data_4P4P
# 
_entry.id   4P4P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4P4P         
WWPDB D_1000200693 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4P4P 
_pdbx_database_status.recvd_initial_deposition_date   2014-03-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mejia, E.'       1 
'Burak, M.'       2 
'Alonso, A.'      3 
'Larraga, V.'     4 
'Kunkel, T.'      5 
'Bebenek, K.'     6 
'Garcia-Diaz, M.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'DNA Repair (Amst.)' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1568-7856 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            18 
_citation.language                  ? 
_citation.page_first                1 
_citation.page_last                 9 
_citation.title                     'Structures of the Leishmania infantum polymerase beta.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.dnarep.2014.03.001 
_citation.pdbx_database_id_PubMed   24666693 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mejia, E.'       1 ? 
primary 'Burak, M.'       2 ? 
primary 'Alonso, A.'      3 ? 
primary 'Larraga, V.'     4 ? 
primary 'Kunkel, T.A.'    5 ? 
primary 'Bebenek, K.'     6 ? 
primary 'Garcia-Diaz, M.' 7 ? 
# 
_cell.entry_id           4P4P 
_cell.length_a           106.497 
_cell.length_b           106.497 
_cell.length_c           159.609 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4P4P 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase beta'                              42962.488 1   ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*GP*TP*AP*CP*T)-3')
;
2097.411  1   ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(P*GP*CP*CP*G)-3')
;
1191.818  1   ? ? ? ? 
4 polymer     syn 
;DNA (5'-D(P*CP*GP*GP*CP*AP*GP*TP*AP*CP*TP*G)-3')
;
3374.210  1   ? ? ? ? 
5 non-polymer syn 'SODIUM ION'                                       22.990    1   ? ? ? ? 
6 water       nat water                                              18.015    250 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GHMLRRKFLRRDHRENIIRIFQEMADLNNALGEKYKVSSYHRSIESLKTNLDKPLNTPQDLKAFSGFGAKLLKKAEEIMA
TGKLEELESKTKPKLKAIQELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQRVGIKYFYDINEKIPMQES
VLHENYLREKCMEVLGKDFSILICGSYRRRHPFSGDVDAILSRTLDAPPLSEPVAATGVLGHFVEFLESLKYLEATMAQG
PLKYMGMGRLPPRIVRDKAGRENTKVYKARRVDIRLIETKSVPTAMLTFTGSKNFNVIMRQAAISKGYLLNEYGLFKLGT
PEEARALYERIGIRGKNAGEELGVPKDELEDKRVEVRSEQDVFDVLGMPYAKPENRDP
;
;GHMLRRKFLRRDHRENIIRIFQEMADLNNALGEKYKVSSYHRSIESLKTNLDKPLNTPQDLKAFSGFGAKLLKKAEEIMA
TGKLEELESKTKPKLKAIQELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQRVGIKYFYDINEKIPMQES
VLHENYLREKCMEVLGKDFSILICGSYRRRHPFSGDVDAILSRTLDAPPLSEPVAATGVLGHFVEFLESLKYLEATMAQG
PLKYMGMGRLPPRIVRDKAGRENTKVYKARRVDIRLIETKSVPTAMLTFTGSKNFNVIMRQAAISKGYLLNEYGLFKLGT
PEEARALYERIGIRGKNAGEELGVPKDELEDKRVEVRSEQDVFDVLGMPYAKPENRDP
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DT)(DA)(DC)(DT)' CAGTACT C ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
4 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DA)(DG)(DT)(DA)(DC)(DT)(DG)' CGGCAGTACTG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   LEU n 
1 5   ARG n 
1 6   ARG n 
1 7   LYS n 
1 8   PHE n 
1 9   LEU n 
1 10  ARG n 
1 11  ARG n 
1 12  ASP n 
1 13  HIS n 
1 14  ARG n 
1 15  GLU n 
1 16  ASN n 
1 17  ILE n 
1 18  ILE n 
1 19  ARG n 
1 20  ILE n 
1 21  PHE n 
1 22  GLN n 
1 23  GLU n 
1 24  MET n 
1 25  ALA n 
1 26  ASP n 
1 27  LEU n 
1 28  ASN n 
1 29  ASN n 
1 30  ALA n 
1 31  LEU n 
1 32  GLY n 
1 33  GLU n 
1 34  LYS n 
1 35  TYR n 
1 36  LYS n 
1 37  VAL n 
1 38  SER n 
1 39  SER n 
1 40  TYR n 
1 41  HIS n 
1 42  ARG n 
1 43  SER n 
1 44  ILE n 
1 45  GLU n 
1 46  SER n 
1 47  LEU n 
1 48  LYS n 
1 49  THR n 
1 50  ASN n 
1 51  LEU n 
1 52  ASP n 
1 53  LYS n 
1 54  PRO n 
1 55  LEU n 
1 56  ASN n 
1 57  THR n 
1 58  PRO n 
1 59  GLN n 
1 60  ASP n 
1 61  LEU n 
1 62  LYS n 
1 63  ALA n 
1 64  PHE n 
1 65  SER n 
1 66  GLY n 
1 67  PHE n 
1 68  GLY n 
1 69  ALA n 
1 70  LYS n 
1 71  LEU n 
1 72  LEU n 
1 73  LYS n 
1 74  LYS n 
1 75  ALA n 
1 76  GLU n 
1 77  GLU n 
1 78  ILE n 
1 79  MET n 
1 80  ALA n 
1 81  THR n 
1 82  GLY n 
1 83  LYS n 
1 84  LEU n 
1 85  GLU n 
1 86  GLU n 
1 87  LEU n 
1 88  GLU n 
1 89  SER n 
1 90  LYS n 
1 91  THR n 
1 92  LYS n 
1 93  PRO n 
1 94  LYS n 
1 95  LEU n 
1 96  LYS n 
1 97  ALA n 
1 98  ILE n 
1 99  GLN n 
1 100 GLU n 
1 101 LEU n 
1 102 THR n 
1 103 GLN n 
1 104 VAL n 
1 105 HIS n 
1 106 GLY n 
1 107 PHE n 
1 108 GLY n 
1 109 PRO n 
1 110 ARG n 
1 111 ALA n 
1 112 ALA n 
1 113 ALA n 
1 114 ALA n 
1 115 LEU n 
1 116 PHE n 
1 117 ASP n 
1 118 ARG n 
1 119 GLU n 
1 120 GLY n 
1 121 ILE n 
1 122 PHE n 
1 123 THR n 
1 124 VAL n 
1 125 ASP n 
1 126 GLU n 
1 127 LEU n 
1 128 LEU n 
1 129 GLN n 
1 130 LYS n 
1 131 ALA n 
1 132 ASP n 
1 133 SER n 
1 134 ILE n 
1 135 PRO n 
1 136 SER n 
1 137 LEU n 
1 138 THR n 
1 139 ASP n 
1 140 GLN n 
1 141 GLN n 
1 142 ARG n 
1 143 VAL n 
1 144 GLY n 
1 145 ILE n 
1 146 LYS n 
1 147 TYR n 
1 148 PHE n 
1 149 TYR n 
1 150 ASP n 
1 151 ILE n 
1 152 ASN n 
1 153 GLU n 
1 154 LYS n 
1 155 ILE n 
1 156 PRO n 
1 157 MET n 
1 158 GLN n 
1 159 GLU n 
1 160 SER n 
1 161 VAL n 
1 162 LEU n 
1 163 HIS n 
1 164 GLU n 
1 165 ASN n 
1 166 TYR n 
1 167 LEU n 
1 168 ARG n 
1 169 GLU n 
1 170 LYS n 
1 171 CYS n 
1 172 MET n 
1 173 GLU n 
1 174 VAL n 
1 175 LEU n 
1 176 GLY n 
1 177 LYS n 
1 178 ASP n 
1 179 PHE n 
1 180 SER n 
1 181 ILE n 
1 182 LEU n 
1 183 ILE n 
1 184 CYS n 
1 185 GLY n 
1 186 SER n 
1 187 TYR n 
1 188 ARG n 
1 189 ARG n 
1 190 ARG n 
1 191 HIS n 
1 192 PRO n 
1 193 PHE n 
1 194 SER n 
1 195 GLY n 
1 196 ASP n 
1 197 VAL n 
1 198 ASP n 
1 199 ALA n 
1 200 ILE n 
1 201 LEU n 
1 202 SER n 
1 203 ARG n 
1 204 THR n 
1 205 LEU n 
1 206 ASP n 
1 207 ALA n 
1 208 PRO n 
1 209 PRO n 
1 210 LEU n 
1 211 SER n 
1 212 GLU n 
1 213 PRO n 
1 214 VAL n 
1 215 ALA n 
1 216 ALA n 
1 217 THR n 
1 218 GLY n 
1 219 VAL n 
1 220 LEU n 
1 221 GLY n 
1 222 HIS n 
1 223 PHE n 
1 224 VAL n 
1 225 GLU n 
1 226 PHE n 
1 227 LEU n 
1 228 GLU n 
1 229 SER n 
1 230 LEU n 
1 231 LYS n 
1 232 TYR n 
1 233 LEU n 
1 234 GLU n 
1 235 ALA n 
1 236 THR n 
1 237 MET n 
1 238 ALA n 
1 239 GLN n 
1 240 GLY n 
1 241 PRO n 
1 242 LEU n 
1 243 LYS n 
1 244 TYR n 
1 245 MET n 
1 246 GLY n 
1 247 MET n 
1 248 GLY n 
1 249 ARG n 
1 250 LEU n 
1 251 PRO n 
1 252 PRO n 
1 253 ARG n 
1 254 ILE n 
1 255 VAL n 
1 256 ARG n 
1 257 ASP n 
1 258 LYS n 
1 259 ALA n 
1 260 GLY n 
1 261 ARG n 
1 262 GLU n 
1 263 ASN n 
1 264 THR n 
1 265 LYS n 
1 266 VAL n 
1 267 TYR n 
1 268 LYS n 
1 269 ALA n 
1 270 ARG n 
1 271 ARG n 
1 272 VAL n 
1 273 ASP n 
1 274 ILE n 
1 275 ARG n 
1 276 LEU n 
1 277 ILE n 
1 278 GLU n 
1 279 THR n 
1 280 LYS n 
1 281 SER n 
1 282 VAL n 
1 283 PRO n 
1 284 THR n 
1 285 ALA n 
1 286 MET n 
1 287 LEU n 
1 288 THR n 
1 289 PHE n 
1 290 THR n 
1 291 GLY n 
1 292 SER n 
1 293 LYS n 
1 294 ASN n 
1 295 PHE n 
1 296 ASN n 
1 297 VAL n 
1 298 ILE n 
1 299 MET n 
1 300 ARG n 
1 301 GLN n 
1 302 ALA n 
1 303 ALA n 
1 304 ILE n 
1 305 SER n 
1 306 LYS n 
1 307 GLY n 
1 308 TYR n 
1 309 LEU n 
1 310 LEU n 
1 311 ASN n 
1 312 GLU n 
1 313 TYR n 
1 314 GLY n 
1 315 LEU n 
1 316 PHE n 
1 317 LYS n 
1 318 LEU n 
1 319 GLY n 
1 320 THR n 
1 321 PRO n 
1 322 GLU n 
1 323 GLU n 
1 324 ALA n 
1 325 ARG n 
1 326 ALA n 
1 327 LEU n 
1 328 TYR n 
1 329 GLU n 
1 330 ARG n 
1 331 ILE n 
1 332 GLY n 
1 333 ILE n 
1 334 ARG n 
1 335 GLY n 
1 336 LYS n 
1 337 ASN n 
1 338 ALA n 
1 339 GLY n 
1 340 GLU n 
1 341 GLU n 
1 342 LEU n 
1 343 GLY n 
1 344 VAL n 
1 345 PRO n 
1 346 LYS n 
1 347 ASP n 
1 348 GLU n 
1 349 LEU n 
1 350 GLU n 
1 351 ASP n 
1 352 LYS n 
1 353 ARG n 
1 354 VAL n 
1 355 GLU n 
1 356 VAL n 
1 357 ARG n 
1 358 SER n 
1 359 GLU n 
1 360 GLN n 
1 361 ASP n 
1 362 VAL n 
1 363 PHE n 
1 364 ASP n 
1 365 VAL n 
1 366 LEU n 
1 367 GLY n 
1 368 MET n 
1 369 PRO n 
1 370 TYR n 
1 371 ALA n 
1 372 LYS n 
1 373 PRO n 
1 374 GLU n 
1 375 ASN n 
1 376 ARG n 
1 377 ASP n 
1 378 PRO n 
2 1   DC  n 
2 2   DA  n 
2 3   DG  n 
2 4   DT  n 
2 5   DA  n 
2 6   DC  n 
2 7   DT  n 
3 1   DG  n 
3 2   DC  n 
3 3   DC  n 
3 4   DG  n 
4 1   DC  n 
4 2   DG  n 
4 3   DG  n 
4 4   DC  n 
4 5   DA  n 
4 6   DG  n 
4 7   DT  n 
4 8   DA  n 
4 9   DC  n 
4 10  DT  n 
4 11  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   378 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Leishmania infantum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5671 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 6  'synthetic construct' ? 32630 ? 
3 1 sample 1 3  'synthetic construct' ? 32630 ? 
4 1 sample 1 11 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9U6N3_LEIIN Q9U6N3 1 
;MLRRKFLRRDHRENIIRIFQEMADLNNALGEKYKVSSYHRSIESLKTNLDKPLNTPQDLKAFSGFGAKLLKKAEEIMATG
KLEELESKTKPKLKAIQELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQRVGIKYFYDINEKIPMQESVL
HENYLREKCMEVLGKDFSILICGSYRRRHPFSGDVDAILSRTLDAPPLSEPVAATGVLGHFVEFLESLKYLEATMAQGPL
KYMGMGRLPPRIVRDKAGRENTKVYKARRVDIRLIETKSVPTAMLTFTGSKNFNVIMRQAAISKGYLLNEYGLFKLGTPE
EARALYERIGIRGKNAGEELGVPKDELEDKRVEVRSEQDVFDVLGMPYAKPENRDP
;
1 ? 
2 PDB 4P4P         4P4P   2 ? 1 ? 
3 PDB 4P4P         4P4P   3 ? 1 ? 
4 PDB 4P4P         4P4P   4 ? 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4P4P A 3 ? 378 ? Q9U6N3 1 ? 376 ? 1 376 
2 2 4P4P C 1 ? 6   ? 4P4P   1 ? 6   ? 1 6   
3 3 4P4P D 1 ? 3   ? 4P4P   1 ? 3   ? 1 3   
4 4 4P4P B 1 ? 11  ? 4P4P   1 ? 11  ? 1 11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4P4P GLY A 1 ? UNP Q9U6N3 ? ? 'expression tag' -1 1 
1 4P4P HIS A 2 ? UNP Q9U6N3 ? ? 'expression tag' 0  2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4P4P 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.65 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.66 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M ammonium sulfate, 0.1 M sodium acetate, pH 4.6 and 12.5% PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-04-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4P4P 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.297 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24544 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4P4P 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     24483 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.303 
_refine.ls_d_res_high                            2.2973 
_refine.ls_percent_reflns_obs                    99.85 
_refine.ls_R_factor_obs                          0.1948 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1912 
_refine.ls_R_factor_R_free                       0.2338 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.16 
_refine.ls_number_reflns_R_free                  1997 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1BPY 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.22 
_refine.pdbx_overall_phase_error                 22.14 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 2705 'X-RAY DIFFRACTION' ? 
f_angle_d          1.045  ? ? 3730 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.591 ? ? 1058 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.064  ? ? 412  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 420  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.2973 2.3548  1536 0.2131 98.00  0.2732 . . 137 . . . . 
'X-RAY DIFFRACTION' . 2.3548 2.4184  1591 0.2122 100.00 0.2372 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.4184 2.4896  1567 0.1860 100.00 0.2696 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.4896 2.5699  1574 0.1773 100.00 0.2097 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.5699 2.6618  1583 0.1833 100.00 0.2085 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.6618 2.7683  1561 0.1896 100.00 0.2178 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.7683 2.8943  1586 0.1915 100.00 0.2590 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.8943 3.0469  1605 0.2017 100.00 0.2690 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.0469 3.2377  1593 0.2152 100.00 0.2475 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.2377 3.4876  1607 0.1822 100.00 0.2331 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.4876 3.8384  1612 0.1817 100.00 0.2344 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.8384 4.3934  1626 0.1656 100.00 0.1981 . . 144 . . . . 
'X-RAY DIFFRACTION' . 4.3934 5.5335  1661 0.1766 100.00 0.2036 . . 148 . . . . 
'X-RAY DIFFRACTION' . 5.5335 44.3107 1784 0.2233 100.00 0.2647 . . 156 . . . . 
# 
_struct.entry_id                     4P4P 
_struct.title                        'Crystal structure of Leishmania infantum polymerase beta: Nick complex' 
_struct.pdbx_descriptor              'Polymerase beta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4P4P 
_struct_keywords.text            'DNA polymerase, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 94  ? THR A 102 ? LYS A 92  THR A 100 1 ? 9  
HELX_P HELX_P2  AA2 GLY A 108 ? GLY A 120 ? GLY A 106 GLY A 118 1 ? 13 
HELX_P HELX_P3  AA3 THR A 123 ? ALA A 131 ? THR A 121 ALA A 129 1 ? 9  
HELX_P HELX_P4  AA4 ASP A 132 ? ILE A 134 ? ASP A 130 ILE A 132 5 ? 3  
HELX_P HELX_P5  AA5 THR A 138 ? TYR A 147 ? THR A 136 TYR A 145 1 ? 10 
HELX_P HELX_P6  AA6 TYR A 147 ? ASN A 152 ? TYR A 145 ASN A 150 1 ? 6  
HELX_P HELX_P7  AA7 MET A 157 ? LEU A 175 ? MET A 155 LEU A 173 1 ? 19 
HELX_P HELX_P8  AA8 CYS A 184 ? ARG A 189 ? CYS A 182 ARG A 187 1 ? 6  
HELX_P HELX_P9  AA9 PRO A 213 ? THR A 217 ? PRO A 211 THR A 215 5 ? 5  
HELX_P HELX_P10 AB1 GLY A 218 ? LEU A 230 ? GLY A 216 LEU A 228 1 ? 13 
HELX_P HELX_P11 AB2 GLU A 278 ? LYS A 280 ? GLU A 276 LYS A 278 5 ? 3  
HELX_P HELX_P12 AB3 SER A 281 ? GLY A 291 ? SER A 279 GLY A 289 1 ? 11 
HELX_P HELX_P13 AB4 SER A 292 ? LYS A 306 ? SER A 290 LYS A 304 1 ? 15 
HELX_P HELX_P14 AB5 THR A 320 ? GLY A 332 ? THR A 318 GLY A 330 1 ? 13 
HELX_P HELX_P15 AB6 LYS A 346 ? ASP A 351 ? LYS A 344 ASP A 349 1 ? 6  
HELX_P HELX_P16 AB7 SER A 358 ? LEU A 366 ? SER A 356 LEU A 364 1 ? 9  
HELX_P HELX_P17 AB8 LYS A 372 ? ARG A 376 ? LYS A 370 ARG A 374 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 102 O   ? ? ? 1_555 E NA  .  NA ? ? A THR 100 A NA  401 1_555 ? ? ? ? ? ? ?            2.472 ? 
metalc2  metalc ? ? A VAL 104 O   ? ? ? 1_555 E NA  .  NA ? ? A VAL 102 A NA  401 1_555 ? ? ? ? ? ? ?            2.923 ? 
metalc3  metalc ? ? A PHE 107 O   ? ? ? 1_555 E NA  .  NA ? ? A PHE 105 A NA  401 1_555 ? ? ? ? ? ? ?            2.935 ? 
metalc4  metalc ? ? B DA  5   OP1 ? ? ? 1_555 E NA  .  NA ? ? C DA  5   A NA  401 1_555 ? ? ? ? ? ? ?            2.534 ? 
metalc5  metalc ? ? E NA  .   NA  ? ? ? 1_555 F HOH .  O  ? ? A NA  401 A HOH 646 1_555 ? ? ? ? ? ? ?            2.849 ? 
metalc6  metalc ? ? E NA  .   NA  ? ? ? 1_555 G HOH .  O  ? ? A NA  401 C HOH 117 1_555 ? ? ? ? ? ? ?            2.160 ? 
hydrog1  hydrog ? ? B DC  1   N3  ? ? ? 1_555 D DG  11 N1 ? ? C DC  1   B DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4  ? ? ? 1_555 D DG  11 O6 ? ? C DC  1   B DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2  ? ? ? 1_555 D DG  11 N2 ? ? C DC  1   B DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  2   N1  ? ? ? 1_555 D DT  10 N3 ? ? C DA  2   B DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  2   N6  ? ? ? 1_555 D DT  10 O4 ? ? C DA  2   B DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  3   N1  ? ? ? 1_555 D DC  9  N3 ? ? C DG  3   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3   N2  ? ? ? 1_555 D DC  9  O2 ? ? C DG  3   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3   O6  ? ? ? 1_555 D DC  9  N4 ? ? C DG  3   B DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DT  4   N3  ? ? ? 1_555 D DA  8  N1 ? ? C DT  4   B DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DT  4   O4  ? ? ? 1_555 D DA  8  N6 ? ? C DT  4   B DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  5   N1  ? ? ? 1_555 D DT  7  N3 ? ? C DA  5   B DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  5   N6  ? ? ? 1_555 D DT  7  O4 ? ? C DA  5   B DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  6   N3  ? ? ? 1_555 D DG  6  N1 ? ? C DC  6   B DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  6   N4  ? ? ? 1_555 D DG  6  O6 ? ? C DC  6   B DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  6   O2  ? ? ? 1_555 D DG  6  N2 ? ? C DC  6   B DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DT  7   N3  ? ? ? 1_555 D DA  5  N1 ? ? C DT  7   B DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  7   O4  ? ? ? 1_555 D DA  5  N6 ? ? C DT  7   B DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  1   N1  ? ? ? 1_555 D DC  4  N3 ? ? D DG  1   B DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  1   N2  ? ? ? 1_555 D DC  4  O2 ? ? D DG  1   B DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG  1   O6  ? ? ? 1_555 D DC  4  N4 ? ? D DG  1   B DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DC  2   N3  ? ? ? 1_555 D DG  3  N1 ? ? D DC  2   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DC  2   N4  ? ? ? 1_555 D DG  3  O6 ? ? D DC  2   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DC  2   O2  ? ? ? 1_555 D DG  3  N2 ? ? D DC  2   B DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           291 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            289 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    292 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     290 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.76 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 155 ? PRO A 156 ? ILE A 153 PRO A 154 
AA1 2 PHE A 193 ? SER A 194 ? PHE A 191 SER A 192 
AA2 1 PHE A 179 ? ILE A 183 ? PHE A 177 ILE A 181 
AA2 2 VAL A 197 ? ARG A 203 ? VAL A 195 ARG A 201 
AA2 3 ARG A 270 ? ILE A 277 ? ARG A 268 ILE A 275 
AA2 4 LYS A 243 ? GLY A 248 ? LYS A 241 GLY A 246 
AA2 5 LEU A 233 ? GLN A 239 ? LEU A 231 GLN A 237 
AA3 1 TYR A 308 ? ASN A 311 ? TYR A 306 ASN A 309 
AA3 2 GLY A 314 ? LYS A 317 ? GLY A 312 LYS A 315 
AA4 1 GLU A 340 ? GLU A 341 ? GLU A 338 GLU A 339 
AA4 2 VAL A 344 ? PRO A 345 ? VAL A 342 PRO A 343 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 155 ? N ILE A 153 O SER A 194 ? O SER A 192 
AA2 1 2 N LEU A 182 ? N LEU A 180 O ILE A 200 ? O ILE A 198 
AA2 2 3 N LEU A 201 ? N LEU A 199 O ARG A 275 ? O ARG A 273 
AA2 3 4 O ARG A 270 ? O ARG A 268 N GLY A 248 ? N GLY A 246 
AA2 4 5 O MET A 245 ? O MET A 243 N ALA A 238 ? N ALA A 236 
AA3 1 2 N LEU A 309 ? N LEU A 307 O PHE A 316 ? O PHE A 314 
AA4 1 2 N GLU A 341 ? N GLU A 339 O VAL A 344 ? O VAL A 342 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NA 
_struct_site.pdbx_auth_seq_id     401 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue NA A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 THR A 102 ? THR A 100 . ? 1_555 ? 
2 AC1 6 VAL A 104 ? VAL A 102 . ? 1_555 ? 
3 AC1 6 PHE A 107 ? PHE A 105 . ? 1_555 ? 
4 AC1 6 HOH F .   ? HOH A 646 . ? 1_555 ? 
5 AC1 6 DA  B 5   ? DA  C 5   . ? 1_555 ? 
6 AC1 6 HOH G .   ? HOH C 117 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4P4P 
_atom_sites.fract_transf_matrix[1][1]   0.009390 
_atom_sites.fract_transf_matrix[1][2]   0.005421 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010843 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006265 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 34  ? 6.742   -31.216 9.428   1.00 64.22  ? 32  LYS A N     1 
ATOM   2    C  CA    . LYS A 1 34  ? 6.102   -32.368 8.802   1.00 63.57  ? 32  LYS A CA    1 
ATOM   3    C  C     . LYS A 1 34  ? 6.638   -33.663 9.390   1.00 64.28  ? 32  LYS A C     1 
ATOM   4    O  O     . LYS A 1 34  ? 5.948   -34.683 9.400   1.00 65.73  ? 32  LYS A O     1 
ATOM   5    C  CB    . LYS A 1 34  ? 6.315   -32.355 7.282   1.00 63.98  ? 32  LYS A CB    1 
ATOM   6    C  CG    . LYS A 1 34  ? 7.743   -32.667 6.844   1.00 66.68  ? 32  LYS A CG    1 
ATOM   7    C  CD    . LYS A 1 34  ? 7.965   -32.362 5.367   1.00 69.55  ? 32  LYS A CD    1 
ATOM   8    C  CE    . LYS A 1 34  ? 7.196   -33.311 4.461   1.00 70.86  ? 32  LYS A CE    1 
ATOM   9    N  NZ    . LYS A 1 34  ? 7.720   -34.704 4.507   1.00 72.98  ? 32  LYS A NZ    1 
ATOM   10   N  N     . TYR A 1 35  ? 7.874   -33.618 9.879   1.00 64.10  ? 33  TYR A N     1 
ATOM   11   C  CA    . TYR A 1 35  ? 8.506   -34.798 10.451  1.00 66.07  ? 33  TYR A CA    1 
ATOM   12   C  C     . TYR A 1 35  ? 7.987   -35.044 11.860  1.00 70.77  ? 33  TYR A C     1 
ATOM   13   O  O     . TYR A 1 35  ? 7.621   -36.170 12.211  1.00 71.90  ? 33  TYR A O     1 
ATOM   14   C  CB    . TYR A 1 35  ? 10.031  -34.653 10.438  1.00 64.38  ? 33  TYR A CB    1 
ATOM   15   C  CG    . TYR A 1 35  ? 10.586  -34.480 9.041   1.00 62.87  ? 33  TYR A CG    1 
ATOM   16   C  CD1   . TYR A 1 35  ? 10.606  -35.544 8.146   1.00 60.04  ? 33  TYR A CD1   1 
ATOM   17   C  CD2   . TYR A 1 35  ? 11.077  -33.253 8.612   1.00 62.68  ? 33  TYR A CD2   1 
ATOM   18   C  CE1   . TYR A 1 35  ? 11.102  -35.390 6.866   1.00 58.84  ? 33  TYR A CE1   1 
ATOM   19   C  CE2   . TYR A 1 35  ? 11.574  -33.090 7.333   1.00 61.62  ? 33  TYR A CE2   1 
ATOM   20   C  CZ    . TYR A 1 35  ? 11.583  -34.162 6.464   1.00 60.89  ? 33  TYR A CZ    1 
ATOM   21   O  OH    . TYR A 1 35  ? 12.077  -34.006 5.187   1.00 61.64  ? 33  TYR A OH    1 
ATOM   22   N  N     . LYS A 1 36  ? 7.941   -33.979 12.655  1.00 72.27  ? 34  LYS A N     1 
ATOM   23   C  CA    . LYS A 1 36  ? 7.393   -34.050 14.004  1.00 73.31  ? 34  LYS A CA    1 
ATOM   24   C  C     . LYS A 1 36  ? 5.955   -34.571 13.965  1.00 72.49  ? 34  LYS A C     1 
ATOM   25   O  O     . LYS A 1 36  ? 5.557   -35.385 14.796  1.00 71.57  ? 34  LYS A O     1 
ATOM   26   C  CB    . LYS A 1 36  ? 7.475   -32.679 14.681  1.00 75.15  ? 34  LYS A CB    1 
ATOM   27   C  CG    . LYS A 1 36  ? 8.905   -32.157 14.808  1.00 77.98  ? 34  LYS A CG    1 
ATOM   28   C  CD    . LYS A 1 36  ? 8.968   -30.641 14.990  1.00 80.37  ? 34  LYS A CD    1 
ATOM   29   C  CE    . LYS A 1 36  ? 8.985   -30.232 16.457  1.00 84.24  ? 34  LYS A CE    1 
ATOM   30   N  NZ    . LYS A 1 36  ? 7.641   -30.329 17.094  1.00 86.08  ? 34  LYS A NZ    1 
ATOM   31   N  N     . VAL A 1 37  ? 5.186   -34.113 12.981  1.00 73.35  ? 35  VAL A N     1 
ATOM   32   C  CA    . VAL A 1 37  ? 3.826   -34.607 12.777  1.00 73.32  ? 35  VAL A CA    1 
ATOM   33   C  C     . VAL A 1 37  ? 3.812   -36.099 12.440  1.00 75.68  ? 35  VAL A C     1 
ATOM   34   O  O     . VAL A 1 37  ? 3.500   -36.941 13.287  1.00 77.37  ? 35  VAL A O     1 
ATOM   35   C  CB    . VAL A 1 37  ? 3.110   -33.834 11.653  1.00 70.57  ? 35  VAL A CB    1 
ATOM   36   C  CG1   . VAL A 1 37  ? 1.825   -34.545 11.253  1.00 69.52  ? 35  VAL A CG1   1 
ATOM   37   C  CG2   . VAL A 1 37  ? 2.835   -32.396 12.083  1.00 70.03  ? 35  VAL A CG2   1 
ATOM   38   N  N     . PRO A 1 93  ? -3.300  -18.984 20.968  1.00 79.74  ? 91  PRO A N     1 
ATOM   39   C  CA    . PRO A 1 93  ? -4.323  -18.186 20.283  1.00 76.89  ? 91  PRO A CA    1 
ATOM   40   C  C     . PRO A 1 93  ? -4.062  -18.123 18.782  1.00 72.34  ? 91  PRO A C     1 
ATOM   41   O  O     . PRO A 1 93  ? -4.836  -18.661 17.990  1.00 69.23  ? 91  PRO A O     1 
ATOM   42   C  CB    . PRO A 1 93  ? -4.148  -16.792 20.896  1.00 78.93  ? 91  PRO A CB    1 
ATOM   43   C  CG    . PRO A 1 93  ? -3.489  -17.029 22.207  1.00 81.84  ? 91  PRO A CG    1 
ATOM   44   C  CD    . PRO A 1 93  ? -2.583  -18.202 21.989  1.00 81.98  ? 91  PRO A CD    1 
ATOM   45   N  N     . LYS A 1 94  ? -2.975  -17.457 18.410  1.00 70.35  ? 92  LYS A N     1 
ATOM   46   C  CA    . LYS A 1 94  ? -2.547  -17.365 17.022  1.00 66.88  ? 92  LYS A CA    1 
ATOM   47   C  C     . LYS A 1 94  ? -2.410  -18.767 16.422  1.00 65.71  ? 92  LYS A C     1 
ATOM   48   O  O     . LYS A 1 94  ? -2.713  -18.985 15.250  1.00 62.46  ? 92  LYS A O     1 
ATOM   49   C  CB    . LYS A 1 94  ? -1.212  -16.616 16.945  1.00 65.96  ? 92  LYS A CB    1 
ATOM   50   C  CG    . LYS A 1 94  ? -0.687  -16.366 15.542  1.00 65.18  ? 92  LYS A CG    1 
ATOM   51   C  CD    . LYS A 1 94  ? 0.821   -16.152 15.560  1.00 66.14  ? 92  LYS A CD    1 
ATOM   52   C  CE    . LYS A 1 94  ? 1.340   -15.592 14.243  1.00 65.70  ? 92  LYS A CE    1 
ATOM   53   N  NZ    . LYS A 1 94  ? 1.093   -14.132 14.122  1.00 66.33  ? 92  LYS A NZ    1 
ATOM   54   N  N     . LEU A 1 95  ? -1.966  -19.719 17.235  1.00 65.18  ? 93  LEU A N     1 
ATOM   55   C  CA    . LEU A 1 95  ? -1.775  -21.085 16.767  1.00 59.76  ? 93  LEU A CA    1 
ATOM   56   C  C     . LEU A 1 95  ? -3.106  -21.745 16.436  1.00 56.13  ? 93  LEU A C     1 
ATOM   57   O  O     . LEU A 1 95  ? -3.238  -22.406 15.405  1.00 55.61  ? 93  LEU A O     1 
ATOM   58   C  CB    . LEU A 1 95  ? -1.014  -21.921 17.800  1.00 59.92  ? 93  LEU A CB    1 
ATOM   59   N  N     . LYS A 1 96  ? -4.090  -21.567 17.312  1.00 55.77  ? 94  LYS A N     1 
ATOM   60   C  CA    . LYS A 1 96  ? -5.409  -22.166 17.117  1.00 51.71  ? 94  LYS A CA    1 
ATOM   61   C  C     . LYS A 1 96  ? -6.105  -21.593 15.878  1.00 45.32  ? 94  LYS A C     1 
ATOM   62   O  O     . LYS A 1 96  ? -6.812  -22.303 15.163  1.00 47.50  ? 94  LYS A O     1 
ATOM   63   C  CB    . LYS A 1 96  ? -6.277  -21.962 18.362  1.00 53.29  ? 94  LYS A CB    1 
ATOM   64   N  N     . ALA A 1 97  ? -5.900  -20.304 15.638  1.00 39.14  ? 95  ALA A N     1 
ATOM   65   C  CA    . ALA A 1 97  ? -6.405  -19.644 14.442  1.00 36.84  ? 95  ALA A CA    1 
ATOM   66   C  C     . ALA A 1 97  ? -5.751  -20.221 13.185  1.00 42.12  ? 95  ALA A C     1 
ATOM   67   O  O     . ALA A 1 97  ? -6.415  -20.460 12.176  1.00 40.90  ? 95  ALA A O     1 
ATOM   68   C  CB    . ALA A 1 97  ? -6.151  -18.157 14.527  1.00 32.39  ? 95  ALA A CB    1 
ATOM   69   N  N     . ILE A 1 98  ? -4.442  -20.435 13.248  1.00 45.37  ? 96  ILE A N     1 
ATOM   70   C  CA    . ILE A 1 98  ? -3.724  -21.039 12.136  1.00 48.18  ? 96  ILE A CA    1 
ATOM   71   C  C     . ILE A 1 98  ? -4.292  -22.425 11.852  1.00 48.94  ? 96  ILE A C     1 
ATOM   72   O  O     . ILE A 1 98  ? -4.530  -22.795 10.705  1.00 48.73  ? 96  ILE A O     1 
ATOM   73   C  CB    . ILE A 1 98  ? -2.213  -21.120 12.417  1.00 50.65  ? 96  ILE A CB    1 
ATOM   74   C  CG1   . ILE A 1 98  ? -1.635  -19.710 12.519  1.00 53.23  ? 96  ILE A CG1   1 
ATOM   75   C  CG2   . ILE A 1 98  ? -1.499  -21.912 11.325  1.00 49.39  ? 96  ILE A CG2   1 
ATOM   76   C  CD1   . ILE A 1 98  ? -0.167  -19.666 12.858  1.00 56.09  ? 96  ILE A CD1   1 
ATOM   77   N  N     . GLN A 1 99  ? -4.540  -23.179 12.911  1.00 50.18  ? 97  GLN A N     1 
ATOM   78   C  CA    . GLN A 1 99  ? -5.121  -24.506 12.778  1.00 49.14  ? 97  GLN A CA    1 
ATOM   79   C  C     . GLN A 1 99  ? -6.508  -24.456 12.120  1.00 45.95  ? 97  GLN A C     1 
ATOM   80   O  O     . GLN A 1 99  ? -6.884  -25.360 11.388  1.00 42.14  ? 97  GLN A O     1 
ATOM   81   C  CB    . GLN A 1 99  ? -5.189  -25.174 14.147  1.00 53.68  ? 97  GLN A CB    1 
ATOM   82   C  CG    . GLN A 1 99  ? -5.614  -26.632 14.124  1.00 59.08  ? 97  GLN A CG    1 
ATOM   83   C  CD    . GLN A 1 99  ? -5.485  -27.288 15.491  1.00 63.81  ? 97  GLN A CD    1 
ATOM   84   O  OE1   . GLN A 1 99  ? -4.807  -26.766 16.380  1.00 65.76  ? 97  GLN A OE1   1 
ATOM   85   N  NE2   . GLN A 1 99  ? -6.138  -28.434 15.665  1.00 63.88  ? 97  GLN A NE2   1 
ATOM   86   N  N     . GLU A 1 100 ? -7.259  -23.392 12.385  1.00 46.72  ? 98  GLU A N     1 
ATOM   87   C  CA    . GLU A 1 100 ? -8.565  -23.193 11.761  1.00 44.88  ? 98  GLU A CA    1 
ATOM   88   C  C     . GLU A 1 100 ? -8.416  -22.830 10.291  1.00 40.66  ? 98  GLU A C     1 
ATOM   89   O  O     . GLU A 1 100 ? -8.976  -23.488 9.417   1.00 36.87  ? 98  GLU A O     1 
ATOM   90   C  CB    . GLU A 1 100 ? -9.340  -22.066 12.472  1.00 44.35  ? 98  GLU A CB    1 
ATOM   91   C  CG    . GLU A 1 100 ? -10.214 -22.517 13.650  1.00 50.06  ? 98  GLU A CG    1 
ATOM   92   C  CD    . GLU A 1 100 ? -11.626 -22.921 13.234  1.00 52.46  ? 98  GLU A CD    1 
ATOM   93   O  OE1   . GLU A 1 100 ? -12.311 -22.122 12.551  1.00 48.28  ? 98  GLU A OE1   1 
ATOM   94   O  OE2   . GLU A 1 100 ? -12.051 -24.041 13.595  1.00 57.10  ? 98  GLU A OE2   1 
ATOM   95   N  N     . LEU A 1 101 ? -7.658  -21.766 10.040  1.00 40.24  ? 99  LEU A N     1 
ATOM   96   C  CA    . LEU A 1 101 ? -7.620  -21.122 8.732   1.00 40.46  ? 99  LEU A CA    1 
ATOM   97   C  C     . LEU A 1 101 ? -6.969  -21.961 7.627   1.00 40.51  ? 99  LEU A C     1 
ATOM   98   O  O     . LEU A 1 101 ? -7.288  -21.789 6.451   1.00 41.38  ? 99  LEU A O     1 
ATOM   99   C  CB    . LEU A 1 101 ? -6.946  -19.749 8.834   1.00 37.29  ? 99  LEU A CB    1 
ATOM   100  C  CG    . LEU A 1 101 ? -7.663  -18.738 9.717   1.00 37.73  ? 99  LEU A CG    1 
ATOM   101  C  CD1   . LEU A 1 101 ? -6.818  -17.477 9.896   1.00 39.57  ? 99  LEU A CD1   1 
ATOM   102  C  CD2   . LEU A 1 101 ? -9.029  -18.397 9.154   1.00 37.85  ? 99  LEU A CD2   1 
ATOM   103  N  N     . THR A 1 102 ? -6.079  -22.874 7.999   1.00 37.74  ? 100 THR A N     1 
ATOM   104  C  CA    . THR A 1 102 ? -5.431  -23.721 7.005   1.00 36.57  ? 100 THR A CA    1 
ATOM   105  C  C     . THR A 1 102 ? -6.346  -24.834 6.525   1.00 36.75  ? 100 THR A C     1 
ATOM   106  O  O     . THR A 1 102 ? -5.922  -25.708 5.788   1.00 38.12  ? 100 THR A O     1 
ATOM   107  C  CB    . THR A 1 102 ? -4.140  -24.358 7.534   1.00 38.29  ? 100 THR A CB    1 
ATOM   108  O  OG1   . THR A 1 102 ? -4.445  -25.221 8.633   1.00 38.49  ? 100 THR A OG1   1 
ATOM   109  C  CG2   . THR A 1 102 ? -3.141  -23.285 7.973   1.00 37.25  ? 100 THR A CG2   1 
ATOM   110  N  N     . GLN A 1 103 ? -7.595  -24.821 6.973   1.00 39.72  ? 101 GLN A N     1 
ATOM   111  C  CA    . GLN A 1 103 ? -8.581  -25.756 6.455   1.00 40.11  ? 101 GLN A CA    1 
ATOM   112  C  C     . GLN A 1 103 ? -9.031  -25.268 5.095   1.00 37.73  ? 101 GLN A C     1 
ATOM   113  O  O     . GLN A 1 103 ? -9.587  -26.032 4.308   1.00 36.67  ? 101 GLN A O     1 
ATOM   114  C  CB    . GLN A 1 103 ? -9.795  -25.821 7.373   1.00 42.24  ? 101 GLN A CB    1 
ATOM   115  C  CG    . GLN A 1 103 ? -9.560  -26.533 8.680   1.00 46.37  ? 101 GLN A CG    1 
ATOM   116  C  CD    . GLN A 1 103 ? -10.785 -26.494 9.561   1.00 49.09  ? 101 GLN A CD    1 
ATOM   117  O  OE1   . GLN A 1 103 ? -11.459 -27.505 9.748   1.00 52.14  ? 101 GLN A OE1   1 
ATOM   118  N  NE2   . GLN A 1 103 ? -11.086 -25.320 10.105  1.00 49.71  ? 101 GLN A NE2   1 
ATOM   119  N  N     . VAL A 1 104 ? -8.804  -23.980 4.843   1.00 32.94  ? 102 VAL A N     1 
ATOM   120  C  CA    . VAL A 1 104 ? -9.229  -23.331 3.613   1.00 32.75  ? 102 VAL A CA    1 
ATOM   121  C  C     . VAL A 1 104 ? -8.183  -23.530 2.528   1.00 31.62  ? 102 VAL A C     1 
ATOM   122  O  O     . VAL A 1 104 ? -6.999  -23.308 2.758   1.00 31.94  ? 102 VAL A O     1 
ATOM   123  C  CB    . VAL A 1 104 ? -9.474  -21.816 3.829   1.00 36.05  ? 102 VAL A CB    1 
ATOM   124  C  CG1   . VAL A 1 104 ? -9.909  -21.154 2.532   1.00 36.09  ? 102 VAL A CG1   1 
ATOM   125  C  CG2   . VAL A 1 104 ? -10.531 -21.598 4.915   1.00 35.79  ? 102 VAL A CG2   1 
ATOM   126  N  N     . HIS A 1 105 ? -8.619  -23.959 1.349   1.00 30.33  ? 103 HIS A N     1 
ATOM   127  C  CA    . HIS A 1 105 ? -7.692  -24.190 0.241   1.00 31.12  ? 103 HIS A CA    1 
ATOM   128  C  C     . HIS A 1 105 ? -6.967  -22.904 -0.172  1.00 29.32  ? 103 HIS A C     1 
ATOM   129  O  O     . HIS A 1 105 ? -7.597  -21.881 -0.438  1.00 30.39  ? 103 HIS A O     1 
ATOM   130  C  CB    . HIS A 1 105 ? -8.424  -24.786 -0.963  1.00 32.13  ? 103 HIS A CB    1 
ATOM   131  C  CG    . HIS A 1 105 ? -7.549  -24.941 -2.171  1.00 31.05  ? 103 HIS A CG    1 
ATOM   132  N  ND1   . HIS A 1 105 ? -7.112  -26.168 -2.624  1.00 29.97  ? 103 HIS A ND1   1 
ATOM   133  C  CD2   . HIS A 1 105 ? -7.011  -24.017 -2.999  1.00 30.39  ? 103 HIS A CD2   1 
ATOM   134  C  CE1   . HIS A 1 105 ? -6.353  -25.992 -3.693  1.00 31.03  ? 103 HIS A CE1   1 
ATOM   135  N  NE2   . HIS A 1 105 ? -6.270  -24.699 -3.937  1.00 30.91  ? 103 HIS A NE2   1 
ATOM   136  N  N     . GLY A 1 106 ? -5.645  -22.953 -0.215  1.00 27.15  ? 104 GLY A N     1 
ATOM   137  C  CA    . GLY A 1 106 ? -4.875  -21.790 -0.596  1.00 27.24  ? 104 GLY A CA    1 
ATOM   138  C  C     . GLY A 1 106 ? -4.224  -21.117 0.592   1.00 31.34  ? 104 GLY A C     1 
ATOM   139  O  O     . GLY A 1 106 ? -3.356  -20.259 0.438   1.00 32.66  ? 104 GLY A O     1 
ATOM   140  N  N     . PHE A 1 107 ? -4.650  -21.507 1.785   1.00 30.91  ? 105 PHE A N     1 
ATOM   141  C  CA    . PHE A 1 107 ? -4.098  -20.932 3.002   1.00 33.43  ? 105 PHE A CA    1 
ATOM   142  C  C     . PHE A 1 107 ? -3.225  -21.930 3.750   1.00 32.62  ? 105 PHE A C     1 
ATOM   143  O  O     . PHE A 1 107 ? -3.682  -23.001 4.143   1.00 31.35  ? 105 PHE A O     1 
ATOM   144  C  CB    . PHE A 1 107 ? -5.214  -20.373 3.900   1.00 31.79  ? 105 PHE A CB    1 
ATOM   145  C  CG    . PHE A 1 107 ? -5.933  -19.197 3.300   1.00 30.43  ? 105 PHE A CG    1 
ATOM   146  C  CD1   . PHE A 1 107 ? -6.982  -19.389 2.413   1.00 31.71  ? 105 PHE A CD1   1 
ATOM   147  C  CD2   . PHE A 1 107 ? -5.554  -17.903 3.606   1.00 30.80  ? 105 PHE A CD2   1 
ATOM   148  C  CE1   . PHE A 1 107 ? -7.643  -18.318 1.851   1.00 32.83  ? 105 PHE A CE1   1 
ATOM   149  C  CE2   . PHE A 1 107 ? -6.214  -16.817 3.041   1.00 32.05  ? 105 PHE A CE2   1 
ATOM   150  C  CZ    . PHE A 1 107 ? -7.256  -17.023 2.166   1.00 33.17  ? 105 PHE A CZ    1 
ATOM   151  N  N     . GLY A 1 108 ? -1.951  -21.580 3.907   1.00 35.68  ? 106 GLY A N     1 
ATOM   152  C  CA    . GLY A 1 108 ? -1.043  -22.339 4.748   1.00 36.96  ? 106 GLY A CA    1 
ATOM   153  C  C     . GLY A 1 108 ? -0.734  -21.512 5.985   1.00 40.05  ? 106 GLY A C     1 
ATOM   154  O  O     . GLY A 1 108 ? -1.308  -20.431 6.175   1.00 41.74  ? 106 GLY A O     1 
ATOM   155  N  N     . PRO A 1 109 ? 0.179   -22.005 6.832   1.00 41.58  ? 107 PRO A N     1 
ATOM   156  C  CA    . PRO A 1 109 ? 0.601   -21.284 8.042   1.00 43.86  ? 107 PRO A CA    1 
ATOM   157  C  C     . PRO A 1 109 ? 0.965   -19.813 7.790   1.00 46.76  ? 107 PRO A C     1 
ATOM   158  O  O     . PRO A 1 109 ? 0.674   -18.944 8.618   1.00 46.91  ? 107 PRO A O     1 
ATOM   159  C  CB    . PRO A 1 109 ? 1.836   -22.060 8.490   1.00 41.95  ? 107 PRO A CB    1 
ATOM   160  C  CG    . PRO A 1 109 ? 1.593   -23.446 8.002   1.00 41.72  ? 107 PRO A CG    1 
ATOM   161  C  CD    . PRO A 1 109 ? 0.857   -23.304 6.695   1.00 39.76  ? 107 PRO A CD    1 
ATOM   162  N  N     . ARG A 1 110 ? 1.591   -19.526 6.657   1.00 46.56  ? 108 ARG A N     1 
ATOM   163  C  CA    . ARG A 1 110 ? 2.014   -18.160 6.395   1.00 47.06  ? 108 ARG A CA    1 
ATOM   164  C  C     . ARG A 1 110 ? 0.833   -17.234 6.126   1.00 44.02  ? 108 ARG A C     1 
ATOM   165  O  O     . ARG A 1 110 ? 0.738   -16.159 6.722   1.00 45.64  ? 108 ARG A O     1 
ATOM   166  C  CB    . ARG A 1 110 ? 3.023   -18.101 5.243   1.00 49.60  ? 108 ARG A CB    1 
ATOM   167  C  CG    . ARG A 1 110 ? 3.547   -16.700 4.957   1.00 51.22  ? 108 ARG A CG    1 
ATOM   168  N  N     . ALA A 1 111 ? -0.064  -17.635 5.227   1.00 42.09  ? 109 ALA A N     1 
ATOM   169  C  CA    . ALA A 1 111 ? -1.223  -16.797 4.925   1.00 42.08  ? 109 ALA A CA    1 
ATOM   170  C  C     . ALA A 1 111 ? -2.107  -16.702 6.160   1.00 42.43  ? 109 ALA A C     1 
ATOM   171  O  O     . ALA A 1 111 ? -2.734  -15.670 6.414   1.00 46.67  ? 109 ALA A O     1 
ATOM   172  C  CB    . ALA A 1 111 ? -2.009  -17.351 3.760   1.00 42.99  ? 109 ALA A CB    1 
ATOM   173  N  N     . ALA A 1 112 ? -2.143  -17.777 6.937   1.00 37.96  ? 110 ALA A N     1 
ATOM   174  C  CA    . ALA A 1 112 ? -3.012  -17.809 8.113   1.00 42.61  ? 110 ALA A CA    1 
ATOM   175  C  C     . ALA A 1 112 ? -2.531  -16.790 9.145   1.00 46.33  ? 110 ALA A C     1 
ATOM   176  O  O     . ALA A 1 112 ? -3.308  -15.949 9.616   1.00 46.69  ? 110 ALA A O     1 
ATOM   177  C  CB    . ALA A 1 112 ? -3.084  -19.210 8.704   1.00 39.53  ? 110 ALA A CB    1 
ATOM   178  N  N     . ALA A 1 113 ? -1.240  -16.846 9.464   1.00 47.29  ? 111 ALA A N     1 
ATOM   179  C  CA    . ALA A 1 113 ? -0.634  -15.885 10.385  1.00 48.73  ? 111 ALA A CA    1 
ATOM   180  C  C     . ALA A 1 113 ? -0.859  -14.433 9.950   1.00 50.43  ? 111 ALA A C     1 
ATOM   181  O  O     . ALA A 1 113 ? -1.113  -13.566 10.782  1.00 55.91  ? 111 ALA A O     1 
ATOM   182  C  CB    . ALA A 1 113 ? 0.838   -16.168 10.553  1.00 49.04  ? 111 ALA A CB    1 
ATOM   183  N  N     . ALA A 1 114 ? -0.776  -14.166 8.651   1.00 48.59  ? 112 ALA A N     1 
ATOM   184  C  CA    . ALA A 1 114 ? -1.001  -12.812 8.155   1.00 47.54  ? 112 ALA A CA    1 
ATOM   185  C  C     . ALA A 1 114 ? -2.461  -12.398 8.318   1.00 47.61  ? 112 ALA A C     1 
ATOM   186  O  O     . ALA A 1 114 ? -2.764  -11.230 8.562   1.00 47.53  ? 112 ALA A O     1 
ATOM   187  C  CB    . ALA A 1 114 ? -0.561  -12.681 6.692   1.00 45.95  ? 112 ALA A CB    1 
ATOM   188  N  N     . LEU A 1 115 ? -3.368  -13.355 8.170   1.00 47.34  ? 113 LEU A N     1 
ATOM   189  C  CA    . LEU A 1 115 ? -4.777  -13.081 8.394   1.00 43.95  ? 113 LEU A CA    1 
ATOM   190  C  C     . LEU A 1 115 ? -4.958  -12.697 9.850   1.00 44.18  ? 113 LEU A C     1 
ATOM   191  O  O     . LEU A 1 115 ? -5.559  -11.671 10.166  1.00 46.40  ? 113 LEU A O     1 
ATOM   192  C  CB    . LEU A 1 115 ? -5.625  -14.307 8.071   1.00 42.97  ? 113 LEU A CB    1 
ATOM   193  C  CG    . LEU A 1 115 ? -5.924  -14.570 6.599   1.00 41.19  ? 113 LEU A CG    1 
ATOM   194  C  CD1   . LEU A 1 115 ? -6.857  -15.768 6.466   1.00 38.61  ? 113 LEU A CD1   1 
ATOM   195  C  CD2   . LEU A 1 115 ? -6.540  -13.337 5.970   1.00 42.26  ? 113 LEU A CD2   1 
ATOM   196  N  N     . PHE A 1 116 ? -4.431  -13.536 10.733  1.00 42.92  ? 114 PHE A N     1 
ATOM   197  C  CA    . PHE A 1 116 ? -4.474  -13.272 12.156  1.00 44.40  ? 114 PHE A CA    1 
ATOM   198  C  C     . PHE A 1 116 ? -3.876  -11.890 12.468  1.00 47.30  ? 114 PHE A C     1 
ATOM   199  O  O     . PHE A 1 116 ? -4.576  -10.999 12.960  1.00 43.43  ? 114 PHE A O     1 
ATOM   200  C  CB    . PHE A 1 116 ? -3.730  -14.371 12.906  1.00 45.76  ? 114 PHE A CB    1 
ATOM   201  C  CG    . PHE A 1 116 ? -3.909  -14.314 14.392  1.00 49.80  ? 114 PHE A CG    1 
ATOM   202  C  CD1   . PHE A 1 116 ? -3.055  -13.554 15.179  1.00 51.94  ? 114 PHE A CD1   1 
ATOM   203  C  CD2   . PHE A 1 116 ? -4.934  -15.019 15.007  1.00 50.39  ? 114 PHE A CD2   1 
ATOM   204  C  CE1   . PHE A 1 116 ? -3.222  -13.498 16.551  1.00 51.21  ? 114 PHE A CE1   1 
ATOM   205  C  CE2   . PHE A 1 116 ? -5.108  -14.966 16.377  1.00 50.84  ? 114 PHE A CE2   1 
ATOM   206  C  CZ    . PHE A 1 116 ? -4.251  -14.205 17.152  1.00 51.12  ? 114 PHE A CZ    1 
ATOM   207  N  N     . ASP A 1 117 ? -2.597  -11.701 12.144  1.00 51.40  ? 115 ASP A N     1 
ATOM   208  C  CA    . ASP A 1 117 ? -1.890  -10.452 12.462  1.00 54.18  ? 115 ASP A CA    1 
ATOM   209  C  C     . ASP A 1 117 ? -2.481  -9.202  11.808  1.00 58.36  ? 115 ASP A C     1 
ATOM   210  O  O     . ASP A 1 117 ? -2.877  -8.258  12.497  1.00 60.75  ? 115 ASP A O     1 
ATOM   211  C  CB    . ASP A 1 117 ? -0.408  -10.575 12.104  1.00 54.35  ? 115 ASP A CB    1 
ATOM   212  C  CG    . ASP A 1 117 ? 0.295   -11.628 12.928  1.00 55.37  ? 115 ASP A CG    1 
ATOM   213  O  OD1   . ASP A 1 117 ? -0.119  -11.826 14.089  1.00 56.92  ? 115 ASP A OD1   1 
ATOM   214  O  OD2   . ASP A 1 117 ? 1.248   -12.260 12.424  1.00 54.16  ? 115 ASP A OD2   1 
ATOM   215  N  N     . ARG A 1 118 ? -2.529  -9.192  10.481  1.00 59.89  ? 116 ARG A N     1 
ATOM   216  C  CA    . ARG A 1 118 ? -2.977  -8.016  9.745   1.00 61.28  ? 116 ARG A CA    1 
ATOM   217  C  C     . ARG A 1 118 ? -4.485  -7.801  9.841   1.00 59.10  ? 116 ARG A C     1 
ATOM   218  O  O     . ARG A 1 118 ? -4.956  -6.666  9.928   1.00 59.21  ? 116 ARG A O     1 
ATOM   219  C  CB    . ARG A 1 118 ? -2.580  -8.123  8.271   1.00 64.66  ? 116 ARG A CB    1 
ATOM   220  C  CG    . ARG A 1 118 ? -1.084  -8.223  8.017   1.00 71.32  ? 116 ARG A CG    1 
ATOM   221  C  CD    . ARG A 1 118 ? -0.797  -8.750  6.611   1.00 75.93  ? 116 ARG A CD    1 
ATOM   222  N  NE    . ARG A 1 118 ? -1.755  -8.251  5.622   1.00 80.99  ? 116 ARG A NE    1 
ATOM   223  C  CZ    . ARG A 1 118 ? -2.800  -8.944  5.169   1.00 82.34  ? 116 ARG A CZ    1 
ATOM   224  N  NH1   . ARG A 1 118 ? -3.028  -10.174 5.610   1.00 82.14  ? 116 ARG A NH1   1 
ATOM   225  N  NH2   . ARG A 1 118 ? -3.617  -8.407  4.271   1.00 82.47  ? 116 ARG A NH2   1 
ATOM   226  N  N     . GLU A 1 119 ? -5.248  -8.885  9.821   1.00 56.51  ? 117 GLU A N     1 
ATOM   227  C  CA    . GLU A 1 119 ? -6.689  -8.749  9.671   1.00 56.16  ? 117 GLU A CA    1 
ATOM   228  C  C     . GLU A 1 119 ? -7.456  -9.065  10.957  1.00 55.61  ? 117 GLU A C     1 
ATOM   229  O  O     . GLU A 1 119 ? -8.640  -8.733  11.077  1.00 55.07  ? 117 GLU A O     1 
ATOM   230  C  CB    . GLU A 1 119 ? -7.171  -9.620  8.508   1.00 56.90  ? 117 GLU A CB    1 
ATOM   231  C  CG    . GLU A 1 119 ? -6.328  -9.463  7.243   1.00 57.94  ? 117 GLU A CG    1 
ATOM   232  C  CD    . GLU A 1 119 ? -6.524  -8.115  6.567   1.00 60.67  ? 117 GLU A CD    1 
ATOM   233  O  OE1   . GLU A 1 119 ? -7.544  -7.453  6.852   1.00 61.06  ? 117 GLU A OE1   1 
ATOM   234  O  OE2   . GLU A 1 119 ? -5.662  -7.716  5.749   1.00 63.00  ? 117 GLU A OE2   1 
ATOM   235  N  N     . GLY A 1 120 ? -6.782  -9.695  11.917  1.00 52.63  ? 118 GLY A N     1 
ATOM   236  C  CA    . GLY A 1 120 ? -7.407  -10.025 13.187  1.00 48.36  ? 118 GLY A CA    1 
ATOM   237  C  C     . GLY A 1 120 ? -8.454  -11.112 13.027  1.00 46.52  ? 118 GLY A C     1 
ATOM   238  O  O     . GLY A 1 120 ? -9.477  -11.121 13.712  1.00 47.05  ? 118 GLY A O     1 
ATOM   239  N  N     . ILE A 1 121 ? -8.191  -12.040 12.117  1.00 44.17  ? 119 ILE A N     1 
ATOM   240  C  CA    . ILE A 1 121 ? -9.120  -13.130 11.841  1.00 44.06  ? 119 ILE A CA    1 
ATOM   241  C  C     . ILE A 1 121 ? -8.725  -14.395 12.581  1.00 43.27  ? 119 ILE A C     1 
ATOM   242  O  O     . ILE A 1 121 ? -7.591  -14.856 12.461  1.00 42.41  ? 119 ILE A O     1 
ATOM   243  C  CB    . ILE A 1 121 ? -9.218  -13.392 10.329  1.00 42.36  ? 119 ILE A CB    1 
ATOM   244  C  CG1   . ILE A 1 121 ? -9.909  -12.198 9.662   1.00 42.81  ? 119 ILE A CG1   1 
ATOM   245  C  CG2   . ILE A 1 121 ? -9.955  -14.707 10.046  1.00 34.31  ? 119 ILE A CG2   1 
ATOM   246  C  CD1   . ILE A 1 121 ? -9.941  -12.270 8.158   1.00 44.36  ? 119 ILE A CD1   1 
ATOM   247  N  N     . PHE A 1 122 ? -9.671  -14.942 13.350  1.00 41.49  ? 120 PHE A N     1 
ATOM   248  C  CA    . PHE A 1 122 ? -9.426  -16.110 14.196  1.00 38.17  ? 120 PHE A CA    1 
ATOM   249  C  C     . PHE A 1 122 ? -10.022 -17.398 13.632  1.00 35.74  ? 120 PHE A C     1 
ATOM   250  O  O     . PHE A 1 122 ? -9.549  -18.491 13.949  1.00 36.44  ? 120 PHE A O     1 
ATOM   251  C  CB    . PHE A 1 122 ? -10.036 -15.895 15.589  1.00 38.41  ? 120 PHE A CB    1 
ATOM   252  C  CG    . PHE A 1 122 ? -9.295  -14.906 16.448  1.00 39.51  ? 120 PHE A CG    1 
ATOM   253  C  CD1   . PHE A 1 122 ? -9.158  -13.584 16.056  1.00 41.73  ? 120 PHE A CD1   1 
ATOM   254  C  CD2   . PHE A 1 122 ? -8.765  -15.295 17.672  1.00 38.89  ? 120 PHE A CD2   1 
ATOM   255  C  CE1   . PHE A 1 122 ? -8.492  -12.670 16.864  1.00 43.31  ? 120 PHE A CE1   1 
ATOM   256  C  CE2   . PHE A 1 122 ? -8.092  -14.382 18.479  1.00 39.79  ? 120 PHE A CE2   1 
ATOM   257  C  CZ    . PHE A 1 122 ? -7.963  -13.074 18.074  1.00 41.06  ? 120 PHE A CZ    1 
ATOM   258  N  N     . THR A 1 123 ? -11.083 -17.275 12.834  1.00 31.89  ? 121 THR A N     1 
ATOM   259  C  CA    . THR A 1 123 ? -11.867 -18.447 12.428  1.00 29.46  ? 121 THR A CA    1 
ATOM   260  C  C     . THR A 1 123 ? -12.177 -18.467 10.942  1.00 34.80  ? 121 THR A C     1 
ATOM   261  O  O     . THR A 1 123 ? -12.144 -17.432 10.270  1.00 37.58  ? 121 THR A O     1 
ATOM   262  C  CB    . THR A 1 123 ? -13.223 -18.513 13.185  1.00 30.25  ? 121 THR A CB    1 
ATOM   263  O  OG1   . THR A 1 123 ? -14.069 -17.439 12.748  1.00 32.40  ? 121 THR A OG1   1 
ATOM   264  C  CG2   . THR A 1 123 ? -13.009 -18.390 14.689  1.00 31.32  ? 121 THR A CG2   1 
ATOM   265  N  N     . VAL A 1 124 ? -12.509 -19.653 10.441  1.00 35.24  ? 122 VAL A N     1 
ATOM   266  C  CA    . VAL A 1 124 ? -12.903 -19.797 9.053   1.00 31.28  ? 122 VAL A CA    1 
ATOM   267  C  C     . VAL A 1 124 ? -14.071 -18.870 8.730   1.00 32.08  ? 122 VAL A C     1 
ATOM   268  O  O     . VAL A 1 124 ? -14.051 -18.177 7.711   1.00 35.53  ? 122 VAL A O     1 
ATOM   269  C  CB    . VAL A 1 124 ? -13.239 -21.258 8.705   1.00 33.20  ? 122 VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 124 ? -13.539 -21.403 7.227   1.00 30.44  ? 122 VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 124 ? -12.079 -22.160 9.080   1.00 36.18  ? 122 VAL A CG2   1 
ATOM   272  N  N     . ASP A 1 125 ? -15.075 -18.826 9.603   1.00 28.31  ? 123 ASP A N     1 
ATOM   273  C  CA    . ASP A 1 125 ? -16.305 -18.105 9.270   1.00 31.37  ? 123 ASP A CA    1 
ATOM   274  C  C     . ASP A 1 125 ? -16.086 -16.605 9.154   1.00 35.12  ? 123 ASP A C     1 
ATOM   275  O  O     . ASP A 1 125 ? -16.756 -15.934 8.368   1.00 35.69  ? 123 ASP A O     1 
ATOM   276  C  CB    . ASP A 1 125 ? -17.442 -18.426 10.252  1.00 32.27  ? 123 ASP A CB    1 
ATOM   277  C  CG    . ASP A 1 125 ? -17.976 -19.849 10.090  1.00 30.65  ? 123 ASP A CG    1 
ATOM   278  O  OD1   . ASP A 1 125 ? -17.591 -20.529 9.120   1.00 25.99  ? 123 ASP A OD1   1 
ATOM   279  O  OD2   . ASP A 1 125 ? -18.786 -20.287 10.932  1.00 31.11  ? 123 ASP A OD2   1 
ATOM   280  N  N     . GLU A 1 126 ? -15.146 -16.083 9.934   1.00 38.17  ? 124 GLU A N     1 
ATOM   281  C  CA    . GLU A 1 126 ? -14.750 -14.680 9.825   1.00 35.32  ? 124 GLU A CA    1 
ATOM   282  C  C     . GLU A 1 126 ? -14.054 -14.432 8.486   1.00 34.15  ? 124 GLU A C     1 
ATOM   283  O  O     . GLU A 1 126 ? -14.277 -13.405 7.846   1.00 33.91  ? 124 GLU A O     1 
ATOM   284  C  CB    . GLU A 1 126 ? -13.818 -14.301 10.975  1.00 33.86  ? 124 GLU A CB    1 
ATOM   285  C  CG    . GLU A 1 126 ? -14.529 -14.035 12.283  1.00 34.28  ? 124 GLU A CG    1 
ATOM   286  C  CD    . GLU A 1 126 ? -13.564 -13.929 13.439  1.00 38.15  ? 124 GLU A CD    1 
ATOM   287  O  OE1   . GLU A 1 126 ? -12.486 -14.561 13.365  1.00 40.15  ? 124 GLU A OE1   1 
ATOM   288  O  OE2   . GLU A 1 126 ? -13.878 -13.212 14.415  1.00 40.82  ? 124 GLU A OE2   1 
ATOM   289  N  N     . LEU A 1 127 ? -13.219 -15.384 8.069   1.00 28.48  ? 125 LEU A N     1 
ATOM   290  C  CA    . LEU A 1 127 ? -12.563 -15.304 6.773   1.00 27.48  ? 125 LEU A CA    1 
ATOM   291  C  C     . LEU A 1 127 ? -13.580 -15.367 5.635   1.00 31.68  ? 125 LEU A C     1 
ATOM   292  O  O     . LEU A 1 127 ? -13.531 -14.564 4.706   1.00 34.91  ? 125 LEU A O     1 
ATOM   293  C  CB    . LEU A 1 127 ? -11.517 -16.409 6.628   1.00 24.76  ? 125 LEU A CB    1 
ATOM   294  C  CG    . LEU A 1 127 ? -10.837 -16.477 5.258   1.00 29.14  ? 125 LEU A CG    1 
ATOM   295  C  CD1   . LEU A 1 127 ? -10.203 -15.128 4.916   1.00 29.27  ? 125 LEU A CD1   1 
ATOM   296  C  CD2   . LEU A 1 127 ? -9.805  -17.598 5.212   1.00 23.74  ? 125 LEU A CD2   1 
ATOM   297  N  N     . LEU A 1 128 ? -14.517 -16.306 5.712   1.00 33.48  ? 126 LEU A N     1 
ATOM   298  C  CA    . LEU A 1 128 ? -15.581 -16.370 4.716   1.00 34.71  ? 126 LEU A CA    1 
ATOM   299  C  C     . LEU A 1 128 ? -16.323 -15.038 4.644   1.00 37.07  ? 126 LEU A C     1 
ATOM   300  O  O     . LEU A 1 128 ? -16.712 -14.580 3.568   1.00 36.52  ? 126 LEU A O     1 
ATOM   301  C  CB    . LEU A 1 128 ? -16.572 -17.487 5.046   1.00 30.55  ? 126 LEU A CB    1 
ATOM   302  C  CG    . LEU A 1 128 ? -16.043 -18.907 5.290   1.00 31.27  ? 126 LEU A CG    1 
ATOM   303  C  CD1   . LEU A 1 128 ? -17.222 -19.859 5.426   1.00 35.03  ? 126 LEU A CD1   1 
ATOM   304  C  CD2   . LEU A 1 128 ? -15.130 -19.362 4.166   1.00 27.88  ? 126 LEU A CD2   1 
ATOM   305  N  N     . GLN A 1 129 ? -16.528 -14.418 5.800   1.00 38.00  ? 127 GLN A N     1 
ATOM   306  C  CA    . GLN A 1 129 ? -17.345 -13.209 5.868   1.00 40.50  ? 127 GLN A CA    1 
ATOM   307  C  C     . GLN A 1 129 ? -16.580 -11.984 5.363   1.00 39.01  ? 127 GLN A C     1 
ATOM   308  O  O     . GLN A 1 129 ? -17.152 -11.100 4.723   1.00 39.06  ? 127 GLN A O     1 
ATOM   309  C  CB    . GLN A 1 129 ? -17.856 -13.003 7.304   1.00 44.81  ? 127 GLN A CB    1 
ATOM   310  C  CG    . GLN A 1 129 ? -17.986 -11.556 7.747   1.00 50.31  ? 127 GLN A CG    1 
ATOM   311  C  CD    . GLN A 1 129 ? -18.271 -11.427 9.243   1.00 58.72  ? 127 GLN A CD    1 
ATOM   312  O  OE1   . GLN A 1 129 ? -17.356 -11.450 10.073  1.00 61.45  ? 127 GLN A OE1   1 
ATOM   313  N  NE2   . GLN A 1 129 ? -19.544 -11.290 9.589   1.00 59.83  ? 127 GLN A NE2   1 
ATOM   314  N  N     . LYS A 1 130 ? -15.281 -11.949 5.633   1.00 37.70  ? 128 LYS A N     1 
ATOM   315  C  CA    . LYS A 1 130 ? -14.452 -10.794 5.282   1.00 43.21  ? 128 LYS A CA    1 
ATOM   316  C  C     . LYS A 1 130 ? -13.719 -10.907 3.939   1.00 44.07  ? 128 LYS A C     1 
ATOM   317  O  O     . LYS A 1 130 ? -13.154 -9.922  3.448   1.00 47.47  ? 128 LYS A O     1 
ATOM   318  C  CB    . LYS A 1 130 ? -13.431 -10.545 6.390   1.00 46.69  ? 128 LYS A CB    1 
ATOM   319  C  CG    . LYS A 1 130 ? -14.030 -9.958  7.651   1.00 51.69  ? 128 LYS A CG    1 
ATOM   320  C  CD    . LYS A 1 130 ? -13.106 -10.131 8.839   1.00 57.09  ? 128 LYS A CD    1 
ATOM   321  C  CE    . LYS A 1 130 ? -13.649 -9.396  10.055  1.00 62.61  ? 128 LYS A CE    1 
ATOM   322  N  NZ    . LYS A 1 130 ? -15.049 -9.806  10.351  1.00 65.84  ? 128 LYS A NZ    1 
ATOM   323  N  N     . ALA A 1 131 ? -13.737 -12.097 3.347   1.00 38.40  ? 129 ALA A N     1 
ATOM   324  C  CA    . ALA A 1 131 ? -12.871 -12.402 2.204   1.00 39.36  ? 129 ALA A CA    1 
ATOM   325  C  C     . ALA A 1 131 ? -12.864 -11.302 1.148   1.00 37.27  ? 129 ALA A C     1 
ATOM   326  O  O     . ALA A 1 131 ? -11.807 -10.789 0.783   1.00 35.01  ? 129 ALA A O     1 
ATOM   327  C  CB    . ALA A 1 131 ? -13.252 -13.746 1.578   1.00 33.99  ? 129 ALA A CB    1 
ATOM   328  N  N     . ASP A 1 132 ? -14.050 -10.950 0.668   1.00 39.73  ? 130 ASP A N     1 
ATOM   329  C  CA    . ASP A 1 132 ? -14.201 -9.969  -0.399  1.00 47.25  ? 130 ASP A CA    1 
ATOM   330  C  C     . ASP A 1 132 ? -13.625 -8.588  -0.096  1.00 51.69  ? 130 ASP A C     1 
ATOM   331  O  O     . ASP A 1 132 ? -13.441 -7.789  -1.010  1.00 56.28  ? 130 ASP A O     1 
ATOM   332  C  CB    . ASP A 1 132 ? -15.671 -9.823  -0.791  1.00 49.17  ? 130 ASP A CB    1 
ATOM   333  C  CG    . ASP A 1 132 ? -16.218 -11.057 -1.465  1.00 52.32  ? 130 ASP A CG    1 
ATOM   334  O  OD1   . ASP A 1 132 ? -15.425 -11.975 -1.764  1.00 54.81  ? 130 ASP A OD1   1 
ATOM   335  O  OD2   . ASP A 1 132 ? -17.442 -11.109 -1.705  1.00 52.89  ? 130 ASP A OD2   1 
ATOM   336  N  N     . SER A 1 133 ? -13.340 -8.301  1.169   1.00 49.70  ? 131 SER A N     1 
ATOM   337  C  CA    . SER A 1 133 ? -12.862 -6.968  1.535   1.00 50.70  ? 131 SER A CA    1 
ATOM   338  C  C     . SER A 1 133 ? -11.381 -6.971  1.914   1.00 50.86  ? 131 SER A C     1 
ATOM   339  O  O     . SER A 1 133 ? -10.845 -5.964  2.389   1.00 49.96  ? 131 SER A O     1 
ATOM   340  C  CB    . SER A 1 133 ? -13.715 -6.366  2.660   1.00 51.70  ? 131 SER A CB    1 
ATOM   341  O  OG    . SER A 1 133 ? -13.371 -6.918  3.921   1.00 50.95  ? 131 SER A OG    1 
ATOM   342  N  N     . ILE A 1 134 ? -10.732 -8.114  1.706   1.00 46.80  ? 132 ILE A N     1 
ATOM   343  C  CA    . ILE A 1 134 ? -9.285  -8.232  1.856   1.00 46.34  ? 132 ILE A CA    1 
ATOM   344  C  C     . ILE A 1 134 ? -8.681  -8.358  0.454   1.00 50.86  ? 132 ILE A C     1 
ATOM   345  O  O     . ILE A 1 134 ? -8.607  -9.452  -0.102  1.00 53.29  ? 132 ILE A O     1 
ATOM   346  C  CB    . ILE A 1 134 ? -8.906  -9.467  2.693   1.00 44.98  ? 132 ILE A CB    1 
ATOM   347  C  CG1   . ILE A 1 134 ? -9.558  -9.402  4.077   1.00 49.80  ? 132 ILE A CG1   1 
ATOM   348  C  CG2   . ILE A 1 134 ? -7.404  -9.594  2.827   1.00 41.37  ? 132 ILE A CG2   1 
ATOM   349  C  CD1   . ILE A 1 134 ? -9.414  -10.686 4.879   1.00 47.55  ? 132 ILE A CD1   1 
ATOM   350  N  N     . PRO A 1 135 ? -8.266  -7.226  -0.131  1.00 53.28  ? 133 PRO A N     1 
ATOM   351  C  CA    . PRO A 1 135 ? -7.804  -7.150  -1.524  1.00 51.95  ? 133 PRO A CA    1 
ATOM   352  C  C     . PRO A 1 135 ? -6.577  -8.010  -1.850  1.00 50.64  ? 133 PRO A C     1 
ATOM   353  O  O     . PRO A 1 135 ? -6.367  -8.322  -3.021  1.00 49.04  ? 133 PRO A O     1 
ATOM   354  C  CB    . PRO A 1 135 ? -7.476  -5.661  -1.699  1.00 52.18  ? 133 PRO A CB    1 
ATOM   355  C  CG    . PRO A 1 135 ? -8.354  -4.975  -0.713  1.00 54.93  ? 133 PRO A CG    1 
ATOM   356  C  CD    . PRO A 1 135 ? -8.380  -5.891  0.481   1.00 54.67  ? 133 PRO A CD    1 
ATOM   357  N  N     . SER A 1 136 ? -5.807  -8.399  -0.838  1.00 48.84  ? 134 SER A N     1 
ATOM   358  C  CA    . SER A 1 136 ? -4.560  -9.134  -1.039  1.00 45.18  ? 134 SER A CA    1 
ATOM   359  C  C     . SER A 1 136 ? -4.699  -10.660 -1.208  1.00 43.81  ? 134 SER A C     1 
ATOM   360  O  O     . SER A 1 136 ? -3.692  -11.362 -1.343  1.00 39.85  ? 134 SER A O     1 
ATOM   361  C  CB    . SER A 1 136 ? -3.628  -8.882  0.141   1.00 47.71  ? 134 SER A CB    1 
ATOM   362  O  OG    . SER A 1 136 ? -4.067  -9.605  1.281   1.00 51.91  ? 134 SER A OG    1 
ATOM   363  N  N     . LEU A 1 137 ? -5.918  -11.187 -1.167  1.00 43.59  ? 135 LEU A N     1 
ATOM   364  C  CA    . LEU A 1 137 ? -6.084  -12.632 -1.302  1.00 39.40  ? 135 LEU A CA    1 
ATOM   365  C  C     . LEU A 1 137 ? -5.838  -13.031 -2.759  1.00 37.49  ? 135 LEU A C     1 
ATOM   366  O  O     . LEU A 1 137 ? -6.167  -12.284 -3.675  1.00 36.92  ? 135 LEU A O     1 
ATOM   367  C  CB    . LEU A 1 137 ? -7.485  -13.071 -0.862  1.00 37.23  ? 135 LEU A CB    1 
ATOM   368  C  CG    . LEU A 1 137 ? -7.959  -12.751 0.557   1.00 38.05  ? 135 LEU A CG    1 
ATOM   369  C  CD1   . LEU A 1 137 ? -9.343  -13.342 0.782   1.00 35.75  ? 135 LEU A CD1   1 
ATOM   370  C  CD2   . LEU A 1 137 ? -6.978  -13.274 1.582   1.00 37.45  ? 135 LEU A CD2   1 
ATOM   371  N  N     . THR A 1 138 ? -5.263  -14.206 -2.986  1.00 37.19  ? 136 THR A N     1 
ATOM   372  C  CA    . THR A 1 138 ? -5.024  -14.623 -4.361  1.00 36.67  ? 136 THR A CA    1 
ATOM   373  C  C     . THR A 1 138 ? -6.345  -15.064 -4.968  1.00 34.38  ? 136 THR A C     1 
ATOM   374  O  O     . THR A 1 138 ? -7.313  -15.308 -4.240  1.00 30.47  ? 136 THR A O     1 
ATOM   375  C  CB    . THR A 1 138 ? -3.978  -15.750 -4.460  1.00 33.42  ? 136 THR A CB    1 
ATOM   376  O  OG1   . THR A 1 138 ? -4.392  -16.860 -3.667  1.00 34.00  ? 136 THR A OG1   1 
ATOM   377  C  CG2   . THR A 1 138 ? -2.641  -15.271 -3.937  1.00 34.88  ? 136 THR A CG2   1 
ATOM   378  N  N     . ASP A 1 139 ? -6.399  -15.131 -6.296  1.00 32.06  ? 137 ASP A N     1 
ATOM   379  C  CA    . ASP A 1 139 ? -7.553  -15.717 -6.961  1.00 36.12  ? 137 ASP A CA    1 
ATOM   380  C  C     . ASP A 1 139 ? -7.789  -17.156 -6.477  1.00 36.57  ? 137 ASP A C     1 
ATOM   381  O  O     . ASP A 1 139 ? -8.934  -17.557 -6.286  1.00 40.06  ? 137 ASP A O     1 
ATOM   382  C  CB    . ASP A 1 139 ? -7.392  -15.695 -8.484  1.00 37.88  ? 137 ASP A CB    1 
ATOM   383  C  CG    . ASP A 1 139 ? -7.337  -14.279 -9.055  1.00 42.52  ? 137 ASP A CG    1 
ATOM   384  O  OD1   . ASP A 1 139 ? -7.736  -13.324 -8.356  1.00 42.36  ? 137 ASP A OD1   1 
ATOM   385  O  OD2   . ASP A 1 139 ? -6.895  -14.120 -10.214 1.00 47.74  ? 137 ASP A OD2   1 
ATOM   386  N  N     . GLN A 1 140 ? -6.715  -17.926 -6.284  1.00 32.52  ? 138 GLN A N     1 
ATOM   387  C  CA    . GLN A 1 140 ? -6.851  -19.326 -5.859  1.00 30.34  ? 138 GLN A CA    1 
ATOM   388  C  C     . GLN A 1 140 ? -7.471  -19.413 -4.461  1.00 29.82  ? 138 GLN A C     1 
ATOM   389  O  O     . GLN A 1 140 ? -8.343  -20.246 -4.207  1.00 28.08  ? 138 GLN A O     1 
ATOM   390  C  CB    . GLN A 1 140 ? -5.507  -20.059 -5.889  1.00 29.62  ? 138 GLN A CB    1 
ATOM   391  C  CG    . GLN A 1 140 ? -5.598  -21.535 -5.489  1.00 32.78  ? 138 GLN A CG    1 
ATOM   392  C  CD    . GLN A 1 140 ? -4.307  -22.313 -5.717  1.00 37.27  ? 138 GLN A CD    1 
ATOM   393  O  OE1   . GLN A 1 140 ? -4.265  -23.534 -5.526  1.00 41.32  ? 138 GLN A OE1   1 
ATOM   394  N  NE2   . GLN A 1 140 ? -3.251  -21.615 -6.136  1.00 34.96  ? 138 GLN A NE2   1 
ATOM   395  N  N     . GLN A 1 141 ? -7.025  -18.536 -3.566  1.00 28.79  ? 139 GLN A N     1 
ATOM   396  C  CA    . GLN A 1 141 ? -7.588  -18.466 -2.226  1.00 30.06  ? 139 GLN A CA    1 
ATOM   397  C  C     . GLN A 1 141 ? -9.066  -18.098 -2.274  1.00 31.23  ? 139 GLN A C     1 
ATOM   398  O  O     . GLN A 1 141 ? -9.868  -18.645 -1.527  1.00 32.02  ? 139 GLN A O     1 
ATOM   399  C  CB    . GLN A 1 141 ? -6.799  -17.479 -1.364  1.00 31.22  ? 139 GLN A CB    1 
ATOM   400  C  CG    . GLN A 1 141 ? -5.413  -18.008 -0.988  1.00 32.57  ? 139 GLN A CG    1 
ATOM   401  C  CD    . GLN A 1 141 ? -4.496  -16.948 -0.396  1.00 36.02  ? 139 GLN A CD    1 
ATOM   402  O  OE1   . GLN A 1 141 ? -4.608  -15.755 -0.701  1.00 35.60  ? 139 GLN A OE1   1 
ATOM   403  N  NE2   . GLN A 1 141 ? -3.571  -17.386 0.445   1.00 37.90  ? 139 GLN A NE2   1 
ATOM   404  N  N     . ARG A 1 142 ? -9.424  -17.183 -3.170  1.00 29.06  ? 140 ARG A N     1 
ATOM   405  C  CA    . ARG A 1 142 ? -10.812 -16.760 -3.306  1.00 32.39  ? 140 ARG A CA    1 
ATOM   406  C  C     . ARG A 1 142 ? -11.701 -17.895 -3.789  1.00 30.60  ? 140 ARG A C     1 
ATOM   407  O  O     . ARG A 1 142 ? -12.871 -17.983 -3.406  1.00 32.31  ? 140 ARG A O     1 
ATOM   408  C  CB    . ARG A 1 142 ? -10.937 -15.532 -4.220  1.00 35.53  ? 140 ARG A CB    1 
ATOM   409  C  CG    . ARG A 1 142 ? -10.325 -14.279 -3.612  1.00 37.26  ? 140 ARG A CG    1 
ATOM   410  C  CD    . ARG A 1 142 ? -10.754 -13.009 -4.344  1.00 40.30  ? 140 ARG A CD    1 
ATOM   411  N  NE    . ARG A 1 142 ? -9.800  -11.938 -4.085  1.00 44.05  ? 140 ARG A NE    1 
ATOM   412  C  CZ    . ARG A 1 142 ? -9.793  -11.185 -2.989  1.00 48.19  ? 140 ARG A CZ    1 
ATOM   413  N  NH1   . ARG A 1 142 ? -10.706 -11.372 -2.039  1.00 46.46  ? 140 ARG A NH1   1 
ATOM   414  N  NH2   . ARG A 1 142 ? -8.865  -10.245 -2.842  1.00 48.93  ? 140 ARG A NH2   1 
ATOM   415  N  N     . VAL A 1 143 ? -11.143 -18.769 -4.622  1.00 26.36  ? 141 VAL A N     1 
ATOM   416  C  CA    . VAL A 1 143 ? -11.838 -19.995 -5.006  1.00 24.55  ? 141 VAL A CA    1 
ATOM   417  C  C     . VAL A 1 143 ? -11.990 -20.955 -3.826  1.00 26.97  ? 141 VAL A C     1 
ATOM   418  O  O     . VAL A 1 143 ? -13.044 -21.562 -3.639  1.00 28.16  ? 141 VAL A O     1 
ATOM   419  C  CB    . VAL A 1 143 ? -11.122 -20.706 -6.167  1.00 22.15  ? 141 VAL A CB    1 
ATOM   420  C  CG1   . VAL A 1 143 ? -11.824 -22.022 -6.505  1.00 17.13  ? 141 VAL A CG1   1 
ATOM   421  C  CG2   . VAL A 1 143 ? -11.065 -19.772 -7.388  1.00 19.60  ? 141 VAL A CG2   1 
ATOM   422  N  N     . GLY A 1 144 ? -10.940 -21.091 -3.024  1.00 28.17  ? 142 GLY A N     1 
ATOM   423  C  CA    . GLY A 1 144 ? -11.001 -21.984 -1.880  1.00 25.66  ? 142 GLY A CA    1 
ATOM   424  C  C     . GLY A 1 144 ? -12.075 -21.526 -0.914  1.00 30.76  ? 142 GLY A C     1 
ATOM   425  O  O     . GLY A 1 144 ? -12.778 -22.333 -0.307  1.00 31.51  ? 142 GLY A O     1 
ATOM   426  N  N     . ILE A 1 145 ? -12.201 -20.212 -0.782  1.00 31.05  ? 143 ILE A N     1 
ATOM   427  C  CA    . ILE A 1 145 ? -13.167 -19.617 0.125   1.00 31.42  ? 143 ILE A CA    1 
ATOM   428  C  C     . ILE A 1 145 ? -14.583 -19.748 -0.422  1.00 31.02  ? 143 ILE A C     1 
ATOM   429  O  O     . ILE A 1 145 ? -15.492 -20.195 0.276   1.00 28.43  ? 143 ILE A O     1 
ATOM   430  C  CB    . ILE A 1 145 ? -12.835 -18.126 0.373   1.00 31.75  ? 143 ILE A CB    1 
ATOM   431  C  CG1   . ILE A 1 145 ? -11.608 -18.005 1.282   1.00 32.85  ? 143 ILE A CG1   1 
ATOM   432  C  CG2   . ILE A 1 145 ? -14.046 -17.379 0.945   1.00 30.43  ? 143 ILE A CG2   1 
ATOM   433  C  CD1   . ILE A 1 145 ? -10.823 -16.722 1.095   1.00 31.62  ? 143 ILE A CD1   1 
ATOM   434  N  N     . LYS A 1 146 ? -14.770 -19.352 -1.674  1.00 27.96  ? 144 LYS A N     1 
ATOM   435  C  CA    . LYS A 1 146 ? -16.094 -19.374 -2.277  1.00 30.38  ? 144 LYS A CA    1 
ATOM   436  C  C     . LYS A 1 146 ? -16.651 -20.794 -2.351  1.00 30.94  ? 144 LYS A C     1 
ATOM   437  O  O     . LYS A 1 146 ? -17.849 -21.004 -2.207  1.00 29.21  ? 144 LYS A O     1 
ATOM   438  C  CB    . LYS A 1 146 ? -16.055 -18.731 -3.667  1.00 35.99  ? 144 LYS A CB    1 
ATOM   439  C  CG    . LYS A 1 146 ? -17.198 -19.147 -4.577  1.00 42.05  ? 144 LYS A CG    1 
ATOM   440  C  CD    . LYS A 1 146 ? -17.154 -18.407 -5.904  1.00 46.46  ? 144 LYS A CD    1 
ATOM   441  C  CE    . LYS A 1 146 ? -18.348 -18.796 -6.768  1.00 52.76  ? 144 LYS A CE    1 
ATOM   442  N  NZ    . LYS A 1 146 ? -18.143 -18.482 -8.215  1.00 57.37  ? 144 LYS A NZ    1 
ATOM   443  N  N     . TYR A 1 147 ? -15.781 -21.774 -2.561  1.00 30.96  ? 145 TYR A N     1 
ATOM   444  C  CA    . TYR A 1 147 ? -16.249 -23.150 -2.669  1.00 30.04  ? 145 TYR A CA    1 
ATOM   445  C  C     . TYR A 1 147 ? -16.013 -23.949 -1.402  1.00 29.02  ? 145 TYR A C     1 
ATOM   446  O  O     . TYR A 1 147 ? -16.036 -25.183 -1.433  1.00 27.05  ? 145 TYR A O     1 
ATOM   447  C  CB    . TYR A 1 147 ? -15.584 -23.861 -3.842  1.00 29.28  ? 145 TYR A CB    1 
ATOM   448  C  CG    . TYR A 1 147 ? -16.142 -23.499 -5.195  1.00 26.72  ? 145 TYR A CG    1 
ATOM   449  C  CD1   . TYR A 1 147 ? -15.562 -22.493 -5.960  1.00 26.91  ? 145 TYR A CD1   1 
ATOM   450  C  CD2   . TYR A 1 147 ? -17.226 -24.190 -5.724  1.00 25.27  ? 145 TYR A CD2   1 
ATOM   451  C  CE1   . TYR A 1 147 ? -16.063 -22.163 -7.212  1.00 27.65  ? 145 TYR A CE1   1 
ATOM   452  C  CE2   . TYR A 1 147 ? -17.721 -23.887 -6.981  1.00 23.72  ? 145 TYR A CE2   1 
ATOM   453  C  CZ    . TYR A 1 147 ? -17.143 -22.866 -7.714  1.00 25.67  ? 145 TYR A CZ    1 
ATOM   454  O  OH    . TYR A 1 147 ? -17.645 -22.550 -8.960  1.00 28.27  ? 145 TYR A OH    1 
ATOM   455  N  N     . PHE A 1 148 ? -15.807 -23.252 -0.288  1.00 31.06  ? 146 PHE A N     1 
ATOM   456  C  CA    . PHE A 1 148 ? -15.509 -23.916 0.982   1.00 29.86  ? 146 PHE A CA    1 
ATOM   457  C  C     . PHE A 1 148 ? -16.485 -25.043 1.342   1.00 27.99  ? 146 PHE A C     1 
ATOM   458  O  O     . PHE A 1 148 ? -16.060 -26.130 1.728   1.00 26.56  ? 146 PHE A O     1 
ATOM   459  C  CB    . PHE A 1 148 ? -15.420 -22.908 2.135   1.00 33.47  ? 146 PHE A CB    1 
ATOM   460  C  CG    . PHE A 1 148 ? -15.055 -23.543 3.451   1.00 31.51  ? 146 PHE A CG    1 
ATOM   461  C  CD1   . PHE A 1 148 ? -13.752 -23.915 3.712   1.00 30.43  ? 146 PHE A CD1   1 
ATOM   462  C  CD2   . PHE A 1 148 ? -16.023 -23.793 4.406   1.00 25.84  ? 146 PHE A CD2   1 
ATOM   463  C  CE1   . PHE A 1 148 ? -13.416 -24.517 4.910   1.00 32.48  ? 146 PHE A CE1   1 
ATOM   464  C  CE2   . PHE A 1 148 ? -15.697 -24.381 5.611   1.00 30.72  ? 146 PHE A CE2   1 
ATOM   465  C  CZ    . PHE A 1 148 ? -14.390 -24.751 5.864   1.00 32.92  ? 146 PHE A CZ    1 
ATOM   466  N  N     . TYR A 1 149 ? -17.786 -24.784 1.238   1.00 28.04  ? 147 TYR A N     1 
ATOM   467  C  CA    . TYR A 1 149 ? -18.785 -25.815 1.546   1.00 27.58  ? 147 TYR A CA    1 
ATOM   468  C  C     . TYR A 1 149 ? -18.634 -27.040 0.628   1.00 28.54  ? 147 TYR A C     1 
ATOM   469  O  O     . TYR A 1 149 ? -18.475 -28.162 1.103   1.00 32.29  ? 147 TYR A O     1 
ATOM   470  C  CB    . TYR A 1 149 ? -20.223 -25.250 1.496   1.00 29.73  ? 147 TYR A CB    1 
ATOM   471  C  CG    . TYR A 1 149 ? -21.306 -26.316 1.374   1.00 29.79  ? 147 TYR A CG    1 
ATOM   472  C  CD1   . TYR A 1 149 ? -21.772 -27.005 2.492   1.00 31.29  ? 147 TYR A CD1   1 
ATOM   473  C  CD2   . TYR A 1 149 ? -21.843 -26.640 0.140   1.00 30.07  ? 147 TYR A CD2   1 
ATOM   474  C  CE1   . TYR A 1 149 ? -22.750 -27.983 2.378   1.00 34.71  ? 147 TYR A CE1   1 
ATOM   475  C  CE2   . TYR A 1 149 ? -22.820 -27.606 0.012   1.00 35.00  ? 147 TYR A CE2   1 
ATOM   476  C  CZ    . TYR A 1 149 ? -23.269 -28.278 1.128   1.00 38.26  ? 147 TYR A CZ    1 
ATOM   477  O  OH    . TYR A 1 149 ? -24.239 -29.247 0.976   1.00 41.84  ? 147 TYR A OH    1 
ATOM   478  N  N     . ASP A 1 150 ? -18.676 -26.819 -0.682  1.00 28.88  ? 148 ASP A N     1 
ATOM   479  C  CA    . ASP A 1 150 ? -18.539 -27.905 -1.652  1.00 29.41  ? 148 ASP A CA    1 
ATOM   480  C  C     . ASP A 1 150 ? -17.293 -28.756 -1.433  1.00 29.75  ? 148 ASP A C     1 
ATOM   481  O  O     . ASP A 1 150 ? -17.356 -29.985 -1.422  1.00 27.36  ? 148 ASP A O     1 
ATOM   482  C  CB    . ASP A 1 150 ? -18.461 -27.346 -3.066  1.00 32.84  ? 148 ASP A CB    1 
ATOM   483  C  CG    . ASP A 1 150 ? -19.678 -26.547 -3.444  1.00 42.02  ? 148 ASP A CG    1 
ATOM   484  O  OD1   . ASP A 1 150 ? -19.709 -25.340 -3.122  1.00 47.98  ? 148 ASP A OD1   1 
ATOM   485  O  OD2   . ASP A 1 150 ? -20.589 -27.124 -4.073  1.00 40.94  ? 148 ASP A OD2   1 
ATOM   486  N  N     . ILE A 1 151 ? -16.157 -28.084 -1.282  1.00 28.93  ? 149 ILE A N     1 
ATOM   487  C  CA    . ILE A 1 151 ? -14.873 -28.755 -1.170  1.00 27.19  ? 149 ILE A CA    1 
ATOM   488  C  C     . ILE A 1 151 ? -14.875 -29.746 -0.022  1.00 27.28  ? 149 ILE A C     1 
ATOM   489  O  O     . ILE A 1 151 ? -14.258 -30.812 -0.100  1.00 26.68  ? 149 ILE A O     1 
ATOM   490  C  CB    . ILE A 1 151 ? -13.739 -27.738 -0.996  1.00 24.59  ? 149 ILE A CB    1 
ATOM   491  C  CG1   . ILE A 1 151 ? -13.527 -26.993 -2.323  1.00 22.07  ? 149 ILE A CG1   1 
ATOM   492  C  CG2   . ILE A 1 151 ? -12.448 -28.445 -0.540  1.00 23.78  ? 149 ILE A CG2   1 
ATOM   493  C  CD1   . ILE A 1 151 ? -12.694 -25.730 -2.212  1.00 20.63  ? 149 ILE A CD1   1 
ATOM   494  N  N     . ASN A 1 152 ? -15.602 -29.401 1.035   1.00 24.73  ? 150 ASN A N     1 
ATOM   495  C  CA    . ASN A 1 152 ? -15.625 -30.228 2.226   1.00 28.95  ? 150 ASN A CA    1 
ATOM   496  C  C     . ASN A 1 152 ? -16.802 -31.203 2.278   1.00 29.48  ? 150 ASN A C     1 
ATOM   497  O  O     . ASN A 1 152 ? -16.989 -31.874 3.274   1.00 26.03  ? 150 ASN A O     1 
ATOM   498  C  CB    . ASN A 1 152 ? -15.501 -29.358 3.480   1.00 32.92  ? 150 ASN A CB    1 
ATOM   499  C  CG    . ASN A 1 152 ? -14.133 -28.678 3.567   1.00 35.05  ? 150 ASN A CG    1 
ATOM   500  O  OD1   . ASN A 1 152 ? -13.160 -29.234 4.104   1.00 39.55  ? 150 ASN A OD1   1 
ATOM   501  N  ND2   . ASN A 1 152 ? -14.066 -27.453 3.070   1.00 28.39  ? 150 ASN A ND2   1 
ATOM   502  N  N     . GLU A 1 153 ? -17.571 -31.289 1.189   1.00 28.66  ? 151 GLU A N     1 
ATOM   503  C  CA    . GLU A 1 153 ? -18.562 -32.354 1.026   1.00 32.23  ? 151 GLU A CA    1 
ATOM   504  C  C     . GLU A 1 153 ? -17.881 -33.550 0.372   1.00 32.10  ? 151 GLU A C     1 
ATOM   505  O  O     . GLU A 1 153 ? -17.364 -33.443 -0.744  1.00 32.41  ? 151 GLU A O     1 
ATOM   506  C  CB    . GLU A 1 153 ? -19.722 -31.895 0.124   1.00 33.18  ? 151 GLU A CB    1 
ATOM   507  C  CG    . GLU A 1 153 ? -20.620 -30.841 0.738   1.00 34.63  ? 151 GLU A CG    1 
ATOM   508  C  CD    . GLU A 1 153 ? -21.315 -31.362 1.965   1.00 35.78  ? 151 GLU A CD    1 
ATOM   509  O  OE1   . GLU A 1 153 ? -22.262 -32.165 1.809   1.00 34.33  ? 151 GLU A OE1   1 
ATOM   510  O  OE2   . GLU A 1 153 ? -20.897 -30.990 3.081   1.00 33.93  ? 151 GLU A OE2   1 
ATOM   511  N  N     . LYS A 1 154 ? -17.882 -34.692 1.046   1.00 32.04  ? 152 LYS A N     1 
ATOM   512  C  CA    . LYS A 1 154 ? -17.261 -35.877 0.466   1.00 32.71  ? 152 LYS A CA    1 
ATOM   513  C  C     . LYS A 1 154 ? -18.019 -36.404 -0.748  1.00 28.89  ? 152 LYS A C     1 
ATOM   514  O  O     . LYS A 1 154 ? -19.225 -36.227 -0.888  1.00 25.26  ? 152 LYS A O     1 
ATOM   515  C  CB    . LYS A 1 154 ? -17.063 -36.979 1.512   1.00 35.04  ? 152 LYS A CB    1 
ATOM   516  C  CG    . LYS A 1 154 ? -18.310 -37.371 2.280   1.00 37.69  ? 152 LYS A CG    1 
ATOM   517  C  CD    . LYS A 1 154 ? -17.914 -38.225 3.486   1.00 41.94  ? 152 LYS A CD    1 
ATOM   518  C  CE    . LYS A 1 154 ? -19.096 -38.510 4.406   1.00 46.35  ? 152 LYS A CE    1 
ATOM   519  N  NZ    . LYS A 1 154 ? -18.697 -39.432 5.514   1.00 49.11  ? 152 LYS A NZ    1 
ATOM   520  N  N     . ILE A 1 155 ? -17.287 -37.036 -1.644  1.00 26.43  ? 153 ILE A N     1 
ATOM   521  C  CA    . ILE A 1 155 ? -17.889 -37.614 -2.828  1.00 25.05  ? 153 ILE A CA    1 
ATOM   522  C  C     . ILE A 1 155 ? -18.188 -39.088 -2.559  1.00 29.23  ? 153 ILE A C     1 
ATOM   523  O  O     . ILE A 1 155 ? -17.301 -39.844 -2.151  1.00 27.74  ? 153 ILE A O     1 
ATOM   524  C  CB    . ILE A 1 155 ? -16.934 -37.480 -4.026  1.00 24.63  ? 153 ILE A CB    1 
ATOM   525  C  CG1   . ILE A 1 155 ? -16.304 -36.076 -4.048  1.00 22.64  ? 153 ILE A CG1   1 
ATOM   526  C  CG2   . ILE A 1 155 ? -17.656 -37.772 -5.326  1.00 23.81  ? 153 ILE A CG2   1 
ATOM   527  C  CD1   . ILE A 1 155 ? -15.196 -35.923 -5.101  1.00 19.29  ? 153 ILE A CD1   1 
ATOM   528  N  N     . PRO A 1 156 ? -19.453 -39.495 -2.738  1.00 32.06  ? 154 PRO A N     1 
ATOM   529  C  CA    . PRO A 1 156 ? -19.761 -40.923 -2.619  1.00 31.49  ? 154 PRO A CA    1 
ATOM   530  C  C     . PRO A 1 156 ? -19.199 -41.667 -3.819  1.00 32.28  ? 154 PRO A C     1 
ATOM   531  O  O     . PRO A 1 156 ? -19.234 -41.149 -4.941  1.00 31.43  ? 154 PRO A O     1 
ATOM   532  C  CB    . PRO A 1 156 ? -21.294 -40.971 -2.618  1.00 30.64  ? 154 PRO A CB    1 
ATOM   533  C  CG    . PRO A 1 156 ? -21.738 -39.654 -3.163  1.00 31.40  ? 154 PRO A CG    1 
ATOM   534  C  CD    . PRO A 1 156 ? -20.656 -38.660 -2.893  1.00 29.89  ? 154 PRO A CD    1 
ATOM   535  N  N     . MET A 1 157 ? -18.657 -42.855 -3.566  1.00 31.47  ? 155 MET A N     1 
ATOM   536  C  CA    . MET A 1 157 ? -18.116 -43.715 -4.617  1.00 34.40  ? 155 MET A CA    1 
ATOM   537  C  C     . MET A 1 157 ? -18.928 -43.678 -5.914  1.00 35.31  ? 155 MET A C     1 
ATOM   538  O  O     . MET A 1 157 ? -18.368 -43.617 -7.004  1.00 32.74  ? 155 MET A O     1 
ATOM   539  C  CB    . MET A 1 157 ? -18.058 -45.152 -4.113  1.00 37.05  ? 155 MET A CB    1 
ATOM   540  C  CG    . MET A 1 157 ? -17.428 -46.123 -5.095  1.00 40.82  ? 155 MET A CG    1 
ATOM   541  S  SD    . MET A 1 157 ? -17.947 -47.825 -4.775  1.00 88.18  ? 155 MET A SD    1 
ATOM   542  C  CE    . MET A 1 157 ? -17.360 -48.055 -3.099  1.00 46.12  ? 155 MET A CE    1 
ATOM   543  N  N     . GLN A 1 158 ? -20.250 -43.721 -5.780  1.00 33.68  ? 156 GLN A N     1 
ATOM   544  C  CA    . GLN A 1 158 ? -21.146 -43.833 -6.921  1.00 37.04  ? 156 GLN A CA    1 
ATOM   545  C  C     . GLN A 1 158 ? -21.105 -42.589 -7.787  1.00 35.38  ? 156 GLN A C     1 
ATOM   546  O  O     . GLN A 1 158 ? -21.286 -42.663 -9.000  1.00 37.23  ? 156 GLN A O     1 
ATOM   547  C  CB    . GLN A 1 158 ? -22.586 -44.090 -6.454  1.00 44.05  ? 156 GLN A CB    1 
ATOM   548  C  CG    . GLN A 1 158 ? -22.810 -45.445 -5.784  1.00 52.04  ? 156 GLN A CG    1 
ATOM   549  C  CD    . GLN A 1 158 ? -22.375 -45.502 -4.311  1.00 57.27  ? 156 GLN A CD    1 
ATOM   550  O  OE1   . GLN A 1 158 ? -21.782 -44.560 -3.771  1.00 52.94  ? 156 GLN A OE1   1 
ATOM   551  N  NE2   . GLN A 1 158 ? -22.680 -46.621 -3.657  1.00 61.67  ? 156 GLN A NE2   1 
ATOM   552  N  N     . GLU A 1 159 ? -20.880 -41.435 -7.171  1.00 29.68  ? 157 GLU A N     1 
ATOM   553  C  CA    . GLU A 1 159 ? -20.738 -40.221 -7.963  1.00 30.04  ? 157 GLU A CA    1 
ATOM   554  C  C     . GLU A 1 159 ? -19.383 -40.205 -8.685  1.00 29.80  ? 157 GLU A C     1 
ATOM   555  O  O     . GLU A 1 159 ? -19.282 -39.709 -9.806  1.00 28.88  ? 157 GLU A O     1 
ATOM   556  C  CB    . GLU A 1 159 ? -20.952 -38.946 -7.131  1.00 27.22  ? 157 GLU A CB    1 
ATOM   557  C  CG    . GLU A 1 159 ? -21.070 -37.701 -8.010  1.00 28.35  ? 157 GLU A CG    1 
ATOM   558  C  CD    . GLU A 1 159 ? -21.114 -36.396 -7.235  1.00 30.58  ? 157 GLU A CD    1 
ATOM   559  O  OE1   . GLU A 1 159 ? -20.455 -35.436 -7.688  1.00 30.64  ? 157 GLU A OE1   1 
ATOM   560  O  OE2   . GLU A 1 159 ? -21.813 -36.321 -6.194  1.00 30.31  ? 157 GLU A OE2   1 
ATOM   561  N  N     . SER A 1 160 ? -18.352 -40.763 -8.052  1.00 27.67  ? 158 SER A N     1 
ATOM   562  C  CA    . SER A 1 160 ? -17.027 -40.839 -8.684  1.00 27.32  ? 158 SER A CA    1 
ATOM   563  C  C     . SER A 1 160 ? -17.084 -41.668 -9.964  1.00 29.38  ? 158 SER A C     1 
ATOM   564  O  O     . SER A 1 160 ? -16.439 -41.322 -10.958 1.00 28.57  ? 158 SER A O     1 
ATOM   565  C  CB    . SER A 1 160 ? -15.983 -41.409 -7.728  1.00 26.37  ? 158 SER A CB    1 
ATOM   566  O  OG    . SER A 1 160 ? -15.569 -40.434 -6.789  1.00 27.19  ? 158 SER A OG    1 
ATOM   567  N  N     . VAL A 1 161 ? -17.870 -42.746 -9.946  1.00 30.83  ? 159 VAL A N     1 
ATOM   568  C  CA    . VAL A 1 161 ? -18.121 -43.533 -11.160 1.00 31.63  ? 159 VAL A CA    1 
ATOM   569  C  C     . VAL A 1 161 ? -18.650 -42.648 -12.285 1.00 31.19  ? 159 VAL A C     1 
ATOM   570  O  O     . VAL A 1 161 ? -18.236 -42.762 -13.432 1.00 34.68  ? 159 VAL A O     1 
ATOM   571  C  CB    . VAL A 1 161 ? -19.136 -44.668 -10.913 1.00 32.21  ? 159 VAL A CB    1 
ATOM   572  C  CG1   . VAL A 1 161 ? -19.538 -45.334 -12.246 1.00 32.37  ? 159 VAL A CG1   1 
ATOM   573  C  CG2   . VAL A 1 161 ? -18.569 -45.704 -9.941  1.00 29.88  ? 159 VAL A CG2   1 
ATOM   574  N  N     . LEU A 1 162 ? -19.572 -41.757 -11.946 1.00 28.68  ? 160 LEU A N     1 
ATOM   575  C  CA    . LEU A 1 162 ? -20.164 -40.877 -12.937 1.00 28.16  ? 160 LEU A CA    1 
ATOM   576  C  C     . LEU A 1 162 ? -19.129 -39.875 -13.465 1.00 29.26  ? 160 LEU A C     1 
ATOM   577  O  O     . LEU A 1 162 ? -19.117 -39.537 -14.645 1.00 33.23  ? 160 LEU A O     1 
ATOM   578  C  CB    . LEU A 1 162 ? -21.379 -40.151 -12.344 1.00 25.03  ? 160 LEU A CB    1 
ATOM   579  C  CG    . LEU A 1 162 ? -22.553 -41.022 -11.885 1.00 30.75  ? 160 LEU A CG    1 
ATOM   580  C  CD1   . LEU A 1 162 ? -23.654 -40.157 -11.259 1.00 28.07  ? 160 LEU A CD1   1 
ATOM   581  C  CD2   . LEU A 1 162 ? -23.111 -41.848 -13.047 1.00 30.58  ? 160 LEU A CD2   1 
ATOM   582  N  N     . HIS A 1 163 ? -18.261 -39.397 -12.584 1.00 26.62  ? 161 HIS A N     1 
ATOM   583  C  CA    . HIS A 1 163 ? -17.219 -38.462 -12.991 1.00 27.45  ? 161 HIS A CA    1 
ATOM   584  C  C     . HIS A 1 163 ? -16.247 -39.164 -13.928 1.00 30.49  ? 161 HIS A C     1 
ATOM   585  O  O     . HIS A 1 163 ? -15.818 -38.594 -14.936 1.00 28.36  ? 161 HIS A O     1 
ATOM   586  C  CB    . HIS A 1 163 ? -16.469 -37.921 -11.767 1.00 24.81  ? 161 HIS A CB    1 
ATOM   587  C  CG    . HIS A 1 163 ? -17.132 -36.744 -11.114 1.00 26.78  ? 161 HIS A CG    1 
ATOM   588  N  ND1   . HIS A 1 163 ? -17.063 -35.465 -11.623 1.00 31.46  ? 161 HIS A ND1   1 
ATOM   589  C  CD2   . HIS A 1 163 ? -17.903 -36.661 -10.000 1.00 26.74  ? 161 HIS A CD2   1 
ATOM   590  C  CE1   . HIS A 1 163 ? -17.756 -34.643 -10.851 1.00 31.51  ? 161 HIS A CE1   1 
ATOM   591  N  NE2   . HIS A 1 163 ? -18.270 -35.346 -9.858  1.00 29.98  ? 161 HIS A NE2   1 
ATOM   592  N  N     . GLU A 1 164 ? -15.898 -40.405 -13.589 1.00 31.03  ? 162 GLU A N     1 
ATOM   593  C  CA    . GLU A 1 164 ? -14.981 -41.187 -14.410 1.00 33.36  ? 162 GLU A CA    1 
ATOM   594  C  C     . GLU A 1 164 ? -15.546 -41.404 -15.811 1.00 35.27  ? 162 GLU A C     1 
ATOM   595  O  O     . GLU A 1 164 ? -14.876 -41.118 -16.805 1.00 36.72  ? 162 GLU A O     1 
ATOM   596  C  CB    . GLU A 1 164 ? -14.660 -42.526 -13.750 1.00 34.71  ? 162 GLU A CB    1 
ATOM   597  C  CG    . GLU A 1 164 ? -13.781 -43.423 -14.602 1.00 37.41  ? 162 GLU A CG    1 
ATOM   598  C  CD    . GLU A 1 164 ? -13.270 -44.626 -13.833 1.00 43.58  ? 162 GLU A CD    1 
ATOM   599  O  OE1   . GLU A 1 164 ? -14.094 -45.309 -13.188 1.00 43.49  ? 162 GLU A OE1   1 
ATOM   600  O  OE2   . GLU A 1 164 ? -12.040 -44.873 -13.859 1.00 47.99  ? 162 GLU A OE2   1 
ATOM   601  N  N     . ASN A 1 165 ? -16.777 -41.910 -15.880 1.00 30.19  ? 163 ASN A N     1 
ATOM   602  C  CA    . ASN A 1 165 ? -17.477 -42.100 -17.154 1.00 29.58  ? 163 ASN A CA    1 
ATOM   603  C  C     . ASN A 1 165 ? -17.550 -40.815 -17.975 1.00 29.52  ? 163 ASN A C     1 
ATOM   604  O  O     . ASN A 1 165 ? -17.301 -40.809 -19.174 1.00 30.60  ? 163 ASN A O     1 
ATOM   605  C  CB    . ASN A 1 165 ? -18.905 -42.613 -16.909 1.00 30.21  ? 163 ASN A CB    1 
ATOM   606  C  CG    . ASN A 1 165 ? -18.933 -43.989 -16.260 1.00 36.13  ? 163 ASN A CG    1 
ATOM   607  O  OD1   . ASN A 1 165 ? -17.918 -44.677 -16.195 1.00 40.91  ? 163 ASN A OD1   1 
ATOM   608  N  ND2   . ASN A 1 165 ? -20.104 -44.398 -15.787 1.00 34.98  ? 163 ASN A ND2   1 
ATOM   609  N  N     . TYR A 1 166 ? -17.904 -39.723 -17.316 1.00 25.49  ? 164 TYR A N     1 
ATOM   610  C  CA    . TYR A 1 166 ? -18.043 -38.444 -17.985 1.00 24.39  ? 164 TYR A CA    1 
ATOM   611  C  C     . TYR A 1 166 ? -16.699 -37.998 -18.556 1.00 26.98  ? 164 TYR A C     1 
ATOM   612  O  O     . TYR A 1 166 ? -16.606 -37.600 -19.723 1.00 31.77  ? 164 TYR A O     1 
ATOM   613  C  CB    . TYR A 1 166 ? -18.616 -37.403 -17.003 1.00 23.16  ? 164 TYR A CB    1 
ATOM   614  C  CG    . TYR A 1 166 ? -18.851 -36.042 -17.608 1.00 24.78  ? 164 TYR A CG    1 
ATOM   615  C  CD1   . TYR A 1 166 ? -17.828 -35.104 -17.655 1.00 23.06  ? 164 TYR A CD1   1 
ATOM   616  C  CD2   . TYR A 1 166 ? -20.089 -35.690 -18.137 1.00 26.25  ? 164 TYR A CD2   1 
ATOM   617  C  CE1   . TYR A 1 166 ? -18.017 -33.862 -18.206 1.00 24.31  ? 164 TYR A CE1   1 
ATOM   618  C  CE2   . TYR A 1 166 ? -20.295 -34.426 -18.698 1.00 27.73  ? 164 TYR A CE2   1 
ATOM   619  C  CZ    . TYR A 1 166 ? -19.245 -33.521 -18.727 1.00 28.77  ? 164 TYR A CZ    1 
ATOM   620  O  OH    . TYR A 1 166 ? -19.400 -32.262 -19.273 1.00 30.64  ? 164 TYR A OH    1 
ATOM   621  N  N     . LEU A 1 167 ? -15.651 -38.073 -17.743 1.00 26.79  ? 165 LEU A N     1 
ATOM   622  C  CA    . LEU A 1 167 ? -14.326 -37.646 -18.197 1.00 29.19  ? 165 LEU A CA    1 
ATOM   623  C  C     . LEU A 1 167 ? -13.808 -38.494 -19.363 1.00 27.60  ? 165 LEU A C     1 
ATOM   624  O  O     . LEU A 1 167 ? -13.209 -37.966 -20.304 1.00 26.34  ? 165 LEU A O     1 
ATOM   625  C  CB    . LEU A 1 167 ? -13.323 -37.600 -17.034 1.00 28.49  ? 165 LEU A CB    1 
ATOM   626  C  CG    . LEU A 1 167 ? -13.542 -36.419 -16.075 1.00 28.60  ? 165 LEU A CG    1 
ATOM   627  C  CD1   . LEU A 1 167 ? -12.776 -36.578 -14.764 1.00 27.03  ? 165 LEU A CD1   1 
ATOM   628  C  CD2   . LEU A 1 167 ? -13.183 -35.108 -16.745 1.00 24.71  ? 165 LEU A CD2   1 
ATOM   629  N  N     . ARG A 1 168 ? -14.070 -39.797 -19.309 1.00 24.77  ? 166 ARG A N     1 
ATOM   630  C  CA    . ARG A 1 168 ? -13.683 -40.710 -20.375 1.00 25.97  ? 166 ARG A CA    1 
ATOM   631  C  C     . ARG A 1 168 ? -14.454 -40.416 -21.638 1.00 29.53  ? 166 ARG A C     1 
ATOM   632  O  O     . ARG A 1 168 ? -13.884 -40.391 -22.720 1.00 34.00  ? 166 ARG A O     1 
ATOM   633  C  CB    . ARG A 1 168 ? -13.904 -42.175 -19.969 1.00 29.53  ? 166 ARG A CB    1 
ATOM   634  C  CG    . ARG A 1 168 ? -12.889 -42.684 -18.958 1.00 30.97  ? 166 ARG A CG    1 
ATOM   635  C  CD    . ARG A 1 168 ? -13.085 -44.159 -18.639 1.00 33.68  ? 166 ARG A CD    1 
ATOM   636  N  NE    . ARG A 1 168 ? -11.896 -44.734 -18.020 1.00 39.16  ? 166 ARG A NE    1 
ATOM   637  C  CZ    . ARG A 1 168 ? -11.905 -45.777 -17.195 1.00 42.84  ? 166 ARG A CZ    1 
ATOM   638  N  NH1   . ARG A 1 168 ? -13.054 -46.362 -16.863 1.00 43.72  ? 166 ARG A NH1   1 
ATOM   639  N  NH2   . ARG A 1 168 ? -10.763 -46.230 -16.691 1.00 40.63  ? 166 ARG A NH2   1 
ATOM   640  N  N     . GLU A 1 169 ? -15.755 -40.189 -21.510 1.00 31.42  ? 167 GLU A N     1 
ATOM   641  C  CA    . GLU A 1 169 ? -16.535 -39.826 -22.687 1.00 34.92  ? 167 GLU A CA    1 
ATOM   642  C  C     . GLU A 1 169 ? -16.037 -38.517 -23.312 1.00 33.26  ? 167 GLU A C     1 
ATOM   643  O  O     . GLU A 1 169 ? -15.845 -38.448 -24.531 1.00 33.32  ? 167 GLU A O     1 
ATOM   644  C  CB    . GLU A 1 169 ? -18.022 -39.735 -22.362 1.00 39.84  ? 167 GLU A CB    1 
ATOM   645  C  CG    . GLU A 1 169 ? -18.843 -39.055 -23.450 1.00 52.99  ? 167 GLU A CG    1 
ATOM   646  C  CD    . GLU A 1 169 ? -20.284 -38.817 -23.029 1.00 65.46  ? 167 GLU A CD    1 
ATOM   647  O  OE1   . GLU A 1 169 ? -20.798 -39.596 -22.196 1.00 70.43  ? 167 GLU A OE1   1 
ATOM   648  O  OE2   . GLU A 1 169 ? -20.899 -37.848 -23.521 1.00 69.72  ? 167 GLU A OE2   1 
ATOM   649  N  N     . LYS A 1 170 ? -15.817 -37.485 -22.490 1.00 26.38  ? 168 LYS A N     1 
ATOM   650  C  CA    . LYS A 1 170 ? -15.389 -36.185 -23.040 1.00 26.84  ? 168 LYS A CA    1 
ATOM   651  C  C     . LYS A 1 170 ? -13.976 -36.254 -23.617 1.00 27.54  ? 168 LYS A C     1 
ATOM   652  O  O     . LYS A 1 170 ? -13.642 -35.546 -24.572 1.00 29.98  ? 168 LYS A O     1 
ATOM   653  C  CB    . LYS A 1 170 ? -15.496 -35.059 -22.003 1.00 26.30  ? 168 LYS A CB    1 
ATOM   654  C  CG    . LYS A 1 170 ? -16.910 -34.858 -21.472 1.00 27.11  ? 168 LYS A CG    1 
ATOM   655  C  CD    . LYS A 1 170 ? -17.916 -34.935 -22.607 1.00 27.73  ? 168 LYS A CD    1 
ATOM   656  C  CE    . LYS A 1 170 ? -19.330 -35.075 -22.082 1.00 33.65  ? 168 LYS A CE    1 
ATOM   657  N  NZ    . LYS A 1 170 ? -20.336 -35.172 -23.177 1.00 34.33  ? 168 LYS A NZ    1 
ATOM   658  N  N     . CYS A 1 171 ? -13.155 -37.118 -23.030 1.00 27.57  ? 169 CYS A N     1 
ATOM   659  C  CA    . CYS A 1 171 ? -11.797 -37.329 -23.501 1.00 29.17  ? 169 CYS A CA    1 
ATOM   660  C  C     . CYS A 1 171 ? -11.858 -37.927 -24.904 1.00 32.14  ? 169 CYS A C     1 
ATOM   661  O  O     . CYS A 1 171 ? -11.160 -37.482 -25.809 1.00 30.08  ? 169 CYS A O     1 
ATOM   662  C  CB    . CYS A 1 171 ? -11.045 -38.267 -22.551 1.00 28.23  ? 169 CYS A CB    1 
ATOM   663  S  SG    . CYS A 1 171 ? -9.381  -38.693 -23.120 1.00 31.88  ? 169 CYS A SG    1 
ATOM   664  N  N     . MET A 1 172 ? -12.725 -38.918 -25.082 1.00 31.07  ? 170 MET A N     1 
ATOM   665  C  CA    . MET A 1 172 ? -12.888 -39.564 -26.374 1.00 30.92  ? 170 MET A CA    1 
ATOM   666  C  C     . MET A 1 172 ? -13.398 -38.580 -27.420 1.00 32.62  ? 170 MET A C     1 
ATOM   667  O  O     . MET A 1 172 ? -12.983 -38.620 -28.574 1.00 36.21  ? 170 MET A O     1 
ATOM   668  C  CB    . MET A 1 172 ? -13.828 -40.773 -26.260 1.00 31.90  ? 170 MET A CB    1 
ATOM   669  C  CG    . MET A 1 172 ? -13.970 -41.582 -27.565 1.00 37.31  ? 170 MET A CG    1 
ATOM   670  S  SD    . MET A 1 172 ? -12.410 -42.218 -28.275 1.00 39.13  ? 170 MET A SD    1 
ATOM   671  C  CE    . MET A 1 172 ? -12.025 -43.541 -27.147 1.00 32.21  ? 170 MET A CE    1 
ATOM   672  N  N     . GLU A 1 173 ? -14.287 -37.683 -27.005 1.00 30.25  ? 171 GLU A N     1 
ATOM   673  C  CA    . GLU A 1 173 ? -14.891 -36.731 -27.932 1.00 32.56  ? 171 GLU A CA    1 
ATOM   674  C  C     . GLU A 1 173 ? -13.903 -35.724 -28.489 1.00 29.52  ? 171 GLU A C     1 
ATOM   675  O  O     . GLU A 1 173 ? -13.854 -35.511 -29.696 1.00 29.90  ? 171 GLU A O     1 
ATOM   676  C  CB    . GLU A 1 173 ? -16.054 -35.970 -27.275 1.00 33.71  ? 171 GLU A CB    1 
ATOM   677  C  CG    . GLU A 1 173 ? -17.335 -36.765 -27.157 1.00 38.25  ? 171 GLU A CG    1 
ATOM   678  C  CD    . GLU A 1 173 ? -18.533 -35.905 -26.739 1.00 44.56  ? 171 GLU A CD    1 
ATOM   679  O  OE1   . GLU A 1 173 ? -19.636 -36.469 -26.577 1.00 50.63  ? 171 GLU A OE1   1 
ATOM   680  O  OE2   . GLU A 1 173 ? -18.377 -34.674 -26.585 1.00 40.04  ? 171 GLU A OE2   1 
ATOM   681  N  N     . VAL A 1 174 ? -13.136 -35.082 -27.613 1.00 30.15  ? 172 VAL A N     1 
ATOM   682  C  CA    . VAL A 1 174 ? -12.321 -33.949 -28.044 1.00 32.36  ? 172 VAL A CA    1 
ATOM   683  C  C     . VAL A 1 174 ? -10.840 -34.309 -28.291 1.00 31.00  ? 172 VAL A C     1 
ATOM   684  O  O     . VAL A 1 174 ? -10.136 -33.601 -29.021 1.00 29.76  ? 172 VAL A O     1 
ATOM   685  C  CB    . VAL A 1 174 ? -12.466 -32.745 -27.065 1.00 26.04  ? 172 VAL A CB    1 
ATOM   686  C  CG1   . VAL A 1 174 ? -11.786 -33.047 -25.726 1.00 23.01  ? 172 VAL A CG1   1 
ATOM   687  C  CG2   . VAL A 1 174 ? -11.909 -31.471 -27.698 1.00 25.82  ? 172 VAL A CG2   1 
ATOM   688  N  N     . LEU A 1 175 ? -10.384 -35.420 -27.712 1.00 28.83  ? 173 LEU A N     1 
ATOM   689  C  CA    . LEU A 1 175 ? -8.986  -35.848 -27.867 1.00 28.52  ? 173 LEU A CA    1 
ATOM   690  C  C     . LEU A 1 175 ? -8.823  -37.109 -28.723 1.00 30.95  ? 173 LEU A C     1 
ATOM   691  O  O     . LEU A 1 175 ? -7.782  -37.319 -29.351 1.00 34.21  ? 173 LEU A O     1 
ATOM   692  C  CB    . LEU A 1 175 ? -8.337  -36.064 -26.500 1.00 28.64  ? 173 LEU A CB    1 
ATOM   693  C  CG    . LEU A 1 175 ? -8.302  -34.849 -25.572 1.00 28.34  ? 173 LEU A CG    1 
ATOM   694  C  CD1   . LEU A 1 175 ? -7.559  -35.171 -24.286 1.00 23.79  ? 173 LEU A CD1   1 
ATOM   695  C  CD2   . LEU A 1 175 ? -7.668  -33.661 -26.277 1.00 29.49  ? 173 LEU A CD2   1 
ATOM   696  N  N     . GLY A 1 176 ? -9.845  -37.951 -28.733 1.00 30.29  ? 174 GLY A N     1 
ATOM   697  C  CA    . GLY A 1 176 ? -9.876  -39.101 -29.617 1.00 29.84  ? 174 GLY A CA    1 
ATOM   698  C  C     . GLY A 1 176 ? -9.260  -40.322 -28.967 1.00 31.78  ? 174 GLY A C     1 
ATOM   699  O  O     . GLY A 1 176 ? -8.842  -40.271 -27.808 1.00 30.69  ? 174 GLY A O     1 
ATOM   700  N  N     . LYS A 1 177 ? -9.178  -41.412 -29.725 1.00 29.66  ? 175 LYS A N     1 
ATOM   701  C  CA    . LYS A 1 177 ? -8.780  -42.706 -29.181 1.00 33.38  ? 175 LYS A CA    1 
ATOM   702  C  C     . LYS A 1 177 ? -7.309  -42.812 -28.742 1.00 34.84  ? 175 LYS A C     1 
ATOM   703  O  O     . LYS A 1 177 ? -6.931  -43.780 -28.085 1.00 38.28  ? 175 LYS A O     1 
ATOM   704  C  CB    . LYS A 1 177 ? -9.102  -43.815 -30.187 1.00 37.47  ? 175 LYS A CB    1 
ATOM   705  C  CG    . LYS A 1 177 ? -8.324  -43.713 -31.499 1.00 42.61  ? 175 LYS A CG    1 
ATOM   706  C  CD    . LYS A 1 177 ? -8.615  -44.914 -32.395 1.00 49.61  ? 175 LYS A CD    1 
ATOM   707  C  CE    . LYS A 1 177 ? -7.951  -44.779 -33.756 1.00 55.03  ? 175 LYS A CE    1 
ATOM   708  N  NZ    . LYS A 1 177 ? -6.469  -44.908 -33.675 1.00 56.15  ? 175 LYS A NZ    1 
ATOM   709  N  N     . ASP A 1 178 ? -6.480  -41.845 -29.124 1.00 32.01  ? 176 ASP A N     1 
ATOM   710  C  CA    . ASP A 1 178 ? -5.080  -41.834 -28.695 1.00 27.81  ? 176 ASP A CA    1 
ATOM   711  C  C     . ASP A 1 178 ? -4.927  -41.572 -27.205 1.00 28.61  ? 176 ASP A C     1 
ATOM   712  O  O     . ASP A 1 178 ? -3.841  -41.761 -26.653 1.00 27.51  ? 176 ASP A O     1 
ATOM   713  C  CB    . ASP A 1 178 ? -4.291  -40.761 -29.438 1.00 29.34  ? 176 ASP A CB    1 
ATOM   714  C  CG    . ASP A 1 178 ? -4.082  -41.099 -30.899 1.00 34.90  ? 176 ASP A CG    1 
ATOM   715  O  OD1   . ASP A 1 178 ? -4.307  -42.277 -31.264 1.00 33.86  ? 176 ASP A OD1   1 
ATOM   716  O  OD2   . ASP A 1 178 ? -3.692  -40.187 -31.673 1.00 37.50  ? 176 ASP A OD2   1 
ATOM   717  N  N     . PHE A 1 179 ? -6.003  -41.101 -26.573 1.00 27.53  ? 177 PHE A N     1 
ATOM   718  C  CA    . PHE A 1 179 ? -5.963  -40.685 -25.176 1.00 28.71  ? 177 PHE A CA    1 
ATOM   719  C  C     . PHE A 1 179 ? -6.944  -41.451 -24.319 1.00 28.09  ? 177 PHE A C     1 
ATOM   720  O  O     . PHE A 1 179 ? -7.987  -41.893 -24.784 1.00 32.18  ? 177 PHE A O     1 
ATOM   721  C  CB    . PHE A 1 179 ? -6.257  -39.195 -25.035 1.00 26.50  ? 177 PHE A CB    1 
ATOM   722  C  CG    . PHE A 1 179 ? -5.123  -38.311 -25.454 1.00 27.44  ? 177 PHE A CG    1 
ATOM   723  C  CD1   . PHE A 1 179 ? -4.203  -37.849 -24.518 1.00 24.68  ? 177 PHE A CD1   1 
ATOM   724  C  CD2   . PHE A 1 179 ? -4.972  -37.937 -26.780 1.00 28.89  ? 177 PHE A CD2   1 
ATOM   725  C  CE1   . PHE A 1 179 ? -3.153  -37.027 -24.900 1.00 28.68  ? 177 PHE A CE1   1 
ATOM   726  C  CE2   . PHE A 1 179 ? -3.915  -37.109 -27.170 1.00 28.71  ? 177 PHE A CE2   1 
ATOM   727  C  CZ    . PHE A 1 179 ? -3.009  -36.657 -26.225 1.00 29.05  ? 177 PHE A CZ    1 
ATOM   728  N  N     . SER A 1 180 ? -6.595  -41.580 -23.050 1.00 28.86  ? 178 SER A N     1 
ATOM   729  C  CA    . SER A 1 180 ? -7.409  -42.300 -22.100 1.00 32.90  ? 178 SER A CA    1 
ATOM   730  C  C     . SER A 1 180 ? -7.349  -41.563 -20.774 1.00 32.97  ? 178 SER A C     1 
ATOM   731  O  O     . SER A 1 180 ? -6.402  -40.814 -20.513 1.00 32.42  ? 178 SER A O     1 
ATOM   732  C  CB    . SER A 1 180 ? -6.859  -43.706 -21.910 1.00 30.42  ? 178 SER A CB    1 
ATOM   733  O  OG    . SER A 1 180 ? -5.777  -43.665 -21.005 1.00 35.67  ? 178 SER A OG    1 
ATOM   734  N  N     . ILE A 1 181 ? -8.360  -41.788 -19.944 1.00 32.45  ? 179 ILE A N     1 
ATOM   735  C  CA    . ILE A 1 181 ? -8.443  -41.194 -18.626 1.00 31.97  ? 179 ILE A CA    1 
ATOM   736  C  C     . ILE A 1 181 ? -8.587  -42.307 -17.617 1.00 31.35  ? 179 ILE A C     1 
ATOM   737  O  O     . ILE A 1 181 ? -9.372  -43.223 -17.819 1.00 29.72  ? 179 ILE A O     1 
ATOM   738  C  CB    . ILE A 1 181 ? -9.708  -40.316 -18.476 1.00 30.28  ? 179 ILE A CB    1 
ATOM   739  C  CG1   . ILE A 1 181 ? -9.513  -38.944 -19.126 1.00 26.16  ? 179 ILE A CG1   1 
ATOM   740  C  CG2   . ILE A 1 181 ? -10.071 -40.160 -16.992 1.00 26.17  ? 179 ILE A CG2   1 
ATOM   741  C  CD1   . ILE A 1 181 ? -8.791  -37.944 -18.247 1.00 21.93  ? 179 ILE A CD1   1 
ATOM   742  N  N     . LEU A 1 182 ? -7.835  -42.214 -16.530 1.00 35.47  ? 180 LEU A N     1 
ATOM   743  C  CA    . LEU A 1 182 ? -7.979  -43.122 -15.402 1.00 36.45  ? 180 LEU A CA    1 
ATOM   744  C  C     . LEU A 1 182 ? -8.144  -42.305 -14.112 1.00 30.86  ? 180 LEU A C     1 
ATOM   745  O  O     . LEU A 1 182 ? -7.372  -41.372 -13.853 1.00 29.35  ? 180 LEU A O     1 
ATOM   746  C  CB    . LEU A 1 182 ? -6.755  -44.034 -15.303 1.00 41.76  ? 180 LEU A CB    1 
ATOM   747  C  CG    . LEU A 1 182 ? -6.778  -45.036 -14.140 1.00 49.87  ? 180 LEU A CG    1 
ATOM   748  C  CD1   . LEU A 1 182 ? -7.931  -46.030 -14.288 1.00 52.11  ? 180 LEU A CD1   1 
ATOM   749  C  CD2   . LEU A 1 182 ? -5.449  -45.771 -14.012 1.00 53.18  ? 180 LEU A CD2   1 
ATOM   750  N  N     . ILE A 1 183 ? -9.158  -42.633 -13.318 1.00 29.04  ? 181 ILE A N     1 
ATOM   751  C  CA    . ILE A 1 183 ? -9.359  -41.980 -12.020 1.00 29.24  ? 181 ILE A CA    1 
ATOM   752  C  C     . ILE A 1 183 ? -8.680  -42.791 -10.926 1.00 29.54  ? 181 ILE A C     1 
ATOM   753  O  O     . ILE A 1 183 ? -8.894  -43.985 -10.815 1.00 30.46  ? 181 ILE A O     1 
ATOM   754  C  CB    . ILE A 1 183 ? -10.865 -41.804 -11.663 1.00 37.29  ? 181 ILE A CB    1 
ATOM   755  C  CG1   . ILE A 1 183 ? -11.615 -41.081 -12.780 1.00 32.95  ? 181 ILE A CG1   1 
ATOM   756  C  CG2   . ILE A 1 183 ? -11.022 -41.018 -10.375 1.00 40.63  ? 181 ILE A CG2   1 
ATOM   757  C  CD1   . ILE A 1 183 ? -11.037 -39.736 -13.123 1.00 32.80  ? 181 ILE A CD1   1 
ATOM   758  N  N     . CYS A 1 184 ? -7.851  -42.136 -10.128 1.00 30.76  ? 182 CYS A N     1 
ATOM   759  C  CA    . CYS A 1 184 ? -7.088  -42.820 -9.096  1.00 32.56  ? 182 CYS A CA    1 
ATOM   760  C  C     . CYS A 1 184 ? -7.550  -42.406 -7.709  1.00 29.47  ? 182 CYS A C     1 
ATOM   761  O  O     . CYS A 1 184 ? -8.748  -42.407 -7.424  1.00 29.08  ? 182 CYS A O     1 
ATOM   762  C  CB    . CYS A 1 184 ? -5.589  -42.539 -9.277  1.00 36.02  ? 182 CYS A CB    1 
ATOM   763  S  SG    . CYS A 1 184 ? -4.948  -43.146 -10.867 1.00 32.50  ? 182 CYS A SG    1 
ATOM   764  N  N     . GLY A 1 185 ? -6.594  -42.065 -6.846  1.00 27.50  ? 183 GLY A N     1 
ATOM   765  C  CA    . GLY A 1 185 ? -6.894  -41.557 -5.517  1.00 24.96  ? 183 GLY A CA    1 
ATOM   766  C  C     . GLY A 1 185 ? -7.575  -42.580 -4.625  1.00 27.83  ? 183 GLY A C     1 
ATOM   767  O  O     . GLY A 1 185 ? -7.580  -43.781 -4.906  1.00 30.75  ? 183 GLY A O     1 
ATOM   768  N  N     . SER A 1 186 ? -8.148  -42.102 -3.532  1.00 24.21  ? 184 SER A N     1 
ATOM   769  C  CA    . SER A 1 186 ? -8.812  -42.978 -2.580  1.00 25.09  ? 184 SER A CA    1 
ATOM   770  C  C     . SER A 1 186 ? -9.956  -43.740 -3.236  1.00 27.24  ? 184 SER A C     1 
ATOM   771  O  O     . SER A 1 186 ? -10.293 -44.839 -2.809  1.00 31.93  ? 184 SER A O     1 
ATOM   772  C  CB    . SER A 1 186 ? -9.310  -42.178 -1.368  1.00 26.88  ? 184 SER A CB    1 
ATOM   773  O  OG    . SER A 1 186 ? -10.356 -41.306 -1.750  1.00 31.92  ? 184 SER A OG    1 
ATOM   774  N  N     . TYR A 1 187 ? -10.544 -43.165 -4.281  1.00 26.85  ? 185 TYR A N     1 
ATOM   775  C  CA    . TYR A 1 187 ? -11.564 -43.872 -5.055  1.00 26.71  ? 185 TYR A CA    1 
ATOM   776  C  C     . TYR A 1 187 ? -11.040 -45.206 -5.578  1.00 30.19  ? 185 TYR A C     1 
ATOM   777  O  O     . TYR A 1 187 ? -11.712 -46.229 -5.479  1.00 30.35  ? 185 TYR A O     1 
ATOM   778  C  CB    . TYR A 1 187 ? -12.062 -43.004 -6.213  1.00 26.03  ? 185 TYR A CB    1 
ATOM   779  C  CG    . TYR A 1 187 ? -12.833 -43.753 -7.285  1.00 31.68  ? 185 TYR A CG    1 
ATOM   780  C  CD1   . TYR A 1 187 ? -14.153 -44.143 -7.086  1.00 30.99  ? 185 TYR A CD1   1 
ATOM   781  C  CD2   . TYR A 1 187 ? -12.242 -44.054 -8.504  1.00 35.65  ? 185 TYR A CD2   1 
ATOM   782  C  CE1   . TYR A 1 187 ? -14.855 -44.818 -8.071  1.00 32.75  ? 185 TYR A CE1   1 
ATOM   783  C  CE2   . TYR A 1 187 ? -12.932 -44.727 -9.489  1.00 36.78  ? 185 TYR A CE2   1 
ATOM   784  C  CZ    . TYR A 1 187 ? -14.235 -45.106 -9.273  1.00 37.94  ? 185 TYR A CZ    1 
ATOM   785  O  OH    . TYR A 1 187 ? -14.911 -45.769 -10.273 1.00 39.41  ? 185 TYR A OH    1 
ATOM   786  N  N     . ARG A 1 188 ? -9.840  -45.200 -6.144  1.00 31.76  ? 186 ARG A N     1 
ATOM   787  C  CA    . ARG A 1 188 ? -9.282  -46.428 -6.683  1.00 28.09  ? 186 ARG A CA    1 
ATOM   788  C  C     . ARG A 1 188 ? -8.890  -47.372 -5.543  1.00 29.11  ? 186 ARG A C     1 
ATOM   789  O  O     . ARG A 1 188 ? -8.855  -48.589 -5.714  1.00 30.10  ? 186 ARG A O     1 
ATOM   790  C  CB    . ARG A 1 188 ? -8.084  -46.145 -7.609  1.00 25.59  ? 186 ARG A CB    1 
ATOM   791  C  CG    . ARG A 1 188 ? -7.495  -47.426 -8.235  1.00 20.40  ? 186 ARG A CG    1 
ATOM   792  C  CD    . ARG A 1 188 ? -6.452  -47.153 -9.322  1.00 21.46  ? 186 ARG A CD    1 
ATOM   793  N  NE    . ARG A 1 188 ? -5.874  -48.411 -9.785  1.00 24.83  ? 186 ARG A NE    1 
ATOM   794  C  CZ    . ARG A 1 188 ? -4.618  -48.794 -9.587  1.00 22.26  ? 186 ARG A CZ    1 
ATOM   795  N  NH1   . ARG A 1 188 ? -3.746  -47.997 -8.965  1.00 20.62  ? 186 ARG A NH1   1 
ATOM   796  N  NH2   . ARG A 1 188 ? -4.228  -49.979 -10.033 1.00 21.08  ? 186 ARG A NH2   1 
ATOM   797  N  N     . ARG A 1 189 ? -8.591  -46.809 -4.380  1.00 27.04  ? 187 ARG A N     1 
ATOM   798  C  CA    . ARG A 1 189 ? -8.306  -47.626 -3.211  1.00 25.71  ? 187 ARG A CA    1 
ATOM   799  C  C     . ARG A 1 189 ? -9.615  -48.143 -2.634  1.00 27.93  ? 187 ARG A C     1 
ATOM   800  O  O     . ARG A 1 189 ? -9.631  -48.762 -1.580  1.00 28.00  ? 187 ARG A O     1 
ATOM   801  C  CB    . ARG A 1 189 ? -7.528  -46.835 -2.158  1.00 23.63  ? 187 ARG A CB    1 
ATOM   802  C  CG    . ARG A 1 189 ? -6.201  -46.329 -2.654  1.00 24.12  ? 187 ARG A CG    1 
ATOM   803  C  CD    . ARG A 1 189 ? -5.188  -46.217 -1.532  1.00 24.81  ? 187 ARG A CD    1 
ATOM   804  N  NE    . ARG A 1 189 ? -5.655  -45.428 -0.398  1.00 28.12  ? 187 ARG A NE    1 
ATOM   805  C  CZ    . ARG A 1 189 ? -5.791  -44.103 -0.410  1.00 28.41  ? 187 ARG A CZ    1 
ATOM   806  N  NH1   . ARG A 1 189 ? -5.528  -43.410 -1.516  1.00 24.66  ? 187 ARG A NH1   1 
ATOM   807  N  NH2   . ARG A 1 189 ? -6.205  -43.466 0.683   1.00 23.79  ? 187 ARG A NH2   1 
ATOM   808  N  N     . ARG A 1 190 ? -10.708 -47.849 -3.333  1.00 30.29  ? 188 ARG A N     1 
ATOM   809  C  CA    . ARG A 1 190 ? -12.026 -48.383 -3.023  1.00 33.24  ? 188 ARG A CA    1 
ATOM   810  C  C     . ARG A 1 190 ? -12.658 -47.870 -1.719  1.00 32.17  ? 188 ARG A C     1 
ATOM   811  O  O     . ARG A 1 190 ? -13.513 -48.536 -1.143  1.00 36.55  ? 188 ARG A O     1 
ATOM   812  C  CB    . ARG A 1 190 ? -11.991 -49.913 -3.051  1.00 39.29  ? 188 ARG A CB    1 
ATOM   813  C  CG    . ARG A 1 190 ? -11.544 -50.474 -4.388  1.00 47.92  ? 188 ARG A CG    1 
ATOM   814  C  CD    . ARG A 1 190 ? -11.432 -51.980 -4.340  1.00 54.19  ? 188 ARG A CD    1 
ATOM   815  N  NE    . ARG A 1 190 ? -12.697 -52.594 -3.957  1.00 60.96  ? 188 ARG A NE    1 
ATOM   816  C  CZ    . ARG A 1 190 ? -13.617 -53.004 -4.822  1.00 67.45  ? 188 ARG A CZ    1 
ATOM   817  N  NH1   . ARG A 1 190 ? -13.410 -52.866 -6.127  1.00 69.28  ? 188 ARG A NH1   1 
ATOM   818  N  NH2   . ARG A 1 190 ? -14.743 -53.553 -4.384  1.00 70.59  ? 188 ARG A NH2   1 
ATOM   819  N  N     . HIS A 1 191 ? -12.248 -46.692 -1.258  1.00 30.27  ? 189 HIS A N     1 
ATOM   820  C  CA    . HIS A 1 191 ? -12.944 -46.042 -0.146  1.00 31.04  ? 189 HIS A CA    1 
ATOM   821  C  C     . HIS A 1 191 ? -14.404 -45.710 -0.526  1.00 32.96  ? 189 HIS A C     1 
ATOM   822  O  O     . HIS A 1 191 ? -14.694 -45.355 -1.666  1.00 34.32  ? 189 HIS A O     1 
ATOM   823  C  CB    . HIS A 1 191 ? -12.212 -44.770 0.291   1.00 31.58  ? 189 HIS A CB    1 
ATOM   824  C  CG    . HIS A 1 191 ? -10.853 -45.015 0.869   1.00 34.52  ? 189 HIS A CG    1 
ATOM   825  N  ND1   . HIS A 1 191 ? -10.244 -44.141 1.738   1.00 32.73  ? 189 HIS A ND1   1 
ATOM   826  C  CD2   . HIS A 1 191 ? -9.984  -46.045 0.700   1.00 31.93  ? 189 HIS A CD2   1 
ATOM   827  C  CE1   . HIS A 1 191 ? -9.053  -44.609 2.076   1.00 30.31  ? 189 HIS A CE1   1 
ATOM   828  N  NE2   . HIS A 1 191 ? -8.880  -45.767 1.464   1.00 32.75  ? 189 HIS A NE2   1 
ATOM   829  N  N     . PRO A 1 192 ? -15.337 -45.845 0.423   1.00 32.00  ? 190 PRO A N     1 
ATOM   830  C  CA    . PRO A 1 192 ? -16.715 -45.449 0.085   1.00 30.50  ? 190 PRO A CA    1 
ATOM   831  C  C     . PRO A 1 192 ? -16.859 -43.952 -0.249  1.00 31.19  ? 190 PRO A C     1 
ATOM   832  O  O     . PRO A 1 192 ? -17.686 -43.589 -1.088  1.00 30.65  ? 190 PRO A O     1 
ATOM   833  C  CB    . PRO A 1 192 ? -17.527 -45.823 1.349   1.00 31.12  ? 190 PRO A CB    1 
ATOM   834  C  CG    . PRO A 1 192 ? -16.500 -46.223 2.404   1.00 34.63  ? 190 PRO A CG    1 
ATOM   835  C  CD    . PRO A 1 192 ? -15.258 -46.635 1.665   1.00 32.44  ? 190 PRO A CD    1 
ATOM   836  N  N     . PHE A 1 193 ? -16.063 -43.097 0.386   1.00 31.09  ? 191 PHE A N     1 
ATOM   837  C  CA    . PHE A 1 193 ? -16.085 -41.664 0.072   1.00 30.29  ? 191 PHE A CA    1 
ATOM   838  C  C     . PHE A 1 193 ? -14.686 -41.142 -0.266  1.00 30.69  ? 191 PHE A C     1 
ATOM   839  O  O     . PHE A 1 193 ? -13.696 -41.650 0.261   1.00 31.29  ? 191 PHE A O     1 
ATOM   840  C  CB    . PHE A 1 193 ? -16.672 -40.866 1.241   1.00 30.92  ? 191 PHE A CB    1 
ATOM   841  C  CG    . PHE A 1 193 ? -18.086 -41.254 1.584   1.00 32.18  ? 191 PHE A CG    1 
ATOM   842  C  CD1   . PHE A 1 193 ? -18.344 -42.215 2.557   1.00 36.18  ? 191 PHE A CD1   1 
ATOM   843  C  CD2   . PHE A 1 193 ? -19.156 -40.665 0.931   1.00 31.83  ? 191 PHE A CD2   1 
ATOM   844  C  CE1   . PHE A 1 193 ? -19.650 -42.580 2.881   1.00 40.19  ? 191 PHE A CE1   1 
ATOM   845  C  CE2   . PHE A 1 193 ? -20.469 -41.024 1.245   1.00 37.45  ? 191 PHE A CE2   1 
ATOM   846  C  CZ    . PHE A 1 193 ? -20.715 -41.988 2.219   1.00 39.14  ? 191 PHE A CZ    1 
ATOM   847  N  N     . SER A 1 194 ? -14.611 -40.138 -1.144  1.00 26.04  ? 192 SER A N     1 
ATOM   848  C  CA    . SER A 1 194 ? -13.345 -39.454 -1.453  1.00 26.60  ? 192 SER A CA    1 
ATOM   849  C  C     . SER A 1 194 ? -13.510 -37.940 -1.357  1.00 25.72  ? 192 SER A C     1 
ATOM   850  O  O     . SER A 1 194 ? -14.621 -37.431 -1.423  1.00 27.51  ? 192 SER A O     1 
ATOM   851  C  CB    . SER A 1 194 ? -12.855 -39.803 -2.860  1.00 27.95  ? 192 SER A CB    1 
ATOM   852  O  OG    . SER A 1 194 ? -12.623 -41.190 -2.989  1.00 40.24  ? 192 SER A OG    1 
ATOM   853  N  N     . GLY A 1 195 ? -12.393 -37.228 -1.219  1.00 20.34  ? 193 GLY A N     1 
ATOM   854  C  CA    . GLY A 1 195 ? -12.410 -35.783 -1.149  1.00 20.86  ? 193 GLY A CA    1 
ATOM   855  C  C     . GLY A 1 195 ? -12.235 -35.119 -2.515  1.00 23.95  ? 193 GLY A C     1 
ATOM   856  O  O     . GLY A 1 195 ? -12.324 -33.909 -2.621  1.00 23.76  ? 193 GLY A O     1 
ATOM   857  N  N     . ASP A 1 196 ? -11.966 -35.892 -3.564  1.00 21.54  ? 194 ASP A N     1 
ATOM   858  C  CA    . ASP A 1 196 ? -11.850 -35.285 -4.884  1.00 21.49  ? 194 ASP A CA    1 
ATOM   859  C  C     . ASP A 1 196 ? -11.848 -36.293 -6.022  1.00 24.24  ? 194 ASP A C     1 
ATOM   860  O  O     . ASP A 1 196 ? -11.972 -37.496 -5.806  1.00 23.39  ? 194 ASP A O     1 
ATOM   861  C  CB    . ASP A 1 196 ? -10.615 -34.371 -4.985  1.00 27.76  ? 194 ASP A CB    1 
ATOM   862  C  CG    . ASP A 1 196 ? -9.298  -35.142 -4.903  1.00 29.49  ? 194 ASP A CG    1 
ATOM   863  O  OD1   . ASP A 1 196 ? -9.336  -36.389 -4.855  1.00 28.64  ? 194 ASP A OD1   1 
ATOM   864  O  OD2   . ASP A 1 196 ? -8.226  -34.496 -4.897  1.00 34.52  ? 194 ASP A OD2   1 
ATOM   865  N  N     . VAL A 1 197 ? -11.746 -35.762 -7.238  1.00 25.74  ? 195 VAL A N     1 
ATOM   866  C  CA    . VAL A 1 197 ? -11.647 -36.550 -8.456  1.00 25.00  ? 195 VAL A CA    1 
ATOM   867  C  C     . VAL A 1 197 ? -10.238 -36.371 -8.995  1.00 25.61  ? 195 VAL A C     1 
ATOM   868  O  O     . VAL A 1 197 ? -9.831  -35.267 -9.372  1.00 22.47  ? 195 VAL A O     1 
ATOM   869  C  CB    . VAL A 1 197 ? -12.649 -36.090 -9.508  1.00 25.43  ? 195 VAL A CB    1 
ATOM   870  C  CG1   . VAL A 1 197 ? -12.536 -36.967 -10.745 1.00 24.70  ? 195 VAL A CG1   1 
ATOM   871  C  CG2   . VAL A 1 197 ? -14.070 -36.121 -8.935  1.00 25.55  ? 195 VAL A CG2   1 
ATOM   872  N  N     . ASP A 1 198 ? -9.487  -37.463 -9.015  1.00 26.12  ? 196 ASP A N     1 
ATOM   873  C  CA    . ASP A 1 198 ? -8.050  -37.386 -9.240  1.00 29.10  ? 196 ASP A CA    1 
ATOM   874  C  C     . ASP A 1 198 ? -7.718  -38.197 -10.498 1.00 26.95  ? 196 ASP A C     1 
ATOM   875  O  O     . ASP A 1 198 ? -7.658  -39.428 -10.477 1.00 26.06  ? 196 ASP A O     1 
ATOM   876  C  CB    . ASP A 1 198 ? -7.351  -37.837 -7.944  1.00 35.21  ? 196 ASP A CB    1 
ATOM   877  C  CG    . ASP A 1 198 ? -5.996  -38.466 -8.159  1.00 42.85  ? 196 ASP A CG    1 
ATOM   878  O  OD1   . ASP A 1 198 ? -5.306  -38.151 -9.149  1.00 46.55  ? 196 ASP A OD1   1 
ATOM   879  O  OD2   . ASP A 1 198 ? -5.607  -39.268 -7.283  1.00 43.31  ? 196 ASP A OD2   1 
ATOM   880  N  N     . ALA A 1 199 ? -7.539  -37.485 -11.607 1.00 19.60  ? 197 ALA A N     1 
ATOM   881  C  CA    . ALA A 1 199 ? -7.489  -38.116 -12.927 1.00 22.05  ? 197 ALA A CA    1 
ATOM   882  C  C     . ALA A 1 199 ? -6.122  -38.088 -13.606 1.00 25.41  ? 197 ALA A C     1 
ATOM   883  O  O     . ALA A 1 199 ? -5.385  -37.108 -13.515 1.00 20.81  ? 197 ALA A O     1 
ATOM   884  C  CB    . ALA A 1 199 ? -8.525  -37.484 -13.849 1.00 19.69  ? 197 ALA A CB    1 
ATOM   885  N  N     . ILE A 1 200 ? -5.798  -39.172 -14.302 1.00 23.45  ? 198 ILE A N     1 
ATOM   886  C  CA    . ILE A 1 200 ? -4.621  -39.194 -15.157 1.00 24.07  ? 198 ILE A CA    1 
ATOM   887  C  C     . ILE A 1 200 ? -5.021  -39.158 -16.629 1.00 23.33  ? 198 ILE A C     1 
ATOM   888  O  O     . ILE A 1 200 ? -5.832  -39.956 -17.087 1.00 25.43  ? 198 ILE A O     1 
ATOM   889  C  CB    . ILE A 1 200 ? -3.756  -40.448 -14.907 1.00 27.62  ? 198 ILE A CB    1 
ATOM   890  C  CG1   . ILE A 1 200 ? -3.095  -40.376 -13.530 1.00 27.26  ? 198 ILE A CG1   1 
ATOM   891  C  CG2   . ILE A 1 200 ? -2.696  -40.586 -15.984 1.00 26.64  ? 198 ILE A CG2   1 
ATOM   892  C  CD1   . ILE A 1 200 ? -2.552  -41.718 -13.064 1.00 27.98  ? 198 ILE A CD1   1 
ATOM   893  N  N     . LEU A 1 201 ? -4.455  -38.211 -17.361 1.00 23.82  ? 199 LEU A N     1 
ATOM   894  C  CA    . LEU A 1 201 ? -4.635  -38.146 -18.802 1.00 23.62  ? 199 LEU A CA    1 
ATOM   895  C  C     . LEU A 1 201 ? -3.344  -38.611 -19.452 1.00 24.74  ? 199 LEU A C     1 
ATOM   896  O  O     . LEU A 1 201 ? -2.258  -38.132 -19.105 1.00 27.30  ? 199 LEU A O     1 
ATOM   897  C  CB    . LEU A 1 201 ? -4.950  -36.711 -19.233 1.00 19.57  ? 199 LEU A CB    1 
ATOM   898  C  CG    . LEU A 1 201 ? -5.090  -36.462 -20.733 1.00 21.81  ? 199 LEU A CG    1 
ATOM   899  C  CD1   . LEU A 1 201 ? -6.293  -37.196 -21.275 1.00 21.39  ? 199 LEU A CD1   1 
ATOM   900  C  CD2   . LEU A 1 201 ? -5.184  -34.974 -21.035 1.00 22.51  ? 199 LEU A CD2   1 
ATOM   901  N  N     . SER A 1 202 ? -3.452  -39.553 -20.381 1.00 23.13  ? 200 SER A N     1 
ATOM   902  C  CA    . SER A 1 202 ? -2.262  -40.103 -21.028 1.00 26.14  ? 200 SER A CA    1 
ATOM   903  C  C     . SER A 1 202 ? -2.573  -40.716 -22.383 1.00 28.19  ? 200 SER A C     1 
ATOM   904  O  O     . SER A 1 202 ? -3.704  -41.127 -22.649 1.00 28.01  ? 200 SER A O     1 
ATOM   905  C  CB    . SER A 1 202 ? -1.615  -41.158 -20.127 1.00 24.72  ? 200 SER A CB    1 
ATOM   906  O  OG    . SER A 1 202 ? -2.489  -42.252 -19.931 1.00 25.19  ? 200 SER A OG    1 
ATOM   907  N  N     . ARG A 1 203 ? -1.566  -40.769 -23.249 1.00 28.00  ? 201 ARG A N     1 
ATOM   908  C  CA    . ARG A 1 203 ? -1.720  -41.448 -24.532 1.00 25.47  ? 201 ARG A CA    1 
ATOM   909  C  C     . ARG A 1 203 ? -1.706  -42.968 -24.359 1.00 25.24  ? 201 ARG A C     1 
ATOM   910  O  O     . ARG A 1 203 ? -0.988  -43.504 -23.510 1.00 26.18  ? 201 ARG A O     1 
ATOM   911  C  CB    . ARG A 1 203 ? -0.669  -40.964 -25.530 1.00 25.49  ? 201 ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 203 ? -0.942  -39.542 -26.000 1.00 25.65  ? 201 ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 203 ? 0.220   -38.951 -26.787 1.00 26.19  ? 201 ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 203 ? 0.366   -39.569 -28.100 1.00 24.98  ? 201 ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 203 ? -0.350  -39.213 -29.159 1.00 29.74  ? 201 ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 203 ? -1.261  -38.250 -29.044 1.00 29.02  ? 201 ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 203 ? -0.166  -39.817 -30.326 1.00 31.12  ? 201 ARG A NH2   1 
ATOM   918  N  N     . THR A 1 204 ? -2.534  -43.659 -25.135 1.00 24.35  ? 202 THR A N     1 
ATOM   919  C  CA    . THR A 1 204 ? -2.640  -45.102 -25.017 1.00 26.19  ? 202 THR A CA    1 
ATOM   920  C  C     . THR A 1 204 ? -1.369  -45.740 -25.558 1.00 30.61  ? 202 THR A C     1 
ATOM   921  O  O     . THR A 1 204 ? -0.596  -45.096 -26.273 1.00 26.43  ? 202 THR A O     1 
ATOM   922  C  CB    . THR A 1 204 ? -3.812  -45.650 -25.828 1.00 27.40  ? 202 THR A CB    1 
ATOM   923  O  OG1   . THR A 1 204 ? -3.534  -45.486 -27.221 1.00 30.74  ? 202 THR A OG1   1 
ATOM   924  C  CG2   . THR A 1 204 ? -5.112  -44.929 -25.473 1.00 25.61  ? 202 THR A CG2   1 
ATOM   925  N  N     . LEU A 1 205 ? -1.156  -47.009 -25.221 1.00 36.23  ? 203 LEU A N     1 
ATOM   926  C  CA    . LEU A 1 205 ? 0.011   -47.740 -25.706 1.00 38.06  ? 203 LEU A CA    1 
ATOM   927  C  C     . LEU A 1 205 ? 0.029   -47.856 -27.234 1.00 38.27  ? 203 LEU A C     1 
ATOM   928  O  O     . LEU A 1 205 ? 1.093   -48.000 -27.825 1.00 35.69  ? 203 LEU A O     1 
ATOM   929  C  CB    . LEU A 1 205 ? 0.110   -49.117 -25.034 1.00 39.38  ? 203 LEU A CB    1 
ATOM   930  C  CG    . LEU A 1 205 ? 0.734   -49.036 -23.631 1.00 43.22  ? 203 LEU A CG    1 
ATOM   931  C  CD1   . LEU A 1 205 ? 0.441   -50.270 -22.791 1.00 45.90  ? 203 LEU A CD1   1 
ATOM   932  C  CD2   . LEU A 1 205 ? 2.242   -48.780 -23.714 1.00 42.10  ? 203 LEU A CD2   1 
ATOM   933  N  N     . ASP A 1 206 ? -1.148  -47.757 -27.856 1.00 40.21  ? 204 ASP A N     1 
ATOM   934  C  CA    . ASP A 1 206 ? -1.308  -47.909 -29.308 1.00 42.56  ? 204 ASP A CA    1 
ATOM   935  C  C     . ASP A 1 206 ? -1.141  -46.617 -30.097 1.00 35.88  ? 204 ASP A C     1 
ATOM   936  O  O     . ASP A 1 206 ? -1.105  -46.636 -31.326 1.00 34.58  ? 204 ASP A O     1 
ATOM   937  C  CB    . ASP A 1 206 ? -2.697  -48.473 -29.630 1.00 49.09  ? 204 ASP A CB    1 
ATOM   938  C  CG    . ASP A 1 206 ? -2.798  -49.955 -29.357 1.00 55.81  ? 204 ASP A CG    1 
ATOM   939  O  OD1   . ASP A 1 206 ? -1.783  -50.661 -29.541 1.00 56.13  ? 204 ASP A OD1   1 
ATOM   940  O  OD2   . ASP A 1 206 ? -3.888  -50.414 -28.954 1.00 59.58  ? 204 ASP A OD2   1 
ATOM   941  N  N     . ALA A 1 207 ? -1.086  -45.492 -29.398 1.00 29.13  ? 205 ALA A N     1 
ATOM   942  C  CA    . ALA A 1 207 ? -1.016  -44.206 -30.069 1.00 28.32  ? 205 ALA A CA    1 
ATOM   943  C  C     . ALA A 1 207 ? 0.365   -44.018 -30.677 1.00 31.25  ? 205 ALA A C     1 
ATOM   944  O  O     . ALA A 1 207 ? 1.363   -44.470 -30.114 1.00 34.99  ? 205 ALA A O     1 
ATOM   945  C  CB    . ALA A 1 207 ? -1.318  -43.075 -29.083 1.00 25.69  ? 205 ALA A CB    1 
ATOM   946  N  N     . PRO A 1 208 ? 0.425   -43.346 -31.830 1.00 33.05  ? 206 PRO A N     1 
ATOM   947  C  CA    . PRO A 1 208 ? 1.706   -43.060 -32.481 1.00 35.46  ? 206 PRO A CA    1 
ATOM   948  C  C     . PRO A 1 208 ? 2.636   -42.312 -31.519 1.00 34.01  ? 206 PRO A C     1 
ATOM   949  O  O     . PRO A 1 208 ? 2.181   -41.467 -30.747 1.00 32.69  ? 206 PRO A O     1 
ATOM   950  C  CB    . PRO A 1 208 ? 1.309   -42.143 -33.647 1.00 35.00  ? 206 PRO A CB    1 
ATOM   951  C  CG    . PRO A 1 208 ? -0.144  -42.445 -33.902 1.00 32.63  ? 206 PRO A CG    1 
ATOM   952  C  CD    . PRO A 1 208 ? -0.717  -42.744 -32.545 1.00 32.22  ? 206 PRO A CD    1 
ATOM   953  N  N     . PRO A 1 209 ? 3.932   -42.626 -31.559 1.00 35.08  ? 207 PRO A N     1 
ATOM   954  C  CA    . PRO A 1 209 ? 4.913   -41.870 -30.774 1.00 36.27  ? 207 PRO A CA    1 
ATOM   955  C  C     . PRO A 1 209 ? 4.955   -40.391 -31.181 1.00 35.38  ? 207 PRO A C     1 
ATOM   956  O  O     . PRO A 1 209 ? 4.660   -40.033 -32.318 1.00 36.33  ? 207 PRO A O     1 
ATOM   957  C  CB    . PRO A 1 209 ? 6.255   -42.560 -31.105 1.00 34.68  ? 207 PRO A CB    1 
ATOM   958  C  CG    . PRO A 1 209 ? 6.008   -43.330 -32.359 1.00 36.09  ? 207 PRO A CG    1 
ATOM   959  C  CD    . PRO A 1 209 ? 4.547   -43.696 -32.363 1.00 37.79  ? 207 PRO A CD    1 
ATOM   960  N  N     . LEU A 1 210 ? 5.308   -39.538 -30.232 1.00 36.32  ? 208 LEU A N     1 
ATOM   961  C  CA    . LEU A 1 210 ? 5.484   -38.124 -30.501 1.00 36.94  ? 208 LEU A CA    1 
ATOM   962  C  C     . LEU A 1 210 ? 6.974   -37.855 -30.472 1.00 36.66  ? 208 LEU A C     1 
ATOM   963  O  O     . LEU A 1 210 ? 7.727   -38.619 -29.878 1.00 37.25  ? 208 LEU A O     1 
ATOM   964  C  CB    . LEU A 1 210 ? 4.794   -37.294 -29.420 1.00 32.70  ? 208 LEU A CB    1 
ATOM   965  C  CG    . LEU A 1 210 ? 3.279   -37.458 -29.300 1.00 32.60  ? 208 LEU A CG    1 
ATOM   966  C  CD1   . LEU A 1 210 ? 2.763   -36.577 -28.178 1.00 32.02  ? 208 LEU A CD1   1 
ATOM   967  C  CD2   . LEU A 1 210 ? 2.610   -37.095 -30.615 1.00 32.67  ? 208 LEU A CD2   1 
ATOM   968  N  N     . SER A 1 211 ? 7.400   -36.775 -31.111 1.00 36.00  ? 209 SER A N     1 
ATOM   969  C  CA    . SER A 1 211 ? 8.800   -36.379 -31.050 1.00 39.73  ? 209 SER A CA    1 
ATOM   970  C  C     . SER A 1 211 ? 9.049   -35.275 -30.005 1.00 39.53  ? 209 SER A C     1 
ATOM   971  O  O     . SER A 1 211 ? 10.150  -34.736 -29.921 1.00 39.61  ? 209 SER A O     1 
ATOM   972  C  CB    . SER A 1 211 ? 9.304   -35.960 -32.437 1.00 37.44  ? 209 SER A CB    1 
ATOM   973  O  OG    . SER A 1 211 ? 8.526   -34.901 -32.961 1.00 38.26  ? 209 SER A OG    1 
ATOM   974  N  N     . GLU A 1 212 ? 8.025   -34.969 -29.204 1.00 34.06  ? 210 GLU A N     1 
ATOM   975  C  CA    A GLU A 1 212 ? 8.077   -33.922 -28.178 0.50 31.07  ? 210 GLU A CA    1 
ATOM   976  C  CA    B GLU A 1 212 ? 8.153   -33.969 -28.149 0.50 31.49  ? 210 GLU A CA    1 
ATOM   977  C  C     . GLU A 1 212 ? 7.403   -34.407 -26.895 1.00 30.81  ? 210 GLU A C     1 
ATOM   978  O  O     . GLU A 1 212 ? 6.587   -35.319 -26.938 1.00 32.50  ? 210 GLU A O     1 
ATOM   979  C  CB    A GLU A 1 212 ? 7.326   -32.679 -28.663 0.50 29.94  ? 210 GLU A CB    1 
ATOM   980  C  CB    B GLU A 1 212 ? 7.633   -32.611 -28.626 0.50 30.60  ? 210 GLU A CB    1 
ATOM   981  C  CG    A GLU A 1 212 ? 7.970   -31.950 -29.830 0.50 29.24  ? 210 GLU A CG    1 
ATOM   982  C  CG    B GLU A 1 212 ? 6.134   -32.551 -28.823 0.50 31.18  ? 210 GLU A CG    1 
ATOM   983  C  CD    A GLU A 1 212 ? 9.199   -31.161 -29.410 0.50 28.57  ? 210 GLU A CD    1 
ATOM   984  C  CD    B GLU A 1 212 ? 5.660   -31.200 -29.342 0.50 32.16  ? 210 GLU A CD    1 
ATOM   985  O  OE1   A GLU A 1 212 ? 9.151   -30.460 -28.373 0.50 28.94  ? 210 GLU A OE1   1 
ATOM   986  O  OE1   B GLU A 1 212 ? 6.314   -30.178 -29.046 0.50 33.39  ? 210 GLU A OE1   1 
ATOM   987  O  OE2   A GLU A 1 212 ? 10.215  -31.250 -30.118 0.50 29.88  ? 210 GLU A OE2   1 
ATOM   988  O  OE2   B GLU A 1 212 ? 4.630   -31.164 -30.045 0.50 31.76  ? 210 GLU A OE2   1 
ATOM   989  N  N     . PRO A 1 213 ? 7.702   -33.768 -25.754 1.00 28.56  ? 211 PRO A N     1 
ATOM   990  C  CA    . PRO A 1 213 ? 6.914   -34.132 -24.567 1.00 26.62  ? 211 PRO A CA    1 
ATOM   991  C  C     . PRO A 1 213 ? 5.437   -33.895 -24.862 1.00 22.87  ? 211 PRO A C     1 
ATOM   992  O  O     . PRO A 1 213 ? 5.096   -32.922 -25.537 1.00 26.25  ? 211 PRO A O     1 
ATOM   993  C  CB    . PRO A 1 213 ? 7.399   -33.141 -23.499 1.00 27.65  ? 211 PRO A CB    1 
ATOM   994  C  CG    . PRO A 1 213 ? 8.780   -32.713 -23.980 1.00 30.13  ? 211 PRO A CG    1 
ATOM   995  C  CD    . PRO A 1 213 ? 8.665   -32.688 -25.480 1.00 28.32  ? 211 PRO A CD    1 
ATOM   996  N  N     . VAL A 1 214 ? 4.562   -34.767 -24.379 1.00 19.73  ? 212 VAL A N     1 
ATOM   997  C  CA    . VAL A 1 214 ? 3.149   -34.598 -24.687 1.00 21.64  ? 212 VAL A CA    1 
ATOM   998  C  C     . VAL A 1 214 ? 2.590   -33.295 -24.103 1.00 26.35  ? 212 VAL A C     1 
ATOM   999  O  O     . VAL A 1 214 ? 1.660   -32.716 -24.658 1.00 29.78  ? 212 VAL A O     1 
ATOM   1000 C  CB    . VAL A 1 214 ? 2.295   -35.828 -24.271 1.00 23.77  ? 212 VAL A CB    1 
ATOM   1001 C  CG1   . VAL A 1 214 ? 2.300   -36.002 -22.777 1.00 21.56  ? 212 VAL A CG1   1 
ATOM   1002 C  CG2   . VAL A 1 214 ? 0.878   -35.682 -24.787 1.00 22.03  ? 212 VAL A CG2   1 
ATOM   1003 N  N     . ALA A 1 215 ? 3.171   -32.813 -23.006 1.00 27.55  ? 213 ALA A N     1 
ATOM   1004 C  CA    . ALA A 1 215 ? 2.689   -31.577 -22.395 1.00 29.01  ? 213 ALA A CA    1 
ATOM   1005 C  C     . ALA A 1 215 ? 3.023   -30.339 -23.233 1.00 29.73  ? 213 ALA A C     1 
ATOM   1006 O  O     . ALA A 1 215 ? 2.482   -29.266 -22.995 1.00 34.19  ? 213 ALA A O     1 
ATOM   1007 C  CB    . ALA A 1 215 ? 3.233   -31.422 -20.970 1.00 27.06  ? 213 ALA A CB    1 
ATOM   1008 N  N     . ALA A 1 216 ? 3.923   -30.486 -24.199 1.00 28.14  ? 214 ALA A N     1 
ATOM   1009 C  CA    . ALA A 1 216 ? 4.298   -29.373 -25.068 1.00 29.31  ? 214 ALA A CA    1 
ATOM   1010 C  C     . ALA A 1 216 ? 3.311   -29.173 -26.227 1.00 31.19  ? 214 ALA A C     1 
ATOM   1011 O  O     . ALA A 1 216 ? 3.374   -28.174 -26.936 1.00 29.24  ? 214 ALA A O     1 
ATOM   1012 C  CB    . ALA A 1 216 ? 5.728   -29.566 -25.608 1.00 24.58  ? 214 ALA A CB    1 
ATOM   1013 N  N     . THR A 1 217 ? 2.412   -30.129 -26.424 1.00 33.16  ? 215 THR A N     1 
ATOM   1014 C  CA    . THR A 1 217 ? 1.410   -30.019 -27.479 1.00 37.40  ? 215 THR A CA    1 
ATOM   1015 C  C     . THR A 1 217 ? 0.185   -29.216 -27.014 1.00 39.19  ? 215 THR A C     1 
ATOM   1016 O  O     . THR A 1 217 ? -0.698  -28.905 -27.810 1.00 44.39  ? 215 THR A O     1 
ATOM   1017 C  CB    . THR A 1 217 ? 0.932   -31.411 -27.931 1.00 40.63  ? 215 THR A CB    1 
ATOM   1018 O  OG1   . THR A 1 217 ? 0.291   -32.071 -26.836 1.00 40.03  ? 215 THR A OG1   1 
ATOM   1019 C  CG2   . THR A 1 217 ? 2.101   -32.267 -28.391 1.00 41.99  ? 215 THR A CG2   1 
ATOM   1020 N  N     . GLY A 1 218 ? 0.125   -28.903 -25.721 1.00 35.02  ? 216 GLY A N     1 
ATOM   1021 C  CA    . GLY A 1 218 ? -0.969  -28.110 -25.176 1.00 32.48  ? 216 GLY A CA    1 
ATOM   1022 C  C     . GLY A 1 218 ? -2.262  -28.883 -24.972 1.00 31.96  ? 216 GLY A C     1 
ATOM   1023 O  O     . GLY A 1 218 ? -3.314  -28.281 -24.795 1.00 36.55  ? 216 GLY A O     1 
ATOM   1024 N  N     . VAL A 1 219 ? -2.189  -30.215 -24.969 1.00 31.40  ? 217 VAL A N     1 
ATOM   1025 C  CA    . VAL A 1 219 ? -3.400  -31.031 -24.884 1.00 29.91  ? 217 VAL A CA    1 
ATOM   1026 C  C     . VAL A 1 219 ? -4.178  -30.917 -23.558 1.00 28.72  ? 217 VAL A C     1 
ATOM   1027 O  O     . VAL A 1 219 ? -5.405  -30.996 -23.555 1.00 31.62  ? 217 VAL A O     1 
ATOM   1028 C  CB    . VAL A 1 219 ? -3.145  -32.513 -25.226 1.00 31.35  ? 217 VAL A CB    1 
ATOM   1029 C  CG1   . VAL A 1 219 ? -2.215  -33.149 -24.217 1.00 25.29  ? 217 VAL A CG1   1 
ATOM   1030 C  CG2   . VAL A 1 219 ? -4.455  -33.261 -25.262 1.00 32.73  ? 217 VAL A CG2   1 
ATOM   1031 N  N     . LEU A 1 220 ? -3.484  -30.716 -22.442 1.00 26.15  ? 218 LEU A N     1 
ATOM   1032 C  CA    . LEU A 1 220 ? -4.183  -30.535 -21.170 1.00 23.76  ? 218 LEU A CA    1 
ATOM   1033 C  C     . LEU A 1 220 ? -5.084  -29.301 -21.232 1.00 23.58  ? 218 LEU A C     1 
ATOM   1034 O  O     . LEU A 1 220 ? -6.235  -29.349 -20.805 1.00 27.35  ? 218 LEU A O     1 
ATOM   1035 C  CB    . LEU A 1 220 ? -3.209  -30.439 -19.983 1.00 23.77  ? 218 LEU A CB    1 
ATOM   1036 C  CG    . LEU A 1 220 ? -3.877  -30.365 -18.601 1.00 24.60  ? 218 LEU A CG    1 
ATOM   1037 C  CD1   . LEU A 1 220 ? -4.861  -31.508 -18.395 1.00 21.20  ? 218 LEU A CD1   1 
ATOM   1038 C  CD2   . LEU A 1 220 ? -2.843  -30.344 -17.476 1.00 26.14  ? 218 LEU A CD2   1 
ATOM   1039 N  N     . GLY A 1 221 ? -4.557  -28.206 -21.774 1.00 26.97  ? 219 GLY A N     1 
ATOM   1040 C  CA    . GLY A 1 221 ? -5.323  -26.976 -21.937 1.00 28.55  ? 219 GLY A CA    1 
ATOM   1041 C  C     . GLY A 1 221 ? -6.522  -27.087 -22.875 1.00 27.10  ? 219 GLY A C     1 
ATOM   1042 O  O     . GLY A 1 221 ? -7.575  -26.502 -22.631 1.00 31.19  ? 219 GLY A O     1 
ATOM   1043 N  N     . HIS A 1 222 ? -6.362  -27.839 -23.953 1.00 28.21  ? 220 HIS A N     1 
ATOM   1044 C  CA    . HIS A 1 222 ? -7.450  -28.070 -24.892 1.00 29.14  ? 220 HIS A CA    1 
ATOM   1045 C  C     . HIS A 1 222 ? -8.542  -28.845 -24.196 1.00 30.64  ? 220 HIS A C     1 
ATOM   1046 O  O     . HIS A 1 222 ? -9.721  -28.536 -24.334 1.00 37.66  ? 220 HIS A O     1 
ATOM   1047 C  CB    . HIS A 1 222 ? -6.950  -28.873 -26.097 1.00 33.25  ? 220 HIS A CB    1 
ATOM   1048 C  CG    . HIS A 1 222 ? -5.935  -28.144 -26.926 1.00 39.02  ? 220 HIS A CG    1 
ATOM   1049 N  ND1   . HIS A 1 222 ? -5.800  -26.777 -26.899 1.00 42.16  ? 220 HIS A ND1   1 
ATOM   1050 C  CD2   . HIS A 1 222 ? -5.011  -28.601 -27.807 1.00 40.66  ? 220 HIS A CD2   1 
ATOM   1051 C  CE1   . HIS A 1 222 ? -4.836  -26.414 -27.733 1.00 41.72  ? 220 HIS A CE1   1 
ATOM   1052 N  NE2   . HIS A 1 222 ? -4.345  -27.501 -28.294 1.00 40.32  ? 220 HIS A NE2   1 
ATOM   1053 N  N     . PHE A 1 223 ? -8.140  -29.859 -23.440 1.00 27.70  ? 221 PHE A N     1 
ATOM   1054 C  CA    . PHE A 1 223 ? -9.093  -30.706 -22.743 1.00 30.07  ? 221 PHE A CA    1 
ATOM   1055 C  C     . PHE A 1 223 ? -9.836  -29.907 -21.668 1.00 25.47  ? 221 PHE A C     1 
ATOM   1056 O  O     . PHE A 1 223 ? -11.048 -30.025 -21.525 1.00 25.22  ? 221 PHE A O     1 
ATOM   1057 C  CB    . PHE A 1 223 ? -8.371  -31.910 -22.132 1.00 31.17  ? 221 PHE A CB    1 
ATOM   1058 C  CG    . PHE A 1 223 ? -9.283  -32.883 -21.445 1.00 31.06  ? 221 PHE A CG    1 
ATOM   1059 C  CD1   . PHE A 1 223 ? -10.406 -33.371 -22.087 1.00 30.90  ? 221 PHE A CD1   1 
ATOM   1060 C  CD2   . PHE A 1 223 ? -9.007  -33.324 -20.162 1.00 30.19  ? 221 PHE A CD2   1 
ATOM   1061 C  CE1   . PHE A 1 223 ? -11.248 -34.276 -21.455 1.00 25.75  ? 221 PHE A CE1   1 
ATOM   1062 C  CE2   . PHE A 1 223 ? -9.835  -34.233 -19.528 1.00 30.78  ? 221 PHE A CE2   1 
ATOM   1063 C  CZ    . PHE A 1 223 ? -10.954 -34.712 -20.174 1.00 26.98  ? 221 PHE A CZ    1 
ATOM   1064 N  N     . VAL A 1 224 ? -9.097  -29.098 -20.919 1.00 22.24  ? 222 VAL A N     1 
ATOM   1065 C  CA    . VAL A 1 224 ? -9.685  -28.271 -19.869 1.00 22.10  ? 222 VAL A CA    1 
ATOM   1066 C  C     . VAL A 1 224 ? -10.724 -27.300 -20.466 1.00 25.86  ? 222 VAL A C     1 
ATOM   1067 O  O     . VAL A 1 224 ? -11.828 -27.158 -19.942 1.00 28.52  ? 222 VAL A O     1 
ATOM   1068 C  CB    . VAL A 1 224 ? -8.581  -27.514 -19.079 1.00 21.54  ? 222 VAL A CB    1 
ATOM   1069 C  CG1   . VAL A 1 224 ? -9.155  -26.304 -18.320 1.00 22.66  ? 222 VAL A CG1   1 
ATOM   1070 C  CG2   . VAL A 1 224 ? -7.850  -28.466 -18.137 1.00 18.94  ? 222 VAL A CG2   1 
ATOM   1071 N  N     . GLU A 1 225 ? -10.361 -26.650 -21.566 1.00 25.83  ? 223 GLU A N     1 
ATOM   1072 C  CA    . GLU A 1 225 ? -11.247 -25.714 -22.243 1.00 30.97  ? 223 GLU A CA    1 
ATOM   1073 C  C     . GLU A 1 225 ? -12.501 -26.412 -22.748 1.00 29.39  ? 223 GLU A C     1 
ATOM   1074 O  O     . GLU A 1 225 ? -13.595 -25.849 -22.691 1.00 31.13  ? 223 GLU A O     1 
ATOM   1075 C  CB    . GLU A 1 225 ? -10.546 -25.049 -23.419 1.00 37.99  ? 223 GLU A CB    1 
ATOM   1076 C  CG    . GLU A 1 225 ? -9.427  -24.111 -23.058 1.00 49.13  ? 223 GLU A CG    1 
ATOM   1077 C  CD    . GLU A 1 225 ? -8.783  -23.513 -24.298 1.00 55.61  ? 223 GLU A CD    1 
ATOM   1078 O  OE1   . GLU A 1 225 ? -7.632  -23.894 -24.619 1.00 54.54  ? 223 GLU A OE1   1 
ATOM   1079 O  OE2   . GLU A 1 225 ? -9.439  -22.673 -24.958 1.00 58.79  ? 223 GLU A OE2   1 
ATOM   1080 N  N     . PHE A 1 226 ? -12.346 -27.638 -23.237 1.00 26.92  ? 224 PHE A N     1 
ATOM   1081 C  CA    . PHE A 1 226 ? -13.505 -28.398 -23.671 1.00 27.07  ? 224 PHE A CA    1 
ATOM   1082 C  C     . PHE A 1 226 ? -14.468 -28.573 -22.502 1.00 28.44  ? 224 PHE A C     1 
ATOM   1083 O  O     . PHE A 1 226 ? -15.660 -28.303 -22.627 1.00 29.75  ? 224 PHE A O     1 
ATOM   1084 C  CB    . PHE A 1 226 ? -13.105 -29.758 -24.245 1.00 26.15  ? 224 PHE A CB    1 
ATOM   1085 C  CG    . PHE A 1 226 ? -14.240 -30.485 -24.913 1.00 26.68  ? 224 PHE A CG    1 
ATOM   1086 C  CD1   . PHE A 1 226 ? -14.836 -29.961 -26.049 1.00 26.08  ? 224 PHE A CD1   1 
ATOM   1087 C  CD2   . PHE A 1 226 ? -14.717 -31.680 -24.402 1.00 24.81  ? 224 PHE A CD2   1 
ATOM   1088 C  CE1   . PHE A 1 226 ? -15.878 -30.622 -26.670 1.00 27.12  ? 224 PHE A CE1   1 
ATOM   1089 C  CE2   . PHE A 1 226 ? -15.763 -32.340 -25.014 1.00 26.77  ? 224 PHE A CE2   1 
ATOM   1090 C  CZ    . PHE A 1 226 ? -16.343 -31.808 -26.155 1.00 26.06  ? 224 PHE A CZ    1 
ATOM   1091 N  N     . LEU A 1 227 ? -13.931 -28.998 -21.361 1.00 26.78  ? 225 LEU A N     1 
ATOM   1092 C  CA    . LEU A 1 227 ? -14.732 -29.261 -20.175 1.00 26.29  ? 225 LEU A CA    1 
ATOM   1093 C  C     . LEU A 1 227 ? -15.322 -27.983 -19.588 1.00 25.35  ? 225 LEU A C     1 
ATOM   1094 O  O     . LEU A 1 227 ? -16.353 -28.019 -18.924 1.00 28.27  ? 225 LEU A O     1 
ATOM   1095 C  CB    . LEU A 1 227 ? -13.891 -29.969 -19.116 1.00 22.24  ? 225 LEU A CB    1 
ATOM   1096 C  CG    . LEU A 1 227 ? -13.362 -31.354 -19.501 1.00 25.18  ? 225 LEU A CG    1 
ATOM   1097 C  CD1   . LEU A 1 227 ? -12.365 -31.820 -18.453 1.00 23.16  ? 225 LEU A CD1   1 
ATOM   1098 C  CD2   . LEU A 1 227 ? -14.520 -32.344 -19.651 1.00 24.63  ? 225 LEU A CD2   1 
ATOM   1099 N  N     . GLU A 1 228 ? -14.661 -26.858 -19.823 1.00 24.37  ? 226 GLU A N     1 
ATOM   1100 C  CA    . GLU A 1 228 ? -15.204 -25.593 -19.372 1.00 27.90  ? 226 GLU A CA    1 
ATOM   1101 C  C     . GLU A 1 228 ? -16.381 -25.182 -20.252 1.00 30.51  ? 226 GLU A C     1 
ATOM   1102 O  O     . GLU A 1 228 ? -17.398 -24.725 -19.738 1.00 30.60  ? 226 GLU A O     1 
ATOM   1103 C  CB    . GLU A 1 228 ? -14.127 -24.512 -19.321 1.00 26.76  ? 226 GLU A CB    1 
ATOM   1104 C  CG    . GLU A 1 228 ? -13.209 -24.679 -18.117 1.00 29.22  ? 226 GLU A CG    1 
ATOM   1105 C  CD    . GLU A 1 228 ? -11.920 -23.885 -18.218 1.00 30.90  ? 226 GLU A CD    1 
ATOM   1106 O  OE1   . GLU A 1 228 ? -11.578 -23.418 -19.332 1.00 28.41  ? 226 GLU A OE1   1 
ATOM   1107 O  OE2   . GLU A 1 228 ? -11.241 -23.738 -17.175 1.00 26.95  ? 226 GLU A OE2   1 
ATOM   1108 N  N     . SER A 1 229 ? -16.260 -25.376 -21.565 1.00 29.23  ? 227 SER A N     1 
ATOM   1109 C  CA    . SER A 1 229 ? -17.326 -24.960 -22.476 1.00 32.25  ? 227 SER A CA    1 
ATOM   1110 C  C     . SER A 1 229 ? -18.601 -25.728 -22.164 1.00 30.07  ? 227 SER A C     1 
ATOM   1111 O  O     . SER A 1 229 ? -19.698 -25.233 -22.385 1.00 33.54  ? 227 SER A O     1 
ATOM   1112 C  CB    . SER A 1 229 ? -16.925 -25.108 -23.951 1.00 30.63  ? 227 SER A CB    1 
ATOM   1113 O  OG    . SER A 1 229 ? -16.908 -26.460 -24.361 1.00 33.60  ? 227 SER A OG    1 
ATOM   1114 N  N     . LEU A 1 230 ? -18.440 -26.924 -21.610 1.00 30.12  ? 228 LEU A N     1 
ATOM   1115 C  CA    . LEU A 1 230 ? -19.567 -27.761 -21.210 1.00 31.25  ? 228 LEU A CA    1 
ATOM   1116 C  C     . LEU A 1 230 ? -20.091 -27.386 -19.822 1.00 31.65  ? 228 LEU A C     1 
ATOM   1117 O  O     . LEU A 1 230 ? -21.073 -27.958 -19.341 1.00 30.98  ? 228 LEU A O     1 
ATOM   1118 C  CB    . LEU A 1 230 ? -19.144 -29.233 -21.197 1.00 28.25  ? 228 LEU A CB    1 
ATOM   1119 C  CG    . LEU A 1 230 ? -18.862 -29.898 -22.543 1.00 30.81  ? 228 LEU A CG    1 
ATOM   1120 C  CD1   . LEU A 1 230 ? -18.019 -31.148 -22.328 1.00 29.08  ? 228 LEU A CD1   1 
ATOM   1121 C  CD2   . LEU A 1 230 ? -20.168 -30.238 -23.281 1.00 26.90  ? 228 LEU A CD2   1 
ATOM   1122 N  N     . LYS A 1 231 ? -19.420 -26.442 -19.172 1.00 31.11  ? 229 LYS A N     1 
ATOM   1123 C  CA    . LYS A 1 231 ? -19.759 -26.071 -17.801 1.00 29.97  ? 229 LYS A CA    1 
ATOM   1124 C  C     . LYS A 1 231 ? -19.541 -27.210 -16.803 1.00 30.95  ? 229 LYS A C     1 
ATOM   1125 O  O     . LYS A 1 231 ? -20.145 -27.215 -15.721 1.00 34.45  ? 229 LYS A O     1 
ATOM   1126 C  CB    . LYS A 1 231 ? -21.208 -25.567 -17.707 1.00 30.13  ? 229 LYS A CB    1 
ATOM   1127 C  CG    . LYS A 1 231 ? -21.548 -24.443 -18.687 1.00 36.86  ? 229 LYS A CG    1 
ATOM   1128 C  CD    . LYS A 1 231 ? -20.467 -23.376 -18.692 1.00 44.22  ? 229 LYS A CD    1 
ATOM   1129 C  CE    . LYS A 1 231 ? -20.851 -22.193 -19.577 1.00 52.98  ? 229 LYS A CE    1 
ATOM   1130 N  NZ    . LYS A 1 231 ? -19.683 -21.300 -19.819 1.00 57.66  ? 229 LYS A NZ    1 
ATOM   1131 N  N     . TYR A 1 232 ? -18.699 -28.181 -17.153 1.00 27.58  ? 230 TYR A N     1 
ATOM   1132 C  CA    . TYR A 1 232 ? -18.309 -29.185 -16.164 1.00 28.04  ? 230 TYR A CA    1 
ATOM   1133 C  C     . TYR A 1 232 ? -17.268 -28.563 -15.227 1.00 27.18  ? 230 TYR A C     1 
ATOM   1134 O  O     . TYR A 1 232 ? -17.413 -28.596 -14.009 1.00 27.26  ? 230 TYR A O     1 
ATOM   1135 C  CB    . TYR A 1 232 ? -17.775 -30.470 -16.820 1.00 26.83  ? 230 TYR A CB    1 
ATOM   1136 C  CG    . TYR A 1 232 ? -17.190 -31.465 -15.825 1.00 26.16  ? 230 TYR A CG    1 
ATOM   1137 C  CD1   . TYR A 1 232 ? -18.009 -32.283 -15.070 1.00 24.88  ? 230 TYR A CD1   1 
ATOM   1138 C  CD2   . TYR A 1 232 ? -15.819 -31.578 -15.643 1.00 24.19  ? 230 TYR A CD2   1 
ATOM   1139 C  CE1   . TYR A 1 232 ? -17.482 -33.193 -14.155 1.00 23.72  ? 230 TYR A CE1   1 
ATOM   1140 C  CE2   . TYR A 1 232 ? -15.278 -32.490 -14.736 1.00 23.55  ? 230 TYR A CE2   1 
ATOM   1141 C  CZ    . TYR A 1 232 ? -16.111 -33.291 -14.002 1.00 24.33  ? 230 TYR A CZ    1 
ATOM   1142 O  OH    . TYR A 1 232 ? -15.584 -34.189 -13.109 1.00 21.04  ? 230 TYR A OH    1 
ATOM   1143 N  N     . LEU A 1 233 ? -16.218 -27.994 -15.805 1.00 23.98  ? 231 LEU A N     1 
ATOM   1144 C  CA    . LEU A 1 233 ? -15.230 -27.258 -15.026 1.00 24.08  ? 231 LEU A CA    1 
ATOM   1145 C  C     . LEU A 1 233 ? -15.710 -25.820 -14.882 1.00 25.32  ? 231 LEU A C     1 
ATOM   1146 O  O     . LEU A 1 233 ? -15.950 -25.149 -15.886 1.00 32.00  ? 231 LEU A O     1 
ATOM   1147 C  CB    . LEU A 1 233 ? -13.849 -27.282 -15.716 1.00 19.44  ? 231 LEU A CB    1 
ATOM   1148 C  CG    . LEU A 1 233 ? -13.059 -28.605 -15.771 1.00 19.02  ? 231 LEU A CG    1 
ATOM   1149 C  CD1   . LEU A 1 233 ? -11.675 -28.360 -16.321 1.00 21.71  ? 231 LEU A CD1   1 
ATOM   1150 C  CD2   . LEU A 1 233 ? -12.949 -29.284 -14.409 1.00 15.75  ? 231 LEU A CD2   1 
ATOM   1151 N  N     . GLU A 1 234 ? -15.857 -25.340 -13.650 1.00 26.58  ? 232 GLU A N     1 
ATOM   1152 C  CA    . GLU A 1 234 ? -16.420 -24.004 -13.450 1.00 31.36  ? 232 GLU A CA    1 
ATOM   1153 C  C     . GLU A 1 234 ? -15.512 -23.038 -12.684 1.00 30.25  ? 232 GLU A C     1 
ATOM   1154 O  O     . GLU A 1 234 ? -15.814 -21.854 -12.581 1.00 28.24  ? 232 GLU A O     1 
ATOM   1155 C  CB    . GLU A 1 234 ? -17.814 -24.074 -12.813 1.00 34.61  ? 232 GLU A CB    1 
ATOM   1156 C  CG    . GLU A 1 234 ? -17.873 -24.758 -11.461 1.00 38.51  ? 232 GLU A CG    1 
ATOM   1157 C  CD    . GLU A 1 234 ? -19.257 -24.663 -10.810 1.00 39.53  ? 232 GLU A CD    1 
ATOM   1158 O  OE1   . GLU A 1 234 ? -20.224 -25.251 -11.339 1.00 39.01  ? 232 GLU A OE1   1 
ATOM   1159 O  OE2   . GLU A 1 234 ? -19.375 -24.000 -9.759  1.00 38.12  ? 232 GLU A OE2   1 
ATOM   1160 N  N     . ALA A 1 235 ? -14.392 -23.533 -12.167 1.00 27.42  ? 233 ALA A N     1 
ATOM   1161 C  CA    . ALA A 1 235 ? -13.460 -22.660 -11.461 1.00 28.10  ? 233 ALA A CA    1 
ATOM   1162 C  C     . ALA A 1 235 ? -12.075 -23.282 -11.430 1.00 25.86  ? 233 ALA A C     1 
ATOM   1163 O  O     . ALA A 1 235 ? -11.942 -24.490 -11.324 1.00 30.40  ? 233 ALA A O     1 
ATOM   1164 C  CB    . ALA A 1 235 ? -13.962 -22.368 -10.035 1.00 26.79  ? 233 ALA A CB    1 
ATOM   1165 N  N     . THR A 1 236 ? -11.047 -22.448 -11.543 1.00 28.24  ? 234 THR A N     1 
ATOM   1166 C  CA    . THR A 1 236 ? -9.674  -22.926 -11.618 1.00 29.48  ? 234 THR A CA    1 
ATOM   1167 C  C     . THR A 1 236 ? -8.888  -22.471 -10.399 1.00 31.04  ? 234 THR A C     1 
ATOM   1168 O  O     . THR A 1 236 ? -8.879  -21.288 -10.062 1.00 32.88  ? 234 THR A O     1 
ATOM   1169 C  CB    . THR A 1 236 ? -8.950  -22.405 -12.890 1.00 32.26  ? 234 THR A CB    1 
ATOM   1170 O  OG1   . THR A 1 236 ? -9.598  -22.904 -14.068 1.00 35.65  ? 234 THR A OG1   1 
ATOM   1171 C  CG2   . THR A 1 236 ? -7.487  -22.857 -12.906 1.00 25.94  ? 234 THR A CG2   1 
ATOM   1172 N  N     . MET A 1 237 ? -8.227  -23.409 -9.732  1.00 26.95  ? 235 MET A N     1 
ATOM   1173 C  CA    . MET A 1 237 ? -7.313  -23.043 -8.657  1.00 26.49  ? 235 MET A CA    1 
ATOM   1174 C  C     . MET A 1 237 ? -5.910  -22.826 -9.184  1.00 28.12  ? 235 MET A C     1 
ATOM   1175 O  O     . MET A 1 237 ? -5.226  -21.889 -8.784  1.00 25.68  ? 235 MET A O     1 
ATOM   1176 C  CB    . MET A 1 237 ? -7.315  -24.115 -7.579  1.00 28.12  ? 235 MET A CB    1 
ATOM   1177 C  CG    . MET A 1 237 ? -8.544  -24.020 -6.705  1.00 27.85  ? 235 MET A CG    1 
ATOM   1178 S  SD    . MET A 1 237 ? -8.949  -25.573 -5.931  1.00 38.84  ? 235 MET A SD    1 
ATOM   1179 C  CE    . MET A 1 237 ? -10.162 -24.991 -4.742  1.00 36.74  ? 235 MET A CE    1 
ATOM   1180 N  N     . ALA A 1 238 ? -5.485  -23.711 -10.080 1.00 28.66  ? 236 ALA A N     1 
ATOM   1181 C  CA    . ALA A 1 238 ? -4.173  -23.615 -10.686 1.00 29.68  ? 236 ALA A CA    1 
ATOM   1182 C  C     . ALA A 1 238 ? -4.131  -24.500 -11.924 1.00 28.03  ? 236 ALA A C     1 
ATOM   1183 O  O     . ALA A 1 238 ? -4.700  -25.586 -11.934 1.00 29.28  ? 236 ALA A O     1 
ATOM   1184 C  CB    . ALA A 1 238 ? -3.103  -24.024 -9.694  1.00 28.96  ? 236 ALA A CB    1 
ATOM   1185 N  N     . GLN A 1 239 ? -3.465  -24.022 -12.968 1.00 32.10  ? 237 GLN A N     1 
ATOM   1186 C  CA    . GLN A 1 239 ? -3.331  -24.787 -14.202 1.00 32.20  ? 237 GLN A CA    1 
ATOM   1187 C  C     . GLN A 1 239 ? -1.972  -24.541 -14.849 1.00 31.52  ? 237 GLN A C     1 
ATOM   1188 O  O     . GLN A 1 239 ? -1.568  -23.404 -15.033 1.00 31.91  ? 237 GLN A O     1 
ATOM   1189 C  CB    . GLN A 1 239 ? -4.440  -24.409 -15.177 1.00 31.73  ? 237 GLN A CB    1 
ATOM   1190 C  CG    . GLN A 1 239 ? -4.387  -25.137 -16.509 1.00 28.89  ? 237 GLN A CG    1 
ATOM   1191 C  CD    . GLN A 1 239 ? -5.539  -24.745 -17.422 1.00 27.86  ? 237 GLN A CD    1 
ATOM   1192 O  OE1   . GLN A 1 239 ? -6.491  -24.089 -16.992 1.00 25.92  ? 237 GLN A OE1   1 
ATOM   1193 N  NE2   . GLN A 1 239 ? -5.466  -25.155 -18.680 1.00 27.43  ? 237 GLN A NE2   1 
ATOM   1194 N  N     . GLY A 1 240 ? -1.266  -25.614 -15.185 1.00 29.76  ? 238 GLY A N     1 
ATOM   1195 C  CA    . GLY A 1 240 ? -0.045  -25.521 -15.971 1.00 20.44  ? 238 GLY A CA    1 
ATOM   1196 C  C     . GLY A 1 240 ? -0.136  -26.578 -17.056 1.00 24.98  ? 238 GLY A C     1 
ATOM   1197 O  O     . GLY A 1 240 ? -1.193  -27.196 -17.227 1.00 24.27  ? 238 GLY A O     1 
ATOM   1198 N  N     . PRO A 1 241 ? 0.962   -26.799 -17.794 1.00 26.34  ? 239 PRO A N     1 
ATOM   1199 C  CA    . PRO A 1 241 ? 0.943   -27.777 -18.891 1.00 26.20  ? 239 PRO A CA    1 
ATOM   1200 C  C     . PRO A 1 241 ? 0.900   -29.225 -18.408 1.00 24.23  ? 239 PRO A C     1 
ATOM   1201 O  O     . PRO A 1 241 ? 0.499   -30.093 -19.181 1.00 22.55  ? 239 PRO A O     1 
ATOM   1202 C  CB    . PRO A 1 241 ? 2.256   -27.505 -19.645 1.00 25.74  ? 239 PRO A CB    1 
ATOM   1203 C  CG    . PRO A 1 241 ? 3.131   -26.805 -18.685 1.00 25.95  ? 239 PRO A CG    1 
ATOM   1204 C  CD    . PRO A 1 241 ? 2.229   -26.052 -17.729 1.00 25.89  ? 239 PRO A CD    1 
ATOM   1205 N  N     . LEU A 1 242 ? 1.284   -29.473 -17.157 1.00 25.03  ? 240 LEU A N     1 
ATOM   1206 C  CA    . LEU A 1 242 ? 1.276   -30.827 -16.589 1.00 23.75  ? 240 LEU A CA    1 
ATOM   1207 C  C     . LEU A 1 242 ? 0.096   -31.115 -15.655 1.00 26.00  ? 240 LEU A C     1 
ATOM   1208 O  O     . LEU A 1 242 ? -0.321  -32.263 -15.511 1.00 22.77  ? 240 LEU A O     1 
ATOM   1209 C  CB    . LEU A 1 242 ? 2.567   -31.067 -15.816 1.00 24.56  ? 240 LEU A CB    1 
ATOM   1210 C  CG    . LEU A 1 242 ? 3.844   -31.118 -16.655 1.00 30.48  ? 240 LEU A CG    1 
ATOM   1211 C  CD1   . LEU A 1 242 ? 5.082   -31.026 -15.774 1.00 31.50  ? 240 LEU A CD1   1 
ATOM   1212 C  CD2   . LEU A 1 242 ? 3.850   -32.386 -17.460 1.00 29.55  ? 240 LEU A CD2   1 
ATOM   1213 N  N     . LYS A 1 243 ? -0.422  -30.083 -14.995 1.00 26.37  ? 241 LYS A N     1 
ATOM   1214 C  CA    . LYS A 1 243 ? -1.411  -30.300 -13.950 1.00 26.22  ? 241 LYS A CA    1 
ATOM   1215 C  C     . LYS A 1 243 ? -2.492  -29.233 -13.863 1.00 23.74  ? 241 LYS A C     1 
ATOM   1216 O  O     . LYS A 1 243 ? -2.202  -28.033 -13.823 1.00 26.57  ? 241 LYS A O     1 
ATOM   1217 C  CB    . LYS A 1 243 ? -0.724  -30.427 -12.586 1.00 26.30  ? 241 LYS A CB    1 
ATOM   1218 C  CG    . LYS A 1 243 ? -1.697  -30.419 -11.430 1.00 28.45  ? 241 LYS A CG    1 
ATOM   1219 C  CD    . LYS A 1 243 ? -1.267  -31.349 -10.340 1.00 35.06  ? 241 LYS A CD    1 
ATOM   1220 C  CE    . LYS A 1 243 ? -1.130  -30.623 -9.040  1.00 37.84  ? 241 LYS A CE    1 
ATOM   1221 N  NZ    . LYS A 1 243 ? -0.262  -29.449 -9.231  1.00 37.85  ? 241 LYS A NZ    1 
ATOM   1222 N  N     . TYR A 1 244 ? -3.737  -29.692 -13.814 1.00 21.75  ? 242 TYR A N     1 
ATOM   1223 C  CA    . TYR A 1 244 ? -4.889  -28.828 -13.594 1.00 22.43  ? 242 TYR A CA    1 
ATOM   1224 C  C     . TYR A 1 244 ? -5.511  -29.137 -12.231 1.00 23.75  ? 242 TYR A C     1 
ATOM   1225 O  O     . TYR A 1 244 ? -5.691  -30.305 -11.880 1.00 27.72  ? 242 TYR A O     1 
ATOM   1226 C  CB    . TYR A 1 244 ? -5.952  -29.031 -14.681 1.00 19.87  ? 242 TYR A CB    1 
ATOM   1227 C  CG    . TYR A 1 244 ? -7.279  -28.368 -14.323 1.00 20.17  ? 242 TYR A CG    1 
ATOM   1228 C  CD1   . TYR A 1 244 ? -7.528  -27.037 -14.652 1.00 20.46  ? 242 TYR A CD1   1 
ATOM   1229 C  CD2   . TYR A 1 244 ? -8.268  -29.065 -13.633 1.00 22.09  ? 242 TYR A CD2   1 
ATOM   1230 C  CE1   . TYR A 1 244 ? -8.739  -26.427 -14.322 1.00 22.52  ? 242 TYR A CE1   1 
ATOM   1231 C  CE2   . TYR A 1 244 ? -9.476  -28.459 -13.288 1.00 24.61  ? 242 TYR A CE2   1 
ATOM   1232 C  CZ    . TYR A 1 244 ? -9.702  -27.143 -13.639 1.00 25.15  ? 242 TYR A CZ    1 
ATOM   1233 O  OH    . TYR A 1 244 ? -10.890 -26.543 -13.304 1.00 26.24  ? 242 TYR A OH    1 
ATOM   1234 N  N     . MET A 1 245 ? -5.833  -28.093 -11.468 1.00 23.38  ? 243 MET A N     1 
ATOM   1235 C  CA    . MET A 1 245 ? -6.599  -28.246 -10.223 1.00 25.11  ? 243 MET A CA    1 
ATOM   1236 C  C     . MET A 1 245 ? -7.763  -27.260 -10.245 1.00 27.31  ? 243 MET A C     1 
ATOM   1237 O  O     . MET A 1 245 ? -7.556  -26.066 -10.424 1.00 22.82  ? 243 MET A O     1 
ATOM   1238 C  CB    . MET A 1 245 ? -5.720  -27.970 -8.996  1.00 24.09  ? 243 MET A CB    1 
ATOM   1239 C  CG    . MET A 1 245 ? -4.536  -28.929 -8.858  1.00 33.04  ? 243 MET A CG    1 
ATOM   1240 S  SD    . MET A 1 245 ? -3.704  -28.854 -7.252  1.00 38.22  ? 243 MET A SD    1 
ATOM   1241 C  CE    . MET A 1 245 ? -3.160  -27.146 -7.232  1.00 24.87  ? 243 MET A CE    1 
ATOM   1242 N  N     . GLY A 1 246 ? -8.986  -27.747 -10.070 1.00 33.05  ? 244 GLY A N     1 
ATOM   1243 C  CA    . GLY A 1 246 ? -10.129 -26.848 -10.045 1.00 30.87  ? 244 GLY A CA    1 
ATOM   1244 C  C     . GLY A 1 246 ? -11.398 -27.466 -9.496  1.00 27.17  ? 244 GLY A C     1 
ATOM   1245 O  O     . GLY A 1 246 ? -11.353 -28.419 -8.709  1.00 21.76  ? 244 GLY A O     1 
ATOM   1246 N  N     . MET A 1 247 ? -12.535 -26.912 -9.907  1.00 27.41  ? 245 MET A N     1 
ATOM   1247 C  CA    . MET A 1 247 ? -13.838 -27.404 -9.462  1.00 25.96  ? 245 MET A CA    1 
ATOM   1248 C  C     . MET A 1 247 ? -14.640 -27.896 -10.646 1.00 25.17  ? 245 MET A C     1 
ATOM   1249 O  O     . MET A 1 247 ? -14.742 -27.207 -11.671 1.00 24.40  ? 245 MET A O     1 
ATOM   1250 C  CB    . MET A 1 247 ? -14.630 -26.311 -8.738  1.00 26.06  ? 245 MET A CB    1 
ATOM   1251 C  CG    . MET A 1 247 ? -13.901 -25.656 -7.570  1.00 29.77  ? 245 MET A CG    1 
ATOM   1252 S  SD    . MET A 1 247 ? -13.515 -26.766 -6.191  1.00 26.88  ? 245 MET A SD    1 
ATOM   1253 C  CE    . MET A 1 247 ? -15.109 -27.478 -5.812  1.00 19.36  ? 245 MET A CE    1 
ATOM   1254 N  N     . GLY A 1 248 ? -15.197 -29.095 -10.507 1.00 20.68  ? 246 GLY A N     1 
ATOM   1255 C  CA    . GLY A 1 248 ? -15.987 -29.694 -11.560 1.00 23.59  ? 246 GLY A CA    1 
ATOM   1256 C  C     . GLY A 1 248 ? -17.322 -30.164 -11.025 1.00 26.33  ? 246 GLY A C     1 
ATOM   1257 O  O     . GLY A 1 248 ? -17.411 -30.679 -9.911  1.00 28.56  ? 246 GLY A O     1 
ATOM   1258 N  N     . ARG A 1 249 ? -18.364 -29.998 -11.831 1.00 25.98  ? 247 ARG A N     1 
ATOM   1259 C  CA    . ARG A 1 249 ? -19.710 -30.358 -11.417 1.00 27.34  ? 247 ARG A CA    1 
ATOM   1260 C  C     . ARG A 1 249 ? -20.402 -31.121 -12.539 1.00 27.67  ? 247 ARG A C     1 
ATOM   1261 O  O     . ARG A 1 249 ? -20.512 -30.624 -13.653 1.00 28.84  ? 247 ARG A O     1 
ATOM   1262 C  CB    . ARG A 1 249 ? -20.499 -29.082 -11.087 1.00 27.33  ? 247 ARG A CB    1 
ATOM   1263 C  CG    . ARG A 1 249 ? -21.814 -29.319 -10.378 1.00 29.71  ? 247 ARG A CG    1 
ATOM   1264 C  CD    . ARG A 1 249 ? -22.723 -28.088 -10.449 1.00 31.15  ? 247 ARG A CD    1 
ATOM   1265 N  NE    . ARG A 1 249 ? -22.098 -26.858 -9.954  1.00 31.79  ? 247 ARG A NE    1 
ATOM   1266 C  CZ    . ARG A 1 249 ? -22.197 -26.425 -8.697  1.00 28.65  ? 247 ARG A CZ    1 
ATOM   1267 N  NH1   . ARG A 1 249 ? -22.877 -27.129 -7.806  1.00 27.22  ? 247 ARG A NH1   1 
ATOM   1268 N  NH2   . ARG A 1 249 ? -21.624 -25.287 -8.327  1.00 25.80  ? 247 ARG A NH2   1 
ATOM   1269 N  N     . LEU A 1 250 ? -20.866 -32.327 -12.257 1.00 26.53  ? 248 LEU A N     1 
ATOM   1270 C  CA    . LEU A 1 250 ? -21.635 -33.066 -13.252 1.00 30.48  ? 248 LEU A CA    1 
ATOM   1271 C  C     . LEU A 1 250 ? -22.883 -32.272 -13.646 1.00 33.60  ? 248 LEU A C     1 
ATOM   1272 O  O     . LEU A 1 250 ? -23.459 -31.575 -12.814 1.00 32.48  ? 248 LEU A O     1 
ATOM   1273 C  CB    . LEU A 1 250 ? -22.056 -34.425 -12.696 1.00 31.28  ? 248 LEU A CB    1 
ATOM   1274 C  CG    . LEU A 1 250 ? -20.955 -35.449 -12.427 1.00 30.43  ? 248 LEU A CG    1 
ATOM   1275 C  CD1   . LEU A 1 250 ? -21.480 -36.549 -11.502 1.00 29.76  ? 248 LEU A CD1   1 
ATOM   1276 C  CD2   . LEU A 1 250 ? -20.465 -36.030 -13.746 1.00 27.98  ? 248 LEU A CD2   1 
ATOM   1277 N  N     . PRO A 1 251 ? -23.305 -32.371 -14.916 1.00 35.90  ? 249 PRO A N     1 
ATOM   1278 C  CA    . PRO A 1 251 ? -24.533 -31.676 -15.306 1.00 38.35  ? 249 PRO A CA    1 
ATOM   1279 C  C     . PRO A 1 251 ? -25.726 -32.336 -14.628 1.00 39.46  ? 249 PRO A C     1 
ATOM   1280 O  O     . PRO A 1 251 ? -25.626 -33.498 -14.231 1.00 36.80  ? 249 PRO A O     1 
ATOM   1281 C  CB    . PRO A 1 251 ? -24.585 -31.882 -16.827 1.00 37.17  ? 249 PRO A CB    1 
ATOM   1282 C  CG    . PRO A 1 251 ? -23.816 -33.125 -17.070 1.00 35.34  ? 249 PRO A CG    1 
ATOM   1283 C  CD    . PRO A 1 251 ? -22.724 -33.144 -16.029 1.00 35.21  ? 249 PRO A CD    1 
ATOM   1284 N  N     . PRO A 1 252 ? -26.840 -31.604 -14.479 1.00 41.94  ? 250 PRO A N     1 
ATOM   1285 C  CA    . PRO A 1 252 ? -28.000 -32.132 -13.757 1.00 45.45  ? 250 PRO A CA    1 
ATOM   1286 C  C     . PRO A 1 252 ? -28.585 -33.344 -14.470 1.00 49.10  ? 250 PRO A C     1 
ATOM   1287 O  O     . PRO A 1 252 ? -28.522 -33.408 -15.694 1.00 48.63  ? 250 PRO A O     1 
ATOM   1288 C  CB    . PRO A 1 252 ? -28.996 -30.967 -13.803 1.00 45.60  ? 250 PRO A CB    1 
ATOM   1289 C  CG    . PRO A 1 252 ? -28.161 -29.752 -14.062 1.00 42.73  ? 250 PRO A CG    1 
ATOM   1290 C  CD    . PRO A 1 252 ? -27.064 -30.227 -14.949 1.00 42.84  ? 250 PRO A CD    1 
ATOM   1291 N  N     . ARG A 1 253 ? -29.131 -34.290 -13.714 1.00 54.88  ? 251 ARG A N     1 
ATOM   1292 C  CA    . ARG A 1 253 ? -29.784 -35.458 -14.296 1.00 61.77  ? 251 ARG A CA    1 
ATOM   1293 C  C     . ARG A 1 253 ? -31.295 -35.388 -14.090 1.00 64.04  ? 251 ARG A C     1 
ATOM   1294 O  O     . ARG A 1 253 ? -31.778 -34.921 -13.056 1.00 63.07  ? 251 ARG A O     1 
ATOM   1295 C  CB    . ARG A 1 253 ? -29.263 -36.746 -13.656 1.00 65.19  ? 251 ARG A CB    1 
ATOM   1296 C  CG    . ARG A 1 253 ? -29.814 -36.986 -12.262 1.00 68.98  ? 251 ARG A CG    1 
ATOM   1297 C  CD    . ARG A 1 253 ? -29.565 -38.399 -11.789 1.00 71.49  ? 251 ARG A CD    1 
ATOM   1298 N  NE    . ARG A 1 253 ? -29.887 -38.554 -10.372 1.00 74.38  ? 251 ARG A NE    1 
ATOM   1299 C  CZ    . ARG A 1 253 ? -31.077 -38.921 -9.908  1.00 78.51  ? 251 ARG A CZ    1 
ATOM   1300 N  NH1   . ARG A 1 253 ? -32.069 -39.178 -10.752 1.00 81.10  ? 251 ARG A NH1   1 
ATOM   1301 N  NH2   . ARG A 1 253 ? -31.277 -39.033 -8.601  1.00 78.74  ? 251 ARG A NH2   1 
ATOM   1302 N  N     . ILE A 1 254 ? -32.037 -35.886 -15.071 1.00 67.54  ? 252 ILE A N     1 
ATOM   1303 C  CA    . ILE A 1 254 ? -33.493 -35.907 -14.995 1.00 70.23  ? 252 ILE A CA    1 
ATOM   1304 C  C     . ILE A 1 254 ? -33.998 -37.338 -14.793 1.00 71.65  ? 252 ILE A C     1 
ATOM   1305 O  O     . ILE A 1 254 ? -35.193 -37.573 -14.603 1.00 73.31  ? 252 ILE A O     1 
ATOM   1306 C  CB    . ILE A 1 254 ? -34.126 -35.313 -16.271 1.00 71.95  ? 252 ILE A CB    1 
ATOM   1307 C  CG1   . ILE A 1 254 ? -33.323 -34.101 -16.744 1.00 73.51  ? 252 ILE A CG1   1 
ATOM   1308 C  CG2   . ILE A 1 254 ? -35.585 -34.946 -16.030 1.00 72.13  ? 252 ILE A CG2   1 
ATOM   1309 C  CD1   . ILE A 1 254 ? -33.791 -33.526 -18.069 1.00 75.66  ? 252 ILE A CD1   1 
ATOM   1310 N  N     . ASN A 1 263 ? -38.178 -35.355 -11.746 1.00 79.57  ? 261 ASN A N     1 
ATOM   1311 C  CA    . ASN A 1 263 ? -37.258 -34.790 -10.764 1.00 79.19  ? 261 ASN A CA    1 
ATOM   1312 C  C     . ASN A 1 263 ? -35.844 -34.620 -11.314 1.00 77.77  ? 261 ASN A C     1 
ATOM   1313 O  O     . ASN A 1 263 ? -35.291 -35.535 -11.928 1.00 78.56  ? 261 ASN A O     1 
ATOM   1314 C  CB    . ASN A 1 263 ? -37.237 -35.642 -9.492  1.00 79.78  ? 261 ASN A CB    1 
ATOM   1315 C  CG    . ASN A 1 263 ? -38.571 -35.636 -8.763  1.00 82.71  ? 261 ASN A CG    1 
ATOM   1316 O  OD1   . ASN A 1 263 ? -39.180 -36.685 -8.550  1.00 84.23  ? 261 ASN A OD1   1 
ATOM   1317 N  ND2   . ASN A 1 263 ? -39.032 -34.449 -8.377  1.00 81.96  ? 261 ASN A ND2   1 
ATOM   1318 N  N     . THR A 1 264 ? -35.267 -33.440 -11.096 1.00 74.09  ? 262 THR A N     1 
ATOM   1319 C  CA    . THR A 1 264 ? -33.906 -33.161 -11.541 1.00 69.80  ? 262 THR A CA    1 
ATOM   1320 C  C     . THR A 1 264 ? -32.961 -33.016 -10.355 1.00 64.55  ? 262 THR A C     1 
ATOM   1321 O  O     . THR A 1 264 ? -33.304 -32.400 -9.341  1.00 61.24  ? 262 THR A O     1 
ATOM   1322 C  CB    . THR A 1 264 ? -33.823 -31.883 -12.394 1.00 69.46  ? 262 THR A CB    1 
ATOM   1323 O  OG1   . THR A 1 264 ? -33.767 -30.735 -11.539 1.00 70.50  ? 262 THR A OG1   1 
ATOM   1324 C  CG2   . THR A 1 264 ? -35.022 -31.779 -13.323 1.00 69.55  ? 262 THR A CG2   1 
ATOM   1325 N  N     . LYS A 1 265 ? -31.772 -33.594 -10.487 1.00 60.78  ? 263 LYS A N     1 
ATOM   1326 C  CA    . LYS A 1 265 ? -30.770 -33.512 -9.438  1.00 57.26  ? 263 LYS A CA    1 
ATOM   1327 C  C     . LYS A 1 265 ? -29.626 -32.598 -9.855  1.00 53.90  ? 263 LYS A C     1 
ATOM   1328 O  O     . LYS A 1 265 ? -29.009 -32.791 -10.906 1.00 51.72  ? 263 LYS A O     1 
ATOM   1329 C  CB    . LYS A 1 265 ? -30.227 -34.898 -9.077  1.00 58.00  ? 263 LYS A CB    1 
ATOM   1330 C  CG    . LYS A 1 265 ? -29.205 -34.858 -7.944  1.00 58.52  ? 263 LYS A CG    1 
ATOM   1331 C  CD    . LYS A 1 265 ? -28.646 -36.229 -7.614  1.00 58.19  ? 263 LYS A CD    1 
ATOM   1332 C  CE    . LYS A 1 265 ? -27.657 -36.150 -6.454  1.00 59.32  ? 263 LYS A CE    1 
ATOM   1333 N  NZ    . LYS A 1 265 ? -27.068 -37.486 -6.123  1.00 60.96  ? 263 LYS A NZ    1 
ATOM   1334 N  N     . VAL A 1 266 ? -29.361 -31.593 -9.028  1.00 51.65  ? 264 VAL A N     1 
ATOM   1335 C  CA    . VAL A 1 266 ? -28.213 -30.726 -9.217  1.00 45.61  ? 264 VAL A CA    1 
ATOM   1336 C  C     . VAL A 1 266 ? -27.079 -31.307 -8.396  1.00 44.65  ? 264 VAL A C     1 
ATOM   1337 O  O     . VAL A 1 266 ? -27.258 -31.599 -7.208  1.00 43.89  ? 264 VAL A O     1 
ATOM   1338 C  CB    . VAL A 1 266 ? -28.507 -29.303 -8.726  1.00 45.61  ? 264 VAL A CB    1 
ATOM   1339 C  CG1   . VAL A 1 266 ? -27.294 -28.408 -8.925  1.00 43.56  ? 264 VAL A CG1   1 
ATOM   1340 C  CG2   . VAL A 1 266 ? -29.722 -28.733 -9.451  1.00 46.60  ? 264 VAL A CG2   1 
ATOM   1341 N  N     . TYR A 1 267 ? -25.919 -31.495 -9.023  1.00 38.75  ? 265 TYR A N     1 
ATOM   1342 C  CA    . TYR A 1 267 ? -24.771 -32.052 -8.317  1.00 34.82  ? 265 TYR A CA    1 
ATOM   1343 C  C     . TYR A 1 267 ? -23.950 -30.983 -7.605  1.00 31.45  ? 265 TYR A C     1 
ATOM   1344 O  O     . TYR A 1 267 ? -23.953 -29.813 -7.997  1.00 28.10  ? 265 TYR A O     1 
ATOM   1345 C  CB    . TYR A 1 267 ? -23.887 -32.853 -9.275  1.00 33.98  ? 265 TYR A CB    1 
ATOM   1346 C  CG    . TYR A 1 267 ? -24.531 -34.143 -9.724  1.00 33.36  ? 265 TYR A CG    1 
ATOM   1347 C  CD1   . TYR A 1 267 ? -24.378 -35.307 -8.986  1.00 29.94  ? 265 TYR A CD1   1 
ATOM   1348 C  CD2   . TYR A 1 267 ? -25.313 -34.190 -10.881 1.00 34.31  ? 265 TYR A CD2   1 
ATOM   1349 C  CE1   . TYR A 1 267 ? -24.979 -36.492 -9.387  1.00 32.38  ? 265 TYR A CE1   1 
ATOM   1350 C  CE2   . TYR A 1 267 ? -25.912 -35.373 -11.298 1.00 33.50  ? 265 TYR A CE2   1 
ATOM   1351 C  CZ    . TYR A 1 267 ? -25.743 -36.516 -10.545 1.00 35.52  ? 265 TYR A CZ    1 
ATOM   1352 O  OH    . TYR A 1 267 ? -26.337 -37.687 -10.946 1.00 40.43  ? 265 TYR A OH    1 
ATOM   1353 N  N     . LYS A 1 268 ? -23.257 -31.383 -6.543  1.00 30.76  ? 266 LYS A N     1 
ATOM   1354 C  CA    . LYS A 1 268 ? -22.281 -30.495 -5.916  1.00 32.70  ? 266 LYS A CA    1 
ATOM   1355 C  C     . LYS A 1 268 ? -21.052 -30.317 -6.812  1.00 31.83  ? 266 LYS A C     1 
ATOM   1356 O  O     . LYS A 1 268 ? -20.733 -31.188 -7.623  1.00 30.83  ? 266 LYS A O     1 
ATOM   1357 C  CB    . LYS A 1 268 ? -21.863 -31.050 -4.554  1.00 33.93  ? 266 LYS A CB    1 
ATOM   1358 C  CG    . LYS A 1 268 ? -22.975 -30.993 -3.526  1.00 37.11  ? 266 LYS A CG    1 
ATOM   1359 C  CD    . LYS A 1 268 ? -22.691 -31.897 -2.348  1.00 41.20  ? 266 LYS A CD    1 
ATOM   1360 C  CE    . LYS A 1 268 ? -23.965 -32.190 -1.563  1.00 41.51  ? 266 LYS A CE    1 
ATOM   1361 N  NZ    . LYS A 1 268 ? -23.686 -33.105 -0.428  1.00 43.69  ? 266 LYS A NZ    1 
ATOM   1362 N  N     . ALA A 1 269 ? -20.379 -29.183 -6.682  1.00 31.81  ? 267 ALA A N     1 
ATOM   1363 C  CA    . ALA A 1 269 ? -19.087 -29.006 -7.329  1.00 27.83  ? 267 ALA A CA    1 
ATOM   1364 C  C     . ALA A 1 269 ? -18.046 -29.781 -6.543  1.00 29.90  ? 267 ALA A C     1 
ATOM   1365 O  O     . ALA A 1 269 ? -18.095 -29.829 -5.312  1.00 30.72  ? 267 ALA A O     1 
ATOM   1366 C  CB    . ALA A 1 269 ? -18.711 -27.547 -7.394  1.00 25.46  ? 267 ALA A CB    1 
ATOM   1367 N  N     . ARG A 1 270 ? -17.092 -30.361 -7.259  1.00 26.71  ? 268 ARG A N     1 
ATOM   1368 C  CA    . ARG A 1 270 ? -16.107 -31.247 -6.660  1.00 28.68  ? 268 ARG A CA    1 
ATOM   1369 C  C     . ARG A 1 270 ? -14.709 -30.802 -7.037  1.00 29.94  ? 268 ARG A C     1 
ATOM   1370 O  O     . ARG A 1 270 ? -14.484 -30.286 -8.133  1.00 30.61  ? 268 ARG A O     1 
ATOM   1371 C  CB    . ARG A 1 270 ? -16.326 -32.671 -7.170  1.00 28.38  ? 268 ARG A CB    1 
ATOM   1372 C  CG    . ARG A 1 270 ? -17.769 -33.170 -7.030  1.00 25.60  ? 268 ARG A CG    1 
ATOM   1373 C  CD    . ARG A 1 270 ? -18.207 -33.107 -5.593  1.00 28.17  ? 268 ARG A CD    1 
ATOM   1374 N  NE    . ARG A 1 270 ? -19.289 -34.033 -5.300  1.00 29.90  ? 268 ARG A NE    1 
ATOM   1375 C  CZ    . ARG A 1 270 ? -19.734 -34.274 -4.074  1.00 29.94  ? 268 ARG A CZ    1 
ATOM   1376 N  NH1   . ARG A 1 270 ? -19.185 -33.645 -3.040  1.00 27.49  ? 268 ARG A NH1   1 
ATOM   1377 N  NH2   . ARG A 1 270 ? -20.724 -35.140 -3.881  1.00 28.24  ? 268 ARG A NH2   1 
ATOM   1378 N  N     . ARG A 1 271 ? -13.762 -30.997 -6.134  1.00 28.39  ? 269 ARG A N     1 
ATOM   1379 C  CA    . ARG A 1 271 ? -12.368 -30.802 -6.497  1.00 26.58  ? 269 ARG A CA    1 
ATOM   1380 C  C     . ARG A 1 271 ? -11.987 -31.814 -7.582  1.00 26.40  ? 269 ARG A C     1 
ATOM   1381 O  O     . ARG A 1 271 ? -12.206 -33.014 -7.427  1.00 23.93  ? 269 ARG A O     1 
ATOM   1382 C  CB    . ARG A 1 271 ? -11.468 -30.935 -5.276  1.00 21.42  ? 269 ARG A CB    1 
ATOM   1383 C  CG    . ARG A 1 271 ? -11.450 -29.678 -4.406  1.00 17.83  ? 269 ARG A CG    1 
ATOM   1384 C  CD    . ARG A 1 271 ? -10.514 -28.617 -5.004  1.00 19.97  ? 269 ARG A CD    1 
ATOM   1385 N  NE    . ARG A 1 271 ? -9.118  -29.012 -4.865  1.00 24.15  ? 269 ARG A NE    1 
ATOM   1386 C  CZ    . ARG A 1 271 ? -8.375  -29.506 -5.853  1.00 25.26  ? 269 ARG A CZ    1 
ATOM   1387 N  NH1   . ARG A 1 271 ? -8.896  -29.647 -7.065  1.00 24.69  ? 269 ARG A NH1   1 
ATOM   1388 N  NH2   . ARG A 1 271 ? -7.107  -29.846 -5.634  1.00 23.04  ? 269 ARG A NH2   1 
ATOM   1389 N  N     . VAL A 1 272 ? -11.460 -31.307 -8.693  1.00 23.83  ? 270 VAL A N     1 
ATOM   1390 C  CA    . VAL A 1 272 ? -10.959 -32.140 -9.778  1.00 25.62  ? 270 VAL A CA    1 
ATOM   1391 C  C     . VAL A 1 272 ? -9.482  -31.833 -10.056 1.00 24.94  ? 270 VAL A C     1 
ATOM   1392 O  O     . VAL A 1 272 ? -9.105  -30.691 -10.279 1.00 25.01  ? 270 VAL A O     1 
ATOM   1393 C  CB    . VAL A 1 272 ? -11.780 -31.946 -11.076 1.00 23.06  ? 270 VAL A CB    1 
ATOM   1394 C  CG1   . VAL A 1 272 ? -11.205 -32.799 -12.197 1.00 18.64  ? 270 VAL A CG1   1 
ATOM   1395 C  CG2   . VAL A 1 272 ? -13.259 -32.305 -10.838 1.00 22.59  ? 270 VAL A CG2   1 
ATOM   1396 N  N     . ASP A 1 273 ? -8.643  -32.856 -10.005 1.00 26.33  ? 271 ASP A N     1 
ATOM   1397 C  CA    . ASP A 1 273 ? -7.266  -32.714 -10.441 1.00 26.59  ? 271 ASP A CA    1 
ATOM   1398 C  C     . ASP A 1 273 ? -7.087  -33.533 -11.708 1.00 25.18  ? 271 ASP A C     1 
ATOM   1399 O  O     . ASP A 1 273 ? -7.607  -34.638 -11.821 1.00 25.08  ? 271 ASP A O     1 
ATOM   1400 C  CB    . ASP A 1 273 ? -6.286  -33.197 -9.369  1.00 27.03  ? 271 ASP A CB    1 
ATOM   1401 C  CG    . ASP A 1 273 ? -6.197  -32.257 -8.183  1.00 33.58  ? 271 ASP A CG    1 
ATOM   1402 O  OD1   . ASP A 1 273 ? -6.748  -31.140 -8.252  1.00 33.17  ? 271 ASP A OD1   1 
ATOM   1403 O  OD2   . ASP A 1 273 ? -5.554  -32.629 -7.183  1.00 36.12  ? 271 ASP A OD2   1 
ATOM   1404 N  N     . ILE A 1 274 ? -6.370  -32.981 -12.675 1.00 23.44  ? 272 ILE A N     1 
ATOM   1405 C  CA    . ILE A 1 274 ? -6.037  -33.740 -13.876 1.00 24.87  ? 272 ILE A CA    1 
ATOM   1406 C  C     . ILE A 1 274 ? -4.554  -33.595 -14.131 1.00 27.63  ? 272 ILE A C     1 
ATOM   1407 O  O     . ILE A 1 274 ? -4.031  -32.469 -14.226 1.00 24.43  ? 272 ILE A O     1 
ATOM   1408 C  CB    . ILE A 1 274 ? -6.804  -33.254 -15.122 1.00 21.51  ? 272 ILE A CB    1 
ATOM   1409 C  CG1   . ILE A 1 274 ? -8.307  -33.200 -14.847 1.00 22.55  ? 272 ILE A CG1   1 
ATOM   1410 C  CG2   . ILE A 1 274 ? -6.517  -34.167 -16.315 1.00 20.76  ? 272 ILE A CG2   1 
ATOM   1411 C  CD1   . ILE A 1 274 ? -9.110  -32.471 -15.945 1.00 19.01  ? 272 ILE A CD1   1 
ATOM   1412 N  N     . ARG A 1 275 ? -3.874  -34.735 -14.228 1.00 28.58  ? 273 ARG A N     1 
ATOM   1413 C  CA    . ARG A 1 275 ? -2.455  -34.735 -14.568 1.00 29.87  ? 273 ARG A CA    1 
ATOM   1414 C  C     . ARG A 1 275 ? -2.193  -35.404 -15.923 1.00 29.83  ? 273 ARG A C     1 
ATOM   1415 O  O     . ARG A 1 275 ? -2.697  -36.496 -16.204 1.00 25.77  ? 273 ARG A O     1 
ATOM   1416 C  CB    . ARG A 1 275 ? -1.637  -35.389 -13.454 1.00 27.27  ? 273 ARG A CB    1 
ATOM   1417 C  CG    . ARG A 1 275 ? -1.670  -34.603 -12.147 1.00 28.34  ? 273 ARG A CG    1 
ATOM   1418 C  CD    . ARG A 1 275 ? -1.025  -35.391 -11.031 1.00 29.91  ? 273 ARG A CD    1 
ATOM   1419 N  NE    . ARG A 1 275 ? -1.022  -34.693 -9.745  1.00 34.67  ? 273 ARG A NE    1 
ATOM   1420 C  CZ    . ARG A 1 275 ? -2.025  -34.732 -8.870  1.00 35.13  ? 273 ARG A CZ    1 
ATOM   1421 N  NH1   . ARG A 1 275 ? -3.133  -35.420 -9.142  1.00 30.64  ? 273 ARG A NH1   1 
ATOM   1422 N  NH2   . ARG A 1 275 ? -1.915  -34.085 -7.723  1.00 35.61  ? 273 ARG A NH2   1 
ATOM   1423 N  N     . LEU A 1 276 ? -1.421  -34.713 -16.757 1.00 28.32  ? 274 LEU A N     1 
ATOM   1424 C  CA    . LEU A 1 276 ? -1.015  -35.195 -18.069 1.00 28.71  ? 274 LEU A CA    1 
ATOM   1425 C  C     . LEU A 1 276 ? 0.310   -35.948 -17.931 1.00 28.17  ? 274 LEU A C     1 
ATOM   1426 O  O     . LEU A 1 276 ? 1.316   -35.354 -17.561 1.00 24.37  ? 274 LEU A O     1 
ATOM   1427 C  CB    . LEU A 1 276 ? -0.832  -34.011 -19.027 1.00 24.39  ? 274 LEU A CB    1 
ATOM   1428 C  CG    . LEU A 1 276 ? -0.277  -34.386 -20.406 1.00 20.44  ? 274 LEU A CG    1 
ATOM   1429 C  CD1   . LEU A 1 276 ? -1.197  -35.388 -21.096 1.00 16.42  ? 274 LEU A CD1   1 
ATOM   1430 C  CD2   . LEU A 1 276 ? -0.087  -33.159 -21.271 1.00 19.82  ? 274 LEU A CD2   1 
ATOM   1431 N  N     . ILE A 1 277 ? 0.296   -37.241 -18.254 1.00 25.99  ? 275 ILE A N     1 
ATOM   1432 C  CA    . ILE A 1 277 ? 1.400   -38.157 -17.973 1.00 23.92  ? 275 ILE A CA    1 
ATOM   1433 C  C     . ILE A 1 277 ? 1.830   -38.916 -19.238 1.00 25.99  ? 275 ILE A C     1 
ATOM   1434 O  O     . ILE A 1 277 ? 0.987   -39.409 -19.984 1.00 24.94  ? 275 ILE A O     1 
ATOM   1435 C  CB    . ILE A 1 277 ? 0.970   -39.191 -16.899 1.00 21.34  ? 275 ILE A CB    1 
ATOM   1436 C  CG1   . ILE A 1 277 ? 0.610   -38.490 -15.583 1.00 20.36  ? 275 ILE A CG1   1 
ATOM   1437 C  CG2   . ILE A 1 277 ? 2.058   -40.245 -16.689 1.00 19.63  ? 275 ILE A CG2   1 
ATOM   1438 C  CD1   . ILE A 1 277 ? 1.774   -37.731 -14.933 1.00 23.62  ? 275 ILE A CD1   1 
ATOM   1439 N  N     . GLU A 1 278 ? 3.137   -38.989 -19.487 1.00 24.74  ? 276 GLU A N     1 
ATOM   1440 C  CA    . GLU A 1 278 ? 3.670   -39.719 -20.641 1.00 25.59  ? 276 GLU A CA    1 
ATOM   1441 C  C     . GLU A 1 278 ? 3.315   -41.206 -20.543 1.00 24.91  ? 276 GLU A C     1 
ATOM   1442 O  O     . GLU A 1 278 ? 3.256   -41.766 -19.449 1.00 29.09  ? 276 GLU A O     1 
ATOM   1443 C  CB    . GLU A 1 278 ? 5.203   -39.558 -20.735 1.00 24.45  ? 276 GLU A CB    1 
ATOM   1444 C  CG    . GLU A 1 278 ? 5.705   -38.113 -20.937 1.00 23.04  ? 276 GLU A CG    1 
ATOM   1445 C  CD    . GLU A 1 278 ? 5.594   -37.646 -22.379 1.00 24.51  ? 276 GLU A CD    1 
ATOM   1446 O  OE1   . GLU A 1 278 ? 5.457   -38.503 -23.268 1.00 21.60  ? 276 GLU A OE1   1 
ATOM   1447 O  OE2   . GLU A 1 278 ? 5.617   -36.421 -22.630 1.00 25.58  ? 276 GLU A OE2   1 
ATOM   1448 N  N     . THR A 1 279 ? 3.088   -41.846 -21.685 1.00 20.96  ? 277 THR A N     1 
ATOM   1449 C  CA    . THR A 1 279 ? 2.682   -43.253 -21.700 1.00 18.91  ? 277 THR A CA    1 
ATOM   1450 C  C     . THR A 1 279 ? 3.559   -44.186 -20.847 1.00 21.90  ? 277 THR A C     1 
ATOM   1451 O  O     . THR A 1 279 ? 3.051   -44.956 -20.054 1.00 21.84  ? 277 THR A O     1 
ATOM   1452 C  CB    . THR A 1 279 ? 2.633   -43.815 -23.139 1.00 24.27  ? 277 THR A CB    1 
ATOM   1453 O  OG1   . THR A 1 279 ? 1.762   -43.006 -23.941 1.00 26.76  ? 277 THR A OG1   1 
ATOM   1454 C  CG2   . THR A 1 279 ? 2.113   -45.244 -23.122 1.00 21.05  ? 277 THR A CG2   1 
ATOM   1455 N  N     . LYS A 1 280 ? 4.874   -44.134 -21.031 1.00 25.56  ? 278 LYS A N     1 
ATOM   1456 C  CA    . LYS A 1 280 ? 5.771   -45.013 -20.284 1.00 24.42  ? 278 LYS A CA    1 
ATOM   1457 C  C     . LYS A 1 280 ? 5.738   -44.718 -18.785 1.00 25.27  ? 278 LYS A C     1 
ATOM   1458 O  O     . LYS A 1 280 ? 6.214   -45.526 -17.994 1.00 25.15  ? 278 LYS A O     1 
ATOM   1459 C  CB    . LYS A 1 280 ? 7.208   -44.872 -20.790 1.00 24.72  ? 278 LYS A CB    1 
ATOM   1460 C  CG    . LYS A 1 280 ? 7.751   -43.439 -20.618 1.00 32.33  ? 278 LYS A CG    1 
ATOM   1461 C  CD    . LYS A 1 280 ? 9.221   -43.341 -20.949 1.00 37.78  ? 278 LYS A CD    1 
ATOM   1462 C  CE    . LYS A 1 280 ? 9.473   -43.488 -22.435 1.00 41.58  ? 278 LYS A CE    1 
ATOM   1463 N  NZ    . LYS A 1 280 ? 10.910  -43.223 -22.759 1.00 44.97  ? 278 LYS A NZ    1 
ATOM   1464 N  N     . SER A 1 281 ? 5.202   -43.557 -18.397 1.00 23.29  ? 279 SER A N     1 
ATOM   1465 C  CA    . SER A 1 281 ? 5.133   -43.171 -16.981 1.00 18.46  ? 279 SER A CA    1 
ATOM   1466 C  C     . SER A 1 281 ? 3.815   -43.562 -16.292 1.00 19.46  ? 279 SER A C     1 
ATOM   1467 O  O     . SER A 1 281 ? 3.650   -43.387 -15.081 1.00 21.53  ? 279 SER A O     1 
ATOM   1468 C  CB    . SER A 1 281 ? 5.382   -41.670 -16.812 1.00 18.97  ? 279 SER A CB    1 
ATOM   1469 O  OG    . SER A 1 281 ? 6.672   -41.288 -17.274 1.00 19.48  ? 279 SER A OG    1 
ATOM   1470 N  N     . VAL A 1 282 ? 2.873   -44.102 -17.049 1.00 20.76  ? 280 VAL A N     1 
ATOM   1471 C  CA    . VAL A 1 282 ? 1.562   -44.437 -16.481 1.00 20.52  ? 280 VAL A CA    1 
ATOM   1472 C  C     . VAL A 1 282 ? 1.584   -45.338 -15.220 1.00 24.54  ? 280 VAL A C     1 
ATOM   1473 O  O     . VAL A 1 282 ? 1.008   -44.973 -14.193 1.00 28.27  ? 280 VAL A O     1 
ATOM   1474 C  CB    . VAL A 1 282 ? 0.621   -44.980 -17.574 1.00 19.48  ? 280 VAL A CB    1 
ATOM   1475 C  CG1   . VAL A 1 282 ? -0.652  -45.582 -16.970 1.00 16.75  ? 280 VAL A CG1   1 
ATOM   1476 C  CG2   . VAL A 1 282 ? 0.278   -43.848 -18.535 1.00 16.35  ? 280 VAL A CG2   1 
ATOM   1477 N  N     . PRO A 1 283 ? 2.266   -46.498 -15.272 1.00 25.40  ? 281 PRO A N     1 
ATOM   1478 C  CA    . PRO A 1 283 ? 2.228   -47.360 -14.076 1.00 24.95  ? 281 PRO A CA    1 
ATOM   1479 C  C     . PRO A 1 283 ? 2.802   -46.673 -12.833 1.00 25.52  ? 281 PRO A C     1 
ATOM   1480 O  O     . PRO A 1 283 ? 2.237   -46.814 -11.749 1.00 25.23  ? 281 PRO A O     1 
ATOM   1481 C  CB    . PRO A 1 283 ? 3.087   -48.578 -14.472 1.00 24.51  ? 281 PRO A CB    1 
ATOM   1482 C  CG    . PRO A 1 283 ? 3.104   -48.552 -16.003 1.00 26.85  ? 281 PRO A CG    1 
ATOM   1483 C  CD    . PRO A 1 283 ? 3.090   -47.076 -16.351 1.00 26.96  ? 281 PRO A CD    1 
ATOM   1484 N  N     . THR A 1 284 ? 3.897   -45.931 -12.984 1.00 20.94  ? 282 THR A N     1 
ATOM   1485 C  CA    . THR A 1 284 ? 4.458   -45.188 -11.851 1.00 19.36  ? 282 THR A CA    1 
ATOM   1486 C  C     . THR A 1 284 ? 3.541   -44.046 -11.373 1.00 23.37  ? 282 THR A C     1 
ATOM   1487 O  O     . THR A 1 284 ? 3.489   -43.743 -10.177 1.00 26.23  ? 282 THR A O     1 
ATOM   1488 C  CB    . THR A 1 284 ? 5.891   -44.657 -12.152 1.00 22.35  ? 282 THR A CB    1 
ATOM   1489 O  OG1   . THR A 1 284 ? 5.946   -44.150 -13.490 1.00 20.63  ? 282 THR A OG1   1 
ATOM   1490 C  CG2   . THR A 1 284 ? 6.917   -45.776 -12.017 1.00 24.97  ? 282 THR A CG2   1 
ATOM   1491 N  N     . ALA A 1 285 ? 2.824   -43.407 -12.298 1.00 22.92  ? 283 ALA A N     1 
ATOM   1492 C  CA    . ALA A 1 285 ? 1.886   -42.327 -11.941 1.00 25.28  ? 283 ALA A CA    1 
ATOM   1493 C  C     . ALA A 1 285 ? 0.615   -42.879 -11.293 1.00 25.60  ? 283 ALA A C     1 
ATOM   1494 O  O     . ALA A 1 285 ? 0.056   -42.271 -10.372 1.00 23.28  ? 283 ALA A O     1 
ATOM   1495 C  CB    . ALA A 1 285 ? 1.533   -41.492 -13.155 1.00 22.44  ? 283 ALA A CB    1 
ATOM   1496 N  N     . MET A 1 286 ? 0.167   -44.035 -11.772 1.00 23.77  ? 284 MET A N     1 
ATOM   1497 C  CA    . MET A 1 286 ? -0.934  -44.739 -11.117 1.00 25.87  ? 284 MET A CA    1 
ATOM   1498 C  C     . MET A 1 286 ? -0.559  -45.059 -9.684  1.00 26.52  ? 284 MET A C     1 
ATOM   1499 O  O     . MET A 1 286 ? -1.380  -44.915 -8.774  1.00 27.81  ? 284 MET A O     1 
ATOM   1500 C  CB    . MET A 1 286 ? -1.306  -46.027 -11.861 1.00 27.59  ? 284 MET A CB    1 
ATOM   1501 C  CG    . MET A 1 286 ? -2.188  -45.810 -13.076 1.00 31.06  ? 284 MET A CG    1 
ATOM   1502 S  SD    . MET A 1 286 ? -2.282  -47.302 -14.082 1.00 46.44  ? 284 MET A SD    1 
ATOM   1503 C  CE    . MET A 1 286 ? -3.087  -48.426 -12.939 1.00 46.27  ? 284 MET A CE    1 
ATOM   1504 N  N     . LEU A 1 287 ? 0.682   -45.493 -9.477  1.00 23.17  ? 285 LEU A N     1 
ATOM   1505 C  CA    . LEU A 1 287 ? 1.132   -45.789 -8.124  1.00 27.52  ? 285 LEU A CA    1 
ATOM   1506 C  C     . LEU A 1 287 ? 1.066   -44.523 -7.293  1.00 24.78  ? 285 LEU A C     1 
ATOM   1507 O  O     . LEU A 1 287 ? 0.507   -44.515 -6.197  1.00 23.81  ? 285 LEU A O     1 
ATOM   1508 C  CB    . LEU A 1 287 ? 2.566   -46.332 -8.110  1.00 27.84  ? 285 LEU A CB    1 
ATOM   1509 C  CG    . LEU A 1 287 ? 2.774   -47.838 -8.256  1.00 28.91  ? 285 LEU A CG    1 
ATOM   1510 C  CD1   . LEU A 1 287 ? 4.244   -48.126 -8.538  1.00 28.49  ? 285 LEU A CD1   1 
ATOM   1511 C  CD2   . LEU A 1 287 ? 2.312   -48.551 -6.997  1.00 24.52  ? 285 LEU A CD2   1 
ATOM   1512 N  N     . THR A 1 288 ? 1.637   -43.445 -7.826  1.00 21.00  ? 286 THR A N     1 
ATOM   1513 C  CA    . THR A 1 288 ? 1.777   -42.231 -7.045  1.00 21.83  ? 286 THR A CA    1 
ATOM   1514 C  C     . THR A 1 288 ? 0.405   -41.646 -6.723  1.00 19.57  ? 286 THR A C     1 
ATOM   1515 O  O     . THR A 1 288 ? 0.140   -41.231 -5.593  1.00 22.33  ? 286 THR A O     1 
ATOM   1516 C  CB    . THR A 1 288 ? 2.638   -41.166 -7.781  1.00 23.88  ? 286 THR A CB    1 
ATOM   1517 O  OG1   . THR A 1 288 ? 3.988   -41.644 -7.916  1.00 25.22  ? 286 THR A OG1   1 
ATOM   1518 C  CG2   . THR A 1 288 ? 2.655   -39.856 -6.993  1.00 21.91  ? 286 THR A CG2   1 
ATOM   1519 N  N     . PHE A 1 289 ? -0.465  -41.616 -7.714  1.00 16.88  ? 287 PHE A N     1 
ATOM   1520 C  CA    . PHE A 1 289 ? -1.683  -40.842 -7.559  1.00 24.89  ? 287 PHE A CA    1 
ATOM   1521 C  C     . PHE A 1 289 ? -2.842  -41.666 -7.003  1.00 27.03  ? 287 PHE A C     1 
ATOM   1522 O  O     . PHE A 1 289 ? -3.931  -41.145 -6.801  1.00 26.06  ? 287 PHE A O     1 
ATOM   1523 C  CB    . PHE A 1 289 ? -2.007  -40.093 -8.852  1.00 23.49  ? 287 PHE A CB    1 
ATOM   1524 C  CG    . PHE A 1 289 ? -0.928  -39.118 -9.242  1.00 23.59  ? 287 PHE A CG    1 
ATOM   1525 C  CD1   . PHE A 1 289 ? -0.549  -38.116 -8.368  1.00 24.06  ? 287 PHE A CD1   1 
ATOM   1526 C  CD2   . PHE A 1 289 ? -0.277  -39.220 -10.461 1.00 26.53  ? 287 PHE A CD2   1 
ATOM   1527 C  CE1   . PHE A 1 289 ? 0.457   -37.227 -8.700  1.00 30.66  ? 287 PHE A CE1   1 
ATOM   1528 C  CE2   . PHE A 1 289 ? 0.720   -38.331 -10.799 1.00 28.90  ? 287 PHE A CE2   1 
ATOM   1529 C  CZ    . PHE A 1 289 ? 1.089   -37.331 -9.914  1.00 29.76  ? 287 PHE A CZ    1 
ATOM   1530 N  N     . THR A 1 290 ? -2.570  -42.940 -6.724  1.00 21.21  ? 288 THR A N     1 
ATOM   1531 C  CA    . THR A 1 290 ? -3.496  -43.810 -6.008  1.00 18.24  ? 288 THR A CA    1 
ATOM   1532 C  C     . THR A 1 290 ? -3.148  -43.756 -4.530  1.00 18.63  ? 288 THR A C     1 
ATOM   1533 O  O     . THR A 1 290 ? -4.008  -43.946 -3.667  1.00 23.92  ? 288 THR A O     1 
ATOM   1534 C  CB    . THR A 1 290 ? -3.386  -45.272 -6.511  1.00 24.77  ? 288 THR A CB    1 
ATOM   1535 O  OG1   . THR A 1 290 ? -3.802  -45.337 -7.880  1.00 23.06  ? 288 THR A OG1   1 
ATOM   1536 C  CG2   . THR A 1 290 ? -4.257  -46.217 -5.680  1.00 21.85  ? 288 THR A CG2   1 
ATOM   1537 N  N     . GLY A 1 291 ? -1.882  -43.493 -4.239  1.00 17.63  ? 289 GLY A N     1 
ATOM   1538 C  CA    . GLY A 1 291 ? -1.438  -43.408 -2.857  1.00 18.86  ? 289 GLY A CA    1 
ATOM   1539 C  C     . GLY A 1 291 ? -1.668  -44.704 -2.091  1.00 25.65  ? 289 GLY A C     1 
ATOM   1540 O  O     . GLY A 1 291 ? -1.619  -45.794 -2.668  1.00 27.85  ? 289 GLY A O     1 
ATOM   1541 N  N     . SER A 1 292 ? -1.927  -44.607 -0.787  1.00 25.50  ? 290 SER A N     1 
ATOM   1542 C  CA    . SER A 1 292 ? -2.016  -43.339 -0.070  1.00 23.42  ? 290 SER A CA    1 
ATOM   1543 C  C     . SER A 1 292 ? -0.689  -42.602 -0.005  1.00 27.31  ? 290 SER A C     1 
ATOM   1544 O  O     . SER A 1 292 ? 0.352   -43.119 -0.432  1.00 30.42  ? 290 SER A O     1 
ATOM   1545 C  CB    . SER A 1 292 ? -2.446  -43.604 1.369   1.00 24.22  ? 290 SER A CB    1 
ATOM   1546 O  OG    . SER A 1 292 ? -1.379  -44.215 2.083   1.00 26.32  ? 290 SER A OG    1 
ATOM   1547 N  N     . LYS A 1 293 ? -0.737  -41.403 0.563   1.00 27.57  ? 291 LYS A N     1 
ATOM   1548 C  CA    . LYS A 1 293 ? 0.470   -40.627 0.806   1.00 27.78  ? 291 LYS A CA    1 
ATOM   1549 C  C     . LYS A 1 293 ? 1.524   -41.411 1.602   1.00 25.20  ? 291 LYS A C     1 
ATOM   1550 O  O     . LYS A 1 293 ? 2.708   -41.421 1.241   1.00 24.55  ? 291 LYS A O     1 
ATOM   1551 C  CB    . LYS A 1 293 ? 0.141   -39.323 1.528   1.00 30.09  ? 291 LYS A CB    1 
ATOM   1552 C  CG    . LYS A 1 293 ? 1.370   -38.586 2.016   1.00 37.39  ? 291 LYS A CG    1 
ATOM   1553 C  CD    . LYS A 1 293 ? 1.025   -37.580 3.083   1.00 45.78  ? 291 LYS A CD    1 
ATOM   1554 C  CE    . LYS A 1 293 ? 2.274   -37.166 3.824   1.00 52.05  ? 291 LYS A CE    1 
ATOM   1555 N  NZ    . LYS A 1 293 ? 2.939   -38.367 4.401   1.00 56.76  ? 291 LYS A NZ    1 
ATOM   1556 N  N     . ASN A 1 294 ? 1.109   -42.037 2.701   1.00 23.82  ? 292 ASN A N     1 
ATOM   1557 C  CA    A ASN A 1 294 ? 2.022   -42.837 3.519   0.70 26.59  ? 292 ASN A CA    1 
ATOM   1558 C  CA    B ASN A 1 294 ? 2.044   -42.822 3.507   0.30 26.52  ? 292 ASN A CA    1 
ATOM   1559 C  C     . ASN A 1 294 ? 2.559   -44.034 2.751   1.00 28.77  ? 292 ASN A C     1 
ATOM   1560 O  O     . ASN A 1 294 ? 3.724   -44.403 2.857   1.00 31.82  ? 292 ASN A O     1 
ATOM   1561 C  CB    A ASN A 1 294 ? 1.330   -43.317 4.800   0.70 26.91  ? 292 ASN A CB    1 
ATOM   1562 C  CB    B ASN A 1 294 ? 1.421   -43.264 4.834   0.30 26.92  ? 292 ASN A CB    1 
ATOM   1563 C  CG    A ASN A 1 294 ? 1.157   -42.212 5.830   0.70 31.25  ? 292 ASN A CG    1 
ATOM   1564 C  CG    B ASN A 1 294 ? 2.461   -43.782 5.819   0.30 25.26  ? 292 ASN A CG    1 
ATOM   1565 O  OD1   A ASN A 1 294 ? 1.840   -41.182 5.782   0.70 36.35  ? 292 ASN A OD1   1 
ATOM   1566 O  OD1   B ASN A 1 294 ? 3.601   -43.311 5.838   0.30 22.69  ? 292 ASN A OD1   1 
ATOM   1567 N  ND2   A ASN A 1 294 ? 0.253   -42.429 6.780   0.70 32.27  ? 292 ASN A ND2   1 
ATOM   1568 N  ND2   B ASN A 1 294 ? 2.074   -44.755 6.637   0.30 27.08  ? 292 ASN A ND2   1 
ATOM   1569 N  N     . PHE A 1 295 ? 1.678   -44.663 1.973   1.00 26.75  ? 293 PHE A N     1 
ATOM   1570 C  CA    . PHE A 1 295 ? 2.115   -45.733 1.115   1.00 26.98  ? 293 PHE A CA    1 
ATOM   1571 C  C     . PHE A 1 295 ? 3.255   -45.259 0.198   1.00 26.44  ? 293 PHE A C     1 
ATOM   1572 O  O     . PHE A 1 295 ? 4.280   -45.944 0.084   1.00 26.88  ? 293 PHE A O     1 
ATOM   1573 C  CB    . PHE A 1 295 ? 0.959   -46.261 0.276   1.00 27.84  ? 293 PHE A CB    1 
ATOM   1574 C  CG    . PHE A 1 295 ? 1.375   -47.331 -0.682  1.00 29.84  ? 293 PHE A CG    1 
ATOM   1575 C  CD1   . PHE A 1 295 ? 1.572   -48.627 -0.240  1.00 32.19  ? 293 PHE A CD1   1 
ATOM   1576 C  CD2   . PHE A 1 295 ? 1.620   -47.033 -2.013  1.00 33.17  ? 293 PHE A CD2   1 
ATOM   1577 C  CE1   . PHE A 1 295 ? 1.983   -49.612 -1.115  1.00 31.37  ? 293 PHE A CE1   1 
ATOM   1578 C  CE2   . PHE A 1 295 ? 2.026   -48.018 -2.893  1.00 33.95  ? 293 PHE A CE2   1 
ATOM   1579 C  CZ    . PHE A 1 295 ? 2.202   -49.308 -2.442  1.00 31.13  ? 293 PHE A CZ    1 
ATOM   1580 N  N     . ASN A 1 296 ? 3.084   -44.100 -0.449  1.00 25.46  ? 294 ASN A N     1 
ATOM   1581 C  CA    . ASN A 1 296 ? 4.101   -43.600 -1.392  1.00 24.27  ? 294 ASN A CA    1 
ATOM   1582 C  C     . ASN A 1 296 ? 5.402   -43.354 -0.670  1.00 23.05  ? 294 ASN A C     1 
ATOM   1583 O  O     . ASN A 1 296 ? 6.469   -43.646 -1.179  1.00 23.82  ? 294 ASN A O     1 
ATOM   1584 C  CB    . ASN A 1 296 ? 3.671   -42.293 -2.067  1.00 23.78  ? 294 ASN A CB    1 
ATOM   1585 C  CG    . ASN A 1 296 ? 2.497   -42.464 -2.988  1.00 24.85  ? 294 ASN A CG    1 
ATOM   1586 O  OD1   . ASN A 1 296 ? 2.131   -43.580 -3.338  1.00 24.95  ? 294 ASN A OD1   1 
ATOM   1587 N  ND2   . ASN A 1 296 ? 1.884   -41.351 -3.399  1.00 23.27  ? 294 ASN A ND2   1 
ATOM   1588 N  N     . VAL A 1 297 ? 5.312   -42.794 0.530   1.00 24.32  ? 295 VAL A N     1 
ATOM   1589 C  CA    . VAL A 1 297 ? 6.514   -42.448 1.272   1.00 26.42  ? 295 VAL A CA    1 
ATOM   1590 C  C     . VAL A 1 297 ? 7.321   -43.712 1.589   1.00 27.60  ? 295 VAL A C     1 
ATOM   1591 O  O     . VAL A 1 297 ? 8.534   -43.760 1.356   1.00 29.12  ? 295 VAL A O     1 
ATOM   1592 C  CB    . VAL A 1 297 ? 6.178   -41.651 2.546   1.00 27.12  ? 295 VAL A CB    1 
ATOM   1593 C  CG1   . VAL A 1 297 ? 7.415   -41.520 3.440   1.00 27.04  ? 295 VAL A CG1   1 
ATOM   1594 C  CG2   . VAL A 1 297 ? 5.627   -40.280 2.164   1.00 28.67  ? 295 VAL A CG2   1 
ATOM   1595 N  N     . ILE A 1 298 ? 6.627   -44.737 2.078   1.00 26.59  ? 296 ILE A N     1 
ATOM   1596 C  CA    . ILE A 1 298 ? 7.240   -46.031 2.392   1.00 25.05  ? 296 ILE A CA    1 
ATOM   1597 C  C     . ILE A 1 298 ? 7.908   -46.666 1.175   1.00 25.24  ? 296 ILE A C     1 
ATOM   1598 O  O     . ILE A 1 298 ? 9.036   -47.173 1.245   1.00 29.26  ? 296 ILE A O     1 
ATOM   1599 C  CB    . ILE A 1 298 ? 6.196   -47.009 2.974   1.00 30.07  ? 296 ILE A CB    1 
ATOM   1600 C  CG1   . ILE A 1 298 ? 5.768   -46.533 4.369   1.00 32.73  ? 296 ILE A CG1   1 
ATOM   1601 C  CG2   . ILE A 1 298 ? 6.769   -48.444 3.028   1.00 27.46  ? 296 ILE A CG2   1 
ATOM   1602 C  CD1   . ILE A 1 298 ? 4.564   -47.246 4.942   1.00 33.29  ? 296 ILE A CD1   1 
ATOM   1603 N  N     . MET A 1 299 ? 7.210   -46.630 0.049   1.00 25.14  ? 297 MET A N     1 
ATOM   1604 C  CA    . MET A 1 299 ? 7.749   -47.218 -1.162  1.00 28.00  ? 297 MET A CA    1 
ATOM   1605 C  C     . MET A 1 299 ? 8.929   -46.408 -1.694  1.00 29.45  ? 297 MET A C     1 
ATOM   1606 O  O     . MET A 1 299 ? 9.860   -46.967 -2.263  1.00 30.52  ? 297 MET A O     1 
ATOM   1607 C  CB    . MET A 1 299 ? 6.663   -47.358 -2.221  1.00 25.60  ? 297 MET A CB    1 
ATOM   1608 C  CG    . MET A 1 299 ? 7.127   -48.084 -3.470  1.00 31.21  ? 297 MET A CG    1 
ATOM   1609 S  SD    . MET A 1 299 ? 5.739   -48.530 -4.532  1.00 45.66  ? 297 MET A SD    1 
ATOM   1610 C  CE    . MET A 1 299 ? 5.072   -49.928 -3.644  1.00 41.78  ? 297 MET A CE    1 
ATOM   1611 N  N     . ARG A 1 300 ? 8.901   -45.094 -1.499  1.00 27.03  ? 298 ARG A N     1 
ATOM   1612 C  CA    . ARG A 1 300 ? 9.994   -44.253 -1.986  1.00 25.48  ? 298 ARG A CA    1 
ATOM   1613 C  C     . ARG A 1 300 ? 11.224  -44.423 -1.121  1.00 23.40  ? 298 ARG A C     1 
ATOM   1614 O  O     . ARG A 1 300 ? 12.348  -44.348 -1.619  1.00 25.53  ? 298 ARG A O     1 
ATOM   1615 C  CB    . ARG A 1 300 ? 9.568   -42.785 -2.097  1.00 19.04  ? 298 ARG A CB    1 
ATOM   1616 C  CG    . ARG A 1 300 ? 8.693   -42.548 -3.323  1.00 23.24  ? 298 ARG A CG    1 
ATOM   1617 C  CD    . ARG A 1 300 ? 7.868   -41.260 -3.266  1.00 23.88  ? 298 ARG A CD    1 
ATOM   1618 N  NE    . ARG A 1 300 ? 6.998   -41.176 -4.439  1.00 21.08  ? 298 ARG A NE    1 
ATOM   1619 C  CZ    . ARG A 1 300 ? 6.613   -40.043 -5.012  1.00 23.98  ? 298 ARG A CZ    1 
ATOM   1620 N  NH1   . ARG A 1 300 ? 6.991   -38.878 -4.504  1.00 25.13  ? 298 ARG A NH1   1 
ATOM   1621 N  NH2   . ARG A 1 300 ? 5.842   -40.077 -6.093  1.00 23.35  ? 298 ARG A NH2   1 
ATOM   1622 N  N     . GLN A 1 301 ? 11.005  -44.678 0.173   1.00 22.52  ? 299 GLN A N     1 
ATOM   1623 C  CA    . GLN A 1 301 ? 12.101  -45.007 1.092   1.00 27.56  ? 299 GLN A CA    1 
ATOM   1624 C  C     . GLN A 1 301 ? 12.708  -46.367 0.740   1.00 27.88  ? 299 GLN A C     1 
ATOM   1625 O  O     . GLN A 1 301 ? 13.923  -46.545 0.816   1.00 30.56  ? 299 GLN A O     1 
ATOM   1626 C  CB    . GLN A 1 301 ? 11.619  -45.008 2.555   1.00 26.84  ? 299 GLN A CB    1 
ATOM   1627 C  CG    . GLN A 1 301 ? 10.815  -43.762 2.918   1.00 34.25  ? 299 GLN A CG    1 
ATOM   1628 C  CD    . GLN A 1 301 ? 10.429  -43.680 4.395   1.00 39.12  ? 299 GLN A CD    1 
ATOM   1629 O  OE1   . GLN A 1 301 ? 9.599   -44.447 4.882   1.00 39.38  ? 299 GLN A OE1   1 
ATOM   1630 N  NE2   . GLN A 1 301 ? 11.032  -42.733 5.108   1.00 38.04  ? 299 GLN A NE2   1 
ATOM   1631 N  N     . ALA A 1 302 ? 11.865  -47.321 0.352   1.00 23.57  ? 300 ALA A N     1 
ATOM   1632 C  CA    . ALA A 1 302 ? 12.365  -48.627 -0.054  1.00 26.62  ? 300 ALA A CA    1 
ATOM   1633 C  C     . ALA A 1 302 ? 13.216  -48.432 -1.301  1.00 27.35  ? 300 ALA A C     1 
ATOM   1634 O  O     . ALA A 1 302 ? 14.312  -48.970 -1.407  1.00 32.47  ? 300 ALA A O     1 
ATOM   1635 C  CB    . ALA A 1 302 ? 11.214  -49.619 -0.299  1.00 21.79  ? 300 ALA A CB    1 
ATOM   1636 N  N     . ALA A 1 303 ? 12.736  -47.606 -2.221  1.00 25.49  ? 301 ALA A N     1 
ATOM   1637 C  CA    . ALA A 1 303 ? 13.512  -47.301 -3.421  1.00 22.27  ? 301 ALA A CA    1 
ATOM   1638 C  C     . ALA A 1 303 ? 14.878  -46.690 -3.075  1.00 26.07  ? 301 ALA A C     1 
ATOM   1639 O  O     . ALA A 1 303 ? 15.922  -47.152 -3.553  1.00 26.87  ? 301 ALA A O     1 
ATOM   1640 C  CB    . ALA A 1 303 ? 12.722  -46.398 -4.342  1.00 17.30  ? 301 ALA A CB    1 
ATOM   1641 N  N     . ILE A 1 304 ? 14.871  -45.662 -2.230  1.00 25.79  ? 302 ILE A N     1 
ATOM   1642 C  CA    . ILE A 1 304 ? 16.109  -45.035 -1.777  1.00 24.51  ? 302 ILE A CA    1 
ATOM   1643 C  C     . ILE A 1 304 ? 17.096  -46.054 -1.187  1.00 29.97  ? 302 ILE A C     1 
ATOM   1644 O  O     . ILE A 1 304 ? 18.298  -46.024 -1.484  1.00 30.13  ? 302 ILE A O     1 
ATOM   1645 C  CB    . ILE A 1 304 ? 15.836  -43.949 -0.695  1.00 25.68  ? 302 ILE A CB    1 
ATOM   1646 C  CG1   . ILE A 1 304 ? 15.208  -42.700 -1.321  1.00 23.29  ? 302 ILE A CG1   1 
ATOM   1647 C  CG2   . ILE A 1 304 ? 17.137  -43.583 0.044   1.00 25.68  ? 302 ILE A CG2   1 
ATOM   1648 C  CD1   . ILE A 1 304 ? 14.690  -41.701 -0.278  1.00 24.27  ? 302 ILE A CD1   1 
ATOM   1649 N  N     . SER A 1 305 ? 16.594  -46.949 -0.340  1.00 31.53  ? 303 SER A N     1 
ATOM   1650 C  CA    . SER A 1 305 ? 17.473  -47.902 0.336   1.00 34.15  ? 303 SER A CA    1 
ATOM   1651 C  C     . SER A 1 305 ? 18.140  -48.847 -0.657  1.00 35.58  ? 303 SER A C     1 
ATOM   1652 O  O     . SER A 1 305 ? 19.216  -49.379 -0.389  1.00 36.29  ? 303 SER A O     1 
ATOM   1653 C  CB    . SER A 1 305 ? 16.719  -48.698 1.405   1.00 36.80  ? 303 SER A CB    1 
ATOM   1654 O  OG    . SER A 1 305 ? 15.892  -49.680 0.812   1.00 43.31  ? 303 SER A OG    1 
ATOM   1655 N  N     . LYS A 1 306 ? 17.510  -49.042 -1.813  1.00 35.15  ? 304 LYS A N     1 
ATOM   1656 C  CA    . LYS A 1 306 ? 18.088  -49.910 -2.840  1.00 34.96  ? 304 LYS A CA    1 
ATOM   1657 C  C     . LYS A 1 306 ? 18.790  -49.142 -3.950  1.00 33.70  ? 304 LYS A C     1 
ATOM   1658 O  O     . LYS A 1 306 ? 19.167  -49.724 -4.961  1.00 34.73  ? 304 LYS A O     1 
ATOM   1659 C  CB    . LYS A 1 306 ? 17.025  -50.837 -3.423  1.00 36.70  ? 304 LYS A CB    1 
ATOM   1660 C  CG    . LYS A 1 306 ? 16.519  -51.869 -2.416  1.00 40.80  ? 304 LYS A CG    1 
ATOM   1661 C  CD    . LYS A 1 306 ? 15.451  -52.755 -3.024  1.00 42.38  ? 304 LYS A CD    1 
ATOM   1662 C  CE    . LYS A 1 306 ? 15.088  -53.902 -2.090  1.00 43.47  ? 304 LYS A CE    1 
ATOM   1663 N  NZ    . LYS A 1 306 ? 16.257  -54.760 -1.786  1.00 42.20  ? 304 LYS A NZ    1 
ATOM   1664 N  N     . GLY A 1 307 ? 18.963  -47.837 -3.768  1.00 32.21  ? 305 GLY A N     1 
ATOM   1665 C  CA    . GLY A 1 307 ? 19.705  -47.037 -4.733  1.00 25.15  ? 305 GLY A CA    1 
ATOM   1666 C  C     . GLY A 1 307 ? 18.882  -46.624 -5.946  1.00 26.32  ? 305 GLY A C     1 
ATOM   1667 O  O     . GLY A 1 307 ? 19.440  -46.368 -7.022  1.00 26.66  ? 305 GLY A O     1 
ATOM   1668 N  N     . TYR A 1 308 ? 17.563  -46.567 -5.778  1.00 21.39  ? 306 TYR A N     1 
ATOM   1669 C  CA    . TYR A 1 308 ? 16.666  -46.070 -6.829  1.00 21.97  ? 306 TYR A CA    1 
ATOM   1670 C  C     . TYR A 1 308 ? 16.048  -44.713 -6.488  1.00 24.79  ? 306 TYR A C     1 
ATOM   1671 O  O     . TYR A 1 308 ? 15.943  -44.333 -5.317  1.00 25.77  ? 306 TYR A O     1 
ATOM   1672 C  CB    . TYR A 1 308 ? 15.504  -47.038 -7.055  1.00 23.07  ? 306 TYR A CB    1 
ATOM   1673 C  CG    . TYR A 1 308 ? 15.877  -48.342 -7.719  1.00 24.48  ? 306 TYR A CG    1 
ATOM   1674 C  CD1   . TYR A 1 308 ? 15.773  -48.506 -9.095  1.00 21.41  ? 306 TYR A CD1   1 
ATOM   1675 C  CD2   . TYR A 1 308 ? 16.329  -49.413 -6.960  1.00 25.80  ? 306 TYR A CD2   1 
ATOM   1676 C  CE1   . TYR A 1 308 ? 16.114  -49.707 -9.693  1.00 24.34  ? 306 TYR A CE1   1 
ATOM   1677 C  CE2   . TYR A 1 308 ? 16.669  -50.598 -7.540  1.00 26.73  ? 306 TYR A CE2   1 
ATOM   1678 C  CZ    . TYR A 1 308 ? 16.563  -50.749 -8.899  1.00 24.73  ? 306 TYR A CZ    1 
ATOM   1679 O  OH    . TYR A 1 308 ? 16.910  -51.959 -9.440  1.00 28.05  ? 306 TYR A OH    1 
ATOM   1680 N  N     . LEU A 1 309 ? 15.614  -43.994 -7.521  1.00 22.78  ? 307 LEU A N     1 
ATOM   1681 C  CA    . LEU A 1 309 ? 14.724  -42.855 -7.339  1.00 20.79  ? 307 LEU A CA    1 
ATOM   1682 C  C     . LEU A 1 309 ? 13.374  -43.297 -7.852  1.00 22.85  ? 307 LEU A C     1 
ATOM   1683 O  O     . LEU A 1 309 ? 13.270  -43.758 -8.991  1.00 22.91  ? 307 LEU A O     1 
ATOM   1684 C  CB    . LEU A 1 309 ? 15.203  -41.642 -8.149  1.00 21.50  ? 307 LEU A CB    1 
ATOM   1685 C  CG    . LEU A 1 309 ? 14.130  -40.579 -8.458  1.00 23.05  ? 307 LEU A CG    1 
ATOM   1686 C  CD1   . LEU A 1 309 ? 13.648  -39.944 -7.179  1.00 22.15  ? 307 LEU A CD1   1 
ATOM   1687 C  CD2   . LEU A 1 309 ? 14.640  -39.493 -9.431  1.00 21.10  ? 307 LEU A CD2   1 
ATOM   1688 N  N     . LEU A 1 310 ? 12.338  -43.176 -7.023  1.00 20.42  ? 308 LEU A N     1 
ATOM   1689 C  CA    . LEU A 1 310 ? 10.985  -43.467 -7.488  1.00 19.83  ? 308 LEU A CA    1 
ATOM   1690 C  C     . LEU A 1 310 ? 10.098  -42.234 -7.445  1.00 22.77  ? 308 LEU A C     1 
ATOM   1691 O  O     . LEU A 1 310 ? 9.976   -41.571 -6.415  1.00 22.27  ? 308 LEU A O     1 
ATOM   1692 C  CB    . LEU A 1 310 ? 10.344  -44.602 -6.680  1.00 23.05  ? 308 LEU A CB    1 
ATOM   1693 C  CG    . LEU A 1 310 ? 8.871   -44.892 -6.989  1.00 23.22  ? 308 LEU A CG    1 
ATOM   1694 C  CD1   . LEU A 1 310 ? 8.680   -45.371 -8.434  1.00 22.24  ? 308 LEU A CD1   1 
ATOM   1695 C  CD2   . LEU A 1 310 ? 8.307   -45.924 -6.023  1.00 21.10  ? 308 LEU A CD2   1 
ATOM   1696 N  N     . ASN A 1 311 ? 9.485   -41.927 -8.581  1.00 24.56  ? 309 ASN A N     1 
ATOM   1697 C  CA    . ASN A 1 311 ? 8.529   -40.837 -8.661  1.00 21.32  ? 309 ASN A CA    1 
ATOM   1698 C  C     . ASN A 1 311 ? 7.436   -41.221 -9.655  1.00 20.76  ? 309 ASN A C     1 
ATOM   1699 O  O     . ASN A 1 311 ? 7.411   -42.354 -10.138 1.00 26.67  ? 309 ASN A O     1 
ATOM   1700 C  CB    . ASN A 1 311 ? 9.233   -39.531 -9.051  1.00 18.08  ? 309 ASN A CB    1 
ATOM   1701 C  CG    . ASN A 1 311 ? 9.901   -39.615 -10.396 1.00 19.33  ? 309 ASN A CG    1 
ATOM   1702 O  OD1   . ASN A 1 311 ? 9.421   -40.304 -11.297 1.00 22.82  ? 309 ASN A OD1   1 
ATOM   1703 N  ND2   . ASN A 1 311 ? 11.005  -38.891 -10.556 1.00 22.52  ? 309 ASN A ND2   1 
ATOM   1704 N  N     . GLU A 1 312 ? 6.532   -40.296 -9.954  1.00 19.80  ? 310 GLU A N     1 
ATOM   1705 C  CA    . GLU A 1 312 ? 5.404   -40.599 -10.851 1.00 17.97  ? 310 GLU A CA    1 
ATOM   1706 C  C     . GLU A 1 312 ? 5.849   -40.855 -12.284 1.00 18.19  ? 310 GLU A C     1 
ATOM   1707 O  O     . GLU A 1 312 ? 5.143   -41.512 -13.057 1.00 20.33  ? 310 GLU A O     1 
ATOM   1708 C  CB    . GLU A 1 312 ? 4.343   -39.477 -10.822 1.00 17.70  ? 310 GLU A CB    1 
ATOM   1709 C  CG    . GLU A 1 312 ? 4.863   -38.090 -11.210 1.00 20.42  ? 310 GLU A CG    1 
ATOM   1710 C  CD    . GLU A 1 312 ? 5.283   -37.260 -10.009 1.00 25.91  ? 310 GLU A CD    1 
ATOM   1711 O  OE1   . GLU A 1 312 ? 6.053   -37.769 -9.160  1.00 22.53  ? 310 GLU A OE1   1 
ATOM   1712 O  OE2   . GLU A 1 312 ? 4.831   -36.096 -9.912  1.00 27.70  ? 310 GLU A OE2   1 
ATOM   1713 N  N     . TYR A 1 313 ? 7.025   -40.345 -12.634 1.00 18.44  ? 311 TYR A N     1 
ATOM   1714 C  CA    . TYR A 1 313 ? 7.500   -40.411 -14.013 1.00 21.43  ? 311 TYR A CA    1 
ATOM   1715 C  C     . TYR A 1 313 ? 8.216   -41.713 -14.335 1.00 25.49  ? 311 TYR A C     1 
ATOM   1716 O  O     . TYR A 1 313 ? 8.261   -42.127 -15.495 1.00 24.48  ? 311 TYR A O     1 
ATOM   1717 C  CB    . TYR A 1 313 ? 8.402   -39.223 -14.321 1.00 20.66  ? 311 TYR A CB    1 
ATOM   1718 C  CG    . TYR A 1 313 ? 7.669   -37.917 -14.200 1.00 23.81  ? 311 TYR A CG    1 
ATOM   1719 C  CD1   . TYR A 1 313 ? 6.480   -37.714 -14.893 1.00 22.25  ? 311 TYR A CD1   1 
ATOM   1720 C  CD2   . TYR A 1 313 ? 8.133   -36.901 -13.362 1.00 21.95  ? 311 TYR A CD2   1 
ATOM   1721 C  CE1   . TYR A 1 313 ? 5.786   -36.530 -14.790 1.00 21.21  ? 311 TYR A CE1   1 
ATOM   1722 C  CE2   . TYR A 1 313 ? 7.428   -35.703 -13.245 1.00 24.25  ? 311 TYR A CE2   1 
ATOM   1723 C  CZ    . TYR A 1 313 ? 6.260   -35.529 -13.971 1.00 22.76  ? 311 TYR A CZ    1 
ATOM   1724 O  OH    . TYR A 1 313 ? 5.543   -34.360 -13.883 1.00 26.59  ? 311 TYR A OH    1 
ATOM   1725 N  N     . GLY A 1 314 ? 8.774   -42.355 -13.310 1.00 26.34  ? 312 GLY A N     1 
ATOM   1726 C  CA    . GLY A 1 314 ? 9.414   -43.642 -13.503 1.00 26.17  ? 312 GLY A CA    1 
ATOM   1727 C  C     . GLY A 1 314 ? 10.164  -44.180 -12.298 1.00 25.72  ? 312 GLY A C     1 
ATOM   1728 O  O     . GLY A 1 314 ? 10.099  -43.617 -11.199 1.00 26.71  ? 312 GLY A O     1 
ATOM   1729 N  N     . LEU A 1 315 ? 10.856  -45.295 -12.517 1.00 19.48  ? 313 LEU A N     1 
ATOM   1730 C  CA    . LEU A 1 315 ? 11.727  -45.909 -11.516 1.00 18.22  ? 313 LEU A CA    1 
ATOM   1731 C  C     . LEU A 1 315 ? 13.131  -45.830 -12.087 1.00 21.28  ? 313 LEU A C     1 
ATOM   1732 O  O     . LEU A 1 315 ? 13.387  -46.348 -13.178 1.00 20.74  ? 313 LEU A O     1 
ATOM   1733 C  CB    . LEU A 1 315 ? 11.323  -47.372 -11.295 1.00 19.32  ? 313 LEU A CB    1 
ATOM   1734 C  CG    . LEU A 1 315 ? 12.183  -48.309 -10.422 1.00 21.68  ? 313 LEU A CG    1 
ATOM   1735 C  CD1   . LEU A 1 315 ? 12.320  -47.786 -9.003  1.00 19.40  ? 313 LEU A CD1   1 
ATOM   1736 C  CD2   . LEU A 1 315 ? 11.571  -49.710 -10.395 1.00 20.88  ? 313 LEU A CD2   1 
ATOM   1737 N  N     . PHE A 1 316 ? 14.034  -45.160 -11.384 1.00 20.38  ? 314 PHE A N     1 
ATOM   1738 C  CA    . PHE A 1 316 ? 15.355  -44.884 -11.952 1.00 20.25  ? 314 PHE A CA    1 
ATOM   1739 C  C     . PHE A 1 316 ? 16.448  -45.431 -11.054 1.00 25.17  ? 314 PHE A C     1 
ATOM   1740 O  O     . PHE A 1 316 ? 16.483  -45.133 -9.859  1.00 29.06  ? 314 PHE A O     1 
ATOM   1741 C  CB    . PHE A 1 316 ? 15.548  -43.380 -12.152 1.00 18.78  ? 314 PHE A CB    1 
ATOM   1742 C  CG    . PHE A 1 316 ? 14.428  -42.717 -12.915 1.00 20.87  ? 314 PHE A CG    1 
ATOM   1743 C  CD1   . PHE A 1 316 ? 14.478  -42.617 -14.295 1.00 20.43  ? 314 PHE A CD1   1 
ATOM   1744 C  CD2   . PHE A 1 316 ? 13.334  -42.185 -12.246 1.00 20.08  ? 314 PHE A CD2   1 
ATOM   1745 C  CE1   . PHE A 1 316 ? 13.448  -41.997 -15.006 1.00 19.06  ? 314 PHE A CE1   1 
ATOM   1746 C  CE2   . PHE A 1 316 ? 12.297  -41.563 -12.946 1.00 19.83  ? 314 PHE A CE2   1 
ATOM   1747 C  CZ    . PHE A 1 316 ? 12.356  -41.471 -14.328 1.00 18.42  ? 314 PHE A CZ    1 
ATOM   1748 N  N     . LYS A 1 317 ? 17.340  -46.223 -11.634 1.00 25.38  ? 315 LYS A N     1 
ATOM   1749 C  CA    . LYS A 1 317 ? 18.395  -46.886 -10.872 1.00 25.64  ? 315 LYS A CA    1 
ATOM   1750 C  C     . LYS A 1 317 ? 19.612  -45.986 -10.783 1.00 24.47  ? 315 LYS A C     1 
ATOM   1751 O  O     . LYS A 1 317 ? 20.326  -45.792 -11.766 1.00 27.80  ? 315 LYS A O     1 
ATOM   1752 C  CB    . LYS A 1 317 ? 18.773  -48.216 -11.524 1.00 26.22  ? 315 LYS A CB    1 
ATOM   1753 C  CG    . LYS A 1 317 ? 19.637  -49.118 -10.656 1.00 25.81  ? 315 LYS A CG    1 
ATOM   1754 C  CD    . LYS A 1 317 ? 19.852  -50.485 -11.328 1.00 23.52  ? 315 LYS A CD    1 
ATOM   1755 C  CE    . LYS A 1 317 ? 20.142  -51.578 -10.297 1.00 26.13  ? 315 LYS A CE    1 
ATOM   1756 N  NZ    . LYS A 1 317 ? 21.408  -51.331 -9.567  1.00 30.93  ? 315 LYS A NZ    1 
ATOM   1757 N  N     . LEU A 1 318 ? 19.847  -45.451 -9.597  1.00 21.38  ? 316 LEU A N     1 
ATOM   1758 C  CA    . LEU A 1 318 ? 20.883  -44.446 -9.389  1.00 24.69  ? 316 LEU A CA    1 
ATOM   1759 C  C     . LEU A 1 318 ? 22.217  -45.013 -8.905  1.00 29.62  ? 316 LEU A C     1 
ATOM   1760 O  O     . LEU A 1 318 ? 23.270  -44.514 -9.286  1.00 29.93  ? 316 LEU A O     1 
ATOM   1761 C  CB    . LEU A 1 318 ? 20.392  -43.418 -8.374  1.00 27.97  ? 316 LEU A CB    1 
ATOM   1762 C  CG    . LEU A 1 318 ? 19.636  -42.198 -8.893  1.00 32.67  ? 316 LEU A CG    1 
ATOM   1763 C  CD1   . LEU A 1 318 ? 18.761  -42.541 -10.081 1.00 30.79  ? 316 LEU A CD1   1 
ATOM   1764 C  CD2   . LEU A 1 318 ? 18.829  -41.599 -7.741  1.00 32.56  ? 316 LEU A CD2   1 
ATOM   1765 N  N     . GLY A 1 319 ? 22.173  -46.037 -8.060  1.00 34.48  ? 317 GLY A N     1 
ATOM   1766 C  CA    . GLY A 1 319 ? 23.388  -46.588 -7.479  1.00 35.09  ? 317 GLY A CA    1 
ATOM   1767 C  C     . GLY A 1 319 ? 23.626  -46.126 -6.053  1.00 38.82  ? 317 GLY A C     1 
ATOM   1768 O  O     . GLY A 1 319 ? 22.695  -46.054 -5.241  1.00 42.25  ? 317 GLY A O     1 
ATOM   1769 N  N     . THR A 1 320 ? 24.877  -45.799 -5.737  1.00 39.59  ? 318 THR A N     1 
ATOM   1770 C  CA    . THR A 1 320 ? 25.228  -45.387 -4.381  1.00 42.63  ? 318 THR A CA    1 
ATOM   1771 C  C     . THR A 1 320 ? 24.726  -43.976 -4.094  1.00 42.97  ? 318 THR A C     1 
ATOM   1772 O  O     . THR A 1 320 ? 24.470  -43.210 -5.025  1.00 41.51  ? 318 THR A O     1 
ATOM   1773 C  CB    . THR A 1 320 ? 26.748  -45.425 -4.163  1.00 47.14  ? 318 THR A CB    1 
ATOM   1774 O  OG1   . THR A 1 320 ? 27.371  -44.441 -4.998  1.00 52.07  ? 318 THR A OG1   1 
ATOM   1775 C  CG2   . THR A 1 320 ? 27.302  -46.806 -4.500  1.00 42.13  ? 318 THR A CG2   1 
ATOM   1776 N  N     . PRO A 1 321 ? 24.578  -43.629 -2.800  1.00 43.76  ? 319 PRO A N     1 
ATOM   1777 C  CA    . PRO A 1 321 ? 24.147  -42.278 -2.436  1.00 49.18  ? 319 PRO A CA    1 
ATOM   1778 C  C     . PRO A 1 321 ? 25.045  -41.228 -3.078  1.00 54.79  ? 319 PRO A C     1 
ATOM   1779 O  O     . PRO A 1 321 ? 24.560  -40.159 -3.450  1.00 57.15  ? 319 PRO A O     1 
ATOM   1780 C  CB    . PRO A 1 321 ? 24.297  -42.265 -0.913  1.00 48.10  ? 319 PRO A CB    1 
ATOM   1781 C  CG    . PRO A 1 321 ? 24.097  -43.701 -0.519  1.00 45.06  ? 319 PRO A CG    1 
ATOM   1782 C  CD    . PRO A 1 321 ? 24.765  -44.486 -1.618  1.00 42.87  ? 319 PRO A CD    1 
ATOM   1783 N  N     . GLU A 1 322 ? 26.329  -41.543 -3.233  1.00 54.28  ? 320 GLU A N     1 
ATOM   1784 C  CA    . GLU A 1 322 ? 27.272  -40.594 -3.810  1.00 54.20  ? 320 GLU A CA    1 
ATOM   1785 C  C     . GLU A 1 322 ? 27.097  -40.459 -5.317  1.00 53.48  ? 320 GLU A C     1 
ATOM   1786 O  O     . GLU A 1 322 ? 27.189  -39.356 -5.860  1.00 54.22  ? 320 GLU A O     1 
ATOM   1787 C  CB    . GLU A 1 322 ? 28.717  -40.970 -3.476  1.00 52.97  ? 320 GLU A CB    1 
ATOM   1788 N  N     . GLU A 1 323 ? 26.853  -41.578 -5.992  1.00 50.82  ? 321 GLU A N     1 
ATOM   1789 C  CA    . GLU A 1 323 ? 26.554  -41.542 -7.418  1.00 49.40  ? 321 GLU A CA    1 
ATOM   1790 C  C     . GLU A 1 323 ? 25.268  -40.754 -7.619  1.00 43.69  ? 321 GLU A C     1 
ATOM   1791 O  O     . GLU A 1 323 ? 25.130  -39.996 -8.577  1.00 45.29  ? 321 GLU A O     1 
ATOM   1792 C  CB    . GLU A 1 323 ? 26.388  -42.952 -7.978  1.00 50.62  ? 321 GLU A CB    1 
ATOM   1793 C  CG    . GLU A 1 323 ? 27.673  -43.753 -8.051  1.00 54.20  ? 321 GLU A CG    1 
ATOM   1794 C  CD    . GLU A 1 323 ? 27.419  -45.199 -8.420  1.00 56.86  ? 321 GLU A CD    1 
ATOM   1795 O  OE1   . GLU A 1 323 ? 26.716  -45.893 -7.652  1.00 58.37  ? 321 GLU A OE1   1 
ATOM   1796 O  OE2   . GLU A 1 323 ? 27.907  -45.639 -9.484  1.00 57.35  ? 321 GLU A OE2   1 
ATOM   1797 N  N     . ALA A 1 324 ? 24.337  -40.939 -6.694  1.00 38.89  ? 322 ALA A N     1 
ATOM   1798 C  CA    . ALA A 1 324 ? 23.066  -40.231 -6.737  1.00 42.63  ? 322 ALA A CA    1 
ATOM   1799 C  C     . ALA A 1 324 ? 23.306  -38.738 -6.534  1.00 46.10  ? 322 ALA A C     1 
ATOM   1800 O  O     . ALA A 1 324 ? 22.779  -37.908 -7.277  1.00 41.74  ? 322 ALA A O     1 
ATOM   1801 C  CB    . ALA A 1 324 ? 22.111  -40.778 -5.674  1.00 41.19  ? 322 ALA A CB    1 
ATOM   1802 N  N     . ARG A 1 325 ? 24.125  -38.406 -5.535  1.00 50.41  ? 323 ARG A N     1 
ATOM   1803 C  CA    . ARG A 1 325 ? 24.459  -37.006 -5.249  1.00 52.96  ? 323 ARG A CA    1 
ATOM   1804 C  C     . ARG A 1 325 ? 25.210  -36.391 -6.417  1.00 49.01  ? 323 ARG A C     1 
ATOM   1805 O  O     . ARG A 1 325 ? 24.956  -35.239 -6.792  1.00 48.29  ? 323 ARG A O     1 
ATOM   1806 C  CB    . ARG A 1 325 ? 25.284  -36.875 -3.963  1.00 58.31  ? 323 ARG A CB    1 
ATOM   1807 C  CG    . ARG A 1 325 ? 24.504  -37.167 -2.689  1.00 63.65  ? 323 ARG A CG    1 
ATOM   1808 C  CD    . ARG A 1 325 ? 25.291  -36.784 -1.447  1.00 71.21  ? 323 ARG A CD    1 
ATOM   1809 N  NE    . ARG A 1 325 ? 26.560  -37.502 -1.370  1.00 77.02  ? 323 ARG A NE    1 
ATOM   1810 C  CZ    . ARG A 1 325 ? 26.738  -38.620 -0.689  1.00 80.60  ? 323 ARG A CZ    1 
ATOM   1811 N  NH1   . ARG A 1 325 ? 25.722  -39.146 -0.013  1.00 81.27  ? 323 ARG A NH1   1 
ATOM   1812 N  NH2   . ARG A 1 325 ? 27.923  -39.220 -0.672  1.00 82.38  ? 323 ARG A NH2   1 
ATOM   1813 N  N     . ALA A 1 326 ? 26.120  -37.148 -7.011  1.00 44.29  ? 324 ALA A N     1 
ATOM   1814 C  CA    . ALA A 1 326 ? 26.855  -36.632 -8.151  1.00 44.56  ? 324 ALA A CA    1 
ATOM   1815 C  C     . ALA A 1 326 ? 25.877  -36.327 -9.289  1.00 48.44  ? 324 ALA A C     1 
ATOM   1816 O  O     . ALA A 1 326 ? 26.009  -35.311 -9.972  1.00 50.32  ? 324 ALA A O     1 
ATOM   1817 C  CB    . ALA A 1 326 ? 27.930  -37.621 -8.593  1.00 39.82  ? 324 ALA A CB    1 
ATOM   1818 N  N     . LEU A 1 327 ? 24.887  -37.201 -9.476  1.00 45.68  ? 325 LEU A N     1 
ATOM   1819 C  CA    . LEU A 1 327 ? 23.872  -37.006 -10.513 1.00 43.92  ? 325 LEU A CA    1 
ATOM   1820 C  C     . LEU A 1 327 ? 22.998  -35.785 -10.204 1.00 43.45  ? 325 LEU A C     1 
ATOM   1821 O  O     . LEU A 1 327 ? 22.738  -34.964 -11.080 1.00 45.34  ? 325 LEU A O     1 
ATOM   1822 C  CB    . LEU A 1 327 ? 23.009  -38.270 -10.680 1.00 40.98  ? 325 LEU A CB    1 
ATOM   1823 C  CG    . LEU A 1 327 ? 21.843  -38.245 -11.681 1.00 40.31  ? 325 LEU A CG    1 
ATOM   1824 C  CD1   . LEU A 1 327 ? 22.325  -38.047 -13.121 1.00 40.08  ? 325 LEU A CD1   1 
ATOM   1825 C  CD2   . LEU A 1 327 ? 20.995  -39.522 -11.584 1.00 36.25  ? 325 LEU A CD2   1 
ATOM   1826 N  N     . TYR A 1 328 ? 22.560  -35.663 -8.955  1.00 42.25  ? 326 TYR A N     1 
ATOM   1827 C  CA    . TYR A 1 328 ? 21.743  -34.527 -8.551  1.00 47.63  ? 326 TYR A CA    1 
ATOM   1828 C  C     . TYR A 1 328 ? 22.483  -33.206 -8.763  1.00 52.94  ? 326 TYR A C     1 
ATOM   1829 O  O     . TYR A 1 328 ? 21.869  -32.202 -9.131  1.00 52.77  ? 326 TYR A O     1 
ATOM   1830 C  CB    . TYR A 1 328 ? 21.295  -34.655 -7.094  1.00 50.06  ? 326 TYR A CB    1 
ATOM   1831 C  CG    . TYR A 1 328 ? 20.222  -33.655 -6.694  1.00 53.52  ? 326 TYR A CG    1 
ATOM   1832 C  CD1   . TYR A 1 328 ? 18.882  -34.026 -6.649  1.00 52.84  ? 326 TYR A CD1   1 
ATOM   1833 C  CD2   . TYR A 1 328 ? 20.548  -32.342 -6.366  1.00 56.69  ? 326 TYR A CD2   1 
ATOM   1834 C  CE1   . TYR A 1 328 ? 17.896  -33.122 -6.290  1.00 52.86  ? 326 TYR A CE1   1 
ATOM   1835 C  CE2   . TYR A 1 328 ? 19.565  -31.426 -6.005  1.00 58.57  ? 326 TYR A CE2   1 
ATOM   1836 C  CZ    . TYR A 1 328 ? 18.240  -31.823 -5.969  1.00 57.60  ? 326 TYR A CZ    1 
ATOM   1837 O  OH    . TYR A 1 328 ? 17.255  -30.924 -5.612  1.00 58.35  ? 326 TYR A OH    1 
ATOM   1838 N  N     . GLU A 1 329 ? 23.795  -33.209 -8.532  1.00 53.19  ? 327 GLU A N     1 
ATOM   1839 C  CA    . GLU A 1 329 ? 24.603  -32.018 -8.765  1.00 58.01  ? 327 GLU A CA    1 
ATOM   1840 C  C     . GLU A 1 329 ? 24.446  -31.577 -10.213 1.00 57.31  ? 327 GLU A C     1 
ATOM   1841 O  O     . GLU A 1 329 ? 24.331  -30.385 -10.500 1.00 57.91  ? 327 GLU A O     1 
ATOM   1842 C  CB    . GLU A 1 329 ? 26.086  -32.285 -8.475  1.00 63.87  ? 327 GLU A CB    1 
ATOM   1843 C  CG    . GLU A 1 329 ? 26.398  -32.756 -7.059  1.00 69.12  ? 327 GLU A CG    1 
ATOM   1844 C  CD    . GLU A 1 329 ? 26.426  -31.626 -6.051  1.00 75.70  ? 327 GLU A CD    1 
ATOM   1845 O  OE1   . GLU A 1 329 ? 26.541  -30.456 -6.471  1.00 78.07  ? 327 GLU A OE1   1 
ATOM   1846 O  OE2   . GLU A 1 329 ? 26.334  -31.909 -4.837  1.00 78.45  ? 327 GLU A OE2   1 
ATOM   1847 N  N     . ARG A 1 330 ? 24.438  -32.543 -11.127 1.00 54.03  ? 328 ARG A N     1 
ATOM   1848 C  CA    . ARG A 1 330 ? 24.398  -32.223 -12.550 1.00 52.25  ? 328 ARG A CA    1 
ATOM   1849 C  C     . ARG A 1 330 ? 23.038  -31.728 -13.056 1.00 50.80  ? 328 ARG A C     1 
ATOM   1850 O  O     . ARG A 1 330 ? 22.983  -30.797 -13.857 1.00 52.79  ? 328 ARG A O     1 
ATOM   1851 C  CB    . ARG A 1 330 ? 24.882  -33.408 -13.396 1.00 50.08  ? 328 ARG A CB    1 
ATOM   1852 C  CG    . ARG A 1 330 ? 26.391  -33.622 -13.367 1.00 50.96  ? 328 ARG A CG    1 
ATOM   1853 C  CD    . ARG A 1 330 ? 26.839  -34.677 -14.378 1.00 53.28  ? 328 ARG A CD    1 
ATOM   1854 N  NE    . ARG A 1 330 ? 26.366  -36.014 -14.027 1.00 58.31  ? 328 ARG A NE    1 
ATOM   1855 C  CZ    . ARG A 1 330 ? 27.033  -36.872 -13.257 1.00 62.13  ? 328 ARG A CZ    1 
ATOM   1856 N  NH1   . ARG A 1 330 ? 28.213  -36.534 -12.752 1.00 66.01  ? 328 ARG A NH1   1 
ATOM   1857 N  NH2   . ARG A 1 330 ? 26.521  -38.072 -12.990 1.00 57.50  ? 328 ARG A NH2   1 
ATOM   1858 N  N     . ILE A 1 331 ? 21.949  -32.347 -12.601 1.00 47.22  ? 329 ILE A N     1 
ATOM   1859 C  CA    . ILE A 1 331 ? 20.636  -32.104 -13.208 1.00 45.15  ? 329 ILE A CA    1 
ATOM   1860 C  C     . ILE A 1 331 ? 19.517  -31.792 -12.211 1.00 45.14  ? 329 ILE A C     1 
ATOM   1861 O  O     . ILE A 1 331 ? 18.442  -31.353 -12.615 1.00 47.77  ? 329 ILE A O     1 
ATOM   1862 C  CB    . ILE A 1 331 ? 20.174  -33.306 -14.063 1.00 42.49  ? 329 ILE A CB    1 
ATOM   1863 C  CG1   . ILE A 1 331 ? 19.730  -34.459 -13.157 1.00 39.60  ? 329 ILE A CG1   1 
ATOM   1864 C  CG2   . ILE A 1 331 ? 21.275  -33.751 -15.019 1.00 41.66  ? 329 ILE A CG2   1 
ATOM   1865 C  CD1   . ILE A 1 331 ? 19.283  -35.695 -13.913 1.00 38.50  ? 329 ILE A CD1   1 
ATOM   1866 N  N     . GLY A 1 332 ? 19.761  -32.042 -10.927 1.00 45.73  ? 330 GLY A N     1 
ATOM   1867 C  CA    . GLY A 1 332 ? 18.784  -31.776 -9.881  1.00 48.91  ? 330 GLY A CA    1 
ATOM   1868 C  C     . GLY A 1 332 ? 18.619  -30.290 -9.591  1.00 56.35  ? 330 GLY A C     1 
ATOM   1869 O  O     . GLY A 1 332 ? 19.597  -29.538 -9.559  1.00 58.99  ? 330 GLY A O     1 
ATOM   1870 N  N     . ILE A 1 333 ? 17.375  -29.871 -9.372  1.00 60.21  ? 331 ILE A N     1 
ATOM   1871 C  CA    . ILE A 1 333 ? 17.039  -28.455 -9.227  1.00 61.32  ? 331 ILE A CA    1 
ATOM   1872 C  C     . ILE A 1 333 ? 16.524  -28.135 -7.824  1.00 60.95  ? 331 ILE A C     1 
ATOM   1873 O  O     . ILE A 1 333 ? 15.431  -28.557 -7.447  1.00 59.64  ? 331 ILE A O     1 
ATOM   1874 C  CB    . ILE A 1 333 ? 15.981  -28.033 -10.256 1.00 64.23  ? 331 ILE A CB    1 
ATOM   1875 C  CG1   . ILE A 1 333 ? 16.326  -28.588 -11.649 1.00 66.06  ? 331 ILE A CG1   1 
ATOM   1876 C  CG2   . ILE A 1 333 ? 15.825  -26.522 -10.270 1.00 66.15  ? 331 ILE A CG2   1 
ATOM   1877 C  CD1   . ILE A 1 333 ? 15.933  -30.078 -11.876 1.00 37.13  ? 331 ILE A CD1   1 
ATOM   1878 N  N     . ARG A 1 334 ? 17.322  -27.374 -7.077  1.00 61.28  ? 332 ARG A N     1 
ATOM   1879 C  CA    . ARG A 1 334 ? 17.095  -27.063 -5.658  1.00 61.69  ? 332 ARG A CA    1 
ATOM   1880 C  C     . ARG A 1 334 ? 15.657  -27.162 -5.135  1.00 61.68  ? 332 ARG A C     1 
ATOM   1881 O  O     . ARG A 1 334 ? 15.360  -28.013 -4.298  1.00 67.19  ? 332 ARG A O     1 
ATOM   1882 C  CB    . ARG A 1 334 ? 17.675  -25.684 -5.320  1.00 61.79  ? 332 ARG A CB    1 
ATOM   1883 N  N     . GLY A 1 335 ? 14.770  -26.290 -5.603  1.00 56.56  ? 333 GLY A N     1 
ATOM   1884 C  CA    . GLY A 1 335 ? 13.401  -26.299 -5.115  1.00 58.56  ? 333 GLY A CA    1 
ATOM   1885 C  C     . GLY A 1 335 ? 12.362  -26.879 -6.062  1.00 57.18  ? 333 GLY A C     1 
ATOM   1886 O  O     . GLY A 1 335 ? 11.162  -26.657 -5.889  1.00 60.02  ? 333 GLY A O     1 
ATOM   1887 N  N     . LYS A 1 336 ? 12.813  -27.633 -7.059  1.00 52.93  ? 334 LYS A N     1 
ATOM   1888 C  CA    . LYS A 1 336 ? 11.919  -28.118 -8.108  1.00 47.58  ? 334 LYS A CA    1 
ATOM   1889 C  C     . LYS A 1 336 ? 11.842  -29.641 -8.124  1.00 42.52  ? 334 LYS A C     1 
ATOM   1890 O  O     . LYS A 1 336 ? 10.930  -30.228 -7.533  1.00 38.82  ? 334 LYS A O     1 
ATOM   1891 C  CB    . LYS A 1 336 ? 12.379  -27.591 -9.465  1.00 48.58  ? 334 LYS A CB    1 
ATOM   1892 C  CG    . LYS A 1 336 ? 11.405  -27.822 -10.605 1.00 49.93  ? 334 LYS A CG    1 
ATOM   1893 C  CD    . LYS A 1 336 ? 11.919  -27.133 -11.864 1.00 53.67  ? 334 LYS A CD    1 
ATOM   1894 C  CE    . LYS A 1 336 ? 10.975  -27.303 -13.038 1.00 55.39  ? 334 LYS A CE    1 
ATOM   1895 N  NZ    . LYS A 1 336 ? 11.520  -26.654 -14.259 1.00 56.34  ? 334 LYS A NZ    1 
ATOM   1896 N  N     . ASN A 1 337 ? 12.801  -30.277 -8.799  1.00 38.44  ? 335 ASN A N     1 
ATOM   1897 C  CA    . ASN A 1 337 ? 12.818  -31.729 -8.897  1.00 29.73  ? 335 ASN A CA    1 
ATOM   1898 C  C     . ASN A 1 337 ? 14.195  -32.330 -9.184  1.00 28.76  ? 335 ASN A C     1 
ATOM   1899 O  O     . ASN A 1 337 ? 15.168  -31.616 -9.426  1.00 29.60  ? 335 ASN A O     1 
ATOM   1900 C  CB    . ASN A 1 337 ? 11.795  -32.201 -9.934  1.00 25.91  ? 335 ASN A CB    1 
ATOM   1901 C  CG    . ASN A 1 337 ? 12.138  -31.753 -11.341 1.00 27.89  ? 335 ASN A CG    1 
ATOM   1902 O  OD1   . ASN A 1 337 ? 13.282  -31.852 -11.775 1.00 30.42  ? 335 ASN A OD1   1 
ATOM   1903 N  ND2   . ASN A 1 337 ? 11.143  -31.261 -12.063 1.00 28.04  ? 335 ASN A ND2   1 
ATOM   1904 N  N     . ALA A 1 338 ? 14.260  -33.657 -9.168  1.00 28.27  ? 336 ALA A N     1 
ATOM   1905 C  CA    . ALA A 1 338 ? 15.519  -34.373 -9.352  1.00 29.15  ? 336 ALA A CA    1 
ATOM   1906 C  C     . ALA A 1 338 ? 16.035  -34.308 -10.786 1.00 30.87  ? 336 ALA A C     1 
ATOM   1907 O  O     . ALA A 1 338 ? 17.160  -34.725 -11.060 1.00 31.64  ? 336 ALA A O     1 
ATOM   1908 C  CB    . ALA A 1 338 ? 15.372  -35.817 -8.916  1.00 24.61  ? 336 ALA A CB    1 
ATOM   1909 N  N     . GLY A 1 339 ? 15.220  -33.809 -11.711 1.00 28.91  ? 337 GLY A N     1 
ATOM   1910 C  CA    . GLY A 1 339 ? 15.665  -33.684 -13.088 1.00 27.69  ? 337 GLY A CA    1 
ATOM   1911 C  C     . GLY A 1 339 ? 14.658  -34.081 -14.156 1.00 27.34  ? 337 GLY A C     1 
ATOM   1912 O  O     . GLY A 1 339 ? 14.954  -34.916 -15.027 1.00 28.09  ? 337 GLY A O     1 
ATOM   1913 N  N     . GLU A 1 340 ? 13.482  -33.484 -14.096 1.00 24.24  ? 338 GLU A N     1 
ATOM   1914 C  CA    . GLU A 1 340 ? 12.511  -33.638 -15.171 1.00 25.91  ? 338 GLU A CA    1 
ATOM   1915 C  C     . GLU A 1 340 ? 12.080  -32.260 -15.652 1.00 28.78  ? 338 GLU A C     1 
ATOM   1916 O  O     . GLU A 1 340 ? 12.150  -31.285 -14.916 1.00 30.09  ? 338 GLU A O     1 
ATOM   1917 C  CB    . GLU A 1 340 ? 11.288  -34.431 -14.707 1.00 26.14  ? 338 GLU A CB    1 
ATOM   1918 C  CG    . GLU A 1 340 ? 11.609  -35.776 -14.097 1.00 25.75  ? 338 GLU A CG    1 
ATOM   1919 C  CD    . GLU A 1 340 ? 11.663  -35.732 -12.582 1.00 27.14  ? 338 GLU A CD    1 
ATOM   1920 O  OE1   . GLU A 1 340 ? 12.241  -36.657 -11.984 1.00 30.85  ? 338 GLU A OE1   1 
ATOM   1921 O  OE2   . GLU A 1 340 ? 11.108  -34.783 -11.989 1.00 26.68  ? 338 GLU A OE2   1 
ATOM   1922 N  N     . GLU A 1 341 ? 11.630  -32.199 -16.899 1.00 26.36  ? 339 GLU A N     1 
ATOM   1923 C  CA    . GLU A 1 341 ? 11.105  -30.973 -17.470 1.00 26.94  ? 339 GLU A CA    1 
ATOM   1924 C  C     . GLU A 1 341 ? 9.960   -31.352 -18.403 1.00 25.69  ? 339 GLU A C     1 
ATOM   1925 O  O     . GLU A 1 341 ? 10.119  -32.240 -19.256 1.00 26.47  ? 339 GLU A O     1 
ATOM   1926 C  CB    . GLU A 1 341 ? 12.204  -30.210 -18.223 1.00 29.61  ? 339 GLU A CB    1 
ATOM   1927 C  CG    . GLU A 1 341 ? 11.697  -29.105 -19.145 1.00 32.98  ? 339 GLU A CG    1 
ATOM   1928 C  CD    . GLU A 1 341 ? 11.125  -27.912 -18.391 1.00 40.74  ? 339 GLU A CD    1 
ATOM   1929 O  OE1   . GLU A 1 341 ? 11.686  -27.543 -17.338 1.00 43.37  ? 339 GLU A OE1   1 
ATOM   1930 O  OE2   . GLU A 1 341 ? 10.116  -27.342 -18.855 1.00 43.70  ? 339 GLU A OE2   1 
ATOM   1931 N  N     . LEU A 1 342 ? 8.817   -30.717 -18.210 1.00 25.28  ? 340 LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 342 ? 7.608   -31.044 -18.965 1.00 24.59  ? 340 LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 342 ? 7.253   -32.526 -18.840 1.00 25.65  ? 340 LEU A C     1 
ATOM   1934 O  O     . LEU A 1 342 ? 6.739   -33.125 -19.795 1.00 25.56  ? 340 LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 342 ? 7.760   -30.639 -20.430 1.00 25.83  ? 340 LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 342 ? 7.667   -29.125 -20.683 1.00 28.28  ? 340 LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 342 ? 7.519   -28.795 -22.167 1.00 28.76  ? 340 LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 342 ? 6.504   -28.522 -19.897 1.00 24.87  ? 340 LEU A CD2   1 
ATOM   1939 N  N     . GLY A 1 343 ? 7.519   -33.099 -17.671 1.00 21.41  ? 341 GLY A N     1 
ATOM   1940 C  CA    . GLY A 1 343 ? 7.136   -34.478 -17.378 1.00 18.59  ? 341 GLY A CA    1 
ATOM   1941 C  C     . GLY A 1 343 ? 8.036   -35.525 -18.020 1.00 22.41  ? 341 GLY A C     1 
ATOM   1942 O  O     . GLY A 1 343 ? 7.700   -36.712 -18.039 1.00 21.31  ? 341 GLY A O     1 
ATOM   1943 N  N     . VAL A 1 344 ? 9.185   -35.087 -18.533 1.00 22.72  ? 342 VAL A N     1 
ATOM   1944 C  CA    . VAL A 1 344 ? 10.155  -35.972 -19.177 1.00 23.95  ? 342 VAL A CA    1 
ATOM   1945 C  C     . VAL A 1 344 ? 11.501  -35.892 -18.467 1.00 28.95  ? 342 VAL A C     1 
ATOM   1946 O  O     . VAL A 1 344 ? 12.037  -34.796 -18.274 1.00 29.54  ? 342 VAL A O     1 
ATOM   1947 C  CB    . VAL A 1 344 ? 10.367  -35.590 -20.659 1.00 21.99  ? 342 VAL A CB    1 
ATOM   1948 C  CG1   . VAL A 1 344 ? 11.436  -36.487 -21.316 1.00 18.87  ? 342 VAL A CG1   1 
ATOM   1949 C  CG2   . VAL A 1 344 ? 9.045   -35.682 -21.418 1.00 21.53  ? 342 VAL A CG2   1 
ATOM   1950 N  N     . PRO A 1 345 ? 12.055  -37.039 -18.067 1.00 27.25  ? 343 PRO A N     1 
ATOM   1951 C  CA    . PRO A 1 345 ? 13.364  -37.014 -17.404 1.00 26.12  ? 343 PRO A CA    1 
ATOM   1952 C  C     . PRO A 1 345 ? 14.434  -36.428 -18.314 1.00 22.36  ? 343 PRO A C     1 
ATOM   1953 O  O     . PRO A 1 345 ? 14.432  -36.684 -19.524 1.00 21.31  ? 343 PRO A O     1 
ATOM   1954 C  CB    . PRO A 1 345 ? 13.657  -38.492 -17.122 1.00 26.01  ? 343 PRO A CB    1 
ATOM   1955 C  CG    . PRO A 1 345 ? 12.291  -39.139 -17.101 1.00 26.26  ? 343 PRO A CG    1 
ATOM   1956 C  CD    . PRO A 1 345 ? 11.493  -38.407 -18.131 1.00 24.67  ? 343 PRO A CD    1 
ATOM   1957 N  N     . LYS A 1 346 ? 15.319  -35.617 -17.744 1.00 23.13  ? 344 LYS A N     1 
ATOM   1958 C  CA    . LYS A 1 346 ? 16.498  -35.190 -18.475 1.00 23.39  ? 344 LYS A CA    1 
ATOM   1959 C  C     . LYS A 1 346 ? 17.302  -36.430 -18.878 1.00 24.36  ? 344 LYS A C     1 
ATOM   1960 O  O     . LYS A 1 346 ? 17.291  -37.461 -18.181 1.00 22.34  ? 344 LYS A O     1 
ATOM   1961 C  CB    . LYS A 1 346 ? 17.339  -34.237 -17.632 1.00 29.53  ? 344 LYS A CB    1 
ATOM   1962 C  CG    . LYS A 1 346 ? 16.715  -32.862 -17.460 1.00 36.97  ? 344 LYS A CG    1 
ATOM   1963 C  CD    . LYS A 1 346 ? 17.585  -31.965 -16.598 1.00 42.61  ? 344 LYS A CD    1 
ATOM   1964 C  CE    . LYS A 1 346 ? 16.995  -30.564 -16.463 1.00 48.87  ? 344 LYS A CE    1 
ATOM   1965 N  NZ    . LYS A 1 346 ? 17.805  -29.708 -15.531 1.00 53.91  ? 344 LYS A NZ    1 
ATOM   1966 N  N     . ASP A 1 347 ? 17.991  -36.323 -20.005 1.00 26.52  ? 345 ASP A N     1 
ATOM   1967 C  CA    . ASP A 1 347 ? 18.684  -37.448 -20.604 1.00 25.74  ? 345 ASP A CA    1 
ATOM   1968 C  C     . ASP A 1 347 ? 19.436  -38.298 -19.606 1.00 25.21  ? 345 ASP A C     1 
ATOM   1969 O  O     . ASP A 1 347 ? 19.324  -39.517 -19.624 1.00 28.80  ? 345 ASP A O     1 
ATOM   1970 C  CB    . ASP A 1 347 ? 19.649  -36.966 -21.676 1.00 29.70  ? 345 ASP A CB    1 
ATOM   1971 C  CG    . ASP A 1 347 ? 18.942  -36.329 -22.820 1.00 34.50  ? 345 ASP A CG    1 
ATOM   1972 O  OD1   . ASP A 1 347 ? 17.717  -36.548 -22.928 1.00 29.92  ? 345 ASP A OD1   1 
ATOM   1973 O  OD2   . ASP A 1 347 ? 19.600  -35.615 -23.604 1.00 37.96  ? 345 ASP A OD2   1 
ATOM   1974 N  N     . GLU A 1 348 ? 20.204  -37.662 -18.735 1.00 29.66  ? 346 GLU A N     1 
ATOM   1975 C  CA    . GLU A 1 348 ? 21.081  -38.424 -17.864 1.00 35.03  ? 346 GLU A CA    1 
ATOM   1976 C  C     . GLU A 1 348 ? 20.294  -39.198 -16.818 1.00 32.65  ? 346 GLU A C     1 
ATOM   1977 O  O     . GLU A 1 348 ? 20.741  -40.234 -16.341 1.00 36.47  ? 346 GLU A O     1 
ATOM   1978 C  CB    . GLU A 1 348 ? 22.139  -37.548 -17.208 1.00 39.82  ? 346 GLU A CB    1 
ATOM   1979 C  CG    . GLU A 1 348 ? 23.153  -38.386 -16.442 1.00 49.01  ? 346 GLU A CG    1 
ATOM   1980 C  CD    . GLU A 1 348 ? 24.428  -37.642 -16.107 1.00 53.93  ? 346 GLU A CD    1 
ATOM   1981 O  OE1   . GLU A 1 348 ? 24.528  -36.441 -16.456 1.00 57.13  ? 346 GLU A OE1   1 
ATOM   1982 O  OE2   . GLU A 1 348 ? 25.330  -38.272 -15.500 1.00 52.99  ? 346 GLU A OE2   1 
ATOM   1983 N  N     . LEU A 1 349 ? 19.120  -38.697 -16.466 1.00 25.68  ? 347 LEU A N     1 
ATOM   1984 C  CA    . LEU A 1 349 ? 18.247  -39.428 -15.559 1.00 25.04  ? 347 LEU A CA    1 
ATOM   1985 C  C     . LEU A 1 349 ? 17.511  -40.509 -16.349 1.00 26.14  ? 347 LEU A C     1 
ATOM   1986 O  O     . LEU A 1 349 ? 17.340  -41.620 -15.859 1.00 26.37  ? 347 LEU A O     1 
ATOM   1987 C  CB    . LEU A 1 349 ? 17.265  -38.477 -14.868 1.00 24.35  ? 347 LEU A CB    1 
ATOM   1988 C  CG    . LEU A 1 349 ? 16.284  -39.076 -13.866 1.00 22.96  ? 347 LEU A CG    1 
ATOM   1989 C  CD1   . LEU A 1 349 ? 17.019  -39.949 -12.847 1.00 20.36  ? 347 LEU A CD1   1 
ATOM   1990 C  CD2   . LEU A 1 349 ? 15.527  -37.941 -13.184 1.00 22.81  ? 347 LEU A CD2   1 
ATOM   1991 N  N     . GLU A 1 350 ? 17.111  -40.192 -17.581 1.00 27.28  ? 348 GLU A N     1 
ATOM   1992 C  CA    . GLU A 1 350 ? 16.409  -41.166 -18.435 1.00 27.73  ? 348 GLU A CA    1 
ATOM   1993 C  C     . GLU A 1 350 ? 17.249  -42.426 -18.655 1.00 27.28  ? 348 GLU A C     1 
ATOM   1994 O  O     . GLU A 1 350 ? 16.711  -43.539 -18.701 1.00 29.17  ? 348 GLU A O     1 
ATOM   1995 C  CB    . GLU A 1 350 ? 16.020  -40.538 -19.783 1.00 29.18  ? 348 GLU A CB    1 
ATOM   1996 C  CG    . GLU A 1 350 ? 15.201  -41.444 -20.728 1.00 25.67  ? 348 GLU A CG    1 
ATOM   1997 C  CD    . GLU A 1 350 ? 13.887  -41.920 -20.104 1.00 28.61  ? 348 GLU A CD    1 
ATOM   1998 O  OE1   . GLU A 1 350 ? 13.308  -41.179 -19.294 1.00 33.68  ? 348 GLU A OE1   1 
ATOM   1999 O  OE2   . GLU A 1 350 ? 13.431  -43.038 -20.418 1.00 31.72  ? 348 GLU A OE2   1 
ATOM   2000 N  N     . ASP A 1 351 ? 18.562  -42.246 -18.781 1.00 27.77  ? 349 ASP A N     1 
ATOM   2001 C  CA    . ASP A 1 351 ? 19.496  -43.360 -18.957 1.00 28.87  ? 349 ASP A CA    1 
ATOM   2002 C  C     . ASP A 1 351 ? 19.408  -44.368 -17.811 1.00 28.70  ? 349 ASP A C     1 
ATOM   2003 O  O     . ASP A 1 351 ? 19.769  -45.532 -17.968 1.00 32.71  ? 349 ASP A O     1 
ATOM   2004 C  CB    . ASP A 1 351 ? 20.934  -42.847 -19.030 1.00 30.41  ? 349 ASP A CB    1 
ATOM   2005 C  CG    . ASP A 1 351 ? 21.224  -42.092 -20.305 1.00 36.18  ? 349 ASP A CG    1 
ATOM   2006 O  OD1   . ASP A 1 351 ? 20.496  -42.295 -21.302 1.00 38.70  ? 349 ASP A OD1   1 
ATOM   2007 O  OD2   . ASP A 1 351 ? 22.191  -41.298 -20.306 1.00 37.43  ? 349 ASP A OD2   1 
ATOM   2008 N  N     . LYS A 1 352 ? 18.944  -43.908 -16.653 1.00 25.36  ? 350 LYS A N     1 
ATOM   2009 C  CA    . LYS A 1 352 ? 18.851  -44.762 -15.475 1.00 25.63  ? 350 LYS A CA    1 
ATOM   2010 C  C     . LYS A 1 352 ? 17.499  -45.456 -15.377 1.00 24.93  ? 350 LYS A C     1 
ATOM   2011 O  O     . LYS A 1 352 ? 17.246  -46.197 -14.425 1.00 25.69  ? 350 LYS A O     1 
ATOM   2012 C  CB    . LYS A 1 352 ? 19.087  -43.939 -14.210 1.00 27.74  ? 350 LYS A CB    1 
ATOM   2013 C  CG    . LYS A 1 352 ? 20.339  -43.040 -14.264 1.00 32.46  ? 350 LYS A CG    1 
ATOM   2014 C  CD    . LYS A 1 352 ? 21.581  -43.798 -13.818 1.00 37.32  ? 350 LYS A CD    1 
ATOM   2015 C  CE    . LYS A 1 352 ? 22.842  -42.957 -13.941 1.00 42.02  ? 350 LYS A CE    1 
ATOM   2016 N  NZ    . LYS A 1 352 ? 23.042  -42.527 -15.358 1.00 47.93  ? 350 LYS A NZ    1 
ATOM   2017 N  N     . ARG A 1 353 ? 16.616  -45.218 -16.346 1.00 22.84  ? 351 ARG A N     1 
ATOM   2018 C  CA    . ARG A 1 353 ? 15.260  -45.745 -16.229 1.00 20.82  ? 351 ARG A CA    1 
ATOM   2019 C  C     . ARG A 1 353 ? 15.211  -47.276 -16.302 1.00 25.38  ? 351 ARG A C     1 
ATOM   2020 O  O     . ARG A 1 353 ? 15.814  -47.891 -17.184 1.00 24.09  ? 351 ARG A O     1 
ATOM   2021 C  CB    . ARG A 1 353 ? 14.337  -45.158 -17.296 1.00 22.12  ? 351 ARG A CB    1 
ATOM   2022 C  CG    . ARG A 1 353 ? 12.925  -45.762 -17.234 1.00 25.12  ? 351 ARG A CG    1 
ATOM   2023 C  CD    . ARG A 1 353 ? 12.048  -45.360 -18.420 1.00 23.64  ? 351 ARG A CD    1 
ATOM   2024 N  NE    . ARG A 1 353 ? 11.778  -43.930 -18.458 1.00 25.32  ? 351 ARG A NE    1 
ATOM   2025 C  CZ    . ARG A 1 353 ? 10.824  -43.320 -17.758 1.00 21.57  ? 351 ARG A CZ    1 
ATOM   2026 N  NH1   . ARG A 1 353 ? 10.042  -44.016 -16.938 1.00 15.72  ? 351 ARG A NH1   1 
ATOM   2027 N  NH2   . ARG A 1 353 ? 10.660  -42.006 -17.874 1.00 20.44  ? 351 ARG A NH2   1 
ATOM   2028 N  N     . VAL A 1 354 ? 14.490  -47.883 -15.366 1.00 26.76  ? 352 VAL A N     1 
ATOM   2029 C  CA    . VAL A 1 354 ? 14.117  -49.283 -15.476 1.00 22.39  ? 352 VAL A CA    1 
ATOM   2030 C  C     . VAL A 1 354 ? 12.682  -49.302 -15.969 1.00 26.08  ? 352 VAL A C     1 
ATOM   2031 O  O     . VAL A 1 354 ? 11.778  -48.935 -15.232 1.00 22.65  ? 352 VAL A O     1 
ATOM   2032 C  CB    . VAL A 1 354 ? 14.193  -50.015 -14.118 1.00 20.72  ? 352 VAL A CB    1 
ATOM   2033 C  CG1   . VAL A 1 354 ? 13.542  -51.400 -14.219 1.00 17.87  ? 352 VAL A CG1   1 
ATOM   2034 C  CG2   . VAL A 1 354 ? 15.649  -50.124 -13.646 1.00 20.82  ? 352 VAL A CG2   1 
ATOM   2035 N  N     . GLU A 1 355 ? 12.478  -49.706 -17.221 1.00 27.21  ? 353 GLU A N     1 
ATOM   2036 C  CA    . GLU A 1 355 ? 11.143  -49.716 -17.796 1.00 27.27  ? 353 GLU A CA    1 
ATOM   2037 C  C     . GLU A 1 355 ? 10.226  -50.613 -17.001 1.00 26.76  ? 353 GLU A C     1 
ATOM   2038 O  O     . GLU A 1 355 ? 10.607  -51.719 -16.606 1.00 26.70  ? 353 GLU A O     1 
ATOM   2039 C  CB    . GLU A 1 355 ? 11.152  -50.233 -19.235 1.00 29.52  ? 353 GLU A CB    1 
ATOM   2040 C  CG    . GLU A 1 355 ? 11.854  -49.353 -20.248 1.00 37.47  ? 353 GLU A CG    1 
ATOM   2041 C  CD    . GLU A 1 355 ? 11.757  -49.951 -21.643 1.00 51.43  ? 353 GLU A CD    1 
ATOM   2042 O  OE1   . GLU A 1 355 ? 12.807  -50.129 -22.299 1.00 59.16  ? 353 GLU A OE1   1 
ATOM   2043 O  OE2   . GLU A 1 355 ? 10.623  -50.263 -22.074 1.00 54.34  ? 353 GLU A OE2   1 
ATOM   2044 N  N     . VAL A 1 356 ? 9.002   -50.139 -16.805 1.00 24.33  ? 354 VAL A N     1 
ATOM   2045 C  CA    . VAL A 1 356 ? 7.964   -50.932 -16.198 1.00 26.94  ? 354 VAL A CA    1 
ATOM   2046 C  C     . VAL A 1 356 ? 6.687   -50.848 -17.017 1.00 29.29  ? 354 VAL A C     1 
ATOM   2047 O  O     . VAL A 1 356 ? 6.422   -49.854 -17.700 1.00 28.21  ? 354 VAL A O     1 
ATOM   2048 C  CB    . VAL A 1 356 ? 7.695   -50.488 -14.756 1.00 24.94  ? 354 VAL A CB    1 
ATOM   2049 C  CG1   . VAL A 1 356 ? 8.914   -50.791 -13.886 1.00 23.54  ? 354 VAL A CG1   1 
ATOM   2050 C  CG2   . VAL A 1 356 ? 7.353   -49.015 -14.722 1.00 23.64  ? 354 VAL A CG2   1 
ATOM   2051 N  N     . ARG A 1 357 ? 5.900   -51.909 -16.941 1.00 26.27  ? 355 ARG A N     1 
ATOM   2052 C  CA    . ARG A 1 357 ? 4.658   -51.998 -17.676 1.00 24.69  ? 355 ARG A CA    1 
ATOM   2053 C  C     . ARG A 1 357 ? 3.471   -51.939 -16.713 1.00 23.64  ? 355 ARG A C     1 
ATOM   2054 O  O     . ARG A 1 357 ? 2.353   -51.611 -17.104 1.00 28.62  ? 355 ARG A O     1 
ATOM   2055 C  CB    . ARG A 1 357 ? 4.646   -53.302 -18.487 1.00 29.31  ? 355 ARG A CB    1 
ATOM   2056 C  CG    . ARG A 1 357 ? 3.272   -53.742 -19.015 1.00 34.39  ? 355 ARG A CG    1 
ATOM   2057 C  CD    . ARG A 1 357 ? 3.282   -55.232 -19.438 1.00 40.64  ? 355 ARG A CD    1 
ATOM   2058 N  NE    . ARG A 1 357 ? 2.111   -55.935 -18.921 1.00 47.85  ? 355 ARG A NE    1 
ATOM   2059 C  CZ    . ARG A 1 357 ? 2.078   -56.583 -17.758 1.00 53.46  ? 355 ARG A CZ    1 
ATOM   2060 N  NH1   . ARG A 1 357 ? 3.165   -56.644 -16.993 1.00 54.03  ? 355 ARG A NH1   1 
ATOM   2061 N  NH2   . ARG A 1 357 ? 0.958   -57.180 -17.362 1.00 54.96  ? 355 ARG A NH2   1 
ATOM   2062 N  N     . SER A 1 358 ? 3.722   -52.240 -15.442 1.00 22.28  ? 356 SER A N     1 
ATOM   2063 C  CA    . SER A 1 358 ? 2.647   -52.413 -14.475 1.00 24.11  ? 356 SER A CA    1 
ATOM   2064 C  C     . SER A 1 358 ? 3.115   -52.020 -13.086 1.00 26.44  ? 356 SER A C     1 
ATOM   2065 O  O     . SER A 1 358 ? 4.311   -52.017 -12.797 1.00 26.16  ? 356 SER A O     1 
ATOM   2066 C  CB    . SER A 1 358 ? 2.195   -53.880 -14.444 1.00 21.07  ? 356 SER A CB    1 
ATOM   2067 O  OG    . SER A 1 358 ? 3.220   -54.689 -13.887 1.00 29.57  ? 356 SER A OG    1 
ATOM   2068 N  N     . GLU A 1 359 ? 2.163   -51.711 -12.211 1.00 27.67  ? 357 GLU A N     1 
ATOM   2069 C  CA    . GLU A 1 359 ? 2.485   -51.441 -10.819 1.00 25.97  ? 357 GLU A CA    1 
ATOM   2070 C  C     . GLU A 1 359 ? 3.296   -52.589 -10.232 1.00 27.65  ? 357 GLU A C     1 
ATOM   2071 O  O     . GLU A 1 359 ? 4.277   -52.370 -9.514  1.00 30.38  ? 357 GLU A O     1 
ATOM   2072 C  CB    . GLU A 1 359 ? 1.202   -51.236 -10.008 1.00 24.24  ? 357 GLU A CB    1 
ATOM   2073 C  CG    . GLU A 1 359 ? 0.403   -49.974 -10.402 1.00 27.27  ? 357 GLU A CG    1 
ATOM   2074 C  CD    . GLU A 1 359 ? -0.763  -49.715 -9.457  1.00 28.15  ? 357 GLU A CD    1 
ATOM   2075 O  OE1   . GLU A 1 359 ? -1.569  -50.648 -9.233  1.00 27.98  ? 357 GLU A OE1   1 
ATOM   2076 O  OE2   . GLU A 1 359 ? -0.859  -48.592 -8.915  1.00 26.34  ? 357 GLU A OE2   1 
ATOM   2077 N  N     . GLN A 1 360 ? 2.886   -53.813 -10.554 1.00 25.59  ? 358 GLN A N     1 
ATOM   2078 C  CA    . GLN A 1 360 ? 3.533   -55.014 -10.029 1.00 24.53  ? 358 GLN A CA    1 
ATOM   2079 C  C     . GLN A 1 360 ? 5.033   -54.994 -10.320 1.00 22.97  ? 358 GLN A C     1 
ATOM   2080 O  O     . GLN A 1 360 ? 5.847   -55.362 -9.466  1.00 25.73  ? 358 GLN A O     1 
ATOM   2081 C  CB    . GLN A 1 360 ? 2.875   -56.263 -10.622 1.00 25.89  ? 358 GLN A CB    1 
ATOM   2082 C  CG    . GLN A 1 360 ? 3.605   -57.569 -10.322 1.00 33.75  ? 358 GLN A CG    1 
ATOM   2083 C  CD    . GLN A 1 360 ? 3.150   -58.198 -9.026  1.00 38.55  ? 358 GLN A CD    1 
ATOM   2084 O  OE1   . GLN A 1 360 ? 1.984   -58.563 -8.880  1.00 40.31  ? 358 GLN A OE1   1 
ATOM   2085 N  NE2   . GLN A 1 360 ? 4.066   -58.320 -8.069  1.00 40.99  ? 358 GLN A NE2   1 
ATOM   2086 N  N     . ASP A 1 361 ? 5.402   -54.546 -11.515 1.00 21.10  ? 359 ASP A N     1 
ATOM   2087 C  CA    . ASP A 1 361 ? 6.820   -54.441 -11.860 1.00 23.90  ? 359 ASP A CA    1 
ATOM   2088 C  C     . ASP A 1 361 ? 7.599   -53.671 -10.796 1.00 28.70  ? 359 ASP A C     1 
ATOM   2089 O  O     . ASP A 1 361 ? 8.730   -54.046 -10.443 1.00 30.91  ? 359 ASP A O     1 
ATOM   2090 C  CB    . ASP A 1 361 ? 7.024   -53.765 -13.224 1.00 19.23  ? 359 ASP A CB    1 
ATOM   2091 C  CG    . ASP A 1 361 ? 6.603   -54.641 -14.380 1.00 22.68  ? 359 ASP A CG    1 
ATOM   2092 O  OD1   . ASP A 1 361 ? 6.675   -55.885 -14.253 1.00 22.54  ? 359 ASP A OD1   1 
ATOM   2093 O  OD2   . ASP A 1 361 ? 6.207   -54.085 -15.426 1.00 26.02  ? 359 ASP A OD2   1 
ATOM   2094 N  N     . VAL A 1 362 ? 6.998   -52.593 -10.286 1.00 27.56  ? 360 VAL A N     1 
ATOM   2095 C  CA    . VAL A 1 362 ? 7.699   -51.705 -9.356  1.00 24.30  ? 360 VAL A CA    1 
ATOM   2096 C  C     . VAL A 1 362 ? 7.921   -52.376 -8.010  1.00 22.85  ? 360 VAL A C     1 
ATOM   2097 O  O     . VAL A 1 362 ? 9.023   -52.336 -7.468  1.00 21.49  ? 360 VAL A O     1 
ATOM   2098 C  CB    . VAL A 1 362 ? 6.963   -50.365 -9.149  1.00 22.92  ? 360 VAL A CB    1 
ATOM   2099 C  CG1   . VAL A 1 362 ? 7.637   -49.555 -8.051  1.00 19.75  ? 360 VAL A CG1   1 
ATOM   2100 C  CG2   . VAL A 1 362 ? 6.927   -49.567 -10.455 1.00 19.77  ? 360 VAL A CG2   1 
ATOM   2101 N  N     . PHE A 1 363 ? 6.866   -52.979 -7.474  1.00 21.75  ? 361 PHE A N     1 
ATOM   2102 C  CA    . PHE A 1 363 ? 6.978   -53.768 -6.253  1.00 25.04  ? 361 PHE A CA    1 
ATOM   2103 C  C     . PHE A 1 363 ? 8.086   -54.822 -6.419  1.00 26.65  ? 361 PHE A C     1 
ATOM   2104 O  O     . PHE A 1 363 ? 8.921   -54.996 -5.538  1.00 28.21  ? 361 PHE A O     1 
ATOM   2105 C  CB    . PHE A 1 363 ? 5.665   -54.496 -5.961  1.00 25.77  ? 361 PHE A CB    1 
ATOM   2106 C  CG    . PHE A 1 363 ? 4.547   -53.613 -5.473  1.00 26.35  ? 361 PHE A CG    1 
ATOM   2107 C  CD1   . PHE A 1 363 ? 3.617   -53.087 -6.359  1.00 26.80  ? 361 PHE A CD1   1 
ATOM   2108 C  CD2   . PHE A 1 363 ? 4.379   -53.374 -4.115  1.00 29.84  ? 361 PHE A CD2   1 
ATOM   2109 C  CE1   . PHE A 1 363 ? 2.563   -52.304 -5.911  1.00 27.54  ? 361 PHE A CE1   1 
ATOM   2110 C  CE2   . PHE A 1 363 ? 3.331   -52.592 -3.654  1.00 27.51  ? 361 PHE A CE2   1 
ATOM   2111 C  CZ    . PHE A 1 363 ? 2.419   -52.054 -4.554  1.00 26.95  ? 361 PHE A CZ    1 
ATOM   2112 N  N     . ASP A 1 364 ? 8.073   -55.534 -7.543  1.00 24.66  ? 362 ASP A N     1 
ATOM   2113 C  CA    . ASP A 1 364 ? 9.033   -56.624 -7.767  1.00 26.23  ? 362 ASP A CA    1 
ATOM   2114 C  C     . ASP A 1 364 ? 10.477  -56.119 -7.757  1.00 25.98  ? 362 ASP A C     1 
ATOM   2115 O  O     . ASP A 1 364 ? 11.333  -56.668 -7.068  1.00 27.03  ? 362 ASP A O     1 
ATOM   2116 C  CB    . ASP A 1 364 ? 8.748   -57.353 -9.086  1.00 24.87  ? 362 ASP A CB    1 
ATOM   2117 C  CG    . ASP A 1 364 ? 7.406   -58.079 -9.088  1.00 25.04  ? 362 ASP A CG    1 
ATOM   2118 O  OD1   . ASP A 1 364 ? 6.804   -58.287 -8.014  1.00 24.23  ? 362 ASP A OD1   1 
ATOM   2119 O  OD2   . ASP A 1 364 ? 6.961   -58.468 -10.183 1.00 24.16  ? 362 ASP A OD2   1 
ATOM   2120 N  N     . VAL A 1 365 ? 10.748  -55.061 -8.510  1.00 23.80  ? 363 VAL A N     1 
ATOM   2121 C  CA    . VAL A 1 365 ? 12.110  -54.551 -8.592  1.00 24.10  ? 363 VAL A CA    1 
ATOM   2122 C  C     . VAL A 1 365 ? 12.593  -54.043 -7.234  1.00 26.70  ? 363 VAL A C     1 
ATOM   2123 O  O     . VAL A 1 365 ? 13.790  -54.049 -6.962  1.00 29.59  ? 363 VAL A O     1 
ATOM   2124 C  CB    . VAL A 1 365 ? 12.243  -53.463 -9.676  1.00 25.24  ? 363 VAL A CB    1 
ATOM   2125 C  CG1   . VAL A 1 365 ? 13.606  -52.776 -9.599  1.00 22.43  ? 363 VAL A CG1   1 
ATOM   2126 C  CG2   . VAL A 1 365 ? 12.025  -54.073 -11.054 1.00 25.01  ? 363 VAL A CG2   1 
ATOM   2127 N  N     . LEU A 1 366 ? 11.659  -53.631 -6.381  1.00 25.05  ? 364 LEU A N     1 
ATOM   2128 C  CA    . LEU A 1 366 ? 12.004  -53.105 -5.060  1.00 22.43  ? 364 LEU A CA    1 
ATOM   2129 C  C     . LEU A 1 366 ? 11.934  -54.169 -3.958  1.00 25.43  ? 364 LEU A C     1 
ATOM   2130 O  O     . LEU A 1 366 ? 12.177  -53.872 -2.791  1.00 32.19  ? 364 LEU A O     1 
ATOM   2131 C  CB    . LEU A 1 366 ? 11.103  -51.900 -4.706  1.00 23.59  ? 364 LEU A CB    1 
ATOM   2132 C  CG    . LEU A 1 366 ? 11.233  -50.675 -5.627  1.00 24.99  ? 364 LEU A CG    1 
ATOM   2133 C  CD1   . LEU A 1 366 ? 10.241  -49.560 -5.250  1.00 22.84  ? 364 LEU A CD1   1 
ATOM   2134 C  CD2   . LEU A 1 366 ? 12.648  -50.144 -5.624  1.00 25.83  ? 364 LEU A CD2   1 
ATOM   2135 N  N     . GLY A 1 367 ? 11.593  -55.398 -4.326  1.00 28.43  ? 365 GLY A N     1 
ATOM   2136 C  CA    . GLY A 1 367 ? 11.591  -56.498 -3.376  1.00 31.58  ? 365 GLY A CA    1 
ATOM   2137 C  C     . GLY A 1 367 ? 10.432  -56.427 -2.396  1.00 36.97  ? 365 GLY A C     1 
ATOM   2138 O  O     . GLY A 1 367 ? 10.513  -56.943 -1.282  1.00 36.00  ? 365 GLY A O     1 
ATOM   2139 N  N     . MET A 1 368 ? 9.349   -55.783 -2.818  1.00 37.14  ? 366 MET A N     1 
ATOM   2140 C  CA    . MET A 1 368 ? 8.177   -55.612 -1.974  1.00 34.80  ? 366 MET A CA    1 
ATOM   2141 C  C     . MET A 1 368 ? 7.033   -56.465 -2.470  1.00 31.57  ? 366 MET A C     1 
ATOM   2142 O  O     . MET A 1 368 ? 6.824   -56.598 -3.670  1.00 34.06  ? 366 MET A O     1 
ATOM   2143 C  CB    . MET A 1 368 ? 7.729   -54.147 -1.957  1.00 35.00  ? 366 MET A CB    1 
ATOM   2144 C  CG    . MET A 1 368 ? 8.738   -53.196 -1.357  1.00 39.37  ? 366 MET A CG    1 
ATOM   2145 S  SD    . MET A 1 368 ? 8.233   -51.480 -1.573  1.00 40.71  ? 366 MET A SD    1 
ATOM   2146 C  CE    . MET A 1 368 ? 6.732   -51.436 -0.579  1.00 29.87  ? 366 MET A CE    1 
ATOM   2147 N  N     . PRO A 1 369 ? 6.274   -57.044 -1.541  1.00 29.07  ? 367 PRO A N     1 
ATOM   2148 C  CA    . PRO A 1 369 ? 5.118   -57.841 -1.944  1.00 30.38  ? 367 PRO A CA    1 
ATOM   2149 C  C     . PRO A 1 369 ? 4.012   -56.933 -2.477  1.00 32.88  ? 367 PRO A C     1 
ATOM   2150 O  O     . PRO A 1 369 ? 3.745   -55.879 -1.905  1.00 35.32  ? 367 PRO A O     1 
ATOM   2151 C  CB    . PRO A 1 369 ? 4.687   -58.532 -0.641  1.00 32.89  ? 367 PRO A CB    1 
ATOM   2152 C  CG    . PRO A 1 369 ? 5.250   -57.677 0.459   1.00 33.44  ? 367 PRO A CG    1 
ATOM   2153 C  CD    . PRO A 1 369 ? 6.515   -57.073 -0.085  1.00 30.04  ? 367 PRO A CD    1 
ATOM   2154 N  N     . TYR A 1 370 ? 3.390   -57.342 -3.574  1.00 29.63  ? 368 TYR A N     1 
ATOM   2155 C  CA    . TYR A 1 370 ? 2.313   -56.585 -4.164  1.00 30.61  ? 368 TYR A CA    1 
ATOM   2156 C  C     . TYR A 1 370 ? 1.200   -56.275 -3.166  1.00 32.52  ? 368 TYR A C     1 
ATOM   2157 O  O     . TYR A 1 370 ? 0.786   -57.130 -2.373  1.00 33.01  ? 368 TYR A O     1 
ATOM   2158 C  CB    . TYR A 1 370 ? 1.727   -57.328 -5.372  1.00 28.41  ? 368 TYR A CB    1 
ATOM   2159 C  CG    . TYR A 1 370 ? 0.634   -56.541 -6.067  1.00 29.02  ? 368 TYR A CG    1 
ATOM   2160 C  CD1   . TYR A 1 370 ? 0.940   -55.424 -6.839  1.00 28.93  ? 368 TYR A CD1   1 
ATOM   2161 C  CD2   . TYR A 1 370 ? -0.700  -56.902 -5.934  1.00 29.90  ? 368 TYR A CD2   1 
ATOM   2162 C  CE1   . TYR A 1 370 ? -0.055  -54.687 -7.460  1.00 29.38  ? 368 TYR A CE1   1 
ATOM   2163 C  CE2   . TYR A 1 370 ? -1.700  -56.180 -6.558  1.00 29.15  ? 368 TYR A CE2   1 
ATOM   2164 C  CZ    . TYR A 1 370 ? -1.372  -55.071 -7.319  1.00 30.81  ? 368 TYR A CZ    1 
ATOM   2165 O  OH    . TYR A 1 370 ? -2.364  -54.348 -7.943  1.00 33.80  ? 368 TYR A OH    1 
ATOM   2166 N  N     . ALA A 1 371 ? 0.705   -55.045 -3.219  1.00 30.62  ? 369 ALA A N     1 
ATOM   2167 C  CA    . ALA A 1 371 ? -0.500  -54.695 -2.479  1.00 29.50  ? 369 ALA A CA    1 
ATOM   2168 C  C     . ALA A 1 371 ? -1.510  -54.100 -3.445  1.00 30.67  ? 369 ALA A C     1 
ATOM   2169 O  O     . ALA A 1 371 ? -1.193  -53.158 -4.183  1.00 32.08  ? 369 ALA A O     1 
ATOM   2170 C  CB    . ALA A 1 371 ? -0.176  -53.719 -1.359  1.00 24.06  ? 369 ALA A CB    1 
ATOM   2171 N  N     . LYS A 1 372 ? -2.715  -54.661 -3.461  1.00 30.47  ? 370 LYS A N     1 
ATOM   2172 C  CA    . LYS A 1 372 ? -3.801  -54.095 -4.261  1.00 32.18  ? 370 LYS A CA    1 
ATOM   2173 C  C     . LYS A 1 372 ? -4.084  -52.678 -3.788  1.00 29.98  ? 370 LYS A C     1 
ATOM   2174 O  O     . LYS A 1 372 ? -3.787  -52.339 -2.648  1.00 30.81  ? 370 LYS A O     1 
ATOM   2175 C  CB    . LYS A 1 372 ? -5.074  -54.925 -4.107  1.00 37.42  ? 370 LYS A CB    1 
ATOM   2176 C  CG    . LYS A 1 372 ? -4.969  -56.359 -4.571  1.00 44.89  ? 370 LYS A CG    1 
ATOM   2177 C  CD    . LYS A 1 372 ? -6.324  -57.063 -4.451  1.00 51.93  ? 370 LYS A CD    1 
ATOM   2178 C  CE    . LYS A 1 372 ? -6.225  -58.530 -4.859  1.00 58.36  ? 370 LYS A CE    1 
ATOM   2179 N  NZ    . LYS A 1 372 ? -7.543  -59.226 -4.809  1.00 60.89  ? 370 LYS A NZ    1 
ATOM   2180 N  N     . PRO A 1 373 ? -4.675  -51.849 -4.659  1.00 31.45  ? 371 PRO A N     1 
ATOM   2181 C  CA    . PRO A 1 373 ? -4.998  -50.463 -4.298  1.00 30.16  ? 371 PRO A CA    1 
ATOM   2182 C  C     . PRO A 1 373 ? -5.700  -50.366 -2.945  1.00 31.43  ? 371 PRO A C     1 
ATOM   2183 O  O     . PRO A 1 373 ? -5.349  -49.499 -2.140  1.00 29.79  ? 371 PRO A O     1 
ATOM   2184 C  CB    . PRO A 1 373 ? -5.945  -50.037 -5.414  1.00 28.49  ? 371 PRO A CB    1 
ATOM   2185 C  CG    . PRO A 1 373 ? -5.461  -50.823 -6.608  1.00 30.99  ? 371 PRO A CG    1 
ATOM   2186 C  CD    . PRO A 1 373 ? -5.054  -52.166 -6.050  1.00 29.48  ? 371 PRO A CD    1 
ATOM   2187 N  N     . GLU A 1 374 ? -6.654  -51.260 -2.700  1.00 34.61  ? 372 GLU A N     1 
ATOM   2188 C  CA    . GLU A 1 374 ? -7.488  -51.228 -1.495  1.00 37.91  ? 372 GLU A CA    1 
ATOM   2189 C  C     . GLU A 1 374 ? -6.714  -51.605 -0.240  1.00 37.43  ? 372 GLU A C     1 
ATOM   2190 O  O     . GLU A 1 374 ? -7.204  -51.438 0.871   1.00 39.56  ? 372 GLU A O     1 
ATOM   2191 C  CB    . GLU A 1 374 ? -8.672  -52.181 -1.646  1.00 42.45  ? 372 GLU A CB    1 
ATOM   2192 C  CG    . GLU A 1 374 ? -8.266  -53.646 -1.604  1.00 47.43  ? 372 GLU A CG    1 
ATOM   2193 C  CD    . GLU A 1 374 ? -9.375  -54.587 -2.031  1.00 54.08  ? 372 GLU A CD    1 
ATOM   2194 O  OE1   . GLU A 1 374 ? -9.799  -54.517 -3.208  1.00 55.50  ? 372 GLU A OE1   1 
ATOM   2195 O  OE2   . GLU A 1 374 ? -9.814  -55.402 -1.188  1.00 56.22  ? 372 GLU A OE2   1 
ATOM   2196 N  N     . ASN A 1 375 ? -5.513  -52.129 -0.415  1.00 33.37  ? 373 ASN A N     1 
ATOM   2197 C  CA    . ASN A 1 375 ? -4.651  -52.433 0.722   1.00 34.09  ? 373 ASN A CA    1 
ATOM   2198 C  C     . ASN A 1 375 ? -3.473  -51.466 0.827   1.00 34.78  ? 373 ASN A C     1 
ATOM   2199 O  O     . ASN A 1 375 ? -2.436  -51.803 1.400   1.00 34.46  ? 373 ASN A O     1 
ATOM   2200 C  CB    . ASN A 1 375 ? -4.151  -53.885 0.650   1.00 35.45  ? 373 ASN A CB    1 
ATOM   2201 C  CG    . ASN A 1 375 ? -5.293  -54.897 0.705   1.00 39.93  ? 373 ASN A CG    1 
ATOM   2202 O  OD1   . ASN A 1 375 ? -6.326  -54.640 1.313   1.00 43.16  ? 373 ASN A OD1   1 
ATOM   2203 N  ND2   . ASN A 1 375 ? -5.110  -56.044 0.065   1.00 41.82  ? 373 ASN A ND2   1 
ATOM   2204 N  N     . ARG A 1 376 ? -3.633  -50.265 0.267   1.00 33.15  ? 374 ARG A N     1 
ATOM   2205 C  CA    . ARG A 1 376 ? -2.577  -49.256 0.332   1.00 33.23  ? 374 ARG A CA    1 
ATOM   2206 C  C     . ARG A 1 376 ? -2.970  -48.104 1.245   1.00 34.45  ? 374 ARG A C     1 
ATOM   2207 O  O     . ARG A 1 376 ? -2.862  -46.925 0.871   1.00 31.87  ? 374 ARG A O     1 
ATOM   2208 C  CB    . ARG A 1 376 ? -2.212  -48.736 -1.063  1.00 28.80  ? 374 ARG A CB    1 
ATOM   2209 C  CG    . ARG A 1 376 ? -1.561  -49.774 -1.962  1.00 27.49  ? 374 ARG A CG    1 
ATOM   2210 C  CD    . ARG A 1 376 ? -1.457  -49.284 -3.399  1.00 25.67  ? 374 ARG A CD    1 
ATOM   2211 N  NE    . ARG A 1 376 ? -1.356  -50.394 -4.343  1.00 26.00  ? 374 ARG A NE    1 
ATOM   2212 C  CZ    . ARG A 1 376 ? -1.339  -50.252 -5.664  1.00 24.77  ? 374 ARG A CZ    1 
ATOM   2213 N  NH1   . ARG A 1 376 ? -1.410  -49.039 -6.201  1.00 19.94  ? 374 ARG A NH1   1 
ATOM   2214 N  NH2   . ARG A 1 376 ? -1.255  -51.317 -6.455  1.00 23.63  ? 374 ARG A NH2   1 
ATOM   2215 N  N     . ASP A 1 377 ? -3.429  -48.458 2.442   1.00 32.76  ? 375 ASP A N     1 
ATOM   2216 C  CA    . ASP A 1 377 ? -3.733  -47.479 3.481   1.00 34.42  ? 375 ASP A CA    1 
ATOM   2217 C  C     . ASP A 1 377 ? -2.988  -47.798 4.779   1.00 38.13  ? 375 ASP A C     1 
ATOM   2218 O  O     . ASP A 1 377 ? -3.604  -47.957 5.829   1.00 40.95  ? 375 ASP A O     1 
ATOM   2219 C  CB    . ASP A 1 377 ? -5.247  -47.397 3.733   1.00 30.84  ? 375 ASP A CB    1 
ATOM   2220 C  CG    . ASP A 1 377 ? -5.962  -46.500 2.730   1.00 32.48  ? 375 ASP A CG    1 
ATOM   2221 O  OD1   . ASP A 1 377 ? -5.810  -45.266 2.810   1.00 38.21  ? 375 ASP A OD1   1 
ATOM   2222 O  OD2   . ASP A 1 377 ? -6.692  -47.018 1.872   1.00 30.52  ? 375 ASP A OD2   1 
ATOM   2223 N  N     . PRO A 1 378 ? -1.652  -47.870 4.714   1.00 44.89  ? 376 PRO A N     1 
ATOM   2224 C  CA    . PRO A 1 378 ? -0.869  -48.253 5.896   1.00 50.21  ? 376 PRO A CA    1 
ATOM   2225 C  C     . PRO A 1 378 ? -0.968  -47.213 7.010   1.00 58.06  ? 376 PRO A C     1 
ATOM   2226 O  O     . PRO A 1 378 ? -1.525  -46.130 6.829   1.00 61.21  ? 376 PRO A O     1 
ATOM   2227 C  CB    . PRO A 1 378 ? 0.564   -48.317 5.357   1.00 45.60  ? 376 PRO A CB    1 
ATOM   2228 C  CG    . PRO A 1 378 ? 0.569   -47.345 4.209   1.00 41.36  ? 376 PRO A CG    1 
ATOM   2229 C  CD    . PRO A 1 378 ? -0.790  -47.486 3.578   1.00 41.86  ? 376 PRO A CD    1 
ATOM   2230 O  OXT   . PRO A 1 378 ? -0.488  -47.433 8.128   1.00 62.19  ? 376 PRO A OXT   1 
ATOM   2231 O  "O5'" . DC  B 2 1   ? 15.596  -19.123 -5.975  1.00 71.24  ? 1   DC  C "O5'" 1 
ATOM   2232 C  "C5'" . DC  B 2 1   ? 14.988  -19.660 -4.809  1.00 66.93  ? 1   DC  C "C5'" 1 
ATOM   2233 C  "C4'" . DC  B 2 1   ? 14.413  -18.545 -3.955  1.00 65.33  ? 1   DC  C "C4'" 1 
ATOM   2234 O  "O4'" . DC  B 2 1   ? 13.351  -17.873 -4.678  1.00 63.38  ? 1   DC  C "O4'" 1 
ATOM   2235 C  "C3'" . DC  B 2 1   ? 13.763  -19.017 -2.665  1.00 65.84  ? 1   DC  C "C3'" 1 
ATOM   2236 O  "O3'" . DC  B 2 1   ? 13.758  -17.967 -1.699  1.00 71.31  ? 1   DC  C "O3'" 1 
ATOM   2237 C  "C2'" . DC  B 2 1   ? 12.355  -19.366 -3.129  1.00 61.26  ? 1   DC  C "C2'" 1 
ATOM   2238 C  "C1'" . DC  B 2 1   ? 12.094  -18.332 -4.221  1.00 58.35  ? 1   DC  C "C1'" 1 
ATOM   2239 N  N1    . DC  B 2 1   ? 11.353  -18.898 -5.382  1.00 49.54  ? 1   DC  C N1    1 
ATOM   2240 C  C2    . DC  B 2 1   ? 10.184  -18.275 -5.822  1.00 47.10  ? 1   DC  C C2    1 
ATOM   2241 O  O2    . DC  B 2 1   ? 9.789   -17.250 -5.236  1.00 47.51  ? 1   DC  C O2    1 
ATOM   2242 N  N3    . DC  B 2 1   ? 9.522   -18.811 -6.882  1.00 43.90  ? 1   DC  C N3    1 
ATOM   2243 C  C4    . DC  B 2 1   ? 9.984   -19.911 -7.478  1.00 39.76  ? 1   DC  C C4    1 
ATOM   2244 N  N4    . DC  B 2 1   ? 9.296   -20.394 -8.516  1.00 36.63  ? 1   DC  C N4    1 
ATOM   2245 C  C5    . DC  B 2 1   ? 11.172  -20.558 -7.037  1.00 45.06  ? 1   DC  C C5    1 
ATOM   2246 C  C6    . DC  B 2 1   ? 11.816  -20.023 -5.994  1.00 47.54  ? 1   DC  C C6    1 
ATOM   2247 P  P     . DA  B 2 2   ? 13.749  -18.316 -0.129  1.00 91.55  ? 2   DA  C P     1 
ATOM   2248 O  OP1   . DA  B 2 2   ? 14.329  -17.164 0.596   1.00 91.34  ? 2   DA  C OP1   1 
ATOM   2249 O  OP2   . DA  B 2 2   ? 14.305  -19.681 0.040   1.00 91.25  ? 2   DA  C OP2   1 
ATOM   2250 O  "O5'" . DA  B 2 2   ? 12.193  -18.375 0.234   1.00 64.85  ? 2   DA  C "O5'" 1 
ATOM   2251 C  "C5'" . DA  B 2 2   ? 11.405  -17.208 0.089   1.00 64.55  ? 2   DA  C "C5'" 1 
ATOM   2252 C  "C4'" . DA  B 2 2   ? 9.941   -17.581 0.215   1.00 64.86  ? 2   DA  C "C4'" 1 
ATOM   2253 O  "O4'" . DA  B 2 2   ? 9.462   -18.111 -1.046  1.00 60.63  ? 2   DA  C "O4'" 1 
ATOM   2254 C  "C3'" . DA  B 2 2   ? 9.636   -18.627 1.290   1.00 62.71  ? 2   DA  C "C3'" 1 
ATOM   2255 O  "O3'" . DA  B 2 2   ? 8.610   -18.081 2.123   1.00 63.42  ? 2   DA  C "O3'" 1 
ATOM   2256 C  "C2'" . DA  B 2 2   ? 9.214   -19.868 0.501   1.00 58.43  ? 2   DA  C "C2'" 1 
ATOM   2257 C  "C1'" . DA  B 2 2   ? 8.689   -19.265 -0.799  1.00 55.02  ? 2   DA  C "C1'" 1 
ATOM   2258 N  N9    . DA  B 2 2   ? 8.818   -20.157 -1.947  1.00 46.30  ? 2   DA  C N9    1 
ATOM   2259 C  C8    . DA  B 2 2   ? 9.745   -21.147 -2.119  1.00 45.62  ? 2   DA  C C8    1 
ATOM   2260 N  N7    . DA  B 2 2   ? 9.626   -21.794 -3.251  1.00 44.98  ? 2   DA  C N7    1 
ATOM   2261 C  C5    . DA  B 2 2   ? 8.540   -21.183 -3.861  1.00 41.65  ? 2   DA  C C5    1 
ATOM   2262 C  C6    . DA  B 2 2   ? 7.896   -21.411 -5.090  1.00 38.77  ? 2   DA  C C6    1 
ATOM   2263 N  N6    . DA  B 2 2   ? 8.285   -22.357 -5.951  1.00 40.78  ? 2   DA  C N6    1 
ATOM   2264 N  N1    . DA  B 2 2   ? 6.842   -20.630 -5.399  1.00 35.62  ? 2   DA  C N1    1 
ATOM   2265 C  C2    . DA  B 2 2   ? 6.455   -19.682 -4.535  1.00 36.51  ? 2   DA  C C2    1 
ATOM   2266 N  N3    . DA  B 2 2   ? 6.982   -19.374 -3.351  1.00 38.63  ? 2   DA  C N3    1 
ATOM   2267 C  C4    . DA  B 2 2   ? 8.030   -20.170 -3.073  1.00 41.55  ? 2   DA  C C4    1 
ATOM   2268 P  P     . DG  B 2 3   ? 7.877   -18.987 3.231   1.00 61.26  ? 3   DG  C P     1 
ATOM   2269 O  OP1   . DG  B 2 3   ? 7.564   -18.119 4.388   1.00 66.91  ? 3   DG  C OP1   1 
ATOM   2270 O  OP2   . DG  B 2 3   ? 8.674   -20.213 3.434   1.00 59.27  ? 3   DG  C OP2   1 
ATOM   2271 O  "O5'" . DG  B 2 3   ? 6.510   -19.403 2.518   1.00 56.31  ? 3   DG  C "O5'" 1 
ATOM   2272 C  "C5'" . DG  B 2 3   ? 5.695   -18.362 1.985   1.00 55.10  ? 3   DG  C "C5'" 1 
ATOM   2273 C  "C4'" . DG  B 2 3   ? 4.520   -18.945 1.223   1.00 50.54  ? 3   DG  C "C4'" 1 
ATOM   2274 O  "O4'" . DG  B 2 3   ? 4.972   -19.504 -0.041  1.00 45.94  ? 3   DG  C "O4'" 1 
ATOM   2275 C  "C3'" . DG  B 2 3   ? 3.785   -20.049 1.985   1.00 47.27  ? 3   DG  C "C3'" 1 
ATOM   2276 O  "O3'" . DG  B 2 3   ? 2.427   -19.670 2.155   1.00 46.12  ? 3   DG  C "O3'" 1 
ATOM   2277 C  "C2'" . DG  B 2 3   ? 3.912   -21.281 1.097   1.00 46.11  ? 3   DG  C "C2'" 1 
ATOM   2278 C  "C1'" . DG  B 2 3   ? 4.247   -20.691 -0.271  1.00 43.66  ? 3   DG  C "C1'" 1 
ATOM   2279 N  N9    . DG  B 2 3   ? 5.028   -21.620 -1.077  1.00 35.87  ? 3   DG  C N9    1 
ATOM   2280 C  C8    . DG  B 2 3   ? 6.208   -22.239 -0.747  1.00 32.18  ? 3   DG  C C8    1 
ATOM   2281 N  N7    . DG  B 2 3   ? 6.649   -23.039 -1.682  1.00 31.51  ? 3   DG  C N7    1 
ATOM   2282 C  C5    . DG  B 2 3   ? 5.698   -22.938 -2.695  1.00 30.91  ? 3   DG  C C5    1 
ATOM   2283 C  C6    . DG  B 2 3   ? 5.628   -23.573 -3.960  1.00 28.55  ? 3   DG  C C6    1 
ATOM   2284 O  O6    . DG  B 2 3   ? 6.429   -24.377 -4.465  1.00 30.85  ? 3   DG  C O6    1 
ATOM   2285 N  N1    . DG  B 2 3   ? 4.489   -23.194 -4.659  1.00 26.27  ? 3   DG  C N1    1 
ATOM   2286 C  C2    . DG  B 2 3   ? 3.536   -22.308 -4.201  1.00 28.65  ? 3   DG  C C2    1 
ATOM   2287 N  N2    . DG  B 2 3   ? 2.500   -22.046 -5.013  1.00 25.33  ? 3   DG  C N2    1 
ATOM   2288 N  N3    . DG  B 2 3   ? 3.591   -21.713 -3.020  1.00 27.93  ? 3   DG  C N3    1 
ATOM   2289 C  C4    . DG  B 2 3   ? 4.694   -22.074 -2.330  1.00 30.39  ? 3   DG  C C4    1 
ATOM   2290 P  P     . DT  B 2 4   ? 1.438   -20.570 3.045   1.00 44.13  ? 4   DT  C P     1 
ATOM   2291 O  OP1   . DT  B 2 4   ? 0.307   -19.711 3.465   1.00 44.15  ? 4   DT  C OP1   1 
ATOM   2292 O  OP2   . DT  B 2 4   ? 2.248   -21.301 4.036   1.00 42.03  ? 4   DT  C OP2   1 
ATOM   2293 O  "O5'" . DT  B 2 4   ? 0.897   -21.674 2.010   1.00 40.92  ? 4   DT  C "O5'" 1 
ATOM   2294 C  "C5'" . DT  B 2 4   ? 0.120   -21.252 0.899   1.00 33.79  ? 4   DT  C "C5'" 1 
ATOM   2295 C  "C4'" . DT  B 2 4   ? -0.113  -22.410 -0.037  1.00 37.57  ? 4   DT  C "C4'" 1 
ATOM   2296 O  "O4'" . DT  B 2 4   ? 1.128   -22.745 -0.697  1.00 39.60  ? 4   DT  C "O4'" 1 
ATOM   2297 C  "C3'" . DT  B 2 4   ? -0.564  -23.693 0.660   1.00 38.45  ? 4   DT  C "C3'" 1 
ATOM   2298 O  "O3'" . DT  B 2 4   ? -1.974  -23.823 0.563   1.00 38.32  ? 4   DT  C "O3'" 1 
ATOM   2299 C  "C2'" . DT  B 2 4   ? 0.147   -24.806 -0.105  1.00 38.98  ? 4   DT  C "C2'" 1 
ATOM   2300 C  "C1'" . DT  B 2 4   ? 0.979   -24.068 -1.152  1.00 38.50  ? 4   DT  C "C1'" 1 
ATOM   2301 N  N1    . DT  B 2 4   ? 2.291   -24.716 -1.313  1.00 34.63  ? 4   DT  C N1    1 
ATOM   2302 C  C2    . DT  B 2 4   ? 2.585   -25.263 -2.540  1.00 33.51  ? 4   DT  C C2    1 
ATOM   2303 O  O2    . DT  B 2 4   ? 1.827   -25.206 -3.494  1.00 33.89  ? 4   DT  C O2    1 
ATOM   2304 N  N3    . DT  B 2 4   ? 3.810   -25.872 -2.602  1.00 30.64  ? 4   DT  C N3    1 
ATOM   2305 C  C4    . DT  B 2 4   ? 4.746   -25.975 -1.592  1.00 30.47  ? 4   DT  C C4    1 
ATOM   2306 O  O4    . DT  B 2 4   ? 5.827   -26.537 -1.753  1.00 32.02  ? 4   DT  C O4    1 
ATOM   2307 C  C5    . DT  B 2 4   ? 4.363   -25.385 -0.333  1.00 31.90  ? 4   DT  C C5    1 
ATOM   2308 C  C7    . DT  B 2 4   ? 5.307   -25.449 0.832   1.00 31.68  ? 4   DT  C C7    1 
ATOM   2309 C  C6    . DT  B 2 4   ? 3.163   -24.795 -0.250  1.00 32.08  ? 4   DT  C C6    1 
ATOM   2310 P  P     . DA  B 2 5   ? -2.701  -25.175 1.046   1.00 29.88  ? 5   DA  C P     1 
ATOM   2311 O  OP1   . DA  B 2 5   ? -4.144  -24.881 1.199   1.00 30.97  ? 5   DA  C OP1   1 
ATOM   2312 O  OP2   . DA  B 2 5   ? -1.902  -25.758 2.145   1.00 34.52  ? 5   DA  C OP2   1 
ATOM   2313 O  "O5'" . DA  B 2 5   ? -2.552  -26.157 -0.213  1.00 28.07  ? 5   DA  C "O5'" 1 
ATOM   2314 C  "C5'" . DA  B 2 5   ? -3.147  -25.806 -1.454  1.00 28.96  ? 5   DA  C "C5'" 1 
ATOM   2315 C  "C4'" . DA  B 2 5   ? -2.764  -26.805 -2.524  1.00 32.60  ? 5   DA  C "C4'" 1 
ATOM   2316 O  "O4'" . DA  B 2 5   ? -1.333  -26.752 -2.730  1.00 36.48  ? 5   DA  C "O4'" 1 
ATOM   2317 C  "C3'" . DA  B 2 5   ? -3.059  -28.252 -2.168  1.00 33.53  ? 5   DA  C "C3'" 1 
ATOM   2318 O  "O3'" . DA  B 2 5   ? -4.257  -28.628 -2.775  1.00 29.29  ? 5   DA  C "O3'" 1 
ATOM   2319 C  "C2'" . DA  B 2 5   ? -1.945  -29.048 -2.835  1.00 37.87  ? 5   DA  C "C2'" 1 
ATOM   2320 C  "C1'" . DA  B 2 5   ? -0.873  -28.016 -3.156  1.00 37.62  ? 5   DA  C "C1'" 1 
ATOM   2321 N  N9    . DA  B 2 5   ? 0.393   -28.319 -2.498  1.00 30.58  ? 5   DA  C N9    1 
ATOM   2322 C  C8    . DA  B 2 5   ? 0.783   -27.989 -1.231  1.00 30.92  ? 5   DA  C C8    1 
ATOM   2323 N  N7    . DA  B 2 5   ? 1.990   -28.406 -0.929  1.00 32.70  ? 5   DA  C N7    1 
ATOM   2324 C  C5    . DA  B 2 5   ? 2.414   -29.058 -2.079  1.00 30.74  ? 5   DA  C C5    1 
ATOM   2325 C  C6    . DA  B 2 5   ? 3.610   -29.728 -2.417  1.00 30.43  ? 5   DA  C C6    1 
ATOM   2326 N  N6    . DA  B 2 5   ? 4.650   -29.854 -1.583  1.00 27.16  ? 5   DA  C N6    1 
ATOM   2327 N  N1    . DA  B 2 5   ? 3.692   -30.263 -3.655  1.00 29.53  ? 5   DA  C N1    1 
ATOM   2328 C  C2    . DA  B 2 5   ? 2.660   -30.137 -4.494  1.00 26.79  ? 5   DA  C C2    1 
ATOM   2329 N  N3    . DA  B 2 5   ? 1.489   -29.533 -4.290  1.00 29.13  ? 5   DA  C N3    1 
ATOM   2330 C  C4    . DA  B 2 5   ? 1.435   -29.014 -3.052  1.00 29.96  ? 5   DA  C C4    1 
ATOM   2331 P  P     . DC  B 2 6   ? -5.004  -29.967 -2.318  1.00 28.21  ? 6   DC  C P     1 
ATOM   2332 O  OP1   . DC  B 2 6   ? -6.348  -29.959 -2.932  1.00 27.84  ? 6   DC  C OP1   1 
ATOM   2333 O  OP2   . DC  B 2 6   ? -4.853  -30.096 -0.855  1.00 33.73  ? 6   DC  C OP2   1 
ATOM   2334 O  "O5'" . DC  B 2 6   ? -4.113  -31.136 -2.966  1.00 32.31  ? 6   DC  C "O5'" 1 
ATOM   2335 C  "C5'" . DC  B 2 6   ? -4.272  -31.487 -4.344  1.00 34.09  ? 6   DC  C "C5'" 1 
ATOM   2336 C  "C4'" . DC  B 2 6   ? -3.393  -32.670 -4.693  1.00 38.19  ? 6   DC  C "C4'" 1 
ATOM   2337 O  "O4'" . DC  B 2 6   ? -2.015  -32.233 -4.672  1.00 35.63  ? 6   DC  C "O4'" 1 
ATOM   2338 C  "C3'" . DC  B 2 6   ? -3.377  -33.803 -3.670  1.00 42.84  ? 6   DC  C "C3'" 1 
ATOM   2339 O  "O3'" . DC  B 2 6   ? -4.613  -34.506 -3.619  1.00 50.82  ? 6   DC  C "O3'" 1 
ATOM   2340 C  "C2'" . DC  B 2 6   ? -2.148  -34.566 -4.115  1.00 45.05  ? 6   DC  C "C2'" 1 
ATOM   2341 C  "C1'" . DC  B 2 6   ? -1.225  -33.360 -4.328  1.00 42.16  ? 6   DC  C "C1'" 1 
ATOM   2342 N  N1    . DC  B 2 6   ? -0.318  -33.009 -3.195  1.00 33.75  ? 6   DC  C N1    1 
ATOM   2343 C  C2    . DC  B 2 6   ? 0.960   -33.552 -3.268  1.00 27.22  ? 6   DC  C C2    1 
ATOM   2344 O  O2    . DC  B 2 6   ? 1.224   -34.286 -4.230  1.00 26.17  ? 6   DC  C O2    1 
ATOM   2345 N  N3    . DC  B 2 6   ? 1.856   -33.273 -2.299  1.00 24.61  ? 6   DC  C N3    1 
ATOM   2346 C  C4    . DC  B 2 6   ? 1.529   -32.489 -1.279  1.00 25.79  ? 6   DC  C C4    1 
ATOM   2347 N  N4    . DC  B 2 6   ? 2.490   -32.283 -0.364  1.00 23.23  ? 6   DC  C N4    1 
ATOM   2348 C  C5    . DC  B 2 6   ? 0.221   -31.913 -1.171  1.00 24.23  ? 6   DC  C C5    1 
ATOM   2349 C  C6    . DC  B 2 6   ? -0.664  -32.195 -2.152  1.00 30.02  ? 6   DC  C C6    1 
ATOM   2350 P  P     . DT  B 2 7   ? -4.909  -35.764 -4.578  1.00 65.84  ? 7   DT  C P     1 
ATOM   2351 O  OP1   . DT  B 2 7   ? -4.559  -35.387 -5.963  1.00 48.17  ? 7   DT  C OP1   1 
ATOM   2352 O  OP2   . DT  B 2 7   ? -6.280  -36.242 -4.277  1.00 70.67  ? 7   DT  C OP2   1 
ATOM   2353 O  "O5'" . DT  B 2 7   ? -3.903  -36.898 -4.044  1.00 60.84  ? 7   DT  C "O5'" 1 
ATOM   2354 C  "C5'" . DT  B 2 7   ? -3.848  -38.137 -4.738  1.00 44.57  ? 7   DT  C "C5'" 1 
ATOM   2355 C  "C4'" . DT  B 2 7   ? -2.588  -38.889 -4.372  1.00 35.51  ? 7   DT  C "C4'" 1 
ATOM   2356 O  "O4'" . DT  B 2 7   ? -1.482  -37.970 -4.201  1.00 28.70  ? 7   DT  C "O4'" 1 
ATOM   2357 C  "C3'" . DT  B 2 7   ? -2.640  -39.617 -3.040  1.00 31.33  ? 7   DT  C "C3'" 1 
ATOM   2358 O  "O3'" . DT  B 2 7   ? -3.356  -40.824 -3.218  1.00 30.38  ? 7   DT  C "O3'" 1 
ATOM   2359 C  "C2'" . DT  B 2 7   ? -1.162  -39.864 -2.788  1.00 28.22  ? 7   DT  C "C2'" 1 
ATOM   2360 C  "C1'" . DT  B 2 7   ? -0.494  -38.665 -3.463  1.00 26.52  ? 7   DT  C "C1'" 1 
ATOM   2361 N  N1    . DT  B 2 7   ? 0.084   -37.743 -2.473  1.00 25.99  ? 7   DT  C N1    1 
ATOM   2362 C  C2    . DT  B 2 7   ? 1.443   -37.727 -2.352  1.00 27.01  ? 7   DT  C C2    1 
ATOM   2363 O  O2    . DT  B 2 7   ? 2.159   -38.428 -3.035  1.00 29.69  ? 7   DT  C O2    1 
ATOM   2364 N  N3    . DT  B 2 7   ? 1.914   -36.852 -1.411  1.00 27.35  ? 7   DT  C N3    1 
ATOM   2365 C  C4    . DT  B 2 7   ? 1.166   -36.016 -0.600  1.00 25.72  ? 7   DT  C C4    1 
ATOM   2366 O  O4    . DT  B 2 7   ? 1.694   -35.277 0.223   1.00 30.12  ? 7   DT  C O4    1 
ATOM   2367 C  C5    . DT  B 2 7   ? -0.263  -36.091 -0.772  1.00 23.51  ? 7   DT  C C5    1 
ATOM   2368 C  C7    . DT  B 2 7   ? -1.183  -35.241 0.067   1.00 19.67  ? 7   DT  C C7    1 
ATOM   2369 C  C6    . DT  B 2 7   ? -0.730  -36.946 -1.690  1.00 22.39  ? 7   DT  C C6    1 
ATOM   2370 O  OP3   . DG  C 3 1   ? 9.296   -33.013 21.046  1.00 130.71 ? 1   DG  D OP3   1 
ATOM   2371 P  P     . DG  C 3 1   ? 9.546   -32.714 19.620  1.00 131.04 ? 1   DG  D P     1 
ATOM   2372 O  OP1   . DG  C 3 1   ? 8.359   -31.983 19.123  1.00 131.19 ? 1   DG  D OP1   1 
ATOM   2373 O  OP2   . DG  C 3 1   ? 10.745  -31.930 19.247  1.00 130.56 ? 1   DG  D OP2   1 
ATOM   2374 O  "O5'" . DG  C 3 1   ? 9.638   -34.102 18.828  1.00 130.70 ? 1   DG  D "O5'" 1 
ATOM   2375 C  "C5'" . DG  C 3 1   ? 8.448   -34.775 18.416  1.00 129.04 ? 1   DG  D "C5'" 1 
ATOM   2376 C  "C4'" . DG  C 3 1   ? 8.735   -35.840 17.367  1.00 127.86 ? 1   DG  D "C4'" 1 
ATOM   2377 O  "O4'" . DG  C 3 1   ? 9.312   -35.226 16.183  1.00 126.52 ? 1   DG  D "O4'" 1 
ATOM   2378 C  "C3'" . DG  C 3 1   ? 9.702   -36.943 17.792  1.00 127.17 ? 1   DG  D "C3'" 1 
ATOM   2379 O  "O3'" . DG  C 3 1   ? 9.182   -38.213 17.385  1.00 127.23 ? 1   DG  D "O3'" 1 
ATOM   2380 C  "C2'" . DG  C 3 1   ? 10.997  -36.572 17.065  1.00 125.77 ? 1   DG  D "C2'" 1 
ATOM   2381 C  "C1'" . DG  C 3 1   ? 10.456  -35.950 15.783  1.00 123.61 ? 1   DG  D "C1'" 1 
ATOM   2382 N  N9    . DG  C 3 1   ? 11.362  -35.026 15.101  1.00 118.33 ? 1   DG  D N9    1 
ATOM   2383 C  C8    . DG  C 3 1   ? 11.753  -33.775 15.519  1.00 116.65 ? 1   DG  D C8    1 
ATOM   2384 N  N7    . DG  C 3 1   ? 12.567  -33.177 14.690  1.00 114.82 ? 1   DG  D N7    1 
ATOM   2385 C  C5    . DG  C 3 1   ? 12.726  -34.089 13.652  1.00 113.89 ? 1   DG  D C5    1 
ATOM   2386 C  C6    . DG  C 3 1   ? 13.494  -34.001 12.465  1.00 112.51 ? 1   DG  D C6    1 
ATOM   2387 O  O6    . DG  C 3 1   ? 14.210  -33.065 12.084  1.00 112.13 ? 1   DG  D O6    1 
ATOM   2388 N  N1    . DG  C 3 1   ? 13.373  -35.151 11.682  1.00 111.84 ? 1   DG  D N1    1 
ATOM   2389 C  C2    . DG  C 3 1   ? 12.605  -36.248 12.007  1.00 111.62 ? 1   DG  D C2    1 
ATOM   2390 N  N2    . DG  C 3 1   ? 12.607  -37.266 11.134  1.00 111.35 ? 1   DG  D N2    1 
ATOM   2391 N  N3    . DG  C 3 1   ? 11.882  -36.341 13.117  1.00 112.38 ? 1   DG  D N3    1 
ATOM   2392 C  C4    . DG  C 3 1   ? 11.989  -35.230 13.890  1.00 114.75 ? 1   DG  D C4    1 
ATOM   2393 P  P     . DC  C 3 2   ? 9.610   -39.554 18.165  1.00 155.94 ? 2   DC  D P     1 
ATOM   2394 O  OP1   . DC  C 3 2   ? 8.373   -40.267 18.559  1.00 156.10 ? 2   DC  D OP1   1 
ATOM   2395 O  OP2   . DC  C 3 2   ? 10.602  -39.184 19.199  1.00 155.67 ? 2   DC  D OP2   1 
ATOM   2396 O  "O5'" . DC  C 3 2   ? 10.339  -40.427 17.036  1.00 115.10 ? 2   DC  D "O5'" 1 
ATOM   2397 C  "C5'" . DC  C 3 2   ? 11.072  -39.761 16.009  1.00 114.67 ? 2   DC  D "C5'" 1 
ATOM   2398 C  "C4'" . DC  C 3 2   ? 12.239  -40.583 15.494  1.00 113.74 ? 2   DC  D "C4'" 1 
ATOM   2399 O  "O4'" . DC  C 3 2   ? 13.038  -39.742 14.621  1.00 112.91 ? 2   DC  D "O4'" 1 
ATOM   2400 C  "C3'" . DC  C 3 2   ? 13.192  -41.095 16.569  1.00 113.25 ? 2   DC  D "C3'" 1 
ATOM   2401 O  "O3'" . DC  C 3 2   ? 13.732  -42.364 16.201  1.00 113.25 ? 2   DC  D "O3'" 1 
ATOM   2402 C  "C2'" . DC  C 3 2   ? 14.268  -40.015 16.598  1.00 112.40 ? 2   DC  D "C2'" 1 
ATOM   2403 C  "C1'" . DC  C 3 2   ? 14.357  -39.649 15.122  1.00 111.41 ? 2   DC  D "C1'" 1 
ATOM   2404 N  N1    . DC  C 3 2   ? 14.882  -38.272 14.892  1.00 108.58 ? 2   DC  D N1    1 
ATOM   2405 C  C2    . DC  C 3 2   ? 15.534  -37.967 13.691  1.00 107.46 ? 2   DC  D C2    1 
ATOM   2406 O  O2    . DC  C 3 2   ? 15.658  -38.846 12.828  1.00 106.96 ? 2   DC  D O2    1 
ATOM   2407 N  N3    . DC  C 3 2   ? 16.010  -36.711 13.503  1.00 106.77 ? 2   DC  D N3    1 
ATOM   2408 C  C4    . DC  C 3 2   ? 15.857  -35.790 14.455  1.00 106.15 ? 2   DC  D C4    1 
ATOM   2409 N  N4    . DC  C 3 2   ? 16.343  -34.566 14.223  1.00 105.93 ? 2   DC  D N4    1 
ATOM   2410 C  C5    . DC  C 3 2   ? 15.198  -36.083 15.687  1.00 106.29 ? 2   DC  D C5    1 
ATOM   2411 C  C6    . DC  C 3 2   ? 14.733  -37.324 15.862  1.00 106.99 ? 2   DC  D C6    1 
ATOM   2412 O  "O5'" . DG  D 4 2   ? 24.246  -31.337 10.620  1.00 138.23 ? 2   DG  B "O5'" 1 
ATOM   2413 C  "C5'" . DG  D 4 2   ? 25.061  -32.126 9.758   1.00 137.27 ? 2   DG  B "C5'" 1 
ATOM   2414 C  "C4'" . DG  D 4 2   ? 24.207  -32.950 8.809   1.00 136.84 ? 2   DG  B "C4'" 1 
ATOM   2415 O  "O4'" . DG  D 4 2   ? 23.361  -33.849 9.572   1.00 135.21 ? 2   DG  B "O4'" 1 
ATOM   2416 C  "C3'" . DG  D 4 2   ? 23.276  -32.143 7.907   1.00 138.24 ? 2   DG  B "C3'" 1 
ATOM   2417 O  "O3'" . DG  D 4 2   ? 23.263  -32.705 6.597   1.00 141.10 ? 2   DG  B "O3'" 1 
ATOM   2418 C  "C2'" . DG  D 4 2   ? 21.917  -32.257 8.593   1.00 134.12 ? 2   DG  B "C2'" 1 
ATOM   2419 C  "C1'" . DG  D 4 2   ? 21.998  -33.619 9.272   1.00 130.82 ? 2   DG  B "C1'" 1 
ATOM   2420 N  N9    . DG  D 4 2   ? 21.237  -33.673 10.516  1.00 124.02 ? 2   DG  B N9    1 
ATOM   2421 C  C8    . DG  D 4 2   ? 20.730  -32.604 11.215  1.00 121.31 ? 2   DG  B C8    1 
ATOM   2422 N  N7    . DG  D 4 2   ? 20.090  -32.949 12.298  1.00 119.06 ? 2   DG  B N7    1 
ATOM   2423 C  C5    . DG  D 4 2   ? 20.178  -34.336 12.319  1.00 117.95 ? 2   DG  B C5    1 
ATOM   2424 C  C6    . DG  D 4 2   ? 19.669  -35.270 13.256  1.00 115.35 ? 2   DG  B C6    1 
ATOM   2425 O  O6    . DG  D 4 2   ? 19.018  -35.051 14.288  1.00 114.52 ? 2   DG  B O6    1 
ATOM   2426 N  N1    . DG  D 4 2   ? 19.982  -36.580 12.902  1.00 114.66 ? 2   DG  B N1    1 
ATOM   2427 C  C2    . DG  D 4 2   ? 20.696  -36.941 11.785  1.00 115.00 ? 2   DG  B C2    1 
ATOM   2428 N  N2    . DG  D 4 2   ? 20.896  -38.257 11.616  1.00 113.44 ? 2   DG  B N2    1 
ATOM   2429 N  N3    . DG  D 4 2   ? 21.178  -36.078 10.897  1.00 117.48 ? 2   DG  B N3    1 
ATOM   2430 C  C4    . DG  D 4 2   ? 20.882  -34.798 11.228  1.00 119.91 ? 2   DG  B C4    1 
ATOM   2431 P  P     . DG  D 4 3   ? 22.364  -32.044 5.439   1.00 203.20 ? 3   DG  B P     1 
ATOM   2432 O  OP1   . DG  D 4 3   ? 23.195  -31.941 4.219   1.00 203.31 ? 3   DG  B OP1   1 
ATOM   2433 O  OP2   . DG  D 4 3   ? 21.723  -30.831 5.994   1.00 202.90 ? 3   DG  B OP2   1 
ATOM   2434 O  "O5'" . DG  D 4 3   ? 21.221  -33.134 5.186   1.00 118.17 ? 3   DG  B "O5'" 1 
ATOM   2435 C  "C5'" . DG  D 4 3   ? 21.579  -34.456 4.792   1.00 114.51 ? 3   DG  B "C5'" 1 
ATOM   2436 C  "C4'" . DG  D 4 3   ? 20.367  -35.373 4.793   1.00 110.32 ? 3   DG  B "C4'" 1 
ATOM   2437 O  "O4'" . DG  D 4 3   ? 19.883  -35.535 6.151   1.00 106.11 ? 3   DG  B "O4'" 1 
ATOM   2438 C  "C3'" . DG  D 4 3   ? 19.184  -34.879 3.964   1.00 110.43 ? 3   DG  B "C3'" 1 
ATOM   2439 O  "O3'" . DG  D 4 3   ? 18.603  -35.968 3.249   1.00 111.85 ? 3   DG  B "O3'" 1 
ATOM   2440 C  "C2'" . DG  D 4 3   ? 18.232  -34.303 5.010   1.00 106.06 ? 3   DG  B "C2'" 1 
ATOM   2441 C  "C1'" . DG  D 4 3   ? 18.517  -35.177 6.227   1.00 101.18 ? 3   DG  B "C1'" 1 
ATOM   2442 N  N9    . DG  D 4 3   ? 18.280  -34.490 7.496   1.00 91.47  ? 3   DG  B N9    1 
ATOM   2443 C  C8    . DG  D 4 3   ? 18.441  -33.149 7.746   1.00 88.39  ? 3   DG  B C8    1 
ATOM   2444 N  N7    . DG  D 4 3   ? 18.153  -32.813 8.973   1.00 85.61  ? 3   DG  B N7    1 
ATOM   2445 C  C5    . DG  D 4 3   ? 17.777  -34.007 9.581   1.00 84.36  ? 3   DG  B C5    1 
ATOM   2446 C  C6    . DG  D 4 3   ? 17.355  -34.267 10.912  1.00 81.96  ? 3   DG  B C6    1 
ATOM   2447 O  O6    . DG  D 4 3   ? 17.230  -33.467 11.853  1.00 80.94  ? 3   DG  B O6    1 
ATOM   2448 N  N1    . DG  D 4 3   ? 17.066  -35.616 11.109  1.00 80.74  ? 3   DG  B N1    1 
ATOM   2449 C  C2    . DG  D 4 3   ? 17.170  -36.591 10.145  1.00 80.31  ? 3   DG  B C2    1 
ATOM   2450 N  N2    . DG  D 4 3   ? 16.847  -37.839 10.523  1.00 77.84  ? 3   DG  B N2    1 
ATOM   2451 N  N3    . DG  D 4 3   ? 17.564  -36.361 8.896   1.00 82.22  ? 3   DG  B N3    1 
ATOM   2452 C  C4    . DG  D 4 3   ? 17.850  -35.050 8.683   1.00 85.64  ? 3   DG  B C4    1 
ATOM   2453 P  P     . DC  D 4 4   ? 17.655  -35.691 1.980   1.00 130.21 ? 4   DC  B P     1 
ATOM   2454 O  OP1   . DC  D 4 4   ? 18.230  -36.402 0.816   1.00 130.19 ? 4   DC  B OP1   1 
ATOM   2455 O  OP2   . DC  D 4 4   ? 17.408  -34.234 1.903   1.00 129.18 ? 4   DC  B OP2   1 
ATOM   2456 O  "O5'" . DC  D 4 4   ? 16.283  -36.408 2.379   1.00 75.62  ? 4   DC  B "O5'" 1 
ATOM   2457 C  "C5'" . DC  D 4 4   ? 16.307  -37.783 2.748   1.00 70.97  ? 4   DC  B "C5'" 1 
ATOM   2458 C  "C4'" . DC  D 4 4   ? 15.321  -38.064 3.868   1.00 68.35  ? 4   DC  B "C4'" 1 
ATOM   2459 O  "O4'" . DC  D 4 4   ? 15.688  -37.295 5.052   1.00 69.17  ? 4   DC  B "O4'" 1 
ATOM   2460 C  "C3'" . DC  D 4 4   ? 13.870  -37.693 3.556   1.00 65.83  ? 4   DC  B "C3'" 1 
ATOM   2461 O  "O3'" . DC  D 4 4   ? 12.987  -38.670 4.087   1.00 65.46  ? 4   DC  B "O3'" 1 
ATOM   2462 C  "C2'" . DC  D 4 4   ? 13.724  -36.381 4.312   1.00 65.15  ? 4   DC  B "C2'" 1 
ATOM   2463 C  "C1'" . DC  D 4 4   ? 14.477  -36.790 5.571   1.00 66.78  ? 4   DC  B "C1'" 1 
ATOM   2464 N  N1    . DC  D 4 4   ? 14.655  -35.683 6.565   1.00 64.76  ? 4   DC  B N1    1 
ATOM   2465 C  C2    . DC  D 4 4   ? 14.383  -35.957 7.911   1.00 63.77  ? 4   DC  B C2    1 
ATOM   2466 O  O2    . DC  D 4 4   ? 14.035  -37.105 8.224   1.00 63.77  ? 4   DC  B O2    1 
ATOM   2467 N  N3    . DC  D 4 4   ? 14.516  -34.965 8.829   1.00 63.87  ? 4   DC  B N3    1 
ATOM   2468 C  C4    . DC  D 4 4   ? 14.890  -33.742 8.437   1.00 65.26  ? 4   DC  B C4    1 
ATOM   2469 N  N4    . DC  D 4 4   ? 15.008  -32.797 9.381   1.00 64.04  ? 4   DC  B N4    1 
ATOM   2470 C  C5    . DC  D 4 4   ? 15.160  -33.442 7.063   1.00 65.31  ? 4   DC  B C5    1 
ATOM   2471 C  C6    . DC  D 4 4   ? 15.027  -34.431 6.168   1.00 65.18  ? 4   DC  B C6    1 
ATOM   2472 P  P     . DA  D 4 5   ? 11.409  -38.600 3.769   1.00 56.22  ? 5   DA  B P     1 
ATOM   2473 O  OP1   . DA  D 4 5   ? 10.967  -37.193 3.905   1.00 56.33  ? 5   DA  B OP1   1 
ATOM   2474 O  OP2   . DA  D 4 5   ? 10.734  -39.648 4.565   1.00 55.21  ? 5   DA  B OP2   1 
ATOM   2475 O  "O5'" . DA  D 4 5   ? 11.327  -38.980 2.219   1.00 42.81  ? 5   DA  B "O5'" 1 
ATOM   2476 C  "C5'" . DA  D 4 5   ? 11.368  -40.323 1.815   1.00 33.24  ? 5   DA  B "C5'" 1 
ATOM   2477 C  "C4'" . DA  D 4 5   ? 11.058  -40.341 0.342   1.00 30.03  ? 5   DA  B "C4'" 1 
ATOM   2478 O  "O4'" . DA  D 4 5   ? 9.669   -39.992 0.145   1.00 23.75  ? 5   DA  B "O4'" 1 
ATOM   2479 C  "C3'" . DA  D 4 5   ? 11.875  -39.342 -0.467  1.00 29.54  ? 5   DA  B "C3'" 1 
ATOM   2480 O  "O3'" . DA  D 4 5   ? 12.218  -39.985 -1.689  1.00 28.59  ? 5   DA  B "O3'" 1 
ATOM   2481 C  "C2'" . DA  D 4 5   ? 10.921  -38.157 -0.625  1.00 29.37  ? 5   DA  B "C2'" 1 
ATOM   2482 C  "C1'" . DA  D 4 5   ? 9.555   -38.837 -0.664  1.00 27.49  ? 5   DA  B "C1'" 1 
ATOM   2483 N  N9    . DA  D 4 5   ? 8.475   -38.063 -0.067  1.00 28.51  ? 5   DA  B N9    1 
ATOM   2484 C  C8    . DA  D 4 5   ? 8.522   -37.412 1.138   1.00 27.62  ? 5   DA  B C8    1 
ATOM   2485 N  N7    . DA  D 4 5   ? 7.402   -36.805 1.451   1.00 26.62  ? 5   DA  B N7    1 
ATOM   2486 C  C5    . DA  D 4 5   ? 6.563   -37.093 0.391   1.00 25.71  ? 5   DA  B C5    1 
ATOM   2487 C  C6    . DA  D 4 5   ? 5.229   -36.739 0.131   1.00 28.98  ? 5   DA  B C6    1 
ATOM   2488 N  N6    . DA  D 4 5   ? 4.510   -35.990 0.971   1.00 30.44  ? 5   DA  B N6    1 
ATOM   2489 N  N1    . DA  D 4 5   ? 4.673   -37.179 -1.024  1.00 30.13  ? 5   DA  B N1    1 
ATOM   2490 C  C2    . DA  D 4 5   ? 5.421   -37.929 -1.852  1.00 30.46  ? 5   DA  B C2    1 
ATOM   2491 N  N3    . DA  D 4 5   ? 6.689   -38.328 -1.711  1.00 28.79  ? 5   DA  B N3    1 
ATOM   2492 C  C4    . DA  D 4 5   ? 7.205   -37.873 -0.555  1.00 26.14  ? 5   DA  B C4    1 
ATOM   2493 P  P     . DG  D 4 6   ? 13.204  -39.275 -2.737  1.00 29.67  ? 6   DG  B P     1 
ATOM   2494 O  OP1   . DG  D 4 6   ? 13.782  -40.328 -3.595  1.00 31.61  ? 6   DG  B OP1   1 
ATOM   2495 O  OP2   . DG  D 4 6   ? 14.062  -38.330 -1.990  1.00 34.40  ? 6   DG  B OP2   1 
ATOM   2496 O  "O5'" . DG  D 4 6   ? 12.220  -38.398 -3.646  1.00 27.45  ? 6   DG  B "O5'" 1 
ATOM   2497 C  "C5'" . DG  D 4 6   ? 11.311  -39.040 -4.528  1.00 22.18  ? 6   DG  B "C5'" 1 
ATOM   2498 C  "C4'" . DG  D 4 6   ? 10.330  -38.017 -5.051  1.00 25.01  ? 6   DG  B "C4'" 1 
ATOM   2499 O  "O4'" . DG  D 4 6   ? 9.477   -37.526 -3.984  1.00 25.49  ? 6   DG  B "O4'" 1 
ATOM   2500 C  "C3'" . DG  D 4 6   ? 10.981  -36.774 -5.670  1.00 26.70  ? 6   DG  B "C3'" 1 
ATOM   2501 O  "O3'" . DG  D 4 6   ? 10.945  -36.961 -7.091  1.00 26.83  ? 6   DG  B "O3'" 1 
ATOM   2502 C  "C2'" . DG  D 4 6   ? 10.131  -35.610 -5.140  1.00 25.01  ? 6   DG  B "C2'" 1 
ATOM   2503 C  "C1'" . DG  D 4 6   ? 8.944   -36.328 -4.481  1.00 23.52  ? 6   DG  B "C1'" 1 
ATOM   2504 N  N9    . DG  D 4 6   ? 8.337   -35.563 -3.403  1.00 23.15  ? 6   DG  B N9    1 
ATOM   2505 C  C8    . DG  D 4 6   ? 8.958   -35.078 -2.284  1.00 23.51  ? 6   DG  B C8    1 
ATOM   2506 N  N7    . DG  D 4 6   ? 8.154   -34.428 -1.505  1.00 26.49  ? 6   DG  B N7    1 
ATOM   2507 C  C5    . DG  D 4 6   ? 6.923   -34.482 -2.147  1.00 24.32  ? 6   DG  B C5    1 
ATOM   2508 C  C6    . DG  D 4 6   ? 5.678   -33.934 -1.776  1.00 24.56  ? 6   DG  B C6    1 
ATOM   2509 O  O6    . DG  D 4 6   ? 5.425   -33.284 -0.759  1.00 29.38  ? 6   DG  B O6    1 
ATOM   2510 N  N1    . DG  D 4 6   ? 4.678   -34.207 -2.711  1.00 23.74  ? 6   DG  B N1    1 
ATOM   2511 C  C2    . DG  D 4 6   ? 4.878   -34.934 -3.863  1.00 24.59  ? 6   DG  B C2    1 
ATOM   2512 N  N2    . DG  D 4 6   ? 3.821   -35.116 -4.666  1.00 26.48  ? 6   DG  B N2    1 
ATOM   2513 N  N3    . DG  D 4 6   ? 6.044   -35.448 -4.219  1.00 19.43  ? 6   DG  B N3    1 
ATOM   2514 C  C4    . DG  D 4 6   ? 7.018   -35.175 -3.319  1.00 21.86  ? 6   DG  B C4    1 
ATOM   2515 P  P     . DT  D 4 7   ? 11.376  -35.782 -8.095  1.00 23.76  ? 7   DT  B P     1 
ATOM   2516 O  OP1   . DT  D 4 7   ? 11.764  -36.399 -9.383  1.00 27.11  ? 7   DT  B OP1   1 
ATOM   2517 O  OP2   . DT  D 4 7   ? 12.293  -34.864 -7.374  1.00 26.27  ? 7   DT  B OP2   1 
ATOM   2518 O  "O5'" . DT  D 4 7   ? 10.014  -35.002 -8.356  1.00 25.17  ? 7   DT  B "O5'" 1 
ATOM   2519 C  "C5'" . DT  D 4 7   ? 8.970   -35.674 -8.996  1.00 25.58  ? 7   DT  B "C5'" 1 
ATOM   2520 C  "C4'" . DT  D 4 7   ? 7.819   -34.712 -9.139  1.00 26.49  ? 7   DT  B "C4'" 1 
ATOM   2521 O  "O4'" . DT  D 4 7   ? 7.312   -34.376 -7.822  1.00 27.60  ? 7   DT  B "O4'" 1 
ATOM   2522 C  "C3'" . DT  D 4 7   ? 8.178   -33.391 -9.826  1.00 24.10  ? 7   DT  B "C3'" 1 
ATOM   2523 O  "O3'" . DT  D 4 7   ? 7.121   -33.144 -10.720 1.00 25.64  ? 7   DT  B "O3'" 1 
ATOM   2524 C  "C2'" . DT  D 4 7   ? 8.197   -32.389 -8.674  1.00 24.31  ? 7   DT  B "C2'" 1 
ATOM   2525 C  "C1'" . DT  D 4 7   ? 7.099   -32.984 -7.797  1.00 27.05  ? 7   DT  B "C1'" 1 
ATOM   2526 N  N1    . DT  D 4 7   ? 7.118   -32.479 -6.402  1.00 25.71  ? 7   DT  B N1    1 
ATOM   2527 C  C2    . DT  D 4 7   ? 5.917   -32.100 -5.849  1.00 30.13  ? 7   DT  B C2    1 
ATOM   2528 O  O2    . DT  D 4 7   ? 4.860   -32.179 -6.453  1.00 31.54  ? 7   DT  B O2    1 
ATOM   2529 N  N3    . DT  D 4 7   ? 6.004   -31.624 -4.568  1.00 26.31  ? 7   DT  B N3    1 
ATOM   2530 C  C4    . DT  D 4 7   ? 7.154   -31.496 -3.813  1.00 26.77  ? 7   DT  B C4    1 
ATOM   2531 O  O4    . DT  D 4 7   ? 7.130   -31.058 -2.669  1.00 30.94  ? 7   DT  B O4    1 
ATOM   2532 C  C5    . DT  D 4 7   ? 8.379   -31.914 -4.453  1.00 26.31  ? 7   DT  B C5    1 
ATOM   2533 C  C7    . DT  D 4 7   ? 9.688   -31.817 -3.718  1.00 27.99  ? 7   DT  B C7    1 
ATOM   2534 C  C6    . DT  D 4 7   ? 8.304   -32.375 -5.708  1.00 23.66  ? 7   DT  B C6    1 
ATOM   2535 P  P     . DA  D 4 8   ? 7.159   -31.881 -11.710 1.00 23.08  ? 8   DA  B P     1 
ATOM   2536 O  OP1   . DA  D 4 8   ? 7.075   -32.396 -13.098 1.00 24.76  ? 8   DA  B OP1   1 
ATOM   2537 O  OP2   . DA  D 4 8   ? 8.278   -31.007 -11.304 1.00 20.85  ? 8   DA  B OP2   1 
ATOM   2538 O  "O5'" . DA  D 4 8   ? 5.804   -31.095 -11.362 1.00 29.23  ? 8   DA  B "O5'" 1 
ATOM   2539 C  "C5'" . DA  D 4 8   ? 4.536   -31.683 -11.682 1.00 26.97  ? 8   DA  B "C5'" 1 
ATOM   2540 C  "C4'" . DA  D 4 8   ? 3.426   -30.648 -11.599 1.00 23.01  ? 8   DA  B "C4'" 1 
ATOM   2541 O  "O4'" . DA  D 4 8   ? 3.211   -30.295 -10.210 1.00 22.53  ? 8   DA  B "O4'" 1 
ATOM   2542 C  "C3'" . DA  D 4 8   ? 3.719   -29.335 -12.321 1.00 21.89  ? 8   DA  B "C3'" 1 
ATOM   2543 O  "O3'" . DA  D 4 8   ? 2.490   -28.856 -12.785 1.00 22.97  ? 8   DA  B "O3'" 1 
ATOM   2544 C  "C2'" . DA  D 4 8   ? 4.286   -28.450 -11.219 1.00 21.56  ? 8   DA  B "C2'" 1 
ATOM   2545 C  "C1'" . DA  D 4 8   ? 3.554   -28.951 -9.972  1.00 23.90  ? 8   DA  B "C1'" 1 
ATOM   2546 N  N9    . DA  D 4 8   ? 4.379   -28.881 -8.770  1.00 24.27  ? 8   DA  B N9    1 
ATOM   2547 C  C8    . DA  D 4 8   ? 5.628   -29.408 -8.591  1.00 26.16  ? 8   DA  B C8    1 
ATOM   2548 N  N7    . DA  D 4 8   ? 6.133   -29.175 -7.403  1.00 28.06  ? 8   DA  B N7    1 
ATOM   2549 C  C5    . DA  D 4 8   ? 5.145   -28.442 -6.756  1.00 27.66  ? 8   DA  B C5    1 
ATOM   2550 C  C6    . DA  D 4 8   ? 5.049   -27.882 -5.456  1.00 27.24  ? 8   DA  B C6    1 
ATOM   2551 N  N6    . DA  D 4 8   ? 6.007   -27.970 -4.528  1.00 24.32  ? 8   DA  B N6    1 
ATOM   2552 N  N1    . DA  D 4 8   ? 3.920   -27.215 -5.141  1.00 25.71  ? 8   DA  B N1    1 
ATOM   2553 C  C2    . DA  D 4 8   ? 2.954   -27.118 -6.061  1.00 26.97  ? 8   DA  B C2    1 
ATOM   2554 N  N3    . DA  D 4 8   ? 2.923   -27.599 -7.302  1.00 27.55  ? 8   DA  B N3    1 
ATOM   2555 C  C4    . DA  D 4 8   ? 4.060   -28.257 -7.589  1.00 24.93  ? 8   DA  B C4    1 
ATOM   2556 P  P     . DC  D 4 9   ? 2.425   -27.602 -13.791 1.00 24.99  ? 9   DC  B P     1 
ATOM   2557 O  OP1   . DC  D 4 9   ? 1.423   -27.922 -14.835 1.00 23.02  ? 9   DC  B OP1   1 
ATOM   2558 O  OP2   . DC  D 4 9   ? 3.813   -27.213 -14.136 1.00 25.04  ? 9   DC  B OP2   1 
ATOM   2559 O  "O5'" . DC  D 4 9   ? 1.873   -26.418 -12.870 1.00 25.82  ? 9   DC  B "O5'" 1 
ATOM   2560 C  "C5'" . DC  D 4 9   ? 0.607   -26.574 -12.234 1.00 24.12  ? 9   DC  B "C5'" 1 
ATOM   2561 C  "C4'" . DC  D 4 9   ? 0.215   -25.319 -11.471 1.00 22.33  ? 9   DC  B "C4'" 1 
ATOM   2562 O  "O4'" . DC  D 4 9   ? 0.940   -25.257 -10.216 1.00 22.50  ? 9   DC  B "O4'" 1 
ATOM   2563 C  "C3'" . DC  D 4 9   ? 0.476   -23.983 -12.165 1.00 22.89  ? 9   DC  B "C3'" 1 
ATOM   2564 O  "O3'" . DC  D 4 9   ? -0.631  -23.155 -11.819 1.00 29.15  ? 9   DC  B "O3'" 1 
ATOM   2565 C  "C2'" . DC  D 4 9   ? 1.799   -23.543 -11.542 1.00 17.69  ? 9   DC  B "C2'" 1 
ATOM   2566 C  "C1'" . DC  D 4 9   ? 1.624   -24.025 -10.101 1.00 22.55  ? 9   DC  B "C1'" 1 
ATOM   2567 N  N1    . DC  D 4 9   ? 2.863   -24.333 -9.330  1.00 24.57  ? 9   DC  B N1    1 
ATOM   2568 C  C2    . DC  D 4 9   ? 3.009   -23.880 -8.014  1.00 24.90  ? 9   DC  B C2    1 
ATOM   2569 O  O2    . DC  D 4 9   ? 2.116   -23.197 -7.514  1.00 24.22  ? 9   DC  B O2    1 
ATOM   2570 N  N3    . DC  D 4 9   ? 4.139   -24.190 -7.322  1.00 26.84  ? 9   DC  B N3    1 
ATOM   2571 C  C4    . DC  D 4 9   ? 5.087   -24.933 -7.896  1.00 24.91  ? 9   DC  B C4    1 
ATOM   2572 N  N4    . DC  D 4 9   ? 6.185   -25.213 -7.184  1.00 23.05  ? 9   DC  B N4    1 
ATOM   2573 C  C5    . DC  D 4 9   ? 4.954   -25.415 -9.235  1.00 21.63  ? 9   DC  B C5    1 
ATOM   2574 C  C6    . DC  D 4 9   ? 3.840   -25.099 -9.901  1.00 24.13  ? 9   DC  B C6    1 
ATOM   2575 P  P     . DT  D 4 10  ? -0.702  -21.624 -12.309 1.00 27.47  ? 10  DT  B P     1 
ATOM   2576 O  OP1   . DT  D 4 10  ? -2.119  -21.312 -12.597 1.00 27.02  ? 10  DT  B OP1   1 
ATOM   2577 O  OP2   . DT  D 4 10  ? 0.335   -21.424 -13.346 1.00 29.77  ? 10  DT  B OP2   1 
ATOM   2578 O  "O5'" . DT  D 4 10  ? -0.257  -20.797 -11.012 1.00 24.70  ? 10  DT  B "O5'" 1 
ATOM   2579 C  "C5'" . DT  D 4 10  ? -1.062  -20.873 -9.816  1.00 24.83  ? 10  DT  B "C5'" 1 
ATOM   2580 C  "C4'" . DT  D 4 10  ? -0.651  -19.804 -8.810  1.00 29.40  ? 10  DT  B "C4'" 1 
ATOM   2581 O  "O4'" . DT  D 4 10  ? 0.586   -20.137 -8.117  1.00 28.26  ? 10  DT  B "O4'" 1 
ATOM   2582 C  "C3'" . DT  D 4 10  ? -0.399  -18.439 -9.438  1.00 32.68  ? 10  DT  B "C3'" 1 
ATOM   2583 O  "O3'" . DT  D 4 10  ? -0.933  -17.462 -8.571  1.00 37.97  ? 10  DT  B "O3'" 1 
ATOM   2584 C  "C2'" . DT  D 4 10  ? 1.121   -18.367 -9.510  1.00 28.68  ? 10  DT  B "C2'" 1 
ATOM   2585 C  "C1'" . DT  D 4 10  ? 1.516   -19.070 -8.220  1.00 31.00  ? 10  DT  B "C1'" 1 
ATOM   2586 N  N1    . DT  D 4 10  ? 2.851   -19.740 -8.244  1.00 29.94  ? 10  DT  B N1    1 
ATOM   2587 C  C2    . DT  D 4 10  ? 3.663   -19.725 -7.132  1.00 33.13  ? 10  DT  B C2    1 
ATOM   2588 O  O2    . DT  D 4 10  ? 3.385   -19.168 -6.086  1.00 41.76  ? 10  DT  B O2    1 
ATOM   2589 N  N3    . DT  D 4 10  ? 4.840   -20.404 -7.285  1.00 27.50  ? 10  DT  B N3    1 
ATOM   2590 C  C4    . DT  D 4 10  ? 5.285   -21.082 -8.399  1.00 25.64  ? 10  DT  B C4    1 
ATOM   2591 O  O4    . DT  D 4 10  ? 6.364   -21.665 -8.414  1.00 31.16  ? 10  DT  B O4    1 
ATOM   2592 C  C5    . DT  D 4 10  ? 4.395   -21.059 -9.527  1.00 23.70  ? 10  DT  B C5    1 
ATOM   2593 C  C7    . DT  D 4 10  ? 4.764   -21.754 -10.808 1.00 20.52  ? 10  DT  B C7    1 
ATOM   2594 C  C6    . DT  D 4 10  ? 3.234   -20.401 -9.395  1.00 25.23  ? 10  DT  B C6    1 
ATOM   2595 P  P     . DG  D 4 11  ? -1.338  -16.014 -9.133  1.00 43.40  ? 11  DG  B P     1 
ATOM   2596 O  OP1   . DG  D 4 11  ? -2.615  -15.626 -8.501  1.00 53.20  ? 11  DG  B OP1   1 
ATOM   2597 O  OP2   . DG  D 4 11  ? -1.221  -16.039 -10.606 1.00 40.54  ? 11  DG  B OP2   1 
ATOM   2598 O  "O5'" . DG  D 4 11  ? -0.193  -15.068 -8.568  1.00 38.90  ? 11  DG  B "O5'" 1 
ATOM   2599 C  "C5'" . DG  D 4 11  ? -0.001  -14.975 -7.171  1.00 40.84  ? 11  DG  B "C5'" 1 
ATOM   2600 C  "C4'" . DG  D 4 11  ? 1.263   -14.192 -6.897  1.00 43.16  ? 11  DG  B "C4'" 1 
ATOM   2601 O  "O4'" . DG  D 4 11  ? 2.413   -15.058 -7.073  1.00 45.49  ? 11  DG  B "O4'" 1 
ATOM   2602 C  "C3'" . DG  D 4 11  ? 1.512   -13.010 -7.827  1.00 44.87  ? 11  DG  B "C3'" 1 
ATOM   2603 O  "O3'" . DG  D 4 11  ? 2.266   -12.030 -7.125  1.00 52.37  ? 11  DG  B "O3'" 1 
ATOM   2604 C  "C2'" . DG  D 4 11  ? 2.375   -13.633 -8.913  1.00 42.02  ? 11  DG  B "C2'" 1 
ATOM   2605 C  "C1'" . DG  D 4 11  ? 3.286   -14.450 -8.004  1.00 41.64  ? 11  DG  B "C1'" 1 
ATOM   2606 N  N9    . DG  D 4 11  ? 4.035   -15.526 -8.636  1.00 36.37  ? 11  DG  B N9    1 
ATOM   2607 C  C8    . DG  D 4 11  ? 3.875   -16.079 -9.885  1.00 35.49  ? 11  DG  B C8    1 
ATOM   2608 N  N7    . DG  D 4 11  ? 4.731   -17.040 -10.115 1.00 34.97  ? 11  DG  B N7    1 
ATOM   2609 C  C5    . DG  D 4 11  ? 5.488   -17.128 -8.953  1.00 33.51  ? 11  DG  B C5    1 
ATOM   2610 C  C6    . DG  D 4 11  ? 6.560   -17.980 -8.604  1.00 38.94  ? 11  DG  B C6    1 
ATOM   2611 O  O6    . DG  D 4 11  ? 7.084   -18.877 -9.282  1.00 38.46  ? 11  DG  B O6    1 
ATOM   2612 N  N1    . DG  D 4 11  ? 7.035   -17.707 -7.319  1.00 39.81  ? 11  DG  B N1    1 
ATOM   2613 C  C2    . DG  D 4 11  ? 6.528   -16.740 -6.481  1.00 37.16  ? 11  DG  B C2    1 
ATOM   2614 N  N2    . DG  D 4 11  ? 7.092   -16.609 -5.270  1.00 39.86  ? 11  DG  B N2    1 
ATOM   2615 N  N3    . DG  D 4 11  ? 5.530   -15.947 -6.802  1.00 32.01  ? 11  DG  B N3    1 
ATOM   2616 C  C4    . DG  D 4 11  ? 5.069   -16.200 -8.040  1.00 33.04  ? 11  DG  B C4    1 
HETATM 2617 NA NA    . NA  E 5 .   ? -5.141  -25.453 3.457   1.00 64.61  ? 401 NA  A NA    1 
HETATM 2618 O  O     . HOH F 6 .   ? 8.375   -51.063 -21.627 1.00 58.35  ? 501 HOH A O     1 
HETATM 2619 O  O     . HOH F 6 .   ? -19.187 -23.655 -1.353  1.00 53.80  ? 502 HOH A O     1 
HETATM 2620 O  O     . HOH F 6 .   ? -20.835 -21.754 10.559  1.00 27.49  ? 503 HOH A O     1 
HETATM 2621 O  O     . HOH F 6 .   ? 6.997   -58.619 -5.478  1.00 32.72  ? 504 HOH A O     1 
HETATM 2622 O  O     . HOH F 6 .   ? 9.457   -31.413 -32.670 1.00 52.92  ? 505 HOH A O     1 
HETATM 2623 O  O     . HOH F 6 .   ? 16.311  -54.125 -7.853  1.00 25.15  ? 506 HOH A O     1 
HETATM 2624 O  O     . HOH F 6 .   ? -20.043 -38.923 -27.592 1.00 56.97  ? 507 HOH A O     1 
HETATM 2625 O  O     . HOH F 6 .   ? -23.152 -27.377 -4.913  1.00 36.58  ? 508 HOH A O     1 
HETATM 2626 O  O     . HOH F 6 .   ? -11.164 -32.319 -31.179 1.00 37.31  ? 509 HOH A O     1 
HETATM 2627 O  O     . HOH F 6 .   ? 8.565   -32.088 -15.366 1.00 18.63  ? 510 HOH A O     1 
HETATM 2628 O  O     . HOH F 6 .   ? -20.286 -32.570 5.225   1.00 34.33  ? 511 HOH A O     1 
HETATM 2629 O  O     . HOH F 6 .   ? -19.965 -23.011 -23.966 1.00 44.50  ? 512 HOH A O     1 
HETATM 2630 O  O     . HOH F 6 .   ? 11.257  -59.283 -6.198  1.00 44.42  ? 513 HOH A O     1 
HETATM 2631 O  O     . HOH F 6 .   ? -16.650 -17.816 13.646  1.00 31.12  ? 514 HOH A O     1 
HETATM 2632 O  O     . HOH F 6 .   ? -15.153 -10.887 13.559  1.00 51.19  ? 515 HOH A O     1 
HETATM 2633 O  O     . HOH F 6 .   ? -19.941 -19.096 13.210  1.00 40.33  ? 516 HOH A O     1 
HETATM 2634 O  O     . HOH F 6 .   ? 17.681  -47.159 -19.165 1.00 31.06  ? 517 HOH A O     1 
HETATM 2635 O  O     . HOH F 6 .   ? 14.746  -38.303 -21.821 1.00 53.07  ? 518 HOH A O     1 
HETATM 2636 O  O     . HOH F 6 .   ? 21.697  -47.431 -13.626 1.00 50.88  ? 519 HOH A O     1 
HETATM 2637 O  O     . HOH F 6 .   ? -21.360 -10.876 7.425   1.00 45.63  ? 520 HOH A O     1 
HETATM 2638 O  O     . HOH F 6 .   ? 15.295  -49.510 -21.024 1.00 36.33  ? 521 HOH A O     1 
HETATM 2639 O  O     . HOH F 6 .   ? 20.790  -33.229 -22.494 1.00 41.97  ? 522 HOH A O     1 
HETATM 2640 O  O     . HOH F 6 .   ? 4.481   -59.506 -5.164  1.00 29.51  ? 523 HOH A O     1 
HETATM 2641 O  O     . HOH F 6 .   ? -3.003  -26.575 -19.427 1.00 28.59  ? 524 HOH A O     1 
HETATM 2642 O  O     . HOH F 6 .   ? -22.179 -31.719 -20.083 1.00 57.48  ? 525 HOH A O     1 
HETATM 2643 O  O     . HOH F 6 .   ? 22.443  -39.070 -22.219 1.00 53.77  ? 526 HOH A O     1 
HETATM 2644 O  O     . HOH F 6 .   ? -15.029 -26.030 -26.602 0.50 29.16  ? 527 HOH A O     1 
HETATM 2645 O  O     . HOH F 6 .   ? 16.752  -45.333 -21.075 1.00 41.73  ? 528 HOH A O     1 
HETATM 2646 O  O     . HOH F 6 .   ? 20.977  -49.321 -7.321  1.00 36.02  ? 529 HOH A O     1 
HETATM 2647 O  O     . HOH F 6 .   ? 23.683  -49.466 -10.287 1.00 46.51  ? 530 HOH A O     1 
HETATM 2648 O  O     . HOH F 6 .   ? 2.675   -57.775 -14.221 1.00 69.01  ? 531 HOH A O     1 
HETATM 2649 O  O     . HOH F 6 .   ? 10.131  -23.953 -14.534 1.00 52.20  ? 532 HOH A O     1 
HETATM 2650 O  O     . HOH F 6 .   ? 23.970  -44.835 -17.127 1.00 58.66  ? 533 HOH A O     1 
HETATM 2651 O  O     . HOH F 6 .   ? -10.608 -8.360  14.397  1.00 55.97  ? 534 HOH A O     1 
HETATM 2652 O  O     . HOH F 6 .   ? 9.097   -40.092 -32.213 1.00 47.07  ? 535 HOH A O     1 
HETATM 2653 O  O     . HOH F 6 .   ? -18.202 -14.291 11.233  1.00 54.78  ? 536 HOH A O     1 
HETATM 2654 O  O     . HOH F 6 .   ? 21.232  -34.650 -18.521 1.00 31.83  ? 537 HOH A O     1 
HETATM 2655 O  O     . HOH F 6 .   ? -11.490 -36.798 -31.458 1.00 61.69  ? 538 HOH A O     1 
HETATM 2656 O  O     . HOH F 6 .   ? -19.117 -21.831 0.938   1.00 46.57  ? 539 HOH A O     1 
HETATM 2657 O  O     . HOH F 6 .   ? 14.196  -24.994 -15.089 1.00 49.30  ? 540 HOH A O     1 
HETATM 2658 O  O     . HOH F 6 .   ? 21.427  -46.599 -20.596 1.00 49.87  ? 541 HOH A O     1 
HETATM 2659 O  O     . HOH F 6 .   ? 4.953   -58.626 -13.301 0.50 69.70  ? 542 HOH A O     1 
HETATM 2660 O  O     . HOH F 6 .   ? -25.126 -25.364 -10.220 1.00 51.45  ? 543 HOH A O     1 
HETATM 2661 O  O     . HOH F 6 .   ? 2.175   -25.853 -23.216 1.00 71.92  ? 544 HOH A O     1 
HETATM 2662 O  O     . HOH F 6 .   ? -19.619 -15.869 5.309   1.00 52.82  ? 545 HOH A O     1 
HETATM 2663 O  O     . HOH F 6 .   ? -24.272 -26.913 -20.149 1.00 47.47  ? 546 HOH A O     1 
HETATM 2664 O  O     . HOH F 6 .   ? -18.623 -19.061 1.271   1.00 55.27  ? 547 HOH A O     1 
HETATM 2665 O  O     . HOH F 6 .   ? -17.926 -21.069 -22.915 1.00 56.09  ? 548 HOH A O     1 
HETATM 2666 O  O     . HOH F 6 .   ? 7.485   -28.301 -31.890 1.00 57.84  ? 549 HOH A O     1 
HETATM 2667 O  O     . HOH F 6 .   ? -7.889  -30.769 -29.350 1.00 74.41  ? 550 HOH A O     1 
HETATM 2668 O  O     . HOH F 6 .   ? 1.041   -24.595 -20.682 1.00 55.40  ? 551 HOH A O     1 
HETATM 2669 O  O     . HOH F 6 .   ? -12.676 -25.621 -26.248 1.00 47.37  ? 552 HOH A O     1 
HETATM 2670 O  O     . HOH F 6 .   ? -21.994 -21.588 -7.622  1.00 61.97  ? 553 HOH A O     1 
HETATM 2671 O  O     . HOH F 6 .   ? 4.907   -26.089 -23.631 1.00 67.59  ? 554 HOH A O     1 
HETATM 2672 O  O     . HOH F 6 .   ? 15.816  -29.196 -19.209 1.00 55.98  ? 555 HOH A O     1 
HETATM 2673 O  O     . HOH F 6 .   ? -19.506 -27.946 5.790   1.00 37.69  ? 556 HOH A O     1 
HETATM 2674 O  O     . HOH F 6 .   ? 3.217   -39.937 -23.924 1.00 19.76  ? 557 HOH A O     1 
HETATM 2675 O  O     . HOH F 6 .   ? 4.844   -34.524 -21.027 1.00 19.07  ? 558 HOH A O     1 
HETATM 2676 O  O     . HOH F 6 .   ? 0.749   -39.313 -22.801 1.00 20.26  ? 559 HOH A O     1 
HETATM 2677 O  O     . HOH F 6 .   ? 10.300  -46.359 -15.198 1.00 21.99  ? 560 HOH A O     1 
HETATM 2678 O  O     . HOH F 6 .   ? 3.569   -35.484 -18.917 1.00 20.76  ? 561 HOH A O     1 
HETATM 2679 O  O     . HOH F 6 .   ? 4.988   -37.577 -17.624 1.00 19.78  ? 562 HOH A O     1 
HETATM 2680 O  O     . HOH F 6 .   ? -0.571  -46.608 -4.854  1.00 22.55  ? 563 HOH A O     1 
HETATM 2681 O  O     . HOH F 6 .   ? -1.639  -27.172 -21.776 1.00 20.17  ? 564 HOH A O     1 
HETATM 2682 O  O     . HOH F 6 .   ? -11.402 -24.353 0.744   1.00 21.74  ? 565 HOH A O     1 
HETATM 2683 O  O     . HOH F 6 .   ? 5.837   -37.226 -6.724  1.00 21.97  ? 566 HOH A O     1 
HETATM 2684 O  O     . HOH F 6 .   ? 8.961   -39.737 -21.119 1.00 24.53  ? 567 HOH A O     1 
HETATM 2685 O  O     . HOH F 6 .   ? -4.780  -42.292 -18.414 1.00 27.60  ? 568 HOH A O     1 
HETATM 2686 O  O     . HOH F 6 .   ? 5.568   -44.236 -8.607  1.00 26.14  ? 569 HOH A O     1 
HETATM 2687 O  O     . HOH F 6 .   ? -20.431 -33.164 -9.453  1.00 25.88  ? 570 HOH A O     1 
HETATM 2688 O  O     . HOH F 6 .   ? -12.971 -39.621 -6.991  1.00 25.75  ? 571 HOH A O     1 
HETATM 2689 O  O     . HOH F 6 .   ? 8.271   -39.643 -18.549 1.00 25.89  ? 572 HOH A O     1 
HETATM 2690 O  O     . HOH F 6 .   ? 3.010   -34.888 -12.127 1.00 26.78  ? 573 HOH A O     1 
HETATM 2691 O  O     . HOH F 6 .   ? -3.523  -40.006 1.078   1.00 27.03  ? 574 HOH A O     1 
HETATM 2692 O  O     . HOH F 6 .   ? -0.285  -29.701 -21.932 1.00 28.37  ? 575 HOH A O     1 
HETATM 2693 O  O     . HOH F 6 .   ? 6.007   -37.766 -25.796 1.00 28.33  ? 576 HOH A O     1 
HETATM 2694 O  O     . HOH F 6 .   ? -7.040  -24.208 -20.832 1.00 30.06  ? 577 HOH A O     1 
HETATM 2695 O  O     . HOH F 6 .   ? -14.378 -32.481 -3.803  1.00 29.20  ? 578 HOH A O     1 
HETATM 2696 O  O     . HOH F 6 .   ? 8.420   -47.432 -18.120 1.00 29.28  ? 579 HOH A O     1 
HETATM 2697 O  O     . HOH F 6 .   ? 7.364   -45.656 -15.383 1.00 28.89  ? 580 HOH A O     1 
HETATM 2698 O  O     . HOH F 6 .   ? 1.915   -33.649 -9.935  1.00 31.86  ? 581 HOH A O     1 
HETATM 2699 O  O     . HOH F 6 .   ? -11.685 -24.421 -14.511 1.00 28.85  ? 582 HOH A O     1 
HETATM 2700 O  O     . HOH F 6 .   ? -0.413  -51.396 -13.442 1.00 28.87  ? 583 HOH A O     1 
HETATM 2701 O  O     . HOH F 6 .   ? 5.455   -43.286 -5.849  1.00 29.77  ? 584 HOH A O     1 
HETATM 2702 O  O     . HOH F 6 .   ? 3.703   -34.461 -7.861  1.00 31.20  ? 585 HOH A O     1 
HETATM 2703 O  O     . HOH F 6 .   ? -0.665  -22.721 -6.770  1.00 32.37  ? 586 HOH A O     1 
HETATM 2704 O  O     . HOH F 6 .   ? -15.738 -41.108 -4.139  1.00 30.35  ? 587 HOH A O     1 
HETATM 2705 O  O     . HOH F 6 .   ? 0.142   -54.432 -11.535 1.00 30.72  ? 588 HOH A O     1 
HETATM 2706 O  O     . HOH F 6 .   ? 5.986   -42.707 -23.345 1.00 30.84  ? 589 HOH A O     1 
HETATM 2707 O  O     . HOH F 6 .   ? -2.255  -44.638 4.785   1.00 36.03  ? 590 HOH A O     1 
HETATM 2708 O  O     . HOH F 6 .   ? -10.233 -39.901 -7.598  1.00 31.56  ? 591 HOH A O     1 
HETATM 2709 O  O     . HOH F 6 .   ? 7.467   -40.397 -23.242 1.00 30.10  ? 592 HOH A O     1 
HETATM 2710 O  O     . HOH F 6 .   ? -6.934  -39.522 -30.748 1.00 30.53  ? 593 HOH A O     1 
HETATM 2711 O  O     . HOH F 6 .   ? -11.460 -41.635 1.665   1.00 30.16  ? 594 HOH A O     1 
HETATM 2712 O  O     . HOH F 6 .   ? -19.029 -29.141 3.510   1.00 29.16  ? 595 HOH A O     1 
HETATM 2713 O  O     . HOH F 6 .   ? 4.205   -45.213 -4.774  1.00 30.24  ? 596 HOH A O     1 
HETATM 2714 O  O     . HOH F 6 .   ? -23.478 -34.233 -5.741  1.00 31.75  ? 597 HOH A O     1 
HETATM 2715 O  O     . HOH F 6 .   ? -11.945 -42.373 -23.221 1.00 36.92  ? 598 HOH A O     1 
HETATM 2716 O  O     . HOH F 6 .   ? -11.384 -26.520 2.407   1.00 31.89  ? 599 HOH A O     1 
HETATM 2717 O  O     . HOH F 6 .   ? -12.925 -13.165 -1.852  1.00 39.81  ? 600 HOH A O     1 
HETATM 2718 O  O     . HOH F 6 .   ? -16.912 -32.058 -3.012  1.00 35.41  ? 601 HOH A O     1 
HETATM 2719 O  O     . HOH F 6 .   ? -1.919  -44.429 -21.320 1.00 33.48  ? 602 HOH A O     1 
HETATM 2720 O  O     . HOH F 6 .   ? -14.491 -43.397 3.131   1.00 35.14  ? 603 HOH A O     1 
HETATM 2721 O  O     . HOH F 6 .   ? -4.166  -37.136 -11.242 1.00 35.09  ? 604 HOH A O     1 
HETATM 2722 O  O     . HOH F 6 .   ? 10.203  -48.459 3.517   1.00 38.10  ? 605 HOH A O     1 
HETATM 2723 O  O     . HOH F 6 .   ? -22.108 -28.963 -15.048 1.00 33.68  ? 606 HOH A O     1 
HETATM 2724 O  O     . HOH F 6 .   ? 18.959  -36.575 -9.507  1.00 33.66  ? 607 HOH A O     1 
HETATM 2725 O  O     . HOH F 6 .   ? 1.793   -43.914 -26.689 1.00 34.70  ? 608 HOH A O     1 
HETATM 2726 O  O     . HOH F 6 .   ? -5.795  -35.607 -30.187 1.00 35.12  ? 609 HOH A O     1 
HETATM 2727 O  O     . HOH F 6 .   ? -8.170  -52.910 -4.721  1.00 35.77  ? 610 HOH A O     1 
HETATM 2728 O  O     . HOH F 6 .   ? -13.884 -15.595 -2.624  1.00 40.02  ? 611 HOH A O     1 
HETATM 2729 O  O     . HOH F 6 .   ? -25.694 -30.459 -11.799 1.00 34.13  ? 612 HOH A O     1 
HETATM 2730 O  O     . HOH F 6 .   ? -14.491 -43.329 -3.386  1.00 35.01  ? 613 HOH A O     1 
HETATM 2731 O  O     . HOH F 6 .   ? -2.133  -53.050 -10.395 1.00 32.94  ? 614 HOH A O     1 
HETATM 2732 O  O     . HOH F 6 .   ? -8.028  -18.775 -9.529  1.00 35.16  ? 615 HOH A O     1 
HETATM 2733 O  O     . HOH F 6 .   ? -10.451 -43.429 -21.115 1.00 38.35  ? 616 HOH A O     1 
HETATM 2734 O  O     . HOH F 6 .   ? -24.037 -37.925 -5.689  1.00 39.33  ? 617 HOH A O     1 
HETATM 2735 O  O     . HOH F 6 .   ? -26.377 -39.733 -9.137  1.00 37.90  ? 618 HOH A O     1 
HETATM 2736 O  O     . HOH F 6 .   ? 11.656  -40.344 -21.699 1.00 39.14  ? 619 HOH A O     1 
HETATM 2737 O  O     . HOH F 6 .   ? -11.870 -31.844 -0.854  1.00 39.52  ? 620 HOH A O     1 
HETATM 2738 O  O     . HOH F 6 .   ? -5.672  -46.169 -28.801 1.00 41.39  ? 621 HOH A O     1 
HETATM 2739 O  O     . HOH F 6 .   ? -9.160  -50.837 -7.289  1.00 34.04  ? 622 HOH A O     1 
HETATM 2740 O  O     . HOH F 6 .   ? -13.581 -17.051 -7.145  1.00 35.66  ? 623 HOH A O     1 
HETATM 2741 O  O     . HOH F 6 .   ? -3.164  -56.899 -1.683  1.00 38.04  ? 624 HOH A O     1 
HETATM 2742 O  O     . HOH F 6 .   ? -1.287  -41.286 4.144   1.00 34.78  ? 625 HOH A O     1 
HETATM 2743 O  O     . HOH F 6 .   ? 5.931   -54.095 2.080   1.00 41.93  ? 626 HOH A O     1 
HETATM 2744 O  O     . HOH F 6 .   ? 5.350   -35.101 -32.607 1.00 40.18  ? 627 HOH A O     1 
HETATM 2745 O  O     . HOH F 6 .   ? -11.376 -19.600 -12.541 1.00 37.81  ? 628 HOH A O     1 
HETATM 2746 O  O     . HOH F 6 .   ? -10.536 -41.499 -25.355 1.00 41.09  ? 629 HOH A O     1 
HETATM 2747 O  O     . HOH F 6 .   ? -10.960 -16.329 -7.817  1.00 41.75  ? 630 HOH A O     1 
HETATM 2748 O  O     . HOH F 6 .   ? -24.305 -27.260 -14.250 1.00 44.20  ? 631 HOH A O     1 
HETATM 2749 O  O     . HOH F 6 .   ? -8.741  -22.651 -17.046 1.00 42.25  ? 632 HOH A O     1 
HETATM 2750 O  O     . HOH F 6 .   ? -2.149  -19.539 -2.428  1.00 44.94  ? 633 HOH A O     1 
HETATM 2751 O  O     . HOH F 6 .   ? 1.376   -50.871 -19.642 1.00 43.57  ? 634 HOH A O     1 
HETATM 2752 O  O     . HOH F 6 .   ? -23.963 -40.710 -5.530  1.00 42.59  ? 635 HOH A O     1 
HETATM 2753 O  O     . HOH F 6 .   ? -3.058  -48.044 -23.307 1.00 38.97  ? 636 HOH A O     1 
HETATM 2754 O  O     . HOH F 6 .   ? -7.634  -11.800 -6.032  1.00 40.25  ? 637 HOH A O     1 
HETATM 2755 O  O     . HOH F 6 .   ? 3.404   -41.138 -26.192 1.00 44.55  ? 638 HOH A O     1 
HETATM 2756 O  O     . HOH F 6 .   ? 8.853   -29.034 -6.099  1.00 40.08  ? 639 HOH A O     1 
HETATM 2757 O  O     . HOH F 6 .   ? -9.233  -28.239 0.931   1.00 43.52  ? 640 HOH A O     1 
HETATM 2758 O  O     . HOH F 6 .   ? -25.432 -27.215 -17.011 1.00 46.48  ? 641 HOH A O     1 
HETATM 2759 O  O     . HOH F 6 .   ? -10.160 -40.221 -4.815  1.00 41.47  ? 642 HOH A O     1 
HETATM 2760 O  O     . HOH F 6 .   ? -9.060  -22.273 -20.128 1.00 45.25  ? 643 HOH A O     1 
HETATM 2761 O  O     . HOH F 6 .   ? 5.685   -40.345 -27.264 1.00 45.35  ? 644 HOH A O     1 
HETATM 2762 O  O     . HOH F 6 .   ? -21.566 -39.490 -16.170 1.00 41.56  ? 645 HOH A O     1 
HETATM 2763 O  O     . HOH F 6 .   ? -7.286  -27.156 2.672   1.00 41.32  ? 646 HOH A O     1 
HETATM 2764 O  O     . HOH F 6 .   ? -17.402 -12.017 1.638   1.00 45.81  ? 647 HOH A O     1 
HETATM 2765 O  O     . HOH F 6 .   ? -0.371  -38.255 -33.150 1.00 46.97  ? 648 HOH A O     1 
HETATM 2766 O  O     . HOH F 6 .   ? -2.653  -18.687 -5.857  1.00 41.75  ? 649 HOH A O     1 
HETATM 2767 O  O     . HOH F 6 .   ? -20.951 -25.059 -13.926 1.00 50.57  ? 650 HOH A O     1 
HETATM 2768 O  O     . HOH F 6 .   ? -5.407  -31.530 -28.176 1.00 42.48  ? 651 HOH A O     1 
HETATM 2769 O  O     . HOH F 6 .   ? -14.365 -46.679 -4.537  1.00 44.60  ? 652 HOH A O     1 
HETATM 2770 O  O     . HOH F 6 .   ? -4.974  -55.223 -8.290  1.00 43.04  ? 653 HOH A O     1 
HETATM 2771 O  O     . HOH F 6 .   ? -26.074 -27.662 -11.955 1.00 41.69  ? 654 HOH A O     1 
HETATM 2772 O  O     . HOH F 6 .   ? 18.962  -37.813 -7.123  1.00 43.47  ? 655 HOH A O     1 
HETATM 2773 O  O     . HOH F 6 .   ? 1.842   -47.526 -20.199 1.00 50.10  ? 656 HOH A O     1 
HETATM 2774 O  O     . HOH F 6 .   ? -3.474  -25.378 -24.855 1.00 47.39  ? 657 HOH A O     1 
HETATM 2775 O  O     . HOH F 6 .   ? -3.327  -37.495 -31.103 1.00 44.86  ? 658 HOH A O     1 
HETATM 2776 O  O     . HOH F 6 .   ? -8.003  -49.380 2.597   1.00 51.31  ? 659 HOH A O     1 
HETATM 2777 O  O     . HOH F 6 .   ? 1.953   -34.240 -14.660 1.00 53.35  ? 660 HOH A O     1 
HETATM 2778 O  O     . HOH F 6 .   ? 4.320   -36.465 -34.287 1.00 47.12  ? 661 HOH A O     1 
HETATM 2779 O  O     . HOH F 6 .   ? -7.161  -39.691 -2.558  1.00 55.35  ? 662 HOH A O     1 
HETATM 2780 O  O     . HOH F 6 .   ? -20.468 -44.681 -1.287  1.00 52.56  ? 663 HOH A O     1 
HETATM 2781 O  O     . HOH F 6 .   ? -13.305 -38.531 1.958   1.00 48.67  ? 664 HOH A O     1 
HETATM 2782 O  O     . HOH F 6 .   ? -1.029  -34.514 -28.277 1.00 44.05  ? 665 HOH A O     1 
HETATM 2783 O  O     . HOH F 6 .   ? -4.875  -43.642 4.982   1.00 47.77  ? 666 HOH A O     1 
HETATM 2784 O  O     . HOH F 6 .   ? -14.666 -33.504 0.064   1.00 49.23  ? 667 HOH A O     1 
HETATM 2785 O  O     . HOH F 6 .   ? 1.950   -41.792 -28.068 1.00 52.20  ? 668 HOH A O     1 
HETATM 2786 O  O     . HOH F 6 .   ? -7.527  -33.467 -1.390  1.00 50.89  ? 669 HOH A O     1 
HETATM 2787 O  O     . HOH F 6 .   ? 4.180   -53.968 -0.074  1.00 46.43  ? 670 HOH A O     1 
HETATM 2788 O  O     . HOH F 6 .   ? -4.719  -58.235 -7.679  1.00 47.71  ? 671 HOH A O     1 
HETATM 2789 O  O     . HOH F 6 .   ? 2.793   -10.963 6.240   1.00 51.49  ? 672 HOH A O     1 
HETATM 2790 O  O     . HOH F 6 .   ? 3.569   -33.611 -31.082 1.00 53.90  ? 673 HOH A O     1 
HETATM 2791 O  O     . HOH F 6 .   ? -16.311 -14.732 -0.894  1.00 48.24  ? 674 HOH A O     1 
HETATM 2792 O  O     . HOH F 6 .   ? -1.573  -56.715 0.704   1.00 49.05  ? 675 HOH A O     1 
HETATM 2793 O  O     . HOH F 6 .   ? -22.772 -44.761 -10.342 1.00 51.02  ? 676 HOH A O     1 
HETATM 2794 O  O     . HOH F 6 .   ? -24.970 -36.116 -15.147 1.00 46.58  ? 677 HOH A O     1 
HETATM 2795 O  O     . HOH F 6 .   ? -17.327 -23.156 -17.151 1.00 49.29  ? 678 HOH A O     1 
HETATM 2796 O  O     . HOH F 6 .   ? 2.208   -11.620 9.406   1.00 53.65  ? 679 HOH A O     1 
HETATM 2797 O  O     . HOH F 6 .   ? -0.091  -57.281 -13.207 1.00 46.86  ? 680 HOH A O     1 
HETATM 2798 O  O     . HOH F 6 .   ? -2.367  -14.569 1.153   1.00 50.30  ? 681 HOH A O     1 
HETATM 2799 O  O     . HOH F 6 .   ? -21.897 -47.069 -8.967  1.00 48.93  ? 682 HOH A O     1 
HETATM 2800 O  O     . HOH F 6 .   ? -13.914 -35.203 2.199   1.00 51.61  ? 683 HOH A O     1 
HETATM 2801 O  O     . HOH F 6 .   ? -21.276 -39.576 -19.254 1.00 51.60  ? 684 HOH A O     1 
HETATM 2802 O  O     . HOH F 6 .   ? -26.702 -33.241 -4.827  1.00 50.06  ? 685 HOH A O     1 
HETATM 2803 O  O     . HOH F 6 .   ? -10.052 -46.350 -20.772 1.00 53.09  ? 686 HOH A O     1 
HETATM 2804 O  O     . HOH F 6 .   ? -0.215  -58.116 -10.379 1.00 52.96  ? 687 HOH A O     1 
HETATM 2805 O  O     . HOH F 6 .   ? -12.093 -44.961 4.153   1.00 56.70  ? 688 HOH A O     1 
HETATM 2806 O  O     . HOH F 6 .   ? 26.742  -41.479 1.785   1.00 61.99  ? 689 HOH A O     1 
HETATM 2807 O  O     . HOH F 6 .   ? -14.063 -22.808 -23.041 1.00 49.80  ? 690 HOH A O     1 
HETATM 2808 O  O     . HOH F 6 .   ? 7.038   -39.331 -33.922 1.00 57.48  ? 691 HOH A O     1 
HETATM 2809 O  O     . HOH F 6 .   ? -20.214 -22.551 -15.162 1.00 52.18  ? 692 HOH A O     1 
HETATM 2810 O  O     . HOH F 6 .   ? 4.665   -40.370 5.811   1.00 62.08  ? 693 HOH A O     1 
HETATM 2811 O  O     . HOH F 6 .   ? -14.678 -21.424 -16.466 1.00 57.21  ? 694 HOH A O     1 
HETATM 2812 O  O     . HOH F 6 .   ? -12.348 -20.662 -15.012 1.00 55.35  ? 695 HOH A O     1 
HETATM 2813 O  O     . HOH F 6 .   ? 9.931   -47.047 5.862   1.00 61.11  ? 696 HOH A O     1 
HETATM 2814 O  O     . HOH F 6 .   ? 29.187  -40.587 -9.733  1.00 59.63  ? 697 HOH A O     1 
HETATM 2815 O  O     . HOH F 6 .   ? -3.303  -11.952 3.269   1.00 59.54  ? 698 HOH A O     1 
HETATM 2816 O  O     . HOH F 6 .   ? 4.349   -48.896 -19.915 1.00 58.51  ? 699 HOH A O     1 
HETATM 2817 O  O     . HOH F 6 .   ? -20.392 -47.480 -6.701  1.00 56.26  ? 700 HOH A O     1 
HETATM 2818 O  O     . HOH F 6 .   ? -25.412 -34.997 -3.304  1.00 59.26  ? 701 HOH A O     1 
HETATM 2819 O  O     . HOH F 6 .   ? 26.557  -40.323 -11.007 1.00 56.76  ? 702 HOH A O     1 
HETATM 2820 O  O     . HOH F 6 .   ? 20.270  -27.218 -7.261  1.00 59.91  ? 703 HOH A O     1 
HETATM 2821 O  O     . HOH F 6 .   ? -24.230 -37.078 -2.740  1.00 63.33  ? 704 HOH A O     1 
HETATM 2822 O  O     . HOH F 6 .   ? -8.430  -57.233 -0.053  1.00 62.71  ? 705 HOH A O     1 
HETATM 2823 O  O     . HOH F 6 .   ? -17.160 -39.906 -28.260 1.00 60.82  ? 706 HOH A O     1 
HETATM 2824 O  O     . HOH F 6 .   ? -14.171 -4.965  6.409   1.00 65.59  ? 707 HOH A O     1 
HETATM 2825 O  O     . HOH F 6 .   ? -11.142 -13.492 -8.082  1.00 60.32  ? 708 HOH A O     1 
HETATM 2826 O  O     . HOH F 6 .   ? 21.124  -43.841 -3.270  1.00 63.96  ? 709 HOH A O     1 
HETATM 2827 O  O     . HOH F 6 .   ? -2.860  -57.374 -10.167 1.00 62.81  ? 710 HOH A O     1 
HETATM 2828 O  O     . HOH F 6 .   ? 13.739  -31.298 -5.510  1.00 69.12  ? 711 HOH A O     1 
HETATM 2829 O  O     . HOH F 6 .   ? -5.549  -6.652  1.534   1.00 64.88  ? 712 HOH A O     1 
HETATM 2830 O  O     . HOH F 6 .   ? -17.117 -15.667 1.285   1.00 65.07  ? 713 HOH A O     1 
HETATM 2831 O  O     . HOH F 6 .   ? -4.495  -45.202 -31.239 1.00 62.17  ? 714 HOH A O     1 
HETATM 2832 O  O     . HOH F 6 .   ? 6.642   -37.337 5.404   1.00 67.83  ? 715 HOH A O     1 
HETATM 2833 O  O     . HOH G 6 .   ? -8.473  -28.544 -2.043  1.00 30.03  ? 101 HOH C O     1 
HETATM 2834 O  O     . HOH G 6 .   ? 1.225   -33.710 2.462   1.00 34.98  ? 102 HOH C O     1 
HETATM 2835 O  O     . HOH G 6 .   ? -5.212  -40.220 -0.980  1.00 46.74  ? 103 HOH C O     1 
HETATM 2836 O  O     . HOH G 6 .   ? -0.988  -28.630 1.790   1.00 45.88  ? 104 HOH C O     1 
HETATM 2837 O  O     . HOH G 6 .   ? 9.081   -24.797 -1.059  1.00 45.40  ? 105 HOH C O     1 
HETATM 2838 O  O     . HOH G 6 .   ? 0.544   -17.358 1.015   1.00 45.41  ? 106 HOH C O     1 
HETATM 2839 O  O     . HOH G 6 .   ? -4.664  -36.059 -1.335  1.00 45.98  ? 107 HOH C O     1 
HETATM 2840 O  O     . HOH G 6 .   ? 8.969   -25.416 -3.886  1.00 41.47  ? 108 HOH C O     1 
HETATM 2841 O  O     . HOH G 6 .   ? -0.531  -24.866 -5.056  1.00 52.57  ? 109 HOH C O     1 
HETATM 2842 O  O     . HOH G 6 .   ? 2.738   -24.650 3.324   1.00 48.60  ? 110 HOH C O     1 
HETATM 2843 O  O     . HOH G 6 .   ? 2.362   -18.757 -2.800  1.00 48.68  ? 111 HOH C O     1 
HETATM 2844 O  O     . HOH G 6 .   ? -6.223  -27.644 0.055   1.00 53.28  ? 112 HOH C O     1 
HETATM 2845 O  O     . HOH G 6 .   ? 10.046  -24.303 -7.122  1.00 58.49  ? 113 HOH C O     1 
HETATM 2846 O  O     . HOH G 6 .   ? 0.781   -33.499 -6.762  1.00 52.27  ? 114 HOH C O     1 
HETATM 2847 O  O     . HOH G 6 .   ? 3.068   -27.873 1.816   1.00 54.56  ? 115 HOH C O     1 
HETATM 2848 O  O     . HOH G 6 .   ? -9.056  -31.356 -2.527  1.00 75.86  ? 116 HOH C O     1 
HETATM 2849 O  O     . HOH G 6 .   ? -3.584  -26.707 4.274   1.00 90.98  ? 117 HOH C O     1 
HETATM 2850 O  O     . HOH H 6 .   ? 0.915   -15.996 -12.429 1.00 47.56  ? 101 HOH B O     1 
HETATM 2851 O  O     . HOH H 6 .   ? 4.657   -24.462 -13.518 1.00 33.01  ? 102 HOH B O     1 
HETATM 2852 O  O     . HOH H 6 .   ? 8.174   -23.300 -10.260 1.00 45.21  ? 103 HOH B O     1 
HETATM 2853 O  O     . HOH H 6 .   ? -3.090  -20.732 -15.481 1.00 32.04  ? 104 HOH B O     1 
HETATM 2854 O  O     . HOH H 6 .   ? 12.472  -42.786 -4.154  1.00 29.30  ? 105 HOH B O     1 
HETATM 2855 O  O     . HOH H 6 .   ? -4.350  -17.481 -7.616  1.00 35.48  ? 106 HOH B O     1 
HETATM 2856 O  O     . HOH H 6 .   ? 0.236   -26.897 -8.242  1.00 40.53  ? 107 HOH B O     1 
HETATM 2857 O  O     . HOH H 6 .   ? -4.331  -19.577 -12.441 1.00 40.64  ? 108 HOH B O     1 
HETATM 2858 O  O     . HOH H 6 .   ? 2.161   -31.383 -7.745  1.00 40.24  ? 109 HOH B O     1 
HETATM 2859 O  O     . HOH H 6 .   ? 9.164   -33.671 1.138   1.00 44.52  ? 110 HOH B O     1 
HETATM 2860 O  O     . HOH H 6 .   ? 8.453   -26.736 -8.235  1.00 48.79  ? 111 HOH B O     1 
HETATM 2861 O  O     . HOH H 6 .   ? 16.166  -41.207 -4.432  1.00 41.72  ? 112 HOH B O     1 
HETATM 2862 O  O     . HOH H 6 .   ? 14.244  -34.656 -5.363  1.00 44.80  ? 113 HOH B O     1 
HETATM 2863 O  O     . HOH H 6 .   ? 12.033  -35.183 1.248   1.00 50.32  ? 114 HOH B O     1 
HETATM 2864 O  O     . HOH H 6 .   ? 6.019   -32.091 1.709   1.00 50.39  ? 115 HOH B O     1 
HETATM 2865 O  O     . HOH H 6 .   ? 8.900   -28.190 -3.334  1.00 52.48  ? 116 HOH B O     1 
HETATM 2866 O  O     . HOH H 6 .   ? 4.263   -34.113 3.262   1.00 53.21  ? 117 HOH B O     1 
HETATM 2867 O  O     . HOH H 6 .   ? 8.481   -29.376 -0.856  1.00 63.76  ? 118 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A 34  ? 0.8299 0.9055 0.7049 -0.0055 -0.0099 -0.0782 32  LYS A N   
2    C CA  . LYS A 34  ? 0.8275 0.8903 0.6975 -0.0016 -0.0070 -0.0614 32  LYS A CA  
3    C C   . LYS A 34  ? 0.8378 0.9095 0.6951 0.0082  -0.0140 -0.0537 32  LYS A C   
4    O O   . LYS A 34  ? 0.8628 0.9250 0.7098 0.0134  -0.0111 -0.0402 32  LYS A O   
5    C CB  . LYS A 34  ? 0.8296 0.8838 0.7176 -0.0067 -0.0039 -0.0580 32  LYS A CB  
6    C CG  . LYS A 34  ? 0.8563 0.9222 0.7552 -0.0061 -0.0108 -0.0618 32  LYS A CG  
7    C CD  . LYS A 34  ? 0.8894 0.9466 0.8064 -0.0120 -0.0064 -0.0609 32  LYS A CD  
8    C CE  . LYS A 34  ? 0.9116 0.9546 0.8263 -0.0096 -0.0026 -0.0462 32  LYS A CE  
9    N NZ  . LYS A 34  ? 0.9387 0.9865 0.8479 -0.0026 -0.0083 -0.0377 32  LYS A NZ  
10   N N   . TYR A 35  ? 0.8290 0.9190 0.6876 0.0110  -0.0229 -0.0627 33  TYR A N   
11   C CA  . TYR A 35  ? 0.8545 0.9546 0.7011 0.0216  -0.0301 -0.0560 33  TYR A CA  
12   C C   . TYR A 35  ? 0.9206 1.0248 0.7436 0.0299  -0.0309 -0.0537 33  TYR A C   
13   O O   . TYR A 35  ? 0.9417 1.0405 0.7497 0.0386  -0.0297 -0.0400 33  TYR A O   
14   C CB  . TYR A 35  ? 0.8228 0.9428 0.6805 0.0222  -0.0397 -0.0669 33  TYR A CB  
15   C CG  . TYR A 35  ? 0.7976 0.9131 0.6780 0.0148  -0.0379 -0.0682 33  TYR A CG  
16   C CD1 . TYR A 35  ? 0.7639 0.8701 0.6472 0.0175  -0.0365 -0.0549 33  TYR A CD1 
17   C CD2 . TYR A 35  ? 0.7876 0.9074 0.6867 0.0053  -0.0367 -0.0826 33  TYR A CD2 
18   C CE1 . TYR A 35  ? 0.7438 0.8457 0.6462 0.0113  -0.0345 -0.0559 33  TYR A CE1 
19   C CE2 . TYR A 35  ? 0.7694 0.8839 0.6880 -0.0007 -0.0339 -0.0829 33  TYR A CE2 
20   C CZ  . TYR A 35  ? 0.7626 0.8686 0.6821 0.0026  -0.0330 -0.0694 33  TYR A CZ  
21   O OH  . TYR A 35  ? 0.7678 0.8686 0.7054 -0.0028 -0.0299 -0.0696 33  TYR A OH  
22   N N   . LYS A 36  ? 0.9378 1.0504 0.7576 0.0272  -0.0321 -0.0671 34  LYS A N   
23   C CA  . LYS A 36  ? 0.9574 1.0737 0.7542 0.0346  -0.0321 -0.0664 34  LYS A CA  
24   C C   . LYS A 36  ? 0.9576 1.0530 0.7436 0.0358  -0.0216 -0.0514 34  LYS A C   
25   O O   . LYS A 36  ? 0.9533 1.0470 0.7190 0.0455  -0.0204 -0.0414 34  LYS A O   
26   C CB  . LYS A 36  ? 0.9767 1.1033 0.7753 0.0292  -0.0336 -0.0849 34  LYS A CB  
27   C CG  . LYS A 36  ? 1.0009 1.1502 0.8118 0.0279  -0.0439 -0.1018 34  LYS A CG  
28   C CD  . LYS A 36  ? 1.0252 1.1800 0.8485 0.0179  -0.0424 -0.1214 34  LYS A CD  
29   C CE  . LYS A 36  ? 1.0748 1.2454 0.8805 0.0235  -0.0474 -0.1329 34  LYS A CE  
30   N NZ  . LYS A 36  ? 1.1097 1.2662 0.8947 0.0270  -0.0396 -0.1236 34  LYS A NZ  
31   N N   . VAL A 37  ? 0.9691 1.0487 0.7692 0.0264  -0.0137 -0.0496 35  VAL A N   
32   C CA  . VAL A 37  ? 0.9769 1.0376 0.7713 0.0265  -0.0038 -0.0365 35  VAL A CA  
33   C C   . VAL A 37  ? 1.0105 1.0644 0.8006 0.0334  -0.0030 -0.0206 35  VAL A C   
34   O O   . VAL A 37  ? 1.0384 1.0909 0.8105 0.0424  -0.0013 -0.0113 35  VAL A O   
35   C CB  . VAL A 37  ? 0.9405 0.9879 0.7528 0.0159  0.0033  -0.0383 35  VAL A CB  
36   C CG1 . VAL A 37  ? 0.9339 0.9638 0.7438 0.0164  0.0121  -0.0246 35  VAL A CG1 
37   C CG2 . VAL A 37  ? 0.9323 0.9819 0.7468 0.0097  0.0056  -0.0520 35  VAL A CG2 
38   N N   . PRO A 93  ? 1.0674 1.1056 0.8569 -0.0272 0.0632  -0.1821 91  PRO A N   
39   C CA  . PRO A 93  ? 1.0325 1.0536 0.8353 -0.0332 0.0754  -0.1796 91  PRO A CA  
40   C C   . PRO A 93  ? 0.9707 0.9843 0.7936 -0.0395 0.0785  -0.1761 91  PRO A C   
41   O O   . PRO A 93  ? 0.9356 0.9374 0.7575 -0.0389 0.0843  -0.1632 91  PRO A O   
42   C CB  . PRO A 93  ? 1.0540 1.0775 0.8676 -0.0380 0.0774  -0.1950 91  PRO A CB  
43   C CG  . PRO A 93  ? 1.0907 1.1304 0.8883 -0.0321 0.0676  -0.2029 91  PRO A CG  
44   C CD  . PRO A 93  ? 1.0912 1.1421 0.8816 -0.0276 0.0574  -0.1978 91  PRO A CD  
45   N N   . LYS A 94  ? 0.9372 0.9574 0.7784 -0.0454 0.0752  -0.1874 92  LYS A N   
46   C CA  . LYS A 94  ? 0.8891 0.9029 0.7492 -0.0509 0.0779  -0.1851 92  LYS A CA  
47   C C   . LYS A 94  ? 0.8772 0.8924 0.7272 -0.0466 0.0731  -0.1730 92  LYS A C   
48   O O   . LYS A 94  ? 0.8368 0.8404 0.6959 -0.0481 0.0776  -0.1626 92  LYS A O   
49   C CB  . LYS A 94  ? 0.8674 0.8920 0.7467 -0.0567 0.0734  -0.1997 92  LYS A CB  
50   C CG  . LYS A 94  ? 0.8528 0.8702 0.7535 -0.0626 0.0775  -0.1983 92  LYS A CG  
51   C CD  . LYS A 94  ? 0.8548 0.8880 0.7702 -0.0662 0.0699  -0.2107 92  LYS A CD  
52   C CE  . LYS A 94  ? 0.8441 0.8685 0.7839 -0.0729 0.0767  -0.2110 92  LYS A CE  
53   N NZ  . LYS A 94  ? 0.8492 0.8638 0.8073 -0.0792 0.0878  -0.2174 92  LYS A NZ  
54   N N   . LEU A 95  ? 0.8717 0.9008 0.7039 -0.0400 0.0634  -0.1717 93  LEU A N   
55   C CA  . LEU A 95  ? 0.8051 0.8360 0.6296 -0.0345 0.0575  -0.1574 93  LEU A CA  
56   C C   . LEU A 95  ? 0.7668 0.7823 0.5837 -0.0308 0.0643  -0.1390 93  LEU A C   
57   O O   . LEU A 95  ? 0.7603 0.7683 0.5844 -0.0302 0.0644  -0.1261 93  LEU A O   
58   C CB  . LEU A 95  ? 0.8071 0.8564 0.6130 -0.0269 0.0463  -0.1599 93  LEU A CB  
59   N N   . LYS A 96  ? 0.7682 0.7795 0.5714 -0.0282 0.0700  -0.1386 94  LYS A N   
60   C CA  . LYS A 96  ? 0.7233 0.7211 0.5202 -0.0248 0.0771  -0.1227 94  LYS A CA  
61   C C   . LYS A 96  ? 0.6410 0.6238 0.4573 -0.0301 0.0852  -0.1178 94  LYS A C   
62   O O   . LYS A 96  ? 0.6707 0.6448 0.4895 -0.0281 0.0878  -0.1037 94  LYS A O   
63   C CB  . LYS A 96  ? 0.7495 0.7464 0.5287 -0.0213 0.0825  -0.1250 94  LYS A CB  
64   N N   . ALA A 97  ? 0.5590 0.5392 0.3892 -0.0366 0.0896  -0.1300 95  ALA A N   
65   C CA  . ALA A 97  ? 0.5282 0.4949 0.3767 -0.0407 0.0974  -0.1262 95  ALA A CA  
66   C C   . ALA A 97  ? 0.5914 0.5576 0.4514 -0.0411 0.0926  -0.1183 95  ALA A C   
67   O O   . ALA A 97  ? 0.5769 0.5331 0.4442 -0.0401 0.0963  -0.1070 95  ALA A O   
68   C CB  . ALA A 97  ? 0.4686 0.4328 0.3292 -0.0471 0.1035  -0.1415 95  ALA A CB  
69   N N   . ILE A 98  ? 0.6280 0.6059 0.4899 -0.0422 0.0842  -0.1250 96  ILE A N   
70   C CA  . ILE A 98  ? 0.6601 0.6386 0.5317 -0.0422 0.0793  -0.1182 96  ILE A CA  
71   C C   . ILE A 98  ? 0.6736 0.6498 0.5359 -0.0362 0.0763  -0.1016 96  ILE A C   
72   O O   . ILE A 98  ? 0.6705 0.6393 0.5416 -0.0358 0.0775  -0.0918 96  ILE A O   
73   C CB  . ILE A 98  ? 0.6854 0.6792 0.5597 -0.0438 0.0703  -0.1288 96  ILE A CB  
74   C CG1 . ILE A 98  ? 0.7129 0.7081 0.6014 -0.0510 0.0746  -0.1461 96  ILE A CG1 
75   C CG2 . ILE A 98  ? 0.6665 0.6612 0.5490 -0.0429 0.0650  -0.1203 96  ILE A CG2 
76   C CD1 . ILE A 98  ? 0.7418 0.7537 0.6357 -0.0533 0.0661  -0.1594 96  ILE A CD1 
77   N N   . GLN A 99  ? 0.6935 0.6755 0.5379 -0.0312 0.0731  -0.0988 97  GLN A N   
78   C CA  . GLN A 99  ? 0.6842 0.6631 0.5199 -0.0255 0.0718  -0.0837 97  GLN A CA  
79   C C   . GLN A 99  ? 0.6463 0.6115 0.4880 -0.0258 0.0805  -0.0745 97  GLN A C   
80   O O   . GLN A 99  ? 0.5985 0.5595 0.4431 -0.0235 0.0801  -0.0631 97  GLN A O   
81   C CB  . GLN A 99  ? 0.7463 0.7325 0.5607 -0.0196 0.0691  -0.0828 97  GLN A CB  
82   C CG  . GLN A 99  ? 0.8187 0.8021 0.6238 -0.0134 0.0683  -0.0675 97  GLN A CG  
83   C CD  . GLN A 99  ? 0.8836 0.8746 0.6664 -0.0063 0.0657  -0.0663 97  GLN A CD  
84   O OE1 . GLN A 99  ? 0.9074 0.9094 0.6816 -0.0054 0.0614  -0.0777 97  GLN A OE1 
85   N NE2 . GLN A 99  ? 0.8894 0.8748 0.6629 -0.0008 0.0687  -0.0529 97  GLN A NE2 
86   N N   . GLU A 100 ? 0.6572 0.6164 0.5014 -0.0284 0.0883  -0.0802 98  GLU A N   
87   C CA  . GLU A 100 ? 0.6354 0.5830 0.4869 -0.0284 0.0964  -0.0730 98  GLU A CA  
88   C C   . GLU A 100 ? 0.5781 0.5201 0.4469 -0.0307 0.0973  -0.0705 98  GLU A C   
89   O O   . GLU A 100 ? 0.5297 0.4674 0.4037 -0.0284 0.0975  -0.0603 98  GLU A O   
90   C CB  . GLU A 100 ? 0.6307 0.5737 0.4806 -0.0302 0.1048  -0.0806 98  GLU A CB  
91   C CG  . GLU A 100 ? 0.7083 0.6514 0.5422 -0.0265 0.1082  -0.0778 98  GLU A CG  
92   C CD  . GLU A 100 ? 0.7402 0.6746 0.5782 -0.0244 0.1150  -0.0670 98  GLU A CD  
93   O OE1 . GLU A 100 ? 0.6856 0.6127 0.5362 -0.0262 0.1210  -0.0674 98  GLU A OE1 
94   O OE2 . GLU A 100 ? 0.8017 0.7367 0.6309 -0.0205 0.1147  -0.0583 98  GLU A OE2 
95   N N   . LEU A 101 ? 0.5697 0.5117 0.4476 -0.0349 0.0983  -0.0803 99  LEU A N   
96   C CA  . LEU A 101 ? 0.5698 0.5041 0.4634 -0.0366 0.1022  -0.0786 99  LEU A CA  
97   C C   . LEU A 101 ? 0.5679 0.5042 0.4672 -0.0352 0.0960  -0.0711 99  LEU A C   
98   O O   . LEU A 101 ? 0.5780 0.5073 0.4870 -0.0341 0.0991  -0.0653 99  LEU A O   
99   C CB  . LEU A 101 ? 0.5273 0.4600 0.4297 -0.0418 0.1066  -0.0915 99  LEU A CB  
100  C CG  . LEU A 101 ? 0.5351 0.4636 0.4349 -0.0435 0.1146  -0.0994 99  LEU A CG  
101  C CD1 . LEU A 101 ? 0.5552 0.4835 0.4647 -0.0493 0.1186  -0.1140 99  LEU A CD1 
102  C CD2 . LEU A 101 ? 0.5390 0.4561 0.4431 -0.0407 0.1229  -0.0914 99  LEU A CD2 
103  N N   . THR A 102 ? 0.5319 0.4776 0.4245 -0.0345 0.0875  -0.0711 100 THR A N   
104  C CA  . THR A 102 ? 0.5147 0.4625 0.4124 -0.0331 0.0818  -0.0643 100 THR A CA  
105  C C   . THR A 102 ? 0.5190 0.4636 0.4139 -0.0288 0.0811  -0.0518 100 THR A C   
106  O O   . THR A 102 ? 0.5347 0.4812 0.4323 -0.0271 0.0762  -0.0457 100 THR A O   
107  C CB  . THR A 102 ? 0.5343 0.4939 0.4267 -0.0332 0.0728  -0.0682 100 THR A CB  
108  O OG1 . THR A 102 ? 0.5402 0.5052 0.4172 -0.0294 0.0695  -0.0653 100 THR A OG1 
109  C CG2 . THR A 102 ? 0.5175 0.4826 0.4154 -0.0380 0.0728  -0.0826 100 THR A CG2 
110  N N   . GLN A 103 ? 0.5596 0.4998 0.4500 -0.0272 0.0862  -0.0488 101 GLN A N   
111  C CA  . GLN A 103 ? 0.5651 0.5022 0.4566 -0.0238 0.0870  -0.0385 101 GLN A CA  
112  C C   . GLN A 103 ? 0.5327 0.4638 0.4370 -0.0232 0.0901  -0.0356 101 GLN A C   
113  O O   . GLN A 103 ? 0.5181 0.4484 0.4267 -0.0205 0.0889  -0.0283 101 GLN A O   
114  C CB  . GLN A 103 ? 0.5952 0.5299 0.4797 -0.0224 0.0925  -0.0370 101 GLN A CB  
115  C CG  . GLN A 103 ? 0.6509 0.5906 0.5203 -0.0209 0.0902  -0.0370 101 GLN A CG  
116  C CD  . GLN A 103 ? 0.6888 0.6248 0.5516 -0.0196 0.0974  -0.0355 101 GLN A CD  
117  O OE1 . GLN A 103 ? 0.7289 0.6637 0.5885 -0.0169 0.0990  -0.0279 101 GLN A OE1 
118  N NE2 . GLN A 103 ? 0.6978 0.6317 0.5594 -0.0215 0.1025  -0.0432 101 GLN A NE2 
119  N N   . VAL A 104 ? 0.4714 0.3985 0.3818 -0.0253 0.0945  -0.0416 102 VAL A N   
120  C CA  . VAL A 104 ? 0.4677 0.3881 0.3885 -0.0234 0.0989  -0.0388 102 VAL A CA  
121  C C   . VAL A 104 ? 0.4511 0.3724 0.3779 -0.0233 0.0948  -0.0370 102 VAL A C   
122  O O   . VAL A 104 ? 0.4541 0.3782 0.3812 -0.0266 0.0925  -0.0427 102 VAL A O   
123  C CB  . VAL A 104 ? 0.5104 0.4240 0.4352 -0.0252 0.1075  -0.0453 102 VAL A CB  
124  C CG1 . VAL A 104 ? 0.5102 0.4164 0.4445 -0.0216 0.1126  -0.0410 102 VAL A CG1 
125  C CG2 . VAL A 104 ? 0.5094 0.4221 0.4282 -0.0252 0.1120  -0.0473 102 VAL A CG2 
126  N N   . HIS A 105 ? 0.4336 0.3533 0.3654 -0.0192 0.0939  -0.0298 103 HIS A N   
127  C CA  . HIS A 105 ? 0.4418 0.3619 0.3786 -0.0183 0.0906  -0.0274 103 HIS A CA  
128  C C   . HIS A 105 ? 0.4190 0.3330 0.3620 -0.0201 0.0964  -0.0321 103 HIS A C   
129  O O   . HIS A 105 ? 0.4338 0.3405 0.3804 -0.0183 0.1041  -0.0323 103 HIS A O   
130  C CB  . HIS A 105 ? 0.4535 0.3732 0.3939 -0.0128 0.0891  -0.0196 103 HIS A CB  
131  C CG  . HIS A 105 ? 0.4385 0.3579 0.3832 -0.0110 0.0867  -0.0170 103 HIS A CG  
132  N ND1 . HIS A 105 ? 0.4233 0.3481 0.3674 -0.0101 0.0796  -0.0134 103 HIS A ND1 
133  C CD2 . HIS A 105 ? 0.4306 0.3441 0.3800 -0.0098 0.0914  -0.0174 103 HIS A CD2 
134  C CE1 . HIS A 105 ? 0.4361 0.3589 0.3840 -0.0084 0.0795  -0.0119 103 HIS A CE1 
135  N NE2 . HIS A 105 ? 0.4359 0.3517 0.3869 -0.0081 0.0868  -0.0140 103 HIS A NE2 
136  N N   . GLY A 106 ? 0.3898 0.3067 0.3350 -0.0233 0.0935  -0.0359 104 GLY A N   
137  C CA  . GLY A 106 ? 0.3903 0.3013 0.3434 -0.0257 0.1000  -0.0409 104 GLY A CA  
138  C C   . GLY A 106 ? 0.4410 0.3548 0.3948 -0.0321 0.1015  -0.0523 104 GLY A C   
139  O O   . GLY A 106 ? 0.4560 0.3668 0.4182 -0.0357 0.1063  -0.0588 104 GLY A O   
140  N N   . PHE A 107 ? 0.4366 0.3562 0.3818 -0.0333 0.0979  -0.0551 105 PHE A N   
141  C CA  . PHE A 107 ? 0.4673 0.3916 0.4112 -0.0385 0.0982  -0.0668 105 PHE A CA  
142  C C   . PHE A 107 ? 0.4551 0.3921 0.3922 -0.0396 0.0880  -0.0696 105 PHE A C   
143  O O   . PHE A 107 ? 0.4409 0.3824 0.3680 -0.0364 0.0825  -0.0635 105 PHE A O   
144  C CB  . PHE A 107 ? 0.4497 0.3704 0.3880 -0.0384 0.1035  -0.0694 105 PHE A CB  
145  C CG  . PHE A 107 ? 0.4339 0.3424 0.3798 -0.0374 0.1144  -0.0686 105 PHE A CG  
146  C CD1 . PHE A 107 ? 0.4520 0.3546 0.3984 -0.0316 0.1168  -0.0581 105 PHE A CD1 
147  C CD2 . PHE A 107 ? 0.4378 0.3412 0.3912 -0.0418 0.1223  -0.0786 105 PHE A CD2 
148  C CE1 . PHE A 107 ? 0.4677 0.3595 0.4202 -0.0292 0.1267  -0.0566 105 PHE A CE1 
149  C CE2 . PHE A 107 ? 0.4555 0.3464 0.4158 -0.0400 0.1334  -0.0769 105 PHE A CE2 
150  C CZ  . PHE A 107 ? 0.4719 0.3571 0.4311 -0.0332 0.1355  -0.0654 105 PHE A CZ  
151  N N   . GLY A 108 ? 0.4898 0.4327 0.4334 -0.0438 0.0861  -0.0787 106 GLY A N   
152  C CA  . GLY A 108 ? 0.5033 0.4600 0.4409 -0.0444 0.0764  -0.0835 106 GLY A CA  
153  C C   . GLY A 108 ? 0.5408 0.5038 0.4772 -0.0485 0.0773  -0.0977 106 GLY A C   
154  O O   . GLY A 108 ? 0.5635 0.5189 0.5034 -0.0510 0.0858  -0.1029 106 GLY A O   
155  N N   . PRO A 109 ? 0.5571 0.5345 0.4884 -0.0487 0.0686  -0.1046 107 PRO A N   
156  C CA  . PRO A 109 ? 0.5833 0.5700 0.5131 -0.0522 0.0677  -0.1200 107 PRO A CA  
157  C C   . PRO A 109 ? 0.6162 0.5976 0.5630 -0.0592 0.0765  -0.1324 107 PRO A C   
158  O O   . PRO A 109 ? 0.6183 0.5999 0.5644 -0.0621 0.0809  -0.1431 107 PRO A O   
159  C CB  . PRO A 109 ? 0.5543 0.5581 0.4815 -0.0508 0.0563  -0.1246 107 PRO A CB  
160  C CG  . PRO A 109 ? 0.5547 0.5572 0.4732 -0.0447 0.0511  -0.1088 107 PRO A CG  
161  C CD  . PRO A 109 ? 0.5326 0.5191 0.4589 -0.0450 0.0588  -0.0982 107 PRO A CD  
162  N N   . ARG A 110 ? 0.6102 0.5864 0.5725 -0.0617 0.0802  -0.1312 108 ARG A N   
163  C CA  . ARG A 110 ? 0.6126 0.5828 0.5925 -0.0683 0.0901  -0.1427 108 ARG A CA  
164  C C   . ARG A 110 ? 0.5795 0.5326 0.5605 -0.0683 0.1024  -0.1391 108 ARG A C   
165  O O   . ARG A 110 ? 0.5989 0.5496 0.5856 -0.0728 0.1093  -0.1510 108 ARG A O   
166  C CB  . ARG A 110 ? 0.6402 0.6083 0.6363 -0.0706 0.0922  -0.1417 108 ARG A CB  
167  C CG  . ARG A 110 ? 0.6563 0.6173 0.6724 -0.0776 0.1040  -0.1536 108 ARG A CG  
168  N N   . ALA A 111 ? 0.5603 0.5022 0.5366 -0.0630 0.1052  -0.1233 109 ALA A N   
169  C CA  . ALA A 111 ? 0.5650 0.4917 0.5422 -0.0616 0.1163  -0.1190 109 ALA A CA  
170  C C   . ALA A 111 ? 0.5725 0.5019 0.5377 -0.0611 0.1157  -0.1230 109 ALA A C   
171  O O   . ALA A 111 ? 0.6281 0.5486 0.5967 -0.0628 0.1253  -0.1277 109 ALA A O   
172  C CB  . ALA A 111 ? 0.5806 0.4982 0.5545 -0.0550 0.1175  -0.1022 109 ALA A CB  
173  N N   . ALA A 112 ? 0.5168 0.4578 0.4677 -0.0584 0.1052  -0.1210 110 ALA A N   
174  C CA  . ALA A 112 ? 0.5794 0.5229 0.5168 -0.0570 0.1048  -0.1233 110 ALA A CA  
175  C C   . ALA A 112 ? 0.6236 0.5724 0.5645 -0.0626 0.1075  -0.1414 110 ALA A C   
176  O O   . ALA A 112 ? 0.6307 0.5724 0.5709 -0.0638 0.1156  -0.1459 110 ALA A O   
177  C CB  . ALA A 112 ? 0.5423 0.4963 0.4634 -0.0522 0.0941  -0.1165 110 ALA A CB  
178  N N   . ALA A 113 ? 0.6297 0.5914 0.5756 -0.0661 0.1010  -0.1524 111 ALA A N   
179  C CA  . ALA A 113 ? 0.6435 0.6127 0.5955 -0.0720 0.1026  -0.1720 111 ALA A CA  
180  C C   . ALA A 113 ? 0.6629 0.6195 0.6335 -0.0765 0.1149  -0.1749 111 ALA A C   
181  O O   . ALA A 113 ? 0.7309 0.6891 0.7041 -0.0788 0.1178  -0.1826 111 ALA A O   
182  C CB  . ALA A 113 ? 0.6396 0.6253 0.5985 -0.0748 0.0936  -0.1826 111 ALA A CB  
183  N N   . ALA A 114 ? 0.6397 0.5837 0.6228 -0.0771 0.1223  -0.1676 112 ALA A N   
184  C CA  . ALA A 114 ? 0.6249 0.5563 0.6250 -0.0802 0.1347  -0.1675 112 ALA A CA  
185  C C   . ALA A 114 ? 0.6323 0.5519 0.6248 -0.0766 0.1417  -0.1599 112 ALA A C   
186  O O   . ALA A 114 ? 0.6299 0.5439 0.6320 -0.0795 0.1498  -0.1637 112 ALA A O   
187  C CB  . ALA A 114 ? 0.6040 0.5248 0.6172 -0.0801 0.1411  -0.1596 112 ALA A CB  
188  N N   . LEU A 115 ? 0.6354 0.5516 0.6117 -0.0705 0.1388  -0.1492 113 LEU A N   
189  C CA  . LEU A 115 ? 0.5978 0.5052 0.5670 -0.0666 0.1443  -0.1421 113 LEU A CA  
190  C C   . LEU A 115 ? 0.5998 0.5157 0.5630 -0.0690 0.1420  -0.1527 113 LEU A C   
191  O O   . LEU A 115 ? 0.6282 0.5376 0.5971 -0.0704 0.1494  -0.1548 113 LEU A O   
192  C CB  . LEU A 115 ? 0.5911 0.4967 0.5449 -0.0600 0.1408  -0.1298 113 LEU A CB  
193  C CG  . LEU A 115 ? 0.5699 0.4660 0.5291 -0.0553 0.1436  -0.1157 113 LEU A CG  
194  C CD1 . LEU A 115 ? 0.5403 0.4393 0.4872 -0.0489 0.1369  -0.1021 113 LEU A CD1 
195  C CD2 . LEU A 115 ? 0.5845 0.4664 0.5550 -0.0543 0.1555  -0.1123 113 LEU A CD2 
196  N N   . PHE A 116 ? 0.5832 0.5136 0.5341 -0.0689 0.1317  -0.1589 114 PHE A N   
197  C CA  . PHE A 116 ? 0.6012 0.5417 0.5443 -0.0699 0.1280  -0.1692 114 PHE A CA  
198  C C   . PHE A 116 ? 0.6314 0.5734 0.5923 -0.0765 0.1328  -0.1821 114 PHE A C   
199  O O   . PHE A 116 ? 0.5835 0.5200 0.5468 -0.0775 0.1394  -0.1847 114 PHE A O   
200  C CB  . PHE A 116 ? 0.6175 0.5751 0.5462 -0.0680 0.1155  -0.1737 114 PHE A CB  
201  C CG  . PHE A 116 ? 0.6696 0.6376 0.5850 -0.0664 0.1109  -0.1817 114 PHE A CG  
202  C CD1 . PHE A 116 ? 0.6902 0.6698 0.6135 -0.0704 0.1076  -0.1969 114 PHE A CD1 
203  C CD2 . PHE A 116 ? 0.6842 0.6508 0.5798 -0.0605 0.1102  -0.1737 114 PHE A CD2 
204  C CE1 . PHE A 116 ? 0.6822 0.6715 0.5921 -0.0679 0.1032  -0.2042 114 PHE A CE1 
205  C CE2 . PHE A 116 ? 0.6913 0.6669 0.5734 -0.0580 0.1066  -0.1802 114 PHE A CE2 
206  C CZ  . PHE A 116 ? 0.6890 0.6759 0.5774 -0.0614 0.1028  -0.1956 114 PHE A CZ  
207  N N   . ASP A 117 ? 0.6763 0.6257 0.6511 -0.0810 0.1302  -0.1899 115 ASP A N   
208  C CA  . ASP A 117 ? 0.7039 0.6571 0.6976 -0.0878 0.1347  -0.2032 115 ASP A CA  
209  C C   . ASP A 117 ? 0.7574 0.6937 0.7664 -0.0904 0.1493  -0.1992 115 ASP A C   
210  O O   . ASP A 117 ? 0.7868 0.7216 0.7999 -0.0929 0.1547  -0.2058 115 ASP A O   
211  C CB  . ASP A 117 ? 0.6977 0.6622 0.7052 -0.0919 0.1298  -0.2109 115 ASP A CB  
212  C CG  . ASP A 117 ? 0.7085 0.6926 0.7026 -0.0894 0.1149  -0.2172 115 ASP A CG  
213  O OD1 . ASP A 117 ? 0.7308 0.7228 0.7092 -0.0864 0.1095  -0.2213 115 ASP A OD1 
214  O OD2 . ASP A 117 ? 0.6893 0.6809 0.6878 -0.0897 0.1089  -0.2175 115 ASP A OD2 
215  N N   . ARG A 118 ? 0.7782 0.7019 0.7953 -0.0893 0.1557  -0.1881 116 ARG A N   
216  C CA  . ARG A 118 ? 0.7963 0.7042 0.8279 -0.0907 0.1698  -0.1829 116 ARG A CA  
217  C C   . ARG A 118 ? 0.7760 0.6720 0.7977 -0.0858 0.1752  -0.1735 116 ARG A C   
218  O O   . ARG A 118 ? 0.7772 0.6648 0.8079 -0.0877 0.1852  -0.1746 116 ARG A O   
219  C CB  . ARG A 118 ? 0.8392 0.7376 0.8801 -0.0893 0.1748  -0.1725 116 ARG A CB  
220  C CG  . ARG A 118 ? 0.9157 0.8244 0.9698 -0.0943 0.1716  -0.1808 116 ARG A CG  
221  C CD  . ARG A 118 ? 0.9761 0.8765 1.0325 -0.0908 0.1735  -0.1687 116 ARG A CD  
222  N NE  . ARG A 118 ? 1.0462 0.9280 1.1030 -0.0859 0.1845  -0.1541 116 ARG A NE  
223  C CZ  . ARG A 118 ? 1.0709 0.9450 1.1128 -0.0783 0.1824  -0.1411 116 ARG A CZ  
224  N NH1 . ARG A 118 ? 1.0711 0.9533 1.0966 -0.0752 0.1710  -0.1406 116 ARG A NH1 
225  N NH2 . ARG A 118 ? 1.0770 0.9361 1.1205 -0.0732 0.1919  -0.1285 116 ARG A NH2 
226  N N   . GLU A 119 ? 0.7493 0.6448 0.7531 -0.0794 0.1691  -0.1643 117 GLU A N   
227  C CA  . GLU A 119 ? 0.7510 0.6350 0.7478 -0.0741 0.1746  -0.1535 117 GLU A CA  
228  C C   . GLU A 119 ? 0.7470 0.6374 0.7286 -0.0724 0.1701  -0.1573 117 GLU A C   
229  O O   . GLU A 119 ? 0.7440 0.6263 0.7222 -0.0692 0.1755  -0.1514 117 GLU A O   
230  C CB  . GLU A 119 ? 0.7647 0.6416 0.7556 -0.0673 0.1736  -0.1382 117 GLU A CB  
231  C CG  . GLU A 119 ? 0.7755 0.6471 0.7789 -0.0680 0.1770  -0.1340 117 GLU A CG  
232  C CD  . GLU A 119 ? 0.8094 0.6678 0.8278 -0.0687 0.1899  -0.1303 117 GLU A CD  
233  O OE1 . GLU A 119 ? 0.8170 0.6685 0.8346 -0.0669 0.1959  -0.1276 117 GLU A OE1 
234  O OE2 . GLU A 119 ? 0.8359 0.6909 0.8668 -0.0709 0.1947  -0.1297 117 GLU A OE2 
235  N N   . GLY A 120 ? 0.7073 0.6127 0.6796 -0.0741 0.1603  -0.1669 118 GLY A N   
236  C CA  . GLY A 120 ? 0.6563 0.5685 0.6125 -0.0718 0.1560  -0.1705 118 GLY A CA  
237  C C   . GLY A 120 ? 0.6394 0.5483 0.5798 -0.0649 0.1539  -0.1573 118 GLY A C   
238  O O   . GLY A 120 ? 0.6498 0.5569 0.5808 -0.0620 0.1559  -0.1549 118 GLY A O   
239  N N   . ILE A 121 ? 0.6105 0.5190 0.5489 -0.0624 0.1502  -0.1489 119 ILE A N   
240  C CA  . ILE A 121 ? 0.6141 0.5201 0.5400 -0.0563 0.1485  -0.1361 119 ILE A CA  
241  C C   . ILE A 121 ? 0.6056 0.5241 0.5141 -0.0543 0.1387  -0.1372 119 ILE A C   
242  O O   . ILE A 121 ? 0.5920 0.5189 0.5004 -0.0561 0.1320  -0.1417 119 ILE A O   
243  C CB  . ILE A 121 ? 0.5928 0.4899 0.5268 -0.0537 0.1512  -0.1248 119 ILE A CB  
244  C CG1 . ILE A 121 ? 0.5984 0.4824 0.5459 -0.0531 0.1615  -0.1206 119 ILE A CG1 
245  C CG2 . ILE A 121 ? 0.4945 0.3926 0.4165 -0.0479 0.1477  -0.1131 119 ILE A CG2 
246  C CD1 . ILE A 121 ? 0.6181 0.4937 0.5738 -0.0496 0.1645  -0.1100 119 ILE A CD1 
247  N N   . PHE A 122 ? 0.5874 0.5073 0.4817 -0.0503 0.1384  -0.1325 120 PHE A N   
248  C CA  . PHE A 122 ? 0.5480 0.4788 0.4235 -0.0473 0.1305  -0.1321 120 PHE A CA  
249  C C   . PHE A 122 ? 0.5207 0.4489 0.3883 -0.0427 0.1295  -0.1180 120 PHE A C   
250  O O   . PHE A 122 ? 0.5303 0.4673 0.3868 -0.0401 0.1214  -0.1143 120 PHE A O   
251  C CB  . PHE A 122 ? 0.5538 0.4883 0.4173 -0.0454 0.1313  -0.1363 120 PHE A CB  
252  C CG  . PHE A 122 ? 0.5643 0.5059 0.4309 -0.0491 0.1295  -0.1517 120 PHE A CG  
253  C CD1 . PHE A 122 ? 0.5884 0.5237 0.4735 -0.0543 0.1356  -0.1585 120 PHE A CD1 
254  C CD2 . PHE A 122 ? 0.5573 0.5121 0.4083 -0.0468 0.1220  -0.1591 120 PHE A CD2 
255  C CE1 . PHE A 122 ? 0.6045 0.5468 0.4942 -0.0583 0.1344  -0.1732 120 PHE A CE1 
256  C CE2 . PHE A 122 ? 0.5648 0.5275 0.4194 -0.0499 0.1198  -0.1740 120 PHE A CE2 
257  C CZ  . PHE A 122 ? 0.5763 0.5328 0.4511 -0.0561 0.1261  -0.1814 120 PHE A CZ  
258  N N   . THR A 123 ? 0.4728 0.3905 0.3483 -0.0408 0.1361  -0.1084 121 THR A N   
259  C CA  . THR A 123 ? 0.4438 0.3605 0.3151 -0.0361 0.1344  -0.0943 121 THR A CA  
260  C C   . THR A 123 ? 0.5089 0.4189 0.3945 -0.0347 0.1357  -0.0852 121 THR A C   
261  O O   . THR A 123 ? 0.5424 0.4454 0.4399 -0.0363 0.1413  -0.0883 121 THR A O   
262  C CB  . THR A 123 ? 0.4573 0.3705 0.3214 -0.0332 0.1407  -0.0907 121 THR A CB  
263  O OG1 . THR A 123 ? 0.4829 0.3877 0.3604 -0.0335 0.1479  -0.0903 121 THR A OG1 
264  C CG2 . THR A 123 ? 0.4732 0.3933 0.3234 -0.0332 0.1389  -0.0986 121 THR A CG2 
265  N N   . VAL A 124 ? 0.5141 0.4263 0.3984 -0.0312 0.1311  -0.0740 122 VAL A N   
266  C CA  . VAL A 124 ? 0.4614 0.3692 0.3577 -0.0288 0.1316  -0.0655 122 VAL A CA  
267  C C   . VAL A 124 ? 0.4717 0.3711 0.3761 -0.0271 0.1410  -0.0646 122 VAL A C   
268  O O   . VAL A 124 ? 0.5136 0.4074 0.4288 -0.0260 0.1441  -0.0633 122 VAL A O   
269  C CB  . VAL A 124 ? 0.4852 0.3972 0.3790 -0.0256 0.1259  -0.0550 122 VAL A CB  
270  C CG1 . VAL A 124 ? 0.4471 0.3563 0.3531 -0.0229 0.1252  -0.0478 122 VAL A CG1 
271  C CG2 . VAL A 124 ? 0.5233 0.4430 0.4085 -0.0265 0.1172  -0.0554 122 VAL A CG2 
272  N N   . ASP A 125 ? 0.4261 0.3245 0.3251 -0.0261 0.1461  -0.0650 123 ASP A N   
273  C CA  . ASP A 125 ? 0.4641 0.3561 0.3719 -0.0234 0.1540  -0.0626 123 ASP A CA  
274  C C   . ASP A 125 ? 0.5109 0.3964 0.4270 -0.0252 0.1586  -0.0687 123 ASP A C   
275  O O   . ASP A 125 ? 0.5165 0.3962 0.4432 -0.0221 0.1628  -0.0646 123 ASP A O   
276  C CB  . ASP A 125 ? 0.4767 0.3702 0.3794 -0.0220 0.1567  -0.0606 123 ASP A CB  
277  C CG  . ASP A 125 ? 0.4555 0.3533 0.3556 -0.0195 0.1543  -0.0523 123 ASP A CG  
278  O OD1 . ASP A 125 ? 0.3941 0.2946 0.2990 -0.0183 0.1486  -0.0471 123 ASP A OD1 
279  O OD2 . ASP A 125 ? 0.4624 0.3616 0.3579 -0.0186 0.1566  -0.0503 123 ASP A OD2 
280  N N   . GLU A 126 ? 0.5506 0.4375 0.4622 -0.0299 0.1578  -0.0785 124 GLU A N   
281  C CA  . GLU A 126 ? 0.5134 0.3942 0.4345 -0.0328 0.1626  -0.0852 124 GLU A CA  
282  C C   . GLU A 126 ? 0.4966 0.3730 0.4280 -0.0323 0.1628  -0.0823 124 GLU A C   
283  O O   . GLU A 126 ? 0.4927 0.3608 0.4349 -0.0313 0.1687  -0.0807 124 GLU A O   
284  C CB  . GLU A 126 ? 0.4952 0.3811 0.4103 -0.0383 0.1605  -0.0977 124 GLU A CB  
285  C CG  . GLU A 126 ? 0.5025 0.3903 0.4099 -0.0385 0.1627  -0.1019 124 GLU A CG  
286  C CD  . GLU A 126 ? 0.5515 0.4477 0.4502 -0.0424 0.1585  -0.1140 124 GLU A CD  
287  O OE1 . GLU A 126 ? 0.5759 0.4793 0.4701 -0.0438 0.1517  -0.1169 124 GLU A OE1 
288  O OE2 . GLU A 126 ? 0.5859 0.4825 0.4824 -0.0438 0.1615  -0.1210 124 GLU A OE2 
289  N N   . LEU A 127 ? 0.4244 0.3060 0.3516 -0.0327 0.1568  -0.0810 125 LEU A N   
290  C CA  . LEU A 127 ? 0.4102 0.2880 0.3459 -0.0315 0.1568  -0.0773 125 LEU A CA  
291  C C   . LEU A 127 ? 0.4630 0.3360 0.4046 -0.0245 0.1593  -0.0659 125 LEU A C   
292  O O   . LEU A 127 ? 0.5032 0.3689 0.4542 -0.0221 0.1637  -0.0627 125 LEU A O   
293  C CB  . LEU A 127 ? 0.3744 0.2611 0.3053 -0.0331 0.1465  -0.0763 125 LEU A CB  
294  C CG  . LEU A 127 ? 0.4278 0.3121 0.3674 -0.0314 0.1448  -0.0709 125 LEU A CG  
295  C CD1 . LEU A 127 ? 0.4289 0.3042 0.3789 -0.0343 0.1536  -0.0777 125 LEU A CD1 
296  C CD2 . LEU A 127 ? 0.3576 0.2516 0.2929 -0.0331 0.1339  -0.0699 125 LEU A CD2 
297  N N   . LEU A 128 ? 0.4858 0.3636 0.4226 -0.0209 0.1564  -0.0596 126 LEU A N   
298  C CA  . LEU A 128 ? 0.4999 0.3757 0.4432 -0.0139 0.1583  -0.0505 126 LEU A CA  
299  C C   . LEU A 128 ? 0.5298 0.3978 0.4809 -0.0116 0.1653  -0.0502 126 LEU A C   
300  O O   . LEU A 128 ? 0.5219 0.3856 0.4801 -0.0057 0.1677  -0.0439 126 LEU A O   
301  C CB  . LEU A 128 ? 0.4460 0.3292 0.3856 -0.0117 0.1541  -0.0456 126 LEU A CB  
302  C CG  . LEU A 128 ? 0.4544 0.3463 0.3872 -0.0140 0.1445  -0.0433 126 LEU A CG  
303  C CD1 . LEU A 128 ? 0.5002 0.3972 0.4334 -0.0111 0.1433  -0.0378 126 LEU A CD1 
304  C CD2 . LEU A 128 ? 0.4097 0.3036 0.3458 -0.0130 0.1379  -0.0394 126 LEU A CD2 
305  N N   . GLN A 129 ? 0.5429 0.4093 0.4918 -0.0157 0.1687  -0.0568 127 GLN A N   
306  C CA  . GLN A 129 ? 0.5747 0.4338 0.5304 -0.0138 0.1757  -0.0565 127 GLN A CA  
307  C C   . GLN A 129 ? 0.5563 0.4063 0.5197 -0.0154 0.1811  -0.0587 127 GLN A C   
308  O O   . GLN A 129 ? 0.5570 0.3997 0.5276 -0.0109 0.1867  -0.0538 127 GLN A O   
309  C CB  . GLN A 129 ? 0.6305 0.4912 0.5809 -0.0175 0.1778  -0.0628 127 GLN A CB  
310  C CG  . GLN A 129 ? 0.7009 0.5537 0.6569 -0.0198 0.1853  -0.0680 127 GLN A CG  
311  C CD  . GLN A 129 ? 0.8088 0.6645 0.7579 -0.0239 0.1864  -0.0757 127 GLN A CD  
312  O OE1 . GLN A 129 ? 0.8441 0.7035 0.7872 -0.0295 0.1841  -0.0846 127 GLN A OE1 
313  N NE2 . GLN A 129 ? 0.8230 0.6777 0.7728 -0.0207 0.1898  -0.0726 127 GLN A NE2 
314  N N   . LYS A 130 ? 0.5398 0.3907 0.5020 -0.0216 0.1795  -0.0660 128 LYS A N   
315  C CA  . LYS A 130 ? 0.6092 0.4521 0.5804 -0.0248 0.1854  -0.0695 128 LYS A CA  
316  C C   . LYS A 130 ? 0.6196 0.4591 0.5956 -0.0219 0.1851  -0.0634 128 LYS A C   
317  O O   . LYS A 130 ? 0.6625 0.4939 0.6471 -0.0234 0.1915  -0.0637 128 LYS A O   
318  C CB  . LYS A 130 ? 0.6524 0.4993 0.6223 -0.0337 0.1845  -0.0827 128 LYS A CB  
319  C CG  . LYS A 130 ? 0.7162 0.5637 0.6839 -0.0367 0.1876  -0.0897 128 LYS A CG  
320  C CD  . LYS A 130 ? 0.7835 0.6399 0.7456 -0.0438 0.1831  -0.1026 128 LYS A CD  
321  C CE  . LYS A 130 ? 0.8540 0.7105 0.8144 -0.0464 0.1869  -0.1101 128 LYS A CE  
322  N NZ  . LYS A 130 ? 0.8974 0.7535 0.8508 -0.0411 0.1874  -0.1031 128 LYS A NZ  
323  N N   . ALA A 131 ? 0.5476 0.3932 0.5182 -0.0179 0.1783  -0.0576 129 ALA A N   
324  C CA  . ALA A 131 ? 0.5593 0.4036 0.5324 -0.0159 0.1766  -0.0532 129 ALA A CA  
325  C C   . ALA A 131 ? 0.5337 0.3669 0.5154 -0.0116 0.1843  -0.0468 129 ALA A C   
326  O O   . ALA A 131 ? 0.5048 0.3332 0.4924 -0.0151 0.1879  -0.0491 129 ALA A O   
327  C CB  . ALA A 131 ? 0.4909 0.3427 0.4579 -0.0101 0.1693  -0.0459 129 ALA A CB  
328  N N   . ASP A 132 ? 0.5658 0.3956 0.5481 -0.0039 0.1870  -0.0387 130 ASP A N   
329  C CA  . ASP A 132 ? 0.6625 0.4822 0.6505 0.0022  0.1942  -0.0305 130 ASP A CA  
330  C C   . ASP A 132 ? 0.7196 0.5288 0.7157 -0.0037 0.2043  -0.0351 130 ASP A C   
331  O O   . ASP A 132 ? 0.7792 0.5792 0.7799 0.0001  0.2113  -0.0283 130 ASP A O   
332  C CB  . ASP A 132 ? 0.6871 0.5071 0.6740 0.0118  0.1947  -0.0223 130 ASP A CB  
333  C CG  . ASP A 132 ? 0.7253 0.5555 0.7072 0.0191  0.1861  -0.0164 130 ASP A CG  
334  O OD1 . ASP A 132 ? 0.7561 0.5915 0.7350 0.0174  0.1804  -0.0172 130 ASP A OD1 
335  O OD2 . ASP A 132 ? 0.7312 0.5651 0.7131 0.0265  0.1852  -0.0115 130 ASP A OD2 
336  N N   . SER A 133 ? 0.6932 0.5043 0.6910 -0.0127 0.2054  -0.0464 131 SER A N   
337  C CA  . SER A 133 ? 0.7055 0.5082 0.7127 -0.0190 0.2154  -0.0521 131 SER A CA  
338  C C   . SER A 133 ? 0.7045 0.5107 0.7172 -0.0287 0.2150  -0.0627 131 SER A C   
339  O O   . SER A 133 ? 0.6912 0.4937 0.7133 -0.0357 0.2225  -0.0704 131 SER A O   
340  C CB  . SER A 133 ? 0.7183 0.5204 0.7257 -0.0216 0.2186  -0.0577 131 SER A CB  
341  O OG  . SER A 133 ? 0.7070 0.5190 0.7100 -0.0290 0.2126  -0.0695 131 SER A OG  
342  N N   . ILE A 134 ? 0.6522 0.4664 0.6597 -0.0290 0.2062  -0.0635 132 ILE A N   
343  C CA  . ILE A 134 ? 0.6431 0.4617 0.6561 -0.0367 0.2049  -0.0723 132 ILE A CA  
344  C C   . ILE A 134 ? 0.7009 0.5143 0.7172 -0.0324 0.2069  -0.0632 132 ILE A C   
345  O O   . ILE A 134 ? 0.7325 0.5506 0.7416 -0.0279 0.1993  -0.0581 132 ILE A O   
346  C CB  . ILE A 134 ? 0.6244 0.4564 0.6284 -0.0402 0.1934  -0.0803 132 ILE A CB  
347  C CG1 . ILE A 134 ? 0.6854 0.5228 0.6838 -0.0433 0.1913  -0.0881 132 ILE A CG1 
348  C CG2 . ILE A 134 ? 0.5744 0.4124 0.5848 -0.0475 0.1911  -0.0898 132 ILE A CG2 
349  C CD1 . ILE A 134 ? 0.6569 0.5069 0.6429 -0.0446 0.1805  -0.0931 132 ILE A CD1 
350  N N   . PRO A 135 ? 0.7313 0.5350 0.7583 -0.0335 0.2179  -0.0607 133 PRO A N   
351  C CA  . PRO A 135 ? 0.7159 0.5128 0.7453 -0.0282 0.2222  -0.0502 133 PRO A CA  
352  C C   . PRO A 135 ? 0.6966 0.5003 0.7272 -0.0314 0.2164  -0.0536 133 PRO A C   
353  O O   . PRO A 135 ? 0.6784 0.4784 0.7067 -0.0251 0.2168  -0.0437 133 PRO A O   
354  C CB  . PRO A 135 ? 0.7178 0.5047 0.7601 -0.0318 0.2369  -0.0504 133 PRO A CB  
355  C CG  . PRO A 135 ? 0.7529 0.5383 0.7960 -0.0340 0.2400  -0.0553 133 PRO A CG  
356  C CD  . PRO A 135 ? 0.7474 0.5454 0.7842 -0.0387 0.2282  -0.0664 133 PRO A CD  
357  N N   . SER A 136 ? 0.6694 0.4834 0.7028 -0.0402 0.2107  -0.0673 134 SER A N   
358  C CA  . SER A 136 ? 0.6198 0.4410 0.6560 -0.0440 0.2054  -0.0721 134 SER A CA  
359  C C   . SER A 136 ? 0.6042 0.4330 0.6273 -0.0394 0.1931  -0.0688 134 SER A C   
360  O O   . SER A 136 ? 0.5515 0.3866 0.5759 -0.0422 0.1879  -0.0729 134 SER A O   
361  C CB  . SER A 136 ? 0.6454 0.4766 0.6905 -0.0550 0.2037  -0.0891 134 SER A CB  
362  O OG  . SER A 136 ? 0.6990 0.5400 0.7334 -0.0565 0.1936  -0.0963 134 SER A OG  
363  N N   . LEU A 137 ? 0.6052 0.4343 0.6166 -0.0325 0.1887  -0.0621 135 LEU A N   
364  C CA  . LEU A 137 ? 0.5531 0.3905 0.5533 -0.0285 0.1782  -0.0592 135 LEU A CA  
365  C C   . LEU A 137 ? 0.5305 0.3640 0.5300 -0.0213 0.1785  -0.0481 135 LEU A C   
366  O O   . LEU A 137 ? 0.5254 0.3495 0.5279 -0.0156 0.1856  -0.0389 135 LEU A O   
367  C CB  . LEU A 137 ? 0.5281 0.3686 0.5181 -0.0236 0.1744  -0.0552 135 LEU A CB  
368  C CG  . LEU A 137 ? 0.5379 0.3821 0.5258 -0.0289 0.1741  -0.0642 135 LEU A CG  
369  C CD1 . LEU A 137 ? 0.5108 0.3582 0.4893 -0.0231 0.1705  -0.0583 135 LEU A CD1 
370  C CD2 . LEU A 137 ? 0.5276 0.3820 0.5135 -0.0371 0.1679  -0.0768 135 LEU A CD2 
371  N N   . THR A 138 ? 0.5254 0.3672 0.5203 -0.0212 0.1698  -0.0478 136 THR A N   
372  C CA  . THR A 138 ? 0.5200 0.3595 0.5139 -0.0142 0.1691  -0.0374 136 THR A CA  
373  C C   . THR A 138 ? 0.4937 0.3342 0.4786 -0.0041 0.1657  -0.0264 136 THR A C   
374  O O   . THR A 138 ? 0.4440 0.2896 0.4242 -0.0039 0.1617  -0.0274 136 THR A O   
375  C CB  . THR A 138 ? 0.4753 0.3260 0.4684 -0.0180 0.1579  -0.0387 136 THR A CB  
376  O OG1 . THR A 138 ? 0.4811 0.3449 0.4659 -0.0196 0.1452  -0.0398 136 THR A OG1 
377  C CG2 . THR A 138 ? 0.4900 0.3413 0.4938 -0.0274 0.1613  -0.0502 136 THR A CG2 
378  N N   . ASP A 139 ? 0.4663 0.3023 0.4494 0.0047  0.1678  -0.0165 137 ASP A N   
379  C CA  . ASP A 139 ? 0.5188 0.3594 0.4942 0.0146  0.1623  -0.0073 137 ASP A CA  
380  C C   . ASP A 139 ? 0.5212 0.3771 0.4914 0.0116  0.1475  -0.0086 137 ASP A C   
381  O O   . ASP A 139 ? 0.5647 0.4262 0.5311 0.0153  0.1431  -0.0063 137 ASP A O   
382  C CB  . ASP A 139 ? 0.5435 0.3794 0.5165 0.0245  0.1650  0.0026  137 ASP A CB  
383  C CG  . ASP A 139 ? 0.6052 0.4280 0.5823 0.0272  0.1756  0.0083  137 ASP A CG  
384  O OD1 . ASP A 139 ? 0.6037 0.4209 0.5851 0.0236  0.1816  0.0053  137 ASP A OD1 
385  O OD2 . ASP A 139 ? 0.6735 0.4915 0.6490 0.0329  0.1786  0.0161  137 ASP A OD2 
386  N N   . GLN A 140 ? 0.4675 0.3299 0.4384 0.0053  0.1405  -0.0123 138 GLN A N   
387  C CA  . GLN A 140 ? 0.4372 0.3125 0.4031 0.0030  0.1276  -0.0127 138 GLN A CA  
388  C C   . GLN A 140 ? 0.4298 0.3097 0.3936 -0.0022 0.1253  -0.0185 138 GLN A C   
389  O O   . GLN A 140 ? 0.4069 0.2938 0.3663 -0.0004 0.1190  -0.0161 138 GLN A O   
390  C CB  . GLN A 140 ? 0.4257 0.3065 0.3931 -0.0023 0.1215  -0.0153 138 GLN A CB  
391  C CG  . GLN A 140 ? 0.4635 0.3563 0.4258 -0.0039 0.1092  -0.0148 138 GLN A CG  
392  C CD  . GLN A 140 ? 0.5181 0.4161 0.4818 -0.0072 0.1032  -0.0158 138 GLN A CD  
393  O OE1 . GLN A 140 ? 0.5678 0.4744 0.5279 -0.0078 0.0941  -0.0145 138 GLN A OE1 
394  N NE2 . GLN A 140 ? 0.4886 0.3812 0.4585 -0.0091 0.1090  -0.0181 138 GLN A NE2 
395  N N   . GLN A 141 ? 0.4171 0.2927 0.3842 -0.0086 0.1312  -0.0266 139 GLN A N   
396  C CA  . GLN A 141 ? 0.4331 0.3121 0.3971 -0.0130 0.1305  -0.0326 139 GLN A CA  
397  C C   . GLN A 141 ? 0.4496 0.3250 0.4120 -0.0072 0.1348  -0.0284 139 GLN A C   
398  O O   . GLN A 141 ? 0.4591 0.3404 0.4170 -0.0077 0.1308  -0.0288 139 GLN A O   
399  C CB  . GLN A 141 ? 0.4474 0.3226 0.4163 -0.0205 0.1366  -0.0434 139 GLN A CB  
400  C CG  . GLN A 141 ? 0.4613 0.3444 0.4316 -0.0269 0.1300  -0.0498 139 GLN A CG  
401  C CD  . GLN A 141 ? 0.5032 0.3833 0.4819 -0.0341 0.1367  -0.0616 139 GLN A CD  
402  O OE1 . GLN A 141 ? 0.4992 0.3679 0.4854 -0.0339 0.1483  -0.0633 139 GLN A OE1 
403  N NE2 . GLN A 141 ? 0.5237 0.4143 0.5019 -0.0400 0.1295  -0.0701 139 GLN A NE2 
404  N N   . ARG A 142 ? 0.4240 0.2899 0.3902 -0.0010 0.1434  -0.0238 140 ARG A N   
405  C CA  . ARG A 142 ? 0.4672 0.3303 0.4329 0.0058  0.1478  -0.0196 140 ARG A CA  
406  C C   . ARG A 142 ? 0.4425 0.3155 0.4047 0.0115  0.1388  -0.0132 140 ARG A C   
407  O O   . ARG A 142 ? 0.4632 0.3395 0.4250 0.0140  0.1387  -0.0126 140 ARG A O   
408  C CB  . ARG A 142 ? 0.5098 0.3603 0.4797 0.0127  0.1594  -0.0152 140 ARG A CB  
409  C CG  . ARG A 142 ? 0.5331 0.3736 0.5091 0.0061  0.1686  -0.0217 140 ARG A CG  
410  C CD  . ARG A 142 ? 0.5738 0.4032 0.5542 0.0119  0.1770  -0.0146 140 ARG A CD  
411  N NE  . ARG A 142 ? 0.6217 0.4421 0.6101 0.0047  0.1854  -0.0197 140 ARG A NE  
412  C CZ  . ARG A 142 ? 0.6733 0.4913 0.6664 -0.0030 0.1899  -0.0282 140 ARG A CZ  
413  N NH1 . ARG A 142 ? 0.6510 0.4739 0.6403 -0.0039 0.1869  -0.0319 140 ARG A NH1 
414  N NH2 . ARG A 142 ? 0.6818 0.4932 0.6841 -0.0098 0.1977  -0.0333 140 ARG A NH2 
415  N N   . VAL A 143 ? 0.3875 0.2656 0.3485 0.0134  0.1317  -0.0093 141 VAL A N   
416  C CA  . VAL A 143 ? 0.3616 0.2504 0.3207 0.0171  0.1225  -0.0054 141 VAL A CA  
417  C C   . VAL A 143 ? 0.3905 0.2871 0.3472 0.0102  0.1162  -0.0095 141 VAL A C   
418  O O   . VAL A 143 ? 0.4034 0.3061 0.3605 0.0122  0.1131  -0.0082 141 VAL A O   
419  C CB  . VAL A 143 ? 0.3305 0.2223 0.2887 0.0204  0.1168  -0.0010 141 VAL A CB  
420  C CG1 . VAL A 143 ? 0.2632 0.1665 0.2210 0.0233  0.1074  0.0014  141 VAL A CG1 
421  C CG2 . VAL A 143 ? 0.3008 0.1845 0.2596 0.0291  0.1240  0.0044  141 VAL A CG2 
422  N N   . GLY A 144 ? 0.4064 0.3030 0.3608 0.0025  0.1146  -0.0145 142 GLY A N   
423  C CA  . GLY A 144 ? 0.3739 0.2772 0.3239 -0.0028 0.1092  -0.0176 142 GLY A CA  
424  C C   . GLY A 144 ? 0.4393 0.3413 0.3882 -0.0035 0.1141  -0.0201 142 GLY A C   
425  O O   . GLY A 144 ? 0.4478 0.3552 0.3943 -0.0041 0.1111  -0.0194 142 GLY A O   
426  N N   . ILE A 145 ? 0.4449 0.3389 0.3961 -0.0033 0.1227  -0.0231 143 ILE A N   
427  C CA  . ILE A 145 ? 0.4506 0.3422 0.4012 -0.0039 0.1285  -0.0261 143 ILE A CA  
428  C C   . ILE A 145 ? 0.4435 0.3372 0.3978 0.0032  0.1296  -0.0207 143 ILE A C   
429  O O   . ILE A 145 ? 0.4096 0.3075 0.3630 0.0026  0.1292  -0.0211 143 ILE A O   
430  C CB  . ILE A 145 ? 0.4572 0.3388 0.4106 -0.0057 0.1383  -0.0315 143 ILE A CB  
431  C CG1 . ILE A 145 ? 0.4717 0.3541 0.4223 -0.0139 0.1371  -0.0400 143 ILE A CG1 
432  C CG2 . ILE A 145 ? 0.4414 0.3190 0.3959 -0.0037 0.1459  -0.0328 143 ILE A CG2 
433  C CD1 . ILE A 145 ? 0.4572 0.3303 0.4140 -0.0163 0.1455  -0.0454 143 ILE A CD1 
434  N N   . LYS A 146 ? 0.4041 0.2952 0.3628 0.0103  0.1312  -0.0157 144 LYS A N   
435  C CA  . LYS A 146 ? 0.4321 0.3268 0.3952 0.0182  0.1318  -0.0113 144 LYS A CA  
436  C C   . LYS A 146 ? 0.4350 0.3412 0.3993 0.0184  0.1232  -0.0097 144 LYS A C   
437  O O   . LYS A 146 ? 0.4100 0.3214 0.3786 0.0212  0.1237  -0.0093 144 LYS A O   
438  C CB  . LYS A 146 ? 0.5037 0.3944 0.4692 0.0271  0.1345  -0.0059 144 LYS A CB  
439  C CG  . LYS A 146 ? 0.5763 0.4756 0.5457 0.0365  0.1307  -0.0013 144 LYS A CG  
440  C CD  . LYS A 146 ? 0.6336 0.5286 0.6031 0.0470  0.1340  0.0045  144 LYS A CD  
441  C CE  . LYS A 146 ? 0.7085 0.6146 0.6817 0.0573  0.1293  0.0078  144 LYS A CE  
442  N NZ  . LYS A 146 ? 0.7680 0.6734 0.7385 0.0685  0.1292  0.0140  144 LYS A NZ  
443  N N   . TYR A 147 ? 0.4347 0.3450 0.3965 0.0152  0.1160  -0.0091 145 TYR A N   
444  C CA  . TYR A 147 ? 0.4191 0.3391 0.3832 0.0151  0.1088  -0.0077 145 TYR A CA  
445  C C   . TYR A 147 ? 0.4072 0.3288 0.3667 0.0076  0.1072  -0.0103 145 TYR A C   
446  O O   . TYR A 147 ? 0.3798 0.3076 0.3404 0.0063  0.1017  -0.0090 145 TYR A O   
447  C CB  . TYR A 147 ? 0.4079 0.3319 0.3726 0.0179  0.1020  -0.0047 145 TYR A CB  
448  C CG  . TYR A 147 ? 0.3733 0.2998 0.3422 0.0275  0.1017  -0.0014 145 TYR A CG  
449  C CD1 . TYR A 147 ? 0.3790 0.2981 0.3454 0.0322  0.1058  0.0012  145 TYR A CD1 
450  C CD2 . TYR A 147 ? 0.3492 0.2860 0.3249 0.0323  0.0974  -0.0010 145 TYR A CD2 
451  C CE1 . TYR A 147 ? 0.3869 0.3085 0.3551 0.0426  0.1057  0.0052  145 TYR A CE1 
452  C CE2 . TYR A 147 ? 0.3271 0.2684 0.3057 0.0423  0.0960  0.0015  145 TYR A CE2 
453  C CZ  . TYR A 147 ? 0.3562 0.2895 0.3298 0.0480  0.1001  0.0051  145 TYR A CZ  
454  O OH  . TYR A 147 ? 0.3873 0.3250 0.3617 0.0596  0.0991  0.0085  145 TYR A OH  
455  N N   . PHE A 148 ? 0.4366 0.3528 0.3910 0.0032  0.1123  -0.0141 146 PHE A N   
456  C CA  . PHE A 148 ? 0.4231 0.3407 0.3705 -0.0027 0.1111  -0.0164 146 PHE A CA  
457  C C   . PHE A 148 ? 0.3968 0.3201 0.3466 -0.0026 0.1099  -0.0142 146 PHE A C   
458  O O   . PHE A 148 ? 0.3791 0.3052 0.3250 -0.0052 0.1059  -0.0129 146 PHE A O   
459  C CB  . PHE A 148 ? 0.4726 0.3846 0.4143 -0.0062 0.1175  -0.0217 146 PHE A CB  
460  C CG  . PHE A 148 ? 0.4503 0.3644 0.3825 -0.0109 0.1160  -0.0242 146 PHE A CG  
461  C CD1 . PHE A 148 ? 0.4381 0.3541 0.3639 -0.0141 0.1108  -0.0259 146 PHE A CD1 
462  C CD2 . PHE A 148 ? 0.3792 0.2940 0.3086 -0.0113 0.1201  -0.0243 146 PHE A CD2 
463  C CE1 . PHE A 148 ? 0.4666 0.3855 0.3821 -0.0168 0.1091  -0.0275 146 PHE A CE1 
464  C CE2 . PHE A 148 ? 0.4441 0.3604 0.3627 -0.0142 0.1193  -0.0256 146 PHE A CE2 
465  C CZ  . PHE A 148 ? 0.4737 0.3924 0.3848 -0.0165 0.1135  -0.0270 146 PHE A CZ  
466  N N   . TYR A 149 ? 0.3946 0.3193 0.3516 0.0007  0.1141  -0.0140 147 TYR A N   
467  C CA  . TYR A 149 ? 0.3851 0.3154 0.3475 0.0004  0.1142  -0.0127 147 TYR A CA  
468  C C   . TYR A 149 ? 0.3931 0.3299 0.3615 0.0016  0.1072  -0.0101 147 TYR A C   
469  O O   . TYR A 149 ? 0.4406 0.3789 0.4073 -0.0015 0.1057  -0.0089 147 TYR A O   
470  C CB  . TYR A 149 ? 0.4087 0.3408 0.3802 0.0041  0.1199  -0.0138 147 TYR A CB  
471  C CG  . TYR A 149 ? 0.4031 0.3431 0.3856 0.0047  0.1194  -0.0132 147 TYR A CG  
472  C CD1 . TYR A 149 ? 0.4229 0.3621 0.4041 0.0008  0.1239  -0.0133 147 TYR A CD1 
473  C CD2 . TYR A 149 ? 0.4000 0.3482 0.3945 0.0096  0.1149  -0.0130 147 TYR A CD2 
474  C CE1 . TYR A 149 ? 0.4599 0.4057 0.4534 0.0007  0.1248  -0.0133 147 TYR A CE1 
475  C CE2 . TYR A 149 ? 0.4555 0.4120 0.4625 0.0096  0.1146  -0.0142 147 TYR A CE2 
476  C CZ  . TYR A 149 ? 0.4972 0.4520 0.5046 0.0047  0.1200  -0.0145 147 TYR A CZ  
477  O OH  . TYR A 149 ? 0.5349 0.4975 0.5572 0.0042  0.1209  -0.0162 147 TYR A OH  
478  N N   . ASP A 150 ? 0.3941 0.3343 0.3690 0.0065  0.1036  -0.0094 148 ASP A N   
479  C CA  . ASP A 150 ? 0.3966 0.3436 0.3774 0.0081  0.0968  -0.0080 148 ASP A CA  
480  C C   . ASP A 150 ? 0.4039 0.3489 0.3774 0.0038  0.0924  -0.0064 148 ASP A C   
481  O O   . ASP A 150 ? 0.3713 0.3199 0.3484 0.0020  0.0898  -0.0056 148 ASP A O   
482  C CB  . ASP A 150 ? 0.4380 0.3876 0.4223 0.0148  0.0934  -0.0072 148 ASP A CB  
483  C CG  . ASP A 150 ? 0.5505 0.5037 0.5423 0.0210  0.0967  -0.0082 148 ASP A CG  
484  O OD1 . ASP A 150 ? 0.6296 0.5760 0.6173 0.0223  0.1024  -0.0080 148 ASP A OD1 
485  O OD2 . ASP A 150 ? 0.5299 0.4931 0.5324 0.0247  0.0937  -0.0097 148 ASP A OD2 
486  N N   . ILE A 151 ? 0.3985 0.3377 0.3629 0.0024  0.0921  -0.0063 149 ILE A N   
487  C CA  . ILE A 151 ? 0.3790 0.3173 0.3369 -0.0008 0.0874  -0.0052 149 ILE A CA  
488  C C   . ILE A 151 ? 0.3815 0.3201 0.3350 -0.0047 0.0881  -0.0043 149 ILE A C   
489  O O   . ILE A 151 ? 0.3738 0.3140 0.3260 -0.0059 0.0839  -0.0022 149 ILE A O   
490  C CB  . ILE A 151 ? 0.3503 0.2832 0.3009 -0.0023 0.0882  -0.0068 149 ILE A CB  
491  C CG1 . ILE A 151 ? 0.3174 0.2491 0.2721 0.0023  0.0878  -0.0060 149 ILE A CG1 
492  C CG2 . ILE A 151 ? 0.3421 0.2755 0.2858 -0.0060 0.0837  -0.0066 149 ILE A CG2 
493  C CD1 . ILE A 151 ? 0.3027 0.2275 0.2537 0.0011  0.0917  -0.0082 149 ILE A CD1 
494  N N   . ASN A 152 ? 0.3509 0.2872 0.3016 -0.0061 0.0940  -0.0056 150 ASN A N   
495  C CA  . ASN A 152 ? 0.4069 0.3421 0.3510 -0.0088 0.0962  -0.0040 150 ASN A CA  
496  C C   . ASN A 152 ? 0.4097 0.3474 0.3630 -0.0086 0.0995  -0.0023 150 ASN A C   
497  O O   . ASN A 152 ? 0.3684 0.3038 0.3168 -0.0102 0.1034  -0.0002 150 ASN A O   
498  C CB  . ASN A 152 ? 0.4623 0.3933 0.3954 -0.0107 0.1009  -0.0067 150 ASN A CB  
499  C CG  . ASN A 152 ? 0.4924 0.4222 0.4172 -0.0121 0.0972  -0.0095 150 ASN A CG  
500  O OD1 . ASN A 152 ? 0.5518 0.4828 0.4680 -0.0133 0.0935  -0.0089 150 ASN A OD1 
501  N ND2 . ASN A 152 ? 0.4077 0.3352 0.3359 -0.0116 0.0987  -0.0128 150 ASN A ND2 
502  N N   . GLU A 153 ? 0.3931 0.3357 0.3600 -0.0062 0.0981  -0.0033 151 GLU A N   
503  C CA  . GLU A 153 ? 0.4329 0.3796 0.4122 -0.0064 0.1001  -0.0032 151 GLU A CA  
504  C C   . GLU A 153 ? 0.4295 0.3784 0.4118 -0.0069 0.0945  -0.0014 151 GLU A C   
505  O O   . GLU A 153 ? 0.4314 0.3837 0.4163 -0.0047 0.0882  -0.0022 151 GLU A O   
506  C CB  . GLU A 153 ? 0.4377 0.3913 0.4316 -0.0030 0.1002  -0.0067 151 GLU A CB  
507  C CG  . GLU A 153 ? 0.4566 0.4086 0.4507 -0.0021 0.1067  -0.0085 151 GLU A CG  
508  C CD  . GLU A 153 ? 0.4720 0.4212 0.4664 -0.0054 0.1146  -0.0078 151 GLU A CD  
509  O OE1 . GLU A 153 ? 0.4472 0.4014 0.4557 -0.0059 0.1171  -0.0091 151 GLU A OE1 
510  O OE2 . GLU A 153 ? 0.4555 0.3977 0.4361 -0.0073 0.1185  -0.0063 151 GLU A OE2 
511  N N   . LYS A 154 ? 0.4296 0.3761 0.4115 -0.0094 0.0976  0.0014  152 LYS A N   
512  C CA  . LYS A 154 ? 0.4366 0.3842 0.4221 -0.0099 0.0934  0.0031  152 LYS A CA  
513  C C   . LYS A 154 ? 0.3796 0.3349 0.3833 -0.0088 0.0909  -0.0009 152 LYS A C   
514  O O   . LYS A 154 ? 0.3280 0.2882 0.3438 -0.0084 0.0942  -0.0047 152 LYS A O   
515  C CB  . LYS A 154 ? 0.4698 0.4115 0.4499 -0.0119 0.0986  0.0079  152 LYS A CB  
516  C CG  . LYS A 154 ? 0.5016 0.4413 0.4890 -0.0134 0.1083  0.0081  152 LYS A CG  
517  C CD  . LYS A 154 ? 0.5620 0.4936 0.5380 -0.0139 0.1143  0.0145  152 LYS A CD  
518  C CE  . LYS A 154 ? 0.6176 0.5454 0.5982 -0.0151 0.1259  0.0157  152 LYS A CE  
519  N NZ  . LYS A 154 ? 0.6593 0.5785 0.6280 -0.0143 0.1326  0.0232  152 LYS A NZ  
520  N N   . ILE A 155 ? 0.3468 0.3045 0.3527 -0.0082 0.0847  -0.0009 153 ILE A N   
521  C CA  . ILE A 155 ? 0.3211 0.2873 0.3434 -0.0069 0.0814  -0.0058 153 ILE A CA  
522  C C   . ILE A 155 ? 0.3710 0.3359 0.4036 -0.0104 0.0857  -0.0058 153 ILE A C   
523  O O   . ILE A 155 ? 0.3567 0.3152 0.3820 -0.0119 0.0862  -0.0010 153 ILE A O   
524  C CB  . ILE A 155 ? 0.3158 0.2852 0.3349 -0.0039 0.0728  -0.0063 153 ILE A CB  
525  C CG1 . ILE A 155 ? 0.2960 0.2624 0.3020 -0.0013 0.0707  -0.0045 153 ILE A CG1 
526  C CG2 . ILE A 155 ? 0.2967 0.2769 0.3310 -0.0010 0.0685  -0.0126 153 ILE A CG2 
527  C CD1 . ILE A 155 ? 0.2548 0.2222 0.2558 0.0014  0.0638  -0.0038 153 ILE A CD1 
528  N N   . PRO A 156 ? 0.3989 0.3698 0.4494 -0.0115 0.0895  -0.0111 154 PRO A N   
529  C CA  . PRO A 156 ? 0.3878 0.3573 0.4514 -0.0151 0.0945  -0.0121 154 PRO A CA  
530  C C   . PRO A 156 ? 0.3938 0.3684 0.4642 -0.0143 0.0873  -0.0155 154 PRO A C   
531  O O   . PRO A 156 ? 0.3789 0.3629 0.4525 -0.0107 0.0794  -0.0205 154 PRO A O   
532  C CB  . PRO A 156 ? 0.3680 0.3448 0.4513 -0.0164 0.1000  -0.0188 154 PRO A CB  
533  C CG  . PRO A 156 ? 0.3751 0.3604 0.4574 -0.0121 0.0946  -0.0225 154 PRO A CG  
534  C CD  . PRO A 156 ? 0.3659 0.3442 0.4256 -0.0097 0.0909  -0.0161 154 PRO A CD  
535  N N   . MET A 157 ? 0.3854 0.3534 0.4569 -0.0169 0.0905  -0.0124 155 MET A N   
536  C CA  . MET A 157 ? 0.4189 0.3904 0.4977 -0.0167 0.0850  -0.0157 155 MET A CA  
537  C C   . MET A 157 ? 0.4198 0.4058 0.5162 -0.0152 0.0793  -0.0266 155 MET A C   
538  O O   . MET A 157 ? 0.3857 0.3776 0.4805 -0.0121 0.0708  -0.0294 155 MET A O   
539  C CB  . MET A 157 ? 0.4525 0.4160 0.5393 -0.0206 0.0931  -0.0134 155 MET A CB  
540  C CG  . MET A 157 ? 0.4971 0.4626 0.5912 -0.0207 0.0886  -0.0165 155 MET A CG  
541  S SD  . MET A 157 ? 1.0923 1.0514 1.2066 -0.0259 0.1002  -0.0183 155 MET A SD  
542  C CE  . MET A 157 ? 0.5717 0.5134 0.6672 -0.0257 0.1102  -0.0039 155 MET A CE  
543  N N   . GLN A 158 ? 0.3913 0.3838 0.5047 -0.0169 0.0841  -0.0329 156 GLN A N   
544  C CA  . GLN A 158 ? 0.4221 0.4304 0.5550 -0.0154 0.0791  -0.0447 156 GLN A CA  
545  C C   . GLN A 158 ? 0.4008 0.4186 0.5251 -0.0085 0.0694  -0.0466 156 GLN A C   
546  O O   . GLN A 158 ? 0.4173 0.4476 0.5497 -0.0048 0.0618  -0.0544 156 GLN A O   
547  C CB  . GLN A 158 ? 0.5021 0.5156 0.6559 -0.0189 0.0872  -0.0512 156 GLN A CB  
548  C CG  . GLN A 158 ? 0.6015 0.6066 0.7690 -0.0256 0.0983  -0.0511 156 GLN A CG  
549  C CD  . GLN A 158 ? 0.6790 0.6663 0.8306 -0.0279 0.1084  -0.0387 156 GLN A CD  
550  O OE1 . GLN A 158 ? 0.6335 0.6149 0.7632 -0.0249 0.1062  -0.0306 156 GLN A OE1 
551  N NE2 . GLN A 158 ? 0.7337 0.7126 0.8969 -0.0327 0.1200  -0.0375 156 GLN A NE2 
552  N N   . GLU A 159 ? 0.3360 0.3478 0.4438 -0.0063 0.0703  -0.0396 157 GLU A N   
553  C CA  . GLU A 159 ? 0.3417 0.3598 0.4400 0.0007  0.0627  -0.0398 157 GLU A CA  
554  C C   . GLU A 159 ? 0.3444 0.3590 0.4287 0.0034  0.0559  -0.0359 157 GLU A C   
555  O O   . GLU A 159 ? 0.3308 0.3535 0.4130 0.0096  0.0488  -0.0388 157 GLU A O   
556  C CB  . GLU A 159 ? 0.3116 0.3242 0.3985 0.0021  0.0665  -0.0345 157 GLU A CB  
557  C CG  . GLU A 159 ? 0.3255 0.3452 0.4066 0.0100  0.0604  -0.0355 157 GLU A CG  
558  C CD  . GLU A 159 ? 0.3602 0.3726 0.4292 0.0114  0.0646  -0.0301 157 GLU A CD  
559  O OE1 . GLU A 159 ? 0.3662 0.3759 0.4222 0.0162  0.0613  -0.0265 157 GLU A OE1 
560  O OE2 . GLU A 159 ? 0.3565 0.3658 0.4294 0.0077  0.0718  -0.0297 157 GLU A OE2 
561  N N   . SER A 160 ? 0.3246 0.3274 0.3994 -0.0006 0.0585  -0.0294 158 SER A N   
562  C CA  . SER A 160 ? 0.3251 0.3246 0.3883 0.0014  0.0528  -0.0260 158 SER A CA  
563  C C   . SER A 160 ? 0.3441 0.3533 0.4189 0.0033  0.0470  -0.0334 158 SER A C   
564  O O   . SER A 160 ? 0.3352 0.3476 0.4027 0.0082  0.0405  -0.0335 158 SER A O   
565  C CB  . SER A 160 ? 0.3206 0.3075 0.3738 -0.0029 0.0565  -0.0184 158 SER A CB  
566  O OG  . SER A 160 ? 0.3386 0.3180 0.3767 -0.0030 0.0590  -0.0120 158 SER A OG  
567  N N   . VAL A 161 ? 0.3549 0.3687 0.4479 -0.0005 0.0501  -0.0400 159 VAL A N   
568  C CA  . VAL A 161 ? 0.3565 0.3818 0.4635 0.0011  0.0448  -0.0497 159 VAL A CA  
569  C C   . VAL A 161 ? 0.3460 0.3856 0.4533 0.0090  0.0369  -0.0557 159 VAL A C   
570  O O   . VAL A 161 ? 0.3887 0.4351 0.4939 0.0138  0.0299  -0.0593 159 VAL A O   
571  C CB  . VAL A 161 ? 0.3546 0.3842 0.4852 -0.0046 0.0504  -0.0580 159 VAL A CB  
572  C CG1 . VAL A 161 ? 0.3461 0.3910 0.4929 -0.0025 0.0439  -0.0708 159 VAL A CG1 
573  C CG2 . VAL A 161 ? 0.3300 0.3449 0.4605 -0.0111 0.0589  -0.0517 159 VAL A CG2 
574  N N   . LEU A 162 ? 0.3122 0.3562 0.4214 0.0112  0.0386  -0.0563 160 LEU A N   
575  C CA  . LEU A 162 ? 0.3010 0.3586 0.4101 0.0200  0.0319  -0.0611 160 LEU A CA  
576  C C   . LEU A 162 ? 0.3241 0.3761 0.4115 0.0266  0.0278  -0.0532 160 LEU A C   
577  O O   . LEU A 162 ? 0.3722 0.4339 0.4564 0.0348  0.0210  -0.0564 160 LEU A O   
578  C CB  . LEU A 162 ? 0.2574 0.3199 0.3739 0.0207  0.0357  -0.0628 160 LEU A CB  
579  C CG  . LEU A 162 ? 0.3194 0.3891 0.4599 0.0147  0.0405  -0.0716 160 LEU A CG  
580  C CD1 . LEU A 162 ? 0.2826 0.3559 0.4282 0.0160  0.0447  -0.0720 160 LEU A CD1 
581  C CD2 . LEU A 162 ? 0.3051 0.3927 0.4642 0.0169  0.0340  -0.0852 160 LEU A CD2 
582  N N   . HIS A 163 ? 0.3006 0.3374 0.3734 0.0234  0.0323  -0.0433 161 HIS A N   
583  C CA  . HIS A 163 ? 0.3194 0.3496 0.3737 0.0284  0.0300  -0.0361 161 HIS A CA  
584  C C   . HIS A 163 ? 0.3590 0.3898 0.4099 0.0298  0.0250  -0.0369 161 HIS A C   
585  O O   . HIS A 163 ? 0.3340 0.3677 0.3759 0.0373  0.0208  -0.0358 161 HIS A O   
586  C CB  . HIS A 163 ? 0.2952 0.3102 0.3372 0.0233  0.0359  -0.0272 161 HIS A CB  
587  C CG  . HIS A 163 ? 0.3219 0.3349 0.3607 0.0248  0.0402  -0.0249 161 HIS A CG  
588  N ND1 . HIS A 163 ? 0.3844 0.3971 0.4139 0.0319  0.0394  -0.0221 161 HIS A ND1 
589  C CD2 . HIS A 163 ? 0.3204 0.3311 0.3643 0.0204  0.0460  -0.0250 161 HIS A CD2 
590  C CE1 . HIS A 163 ? 0.3857 0.3961 0.4153 0.0316  0.0443  -0.0209 161 HIS A CE1 
591  N NE2 . HIS A 163 ? 0.3639 0.3732 0.4018 0.0246  0.0481  -0.0228 161 HIS A NE2 
592  N N   . GLU A 164 ? 0.3646 0.3921 0.4225 0.0230  0.0264  -0.0383 162 GLU A N   
593  C CA  . GLU A 164 ? 0.3946 0.4222 0.4507 0.0237  0.0223  -0.0395 162 GLU A CA  
594  C C   . GLU A 164 ? 0.4112 0.4542 0.4746 0.0306  0.0154  -0.0488 162 GLU A C   
595  O O   . GLU A 164 ? 0.4324 0.4771 0.4858 0.0369  0.0109  -0.0477 162 GLU A O   
596  C CB  . GLU A 164 ? 0.4110 0.4324 0.4754 0.0157  0.0260  -0.0397 162 GLU A CB  
597  C CG  . GLU A 164 ? 0.4451 0.4669 0.5096 0.0162  0.0222  -0.0417 162 GLU A CG  
598  C CD  . GLU A 164 ? 0.5246 0.5371 0.5943 0.0090  0.0271  -0.0392 162 GLU A CD  
599  O OE1 . GLU A 164 ? 0.5188 0.5313 0.6021 0.0040  0.0322  -0.0425 162 GLU A OE1 
600  O OE2 . GLU A 164 ? 0.5861 0.5910 0.6463 0.0086  0.0265  -0.0336 162 GLU A OE2 
601  N N   . ASN A 165 ? 0.3371 0.3918 0.4181 0.0296  0.0149  -0.0584 163 ASN A N   
602  C CA  . ASN A 165 ? 0.3205 0.3930 0.4102 0.0365  0.0077  -0.0693 163 ASN A CA  
603  C C   . ASN A 165 ? 0.3224 0.4008 0.3984 0.0481  0.0031  -0.0666 163 ASN A C   
604  O O   . ASN A 165 ? 0.3352 0.4218 0.4057 0.0560  -0.0031 -0.0699 163 ASN A O   
605  C CB  . ASN A 165 ? 0.3169 0.4018 0.4292 0.0334  0.0087  -0.0802 163 ASN A CB  
606  C CG  . ASN A 165 ? 0.3882 0.4679 0.5166 0.0228  0.0143  -0.0841 163 ASN A CG  
607  O OD1 . ASN A 165 ? 0.4539 0.5234 0.5773 0.0190  0.0158  -0.0801 163 ASN A OD1 
608  N ND2 . ASN A 165 ? 0.3646 0.4512 0.5131 0.0183  0.0181  -0.0918 163 ASN A ND2 
609  N N   . TYR A 166 ? 0.2749 0.3486 0.3449 0.0495  0.0068  -0.0604 164 TYR A N   
610  C CA  . TYR A 166 ? 0.2640 0.3414 0.3214 0.0607  0.0044  -0.0568 164 TYR A CA  
611  C C   . TYR A 166 ? 0.3065 0.3737 0.3449 0.0649  0.0040  -0.0484 164 TYR A C   
612  O O   . TYR A 166 ? 0.3676 0.4418 0.3977 0.0755  -0.0006 -0.0490 164 TYR A O   
613  C CB  . TYR A 166 ? 0.2509 0.3225 0.3066 0.0598  0.0102  -0.0514 164 TYR A CB  
614  C CG  . TYR A 166 ? 0.2745 0.3486 0.3185 0.0716  0.0092  -0.0471 164 TYR A CG  
615  C CD1 . TYR A 166 ? 0.2633 0.3235 0.2892 0.0746  0.0127  -0.0366 164 TYR A CD1 
616  C CD2 . TYR A 166 ? 0.2850 0.3754 0.3369 0.0802  0.0054  -0.0535 164 TYR A CD2 
617  C CE1 . TYR A 166 ? 0.2826 0.3431 0.2979 0.0857  0.0135  -0.0318 164 TYR A CE1 
618  C CE2 . TYR A 166 ? 0.3071 0.3991 0.3473 0.0924  0.0053  -0.0483 164 TYR A CE2 
619  C CZ  . TYR A 166 ? 0.3319 0.4077 0.3534 0.0951  0.0099  -0.0371 164 TYR A CZ  
620  O OH  . TYR A 166 ? 0.3598 0.4347 0.3696 0.1073  0.0116  -0.0310 164 TYR A OH  
621  N N   . LEU A 167 ? 0.3117 0.3630 0.3433 0.0571  0.0089  -0.0408 165 LEU A N   
622  C CA  . LEU A 167 ? 0.3506 0.3920 0.3663 0.0600  0.0095  -0.0332 165 LEU A CA  
623  C C   . LEU A 167 ? 0.3286 0.3763 0.3438 0.0635  0.0039  -0.0377 165 LEU A C   
624  O O   . LEU A 167 ? 0.3171 0.3640 0.3199 0.0717  0.0025  -0.0342 165 LEU A O   
625  C CB  . LEU A 167 ? 0.3489 0.3742 0.3594 0.0507  0.0153  -0.0256 165 LEU A CB  
626  C CG  . LEU A 167 ? 0.3547 0.3720 0.3600 0.0494  0.0211  -0.0198 165 LEU A CG  
627  C CD1 . LEU A 167 ? 0.3398 0.3447 0.3427 0.0396  0.0258  -0.0151 165 LEU A CD1 
628  C CD2 . LEU A 167 ? 0.3110 0.3244 0.3034 0.0582  0.0227  -0.0143 165 LEU A CD2 
629  N N   . ARG A 168 ? 0.2861 0.3398 0.3152 0.0577  0.0016  -0.0456 166 ARG A N   
630  C CA  . ARG A 168 ? 0.2983 0.3590 0.3293 0.0603  -0.0036 -0.0518 166 ARG A CA  
631  C C   . ARG A 168 ? 0.3381 0.4155 0.3685 0.0721  -0.0102 -0.0590 166 ARG A C   
632  O O   . ARG A 168 ? 0.3971 0.4773 0.4175 0.0796  -0.0137 -0.0590 166 ARG A O   
633  C CB  . ARG A 168 ? 0.3369 0.3998 0.3853 0.0510  -0.0034 -0.0595 166 ARG A CB  
634  C CG  . ARG A 168 ? 0.3611 0.4080 0.4076 0.0415  0.0021  -0.0521 166 ARG A CG  
635  C CD  . ARG A 168 ? 0.3894 0.4373 0.4528 0.0335  0.0036  -0.0589 166 ARG A CD  
636  N NE  . ARG A 168 ? 0.4651 0.4990 0.5238 0.0275  0.0074  -0.0516 166 ARG A NE  
637  C CZ  . ARG A 168 ? 0.5101 0.5380 0.5795 0.0196  0.0122  -0.0520 166 ARG A CZ  
638  N NH1 . ARG A 168 ? 0.5136 0.5473 0.6002 0.0157  0.0146  -0.0595 166 ARG A NH1 
639  N NH2 . ARG A 168 ? 0.4881 0.5042 0.5514 0.0159  0.0151  -0.0446 166 ARG A NH2 
640  N N   . GLU A 169 ? 0.3547 0.4439 0.3954 0.0743  -0.0119 -0.0652 167 GLU A N   
641  C CA  . GLU A 169 ? 0.3935 0.5005 0.4328 0.0871  -0.0188 -0.0721 167 GLU A CA  
642  C C   . GLU A 169 ? 0.3815 0.4831 0.3990 0.0990  -0.0179 -0.0618 167 GLU A C   
643  O O   . GLU A 169 ? 0.3828 0.4925 0.3909 0.1099  -0.0228 -0.0637 167 GLU A O   
644  C CB  . GLU A 169 ? 0.4458 0.5669 0.5011 0.0876  -0.0205 -0.0804 167 GLU A CB  
645  C CG  . GLU A 169 ? 0.6077 0.7470 0.6588 0.1028  -0.0273 -0.0852 167 GLU A CG  
646  C CD  . GLU A 169 ? 0.7558 0.9086 0.8228 0.1035  -0.0283 -0.0923 167 GLU A CD  
647  O OE1 . GLU A 169 ? 0.8120 0.9657 0.8985 0.0920  -0.0257 -0.0988 167 GLU A OE1 
648  O OE2 . GLU A 169 ? 0.8090 0.9710 0.8691 0.1159  -0.0311 -0.0910 167 GLU A OE2 
649  N N   . LYS A 170 ? 0.3017 0.3894 0.3114 0.0972  -0.0110 -0.0511 168 LYS A N   
650  C CA  . LYS A 170 ? 0.3160 0.3970 0.3067 0.1083  -0.0082 -0.0411 168 LYS A CA  
651  C C   . LYS A 170 ? 0.3331 0.4033 0.3101 0.1094  -0.0064 -0.0348 168 LYS A C   
652  O O   . LYS A 170 ? 0.3692 0.4387 0.3314 0.1213  -0.0060 -0.0298 168 LYS A O   
653  C CB  . LYS A 170 ? 0.3146 0.3830 0.3018 0.1054  -0.0005 -0.0323 168 LYS A CB  
654  C CG  . LYS A 170 ? 0.3171 0.3960 0.3170 0.1056  -0.0014 -0.0377 168 LYS A CG  
655  C CD  . LYS A 170 ? 0.3169 0.4170 0.3199 0.1183  -0.0095 -0.0462 168 LYS A CD  
656  C CE  . LYS A 170 ? 0.3814 0.4950 0.4022 0.1164  -0.0115 -0.0547 168 LYS A CE  
657  N NZ  . LYS A 170 ? 0.3805 0.5177 0.4062 0.1291  -0.0204 -0.0645 168 LYS A NZ  
658  N N   . CYS A 171 ? 0.3346 0.3962 0.3168 0.0976  -0.0049 -0.0349 169 CYS A N   
659  C CA  . CYS A 171 ? 0.3613 0.4135 0.3335 0.0973  -0.0033 -0.0300 169 CYS A CA  
660  C C   . CYS A 171 ? 0.3956 0.4609 0.3648 0.1067  -0.0101 -0.0370 169 CYS A C   
661  O O   . CYS A 171 ? 0.3755 0.4374 0.3301 0.1155  -0.0090 -0.0319 169 CYS A O   
662  C CB  . CYS A 171 ? 0.3497 0.3928 0.3301 0.0834  -0.0012 -0.0299 169 CYS A CB  
663  S SG  . CYS A 171 ? 0.4022 0.4356 0.3733 0.0825  0.0002  -0.0253 169 CYS A SG  
664  N N   . MET A 172 ? 0.3722 0.4528 0.3557 0.1050  -0.0166 -0.0492 170 MET A N   
665  C CA  . MET A 172 ? 0.3657 0.4611 0.3482 0.1134  -0.0239 -0.0584 170 MET A CA  
666  C C   . MET A 172 ? 0.3885 0.4937 0.3572 0.1304  -0.0268 -0.0569 170 MET A C   
667  O O   . MET A 172 ? 0.4365 0.5462 0.3931 0.1406  -0.0297 -0.0575 170 MET A O   
668  C CB  . MET A 172 ? 0.3658 0.4765 0.3698 0.1073  -0.0297 -0.0734 170 MET A CB  
669  C CG  . MET A 172 ? 0.4283 0.5556 0.4337 0.1147  -0.0377 -0.0855 170 MET A CG  
670  S SD  . MET A 172 ? 0.4586 0.5756 0.4525 0.1142  -0.0365 -0.0821 170 MET A SD  
671  C CE  . MET A 172 ? 0.3677 0.4749 0.3812 0.0957  -0.0327 -0.0853 170 MET A CE  
672  N N   . GLU A 173 ? 0.3574 0.4652 0.3269 0.1342  -0.0255 -0.0544 171 GLU A N   
673  C CA  . GLU A 173 ? 0.3875 0.5052 0.3445 0.1515  -0.0281 -0.0526 171 GLU A CA  
674  C C   . GLU A 173 ? 0.3613 0.4644 0.2957 0.1608  -0.0214 -0.0388 171 GLU A C   
675  O O   . GLU A 173 ? 0.3683 0.4790 0.2889 0.1754  -0.0244 -0.0386 171 GLU A O   
676  C CB  . GLU A 173 ? 0.3981 0.5207 0.3621 0.1532  -0.0272 -0.0523 171 GLU A CB  
677  C CG  . GLU A 173 ? 0.4415 0.5852 0.4265 0.1505  -0.0349 -0.0675 171 GLU A CG  
678  C CD  . GLU A 173 ? 0.5172 0.6683 0.5074 0.1556  -0.0346 -0.0673 171 GLU A CD  
679  O OE1 . GLU A 173 ? 0.5820 0.7506 0.5911 0.1532  -0.0401 -0.0798 171 GLU A OE1 
680  O OE2 . GLU A 173 ? 0.4684 0.6080 0.4450 0.1620  -0.0283 -0.0551 171 GLU A OE2 
681  N N   . VAL A 174 ? 0.3774 0.4600 0.3083 0.1529  -0.0120 -0.0277 172 VAL A N   
682  C CA  . VAL A 174 ? 0.4166 0.4845 0.3286 0.1615  -0.0038 -0.0146 172 VAL A CA  
683  C C   . VAL A 174 ? 0.4060 0.4607 0.3111 0.1567  0.0004  -0.0098 172 VAL A C   
684  O O   . VAL A 174 ? 0.3987 0.4444 0.2877 0.1661  0.0063  -0.0010 172 VAL A O   
685  C CB  . VAL A 174 ? 0.3412 0.3954 0.2528 0.1585  0.0051  -0.0054 172 VAL A CB  
686  C CG1 . VAL A 174 ? 0.3040 0.3445 0.2259 0.1403  0.0096  -0.0040 172 VAL A CG1 
687  C CG2 . VAL A 174 ? 0.3489 0.3904 0.2418 0.1707  0.0140  0.0071  172 VAL A CG2 
688  N N   . LEU A 175 ? 0.3748 0.4284 0.2922 0.1428  -0.0020 -0.0155 173 LEU A N   
689  C CA  . LEU A 175 ? 0.3761 0.4184 0.2892 0.1375  0.0015  -0.0118 173 LEU A CA  
690  C C   . LEU A 175 ? 0.4023 0.4559 0.3178 0.1388  -0.0059 -0.0211 173 LEU A C   
691  O O   . LEU A 175 ? 0.4484 0.4959 0.3555 0.1408  -0.0036 -0.0180 173 LEU A O   
692  C CB  . LEU A 175 ? 0.3785 0.4079 0.3019 0.1211  0.0060  -0.0091 173 LEU A CB  
693  C CG  . LEU A 175 ? 0.3796 0.3963 0.3011 0.1180  0.0140  -0.0006 173 LEU A CG  
694  C CD1 . LEU A 175 ? 0.3225 0.3286 0.2529 0.1027  0.0172  0.0009  173 LEU A CD1 
695  C CD2 . LEU A 175 ? 0.4028 0.4090 0.3086 0.1282  0.0219  0.0094  173 LEU A CD2 
696  N N   . GLY A 176 ? 0.3842 0.4541 0.3123 0.1373  -0.0142 -0.0332 174 GLY A N   
697  C CA  . GLY A 176 ? 0.3731 0.4561 0.3046 0.1397  -0.0216 -0.0442 174 GLY A CA  
698  C C   . GLY A 176 ? 0.3947 0.4724 0.3403 0.1248  -0.0215 -0.0485 174 GLY A C   
699  O O   . GLY A 176 ? 0.3831 0.4480 0.3349 0.1133  -0.0162 -0.0428 174 GLY A O   
700  N N   . LYS A 177 ? 0.3632 0.4507 0.3130 0.1257  -0.0270 -0.0586 175 LYS A N   
701  C CA  . LYS A 177 ? 0.4062 0.4906 0.3714 0.1125  -0.0272 -0.0644 175 LYS A CA  
702  C C   . LYS A 177 ? 0.4324 0.4985 0.3930 0.1053  -0.0205 -0.0545 175 LYS A C   
703  O O   . LYS A 177 ? 0.4734 0.5346 0.4463 0.0942  -0.0195 -0.0569 175 LYS A O   
704  C CB  . LYS A 177 ? 0.4507 0.5509 0.4222 0.1161  -0.0345 -0.0789 175 LYS A CB  
705  C CG  . LYS A 177 ? 0.5213 0.6226 0.4752 0.1274  -0.0355 -0.0775 175 LYS A CG  
706  C CD  . LYS A 177 ? 0.6021 0.7190 0.5639 0.1294  -0.0427 -0.0934 175 LYS A CD  
707  C CE  . LYS A 177 ? 0.6761 0.7958 0.6188 0.1423  -0.0440 -0.0926 175 LYS A CE  
708  N NZ  . LYS A 177 ? 0.6989 0.8003 0.6344 0.1376  -0.0367 -0.0826 175 LYS A NZ  
709  N N   . ASP A 178 ? 0.4054 0.4617 0.3492 0.1118  -0.0156 -0.0437 176 ASP A N   
710  C CA  . ASP A 178 ? 0.3586 0.3988 0.2994 0.1052  -0.0091 -0.0348 176 ASP A CA  
711  C C   . ASP A 178 ? 0.3696 0.3991 0.3184 0.0936  -0.0047 -0.0289 176 ASP A C   
712  O O   . ASP A 178 ? 0.3590 0.3774 0.3090 0.0863  -0.0006 -0.0235 176 ASP A O   
713  C CB  . ASP A 178 ? 0.3867 0.4189 0.3093 0.1149  -0.0035 -0.0249 176 ASP A CB  
714  C CG  . ASP A 178 ? 0.4581 0.4978 0.3701 0.1262  -0.0063 -0.0289 176 ASP A CG  
715  O OD1 . ASP A 178 ? 0.4389 0.4886 0.3591 0.1243  -0.0125 -0.0397 176 ASP A OD1 
716  O OD2 . ASP A 178 ? 0.4981 0.5333 0.3935 0.1371  -0.0017 -0.0214 176 ASP A OD2 
717  N N   . PHE A 179 ? 0.3530 0.3865 0.3067 0.0926  -0.0056 -0.0300 177 PHE A N   
718  C CA  . PHE A 179 ? 0.3694 0.3933 0.3283 0.0832  -0.0012 -0.0243 177 PHE A CA  
719  C C   . PHE A 179 ? 0.3543 0.3843 0.3288 0.0754  -0.0040 -0.0314 177 PHE A C   
720  O O   . PHE A 179 ? 0.3993 0.4425 0.3809 0.0787  -0.0091 -0.0406 177 PHE A O   
721  C CB  . PHE A 179 ? 0.3460 0.3655 0.2953 0.0888  0.0031  -0.0170 177 PHE A CB  
722  C CG  . PHE A 179 ? 0.3661 0.3743 0.3024 0.0932  0.0094  -0.0078 177 PHE A CG  
723  C CD1 . PHE A 179 ? 0.3352 0.3304 0.2721 0.0852  0.0155  -0.0009 177 PHE A CD1 
724  C CD2 . PHE A 179 ? 0.3876 0.3986 0.3114 0.1056  0.0097  -0.0063 177 PHE A CD2 
725  C CE1 . PHE A 179 ? 0.3924 0.3774 0.3199 0.0884  0.0223  0.0066  177 PHE A CE1 
726  C CE2 . PHE A 179 ? 0.3930 0.3922 0.3056 0.1095  0.0173  0.0026  177 PHE A CE2 
727  C CZ  . PHE A 179 ? 0.4006 0.3868 0.3163 0.1004  0.0238  0.0087  177 PHE A CZ  
728  N N   . SER A 180 ? 0.3652 0.3859 0.3454 0.0652  -0.0003 -0.0272 178 SER A N   
729  C CA  . SER A 180 ? 0.4108 0.4342 0.4051 0.0573  -0.0009 -0.0320 178 SER A CA  
730  C C   . SER A 180 ? 0.4153 0.4292 0.4081 0.0514  0.0041  -0.0247 178 SER A C   
731  O O   . SER A 180 ? 0.4147 0.4191 0.3982 0.0511  0.0077  -0.0169 178 SER A O   
732  C CB  . SER A 180 ? 0.3770 0.3983 0.3806 0.0503  -0.0012 -0.0353 178 SER A CB  
733  O OG  . SER A 180 ? 0.4488 0.4577 0.4490 0.0442  0.0030  -0.0270 178 SER A OG  
734  N N   . ILE A 181 ? 0.4045 0.4214 0.4073 0.0467  0.0046  -0.0280 179 ILE A N   
735  C CA  . ILE A 181 ? 0.4013 0.4102 0.4032 0.0411  0.0091  -0.0223 179 ILE A CA  
736  C C   . ILE A 181 ? 0.3906 0.3970 0.4036 0.0323  0.0109  -0.0239 179 ILE A C   
737  O O   . ILE A 181 ? 0.3635 0.3770 0.3887 0.0309  0.0093  -0.0315 179 ILE A O   
738  C CB  . ILE A 181 ? 0.3775 0.3922 0.3808 0.0446  0.0095  -0.0240 179 ILE A CB  
739  C CG1 . ILE A 181 ? 0.3302 0.3433 0.3205 0.0532  0.0104  -0.0192 179 ILE A CG1 
740  C CG2 . ILE A 181 ? 0.3261 0.3347 0.3333 0.0370  0.0141  -0.0212 179 ILE A CG2 
741  C CD1 . ILE A 181 ? 0.2835 0.2841 0.2657 0.0498  0.0162  -0.0108 179 ILE A CD1 
742  N N   . LEU A 182 ? 0.4476 0.4438 0.4563 0.0268  0.0147  -0.0172 180 LEU A N   
743  C CA  . LEU A 182 ? 0.4588 0.4508 0.4752 0.0195  0.0177  -0.0166 180 LEU A CA  
744  C C   . LEU A 182 ? 0.3917 0.3778 0.4030 0.0164  0.0218  -0.0113 180 LEU A C   
745  O O   . LEU A 182 ? 0.3777 0.3587 0.3786 0.0171  0.0226  -0.0061 180 LEU A O   
746  C CB  . LEU A 182 ? 0.5284 0.5145 0.5439 0.0168  0.0179  -0.0135 180 LEU A CB  
747  C CG  . LEU A 182 ? 0.6309 0.6113 0.6525 0.0107  0.0219  -0.0113 180 LEU A CG  
748  C CD1 . LEU A 182 ? 0.6526 0.6379 0.6896 0.0087  0.0233  -0.0186 180 LEU A CD1 
749  C CD2 . LEU A 182 ? 0.6759 0.6503 0.6945 0.0095  0.0220  -0.0068 180 LEU A CD2 
750  N N   . ILE A 183 ? 0.3658 0.3527 0.3850 0.0128  0.0248  -0.0133 181 ILE A N   
751  C CA  . ILE A 183 ? 0.3718 0.3530 0.3860 0.0097  0.0292  -0.0087 181 ILE A CA  
752  C C   . ILE A 183 ? 0.3789 0.3523 0.3913 0.0049  0.0324  -0.0038 181 ILE A C   
753  O O   . ILE A 183 ? 0.3877 0.3605 0.4090 0.0025  0.0341  -0.0053 181 ILE A O   
754  C CB  . ILE A 183 ? 0.4693 0.4552 0.4922 0.0090  0.0318  -0.0128 181 ILE A CB  
755  C CG1 . ILE A 183 ? 0.4104 0.4058 0.4356 0.0152  0.0281  -0.0180 181 ILE A CG1 
756  C CG2 . ILE A 183 ? 0.5161 0.4958 0.5321 0.0065  0.0364  -0.0081 181 ILE A CG2 
757  C CD1 . ILE A 183 ? 0.4138 0.4066 0.4260 0.0199  0.0271  -0.0137 181 ILE A CD1 
758  N N   . CYS A 184 ? 0.3998 0.3676 0.4011 0.0040  0.0333  0.0018  182 CYS A N   
759  C CA  . CYS A 184 ? 0.4261 0.3878 0.4233 0.0011  0.0354  0.0069  182 CYS A CA  
760  C C   . CYS A 184 ? 0.3898 0.3478 0.3819 -0.0011 0.0399  0.0098  182 CYS A C   
761  O O   . CYS A 184 ? 0.3826 0.3417 0.3808 -0.0022 0.0435  0.0076  182 CYS A O   
762  C CB  . CYS A 184 ? 0.4732 0.4332 0.4620 0.0023  0.0321  0.0101  182 CYS A CB  
763  S SG  . CYS A 184 ? 0.4259 0.3892 0.4196 0.0053  0.0277  0.0073  182 CYS A SG  
764  N N   . GLY A 185 ? 0.3697 0.3242 0.3511 -0.0016 0.0398  0.0142  183 GLY A N   
765  C CA  . GLY A 185 ? 0.3408 0.2925 0.3149 -0.0031 0.0435  0.0165  183 GLY A CA  
766  C C   . GLY A 185 ? 0.3776 0.3254 0.3545 -0.0044 0.0491  0.0192  183 GLY A C   
767  O O   . GLY A 185 ? 0.4127 0.3590 0.3968 -0.0045 0.0504  0.0201  183 GLY A O   
768  N N   . SER A 186 ? 0.3344 0.2799 0.3056 -0.0053 0.0534  0.0206  184 SER A N   
769  C CA  . SER A 186 ? 0.3467 0.2874 0.3191 -0.0061 0.0604  0.0241  184 SER A CA  
770  C C   . SER A 186 ? 0.3681 0.3097 0.3571 -0.0077 0.0641  0.0205  184 SER A C   
771  O O   . SER A 186 ? 0.4274 0.3642 0.4217 -0.0086 0.0701  0.0231  184 SER A O   
772  C CB  . SER A 186 ? 0.3732 0.3119 0.3363 -0.0065 0.0646  0.0254  184 SER A CB  
773  O OG  . SER A 186 ? 0.4338 0.3757 0.4034 -0.0077 0.0657  0.0203  184 SER A OG  
774  N N   . TYR A 187 ? 0.3583 0.3062 0.3559 -0.0078 0.0607  0.0141  185 TYR A N   
775  C CA  . TYR A 187 ? 0.3494 0.3012 0.3643 -0.0090 0.0625  0.0085  185 TYR A CA  
776  C C   . TYR A 187 ? 0.3917 0.3417 0.4137 -0.0094 0.0621  0.0087  185 TYR A C   
777  O O   . TYR A 187 ? 0.3903 0.3383 0.4247 -0.0116 0.0679  0.0072  185 TYR A O   
778  C CB  . TYR A 187 ? 0.3360 0.2967 0.3564 -0.0071 0.0571  0.0018  185 TYR A CB  
779  C CG  . TYR A 187 ? 0.3994 0.3672 0.4371 -0.0072 0.0559  -0.0057 185 TYR A CG  
780  C CD1 . TYR A 187 ? 0.3848 0.3557 0.4371 -0.0094 0.0611  -0.0104 185 TYR A CD1 
781  C CD2 . TYR A 187 ? 0.4474 0.4197 0.4875 -0.0049 0.0496  -0.0088 185 TYR A CD2 
782  C CE1 . TYR A 187 ? 0.3984 0.3778 0.4683 -0.0097 0.0594  -0.0191 185 TYR A CE1 
783  C CE2 . TYR A 187 ? 0.4537 0.4341 0.5095 -0.0047 0.0479  -0.0170 185 TYR A CE2 
784  C CZ  . TYR A 187 ? 0.4620 0.4465 0.5331 -0.0072 0.0525  -0.0227 185 TYR A CZ  
785  O OH  . TYR A 187 ? 0.4717 0.4660 0.5598 -0.0071 0.0501  -0.0326 185 TYR A OH  
786  N N   . ARG A 188 ? 0.4136 0.3640 0.4290 -0.0074 0.0561  0.0103  186 ARG A N   
787  C CA  . ARG A 188 ? 0.3655 0.3143 0.3876 -0.0074 0.0557  0.0104  186 ARG A CA  
788  C C   . ARG A 188 ? 0.3830 0.3224 0.4008 -0.0078 0.0622  0.0180  186 ARG A C   
789  O O   . ARG A 188 ? 0.3938 0.3294 0.4206 -0.0085 0.0659  0.0184  186 ARG A O   
790  C CB  . ARG A 188 ? 0.3348 0.2865 0.3510 -0.0048 0.0480  0.0102  186 ARG A CB  
791  C CG  . ARG A 188 ? 0.2672 0.2173 0.2907 -0.0047 0.0476  0.0097  186 ARG A CG  
792  C CD  . ARG A 188 ? 0.2807 0.2346 0.3003 -0.0020 0.0405  0.0083  186 ARG A CD  
793  N NE  . ARG A 188 ? 0.3219 0.2733 0.3481 -0.0019 0.0410  0.0083  186 ARG A NE  
794  C CZ  . ARG A 188 ? 0.2929 0.2404 0.3124 -0.0003 0.0397  0.0138  186 ARG A CZ  
795  N NH1 . ARG A 188 ? 0.2766 0.2236 0.2832 0.0011  0.0373  0.0190  186 ARG A NH1 
796  N NH2 . ARG A 188 ? 0.2763 0.2212 0.3033 -0.0001 0.0410  0.0133  186 ARG A NH2 
797  N N   . ARG A 189 ? 0.3626 0.2984 0.3663 -0.0068 0.0638  0.0240  187 ARG A N   
798  C CA  . ARG A 189 ? 0.3507 0.2782 0.3479 -0.0056 0.0704  0.0320  187 ARG A CA  
799  C C   . ARG A 189 ? 0.3773 0.3000 0.3838 -0.0079 0.0804  0.0319  187 ARG A C   
800  O O   . ARG A 189 ? 0.3827 0.2973 0.3838 -0.0066 0.0881  0.0390  187 ARG A O   
801  C CB  . ARG A 189 ? 0.3308 0.2578 0.3090 -0.0029 0.0681  0.0375  187 ARG A CB  
802  C CG  . ARG A 189 ? 0.3378 0.2697 0.3088 -0.0011 0.0591  0.0370  187 ARG A CG  
803  C CD  . ARG A 189 ? 0.3523 0.2831 0.3072 0.0024  0.0578  0.0432  187 ARG A CD  
804  N NE  . ARG A 189 ? 0.3979 0.3283 0.3423 0.0025  0.0606  0.0442  187 ARG A NE  
805  C CZ  . ARG A 189 ? 0.4012 0.3363 0.3420 0.0008  0.0573  0.0393  187 ARG A CZ  
806  N NH1 . ARG A 189 ? 0.3501 0.2901 0.2969 -0.0009 0.0517  0.0339  187 ARG A NH1 
807  N NH2 . ARG A 189 ? 0.3461 0.2804 0.2773 0.0010  0.0604  0.0401  187 ARG A NH2 
808  N N   . ARG A 190 ? 0.4007 0.3291 0.4212 -0.0109 0.0805  0.0238  188 ARG A N   
809  C CA  . ARG A 190 ? 0.4342 0.3600 0.4688 -0.0140 0.0899  0.0213  188 ARG A CA  
810  C C   . ARG A 190 ? 0.4250 0.3463 0.4511 -0.0140 0.0971  0.0258  188 ARG A C   
811  O O   . ARG A 190 ? 0.4794 0.3950 0.5142 -0.0158 0.1075  0.0270  188 ARG A O   
812  C CB  . ARG A 190 ? 0.5095 0.4280 0.5555 -0.0150 0.0974  0.0232  188 ARG A CB  
813  C CG  . ARG A 190 ? 0.6134 0.5368 0.6704 -0.0155 0.0912  0.0169  188 ARG A CG  
814  C CD  . ARG A 190 ? 0.6921 0.6067 0.7600 -0.0165 0.0995  0.0191  188 ARG A CD  
815  N NE  . ARG A 190 ? 0.7736 0.6843 0.8583 -0.0205 0.1110  0.0161  188 ARG A NE  
816  C CZ  . ARG A 190 ? 0.8460 0.7632 0.9536 -0.0247 0.1123  0.0046  188 ARG A CZ  
817  N NH1 . ARG A 190 ? 0.8634 0.7913 0.9776 -0.0248 0.1023  -0.0045 188 ARG A NH1 
818  N NH2 . ARG A 190 ? 0.8815 0.7951 1.0057 -0.0286 0.1238  0.0018  188 ARG A NH2 
819  N N   . HIS A 191 ? 0.4055 0.3292 0.4154 -0.0120 0.0922  0.0278  189 HIS A N   
820  C CA  . HIS A 191 ? 0.4186 0.3397 0.4210 -0.0121 0.0981  0.0302  189 HIS A CA  
821  C C   . HIS A 191 ? 0.4357 0.3618 0.4547 -0.0153 0.1015  0.0226  189 HIS A C   
822  O O   . HIS A 191 ? 0.4464 0.3813 0.4763 -0.0162 0.0952  0.0149  189 HIS A O   
823  C CB  . HIS A 191 ? 0.4307 0.3545 0.4145 -0.0098 0.0915  0.0316  189 HIS A CB  
824  C CG  . HIS A 191 ? 0.4745 0.3951 0.4419 -0.0063 0.0884  0.0384  189 HIS A CG  
825  N ND1 . HIS A 191 ? 0.4574 0.3789 0.4072 -0.0041 0.0857  0.0406  189 HIS A ND1 
826  C CD2 . HIS A 191 ? 0.4430 0.3605 0.4098 -0.0043 0.0875  0.0427  189 HIS A CD2 
827  C CE1 . HIS A 191 ? 0.4307 0.3511 0.3699 -0.0006 0.0826  0.0458  189 HIS A CE1 
828  N NE2 . HIS A 191 ? 0.4594 0.3768 0.4083 -0.0005 0.0838  0.0477  189 HIS A NE2 
829  N N   . PRO A 192 ? 0.4245 0.3456 0.4457 -0.0166 0.1118  0.0246  190 PRO A N   
830  C CA  . PRO A 192 ? 0.3979 0.3253 0.4356 -0.0194 0.1147  0.0168  190 PRO A CA  
831  C C   . PRO A 192 ? 0.4058 0.3415 0.4379 -0.0182 0.1070  0.0125  190 PRO A C   
832  O O   . PRO A 192 ? 0.3911 0.3357 0.4376 -0.0190 0.1043  0.0046  190 PRO A O   
833  C CB  . PRO A 192 ? 0.4086 0.3274 0.4465 -0.0205 0.1283  0.0215  190 PRO A CB  
834  C CG  . PRO A 192 ? 0.4635 0.3718 0.4803 -0.0170 0.1314  0.0325  190 PRO A CG  
835  C CD  . PRO A 192 ? 0.4367 0.3464 0.4496 -0.0152 0.1224  0.0336  190 PRO A CD  
836  N N   . PHE A 193 ? 0.4122 0.3452 0.4240 -0.0158 0.1037  0.0172  191 PHE A N   
837  C CA  . PHE A 193 ? 0.4018 0.3408 0.4081 -0.0146 0.0975  0.0134  191 PHE A CA  
838  C C   . PHE A 193 ? 0.4113 0.3510 0.4038 -0.0125 0.0885  0.0152  191 PHE A C   
839  O O   . PHE A 193 ? 0.4242 0.3590 0.4056 -0.0115 0.0880  0.0206  191 PHE A O   
840  C CB  . PHE A 193 ? 0.4139 0.3495 0.4114 -0.0147 0.1038  0.0151  191 PHE A CB  
841  C CG  . PHE A 193 ? 0.4252 0.3604 0.4371 -0.0169 0.1134  0.0130  191 PHE A CG  
842  C CD1 . PHE A 193 ? 0.4788 0.4056 0.4901 -0.0178 0.1237  0.0184  191 PHE A CD1 
843  C CD2 . PHE A 193 ? 0.4131 0.3565 0.4397 -0.0174 0.1126  0.0058  191 PHE A CD2 
844  C CE1 . PHE A 193 ? 0.5250 0.4510 0.5512 -0.0203 0.1339  0.0162  191 PHE A CE1 
845  C CE2 . PHE A 193 ? 0.4789 0.4232 0.5210 -0.0197 0.1216  0.0030  191 PHE A CE2 
846  C CZ  . PHE A 193 ? 0.5030 0.4383 0.5457 -0.0216 0.1326  0.0080  191 PHE A CZ  
847  N N   . SER A 194 ? 0.3500 0.2957 0.3435 -0.0113 0.0819  0.0107  192 SER A N   
848  C CA  . SER A 194 ? 0.3609 0.3071 0.3427 -0.0096 0.0748  0.0117  192 SER A CA  
849  C C   . SER A 194 ? 0.3513 0.2989 0.3273 -0.0087 0.0740  0.0093  192 SER A C   
850  O O   . SER A 194 ? 0.3708 0.3207 0.3538 -0.0085 0.0771  0.0063  192 SER A O   
851  C CB  . SER A 194 ? 0.3739 0.3248 0.3631 -0.0083 0.0680  0.0092  192 SER A CB  
852  O OG  . SER A 194 ? 0.5282 0.4774 0.5233 -0.0092 0.0688  0.0110  192 SER A OG  
853  N N   . GLY A 195 ? 0.2874 0.2336 0.2517 -0.0081 0.0702  0.0103  193 GLY A N   
854  C CA  . GLY A 195 ? 0.2956 0.2418 0.2550 -0.0076 0.0702  0.0077  193 GLY A CA  
855  C C   . GLY A 195 ? 0.3319 0.2815 0.2966 -0.0051 0.0658  0.0051  193 GLY A C   
856  O O   . GLY A 195 ? 0.3305 0.2793 0.2929 -0.0040 0.0669  0.0033  193 GLY A O   
857  N N   . ASP A 196 ? 0.2982 0.2510 0.2693 -0.0037 0.0615  0.0052  194 ASP A N   
858  C CA  . ASP A 196 ? 0.2952 0.2513 0.2699 -0.0001 0.0578  0.0032  194 ASP A CA  
859  C C   . ASP A 196 ? 0.3257 0.2867 0.3088 0.0017  0.0535  0.0021  194 ASP A C   
860  O O   . ASP A 196 ? 0.3131 0.2746 0.3012 -0.0004 0.0538  0.0025  194 ASP A O   
861  C CB  . ASP A 196 ? 0.3788 0.3315 0.3446 0.0001  0.0562  0.0041  194 ASP A CB  
862  C CG  . ASP A 196 ? 0.4024 0.3542 0.3640 -0.0016 0.0525  0.0062  194 ASP A CG  
863  O OD1 . ASP A 196 ? 0.3901 0.3431 0.3551 -0.0024 0.0513  0.0076  194 ASP A OD1 
864  O OD2 . ASP A 196 ? 0.4686 0.4185 0.4246 -0.0021 0.0514  0.0062  194 ASP A OD2 
865  N N   . VAL A 197 ? 0.3430 0.3073 0.3275 0.0061  0.0503  0.0007  195 VAL A N   
866  C CA  . VAL A 197 ? 0.3298 0.2996 0.3206 0.0089  0.0456  -0.0012 195 VAL A CA  
867  C C   . VAL A 197 ? 0.3410 0.3076 0.3243 0.0099  0.0426  0.0013  195 VAL A C   
868  O O   . VAL A 197 ? 0.3040 0.2683 0.2816 0.0127  0.0433  0.0024  195 VAL A O   
869  C CB  . VAL A 197 ? 0.3305 0.3078 0.3277 0.0147  0.0440  -0.0049 195 VAL A CB  
870  C CG1 . VAL A 197 ? 0.3171 0.3012 0.3202 0.0178  0.0386  -0.0080 195 VAL A CG1 
871  C CG2 . VAL A 197 ? 0.3279 0.3091 0.3338 0.0136  0.0473  -0.0080 195 VAL A CG2 
872  N N   . ASP A 198 ? 0.3474 0.3134 0.3315 0.0077  0.0402  0.0023  196 ASP A N   
873  C CA  . ASP A 198 ? 0.3884 0.3513 0.3661 0.0076  0.0381  0.0049  196 ASP A CA  
874  C C   . ASP A 198 ? 0.3584 0.3250 0.3404 0.0105  0.0339  0.0035  196 ASP A C   
875  O O   . ASP A 198 ? 0.3450 0.3128 0.3323 0.0086  0.0327  0.0029  196 ASP A O   
876  C CB  . ASP A 198 ? 0.4687 0.4274 0.4416 0.0030  0.0393  0.0077  196 ASP A CB  
877  C CG  . ASP A 198 ? 0.5667 0.5245 0.5372 0.0025  0.0361  0.0098  196 ASP A CG  
878  O OD1 . ASP A 198 ? 0.6133 0.5719 0.5834 0.0049  0.0339  0.0094  196 ASP A OD1 
879  O OD2 . ASP A 198 ? 0.5736 0.5298 0.5423 0.0003  0.0364  0.0121  196 ASP A OD2 
880  N N   . ALA A 199 ? 0.2656 0.2338 0.2453 0.0155  0.0326  0.0030  197 ALA A N   
881  C CA  . ALA A 199 ? 0.2937 0.2671 0.2770 0.0197  0.0287  0.0006  197 ALA A CA  
882  C C   . ALA A 199 ? 0.3390 0.3095 0.3170 0.0213  0.0273  0.0030  197 ALA A C   
883  O O   . ALA A 199 ? 0.2845 0.2501 0.2562 0.0216  0.0298  0.0059  197 ALA A O   
884  C CB  . ALA A 199 ? 0.2613 0.2408 0.2461 0.0263  0.0279  -0.0023 197 ALA A CB  
885  N N   . ILE A 200 ? 0.3118 0.2854 0.2937 0.0220  0.0241  0.0012  198 ILE A N   
886  C CA  . ILE A 200 ? 0.3215 0.2935 0.2993 0.0246  0.0228  0.0029  198 ILE A CA  
887  C C   . ILE A 200 ? 0.3105 0.2882 0.2878 0.0321  0.0204  0.0000  198 ILE A C   
888  O O   . ILE A 200 ? 0.3325 0.3172 0.3164 0.0335  0.0173  -0.0051 198 ILE A O   
889  C CB  . ILE A 200 ? 0.3658 0.3365 0.3470 0.0207  0.0211  0.0034  198 ILE A CB  
890  C CG1 . ILE A 200 ? 0.3637 0.3294 0.3426 0.0153  0.0230  0.0071  198 ILE A CG1 
891  C CG2 . ILE A 200 ? 0.3544 0.3248 0.3330 0.0241  0.0197  0.0041  198 ILE A CG2 
892  C CD1 . ILE A 200 ? 0.3718 0.3367 0.3546 0.0122  0.0218  0.0082  198 ILE A CD1 
893  N N   . LEU A 201 ? 0.3202 0.2950 0.2898 0.0371  0.0223  0.0029  199 LEU A N   
894  C CA  . LEU A 201 ? 0.3173 0.2969 0.2834 0.0457  0.0204  0.0012  199 LEU A CA  
895  C C   . LEU A 201 ? 0.3333 0.3101 0.2967 0.0463  0.0202  0.0028  199 LEU A C   
896  O O   . LEU A 201 ? 0.3691 0.3387 0.3296 0.0435  0.0238  0.0071  199 LEU A O   
897  C CB  . LEU A 201 ? 0.2693 0.2466 0.2275 0.0526  0.0243  0.0046  199 LEU A CB  
898  C CG  . LEU A 201 ? 0.2986 0.2801 0.2498 0.0637  0.0233  0.0044  199 LEU A CG  
899  C CD1 . LEU A 201 ? 0.2874 0.2817 0.2437 0.0678  0.0169  -0.0027 199 LEU A CD1 
900  C CD2 . LEU A 201 ? 0.3123 0.2881 0.2547 0.0705  0.0293  0.0099  199 LEU A CD2 
901  N N   . SER A 202 ? 0.3101 0.2932 0.2757 0.0496  0.0161  -0.0014 200 SER A N   
902  C CA  . SER A 202 ? 0.3495 0.3303 0.3132 0.0503  0.0160  -0.0004 200 SER A CA  
903  C C   . SER A 202 ? 0.3733 0.3620 0.3358 0.0575  0.0121  -0.0055 200 SER A C   
904  O O   . SER A 202 ? 0.3666 0.3641 0.3336 0.0598  0.0081  -0.0118 200 SER A O   
905  C CB  . SER A 202 ? 0.3299 0.3081 0.3013 0.0418  0.0151  -0.0005 200 SER A CB  
906  O OG  . SER A 202 ? 0.3310 0.3149 0.3112 0.0394  0.0117  -0.0061 200 SER A OG  
907  N N   . ARG A 203 ? 0.3737 0.3597 0.3304 0.0613  0.0134  -0.0035 201 ARG A N   
908  C CA  . ARG A 203 ? 0.3399 0.3334 0.2946 0.0682  0.0096  -0.0089 201 ARG A CA  
909  C C   . ARG A 203 ? 0.3319 0.3292 0.2979 0.0624  0.0057  -0.0153 201 ARG A C   
910  O O   . ARG A 203 ? 0.3438 0.3352 0.3157 0.0547  0.0073  -0.0128 201 ARG A O   
911  C CB  . ARG A 203 ? 0.3453 0.3340 0.2893 0.0748  0.0134  -0.0042 201 ARG A CB  
912  C CG  . ARG A 203 ? 0.3521 0.3381 0.2846 0.0833  0.0178  0.0011  201 ARG A CG  
913  C CD  . ARG A 203 ? 0.3648 0.3428 0.2876 0.0886  0.0243  0.0074  201 ARG A CD  
914  N NE  . ARG A 203 ? 0.3497 0.3333 0.2661 0.0968  0.0218  0.0040  201 ARG A NE  
915  C CZ  . ARG A 203 ? 0.4114 0.4015 0.3171 0.1089  0.0204  0.0028  201 ARG A CZ  
916  N NH1 . ARG A 203 ? 0.4035 0.3948 0.3044 0.1141  0.0213  0.0052  201 ARG A NH1 
917  N NH2 . ARG A 203 ? 0.4291 0.4249 0.3284 0.1164  0.0179  -0.0010 201 ARG A NH2 
918  N N   . THR A 204 ? 0.3160 0.3237 0.2856 0.0664  0.0009  -0.0239 202 THR A N   
919  C CA  . THR A 204 ? 0.3340 0.3451 0.3161 0.0608  -0.0018 -0.0311 202 THR A CA  
920  C C   . THR A 204 ? 0.3921 0.3987 0.3722 0.0610  -0.0006 -0.0298 202 THR A C   
921  O O   . THR A 204 ? 0.3440 0.3474 0.3128 0.0668  0.0015  -0.0252 202 THR A O   
922  C CB  . THR A 204 ? 0.3428 0.3677 0.3306 0.0653  -0.0072 -0.0427 202 THR A CB  
923  O OG1 . THR A 204 ? 0.3868 0.4171 0.3640 0.0753  -0.0094 -0.0451 202 THR A OG1 
924  C CG2 . THR A 204 ? 0.3173 0.3488 0.3069 0.0670  -0.0088 -0.0445 202 THR A CG2 
925  N N   . LEU A 205 ? 0.4599 0.4655 0.4513 0.0547  -0.0010 -0.0336 203 LEU A N   
926  C CA  . LEU A 205 ? 0.4844 0.4860 0.4756 0.0547  0.0001  -0.0330 203 LEU A CA  
927  C C   . LEU A 205 ? 0.4870 0.4957 0.4715 0.0635  -0.0024 -0.0391 203 LEU A C   
928  O O   . LEU A 205 ? 0.4573 0.4621 0.4365 0.0660  -0.0005 -0.0366 203 LEU A O   
929  C CB  . LEU A 205 ? 0.4973 0.4961 0.5027 0.0470  0.0008  -0.0360 203 LEU A CB  
930  C CG  . LEU A 205 ? 0.5484 0.5378 0.5560 0.0402  0.0043  -0.0270 203 LEU A CG  
931  C CD1 . LEU A 205 ? 0.5788 0.5654 0.5997 0.0336  0.0058  -0.0292 203 LEU A CD1 
932  C CD2 . LEU A 205 ? 0.5386 0.5215 0.5396 0.0411  0.0067  -0.0197 203 LEU A CD2 
933  N N   . ASP A 206 ? 0.5078 0.5278 0.4922 0.0686  -0.0068 -0.0472 204 ASP A N   
934  C CA  . ASP A 206 ? 0.5368 0.5662 0.5142 0.0781  -0.0104 -0.0547 204 ASP A CA  
935  C C   . ASP A 206 ? 0.4583 0.4880 0.4172 0.0890  -0.0092 -0.0485 204 ASP A C   
936  O O   . ASP A 206 ? 0.4427 0.4789 0.3921 0.0985  -0.0113 -0.0526 204 ASP A O   
937  C CB  . ASP A 206 ? 0.6114 0.6553 0.5986 0.0793  -0.0163 -0.0681 204 ASP A CB  
938  C CG  . ASP A 206 ? 0.6901 0.7350 0.6954 0.0711  -0.0167 -0.0772 204 ASP A CG  
939  O OD1 . ASP A 206 ? 0.6961 0.7343 0.7024 0.0689  -0.0142 -0.0759 204 ASP A OD1 
940  O OD2 . ASP A 206 ? 0.7308 0.7828 0.7502 0.0668  -0.0188 -0.0855 204 ASP A OD2 
941  N N   . ALA A 207 ? 0.3770 0.3995 0.3305 0.0881  -0.0055 -0.0389 205 ALA A N   
942  C CA  . ALA A 207 ? 0.3727 0.3938 0.3097 0.0985  -0.0028 -0.0323 205 ALA A CA  
943  C C   . ALA A 207 ? 0.4159 0.4281 0.3433 0.1016  0.0027  -0.0256 205 ALA A C   
944  O O   . ALA A 207 ? 0.4638 0.4679 0.3979 0.0937  0.0058  -0.0224 205 ALA A O   
945  C CB  . ALA A 207 ? 0.3417 0.3566 0.2777 0.0956  0.0007  -0.0244 205 ALA A CB  
946  N N   . PRO A 208 ? 0.4433 0.4574 0.3551 0.1139  0.0044  -0.0234 206 PRO A N   
947  C CA  . PRO A 208 ? 0.4802 0.4851 0.3821 0.1180  0.0112  -0.0165 206 PRO A CA  
948  C C   . PRO A 208 ? 0.4654 0.4564 0.3705 0.1103  0.0189  -0.0062 206 PRO A C   
949  O O   . PRO A 208 ? 0.4493 0.4372 0.3555 0.1079  0.0206  -0.0021 206 PRO A O   
950  C CB  . PRO A 208 ? 0.4794 0.4877 0.3626 0.1334  0.0129  -0.0137 206 PRO A CB  
951  C CG  . PRO A 208 ? 0.4438 0.4678 0.3283 0.1383  0.0037  -0.0236 206 PRO A CG  
952  C CD  . PRO A 208 ? 0.4326 0.4571 0.3345 0.1255  0.0008  -0.0263 206 PRO A CD  
953  N N   . PRO A 209 ? 0.4806 0.4642 0.3881 0.1066  0.0235  -0.0029 207 PRO A N   
954  C CA  . PRO A 209 ? 0.4984 0.4704 0.4092 0.1003  0.0309  0.0056  207 PRO A CA  
955  C C   . PRO A 209 ? 0.4936 0.4586 0.3922 0.1081  0.0390  0.0137  207 PRO A C   
956  O O   . PRO A 209 ? 0.5096 0.4766 0.3944 0.1200  0.0407  0.0147  207 PRO A O   
957  C CB  . PRO A 209 ? 0.4784 0.4464 0.3928 0.0979  0.0340  0.0061  207 PRO A CB  
958  C CG  . PRO A 209 ? 0.4963 0.4714 0.4034 0.1063  0.0305  0.0000  207 PRO A CG  
959  C CD  . PRO A 209 ? 0.5139 0.5001 0.4217 0.1083  0.0220  -0.0079 207 PRO A CD  
960  N N   . LEU A 210 ? 0.5064 0.4634 0.4101 0.1016  0.0443  0.0192  208 LEU A N   
961  C CA  . LEU A 210 ? 0.5202 0.4682 0.4152 0.1074  0.0540  0.0271  208 LEU A CA  
962  C C   . LEU A 210 ? 0.5183 0.4568 0.4179 0.1032  0.0628  0.0317  208 LEU A C   
963  O O   . LEU A 210 ? 0.5215 0.4610 0.4328 0.0942  0.0602  0.0289  208 LEU A O   
964  C CB  . LEU A 210 ? 0.4657 0.4117 0.3651 0.1024  0.0543  0.0287  208 LEU A CB  
965  C CG  . LEU A 210 ? 0.4619 0.4176 0.3593 0.1056  0.0462  0.0241  208 LEU A CG  
966  C CD1 . LEU A 210 ? 0.4541 0.4060 0.3563 0.1001  0.0482  0.0264  208 LEU A CD1 
967  C CD2 . LEU A 210 ? 0.4667 0.4264 0.3484 0.1208  0.0466  0.0252  208 LEU A CD2 
968  N N   . SER A 211 ? 0.5158 0.4450 0.4069 0.1102  0.0738  0.0387  209 SER A N   
969  C CA  . SER A 211 ? 0.5641 0.4838 0.4617 0.1057  0.0838  0.0427  209 SER A CA  
970  C C   . SER A 211 ? 0.5610 0.4731 0.4679 0.0980  0.0905  0.0456  209 SER A C   
971  O O   . SER A 211 ? 0.5623 0.4665 0.4762 0.0942  0.1001  0.0484  209 SER A O   
972  C CB  . SER A 211 ? 0.5418 0.4548 0.4261 0.1176  0.0939  0.0485  209 SER A CB  
973  O OG  . SER A 211 ? 0.5583 0.4666 0.4289 0.1279  0.0992  0.0543  209 SER A OG  
974  N N   . GLU A 212 ? 0.4904 0.4055 0.3984 0.0953  0.0855  0.0440  210 GLU A N   
975  C CA  A GLU A 212 ? 0.4520 0.3608 0.3678 0.0884  0.0909  0.0456  210 GLU A CA  
976  C CA  B GLU A 212 ? 0.4569 0.3659 0.3736 0.0877  0.0908  0.0454  210 GLU A CA  
977  C C   . GLU A 212 ? 0.4432 0.3599 0.3674 0.0793  0.0805  0.0401  210 GLU A C   
978  O O   . GLU A 212 ? 0.4626 0.3882 0.3842 0.0807  0.0706  0.0363  210 GLU A O   
979  C CB  A GLU A 212 ? 0.4439 0.3454 0.3484 0.0979  0.0990  0.0516  210 GLU A CB  
980  C CB  B GLU A 212 ? 0.4521 0.3518 0.3587 0.0965  0.1010  0.0519  210 GLU A CB  
981  C CG  A GLU A 212 ? 0.4417 0.3324 0.3371 0.1076  0.1124  0.0589  210 GLU A CG  
982  C CG  B GLU A 212 ? 0.4611 0.3666 0.3569 0.1044  0.0946  0.0518  210 GLU A CG  
983  C CD  A GLU A 212 ? 0.4326 0.3124 0.3404 0.0999  0.1248  0.0608  210 GLU A CD  
984  C CD  B GLU A 212 ? 0.4803 0.3761 0.3654 0.1146  0.1054  0.0593  210 GLU A CD  
985  O OE1 A GLU A 212 ? 0.4350 0.3118 0.3529 0.0917  0.1272  0.0592  210 GLU A OE1 
986  O OE1 B GLU A 212 ? 0.4981 0.3820 0.3885 0.1112  0.1174  0.0633  210 GLU A OE1 
987  O OE2 A GLU A 212 ? 0.4505 0.3258 0.3590 0.1009  0.1310  0.0633  210 GLU A OE2 
988  O OE2 B GLU A 212 ? 0.4780 0.3786 0.3500 0.1261  0.1019  0.0609  210 GLU A OE2 
989  N N   . PRO A 213 ? 0.4125 0.3259 0.3468 0.0702  0.0832  0.0392  211 PRO A N   
990  C CA  . PRO A 213 ? 0.3839 0.3041 0.3233 0.0634  0.0742  0.0349  211 PRO A CA  
991  C C   . PRO A 213 ? 0.3390 0.2615 0.2684 0.0707  0.0713  0.0357  211 PRO A C   
992  O O   . PRO A 213 ? 0.3867 0.3030 0.3076 0.0790  0.0786  0.0404  211 PRO A O   
993  C CB  . PRO A 213 ? 0.3957 0.3105 0.3443 0.0552  0.0801  0.0344  211 PRO A CB  
994  C CG  . PRO A 213 ? 0.4275 0.3358 0.3815 0.0544  0.0898  0.0362  211 PRO A CG  
995  C CD  . PRO A 213 ? 0.4101 0.3142 0.3518 0.0661  0.0947  0.0414  211 PRO A CD  
996  N N   . VAL A 214 ? 0.2957 0.2271 0.2268 0.0684  0.0611  0.0313  212 VAL A N   
997  C CA  . VAL A 214 ? 0.3210 0.2567 0.2446 0.0754  0.0578  0.0309  212 VAL A CA  
998  C C   . VAL A 214 ? 0.3829 0.3127 0.3056 0.0753  0.0636  0.0337  212 VAL A C   
999  O O   . VAL A 214 ? 0.4290 0.3590 0.3433 0.0843  0.0651  0.0360  212 VAL A O   
1000 C CB  . VAL A 214 ? 0.3428 0.2894 0.2710 0.0721  0.0467  0.0247  212 VAL A CB  
1001 C CG1 . VAL A 214 ? 0.3114 0.2583 0.2494 0.0610  0.0442  0.0226  212 VAL A CG1 
1002 C CG2 . VAL A 214 ? 0.3208 0.2737 0.2424 0.0804  0.0432  0.0232  212 VAL A CG2 
1003 N N   . ALA A 215 ? 0.3969 0.3218 0.3281 0.0659  0.0671  0.0333  213 ALA A N   
1004 C CA  . ALA A 215 ? 0.4173 0.3361 0.3487 0.0650  0.0732  0.0351  213 ALA A CA  
1005 C C   . ALA A 215 ? 0.4322 0.3399 0.3576 0.0726  0.0856  0.0413  213 ALA A C   
1006 O O   . ALA A 215 ? 0.4912 0.3928 0.4148 0.0748  0.0918  0.0437  213 ALA A O   
1007 C CB  . ALA A 215 ? 0.3894 0.3072 0.3316 0.0529  0.0732  0.0315  213 ALA A CB  
1008 N N   . ALA A 216 ? 0.4142 0.3184 0.3365 0.0768  0.0900  0.0441  214 ALA A N   
1009 C CA  . ALA A 216 ? 0.4351 0.3274 0.3511 0.0849  0.1033  0.0509  214 ALA A CA  
1010 C C   . ALA A 216 ? 0.4639 0.3571 0.3641 0.1001  0.1037  0.0559  214 ALA A C   
1011 O O   . ALA A 216 ? 0.4452 0.3282 0.3377 0.1091  0.1152  0.0629  214 ALA A O   
1012 C CB  . ALA A 216 ? 0.3755 0.2631 0.2953 0.0832  0.1094  0.0521  214 ALA A CB  
1013 N N   . THR A 217 ? 0.4860 0.3919 0.3820 0.1035  0.0916  0.0521  215 THR A N   
1014 C CA  . THR A 217 ? 0.5429 0.4532 0.4247 0.1182  0.0898  0.0549  215 THR A CA  
1015 C C   . THR A 217 ? 0.5661 0.4768 0.4462 0.1216  0.0901  0.0560  215 THR A C   
1016 O O   . THR A 217 ? 0.6346 0.5488 0.5031 0.1348  0.0896  0.0589  215 THR A O   
1017 C CB  . THR A 217 ? 0.5795 0.5049 0.4595 0.1204  0.0765  0.0485  215 THR A CB  
1018 O OG1 . THR A 217 ? 0.5654 0.4993 0.4562 0.1104  0.0669  0.0415  215 THR A OG1 
1019 C CG2 . THR A 217 ? 0.5962 0.5214 0.4780 0.1173  0.0760  0.0471  215 THR A CG2 
1020 N N   . GLY A 218 ? 0.5104 0.4185 0.4017 0.1101  0.0904  0.0533  216 GLY A N   
1021 C CA  . GLY A 218 ? 0.4785 0.3860 0.3695 0.1121  0.0916  0.0540  216 GLY A CA  
1022 C C   . GLY A 218 ? 0.4667 0.3891 0.3584 0.1134  0.0790  0.0483  216 GLY A C   
1023 O O   . GLY A 218 ? 0.5250 0.4491 0.4147 0.1183  0.0793  0.0492  216 GLY A O   
1024 N N   . VAL A 219 ? 0.4546 0.3877 0.3506 0.1087  0.0687  0.0420  217 VAL A N   
1025 C CA  . VAL A 219 ? 0.4301 0.3777 0.3285 0.1099  0.0575  0.0356  217 VAL A CA  
1026 C C   . VAL A 219 ? 0.4112 0.3609 0.3193 0.1011  0.0551  0.0321  217 VAL A C   
1027 O O   . VAL A 219 ? 0.4446 0.4034 0.3533 0.1054  0.0500  0.0291  217 VAL A O   
1028 C CB  . VAL A 219 ? 0.4438 0.4014 0.3458 0.1069  0.0482  0.0293  217 VAL A CB  
1029 C CG1 . VAL A 219 ? 0.3648 0.3187 0.2775 0.0927  0.0474  0.0270  217 VAL A CG1 
1030 C CG2 . VAL A 219 ? 0.4551 0.4277 0.3609 0.1091  0.0382  0.0220  217 VAL A CG2 
1031 N N   . LEU A 220 ? 0.3787 0.3206 0.2942 0.0894  0.0588  0.0322  218 LEU A N   
1032 C CA  . LEU A 220 ? 0.3456 0.2885 0.2685 0.0817  0.0575  0.0293  218 LEU A CA  
1033 C C   . LEU A 220 ? 0.3461 0.2854 0.2645 0.0892  0.0632  0.0328  218 LEU A C   
1034 O O   . LEU A 220 ? 0.3905 0.3366 0.3119 0.0897  0.0593  0.0299  218 LEU A O   
1035 C CB  . LEU A 220 ? 0.3458 0.2815 0.2758 0.0691  0.0606  0.0284  218 LEU A CB  
1036 C CG  . LEU A 220 ? 0.3537 0.2908 0.2900 0.0611  0.0589  0.0251  218 LEU A CG  
1037 C CD1 . LEU A 220 ? 0.3055 0.2542 0.2459 0.0599  0.0498  0.0203  218 LEU A CD1 
1038 C CD2 . LEU A 220 ? 0.3730 0.3051 0.3150 0.0498  0.0609  0.0235  218 LEU A CD2 
1039 N N   . GLY A 221 ? 0.3949 0.3231 0.3067 0.0953  0.0733  0.0393  219 GLY A N   
1040 C CA  . GLY A 221 ? 0.4184 0.3412 0.3251 0.1040  0.0804  0.0440  219 GLY A CA  
1041 C C   . GLY A 221 ? 0.3989 0.3325 0.2982 0.1179  0.0751  0.0445  219 GLY A C   
1042 O O   . GLY A 221 ? 0.4500 0.3859 0.3493 0.1224  0.0758  0.0450  219 GLY A O   
1043 N N   . HIS A 222 ? 0.4124 0.3537 0.3056 0.1250  0.0697  0.0439  220 HIS A N   
1044 C CA  . HIS A 222 ? 0.4220 0.3766 0.3085 0.1385  0.0629  0.0425  220 HIS A CA  
1045 C C   . HIS A 222 ? 0.4327 0.4015 0.3301 0.1327  0.0527  0.0338  220 HIS A C   
1046 O O   . HIS A 222 ? 0.5189 0.4963 0.4158 0.1406  0.0500  0.0325  220 HIS A O   
1047 C CB  . HIS A 222 ? 0.4745 0.4354 0.3534 0.1454  0.0583  0.0416  220 HIS A CB  
1048 C CG  . HIS A 222 ? 0.5559 0.5035 0.4231 0.1525  0.0689  0.0506  220 HIS A CG  
1049 N ND1 . HIS A 222 ? 0.6019 0.5362 0.4639 0.1535  0.0800  0.0591  220 HIS A ND1 
1050 C CD2 . HIS A 222 ? 0.5794 0.5255 0.4400 0.1549  0.0695  0.0522  220 HIS A CD2 
1051 C CE1 . HIS A 222 ? 0.6024 0.5276 0.4553 0.1563  0.0875  0.0657  220 HIS A CE1 
1052 N NE2 . HIS A 222 ? 0.5827 0.5148 0.4343 0.1573  0.0812  0.0618  220 HIS A NE2 
1053 N N   . PHE A 223 ? 0.3912 0.3623 0.2988 0.1192  0.0477  0.0279  221 PHE A N   
1054 C CA  . PHE A 223 ? 0.4134 0.3966 0.3325 0.1127  0.0394  0.0197  221 PHE A CA  
1055 C C   . PHE A 223 ? 0.3547 0.3341 0.2788 0.1088  0.0434  0.0205  221 PHE A C   
1056 O O   . PHE A 223 ? 0.3463 0.3363 0.2758 0.1115  0.0389  0.0162  221 PHE A O   
1057 C CB  . PHE A 223 ? 0.4244 0.4079 0.3520 0.0997  0.0352  0.0151  221 PHE A CB  
1058 C CG  . PHE A 223 ? 0.4154 0.4096 0.3553 0.0928  0.0282  0.0071  221 PHE A CG  
1059 C CD1 . PHE A 223 ? 0.4071 0.4166 0.3505 0.0998  0.0212  0.0006  221 PHE A CD1 
1060 C CD2 . PHE A 223 ? 0.4031 0.3926 0.3513 0.0798  0.0289  0.0057  221 PHE A CD2 
1061 C CE1 . PHE A 223 ? 0.3342 0.3531 0.2911 0.0928  0.0160  -0.0073 221 PHE A CE1 
1062 C CE2 . PHE A 223 ? 0.4041 0.4020 0.3636 0.0738  0.0241  -0.0009 221 PHE A CE2 
1063 C CZ  . PHE A 223 ? 0.3494 0.3616 0.3142 0.0798  0.0182  -0.0074 221 PHE A CZ  
1064 N N   . VAL A 224 ? 0.3189 0.2837 0.2423 0.1024  0.0520  0.0254  222 VAL A N   
1065 C CA  . VAL A 224 ? 0.3174 0.2772 0.2450 0.0984  0.0568  0.0260  222 VAL A CA  
1066 C C   . VAL A 224 ? 0.3662 0.3282 0.2883 0.1118  0.0597  0.0294  222 VAL A C   
1067 O O   . VAL A 224 ? 0.3959 0.3641 0.3237 0.1120  0.0579  0.0265  222 VAL A O   
1068 C CB  . VAL A 224 ? 0.3156 0.2596 0.2432 0.0898  0.0659  0.0296  222 VAL A CB  
1069 C CG1 . VAL A 224 ? 0.3319 0.2685 0.2607 0.0895  0.0736  0.0316  222 VAL A CG1 
1070 C CG2 . VAL A 224 ? 0.2801 0.2247 0.2148 0.0762  0.0619  0.0252  222 VAL A CG2 
1071 N N   . GLU A 225 ? 0.3710 0.3281 0.2822 0.1236  0.0646  0.0359  223 GLU A N   
1072 C CA  . GLU A 225 ? 0.4381 0.3967 0.3420 0.1387  0.0679  0.0405  223 GLU A CA  
1073 C C   . GLU A 225 ? 0.4105 0.3894 0.3168 0.1465  0.0568  0.0343  223 GLU A C   
1074 O O   . GLU A 225 ? 0.4303 0.4147 0.3378 0.1538  0.0569  0.0344  223 GLU A O   
1075 C CB  . GLU A 225 ? 0.5345 0.4844 0.4245 0.1496  0.0748  0.0491  223 GLU A CB  
1076 C CG  . GLU A 225 ? 0.6827 0.6127 0.5713 0.1429  0.0874  0.0556  223 GLU A CG  
1077 C CD  . GLU A 225 ? 0.7716 0.6945 0.6468 0.1505  0.0933  0.0642  223 GLU A CD  
1078 O OE1 . GLU A 225 ? 0.7604 0.6779 0.6341 0.1471  0.0955  0.0651  223 GLU A OE1 
1079 O OE2 . GLU A 225 ? 0.8149 0.7381 0.6807 0.1601  0.0964  0.0699  223 GLU A OE2 
1080 N N   . PHE A 226 ? 0.3746 0.3651 0.2831 0.1449  0.0474  0.0281  224 PHE A N   
1081 C CA  . PHE A 226 ? 0.3678 0.3789 0.2818 0.1506  0.0365  0.0197  224 PHE A CA  
1082 C C   . PHE A 226 ? 0.3785 0.3951 0.3071 0.1414  0.0343  0.0138  224 PHE A C   
1083 O O   . PHE A 226 ? 0.3901 0.4180 0.3222 0.1491  0.0313  0.0110  224 PHE A O   
1084 C CB  . PHE A 226 ? 0.3519 0.3731 0.2683 0.1477  0.0277  0.0127  224 PHE A CB  
1085 C CG  . PHE A 226 ? 0.3495 0.3931 0.2713 0.1553  0.0168  0.0031  224 PHE A CG  
1086 C CD1 . PHE A 226 ? 0.3420 0.3956 0.2534 0.1734  0.0144  0.0046  224 PHE A CD1 
1087 C CD2 . PHE A 226 ? 0.3166 0.3716 0.2545 0.1449  0.0093  -0.0078 224 PHE A CD2 
1088 C CE1 . PHE A 226 ? 0.3457 0.4220 0.2629 0.1804  0.0035  -0.0059 224 PHE A CE1 
1089 C CE2 . PHE A 226 ? 0.3317 0.4081 0.2772 0.1512  -0.0003 -0.0182 224 PHE A CE2 
1090 C CZ  . PHE A 226 ? 0.3222 0.4103 0.2576 0.1691  -0.0038 -0.0179 224 PHE A CZ  
1091 N N   . LEU A 227 ? 0.3575 0.3658 0.2940 0.1256  0.0362  0.0122  225 LEU A N   
1092 C CA  . LEU A 227 ? 0.3458 0.3577 0.2954 0.1159  0.0352  0.0070  225 LEU A CA  
1093 C C   . LEU A 227 ? 0.3365 0.3415 0.2850 0.1188  0.0427  0.0115  225 LEU A C   
1094 O O   . LEU A 227 ? 0.3681 0.3798 0.3262 0.1162  0.0414  0.0072  225 LEU A O   
1095 C CB  . LEU A 227 ? 0.2954 0.2991 0.2507 0.1000  0.0362  0.0055  225 LEU A CB  
1096 C CG  . LEU A 227 ? 0.3293 0.3393 0.2882 0.0954  0.0293  0.0005  225 LEU A CG  
1097 C CD1 . LEU A 227 ? 0.3065 0.3057 0.2680 0.0817  0.0320  0.0016  225 LEU A CD1 
1098 C CD2 . LEU A 227 ? 0.3123 0.3398 0.2837 0.0958  0.0213  -0.0092 225 LEU A CD2 
1099 N N   . GLU A 228 ? 0.3326 0.3233 0.2702 0.1238  0.0514  0.0201  226 GLU A N   
1100 C CA  . GLU A 228 ? 0.3802 0.3633 0.3165 0.1277  0.0595  0.0247  226 GLU A CA  
1101 C C   . GLU A 228 ? 0.4099 0.4054 0.3438 0.1440  0.0566  0.0251  226 GLU A C   
1102 O O   . GLU A 228 ? 0.4077 0.4071 0.3477 0.1456  0.0578  0.0237  226 GLU A O   
1103 C CB  . GLU A 228 ? 0.3754 0.3386 0.3029 0.1275  0.0711  0.0330  226 GLU A CB  
1104 C CG  . GLU A 228 ? 0.4084 0.3608 0.3411 0.1109  0.0745  0.0312  226 GLU A CG  
1105 C CD  . GLU A 228 ? 0.4374 0.3727 0.3638 0.1092  0.0844  0.0372  226 GLU A CD  
1106 O OE1 . GLU A 228 ? 0.4103 0.3414 0.3276 0.1204  0.0884  0.0433  226 GLU A OE1 
1107 O OE2 . GLU A 228 ? 0.3888 0.3153 0.3197 0.0970  0.0884  0.0354  226 GLU A OE2 
1108 N N   . SER A 229 ? 0.3943 0.3971 0.3192 0.1565  0.0524  0.0267  227 SER A N   
1109 C CA  . SER A 229 ? 0.4298 0.4453 0.3502 0.1706  0.0480  0.0272  227 SER A CA  
1110 C C   . SER A 229 ? 0.3903 0.4266 0.3257 0.1707  0.0388  0.0164  227 SER A C   
1111 O O   . SER A 229 ? 0.4306 0.4762 0.3675 0.1778  0.0365  0.0157  227 SER A O   
1112 C CB  . SER A 229 ? 0.4126 0.4327 0.3187 0.1802  0.0438  0.0301  227 SER A CB  
1113 O OG  . SER A 229 ? 0.4431 0.4787 0.3547 0.1795  0.0333  0.0208  227 SER A OG  
1114 N N   . LEU A 230 ? 0.3853 0.4271 0.3322 0.1579  0.0333  0.0081  228 LEU A N   
1115 C CA  . LEU A 230 ? 0.3880 0.4476 0.3519 0.1534  0.0255  -0.0030 228 LEU A CA  
1116 C C   . LEU A 230 ? 0.3919 0.4448 0.3659 0.1432  0.0313  -0.0033 228 LEU A C   
1117 O O   . LEU A 230 ? 0.3741 0.4397 0.3632 0.1387  0.0271  -0.0116 228 LEU A O   
1118 C CB  . LEU A 230 ? 0.3450 0.4111 0.3171 0.1427  0.0184  -0.0112 228 LEU A CB  
1119 C CG  . LEU A 230 ? 0.3755 0.4533 0.3417 0.1516  0.0104  -0.0148 228 LEU A CG  
1120 C CD1 . LEU A 230 ? 0.3528 0.4279 0.3243 0.1387  0.0076  -0.0194 228 LEU A CD1 
1121 C CD2 . LEU A 230 ? 0.3148 0.4179 0.2895 0.1624  0.0008  -0.0248 228 LEU A CD2 
1122 N N   . LYS A 231 ? 0.3942 0.4273 0.3606 0.1392  0.0415  0.0052  229 LYS A N   
1123 C CA  . LYS A 231 ? 0.3799 0.4049 0.3540 0.1288  0.0477  0.0049  229 LYS A CA  
1124 C C   . LYS A 231 ? 0.3888 0.4140 0.3733 0.1124  0.0452  -0.0013 229 LYS A C   
1125 O O   . LYS A 231 ? 0.4303 0.4548 0.4239 0.1047  0.0480  -0.0041 229 LYS A O   
1126 C CB  . LYS A 231 ? 0.3755 0.4118 0.3576 0.1366  0.0473  0.0023  229 LYS A CB  
1127 C CG  . LYS A 231 ? 0.4639 0.5012 0.4356 0.1548  0.0499  0.0090  229 LYS A CG  
1128 C CD  . LYS A 231 ? 0.5694 0.5842 0.5267 0.1562  0.0608  0.0198  229 LYS A CD  
1129 C CE  . LYS A 231 ? 0.6847 0.6971 0.6311 0.1688  0.0634  0.0277  229 LYS A CE  
1130 N NZ  . LYS A 231 ? 0.7555 0.7468 0.6883 0.1681  0.0729  0.0378  229 LYS A NZ  
1131 N N   . TYR A 232 ? 0.3463 0.3722 0.3294 0.1076  0.0405  -0.0032 230 TYR A N   
1132 C CA  . TYR A 232 ? 0.3507 0.3734 0.3413 0.0927  0.0398  -0.0070 230 TYR A CA  
1133 C C   . TYR A 232 ? 0.3486 0.3524 0.3315 0.0843  0.0478  -0.0007 230 TYR A C   
1134 O O   . TYR A 232 ? 0.3499 0.3486 0.3374 0.0749  0.0515  -0.0018 230 TYR A O   
1135 C CB  . TYR A 232 ? 0.3323 0.3621 0.3251 0.0904  0.0325  -0.0114 230 TYR A CB  
1136 C CG  . TYR A 232 ? 0.3240 0.3478 0.3223 0.0761  0.0330  -0.0134 230 TYR A CG  
1137 C CD1 . TYR A 232 ? 0.3009 0.3314 0.3132 0.0688  0.0320  -0.0197 230 TYR A CD1 
1138 C CD2 . TYR A 232 ? 0.3059 0.3175 0.2958 0.0705  0.0351  -0.0086 230 TYR A CD2 
1139 C CE1 . TYR A 232 ? 0.2871 0.3112 0.3031 0.0571  0.0335  -0.0202 230 TYR A CE1 
1140 C CE2 . TYR A 232 ? 0.2980 0.3048 0.2920 0.0590  0.0354  -0.0098 230 TYR A CE2 
1141 C CZ  . TYR A 232 ? 0.3019 0.3146 0.3081 0.0527  0.0348  -0.0151 230 TYR A CZ  
1142 O OH  . TYR A 232 ? 0.2611 0.2682 0.2700 0.0427  0.0359  -0.0152 230 TYR A OH  
1143 N N   . LEU A 233 ? 0.3153 0.3092 0.2867 0.0881  0.0508  0.0053  231 LEU A N   
1144 C CA  . LEU A 233 ? 0.3241 0.3013 0.2894 0.0812  0.0588  0.0101  231 LEU A CA  
1145 C C   . LEU A 233 ? 0.3434 0.3133 0.3053 0.0874  0.0669  0.0144  231 LEU A C   
1146 O O   . LEU A 233 ? 0.4296 0.4004 0.3858 0.0998  0.0684  0.0184  231 LEU A O   
1147 C CB  . LEU A 233 ? 0.2707 0.2403 0.2274 0.0819  0.0595  0.0142  231 LEU A CB  
1148 C CG  . LEU A 233 ? 0.2636 0.2367 0.2225 0.0748  0.0532  0.0111  231 LEU A CG  
1149 C CD1 . LEU A 233 ? 0.3035 0.2671 0.2541 0.0754  0.0562  0.0157  231 LEU A CD1 
1150 C CD2 . LEU A 233 ? 0.2205 0.1920 0.1859 0.0618  0.0527  0.0077  231 LEU A CD2 
1151 N N   . GLU A 234 ? 0.3608 0.3235 0.3257 0.0796  0.0725  0.0136  232 GLU A N   
1152 C CA  . GLU A 234 ? 0.4241 0.3800 0.3874 0.0851  0.0806  0.0168  232 GLU A CA  
1153 C C   . GLU A 234 ? 0.4171 0.3560 0.3761 0.0786  0.0903  0.0194  232 GLU A C   
1154 O O   . GLU A 234 ? 0.3950 0.3258 0.3524 0.0831  0.0986  0.0224  232 GLU A O   
1155 C CB  . GLU A 234 ? 0.4593 0.4241 0.4316 0.0850  0.0796  0.0126  232 GLU A CB  
1156 C CG  . GLU A 234 ? 0.5067 0.4713 0.4851 0.0717  0.0790  0.0078  232 GLU A CG  
1157 C CD  . GLU A 234 ? 0.5143 0.4859 0.5018 0.0719  0.0803  0.0042  232 GLU A CD  
1158 O OE1 . GLU A 234 ? 0.5002 0.4862 0.4959 0.0771  0.0745  0.0007  232 GLU A OE1 
1159 O OE2 . GLU A 234 ? 0.4994 0.4624 0.4866 0.0668  0.0872  0.0042  232 GLU A OE2 
1160 N N   . ALA A 235 ? 0.3833 0.3174 0.3413 0.0684  0.0893  0.0178  233 ALA A N   
1161 C CA  . ALA A 235 ? 0.3974 0.3175 0.3529 0.0618  0.0976  0.0184  233 ALA A CA  
1162 C C   . ALA A 235 ? 0.3705 0.2881 0.3241 0.0544  0.0948  0.0175  233 ALA A C   
1163 O O   . ALA A 235 ? 0.4247 0.3506 0.3800 0.0502  0.0868  0.0150  233 ALA A O   
1164 C CB  . ALA A 235 ? 0.3802 0.2981 0.3395 0.0539  0.1009  0.0142  233 ALA A CB  
1165 N N   . THR A 236 ? 0.4052 0.3114 0.3564 0.0532  0.1021  0.0194  234 THR A N   
1166 C CA  . THR A 236 ? 0.4219 0.3260 0.3723 0.0472  0.1002  0.0186  234 THR A CA  
1167 C C   . THR A 236 ? 0.4429 0.3405 0.3960 0.0364  0.1045  0.0138  234 THR A C   
1168 O O   . THR A 236 ? 0.4688 0.3571 0.4233 0.0359  0.1138  0.0132  234 THR A O   
1169 C CB  . THR A 236 ? 0.4607 0.3579 0.4073 0.0548  0.1054  0.0241  234 THR A CB  
1170 O OG1 . THR A 236 ? 0.5024 0.4073 0.4450 0.0656  0.1002  0.0279  234 THR A OG1 
1171 C CG2 . THR A 236 ? 0.3810 0.2761 0.3286 0.0479  0.1041  0.0226  234 THR A CG2 
1172 N N   . MET A 237 ? 0.3890 0.2920 0.3431 0.0281  0.0979  0.0099  235 MET A N   
1173 C CA  . MET A 237 ? 0.3838 0.2829 0.3399 0.0187  0.1007  0.0046  235 MET A CA  
1174 C C   . MET A 237 ? 0.4054 0.2998 0.3633 0.0169  0.1034  0.0046  235 MET A C   
1175 O O   . MET A 237 ? 0.3756 0.2628 0.3372 0.0125  0.1107  0.0011  235 MET A O   
1176 C CB  . MET A 237 ? 0.4019 0.3094 0.3572 0.0118  0.0927  0.0007  235 MET A CB  
1177 C CG  . MET A 237 ? 0.3980 0.3075 0.3528 0.0112  0.0934  -0.0009 235 MET A CG  
1178 S SD  . MET A 237 ? 0.5343 0.4540 0.4875 0.0074  0.0844  -0.0019 235 MET A SD  
1179 C CE  . MET A 237 ? 0.5083 0.4266 0.4610 0.0058  0.0892  -0.0047 235 MET A CE  
1180 N N   . ALA A 238 ? 0.4112 0.3101 0.3677 0.0200  0.0978  0.0080  236 ALA A N   
1181 C CA  . ALA A 238 ? 0.4247 0.3198 0.3833 0.0189  0.1002  0.0085  236 ALA A CA  
1182 C C   . ALA A 238 ? 0.4035 0.3030 0.3585 0.0257  0.0950  0.0136  236 ALA A C   
1183 O O   . ALA A 238 ? 0.4171 0.3254 0.3702 0.0267  0.0863  0.0138  236 ALA A O   
1184 C CB  . ALA A 238 ? 0.4130 0.3121 0.3753 0.0090  0.0965  0.0022  236 ALA A CB  
1185 N N   . GLN A 239 ? 0.4575 0.3502 0.4119 0.0304  0.1010  0.0175  237 GLN A N   
1186 C CA  . GLN A 239 ? 0.4589 0.3554 0.4091 0.0375  0.0968  0.0220  237 GLN A CA  
1187 C C   . GLN A 239 ? 0.4517 0.3420 0.4040 0.0369  0.1023  0.0234  237 GLN A C   
1188 O O   . GLN A 239 ? 0.4595 0.3390 0.4139 0.0378  0.1134  0.0249  237 GLN A O   
1189 C CB  . GLN A 239 ? 0.4554 0.3511 0.3993 0.0495  0.0989  0.0275  237 GLN A CB  
1190 C CG  . GLN A 239 ? 0.4197 0.3202 0.3579 0.0582  0.0945  0.0315  237 GLN A CG  
1191 C CD  . GLN A 239 ? 0.4085 0.3105 0.3398 0.0712  0.0956  0.0362  237 GLN A CD  
1192 O OE1 . GLN A 239 ? 0.3840 0.2849 0.3158 0.0733  0.0982  0.0363  237 GLN A OE1 
1193 N NE2 . GLN A 239 ? 0.4041 0.3094 0.3288 0.0806  0.0932  0.0397  237 GLN A NE2 
1194 N N   . GLY A 240 ? 0.4273 0.3238 0.3797 0.0353  0.0955  0.0230  238 GLY A N   
1195 C CA  . GLY A 240 ? 0.3103 0.2020 0.2644 0.0361  0.1003  0.0249  238 GLY A CA  
1196 C C   . GLY A 240 ? 0.3677 0.2656 0.3157 0.0431  0.0936  0.0284  238 GLY A C   
1197 O O   . GLY A 240 ? 0.3579 0.2630 0.3013 0.0475  0.0865  0.0288  238 GLY A O   
1198 N N   . PRO A 241 ? 0.3854 0.2810 0.3343 0.0439  0.0960  0.0300  239 PRO A N   
1199 C CA  . PRO A 241 ? 0.3838 0.2850 0.3266 0.0508  0.0903  0.0328  239 PRO A CA  
1200 C C   . PRO A 241 ? 0.3543 0.2668 0.2997 0.0456  0.0780  0.0285  239 PRO A C   
1201 O O   . PRO A 241 ? 0.3324 0.2512 0.2732 0.0512  0.0720  0.0293  239 PRO A O   
1202 C CB  . PRO A 241 ? 0.3798 0.2739 0.3243 0.0517  0.0980  0.0353  239 PRO A CB  
1203 C CG  . PRO A 241 ? 0.3806 0.2697 0.3358 0.0418  0.1040  0.0312  239 PRO A CG  
1204 C CD  . PRO A 241 ? 0.3800 0.2673 0.3362 0.0391  0.1055  0.0291  239 PRO A CD  
1205 N N   . LEU A 242 ? 0.3610 0.2764 0.3135 0.0356  0.0748  0.0238  240 LEU A N   
1206 C CA  . LEU A 242 ? 0.3410 0.2657 0.2958 0.0310  0.0646  0.0206  240 LEU A CA  
1207 C C   . LEU A 242 ? 0.3679 0.2975 0.3224 0.0286  0.0596  0.0184  240 LEU A C   
1208 O O   . LEU A 242 ? 0.3246 0.2611 0.2795 0.0279  0.0522  0.0171  240 LEU A O   
1209 C CB  . LEU A 242 ? 0.3485 0.2744 0.3104 0.0227  0.0637  0.0174  240 LEU A CB  
1210 C CG  . LEU A 242 ? 0.4233 0.3468 0.3880 0.0237  0.0672  0.0187  240 LEU A CG  
1211 C CD1 . LEU A 242 ? 0.4326 0.3579 0.4063 0.0154  0.0676  0.0143  240 LEU A CD1 
1212 C CD2 . LEU A 242 ? 0.4107 0.3395 0.3724 0.0278  0.0608  0.0202  240 LEU A CD2 
1213 N N   . LYS A 243 ? 0.3741 0.2994 0.3286 0.0271  0.0644  0.0177  241 LYS A N   
1214 C CA  . LYS A 243 ? 0.3706 0.3000 0.3255 0.0238  0.0607  0.0153  241 LYS A CA  
1215 C C   . LYS A 243 ? 0.3413 0.2666 0.2940 0.0274  0.0660  0.0162  241 LYS A C   
1216 O O   . LYS A 243 ? 0.3797 0.2971 0.3328 0.0274  0.0740  0.0168  241 LYS A O   
1217 C CB  . LYS A 243 ? 0.3699 0.3007 0.3286 0.0148  0.0591  0.0114  241 LYS A CB  
1218 C CG  . LYS A 243 ? 0.3967 0.3297 0.3545 0.0117  0.0576  0.0093  241 LYS A CG  
1219 C CD  . LYS A 243 ? 0.4784 0.4168 0.4370 0.0058  0.0519  0.0069  241 LYS A CD  
1220 C CE  . LYS A 243 ? 0.5139 0.4513 0.4724 0.0004  0.0543  0.0031  241 LYS A CE  
1221 N NZ  . LYS A 243 ? 0.5146 0.4470 0.4765 -0.0011 0.0605  0.0007  241 LYS A NZ  
1222 N N   . TYR A 244 ? 0.3147 0.2455 0.2663 0.0302  0.0618  0.0159  242 TYR A N   
1223 C CA  . TYR A 244 ? 0.3242 0.2532 0.2747 0.0334  0.0656  0.0163  242 TYR A CA  
1224 C C   . TYR A 244 ? 0.3390 0.2712 0.2921 0.0267  0.0631  0.0128  242 TYR A C   
1225 O O   . TYR A 244 ? 0.3866 0.3253 0.3416 0.0238  0.0568  0.0112  242 TYR A O   
1226 C CB  . TYR A 244 ? 0.2909 0.2251 0.2389 0.0431  0.0631  0.0182  242 TYR A CB  
1227 C CG  . TYR A 244 ? 0.2943 0.2294 0.2427 0.0462  0.0654  0.0179  242 TYR A CG  
1228 C CD1 . TYR A 244 ? 0.3015 0.2291 0.2467 0.0522  0.0734  0.0212  242 TYR A CD1 
1229 C CD2 . TYR A 244 ? 0.3147 0.2573 0.2674 0.0432  0.0605  0.0144  242 TYR A CD2 
1230 C CE1 . TYR A 244 ? 0.3270 0.2556 0.2730 0.0555  0.0757  0.0210  242 TYR A CE1 
1231 C CE2 . TYR A 244 ? 0.3457 0.2895 0.2999 0.0459  0.0629  0.0138  242 TYR A CE2 
1232 C CZ  . TYR A 244 ? 0.3558 0.2930 0.3066 0.0522  0.0701  0.0171  242 TYR A CZ  
1233 O OH  . TYR A 244 ? 0.3686 0.3072 0.3212 0.0554  0.0726  0.0166  242 TYR A OH  
1234 N N   . MET A 245 ? 0.3361 0.2632 0.2892 0.0247  0.0689  0.0117  243 MET A N   
1235 C CA  . MET A 245 ? 0.3566 0.2863 0.3110 0.0198  0.0678  0.0088  243 MET A CA  
1236 C C   . MET A 245 ? 0.3854 0.3125 0.3396 0.0245  0.0730  0.0095  243 MET A C   
1237 O O   . MET A 245 ? 0.3315 0.2507 0.2848 0.0265  0.0803  0.0106  243 MET A O   
1238 C CB  . MET A 245 ? 0.3447 0.2716 0.2990 0.0116  0.0694  0.0053  243 MET A CB  
1239 C CG  . MET A 245 ? 0.4567 0.3872 0.4114 0.0074  0.0640  0.0045  243 MET A CG  
1240 S SD  . MET A 245 ? 0.5221 0.4539 0.4761 -0.0010 0.0633  -0.0005 243 MET A SD  
1241 C CE  . MET A 245 ? 0.3549 0.2786 0.3116 -0.0027 0.0723  -0.0040 243 MET A CE  
1242 N N   . GLY A 246 ? 0.4555 0.3887 0.4116 0.0262  0.0701  0.0088  244 GLY A N   
1243 C CA  . GLY A 246 ? 0.4281 0.3600 0.3850 0.0309  0.0747  0.0092  244 GLY A CA  
1244 C C   . GLY A 246 ? 0.3773 0.3167 0.3384 0.0302  0.0718  0.0069  244 GLY A C   
1245 O O   . GLY A 246 ? 0.3071 0.2499 0.2698 0.0240  0.0683  0.0048  244 GLY A O   
1246 N N   . MET A 247 ? 0.3788 0.3206 0.3420 0.0371  0.0738  0.0075  245 MET A N   
1247 C CA  . MET A 247 ? 0.3557 0.3054 0.3252 0.0369  0.0719  0.0048  245 MET A CA  
1248 C C   . MET A 247 ? 0.3406 0.3011 0.3147 0.0453  0.0667  0.0043  245 MET A C   
1249 O O   . MET A 247 ? 0.3319 0.2924 0.3029 0.0545  0.0676  0.0070  245 MET A O   
1250 C CB  . MET A 247 ? 0.3583 0.3036 0.3284 0.0375  0.0788  0.0044  245 MET A CB  
1251 C CG  . MET A 247 ? 0.4100 0.3454 0.3756 0.0299  0.0844  0.0034  245 MET A CG  
1252 S SD  . MET A 247 ? 0.3731 0.3103 0.3378 0.0193  0.0813  0.0004  245 MET A SD  
1253 C CE  . MET A 247 ? 0.2725 0.2181 0.2449 0.0200  0.0804  -0.0014 245 MET A CE  
1254 N N   . GLY A 248 ? 0.2782 0.2478 0.2596 0.0424  0.0615  0.0006  246 GLY A N   
1255 C CA  . GLY A 248 ? 0.3087 0.2909 0.2967 0.0493  0.0557  -0.0022 246 GLY A CA  
1256 C C   . GLY A 248 ? 0.3366 0.3276 0.3362 0.0475  0.0553  -0.0071 246 GLY A C   
1257 O O   . GLY A 248 ? 0.3647 0.3529 0.3676 0.0391  0.0575  -0.0084 246 GLY A O   
1258 N N   . ARG A 249 ? 0.3264 0.3286 0.3322 0.0561  0.0525  -0.0099 247 ARG A N   
1259 C CA  . ARG A 249 ? 0.3358 0.3480 0.3549 0.0552  0.0524  -0.0154 247 ARG A CA  
1260 C C   . ARG A 249 ? 0.3310 0.3601 0.3603 0.0614  0.0448  -0.0218 247 ARG A C   
1261 O O   . ARG A 249 ? 0.3450 0.3804 0.3702 0.0721  0.0412  -0.0213 247 ARG A O   
1262 C CB  . ARG A 249 ? 0.3366 0.3468 0.3550 0.0601  0.0580  -0.0136 247 ARG A CB  
1263 C CG  . ARG A 249 ? 0.3597 0.3776 0.3916 0.0576  0.0601  -0.0187 247 ARG A CG  
1264 C CD  . ARG A 249 ? 0.3770 0.3969 0.4098 0.0659  0.0638  -0.0175 247 ARG A CD  
1265 N NE  . ARG A 249 ? 0.3945 0.3986 0.4147 0.0658  0.0711  -0.0111 247 ARG A NE  
1266 C CZ  . ARG A 249 ? 0.3582 0.3530 0.3773 0.0589  0.0784  -0.0103 247 ARG A CZ  
1267 N NH1 . ARG A 249 ? 0.3356 0.3344 0.3642 0.0520  0.0797  -0.0145 247 ARG A NH1 
1268 N NH2 . ARG A 249 ? 0.3299 0.3113 0.3389 0.0591  0.0849  -0.0059 247 ARG A NH2 
1269 N N   . LEU A 250 ? 0.3096 0.3462 0.3521 0.0551  0.0426  -0.0282 248 LEU A N   
1270 C CA  . LEU A 250 ? 0.3494 0.4040 0.4047 0.0601  0.0354  -0.0366 248 LEU A CA  
1271 C C   . LEU A 250 ? 0.3827 0.4496 0.4444 0.0697  0.0344  -0.0398 248 LEU A C   
1272 O O   . LEU A 250 ? 0.3694 0.4320 0.4327 0.0684  0.0404  -0.0378 248 LEU A O   
1273 C CB  . LEU A 250 ? 0.3525 0.4118 0.4241 0.0505  0.0357  -0.0435 248 LEU A CB  
1274 C CG  . LEU A 250 ? 0.3460 0.3960 0.4140 0.0423  0.0359  -0.0415 248 LEU A CG  
1275 C CD1 . LEU A 250 ? 0.3326 0.3825 0.4156 0.0325  0.0403  -0.0458 248 LEU A CD1 
1276 C CD2 . LEU A 250 ? 0.3126 0.3707 0.3799 0.0472  0.0281  -0.0452 248 LEU A CD2 
1277 N N   . PRO A 251 ? 0.4054 0.4882 0.4704 0.0800  0.0267  -0.0450 249 PRO A N   
1278 C CA  . PRO A 251 ? 0.4294 0.5262 0.5014 0.0903  0.0250  -0.0486 249 PRO A CA  
1279 C C   . PRO A 251 ? 0.4324 0.5402 0.5266 0.0837  0.0261  -0.0578 249 PRO A C   
1280 O O   . PRO A 251 ? 0.3952 0.5031 0.5001 0.0734  0.0263  -0.0629 249 PRO A O   
1281 C CB  . PRO A 251 ? 0.4099 0.5227 0.4799 0.1024  0.0153  -0.0532 249 PRO A CB  
1282 C CG  . PRO A 251 ? 0.3861 0.4983 0.4583 0.0948  0.0116  -0.0571 249 PRO A CG  
1283 C CD  . PRO A 251 ? 0.3951 0.4849 0.4579 0.0833  0.0192  -0.0485 249 PRO A CD  
1284 N N   . PRO A 252 ? 0.4585 0.5748 0.5602 0.0897  0.0276  -0.0597 250 PRO A N   
1285 C CA  . PRO A 252 ? 0.4924 0.6183 0.6162 0.0832  0.0303  -0.0682 250 PRO A CA  
1286 C C   . PRO A 252 ? 0.5251 0.6717 0.6689 0.0826  0.0226  -0.0816 250 PRO A C   
1287 O O   . PRO A 252 ? 0.5156 0.6754 0.6567 0.0924  0.0137  -0.0856 250 PRO A O   
1288 C CB  . PRO A 252 ? 0.4912 0.6245 0.6170 0.0934  0.0316  -0.0674 250 PRO A CB  
1289 C CG  . PRO A 252 ? 0.4675 0.5863 0.5697 0.1012  0.0340  -0.0554 250 PRO A CG  
1290 C CD  . PRO A 252 ? 0.4737 0.5900 0.5640 0.1029  0.0282  -0.0536 250 PRO A CD  
1291 N N   . ARG A 253 ? 0.5910 0.7399 0.7543 0.0714  0.0268  -0.0887 251 ARG A N   
1292 C CA  . ARG A 253 ? 0.6641 0.8326 0.8504 0.0695  0.0211  -0.1032 251 ARG A CA  
1293 C C   . ARG A 253 ? 0.6787 0.8652 0.8892 0.0709  0.0220  -0.1133 251 ARG A C   
1294 O O   . ARG A 253 ? 0.6680 0.8466 0.8817 0.0667  0.0307  -0.1093 251 ARG A O   
1295 C CB  . ARG A 253 ? 0.7085 0.8663 0.9023 0.0553  0.0262  -0.1047 251 ARG A CB  
1296 C CG  . ARG A 253 ? 0.7556 0.9042 0.9612 0.0445  0.0377  -0.1037 251 ARG A CG  
1297 C CD  . ARG A 253 ? 0.7853 0.9277 1.0033 0.0322  0.0427  -0.1075 251 ARG A CD  
1298 N NE  . ARG A 253 ? 0.8246 0.9537 1.0478 0.0228  0.0552  -0.1032 251 ARG A NE  
1299 C CZ  . ARG A 253 ? 0.8657 1.0038 1.1134 0.0184  0.0612  -0.1116 251 ARG A CZ  
1300 N NH1 . ARG A 253 ? 0.8830 1.0448 1.1538 0.0224  0.0550  -0.1258 251 ARG A NH1 
1301 N NH2 . ARG A 253 ? 0.8729 0.9968 1.1220 0.0105  0.0734  -0.1061 251 ARG A NH2 
1302 N N   . ILE A 254 ? 0.7087 0.9204 0.9371 0.0766  0.0131  -0.1273 252 ILE A N   
1303 C CA  . ILE A 254 ? 0.7270 0.9596 0.9818 0.0782  0.0128  -0.1393 252 ILE A CA  
1304 C C   . ILE A 254 ? 0.7348 0.9729 1.0145 0.0651  0.0145  -0.1516 252 ILE A C   
1305 O O   . ILE A 254 ? 0.7463 0.9943 1.0450 0.0615  0.0153  -0.1601 252 ILE A O   
1306 C CB  . ILE A 254 ? 0.7447 0.9957 0.9933 0.0924  0.0002  -0.1429 252 ILE A CB  
1307 C CG1 . ILE A 254 ? 0.7767 1.0194 0.9968 0.1059  -0.0020 -0.1298 252 ILE A CG1 
1308 C CG2 . ILE A 254 ? 0.7378 1.0008 1.0020 0.0936  0.0007  -0.1485 252 ILE A CG2 
1309 C CD1 . ILE A 254 ? 0.8024 1.0603 1.0120 0.1206  -0.0135 -0.1313 252 ILE A CD1 
1310 N N   . ASN A 263 ? 0.8201 1.0620 1.1413 0.0588  0.0402  -0.1511 261 ASN A N   
1311 C CA  . ASN A 263 ? 0.8282 1.0481 1.1325 0.0564  0.0508  -0.1378 261 ASN A CA  
1312 C C   . ASN A 263 ? 0.8200 1.0322 1.1028 0.0616  0.0463  -0.1310 261 ASN A C   
1313 O O   . ASN A 263 ? 0.8283 1.0436 1.1129 0.0588  0.0409  -0.1359 261 ASN A O   
1314 C CB  . ASN A 263 ? 0.8375 1.0417 1.1519 0.0411  0.0643  -0.1369 261 ASN A CB  
1315 C CG  . ASN A 263 ? 0.8676 1.0752 1.2000 0.0363  0.0711  -0.1412 261 ASN A CG  
1316 O OD1 . ASN A 263 ? 0.8793 1.0895 1.2314 0.0268  0.0742  -0.1496 261 ASN A OD1 
1317 N ND2 . ASN A 263 ? 0.8605 1.0672 1.1864 0.0428  0.0740  -0.1355 261 ASN A ND2 
1318 N N   . THR A 264 ? 0.7867 0.9841 1.0442 0.0677  0.0482  -0.1178 262 THR A N   
1319 C CA  . THR A 264 ? 0.7465 0.9293 0.9762 0.0708  0.0442  -0.1075 262 THR A CA  
1320 C C   . THR A 264 ? 0.6956 0.8501 0.9068 0.0609  0.0544  -0.0950 262 THR A C   
1321 O O   . THR A 264 ? 0.6577 0.8022 0.8671 0.0581  0.0634  -0.0901 262 THR A O   
1322 C CB  . THR A 264 ? 0.7464 0.9337 0.9592 0.0867  0.0378  -0.1018 262 THR A CB  
1323 O OG1 . THR A 264 ? 0.7696 0.9402 0.9689 0.0875  0.0466  -0.0910 262 THR A OG1 
1324 C CG2 . THR A 264 ? 0.7316 0.9482 0.9630 0.0983  0.0292  -0.1136 262 THR A CG2 
1325 N N   . LYS A 265 ? 0.6562 0.7989 0.8541 0.0562  0.0526  -0.0906 263 LYS A N   
1326 C CA  . LYS A 265 ? 0.6259 0.7439 0.8057 0.0477  0.0607  -0.0795 263 LYS A CA  
1327 C C   . LYS A 265 ? 0.5962 0.7023 0.7495 0.0541  0.0574  -0.0692 263 LYS A C   
1328 O O   . LYS A 265 ? 0.5693 0.6801 0.7159 0.0593  0.0493  -0.0697 263 LYS A O   
1329 C CB  . LYS A 265 ? 0.6357 0.7470 0.8209 0.0365  0.0631  -0.0813 263 LYS A CB  
1330 C CG  . LYS A 265 ? 0.6566 0.7441 0.8229 0.0287  0.0709  -0.0701 263 LYS A CG  
1331 C CD  . LYS A 265 ? 0.6533 0.7338 0.8237 0.0193  0.0735  -0.0708 263 LYS A CD  
1332 C CE  . LYS A 265 ? 0.6814 0.7401 0.8322 0.0131  0.0807  -0.0597 263 LYS A CE  
1333 N NZ  . LYS A 265 ? 0.7039 0.7550 0.8573 0.0051  0.0837  -0.0591 263 LYS A NZ  
1334 N N   . VAL A 266 ? 0.5776 0.6684 0.7166 0.0536  0.0644  -0.0604 264 VAL A N   
1335 C CA  . VAL A 266 ? 0.5136 0.5903 0.6290 0.0574  0.0639  -0.0508 264 VAL A CA  
1336 C C   . VAL A 266 ? 0.5109 0.5705 0.6152 0.0466  0.0678  -0.0456 264 VAL A C   
1337 O O   . VAL A 266 ? 0.5030 0.5547 0.6100 0.0381  0.0754  -0.0448 264 VAL A O   
1338 C CB  . VAL A 266 ? 0.5190 0.5880 0.6259 0.0622  0.0701  -0.0451 264 VAL A CB  
1339 C CG1 . VAL A 266 ? 0.5055 0.5593 0.5902 0.0653  0.0708  -0.0360 264 VAL A CG1 
1340 C CG2 . VAL A 266 ? 0.5217 0.6083 0.6405 0.0736  0.0668  -0.0500 264 VAL A CG2 
1341 N N   . TYR A 267 ? 0.4419 0.4965 0.5337 0.0476  0.0628  -0.0420 265 TYR A N   
1342 C CA  . TYR A 267 ? 0.4006 0.4404 0.4818 0.0385  0.0655  -0.0372 265 TYR A CA  
1343 C C   . TYR A 267 ? 0.3696 0.3929 0.4324 0.0375  0.0708  -0.0290 265 TYR A C   
1344 O O   . TYR A 267 ? 0.3301 0.3518 0.3856 0.0448  0.0711  -0.0261 265 TYR A O   
1345 C CB  . TYR A 267 ? 0.3901 0.4326 0.4684 0.0392  0.0581  -0.0380 265 TYR A CB  
1346 C CG  . TYR A 267 ? 0.3713 0.4275 0.4686 0.0370  0.0543  -0.0470 265 TYR A CG  
1347 C CD1 . TYR A 267 ? 0.3273 0.3785 0.4316 0.0272  0.0583  -0.0482 265 TYR A CD1 
1348 C CD2 . TYR A 267 ? 0.3734 0.4480 0.4822 0.0451  0.0472  -0.0548 265 TYR A CD2 
1349 C CE1 . TYR A 267 ? 0.3478 0.4107 0.4716 0.0245  0.0562  -0.0573 265 TYR A CE1 
1350 C CE2 . TYR A 267 ? 0.3521 0.4405 0.4804 0.0425  0.0438  -0.0650 265 TYR A CE2 
1351 C CZ  . TYR A 267 ? 0.3771 0.4589 0.5137 0.0317  0.0488  -0.0663 265 TYR A CZ  
1352 O OH  . TYR A 267 ? 0.4280 0.5224 0.5858 0.0285  0.0468  -0.0770 265 TYR A OH  
1353 N N   . LYS A 268 ? 0.3672 0.3786 0.4228 0.0287  0.0752  -0.0257 266 LYS A N   
1354 C CA  . LYS A 268 ? 0.4022 0.3994 0.4407 0.0270  0.0789  -0.0195 266 LYS A CA  
1355 C C   . LYS A 268 ? 0.3960 0.3897 0.4236 0.0301  0.0735  -0.0162 266 LYS A C   
1356 O O   . LYS A 268 ? 0.3802 0.3798 0.4113 0.0310  0.0675  -0.0179 266 LYS A O   
1357 C CB  . LYS A 268 ? 0.4228 0.4104 0.4561 0.0179  0.0841  -0.0175 266 LYS A CB  
1358 C CG  . LYS A 268 ? 0.4605 0.4483 0.5011 0.0151  0.0916  -0.0194 266 LYS A CG  
1359 C CD  . LYS A 268 ? 0.5158 0.4965 0.5530 0.0073  0.0963  -0.0175 266 LYS A CD  
1360 C CE  . LYS A 268 ? 0.5150 0.4983 0.5641 0.0048  0.1038  -0.0202 266 LYS A CE  
1361 N NZ  . LYS A 268 ? 0.5467 0.5220 0.5912 -0.0016 0.1096  -0.0172 266 LYS A NZ  
1362 N N   . ALA A 269 ? 0.4031 0.3871 0.4186 0.0319  0.0764  -0.0120 267 ALA A N   
1363 C CA  . ALA A 269 ? 0.3579 0.3364 0.3631 0.0332  0.0733  -0.0086 267 ALA A CA  
1364 C C   . ALA A 269 ? 0.3883 0.3601 0.3876 0.0246  0.0730  -0.0074 267 ALA A C   
1365 O O   . ALA A 269 ? 0.4012 0.3678 0.3982 0.0186  0.0775  -0.0073 267 ALA A O   
1366 C CB  . ALA A 269 ? 0.3338 0.3033 0.3301 0.0372  0.0780  -0.0052 267 ALA A CB  
1367 N N   . ARG A 270 ? 0.3488 0.3210 0.3451 0.0248  0.0679  -0.0062 268 ARG A N   
1368 C CA  . ARG A 270 ? 0.3766 0.3445 0.3686 0.0180  0.0665  -0.0050 268 ARG A CA  
1369 C C   . ARG A 270 ? 0.3979 0.3595 0.3802 0.0183  0.0651  -0.0021 268 ARG A C   
1370 O O   . ARG A 270 ? 0.4065 0.3690 0.3875 0.0243  0.0634  -0.0011 268 ARG A O   
1371 C CB  . ARG A 270 ? 0.3672 0.3428 0.3682 0.0172  0.0618  -0.0073 268 ARG A CB  
1372 C CG  . ARG A 270 ? 0.3248 0.3086 0.3393 0.0172  0.0632  -0.0117 268 ARG A CG  
1373 C CD  . ARG A 270 ? 0.3595 0.3378 0.3731 0.0118  0.0700  -0.0108 268 ARG A CD  
1374 N NE  . ARG A 270 ? 0.3748 0.3591 0.4023 0.0093  0.0723  -0.0145 268 ARG A NE  
1375 C CZ  . ARG A 270 ? 0.3766 0.3563 0.4047 0.0046  0.0791  -0.0136 268 ARG A CZ  
1376 N NH1 . ARG A 270 ? 0.3532 0.3234 0.3678 0.0022  0.0830  -0.0097 268 ARG A NH1 
1377 N NH2 . ARG A 270 ? 0.3486 0.3333 0.3911 0.0023  0.0822  -0.0171 268 ARG A NH2 
1378 N N   . ARG A 271 ? 0.3825 0.3381 0.3580 0.0123  0.0660  -0.0009 269 ARG A N   
1379 C CA  . ARG A 271 ? 0.3632 0.3145 0.3322 0.0118  0.0639  0.0009  269 ARG A CA  
1380 C C   . ARG A 271 ? 0.3581 0.3146 0.3305 0.0141  0.0580  0.0014  269 ARG A C   
1381 O O   . ARG A 271 ? 0.3239 0.2843 0.3010 0.0117  0.0554  0.0006  269 ARG A O   
1382 C CB  . ARG A 271 ? 0.3017 0.2484 0.2639 0.0054  0.0650  0.0010  269 ARG A CB  
1383 C CG  . ARG A 271 ? 0.2597 0.2007 0.2169 0.0035  0.0706  -0.0005 269 ARG A CG  
1384 C CD  . ARG A 271 ? 0.2893 0.2255 0.2441 0.0049  0.0721  -0.0006 269 ARG A CD  
1385 N NE  . ARG A 271 ? 0.3435 0.2792 0.2949 0.0014  0.0688  -0.0008 269 ARG A NE  
1386 C CZ  . ARG A 271 ? 0.3565 0.2938 0.3094 0.0033  0.0650  0.0011  269 ARG A CZ  
1387 N NH1 . ARG A 271 ? 0.3474 0.2868 0.3039 0.0090  0.0637  0.0031  269 ARG A NH1 
1388 N NH2 . ARG A 271 ? 0.3292 0.2667 0.2798 0.0000  0.0622  0.0005  269 ARG A NH2 
1389 N N   . VAL A 272 ? 0.3264 0.2822 0.2967 0.0190  0.0568  0.0027  270 VAL A N   
1390 C CA  . VAL A 272 ? 0.3472 0.3072 0.3191 0.0216  0.0515  0.0030  270 VAL A CA  
1391 C C   . VAL A 272 ? 0.3426 0.2968 0.3083 0.0207  0.0516  0.0053  270 VAL A C   
1392 O O   . VAL A 272 ? 0.3467 0.2953 0.3084 0.0229  0.0557  0.0068  270 VAL A O   
1393 C CB  . VAL A 272 ? 0.3115 0.2781 0.2867 0.0303  0.0494  0.0020  270 VAL A CB  
1394 C CG1 . VAL A 272 ? 0.2538 0.2249 0.2296 0.0332  0.0440  0.0017  270 VAL A CG1 
1395 C CG2 . VAL A 272 ? 0.2999 0.2745 0.2840 0.0311  0.0489  -0.0017 270 VAL A CG2 
1396 N N   . ASP A 273 ? 0.3597 0.3149 0.3256 0.0173  0.0478  0.0055  271 ASP A N   
1397 C CA  . ASP A 273 ? 0.3655 0.3172 0.3276 0.0170  0.0473  0.0072  271 ASP A CA  
1398 C C   . ASP A 273 ? 0.3455 0.3017 0.3096 0.0214  0.0428  0.0074  271 ASP A C   
1399 O O   . ASP A 273 ? 0.3407 0.3025 0.3098 0.0211  0.0391  0.0056  271 ASP A O   
1400 C CB  . ASP A 273 ? 0.3723 0.3221 0.3325 0.0104  0.0462  0.0072  271 ASP A CB  
1401 C CG  . ASP A 273 ? 0.4578 0.4035 0.4146 0.0064  0.0504  0.0060  271 ASP A CG  
1402 O OD1 . ASP A 273 ? 0.4538 0.3964 0.4101 0.0084  0.0550  0.0054  271 ASP A OD1 
1403 O OD2 . ASP A 273 ? 0.4907 0.4366 0.4450 0.0018  0.0492  0.0053  271 ASP A OD2 
1404 N N   . ILE A 274 ? 0.3254 0.2789 0.2862 0.0257  0.0440  0.0093  272 ILE A N   
1405 C CA  . ILE A 274 ? 0.3421 0.2995 0.3032 0.0300  0.0400  0.0094  272 ILE A CA  
1406 C C   . ILE A 274 ? 0.3797 0.3321 0.3380 0.0285  0.0414  0.0116  272 ILE A C   
1407 O O   . ILE A 274 ? 0.3424 0.2885 0.2975 0.0295  0.0468  0.0135  272 ILE A O   
1408 C CB  . ILE A 274 ? 0.2991 0.2600 0.2582 0.0396  0.0401  0.0097  272 ILE A CB  
1409 C CG1 . ILE A 274 ? 0.3089 0.2757 0.2722 0.0414  0.0392  0.0070  272 ILE A CG1 
1410 C CG2 . ILE A 274 ? 0.2877 0.2541 0.2469 0.0440  0.0353  0.0085  272 ILE A CG2 
1411 C CD1 . ILE A 274 ? 0.2638 0.2346 0.2241 0.0522  0.0397  0.0075  272 ILE A CD1 
1412 N N   . ARG A 275 ? 0.3902 0.3452 0.3507 0.0261  0.0372  0.0110  273 ARG A N   
1413 C CA  . ARG A 275 ? 0.4080 0.3597 0.3672 0.0251  0.0380  0.0126  273 ARG A CA  
1414 C C   . ARG A 275 ? 0.4067 0.3614 0.3653 0.0306  0.0353  0.0128  273 ARG A C   
1415 O O   . ARG A 275 ? 0.3523 0.3127 0.3141 0.0314  0.0306  0.0105  273 ARG A O   
1416 C CB  . ARG A 275 ? 0.3742 0.3262 0.3359 0.0179  0.0359  0.0120  273 ARG A CB  
1417 C CG  . ARG A 275 ? 0.3890 0.3383 0.3497 0.0130  0.0387  0.0112  273 ARG A CG  
1418 C CD  . ARG A 275 ? 0.4077 0.3593 0.3693 0.0077  0.0356  0.0106  273 ARG A CD  
1419 N NE  . ARG A 275 ? 0.4691 0.4195 0.4285 0.0035  0.0376  0.0090  273 ARG A NE  
1420 C CZ  . ARG A 275 ? 0.4755 0.4262 0.4332 0.0021  0.0382  0.0085  273 ARG A CZ  
1421 N NH1 . ARG A 275 ? 0.4175 0.3699 0.3770 0.0042  0.0371  0.0094  273 ARG A NH1 
1422 N NH2 . ARG A 275 ? 0.4827 0.4327 0.4376 -0.0013 0.0400  0.0066  273 ARG A NH2 
1423 N N   . LEU A 276 ? 0.3902 0.3405 0.3451 0.0345  0.0392  0.0153  274 LEU A N   
1424 C CA  . LEU A 276 ? 0.3954 0.3475 0.3480 0.0404  0.0379  0.0160  274 LEU A CA  
1425 C C   . LEU A 276 ? 0.3876 0.3390 0.3436 0.0357  0.0365  0.0160  274 LEU A C   
1426 O O   . LEU A 276 ? 0.3407 0.2873 0.2978 0.0323  0.0404  0.0173  274 LEU A O   
1427 C CB  . LEU A 276 ? 0.3448 0.2912 0.2907 0.0478  0.0444  0.0197  274 LEU A CB  
1428 C CG  . LEU A 276 ? 0.2960 0.2431 0.2375 0.0547  0.0444  0.0211  274 LEU A CG  
1429 C CD1 . LEU A 276 ? 0.2422 0.1990 0.1829 0.0597  0.0371  0.0174  274 LEU A CD1 
1430 C CD2 . LEU A 276 ? 0.2931 0.2330 0.2270 0.0626  0.0526  0.0260  274 LEU A CD2 
1431 N N   . ILE A 277 ? 0.3574 0.3139 0.3161 0.0358  0.0311  0.0139  275 ILE A N   
1432 C CA  . ILE A 277 ? 0.3297 0.2865 0.2927 0.0314  0.0290  0.0138  275 ILE A CA  
1433 C C   . ILE A 277 ? 0.3554 0.3143 0.3177 0.0362  0.0273  0.0131  275 ILE A C   
1434 O O   . ILE A 277 ? 0.3409 0.3044 0.3022 0.0407  0.0244  0.0105  275 ILE A O   
1435 C CB  . ILE A 277 ? 0.2942 0.2542 0.2623 0.0259  0.0248  0.0120  275 ILE A CB  
1436 C CG1 . ILE A 277 ? 0.2826 0.2407 0.2503 0.0214  0.0265  0.0126  275 ILE A CG1 
1437 C CG2 . ILE A 277 ? 0.2711 0.2316 0.2433 0.0230  0.0226  0.0125  275 ILE A CG2 
1438 C CD1 . ILE A 277 ? 0.3250 0.2800 0.2924 0.0177  0.0293  0.0138  275 ILE A CD1 
1439 N N   . GLU A 278 ? 0.3402 0.2964 0.3034 0.0353  0.0292  0.0148  276 GLU A N   
1440 C CA  . GLU A 278 ? 0.3508 0.3084 0.3132 0.0396  0.0283  0.0142  276 GLU A CA  
1441 C C   . GLU A 278 ? 0.3388 0.3014 0.3065 0.0378  0.0225  0.0108  276 GLU A C   
1442 O O   . GLU A 278 ? 0.3897 0.3529 0.3626 0.0321  0.0204  0.0105  276 GLU A O   
1443 C CB  . GLU A 278 ? 0.3368 0.2908 0.3015 0.0378  0.0318  0.0165  276 GLU A CB  
1444 C CG  . GLU A 278 ? 0.3219 0.2698 0.2837 0.0391  0.0394  0.0195  276 GLU A CG  
1445 C CD  . GLU A 278 ? 0.3442 0.2892 0.2978 0.0481  0.0438  0.0216  276 GLU A CD  
1446 O OE1 . GLU A 278 ? 0.3070 0.2556 0.2578 0.0528  0.0406  0.0202  276 GLU A OE1 
1447 O OE2 . GLU A 278 ? 0.3610 0.3000 0.3107 0.0510  0.0510  0.0247  276 GLU A OE2 
1448 N N   . THR A 279 ? 0.2881 0.2541 0.2543 0.0430  0.0206  0.0079  277 THR A N   
1449 C CA  . THR A 279 ? 0.2585 0.2289 0.2313 0.0414  0.0161  0.0034  277 THR A CA  
1450 C C   . THR A 279 ? 0.2947 0.2628 0.2746 0.0354  0.0155  0.0049  277 THR A C   
1451 O O   . THR A 279 ? 0.2918 0.2607 0.2775 0.0314  0.0137  0.0036  277 THR A O   
1452 C CB  . THR A 279 ? 0.3258 0.3002 0.2962 0.0479  0.0145  -0.0007 277 THR A CB  
1453 O OG1 . THR A 279 ? 0.3588 0.3366 0.3215 0.0551  0.0144  -0.0021 277 THR A OG1 
1454 C CG2 . THR A 279 ? 0.2806 0.2594 0.2598 0.0455  0.0106  -0.0068 277 THR A CG2 
1455 N N   . LYS A 280 ? 0.3421 0.3074 0.3217 0.0353  0.0175  0.0077  278 LYS A N   
1456 C CA  . LYS A 280 ? 0.3259 0.2902 0.3119 0.0311  0.0166  0.0094  278 LYS A CA  
1457 C C   . LYS A 280 ? 0.3364 0.2998 0.3238 0.0260  0.0163  0.0121  278 LYS A C   
1458 O O   . LYS A 280 ? 0.3335 0.2968 0.3253 0.0233  0.0150  0.0136  278 LYS A O   
1459 C CB  . LYS A 280 ? 0.3301 0.2928 0.3163 0.0324  0.0189  0.0115  278 LYS A CB  
1460 C CG  . LYS A 280 ? 0.4283 0.3888 0.4113 0.0319  0.0228  0.0142  278 LYS A CG  
1461 C CD  . LYS A 280 ? 0.4966 0.4561 0.4829 0.0320  0.0257  0.0158  278 LYS A CD  
1462 C CE  . LYS A 280 ? 0.5464 0.5045 0.5289 0.0379  0.0283  0.0152  278 LYS A CE  
1463 N NZ  . LYS A 280 ? 0.5886 0.5452 0.5750 0.0379  0.0326  0.0169  278 LYS A NZ  
1464 N N   . SER A 281 ? 0.3129 0.2757 0.2961 0.0253  0.0178  0.0127  279 SER A N   
1465 C CA  . SER A 281 ? 0.2519 0.2143 0.2353 0.0207  0.0176  0.0145  279 SER A CA  
1466 C C   . SER A 281 ? 0.2642 0.2271 0.2482 0.0191  0.0164  0.0134  279 SER A C   
1467 O O   . SER A 281 ? 0.2908 0.2533 0.2741 0.0158  0.0164  0.0150  279 SER A O   
1468 C CB  . SER A 281 ? 0.2601 0.2208 0.2400 0.0201  0.0209  0.0152  279 SER A CB  
1469 O OG  . SER A 281 ? 0.2663 0.2262 0.2477 0.0206  0.0232  0.0160  279 SER A OG  
1470 N N   . VAL A 282 ? 0.2795 0.2441 0.2653 0.0214  0.0155  0.0102  280 VAL A N   
1471 C CA  . VAL A 282 ? 0.2752 0.2408 0.2637 0.0196  0.0151  0.0083  280 VAL A CA  
1472 C C   . VAL A 282 ? 0.3256 0.2890 0.3177 0.0156  0.0155  0.0108  280 VAL A C   
1473 O O   . VAL A 282 ? 0.3737 0.3362 0.3641 0.0132  0.0167  0.0122  280 VAL A O   
1474 C CB  . VAL A 282 ? 0.2595 0.2291 0.2517 0.0228  0.0137  0.0028  280 VAL A CB  
1475 C CG1 . VAL A 282 ? 0.2221 0.1933 0.2210 0.0201  0.0139  -0.0002 280 VAL A CG1 
1476 C CG2 . VAL A 282 ? 0.2211 0.1931 0.2069 0.0280  0.0137  0.0014  280 VAL A CG2 
1477 N N   . PRO A 283 ? 0.3355 0.2977 0.3320 0.0155  0.0151  0.0118  281 PRO A N   
1478 C CA  . PRO A 283 ? 0.3300 0.2892 0.3289 0.0131  0.0165  0.0152  281 PRO A CA  
1479 C C   . PRO A 283 ? 0.3395 0.2983 0.3318 0.0117  0.0164  0.0197  281 PRO A C   
1480 O O   . PRO A 283 ? 0.3369 0.2940 0.3276 0.0101  0.0181  0.0219  281 PRO A O   
1481 C CB  . PRO A 283 ? 0.3232 0.2808 0.3271 0.0144  0.0164  0.0161  281 PRO A CB  
1482 C CG  . PRO A 283 ? 0.3513 0.3116 0.3574 0.0169  0.0150  0.0109  281 PRO A CG  
1483 C CD  . PRO A 283 ? 0.3543 0.3170 0.3532 0.0181  0.0141  0.0104  281 PRO A CD  
1484 N N   . THR A 284 ? 0.2820 0.2428 0.2709 0.0124  0.0149  0.0205  282 THR A N   
1485 C CA  . THR A 284 ? 0.2631 0.2254 0.2469 0.0110  0.0142  0.0227  282 THR A CA  
1486 C C   . THR A 284 ? 0.3155 0.2776 0.2949 0.0091  0.0157  0.0211  282 THR A C   
1487 O O   . THR A 284 ? 0.3529 0.3156 0.3281 0.0076  0.0158  0.0226  282 THR A O   
1488 C CB  . THR A 284 ? 0.2998 0.2653 0.2840 0.0115  0.0127  0.0224  282 THR A CB  
1489 O OG1 . THR A 284 ? 0.2777 0.2425 0.2635 0.0128  0.0138  0.0198  282 THR A OG1 
1490 C CG2 . THR A 284 ? 0.3316 0.2983 0.3191 0.0133  0.0109  0.0251  282 THR A CG2 
1491 N N   . ALA A 285 ? 0.3097 0.2714 0.2897 0.0098  0.0168  0.0182  283 ALA A N   
1492 C CA  . ALA A 285 ? 0.3410 0.3022 0.3175 0.0087  0.0187  0.0168  283 ALA A CA  
1493 C C   . ALA A 285 ? 0.3450 0.3051 0.3227 0.0075  0.0199  0.0169  283 ALA A C   
1494 O O   . ALA A 285 ? 0.3169 0.2764 0.2911 0.0058  0.0215  0.0172  283 ALA A O   
1495 C CB  . ALA A 285 ? 0.3051 0.2663 0.2813 0.0114  0.0198  0.0145  283 ALA A CB  
1496 N N   . MET A 286 ? 0.3198 0.2798 0.3034 0.0083  0.0198  0.0161  284 MET A N   
1497 C CA  . MET A 286 ? 0.3457 0.3042 0.3330 0.0067  0.0222  0.0161  284 MET A CA  
1498 C C   . MET A 286 ? 0.3565 0.3121 0.3391 0.0053  0.0237  0.0210  284 MET A C   
1499 O O   . MET A 286 ? 0.3740 0.3280 0.3547 0.0038  0.0266  0.0219  284 MET A O   
1500 C CB  . MET A 286 ? 0.3645 0.3229 0.3609 0.0072  0.0226  0.0136  284 MET A CB  
1501 C CG  . MET A 286 ? 0.4052 0.3681 0.4068 0.0089  0.0213  0.0073  284 MET A CG  
1502 S SD  . MET A 286 ? 0.5958 0.5601 0.6085 0.0096  0.0208  0.0025  284 MET A SD  
1503 C CE  . MET A 286 ? 0.5924 0.5520 0.6135 0.0056  0.0263  0.0037  284 MET A CE  
1504 N N   . LEU A 287 ? 0.3148 0.2704 0.2952 0.0064  0.0219  0.0241  285 LEU A N   
1505 C CA  . LEU A 287 ? 0.3723 0.3267 0.3467 0.0067  0.0226  0.0290  285 LEU A CA  
1506 C C   . LEU A 287 ? 0.3394 0.2960 0.3061 0.0054  0.0222  0.0281  285 LEU A C   
1507 O O   . LEU A 287 ? 0.3293 0.2843 0.2911 0.0050  0.0246  0.0302  285 LEU A O   
1508 C CB  . LEU A 287 ? 0.3761 0.3322 0.3497 0.0091  0.0197  0.0318  285 LEU A CB  
1509 C CG  . LEU A 287 ? 0.3892 0.3416 0.3678 0.0111  0.0214  0.0352  285 LEU A CG  
1510 C CD1 . LEU A 287 ? 0.3827 0.3383 0.3617 0.0137  0.0178  0.0367  285 LEU A CD1 
1511 C CD2 . LEU A 287 ? 0.3363 0.2843 0.3109 0.0124  0.0255  0.0407  285 LEU A CD2 
1512 N N   . THR A 288 ? 0.2907 0.2505 0.2568 0.0048  0.0199  0.0249  286 THR A N   
1513 C CA  . THR A 288 ? 0.3025 0.2644 0.2626 0.0032  0.0198  0.0231  286 THR A CA  
1514 C C   . THR A 288 ? 0.2752 0.2346 0.2338 0.0017  0.0232  0.0218  286 THR A C   
1515 O O   . THR A 288 ? 0.3122 0.2717 0.2646 0.0007  0.0245  0.0221  286 THR A O   
1516 C CB  . THR A 288 ? 0.3270 0.2914 0.2890 0.0025  0.0184  0.0196  286 THR A CB  
1517 O OG1 . THR A 288 ? 0.3421 0.3099 0.3062 0.0037  0.0154  0.0204  286 THR A OG1 
1518 C CG2 . THR A 288 ? 0.3029 0.2688 0.2607 0.0002  0.0195  0.0165  286 THR A CG2 
1519 N N   . PHE A 289 ? 0.2398 0.1978 0.2038 0.0020  0.0246  0.0199  287 PHE A N   
1520 C CA  . PHE A 289 ? 0.3418 0.2987 0.3053 0.0010  0.0275  0.0179  287 PHE A CA  
1521 C C   . PHE A 289 ? 0.3687 0.3237 0.3347 0.0004  0.0305  0.0192  287 PHE A C   
1522 O O   . PHE A 289 ? 0.3563 0.3109 0.3231 -0.0004 0.0332  0.0175  287 PHE A O   
1523 C CB  . PHE A 289 ? 0.3226 0.2804 0.2896 0.0027  0.0274  0.0149  287 PHE A CB  
1524 C CG  . PHE A 289 ? 0.3246 0.2826 0.2890 0.0030  0.0267  0.0141  287 PHE A CG  
1525 C CD1 . PHE A 289 ? 0.3322 0.2897 0.2922 0.0008  0.0281  0.0131  287 PHE A CD1 
1526 C CD2 . PHE A 289 ? 0.3609 0.3193 0.3279 0.0054  0.0253  0.0138  287 PHE A CD2 
1527 C CE1 . PHE A 289 ? 0.4157 0.3732 0.3759 0.0003  0.0285  0.0114  287 PHE A CE1 
1528 C CE2 . PHE A 289 ? 0.3914 0.3493 0.3575 0.0055  0.0262  0.0132  287 PHE A CE2 
1529 C CZ  . PHE A 289 ? 0.4033 0.3606 0.3668 0.0026  0.0280  0.0118  287 PHE A CZ  
1530 N N   . THR A 290 ? 0.2949 0.2483 0.2627 0.0009  0.0308  0.0223  288 THR A N   
1531 C CA  . THR A 290 ? 0.2577 0.2076 0.2278 0.0002  0.0354  0.0245  288 THR A CA  
1532 C C   . THR A 290 ? 0.2668 0.2148 0.2264 0.0006  0.0371  0.0290  288 THR A C   
1533 O O   . THR A 290 ? 0.3354 0.2802 0.2931 0.0000  0.0420  0.0309  288 THR A O   
1534 C CB  . THR A 290 ? 0.3385 0.2862 0.3167 0.0009  0.0364  0.0259  288 THR A CB  
1535 O OG1 . THR A 290 ? 0.3127 0.2634 0.3003 0.0009  0.0345  0.0205  288 THR A OG1 
1536 C CG2 . THR A 290 ? 0.3021 0.2446 0.2835 0.0001  0.0430  0.0288  288 THR A CG2 
1537 N N   . GLY A 291 ? 0.2554 0.2061 0.2082 0.0019  0.0331  0.0302  289 GLY A N   
1538 C CA  . GLY A 291 ? 0.2746 0.2258 0.2163 0.0034  0.0333  0.0335  289 GLY A CA  
1539 C C   . GLY A 291 ? 0.3630 0.3093 0.3023 0.0060  0.0376  0.0400  289 GLY A C   
1540 O O   . GLY A 291 ? 0.3895 0.3326 0.3361 0.0069  0.0390  0.0423  289 GLY A O   
1541 N N   . SER A 292 ? 0.3650 0.3100 0.2938 0.0077  0.0406  0.0432  290 SER A N   
1542 C CA  . SER A 292 ? 0.3402 0.2890 0.2607 0.0065  0.0394  0.0396  290 SER A CA  
1543 C C   . SER A 292 ? 0.3884 0.3450 0.3042 0.0071  0.0323  0.0362  290 SER A C   
1544 O O   . SER A 292 ? 0.4260 0.3856 0.3443 0.0090  0.0282  0.0373  290 SER A O   
1545 C CB  . SER A 292 ? 0.3552 0.3011 0.2639 0.0094  0.0442  0.0444  290 SER A CB  
1546 O OG  . SER A 292 ? 0.3841 0.3327 0.2832 0.0148  0.0414  0.0492  290 SER A OG  
1547 N N   . LYS A 293 ? 0.3924 0.3525 0.3026 0.0054  0.0314  0.0314  291 LYS A N   
1548 C CA  . LYS A 293 ? 0.3934 0.3618 0.3003 0.0054  0.0256  0.0266  291 LYS A CA  
1549 C C   . LYS A 293 ? 0.3616 0.3354 0.2604 0.0107  0.0216  0.0302  291 LYS A C   
1550 O O   . LYS A 293 ? 0.3501 0.3304 0.2523 0.0115  0.0161  0.0281  291 LYS A O   
1551 C CB  . LYS A 293 ? 0.4237 0.3944 0.3251 0.0029  0.0265  0.0206  291 LYS A CB  
1552 C CG  . LYS A 293 ? 0.5140 0.4944 0.4123 0.0029  0.0209  0.0143  291 LYS A CG  
1553 C CD  . LYS A 293 ? 0.6221 0.6051 0.5122 0.0016  0.0223  0.0089  291 LYS A CD  
1554 C CE  . LYS A 293 ? 0.6991 0.6938 0.5846 0.0029  0.0160  0.0026  291 LYS A CE  
1555 N NZ  . LYS A 293 ? 0.7598 0.7594 0.6373 0.0096  0.0120  0.0087  291 LYS A NZ  
1556 N N   . ASN A 294 ? 0.3486 0.3202 0.2364 0.0150  0.0246  0.0359  292 ASN A N   
1557 C CA  A ASN A 294 ? 0.3853 0.3617 0.2633 0.0220  0.0214  0.0407  292 ASN A CA  
1558 C CA  B ASN A 294 ? 0.3842 0.3609 0.2624 0.0219  0.0213  0.0406  292 ASN A CA  
1559 C C   . ASN A 294 ? 0.4114 0.3852 0.2967 0.0245  0.0208  0.0464  292 ASN A C   
1560 O O   . ASN A 294 ? 0.4481 0.4290 0.3317 0.0287  0.0153  0.0473  292 ASN A O   
1561 C CB  A ASN A 294 ? 0.3955 0.3677 0.2592 0.0270  0.0268  0.0472  292 ASN A CB  
1562 C CB  B ASN A 294 ? 0.3955 0.3687 0.2587 0.0272  0.0262  0.0467  292 ASN A CB  
1563 C CG  A ASN A 294 ? 0.4521 0.4302 0.3049 0.0266  0.0258  0.0413  292 ASN A CG  
1564 C CG  B ASN A 294 ? 0.3762 0.3575 0.2263 0.0357  0.0215  0.0504  292 ASN A CG  
1565 O OD1 A ASN A 294 ? 0.5131 0.5004 0.3679 0.0238  0.0198  0.0323  292 ASN A OD1 
1566 O OD1 B ASN A 294 ? 0.3395 0.3326 0.1900 0.0365  0.0133  0.0444  292 ASN A OD1 
1567 N ND2 A ASN A 294 ? 0.4707 0.4430 0.3124 0.0295  0.0323  0.0461  292 ASN A ND2 
1568 N ND2 B ASN A 294 ? 0.4049 0.3800 0.2438 0.0427  0.0271  0.0601  292 ASN A ND2 
1569 N N   . PHE A 295 ? 0.3861 0.3500 0.2803 0.0221  0.0265  0.0496  293 PHE A N   
1570 C CA  . PHE A 295 ? 0.3871 0.3479 0.2900 0.0235  0.0264  0.0535  293 PHE A CA  
1571 C C   . PHE A 295 ? 0.3752 0.3437 0.2858 0.0216  0.0192  0.0478  293 PHE A C   
1572 O O   . PHE A 295 ? 0.3793 0.3513 0.2908 0.0256  0.0158  0.0505  293 PHE A O   
1573 C CB  . PHE A 295 ? 0.3976 0.3487 0.3115 0.0198  0.0329  0.0544  293 PHE A CB  
1574 C CG  . PHE A 295 ? 0.4206 0.3686 0.3445 0.0207  0.0330  0.0569  293 PHE A CG  
1575 C CD1 . PHE A 295 ? 0.4529 0.3955 0.3745 0.0259  0.0370  0.0649  293 PHE A CD1 
1576 C CD2 . PHE A 295 ? 0.4583 0.4086 0.3933 0.0170  0.0295  0.0513  293 PHE A CD2 
1577 C CE1 . PHE A 295 ? 0.4404 0.3797 0.3718 0.0267  0.0375  0.0666  293 PHE A CE1 
1578 C CE2 . PHE A 295 ? 0.4662 0.4139 0.4099 0.0180  0.0296  0.0528  293 PHE A CE2 
1579 C CZ  . PHE A 295 ? 0.4327 0.3749 0.3752 0.0225  0.0336  0.0602  293 PHE A CZ  
1580 N N   . ASN A 296 ? 0.3600 0.3308 0.2765 0.0160  0.0177  0.0403  294 ASN A N   
1581 C CA  . ASN A 296 ? 0.3404 0.3169 0.2650 0.0140  0.0127  0.0352  294 ASN A CA  
1582 C C   . ASN A 296 ? 0.3229 0.3101 0.2427 0.0169  0.0066  0.0330  294 ASN A C   
1583 O O   . ASN A 296 ? 0.3292 0.3212 0.2548 0.0183  0.0028  0.0323  294 ASN A O   
1584 C CB  . ASN A 296 ? 0.3325 0.3086 0.2625 0.0084  0.0136  0.0283  294 ASN A CB  
1585 C CG  . ASN A 296 ? 0.3466 0.3148 0.2829 0.0062  0.0181  0.0291  294 ASN A CG  
1586 O OD1 . ASN A 296 ? 0.3483 0.3118 0.2880 0.0078  0.0202  0.0334  294 ASN A OD1 
1587 N ND2 . ASN A 296 ? 0.3262 0.2932 0.2649 0.0028  0.0198  0.0244  294 ASN A ND2 
1588 N N   . VAL A 297 ? 0.3408 0.3328 0.2505 0.0181  0.0057  0.0310  295 VAL A N   
1589 C CA  . VAL A 297 ? 0.3646 0.3693 0.2701 0.0209  -0.0009 0.0268  295 VAL A CA  
1590 C C   . VAL A 297 ? 0.3795 0.3877 0.2813 0.0286  -0.0039 0.0337  295 VAL A C   
1591 O O   . VAL A 297 ? 0.3939 0.4114 0.3011 0.0302  -0.0095 0.0309  295 VAL A O   
1592 C CB  . VAL A 297 ? 0.3756 0.3852 0.2698 0.0213  -0.0013 0.0228  295 VAL A CB  
1593 C CG1 . VAL A 297 ? 0.3713 0.3961 0.2599 0.0260  -0.0090 0.0184  295 VAL A CG1 
1594 C CG2 . VAL A 297 ? 0.3940 0.4014 0.2940 0.0137  0.0012  0.0147  295 VAL A CG2 
1595 N N   . ILE A 298 ? 0.3721 0.3722 0.2659 0.0333  0.0008  0.0430  296 ILE A N   
1596 C CA  . ILE A 298 ? 0.3540 0.3544 0.2435 0.0416  0.0000  0.0514  296 ILE A CA  
1597 C C   . ILE A 298 ? 0.3525 0.3513 0.2552 0.0408  -0.0011 0.0524  296 ILE A C   
1598 O O   . ILE A 298 ? 0.4006 0.4070 0.3040 0.0461  -0.0059 0.0540  296 ILE A O   
1599 C CB  . ILE A 298 ? 0.4245 0.4127 0.3054 0.0457  0.0083  0.0616  296 ILE A CB  
1600 C CG1 . ILE A 298 ? 0.4626 0.4538 0.3271 0.0492  0.0090  0.0620  296 ILE A CG1 
1601 C CG2 . ILE A 298 ? 0.3930 0.3780 0.2724 0.0539  0.0096  0.0713  296 ILE A CG2 
1602 C CD1 . ILE A 298 ? 0.4767 0.4548 0.3335 0.0518  0.0190  0.0709  296 ILE A CD1 
1603 N N   . MET A 299 ? 0.3508 0.3405 0.2640 0.0345  0.0032  0.0511  297 MET A N   
1604 C CA  . MET A 299 ? 0.3837 0.3714 0.3088 0.0336  0.0027  0.0515  297 MET A CA  
1605 C C   . MET A 299 ? 0.3960 0.3944 0.3284 0.0313  -0.0037 0.0439  297 MET A C   
1606 O O   . MET A 299 ? 0.4063 0.4078 0.3455 0.0336  -0.0061 0.0449  297 MET A O   
1607 C CB  . MET A 299 ? 0.3541 0.3308 0.2876 0.0283  0.0084  0.0511  297 MET A CB  
1608 C CG  . MET A 299 ? 0.4224 0.3963 0.3670 0.0280  0.0085  0.0515  297 MET A CG  
1609 S SD  . MET A 299 ? 0.6065 0.5688 0.5597 0.0235  0.0151  0.0510  297 MET A SD  
1610 C CE  . MET A 299 ? 0.5617 0.5148 0.5109 0.0280  0.0220  0.0600  297 MET A CE  
1611 N N   . ARG A 300 ? 0.3637 0.3677 0.2958 0.0268  -0.0057 0.0362  298 ARG A N   
1612 C CA  . ARG A 300 ? 0.3379 0.3515 0.2788 0.0239  -0.0102 0.0283  298 ARG A CA  
1613 C C   . ARG A 300 ? 0.3079 0.3353 0.2461 0.0293  -0.0169 0.0269  298 ARG A C   
1614 O O   . ARG A 300 ? 0.3289 0.3643 0.2767 0.0292  -0.0205 0.0230  298 ARG A O   
1615 C CB  . ARG A 300 ? 0.2554 0.2693 0.1986 0.0171  -0.0087 0.0202  298 ARG A CB  
1616 C CG  . ARG A 300 ? 0.3103 0.3130 0.2595 0.0126  -0.0032 0.0206  298 ARG A CG  
1617 C CD  . ARG A 300 ? 0.3198 0.3196 0.2680 0.0075  0.0000  0.0154  298 ARG A CD  
1618 N NE  . ARG A 300 ? 0.2860 0.2762 0.2389 0.0051  0.0047  0.0168  298 ARG A NE  
1619 C CZ  . ARG A 300 ? 0.3225 0.3097 0.2788 0.0013  0.0078  0.0124  298 ARG A CZ  
1620 N NH1 . ARG A 300 ? 0.3353 0.3271 0.2922 -0.0016 0.0077  0.0061  298 ARG A NH1 
1621 N NH2 . ARG A 300 ? 0.3159 0.2958 0.2755 0.0008  0.0113  0.0141  298 ARG A NH2 
1622 N N   . GLN A 301 ? 0.2998 0.3308 0.2249 0.0346  -0.0184 0.0300  299 GLN A N   
1623 C CA  . GLN A 301 ? 0.3607 0.4059 0.2806 0.0422  -0.0253 0.0297  299 GLN A CA  
1624 C C   . GLN A 301 ? 0.3645 0.4080 0.2868 0.0489  -0.0257 0.0382  299 GLN A C   
1625 O O   . GLN A 301 ? 0.3927 0.4487 0.3195 0.0531  -0.0317 0.0359  299 GLN A O   
1626 C CB  . GLN A 301 ? 0.3563 0.4046 0.2589 0.0478  -0.0260 0.0322  299 GLN A CB  
1627 C CG  . GLN A 301 ? 0.4515 0.4988 0.3509 0.0411  -0.0241 0.0249  299 GLN A CG  
1628 C CD  . GLN A 301 ? 0.5176 0.5694 0.3992 0.0469  -0.0251 0.0261  299 GLN A CD  
1629 O OE1 . GLN A 301 ? 0.5280 0.5700 0.3981 0.0516  -0.0199 0.0358  299 GLN A OE1 
1630 N NE2 . GLN A 301 ? 0.4995 0.5665 0.3793 0.0465  -0.0313 0.0155  299 GLN A NE2 
1631 N N   . ALA A 302 ? 0.3155 0.3440 0.2361 0.0500  -0.0189 0.0472  300 ALA A N   
1632 C CA  . ALA A 302 ? 0.3543 0.3790 0.2783 0.0558  -0.0178 0.0551  300 ALA A CA  
1633 C C   . ALA A 302 ? 0.3571 0.3853 0.2969 0.0514  -0.0201 0.0495  300 ALA A C   
1634 O O   . ALA A 302 ? 0.4178 0.4535 0.3623 0.0564  -0.0239 0.0507  300 ALA A O   
1635 C CB  . ALA A 302 ? 0.2997 0.3068 0.2215 0.0562  -0.0089 0.0640  300 ALA A CB  
1636 N N   . ALA A 303 ? 0.3326 0.3558 0.2802 0.0427  -0.0175 0.0435  301 ALA A N   
1637 C CA  . ALA A 303 ? 0.2863 0.3122 0.2478 0.0387  -0.0186 0.0382  301 ALA A CA  
1638 C C   . ALA A 303 ? 0.3270 0.3697 0.2939 0.0397  -0.0256 0.0311  301 ALA A C   
1639 O O   . ALA A 303 ? 0.3324 0.3807 0.3079 0.0423  -0.0280 0.0311  301 ALA A O   
1640 C CB  . ALA A 303 ? 0.2243 0.2425 0.1907 0.0304  -0.0144 0.0334  301 ALA A CB  
1641 N N   . ILE A 304 ? 0.3218 0.3733 0.2846 0.0377  -0.0287 0.0245  302 ILE A N   
1642 C CA  . ILE A 304 ? 0.2976 0.3670 0.2667 0.0384  -0.0355 0.0158  302 ILE A CA  
1643 C C   . ILE A 304 ? 0.3637 0.4442 0.3306 0.0483  -0.0414 0.0201  302 ILE A C   
1644 O O   . ILE A 304 ? 0.3580 0.4502 0.3365 0.0493  -0.0456 0.0152  302 ILE A O   
1645 C CB  . ILE A 304 ? 0.3119 0.3895 0.2741 0.0362  -0.0382 0.0081  302 ILE A CB  
1646 C CG1 . ILE A 304 ? 0.2821 0.3523 0.2504 0.0263  -0.0330 0.0014  302 ILE A CG1 
1647 C CG2 . ILE A 304 ? 0.3032 0.4024 0.2703 0.0393  -0.0467 -0.0008 302 ILE A CG2 
1648 C CD1 . ILE A 304 ? 0.2956 0.3703 0.2561 0.0239  -0.0339 -0.0051 302 ILE A CD1 
1649 N N   . SER A 305 ? 0.3897 0.4663 0.3420 0.0562  -0.0411 0.0294  303 SER A N   
1650 C CA  . SER A 305 ? 0.4210 0.5078 0.3688 0.0673  -0.0464 0.0346  303 SER A CA  
1651 C C   . SER A 305 ? 0.4367 0.5197 0.3955 0.0696  -0.0448 0.0394  303 SER A C   
1652 O O   . SER A 305 ? 0.4407 0.5359 0.4023 0.0772  -0.0502 0.0404  303 SER A O   
1653 C CB  . SER A 305 ? 0.4630 0.5435 0.3918 0.0760  -0.0442 0.0452  303 SER A CB  
1654 O OG  . SER A 305 ? 0.5522 0.6134 0.4799 0.0760  -0.0356 0.0556  303 SER A OG  
1655 N N   . LYS A 306 ? 0.4344 0.5015 0.3996 0.0633  -0.0377 0.0418  304 LYS A N   
1656 C CA  . LYS A 306 ? 0.4300 0.4926 0.4059 0.0647  -0.0356 0.0455  304 LYS A CA  
1657 C C   . LYS A 306 ? 0.4071 0.4741 0.3991 0.0573  -0.0361 0.0365  304 LYS A C   
1658 O O   . LYS A 306 ? 0.4189 0.4808 0.4200 0.0571  -0.0333 0.0385  304 LYS A O   
1659 C CB  . LYS A 306 ? 0.4596 0.5024 0.4324 0.0641  -0.0273 0.0542  304 LYS A CB  
1660 C CG  . LYS A 306 ? 0.5181 0.5548 0.4773 0.0729  -0.0249 0.0649  304 LYS A CG  
1661 C CD  . LYS A 306 ? 0.5444 0.5618 0.5039 0.0710  -0.0157 0.0717  304 LYS A CD  
1662 C CE  . LYS A 306 ? 0.5645 0.5744 0.5128 0.0803  -0.0114 0.0833  304 LYS A CE  
1663 N NZ  . LYS A 306 ? 0.5459 0.5631 0.4945 0.0908  -0.0146 0.0888  304 LYS A NZ  
1664 N N   . GLY A 307 ? 0.3841 0.4600 0.3799 0.0513  -0.0387 0.0265  305 GLY A N   
1665 C CA  . GLY A 307 ? 0.2878 0.3682 0.2994 0.0447  -0.0380 0.0179  305 GLY A CA  
1666 C C   . GLY A 307 ? 0.3070 0.3716 0.3216 0.0371  -0.0304 0.0178  305 GLY A C   
1667 O O   . GLY A 307 ? 0.3077 0.3713 0.3341 0.0335  -0.0276 0.0144  305 GLY A O   
1668 N N   . TYR A 308 ? 0.2519 0.3049 0.2558 0.0352  -0.0267 0.0215  306 TYR A N   
1669 C CA  . TYR A 308 ? 0.2633 0.3030 0.2686 0.0288  -0.0203 0.0207  306 TYR A CA  
1670 C C   . TYR A 308 ? 0.2998 0.3396 0.3024 0.0228  -0.0190 0.0145  306 TYR A C   
1671 O O   . TYR A 308 ? 0.3120 0.3590 0.3081 0.0237  -0.0225 0.0123  306 TYR A O   
1672 C CB  . TYR A 308 ? 0.2845 0.3103 0.2818 0.0306  -0.0162 0.0289  306 TYR A CB  
1673 C CG  . TYR A 308 ? 0.3025 0.3237 0.3039 0.0350  -0.0149 0.0345  306 TYR A CG  
1674 C CD1 . TYR A 308 ? 0.2640 0.2774 0.2721 0.0324  -0.0108 0.0339  306 TYR A CD1 
1675 C CD2 . TYR A 308 ? 0.3192 0.3438 0.3172 0.0424  -0.0175 0.0406  306 TYR A CD2 
1676 C CE1 . TYR A 308 ? 0.3011 0.3103 0.3134 0.0363  -0.0093 0.0382  306 TYR A CE1 
1677 C CE2 . TYR A 308 ? 0.3311 0.3508 0.3336 0.0464  -0.0155 0.0457  306 TYR A CE2 
1678 C CZ  . TYR A 308 ? 0.3059 0.3179 0.3159 0.0430  -0.0114 0.0441  306 TYR A CZ  
1679 O OH  . TYR A 308 ? 0.3480 0.3551 0.3626 0.0471  -0.0092 0.0486  306 TYR A OH  
1680 N N   . LEU A 309 ? 0.2757 0.3072 0.2825 0.0175  -0.0136 0.0121  307 LEU A N   
1681 C CA  . LEU A 309 ? 0.2532 0.2805 0.2560 0.0125  -0.0106 0.0084  307 LEU A CA  
1682 C C   . LEU A 309 ? 0.2863 0.3002 0.2819 0.0127  -0.0065 0.0142  307 LEU A C   
1683 O O   . LEU A 309 ? 0.2881 0.2952 0.2872 0.0131  -0.0036 0.0167  307 LEU A O   
1684 C CB  . LEU A 309 ? 0.2588 0.2861 0.2719 0.0072  -0.0066 0.0016  307 LEU A CB  
1685 C CG  . LEU A 309 ? 0.2828 0.3007 0.2923 0.0029  -0.0009 0.0000  307 LEU A CG  
1686 C CD1 . LEU A 309 ? 0.2721 0.2942 0.2752 0.0012  -0.0030 -0.0035 307 LEU A CD1 
1687 C CD2 . LEU A 309 ? 0.2556 0.2710 0.2753 -0.0010 0.0051  -0.0049 307 LEU A CD2 
1688 N N   . LEU A 310 ? 0.2597 0.2705 0.2458 0.0124  -0.0063 0.0158  308 LEU A N   
1689 C CA  . LEU A 310 ? 0.2575 0.2570 0.2388 0.0119  -0.0021 0.0198  308 LEU A CA  
1690 C C   . LEU A 310 ? 0.2969 0.2928 0.2755 0.0076  0.0011  0.0160  308 LEU A C   
1691 O O   . LEU A 310 ? 0.2907 0.2907 0.2649 0.0062  -0.0001 0.0131  308 LEU A O   
1692 C CB  . LEU A 310 ? 0.3019 0.2984 0.2754 0.0157  -0.0027 0.0262  308 LEU A CB  
1693 C CG  . LEU A 310 ? 0.3085 0.2947 0.2788 0.0145  0.0018  0.0291  308 LEU A CG  
1694 C CD1 . LEU A 310 ? 0.2959 0.2762 0.2731 0.0142  0.0043  0.0293  308 LEU A CD1 
1695 C CD2 . LEU A 310 ? 0.2851 0.2681 0.2485 0.0180  0.0027  0.0352  308 LEU A CD2 
1696 N N   . ASN A 311 ? 0.3212 0.3098 0.3023 0.0062  0.0052  0.0159  309 ASN A N   
1697 C CA  . ASN A 311 ? 0.2826 0.2666 0.2609 0.0033  0.0088  0.0135  309 ASN A CA  
1698 C C   . ASN A 311 ? 0.2783 0.2546 0.2558 0.0046  0.0117  0.0162  309 ASN A C   
1699 O O   . ASN A 311 ? 0.3532 0.3278 0.3322 0.0070  0.0107  0.0193  309 ASN A O   
1700 C CB  . ASN A 311 ? 0.2391 0.2247 0.2232 0.0004  0.0114  0.0081  309 ASN A CB  
1701 C CG  . ASN A 311 ? 0.2534 0.2369 0.2442 0.0015  0.0137  0.0085  309 ASN A CG  
1702 O OD1 . ASN A 311 ? 0.2997 0.2782 0.2892 0.0041  0.0145  0.0120  309 ASN A OD1 
1703 N ND2 . ASN A 311 ? 0.2900 0.2773 0.2884 -0.0006 0.0152  0.0042  309 ASN A ND2 
1704 N N   . GLU A 312 ? 0.2682 0.2403 0.2437 0.0033  0.0151  0.0146  310 GLU A N   
1705 C CA  . GLU A 312 ? 0.2470 0.2140 0.2218 0.0051  0.0170  0.0161  310 GLU A CA  
1706 C C   . GLU A 312 ? 0.2490 0.2146 0.2276 0.0077  0.0178  0.0162  310 GLU A C   
1707 O O   . GLU A 312 ? 0.2766 0.2403 0.2555 0.0100  0.0178  0.0169  310 GLU A O   
1708 C CB  . GLU A 312 ? 0.2457 0.2096 0.2174 0.0042  0.0204  0.0144  310 GLU A CB  
1709 C CG  . GLU A 312 ? 0.2801 0.2426 0.2531 0.0032  0.0241  0.0118  310 GLU A CG  
1710 C CD  . GLU A 312 ? 0.3490 0.3141 0.3215 -0.0006 0.0244  0.0087  310 GLU A CD  
1711 O OE1 . GLU A 312 ? 0.3041 0.2747 0.2771 -0.0018 0.0206  0.0080  310 GLU A OE1 
1712 O OE2 . GLU A 312 ? 0.3730 0.3349 0.3446 -0.0020 0.0286  0.0065  310 GLU A OE2 
1713 N N   . TYR A 313 ? 0.2506 0.2177 0.2326 0.0073  0.0188  0.0150  311 TYR A N   
1714 C CA  . TYR A 313 ? 0.2882 0.2533 0.2728 0.0101  0.0208  0.0153  311 TYR A CA  
1715 C C   . TYR A 313 ? 0.3376 0.3049 0.3259 0.0118  0.0178  0.0167  311 TYR A C   
1716 O O   . TYR A 313 ? 0.3252 0.2906 0.3142 0.0148  0.0188  0.0170  311 TYR A O   
1717 C CB  . TYR A 313 ? 0.2776 0.2420 0.2654 0.0089  0.0250  0.0133  311 TYR A CB  
1718 C CG  . TYR A 313 ? 0.3198 0.2803 0.3045 0.0079  0.0294  0.0122  311 TYR A CG  
1719 C CD1 . TYR A 313 ? 0.3033 0.2594 0.2825 0.0114  0.0313  0.0137  311 TYR A CD1 
1720 C CD2 . TYR A 313 ? 0.2950 0.2566 0.2826 0.0038  0.0316  0.0089  311 TYR A CD2 
1721 C CE1 . TYR A 313 ? 0.2924 0.2447 0.2688 0.0114  0.0357  0.0132  311 TYR A CE1 
1722 C CE2 . TYR A 313 ? 0.3264 0.2833 0.3116 0.0030  0.0365  0.0078  311 TYR A CE2 
1723 C CZ  . TYR A 313 ? 0.3112 0.2631 0.2905 0.0070  0.0387  0.0106  311 TYR A CZ  
1724 O OH  . TYR A 313 ? 0.3622 0.3091 0.3390 0.0072  0.0438  0.0101  311 TYR A OH  
1725 N N   . GLY A 314 ? 0.3465 0.3179 0.3364 0.0106  0.0144  0.0176  312 GLY A N   
1726 C CA  . GLY A 314 ? 0.3427 0.3157 0.3361 0.0127  0.0120  0.0197  312 GLY A CA  
1727 C C   . GLY A 314 ? 0.3348 0.3132 0.3292 0.0126  0.0084  0.0212  312 GLY A C   
1728 O O   . GLY A 314 ? 0.3474 0.3290 0.3386 0.0108  0.0071  0.0203  312 GLY A O   
1729 N N   . LEU A 315 ? 0.2541 0.2337 0.2523 0.0152  0.0069  0.0235  313 LEU A N   
1730 C CA  . LEU A 315 ? 0.2359 0.2214 0.2351 0.0170  0.0033  0.0256  313 LEU A CA  
1731 C C   . LEU A 315 ? 0.2703 0.2610 0.2774 0.0178  0.0026  0.0237  313 LEU A C   
1732 O O   . LEU A 315 ? 0.2632 0.2505 0.2742 0.0193  0.0045  0.0242  313 LEU A O   
1733 C CB  . LEU A 315 ? 0.2516 0.2330 0.2496 0.0202  0.0032  0.0306  313 LEU A CB  
1734 C CG  . LEU A 315 ? 0.2799 0.2657 0.2781 0.0243  0.0004  0.0348  313 LEU A CG  
1735 C CD1 . LEU A 315 ? 0.2508 0.2433 0.2429 0.0248  -0.0028 0.0350  313 LEU A CD1 
1736 C CD2 . LEU A 315 ? 0.2725 0.2507 0.2702 0.0272  0.0030  0.0399  313 LEU A CD2 
1737 N N   . PHE A 316 ? 0.2549 0.2542 0.2650 0.0167  0.0002  0.0207  314 PHE A N   
1738 C CA  . PHE A 316 ? 0.2482 0.2532 0.2681 0.0165  0.0005  0.0176  314 PHE A CA  
1739 C C   . PHE A 316 ? 0.3055 0.3214 0.3294 0.0194  -0.0048 0.0177  314 PHE A C   
1740 O O   . PHE A 316 ? 0.3535 0.3766 0.3740 0.0195  -0.0087 0.0162  314 PHE A O   
1741 C CB  . PHE A 316 ? 0.2279 0.2341 0.2516 0.0120  0.0037  0.0118  314 PHE A CB  
1742 C CG  . PHE A 316 ? 0.2596 0.2557 0.2778 0.0103  0.0089  0.0122  314 PHE A CG  
1743 C CD1 . PHE A 316 ? 0.2554 0.2453 0.2755 0.0113  0.0137  0.0128  314 PHE A CD1 
1744 C CD2 . PHE A 316 ? 0.2529 0.2463 0.2637 0.0085  0.0089  0.0120  314 PHE A CD2 
1745 C CE1 . PHE A 316 ? 0.2427 0.2246 0.2569 0.0113  0.0180  0.0133  314 PHE A CE1 
1746 C CE2 . PHE A 316 ? 0.2540 0.2391 0.2602 0.0079  0.0133  0.0124  314 PHE A CE2 
1747 C CZ  . PHE A 316 ? 0.2375 0.2172 0.2451 0.0096  0.0176  0.0131  314 PHE A CZ  
1748 N N   . LYS A 317 ? 0.3053 0.3231 0.3360 0.0225  -0.0051 0.0192  315 LYS A N   
1749 C CA  . LYS A 317 ? 0.3035 0.3322 0.3384 0.0268  -0.0103 0.0201  315 LYS A CA  
1750 C C   . LYS A 317 ? 0.2809 0.3217 0.3271 0.0244  -0.0119 0.0127  315 LYS A C   
1751 O O   . LYS A 317 ? 0.3199 0.3605 0.3759 0.0230  -0.0084 0.0103  315 LYS A O   
1752 C CB  . LYS A 317 ? 0.3112 0.3360 0.3492 0.0315  -0.0095 0.0252  315 LYS A CB  
1753 C CG  . LYS A 317 ? 0.3023 0.3365 0.3420 0.0378  -0.0146 0.0284  315 LYS A CG  
1754 C CD  . LYS A 317 ? 0.2745 0.3022 0.3168 0.0425  -0.0123 0.0340  315 LYS A CD  
1755 C CE  . LYS A 317 ? 0.3076 0.3391 0.3461 0.0502  -0.0159 0.0405  315 LYS A CE  
1756 N NZ  . LYS A 317 ? 0.3608 0.4093 0.4051 0.0539  -0.0221 0.0377  315 LYS A NZ  
1757 N N   . LEU A 318 ? 0.2384 0.2902 0.2837 0.0241  -0.0167 0.0087  316 LEU A N   
1758 C CA  . LEU A 318 ? 0.2720 0.3365 0.3295 0.0207  -0.0181 -0.0005 316 LEU A CA  
1759 C C   . LEU A 318 ? 0.3260 0.4066 0.3927 0.0255  -0.0242 -0.0026 316 LEU A C   
1760 O O   . LEU A 318 ? 0.3221 0.4112 0.4038 0.0230  -0.0234 -0.0094 316 LEU A O   
1761 C CB  . LEU A 318 ? 0.3137 0.3827 0.3663 0.0171  -0.0200 -0.0060 316 LEU A CB  
1762 C CG  . LEU A 318 ? 0.3766 0.4357 0.4289 0.0102  -0.0131 -0.0094 316 LEU A CG  
1763 C CD1 . LEU A 318 ? 0.3603 0.4027 0.4069 0.0103  -0.0068 -0.0026 316 LEU A CD1 
1764 C CD2 . LEU A 318 ? 0.3779 0.4387 0.4204 0.0087  -0.0155 -0.0119 316 LEU A CD2 
1765 N N   . GLY A 319 ? 0.3891 0.4737 0.4472 0.0327  -0.0299 0.0033  317 GLY A N   
1766 C CA  . GLY A 319 ? 0.3890 0.4903 0.4541 0.0390  -0.0367 0.0018  317 GLY A CA  
1767 C C   . GLY A 319 ? 0.4319 0.5496 0.4934 0.0413  -0.0445 -0.0038 317 GLY A C   
1768 O O   . GLY A 319 ? 0.4815 0.5954 0.5283 0.0423  -0.0457 -0.0010 317 GLY A O   
1769 N N   . THR A 320 ? 0.4306 0.5677 0.5058 0.0422  -0.0498 -0.0125 318 THR A N   
1770 C CA  . THR A 320 ? 0.4637 0.6198 0.5364 0.0453  -0.0584 -0.0196 318 THR A CA  
1771 C C   . THR A 320 ? 0.4676 0.6238 0.5412 0.0363  -0.0564 -0.0293 318 THR A C   
1772 O O   . THR A 320 ? 0.4503 0.5954 0.5317 0.0277  -0.0485 -0.0324 318 THR A O   
1773 C CB  . THR A 320 ? 0.5075 0.6865 0.5972 0.0488  -0.0651 -0.0279 318 THR A CB  
1774 O OG1 . THR A 320 ? 0.5622 0.7437 0.6724 0.0393  -0.0602 -0.0384 318 THR A OG1 
1775 C CG2 . THR A 320 ? 0.4440 0.6227 0.5342 0.0580  -0.0665 -0.0181 318 THR A CG2 
1776 N N   . PRO A 321 ? 0.4765 0.6449 0.5414 0.0389  -0.0632 -0.0341 319 PRO A N   
1777 C CA  . PRO A 321 ? 0.5442 0.7139 0.6106 0.0306  -0.0614 -0.0445 319 PRO A CA  
1778 C C   . PRO A 321 ? 0.6048 0.7819 0.6950 0.0218  -0.0580 -0.0577 319 PRO A C   
1779 O O   . PRO A 321 ? 0.6364 0.8042 0.7309 0.0129  -0.0509 -0.0628 319 PRO A O   
1780 C CB  . PRO A 321 ? 0.5276 0.7158 0.5841 0.0371  -0.0714 -0.0494 319 PRO A CB  
1781 C CG  . PRO A 321 ? 0.4955 0.6809 0.5357 0.0491  -0.0750 -0.0352 319 PRO A CG  
1782 C CD  . PRO A 321 ? 0.4653 0.6461 0.5173 0.0505  -0.0721 -0.0296 319 PRO A CD  
1783 N N   . GLU A 322 ? 0.5878 0.7806 0.6940 0.0245  -0.0621 -0.0626 320 GLU A N   
1784 C CA  . GLU A 322 ? 0.5758 0.7767 0.7069 0.0163  -0.0582 -0.0755 320 GLU A CA  
1785 C C   . GLU A 322 ? 0.5710 0.7517 0.7094 0.0104  -0.0462 -0.0701 320 GLU A C   
1786 O O   . GLU A 322 ? 0.5775 0.7535 0.7290 0.0014  -0.0381 -0.0779 320 GLU A O   
1787 C CB  . GLU A 322 ? 0.5463 0.7723 0.6939 0.0213  -0.0665 -0.0833 320 GLU A CB  
1788 N N   . GLU A 323 ? 0.5443 0.7128 0.6739 0.0159  -0.0445 -0.0568 321 GLU A N   
1789 C CA  . GLU A 323 ? 0.5319 0.6807 0.6643 0.0117  -0.0336 -0.0508 321 GLU A CA  
1790 C C   . GLU A 323 ? 0.4693 0.6005 0.5903 0.0061  -0.0268 -0.0486 321 GLU A C   
1791 O O   . GLU A 323 ? 0.4912 0.6107 0.6191 -0.0001 -0.0171 -0.0500 321 GLU A O   
1792 C CB  . GLU A 323 ? 0.5536 0.6930 0.6767 0.0191  -0.0339 -0.0376 321 GLU A CB  
1793 C CG  . GLU A 323 ? 0.5901 0.7437 0.7257 0.0248  -0.0386 -0.0384 321 GLU A CG  
1794 C CD  . GLU A 323 ? 0.6305 0.7745 0.7553 0.0327  -0.0391 -0.0253 321 GLU A CD  
1795 O OE1 . GLU A 323 ? 0.6562 0.7975 0.7641 0.0387  -0.0436 -0.0179 321 GLU A OE1 
1796 O OE2 . GLU A 323 ? 0.6358 0.7741 0.7691 0.0330  -0.0340 -0.0225 321 GLU A OE2 
1797 N N   . ALA A 324 ? 0.4148 0.5443 0.5183 0.0089  -0.0315 -0.0449 322 ALA A N   
1798 C CA  . ALA A 324 ? 0.4710 0.5855 0.5632 0.0043  -0.0260 -0.0430 322 ALA A CA  
1799 C C   . ALA A 324 ? 0.5092 0.6287 0.6138 -0.0039 -0.0222 -0.0558 322 ALA A C   
1800 O O   . ALA A 324 ? 0.4581 0.5634 0.5644 -0.0096 -0.0128 -0.0559 322 ALA A O   
1801 C CB  . ALA A 324 ? 0.4598 0.5734 0.5320 0.0094  -0.0319 -0.0370 322 ALA A CB  
1802 N N   . ARG A 325 ? 0.5539 0.6940 0.6675 -0.0041 -0.0293 -0.0670 323 ARG A N   
1803 C CA  . ARG A 325 ? 0.5790 0.7259 0.7072 -0.0124 -0.0259 -0.0815 323 ARG A CA  
1804 C C   . ARG A 325 ? 0.5236 0.6658 0.6727 -0.0186 -0.0158 -0.0859 323 ARG A C   
1805 O O   . ARG A 325 ? 0.5152 0.6481 0.6716 -0.0260 -0.0062 -0.0911 323 ARG A O   
1806 C CB  . ARG A 325 ? 0.6359 0.8087 0.7710 -0.0106 -0.0366 -0.0941 323 ARG A CB  
1807 C CG  . ARG A 325 ? 0.7089 0.8865 0.8229 -0.0052 -0.0451 -0.0918 323 ARG A CG  
1808 C CD  . ARG A 325 ? 0.7934 0.9974 0.9147 -0.0040 -0.0550 -0.1068 323 ARG A CD  
1809 N NE  . ARG A 325 ? 0.8566 1.0802 0.9896 0.0018  -0.0628 -0.1098 323 ARG A NE  
1810 C CZ  . ARG A 325 ? 0.9028 1.1370 1.0227 0.0131  -0.0729 -0.1030 323 ARG A CZ  
1811 N NH1 . ARG A 325 ? 0.9223 1.1486 1.0171 0.0193  -0.0757 -0.0928 323 ARG A NH1 
1812 N NH2 . ARG A 325 ? 0.9152 1.1675 1.0473 0.0186  -0.0796 -0.1061 323 ARG A NH2 
1813 N N   . ALA A 326 ? 0.4589 0.6063 0.6174 -0.0152 -0.0169 -0.0834 324 ALA A N   
1814 C CA  . ALA A 326 ? 0.4577 0.6000 0.6356 -0.0204 -0.0064 -0.0867 324 ALA A CA  
1815 C C   . ALA A 326 ? 0.5187 0.6352 0.6866 -0.0225 0.0054  -0.0767 324 ALA A C   
1816 O O   . ALA A 326 ? 0.5416 0.6495 0.7210 -0.0287 0.0169  -0.0809 324 ALA A O   
1817 C CB  . ALA A 326 ? 0.3912 0.5429 0.5790 -0.0155 -0.0098 -0.0844 324 ALA A CB  
1818 N N   . LEU A 327 ? 0.4948 0.5995 0.6415 -0.0168 0.0029  -0.0638 325 LEU A N   
1819 C CA  . LEU A 327 ? 0.4837 0.5661 0.6192 -0.0173 0.0123  -0.0546 325 LEU A CA  
1820 C C   . LEU A 327 ? 0.4818 0.5561 0.6132 -0.0226 0.0177  -0.0583 325 LEU A C   
1821 O O   . LEU A 327 ? 0.5093 0.5698 0.6437 -0.0259 0.0290  -0.0573 325 LEU A O   
1822 C CB  . LEU A 327 ? 0.4557 0.5299 0.5716 -0.0103 0.0075  -0.0419 325 LEU A CB  
1823 C CG  . LEU A 327 ? 0.4584 0.5121 0.5609 -0.0094 0.0148  -0.0327 325 LEU A CG  
1824 C CD1 . LEU A 327 ? 0.4559 0.5004 0.5665 -0.0099 0.0247  -0.0306 325 LEU A CD1 
1825 C CD2 . LEU A 327 ? 0.4143 0.4631 0.4999 -0.0033 0.0088  -0.0228 325 LEU A CD2 
1826 N N   . TYR A 328 ? 0.4662 0.5487 0.5903 -0.0227 0.0102  -0.0623 326 TYR A N   
1827 C CA  . TYR A 328 ? 0.5378 0.6136 0.6582 -0.0276 0.0149  -0.0665 326 TYR A CA  
1828 C C   . TYR A 328 ? 0.5975 0.6751 0.7389 -0.0354 0.0241  -0.0782 326 TYR A C   
1829 O O   . TYR A 328 ? 0.6000 0.6639 0.7410 -0.0393 0.0340  -0.0784 326 TYR A O   
1830 C CB  . TYR A 328 ? 0.5685 0.6552 0.6783 -0.0262 0.0049  -0.0700 326 TYR A CB  
1831 C CG  . TYR A 328 ? 0.6180 0.6955 0.7201 -0.0301 0.0095  -0.0721 326 TYR A CG  
1832 C CD1 . TYR A 328 ? 0.6201 0.6853 0.7024 -0.0267 0.0091  -0.0620 326 TYR A CD1 
1833 C CD2 . TYR A 328 ? 0.6524 0.7333 0.7683 -0.0373 0.0149  -0.0847 326 TYR A CD2 
1834 C CE1 . TYR A 328 ? 0.6253 0.6823 0.7010 -0.0299 0.0134  -0.0638 326 TYR A CE1 
1835 C CE2 . TYR A 328 ? 0.6815 0.7533 0.7906 -0.0406 0.0197  -0.0865 326 TYR A CE2 
1836 C CZ  . TYR A 328 ? 0.6800 0.7400 0.7686 -0.0366 0.0187  -0.0757 326 TYR A CZ  
1837 O OH  . TYR A 328 ? 0.6945 0.7457 0.7767 -0.0396 0.0236  -0.0773 326 TYR A OH  
1838 N N   . GLU A 329 ? 0.5888 0.6830 0.7493 -0.0374 0.0212  -0.0881 327 GLU A N   
1839 C CA  . GLU A 329 ? 0.6411 0.7377 0.8251 -0.0453 0.0309  -0.1003 327 GLU A CA  
1840 C C   . GLU A 329 ? 0.6384 0.7141 0.8251 -0.0466 0.0460  -0.0927 327 GLU A C   
1841 O O   . GLU A 329 ? 0.6462 0.7121 0.8418 -0.0523 0.0580  -0.0973 327 GLU A O   
1842 C CB  . GLU A 329 ? 0.7009 0.8194 0.9065 -0.0463 0.0255  -0.1111 327 GLU A CB  
1843 C CG  . GLU A 329 ? 0.7603 0.9023 0.9637 -0.0434 0.0098  -0.1190 327 GLU A CG  
1844 C CD  . GLU A 329 ? 0.8369 0.9894 1.0498 -0.0500 0.0093  -0.1348 327 GLU A CD  
1845 O OE1 . GLU A 329 ? 0.8644 1.0088 1.0929 -0.0581 0.0217  -0.1422 327 GLU A OE1 
1846 O OE2 . GLU A 329 ? 0.8692 1.0377 1.0737 -0.0467 -0.0031 -0.1399 327 GLU A OE2 
1847 N N   . ARG A 330 ? 0.6019 0.6706 0.7803 -0.0407 0.0459  -0.0811 328 ARG A N   
1848 C CA  . ARG A 330 ? 0.5850 0.6356 0.7649 -0.0403 0.0597  -0.0739 328 ARG A CA  
1849 C C   . ARG A 330 ? 0.5794 0.6095 0.7414 -0.0387 0.0669  -0.0648 328 ARG A C   
1850 O O   . ARG A 330 ? 0.6074 0.6237 0.7745 -0.0408 0.0808  -0.0638 328 ARG A O   
1851 C CB  . ARG A 330 ? 0.5582 0.6088 0.7357 -0.0344 0.0574  -0.0656 328 ARG A CB  
1852 C CG  . ARG A 330 ? 0.5564 0.6230 0.7567 -0.0364 0.0563  -0.0741 328 ARG A CG  
1853 C CD  . ARG A 330 ? 0.5876 0.6509 0.7858 -0.0306 0.0568  -0.0654 328 ARG A CD  
1854 N NE  . ARG A 330 ? 0.6558 0.7229 0.8367 -0.0237 0.0441  -0.0576 328 ARG A NE  
1855 C CZ  . ARG A 330 ? 0.6968 0.7817 0.8823 -0.0209 0.0325  -0.0608 328 ARG A CZ  
1856 N NH1 . ARG A 330 ? 0.7327 0.8353 0.9400 -0.0244 0.0306  -0.0726 328 ARG A NH1 
1857 N NH2 . ARG A 330 ? 0.6434 0.7288 0.8124 -0.0142 0.0231  -0.0524 328 ARG A NH2 
1858 N N   . ILE A 331 ? 0.5414 0.5696 0.6830 -0.0344 0.0581  -0.0581 329 ILE A N   
1859 C CA  . ILE A 331 ? 0.5271 0.5374 0.6512 -0.0313 0.0636  -0.0484 329 ILE A CA  
1860 C C   . ILE A 331 ? 0.5311 0.5410 0.6431 -0.0322 0.0587  -0.0493 329 ILE A C   
1861 O O   . ILE A 331 ? 0.5729 0.5690 0.6733 -0.0304 0.0642  -0.0433 329 ILE A O   
1862 C CB  . ILE A 331 ? 0.5004 0.5044 0.6096 -0.0238 0.0601  -0.0366 329 ILE A CB  
1863 C CG1 . ILE A 331 ? 0.4645 0.4779 0.5621 -0.0206 0.0461  -0.0342 329 ILE A CG1 
1864 C CG2 . ILE A 331 ? 0.4861 0.4911 0.6058 -0.0222 0.0642  -0.0354 329 ILE A CG2 
1865 C CD1 . ILE A 331 ? 0.4566 0.4645 0.5418 -0.0140 0.0427  -0.0241 329 ILE A CD1 
1866 N N   . GLY A 332 ? 0.5328 0.5582 0.6467 -0.0340 0.0483  -0.0566 330 GLY A N   
1867 C CA  . GLY A 332 ? 0.5765 0.6028 0.6791 -0.0348 0.0435  -0.0581 330 GLY A CA  
1868 C C   . GLY A 332 ? 0.6695 0.6911 0.7805 -0.0412 0.0525  -0.0665 330 GLY A C   
1869 O O   . GLY A 332 ? 0.6947 0.7217 0.8250 -0.0467 0.0579  -0.0767 330 GLY A O   
1870 N N   . ILE A 333 ? 0.7262 0.7377 0.8239 -0.0405 0.0545  -0.0627 331 ILE A N   
1871 C CA  . ILE A 333 ? 0.7409 0.7443 0.8447 -0.0456 0.0646  -0.0687 331 ILE A CA  
1872 C C   . ILE A 333 ? 0.7352 0.7467 0.8340 -0.0483 0.0582  -0.0762 331 ILE A C   
1873 O O   . ILE A 333 ? 0.7254 0.7336 0.8070 -0.0446 0.0532  -0.0696 331 ILE A O   
1874 C CB  . ILE A 333 ? 0.7880 0.7714 0.8812 -0.0420 0.0746  -0.0580 331 ILE A CB  
1875 C CG1 . ILE A 333 ? 0.8138 0.7899 0.9064 -0.0371 0.0789  -0.0489 331 ILE A CG1 
1876 C CG2 . ILE A 333 ? 0.8125 0.7859 0.9148 -0.0468 0.0876  -0.0637 331 ILE A CG2 
1877 C CD1 . ILE A 333 ? 0.4511 0.4305 0.5291 -0.0306 0.0681  -0.0398 331 ILE A CD1 
1878 N N   . ARG A 334 ? 0.7304 0.7527 0.8453 -0.0548 0.0590  -0.0905 332 ARG A N   
1879 C CA  . ARG A 334 ? 0.7326 0.7664 0.8449 -0.0576 0.0521  -0.1005 332 ARG A CA  
1880 C C   . ARG A 334 ? 0.7418 0.7682 0.8334 -0.0543 0.0493  -0.0937 332 ARG A C   
1881 O O   . ARG A 334 ? 0.8129 0.8487 0.8914 -0.0505 0.0381  -0.0917 332 ARG A O   
1882 C CB  . ARG A 334 ? 0.7264 0.7625 0.8589 -0.0661 0.0607  -0.1159 332 ARG A CB  
1883 N N   . GLY A 335 ? 0.6836 0.6932 0.7722 -0.0553 0.0600  -0.0900 333 GLY A N   
1884 C CA  . GLY A 335 ? 0.7171 0.7200 0.7881 -0.0526 0.0583  -0.0844 333 GLY A CA  
1885 C C   . GLY A 335 ? 0.7090 0.6981 0.7656 -0.0461 0.0601  -0.0690 333 GLY A C   
1886 O O   . GLY A 335 ? 0.7515 0.7324 0.7966 -0.0442 0.0619  -0.0644 333 GLY A O   
1887 N N   . LYS A 336 ? 0.6554 0.6428 0.7130 -0.0426 0.0595  -0.0617 334 LYS A N   
1888 C CA  . LYS A 336 ? 0.5955 0.5707 0.6415 -0.0364 0.0619  -0.0488 334 LYS A CA  
1889 C C   . LYS A 336 ? 0.5326 0.5142 0.5688 -0.0314 0.0512  -0.0417 334 LYS A C   
1890 O O   . LYS A 336 ? 0.4894 0.4722 0.5131 -0.0289 0.0453  -0.0378 334 LYS A O   
1891 C CB  . LYS A 336 ? 0.6089 0.5733 0.6634 -0.0357 0.0730  -0.0455 334 LYS A CB  
1892 C CG  . LYS A 336 ? 0.6344 0.5859 0.6769 -0.0288 0.0768  -0.0335 334 LYS A CG  
1893 C CD  . LYS A 336 ? 0.6829 0.6234 0.7331 -0.0275 0.0893  -0.0307 334 LYS A CD  
1894 C CE  . LYS A 336 ? 0.7128 0.6418 0.7501 -0.0193 0.0930  -0.0193 334 LYS A CE  
1895 N NZ  . LYS A 336 ? 0.7266 0.6447 0.7695 -0.0167 0.1056  -0.0158 334 LYS A NZ  
1896 N N   . ASN A 337 ? 0.4776 0.4629 0.5203 -0.0301 0.0498  -0.0401 335 ASN A N   
1897 C CA  . ASN A 337 ? 0.3681 0.3585 0.4032 -0.0253 0.0409  -0.0335 335 ASN A CA  
1898 C C   . ASN A 337 ? 0.3492 0.3486 0.3950 -0.0253 0.0379  -0.0357 335 ASN A C   
1899 O O   . ASN A 337 ? 0.3542 0.3559 0.4145 -0.0292 0.0432  -0.0424 335 ASN A O   
1900 C CB  . ASN A 337 ? 0.3270 0.3058 0.3515 -0.0200 0.0433  -0.0230 335 ASN A CB  
1901 C CG  . ASN A 337 ? 0.3534 0.3230 0.3833 -0.0184 0.0523  -0.0200 335 ASN A CG  
1902 O OD1 . ASN A 337 ? 0.3810 0.3539 0.4210 -0.0194 0.0539  -0.0222 335 ASN A OD1 
1903 N ND2 . ASN A 337 ? 0.3615 0.3196 0.3842 -0.0153 0.0585  -0.0148 335 ASN A ND2 
1904 N N   . ALA A 338 ? 0.3435 0.3478 0.3830 -0.0209 0.0300  -0.0302 336 ALA A N   
1905 C CA  . ALA A 338 ? 0.3484 0.3621 0.3971 -0.0199 0.0260  -0.0317 336 ALA A CA  
1906 C C   . ALA A 338 ? 0.3702 0.3764 0.4262 -0.0190 0.0335  -0.0285 336 ALA A C   
1907 O O   . ALA A 338 ? 0.3743 0.3875 0.4404 -0.0188 0.0322  -0.0305 336 ALA A O   
1908 C CB  . ALA A 338 ? 0.2922 0.3115 0.3315 -0.0148 0.0166  -0.0258 336 ALA A CB  
1909 N N   . GLY A 339 ? 0.3520 0.3442 0.4023 -0.0177 0.0414  -0.0234 337 GLY A N   
1910 C CA  . GLY A 339 ? 0.3377 0.3219 0.3926 -0.0158 0.0493  -0.0199 337 GLY A CA  
1911 C C   . GLY A 339 ? 0.3414 0.3142 0.3834 -0.0099 0.0517  -0.0107 337 GLY A C   
1912 O O   . GLY A 339 ? 0.3517 0.3234 0.3923 -0.0059 0.0510  -0.0063 337 GLY A O   
1913 N N   . GLU A 340 ? 0.3075 0.2728 0.3406 -0.0091 0.0544  -0.0086 338 GLU A N   
1914 C CA  . GLU A 340 ? 0.3357 0.2912 0.3577 -0.0031 0.0575  -0.0012 338 GLU A CA  
1915 C C   . GLU A 340 ? 0.3758 0.3206 0.3971 -0.0026 0.0683  -0.0005 338 GLU A C   
1916 O O   . GLU A 340 ? 0.3905 0.3349 0.4177 -0.0074 0.0720  -0.0056 338 GLU A O   
1917 C CB  . GLU A 340 ? 0.3418 0.2989 0.3525 -0.0008 0.0496  0.0019  338 GLU A CB  
1918 C CG  . GLU A 340 ? 0.3338 0.2999 0.3446 -0.0010 0.0401  0.0019  338 GLU A CG  
1919 C CD  . GLU A 340 ? 0.3485 0.3225 0.3604 -0.0051 0.0347  -0.0025 338 GLU A CD  
1920 O OE1 . GLU A 340 ? 0.3921 0.3744 0.4057 -0.0050 0.0279  -0.0029 338 GLU A OE1 
1921 O OE2 . GLU A 340 ? 0.3438 0.3157 0.3541 -0.0077 0.0373  -0.0052 338 GLU A OE2 
1922 N N   . GLU A 341 ? 0.3505 0.2867 0.3645 0.0039  0.0736  0.0057  339 GLU A N   
1923 C CA  . GLU A 341 ? 0.3627 0.2875 0.3733 0.0067  0.0843  0.0084  339 GLU A CA  
1924 C C   . GLU A 341 ? 0.3531 0.2736 0.3493 0.0154  0.0829  0.0152  339 GLU A C   
1925 O O   . GLU A 341 ? 0.3638 0.2860 0.3559 0.0201  0.0800  0.0183  339 GLU A O   
1926 C CB  . GLU A 341 ? 0.3957 0.3139 0.4156 0.0064  0.0962  0.0082  339 GLU A CB  
1927 C CG  . GLU A 341 ? 0.4450 0.3493 0.4590 0.0123  0.1089  0.0138  339 GLU A CG  
1928 C CD  . GLU A 341 ? 0.5442 0.4432 0.5605 0.0088  0.1144  0.0111  339 GLU A CD  
1929 O OE1 . GLU A 341 ? 0.5718 0.4758 0.6004 0.0002  0.1139  0.0030  339 GLU A OE1 
1930 O OE2 . GLU A 341 ? 0.5880 0.4785 0.5940 0.0152  0.1192  0.0166  339 GLU A OE2 
1931 N N   . LEU A 342 ? 0.3515 0.2679 0.3410 0.0175  0.0845  0.0168  340 LEU A N   
1932 C CA  . LEU A 342 ? 0.3476 0.2624 0.3244 0.0258  0.0820  0.0218  340 LEU A CA  
1933 C C   . LEU A 342 ? 0.3589 0.2831 0.3326 0.0261  0.0701  0.0210  340 LEU A C   
1934 O O   . LEU A 342 ? 0.3601 0.2850 0.3262 0.0330  0.0677  0.0240  340 LEU A O   
1935 C CB  . LEU A 342 ? 0.3680 0.2748 0.3386 0.0345  0.0906  0.0275  340 LEU A CB  
1936 C CG  . LEU A 342 ? 0.4030 0.2980 0.3734 0.0370  0.1038  0.0304  340 LEU A CG  
1937 C CD1 . LEU A 342 ? 0.4153 0.3023 0.3751 0.0486  0.1118  0.0378  340 LEU A CD1 
1938 C CD2 . LEU A 342 ? 0.3610 0.2553 0.3286 0.0362  0.1026  0.0295  340 LEU A CD2 
1939 N N   . GLY A 343 ? 0.3009 0.2321 0.2804 0.0191  0.0633  0.0169  341 GLY A N   
1940 C CA  . GLY A 343 ? 0.2634 0.2020 0.2408 0.0189  0.0534  0.0165  341 GLY A CA  
1941 C C   . GLY A 343 ? 0.3099 0.2517 0.2900 0.0203  0.0506  0.0171  341 GLY A C   
1942 O O   . GLY A 343 ? 0.2949 0.2413 0.2733 0.0214  0.0438  0.0172  341 GLY A O   
1943 N N   . VAL A 344 ? 0.3129 0.2520 0.2982 0.0200  0.0565  0.0172  342 VAL A N   
1944 C CA  . VAL A 344 ? 0.3266 0.2682 0.3153 0.0214  0.0551  0.0176  342 VAL A CA  
1945 C C   . VAL A 344 ? 0.3845 0.3305 0.3852 0.0152  0.0555  0.0141  342 VAL A C   
1946 O O   . VAL A 344 ? 0.3908 0.3338 0.3977 0.0121  0.0624  0.0119  342 VAL A O   
1947 C CB  . VAL A 344 ? 0.3054 0.2403 0.2896 0.0282  0.0628  0.0212  342 VAL A CB  
1948 C CG1 . VAL A 344 ? 0.2638 0.2011 0.2520 0.0293  0.0621  0.0214  342 VAL A CG1 
1949 C CG2 . VAL A 344 ? 0.3044 0.2373 0.2764 0.0356  0.0615  0.0240  342 VAL A CG2 
1950 N N   . PRO A 345 ? 0.3591 0.3125 0.3639 0.0136  0.0484  0.0129  343 PRO A N   
1951 C CA  . PRO A 345 ? 0.3387 0.2985 0.3552 0.0088  0.0477  0.0090  343 PRO A CA  
1952 C C   . PRO A 345 ? 0.2899 0.2460 0.3139 0.0092  0.0564  0.0086  343 PRO A C   
1953 O O   . PRO A 345 ? 0.2798 0.2307 0.2993 0.0145  0.0601  0.0124  343 PRO A O   
1954 C CB  . PRO A 345 ? 0.3348 0.3015 0.3520 0.0097  0.0393  0.0098  343 PRO A CB  
1955 C CG  . PRO A 345 ? 0.3422 0.3067 0.3490 0.0125  0.0350  0.0126  343 PRO A CG  
1956 C CD  . PRO A 345 ? 0.3271 0.2836 0.3268 0.0162  0.0409  0.0146  343 PRO A CD  
1957 N N   . LYS A 346 ? 0.2947 0.2538 0.3305 0.0039  0.0601  0.0036  344 LYS A N   
1958 C CA  . LYS A 346 ? 0.2950 0.2522 0.3415 0.0033  0.0685  0.0024  344 LYS A CA  
1959 C C   . LYS A 346 ? 0.3042 0.2673 0.3541 0.0056  0.0637  0.0034  344 LYS A C   
1960 O O   . LYS A 346 ? 0.2761 0.2475 0.3252 0.0054  0.0538  0.0029  344 LYS A O   
1961 C CB  . LYS A 346 ? 0.3661 0.3282 0.4278 -0.0038 0.0719  -0.0053 344 LYS A CB  
1962 C CG  . LYS A 346 ? 0.4634 0.4172 0.5241 -0.0061 0.0800  -0.0066 344 LYS A CG  
1963 C CD  . LYS A 346 ? 0.5271 0.4869 0.6049 -0.0139 0.0834  -0.0161 344 LYS A CD  
1964 C CE  . LYS A 346 ? 0.6096 0.5595 0.6877 -0.0163 0.0930  -0.0177 344 LYS A CE  
1965 N NZ  . LYS A 346 ? 0.6651 0.6220 0.7612 -0.0247 0.0958  -0.0290 344 LYS A NZ  
1966 N N   . ASP A 347 ? 0.3320 0.2901 0.3853 0.0083  0.0718  0.0054  345 ASP A N   
1967 C CA  . ASP A 347 ? 0.3204 0.2820 0.3757 0.0114  0.0690  0.0070  345 ASP A CA  
1968 C C   . ASP A 347 ? 0.3060 0.2807 0.3711 0.0082  0.0596  0.0030  345 ASP A C   
1969 O O   . ASP A 347 ? 0.3518 0.3298 0.4125 0.0112  0.0525  0.0054  345 ASP A O   
1970 C CB  . ASP A 347 ? 0.3699 0.3261 0.4326 0.0127  0.0805  0.0077  345 ASP A CB  
1971 C CG  . ASP A 347 ? 0.4393 0.3822 0.4894 0.0186  0.0897  0.0133  345 ASP A CG  
1972 O OD1 . ASP A 347 ? 0.3872 0.3271 0.4227 0.0225  0.0853  0.0166  345 ASP A OD1 
1973 O OD2 . ASP A 347 ? 0.4838 0.4197 0.5388 0.0197  0.1017  0.0145  345 ASP A OD2 
1974 N N   . GLU A 348 ? 0.3553 0.3377 0.4339 0.0025  0.0598  -0.0034 346 GLU A N   
1975 C CA  . GLU A 348 ? 0.4154 0.4119 0.5039 0.0008  0.0513  -0.0074 346 GLU A CA  
1976 C C   . GLU A 348 ? 0.3867 0.3884 0.4654 0.0018  0.0401  -0.0060 346 GLU A C   
1977 O O   . GLU A 348 ? 0.4315 0.4418 0.5123 0.0038  0.0325  -0.0056 346 GLU A O   
1978 C CB  . GLU A 348 ? 0.4668 0.4726 0.5736 -0.0052 0.0537  -0.0162 346 GLU A CB  
1979 C CG  . GLU A 348 ? 0.5741 0.5963 0.6916 -0.0053 0.0446  -0.0204 346 GLU A CG  
1980 C CD  . GLU A 348 ? 0.6255 0.6587 0.7647 -0.0106 0.0479  -0.0302 346 GLU A CD  
1981 O OE1 . GLU A 348 ? 0.6657 0.6924 0.8126 -0.0150 0.0584  -0.0339 346 GLU A OE1 
1982 O OE2 . GLU A 348 ? 0.6053 0.6537 0.7545 -0.0100 0.0402  -0.0344 346 GLU A OE2 
1983 N N   . LEU A 349 ? 0.3039 0.2999 0.3720 0.0011  0.0399  -0.0047 347 LEU A N   
1984 C CA  . LEU A 349 ? 0.2983 0.2971 0.3561 0.0024  0.0311  -0.0025 347 LEU A CA  
1985 C C   . LEU A 349 ? 0.3180 0.3098 0.3653 0.0076  0.0296  0.0042  347 LEU A C   
1986 O O   . LEU A 349 ? 0.3209 0.3164 0.3647 0.0098  0.0229  0.0065  347 LEU A O   
1987 C CB  . LEU A 349 ? 0.2926 0.2883 0.3442 -0.0006 0.0319  -0.0042 347 LEU A CB  
1988 C CG  . LEU A 349 ? 0.2779 0.2756 0.3188 0.0004  0.0243  -0.0020 347 LEU A CG  
1989 C CD1 . LEU A 349 ? 0.2398 0.2497 0.2843 0.0013  0.0159  -0.0034 347 LEU A CD1 
1990 C CD2 . LEU A 349 ? 0.2779 0.2734 0.3153 -0.0032 0.0264  -0.0052 347 LEU A CD2 
1991 N N   . GLU A 350 ? 0.3373 0.3194 0.3799 0.0100  0.0364  0.0069  348 GLU A N   
1992 C CA  . GLU A 350 ? 0.3479 0.3245 0.3812 0.0150  0.0351  0.0114  348 GLU A CA  
1993 C C   . GLU A 350 ? 0.3389 0.3200 0.3775 0.0173  0.0317  0.0123  348 GLU A C   
1994 O O   . GLU A 350 ? 0.3648 0.3450 0.3983 0.0200  0.0273  0.0148  348 GLU A O   
1995 C CB  . GLU A 350 ? 0.3714 0.3386 0.3988 0.0183  0.0430  0.0135  348 GLU A CB  
1996 C CG  . GLU A 350 ? 0.3317 0.2946 0.3492 0.0239  0.0414  0.0164  348 GLU A CG  
1997 C CD  . GLU A 350 ? 0.3711 0.3346 0.3813 0.0237  0.0352  0.0169  348 GLU A CD  
1998 O OE1 . GLU A 350 ? 0.4360 0.3995 0.4443 0.0208  0.0347  0.0162  348 GLU A OE1 
1999 O OE2 . GLU A 350 ? 0.4115 0.3751 0.4186 0.0263  0.0314  0.0176  348 GLU A OE2 
2000 N N   . ASP A 351 ? 0.3397 0.3256 0.3899 0.0161  0.0342  0.0100  349 ASP A N   
2001 C CA  . ASP A 351 ? 0.3496 0.3406 0.4066 0.0185  0.0315  0.0107  349 ASP A CA  
2002 C C   . ASP A 351 ? 0.3454 0.3433 0.4018 0.0191  0.0226  0.0117  349 ASP A C   
2003 O O   . ASP A 351 ? 0.3951 0.3945 0.4532 0.0224  0.0200  0.0140  349 ASP A O   
2004 C CB  . ASP A 351 ? 0.3621 0.3595 0.4339 0.0163  0.0352  0.0068  349 ASP A CB  
2005 C CG  . ASP A 351 ? 0.4374 0.4267 0.5107 0.0169  0.0457  0.0070  349 ASP A CG  
2006 O OD1 . ASP A 351 ? 0.4761 0.4562 0.5382 0.0209  0.0488  0.0108  349 ASP A OD1 
2007 O OD2 . ASP A 351 ? 0.4479 0.4406 0.5338 0.0138  0.0511  0.0031  349 ASP A OD2 
2008 N N   . LYS A 352 ? 0.3028 0.3045 0.3564 0.0165  0.0188  0.0103  350 LYS A N   
2009 C CA  . LYS A 352 ? 0.3048 0.3128 0.3562 0.0179  0.0112  0.0120  350 LYS A CA  
2010 C C   . LYS A 352 ? 0.3023 0.3027 0.3421 0.0197  0.0096  0.0163  350 LYS A C   
2011 O O   . LYS A 352 ? 0.3122 0.3153 0.3486 0.0214  0.0049  0.0189  350 LYS A O   
2012 C CB  . LYS A 352 ? 0.3276 0.3448 0.3817 0.0147  0.0078  0.0076  350 LYS A CB  
2013 C CG  . LYS A 352 ? 0.3799 0.4053 0.4480 0.0116  0.0102  0.0011  350 LYS A CG  
2014 C CD  . LYS A 352 ? 0.4340 0.4720 0.5120 0.0143  0.0049  -0.0002 350 LYS A CD  
2015 C CE  . LYS A 352 ? 0.4847 0.5322 0.5795 0.0109  0.0077  -0.0079 350 LYS A CE  
2016 N NZ  . LYS A 352 ? 0.5613 0.5989 0.6608 0.0094  0.0174  -0.0074 350 LYS A NZ  
2017 N N   . ARG A 353 ? 0.2809 0.2722 0.3148 0.0198  0.0139  0.0171  351 ARG A N   
2018 C CA  . ARG A 353 ? 0.2602 0.2457 0.2852 0.0207  0.0125  0.0196  351 ARG A CA  
2019 C C   . ARG A 353 ? 0.3184 0.3023 0.3438 0.0240  0.0104  0.0227  351 ARG A C   
2020 O O   . ARG A 353 ? 0.3010 0.2837 0.3307 0.0264  0.0120  0.0228  351 ARG A O   
2021 C CB  . ARG A 353 ? 0.2811 0.2591 0.3002 0.0209  0.0169  0.0188  351 ARG A CB  
2022 C CG  . ARG A 353 ? 0.3228 0.2965 0.3351 0.0218  0.0153  0.0200  351 ARG A CG  
2023 C CD  . ARG A 353 ? 0.3077 0.2762 0.3145 0.0237  0.0185  0.0187  351 ARG A CD  
2024 N NE  . ARG A 353 ? 0.3306 0.2976 0.3340 0.0224  0.0217  0.0178  351 ARG A NE  
2025 C CZ  . ARG A 353 ? 0.2847 0.2511 0.2838 0.0204  0.0210  0.0176  351 ARG A CZ  
2026 N NH1 . ARG A 353 ? 0.2108 0.1779 0.2084 0.0193  0.0174  0.0182  351 ARG A NH1 
2027 N NH2 . ARG A 353 ? 0.2719 0.2360 0.2685 0.0197  0.0250  0.0169  351 ARG A NH2 
2028 N N   . VAL A 354 ? 0.3374 0.3205 0.3587 0.0243  0.0077  0.0252  352 VAL A N   
2029 C CA  . VAL A 354 ? 0.2835 0.2622 0.3050 0.0270  0.0076  0.0281  352 VAL A CA  
2030 C C   . VAL A 354 ? 0.3340 0.3062 0.3508 0.0258  0.0095  0.0267  352 VAL A C   
2031 O O   . VAL A 354 ? 0.2925 0.2637 0.3044 0.0239  0.0090  0.0272  352 VAL A O   
2032 C CB  . VAL A 354 ? 0.2620 0.2430 0.2821 0.0288  0.0048  0.0325  352 VAL A CB  
2033 C CG1 . VAL A 354 ? 0.2282 0.2020 0.2488 0.0310  0.0068  0.0356  352 VAL A CG1 
2034 C CG2 . VAL A 354 ? 0.2586 0.2483 0.2841 0.0313  0.0018  0.0334  352 VAL A CG2 
2035 N N   . GLU A 355 ? 0.3490 0.3176 0.3673 0.0272  0.0117  0.0245  353 GLU A N   
2036 C CA  . GLU A 355 ? 0.3522 0.3169 0.3670 0.0267  0.0128  0.0217  353 GLU A CA  
2037 C C   . GLU A 355 ? 0.3464 0.3082 0.3621 0.0257  0.0126  0.0231  353 GLU A C   
2038 O O   . GLU A 355 ? 0.3449 0.3048 0.3647 0.0271  0.0131  0.0259  353 GLU A O   
2039 C CB  . GLU A 355 ? 0.3807 0.3435 0.3974 0.0292  0.0145  0.0182  353 GLU A CB  
2040 C CG  . GLU A 355 ? 0.4817 0.4457 0.4962 0.0310  0.0164  0.0168  353 GLU A CG  
2041 C CD  . GLU A 355 ? 0.6590 0.6215 0.6736 0.0345  0.0179  0.0132  353 GLU A CD  
2042 O OE1 . GLU A 355 ? 0.7560 0.7187 0.7731 0.0366  0.0197  0.0134  353 GLU A OE1 
2043 O OE2 . GLU A 355 ? 0.6967 0.6585 0.7092 0.0352  0.0171  0.0095  353 GLU A OE2 
2044 N N   . VAL A 356 ? 0.3172 0.2779 0.3292 0.0238  0.0128  0.0214  354 VAL A N   
2045 C CA  . VAL A 356 ? 0.3508 0.3081 0.3647 0.0226  0.0140  0.0218  354 VAL A CA  
2046 C C   . VAL A 356 ? 0.3804 0.3374 0.3951 0.0219  0.0147  0.0160  354 VAL A C   
2047 O O   . VAL A 356 ? 0.3672 0.3269 0.3777 0.0226  0.0138  0.0132  354 VAL A O   
2048 C CB  . VAL A 356 ? 0.3269 0.2846 0.3362 0.0209  0.0136  0.0259  354 VAL A CB  
2049 C CG1 . VAL A 356 ? 0.3087 0.2683 0.3174 0.0228  0.0123  0.0310  354 VAL A CG1 
2050 C CG2 . VAL A 356 ? 0.3114 0.2719 0.3148 0.0192  0.0125  0.0239  354 VAL A CG2 
2051 N N   . ARG A 357 ? 0.3411 0.2951 0.3621 0.0210  0.0167  0.0142  355 ARG A N   
2052 C CA  . ARG A 357 ? 0.3194 0.2749 0.3439 0.0203  0.0170  0.0072  355 ARG A CA  
2053 C C   . ARG A 357 ? 0.3061 0.2603 0.3319 0.0173  0.0187  0.0076  355 ARG A C   
2054 O O   . ARG A 357 ? 0.3675 0.3249 0.3951 0.0165  0.0182  0.0021  355 ARG A O   
2055 C CB  . ARG A 357 ? 0.3753 0.3292 0.4090 0.0210  0.0186  0.0023  355 ARG A CB  
2056 C CG  . ARG A 357 ? 0.4364 0.3925 0.4778 0.0195  0.0193  -0.0064 355 ARG A CG  
2057 C CD  . ARG A 357 ? 0.5127 0.4655 0.5660 0.0188  0.0225  -0.0109 355 ARG A CD  
2058 N NE  . ARG A 357 ? 0.6012 0.5517 0.6651 0.0151  0.0264  -0.0145 355 ARG A NE  
2059 C CZ  . ARG A 357 ? 0.6737 0.6163 0.7414 0.0130  0.0317  -0.0082 355 ARG A CZ  
2060 N NH1 . ARG A 357 ? 0.6847 0.6222 0.7459 0.0149  0.0326  0.0018  355 ARG A NH1 
2061 N NH2 . ARG A 357 ? 0.6899 0.6300 0.7682 0.0095  0.0365  -0.0119 355 ARG A NH2 
2062 N N   . SER A 358 ? 0.2907 0.2407 0.3153 0.0162  0.0209  0.0142  356 SER A N   
2063 C CA  . SER A 358 ? 0.3142 0.2612 0.3405 0.0136  0.0241  0.0153  356 SER A CA  
2064 C C   . SER A 358 ? 0.3471 0.2923 0.3652 0.0139  0.0245  0.0233  356 SER A C   
2065 O O   . SER A 358 ? 0.3448 0.2905 0.3586 0.0161  0.0227  0.0279  356 SER A O   
2066 C CB  . SER A 358 ? 0.2738 0.2153 0.3115 0.0125  0.0294  0.0140  356 SER A CB  
2067 O OG  . SER A 358 ? 0.3834 0.3195 0.4205 0.0147  0.0315  0.0210  356 SER A OG  
2068 N N   . GLU A 359 ? 0.3638 0.3076 0.3798 0.0119  0.0269  0.0244  357 GLU A N   
2069 C CA  . GLU A 359 ? 0.3458 0.2879 0.3532 0.0127  0.0276  0.0315  357 GLU A CA  
2070 C C   . GLU A 359 ? 0.3685 0.3059 0.3763 0.0158  0.0301  0.0381  357 GLU A C   
2071 O O   . GLU A 359 ? 0.4048 0.3443 0.4050 0.0186  0.0277  0.0433  357 GLU A O   
2072 C CB  . GLU A 359 ? 0.3248 0.2646 0.3316 0.0104  0.0316  0.0317  357 GLU A CB  
2073 C CG  . GLU A 359 ? 0.3621 0.3069 0.3671 0.0082  0.0291  0.0262  357 GLU A CG  
2074 C CD  . GLU A 359 ? 0.3744 0.3171 0.3782 0.0061  0.0332  0.0270  357 GLU A CD  
2075 O OE1 . GLU A 359 ? 0.3711 0.3092 0.3828 0.0048  0.0387  0.0268  357 GLU A OE1 
2076 O OE2 . GLU A 359 ? 0.3533 0.2985 0.3490 0.0057  0.0316  0.0276  357 GLU A OE2 
2077 N N   . GLN A 360 ? 0.3412 0.2726 0.3587 0.0155  0.0352  0.0374  358 GLN A N   
2078 C CA  . GLN A 360 ? 0.3293 0.2542 0.3483 0.0190  0.0393  0.0443  358 GLN A CA  
2079 C C   . GLN A 360 ? 0.3094 0.2384 0.3251 0.0228  0.0343  0.0467  358 GLN A C   
2080 O O   . GLN A 360 ? 0.3465 0.2745 0.3566 0.0273  0.0346  0.0542  358 GLN A O   
2081 C CB  . GLN A 360 ? 0.3443 0.2622 0.3772 0.0173  0.0459  0.0408  358 GLN A CB  
2082 C CG  . GLN A 360 ? 0.4454 0.3554 0.4817 0.0213  0.0511  0.0474  358 GLN A CG  
2083 C CD  . GLN A 360 ? 0.5100 0.4109 0.5437 0.0233  0.0594  0.0559  358 GLN A CD  
2084 O OE1 . GLN A 360 ? 0.5316 0.4269 0.5731 0.0198  0.0664  0.0535  358 GLN A OE1 
2085 N NE2 . GLN A 360 ? 0.5450 0.4448 0.5677 0.0295  0.0589  0.0658  358 GLN A NE2 
2086 N N   . ASP A 361 ? 0.2829 0.2172 0.3018 0.0216  0.0299  0.0404  359 ASP A N   
2087 C CA  . ASP A 361 ? 0.3174 0.2561 0.3344 0.0246  0.0256  0.0419  359 ASP A CA  
2088 C C   . ASP A 361 ? 0.3797 0.3238 0.3869 0.0268  0.0218  0.0468  359 ASP A C   
2089 O O   . ASP A 361 ? 0.4074 0.3538 0.4133 0.0310  0.0201  0.0513  359 ASP A O   
2090 C CB  . ASP A 361 ? 0.2559 0.1996 0.2753 0.0230  0.0220  0.0347  359 ASP A CB  
2091 C CG  . ASP A 361 ? 0.2974 0.2379 0.3263 0.0223  0.0245  0.0291  359 ASP A CG  
2092 O OD1 . ASP A 361 ? 0.2955 0.2300 0.3310 0.0235  0.0288  0.0312  359 ASP A OD1 
2093 O OD2 . ASP A 361 ? 0.3382 0.2824 0.3680 0.0211  0.0225  0.0223  359 ASP A OD2 
2094 N N   . VAL A 362 ? 0.3664 0.3135 0.3672 0.0243  0.0202  0.0454  360 VAL A N   
2095 C CA  . VAL A 362 ? 0.3258 0.2796 0.3180 0.0256  0.0161  0.0476  360 VAL A CA  
2096 C C   . VAL A 362 ? 0.3100 0.2622 0.2959 0.0302  0.0176  0.0552  360 VAL A C   
2097 O O   . VAL A 362 ? 0.2919 0.2503 0.2741 0.0342  0.0137  0.0580  360 VAL A O   
2098 C CB  . VAL A 362 ? 0.3090 0.2656 0.2962 0.0217  0.0148  0.0436  360 VAL A CB  
2099 C CG1 . VAL A 362 ? 0.2693 0.2328 0.2484 0.0230  0.0111  0.0450  360 VAL A CG1 
2100 C CG2 . VAL A 362 ? 0.2670 0.2259 0.2584 0.0190  0.0133  0.0371  360 VAL A CG2 
2101 N N   . PHE A 363 ? 0.2990 0.2434 0.2840 0.0301  0.0234  0.0585  361 PHE A N   
2102 C CA  . PHE A 363 ? 0.3442 0.2847 0.3226 0.0356  0.0268  0.0671  361 PHE A CA  
2103 C C   . PHE A 363 ? 0.3638 0.3034 0.3455 0.0413  0.0268  0.0719  361 PHE A C   
2104 O O   . PHE A 363 ? 0.3846 0.3284 0.3589 0.0476  0.0245  0.0777  361 PHE A O   
2105 C CB  . PHE A 363 ? 0.3562 0.2857 0.3372 0.0341  0.0356  0.0696  361 PHE A CB  
2106 C CG  . PHE A 363 ? 0.3651 0.2948 0.3415 0.0301  0.0368  0.0670  361 PHE A CG  
2107 C CD1 . PHE A 363 ? 0.3681 0.2981 0.3521 0.0239  0.0369  0.0591  361 PHE A CD1 
2108 C CD2 . PHE A 363 ? 0.4133 0.3430 0.3775 0.0333  0.0382  0.0726  361 PHE A CD2 
2109 C CE1 . PHE A 363 ? 0.3786 0.3088 0.3592 0.0206  0.0384  0.0569  361 PHE A CE1 
2110 C CE2 . PHE A 363 ? 0.3852 0.3145 0.3455 0.0296  0.0400  0.0702  361 PHE A CE2 
2111 C CZ  . PHE A 363 ? 0.3751 0.3046 0.3442 0.0231  0.0402  0.0624  361 PHE A CZ  
2112 N N   . ASP A 364 ? 0.3363 0.2711 0.3294 0.0395  0.0294  0.0691  362 ASP A N   
2113 C CA  . ASP A 364 ? 0.3555 0.2879 0.3532 0.0448  0.0307  0.0735  362 ASP A CA  
2114 C C   . ASP A 364 ? 0.3494 0.2933 0.3443 0.0483  0.0228  0.0734  362 ASP A C   
2115 O O   . ASP A 364 ? 0.3632 0.3093 0.3543 0.0555  0.0220  0.0801  362 ASP A O   
2116 C CB  . ASP A 364 ? 0.3360 0.2623 0.3469 0.0414  0.0344  0.0684  362 ASP A CB  
2117 C CG  . ASP A 364 ? 0.3396 0.2549 0.3568 0.0383  0.0430  0.0677  362 ASP A CG  
2118 O OD1 . ASP A 364 ? 0.3330 0.2430 0.3447 0.0399  0.0480  0.0737  362 ASP A OD1 
2119 O OD2 . ASP A 364 ? 0.3258 0.2383 0.3540 0.0343  0.0452  0.0608  362 ASP A OD2 
2120 N N   . VAL A 365 ? 0.3185 0.2701 0.3157 0.0438  0.0175  0.0658  363 VAL A N   
2121 C CA  . VAL A 365 ? 0.3186 0.2811 0.3161 0.0461  0.0110  0.0644  363 VAL A CA  
2122 C C   . VAL A 365 ? 0.3519 0.3232 0.3395 0.0501  0.0065  0.0675  363 VAL A C   
2123 O O   . VAL A 365 ? 0.3852 0.3658 0.3733 0.0547  0.0018  0.0684  363 VAL A O   
2124 C CB  . VAL A 365 ? 0.3299 0.2973 0.3320 0.0402  0.0080  0.0558  363 VAL A CB  
2125 C CG1 . VAL A 365 ? 0.2899 0.2691 0.2933 0.0418  0.0021  0.0536  363 VAL A CG1 
2126 C CG2 . VAL A 365 ? 0.3261 0.2870 0.3370 0.0383  0.0114  0.0527  363 VAL A CG2 
2127 N N   . LEU A 366 ? 0.3345 0.3036 0.3135 0.0488  0.0079  0.0687  364 LEU A N   
2128 C CA  . LEU A 366 ? 0.3021 0.2799 0.2702 0.0528  0.0037  0.0708  364 LEU A CA  
2129 C C   . LEU A 366 ? 0.3445 0.3178 0.3040 0.0614  0.0072  0.0810  364 LEU A C   
2130 O O   . LEU A 366 ? 0.4314 0.4118 0.3798 0.0664  0.0040  0.0836  364 LEU A O   
2131 C CB  . LEU A 366 ? 0.3182 0.2973 0.2807 0.0470  0.0032  0.0658  364 LEU A CB  
2132 C CG  . LEU A 366 ? 0.3321 0.3163 0.3012 0.0398  0.0001  0.0565  364 LEU A CG  
2133 C CD1 . LEU A 366 ? 0.3068 0.2904 0.2704 0.0347  0.0008  0.0525  364 LEU A CD1 
2134 C CD2 . LEU A 366 ? 0.3372 0.3343 0.3098 0.0413  -0.0064 0.0526  364 LEU A CD2 
2135 N N   . GLY A 367 ? 0.3849 0.3460 0.3492 0.0634  0.0144  0.0866  365 GLY A N   
2136 C CA  . GLY A 367 ? 0.4294 0.3841 0.3864 0.0723  0.0195  0.0975  365 GLY A CA  
2137 C C   . GLY A 367 ? 0.5035 0.4510 0.4501 0.0725  0.0252  0.1017  365 GLY A C   
2138 O O   . GLY A 367 ? 0.4957 0.4414 0.4309 0.0811  0.0279  0.1107  365 GLY A O   
2139 N N   . MET A 368 ? 0.5057 0.4493 0.4559 0.0636  0.0273  0.0954  366 MET A N   
2140 C CA  . MET A 368 ? 0.4809 0.4181 0.4230 0.0626  0.0330  0.0982  366 MET A CA  
2141 C C   . MET A 368 ? 0.4419 0.3640 0.3937 0.0585  0.0435  0.0994  366 MET A C   
2142 O O   . MET A 368 ? 0.4697 0.3895 0.4349 0.0525  0.0440  0.0930  366 MET A O   
2143 C CB  . MET A 368 ? 0.4820 0.4270 0.4211 0.0557  0.0277  0.0896  366 MET A CB  
2144 C CG  . MET A 368 ? 0.5350 0.4952 0.4656 0.0585  0.0181  0.0866  366 MET A CG  
2145 S SD  . MET A 368 ? 0.5496 0.5168 0.4804 0.0493  0.0134  0.0755  366 MET A SD  
2146 C CE  . MET A 368 ? 0.4186 0.3768 0.3396 0.0487  0.0211  0.0795  366 MET A CE  
2147 N N   . PRO A 369 ? 0.4156 0.3278 0.3610 0.0620  0.0525  0.1071  367 PRO A N   
2148 C CA  . PRO A 369 ? 0.4330 0.3312 0.3899 0.0574  0.0636  0.1072  367 PRO A CA  
2149 C C   . PRO A 369 ? 0.4619 0.3621 0.4252 0.0475  0.0627  0.0973  367 PRO A C   
2150 O O   . PRO A 369 ? 0.4939 0.4006 0.4477 0.0462  0.0586  0.0953  367 PRO A O   
2151 C CB  . PRO A 369 ? 0.4719 0.3598 0.4181 0.0646  0.0737  0.1189  367 PRO A CB  
2152 C CG  . PRO A 369 ? 0.4815 0.3805 0.4086 0.0707  0.0662  0.1219  367 PRO A CG  
2153 C CD  . PRO A 369 ? 0.4333 0.3470 0.3611 0.0711  0.0533  0.1162  367 PRO A CD  
2154 N N   . TYR A 370 ? 0.4170 0.3123 0.3965 0.0412  0.0662  0.0908  368 TYR A N   
2155 C CA  . TYR A 370 ? 0.4261 0.3240 0.4128 0.0329  0.0653  0.0813  368 TYR A CA  
2156 C C   . TYR A 370 ? 0.4537 0.3473 0.4346 0.0317  0.0715  0.0838  368 TYR A C   
2157 O O   . TYR A 370 ? 0.4639 0.3470 0.4435 0.0350  0.0817  0.0916  368 TYR A O   
2158 C CB  . TYR A 370 ? 0.3937 0.2867 0.3991 0.0276  0.0696  0.0742  368 TYR A CB  
2159 C CG  . TYR A 370 ? 0.3973 0.2951 0.4104 0.0202  0.0676  0.0638  368 TYR A CG  
2160 C CD1 . TYR A 370 ? 0.3933 0.3019 0.4042 0.0179  0.0577  0.0567  368 TYR A CD1 
2161 C CD2 . TYR A 370 ? 0.4072 0.2989 0.4300 0.0161  0.0761  0.0611  368 TYR A CD2 
2162 C CE1 . TYR A 370 ? 0.3955 0.3087 0.4121 0.0126  0.0559  0.0480  368 TYR A CE1 
2163 C CE2 . TYR A 370 ? 0.3933 0.2910 0.4233 0.0102  0.0737  0.0514  368 TYR A CE2 
2164 C CZ  . TYR A 370 ? 0.4120 0.3205 0.4381 0.0090  0.0633  0.0452  368 TYR A CZ  
2165 O OH  . TYR A 370 ? 0.4457 0.3603 0.4781 0.0046  0.0610  0.0363  368 TYR A OH  
2166 N N   . ALA A 371 ? 0.4281 0.3293 0.4059 0.0273  0.0663  0.0775  369 ALA A N   
2167 C CA  . ALA A 371 ? 0.4160 0.3135 0.3912 0.0249  0.0723  0.0779  369 ALA A CA  
2168 C C   . ALA A 371 ? 0.4253 0.3267 0.4131 0.0172  0.0709  0.0671  369 ALA A C   
2169 O O   . ALA A 371 ? 0.4403 0.3509 0.4278 0.0149  0.0620  0.0605  369 ALA A O   
2170 C CB  . ALA A 371 ? 0.3513 0.2546 0.3082 0.0284  0.0680  0.0814  369 ALA A CB  
2171 N N   . LYS A 372 ? 0.4212 0.3158 0.4206 0.0136  0.0800  0.0652  370 LYS A N   
2172 C CA  . LYS A 372 ? 0.4373 0.3369 0.4486 0.0072  0.0787  0.0547  370 LYS A CA  
2173 C C   . LYS A 372 ? 0.4108 0.3173 0.4109 0.0064  0.0737  0.0532  370 LYS A C   
2174 O O   . LYS A 372 ? 0.4268 0.3318 0.4122 0.0098  0.0745  0.0600  370 LYS A O   
2175 C CB  . LYS A 372 ? 0.5013 0.3931 0.5273 0.0037  0.0903  0.0531  370 LYS A CB  
2176 C CG  . LYS A 372 ? 0.5939 0.4776 0.6341 0.0035  0.0974  0.0533  370 LYS A CG  
2177 C CD  . LYS A 372 ? 0.6796 0.5564 0.7372 -0.0012 0.1095  0.0496  370 LYS A CD  
2178 C CE  . LYS A 372 ? 0.7589 0.6263 0.8323 -0.0018 0.1182  0.0493  370 LYS A CE  
2179 N NZ  . LYS A 372 ? 0.7861 0.6474 0.8800 -0.0073 0.1307  0.0440  370 LYS A NZ  
2180 N N   . PRO A 373 ? 0.4247 0.3388 0.4316 0.0024  0.0687  0.0441  371 PRO A N   
2181 C CA  . PRO A 373 ? 0.4094 0.3293 0.4072 0.0015  0.0648  0.0421  371 PRO A CA  
2182 C C   . PRO A 373 ? 0.4297 0.3443 0.4204 0.0019  0.0722  0.0473  371 PRO A C   
2183 O O   . PRO A 373 ? 0.4130 0.3298 0.3891 0.0039  0.0694  0.0502  371 PRO A O   
2184 C CB  . PRO A 373 ? 0.3818 0.3079 0.3927 -0.0024 0.0626  0.0321  371 PRO A CB  
2185 C CG  . PRO A 373 ? 0.4097 0.3371 0.4307 -0.0024 0.0598  0.0282  371 PRO A CG  
2186 C CD  . PRO A 373 ? 0.3931 0.3111 0.4160 -0.0008 0.0666  0.0349  371 PRO A CD  
2187 N N   . GLU A 374 ? 0.4687 0.3763 0.4700 0.0002  0.0821  0.0480  372 GLU A N   
2188 C CA  . GLU A 374 ? 0.5141 0.4157 0.5107 0.0003  0.0910  0.0527  372 GLU A CA  
2189 C C   . GLU A 374 ? 0.5160 0.4109 0.4952 0.0065  0.0946  0.0640  372 GLU A C   
2190 O O   . GLU A 374 ? 0.5474 0.4380 0.5175 0.0081  0.1010  0.0689  372 GLU A O   
2191 C CB  . GLU A 374 ? 0.5673 0.4627 0.5827 -0.0034 0.1019  0.0500  372 GLU A CB  
2192 C CG  . GLU A 374 ? 0.6318 0.5172 0.6532 -0.0015 0.1094  0.0555  372 GLU A CG  
2193 C CD  . GLU A 374 ? 0.7098 0.5904 0.7546 -0.0065 0.1195  0.0498  372 GLU A CD  
2194 O OE1 . GLU A 374 ? 0.7198 0.6085 0.7806 -0.0109 0.1147  0.0386  372 GLU A OE1 
2195 O OE2 . GLU A 374 ? 0.7399 0.6089 0.7872 -0.0057 0.1327  0.0564  372 GLU A OE2 
2196 N N   . ASN A 375 ? 0.4664 0.3610 0.4406 0.0105  0.0905  0.0681  373 ASN A N   
2197 C CA  . ASN A 375 ? 0.4826 0.3734 0.4391 0.0178  0.0919  0.0786  373 ASN A CA  
2198 C C   . ASN A 375 ? 0.4926 0.3939 0.4350 0.0207  0.0798  0.0776  373 ASN A C   
2199 O O   . ASN A 375 ? 0.4923 0.3941 0.4230 0.0272  0.0775  0.0843  373 ASN A O   
2200 C CB  . ASN A 375 ? 0.5013 0.3832 0.4626 0.0218  0.0980  0.0855  373 ASN A CB  
2201 C CG  . ASN A 375 ? 0.5570 0.4271 0.5330 0.0190  0.1122  0.0867  373 ASN A CG  
2202 O OD1 . ASN A 375 ? 0.5990 0.4657 0.5751 0.0169  0.1193  0.0868  373 ASN A OD1 
2203 N ND2 . ASN A 375 ? 0.5786 0.4424 0.5680 0.0187  0.1168  0.0871  373 ASN A ND2 
2204 N N   . ARG A 376 ? 0.4684 0.3783 0.4129 0.0161  0.0724  0.0691  374 ARG A N   
2205 C CA  . ARG A 376 ? 0.4697 0.3894 0.4036 0.0177  0.0621  0.0668  374 ARG A CA  
2206 C C   . ARG A 376 ? 0.4878 0.4109 0.4101 0.0172  0.0615  0.0651  374 ARG A C   
2207 O O   . ARG A 376 ? 0.4528 0.3830 0.3751 0.0140  0.0553  0.0583  374 ARG A O   
2208 C CB  . ARG A 376 ? 0.4079 0.3341 0.3522 0.0137  0.0545  0.0588  374 ARG A CB  
2209 C CG  . ARG A 376 ? 0.3888 0.3132 0.3423 0.0148  0.0536  0.0597  374 ARG A CG  
2210 C CD  . ARG A 376 ? 0.3606 0.2903 0.3244 0.0109  0.0477  0.0516  374 ARG A CD  
2211 N NE  . ARG A 376 ? 0.3619 0.2883 0.3379 0.0107  0.0494  0.0509  374 ARG A NE  
2212 C CZ  . ARG A 376 ? 0.3418 0.2720 0.3273 0.0083  0.0455  0.0442  374 ARG A CZ  
2213 N NH1 . ARG A 376 ? 0.2790 0.2157 0.2630 0.0064  0.0403  0.0387  374 ARG A NH1 
2214 N NH2 . ARG A 376 ? 0.3248 0.2520 0.3211 0.0083  0.0474  0.0429  374 ARG A NH2 
2215 N N   . ASP A 377 ? 0.4717 0.3891 0.3841 0.0208  0.0688  0.0716  375 ASP A N   
2216 C CA  . ASP A 377 ? 0.4961 0.4164 0.3951 0.0215  0.0689  0.0708  375 ASP A CA  
2217 C C   . ASP A 377 ? 0.5493 0.4702 0.4293 0.0298  0.0691  0.0785  375 ASP A C   
2218 O O   . ASP A 377 ? 0.5903 0.5058 0.4600 0.0331  0.0767  0.0837  375 ASP A O   
2219 C CB  . ASP A 377 ? 0.4512 0.3649 0.3556 0.0179  0.0784  0.0702  375 ASP A CB  
2220 C CG  . ASP A 377 ? 0.4661 0.3841 0.3839 0.0109  0.0754  0.0607  375 ASP A CG  
2221 O OD1 . ASP A 377 ? 0.5384 0.4629 0.4507 0.0093  0.0700  0.0554  375 ASP A OD1 
2222 O OD2 . ASP A 377 ? 0.4370 0.3520 0.3708 0.0073  0.0789  0.0582  375 ASP A OD2 
2223 N N   . PRO A 378 ? 0.6342 0.5624 0.5090 0.0339  0.0608  0.0790  376 PRO A N   
2224 C CA  . PRO A 378 ? 0.7068 0.6374 0.5634 0.0433  0.0599  0.0861  376 PRO A CA  
2225 C C   . PRO A 378 ? 0.8094 0.7466 0.6501 0.0451  0.0577  0.0831  376 PRO A C   
2226 O O   . PRO A 378 ? 0.8471 0.7871 0.6916 0.0386  0.0564  0.0751  376 PRO A O   
2227 C CB  . PRO A 378 ? 0.6446 0.5847 0.5034 0.0456  0.0497  0.0840  376 PRO A CB  
2228 C CG  . PRO A 378 ? 0.5845 0.5299 0.4570 0.0367  0.0437  0.0734  376 PRO A CG  
2229 C CD  . PRO A 378 ? 0.5900 0.5258 0.4748 0.0304  0.0516  0.0723  376 PRO A CD  
2230 O OXT . PRO A 378 ? 0.8665 0.8067 0.6897 0.0537  0.0573  0.0885  376 PRO A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   HIS 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   LEU 4   2   ?   ?   ?   A . n 
A 1 5   ARG 5   3   ?   ?   ?   A . n 
A 1 6   ARG 6   4   ?   ?   ?   A . n 
A 1 7   LYS 7   5   ?   ?   ?   A . n 
A 1 8   PHE 8   6   ?   ?   ?   A . n 
A 1 9   LEU 9   7   ?   ?   ?   A . n 
A 1 10  ARG 10  8   ?   ?   ?   A . n 
A 1 11  ARG 11  9   ?   ?   ?   A . n 
A 1 12  ASP 12  10  ?   ?   ?   A . n 
A 1 13  HIS 13  11  ?   ?   ?   A . n 
A 1 14  ARG 14  12  ?   ?   ?   A . n 
A 1 15  GLU 15  13  ?   ?   ?   A . n 
A 1 16  ASN 16  14  ?   ?   ?   A . n 
A 1 17  ILE 17  15  ?   ?   ?   A . n 
A 1 18  ILE 18  16  ?   ?   ?   A . n 
A 1 19  ARG 19  17  ?   ?   ?   A . n 
A 1 20  ILE 20  18  ?   ?   ?   A . n 
A 1 21  PHE 21  19  ?   ?   ?   A . n 
A 1 22  GLN 22  20  ?   ?   ?   A . n 
A 1 23  GLU 23  21  ?   ?   ?   A . n 
A 1 24  MET 24  22  ?   ?   ?   A . n 
A 1 25  ALA 25  23  ?   ?   ?   A . n 
A 1 26  ASP 26  24  ?   ?   ?   A . n 
A 1 27  LEU 27  25  ?   ?   ?   A . n 
A 1 28  ASN 28  26  ?   ?   ?   A . n 
A 1 29  ASN 29  27  ?   ?   ?   A . n 
A 1 30  ALA 30  28  ?   ?   ?   A . n 
A 1 31  LEU 31  29  ?   ?   ?   A . n 
A 1 32  GLY 32  30  ?   ?   ?   A . n 
A 1 33  GLU 33  31  ?   ?   ?   A . n 
A 1 34  LYS 34  32  32  LYS LYS A . n 
A 1 35  TYR 35  33  33  TYR TYR A . n 
A 1 36  LYS 36  34  34  LYS LYS A . n 
A 1 37  VAL 37  35  35  VAL VAL A . n 
A 1 38  SER 38  36  ?   ?   ?   A . n 
A 1 39  SER 39  37  ?   ?   ?   A . n 
A 1 40  TYR 40  38  ?   ?   ?   A . n 
A 1 41  HIS 41  39  ?   ?   ?   A . n 
A 1 42  ARG 42  40  ?   ?   ?   A . n 
A 1 43  SER 43  41  ?   ?   ?   A . n 
A 1 44  ILE 44  42  ?   ?   ?   A . n 
A 1 45  GLU 45  43  ?   ?   ?   A . n 
A 1 46  SER 46  44  ?   ?   ?   A . n 
A 1 47  LEU 47  45  ?   ?   ?   A . n 
A 1 48  LYS 48  46  ?   ?   ?   A . n 
A 1 49  THR 49  47  ?   ?   ?   A . n 
A 1 50  ASN 50  48  ?   ?   ?   A . n 
A 1 51  LEU 51  49  ?   ?   ?   A . n 
A 1 52  ASP 52  50  ?   ?   ?   A . n 
A 1 53  LYS 53  51  ?   ?   ?   A . n 
A 1 54  PRO 54  52  ?   ?   ?   A . n 
A 1 55  LEU 55  53  ?   ?   ?   A . n 
A 1 56  ASN 56  54  ?   ?   ?   A . n 
A 1 57  THR 57  55  ?   ?   ?   A . n 
A 1 58  PRO 58  56  ?   ?   ?   A . n 
A 1 59  GLN 59  57  ?   ?   ?   A . n 
A 1 60  ASP 60  58  ?   ?   ?   A . n 
A 1 61  LEU 61  59  ?   ?   ?   A . n 
A 1 62  LYS 62  60  ?   ?   ?   A . n 
A 1 63  ALA 63  61  ?   ?   ?   A . n 
A 1 64  PHE 64  62  ?   ?   ?   A . n 
A 1 65  SER 65  63  ?   ?   ?   A . n 
A 1 66  GLY 66  64  ?   ?   ?   A . n 
A 1 67  PHE 67  65  ?   ?   ?   A . n 
A 1 68  GLY 68  66  ?   ?   ?   A . n 
A 1 69  ALA 69  67  ?   ?   ?   A . n 
A 1 70  LYS 70  68  ?   ?   ?   A . n 
A 1 71  LEU 71  69  ?   ?   ?   A . n 
A 1 72  LEU 72  70  ?   ?   ?   A . n 
A 1 73  LYS 73  71  ?   ?   ?   A . n 
A 1 74  LYS 74  72  ?   ?   ?   A . n 
A 1 75  ALA 75  73  ?   ?   ?   A . n 
A 1 76  GLU 76  74  ?   ?   ?   A . n 
A 1 77  GLU 77  75  ?   ?   ?   A . n 
A 1 78  ILE 78  76  ?   ?   ?   A . n 
A 1 79  MET 79  77  ?   ?   ?   A . n 
A 1 80  ALA 80  78  ?   ?   ?   A . n 
A 1 81  THR 81  79  ?   ?   ?   A . n 
A 1 82  GLY 82  80  ?   ?   ?   A . n 
A 1 83  LYS 83  81  ?   ?   ?   A . n 
A 1 84  LEU 84  82  ?   ?   ?   A . n 
A 1 85  GLU 85  83  ?   ?   ?   A . n 
A 1 86  GLU 86  84  ?   ?   ?   A . n 
A 1 87  LEU 87  85  ?   ?   ?   A . n 
A 1 88  GLU 88  86  ?   ?   ?   A . n 
A 1 89  SER 89  87  ?   ?   ?   A . n 
A 1 90  LYS 90  88  ?   ?   ?   A . n 
A 1 91  THR 91  89  ?   ?   ?   A . n 
A 1 92  LYS 92  90  ?   ?   ?   A . n 
A 1 93  PRO 93  91  91  PRO PRO A . n 
A 1 94  LYS 94  92  92  LYS LYS A . n 
A 1 95  LEU 95  93  93  LEU LEU A . n 
A 1 96  LYS 96  94  94  LYS LYS A . n 
A 1 97  ALA 97  95  95  ALA ALA A . n 
A 1 98  ILE 98  96  96  ILE ILE A . n 
A 1 99  GLN 99  97  97  GLN GLN A . n 
A 1 100 GLU 100 98  98  GLU GLU A . n 
A 1 101 LEU 101 99  99  LEU LEU A . n 
A 1 102 THR 102 100 100 THR THR A . n 
A 1 103 GLN 103 101 101 GLN GLN A . n 
A 1 104 VAL 104 102 102 VAL VAL A . n 
A 1 105 HIS 105 103 103 HIS HIS A . n 
A 1 106 GLY 106 104 104 GLY GLY A . n 
A 1 107 PHE 107 105 105 PHE PHE A . n 
A 1 108 GLY 108 106 106 GLY GLY A . n 
A 1 109 PRO 109 107 107 PRO PRO A . n 
A 1 110 ARG 110 108 108 ARG ARG A . n 
A 1 111 ALA 111 109 109 ALA ALA A . n 
A 1 112 ALA 112 110 110 ALA ALA A . n 
A 1 113 ALA 113 111 111 ALA ALA A . n 
A 1 114 ALA 114 112 112 ALA ALA A . n 
A 1 115 LEU 115 113 113 LEU LEU A . n 
A 1 116 PHE 116 114 114 PHE PHE A . n 
A 1 117 ASP 117 115 115 ASP ASP A . n 
A 1 118 ARG 118 116 116 ARG ARG A . n 
A 1 119 GLU 119 117 117 GLU GLU A . n 
A 1 120 GLY 120 118 118 GLY GLY A . n 
A 1 121 ILE 121 119 119 ILE ILE A . n 
A 1 122 PHE 122 120 120 PHE PHE A . n 
A 1 123 THR 123 121 121 THR THR A . n 
A 1 124 VAL 124 122 122 VAL VAL A . n 
A 1 125 ASP 125 123 123 ASP ASP A . n 
A 1 126 GLU 126 124 124 GLU GLU A . n 
A 1 127 LEU 127 125 125 LEU LEU A . n 
A 1 128 LEU 128 126 126 LEU LEU A . n 
A 1 129 GLN 129 127 127 GLN GLN A . n 
A 1 130 LYS 130 128 128 LYS LYS A . n 
A 1 131 ALA 131 129 129 ALA ALA A . n 
A 1 132 ASP 132 130 130 ASP ASP A . n 
A 1 133 SER 133 131 131 SER SER A . n 
A 1 134 ILE 134 132 132 ILE ILE A . n 
A 1 135 PRO 135 133 133 PRO PRO A . n 
A 1 136 SER 136 134 134 SER SER A . n 
A 1 137 LEU 137 135 135 LEU LEU A . n 
A 1 138 THR 138 136 136 THR THR A . n 
A 1 139 ASP 139 137 137 ASP ASP A . n 
A 1 140 GLN 140 138 138 GLN GLN A . n 
A 1 141 GLN 141 139 139 GLN GLN A . n 
A 1 142 ARG 142 140 140 ARG ARG A . n 
A 1 143 VAL 143 141 141 VAL VAL A . n 
A 1 144 GLY 144 142 142 GLY GLY A . n 
A 1 145 ILE 145 143 143 ILE ILE A . n 
A 1 146 LYS 146 144 144 LYS LYS A . n 
A 1 147 TYR 147 145 145 TYR TYR A . n 
A 1 148 PHE 148 146 146 PHE PHE A . n 
A 1 149 TYR 149 147 147 TYR TYR A . n 
A 1 150 ASP 150 148 148 ASP ASP A . n 
A 1 151 ILE 151 149 149 ILE ILE A . n 
A 1 152 ASN 152 150 150 ASN ASN A . n 
A 1 153 GLU 153 151 151 GLU GLU A . n 
A 1 154 LYS 154 152 152 LYS LYS A . n 
A 1 155 ILE 155 153 153 ILE ILE A . n 
A 1 156 PRO 156 154 154 PRO PRO A . n 
A 1 157 MET 157 155 155 MET MET A . n 
A 1 158 GLN 158 156 156 GLN GLN A . n 
A 1 159 GLU 159 157 157 GLU GLU A . n 
A 1 160 SER 160 158 158 SER SER A . n 
A 1 161 VAL 161 159 159 VAL VAL A . n 
A 1 162 LEU 162 160 160 LEU LEU A . n 
A 1 163 HIS 163 161 161 HIS HIS A . n 
A 1 164 GLU 164 162 162 GLU GLU A . n 
A 1 165 ASN 165 163 163 ASN ASN A . n 
A 1 166 TYR 166 164 164 TYR TYR A . n 
A 1 167 LEU 167 165 165 LEU LEU A . n 
A 1 168 ARG 168 166 166 ARG ARG A . n 
A 1 169 GLU 169 167 167 GLU GLU A . n 
A 1 170 LYS 170 168 168 LYS LYS A . n 
A 1 171 CYS 171 169 169 CYS CYS A . n 
A 1 172 MET 172 170 170 MET MET A . n 
A 1 173 GLU 173 171 171 GLU GLU A . n 
A 1 174 VAL 174 172 172 VAL VAL A . n 
A 1 175 LEU 175 173 173 LEU LEU A . n 
A 1 176 GLY 176 174 174 GLY GLY A . n 
A 1 177 LYS 177 175 175 LYS LYS A . n 
A 1 178 ASP 178 176 176 ASP ASP A . n 
A 1 179 PHE 179 177 177 PHE PHE A . n 
A 1 180 SER 180 178 178 SER SER A . n 
A 1 181 ILE 181 179 179 ILE ILE A . n 
A 1 182 LEU 182 180 180 LEU LEU A . n 
A 1 183 ILE 183 181 181 ILE ILE A . n 
A 1 184 CYS 184 182 182 CYS CYS A . n 
A 1 185 GLY 185 183 183 GLY GLY A . n 
A 1 186 SER 186 184 184 SER SER A . n 
A 1 187 TYR 187 185 185 TYR TYR A . n 
A 1 188 ARG 188 186 186 ARG ARG A . n 
A 1 189 ARG 189 187 187 ARG ARG A . n 
A 1 190 ARG 190 188 188 ARG ARG A . n 
A 1 191 HIS 191 189 189 HIS HIS A . n 
A 1 192 PRO 192 190 190 PRO PRO A . n 
A 1 193 PHE 193 191 191 PHE PHE A . n 
A 1 194 SER 194 192 192 SER SER A . n 
A 1 195 GLY 195 193 193 GLY GLY A . n 
A 1 196 ASP 196 194 194 ASP ASP A . n 
A 1 197 VAL 197 195 195 VAL VAL A . n 
A 1 198 ASP 198 196 196 ASP ASP A . n 
A 1 199 ALA 199 197 197 ALA ALA A . n 
A 1 200 ILE 200 198 198 ILE ILE A . n 
A 1 201 LEU 201 199 199 LEU LEU A . n 
A 1 202 SER 202 200 200 SER SER A . n 
A 1 203 ARG 203 201 201 ARG ARG A . n 
A 1 204 THR 204 202 202 THR THR A . n 
A 1 205 LEU 205 203 203 LEU LEU A . n 
A 1 206 ASP 206 204 204 ASP ASP A . n 
A 1 207 ALA 207 205 205 ALA ALA A . n 
A 1 208 PRO 208 206 206 PRO PRO A . n 
A 1 209 PRO 209 207 207 PRO PRO A . n 
A 1 210 LEU 210 208 208 LEU LEU A . n 
A 1 211 SER 211 209 209 SER SER A . n 
A 1 212 GLU 212 210 210 GLU GLU A . n 
A 1 213 PRO 213 211 211 PRO PRO A . n 
A 1 214 VAL 214 212 212 VAL VAL A . n 
A 1 215 ALA 215 213 213 ALA ALA A . n 
A 1 216 ALA 216 214 214 ALA ALA A . n 
A 1 217 THR 217 215 215 THR THR A . n 
A 1 218 GLY 218 216 216 GLY GLY A . n 
A 1 219 VAL 219 217 217 VAL VAL A . n 
A 1 220 LEU 220 218 218 LEU LEU A . n 
A 1 221 GLY 221 219 219 GLY GLY A . n 
A 1 222 HIS 222 220 220 HIS HIS A . n 
A 1 223 PHE 223 221 221 PHE PHE A . n 
A 1 224 VAL 224 222 222 VAL VAL A . n 
A 1 225 GLU 225 223 223 GLU GLU A . n 
A 1 226 PHE 226 224 224 PHE PHE A . n 
A 1 227 LEU 227 225 225 LEU LEU A . n 
A 1 228 GLU 228 226 226 GLU GLU A . n 
A 1 229 SER 229 227 227 SER SER A . n 
A 1 230 LEU 230 228 228 LEU LEU A . n 
A 1 231 LYS 231 229 229 LYS LYS A . n 
A 1 232 TYR 232 230 230 TYR TYR A . n 
A 1 233 LEU 233 231 231 LEU LEU A . n 
A 1 234 GLU 234 232 232 GLU GLU A . n 
A 1 235 ALA 235 233 233 ALA ALA A . n 
A 1 236 THR 236 234 234 THR THR A . n 
A 1 237 MET 237 235 235 MET MET A . n 
A 1 238 ALA 238 236 236 ALA ALA A . n 
A 1 239 GLN 239 237 237 GLN GLN A . n 
A 1 240 GLY 240 238 238 GLY GLY A . n 
A 1 241 PRO 241 239 239 PRO PRO A . n 
A 1 242 LEU 242 240 240 LEU LEU A . n 
A 1 243 LYS 243 241 241 LYS LYS A . n 
A 1 244 TYR 244 242 242 TYR TYR A . n 
A 1 245 MET 245 243 243 MET MET A . n 
A 1 246 GLY 246 244 244 GLY GLY A . n 
A 1 247 MET 247 245 245 MET MET A . n 
A 1 248 GLY 248 246 246 GLY GLY A . n 
A 1 249 ARG 249 247 247 ARG ARG A . n 
A 1 250 LEU 250 248 248 LEU LEU A . n 
A 1 251 PRO 251 249 249 PRO PRO A . n 
A 1 252 PRO 252 250 250 PRO PRO A . n 
A 1 253 ARG 253 251 251 ARG ARG A . n 
A 1 254 ILE 254 252 252 ILE ILE A . n 
A 1 255 VAL 255 253 ?   ?   ?   A . n 
A 1 256 ARG 256 254 ?   ?   ?   A . n 
A 1 257 ASP 257 255 ?   ?   ?   A . n 
A 1 258 LYS 258 256 ?   ?   ?   A . n 
A 1 259 ALA 259 257 ?   ?   ?   A . n 
A 1 260 GLY 260 258 ?   ?   ?   A . n 
A 1 261 ARG 261 259 ?   ?   ?   A . n 
A 1 262 GLU 262 260 ?   ?   ?   A . n 
A 1 263 ASN 263 261 261 ASN ASN A . n 
A 1 264 THR 264 262 262 THR THR A . n 
A 1 265 LYS 265 263 263 LYS LYS A . n 
A 1 266 VAL 266 264 264 VAL VAL A . n 
A 1 267 TYR 267 265 265 TYR TYR A . n 
A 1 268 LYS 268 266 266 LYS LYS A . n 
A 1 269 ALA 269 267 267 ALA ALA A . n 
A 1 270 ARG 270 268 268 ARG ARG A . n 
A 1 271 ARG 271 269 269 ARG ARG A . n 
A 1 272 VAL 272 270 270 VAL VAL A . n 
A 1 273 ASP 273 271 271 ASP ASP A . n 
A 1 274 ILE 274 272 272 ILE ILE A . n 
A 1 275 ARG 275 273 273 ARG ARG A . n 
A 1 276 LEU 276 274 274 LEU LEU A . n 
A 1 277 ILE 277 275 275 ILE ILE A . n 
A 1 278 GLU 278 276 276 GLU GLU A . n 
A 1 279 THR 279 277 277 THR THR A . n 
A 1 280 LYS 280 278 278 LYS LYS A . n 
A 1 281 SER 281 279 279 SER SER A . n 
A 1 282 VAL 282 280 280 VAL VAL A . n 
A 1 283 PRO 283 281 281 PRO PRO A . n 
A 1 284 THR 284 282 282 THR THR A . n 
A 1 285 ALA 285 283 283 ALA ALA A . n 
A 1 286 MET 286 284 284 MET MET A . n 
A 1 287 LEU 287 285 285 LEU LEU A . n 
A 1 288 THR 288 286 286 THR THR A . n 
A 1 289 PHE 289 287 287 PHE PHE A . n 
A 1 290 THR 290 288 288 THR THR A . n 
A 1 291 GLY 291 289 289 GLY GLY A . n 
A 1 292 SER 292 290 290 SER SER A . n 
A 1 293 LYS 293 291 291 LYS LYS A . n 
A 1 294 ASN 294 292 292 ASN ASN A . n 
A 1 295 PHE 295 293 293 PHE PHE A . n 
A 1 296 ASN 296 294 294 ASN ASN A . n 
A 1 297 VAL 297 295 295 VAL VAL A . n 
A 1 298 ILE 298 296 296 ILE ILE A . n 
A 1 299 MET 299 297 297 MET MET A . n 
A 1 300 ARG 300 298 298 ARG ARG A . n 
A 1 301 GLN 301 299 299 GLN GLN A . n 
A 1 302 ALA 302 300 300 ALA ALA A . n 
A 1 303 ALA 303 301 301 ALA ALA A . n 
A 1 304 ILE 304 302 302 ILE ILE A . n 
A 1 305 SER 305 303 303 SER SER A . n 
A 1 306 LYS 306 304 304 LYS LYS A . n 
A 1 307 GLY 307 305 305 GLY GLY A . n 
A 1 308 TYR 308 306 306 TYR TYR A . n 
A 1 309 LEU 309 307 307 LEU LEU A . n 
A 1 310 LEU 310 308 308 LEU LEU A . n 
A 1 311 ASN 311 309 309 ASN ASN A . n 
A 1 312 GLU 312 310 310 GLU GLU A . n 
A 1 313 TYR 313 311 311 TYR TYR A . n 
A 1 314 GLY 314 312 312 GLY GLY A . n 
A 1 315 LEU 315 313 313 LEU LEU A . n 
A 1 316 PHE 316 314 314 PHE PHE A . n 
A 1 317 LYS 317 315 315 LYS LYS A . n 
A 1 318 LEU 318 316 316 LEU LEU A . n 
A 1 319 GLY 319 317 317 GLY GLY A . n 
A 1 320 THR 320 318 318 THR THR A . n 
A 1 321 PRO 321 319 319 PRO PRO A . n 
A 1 322 GLU 322 320 320 GLU GLU A . n 
A 1 323 GLU 323 321 321 GLU GLU A . n 
A 1 324 ALA 324 322 322 ALA ALA A . n 
A 1 325 ARG 325 323 323 ARG ARG A . n 
A 1 326 ALA 326 324 324 ALA ALA A . n 
A 1 327 LEU 327 325 325 LEU LEU A . n 
A 1 328 TYR 328 326 326 TYR TYR A . n 
A 1 329 GLU 329 327 327 GLU GLU A . n 
A 1 330 ARG 330 328 328 ARG ARG A . n 
A 1 331 ILE 331 329 329 ILE ILE A . n 
A 1 332 GLY 332 330 330 GLY GLY A . n 
A 1 333 ILE 333 331 331 ILE ILE A . n 
A 1 334 ARG 334 332 332 ARG ARG A . n 
A 1 335 GLY 335 333 333 GLY GLY A . n 
A 1 336 LYS 336 334 334 LYS LYS A . n 
A 1 337 ASN 337 335 335 ASN ASN A . n 
A 1 338 ALA 338 336 336 ALA ALA A . n 
A 1 339 GLY 339 337 337 GLY GLY A . n 
A 1 340 GLU 340 338 338 GLU GLU A . n 
A 1 341 GLU 341 339 339 GLU GLU A . n 
A 1 342 LEU 342 340 340 LEU LEU A . n 
A 1 343 GLY 343 341 341 GLY GLY A . n 
A 1 344 VAL 344 342 342 VAL VAL A . n 
A 1 345 PRO 345 343 343 PRO PRO A . n 
A 1 346 LYS 346 344 344 LYS LYS A . n 
A 1 347 ASP 347 345 345 ASP ASP A . n 
A 1 348 GLU 348 346 346 GLU GLU A . n 
A 1 349 LEU 349 347 347 LEU LEU A . n 
A 1 350 GLU 350 348 348 GLU GLU A . n 
A 1 351 ASP 351 349 349 ASP ASP A . n 
A 1 352 LYS 352 350 350 LYS LYS A . n 
A 1 353 ARG 353 351 351 ARG ARG A . n 
A 1 354 VAL 354 352 352 VAL VAL A . n 
A 1 355 GLU 355 353 353 GLU GLU A . n 
A 1 356 VAL 356 354 354 VAL VAL A . n 
A 1 357 ARG 357 355 355 ARG ARG A . n 
A 1 358 SER 358 356 356 SER SER A . n 
A 1 359 GLU 359 357 357 GLU GLU A . n 
A 1 360 GLN 360 358 358 GLN GLN A . n 
A 1 361 ASP 361 359 359 ASP ASP A . n 
A 1 362 VAL 362 360 360 VAL VAL A . n 
A 1 363 PHE 363 361 361 PHE PHE A . n 
A 1 364 ASP 364 362 362 ASP ASP A . n 
A 1 365 VAL 365 363 363 VAL VAL A . n 
A 1 366 LEU 366 364 364 LEU LEU A . n 
A 1 367 GLY 367 365 365 GLY GLY A . n 
A 1 368 MET 368 366 366 MET MET A . n 
A 1 369 PRO 369 367 367 PRO PRO A . n 
A 1 370 TYR 370 368 368 TYR TYR A . n 
A 1 371 ALA 371 369 369 ALA ALA A . n 
A 1 372 LYS 372 370 370 LYS LYS A . n 
A 1 373 PRO 373 371 371 PRO PRO A . n 
A 1 374 GLU 374 372 372 GLU GLU A . n 
A 1 375 ASN 375 373 373 ASN ASN A . n 
A 1 376 ARG 376 374 374 ARG ARG A . n 
A 1 377 ASP 377 375 375 ASP ASP A . n 
A 1 378 PRO 378 376 376 PRO PRO A . n 
B 2 1   DC  1   1   1   DC  Cd  C . n 
B 2 2   DA  2   2   2   DA  Ad  C . n 
B 2 3   DG  3   3   3   DG  Gd  C . n 
B 2 4   DT  4   4   4   DT  Td  C . n 
B 2 5   DA  5   5   5   DA  Ad  C . n 
B 2 6   DC  6   6   6   DC  Cd  C . n 
B 2 7   DT  7   7   7   DT  Td  C . n 
C 3 1   DG  1   1   1   DG  Gd  D . n 
C 3 2   DC  2   2   2   DC  Cd  D . n 
C 3 3   DC  3   3   ?   ?   ?   D . n 
C 3 4   DG  4   4   ?   ?   ?   D . n 
D 4 1   DC  1   1   ?   ?   ?   B . n 
D 4 2   DG  2   2   2   DG  Gd  B . n 
D 4 3   DG  3   3   3   DG  Gd  B . n 
D 4 4   DC  4   4   4   DC  Cd  B . n 
D 4 5   DA  5   5   5   DA  Ad  B . n 
D 4 6   DG  6   6   6   DG  Gd  B . n 
D 4 7   DT  7   7   7   DT  Td  B . n 
D 4 8   DA  8   8   8   DA  Ad  B . n 
D 4 9   DC  9   9   9   DC  Cd  B . n 
D 4 10  DT  10  10  10  DT  Td  B . n 
D 4 11  DG  11  11  11  DG  Gd  B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 NA  1   401 377 NA  NA  A . 
F 6 HOH 1   501 560 HOH HOH A . 
F 6 HOH 2   502 566 HOH HOH A . 
F 6 HOH 3   503 396 HOH HOH A . 
F 6 HOH 4   504 441 HOH HOH A . 
F 6 HOH 5   505 549 HOH HOH A . 
F 6 HOH 6   506 389 HOH HOH A . 
F 6 HOH 7   507 543 HOH HOH A . 
F 6 HOH 8   508 473 HOH HOH A . 
F 6 HOH 9   509 461 HOH HOH A . 
F 6 HOH 10  510 380 HOH HOH A . 
F 6 HOH 11  511 420 HOH HOH A . 
F 6 HOH 12  512 471 HOH HOH A . 
F 6 HOH 13  513 495 HOH HOH A . 
F 6 HOH 14  514 408 HOH HOH A . 
F 6 HOH 15  515 532 HOH HOH A . 
F 6 HOH 16  516 452 HOH HOH A . 
F 6 HOH 17  517 409 HOH HOH A . 
F 6 HOH 18  518 539 HOH HOH A . 
F 6 HOH 19  519 515 HOH HOH A . 
F 6 HOH 20  520 489 HOH HOH A . 
F 6 HOH 21  521 458 HOH HOH A . 
F 6 HOH 22  522 479 HOH HOH A . 
F 6 HOH 23  523 417 HOH HOH A . 
F 6 HOH 24  524 403 HOH HOH A . 
F 6 HOH 25  525 557 HOH HOH A . 
F 6 HOH 26  526 544 HOH HOH A . 
F 6 HOH 27  527 401 HOH HOH A . 
F 6 HOH 28  528 468 HOH HOH A . 
F 6 HOH 29  529 431 HOH HOH A . 
F 6 HOH 30  530 482 HOH HOH A . 
F 6 HOH 31  531 584 HOH HOH A . 
F 6 HOH 32  532 561 HOH HOH A . 
F 6 HOH 33  533 573 HOH HOH A . 
F 6 HOH 34  534 552 HOH HOH A . 
F 6 HOH 35  535 493 HOH HOH A . 
F 6 HOH 36  536 547 HOH HOH A . 
F 6 HOH 37  537 429 HOH HOH A . 
F 6 HOH 38  538 586 HOH HOH A . 
F 6 HOH 39  539 502 HOH HOH A . 
F 6 HOH 40  540 534 HOH HOH A . 
F 6 HOH 41  541 519 HOH HOH A . 
F 6 HOH 42  542 591 HOH HOH A . 
F 6 HOH 43  543 505 HOH HOH A . 
F 6 HOH 44  544 590 HOH HOH A . 
F 6 HOH 45  545 535 HOH HOH A . 
F 6 HOH 46  546 511 HOH HOH A . 
F 6 HOH 47  547 545 HOH HOH A . 
F 6 HOH 48  548 531 HOH HOH A . 
F 6 HOH 49  549 558 HOH HOH A . 
F 6 HOH 50  550 592 HOH HOH A . 
F 6 HOH 51  551 564 HOH HOH A . 
F 6 HOH 52  552 501 HOH HOH A . 
F 6 HOH 53  553 569 HOH HOH A . 
F 6 HOH 54  554 589 HOH HOH A . 
F 6 HOH 55  555 570 HOH HOH A . 
F 6 HOH 56  556 455 HOH HOH A . 
F 6 HOH 57  557 378 HOH HOH A . 
F 6 HOH 58  558 379 HOH HOH A . 
F 6 HOH 59  559 381 HOH HOH A . 
F 6 HOH 60  560 382 HOH HOH A . 
F 6 HOH 61  561 383 HOH HOH A . 
F 6 HOH 62  562 384 HOH HOH A . 
F 6 HOH 63  563 385 HOH HOH A . 
F 6 HOH 64  564 386 HOH HOH A . 
F 6 HOH 65  565 387 HOH HOH A . 
F 6 HOH 66  566 388 HOH HOH A . 
F 6 HOH 67  567 390 HOH HOH A . 
F 6 HOH 68  568 391 HOH HOH A . 
F 6 HOH 69  569 392 HOH HOH A . 
F 6 HOH 70  570 393 HOH HOH A . 
F 6 HOH 71  571 394 HOH HOH A . 
F 6 HOH 72  572 395 HOH HOH A . 
F 6 HOH 73  573 397 HOH HOH A . 
F 6 HOH 74  574 398 HOH HOH A . 
F 6 HOH 75  575 399 HOH HOH A . 
F 6 HOH 76  576 400 HOH HOH A . 
F 6 HOH 77  577 402 HOH HOH A . 
F 6 HOH 78  578 404 HOH HOH A . 
F 6 HOH 79  579 405 HOH HOH A . 
F 6 HOH 80  580 406 HOH HOH A . 
F 6 HOH 81  581 407 HOH HOH A . 
F 6 HOH 82  582 410 HOH HOH A . 
F 6 HOH 83  583 411 HOH HOH A . 
F 6 HOH 84  584 412 HOH HOH A . 
F 6 HOH 85  585 413 HOH HOH A . 
F 6 HOH 86  586 414 HOH HOH A . 
F 6 HOH 87  587 415 HOH HOH A . 
F 6 HOH 88  588 416 HOH HOH A . 
F 6 HOH 89  589 418 HOH HOH A . 
F 6 HOH 90  590 419 HOH HOH A . 
F 6 HOH 91  591 421 HOH HOH A . 
F 6 HOH 92  592 422 HOH HOH A . 
F 6 HOH 93  593 423 HOH HOH A . 
F 6 HOH 94  594 424 HOH HOH A . 
F 6 HOH 95  595 425 HOH HOH A . 
F 6 HOH 96  596 426 HOH HOH A . 
F 6 HOH 97  597 427 HOH HOH A . 
F 6 HOH 98  598 428 HOH HOH A . 
F 6 HOH 99  599 430 HOH HOH A . 
F 6 HOH 100 600 432 HOH HOH A . 
F 6 HOH 101 601 433 HOH HOH A . 
F 6 HOH 102 602 434 HOH HOH A . 
F 6 HOH 103 603 435 HOH HOH A . 
F 6 HOH 104 604 436 HOH HOH A . 
F 6 HOH 105 605 437 HOH HOH A . 
F 6 HOH 106 606 438 HOH HOH A . 
F 6 HOH 107 607 439 HOH HOH A . 
F 6 HOH 108 608 440 HOH HOH A . 
F 6 HOH 109 609 442 HOH HOH A . 
F 6 HOH 110 610 443 HOH HOH A . 
F 6 HOH 111 611 444 HOH HOH A . 
F 6 HOH 112 612 445 HOH HOH A . 
F 6 HOH 113 613 446 HOH HOH A . 
F 6 HOH 114 614 447 HOH HOH A . 
F 6 HOH 115 615 448 HOH HOH A . 
F 6 HOH 116 616 449 HOH HOH A . 
F 6 HOH 117 617 450 HOH HOH A . 
F 6 HOH 118 618 451 HOH HOH A . 
F 6 HOH 119 619 453 HOH HOH A . 
F 6 HOH 120 620 454 HOH HOH A . 
F 6 HOH 121 621 456 HOH HOH A . 
F 6 HOH 122 622 457 HOH HOH A . 
F 6 HOH 123 623 459 HOH HOH A . 
F 6 HOH 124 624 460 HOH HOH A . 
F 6 HOH 125 625 462 HOH HOH A . 
F 6 HOH 126 626 463 HOH HOH A . 
F 6 HOH 127 627 464 HOH HOH A . 
F 6 HOH 128 628 465 HOH HOH A . 
F 6 HOH 129 629 466 HOH HOH A . 
F 6 HOH 130 630 467 HOH HOH A . 
F 6 HOH 131 631 469 HOH HOH A . 
F 6 HOH 132 632 470 HOH HOH A . 
F 6 HOH 133 633 472 HOH HOH A . 
F 6 HOH 134 634 474 HOH HOH A . 
F 6 HOH 135 635 475 HOH HOH A . 
F 6 HOH 136 636 476 HOH HOH A . 
F 6 HOH 137 637 477 HOH HOH A . 
F 6 HOH 138 638 478 HOH HOH A . 
F 6 HOH 139 639 480 HOH HOH A . 
F 6 HOH 140 640 481 HOH HOH A . 
F 6 HOH 141 641 483 HOH HOH A . 
F 6 HOH 142 642 484 HOH HOH A . 
F 6 HOH 143 643 485 HOH HOH A . 
F 6 HOH 144 644 486 HOH HOH A . 
F 6 HOH 145 645 487 HOH HOH A . 
F 6 HOH 146 646 488 HOH HOH A . 
F 6 HOH 147 647 490 HOH HOH A . 
F 6 HOH 148 648 491 HOH HOH A . 
F 6 HOH 149 649 492 HOH HOH A . 
F 6 HOH 150 650 494 HOH HOH A . 
F 6 HOH 151 651 496 HOH HOH A . 
F 6 HOH 152 652 497 HOH HOH A . 
F 6 HOH 153 653 498 HOH HOH A . 
F 6 HOH 154 654 499 HOH HOH A . 
F 6 HOH 155 655 500 HOH HOH A . 
F 6 HOH 156 656 503 HOH HOH A . 
F 6 HOH 157 657 504 HOH HOH A . 
F 6 HOH 158 658 506 HOH HOH A . 
F 6 HOH 159 659 507 HOH HOH A . 
F 6 HOH 160 660 508 HOH HOH A . 
F 6 HOH 161 661 509 HOH HOH A . 
F 6 HOH 162 662 510 HOH HOH A . 
F 6 HOH 163 663 512 HOH HOH A . 
F 6 HOH 164 664 513 HOH HOH A . 
F 6 HOH 165 665 514 HOH HOH A . 
F 6 HOH 166 666 516 HOH HOH A . 
F 6 HOH 167 667 517 HOH HOH A . 
F 6 HOH 168 668 518 HOH HOH A . 
F 6 HOH 169 669 520 HOH HOH A . 
F 6 HOH 170 670 521 HOH HOH A . 
F 6 HOH 171 671 522 HOH HOH A . 
F 6 HOH 172 672 523 HOH HOH A . 
F 6 HOH 173 673 524 HOH HOH A . 
F 6 HOH 174 674 525 HOH HOH A . 
F 6 HOH 175 675 526 HOH HOH A . 
F 6 HOH 176 676 527 HOH HOH A . 
F 6 HOH 177 677 528 HOH HOH A . 
F 6 HOH 178 678 529 HOH HOH A . 
F 6 HOH 179 679 530 HOH HOH A . 
F 6 HOH 180 680 533 HOH HOH A . 
F 6 HOH 181 681 536 HOH HOH A . 
F 6 HOH 182 682 537 HOH HOH A . 
F 6 HOH 183 683 538 HOH HOH A . 
F 6 HOH 184 684 540 HOH HOH A . 
F 6 HOH 185 685 541 HOH HOH A . 
F 6 HOH 186 686 542 HOH HOH A . 
F 6 HOH 187 687 546 HOH HOH A . 
F 6 HOH 188 688 548 HOH HOH A . 
F 6 HOH 189 689 550 HOH HOH A . 
F 6 HOH 190 690 551 HOH HOH A . 
F 6 HOH 191 691 553 HOH HOH A . 
F 6 HOH 192 692 554 HOH HOH A . 
F 6 HOH 193 693 555 HOH HOH A . 
F 6 HOH 194 694 556 HOH HOH A . 
F 6 HOH 195 695 559 HOH HOH A . 
F 6 HOH 196 696 562 HOH HOH A . 
F 6 HOH 197 697 563 HOH HOH A . 
F 6 HOH 198 698 565 HOH HOH A . 
F 6 HOH 199 699 567 HOH HOH A . 
F 6 HOH 200 700 568 HOH HOH A . 
F 6 HOH 201 701 571 HOH HOH A . 
F 6 HOH 202 702 572 HOH HOH A . 
F 6 HOH 203 703 574 HOH HOH A . 
F 6 HOH 204 704 575 HOH HOH A . 
F 6 HOH 205 705 576 HOH HOH A . 
F 6 HOH 206 706 577 HOH HOH A . 
F 6 HOH 207 707 578 HOH HOH A . 
F 6 HOH 208 708 579 HOH HOH A . 
F 6 HOH 209 709 580 HOH HOH A . 
F 6 HOH 210 710 581 HOH HOH A . 
F 6 HOH 211 711 582 HOH HOH A . 
F 6 HOH 212 712 583 HOH HOH A . 
F 6 HOH 213 713 585 HOH HOH A . 
F 6 HOH 214 714 587 HOH HOH A . 
F 6 HOH 215 715 588 HOH HOH A . 
G 6 HOH 1   101 8   HOH HOH C . 
G 6 HOH 2   102 9   HOH HOH C . 
G 6 HOH 3   103 10  HOH HOH C . 
G 6 HOH 4   104 11  HOH HOH C . 
G 6 HOH 5   105 12  HOH HOH C . 
G 6 HOH 6   106 13  HOH HOH C . 
G 6 HOH 7   107 14  HOH HOH C . 
G 6 HOH 8   108 15  HOH HOH C . 
G 6 HOH 9   109 16  HOH HOH C . 
G 6 HOH 10  110 17  HOH HOH C . 
G 6 HOH 11  111 18  HOH HOH C . 
G 6 HOH 12  112 19  HOH HOH C . 
G 6 HOH 13  113 20  HOH HOH C . 
G 6 HOH 14  114 21  HOH HOH C . 
G 6 HOH 15  115 22  HOH HOH C . 
G 6 HOH 16  116 23  HOH HOH C . 
G 6 HOH 17  117 24  HOH HOH C . 
H 6 HOH 1   101 22  HOH HOH B . 
H 6 HOH 2   102 13  HOH HOH B . 
H 6 HOH 3   103 20  HOH HOH B . 
H 6 HOH 4   104 15  HOH HOH B . 
H 6 HOH 5   105 12  HOH HOH B . 
H 6 HOH 6   106 14  HOH HOH B . 
H 6 HOH 7   107 16  HOH HOH B . 
H 6 HOH 8   108 17  HOH HOH B . 
H 6 HOH 9   109 18  HOH HOH B . 
H 6 HOH 10  110 19  HOH HOH B . 
H 6 HOH 11  111 21  HOH HOH B . 
H 6 HOH 12  112 23  HOH HOH B . 
H 6 HOH 13  113 24  HOH HOH B . 
H 6 HOH 14  114 25  HOH HOH B . 
H 6 HOH 15  115 26  HOH HOH B . 
H 6 HOH 16  116 27  HOH HOH B . 
H 6 HOH 17  117 28  HOH HOH B . 
H 6 HOH 18  118 29  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4040  ? 
1 MORE         -35   ? 
1 'SSA (A^2)'  16190 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 527 ? F HOH . 
2 1 A HOH 542 ? F HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A THR 102 ? A THR 100 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? A VAL 104 ? A VAL 102 ? 1_555 95.8  ? 
2  O   ? A THR 102 ? A THR 100 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? A PHE 107 ? A PHE 105 ? 1_555 91.3  ? 
3  O   ? A VAL 104 ? A VAL 102 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? A PHE 107 ? A PHE 105 ? 1_555 76.0  ? 
4  O   ? A THR 102 ? A THR 100 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 OP1 ? B DA  5   ? C DA  5   ? 1_555 171.2 ? 
5  O   ? A VAL 104 ? A VAL 102 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 OP1 ? B DA  5   ? C DA  5   ? 1_555 82.6  ? 
6  O   ? A PHE 107 ? A PHE 105 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 OP1 ? B DA  5   ? C DA  5   ? 1_555 79.9  ? 
7  O   ? A THR 102 ? A THR 100 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? F HOH .   ? A HOH 646 ? 1_555 87.7  ? 
8  O   ? A VAL 104 ? A VAL 102 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? F HOH .   ? A HOH 646 ? 1_555 83.9  ? 
9  O   ? A PHE 107 ? A PHE 105 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? F HOH .   ? A HOH 646 ? 1_555 159.7 ? 
10 OP1 ? B DA  5   ? C DA  5   ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? F HOH .   ? A HOH 646 ? 1_555 100.7 ? 
11 O   ? A THR 102 ? A THR 100 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? G HOH .   ? C HOH 117 ? 1_555 79.1  ? 
12 O   ? A VAL 104 ? A VAL 102 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? G HOH .   ? C HOH 117 ? 1_555 167.1 ? 
13 O   ? A PHE 107 ? A PHE 105 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? G HOH .   ? C HOH 117 ? 1_555 92.2  ? 
14 OP1 ? B DA  5   ? C DA  5   ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? G HOH .   ? C HOH 117 ? 1_555 100.6 ? 
15 O   ? F HOH .   ? A HOH 646 ? 1_555 NA ? E NA . ? A NA 401 ? 1_555 O   ? G HOH .   ? C HOH 117 ? 1_555 107.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-08-06 
2 'Structure model' 1 1 2017-09-06 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Derived calculations'       
3 2 'Structure model' Other                        
4 2 'Structure model' 'Source and taxonomy'        
5 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' entity_src_gen        
2 2 'Structure model' pdbx_audit_support    
3 2 'Structure model' pdbx_database_status  
4 2 'Structure model' pdbx_entity_src_syn   
5 2 'Structure model' pdbx_struct_oper_list 
6 3 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
2 2 'Structure model' '_pdbx_audit_support.funding_organization'    
3 2 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
4 2 'Structure model' '_pdbx_entity_src_syn.pdbx_alt_source_flag'   
5 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
6 3 'Structure model' '_pdbx_audit_support.funding_organization'    
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -2.9780 
_pdbx_refine_tls.origin_y         -34.8218 
_pdbx_refine_tls.origin_z         -8.3482 
_pdbx_refine_tls.T[1][1]          0.1832 
_pdbx_refine_tls.T[2][2]          0.1342 
_pdbx_refine_tls.T[3][3]          0.1402 
_pdbx_refine_tls.T[1][2]          0.0018 
_pdbx_refine_tls.T[1][3]          0.0389 
_pdbx_refine_tls.T[2][3]          0.0084 
_pdbx_refine_tls.L[1][1]          1.2033 
_pdbx_refine_tls.L[2][2]          0.9346 
_pdbx_refine_tls.L[3][3]          0.6783 
_pdbx_refine_tls.L[1][2]          -0.5622 
_pdbx_refine_tls.L[1][3]          -0.6819 
_pdbx_refine_tls.L[2][3]          0.3895 
_pdbx_refine_tls.S[1][1]          0.1093 
_pdbx_refine_tls.S[1][2]          -0.0669 
_pdbx_refine_tls.S[1][3]          0.0329 
_pdbx_refine_tls.S[2][1]          0.0630 
_pdbx_refine_tls.S[2][2]          -0.0528 
_pdbx_refine_tls.S[2][3]          0.0153 
_pdbx_refine_tls.S[3][1]          -0.0646 
_pdbx_refine_tls.S[3][2]          0.0016 
_pdbx_refine_tls.S[3][3]          -0.0444 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   
;chain 'A' and (resid 32 through 376 )
;
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: 1.9_1692)' 
_software.pdbx_ordinal           1 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.478 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.129 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DG 3 ? ? "C1'" C DG 3 ? ? N9    C DG 3 ? ? 110.58 108.30 2.28   0.30 N 
2 1 "O4'" C DT 4 ? ? "C1'" C DT 4 ? ? N1    C DT 4 ? ? 110.79 108.30 2.49   0.30 N 
3 1 "O4'" C DC 6 ? ? "C4'" C DC 6 ? ? "C3'" C DC 6 ? ? 101.81 104.50 -2.69  0.40 N 
4 1 OP1   D DG 1 ? ? P     D DG 1 ? ? OP2   D DG 1 ? ? 107.66 119.60 -11.94 1.50 N 
5 1 "C3'" B DC 4 ? ? "C2'" B DC 4 ? ? "C1'" B DC 4 ? ? 97.57  102.40 -4.83  0.80 N 
6 1 "O4'" B DC 4 ? ? "C1'" B DC 4 ? ? N1    B DC 4 ? ? 113.98 108.30 5.68   0.30 N 
7 1 "O4'" B DG 6 ? ? "C1'" B DG 6 ? ? N9    B DG 6 ? ? 110.20 108.30 1.90   0.30 N 
8 1 "O4'" B DT 7 ? ? "C1'" B DT 7 ? ? N1    B DT 7 ? ? 110.56 108.30 2.26   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 182 ? ? -112.65 -131.69 
2 1 ARG A 332 ? ? -23.39  -66.68  
3 1 LYS A 334 ? ? -117.39 -84.28  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 93  ? CG  ? A LEU 95  CG  
2  1 Y 1 A LEU 93  ? CD1 ? A LEU 95  CD1 
3  1 Y 1 A LEU 93  ? CD2 ? A LEU 95  CD2 
4  1 Y 1 A LYS 94  ? CG  ? A LYS 96  CG  
5  1 Y 1 A LYS 94  ? CD  ? A LYS 96  CD  
6  1 Y 1 A LYS 94  ? CE  ? A LYS 96  CE  
7  1 Y 1 A LYS 94  ? NZ  ? A LYS 96  NZ  
8  1 Y 1 A ARG 108 ? CD  ? A ARG 110 CD  
9  1 Y 1 A ARG 108 ? NE  ? A ARG 110 NE  
10 1 Y 1 A ARG 108 ? CZ  ? A ARG 110 CZ  
11 1 Y 1 A ARG 108 ? NH1 ? A ARG 110 NH1 
12 1 Y 1 A ARG 108 ? NH2 ? A ARG 110 NH2 
13 1 Y 1 A GLU 320 ? CG  ? A GLU 322 CG  
14 1 Y 1 A GLU 320 ? CD  ? A GLU 322 CD  
15 1 Y 1 A GLU 320 ? OE1 ? A GLU 322 OE1 
16 1 Y 1 A GLU 320 ? OE2 ? A GLU 322 OE2 
17 1 Y 1 A ARG 332 ? CG  ? A ARG 334 CG  
18 1 Y 1 A ARG 332 ? CD  ? A ARG 334 CD  
19 1 Y 1 A ARG 332 ? NE  ? A ARG 334 NE  
20 1 Y 1 A ARG 332 ? CZ  ? A ARG 334 CZ  
21 1 Y 1 A ARG 332 ? NH1 ? A ARG 334 NH1 
22 1 Y 1 A ARG 332 ? NH2 ? A ARG 334 NH2 
23 1 Y 1 B DG  2   ? P   ? D DG  2   P   
24 1 Y 1 B DG  2   ? OP1 ? D DG  2   OP1 
25 1 Y 1 B DG  2   ? OP2 ? D DG  2   OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A HIS 0   ? A HIS 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A LEU 2   ? A LEU 4   
5  1 Y 1 A ARG 3   ? A ARG 5   
6  1 Y 1 A ARG 4   ? A ARG 6   
7  1 Y 1 A LYS 5   ? A LYS 7   
8  1 Y 1 A PHE 6   ? A PHE 8   
9  1 Y 1 A LEU 7   ? A LEU 9   
10 1 Y 1 A ARG 8   ? A ARG 10  
11 1 Y 1 A ARG 9   ? A ARG 11  
12 1 Y 1 A ASP 10  ? A ASP 12  
13 1 Y 1 A HIS 11  ? A HIS 13  
14 1 Y 1 A ARG 12  ? A ARG 14  
15 1 Y 1 A GLU 13  ? A GLU 15  
16 1 Y 1 A ASN 14  ? A ASN 16  
17 1 Y 1 A ILE 15  ? A ILE 17  
18 1 Y 1 A ILE 16  ? A ILE 18  
19 1 Y 1 A ARG 17  ? A ARG 19  
20 1 Y 1 A ILE 18  ? A ILE 20  
21 1 Y 1 A PHE 19  ? A PHE 21  
22 1 Y 1 A GLN 20  ? A GLN 22  
23 1 Y 1 A GLU 21  ? A GLU 23  
24 1 Y 1 A MET 22  ? A MET 24  
25 1 Y 1 A ALA 23  ? A ALA 25  
26 1 Y 1 A ASP 24  ? A ASP 26  
27 1 Y 1 A LEU 25  ? A LEU 27  
28 1 Y 1 A ASN 26  ? A ASN 28  
29 1 Y 1 A ASN 27  ? A ASN 29  
30 1 Y 1 A ALA 28  ? A ALA 30  
31 1 Y 1 A LEU 29  ? A LEU 31  
32 1 Y 1 A GLY 30  ? A GLY 32  
33 1 Y 1 A GLU 31  ? A GLU 33  
34 1 Y 1 A SER 36  ? A SER 38  
35 1 Y 1 A SER 37  ? A SER 39  
36 1 Y 1 A TYR 38  ? A TYR 40  
37 1 Y 1 A HIS 39  ? A HIS 41  
38 1 Y 1 A ARG 40  ? A ARG 42  
39 1 Y 1 A SER 41  ? A SER 43  
40 1 Y 1 A ILE 42  ? A ILE 44  
41 1 Y 1 A GLU 43  ? A GLU 45  
42 1 Y 1 A SER 44  ? A SER 46  
43 1 Y 1 A LEU 45  ? A LEU 47  
44 1 Y 1 A LYS 46  ? A LYS 48  
45 1 Y 1 A THR 47  ? A THR 49  
46 1 Y 1 A ASN 48  ? A ASN 50  
47 1 Y 1 A LEU 49  ? A LEU 51  
48 1 Y 1 A ASP 50  ? A ASP 52  
49 1 Y 1 A LYS 51  ? A LYS 53  
50 1 Y 1 A PRO 52  ? A PRO 54  
51 1 Y 1 A LEU 53  ? A LEU 55  
52 1 Y 1 A ASN 54  ? A ASN 56  
53 1 Y 1 A THR 55  ? A THR 57  
54 1 Y 1 A PRO 56  ? A PRO 58  
55 1 Y 1 A GLN 57  ? A GLN 59  
56 1 Y 1 A ASP 58  ? A ASP 60  
57 1 Y 1 A LEU 59  ? A LEU 61  
58 1 Y 1 A LYS 60  ? A LYS 62  
59 1 Y 1 A ALA 61  ? A ALA 63  
60 1 Y 1 A PHE 62  ? A PHE 64  
61 1 Y 1 A SER 63  ? A SER 65  
62 1 Y 1 A GLY 64  ? A GLY 66  
63 1 Y 1 A PHE 65  ? A PHE 67  
64 1 Y 1 A GLY 66  ? A GLY 68  
65 1 Y 1 A ALA 67  ? A ALA 69  
66 1 Y 1 A LYS 68  ? A LYS 70  
67 1 Y 1 A LEU 69  ? A LEU 71  
68 1 Y 1 A LEU 70  ? A LEU 72  
69 1 Y 1 A LYS 71  ? A LYS 73  
70 1 Y 1 A LYS 72  ? A LYS 74  
71 1 Y 1 A ALA 73  ? A ALA 75  
72 1 Y 1 A GLU 74  ? A GLU 76  
73 1 Y 1 A GLU 75  ? A GLU 77  
74 1 Y 1 A ILE 76  ? A ILE 78  
75 1 Y 1 A MET 77  ? A MET 79  
76 1 Y 1 A ALA 78  ? A ALA 80  
77 1 Y 1 A THR 79  ? A THR 81  
78 1 Y 1 A GLY 80  ? A GLY 82  
79 1 Y 1 A LYS 81  ? A LYS 83  
80 1 Y 1 A LEU 82  ? A LEU 84  
81 1 Y 1 A GLU 83  ? A GLU 85  
82 1 Y 1 A GLU 84  ? A GLU 86  
83 1 Y 1 A LEU 85  ? A LEU 87  
84 1 Y 1 A GLU 86  ? A GLU 88  
85 1 Y 1 A SER 87  ? A SER 89  
86 1 Y 1 A LYS 88  ? A LYS 90  
87 1 Y 1 A THR 89  ? A THR 91  
88 1 Y 1 A LYS 90  ? A LYS 92  
89 1 Y 1 A VAL 253 ? A VAL 255 
90 1 Y 1 A ARG 254 ? A ARG 256 
91 1 Y 1 A ASP 255 ? A ASP 257 
92 1 Y 1 A LYS 256 ? A LYS 258 
93 1 Y 1 A ALA 257 ? A ALA 259 
94 1 Y 1 A GLY 258 ? A GLY 260 
95 1 Y 1 A ARG 259 ? A ARG 261 
96 1 Y 1 A GLU 260 ? A GLU 262 
97 1 Y 1 D DC  3   ? C DC  3   
98 1 Y 1 D DG  4   ? C DG  4   
99 1 Y 1 B DC  1   ? D DC  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4P4P 'double helix'        
4P4P 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1 1_555 D DG 11 1_555 0.294  -0.327 -0.313 -9.001  -13.930 2.714  1 C_DC1:DG11_B C 1 ? B 11 ? 19 1 
1 B DA 2 1_555 D DT 10 1_555 0.625  -0.157 0.027  1.774   -15.750 7.323  2 C_DA2:DT10_B C 2 ? B 10 ? 20 1 
1 B DG 3 1_555 D DC 9  1_555 -0.064 -0.145 0.034  -3.791  -5.517  -0.379 3 C_DG3:DC9_B  C 3 ? B 9  ? 19 1 
1 B DT 4 1_555 D DA 8  1_555 0.356  -0.120 -0.359 3.007   -1.375  3.934  4 C_DT4:DA8_B  C 4 ? B 8  ? 20 1 
1 B DA 5 1_555 D DT 7  1_555 0.000  -0.118 -0.447 -12.882 -8.008  0.631  5 C_DA5:DT7_B  C 5 ? B 7  ? 20 1 
1 B DC 6 1_555 D DG 6  1_555 0.133  0.027  0.251  -5.755  1.844   3.729  6 C_DC6:DG6_B  C 6 ? B 6  ? 19 1 
1 B DT 7 1_555 D DA 5  1_555 0.126  -0.147 -0.367 18.138  10.355  -0.088 7 C_DT7:DA5_B  C 7 ? B 5  ? 20 1 
1 C DG 1 1_555 D DC 4  1_555 0.010  0.080  -0.291 -21.373 -10.632 -6.681 8 D_DG1:DC4_B  D 1 ? B 4  ? 19 1 
1 C DC 2 1_555 D DG 3  1_555 -0.328 -0.149 0.257  -10.562 -2.388  -2.208 9 D_DC2:DG3_B  D 2 ? B 3  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 11 1_555 B DA 2 1_555 D DT 10 1_555 0.243  1.160  3.118 -0.426 10.731 30.997 0.184  -0.505 3.322 19.365 0.769 
32.762 1 CC_DC1DA2:DT10DG11_BB C 1 ? B 11 ? C 2 ? B 10 ? 
1 B DA 2 1_555 D DT 10 1_555 B DG 3 1_555 D DC 9  1_555 0.242  -0.635 3.379 -0.369 4.156  30.334 -2.040 -0.533 3.262 7.896  0.700 
30.613 2 CC_DA2DG3:DC9DT10_BB  C 2 ? B 10 ? C 3 ? B 9  ? 
1 B DG 3 1_555 D DC 9  1_555 B DT 4 1_555 D DA 8  1_555 1.171  -0.589 3.130 4.896  4.131  32.358 -1.721 -1.253 3.171 7.323  -8.679 
32.969 3 CC_DG3DT4:DA8DC9_BB   C 3 ? B 9  ? C 4 ? B 8  ? 
1 B DT 4 1_555 D DA 8  1_555 B DA 5 1_555 D DT 7  1_555 0.756  -0.684 3.660 4.389  8.165  36.097 -2.276 -0.535 3.493 12.916 -6.944 
37.230 4 CC_DT4DA5:DT7DA8_BB   C 4 ? B 8  ? C 5 ? B 7  ? 
1 B DA 5 1_555 D DT 7  1_555 B DC 6 1_555 D DG 6  1_555 0.021  -0.744 3.305 -4.086 8.831  29.452 -3.062 -0.811 2.936 16.803 7.775 
30.984 5 CC_DA5DC6:DG6DT7_BB   C 5 ? B 7  ? C 6 ? B 6  ? 
1 B DC 6 1_555 D DG 6  1_555 B DT 7 1_555 D DA 5  1_555 -0.569 -0.615 2.919 5.062  5.134  22.810 -2.913 2.781  2.538 12.584 
-12.407 23.908 6 CC_DC6DT7:DA5DG6_BB   C 6 ? B 6  ? C 7 ? B 5  ? 
1 C DG 1 1_555 D DC 4  1_555 C DC 2 1_555 D DG 3  1_555 0.076  -0.343 3.073 0.399  6.945  26.291 -2.349 -0.068 2.890 14.938 -0.858 
27.180 7 DD_DG1DC2:DG3DC4_BB   D 1 ? B 4  ? D 2 ? B 3  ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01GM100021-02 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'SODIUM ION' NA  
6 water        HOH 
#