.3918 -0.0219 0.0332  0.0264  331 ILE B C   
4971 O O   . ILE B 338 ? 0.5219 0.3998 0.4667 -0.0265 0.0346  0.0256  331 ILE B O   
4972 C CB  . ILE B 338 ? 0.5028 0.3656 0.4586 -0.0179 0.0362  0.0246  331 ILE B CB  
4973 C CG1 . ILE B 338 ? 0.4494 0.3098 0.4082 -0.0170 0.0399  0.0189  331 ILE B CG1 
4974 C CG2 . ILE B 338 ? 0.5796 0.4310 0.5311 -0.0217 0.0369  0.0280  331 ILE B CG2 
4975 C CD1 . ILE B 338 ? 0.5394 0.3871 0.5025 -0.0134 0.0393  0.0208  331 ILE B CD1 
4976 N N   . GLY B 339 ? 0.4314 0.3132 0.3848 -0.0182 0.0290  0.0314  332 GLY B N   
4977 C CA  . GLY B 339 ? 0.4409 0.3265 0.3924 -0.0195 0.0260  0.0364  332 GLY B CA  
4978 C C   . GLY B 339 ? 0.4098 0.3056 0.3580 -0.0228 0.0268  0.0322  332 GLY B C   
4979 O O   . GLY B 339 ? 0.3703 0.2654 0.3140 -0.0266 0.0272  0.0334  332 GLY B O   
4980 N N   . PHE B 340 ? 0.3073 0.2122 0.2578 -0.0212 0.0269  0.0271  333 PHE B N   
4981 C CA  . PHE B 340 ? 0.3274 0.2414 0.2755 -0.0236 0.0268  0.0226  333 PHE B CA  
4982 C C   . PHE B 340 ? 0.3918 0.3020 0.3338 -0.0286 0.0301  0.0182  333 PHE B C   
4983 O O   . PHE B 340 ? 0.3697 0.2835 0.3079 -0.0320 0.0296  0.0166  333 PHE B O   
4984 C CB  . PHE B 340 ? 0.2786 0.2012 0.2304 -0.0209 0.0262  0.0183  333 PHE B CB  
4985 C CG  . PHE B 340 ? 0.3999 0.3307 0.3559 -0.0180 0.0224  0.0209  333 PHE B CG  
4986 C CD1 . PHE B 340 ? 0.4355 0.3651 0.3954 -0.0145 0.0205  0.0257  333 PHE B CD1 
4987 C CD2 . PHE B 340 ? 0.4159 0.3554 0.3719 -0.0189 0.0207  0.0183  333 PHE B CD2 
4988 C CE1 . PHE B 340 ? 0.4011 0.3387 0.3644 -0.0124 0.0172  0.0278  333 PHE B CE1 
4989 C CE2 . PHE B 340 ? 0.3253 0.2723 0.2854 -0.0166 0.0177  0.0205  333 PHE B CE2 
4990 C CZ  . PHE B 340 ? 0.4361 0.3826 0.3998 -0.0135 0.0161  0.0253  333 PHE B CZ  
4991 N N   . GLN B 341 ? 0.3369 0.2400 0.2782 -0.0293 0.0335  0.0159  334 GLN B N   
4992 C CA  . GLN B 341 ? 0.4005 0.2994 0.3359 -0.0344 0.0370  0.0119  334 GLN B CA  
4993 C C   . GLN B 341 ? 0.4732 0.3655 0.4043 -0.0378 0.0368  0.0163  334 GLN B C   
4994 O O   . GLN B 341 ? 0.4808 0.3757 0.4067 -0.0423 0.0373  0.0138  334 GLN B O   
4995 C CB  . GLN B 341 ? 0.4334 0.3253 0.3695 -0.0344 0.0410  0.0092  334 GLN B CB  
4996 C CG  . GLN B 341 ? 0.6538 0.5519 0.5884 -0.0361 0.0437  0.0016  334 GLN B CG  
4997 C CD  . GLN B 341 ? 0.8378 0.7341 0.7764 -0.0338 0.0465  -0.0006 334 GLN B CD  
4998 O OE1 . GLN B 341 ? 0.7322 0.6283 0.6764 -0.0293 0.0449  0.0023  334 GLN B OE1 
4999 N NE2 . GLN B 341 ? 0.8885 0.7840 0.8243 -0.0372 0.0508  -0.0060 334 GLN B NE2 
5000 N N   . ALA B 342 ? 0.4502 0.3342 0.3835 -0.0359 0.0358  0.0229  335 ALA B N   
5001 C CA  . ALA B 342 ? 0.5017 0.3787 0.4313 -0.0389 0.0353  0.0285  335 ALA B CA  
5002 C C   . ALA B 342 ? 0.6173 0.5033 0.5447 -0.0404 0.0329  0.0297  335 ALA B C   
5003 O O   . ALA B 342 ? 0.6122 0.4965 0.5337 -0.0453 0.0338  0.0299  335 ALA B O   
5004 C CB  . ALA B 342 ? 0.4784 0.3466 0.4122 -0.0353 0.0333  0.0361  335 ALA B CB  
5005 N N   . LEU B 343 ? 0.6495 0.5450 0.5816 -0.0364 0.0299  0.0301  336 LEU B N   
5006 C CA  . LEU B 343 ? 0.5485 0.4529 0.4796 -0.0372 0.0275  0.0309  336 LEU B CA  
5007 C C   . LEU B 343 ? 0.5196 0.4290 0.4457 -0.0419 0.0286  0.0239  336 LEU B C   
5008 O O   . LEU B 343 ? 0.6015 0.5132 0.5234 -0.0456 0.0279  0.0243  336 LEU B O   
5009 C CB  . LEU B 343 ? 0.4915 0.4051 0.4291 -0.0320 0.0245  0.0316  336 LEU B CB  
5010 C CG  . LEU B 343 ? 0.4381 0.3599 0.3758 -0.0320 0.0220  0.0339  336 LEU B CG  
5011 C CD1 . LEU B 343 ? 0.4354 0.3515 0.3694 -0.0339 0.0220  0.0407  336 LEU B CD1 
5012 C CD2 . LEU B 343 ? 0.4603 0.3891 0.4048 -0.0267 0.0194  0.0359  336 LEU B CD2 
5013 N N   . HIS B 344 ? 0.4768 0.3884 0.4033 -0.0420 0.0301  0.0173  337 HIS B N   
5014 C CA  . HIS B 344 ? 0.4734 0.3898 0.3955 -0.0464 0.0307  0.0104  337 HIS B CA  
5015 C C   . HIS B 344 ? 0.4623 0.3719 0.3772 -0.0525 0.0334  0.0102  337 HIS B C   
5016 O O   . HIS B 344 ? 0.6366 0.5498 0.5473 -0.0567 0.0326  0.0084  337 HIS B O   
5017 C CB  . HIS B 344 ? 0.5295 0.4489 0.4531 -0.0452 0.0320  0.0040  337 HIS B CB  
5018 C CG  . HIS B 344 ? 0.5055 0.4341 0.4349 -0.0411 0.0289  0.0025  337 HIS B CG  
5019 N ND1 . HIS B 344 ? 0.5611 0.4979 0.4910 -0.0421 0.0259  0.0000  337 HIS B ND1 
5020 C CD2 . HIS B 344 ? 0.4461 0.3764 0.3809 -0.0362 0.0284  0.0030  337 HIS B CD2 
5021 C CE1 . HIS B 344 ? 0.4566 0.3994 0.3922 -0.0380 0.0236  -0.0007 337 HIS B CE1 
5022 N NE2 . HIS B 344 ? 0.4788 0.4179 0.4172 -0.0344 0.0251  0.0011  337 HIS B NE2 
5023 N N   . GLN B 345 ? 0.4514 0.3507 0.3649 -0.0531 0.0365  0.0121  338 GLN B N   
5024 C CA  . GLN B 345 ? 0.5561 0.4473 0.4627 -0.0591 0.0392  0.0127  338 GLN B CA  
5025 C C   . GLN B 345 ? 0.6731 0.5631 0.5767 -0.0614 0.0374  0.0186  338 GLN B C   
5026 O O   . GLN B 345 ? 0.6523 0.5424 0.5494 -0.0674 0.0384  0.0166  338 GLN B O   
5027 C CB  . GLN B 345 ? 0.4610 0.3402 0.3680 -0.0587 0.0424  0.0149  338 GLN B CB  
5028 C CG  . GLN B 345 ? 0.6101 0.4898 0.5183 -0.0581 0.0453  0.0084  338 GLN B CG  
5029 C CD  . GLN B 345 ? 0.8456 0.7124 0.7540 -0.0586 0.0487  0.0102  338 GLN B CD  
5030 O OE1 . GLN B 345 ? 1.0026 0.8594 0.9094 -0.0603 0.0489  0.0158  338 GLN B OE1 
5031 N NE2 . GLN B 345 ? 0.6322 0.4991 0.5429 -0.0573 0.0514  0.0054  338 GLN B NE2 
5032 N N   . PHE B 346 ? 0.6004 0.4896 0.5085 -0.0569 0.0349  0.0258  339 PHE B N   
5033 C CA  . PHE B 346 ? 0.6462 0.5353 0.5517 -0.0586 0.0332  0.0318  339 PHE B CA  
5034 C C   . PHE B 346 ? 0.6420 0.5422 0.5447 -0.0618 0.0315  0.0273  339 PHE B C   
5035 O O   . PHE B 346 ? 0.5894 0.4890 0.4859 -0.0672 0.0317  0.0281  339 PHE B O   
5036 C CB  . PHE B 346 ? 0.6347 0.5238 0.5463 -0.0524 0.0305  0.0395  339 PHE B CB  
5037 C CG  . PHE B 346 ? 0.5945 0.4829 0.5030 -0.0537 0.0291  0.0466  339 PHE B CG  
5038 C CD1 . PHE B 346 ? 0.6820 0.5588 0.5882 -0.0547 0.0300  0.0541  339 PHE B CD1 
5039 C CD2 . PHE B 346 ? 0.5958 0.4946 0.5035 -0.0541 0.0269  0.0458  339 PHE B CD2 
5040 C CE1 . PHE B 346 ? 0.7006 0.5768 0.6032 -0.0559 0.0290  0.0611  339 PHE B CE1 
5041 C CE2 . PHE B 346 ? 0.5815 0.4800 0.4855 -0.0556 0.0259  0.0520  339 PHE B CE2 
5042 C CZ  . PHE B 346 ? 0.5690 0.4563 0.4700 -0.0564 0.0271  0.0599  339 PHE B CZ  
5043 N N   . CYS B 347 ? 0.6308 0.5408 0.5382 -0.0586 0.0295  0.0226  340 CYS B N   
5044 C CA  . CYS B 347 ? 0.5619 0.4825 0.4684 -0.0610 0.0272  0.0185  340 CYS B CA  
5045 C C   . CYS B 347 ? 0.6240 0.5460 0.5247 -0.0676 0.0288  0.0114  340 CYS B C   
5046 O O   . CYS B 347 ? 0.7146 0.6412 0.6115 -0.0725 0.0279  0.0097  340 CYS B O   
5047 C CB  . CYS B 347 ? 0.4089 0.3385 0.3226 -0.0559 0.0245  0.0157  340 CYS B CB  
5048 S SG  . CYS B 347 ? 0.7709 0.7024 0.6914 -0.0488 0.0221  0.0232  340 CYS B SG  
5049 N N   . ALA B 348 ? 0.5143 0.4329 0.4143 -0.0679 0.0313  0.0070  341 ALA B N   
5050 C CA  . ALA B 348 ? 0.5338 0.4540 0.4283 -0.0741 0.0331  0.0001  341 ALA B CA  
5051 C C   . ALA B 348 ? 0.6241 0.5376 0.5107 -0.0807 0.0354  0.0025  341 ALA B C   
5052 O O   . ALA B 348 ? 0.6399 0.5575 0.5215 -0.0869 0.0358  -0.0022 341 ALA B O   
5053 C CB  . ALA B 348 ? 0.2126 0.1300 0.1075 -0.0731 0.0359  -0.0045 341 ALA B CB  
5054 N N   . GLN B 349 ? 0.5639 0.4673 0.4498 -0.0795 0.0366  0.0099  342 GLN B N   
5055 C CA  . GLN B 349 ? 0.6344 0.5300 0.5129 -0.0856 0.0387  0.0133  342 GLN B CA  
5056 C C   . GLN B 349 ? 0.6506 0.5508 0.5266 -0.0881 0.0361  0.0170  342 GLN B C   
5057 O O   . GLN B 349 ? 0.7677 0.6700 0.6372 -0.0952 0.0368  0.0144  342 GLN B O   
5058 C CB  . GLN B 349 ? 0.7700 0.6518 0.6490 -0.0836 0.0409  0.0202  342 GLN B CB  
5059 C CG  . GLN B 349 ? 0.8998 0.7757 0.7793 -0.0835 0.0444  0.0159  342 GLN B CG  
5060 C CD  . GLN B 349 ? 0.9262 0.7876 0.8067 -0.0821 0.0464  0.0223  342 GLN B CD  
5061 O OE1 . GLN B 349 ? 0.9872 0.8412 0.8658 -0.0831 0.0458  0.0299  342 GLN B OE1 
5062 N NE2 . GLN B 349 ? 0.7925 0.6498 0.6761 -0.0799 0.0487  0.0191  342 GLN B NE2 
5063 N N   . HIS B 350 ? 0.5203 0.4230 0.4014 -0.0826 0.0333  0.0226  343 HIS B N   
5064 C CA  . HIS B 350 ? 0.6050 0.5119 0.4836 -0.0848 0.0312  0.0267  343 HIS B CA  
5065 C C   . HIS B 350 ? 0.6644 0.5852 0.5452 -0.0857 0.0282  0.0208  343 HIS B C   
5066 O O   . HIS B 350 ? 0.6608 0.5868 0.5394 -0.0885 0.0264  0.0227  343 HIS B O   
5067 C CB  . HIS B 350 ? 0.7961 0.6990 0.6785 -0.0788 0.0297  0.0360  343 HIS B CB  
5068 C CG  . HIS B 350 ? 0.9328 0.8215 0.8133 -0.0784 0.0321  0.0430  343 HIS B CG  
5069 N ND1 . HIS B 350 ? 0.9043 0.7850 0.7864 -0.0774 0.0346  0.0412  343 HIS B ND1 
5070 C CD2 . HIS B 350 ? 1.0965 0.9775 0.9736 -0.0791 0.0321  0.0520  343 HIS B CD2 
5071 C CE1 . HIS B 350 ? 1.0082 0.8763 0.8888 -0.0775 0.0360  0.0486  343 HIS B CE1 
5072 N NE2 . HIS B 350 ? 1.1380 1.0060 1.0157 -0.0784 0.0345  0.0555  343 HIS B NE2 
5073 N N   . GLY B 351 ? 0.7108 0.6377 0.5964 -0.0833 0.0276  0.0140  344 GLY B N   
5074 C CA  . GLY B 351 ? 0.6031 0.5426 0.4925 -0.0834 0.0245  0.0086  344 GLY B CA  
5075 C C   . GLY B 351 ? 0.6296 0.5741 0.5245 -0.0784 0.0215  0.0131  344 GLY B C   
5076 O O   . GLY B 351 ? 0.6129 0.5675 0.5106 -0.0793 0.0189  0.0099  344 GLY B O   
5077 N N   . ARG B 352 ? 0.6060 0.5437 0.5027 -0.0733 0.0219  0.0204  345 ARG B N   
5078 C CA  . ARG B 352 ? 0.5923 0.5343 0.4939 -0.0682 0.0195  0.0250  345 ARG B CA  
5079 C C   . ARG B 352 ? 0.5580 0.4924 0.4636 -0.0615 0.0205  0.0307  345 ARG B C   
5080 O O   . ARG B 352 ? 0.5730 0.4979 0.4763 -0.0619 0.0230  0.0324  345 ARG B O   
5081 C CB  . ARG B 352 ? 0.6355 0.5787 0.5322 -0.0718 0.0186  0.0298  345 ARG B CB  
5082 C CG  . ARG B 352 ? 0.6099 0.5419 0.4998 -0.0744 0.0210  0.0363  345 ARG B CG  
5083 C CD  . ARG B 352 ? 0.6693 0.6011 0.5562 -0.0745 0.0198  0.0439  345 ARG B CD  
5084 N NE  . ARG B 352 ? 0.8364 0.7571 0.7232 -0.0700 0.0211  0.0527  345 ARG B NE  
5085 C CZ  . ARG B 352 ? 0.8702 0.7795 0.7517 -0.0729 0.0235  0.0569  345 ARG B CZ  
5086 N NH1 . ARG B 352 ? 0.7968 0.7043 0.6717 -0.0807 0.0252  0.0530  345 ARG B NH1 
5087 N NH2 . ARG B 352 ? 0.8308 0.7304 0.7139 -0.0682 0.0242  0.0651  345 ARG B NH2 
5088 N N   . PRO B 353 ? 0.5925 0.5312 0.5040 -0.0555 0.0185  0.0333  346 PRO B N   
5089 C CA  . PRO B 353 ? 0.6854 0.6182 0.6013 -0.0492 0.0191  0.0391  346 PRO B CA  
5090 C C   . PRO B 353 ? 0.7428 0.6684 0.6550 -0.0490 0.0197  0.0480  346 PRO B C   
5091 O O   . PRO B 353 ? 0.7785 0.7052 0.6847 -0.0535 0.0193  0.0496  346 PRO B O   
5092 C CB  . PRO B 353 ? 0.6630 0.6046 0.5856 -0.0439 0.0167  0.0385  346 PRO B CB  
5093 C CG  . PRO B 353 ? 0.6776 0.6286 0.6003 -0.0474 0.0149  0.0314  346 PRO B CG  
5094 C CD  . PRO B 353 ? 0.6279 0.5777 0.5432 -0.0546 0.0156  0.0303  346 PRO B CD  
5095 N N   . PRO B 354 ? 0.7267 0.6452 0.6425 -0.0440 0.0204  0.0539  347 PRO B N   
5096 C CA  . PRO B 354 ? 0.7557 0.6680 0.6692 -0.0423 0.0204  0.0633  347 PRO B CA  
5097 C C   . PRO B 354 ? 0.7524 0.6725 0.6647 -0.0404 0.0183  0.0657  347 PRO B C   
5098 O O   . PRO B 354 ? 0.6937 0.6214 0.6114 -0.0360 0.0168  0.0634  347 PRO B O   
5099 C CB  . PRO B 354 ? 0.6967 0.6035 0.6176 -0.0362 0.0204  0.0675  347 PRO B CB  
5100 C CG  . PRO B 354 ? 0.6703 0.5762 0.5940 -0.0373 0.0214  0.0604  347 PRO B CG  
5101 C CD  . PRO B 354 ? 0.6552 0.5712 0.5775 -0.0399 0.0209  0.0522  347 PRO B CD  
5102 N N   . ARG B 355 ? 0.7234 0.6415 0.6282 -0.0442 0.0181  0.0700  348 ARG B N   
5103 C CA  . ARG B 355 ? 0.6853 0.6096 0.5873 -0.0432 0.0160  0.0727  348 ARG B CA  
5104 C C   . ARG B 355 ? 0.7909 0.7113 0.6956 -0.0350 0.0157  0.0797  348 ARG B C   
5105 O O   . ARG B 355 ? 0.8883 0.7987 0.7942 -0.0321 0.0173  0.0856  348 ARG B O   
5106 C CB  . ARG B 355 ? 0.7825 0.7041 0.6751 -0.0495 0.0159  0.0766  348 ARG B CB  
5107 C CG  . ARG B 355 ? 0.9249 0.8496 0.8135 -0.0582 0.0165  0.0701  348 ARG B CG  
5108 C CD  . ARG B 355 ? 0.9860 0.9047 0.8650 -0.0645 0.0173  0.0752  348 ARG B CD  
5109 N NE  . ARG B 355 ? 1.1486 1.0540 1.0257 -0.0652 0.0201  0.0789  348 ARG B NE  
5110 C CZ  . ARG B 355 ? 1.1662 1.0648 1.0353 -0.0721 0.0217  0.0811  348 ARG B CZ  
5111 N NH1 . ARG B 355 ? 1.1185 1.0230 0.9805 -0.0791 0.0207  0.0800  348 ARG B NH1 
5112 N NH2 . ARG B 355 ? 1.1313 1.0172 0.9997 -0.0725 0.0242  0.0843  348 ARG B NH2 
5113 N N   . PRO B 356 ? 0.8165 0.7444 0.7222 -0.0314 0.0135  0.0789  349 PRO B N   
5114 C CA  . PRO B 356 ? 0.8889 0.8120 0.7946 -0.0236 0.0132  0.0850  349 PRO B CA  
5115 C C   . PRO B 356 ? 1.0080 0.9236 0.9049 -0.0243 0.0128  0.0936  349 PRO B C   
5116 O O   . PRO B 356 ? 1.0768 0.9926 0.9681 -0.0313 0.0128  0.0941  349 PRO B O   
5117 C CB  . PRO B 356 ? 0.8281 0.7617 0.7352 -0.0218 0.0103  0.0806  349 PRO B CB  
5118 C CG  . PRO B 356 ? 0.8522 0.7962 0.7625 -0.0280 0.0095  0.0725  349 PRO B CG  
5119 C CD  . PRO B 356 ? 0.8008 0.7410 0.7068 -0.0348 0.0110  0.0727  349 PRO B CD  
5120 N N   . ARG B 357 ? 1.0011 0.9094 0.8954 -0.0173 0.0124  0.0999  350 ARG B N   
5121 C CA  . ARG B 357 ? 1.0115 0.9109 0.8969 -0.0170 0.0118  0.1089  350 ARG B CA  
5122 C C   . ARG B 357 ? 0.8088 0.6993 0.6927 -0.0219 0.0146  0.1134  350 ARG B C   
5123 O O   . ARG B 357 ? 0.7908 0.6742 0.6666 -0.0233 0.0142  0.1207  350 ARG B O   
5124 C CB  . ARG B 357 ? 1.0222 0.9297 0.9000 -0.0210 0.0079  0.1096  350 ARG B CB  
5125 C CG  . ARG B 357 ? 0.9980 0.9209 0.8803 -0.0232 0.0053  0.1015  350 ARG B CG  
5126 C CD  . ARG B 357 ? 1.1108 1.0435 0.9878 -0.0297 0.0023  0.1023  350 ARG B CD  
5127 N NE  . ARG B 357 ? 1.1620 1.1086 1.0445 -0.0353 0.0016  0.0936  350 ARG B NE  
5128 C CZ  . ARG B 357 ? 1.2687 1.2272 1.1498 -0.0407 -0.0011 0.0920  350 ARG B CZ  
5129 N NH1 . ARG B 357 ? 1.3153 1.2744 1.1896 -0.0414 -0.0034 0.0986  350 ARG B NH1 
5130 N NH2 . ARG B 357 ? 1.2843 1.2545 1.1712 -0.0453 -0.0014 0.0839  350 ARG B NH2 
5131 N N   . ASN B 358 ? 0.7364 0.6271 0.6275 -0.0250 0.0168  0.1087  351 ASN B N   
5132 C CA  . ASN B 358 ? 0.6992 0.5806 0.5888 -0.0304 0.0188  0.1117  351 ASN B CA  
5133 C C   . ASN B 358 ? 0.8337 0.7061 0.7328 -0.0263 0.0204  0.1147  351 ASN B C   
5134 O O   . ASN B 358 ? 0.7853 0.6606 0.6922 -0.0276 0.0207  0.1083  351 ASN B O   
5135 C CB  . ASN B 358 ? 0.6114 0.4988 0.4994 -0.0393 0.0193  0.1032  351 ASN B CB  
5136 C CG  . ASN B 358 ? 0.7692 0.6465 0.6518 -0.0462 0.0213  0.1057  351 ASN B CG  
5137 O OD1 . ASN B 358 ? 0.9105 0.7755 0.7933 -0.0442 0.0224  0.1133  351 ASN B OD1 
5138 N ND2 . ASN B 358 ? 0.7658 0.6479 0.6436 -0.0544 0.0216  0.0991  351 ASN B ND2 
5139 N N   . ASP B 359 ? 0.9194 0.7813 0.8178 -0.0221 0.0205  0.1238  352 ASP B N   
5140 C CA  . ASP B 359 ? 0.8891 0.7430 0.7982 -0.0190 0.0199  0.1262  352 ASP B CA  
5141 C C   . ASP B 359 ? 0.9126 0.7579 0.8230 -0.0264 0.0214  0.1250  352 ASP B C   
5142 O O   . ASP B 359 ? 0.9336 0.7738 0.8528 -0.0259 0.0201  0.1230  352 ASP B O   
5143 C CB  . ASP B 359 ? 0.9443 0.7887 0.8514 -0.0128 0.0193  0.1357  352 ASP B CB  
5144 C CG  . ASP B 359 ? 1.1631 1.0013 1.0548 -0.0158 0.0203  0.1424  352 ASP B CG  
5145 O OD1 . ASP B 359 ? 1.2912 1.1226 1.1768 -0.0100 0.0193  0.1493  352 ASP B OD1 
5146 O OD2 . ASP B 359 ? 1.1549 0.9948 1.0396 -0.0241 0.0217  0.1407  352 ASP B OD2 
5147 N N   . GLU B 360 ? 0.9696 0.8129 0.8696 -0.0340 0.0233  0.1239  353 GLU B N   
5148 C CA  . GLU B 360 ? 0.9606 0.7959 0.8588 -0.0414 0.0251  0.1200  353 GLU B CA  
5149 C C   . GLU B 360 ? 0.9163 0.7596 0.8182 -0.0438 0.0254  0.1082  353 GLU B C   
5150 O O   . GLU B 360 ? 0.8224 0.6586 0.7268 -0.0461 0.0265  0.1041  353 GLU B O   
5151 C CB  . GLU B 360 ? 1.0133 0.8451 0.8988 -0.0492 0.0267  0.1217  353 GLU B CB  
5152 C CG  . GLU B 360 ? 1.2028 1.0246 1.0831 -0.0472 0.0266  0.1339  353 GLU B CG  
5153 C CD  . GLU B 360 ? 1.3081 1.1258 1.1755 -0.0560 0.0278  0.1361  353 GLU B CD  
5154 O OE1 . GLU B 360 ? 1.4515 1.2747 1.3144 -0.0638 0.0288  0.1277  353 GLU B OE1 
5155 O OE2 . GLU B 360 ? 1.1430 0.9518 1.0044 -0.0551 0.0278  0.1462  353 GLU B OE2 
5156 N N   . ASP B 361 ? 0.8929 0.7503 0.7943 -0.0430 0.0245  0.1025  354 ASP B N   
5157 C CA  . ASP B 361 ? 0.7867 0.6525 0.6921 -0.0439 0.0245  0.0920  354 ASP B CA  
5158 C C   . ASP B 361 ? 0.6852 0.5490 0.6012 -0.0380 0.0233  0.0918  354 ASP B C   
5159 O O   . ASP B 361 ? 0.7270 0.5878 0.6450 -0.0398 0.0242  0.0855  354 ASP B O   
5160 C CB  . ASP B 361 ? 0.7837 0.6643 0.6882 -0.0431 0.0231  0.0873  354 ASP B CB  
5161 C CG  . ASP B 361 ? 0.8070 0.6921 0.7026 -0.0510 0.0236  0.0827  354 ASP B CG  
5162 O OD1 . ASP B 361 ? 0.7967 0.6739 0.6863 -0.0571 0.0255  0.0830  354 ASP B OD1 
5163 O OD2 . ASP B 361 ? 0.7849 0.6815 0.6799 -0.0514 0.0219  0.0784  354 ASP B OD2 
5164 N N   . ALA B 362 ? 0.6473 0.5129 0.5691 -0.0313 0.0211  0.0983  355 ALA B N   
5165 C CA  . ALA B 362 ? 0.6466 0.5114 0.5787 -0.0261 0.0184  0.0984  355 ALA B CA  
5166 C C   . ALA B 362 ? 0.7603 0.6096 0.6943 -0.0276 0.0182  0.0996  355 ALA B C   
5167 O O   . ALA B 362 ? 0.8181 0.6645 0.7561 -0.0269 0.0174  0.0937  355 ALA B O   
5168 C CB  . ALA B 362 ? 0.5543 0.4244 0.4910 -0.0191 0.0154  0.1039  355 ALA B CB  
5169 N N   . ALA B 363 ? 0.7711 0.6093 0.7010 -0.0296 0.0193  0.1069  356 ALA B N   
5170 C CA  . ALA B 363 ? 0.7174 0.5391 0.6484 -0.0312 0.0194  0.1083  356 ALA B CA  
5171 C C   . ALA B 363 ? 0.7900 0.6085 0.7160 -0.0373 0.0233  0.0986  356 ALA B C   
5172 O O   . ALA B 363 ? 0.9169 0.7248 0.8450 -0.0375 0.0239  0.0953  356 ALA B O   
5173 C CB  . ALA B 363 ? 0.5330 0.3438 0.4604 -0.0321 0.0200  0.1189  356 ALA B CB  
5174 N N   . GLU B 364 ? 0.6495 0.4770 0.5685 -0.0420 0.0259  0.0936  357 GLU B N   
5175 C CA  . GLU B 364 ? 0.7748 0.6009 0.6889 -0.0477 0.0294  0.0842  357 GLU B CA  
5176 C C   . GLU B 364 ? 0.7813 0.6143 0.7004 -0.0450 0.0293  0.0754  357 GLU B C   
5177 O O   . GLU B 364 ? 0.7670 0.5942 0.6855 -0.0469 0.0319  0.0693  357 GLU B O   
5178 C CB  . GLU B 364 ? 0.8053 0.6390 0.7105 -0.0539 0.0312  0.0808  357 GLU B CB  
5179 C CG  . GLU B 364 ? 0.8084 0.6413 0.7087 -0.0599 0.0346  0.0713  357 GLU B CG  
5180 C CD  . GLU B 364 ? 0.9652 0.8061 0.8571 -0.0664 0.0357  0.0670  357 GLU B CD  
5181 O OE1 . GLU B 364 ? 1.0306 0.8759 0.9192 -0.0671 0.0342  0.0717  357 GLU B OE1 
5182 O OE2 . GLU B 364 ? 1.0272 0.8702 0.9157 -0.0708 0.0381  0.0585  357 GLU B OE2 
5183 N N   . LEU B 365 ? 0.6565 0.5020 0.5802 -0.0405 0.0267  0.0747  358 LEU B N   
5184 C CA  . LEU B 365 ? 0.5848 0.4371 0.5130 -0.0378 0.0266  0.0670  358 LEU B CA  
5185 C C   . LEU B 365 ? 0.6868 0.5282 0.6202 -0.0343 0.0260  0.0675  358 LEU B C   
5186 O O   . LEU B 365 ? 0.6668 0.5076 0.6010 -0.0343 0.0281  0.0602  358 LEU B O   
5187 C CB  . LEU B 365 ? 0.5003 0.3665 0.4328 -0.0335 0.0236  0.0674  358 LEU B CB  
5188 C CG  . LEU B 365 ? 0.4420 0.3171 0.3778 -0.0316 0.0237  0.0590  358 LEU B CG  
5189 C CD1 . LEU B 365 ? 0.3935 0.2755 0.3240 -0.0362 0.0261  0.0514  358 LEU B CD1 
5190 C CD2 . LEU B 365 ? 0.4006 0.2859 0.3424 -0.0265 0.0202  0.0610  358 LEU B CD2 
5191 N N   . VAL B 366 ? 0.7518 0.5845 0.6884 -0.0313 0.0230  0.0759  359 VAL B N   
5192 C CA  . VAL B 366 ? 0.6845 0.5052 0.6259 -0.0276 0.0217  0.0761  359 VAL B CA  
5193 C C   . VAL B 366 ? 0.6646 0.4733 0.6024 -0.0318 0.0262  0.0717  359 VAL B C   
5194 O O   . VAL B 366 ? 0.7884 0.5937 0.7285 -0.0303 0.0280  0.0653  359 VAL B O   
5195 C CB  . VAL B 366 ? 0.6064 0.4186 0.5515 -0.0237 0.0169  0.0863  359 VAL B CB  
5196 C CG1 . VAL B 366 ? 0.4735 0.2703 0.4222 -0.0204 0.0158  0.0854  359 VAL B CG1 
5197 C CG2 . VAL B 366 ? 0.6186 0.4428 0.5677 -0.0191 0.0122  0.0894  359 VAL B CG2 
5198 N N   . ALA B 367 ? 0.6136 0.4166 0.5454 -0.0373 0.0284  0.0748  360 ALA B N   
5199 C CA  . ALA B 367 ? 0.6865 0.4789 0.6139 -0.0425 0.0330  0.0703  360 ALA B CA  
5200 C C   . ALA B 367 ? 0.6796 0.4807 0.6039 -0.0455 0.0371  0.0592  360 ALA B C   
5201 O O   . ALA B 367 ? 0.7094 0.5035 0.6333 -0.0472 0.0406  0.0537  360 ALA B O   
5202 C CB  . ALA B 367 ? 0.5443 0.3298 0.4648 -0.0484 0.0345  0.0758  360 ALA B CB  
5203 N N   . LEU B 368 ? 0.5452 0.3617 0.4677 -0.0462 0.0367  0.0562  361 LEU B N   
5204 C CA  . LEU B 368 ? 0.5740 0.4000 0.4944 -0.0483 0.0397  0.0464  361 LEU B CA  
5205 C C   . LEU B 368 ? 0.6638 0.4915 0.5906 -0.0431 0.0396  0.0421  361 LEU B C   
5206 O O   . LEU B 368 ? 0.5929 0.4200 0.5190 -0.0446 0.0433  0.0351  361 LEU B O   
5207 C CB  . LEU B 368 ? 0.5936 0.4348 0.5119 -0.0489 0.0380  0.0447  361 LEU B CB  
5208 C CG  . LEU B 368 ? 0.5754 0.4213 0.4856 -0.0555 0.0399  0.0413  361 LEU B CG  
5209 C CD1 . LEU B 368 ? 0.6375 0.4744 0.5423 -0.0612 0.0443  0.0372  361 LEU B CD1 
5210 C CD2 . LEU B 368 ? 0.5772 0.4237 0.4844 -0.0571 0.0377  0.0483  361 LEU B CD2 
5211 N N   . ALA B 369 ? 0.6000 0.4303 0.5330 -0.0371 0.0355  0.0466  362 ALA B N   
5212 C CA  . ALA B 369 ? 0.5782 0.4108 0.5173 -0.0319 0.0349  0.0432  362 ALA B CA  
5213 C C   . ALA B 369 ? 0.5858 0.4042 0.5273 -0.0308 0.0368  0.0421  362 ALA B C   
5214 O O   . ALA B 369 ? 0.5121 0.3318 0.4561 -0.0293 0.0393  0.0358  362 ALA B O   
5215 C CB  . ALA B 369 ? 0.3765 0.2144 0.3208 -0.0263 0.0297  0.0485  362 ALA B CB  
5216 N N   . GLN B 370 ? 0.6006 0.4054 0.5415 -0.0314 0.0356  0.0483  363 GLN B N   
5217 C CA  . GLN B 370 ? 0.5382 0.3281 0.4818 -0.0300 0.0369  0.0475  363 GLN B CA  
5218 C C   . GLN B 370 ? 0.5923 0.3800 0.5321 -0.0354 0.0431  0.0396  363 GLN B C   
5219 O O   . GLN B 370 ? 0.6115 0.3921 0.5543 -0.0341 0.0456  0.0351  363 GLN B O   
5220 C CB  . GLN B 370 ? 0.5060 0.2812 0.4495 -0.0299 0.0340  0.0564  363 GLN B CB  
5221 C CG  . GLN B 370 ? 0.7750 0.5348 0.7238 -0.0253 0.0328  0.0569  363 GLN B CG  
5222 C CD  . GLN B 370 ? 0.8257 0.5888 0.7810 -0.0172 0.0279  0.0583  363 GLN B CD  
5223 O OE1 . GLN B 370 ? 0.8731 0.6437 0.8290 -0.0150 0.0235  0.0639  363 GLN B OE1 
5224 N NE2 . GLN B 370 ? 0.8102 0.5678 0.7702 -0.0129 0.0289  0.0528  363 GLN B NE2 
5225 N N   . ALA B 371 ? 0.6447 0.4392 0.5778 -0.0413 0.0456  0.0374  364 ALA B N   
5226 C CA  . ALA B 371 ? 0.6185 0.4122 0.5469 -0.0471 0.0514  0.0299  364 ALA B CA  
5227 C C   . ALA B 371 ? 0.6100 0.4175 0.5398 -0.0462 0.0536  0.0218  364 ALA B C   
5228 O O   . ALA B 371 ? 0.6331 0.4395 0.5624 -0.0485 0.0581  0.0152  364 ALA B O   
5229 C CB  . ALA B 371 ? 0.4585 0.2531 0.3787 -0.0539 0.0528  0.0307  364 ALA B CB  
5230 N N   . VAL B 372 ? 0.6064 0.4268 0.5378 -0.0431 0.0504  0.0225  365 VAL B N   
5231 C CA  . VAL B 372 ? 0.5643 0.3975 0.4978 -0.0414 0.0516  0.0161  365 VAL B CA  
5232 C C   . VAL B 372 ? 0.6630 0.4921 0.6032 -0.0370 0.0525  0.0141  365 VAL B C   
5233 O O   . VAL B 372 ? 0.6130 0.4476 0.5542 -0.0376 0.0560  0.0075  365 VAL B O   
5234 C CB  . VAL B 372 ? 0.3645 0.2105 0.2994 -0.0382 0.0474  0.0182  365 VAL B CB  
5235 C CG1 . VAL B 372 ? 0.3372 0.1943 0.2754 -0.0356 0.0480  0.0128  365 VAL B CG1 
5236 C CG2 . VAL B 372 ? 0.3803 0.2322 0.3090 -0.0426 0.0469  0.0182  365 VAL B CG2 
5237 N N   . ASN B 373 ? 0.6670 0.4864 0.6115 -0.0327 0.0493  0.0198  366 ASN B N   
5238 C CA  . ASN B 373 ? 0.6596 0.4742 0.6108 -0.0277 0.0492  0.0182  366 ASN B CA  
5239 C C   . ASN B 373 ? 0.7415 0.5461 0.6926 -0.0306 0.0541  0.0133  366 ASN B C   
5240 O O   . ASN B 373 ? 0.6616 0.4679 0.6167 -0.0291 0.0568  0.0077  366 ASN B O   
5241 C CB  . ASN B 373 ? 0.5296 0.3354 0.4848 -0.0223 0.0439  0.0257  366 ASN B CB  
5242 C CG  . ASN B 373 ? 0.5266 0.3299 0.4890 -0.0160 0.0429  0.0237  366 ASN B CG  
5243 O OD1 . ASN B 373 ? 0.4813 0.2955 0.4468 -0.0126 0.0416  0.0220  366 ASN B OD1 
5244 N ND2 . ASN B 373 ? 0.5388 0.3272 0.5037 -0.0143 0.0434  0.0236  366 ASN B ND2 
5245 N N   . ALA B 374 ? 0.7558 0.5497 0.7021 -0.0351 0.0555  0.0153  367 ALA B N   
5246 C CA  . ALA B 374 ? 0.6294 0.4124 0.5751 -0.0386 0.0602  0.0110  367 ALA B CA  
5247 C C   . ALA B 374 ? 0.6022 0.3959 0.5456 -0.0430 0.0658  0.0023  367 ALA B C   
5248 O O   . ALA B 374 ? 0.6453 0.4362 0.5918 -0.0432 0.0696  -0.0033 367 ALA B O   
5249 C CB  . ALA B 374 ? 0.5063 0.2770 0.4464 -0.0434 0.0605  0.0154  367 ALA B CB  
5250 N N   . ARG B 375 ? 0.4696 0.2759 0.4077 -0.0462 0.0661  0.0011  368 ARG B N   
5251 C CA  . ARG B 375 ? 0.5065 0.3242 0.4422 -0.0500 0.0707  -0.0067 368 ARG B CA  
5252 C C   . ARG B 375 ? 0.4464 0.2753 0.3880 -0.0458 0.0704  -0.0099 368 ARG B C   
5253 O O   . ARG B 375 ? 0.5509 0.3874 0.4923 -0.0483 0.0745  -0.0162 368 ARG B O   
5254 C CB  . ARG B 375 ? 0.6347 0.4624 0.5632 -0.0541 0.0704  -0.0073 368 ARG B CB  
5255 C CG  . ARG B 375 ? 0.7414 0.5605 0.6629 -0.0597 0.0714  -0.0053 368 ARG B CG  
5256 C CD  . ARG B 375 ? 0.8588 0.6895 0.7734 -0.0638 0.0713  -0.0078 368 ARG B CD  
5257 N NE  . ARG B 375 ? 1.0421 0.8811 0.9576 -0.0601 0.0660  -0.0036 368 ARG B NE  
5258 C CZ  . ARG B 375 ? 1.0475 0.8996 0.9655 -0.0567 0.0640  -0.0059 368 ARG B CZ  
5259 N NH1 . ARG B 375 ? 1.0136 0.8724 0.9335 -0.0565 0.0669  -0.0119 368 ARG B NH1 
5260 N NH2 . ARG B 375 ? 0.8906 0.7492 0.8095 -0.0538 0.0592  -0.0021 368 ARG B NH2 
5261 N N   . ALA B 376 ? 0.4086 0.2388 0.3551 -0.0396 0.0657  -0.0054 369 ALA B N   
5262 C CA  . ALA B 376 ? 0.5516 0.3931 0.5031 -0.0358 0.0650  -0.0077 369 ALA B CA  
5263 C C   . ALA B 376 ? 0.6054 0.4460 0.5622 -0.0354 0.0689  -0.0133 369 ALA B C   
5264 O O   . ALA B 376 ? 0.5899 0.4182 0.5483 -0.0359 0.0710  -0.0145 369 ALA B O   
5265 C CB  . ALA B 376 ? 0.5695 0.4116 0.5252 -0.0295 0.0593  -0.0017 369 ALA B CB  
5266 N N   . LEU B 377 ? 0.5800 0.4336 0.5393 -0.0345 0.0696  -0.0166 370 LEU B N   
5267 C CA  . LEU B 377 ? 0.5036 0.3598 0.4683 -0.0343 0.0730  -0.0221 370 LEU B CA  
5268 C C   . LEU B 377 ? 0.5295 0.3833 0.5016 -0.0276 0.0696  -0.0200 370 LEU B C   
5269 O O   . LEU B 377 ? 0.5499 0.4045 0.5224 -0.0234 0.0647  -0.0147 370 LEU B O   
5270 C CB  . LEU B 377 ? 0.5608 0.4333 0.5242 -0.0374 0.0753  -0.0261 370 LEU B CB  
5271 C CG  . LEU B 377 ? 0.5972 0.4742 0.5553 -0.0442 0.0803  -0.0311 370 LEU B CG  
5272 C CD1 . LEU B 377 ? 0.6693 0.5357 0.6215 -0.0476 0.0814  -0.0301 370 LEU B CD1 
5273 C CD2 . LEU B 377 ? 0.4842 0.3763 0.4387 -0.0455 0.0794  -0.0319 370 LEU B CD2 
5274 N N   . PRO B 378 ? 0.5591 0.4101 0.5368 -0.0266 0.0727  -0.0247 371 PRO B N   
5275 C CA  . PRO B 378 ? 0.5474 0.3948 0.5320 -0.0199 0.0703  -0.0239 371 PRO B CA  
5276 C C   . PRO B 378 ? 0.5872 0.4458 0.5737 -0.0162 0.0667  -0.0211 371 PRO B C   
5277 O O   . PRO B 378 ? 0.5912 0.4459 0.5815 -0.0100 0.0629  -0.0180 371 PRO B O   
5278 C CB  . PRO B 378 ? 0.4718 0.3193 0.4616 -0.0211 0.0754  -0.0314 371 PRO B CB  
5279 C CG  . PRO B 378 ? 0.4186 0.2724 0.4042 -0.0290 0.0804  -0.0357 371 PRO B CG  
5280 C CD  . PRO B 378 ? 0.4299 0.2806 0.4079 -0.0318 0.0789  -0.0316 371 PRO B CD  
5281 N N   . ALA B 379 ? 0.6420 0.5143 0.6259 -0.0197 0.0676  -0.0222 372 ALA B N   
5282 C CA  . ALA B 379 ? 0.7111 0.5933 0.6957 -0.0168 0.0640  -0.0189 372 ALA B CA  
5283 C C   . ALA B 379 ? 0.7599 0.6372 0.7425 -0.0129 0.0583  -0.0120 372 ALA B C   
5284 O O   . ALA B 379 ? 0.7836 0.6638 0.7692 -0.0083 0.0547  -0.0090 372 ALA B O   
5285 C CB  . ALA B 379 ? 0.6180 0.5138 0.5987 -0.0215 0.0653  -0.0205 372 ALA B CB  
5286 N N   . VAL B 380 ? 0.5812 0.4515 0.5589 -0.0153 0.0574  -0.0095 373 VAL B N   
5287 C CA  . VAL B 380 ? 0.5893 0.4568 0.5643 -0.0134 0.0527  -0.0030 373 VAL B CA  
5288 C C   . VAL B 380 ? 0.6542 0.5064 0.6299 -0.0110 0.0508  0.0009  373 VAL B C   
5289 O O   . VAL B 380 ? 0.6272 0.4766 0.6048 -0.0065 0.0461  0.0062  373 VAL B O   
5290 C CB  . VAL B 380 ? 0.5243 0.3969 0.4922 -0.0183 0.0534  -0.0026 373 VAL B CB  
5291 C CG1 . VAL B 380 ? 0.4526 0.3211 0.4176 -0.0173 0.0492  0.0037  373 VAL B CG1 
5292 C CG2 . VAL B 380 ? 0.3857 0.2730 0.3529 -0.0193 0.0537  -0.0053 373 VAL B CG2 
5293 N N   . GLN B 381 ? 0.6956 0.5380 0.6698 -0.0142 0.0543  -0.0016 374 GLN B N   
5294 C CA  . GLN B 381 ? 0.6753 0.5017 0.6493 -0.0128 0.0525  0.0024  374 GLN B CA  
5295 C C   . GLN B 381 ? 0.7597 0.5792 0.7400 -0.0053 0.0485  0.0050  374 GLN B C   
5296 O O   . GLN B 381 ? 0.8324 0.6557 0.8182 -0.0017 0.0493  0.0009  374 GLN B O   
5297 C CB  . GLN B 381 ? 0.5567 0.3735 0.5292 -0.0172 0.0575  -0.0021 374 GLN B CB  
5298 C CG  . GLN B 381 ? 0.6022 0.4017 0.5736 -0.0167 0.0558  0.0024  374 GLN B CG  
5299 C CD  . GLN B 381 ? 0.5957 0.3845 0.5668 -0.0203 0.0607  -0.0024 374 GLN B CD  
5300 O OE1 . GLN B 381 ? 0.6388 0.4278 0.6043 -0.0269 0.0644  -0.0044 374 GLN B OE1 
5301 N NE2 . GLN B 381 ? 0.6381 0.4173 0.6151 -0.0159 0.0608  -0.0048 374 GLN B NE2 
5302 N N   . GLN B 382 ? 0.7243 0.5342 0.7036 -0.0030 0.0441  0.0118  375 GLN B N   
5303 C CA  . GLN B 382 ? 0.7535 0.5562 0.7379 0.0045  0.0395  0.0151  375 GLN B CA  
5304 C C   . GLN B 382 ? 0.8146 0.5985 0.7990 0.0052  0.0391  0.0170  375 GLN B C   
5305 O O   . GLN B 382 ? 0.8217 0.5991 0.8010 -0.0001 0.0401  0.0198  375 GLN B O   
5306 C CB  . GLN B 382 ? 0.7483 0.5562 0.7312 0.0067  0.0339  0.0225  375 GLN B CB  
5307 C CG  . GLN B 382 ? 0.6289 0.4543 0.6110 0.0055  0.0339  0.0214  375 GLN B CG  
5308 C CD  . GLN B 382 ? 0.6989 0.5320 0.6869 0.0102  0.0343  0.0168  375 GLN B CD  
5309 O OE1 . GLN B 382 ? 0.6265 0.4695 0.6149 0.0076  0.0379  0.0114  375 GLN B OE1 
5310 N NE2 . GLN B 382 ? 0.7104 0.5392 0.7031 0.0171  0.0304  0.0188  375 GLN B NE2 
5311 N N   . ASN B 383 ? 0.8585 0.6335 0.8487 0.0116  0.0375  0.0155  376 ASN B N   
5312 C CA  . ASN B 383 ? 0.9164 0.6721 0.9068 0.0132  0.0362  0.0181  376 ASN B CA  
5313 C C   . ASN B 383 ? 0.8140 0.5635 0.8015 0.0146  0.0300  0.0282  376 ASN B C   
5314 O O   . ASN B 383 ? 0.6533 0.3890 0.6380 0.0121  0.0292  0.0327  376 ASN B O   
5315 C CB  . ASN B 383 ? 1.0253 0.7727 1.0227 0.0207  0.0359  0.0136  376 ASN B CB  
5316 C CG  . ASN B 383 ? 1.1733 0.9228 1.1732 0.0182  0.0432  0.0037  376 ASN B CG  
5317 O OD1 . ASN B 383 ? 1.1945 0.9584 1.1970 0.0183  0.0460  -0.0014 376 ASN B OD1 
5318 N ND2 . ASN B 383 ? 1.1900 0.9253 1.1893 0.0156  0.0462  0.0011  376 ASN B ND2 
5319 N N   . ASN B 384 ? 0.8234 0.5838 0.8118 0.0181  0.0258  0.0319  377 ASN B N   
5320 C CA  . ASN B 384 ? 0.8706 0.6275 0.8568 0.0198  0.0196  0.0414  377 ASN B CA  
5321 C C   . ASN B 384 ? 0.8034 0.5772 0.7864 0.0169  0.0185  0.0442  377 ASN B C   
5322 O O   . ASN B 384 ? 0.8700 0.6550 0.8558 0.0211  0.0166  0.0430  377 ASN B O   
5323 C CB  . ASN B 384 ? 0.9824 0.7321 0.9737 0.0294  0.0142  0.0435  377 ASN B CB  
5324 C CG  . ASN B 384 ? 1.1524 0.8964 1.1411 0.0312  0.0075  0.0537  377 ASN B CG  
5325 O OD1 . ASN B 384 ? 1.2321 0.9607 1.2187 0.0301  0.0056  0.0589  377 ASN B OD1 
5326 N ND2 . ASN B 384 ? 1.1510 0.9073 1.1396 0.0339  0.0037  0.0568  377 ASN B ND2 
5327 N N   . LEU B 385 ? 0.7130 0.4886 0.6901 0.0098  0.0198  0.0475  378 LEU B N   
5328 C CA  . LEU B 385 ? 0.6416 0.4331 0.6153 0.0063  0.0194  0.0490  378 LEU B CA  
5329 C C   . LEU B 385 ? 0.7473 0.5417 0.7209 0.0098  0.0129  0.0569  378 LEU B C   
5330 O O   . LEU B 385 ? 0.7996 0.5834 0.7718 0.0101  0.0092  0.0641  378 LEU B O   
5331 C CB  . LEU B 385 ? 0.5626 0.3547 0.5303 -0.0019 0.0230  0.0495  378 LEU B CB  
5332 C CG  . LEU B 385 ? 0.5827 0.3908 0.5465 -0.0067 0.0253  0.0470  378 LEU B CG  
5333 C CD1 . LEU B 385 ? 0.5848 0.3940 0.5436 -0.0112 0.0236  0.0536  378 LEU B CD1 
5334 C CD2 . LEU B 385 ? 0.5693 0.3917 0.5360 -0.0030 0.0236  0.0448  378 LEU B CD2 
5335 N N   . ASP B 386 ? 0.6946 0.5031 0.6696 0.0121  0.0115  0.0555  379 ASP B N   
5336 C CA  . ASP B 386 ? 0.6539 0.4667 0.6285 0.0155  0.0056  0.0617  379 ASP B CA  
5337 C C   . ASP B 386 ? 0.5808 0.3985 0.5500 0.0094  0.0043  0.0676  379 ASP B C   
5338 O O   . ASP B 386 ? 0.5843 0.4157 0.5517 0.0061  0.0057  0.0657  379 ASP B O   
5339 C CB  . ASP B 386 ? 0.7147 0.5417 0.6924 0.0192  0.0052  0.0575  379 ASP B CB  
5340 C CG  . ASP B 386 ? 0.9385 0.7679 0.9169 0.0247  -0.0008 0.0624  379 ASP B CG  
5341 O OD1 . ASP B 386 ? 1.0618 0.8953 1.0451 0.0308  -0.0015 0.0590  379 ASP B OD1 
5342 O OD2 . ASP B 386 ? 0.9809 0.8086 0.9547 0.0228  -0.0047 0.0694  379 ASP B OD2 
5343 N N   . GLU B 387 ? 0.5706 0.3773 0.5376 0.0080  0.0016  0.0750  380 GLU B N   
5344 C CA  . GLU B 387 ? 0.5225 0.3340 0.4853 0.0018  0.0014  0.0808  380 GLU B CA  
5345 C C   . GLU B 387 ? 0.6161 0.4392 0.5772 0.0028  -0.0032 0.0852  380 GLU B C   
5346 O O   . GLU B 387 ? 0.7075 0.5393 0.6661 -0.0018 -0.0025 0.0887  380 GLU B O   
5347 C CB  . GLU B 387 ? 0.5036 0.3003 0.4650 -0.0006 0.0010  0.0875  380 GLU B CB  
5348 C CG  . GLU B 387 ? 0.7327 0.5187 0.6942 -0.0026 0.0063  0.0818  380 GLU B CG  
5349 C CD  . GLU B 387 ? 1.0243 0.7945 0.9843 -0.0053 0.0062  0.0882  380 GLU B CD  
5350 O OE1 . GLU B 387 ? 1.1024 0.8654 1.0606 -0.0093 0.0113  0.0840  380 GLU B OE1 
5351 O OE2 . GLU B 387 ? 1.1251 0.8903 1.0852 -0.0036 0.0011  0.0974  380 GLU B OE2 
5352 N N   . ASP B 388 ? 0.6421 0.4663 0.6046 0.0093  -0.0071 0.0841  381 ASP B N   
5353 C CA  . ASP B 388 ? 0.6956 0.5315 0.6552 0.0104  -0.0109 0.0859  381 ASP B CA  
5354 C C   . ASP B 388 ? 0.7149 0.5661 0.6748 0.0070  -0.0075 0.0802  381 ASP B C   
5355 O O   . ASP B 388 ? 0.7313 0.5936 0.6884 0.0034  -0.0083 0.0816  381 ASP B O   
5356 C CB  . ASP B 388 ? 0.7203 0.5529 0.6811 0.0190  -0.0150 0.0854  381 ASP B CB  
5357 C CG  . ASP B 388 ? 0.9475 0.7645 0.9075 0.0233  -0.0191 0.0912  381 ASP B CG  
5358 O OD1 . ASP B 388 ? 1.0153 0.8254 0.9722 0.0188  -0.0198 0.0971  381 ASP B OD1 
5359 O OD2 . ASP B 388 ? 1.0437 0.8562 1.0072 0.0314  -0.0215 0.0901  381 ASP B OD2 
5360 N N   . LEU B 389 ? 0.6816 0.5335 0.6454 0.0083  -0.0039 0.0736  382 LEU B N   
5361 C CA  . LEU B 389 ? 0.5635 0.4294 0.5278 0.0056  -0.0004 0.0676  382 LEU B CA  
5362 C C   . LEU B 389 ? 0.6310 0.5017 0.5928 -0.0014 0.0027  0.0680  382 LEU B C   
5363 O O   . LEU B 389 ? 0.6357 0.5191 0.5969 -0.0039 0.0032  0.0662  382 LEU B O   
5364 C CB  . LEU B 389 ? 0.4853 0.3514 0.4539 0.0081  0.0037  0.0599  382 LEU B CB  
5365 C CG  . LEU B 389 ? 0.4749 0.3556 0.4443 0.0066  0.0062  0.0541  382 LEU B CG  
5366 C CD1 . LEU B 389 ? 0.4920 0.3819 0.4606 0.0082  0.0022  0.0564  382 LEU B CD1 
5367 C CD2 . LEU B 389 ? 0.4303 0.3123 0.4042 0.0097  0.0095  0.0476  382 LEU B CD2 
5368 N N   . ILE B 390 ? 0.6674 0.5280 0.6281 -0.0041 0.0052  0.0697  383 ILE B N   
5369 C CA  . ILE B 390 ? 0.7015 0.5657 0.6590 -0.0100 0.0091  0.0693  383 ILE B CA  
5370 C C   . ILE B 390 ? 0.6779 0.5481 0.6341 -0.0120 0.0070  0.0769  383 ILE B C   
5371 O O   . ILE B 390 ? 0.4667 0.3481 0.4213 -0.0147 0.0092  0.0755  383 ILE B O   
5372 C CB  . ILE B 390 ? 0.5402 0.3906 0.4956 -0.0125 0.0127  0.0686  383 ILE B CB  
5373 C CG1 . ILE B 390 ? 0.4585 0.3037 0.4164 -0.0101 0.0152  0.0615  383 ILE B CG1 
5374 C CG2 . ILE B 390 ? 0.4212 0.2750 0.3715 -0.0187 0.0171  0.0666  383 ILE B CG2 
5375 C CD1 . ILE B 390 ? 0.3917 0.2488 0.3498 -0.0109 0.0183  0.0535  383 ILE B CD1 
5376 N N   . ARG B 391 ? 0.8065 0.6699 0.7628 -0.0098 0.0033  0.0838  384 ARG B N   
5377 C CA  . ARG B 391 ? 0.6804 0.5511 0.6357 -0.0107 0.0023  0.0906  384 ARG B CA  
5378 C C   . ARG B 391 ? 0.5472 0.4346 0.5039 -0.0095 0.0006  0.0883  384 ARG B C   
5379 O O   . ARG B 391 ? 0.5046 0.4025 0.4605 -0.0099 0.0044  0.0903  384 ARG B O   
5380 C CB  . ARG B 391 ? 0.5811 0.4417 0.5367 -0.0081 -0.0023 0.0985  384 ARG B CB  
5381 C CG  . ARG B 391 ? 0.6384 0.4885 0.5921 -0.0107 0.0014  0.1046  384 ARG B CG  
5382 C CD  . ARG B 391 ? 0.6777 0.5184 0.6327 -0.0078 -0.0033 0.1135  384 ARG B CD  
5383 N NE  . ARG B 391 ? 0.6903 0.5135 0.6459 -0.0049 -0.0072 0.1117  384 ARG B NE  
5384 C CZ  . ARG B 391 ? 0.6659 0.4842 0.6208 0.0006  -0.0134 0.1094  384 ARG B CZ  
5385 N NH1 . ARG B 391 ? 0.6027 0.4306 0.5542 0.0025  -0.0178 0.1083  384 ARG B NH1 
5386 N NH2 . ARG B 391 ? 0.6435 0.4460 0.6000 0.0049  -0.0144 0.1075  384 ARG B NH2 
5387 N N   . LYS B 392 ? 0.4332 0.3210 0.3900 -0.0069 -0.0036 0.0834  385 LYS B N   
5388 C CA  . LYS B 392 ? 0.5109 0.4115 0.4667 -0.0069 -0.0061 0.0801  385 LYS B CA  
5389 C C   . LYS B 392 ? 0.6943 0.6080 0.6537 -0.0091 -0.0001 0.0758  385 LYS B C   
5390 O O   . LYS B 392 ? 0.8649 0.7911 0.8261 -0.0083 0.0032  0.0771  385 LYS B O   
5391 C CB  . LYS B 392 ? 0.3501 0.2455 0.3025 -0.0020 -0.0089 0.0748  385 LYS B CB  
5392 C CG  . LYS B 392 ? 0.2460 0.1504 0.1937 -0.0016 -0.0101 0.0701  385 LYS B CG  
5393 C CD  . LYS B 392 ? 0.2823 0.1862 0.2324 0.0055  -0.0104 0.0675  385 LYS B CD  
5394 C CE  . LYS B 392 ? 0.4576 0.3720 0.4057 0.0065  -0.0100 0.0635  385 LYS B CE  
5395 N NZ  . LYS B 392 ? 0.4689 0.3880 0.4239 0.0125  -0.0101 0.0617  385 LYS B NZ  
5396 N N   . LEU B 393 ? 0.6830 0.5921 0.6425 -0.0099 0.0032  0.0705  386 LEU B N   
5397 C CA  . LEU B 393 ? 0.5601 0.4768 0.5194 -0.0123 0.0075  0.0649  386 LEU B CA  
5398 C C   . LEU B 393 ? 0.5359 0.4544 0.4908 -0.0152 0.0114  0.0668  386 LEU B C   
5399 O O   . LEU B 393 ? 0.5301 0.4565 0.4831 -0.0166 0.0134  0.0626  386 LEU B O   
5400 C CB  . LEU B 393 ? 0.4410 0.3498 0.3995 -0.0131 0.0103  0.0593  386 LEU B CB  
5401 C CG  . LEU B 393 ? 0.5185 0.4329 0.4748 -0.0161 0.0141  0.0519  386 LEU B CG  
5402 C CD1 . LEU B 393 ? 0.4752 0.4028 0.4341 -0.0149 0.0130  0.0485  386 LEU B CD1 
5403 C CD2 . LEU B 393 ? 0.6202 0.5277 0.5758 -0.0163 0.0169  0.0462  386 LEU B CD2 
5404 N N   . ALA B 394 ? 0.5415 0.4507 0.4933 -0.0164 0.0122  0.0728  387 ALA B N   
5405 C CA  . ALA B 394 ? 0.5013 0.4092 0.4458 -0.0198 0.0155  0.0748  387 ALA B CA  
5406 C C   . ALA B 394 ? 0.5456 0.4612 0.4870 -0.0171 0.0156  0.0773  387 ALA B C   
5407 O O   . ALA B 394 ? 0.5588 0.4789 0.4941 -0.0202 0.0168  0.0737  387 ALA B O   
5408 C CB  . ALA B 394 ? 0.5831 0.4778 0.5246 -0.0219 0.0162  0.0805  387 ALA B CB  
5409 N N   . TYR B 395 ? 0.5963 0.5125 0.5408 -0.0115 0.0139  0.0821  388 TYR B N   
5410 C CA  . TYR B 395 ? 0.6646 0.5831 0.6011 -0.0075 0.0151  0.0834  388 TYR B CA  
5411 C C   . TYR B 395 ? 0.6437 0.5713 0.5797 -0.0070 0.0147  0.0758  388 TYR B C   
5412 O O   . TYR B 395 ? 0.6250 0.5546 0.5525 -0.0077 0.0136  0.0746  388 TYR B O   
5413 C CB  . TYR B 395 ? 0.6430 0.5564 0.5791 0.0003  0.0148  0.0880  388 TYR B CB  
5414 C CG  . TYR B 395 ? 0.7246 0.6281 0.6590 -0.0002 0.0150  0.0966  388 TYR B CG  
5415 C CD1 . TYR B 395 ? 0.7597 0.6612 0.7051 0.0033  0.0124  0.1026  388 TYR B CD1 
5416 C CD2 . TYR B 395 ? 0.7362 0.6342 0.6607 -0.0057 0.0161  0.0996  388 TYR B CD2 
5417 C CE1 . TYR B 395 ? 0.7333 0.6238 0.6769 0.0027  0.0122  0.1106  388 TYR B CE1 
5418 C CE2 . TYR B 395 ? 0.7614 0.6487 0.6832 -0.0063 0.0166  0.1076  388 TYR B CE2 
5419 C CZ  . TYR B 395 ? 0.7228 0.6050 0.6530 -0.0012 0.0153  0.1128  388 TYR B CZ  
5420 O OH  . TYR B 395 ? 0.8035 0.6739 0.7311 -0.0017 0.0156  0.1209  388 TYR B OH  
5421 N N   . VAL B 396 ? 0.6870 0.6205 0.6327 -0.0075 0.0140  0.0713  389 VAL B N   
5422 C CA  . VAL B 396 ? 0.5626 0.5042 0.5108 -0.0056 0.0136  0.0646  389 VAL B CA  
5423 C C   . VAL B 396 ? 0.5413 0.4877 0.4880 -0.0111 0.0138  0.0589  389 VAL B C   
5424 O O   . VAL B 396 ? 0.4741 0.4265 0.4201 -0.0108 0.0130  0.0542  389 VAL B O   
5425 C CB  . VAL B 396 ? 1.2813 1.2289 1.2435 -0.0049 0.0095  0.0646  389 VAL B CB  
5426 C CG1 . VAL B 396 ? 1.2722 1.2242 1.2368 -0.0079 0.0087  0.0573  389 VAL B CG1 
5427 C CG2 . VAL B 396 ? 0.9147 0.8530 0.8649 -0.0135 -0.0075 0.0623  389 VAL B CG2 
5428 N N   . ALA B 397 ? 0.4524 0.3946 0.3975 -0.0163 0.0147  0.0586  390 ALA B N   
5429 C CA  . ALA B 397 ? 0.3972 0.3430 0.3416 -0.0207 0.0146  0.0505  390 ALA B CA  
5430 C C   . ALA B 397 ? 0.3867 0.3400 0.3281 -0.0236 0.0132  0.0460  390 ALA B C   
5431 O O   . ALA B 397 ? 0.5777 0.5367 0.5218 -0.0246 0.0122  0.0396  390 ALA B O   
5432 C CB  . ALA B 397 ? 0.4503 0.3883 0.3906 -0.0257 0.0161  0.0494  390 ALA B CB  
5433 N N   . ALA B 398 ? 0.5824 0.5358 0.5183 -0.0253 0.0125  0.0494  391 ALA B N   
5434 C CA  . ALA B 398 ? 0.6369 0.5984 0.5707 -0.0295 0.0103  0.0454  391 ALA B CA  
5435 C C   . ALA B 398 ? 0.4228 0.3928 0.3625 -0.0268 0.0083  0.0413  391 ALA B C   
5436 O O   . ALA B 398 ? 0.3436 0.3207 0.2855 -0.0301 0.0067  0.0358  391 ALA B O   
5437 C CB  . ALA B 398 ? 0.2090 0.1699 0.1362 -0.0318 0.0094  0.0506  391 ALA B CB  
5438 N N   . GLY B 399 ? 0.2818 0.2505 0.2240 -0.0209 0.0084  0.0440  392 GLY B N   
5439 C CA  . GLY B 399 ? 0.4055 0.3813 0.3522 -0.0188 0.0063  0.0409  392 GLY B CA  
5440 C C   . GLY B 399 ? 0.4044 0.3859 0.3571 -0.0197 0.0056  0.0344  392 GLY B C   
5441 O O   . GLY B 399 ? 0.4743 0.4528 0.4287 -0.0193 0.0071  0.0324  392 GLY B O   
5442 N N   . ASP B 400 ? 0.4006 0.3908 0.3569 -0.0211 0.0031  0.0313  393 ASP B N   
5443 C CA  . ASP B 400 ? 0.3281 0.3237 0.2904 -0.0216 0.0020  0.0256  393 ASP B CA  
5444 C C   . ASP B 400 ? 0.2514 0.2537 0.2191 -0.0195 0.0001  0.0249  393 ASP B C   
5445 O O   . ASP B 400 ? 0.2675 0.2778 0.2381 -0.0222 -0.0019 0.0231  393 ASP B O   
5446 C CB  . ASP B 400 ? 0.2686 0.2686 0.2304 -0.0272 0.0008  0.0215  393 ASP B CB  
5447 C CG  . ASP B 400 ? 0.5832 0.5868 0.5501 -0.0275 -0.0002 0.0160  393 ASP B CG  
5448 O OD1 . ASP B 400 ? 0.7266 0.7375 0.6965 -0.0303 -0.0022 0.0129  393 ASP B OD1 
5449 O OD2 . ASP B 400 ? 0.6931 0.6923 0.6608 -0.0251 0.0009  0.0150  393 ASP B OD2 
5450 N N   . LEU B 401 ? 0.3707 0.3698 0.3397 -0.0150 0.0009  0.0263  394 LEU B N   
5451 C CA  . LEU B 401 ? 0.2046 0.2096 0.1779 -0.0132 -0.0008 0.0266  394 LEU B CA  
5452 C C   . LEU B 401 ? 0.2766 0.2874 0.2574 -0.0128 -0.0017 0.0224  394 LEU B C   
5453 O O   . LEU B 401 ? 0.4693 0.4766 0.4514 -0.0108 -0.0007 0.0208  394 LEU B O   
5454 C CB  . LEU B 401 ? 0.2176 0.2164 0.1877 -0.0092 -0.0001 0.0306  394 LEU B CB  
5455 C CG  . LEU B 401 ? 0.2678 0.2582 0.2298 -0.0091 0.0010  0.0353  394 LEU B CG  
5456 C CD1 . LEU B 401 ? 0.2438 0.2259 0.2017 -0.0052 0.0010  0.0390  394 LEU B CD1 
5457 C CD2 . LEU B 401 ? 0.3173 0.3135 0.2774 -0.0123 -0.0007 0.0373  394 LEU B CD2 
5458 N N   . ALA B 402 ? 0.2554 0.2751 0.2409 -0.0147 -0.0036 0.0210  395 ALA B N   
5459 C CA  . ALA B 402 ? 0.3275 0.3529 0.3200 -0.0146 -0.0046 0.0176  395 ALA B CA  
5460 C C   . ALA B 402 ? 0.3431 0.3675 0.3390 -0.0110 -0.0039 0.0176  395 ALA B C   
5461 O O   . ALA B 402 ? 0.2835 0.3071 0.2820 -0.0104 -0.0039 0.0149  395 ALA B O   
5462 C CB  . ALA B 402 ? 0.2039 0.2387 0.2005 -0.0171 -0.0060 0.0169  395 ALA B CB  
5463 N N   . PRO B 403 ? 0.3323 0.3571 0.3279 -0.0087 -0.0034 0.0206  396 PRO B N   
5464 C CA  . PRO B 403 ? 0.2340 0.2587 0.2331 -0.0058 -0.0026 0.0202  396 PRO B CA  
5465 C C   . PRO B 403 ? 0.3773 0.3937 0.3731 -0.0042 -0.0012 0.0195  396 PRO B C   
5466 O O   . PRO B 403 ? 0.3812 0.3984 0.3806 -0.0030 -0.0008 0.0176  396 PRO B O   
5467 C CB  . PRO B 403 ? 0.1955 0.2218 0.1938 -0.0038 -0.0024 0.0238  396 PRO B CB  
5468 C CG  . PRO B 403 ? 0.2403 0.2698 0.2361 -0.0061 -0.0036 0.0257  396 PRO B CG  
5469 C CD  . PRO B 403 ? 0.1000 0.1250 0.0918 -0.0086 -0.0036 0.0245  396 PRO B CD  
5470 N N   . ILE B 404 ? 0.3142 0.3228 0.3032 -0.0045 -0.0003 0.0212  397 ILE B N   
5471 C CA  . ILE B 404 ? 0.3864 0.3865 0.3715 -0.0036 0.0014  0.0205  397 ILE B CA  
5472 C C   . ILE B 404 ? 0.3819 0.3828 0.3688 -0.0050 0.0016  0.0167  397 ILE B C   
5473 O O   . ILE B 404 ? 0.3459 0.3456 0.3344 -0.0040 0.0022  0.0149  397 ILE B O   
5474 C CB  . ILE B 404 ? 0.4113 0.4016 0.3879 -0.0038 0.0029  0.0234  397 ILE B CB  
5475 C CG1 . ILE B 404 ? 0.3542 0.3406 0.3285 -0.0017 0.0021  0.0272  397 ILE B CG1 
5476 C CG2 . ILE B 404 ? 0.3721 0.3551 0.3456 -0.0041 0.0054  0.0215  397 ILE B CG2 
5477 C CD1 . ILE B 404 ? 0.2032 0.1952 0.1788 -0.0009 0.0004  0.0301  397 ILE B CD1 
5478 N N   . ASN B 405 ? 0.2447 0.2483 0.2315 -0.0077 0.0007  0.0156  398 ASN B N   
5479 C CA  . ASN B 405 ? 0.2228 0.2277 0.2113 -0.0094 -0.0001 0.0122  398 ASN B CA  
5480 C C   . ASN B 405 ? 0.2863 0.2963 0.2807 -0.0086 -0.0018 0.0099  398 ASN B C   
5481 O O   . ASN B 405 ? 0.3980 0.4070 0.3931 -0.0086 -0.0021 0.0077  398 ASN B O   
5482 C CB  . ASN B 405 ? 0.2695 0.2775 0.2571 -0.0131 -0.0017 0.0110  398 ASN B CB  
5483 C CG  . ASN B 405 ? 0.3650 0.3681 0.3467 -0.0146 -0.0001 0.0130  398 ASN B CG  
5484 O OD1 . ASN B 405 ? 0.2929 0.2898 0.2716 -0.0133 0.0022  0.0142  398 ASN B OD1 
5485 N ND2 . ASN B 405 ? 0.3644 0.3707 0.3445 -0.0177 -0.0011 0.0135  398 ASN B ND2 
5486 N N   . ALA B 406 ? 0.1836 0.1994 0.1823 -0.0081 -0.0029 0.0107  399 ALA B N   
5487 C CA  . ALA B 406 ? 0.2890 0.3057 0.2913 -0.0064 -0.0031 0.0083  399 ALA B CA  
5488 C C   . ALA B 406 ? 0.3330 0.3485 0.3364 -0.0045 -0.0024 0.0084  399 ALA B C   
5489 O O   . ALA B 406 ? 0.2622 0.2736 0.2649 -0.0034 -0.0020 0.0056  399 ALA B O   
5490 C CB  . ALA B 406 ? 0.1945 0.2131 0.1980 -0.0057 -0.0028 0.0086  399 ALA B CB  
5491 N N   . PHE B 407 ? 0.2721 0.2880 0.2755 -0.0032 -0.0013 0.0113  400 PHE B N   
5492 C CA  . PHE B 407 ? 0.2499 0.2641 0.2540 -0.0010 0.0000  0.0115  400 PHE B CA  
5493 C C   . PHE B 407 ? 0.3373 0.3446 0.3369 -0.0012 0.0012  0.0102  400 PHE B C   
5494 O O   . PHE B 407 ? 0.4387 0.4463 0.4399 -0.0007 0.0011  0.0087  400 PHE B O   
5495 C CB  . PHE B 407 ? 0.3013 0.3152 0.3047 0.0008  0.0013  0.0144  400 PHE B CB  
5496 C CG  . PHE B 407 ? 0.4727 0.4806 0.4729 0.0024  0.0031  0.0153  400 PHE B CG  
5497 C CD1 . PHE B 407 ? 0.5928 0.6023 0.5961 0.0040  0.0040  0.0143  400 PHE B CD1 
5498 C CD2 . PHE B 407 ? 0.5650 0.5656 0.5593 0.0020  0.0038  0.0172  400 PHE B CD2 
5499 C CE1 . PHE B 407 ? 0.5484 0.5529 0.5495 0.0054  0.0059  0.0150  400 PHE B CE1 
5500 C CE2 . PHE B 407 ? 0.7017 0.6970 0.6942 0.0032  0.0052  0.0181  400 PHE B CE2 
5501 C CZ  . PHE B 407 ? 0.6778 0.6753 0.6739 0.0051  0.0065  0.0168  400 PHE B CZ  
5502 N N   . ILE B 408 ? 0.3047 0.3056 0.2983 -0.0024 0.0024  0.0107  401 ILE B N   
5503 C CA  . ILE B 408 ? 0.3543 0.3489 0.3436 -0.0032 0.0042  0.0092  401 ILE B CA  
5504 C C   . ILE B 408 ? 0.3685 0.3677 0.3614 -0.0040 0.0023  0.0068  401 ILE B C   
5505 O O   . ILE B 408 ? 0.3826 0.3810 0.3757 -0.0040 0.0025  0.0054  401 ILE B O   
5506 C CB  . ILE B 408 ? 0.4244 0.4165 0.4123 -0.0025 0.0064  0.0114  401 ILE B CB  
5507 C CG1 . ILE B 408 ? 0.4845 0.4736 0.4689 -0.0057 0.0041  0.0144  401 ILE B CG1 
5508 C CG2 . ILE B 408 ? 0.3657 0.3581 0.3532 -0.0053 0.0058  0.0104  401 ILE B CG2 
5509 C CD1 . ILE B 408 ? 0.5113 0.4978 0.4969 -0.0039 0.0064  0.0145  401 ILE B CD1 
5510 N N   . GLY B 409 ? 0.3157 0.3198 0.3109 -0.0057 -0.0003 0.0060  402 GLY B N   
5511 C CA  . GLY B 409 ? 0.2179 0.2241 0.2149 -0.0067 -0.0023 0.0034  402 GLY B CA  
5512 C C   . GLY B 409 ? 0.3415 0.3471 0.3412 -0.0041 -0.0014 0.0026  402 GLY B C   
5513 O O   . GLY B 409 ? 0.3747 0.3790 0.3725 -0.0036 -0.0012 0.0022  402 GLY B O   
5514 N N   . GLY B 410 ? 0.3510 0.3571 0.3508 -0.0027 -0.0014 0.0037  403 GLY B N   
5515 C CA  . GLY B 410 ? 0.3456 0.3520 0.3471 -0.0023 -0.0010 0.0030  403 GLY B CA  
5516 C C   . GLY B 410 ? 0.3957 0.4010 0.3968 -0.0021 -0.0009 0.0026  403 GLY B C   
5517 O O   . GLY B 410 ? 0.4353 0.4392 0.4347 -0.0020 -0.0009 0.0021  403 GLY B O   
5518 N N   . LEU B 411 ? 0.3197 0.3262 0.3208 -0.0021 -0.0007 0.0043  404 LEU B N   
5519 C CA  . LEU B 411 ? 0.2129 0.2144 0.2107 -0.0019 0.0015  0.0038  404 LEU B CA  
5520 C C   . LEU B 411 ? 0.3593 0.3595 0.3552 -0.0036 0.0009  0.0021  404 LEU B C   
5521 O O   . LEU B 411 ? 0.4387 0.4389 0.4342 -0.0044 0.0003  0.0008  404 LEU B O   
5522 C CB  . LEU B 411 ? 0.2027 0.2007 0.1976 -0.0021 0.0035  0.0053  404 LEU B CB  
5523 C CG  . LEU B 411 ? 0.2355 0.2361 0.2341 0.0010  0.0042  0.0070  404 LEU B CG  
5524 C CD1 . LEU B 411 ? 0.2822 0.2788 0.2791 0.0022  0.0067  0.0087  404 LEU B CD1 
5525 C CD2 . LEU B 411 ? 0.2320 0.2346 0.2329 0.0018  0.0037  0.0064  404 LEU B CD2 
5526 N N   . ALA B 412 ? 0.4680 0.4670 0.4620 -0.0050 0.0007  0.0015  405 ALA B N   
5527 C CA  . ALA B 412 ? 0.3140 0.3119 0.3065 -0.0064 0.0003  -0.0005 405 ALA B CA  
5528 C C   . ALA B 412 ? 0.3315 0.3323 0.3277 -0.0050 -0.0002 0.0002  405 ALA B C   
5529 O O   . ALA B 412 ? 0.3992 0.4000 0.3949 -0.0056 0.0001  -0.0001 405 ALA B O   
5530 C CB  . ALA B 412 ? 0.1339 0.1308 0.1245 -0.0078 0.0004  -0.0007 405 ALA B CB  
5531 N N   . ALA B 413 ? 0.2488 0.2510 0.2455 -0.0037 -0.0007 0.0009  406 ALA B N   
5532 C CA  . ALA B 413 ? 0.1088 0.1116 0.1062 -0.0033 -0.0007 0.0010  406 ALA B CA  
5533 C C   . ALA B 413 ? 0.2802 0.2831 0.2779 -0.0030 -0.0007 0.0011  406 ALA B C   
5534 O O   . ALA B 413 ? 0.2675 0.2711 0.2662 -0.0036 -0.0006 0.0010  406 ALA B O   
5535 C CB  . ALA B 413 ? 0.0739 0.0775 0.0731 -0.0030 -0.0007 0.0013  406 ALA B CB  
5536 N N   . GLN B 414 ? 0.2095 0.2124 0.2076 -0.0027 -0.0007 0.0012  407 GLN B N   
5537 C CA  . GLN B 414 ? 0.2716 0.2748 0.2697 -0.0028 -0.0007 0.0012  407 GLN B CA  
5538 C C   . GLN B 414 ? 0.3342 0.3373 0.3322 -0.0041 -0.0005 0.0007  407 GLN B C   
5539 O O   . GLN B 414 ? 0.2255 0.2294 0.2233 -0.0047 -0.0005 0.0007  407 GLN B O   
5540 C CB  . GLN B 414 ? 0.3323 0.3358 0.3310 -0.0023 -0.0007 0.0015  407 GLN B CB  
5541 C CG  . GLN B 414 ? 0.6259 0.6300 0.6256 -0.0017 -0.0007 0.0021  407 GLN B CG  
5542 C CD  . GLN B 414 ? 0.6826 0.6882 0.6841 -0.0012 -0.0006 0.0025  407 GLN B CD  
5543 O OE1 . GLN B 414 ? 0.5267 0.5327 0.5283 -0.0012 -0.0006 0.0026  407 GLN B OE1 
5544 N NE2 . GLN B 414 ? 0.6376 0.6433 0.6388 -0.0006 -0.0003 0.0035  407 GLN B NE2 
5545 N N   . GLU B 415 ? 0.2265 0.2280 0.2220 -0.0044 -0.0001 0.0001  408 GLU B N   
5546 C CA  . GLU B 415 ? 0.1730 0.1737 0.1682 -0.0063 0.0006  -0.0007 408 GLU B CA  
5547 C C   . GLU B 415 ? 0.1302 0.1326 0.1257 -0.0068 0.0004  -0.0004 408 GLU B C   
5548 O O   . GLU B 415 ? 0.2212 0.2246 0.2164 -0.0077 0.0005  -0.0006 408 GLU B O   
5549 C CB  . GLU B 415 ? 0.0932 0.0910 0.0866 -0.0071 0.0017  -0.0015 408 GLU B CB  
5550 C CG  . GLU B 415 ? 0.2430 0.2370 0.2334 -0.0071 0.0031  -0.0024 408 GLU B CG  
5551 C CD  . GLU B 415 ? 0.5076 0.5010 0.4977 -0.0075 0.0041  -0.0029 408 GLU B CD  
5552 O OE1 . GLU B 415 ? 0.5251 0.5182 0.5147 -0.0085 0.0048  -0.0038 408 GLU B OE1 
5553 O OE2 . GLU B 415 ? 0.6040 0.5984 0.5953 -0.0065 0.0041  -0.0018 408 GLU B OE2 
5554 N N   . VAL B 416 ? 0.1689 0.1715 0.1632 -0.0057 0.0001  -0.0001 409 VAL B N   
5555 C CA  . VAL B 416 ? 0.2950 0.2993 0.2913 -0.0067 0.0000  0.0000  409 VAL B CA  
5556 C C   . VAL B 416 ? 0.2630 0.2680 0.2581 -0.0058 -0.0004 0.0006  409 VAL B C   
5557 O O   . VAL B 416 ? 0.3285 0.3354 0.3252 -0.0073 -0.0004 0.0006  409 VAL B O   
5558 C CB  . VAL B 416 ? 0.2239 0.2281 0.2189 -0.0056 -0.0002 0.0003  409 VAL B CB  
5559 C CG1 . VAL B 416 ? 0.1288 0.1349 0.1259 -0.0065 -0.0002 0.0004  409 VAL B CG1 
5560 C CG2 . VAL B 416 ? 0.0966 0.0999 0.0905 -0.0064 0.0002  -0.0003 409 VAL B CG2 
5561 N N   . MET B 417 ? 0.3043 0.3095 0.3021 -0.0053 -0.0006 0.0010  410 MET B N   
5562 C CA  . MET B 417 ? 0.3571 0.3627 0.3536 -0.0049 -0.0010 0.0017  410 MET B CA  
5563 C C   . MET B 417 ? 0.4064 0.4135 0.4039 -0.0066 -0.0009 0.0015  410 MET B C   
5564 O O   . MET B 417 ? 0.2415 0.2495 0.2364 -0.0069 -0.0012 0.0020  410 MET B O   
5565 C CB  . MET B 417 ? 0.2315 0.2372 0.2304 -0.0045 -0.0010 0.0018  410 MET B CB  
5566 C CG  . MET B 417 ? 0.4828 0.4873 0.4809 -0.0032 -0.0010 0.0019  410 MET B CG  
5567 S SD  . MET B 417 ? 0.3197 0.3250 0.3193 -0.0036 -0.0011 0.0021  410 MET B SD  
5568 C CE  . MET B 417 ? 1.5072 1.5112 1.5060 -0.0026 -0.0010 0.0020  410 MET B CE  
5569 N N   . LYS B 418 ? 0.1764 0.1828 0.1734 -0.0068 -0.0006 0.0009  411 LYS B N   
5570 C CA  . LYS B 418 ? 0.1837 0.1902 0.1771 -0.0076 -0.0003 0.0005  411 LYS B CA  
5571 C C   . LYS B 418 ? 0.4244 0.4321 0.4167 -0.0090 -0.0001 0.0001  411 LYS B C   
5572 O O   . LYS B 418 ? 0.5742 0.5846 0.5691 -0.0112 -0.0001 0.0002  411 LYS B O   
5573 C CB  . LYS B 418 ? 0.1410 0.1459 0.1339 -0.0078 0.0004  -0.0005 411 LYS B CB  
5574 C CG  . LYS B 418 ? 0.1215 0.1267 0.1175 -0.0075 0.0002  -0.0002 411 LYS B CG  
5575 C CD  . LYS B 418 ? 0.3215 0.3244 0.3165 -0.0078 0.0011  -0.0013 411 LYS B CD  
5576 C CE  . LYS B 418 ? 0.3649 0.3679 0.3590 -0.0075 0.0008  -0.0015 411 LYS B CE  
5577 N NZ  . LYS B 418 ? 0.3705 0.3694 0.3631 -0.0075 0.0036  -0.0018 411 LYS B NZ  
5578 N N   . ALA B 419 ? 0.3631 0.3700 0.3552 -0.0090 0.0002  -0.0003 412 ALA B N   
5579 C CA  . ALA B 419 ? 0.3702 0.3786 0.3612 -0.0104 0.0006  -0.0008 412 ALA B CA  
5580 C C   . ALA B 419 ? 0.4154 0.4271 0.4107 -0.0113 -0.0001 0.0002  412 ALA B C   
5581 O O   . ALA B 419 ? 0.4100 0.4242 0.4049 -0.0128 0.0000  0.0000  412 ALA B O   
5582 C CB  . ALA B 419 ? 0.3759 0.3830 0.3665 -0.0105 0.0011  -0.0016 412 ALA B CB  
5583 N N   . CYS B 420 ? 0.2949 0.3051 0.2879 -0.0089 -0.0008 0.0013  413 CYS B N   
5584 C CA  . CYS B 420 ? 0.2699 0.2830 0.2670 -0.0098 -0.0012 0.0022  413 CYS B CA  
5585 C C   . CYS B 420 ? 0.3790 0.3925 0.3723 -0.0097 -0.0018 0.0034  413 CYS B C   
5586 O O   . CYS B 420 ? 0.4716 0.4872 0.4648 -0.0105 -0.0022 0.0045  413 CYS B O   
5587 C CB  . CYS B 420 ? 0.3153 0.3260 0.3103 -0.0074 -0.0015 0.0029  413 CYS B CB  
5588 S SG  . CYS B 420 ? 0.4082 0.4189 0.4061 -0.0076 -0.0009 0.0018  413 CYS B SG  
5589 N N   . SER B 421 ? 0.5816 0.5942 0.5746 -0.0097 -0.0017 0.0032  414 SER B N   
5590 C CA  . SER B 421 ? 0.5766 0.5921 0.5733 -0.0118 -0.0020 0.0037  414 SER B CA  
5591 C C   . SER B 421 ? 0.8590 0.8758 0.8545 -0.0135 -0.0015 0.0027  414 SER B C   
5592 O O   . SER B 421 ? 1.1161 1.1312 1.1061 -0.0129 -0.0009 0.0016  414 SER B O   
5593 C CB  . SER B 421 ? 0.7586 0.7728 0.7559 -0.0108 -0.0022 0.0041  414 SER B CB  
5594 O OG  . SER B 421 ? 0.8273 0.8428 0.8252 -0.0115 -0.0030 0.0055  414 SER B OG  
5595 N N   . GLY B 422 ? 0.6999 0.7165 0.6901 -0.0133 -0.0019 0.0035  415 GLY B N   
5596 C CA  . GLY B 422 ? 0.8002 0.8192 0.7884 -0.0155 -0.0016 0.0028  415 GLY B CA  
5597 C C   . GLY B 422 ? 0.8031 0.8213 0.7904 -0.0160 -0.0004 0.0007  415 GLY B C   
5598 O O   . GLY B 422 ? 0.9723 0.9917 0.9649 -0.0181 0.0004  -0.0007 415 GLY B O   
5599 N N   . LYS B 423 ? 0.5158 0.5336 0.5030 -0.0160 -0.0002 0.0004  416 LYS B N   
5600 C CA  . LYS B 423 ? 0.4835 0.5019 0.4694 -0.0175 0.0010  -0.0016 416 LYS B CA  
5601 C C   . LYS B 423 ? 0.5109 0.5266 0.4976 -0.0163 0.0017  -0.0027 416 LYS B C   
5602 O O   . LYS B 423 ? 0.6681 0.6863 0.6602 -0.0189 0.0023  -0.0036 416 LYS B O   
5603 C CB  . LYS B 423 ? 0.5264 0.5484 0.5107 -0.0197 0.0008  -0.0014 416 LYS B CB  
5604 C CG  . LYS B 423 ? 0.4259 0.4512 0.4084 -0.0223 0.0012  -0.0020 416 LYS B CG  
5605 C CD  . LYS B 423 ? 0.5176 0.5478 0.5084 -0.0249 -0.0002 0.0004  416 LYS B CD  
5606 C CE  . LYS B 423 ? 0.5888 0.6241 0.5788 -0.0282 -0.0004 0.0008  416 LYS B CE  
5607 N NZ  . LYS B 423 ? 0.4831 0.5184 0.4628 -0.0270 -0.0017 0.0032  416 LYS B NZ  
5608 N N   . PHE B 424 ? 0.4831 0.4960 0.4714 -0.0142 0.0014  -0.0022 417 PHE B N   
5609 C CA  . PHE B 424 ? 0.5996 0.6115 0.5931 -0.0142 0.0017  -0.0026 417 PHE B CA  
5610 C C   . PHE B 424 ? 0.5139 0.5218 0.5047 -0.0139 0.0023  -0.0049 417 PHE B C   
5611 O O   . PHE B 424 ? 0.6431 0.6500 0.6316 -0.0130 0.0035  -0.0045 417 PHE B O   
5612 C CB  . PHE B 424 ? 0.6888 0.7003 0.6834 -0.0121 0.0006  -0.0010 417 PHE B CB  
5613 C CG  . PHE B 424 ? 0.8727 0.8857 0.8633 -0.0117 -0.0001 0.0002  417 PHE B CG  
5614 C CD1 . PHE B 424 ? 0.8673 0.8824 0.8570 -0.0131 0.0002  -0.0003 417 PHE B CD1 
5615 C CD2 . PHE B 424 ? 0.9237 0.9382 0.9191 -0.0124 -0.0009 0.0016  417 PHE B CD2 
5616 C CE1 . PHE B 424 ? 0.7907 0.8080 0.7799 -0.0141 -0.0006 0.0010  417 PHE B CE1 
5617 C CE2 . PHE B 424 ? 0.8951 0.9101 0.8860 -0.0122 -0.0017 0.0030  417 PHE B CE2 
5618 C CZ  . PHE B 424 ? 0.8265 0.8451 0.8214 -0.0149 -0.0014 0.0025  417 PHE B CZ  
5619 N N   . MET B 425 ? 0.3567 0.3634 0.3468 -0.0149 0.0041  -0.0063 418 MET B N   
5620 C CA  . MET B 425 ? 0.4645 0.4669 0.4537 -0.0158 0.0070  -0.0082 418 MET B CA  
5621 C C   . MET B 425 ? 0.4891 0.4879 0.4784 -0.0137 0.0067  -0.0070 418 MET B C   
5622 O O   . MET B 425 ? 0.6131 0.6107 0.6028 -0.0124 0.0068  -0.0062 418 MET B O   
5623 C CB  . MET B 425 ? 0.4765 0.4773 0.4659 -0.0173 0.0103  -0.0106 418 MET B CB  
5624 C CG  . MET B 425 ? 0.6129 0.6132 0.6023 -0.0199 0.0132  -0.0136 418 MET B CG  
5625 S SD  . MET B 425 ? 0.7181 0.7122 0.7075 -0.0196 0.0161  -0.0144 418 MET B SD  
5626 C CE  . MET B 425 ? 1.5842 1.5714 1.5753 -0.0168 0.0194  -0.0134 418 MET B CE  
5627 N N   . PRO B 426 ? 0.3683 0.3658 0.3573 -0.0135 0.0067  -0.0070 419 PRO B N   
5628 C CA  . PRO B 426 ? 0.2817 0.2763 0.2706 -0.0119 0.0068  -0.0062 419 PRO B CA  
5629 C C   . PRO B 426 ? 0.2673 0.2561 0.2551 -0.0117 0.0104  -0.0071 419 PRO B C   
5630 O O   . PRO B 426 ? 0.3770 0.3641 0.3650 -0.0128 0.0129  -0.0085 419 PRO B O   
5631 C CB  . PRO B 426 ? 0.3744 0.3701 0.3632 -0.0122 0.0058  -0.0063 419 PRO B CB  
5632 C CG  . PRO B 426 ? 0.3950 0.3923 0.3833 -0.0144 0.0064  -0.0077 419 PRO B CG  
5633 C CD  . PRO B 426 ? 0.3881 0.3865 0.3764 -0.0153 0.0072  -0.0083 419 PRO B CD  
5634 N N   . ILE B 427 ? 0.3366 0.3225 0.3238 -0.0102 0.0108  -0.0062 420 ILE B N   
5635 C CA  . ILE B 427 ? 0.3851 0.3657 0.3716 -0.0091 0.0143  -0.0062 420 ILE B CA  
5636 C C   . ILE B 427 ? 0.3069 0.2863 0.2926 -0.0112 0.0161  -0.0081 420 ILE B C   
5637 O O   . ILE B 427 ? 0.2854 0.2668 0.2702 -0.0128 0.0147  -0.0088 420 ILE B O   
5638 C CB  . ILE B 427 ? 0.3497 0.3286 0.3348 -0.0077 0.0141  -0.0050 420 ILE B CB  
5639 C CG1 . ILE B 427 ? 0.2865 0.2666 0.2730 -0.0055 0.0130  -0.0032 420 ILE B CG1 
5640 C CG2 . ILE B 427 ? 0.2554 0.2288 0.2386 -0.0072 0.0179  -0.0050 420 ILE B CG2 
5641 C CD1 . ILE B 427 ? 0.4657 0.4464 0.4521 -0.0042 0.0124  -0.0012 420 ILE B CD1 
5642 N N   . MET B 428 ? 0.4575 0.4340 0.4441 -0.0114 0.0193  -0.0089 421 MET B N   
5643 C CA  . MET B 428 ? 0.3877 0.3631 0.3740 -0.0138 0.0214  -0.0111 421 MET B CA  
5644 C C   . MET B 428 ? 0.5484 0.5198 0.5326 -0.0132 0.0234  -0.0110 421 MET B C   
5645 O O   . MET B 428 ? 0.4409 0.4081 0.4252 -0.0124 0.0273  -0.0112 421 MET B O   
5646 C CB  . MET B 428 ? 0.6373 0.6113 0.6261 -0.0149 0.0246  -0.0124 421 MET B CB  
5647 C CG  . MET B 428 ? 0.8591 0.8331 0.8480 -0.0183 0.0267  -0.0152 421 MET B CG  
5648 S SD  . MET B 428 ? 1.3760 1.3552 1.3626 -0.0207 0.0231  -0.0163 421 MET B SD  
5649 C CE  . MET B 428 ? 0.5003 0.4773 0.4867 -0.0239 0.0266  -0.0192 421 MET B CE  
5650 N N   . GLN B 429 ? 0.6140 0.5871 0.5962 -0.0137 0.0210  -0.0107 422 GLN B N   
5651 C CA  . GLN B 429 ? 0.4606 0.4306 0.4396 -0.0142 0.0225  -0.0109 422 GLN B CA  
5652 C C   . GLN B 429 ? 0.3792 0.3456 0.3565 -0.0121 0.0237  -0.0089 422 GLN B C   
5653 O O   . GLN B 429 ? 0.5037 0.4721 0.4804 -0.0119 0.0209  -0.0080 422 GLN B O   
5654 C CB  . GLN B 429 ? 0.5441 0.5109 0.5216 -0.0162 0.0265  -0.0131 422 GLN B CB  
5655 C CG  . GLN B 429 ? 0.5145 0.4851 0.4940 -0.0186 0.0252  -0.0152 422 GLN B CG  
5656 C CD  . GLN B 429 ? 0.5339 0.5081 0.5123 -0.0208 0.0229  -0.0162 422 GLN B CD  
5657 O OE1 . GLN B 429 ? 0.5436 0.5196 0.5225 -0.0233 0.0232  -0.0181 422 GLN B OE1 
5658 N NE2 . GLN B 429 ? 0.5271 0.5024 0.5044 -0.0201 0.0207  -0.0148 422 GLN B NE2 
5659 N N   . TRP B 430 ? 0.3212 0.2822 0.2979 -0.0104 0.0280  -0.0079 423 TRP B N   
5660 C CA  . TRP B 430 ? 0.3228 0.2784 0.2963 -0.0086 0.0301  -0.0058 423 TRP B CA  
5661 C C   . TRP B 430 ? 0.3211 0.2779 0.2984 -0.0049 0.0295  -0.0021 423 TRP B C   
5662 O O   . TRP B 430 ? 0.3209 0.2766 0.3012 -0.0034 0.0321  -0.0013 423 TRP B O   
5663 C CB  . TRP B 430 ? 0.2440 0.1918 0.2141 -0.0099 0.0346  -0.0052 423 TRP B CB  
5664 C CG  . TRP B 430 ? 0.3498 0.2959 0.3151 -0.0139 0.0360  -0.0088 423 TRP B CG  
5665 C CD1 . TRP B 430 ? 0.4036 0.3521 0.3706 -0.0163 0.0369  -0.0112 423 TRP B CD1 
5666 C CD2 . TRP B 430 ? 0.4728 0.4170 0.4335 -0.0162 0.0349  -0.0090 423 TRP B CD2 
5667 N NE1 . TRP B 430 ? 0.4514 0.3994 0.4148 -0.0195 0.0368  -0.0130 423 TRP B NE1 
5668 C CE2 . TRP B 430 ? 0.4996 0.4447 0.4588 -0.0197 0.0358  -0.0119 423 TRP B CE2 
5669 C CE3 . TRP B 430 ? 0.5099 0.4547 0.4703 -0.0158 0.0315  -0.0056 423 TRP B CE3 
5670 C CZ2 . TRP B 430 ? 0.5857 0.5299 0.5407 -0.0228 0.0353  -0.0130 423 TRP B CZ2 
5671 C CZ3 . TRP B 430 ? 0.4129 0.3564 0.3687 -0.0192 0.0311  -0.0069 423 TRP B CZ3 
5672 C CH2 . TRP B 430 ? 0.4870 0.4287 0.4384 -0.0228 0.0339  -0.0115 423 TRP B CH2 
5673 N N   . LEU B 431 ? 0.3899 0.3503 0.3682 -0.0039 0.0255  0.0005  424 LEU B N   
5674 C CA  . LEU B 431 ? 0.4341 0.3968 0.4161 -0.0008 0.0239  0.0045  424 LEU B CA  
5675 C C   . LEU B 431 ? 0.3933 0.3535 0.3739 -0.0009 0.0222  0.0084  424 LEU B C   
5676 O O   . LEU B 431 ? 0.4695 0.4322 0.4485 -0.0026 0.0199  0.0084  424 LEU B O   
5677 C CB  . LEU B 431 ? 0.4823 0.4522 0.4670 0.0000  0.0204  0.0042  424 LEU B CB  
5678 C CG  . LEU B 431 ? 0.4387 0.4125 0.4277 0.0029  0.0198  0.0061  424 LEU B CG  
5679 C CD1 . LEU B 431 ? 0.2415 0.2218 0.2325 0.0031  0.0157  0.0071  424 LEU B CD1 
5680 C CD2 . LEU B 431 ? 0.4116 0.3821 0.4016 0.0051  0.0213  0.0097  424 LEU B CD2 
5681 N N   . TYR B 432 ? 0.4406 0.3953 0.4218 0.0007  0.0230  0.0118  425 TYR B N   
5682 C CA  . TYR B 432 ? 0.5003 0.4519 0.4799 0.0006  0.0205  0.0161  425 TYR B CA  
5683 C C   . TYR B 432 ? 0.5365 0.4910 0.5188 0.0036  0.0176  0.0195  425 TYR B C   
5684 O O   . TYR B 432 ? 0.6824 0.6380 0.6680 0.0065  0.0182  0.0194  425 TYR B O   
5685 C CB  . TYR B 432 ? 0.5358 0.4768 0.5132 0.0001  0.0223  0.0179  425 TYR B CB  
5686 C CG  . TYR B 432 ? 0.4748 0.4128 0.4480 -0.0039 0.0244  0.0153  425 TYR B CG  
5687 C CD1 . TYR B 432 ? 0.4172 0.3519 0.3894 -0.0052 0.0284  0.0114  425 TYR B CD1 
5688 C CD2 . TYR B 432 ? 0.3395 0.2785 0.3095 -0.0065 0.0228  0.0166  425 TYR B CD2 
5689 C CE1 . TYR B 432 ? 0.4824 0.4146 0.4502 -0.0090 0.0305  0.0087  425 TYR B CE1 
5690 C CE2 . TYR B 432 ? 0.3541 0.2904 0.3198 -0.0101 0.0248  0.0139  425 TYR B CE2 
5691 C CZ  . TYR B 432 ? 0.4688 0.4017 0.4332 -0.0113 0.0286  0.0098  425 TYR B CZ  
5692 O OH  . TYR B 432 ? 0.5324 0.4629 0.4920 -0.0152 0.0307  0.0067  425 TYR B OH  
5693 N N   . PHE B 433 ? 0.4759 0.4321 0.4568 0.0027  0.0146  0.0224  426 PHE B N   
5694 C CA  . PHE B 433 ? 0.4729 0.4333 0.4556 0.0051  0.0119  0.0248  426 PHE B CA  
5695 C C   . PHE B 433 ? 0.6152 0.5712 0.5949 0.0050  0.0092  0.0296  426 PHE B C   
5696 O O   . PHE B 433 ? 0.7218 0.6755 0.6982 0.0016  0.0086  0.0310  426 PHE B O   
5697 C CB  . PHE B 433 ? 0.6356 0.6056 0.6198 0.0038  0.0107  0.0222  426 PHE B CB  
5698 C CG  . PHE B 433 ? 1.0071 0.9818 0.9924 0.0053  0.0083  0.0241  426 PHE B CG  
5699 C CD1 . PHE B 433 ? 1.1709 1.1492 1.1601 0.0087  0.0086  0.0244  426 PHE B CD1 
5700 C CD2 . PHE B 433 ? 1.1021 1.0779 1.0845 0.0031  0.0060  0.0254  426 PHE B CD2 
5701 C CE1 . PHE B 433 ? 1.2030 1.1868 1.1937 0.0101  0.0068  0.0260  426 PHE B CE1 
5702 C CE2 . PHE B 433 ? 1.0968 1.0772 1.0802 0.0046  0.0045  0.0268  426 PHE B CE2 
5703 C CZ  . PHE B 433 ? 1.1422 1.1272 1.1303 0.0081  0.0048  0.0271  426 PHE B CZ  
5704 N N   . ASP B 434 ? 0.7301 0.6854 0.7112 0.0087  0.0074  0.0324  427 ASP B N   
5705 C CA  . ASP B 434 ? 0.6704 0.6232 0.6482 0.0091  0.0041  0.0370  427 ASP B CA  
5706 C C   . ASP B 434 ? 0.6752 0.6369 0.6552 0.0111  0.0027  0.0366  427 ASP B C   
5707 O O   . ASP B 434 ? 0.8793 0.8451 0.8641 0.0144  0.0034  0.0354  427 ASP B O   
5708 C CB  . ASP B 434 ? 0.8105 0.7537 0.7883 0.0127  0.0029  0.0409  427 ASP B CB  
5709 C CG  . ASP B 434 ? 0.9599 0.8998 0.9335 0.0134  -0.0010 0.0461  427 ASP B CG  
5710 O OD1 . ASP B 434 ? 0.9442 0.8750 0.9170 0.0161  -0.0027 0.0500  427 ASP B OD1 
5711 O OD2 . ASP B 434 ? 1.0822 1.0282 1.0529 0.0115  -0.0022 0.0463  427 ASP B OD2 
5712 N N   . ALA B 435 ? 0.6981 0.6628 0.6746 0.0089  0.0010  0.0376  428 ALA B N   
5713 C CA  . ALA B 435 ? 0.7639 0.7377 0.7432 0.0107  0.0001  0.0373  428 ALA B CA  
5714 C C   . ALA B 435 ? 0.9342 0.9074 0.9150 0.0153  -0.0020 0.0411  428 ALA B C   
5715 O O   . ALA B 435 ? 0.7386 0.7144 0.7176 0.0159  -0.0041 0.0438  428 ALA B O   
5716 C CB  . ALA B 435 ? 0.7889 0.7659 0.7647 0.0076  -0.0007 0.0371  428 ALA B CB  
5717 N N   . LEU B 436 ? 1.2504 1.2206 1.2348 0.0187  -0.0014 0.0410  429 LEU B N   
5718 C CA  . LEU B 436 ? 1.2637 1.2331 1.2511 0.0240  -0.0034 0.0437  429 LEU B CA  
5719 C C   . LEU B 436 ? 1.2194 1.1924 1.2130 0.0265  -0.0015 0.0404  429 LEU B C   
5720 O O   . LEU B 436 ? 1.0965 1.0668 1.0907 0.0249  0.0013  0.0376  429 LEU B O   
5721 C CB  . LEU B 436 ? 1.1955 1.1523 1.1798 0.0261  -0.0054 0.0478  429 LEU B CB  
5722 C CG  . LEU B 436 ? 1.0018 0.9540 0.9802 0.0263  -0.0090 0.0531  429 LEU B CG  
5723 C CD1 . LEU B 436 ? 0.7454 0.6962 0.7166 0.0204  -0.0083 0.0533  429 LEU B CD1 
5724 C CD2 . LEU B 436 ? 1.0182 0.9580 0.9958 0.0299  -0.0113 0.0571  429 LEU B CD2 
5725 N N   . GLU B 437 ? 1.3589 1.3383 1.3568 0.0301  -0.0029 0.0407  430 GLU B N   
5726 C CA  . GLU B 437 ? 1.4303 1.4149 1.4338 0.0319  -0.0012 0.0373  430 GLU B CA  
5727 C C   . GLU B 437 ? 1.4143 1.3987 1.4231 0.0381  -0.0036 0.0380  430 GLU B C   
5728 O O   . GLU B 437 ? 1.4030 1.3841 1.4115 0.0414  -0.0069 0.0417  430 GLU B O   
5729 C CB  . GLU B 437 ? 1.4295 1.4253 1.4339 0.0289  0.0001  0.0349  430 GLU B CB  
5730 C CG  . GLU B 437 ? 1.4072 1.4096 1.4108 0.0285  -0.0020 0.0370  430 GLU B CG  
5731 C CD  . GLU B 437 ? 1.4749 1.4826 1.4824 0.0329  -0.0044 0.0381  430 GLU B CD  
5732 O OE1 . GLU B 437 ? 1.5292 1.5385 1.5410 0.0353  -0.0039 0.0359  430 GLU B OE1 
5733 O OE2 . GLU B 437 ? 1.5175 1.5281 1.5240 0.0339  -0.0069 0.0410  430 GLU B OE2 
5734 N N   . CYS B 438 ? 1.3504 1.3385 1.3644 0.0397  -0.0021 0.0343  431 CYS B N   
5735 C CA  . CYS B 438 ? 1.2449 1.2338 1.2660 0.0458  -0.0040 0.0333  431 CYS B CA  
5736 C C   . CYS B 438 ? 1.0995 1.1008 1.1251 0.0470  -0.0051 0.0317  431 CYS B C   
5737 O O   . CYS B 438 ? 0.9693 0.9746 1.0021 0.0504  -0.0052 0.0284  431 CYS B O   
5738 C CB  . CYS B 438 ? 1.2176 1.2017 1.2425 0.0472  -0.0016 0.0291  431 CYS B CB  
5739 S SG  . CYS B 438 ? 1.2168 1.1865 1.2432 0.0520  -0.0028 0.0302  431 CYS B SG  
5740 O O   . HOH C .   ? 0.4457 0.5438 0.4434 -0.0276 0.0022  0.0041  501 HOH A O   
5741 O O   . HOH C .   ? 0.4291 0.5148 0.4020 -0.0552 0.0043  -0.0093 502 HOH A O   
5742 O O   . HOH C .   ? 0.1974 0.3325 0.1865 -0.0496 0.0094  -0.0292 503 HOH A O   
5743 O O   . HOH C .   ? 0.6561 0.6776 0.6252 -0.0570 -0.0035 0.0120  504 HOH A O   
5744 O O   . HOH C .   ? 0.7261 0.8156 0.7197 -0.0310 0.0105  -0.0258 505 HOH A O   
5745 O O   . HOH C .   ? 0.3769 0.6155 0.3705 -0.0357 0.0039  -0.0137 506 HOH A O   
5746 O O   . HOH C .   ? 0.2487 0.3776 0.2596 0.0147  -0.0042 0.0235  507 HOH A O   
5747 O O   . HOH C .   ? 0.3350 0.3740 0.3317 -0.0057 -0.0011 0.0078  508 HOH A O