data_4P5K
# 
_entry.id   4P5K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4P5K         
WWPDB D_1000200739 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4P4K PDB . 
unspecified 4P4R PDB . 
unspecified 4P57 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4P5K 
_pdbx_database_status.recvd_initial_deposition_date   2014-03-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clayton, G.M.'  1  
'Wang, Y.'       2  
'Crawford, F.'   3  
'Novikov, A.'    4  
'Wimberly, B.T.' 5  
'Kieft, J.S.'    6  
'Falta, M.T.'    7  
'Bowerman, N.A.' 8  
'Marrack, P.'    9  
'Fontenot, A.P.' 10 
'Dai, S.'        11 
'Kappler, J.W.'  12 
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.book_id_ISBN              . 
_citation.book_publisher            ? 
_citation.book_publisher_city       . 
_citation.book_title                . 
_citation.coordinate_linkage        . 
_citation.country                   ? 
_citation.database_id_Medline       . 
_citation.details                   . 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              . 
_citation.journal_issue             . 
_citation.journal_volume            158 
_citation.language                  . 
_citation.page_first                132 
_citation.page_last                 142 
_citation.title                     
'Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.' 
_citation.year                      2014 
_citation.database_id_CSD           . 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2014.04.048 
_citation.pdbx_database_id_PubMed   24995984 
_citation.unpublished_flag          . 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Clayton, G.M.'  1  
primary 'Wang, Y.'       2  
primary 'Crawford, F.'   3  
primary 'Novikov, A.'    4  
primary 'Wimberly, B.T.' 5  
primary 'Kieft, J.S.'    6  
primary 'Falta, M.T.'    7  
primary 'Bowerman, N.A.' 8  
primary 'Marrack, P.'    9  
primary 'Fontenot, A.P.' 10 
primary 'Dai, S.'        11 
primary 'Kappler, J.W.'  12 
# 
_cell.length_a           182.779 
_cell.length_b           68.738 
_cell.length_c           71.133 
_cell.angle_alpha        90.000 
_cell.angle_beta         105.720 
_cell.angle_gamma        90.000 
_cell.entry_id           4P5K 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4P5K 
_symmetry.cell_setting                     . 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            . 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   . 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HLA class II histocompatibility antigen, DP alpha 1 chain'            21169.566 2 ? ? 'UNP RESIDUES 32-214' ? 
2 polymer man 'RAS peptide,HLA class II histocompatibility antigen, DP beta 1 chain' 24421.178 2 ? ? 'UNP residues 32-218' ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DP(W3),DP(W4),HLA-SB alpha chain,MHC class II DP3-alpha,MHC class II DPA1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHT
QATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDF
YDCRVEHWGLDQPLLKHWEAQEP
;
;IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHT
QATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDF
YDCRVEHWGLDQPLLKHWEAQEP
;
A,D ? 
2 'polypeptide(L)' no no 
;NKFDTQLFHTITGGSLVPRGSGGGGSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEE
YWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEET
AGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
;
;NKFDTQLFHTITGGSLVPRGSGGGGSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEE
YWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEET
AGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
;
B,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   LYS n 
1 3   ALA n 
1 4   ASP n 
1 5   HIS n 
1 6   VAL n 
1 7   SER n 
1 8   THR n 
1 9   TYR n 
1 10  ALA n 
1 11  ALA n 
1 12  PHE n 
1 13  VAL n 
1 14  GLN n 
1 15  THR n 
1 16  HIS n 
1 17  ARG n 
1 18  PRO n 
1 19  THR n 
1 20  GLY n 
1 21  GLU n 
1 22  PHE n 
1 23  MET n 
1 24  PHE n 
1 25  GLU n 
1 26  PHE n 
1 27  ASP n 
1 28  GLU n 
1 29  ASP n 
1 30  GLU n 
1 31  MET n 
1 32  PHE n 
1 33  TYR n 
1 34  VAL n 
1 35  ASP n 
1 36  LEU n 
1 37  ASP n 
1 38  LYS n 
1 39  LYS n 
1 40  GLU n 
1 41  THR n 
1 42  VAL n 
1 43  TRP n 
1 44  HIS n 
1 45  LEU n 
1 46  GLU n 
1 47  GLU n 
1 48  PHE n 
1 49  GLY n 
1 50  GLN n 
1 51  ALA n 
1 52  PHE n 
1 53  SER n 
1 54  PHE n 
1 55  GLU n 
1 56  ALA n 
1 57  GLN n 
1 58  GLY n 
1 59  GLY n 
1 60  LEU n 
1 61  ALA n 
1 62  ASN n 
1 63  ILE n 
1 64  ALA n 
1 65  ILE n 
1 66  LEU n 
1 67  ASN n 
1 68  ASN n 
1 69  ASN n 
1 70  LEU n 
1 71  ASN n 
1 72  THR n 
1 73  LEU n 
1 74  ILE n 
1 75  GLN n 
1 76  ARG n 
1 77  SER n 
1 78  ASN n 
1 79  HIS n 
1 80  THR n 
1 81  GLN n 
1 82  ALA n 
1 83  THR n 
1 84  ASN n 
1 85  ASP n 
1 86  PRO n 
1 87  PRO n 
1 88  GLU n 
1 89  VAL n 
1 90  THR n 
1 91  VAL n 
1 92  PHE n 
1 93  PRO n 
1 94  LYS n 
1 95  GLU n 
1 96  PRO n 
1 97  VAL n 
1 98  GLU n 
1 99  LEU n 
1 100 GLY n 
1 101 GLN n 
1 102 PRO n 
1 103 ASN n 
1 104 THR n 
1 105 LEU n 
1 106 ILE n 
1 107 CYS n 
1 108 HIS n 
1 109 ILE n 
1 110 ASP n 
1 111 LYS n 
1 112 PHE n 
1 113 PHE n 
1 114 PRO n 
1 115 PRO n 
1 116 VAL n 
1 117 LEU n 
1 118 ASN n 
1 119 VAL n 
1 120 THR n 
1 121 TRP n 
1 122 LEU n 
1 123 CYS n 
1 124 ASN n 
1 125 GLY n 
1 126 GLU n 
1 127 LEU n 
1 128 VAL n 
1 129 THR n 
1 130 GLU n 
1 131 GLY n 
1 132 VAL n 
1 133 ALA n 
1 134 GLU n 
1 135 SER n 
1 136 LEU n 
1 137 PHE n 
1 138 LEU n 
1 139 PRO n 
1 140 ARG n 
1 141 THR n 
1 142 ASP n 
1 143 TYR n 
1 144 SER n 
1 145 PHE n 
1 146 HIS n 
1 147 LYS n 
1 148 PHE n 
1 149 HIS n 
1 150 TYR n 
1 151 LEU n 
1 152 THR n 
1 153 PHE n 
1 154 VAL n 
1 155 PRO n 
1 156 SER n 
1 157 ALA n 
1 158 GLU n 
1 159 ASP n 
1 160 PHE n 
1 161 TYR n 
1 162 ASP n 
1 163 CYS n 
1 164 ARG n 
1 165 VAL n 
1 166 GLU n 
1 167 HIS n 
1 168 TRP n 
1 169 GLY n 
1 170 LEU n 
1 171 ASP n 
1 172 GLN n 
1 173 PRO n 
1 174 LEU n 
1 175 LEU n 
1 176 LYS n 
1 177 HIS n 
1 178 TRP n 
1 179 GLU n 
1 180 ALA n 
1 181 GLN n 
1 182 GLU n 
1 183 PRO n 
2 1   ASN n 
2 2   LYS n 
2 3   PHE n 
2 4   ASP n 
2 5   THR n 
2 6   GLN n 
2 7   LEU n 
2 8   PHE n 
2 9   HIS n 
2 10  THR n 
2 11  ILE n 
2 12  THR n 
2 13  GLY n 
2 14  GLY n 
2 15  SER n 
2 16  LEU n 
2 17  VAL n 
2 18  PRO n 
2 19  ARG n 
2 20  GLY n 
2 21  SER n 
2 22  GLY n 
2 23  GLY n 
2 24  GLY n 
2 25  GLY n 
2 26  SER n 
2 27  PRO n 
2 28  GLU n 
2 29  ASN n 
2 30  TYR n 
2 31  LEU n 
2 32  PHE n 
2 33  GLN n 
2 34  GLY n 
2 35  ARG n 
2 36  GLN n 
2 37  GLU n 
2 38  CYS n 
2 39  TYR n 
2 40  ALA n 
2 41  PHE n 
2 42  ASN n 
2 43  GLY n 
2 44  THR n 
2 45  GLN n 
2 46  ARG n 
2 47  PHE n 
2 48  LEU n 
2 49  GLU n 
2 50  ARG n 
2 51  TYR n 
2 52  ILE n 
2 53  TYR n 
2 54  ASN n 
2 55  ARG n 
2 56  GLU n 
2 57  GLU n 
2 58  PHE n 
2 59  VAL n 
2 60  ARG n 
2 61  PHE n 
2 62  ASP n 
2 63  SER n 
2 64  ASP n 
2 65  VAL n 
2 66  GLY n 
2 67  GLU n 
2 68  PHE n 
2 69  ARG n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  GLU n 
2 74  LEU n 
2 75  GLY n 
2 76  ARG n 
2 77  PRO n 
2 78  ASP n 
2 79  GLU n 
2 80  GLU n 
2 81  TYR n 
2 82  TRP n 
2 83  ASN n 
2 84  SER n 
2 85  GLN n 
2 86  LYS n 
2 87  ASP n 
2 88  ILE n 
2 89  LEU n 
2 90  GLU n 
2 91  GLU n 
2 92  GLU n 
2 93  ARG n 
2 94  ALA n 
2 95  VAL n 
2 96  PRO n 
2 97  ASP n 
2 98  ARG n 
2 99  MET n 
2 100 CYS n 
2 101 ARG n 
2 102 HIS n 
2 103 ASN n 
2 104 TYR n 
2 105 GLU n 
2 106 LEU n 
2 107 GLY n 
2 108 GLY n 
2 109 PRO n 
2 110 MET n 
2 111 THR n 
2 112 LEU n 
2 113 GLN n 
2 114 ARG n 
2 115 ARG n 
2 116 VAL n 
2 117 GLN n 
2 118 PRO n 
2 119 ARG n 
2 120 VAL n 
2 121 ASN n 
2 122 VAL n 
2 123 SER n 
2 124 PRO n 
2 125 SER n 
2 126 LYS n 
2 127 LYS n 
2 128 GLY n 
2 129 PRO n 
2 130 LEU n 
2 131 GLN n 
2 132 HIS n 
2 133 HIS n 
2 134 ASN n 
2 135 LEU n 
2 136 LEU n 
2 137 VAL n 
2 138 CYS n 
2 139 HIS n 
2 140 VAL n 
2 141 THR n 
2 142 ASP n 
2 143 PHE n 
2 144 TYR n 
2 145 PRO n 
2 146 GLY n 
2 147 SER n 
2 148 ILE n 
2 149 GLN n 
2 150 VAL n 
2 151 ARG n 
2 152 TRP n 
2 153 PHE n 
2 154 LEU n 
2 155 ASN n 
2 156 GLY n 
2 157 GLN n 
2 158 GLU n 
2 159 GLU n 
2 160 THR n 
2 161 ALA n 
2 162 GLY n 
2 163 VAL n 
2 164 VAL n 
2 165 SER n 
2 166 THR n 
2 167 ASN n 
2 168 LEU n 
2 169 ILE n 
2 170 ARG n 
2 171 ASN n 
2 172 GLY n 
2 173 ASP n 
2 174 TRP n 
2 175 THR n 
2 176 PHE n 
2 177 GLN n 
2 178 ILE n 
2 179 LEU n 
2 180 VAL n 
2 181 MET n 
2 182 LEU n 
2 183 GLU n 
2 184 MET n 
2 185 THR n 
2 186 PRO n 
2 187 GLN n 
2 188 GLN n 
2 189 GLY n 
2 190 ASP n 
2 191 VAL n 
2 192 TYR n 
2 193 THR n 
2 194 CYS n 
2 195 GLN n 
2 196 VAL n 
2 197 GLU n 
2 198 HIS n 
2 199 THR n 
2 200 SER n 
2 201 LEU n 
2 202 ASP n 
2 203 SER n 
2 204 PRO n 
2 205 VAL n 
2 206 THR n 
2 207 VAL n 
2 208 GLU n 
2 209 TRP n 
2 210 LYS n 
2 211 ALA n 
2 212 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  183 Human ? 'HLA-DPA1, HLA-DP1A, HLASB' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1  12  ?     ? ?                           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 2 sample 'Biological sequence' 16 212 Human ? HLA-DPB1                    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPA1_HUMAN   P20036 ? 1 
;IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHT
QATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDF
YDCRVEHWGLDQPLLKHWEAQEP
;
32 
2 PDB 4P5K         4P5K   ? 2 ? 1  
3 UNP Q5EP54_HUMAN Q5EP54 ? 2 
;TPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYE
LGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMT
PQQGDVYTCQVEHTSLDSPVTVEWKAQ
;
32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4P5K A 1  ? 183 ? P20036 32  ? 214 ? 1   183 
2 2 4P5K B 1  ? 12  ? 4P5K   -25 ? -14 ? -25 -14 
3 3 4P5K B 26 ? 212 ? Q5EP54 32  ? 218 ? 3   189 
4 1 4P5K D 1  ? 183 ? P20036 32  ? 214 ? 1   183 
5 2 4P5K E 1  ? 12  ? 4P5K   -25 ? -14 ? -25 -14 
6 3 4P5K E 26 ? 212 ? Q5EP54 32  ? 218 ? 3   189 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 4P5K GLY B 13 ? PDB ?      ?   ?  linker  -13 1  
2 4P5K GLY B 14 ? PDB ?      ?   ?  linker  -12 2  
2 4P5K SER B 15 ? PDB ?      ?   ?  linker  -11 3  
2 4P5K LEU B 16 ? PDB ?      ?   ?  linker  -10 4  
2 4P5K VAL B 17 ? PDB ?      ?   ?  linker  -9  5  
2 4P5K PRO B 18 ? PDB ?      ?   ?  linker  -8  6  
2 4P5K ARG B 19 ? PDB ?      ?   ?  linker  -7  7  
2 4P5K GLY B 20 ? PDB ?      ?   ?  linker  -6  8  
2 4P5K SER B 21 ? PDB ?      ?   ?  linker  -5  9  
2 4P5K GLY B 22 ? PDB ?      ?   ?  linker  -4  10 
2 4P5K GLY B 23 ? PDB ?      ?   ?  linker  -3  11 
2 4P5K GLY B 24 ? PDB ?      ?   ?  linker  -2  12 
2 4P5K GLY B 25 ? PDB ?      ?   ?  linker  -1  13 
3 4P5K SER B 26 ? UNP Q5EP54 THR 32 VARIANT 3   14 
5 4P5K GLY E 13 ? PDB ?      ?   ?  linker  -13 15 
5 4P5K GLY E 14 ? PDB ?      ?   ?  linker  -12 16 
5 4P5K SER E 15 ? PDB ?      ?   ?  linker  -11 17 
5 4P5K LEU E 16 ? PDB ?      ?   ?  linker  -10 18 
5 4P5K VAL E 17 ? PDB ?      ?   ?  linker  -9  19 
5 4P5K PRO E 18 ? PDB ?      ?   ?  linker  -8  20 
5 4P5K ARG E 19 ? PDB ?      ?   ?  linker  -7  21 
5 4P5K GLY E 20 ? PDB ?      ?   ?  linker  -6  22 
5 4P5K SER E 21 ? PDB ?      ?   ?  linker  -5  23 
5 4P5K GLY E 22 ? PDB ?      ?   ?  linker  -4  24 
5 4P5K GLY E 23 ? PDB ?      ?   ?  linker  -3  25 
5 4P5K GLY E 24 ? PDB ?      ?   ?  linker  -2  26 
5 4P5K GLY E 25 ? PDB ?      ?   ?  linker  -1  27 
6 4P5K SER E 26 ? UNP Q5EP54 THR 32 VARIANT 3   28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4P5K 
_exptl.crystals_number            1 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            2.43 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         49.36 
_exptl_crystal.description                 . 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            316 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    '0.2 M ammonium formate and 25 % PEG 4000 in 0.1 M HEPES buffer' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2010-03-15 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    . 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  0.99 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        0.99 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            . 
_reflns.entry_id                         4P5K 
_reflns.data_reduction_details           . 
_reflns.data_reduction_method            . 
_reflns.d_resolution_high                2.6 
_reflns.d_resolution_low                 50 
_reflns.details                          . 
_reflns.limit_h_max                      . 
_reflns.limit_h_min                      . 
_reflns.limit_k_max                      . 
_reflns.limit_k_min                      . 
_reflns.limit_l_max                      . 
_reflns.limit_l_min                      . 
_reflns.number_all                       . 
_reflns.number_obs                       26282 
_reflns.observed_criterion               . 
_reflns.observed_criterion_F_max         . 
_reflns.observed_criterion_F_min         . 
_reflns.observed_criterion_I_max         . 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_sigma_F       . 
_reflns.observed_criterion_sigma_I       . 
_reflns.percent_possible_obs             92.6 
_reflns.R_free_details                   . 
_reflns.Rmerge_F_all                     . 
_reflns.Rmerge_F_obs                     . 
_reflns.Friedel_coverage                 . 
_reflns.number_gt                        . 
_reflns.threshold_expression             . 
_reflns.pdbx_redundancy                  3.1 
_reflns.pdbx_Rmerge_I_obs                . 
_reflns.pdbx_Rmerge_I_all                . 
_reflns.pdbx_Rsym_value                  . 
_reflns.pdbx_netI_over_av_sigmaI         . 
_reflns.pdbx_netI_over_sigmaI            18.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.pdbx_chi_squared                 . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_res_high_opt              . 
_reflns.pdbx_d_res_low_opt               . 
_reflns.pdbx_d_res_opt_method            . 
_reflns.phase_calculation_details        . 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_Rpim_I_all                  . 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_number_measured_all         . 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
# 
_refine.aniso_B[1][1]                            -0.0900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0400 
_refine.aniso_B[2][2]                            0.0900 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            0.0200 
_refine.B_iso_max                                92.560 
_refine.B_iso_mean                               31.1440 
_refine.B_iso_min                                7.000 
_refine.correlation_coeff_Fo_to_Fc               0.9260 
_refine.correlation_coeff_Fo_to_Fc_free          0.8750 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : RESIDUAL ONLY' 
_refine.diff_density_max                         . 
_refine.diff_density_max_esd                     . 
_refine.diff_density_min                         . 
_refine.diff_density_min_esd                     . 
_refine.diff_density_rms                         . 
_refine.diff_density_rms_esd                     . 
_refine.entry_id                                 4P5K 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 . 
_refine.ls_abs_structure_Flack                   . 
_refine.ls_abs_structure_Flack_esd               . 
_refine.ls_abs_structure_Rogers                  . 
_refine.ls_abs_structure_Rogers_esd              . 
_refine.ls_d_res_high                            2.5900 
_refine.ls_d_res_low                             44.6200 
_refine.ls_extinction_coef                       . 
_refine.ls_extinction_coef_esd                   . 
_refine.ls_extinction_expression                 . 
_refine.ls_extinction_method                     . 
_refine.ls_goodness_of_fit_all                   . 
_refine.ls_goodness_of_fit_all_esd               . 
_refine.ls_goodness_of_fit_obs                   . 
_refine.ls_goodness_of_fit_obs_esd               . 
_refine.ls_hydrogen_treatment                    . 
_refine.ls_matrix_type                           . 
_refine.ls_number_constraints                    . 
_refine.ls_number_parameters                     . 
_refine.ls_number_reflns_all                     . 
_refine.ls_number_reflns_obs                     24286 
_refine.ls_number_reflns_R_free                  1243 
_refine.ls_number_reflns_R_work                  23043 
_refine.ls_number_restraints                     . 
_refine.ls_percent_reflns_obs                    91.1900 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          . 
_refine.ls_R_factor_obs                          0.2245 
_refine.ls_R_factor_R_free                       0.2810 
_refine.ls_R_factor_R_free_error                 . 
_refine.ls_R_factor_R_free_error_details         . 
_refine.ls_R_factor_R_work                       0.2213 
_refine.ls_R_Fsqd_factor_obs                     . 
_refine.ls_R_I_factor_obs                        . 
_refine.ls_redundancy_reflns_all                 . 
_refine.ls_redundancy_reflns_obs                 . 
_refine.ls_restrained_S_all                      . 
_refine.ls_restrained_S_obs                      . 
_refine.ls_shift_over_esd_max                    . 
_refine.ls_shift_over_esd_mean                   . 
_refine.ls_structure_factor_coef                 . 
_refine.ls_weighting_details                     . 
_refine.ls_weighting_scheme                      . 
_refine.ls_wR_factor_all                         . 
_refine.ls_wR_factor_obs                         . 
_refine.ls_wR_factor_R_free                      . 
_refine.ls_wR_factor_R_work                      . 
_refine.occupancy_max                            . 
_refine.occupancy_min                            . 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 . 
_refine.solvent_model_param_ksol                 . 
_refine.ls_R_factor_gt                           . 
_refine.ls_goodness_of_fit_gt                    . 
_refine.ls_goodness_of_fit_ref                   . 
_refine.ls_shift_over_su_max                     . 
_refine.ls_shift_over_su_max_lt                  . 
_refine.ls_shift_over_su_mean                    . 
_refine.ls_shift_over_su_mean_lt                 . 
_refine.pdbx_ls_sigma_I                          . 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       . 
_refine.pdbx_data_cutoff_high_absF               . 
_refine.pdbx_data_cutoff_high_rms_absF           . 
_refine.pdbx_data_cutoff_low_absF                . 
_refine.pdbx_isotropic_thermal_model             . 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      . 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     . 
_refine.pdbx_overall_ESU_R                       . 
_refine.pdbx_overall_ESU_R_Free                  0.3970 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        . 
_refine.pdbx_density_correlation                 . 
_refine.pdbx_pd_number_of_powder_patterns        . 
_refine.pdbx_pd_number_of_points                 . 
_refine.pdbx_pd_meas_number_of_points            . 
_refine.pdbx_pd_proc_ls_prof_R_factor            . 
_refine.pdbx_pd_proc_ls_prof_wR_factor           . 
_refine.pdbx_pd_Marquardt_correlation_coeff      . 
_refine.pdbx_pd_Fsqrd_R_factor                   . 
_refine.pdbx_pd_ls_matrix_band_width             . 
_refine.pdbx_overall_phase_error                 . 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   . 
_refine.pdbx_overall_SU_R_free_Blow_DPI          . 
_refine.pdbx_overall_SU_R_Blow_DPI               . 
_refine.pdbx_TLS_residual_ADP_flag               . 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             33.3050 
_refine.overall_SU_ML                            0.3310 
_refine.overall_SU_R_Cruickshank_DPI             . 
_refine.overall_SU_R_free                        . 
_refine.overall_FOM_free_R_set                   . 
_refine.overall_FOM_work_R_set                   . 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.5900 
_refine_hist.d_res_low                        44.6200 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6223 
_refine_hist.pdbx_number_residues_total       758 
_refine_hist.pdbx_B_iso_mean_ligand           79.63 
_refine_hist.pdbx_number_atoms_protein        6222 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' . 0.015  0.022  6400 . r_bond_refined_d       . . 
'X-RAY DIFFRACTION' . 1.626  1.928  8706 . r_angle_refined_deg    . . 
'X-RAY DIFFRACTION' . 7.599  5.000  750  . r_dihedral_angle_1_deg . . 
'X-RAY DIFFRACTION' . 37.097 24.444 360  . r_dihedral_angle_2_deg . . 
'X-RAY DIFFRACTION' . 21.840 15.000 1014 . r_dihedral_angle_3_deg . . 
'X-RAY DIFFRACTION' . 23.378 15.000 38   . r_dihedral_angle_4_deg . . 
'X-RAY DIFFRACTION' . 0.113  0.200  914  . r_chiral_restr         . . 
'X-RAY DIFFRACTION' . 0.007  0.021  5080 . r_gen_planes_refined   . . 
'X-RAY DIFFRACTION' . 0.609  1.500  3784 . r_mcbond_it            . . 
'X-RAY DIFFRACTION' . 1.185  2.000  6146 . r_mcangle_it           . . 
'X-RAY DIFFRACTION' . 1.732  3.000  2616 . r_scbond_it            . . 
'X-RAY DIFFRACTION' . 2.899  4.500  2560 . r_scangle_it           . . 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.5910 
_refine_ls_shell.d_res_low                        2.6580 
_refine_ls_shell.number_reflns_all                763 
_refine_ls_shell.number_reflns_obs                . 
_refine_ls_shell.number_reflns_R_free             39 
_refine_ls_shell.number_reflns_R_work             724 
_refine_ls_shell.percent_reflns_obs               39.2500 
_refine_ls_shell.percent_reflns_R_free            . 
_refine_ls_shell.R_factor_all                     . 
_refine_ls_shell.R_factor_obs                     . 
_refine_ls_shell.R_factor_R_free                  0.4180 
_refine_ls_shell.R_factor_R_free_error            . 
_refine_ls_shell.R_factor_R_work                  0.3110 
_refine_ls_shell.redundancy_reflns_all            . 
_refine_ls_shell.redundancy_reflns_obs            . 
_refine_ls_shell.wR_factor_all                    . 
_refine_ls_shell.wR_factor_obs                    . 
_refine_ls_shell.wR_factor_R_free                 . 
_refine_ls_shell.wR_factor_R_work                 . 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 . 
# 
_struct.entry_id                     4P5K 
_struct.title                        
'Structural Basis of Chronic Beryllium Disease: Bridging the Gap Between Allergy and Autoimmunity' 
_struct.pdbx_descriptor              'HLA-DP2 alpha chain, HLA-DP2 beta chain' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4P5K 
_struct_keywords.text            'MHC, TCR, complex, HLA, Chronic Beryllium Disease, allergy, autoimmunity, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 45  ? GLN A 50  ? LEU A 45 GLN A 50 1 ? 6  
HELX_P HELX_P2  AA2 ALA A 56  ? ASN A 78  ? ALA A 56 ASN A 78 1 ? 23 
HELX_P HELX_P3  AA3 GLY B 75  ? ASN B 83  ? GLY B 52 ASN B 60 1 ? 9  
HELX_P HELX_P4  AA4 GLN B 85  ? VAL B 95  ? GLN B 62 VAL B 72 1 ? 11 
HELX_P HELX_P5  AA5 ARG B 98  ? GLY B 108 ? ARG B 75 GLY B 85 1 ? 11 
HELX_P HELX_P6  AA6 PRO B 109 ? THR B 111 ? PRO B 86 THR B 88 5 ? 3  
HELX_P HELX_P7  AA7 LEU C 45  ? PHE C 52  ? LEU D 45 PHE D 52 1 ? 8  
HELX_P HELX_P8  AA8 ALA C 56  ? SER C 77  ? ALA D 56 SER D 77 1 ? 22 
HELX_P HELX_P9  AA9 THR D 72  ? LEU D 74  ? THR E 49 LEU E 51 5 ? 3  
HELX_P HELX_P10 AB1 GLY D 75  ? ASN D 83  ? GLY E 52 ASN E 60 1 ? 9  
HELX_P HELX_P11 AB2 GLN D 85  ? ALA D 94  ? GLN E 62 ALA E 71 1 ? 10 
HELX_P HELX_P12 AB3 ARG D 98  ? GLN D 113 ? ARG E 75 GLN E 90 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 107 SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 107 A CYS 163 1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf2 disulf ? ? B CYS 38  SG ? ? ? 1_555 B CYS 100 SG ? ? B CYS 15  B CYS 77  1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf3 disulf ? ? B CYS 138 SG ? ? ? 1_555 B CYS 194 SG ? ? B CYS 115 B CYS 171 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4 disulf ? ? C CYS 107 SG ? ? ? 1_555 C CYS 163 SG ? ? D CYS 107 D CYS 163 1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf5 disulf ? ? D CYS 38  SG ? ? ? 1_555 D CYS 100 SG ? ? E CYS 15  E CYS 77  1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf6 disulf ? ? D CYS 138 SG ? ? ? 1_555 D CYS 194 SG ? ? E CYS 115 E CYS 171 1_555 ? ? ? ? ? ? ? 2.046 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 113 A . ? PHE 113 A PRO 114 A ? PRO 114 A 1 -1.99 
2 TYR 144 B . ? TYR 121 B PRO 145 B ? PRO 122 B 1 6.85  
3 PHE 113 C . ? PHE 113 D PRO 114 C ? PRO 114 D 1 4.09  
4 TYR 144 D . ? TYR 121 E PRO 145 D ? PRO 122 E 1 -2.00 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 8 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA8 6 7 ? anti-parallel 
AA8 7 8 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 40  ? TRP A 43  ? GLU A 40  TRP A 43  
AA1 2 ASP A 29  ? ASP A 35  ? ASP A 29  ASP A 35  
AA1 3 GLY A 20  ? PHE A 26  ? GLY A 20  PHE A 26  
AA1 4 VAL A 6   ? GLN A 14  ? VAL A 6   GLN A 14  
AA1 5 LEU B 31  ? TYR B 39  ? LEU B 8   TYR B 16  
AA1 6 ARG B 46  ? TYR B 53  ? ARG B 23  TYR B 30  
AA1 7 GLU B 56  ? ASP B 62  ? GLU B 33  ASP B 39  
AA1 8 GLU B 67  ? ALA B 70  ? GLU B 44  ALA B 47  
AA2 1 GLU A 88  ? PRO A 93  ? GLU A 88  PRO A 93  
AA2 2 ASN A 103 ? PHE A 112 ? ASN A 103 PHE A 112 
AA2 3 PHE A 145 ? PHE A 153 ? PHE A 145 PHE A 153 
AA2 4 VAL A 132 ? GLU A 134 ? VAL A 132 GLU A 134 
AA3 1 GLU A 88  ? PRO A 93  ? GLU A 88  PRO A 93  
AA3 2 ASN A 103 ? PHE A 112 ? ASN A 103 PHE A 112 
AA3 3 PHE A 145 ? PHE A 153 ? PHE A 145 PHE A 153 
AA3 4 LEU A 138 ? PRO A 139 ? LEU A 138 PRO A 139 
AA4 1 GLU A 126 ? LEU A 127 ? GLU A 126 LEU A 127 
AA4 2 ASN A 118 ? CYS A 123 ? ASN A 118 CYS A 123 
AA4 3 PHE A 160 ? GLU A 166 ? PHE A 160 GLU A 166 
AA4 4 LEU A 174 ? GLU A 179 ? LEU A 174 GLU A 179 
AA5 1 ARG B 119 ? SER B 125 ? ARG B 96  SER B 102 
AA5 2 LEU B 135 ? PHE B 143 ? LEU B 112 PHE B 120 
AA5 3 PHE B 176 ? GLU B 183 ? PHE B 153 GLU B 160 
AA5 4 VAL B 163 ? SER B 165 ? VAL B 140 SER B 142 
AA6 1 ARG B 119 ? SER B 125 ? ARG B 96  SER B 102 
AA6 2 LEU B 135 ? PHE B 143 ? LEU B 112 PHE B 120 
AA6 3 PHE B 176 ? GLU B 183 ? PHE B 153 GLU B 160 
AA6 4 ILE B 169 ? ARG B 170 ? ILE B 146 ARG B 147 
AA7 1 GLN B 157 ? GLU B 158 ? GLN B 134 GLU B 135 
AA7 2 GLN B 149 ? LEU B 154 ? GLN B 126 LEU B 131 
AA7 3 ASP B 190 ? GLU B 197 ? ASP B 167 GLU B 174 
AA7 4 VAL B 205 ? ALA B 211 ? VAL B 182 ALA B 188 
AA8 1 GLU C 40  ? TRP C 43  ? GLU D 40  TRP D 43  
AA8 2 ASP C 29  ? ASP C 35  ? ASP D 29  ASP D 35  
AA8 3 GLY C 20  ? PHE C 26  ? GLY D 20  PHE D 26  
AA8 4 HIS C 5   ? GLN C 14  ? HIS D 5   GLN D 14  
AA8 5 LEU D 31  ? ALA D 40  ? LEU E 8   ALA E 17  
AA8 6 GLN D 45  ? TYR D 53  ? GLN E 22  TYR E 30  
AA8 7 GLU D 56  ? ASP D 62  ? GLU E 33  ASP E 39  
AA8 8 PHE D 68  ? ALA D 70  ? PHE E 45  ALA E 47  
AA9 1 GLU C 88  ? PRO C 93  ? GLU D 88  PRO D 93  
AA9 2 ASN C 103 ? PHE C 112 ? ASN D 103 PHE D 112 
AA9 3 PHE C 145 ? PHE C 153 ? PHE D 145 PHE D 153 
AA9 4 VAL C 132 ? GLU C 134 ? VAL D 132 GLU D 134 
AB1 1 GLU C 88  ? PRO C 93  ? GLU D 88  PRO D 93  
AB1 2 ASN C 103 ? PHE C 112 ? ASN D 103 PHE D 112 
AB1 3 PHE C 145 ? PHE C 153 ? PHE D 145 PHE D 153 
AB1 4 LEU C 138 ? PRO C 139 ? LEU D 138 PRO D 139 
AB2 1 GLU C 126 ? VAL C 128 ? GLU D 126 VAL D 128 
AB2 2 ASN C 118 ? CYS C 123 ? ASN D 118 CYS D 123 
AB2 3 TYR C 161 ? GLU C 166 ? TYR D 161 GLU D 166 
AB2 4 LEU C 174 ? TRP C 178 ? LEU D 174 TRP D 178 
AB3 1 ARG D 119 ? SER D 123 ? ARG E 96  SER E 100 
AB3 2 LEU D 135 ? PHE D 143 ? LEU E 112 PHE E 120 
AB3 3 PHE D 176 ? GLU D 183 ? PHE E 153 GLU E 160 
AB3 4 VAL D 163 ? SER D 165 ? VAL E 140 SER E 142 
AB4 1 ARG D 119 ? SER D 123 ? ARG E 96  SER E 100 
AB4 2 LEU D 135 ? PHE D 143 ? LEU E 112 PHE E 120 
AB4 3 PHE D 176 ? GLU D 183 ? PHE E 153 GLU E 160 
AB4 4 ILE D 169 ? ARG D 170 ? ILE E 146 ARG E 147 
AB5 1 GLN D 157 ? GLU D 159 ? GLN E 134 GLU E 136 
AB5 2 GLN D 149 ? LEU D 154 ? GLN E 126 LEU E 131 
AB5 3 VAL D 191 ? GLU D 197 ? VAL E 168 GLU E 174 
AB5 4 VAL D 205 ? LYS D 210 ? VAL E 182 LYS E 187 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 42  ? O VAL A 42  N TYR A 33  ? N TYR A 33  
AA1 2 3 O MET A 31  ? O MET A 31  N PHE A 24  ? N PHE A 24  
AA1 3 4 O GLU A 21  ? O GLU A 21  N PHE A 12  ? N PHE A 12  
AA1 4 5 N SER A 7   ? N SER A 7   O CYS B 38  ? O CYS B 15  
AA1 5 6 N GLN B 33  ? N GLN B 10  O ILE B 52  ? O ILE B 29  
AA1 6 7 N GLU B 49  ? N GLU B 26  O PHE B 61  ? O PHE B 38  
AA1 7 8 N ARG B 60  ? N ARG B 37  O ARG B 69  ? O ARG B 46  
AA2 1 2 N PHE A 92  ? N PHE A 92  O ILE A 106 ? O ILE A 106 
AA2 2 3 N LEU A 105 ? N LEU A 105 O LEU A 151 ? O LEU A 151 
AA2 3 4 O TYR A 150 ? O TYR A 150 N ALA A 133 ? N ALA A 133 
AA3 1 2 N PHE A 92  ? N PHE A 92  O ILE A 106 ? O ILE A 106 
AA3 2 3 N LEU A 105 ? N LEU A 105 O LEU A 151 ? O LEU A 151 
AA3 3 4 O HIS A 146 ? O HIS A 146 N LEU A 138 ? N LEU A 138 
AA4 1 2 O GLU A 126 ? O GLU A 126 N CYS A 123 ? N CYS A 123 
AA4 2 3 N THR A 120 ? N THR A 120 O ARG A 164 ? O ARG A 164 
AA4 3 4 N VAL A 165 ? N VAL A 165 O LEU A 174 ? O LEU A 174 
AA5 1 2 N ARG B 119 ? N ARG B 96  O THR B 141 ? O THR B 118 
AA5 2 3 N VAL B 140 ? N VAL B 117 O ILE B 178 ? O ILE B 155 
AA5 3 4 O MET B 181 ? O MET B 158 N VAL B 164 ? N VAL B 141 
AA6 1 2 N ARG B 119 ? N ARG B 96  O THR B 141 ? O THR B 118 
AA6 2 3 N VAL B 140 ? N VAL B 117 O ILE B 178 ? O ILE B 155 
AA6 3 4 O GLN B 177 ? O GLN B 154 N ILE B 169 ? N ILE B 146 
AA7 1 2 O GLN B 157 ? O GLN B 134 N LEU B 154 ? N LEU B 131 
AA7 2 3 N PHE B 153 ? N PHE B 130 O THR B 193 ? O THR B 170 
AA7 3 4 N ASP B 190 ? N ASP B 167 O ALA B 211 ? O ALA B 188 
AA8 1 2 O VAL C 42  ? O VAL D 42  N TYR C 33  ? N TYR D 33  
AA8 2 3 O MET C 31  ? O MET D 31  N PHE C 24  ? N PHE D 24  
AA8 3 4 O GLU C 25  ? O GLU D 25  N THR C 8   ? N THR D 8   
AA8 4 5 N HIS C 5   ? N HIS D 5   O ALA D 40  ? O ALA E 17  
AA8 5 6 N GLU D 37  ? N GLU E 14  O LEU D 48  ? O LEU E 25  
AA8 6 7 N TYR D 53  ? N TYR E 30  O GLU D 56  ? O GLU E 33  
AA8 7 8 N ARG D 60  ? N ARG E 37  O ARG D 69  ? O ARG E 46  
AA9 1 2 N PHE C 92  ? N PHE D 92  O ILE C 106 ? O ILE D 106 
AA9 2 3 N ASN C 103 ? N ASN D 103 O PHE C 153 ? O PHE D 153 
AA9 3 4 O TYR C 150 ? O TYR D 150 N ALA C 133 ? N ALA D 133 
AB1 1 2 N PHE C 92  ? N PHE D 92  O ILE C 106 ? O ILE D 106 
AB1 2 3 N ASN C 103 ? N ASN D 103 O PHE C 153 ? O PHE D 153 
AB1 3 4 O HIS C 146 ? O HIS D 146 N LEU C 138 ? N LEU D 138 
AB2 1 2 O GLU C 126 ? O GLU D 126 N CYS C 123 ? N CYS D 123 
AB2 2 3 N THR C 120 ? N THR D 120 O ARG C 164 ? O ARG D 164 
AB2 3 4 N TYR C 161 ? N TYR D 161 O TRP C 178 ? O TRP D 178 
AB3 1 2 N SER D 123 ? N SER E 100 O VAL D 137 ? O VAL E 114 
AB3 2 3 N CYS D 138 ? N CYS E 115 O VAL D 180 ? O VAL E 157 
AB3 3 4 O MET D 181 ? O MET E 158 N VAL D 164 ? N VAL E 141 
AB4 1 2 N SER D 123 ? N SER E 100 O VAL D 137 ? O VAL E 114 
AB4 2 3 N CYS D 138 ? N CYS E 115 O VAL D 180 ? O VAL E 157 
AB4 3 4 O GLN D 177 ? O GLN E 154 N ILE D 169 ? N ILE E 146 
AB5 1 2 O GLU D 159 ? O GLU E 136 N TRP D 152 ? N TRP E 129 
AB5 2 3 N ARG D 151 ? N ARG E 128 O GLN D 195 ? O GLN E 172 
AB5 3 4 N TYR D 192 ? N TYR E 169 O TRP D 209 ? O TRP E 186 
# 
_atom_sites.entry_id                    4P5K 
_atom_sites.fract_transf_matrix[1][1]   0.005471 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001540 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014548 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014604 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ILE A 1 1   ? 34.216 -37.437 0.696   1.00 61.73  ? 1   ILE A N   1 
ATOM 2    C CA  . ILE A 1 1   ? 35.317 -38.427 0.829   1.00 62.11  ? 1   ILE A CA  1 
ATOM 3    C C   . ILE A 1 1   ? 36.565 -37.786 1.490   1.00 63.74  ? 1   ILE A C   1 
ATOM 4    O O   . ILE A 1 1   ? 37.448 -38.510 2.007   1.00 65.29  ? 1   ILE A O   1 
ATOM 5    C CB  . ILE A 1 1   ? 35.629 -39.141 -0.560  1.00 60.76  ? 1   ILE A CB  1 
ATOM 6    C CG1 . ILE A 1 1   ? 34.917 -40.494 -0.678  1.00 59.65  ? 1   ILE A CG1 1 
ATOM 7    C CG2 . ILE A 1 1   ? 37.110 -39.367 -0.787  1.00 60.82  ? 1   ILE A CG2 1 
ATOM 8    C CD1 . ILE A 1 1   ? 33.511 -40.416 -1.329  1.00 57.76  ? 1   ILE A CD1 1 
ATOM 9    N N   . LYS A 1 2   ? 36.624 -36.445 1.509   1.00 63.02  ? 2   LYS A N   1 
ATOM 10   C CA  . LYS A 1 2   ? 37.858 -35.692 1.896   1.00 63.48  ? 2   LYS A CA  1 
ATOM 11   C C   . LYS A 1 2   ? 38.929 -35.813 0.800   1.00 61.84  ? 2   LYS A C   1 
ATOM 12   O O   . LYS A 1 2   ? 39.838 -36.641 0.898   1.00 62.55  ? 2   LYS A O   1 
ATOM 13   C CB  . LYS A 1 2   ? 38.470 -36.149 3.238   1.00 65.24  ? 2   LYS A CB  1 
ATOM 14   C CG  . LYS A 1 2   ? 37.510 -36.280 4.418   1.00 67.40  ? 2   LYS A CG  1 
ATOM 15   C CD  . LYS A 1 2   ? 38.095 -37.154 5.550   1.00 70.32  ? 2   LYS A CD  1 
ATOM 16   C CE  . LYS A 1 2   ? 38.248 -38.630 5.124   1.00 71.04  ? 2   LYS A CE  1 
ATOM 17   N NZ  . LYS A 1 2   ? 38.479 -39.566 6.270   1.00 74.21  ? 2   LYS A NZ  1 
ATOM 18   N N   . ALA A 1 3   ? 38.786 -35.013 -0.255  1.00 59.12  ? 3   ALA A N   1 
ATOM 19   C CA  . ALA A 1 3   ? 39.782 -34.925 -1.313  1.00 56.75  ? 3   ALA A CA  1 
ATOM 20   C C   . ALA A 1 3   ? 40.025 -33.453 -1.627  1.00 55.66  ? 3   ALA A C   1 
ATOM 21   O O   . ALA A 1 3   ? 39.291 -32.592 -1.165  1.00 55.76  ? 3   ALA A O   1 
ATOM 22   C CB  . ALA A 1 3   ? 39.300 -35.660 -2.532  1.00 55.18  ? 3   ALA A CB  1 
ATOM 23   N N   . ASP A 1 4   ? 41.046 -33.134 -2.403  1.00 54.27  ? 4   ASP A N   1 
ATOM 24   C CA  . ASP A 1 4   ? 41.205 -31.737 -2.761  1.00 53.19  ? 4   ASP A CA  1 
ATOM 25   C C   . ASP A 1 4   ? 40.447 -31.467 -4.017  1.00 50.18  ? 4   ASP A C   1 
ATOM 26   O O   . ASP A 1 4   ? 40.013 -30.343 -4.240  1.00 49.31  ? 4   ASP A O   1 
ATOM 27   C CB  . ASP A 1 4   ? 42.669 -31.333 -2.913  1.00 54.49  ? 4   ASP A CB  1 
ATOM 28   C CG  . ASP A 1 4   ? 43.425 -31.434 -1.609  1.00 57.56  ? 4   ASP A CG  1 
ATOM 29   O OD1 . ASP A 1 4   ? 42.754 -31.409 -0.548  1.00 57.40  ? 4   ASP A OD1 1 
ATOM 30   O OD2 . ASP A 1 4   ? 44.677 -31.571 -1.648  1.00 61.01  ? 4   ASP A OD2 1 
ATOM 31   N N   . HIS A 1 5   ? 40.270 -32.530 -4.806  1.00 48.12  ? 5   HIS A N   1 
ATOM 32   C CA  . HIS A 1 5   ? 39.758 -32.456 -6.170  1.00 45.44  ? 5   HIS A CA  1 
ATOM 33   C C   . HIS A 1 5   ? 39.227 -33.792 -6.636  1.00 44.35  ? 5   HIS A C   1 
ATOM 34   O O   . HIS A 1 5   ? 39.766 -34.838 -6.279  1.00 44.91  ? 5   HIS A O   1 
ATOM 35   C CB  . HIS A 1 5   ? 40.855 -32.012 -7.120  1.00 44.85  ? 5   HIS A CB  1 
ATOM 36   C CG  . HIS A 1 5   ? 41.425 -30.669 -6.798  1.00 45.78  ? 5   HIS A CG  1 
ATOM 37   N ND1 . HIS A 1 5   ? 40.677 -29.512 -6.844  1.00 46.43  ? 5   HIS A ND1 1 
ATOM 38   C CD2 . HIS A 1 5   ? 42.672 -30.294 -6.427  1.00 47.48  ? 5   HIS A CD2 1 
ATOM 39   C CE1 . HIS A 1 5   ? 41.438 -28.482 -6.520  1.00 47.02  ? 5   HIS A CE1 1 
ATOM 40   N NE2 . HIS A 1 5   ? 42.654 -28.929 -6.262  1.00 49.15  ? 5   HIS A NE2 1 
ATOM 41   N N   . VAL A 1 6   ? 38.185 -33.745 -7.466  1.00 42.83  ? 6   VAL A N   1 
ATOM 42   C CA  . VAL A 1 6   ? 37.506 -34.937 -7.956  1.00 41.68  ? 6   VAL A CA  1 
ATOM 43   C C   . VAL A 1 6   ? 37.340 -34.903 -9.498  1.00 40.54  ? 6   VAL A C   1 
ATOM 44   O O   . VAL A 1 6   ? 36.767 -33.952 -10.056 1.00 40.32  ? 6   VAL A O   1 
ATOM 45   C CB  . VAL A 1 6   ? 36.162 -35.075 -7.234  1.00 41.43  ? 6   VAL A CB  1 
ATOM 46   C CG1 . VAL A 1 6   ? 35.610 -36.486 -7.361  1.00 42.44  ? 6   VAL A CG1 1 
ATOM 47   C CG2 . VAL A 1 6   ? 36.337 -34.734 -5.746  1.00 42.93  ? 6   VAL A CG2 1 
ATOM 48   N N   . SER A 1 7   ? 37.879 -35.920 -10.177 1.00 39.92  ? 7   SER A N   1 
ATOM 49   C CA  . SER A 1 7   ? 37.831 -36.039 -11.643 1.00 38.60  ? 7   SER A CA  1 
ATOM 50   C C   . SER A 1 7   ? 37.178 -37.354 -12.008 1.00 38.40  ? 7   SER A C   1 
ATOM 51   O O   . SER A 1 7   ? 37.704 -38.440 -11.709 1.00 39.19  ? 7   SER A O   1 
ATOM 52   C CB  . SER A 1 7   ? 39.223 -36.020 -12.265 1.00 38.93  ? 7   SER A CB  1 
ATOM 53   O OG  . SER A 1 7   ? 39.904 -34.813 -12.010 1.00 38.99  ? 7   SER A OG  1 
ATOM 54   N N   . THR A 1 8   ? 36.036 -37.257 -12.672 1.00 37.23  ? 8   THR A N   1 
ATOM 55   C CA  . THR A 1 8   ? 35.173 -38.397 -12.820 1.00 36.62  ? 8   THR A CA  1 
ATOM 56   C C   . THR A 1 8   ? 34.602 -38.483 -14.234 1.00 35.51  ? 8   THR A C   1 
ATOM 57   O O   . THR A 1 8   ? 34.106 -37.510 -14.777 1.00 35.40  ? 8   THR A O   1 
ATOM 58   C CB  . THR A 1 8   ? 34.070 -38.386 -11.727 1.00 36.88  ? 8   THR A CB  1 
ATOM 59   O OG1 . THR A 1 8   ? 32.933 -37.663 -12.182 1.00 36.66  ? 8   THR A OG1 1 
ATOM 60   C CG2 . THR A 1 8   ? 34.582 -37.704 -10.424 1.00 37.42  ? 8   THR A CG2 1 
ATOM 61   N N   . TYR A 1 9   ? 34.741 -39.644 -14.845 1.00 35.27  ? 9   TYR A N   1 
ATOM 62   C CA  . TYR A 1 9   ? 34.013 -39.946 -16.052 1.00 35.25  ? 9   TYR A CA  1 
ATOM 63   C C   . TYR A 1 9   ? 32.634 -40.384 -15.585 1.00 35.46  ? 9   TYR A C   1 
ATOM 64   O O   . TYR A 1 9   ? 32.524 -41.210 -14.679 1.00 36.67  ? 9   TYR A O   1 
ATOM 65   C CB  . TYR A 1 9   ? 34.671 -41.078 -16.856 1.00 35.15  ? 9   TYR A CB  1 
ATOM 66   C CG  . TYR A 1 9   ? 35.920 -40.689 -17.617 1.00 33.87  ? 9   TYR A CG  1 
ATOM 67   C CD1 . TYR A 1 9   ? 37.200 -40.895 -17.064 1.00 32.37  ? 9   TYR A CD1 1 
ATOM 68   C CD2 . TYR A 1 9   ? 35.839 -40.106 -18.897 1.00 35.37  ? 9   TYR A CD2 1 
ATOM 69   C CE1 . TYR A 1 9   ? 38.371 -40.546 -17.759 1.00 29.69  ? 9   TYR A CE1 1 
ATOM 70   C CE2 . TYR A 1 9   ? 37.036 -39.746 -19.624 1.00 33.27  ? 9   TYR A CE2 1 
ATOM 71   C CZ  . TYR A 1 9   ? 38.276 -39.981 -19.029 1.00 31.02  ? 9   TYR A CZ  1 
ATOM 72   O OH  . TYR A 1 9   ? 39.412 -39.639 -19.695 1.00 32.05  ? 9   TYR A OH  1 
ATOM 73   N N   . ALA A 1 10  ? 31.584 -39.816 -16.170 1.00 34.81  ? 10  ALA A N   1 
ATOM 74   C CA  . ALA A 1 10  ? 30.229 -40.200 -15.805 1.00 34.76  ? 10  ALA A CA  1 
ATOM 75   C C   . ALA A 1 10  ? 29.482 -40.455 -17.078 1.00 34.75  ? 10  ALA A C   1 
ATOM 76   O O   . ALA A 1 10  ? 29.499 -39.629 -17.963 1.00 34.81  ? 10  ALA A O   1 
ATOM 77   C CB  . ALA A 1 10  ? 29.554 -39.088 -15.015 1.00 34.73  ? 10  ALA A CB  1 
ATOM 78   N N   . ALA A 1 11  ? 28.863 -41.618 -17.187 1.00 35.17  ? 11  ALA A N   1 
ATOM 79   C CA  . ALA A 1 11  ? 28.172 -41.982 -18.399 1.00 35.76  ? 11  ALA A CA  1 
ATOM 80   C C   . ALA A 1 11  ? 26.834 -42.602 -18.024 1.00 36.93  ? 11  ALA A C   1 
ATOM 81   O O   . ALA A 1 11  ? 26.683 -43.205 -16.940 1.00 37.63  ? 11  ALA A O   1 
ATOM 82   C CB  . ALA A 1 11  ? 29.005 -42.949 -19.222 1.00 35.76  ? 11  ALA A CB  1 
ATOM 83   N N   . PHE A 1 12  ? 25.850 -42.419 -18.898 1.00 37.16  ? 12  PHE A N   1 
ATOM 84   C CA  . PHE A 1 12  ? 24.552 -43.046 -18.704 1.00 38.04  ? 12  PHE A CA  1 
ATOM 85   C C   . PHE A 1 12  ? 23.918 -43.433 -20.031 1.00 39.07  ? 12  PHE A C   1 
ATOM 86   O O   . PHE A 1 12  ? 24.323 -42.979 -21.117 1.00 38.79  ? 12  PHE A O   1 
ATOM 87   C CB  . PHE A 1 12  ? 23.597 -42.177 -17.859 1.00 37.47  ? 12  PHE A CB  1 
ATOM 88   C CG  . PHE A 1 12  ? 22.996 -41.005 -18.604 1.00 35.10  ? 12  PHE A CG  1 
ATOM 89   C CD1 . PHE A 1 12  ? 23.405 -39.691 -18.308 1.00 33.75  ? 12  PHE A CD1 1 
ATOM 90   C CD2 . PHE A 1 12  ? 22.008 -41.198 -19.567 1.00 32.28  ? 12  PHE A CD2 1 
ATOM 91   C CE1 . PHE A 1 12  ? 22.853 -38.597 -18.976 1.00 31.53  ? 12  PHE A CE1 1 
ATOM 92   C CE2 . PHE A 1 12  ? 21.452 -40.115 -20.258 1.00 31.62  ? 12  PHE A CE2 1 
ATOM 93   C CZ  . PHE A 1 12  ? 21.867 -38.814 -19.962 1.00 31.48  ? 12  PHE A CZ  1 
ATOM 94   N N   . VAL A 1 13  ? 22.886 -44.253 -19.910 1.00 39.82  ? 13  VAL A N   1 
ATOM 95   C CA  . VAL A 1 13  ? 22.325 -44.971 -21.028 1.00 40.44  ? 13  VAL A CA  1 
ATOM 96   C C   . VAL A 1 13  ? 20.904 -45.318 -20.597 1.00 40.75  ? 13  VAL A C   1 
ATOM 97   O O   . VAL A 1 13  ? 20.664 -45.717 -19.461 1.00 40.89  ? 13  VAL A O   1 
ATOM 98   C CB  . VAL A 1 13  ? 23.237 -46.202 -21.316 1.00 41.11  ? 13  VAL A CB  1 
ATOM 99   C CG1 . VAL A 1 13  ? 22.531 -47.525 -21.083 1.00 42.63  ? 13  VAL A CG1 1 
ATOM 100  C CG2 . VAL A 1 13  ? 23.841 -46.109 -22.696 1.00 41.91  ? 13  VAL A CG2 1 
ATOM 101  N N   . GLN A 1 14  ? 19.941 -45.081 -21.464 1.00 41.49  ? 14  GLN A N   1 
ATOM 102  C CA  . GLN A 1 14  ? 18.544 -45.318 -21.092 1.00 42.61  ? 14  GLN A CA  1 
ATOM 103  C C   . GLN A 1 14  ? 17.750 -45.529 -22.349 1.00 44.62  ? 14  GLN A C   1 
ATOM 104  O O   . GLN A 1 14  ? 18.191 -45.140 -23.445 1.00 44.89  ? 14  GLN A O   1 
ATOM 105  C CB  . GLN A 1 14  ? 17.953 -44.160 -20.269 1.00 41.22  ? 14  GLN A CB  1 
ATOM 106  C CG  . GLN A 1 14  ? 17.684 -42.901 -21.058 1.00 39.00  ? 14  GLN A CG  1 
ATOM 107  C CD  . GLN A 1 14  ? 17.339 -41.714 -20.192 1.00 38.97  ? 14  GLN A CD  1 
ATOM 108  O OE1 . GLN A 1 14  ? 16.670 -41.836 -19.163 1.00 35.79  ? 14  GLN A OE1 1 
ATOM 109  N NE2 . GLN A 1 14  ? 17.795 -40.531 -20.618 1.00 39.37  ? 14  GLN A NE2 1 
ATOM 110  N N   . THR A 1 15  ? 16.575 -46.132 -22.192 1.00 46.50  ? 15  THR A N   1 
ATOM 111  C CA  . THR A 1 15  ? 15.688 -46.336 -23.326 1.00 48.27  ? 15  THR A CA  1 
ATOM 112  C C   . THR A 1 15  ? 15.241 -44.999 -23.961 1.00 48.13  ? 15  THR A C   1 
ATOM 113  O O   . THR A 1 15  ? 15.201 -44.889 -25.176 1.00 49.25  ? 15  THR A O   1 
ATOM 114  C CB  . THR A 1 15  ? 14.478 -47.325 -23.012 1.00 49.67  ? 15  THR A CB  1 
ATOM 115  O OG1 . THR A 1 15  ? 13.305 -46.595 -22.669 1.00 50.20  ? 15  THR A OG1 1 
ATOM 116  C CG2 . THR A 1 15  ? 14.797 -48.273 -21.880 1.00 49.27  ? 15  THR A CG2 1 
ATOM 117  N N   . HIS A 1 16  ? 14.952 -43.977 -23.160 1.00 47.90  ? 16  HIS A N   1 
ATOM 118  C CA  . HIS A 1 16  ? 14.281 -42.771 -23.686 1.00 48.81  ? 16  HIS A CA  1 
ATOM 119  C C   . HIS A 1 16  ? 15.142 -41.614 -24.158 1.00 48.13  ? 16  HIS A C   1 
ATOM 120  O O   . HIS A 1 16  ? 16.339 -41.529 -23.900 1.00 47.18  ? 16  HIS A O   1 
ATOM 121  C CB  . HIS A 1 16  ? 13.259 -42.203 -22.687 1.00 48.83  ? 16  HIS A CB  1 
ATOM 122  C CG  . HIS A 1 16  ? 11.882 -42.742 -22.870 1.00 51.37  ? 16  HIS A CG  1 
ATOM 123  N ND1 . HIS A 1 16  ? 11.508 -43.994 -22.430 1.00 53.48  ? 16  HIS A ND1 1 
ATOM 124  C CD2 . HIS A 1 16  ? 10.787 -42.205 -23.459 1.00 53.69  ? 16  HIS A CD2 1 
ATOM 125  C CE1 . HIS A 1 16  ? 10.240 -44.205 -22.739 1.00 56.22  ? 16  HIS A CE1 1 
ATOM 126  N NE2 . HIS A 1 16  ? 9.781  -43.137 -23.369 1.00 55.37  ? 16  HIS A NE2 1 
ATOM 127  N N   . ARG A 1 17  ? 14.464 -40.742 -24.891 1.00 48.92  ? 17  ARG A N   1 
ATOM 128  C CA  . ARG A 1 17  ? 14.783 -39.317 -25.000 1.00 48.20  ? 17  ARG A CA  1 
ATOM 129  C C   . ARG A 1 17  ? 16.194 -39.013 -25.400 1.00 46.48  ? 17  ARG A C   1 
ATOM 130  O O   . ARG A 1 17  ? 16.430 -39.086 -26.613 1.00 48.33  ? 17  ARG A O   1 
ATOM 131  C CB  . ARG A 1 17  ? 14.250 -38.501 -23.798 1.00 48.35  ? 17  ARG A CB  1 
ATOM 132  C CG  . ARG A 1 17  ? 12.673 -38.443 -23.711 1.00 51.04  ? 17  ARG A CG  1 
ATOM 133  C CD  . ARG A 1 17  ? 11.948 -38.525 -25.072 1.00 54.35  ? 17  ARG A CD  1 
ATOM 134  N NE  . ARG A 1 17  ? 12.012 -39.878 -25.643 1.00 57.97  ? 17  ARG A NE  1 
ATOM 135  C CZ  . ARG A 1 17  ? 11.870 -40.175 -26.936 1.00 60.41  ? 17  ARG A CZ  1 
ATOM 136  N NH1 . ARG A 1 17  ? 11.628 -39.218 -27.839 1.00 60.42  ? 17  ARG A NH1 1 
ATOM 137  N NH2 . ARG A 1 17  ? 11.975 -41.441 -27.329 1.00 60.85  ? 17  ARG A NH2 1 
ATOM 138  N N   . PRO A 1 18  ? 17.106 -38.632 -24.442 1.00 43.83  ? 18  PRO A N   1 
ATOM 139  C CA  . PRO A 1 18  ? 18.587 -38.724 -24.670 1.00 41.90  ? 18  PRO A CA  1 
ATOM 140  C C   . PRO A 1 18  ? 19.171 -40.090 -24.264 1.00 40.67  ? 18  PRO A C   1 
ATOM 141  O O   . PRO A 1 18  ? 19.444 -40.362 -23.095 1.00 39.99  ? 18  PRO A O   1 
ATOM 142  C CB  . PRO A 1 18  ? 19.172 -37.587 -23.816 1.00 40.68  ? 18  PRO A CB  1 
ATOM 143  C CG  . PRO A 1 18  ? 18.172 -37.375 -22.717 1.00 40.63  ? 18  PRO A CG  1 
ATOM 144  C CD  . PRO A 1 18  ? 16.802 -37.859 -23.218 1.00 43.05  ? 18  PRO A CD  1 
ATOM 145  N N   . THR A 1 19  ? 19.364 -40.928 -25.263 1.00 40.27  ? 19  THR A N   1 
ATOM 146  C CA  . THR A 1 19  ? 19.642 -42.343 -25.090 1.00 39.64  ? 19  THR A CA  1 
ATOM 147  C C   . THR A 1 19  ? 21.002 -42.695 -24.507 1.00 38.82  ? 19  THR A C   1 
ATOM 148  O O   . THR A 1 19  ? 21.210 -43.797 -24.032 1.00 39.33  ? 19  THR A O   1 
ATOM 149  C CB  . THR A 1 19  ? 19.422 -43.008 -26.430 1.00 40.86  ? 19  THR A CB  1 
ATOM 150  O OG1 . THR A 1 19  ? 18.239 -43.812 -26.348 1.00 41.43  ? 19  THR A OG1 1 
ATOM 151  C CG2 . THR A 1 19  ? 20.650 -43.816 -26.902 1.00 41.93  ? 19  THR A CG2 1 
ATOM 152  N N   . GLY A 1 20  ? 21.927 -41.748 -24.534 1.00 38.05  ? 20  GLY A N   1 
ATOM 153  C CA  . GLY A 1 20  ? 23.262 -41.946 -23.974 1.00 37.28  ? 20  GLY A CA  1 
ATOM 154  C C   . GLY A 1 20  ? 24.094 -40.676 -23.827 1.00 36.36  ? 20  GLY A C   1 
ATOM 155  O O   . GLY A 1 20  ? 24.014 -39.745 -24.655 1.00 35.58  ? 20  GLY A O   1 
ATOM 156  N N   . GLU A 1 21  ? 24.895 -40.635 -22.764 1.00 35.82  ? 21  GLU A N   1 
ATOM 157  C CA  . GLU A 1 21  ? 25.810 -39.504 -22.533 1.00 35.29  ? 21  GLU A CA  1 
ATOM 158  C C   . GLU A 1 21  ? 27.126 -40.022 -22.013 1.00 34.90  ? 21  GLU A C   1 
ATOM 159  O O   . GLU A 1 21  ? 27.161 -40.915 -21.170 1.00 35.45  ? 21  GLU A O   1 
ATOM 160  C CB  . GLU A 1 21  ? 25.213 -38.502 -21.530 1.00 34.31  ? 21  GLU A CB  1 
ATOM 161  C CG  . GLU A 1 21  ? 25.788 -37.088 -21.573 1.00 32.85  ? 21  GLU A CG  1 
ATOM 162  C CD  . GLU A 1 21  ? 24.861 -36.065 -20.890 1.00 35.02  ? 21  GLU A CD  1 
ATOM 163  O OE1 . GLU A 1 21  ? 25.307 -35.445 -19.903 1.00 35.35  ? 21  GLU A OE1 1 
ATOM 164  O OE2 . GLU A 1 21  ? 23.679 -35.883 -21.316 1.00 33.02  ? 21  GLU A OE2 1 
ATOM 165  N N   . PHE A 1 22  ? 28.203 -39.453 -22.523 1.00 34.48  ? 22  PHE A N   1 
ATOM 166  C CA  . PHE A 1 22  ? 29.527 -39.768 -22.059 1.00 33.97  ? 22  PHE A CA  1 
ATOM 167  C C   . PHE A 1 22  ? 30.275 -38.462 -21.795 1.00 34.07  ? 22  PHE A C   1 
ATOM 168  O O   . PHE A 1 22  ? 30.532 -37.664 -22.722 1.00 33.66  ? 22  PHE A O   1 
ATOM 169  C CB  . PHE A 1 22  ? 30.264 -40.603 -23.108 1.00 34.45  ? 22  PHE A CB  1 
ATOM 170  C CG  . PHE A 1 22  ? 31.611 -41.078 -22.652 1.00 35.19  ? 22  PHE A CG  1 
ATOM 171  C CD1 . PHE A 1 22  ? 31.748 -42.314 -22.012 1.00 36.47  ? 22  PHE A CD1 1 
ATOM 172  C CD2 . PHE A 1 22  ? 32.737 -40.272 -22.814 1.00 34.46  ? 22  PHE A CD2 1 
ATOM 173  C CE1 . PHE A 1 22  ? 32.988 -42.741 -21.550 1.00 38.94  ? 22  PHE A CE1 1 
ATOM 174  C CE2 . PHE A 1 22  ? 33.977 -40.690 -22.362 1.00 35.80  ? 22  PHE A CE2 1 
ATOM 175  C CZ  . PHE A 1 22  ? 34.112 -41.931 -21.736 1.00 38.04  ? 22  PHE A CZ  1 
ATOM 176  N N   . MET A 1 23  ? 30.658 -38.244 -20.541 1.00 34.10  ? 23  MET A N   1 
ATOM 177  C CA  . MET A 1 23  ? 31.347 -37.000 -20.207 1.00 34.46  ? 23  MET A CA  1 
ATOM 178  C C   . MET A 1 23  ? 32.411 -37.141 -19.123 1.00 34.11  ? 23  MET A C   1 
ATOM 179  O O   . MET A 1 23  ? 32.568 -38.201 -18.545 1.00 34.51  ? 23  MET A O   1 
ATOM 180  C CB  . MET A 1 23  ? 30.320 -35.959 -19.780 1.00 34.45  ? 23  MET A CB  1 
ATOM 181  C CG  . MET A 1 23  ? 29.726 -36.260 -18.431 1.00 36.35  ? 23  MET A CG  1 
ATOM 182  S SD  . MET A 1 23  ? 29.235 -34.733 -17.635 1.00 43.71  ? 23  MET A SD  1 
ATOM 183  C CE  . MET A 1 23  ? 27.572 -34.655 -18.206 1.00 39.06  ? 23  MET A CE  1 
ATOM 184  N N   . PHE A 1 24  ? 33.108 -36.039 -18.849 1.00 33.82  ? 24  PHE A N   1 
ATOM 185  C CA  . PHE A 1 24  ? 34.157 -35.968 -17.855 1.00 33.36  ? 24  PHE A CA  1 
ATOM 186  C C   . PHE A 1 24  ? 34.170 -34.598 -17.227 1.00 33.36  ? 24  PHE A C   1 
ATOM 187  O O   . PHE A 1 24  ? 33.991 -33.584 -17.915 1.00 32.48  ? 24  PHE A O   1 
ATOM 188  C CB  . PHE A 1 24  ? 35.481 -36.223 -18.526 1.00 34.28  ? 24  PHE A CB  1 
ATOM 189  C CG  . PHE A 1 24  ? 36.660 -35.986 -17.653 1.00 33.68  ? 24  PHE A CG  1 
ATOM 190  C CD1 . PHE A 1 24  ? 37.191 -37.019 -16.902 1.00 33.62  ? 24  PHE A CD1 1 
ATOM 191  C CD2 . PHE A 1 24  ? 37.268 -34.740 -17.610 1.00 33.88  ? 24  PHE A CD2 1 
ATOM 192  C CE1 . PHE A 1 24  ? 38.294 -36.813 -16.102 1.00 33.89  ? 24  PHE A CE1 1 
ATOM 193  C CE2 . PHE A 1 24  ? 38.382 -34.522 -16.816 1.00 34.18  ? 24  PHE A CE2 1 
ATOM 194  C CZ  . PHE A 1 24  ? 38.894 -35.565 -16.061 1.00 34.74  ? 24  PHE A CZ  1 
ATOM 195  N N   . GLU A 1 25  ? 34.386 -34.563 -15.913 1.00 34.00  ? 25  GLU A N   1 
ATOM 196  C CA  . GLU A 1 25  ? 34.269 -33.305 -15.189 1.00 35.10  ? 25  GLU A CA  1 
ATOM 197  C C   . GLU A 1 25  ? 35.387 -33.107 -14.225 1.00 35.63  ? 25  GLU A C   1 
ATOM 198  O O   . GLU A 1 25  ? 35.974 -34.049 -13.764 1.00 36.24  ? 25  GLU A O   1 
ATOM 199  C CB  . GLU A 1 25  ? 32.938 -33.205 -14.446 1.00 35.13  ? 25  GLU A CB  1 
ATOM 200  C CG  . GLU A 1 25  ? 32.691 -34.309 -13.452 1.00 38.84  ? 25  GLU A CG  1 
ATOM 201  C CD  . GLU A 1 25  ? 31.396 -34.127 -12.655 1.00 45.27  ? 25  GLU A CD  1 
ATOM 202  O OE1 . GLU A 1 25  ? 31.038 -35.071 -11.902 1.00 48.76  ? 25  GLU A OE1 1 
ATOM 203  O OE2 . GLU A 1 25  ? 30.729 -33.063 -12.756 1.00 46.14  ? 25  GLU A OE2 1 
ATOM 204  N N   . PHE A 1 26  ? 35.660 -31.859 -13.903 1.00 36.56  ? 26  PHE A N   1 
ATOM 205  C CA  . PHE A 1 26  ? 36.641 -31.537 -12.901 1.00 37.50  ? 26  PHE A CA  1 
ATOM 206  C C   . PHE A 1 26  ? 36.033 -30.675 -11.791 1.00 39.04  ? 26  PHE A C   1 
ATOM 207  O O   . PHE A 1 26  ? 35.638 -29.512 -12.017 1.00 39.02  ? 26  PHE A O   1 
ATOM 208  C CB  . PHE A 1 26  ? 37.780 -30.797 -13.549 1.00 37.58  ? 26  PHE A CB  1 
ATOM 209  C CG  . PHE A 1 26  ? 38.791 -30.345 -12.587 1.00 38.43  ? 26  PHE A CG  1 
ATOM 210  C CD1 . PHE A 1 26  ? 39.733 -31.228 -12.104 1.00 37.66  ? 26  PHE A CD1 1 
ATOM 211  C CD2 . PHE A 1 26  ? 38.789 -29.031 -12.125 1.00 40.57  ? 26  PHE A CD2 1 
ATOM 212  C CE1 . PHE A 1 26  ? 40.667 -30.819 -11.172 1.00 39.99  ? 26  PHE A CE1 1 
ATOM 213  C CE2 . PHE A 1 26  ? 39.728 -28.605 -11.188 1.00 42.31  ? 26  PHE A CE2 1 
ATOM 214  C CZ  . PHE A 1 26  ? 40.667 -29.503 -10.713 1.00 42.38  ? 26  PHE A CZ  1 
ATOM 215  N N   . ASP A 1 27  ? 35.973 -31.230 -10.583 1.00 40.37  ? 27  ASP A N   1 
ATOM 216  C CA  . ASP A 1 27  ? 35.267 -30.561 -9.488  1.00 41.82  ? 27  ASP A CA  1 
ATOM 217  C C   . ASP A 1 27  ? 33.911 -30.131 -9.992  1.00 40.67  ? 27  ASP A C   1 
ATOM 218  O O   . ASP A 1 27  ? 33.561 -28.963 -9.896  1.00 40.89  ? 27  ASP A O   1 
ATOM 219  C CB  . ASP A 1 27  ? 36.023 -29.322 -8.978  1.00 42.99  ? 27  ASP A CB  1 
ATOM 220  C CG  . ASP A 1 27  ? 37.284 -29.670 -8.229  1.00 47.34  ? 27  ASP A CG  1 
ATOM 221  O OD1 . ASP A 1 27  ? 37.510 -30.882 -7.980  1.00 49.59  ? 27  ASP A OD1 1 
ATOM 222  O OD2 . ASP A 1 27  ? 38.060 -28.726 -7.898  1.00 51.02  ? 27  ASP A OD2 1 
ATOM 223  N N   . GLU A 1 28  ? 33.183 -31.068 -10.597 1.00 40.85  ? 28  GLU A N   1 
ATOM 224  C CA  . GLU A 1 28  ? 31.756 -30.897 -10.842 1.00 40.26  ? 28  GLU A CA  1 
ATOM 225  C C   . GLU A 1 28  ? 31.481 -30.190 -12.184 1.00 38.68  ? 28  GLU A C   1 
ATOM 226  O O   . GLU A 1 28  ? 30.344 -30.182 -12.652 1.00 38.05  ? 28  GLU A O   1 
ATOM 227  C CB  . GLU A 1 28  ? 31.171 -30.089 -9.679  1.00 41.35  ? 28  GLU A CB  1 
ATOM 228  C CG  . GLU A 1 28  ? 29.973 -30.658 -8.982  1.00 46.72  ? 28  GLU A CG  1 
ATOM 229  C CD  . GLU A 1 28  ? 30.320 -31.804 -8.040  1.00 52.91  ? 28  GLU A CD  1 
ATOM 230  O OE1 . GLU A 1 28  ? 29.995 -31.708 -6.823  1.00 55.96  ? 28  GLU A OE1 1 
ATOM 231  O OE2 . GLU A 1 28  ? 30.892 -32.810 -8.526  1.00 54.39  ? 28  GLU A OE2 1 
ATOM 232  N N   . ASP A 1 29  ? 32.509 -29.598 -12.795 1.00 37.79  ? 29  ASP A N   1 
ATOM 233  C CA  . ASP A 1 29  ? 32.334 -28.859 -14.051 1.00 36.47  ? 29  ASP A CA  1 
ATOM 234  C C   . ASP A 1 29  ? 32.667 -29.747 -15.251 1.00 35.75  ? 29  ASP A C   1 
ATOM 235  O O   . ASP A 1 29  ? 33.782 -30.261 -15.335 1.00 36.34  ? 29  ASP A O   1 
ATOM 236  C CB  . ASP A 1 29  ? 33.199 -27.584 -14.066 1.00 36.43  ? 29  ASP A CB  1 
ATOM 237  C CG  . ASP A 1 29  ? 32.590 -26.429 -13.251 1.00 37.26  ? 29  ASP A CG  1 
ATOM 238  O OD1 . ASP A 1 29  ? 31.344 -26.353 -13.105 1.00 39.83  ? 29  ASP A OD1 1 
ATOM 239  O OD2 . ASP A 1 29  ? 33.347 -25.568 -12.762 1.00 35.36  ? 29  ASP A OD2 1 
ATOM 240  N N   . GLU A 1 30  ? 31.701 -29.954 -16.148 1.00 34.24  ? 30  GLU A N   1 
ATOM 241  C CA  . GLU A 1 30  ? 31.940 -30.677 -17.400 1.00 33.95  ? 30  GLU A CA  1 
ATOM 242  C C   . GLU A 1 30  ? 33.109 -30.049 -18.148 1.00 34.24  ? 30  GLU A C   1 
ATOM 243  O O   . GLU A 1 30  ? 33.073 -28.840 -18.419 1.00 35.32  ? 30  GLU A O   1 
ATOM 244  C CB  . GLU A 1 30  ? 30.710 -30.637 -18.307 1.00 33.18  ? 30  GLU A CB  1 
ATOM 245  C CG  . GLU A 1 30  ? 30.840 -31.428 -19.615 1.00 35.18  ? 30  GLU A CG  1 
ATOM 246  C CD  . GLU A 1 30  ? 31.114 -30.560 -20.854 1.00 41.04  ? 30  GLU A CD  1 
ATOM 247  O OE1 . GLU A 1 30  ? 32.106 -30.796 -21.593 1.00 44.10  ? 30  GLU A OE1 1 
ATOM 248  O OE2 . GLU A 1 30  ? 30.320 -29.642 -21.128 1.00 42.23  ? 30  GLU A OE2 1 
ATOM 249  N N   . MET A 1 31  ? 34.135 -30.850 -18.478 1.00 32.88  ? 31  MET A N   1 
ATOM 250  C CA  . MET A 1 31  ? 35.289 -30.338 -19.236 1.00 31.72  ? 31  MET A CA  1 
ATOM 251  C C   . MET A 1 31  ? 35.194 -30.729 -20.724 1.00 31.48  ? 31  MET A C   1 
ATOM 252  O O   . MET A 1 31  ? 35.403 -29.903 -21.606 1.00 30.41  ? 31  MET A O   1 
ATOM 253  C CB  . MET A 1 31  ? 36.588 -30.832 -18.607 1.00 32.00  ? 31  MET A CB  1 
ATOM 254  C CG  . MET A 1 31  ? 37.863 -30.481 -19.356 1.00 30.67  ? 31  MET A CG  1 
ATOM 255  S SD  . MET A 1 31  ? 39.376 -30.942 -18.459 1.00 27.06  ? 31  MET A SD  1 
ATOM 256  C CE  . MET A 1 31  ? 40.605 -29.752 -19.034 1.00 22.17  ? 31  MET A CE  1 
ATOM 257  N N   . PHE A 1 32  ? 34.863 -31.992 -20.985 1.00 31.27  ? 32  PHE A N   1 
ATOM 258  C CA  . PHE A 1 32  ? 34.535 -32.437 -22.332 1.00 31.80  ? 32  PHE A CA  1 
ATOM 259  C C   . PHE A 1 32  ? 33.445 -33.510 -22.376 1.00 32.11  ? 32  PHE A C   1 
ATOM 260  O O   . PHE A 1 32  ? 33.056 -34.062 -21.344 1.00 30.84  ? 32  PHE A O   1 
ATOM 261  C CB  . PHE A 1 32  ? 35.780 -32.878 -23.094 1.00 32.28  ? 32  PHE A CB  1 
ATOM 262  C CG  . PHE A 1 32  ? 36.440 -34.136 -22.563 1.00 32.76  ? 32  PHE A CG  1 
ATOM 263  C CD1 . PHE A 1 32  ? 36.092 -35.387 -23.065 1.00 33.59  ? 32  PHE A CD1 1 
ATOM 264  C CD2 . PHE A 1 32  ? 37.449 -34.060 -21.594 1.00 33.64  ? 32  PHE A CD2 1 
ATOM 265  C CE1 . PHE A 1 32  ? 36.727 -36.563 -22.578 1.00 35.51  ? 32  PHE A CE1 1 
ATOM 266  C CE2 . PHE A 1 32  ? 38.089 -35.202 -21.115 1.00 33.84  ? 32  PHE A CE2 1 
ATOM 267  C CZ  . PHE A 1 32  ? 37.731 -36.458 -21.607 1.00 35.67  ? 32  PHE A CZ  1 
ATOM 268  N N   . TYR A 1 33  ? 32.953 -33.783 -23.587 1.00 33.40  ? 33  TYR A N   1 
ATOM 269  C CA  . TYR A 1 33  ? 32.088 -34.945 -23.845 1.00 34.28  ? 33  TYR A CA  1 
ATOM 270  C C   . TYR A 1 33  ? 32.255 -35.488 -25.265 1.00 35.38  ? 33  TYR A C   1 
ATOM 271  O O   . TYR A 1 33  ? 32.832 -34.824 -26.148 1.00 36.23  ? 33  TYR A O   1 
ATOM 272  C CB  . TYR A 1 33  ? 30.616 -34.645 -23.544 1.00 34.11  ? 33  TYR A CB  1 
ATOM 273  C CG  . TYR A 1 33  ? 29.947 -33.746 -24.537 1.00 35.33  ? 33  TYR A CG  1 
ATOM 274  C CD1 . TYR A 1 33  ? 29.307 -34.271 -25.675 1.00 37.73  ? 33  TYR A CD1 1 
ATOM 275  C CD2 . TYR A 1 33  ? 29.943 -32.372 -24.355 1.00 37.05  ? 33  TYR A CD2 1 
ATOM 276  C CE1 . TYR A 1 33  ? 28.693 -33.427 -26.611 1.00 39.24  ? 33  TYR A CE1 1 
ATOM 277  C CE2 . TYR A 1 33  ? 29.333 -31.520 -25.292 1.00 38.98  ? 33  TYR A CE2 1 
ATOM 278  C CZ  . TYR A 1 33  ? 28.718 -32.056 -26.403 1.00 39.16  ? 33  TYR A CZ  1 
ATOM 279  O OH  . TYR A 1 33  ? 28.125 -31.216 -27.294 1.00 40.13  ? 33  TYR A OH  1 
ATOM 280  N N   . VAL A 1 34  ? 31.760 -36.700 -25.478 1.00 35.86  ? 34  VAL A N   1 
ATOM 281  C CA  . VAL A 1 34  ? 31.805 -37.304 -26.801 1.00 37.54  ? 34  VAL A CA  1 
ATOM 282  C C   . VAL A 1 34  ? 30.432 -37.197 -27.465 1.00 38.30  ? 34  VAL A C   1 
ATOM 283  O O   . VAL A 1 34  ? 29.477 -37.805 -27.010 1.00 37.60  ? 34  VAL A O   1 
ATOM 284  C CB  . VAL A 1 34  ? 32.280 -38.795 -26.748 1.00 37.68  ? 34  VAL A CB  1 
ATOM 285  C CG1 . VAL A 1 34  ? 32.270 -39.391 -28.116 1.00 38.66  ? 34  VAL A CG1 1 
ATOM 286  C CG2 . VAL A 1 34  ? 33.666 -38.905 -26.184 1.00 37.17  ? 34  VAL A CG2 1 
ATOM 287  N N   . ASP A 1 35  ? 30.337 -36.416 -28.533 1.00 40.16  ? 35  ASP A N   1 
ATOM 288  C CA  . ASP A 1 35  ? 29.087 -36.304 -29.267 1.00 42.38  ? 35  ASP A CA  1 
ATOM 289  C C   . ASP A 1 35  ? 28.813 -37.625 -29.989 1.00 44.31  ? 35  ASP A C   1 
ATOM 290  O O   . ASP A 1 35  ? 29.546 -37.990 -30.923 1.00 45.84  ? 35  ASP A O   1 
ATOM 291  C CB  . ASP A 1 35  ? 29.165 -35.156 -30.267 1.00 43.01  ? 35  ASP A CB  1 
ATOM 292  C CG  . ASP A 1 35  ? 27.896 -35.019 -31.111 1.00 45.94  ? 35  ASP A CG  1 
ATOM 293  O OD1 . ASP A 1 35  ? 27.388 -36.041 -31.623 1.00 47.20  ? 35  ASP A OD1 1 
ATOM 294  O OD2 . ASP A 1 35  ? 27.405 -33.875 -31.273 1.00 48.44  ? 35  ASP A OD2 1 
ATOM 295  N N   . LEU A 1 36  ? 27.766 -38.336 -29.568 1.00 45.05  ? 36  LEU A N   1 
ATOM 296  C CA  . LEU A 1 36  ? 27.506 -39.679 -30.090 1.00 46.68  ? 36  LEU A CA  1 
ATOM 297  C C   . LEU A 1 36  ? 26.956 -39.737 -31.509 1.00 49.00  ? 36  LEU A C   1 
ATOM 298  O O   . LEU A 1 36  ? 26.953 -40.814 -32.108 1.00 50.80  ? 36  LEU A O   1 
ATOM 299  C CB  . LEU A 1 36  ? 26.612 -40.485 -29.150 1.00 46.23  ? 36  LEU A CB  1 
ATOM 300  C CG  . LEU A 1 36  ? 27.018 -40.479 -27.671 1.00 45.36  ? 36  LEU A CG  1 
ATOM 301  C CD1 . LEU A 1 36  ? 25.963 -41.152 -26.826 1.00 44.70  ? 36  LEU A CD1 1 
ATOM 302  C CD2 . LEU A 1 36  ? 28.369 -41.145 -27.430 1.00 45.57  ? 36  LEU A CD2 1 
ATOM 303  N N   . ASP A 1 37  ? 26.493 -38.613 -32.053 1.00 50.03  ? 37  ASP A N   1 
ATOM 304  C CA  . ASP A 1 37  ? 26.126 -38.569 -33.469 1.00 52.80  ? 37  ASP A CA  1 
ATOM 305  C C   . ASP A 1 37  ? 27.282 -38.120 -34.334 1.00 53.22  ? 37  ASP A C   1 
ATOM 306  O O   . ASP A 1 37  ? 27.768 -38.883 -35.162 1.00 54.65  ? 37  ASP A O   1 
ATOM 307  C CB  . ASP A 1 37  ? 24.884 -37.719 -33.729 1.00 53.78  ? 37  ASP A CB  1 
ATOM 308  C CG  . ASP A 1 37  ? 23.599 -38.394 -33.240 1.00 57.54  ? 37  ASP A CG  1 
ATOM 309  O OD1 . ASP A 1 37  ? 23.606 -39.625 -32.981 1.00 60.39  ? 37  ASP A OD1 1 
ATOM 310  O OD2 . ASP A 1 37  ? 22.568 -37.688 -33.111 1.00 61.51  ? 37  ASP A OD2 1 
ATOM 311  N N   . LYS A 1 38  ? 27.719 -36.884 -34.143 1.00 52.52  ? 38  LYS A N   1 
ATOM 312  C CA  . LYS A 1 38  ? 28.889 -36.367 -34.846 1.00 53.35  ? 38  LYS A CA  1 
ATOM 313  C C   . LYS A 1 38  ? 30.134 -37.248 -34.687 1.00 52.82  ? 38  LYS A C   1 
ATOM 314  O O   . LYS A 1 38  ? 31.068 -37.124 -35.476 1.00 53.38  ? 38  LYS A O   1 
ATOM 315  C CB  . LYS A 1 38  ? 29.213 -34.951 -34.376 1.00 52.93  ? 38  LYS A CB  1 
ATOM 316  C CG  . LYS A 1 38  ? 28.912 -33.867 -35.387 1.00 56.07  ? 38  LYS A CG  1 
ATOM 317  C CD  . LYS A 1 38  ? 29.059 -32.476 -34.734 1.00 59.60  ? 38  LYS A CD  1 
ATOM 318  C CE  . LYS A 1 38  ? 28.352 -31.369 -35.541 1.00 61.00  ? 38  LYS A CE  1 
ATOM 319  N NZ  . LYS A 1 38  ? 27.545 -30.516 -34.615 1.00 58.14  ? 38  LYS A NZ  1 
ATOM 320  N N   . LYS A 1 39  ? 30.141 -38.118 -33.666 1.00 51.50  ? 39  LYS A N   1 
ATOM 321  C CA  . LYS A 1 39  ? 31.300 -38.976 -33.315 1.00 50.86  ? 39  LYS A CA  1 
ATOM 322  C C   . LYS A 1 39  ? 32.603 -38.216 -33.006 1.00 50.20  ? 39  LYS A C   1 
ATOM 323  O O   . LYS A 1 39  ? 33.700 -38.699 -33.280 1.00 50.48  ? 39  LYS A O   1 
ATOM 324  C CB  . LYS A 1 39  ? 31.551 -40.064 -34.372 1.00 52.04  ? 39  LYS A CB  1 
ATOM 325  C CG  . LYS A 1 39  ? 30.625 -41.277 -34.269 1.00 53.09  ? 39  LYS A CG  1 
ATOM 326  C CD  . LYS A 1 39  ? 29.543 -41.344 -35.353 1.00 53.72  ? 39  LYS A CD  1 
ATOM 327  C CE  . LYS A 1 39  ? 28.381 -42.244 -34.914 1.00 53.87  ? 39  LYS A CE  1 
ATOM 328  N NZ  . LYS A 1 39  ? 27.725 -42.970 -36.071 1.00 57.55  ? 39  LYS A NZ  1 
ATOM 329  N N   . GLU A 1 40  ? 32.485 -37.036 -32.407 1.00 48.74  ? 40  GLU A N   1 
ATOM 330  C CA  . GLU A 1 40  ? 33.664 -36.228 -32.131 1.00 47.94  ? 40  GLU A CA  1 
ATOM 331  C C   . GLU A 1 40  ? 33.683 -35.792 -30.669 1.00 44.94  ? 40  GLU A C   1 
ATOM 332  O O   . GLU A 1 40  ? 32.659 -35.838 -30.006 1.00 44.43  ? 40  GLU A O   1 
ATOM 333  C CB  . GLU A 1 40  ? 33.787 -35.063 -33.158 1.00 49.50  ? 40  GLU A CB  1 
ATOM 334  C CG  . GLU A 1 40  ? 34.945 -35.299 -34.227 1.00 54.46  ? 40  GLU A CG  1 
ATOM 335  C CD  . GLU A 1 40  ? 34.497 -35.201 -35.724 1.00 60.89  ? 40  GLU A CD  1 
ATOM 336  O OE1 . GLU A 1 40  ? 33.556 -34.413 -36.029 1.00 62.40  ? 40  GLU A OE1 1 
ATOM 337  O OE2 . GLU A 1 40  ? 35.089 -35.915 -36.592 1.00 61.20  ? 40  GLU A OE2 1 
ATOM 338  N N   . THR A 1 41  ? 34.856 -35.445 -30.147 1.00 43.05  ? 41  THR A N   1 
ATOM 339  C CA  . THR A 1 41  ? 34.938 -34.930 -28.791 1.00 40.56  ? 41  THR A CA  1 
ATOM 340  C C   . THR A 1 41  ? 34.651 -33.450 -28.866 1.00 39.93  ? 41  THR A C   1 
ATOM 341  O O   . THR A 1 41  ? 35.198 -32.783 -29.722 1.00 40.96  ? 41  THR A O   1 
ATOM 342  C CB  . THR A 1 41  ? 36.341 -35.093 -28.164 1.00 40.99  ? 41  THR A CB  1 
ATOM 343  O OG1 . THR A 1 41  ? 36.749 -36.478 -28.176 1.00 40.13  ? 41  THR A OG1 1 
ATOM 344  C CG2 . THR A 1 41  ? 36.352 -34.530 -26.717 1.00 37.15  ? 41  THR A CG2 1 
ATOM 345  N N   . VAL A 1 42  ? 33.781 -32.958 -27.985 1.00 38.08  ? 42  VAL A N   1 
ATOM 346  C CA  . VAL A 1 42  ? 33.540 -31.539 -27.811 1.00 36.59  ? 42  VAL A CA  1 
ATOM 347  C C   . VAL A 1 42  ? 34.112 -31.085 -26.474 1.00 35.52  ? 42  VAL A C   1 
ATOM 348  O O   . VAL A 1 42  ? 33.786 -31.638 -25.415 1.00 34.44  ? 42  VAL A O   1 
ATOM 349  C CB  . VAL A 1 42  ? 32.027 -31.198 -27.857 1.00 37.31  ? 42  VAL A CB  1 
ATOM 350  C CG1 . VAL A 1 42  ? 31.788 -29.708 -27.557 1.00 36.56  ? 42  VAL A CG1 1 
ATOM 351  C CG2 . VAL A 1 42  ? 31.404 -31.582 -29.220 1.00 37.72  ? 42  VAL A CG2 1 
ATOM 352  N N   . TRP A 1 43  ? 34.987 -30.088 -26.551 1.00 35.31  ? 43  TRP A N   1 
ATOM 353  C CA  . TRP A 1 43  ? 35.568 -29.431 -25.401 1.00 34.37  ? 43  TRP A CA  1 
ATOM 354  C C   . TRP A 1 43  ? 34.733 -28.239 -24.943 1.00 34.57  ? 43  TRP A C   1 
ATOM 355  O O   . TRP A 1 43  ? 34.258 -27.457 -25.742 1.00 33.71  ? 43  TRP A O   1 
ATOM 356  C CB  . TRP A 1 43  ? 36.973 -29.002 -25.730 1.00 34.77  ? 43  TRP A CB  1 
ATOM 357  C CG  . TRP A 1 43  ? 37.861 -30.194 -25.905 1.00 34.28  ? 43  TRP A CG  1 
ATOM 358  C CD1 . TRP A 1 43  ? 38.120 -30.865 -27.069 1.00 31.00  ? 43  TRP A CD1 1 
ATOM 359  C CD2 . TRP A 1 43  ? 38.572 -30.894 -24.868 1.00 32.18  ? 43  TRP A CD2 1 
ATOM 360  N NE1 . TRP A 1 43  ? 38.954 -31.927 -26.820 1.00 32.21  ? 43  TRP A NE1 1 
ATOM 361  C CE2 . TRP A 1 43  ? 39.252 -31.965 -25.481 1.00 32.91  ? 43  TRP A CE2 1 
ATOM 362  C CE3 . TRP A 1 43  ? 38.695 -30.719 -23.485 1.00 30.85  ? 43  TRP A CE3 1 
ATOM 363  C CZ2 . TRP A 1 43  ? 40.058 -32.857 -24.754 1.00 34.18  ? 43  TRP A CZ2 1 
ATOM 364  C CZ3 . TRP A 1 43  ? 39.499 -31.595 -22.764 1.00 30.73  ? 43  TRP A CZ3 1 
ATOM 365  C CH2 . TRP A 1 43  ? 40.169 -32.647 -23.397 1.00 33.99  ? 43  TRP A CH2 1 
ATOM 366  N N   . HIS A 1 44  ? 34.576 -28.115 -23.628 1.00 35.13  ? 44  HIS A N   1 
ATOM 367  C CA  . HIS A 1 44  ? 33.659 -27.159 -23.043 1.00 34.83  ? 44  HIS A CA  1 
ATOM 368  C C   . HIS A 1 44  ? 34.084 -25.734 -23.248 1.00 36.57  ? 44  HIS A C   1 
ATOM 369  O O   . HIS A 1 44  ? 33.229 -24.865 -23.467 1.00 36.58  ? 44  HIS A O   1 
ATOM 370  C CB  . HIS A 1 44  ? 33.473 -27.386 -21.548 1.00 34.06  ? 44  HIS A CB  1 
ATOM 371  C CG  . HIS A 1 44  ? 32.251 -26.718 -21.035 1.00 32.12  ? 44  HIS A CG  1 
ATOM 372  N ND1 . HIS A 1 44  ? 32.162 -25.351 -20.914 1.00 33.32  ? 44  HIS A ND1 1 
ATOM 373  C CD2 . HIS A 1 44  ? 31.031 -27.207 -20.727 1.00 27.95  ? 44  HIS A CD2 1 
ATOM 374  C CE1 . HIS A 1 44  ? 30.947 -25.030 -20.502 1.00 31.91  ? 44  HIS A CE1 1 
ATOM 375  N NE2 . HIS A 1 44  ? 30.246 -26.140 -20.382 1.00 28.33  ? 44  HIS A NE2 1 
ATOM 376  N N   . LEU A 1 45  ? 35.388 -25.486 -23.117 1.00 37.63  ? 45  LEU A N   1 
ATOM 377  C CA  . LEU A 1 45  ? 35.950 -24.189 -23.435 1.00 39.44  ? 45  LEU A CA  1 
ATOM 378  C C   . LEU A 1 45  ? 36.961 -24.413 -24.533 1.00 41.73  ? 45  LEU A C   1 
ATOM 379  O O   . LEU A 1 45  ? 37.757 -25.346 -24.478 1.00 42.20  ? 45  LEU A O   1 
ATOM 380  C CB  . LEU A 1 45  ? 36.631 -23.579 -22.222 1.00 39.68  ? 45  LEU A CB  1 
ATOM 381  C CG  . LEU A 1 45  ? 35.835 -23.300 -20.951 1.00 39.03  ? 45  LEU A CG  1 
ATOM 382  C CD1 . LEU A 1 45  ? 36.654 -22.409 -20.050 1.00 39.63  ? 45  LEU A CD1 1 
ATOM 383  C CD2 . LEU A 1 45  ? 34.480 -22.673 -21.247 1.00 36.61  ? 45  LEU A CD2 1 
ATOM 384  N N   . GLU A 1 46  ? 36.942 -23.577 -25.550 1.00 44.00  ? 46  GLU A N   1 
ATOM 385  C CA  . GLU A 1 46  ? 37.757 -23.866 -26.708 1.00 46.69  ? 46  GLU A CA  1 
ATOM 386  C C   . GLU A 1 46  ? 39.263 -23.894 -26.377 1.00 47.89  ? 46  GLU A C   1 
ATOM 387  O O   . GLU A 1 46  ? 40.006 -24.736 -26.907 1.00 48.43  ? 46  GLU A O   1 
ATOM 388  C CB  . GLU A 1 46  ? 37.370 -22.923 -27.845 1.00 48.17  ? 46  GLU A CB  1 
ATOM 389  C CG  . GLU A 1 46  ? 38.511 -22.210 -28.556 1.00 53.18  ? 46  GLU A CG  1 
ATOM 390  C CD  . GLU A 1 46  ? 38.075 -20.832 -29.015 1.00 59.21  ? 46  GLU A CD  1 
ATOM 391  O OE1 . GLU A 1 46  ? 38.932 -19.917 -29.071 1.00 61.86  ? 46  GLU A OE1 1 
ATOM 392  O OE2 . GLU A 1 46  ? 36.857 -20.664 -29.296 1.00 61.10  ? 46  GLU A OE2 1 
ATOM 393  N N   . GLU A 1 47  ? 39.695 -23.014 -25.469 1.00 48.65  ? 47  GLU A N   1 
ATOM 394  C CA  . GLU A 1 47  ? 41.097 -22.992 -25.011 1.00 50.09  ? 47  GLU A CA  1 
ATOM 395  C C   . GLU A 1 47  ? 41.552 -24.390 -24.497 1.00 48.69  ? 47  GLU A C   1 
ATOM 396  O O   . GLU A 1 47  ? 42.733 -24.751 -24.615 1.00 49.82  ? 47  GLU A O   1 
ATOM 397  C CB  . GLU A 1 47  ? 41.386 -21.813 -24.015 1.00 51.50  ? 47  GLU A CB  1 
ATOM 398  C CG  . GLU A 1 47  ? 40.421 -21.709 -22.734 1.00 53.62  ? 47  GLU A CG  1 
ATOM 399  C CD  . GLU A 1 47  ? 40.922 -20.754 -21.582 1.00 57.12  ? 47  GLU A CD  1 
ATOM 400  O OE1 . GLU A 1 47  ? 40.683 -21.074 -20.389 1.00 54.96  ? 47  GLU A OE1 1 
ATOM 401  O OE2 . GLU A 1 47  ? 41.550 -19.690 -21.862 1.00 59.80  ? 47  GLU A OE2 1 
ATOM 402  N N   . PHE A 1 48  ? 40.612 -25.178 -23.967 1.00 46.15  ? 48  PHE A N   1 
ATOM 403  C CA  . PHE A 1 48  ? 40.854 -26.597 -23.663 1.00 44.28  ? 48  PHE A CA  1 
ATOM 404  C C   . PHE A 1 48  ? 41.224 -27.374 -24.921 1.00 43.92  ? 48  PHE A C   1 
ATOM 405  O O   . PHE A 1 48  ? 42.135 -28.212 -24.906 1.00 43.95  ? 48  PHE A O   1 
ATOM 406  C CB  . PHE A 1 48  ? 39.594 -27.282 -23.105 1.00 42.87  ? 48  PHE A CB  1 
ATOM 407  C CG  . PHE A 1 48  ? 39.187 -26.858 -21.717 1.00 42.33  ? 48  PHE A CG  1 
ATOM 408  C CD1 . PHE A 1 48  ? 37.858 -27.037 -21.301 1.00 42.64  ? 48  PHE A CD1 1 
ATOM 409  C CD2 . PHE A 1 48  ? 40.095 -26.298 -20.825 1.00 42.54  ? 48  PHE A CD2 1 
ATOM 410  C CE1 . PHE A 1 48  ? 37.441 -26.658 -20.021 1.00 42.01  ? 48  PHE A CE1 1 
ATOM 411  C CE2 . PHE A 1 48  ? 39.695 -25.910 -19.546 1.00 41.50  ? 48  PHE A CE2 1 
ATOM 412  C CZ  . PHE A 1 48  ? 38.364 -26.103 -19.138 1.00 42.65  ? 48  PHE A CZ  1 
ATOM 413  N N   . GLY A 1 49  ? 40.488 -27.109 -25.997 1.00 43.40  ? 49  GLY A N   1 
ATOM 414  C CA  . GLY A 1 49  ? 40.544 -27.917 -27.210 1.00 44.13  ? 49  GLY A CA  1 
ATOM 415  C C   . GLY A 1 49  ? 41.893 -27.818 -27.886 1.00 45.99  ? 49  GLY A C   1 
ATOM 416  O O   . GLY A 1 49  ? 42.350 -28.762 -28.522 1.00 46.14  ? 49  GLY A O   1 
ATOM 417  N N   . GLN A 1 50  ? 42.532 -26.667 -27.701 1.00 47.16  ? 50  GLN A N   1 
ATOM 418  C CA  . GLN A 1 50  ? 43.794 -26.355 -28.317 1.00 48.76  ? 50  GLN A CA  1 
ATOM 419  C C   . GLN A 1 50  ? 44.986 -26.900 -27.546 1.00 48.88  ? 50  GLN A C   1 
ATOM 420  O O   . GLN A 1 50  ? 46.137 -26.838 -28.019 1.00 50.44  ? 50  GLN A O   1 
ATOM 421  C CB  . GLN A 1 50  ? 43.883 -24.846 -28.523 1.00 50.10  ? 50  GLN A CB  1 
ATOM 422  C CG  . GLN A 1 50  ? 43.259 -24.464 -29.844 1.00 53.65  ? 50  GLN A CG  1 
ATOM 423  C CD  . GLN A 1 50  ? 42.325 -23.291 -29.753 1.00 57.75  ? 50  GLN A CD  1 
ATOM 424  O OE1 . GLN A 1 50  ? 42.728 -22.129 -29.911 1.00 60.59  ? 50  GLN A OE1 1 
ATOM 425  N NE2 . GLN A 1 50  ? 41.050 -23.583 -29.530 1.00 58.82  ? 50  GLN A NE2 1 
ATOM 426  N N   . ALA A 1 51  ? 44.737 -27.449 -26.365 1.00 46.86  ? 51  ALA A N   1 
ATOM 427  C CA  . ALA A 1 51  ? 45.837 -28.066 -25.634 1.00 46.47  ? 51  ALA A CA  1 
ATOM 428  C C   . ALA A 1 51  ? 45.701 -29.587 -25.500 1.00 45.47  ? 51  ALA A C   1 
ATOM 429  O O   . ALA A 1 51  ? 46.623 -30.315 -25.840 1.00 45.68  ? 51  ALA A O   1 
ATOM 430  C CB  . ALA A 1 51  ? 46.009 -27.408 -24.283 1.00 46.55  ? 51  ALA A CB  1 
ATOM 431  N N   . PHE A 1 52  ? 44.547 -30.064 -25.022 1.00 44.16  ? 52  PHE A N   1 
ATOM 432  C CA  . PHE A 1 52  ? 44.344 -31.496 -24.781 1.00 43.06  ? 52  PHE A CA  1 
ATOM 433  C C   . PHE A 1 52  ? 43.508 -32.127 -25.874 1.00 42.47  ? 52  PHE A C   1 
ATOM 434  O O   . PHE A 1 52  ? 42.865 -31.438 -26.646 1.00 42.99  ? 52  PHE A O   1 
ATOM 435  C CB  . PHE A 1 52  ? 43.649 -31.724 -23.440 1.00 42.41  ? 52  PHE A CB  1 
ATOM 436  C CG  . PHE A 1 52  ? 44.055 -30.754 -22.375 1.00 43.18  ? 52  PHE A CG  1 
ATOM 437  C CD1 . PHE A 1 52  ? 45.365 -30.696 -21.936 1.00 44.73  ? 52  PHE A CD1 1 
ATOM 438  C CD2 . PHE A 1 52  ? 43.123 -29.886 -21.824 1.00 43.24  ? 52  PHE A CD2 1 
ATOM 439  C CE1 . PHE A 1 52  ? 45.744 -29.782 -20.958 1.00 47.11  ? 52  PHE A CE1 1 
ATOM 440  C CE2 . PHE A 1 52  ? 43.490 -28.964 -20.850 1.00 45.15  ? 52  PHE A CE2 1 
ATOM 441  C CZ  . PHE A 1 52  ? 44.796 -28.917 -20.403 1.00 47.22  ? 52  PHE A CZ  1 
ATOM 442  N N   . SER A 1 53  ? 43.538 -33.447 -25.939 1.00 42.39  ? 53  SER A N   1 
ATOM 443  C CA  . SER A 1 53  ? 42.631 -34.210 -26.776 1.00 42.11  ? 53  SER A CA  1 
ATOM 444  C C   . SER A 1 53  ? 42.163 -35.510 -26.067 1.00 41.64  ? 53  SER A C   1 
ATOM 445  O O   . SER A 1 53  ? 42.742 -35.920 -25.045 1.00 41.04  ? 53  SER A O   1 
ATOM 446  C CB  . SER A 1 53  ? 43.295 -34.513 -28.106 1.00 42.95  ? 53  SER A CB  1 
ATOM 447  O OG  . SER A 1 53  ? 44.391 -35.376 -27.894 1.00 45.30  ? 53  SER A OG  1 
ATOM 448  N N   . PHE A 1 54  ? 41.090 -36.112 -26.599 1.00 41.52  ? 54  PHE A N   1 
ATOM 449  C CA  . PHE A 1 54  ? 40.574 -37.404 -26.140 1.00 41.63  ? 54  PHE A CA  1 
ATOM 450  C C   . PHE A 1 54  ? 40.107 -38.265 -27.305 1.00 42.71  ? 54  PHE A C   1 
ATOM 451  O O   . PHE A 1 54  ? 39.335 -37.810 -28.124 1.00 43.23  ? 54  PHE A O   1 
ATOM 452  C CB  . PHE A 1 54  ? 39.414 -37.224 -25.166 1.00 40.13  ? 54  PHE A CB  1 
ATOM 453  C CG  . PHE A 1 54  ? 38.855 -38.513 -24.657 1.00 39.63  ? 54  PHE A CG  1 
ATOM 454  C CD1 . PHE A 1 54  ? 39.499 -39.208 -23.638 1.00 39.80  ? 54  PHE A CD1 1 
ATOM 455  C CD2 . PHE A 1 54  ? 37.680 -39.040 -25.194 1.00 40.63  ? 54  PHE A CD2 1 
ATOM 456  C CE1 . PHE A 1 54  ? 38.979 -40.421 -23.146 1.00 39.94  ? 54  PHE A CE1 1 
ATOM 457  C CE2 . PHE A 1 54  ? 37.139 -40.267 -24.721 1.00 39.92  ? 54  PHE A CE2 1 
ATOM 458  C CZ  . PHE A 1 54  ? 37.793 -40.957 -23.695 1.00 39.57  ? 54  PHE A CZ  1 
ATOM 459  N N   . GLU A 1 55  ? 40.555 -39.514 -27.360 1.00 44.10  ? 55  GLU A N   1 
ATOM 460  C CA  . GLU A 1 55  ? 40.130 -40.424 -28.410 1.00 45.57  ? 55  GLU A CA  1 
ATOM 461  C C   . GLU A 1 55  ? 38.652 -40.847 -28.288 1.00 44.76  ? 55  GLU A C   1 
ATOM 462  O O   . GLU A 1 55  ? 38.260 -41.673 -27.459 1.00 44.45  ? 55  GLU A O   1 
ATOM 463  C CB  . GLU A 1 55  ? 41.113 -41.594 -28.549 1.00 46.46  ? 55  GLU A CB  1 
ATOM 464  C CG  . GLU A 1 55  ? 42.348 -41.240 -29.403 1.00 53.07  ? 55  GLU A CG  1 
ATOM 465  C CD  . GLU A 1 55  ? 41.988 -40.559 -30.798 1.00 61.38  ? 55  GLU A CD  1 
ATOM 466  O OE1 . GLU A 1 55  ? 41.408 -41.270 -31.683 1.00 63.08  ? 55  GLU A OE1 1 
ATOM 467  O OE2 . GLU A 1 55  ? 42.283 -39.327 -31.002 1.00 61.54  ? 55  GLU A OE2 1 
ATOM 468  N N   . ALA A 1 56  ? 37.848 -40.255 -29.158 1.00 45.21  ? 56  ALA A N   1 
ATOM 469  C CA  . ALA A 1 56  ? 36.391 -40.365 -29.136 1.00 44.75  ? 56  ALA A CA  1 
ATOM 470  C C   . ALA A 1 56  ? 35.871 -41.779 -29.011 1.00 45.04  ? 56  ALA A C   1 
ATOM 471  O O   . ALA A 1 56  ? 34.862 -41.992 -28.365 1.00 44.82  ? 56  ALA A O   1 
ATOM 472  C CB  . ALA A 1 56  ? 35.786 -39.690 -30.362 1.00 44.87  ? 56  ALA A CB  1 
ATOM 473  N N   . GLN A 1 57  ? 36.551 -42.743 -29.624 1.00 46.42  ? 57  GLN A N   1 
ATOM 474  C CA  . GLN A 1 57  ? 36.053 -44.123 -29.631 1.00 46.95  ? 57  GLN A CA  1 
ATOM 475  C C   . GLN A 1 57  ? 35.949 -44.617 -28.220 1.00 45.62  ? 57  GLN A C   1 
ATOM 476  O O   . GLN A 1 57  ? 35.166 -45.517 -27.937 1.00 46.15  ? 57  GLN A O   1 
ATOM 477  C CB  . GLN A 1 57  ? 36.976 -45.080 -30.381 1.00 48.41  ? 57  GLN A CB  1 
ATOM 478  C CG  . GLN A 1 57  ? 37.247 -44.710 -31.803 1.00 51.90  ? 57  GLN A CG  1 
ATOM 479  C CD  . GLN A 1 57  ? 38.612 -44.092 -31.985 1.00 55.58  ? 57  GLN A CD  1 
ATOM 480  O OE1 . GLN A 1 57  ? 38.944 -43.061 -31.372 1.00 56.41  ? 57  GLN A OE1 1 
ATOM 481  N NE2 . GLN A 1 57  ? 39.409 -44.701 -32.854 1.00 55.96  ? 57  GLN A NE2 1 
ATOM 482  N N   . GLY A 1 58  ? 36.752 -44.034 -27.339 1.00 44.49  ? 58  GLY A N   1 
ATOM 483  C CA  . GLY A 1 58  ? 36.846 -44.519 -25.972 1.00 44.30  ? 58  GLY A CA  1 
ATOM 484  C C   . GLY A 1 58  ? 35.515 -44.279 -25.322 1.00 43.86  ? 58  GLY A C   1 
ATOM 485  O O   . GLY A 1 58  ? 35.139 -44.984 -24.394 1.00 44.17  ? 58  GLY A O   1 
ATOM 486  N N   . GLY A 1 59  ? 34.796 -43.286 -25.849 1.00 43.40  ? 59  GLY A N   1 
ATOM 487  C CA  . GLY A 1 59  ? 33.447 -42.979 -25.422 1.00 42.26  ? 59  GLY A CA  1 
ATOM 488  C C   . GLY A 1 59  ? 32.363 -43.834 -26.040 1.00 42.53  ? 59  GLY A C   1 
ATOM 489  O O   . GLY A 1 59  ? 31.411 -44.203 -25.353 1.00 42.18  ? 59  GLY A O   1 
ATOM 490  N N   . LEU A 1 60  ? 32.471 -44.129 -27.338 1.00 43.35  ? 60  LEU A N   1 
ATOM 491  C CA  . LEU A 1 60  ? 31.437 -44.943 -28.015 1.00 44.27  ? 60  LEU A CA  1 
ATOM 492  C C   . LEU A 1 60  ? 31.456 -46.387 -27.498 1.00 44.77  ? 60  LEU A C   1 
ATOM 493  O O   . LEU A 1 60  ? 30.406 -46.993 -27.264 1.00 45.25  ? 60  LEU A O   1 
ATOM 494  C CB  . LEU A 1 60  ? 31.616 -44.961 -29.528 1.00 45.23  ? 60  LEU A CB  1 
ATOM 495  C CG  . LEU A 1 60  ? 31.726 -43.679 -30.335 1.00 45.22  ? 60  LEU A CG  1 
ATOM 496  C CD1 . LEU A 1 60  ? 32.640 -43.967 -31.505 1.00 45.49  ? 60  LEU A CD1 1 
ATOM 497  C CD2 . LEU A 1 60  ? 30.380 -43.178 -30.806 1.00 44.11  ? 60  LEU A CD2 1 
ATOM 498  N N   . ALA A 1 61  ? 32.661 -46.915 -27.325 1.00 44.38  ? 61  ALA A N   1 
ATOM 499  C CA  . ALA A 1 61  ? 32.857 -48.191 -26.659 1.00 44.85  ? 61  ALA A CA  1 
ATOM 500  C C   . ALA A 1 61  ? 32.195 -48.306 -25.278 1.00 43.85  ? 61  ALA A C   1 
ATOM 501  O O   . ALA A 1 61  ? 31.442 -49.263 -25.035 1.00 45.05  ? 61  ALA A O   1 
ATOM 502  C CB  . ALA A 1 61  ? 34.326 -48.501 -26.564 1.00 45.21  ? 61  ALA A CB  1 
ATOM 503  N N   . ASN A 1 62  ? 32.464 -47.355 -24.383 1.00 41.84  ? 62  ASN A N   1 
ATOM 504  C CA  . ASN A 1 62  ? 31.830 -47.362 -23.059 1.00 40.85  ? 62  ASN A CA  1 
ATOM 505  C C   . ASN A 1 62  ? 30.292 -47.311 -23.075 1.00 40.83  ? 62  ASN A C   1 
ATOM 506  O O   . ASN A 1 62  ? 29.627 -47.804 -22.141 1.00 40.60  ? 62  ASN A O   1 
ATOM 507  C CB  . ASN A 1 62  ? 32.392 -46.255 -22.178 1.00 39.63  ? 62  ASN A CB  1 
ATOM 508  C CG  . ASN A 1 62  ? 33.746 -46.615 -21.566 1.00 40.29  ? 62  ASN A CG  1 
ATOM 509  O OD1 . ASN A 1 62  ? 33.877 -47.572 -20.782 1.00 40.49  ? 62  ASN A OD1 1 
ATOM 510  N ND2 . ASN A 1 62  ? 34.753 -45.832 -21.901 1.00 40.52  ? 62  ASN A ND2 1 
ATOM 511  N N   . ILE A 1 63  ? 29.739 -46.742 -24.148 1.00 40.64  ? 63  ILE A N   1 
ATOM 512  C CA  . ILE A 1 63  ? 28.294 -46.679 -24.344 1.00 40.53  ? 63  ILE A CA  1 
ATOM 513  C C   . ILE A 1 63  ? 27.733 -48.061 -24.663 1.00 42.13  ? 63  ILE A C   1 
ATOM 514  O O   . ILE A 1 63  ? 26.857 -48.582 -23.955 1.00 42.50  ? 63  ILE A O   1 
ATOM 515  C CB  . ILE A 1 63  ? 27.951 -45.639 -25.426 1.00 40.25  ? 63  ILE A CB  1 
ATOM 516  C CG1 . ILE A 1 63  ? 28.299 -44.257 -24.895 1.00 39.54  ? 63  ILE A CG1 1 
ATOM 517  C CG2 . ILE A 1 63  ? 26.493 -45.666 -25.801 1.00 39.75  ? 63  ILE A CG2 1 
ATOM 518  C CD1 . ILE A 1 63  ? 28.146 -44.140 -23.342 1.00 39.23  ? 63  ILE A CD1 1 
ATOM 519  N N   . ALA A 1 64  ? 28.270 -48.666 -25.717 1.00 43.11  ? 64  ALA A N   1 
ATOM 520  C CA  . ALA A 1 64  ? 27.946 -50.039 -26.063 1.00 44.21  ? 64  ALA A CA  1 
ATOM 521  C C   . ALA A 1 64  ? 28.021 -50.919 -24.826 1.00 44.19  ? 64  ALA A C   1 
ATOM 522  O O   . ALA A 1 64  ? 27.144 -51.736 -24.612 1.00 44.88  ? 64  ALA A O   1 
ATOM 523  C CB  . ALA A 1 64  ? 28.862 -50.540 -27.146 1.00 44.40  ? 64  ALA A CB  1 
ATOM 524  N N   . ILE A 1 65  ? 29.043 -50.709 -24.000 1.00 44.07  ? 65  ILE A N   1 
ATOM 525  C CA  . ILE A 1 65  ? 29.279 -51.538 -22.818 1.00 44.84  ? 65  ILE A CA  1 
ATOM 526  C C   . ILE A 1 65  ? 28.170 -51.337 -21.812 1.00 44.77  ? 65  ILE A C   1 
ATOM 527  O O   . ILE A 1 65  ? 27.720 -52.313 -21.202 1.00 46.14  ? 65  ILE A O   1 
ATOM 528  C CB  . ILE A 1 65  ? 30.667 -51.255 -22.143 1.00 44.90  ? 65  ILE A CB  1 
ATOM 529  C CG1 . ILE A 1 65  ? 31.821 -51.682 -23.053 1.00 44.68  ? 65  ILE A CG1 1 
ATOM 530  C CG2 . ILE A 1 65  ? 30.782 -51.923 -20.714 1.00 44.47  ? 65  ILE A CG2 1 
ATOM 531  C CD1 . ILE A 1 65  ? 33.160 -51.740 -22.336 1.00 45.40  ? 65  ILE A CD1 1 
ATOM 532  N N   . LEU A 1 66  ? 27.716 -50.089 -21.657 1.00 43.81  ? 66  LEU A N   1 
ATOM 533  C CA  . LEU A 1 66  ? 26.610 -49.780 -20.730 1.00 43.70  ? 66  LEU A CA  1 
ATOM 534  C C   . LEU A 1 66  ? 25.239 -50.305 -21.170 1.00 44.69  ? 66  LEU A C   1 
ATOM 535  O O   . LEU A 1 66  ? 24.434 -50.646 -20.312 1.00 45.54  ? 66  LEU A O   1 
ATOM 536  C CB  . LEU A 1 66  ? 26.530 -48.284 -20.401 1.00 42.29  ? 66  LEU A CB  1 
ATOM 537  C CG  . LEU A 1 66  ? 27.686 -47.599 -19.643 1.00 42.58  ? 66  LEU A CG  1 
ATOM 538  C CD1 . LEU A 1 66  ? 27.334 -46.166 -19.300 1.00 41.15  ? 66  LEU A CD1 1 
ATOM 539  C CD2 . LEU A 1 66  ? 28.125 -48.326 -18.358 1.00 44.45  ? 66  LEU A CD2 1 
ATOM 540  N N   . ASN A 1 67  ? 24.968 -50.378 -22.475 1.00 45.16  ? 67  ASN A N   1 
ATOM 541  C CA  . ASN A 1 67  ? 23.739 -51.024 -22.957 1.00 46.99  ? 67  ASN A CA  1 
ATOM 542  C C   . ASN A 1 67  ? 23.681 -52.499 -22.611 1.00 49.02  ? 67  ASN A C   1 
ATOM 543  O O   . ASN A 1 67  ? 22.621 -52.991 -22.241 1.00 50.01  ? 67  ASN A O   1 
ATOM 544  C CB  . ASN A 1 67  ? 23.544 -50.879 -24.468 1.00 47.60  ? 67  ASN A CB  1 
ATOM 545  C CG  . ASN A 1 67  ? 23.373 -49.452 -24.895 1.00 47.03  ? 67  ASN A CG  1 
ATOM 546  O OD1 . ASN A 1 67  ? 22.530 -48.717 -24.361 1.00 44.45  ? 67  ASN A OD1 1 
ATOM 547  N ND2 . ASN A 1 67  ? 24.198 -49.029 -25.853 1.00 47.35  ? 67  ASN A ND2 1 
ATOM 548  N N   . ASN A 1 68  ? 24.803 -53.213 -22.760 1.00 50.19  ? 68  ASN A N   1 
ATOM 549  C CA  . ASN A 1 68  ? 24.864 -54.600 -22.305 1.00 52.42  ? 68  ASN A CA  1 
ATOM 550  C C   . ASN A 1 68  ? 24.517 -54.638 -20.820 1.00 51.96  ? 68  ASN A C   1 
ATOM 551  O O   . ASN A 1 68  ? 23.642 -55.402 -20.394 1.00 53.11  ? 68  ASN A O   1 
ATOM 552  C CB  . ASN A 1 68  ? 26.225 -55.253 -22.570 1.00 53.03  ? 68  ASN A CB  1 
ATOM 553  C CG  . ASN A 1 68  ? 26.608 -55.263 -24.073 1.00 57.49  ? 68  ASN A CG  1 
ATOM 554  O OD1 . ASN A 1 68  ? 27.800 -55.468 -24.436 1.00 60.18  ? 68  ASN A OD1 1 
ATOM 555  N ND2 . ASN A 1 68  ? 25.611 -55.032 -24.955 1.00 59.59  ? 68  ASN A ND2 1 
ATOM 556  N N   . ASN A 1 69  ? 25.170 -53.782 -20.039 1.00 50.03  ? 69  ASN A N   1 
ATOM 557  C CA  . ASN A 1 69  ? 24.859 -53.708 -18.630 1.00 49.39  ? 69  ASN A CA  1 
ATOM 558  C C   . ASN A 1 69  ? 23.412 -53.300 -18.359 1.00 49.32  ? 69  ASN A C   1 
ATOM 559  O O   . ASN A 1 69  ? 22.831 -53.760 -17.360 1.00 50.21  ? 69  ASN A O   1 
ATOM 560  C CB  . ASN A 1 69  ? 25.839 -52.806 -17.902 1.00 48.09  ? 69  ASN A CB  1 
ATOM 561  C CG  . ASN A 1 69  ? 27.277 -53.311 -17.986 1.00 49.62  ? 69  ASN A CG  1 
ATOM 562  O OD1 . ASN A 1 69  ? 28.204 -52.544 -17.761 1.00 51.87  ? 69  ASN A OD1 1 
ATOM 563  N ND2 . ASN A 1 69  ? 27.470 -54.590 -18.313 1.00 49.99  ? 69  ASN A ND2 1 
ATOM 564  N N   . LEU A 1 70  ? 22.815 -52.479 -19.239 1.00 47.96  ? 70  LEU A N   1 
ATOM 565  C CA  . LEU A 1 70  ? 21.400 -52.126 -19.090 1.00 47.97  ? 70  LEU A CA  1 
ATOM 566  C C   . LEU A 1 70  ? 20.520 -53.356 -19.249 1.00 50.19  ? 70  LEU A C   1 
ATOM 567  O O   . LEU A 1 70  ? 19.728 -53.685 -18.357 1.00 50.49  ? 70  LEU A O   1 
ATOM 568  C CB  . LEU A 1 70  ? 20.967 -51.062 -20.089 1.00 47.02  ? 70  LEU A CB  1 
ATOM 569  C CG  . LEU A 1 70  ? 19.627 -50.365 -19.785 1.00 47.75  ? 70  LEU A CG  1 
ATOM 570  C CD1 . LEU A 1 70  ? 19.411 -50.035 -18.274 1.00 47.32  ? 70  LEU A CD1 1 
ATOM 571  C CD2 . LEU A 1 70  ? 19.423 -49.094 -20.619 1.00 46.33  ? 70  LEU A CD2 1 
ATOM 572  N N   . ASN A 1 71  ? 20.679 -54.036 -20.385 1.00 51.33  ? 71  ASN A N   1 
ATOM 573  C CA  . ASN A 1 71  ? 19.959 -55.259 -20.650 1.00 53.82  ? 71  ASN A CA  1 
ATOM 574  C C   . ASN A 1 71  ? 20.065 -56.226 -19.484 1.00 54.25  ? 71  ASN A C   1 
ATOM 575  O O   . ASN A 1 71  ? 19.059 -56.727 -18.994 1.00 55.45  ? 71  ASN A O   1 
ATOM 576  C CB  . ASN A 1 71  ? 20.465 -55.909 -21.937 1.00 55.32  ? 71  ASN A CB  1 
ATOM 577  C CG  . ASN A 1 71  ? 20.318 -54.996 -23.143 1.00 56.67  ? 71  ASN A CG  1 
ATOM 578  O OD1 . ASN A 1 71  ? 21.304 -54.412 -23.610 1.00 56.49  ? 71  ASN A OD1 1 
ATOM 579  N ND2 . ASN A 1 71  ? 19.083 -54.859 -23.651 1.00 57.32  ? 71  ASN A ND2 1 
ATOM 580  N N   . THR A 1 72  ? 21.290 -56.444 -19.026 1.00 53.33  ? 72  THR A N   1 
ATOM 581  C CA  . THR A 1 72  ? 21.585 -57.392 -17.963 1.00 53.98  ? 72  THR A CA  1 
ATOM 582  C C   . THR A 1 72  ? 20.954 -57.023 -16.613 1.00 54.02  ? 72  THR A C   1 
ATOM 583  O O   . THR A 1 72  ? 20.815 -57.873 -15.716 1.00 55.22  ? 72  THR A O   1 
ATOM 584  C CB  . THR A 1 72  ? 23.088 -57.520 -17.794 1.00 53.42  ? 72  THR A CB  1 
ATOM 585  O OG1 . THR A 1 72  ? 23.669 -57.816 -19.067 1.00 53.76  ? 72  THR A OG1 1 
ATOM 586  C CG2 . THR A 1 72  ? 23.435 -58.606 -16.794 1.00 53.47  ? 72  THR A CG2 1 
ATOM 587  N N   . LEU A 1 73  ? 20.565 -55.765 -16.459 1.00 52.13  ? 73  LEU A N   1 
ATOM 588  C CA  . LEU A 1 73  ? 19.974 -55.378 -15.203 1.00 51.53  ? 73  LEU A CA  1 
ATOM 589  C C   . LEU A 1 73  ? 18.497 -55.079 -15.309 1.00 52.46  ? 73  LEU A C   1 
ATOM 590  O O   . LEU A 1 73  ? 17.800 -55.022 -14.294 1.00 53.75  ? 73  LEU A O   1 
ATOM 591  C CB  . LEU A 1 73  ? 20.758 -54.245 -14.558 1.00 49.45  ? 73  LEU A CB  1 
ATOM 592  C CG  . LEU A 1 73  ? 21.821 -54.897 -13.692 1.00 48.63  ? 73  LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 73  ? 23.147 -55.050 -14.428 1.00 48.84  ? 73  LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 73  ? 22.000 -54.109 -12.478 1.00 46.40  ? 73  LEU A CD2 1 
ATOM 595  N N   . ILE A 1 74  ? 18.007 -54.894 -16.527 1.00 52.37  ? 74  ILE A N   1 
ATOM 596  C CA  . ILE A 1 74  ? 16.572 -54.962 -16.761 1.00 53.03  ? 74  ILE A CA  1 
ATOM 597  C C   . ILE A 1 74  ? 16.158 -56.400 -16.404 1.00 55.47  ? 74  ILE A C   1 
ATOM 598  O O   . ILE A 1 74  ? 15.252 -56.611 -15.579 1.00 56.60  ? 74  ILE A O   1 
ATOM 599  C CB  . ILE A 1 74  ? 16.209 -54.570 -18.221 1.00 53.02  ? 74  ILE A CB  1 
ATOM 600  C CG1 . ILE A 1 74  ? 16.543 -53.080 -18.463 1.00 51.30  ? 74  ILE A CG1 1 
ATOM 601  C CG2 . ILE A 1 74  ? 14.758 -54.873 -18.529 1.00 52.85  ? 74  ILE A CG2 1 
ATOM 602  C CD1 . ILE A 1 74  ? 16.669 -52.658 -19.934 1.00 50.57  ? 74  ILE A CD1 1 
ATOM 603  N N   . GLN A 1 75  ? 16.865 -57.374 -16.985 1.00 56.11  ? 75  GLN A N   1 
ATOM 604  C CA  . GLN A 1 75  ? 16.618 -58.783 -16.712 1.00 58.32  ? 75  GLN A CA  1 
ATOM 605  C C   . GLN A 1 75  ? 16.698 -59.094 -15.242 1.00 58.84  ? 75  GLN A C   1 
ATOM 606  O O   . GLN A 1 75  ? 15.725 -59.536 -14.656 1.00 60.58  ? 75  GLN A O   1 
ATOM 607  C CB  . GLN A 1 75  ? 17.572 -59.709 -17.493 1.00 59.11  ? 75  GLN A CB  1 
ATOM 608  C CG  . GLN A 1 75  ? 17.311 -59.783 -18.992 1.00 59.57  ? 75  GLN A CG  1 
ATOM 609  C CD  . GLN A 1 75  ? 15.857 -59.502 -19.325 1.00 60.56  ? 75  GLN A CD  1 
ATOM 610  O OE1 . GLN A 1 75  ? 14.984 -60.351 -19.138 1.00 61.56  ? 75  GLN A OE1 1 
ATOM 611  N NE2 . GLN A 1 75  ? 15.589 -58.288 -19.799 1.00 59.26  ? 75  GLN A NE2 1 
ATOM 612  N N   . ARG A 1 76  ? 17.839 -58.866 -14.618 1.00 58.37  ? 76  ARG A N   1 
ATOM 613  C CA  . ARG A 1 76  ? 17.957 -59.420 -13.287 1.00 60.06  ? 76  ARG A CA  1 
ATOM 614  C C   . ARG A 1 76  ? 17.192 -58.652 -12.210 1.00 60.22  ? 76  ARG A C   1 
ATOM 615  O O   . ARG A 1 76  ? 16.792 -59.234 -11.205 1.00 61.59  ? 76  ARG A O   1 
ATOM 616  C CB  . ARG A 1 76  ? 19.395 -59.833 -12.920 1.00 59.45  ? 76  ARG A CB  1 
ATOM 617  C CG  . ARG A 1 76  ? 20.288 -58.817 -12.237 1.00 59.10  ? 76  ARG A CG  1 
ATOM 618  C CD  . ARG A 1 76  ? 21.755 -59.201 -12.475 1.00 60.35  ? 76  ARG A CD  1 
ATOM 619  N NE  . ARG A 1 76  ? 22.669 -58.762 -11.419 1.00 60.01  ? 76  ARG A NE  1 
ATOM 620  C CZ  . ARG A 1 76  ? 23.995 -58.666 -11.559 1.00 59.84  ? 76  ARG A CZ  1 
ATOM 621  N NH1 . ARG A 1 76  ? 24.584 -58.950 -12.723 1.00 58.54  ? 76  ARG A NH1 1 
ATOM 622  N NH2 . ARG A 1 76  ? 24.736 -58.260 -10.536 1.00 59.44  ? 76  ARG A NH2 1 
ATOM 623  N N   . SER A 1 77  ? 16.931 -57.366 -12.461 1.00 59.23  ? 77  SER A N   1 
ATOM 624  C CA  . SER A 1 77  ? 16.174 -56.524 -11.525 1.00 59.33  ? 77  SER A CA  1 
ATOM 625  C C   . SER A 1 77  ? 14.701 -56.909 -11.428 1.00 61.48  ? 77  SER A C   1 
ATOM 626  O O   . SER A 1 77  ? 14.004 -56.455 -10.512 1.00 62.10  ? 77  SER A O   1 
ATOM 627  C CB  . SER A 1 77  ? 16.284 -55.043 -11.914 1.00 57.27  ? 77  SER A CB  1 
ATOM 628  O OG  . SER A 1 77  ? 15.440 -54.727 -13.019 1.00 57.50  ? 77  SER A OG  1 
ATOM 629  N N   . ASN A 1 78  ? 14.246 -57.743 -12.366 1.00 63.20  ? 78  ASN A N   1 
ATOM 630  C CA  . ASN A 1 78  ? 12.822 -58.060 -12.580 1.00 65.60  ? 78  ASN A CA  1 
ATOM 631  C C   . ASN A 1 78  ? 12.078 -56.916 -13.262 1.00 64.74  ? 78  ASN A C   1 
ATOM 632  O O   . ASN A 1 78  ? 10.860 -56.820 -13.152 1.00 66.00  ? 78  ASN A O   1 
ATOM 633  C CB  . ASN A 1 78  ? 12.085 -58.478 -11.286 1.00 66.87  ? 78  ASN A CB  1 
ATOM 634  C CG  . ASN A 1 78  ? 12.331 -59.922 -10.907 1.00 69.99  ? 78  ASN A CG  1 
ATOM 635  O OD1 . ASN A 1 78  ? 13.107 -60.624 -11.562 1.00 70.50  ? 78  ASN A OD1 1 
ATOM 636  N ND2 . ASN A 1 78  ? 11.660 -60.386 -9.841  1.00 73.16  ? 78  ASN A ND2 1 
ATOM 637  N N   . HIS A 1 79  ? 12.807 -56.052 -13.966 1.00 63.01  ? 79  HIS A N   1 
ATOM 638  C CA  . HIS A 1 79  ? 12.195 -54.913 -14.691 1.00 62.10  ? 79  HIS A CA  1 
ATOM 639  C C   . HIS A 1 79  ? 11.798 -53.744 -13.798 1.00 60.45  ? 79  HIS A C   1 
ATOM 640  O O   . HIS A 1 79  ? 10.750 -53.143 -14.000 1.00 60.10  ? 79  HIS A O   1 
ATOM 641  C CB  . HIS A 1 79  ? 10.986 -55.359 -15.535 1.00 63.87  ? 79  HIS A CB  1 
ATOM 642  C CG  . HIS A 1 79  ? 11.362 -55.958 -16.858 1.00 65.98  ? 79  HIS A CG  1 
ATOM 643  N ND1 . HIS A 1 79  ? 11.106 -55.330 -18.059 1.00 66.07  ? 79  HIS A ND1 1 
ATOM 644  C CD2 . HIS A 1 79  ? 11.996 -57.117 -17.166 1.00 66.71  ? 79  HIS A CD2 1 
ATOM 645  C CE1 . HIS A 1 79  ? 11.555 -56.082 -19.050 1.00 67.07  ? 79  HIS A CE1 1 
ATOM 646  N NE2 . HIS A 1 79  ? 12.101 -57.169 -18.535 1.00 67.33  ? 79  HIS A NE2 1 
ATOM 647  N N   . THR A 1 80  ? 12.649 -53.413 -12.829 1.00 59.10  ? 80  THR A N   1 
ATOM 648  C CA  . THR A 1 80  ? 12.334 -52.340 -11.900 1.00 58.04  ? 80  THR A CA  1 
ATOM 649  C C   . THR A 1 80  ? 12.557 -50.996 -12.575 1.00 55.89  ? 80  THR A C   1 
ATOM 650  O O   . THR A 1 80  ? 13.636 -50.701 -13.084 1.00 54.72  ? 80  THR A O   1 
ATOM 651  C CB  . THR A 1 80  ? 13.141 -52.443 -10.576 1.00 58.10  ? 80  THR A CB  1 
ATOM 652  O OG1 . THR A 1 80  ? 12.724 -53.609 -9.847  1.00 61.00  ? 80  THR A OG1 1 
ATOM 653  C CG2 . THR A 1 80  ? 12.926 -51.200 -9.690  1.00 56.68  ? 80  THR A CG2 1 
ATOM 654  N N   . GLN A 1 81  ? 11.499 -50.205 -12.606 1.00 55.34  ? 81  GLN A N   1 
ATOM 655  C CA  . GLN A 1 81  ? 11.577 -48.835 -13.002 1.00 53.19  ? 81  GLN A CA  1 
ATOM 656  C C   . GLN A 1 81  ? 11.646 -48.028 -11.714 1.00 52.50  ? 81  GLN A C   1 
ATOM 657  O O   . GLN A 1 81  ? 10.980 -48.367 -10.728 1.00 53.26  ? 81  GLN A O   1 
ATOM 658  C CB  . GLN A 1 81  ? 10.347 -48.458 -13.802 1.00 53.77  ? 81  GLN A CB  1 
ATOM 659  C CG  . GLN A 1 81  ? 10.514 -47.178 -14.590 1.00 52.96  ? 81  GLN A CG  1 
ATOM 660  C CD  . GLN A 1 81  ? 9.434  -47.008 -15.633 1.00 54.47  ? 81  GLN A CD  1 
ATOM 661  O OE1 . GLN A 1 81  ? 8.899  -47.994 -16.172 1.00 56.58  ? 81  GLN A OE1 1 
ATOM 662  N NE2 . GLN A 1 81  ? 9.096  -45.755 -15.923 1.00 51.78  ? 81  GLN A NE2 1 
ATOM 663  N N   . ALA A 1 82  ? 12.482 -46.985 -11.727 1.00 50.48  ? 82  ALA A N   1 
ATOM 664  C CA  . ALA A 1 82  ? 12.667 -46.085 -10.590 1.00 49.37  ? 82  ALA A CA  1 
ATOM 665  C C   . ALA A 1 82  ? 11.479 -45.127 -10.441 1.00 49.36  ? 82  ALA A C   1 
ATOM 666  O O   . ALA A 1 82  ? 10.857 -44.766 -11.434 1.00 49.40  ? 82  ALA A O   1 
ATOM 667  C CB  . ALA A 1 82  ? 13.950 -45.292 -10.786 1.00 47.56  ? 82  ALA A CB  1 
ATOM 668  N N   . THR A 1 83  ? 11.174 -44.698 -9.223  1.00 49.31  ? 83  THR A N   1 
ATOM 669  C CA  . THR A 1 83  ? 10.161 -43.681 -9.056  1.00 50.05  ? 83  THR A CA  1 
ATOM 670  C C   . THR A 1 83  ? 10.651 -42.350 -9.656  1.00 48.69  ? 83  THR A C   1 
ATOM 671  O O   . THR A 1 83  ? 11.853 -42.092 -9.734  1.00 47.91  ? 83  THR A O   1 
ATOM 672  C CB  . THR A 1 83  ? 9.723  -43.499 -7.561  1.00 51.29  ? 83  THR A CB  1 
ATOM 673  O OG1 . THR A 1 83  ? 10.786 -42.908 -6.817  1.00 50.55  ? 83  THR A OG1 1 
ATOM 674  C CG2 . THR A 1 83  ? 9.333  -44.846 -6.898  1.00 53.26  ? 83  THR A CG2 1 
ATOM 675  N N   . ASN A 1 84  ? 9.709  -41.505 -10.076 1.00 49.18  ? 84  ASN A N   1 
ATOM 676  C CA  . ASN A 1 84  ? 10.017 -40.221 -10.709 1.00 47.58  ? 84  ASN A CA  1 
ATOM 677  C C   . ASN A 1 84  ? 10.343 -39.152 -9.692  1.00 46.85  ? 84  ASN A C   1 
ATOM 678  O O   . ASN A 1 84  ? 9.455  -38.675 -8.991  1.00 47.52  ? 84  ASN A O   1 
ATOM 679  C CB  . ASN A 1 84  ? 8.846  -39.764 -11.580 1.00 47.95  ? 84  ASN A CB  1 
ATOM 680  C CG  . ASN A 1 84  ? 8.736  -40.559 -12.849 1.00 49.05  ? 84  ASN A CG  1 
ATOM 681  O OD1 . ASN A 1 84  ? 9.571  -40.447 -13.741 1.00 49.86  ? 84  ASN A OD1 1 
ATOM 682  N ND2 . ASN A 1 84  ? 7.714  -41.391 -12.932 1.00 51.93  ? 84  ASN A ND2 1 
ATOM 683  N N   . ASP A 1 85  ? 11.623 -38.790 -9.614  1.00 45.71  ? 85  ASP A N   1 
ATOM 684  C CA  . ASP A 1 85  ? 12.091 -37.751 -8.707  1.00 44.64  ? 85  ASP A CA  1 
ATOM 685  C C   . ASP A 1 85  ? 11.989 -36.393 -9.410  1.00 43.04  ? 85  ASP A C   1 
ATOM 686  O O   . ASP A 1 85  ? 12.647 -36.184 -10.437 1.00 41.79  ? 85  ASP A O   1 
ATOM 687  C CB  . ASP A 1 85  ? 13.527 -38.040 -8.260  1.00 44.82  ? 85  ASP A CB  1 
ATOM 688  C CG  . ASP A 1 85  ? 13.658 -39.335 -7.465  1.00 47.41  ? 85  ASP A CG  1 
ATOM 689  O OD1 . ASP A 1 85  ? 14.366 -40.256 -7.932  1.00 50.32  ? 85  ASP A OD1 1 
ATOM 690  O OD2 . ASP A 1 85  ? 13.061 -39.438 -6.369  1.00 50.41  ? 85  ASP A OD2 1 
ATOM 691  N N   . PRO A 1 86  ? 11.150 -35.474 -8.868  1.00 42.62  ? 86  PRO A N   1 
ATOM 692  C CA  . PRO A 1 86  ? 10.848 -34.189 -9.509  1.00 41.59  ? 86  PRO A CA  1 
ATOM 693  C C   . PRO A 1 86  ? 11.957 -33.139 -9.394  1.00 40.59  ? 86  PRO A C   1 
ATOM 694  O O   . PRO A 1 86  ? 12.645 -33.098 -8.373  1.00 40.86  ? 86  PRO A O   1 
ATOM 695  C CB  . PRO A 1 86  ? 9.594  -33.715 -8.760  1.00 42.18  ? 86  PRO A CB  1 
ATOM 696  C CG  . PRO A 1 86  ? 9.660  -34.370 -7.448  1.00 42.45  ? 86  PRO A CG  1 
ATOM 697  C CD  . PRO A 1 86  ? 10.346 -35.674 -7.644  1.00 43.34  ? 86  PRO A CD  1 
ATOM 698  N N   . PRO A 1 87  ? 12.130 -32.287 -10.437 1.00 39.83  ? 87  PRO A N   1 
ATOM 699  C CA  . PRO A 1 87  ? 13.078 -31.163 -10.375 1.00 39.05  ? 87  PRO A CA  1 
ATOM 700  C C   . PRO A 1 87  ? 12.731 -30.053 -9.364  1.00 39.86  ? 87  PRO A C   1 
ATOM 701  O O   . PRO A 1 87  ? 11.554 -29.724 -9.141  1.00 39.88  ? 87  PRO A O   1 
ATOM 702  C CB  . PRO A 1 87  ? 13.050 -30.592 -11.807 1.00 37.50  ? 87  PRO A CB  1 
ATOM 703  C CG  . PRO A 1 87  ? 11.790 -31.021 -12.373 1.00 37.53  ? 87  PRO A CG  1 
ATOM 704  C CD  . PRO A 1 87  ? 11.486 -32.364 -11.766 1.00 39.58  ? 87  PRO A CD  1 
ATOM 705  N N   . GLU A 1 88  ? 13.786 -29.504 -8.768  1.00 40.42  ? 88  GLU A N   1 
ATOM 706  C CA  . GLU A 1 88  ? 13.764 -28.243 -8.022  1.00 41.61  ? 88  GLU A CA  1 
ATOM 707  C C   . GLU A 1 88  ? 14.472 -27.227 -8.949  1.00 40.20  ? 88  GLU A C   1 
ATOM 708  O O   . GLU A 1 88  ? 15.531 -27.540 -9.510  1.00 39.91  ? 88  GLU A O   1 
ATOM 709  C CB  . GLU A 1 88  ? 14.511 -28.423 -6.691  1.00 42.30  ? 88  GLU A CB  1 
ATOM 710  C CG  . GLU A 1 88  ? 14.899 -27.137 -5.943  1.00 47.17  ? 88  GLU A CG  1 
ATOM 711  C CD  . GLU A 1 88  ? 16.333 -27.185 -5.354  1.00 54.56  ? 88  GLU A CD  1 
ATOM 712  O OE1 . GLU A 1 88  ? 17.106 -26.210 -5.561  1.00 57.12  ? 88  GLU A OE1 1 
ATOM 713  O OE2 . GLU A 1 88  ? 16.711 -28.202 -4.708  1.00 56.69  ? 88  GLU A OE2 1 
ATOM 714  N N   . VAL A 1 89  ? 13.870 -26.050 -9.145  1.00 39.40  ? 89  VAL A N   1 
ATOM 715  C CA  . VAL A 1 89  ? 14.359 -25.058 -10.128 1.00 38.43  ? 89  VAL A CA  1 
ATOM 716  C C   . VAL A 1 89  ? 14.647 -23.656 -9.552  1.00 38.48  ? 89  VAL A C   1 
ATOM 717  O O   . VAL A 1 89  ? 13.835 -23.102 -8.823  1.00 39.91  ? 89  VAL A O   1 
ATOM 718  C CB  . VAL A 1 89  ? 13.342 -24.864 -11.254 1.00 38.53  ? 89  VAL A CB  1 
ATOM 719  C CG1 . VAL A 1 89  ? 13.900 -23.928 -12.326 1.00 39.36  ? 89  VAL A CG1 1 
ATOM 720  C CG2 . VAL A 1 89  ? 12.933 -26.199 -11.847 1.00 37.90  ? 89  VAL A CG2 1 
ATOM 721  N N   . THR A 1 90  ? 15.795 -23.091 -9.898  1.00 37.37  ? 90  THR A N   1 
ATOM 722  C CA  . THR A 1 90  ? 16.150 -21.719 -9.573  1.00 37.26  ? 90  THR A CA  1 
ATOM 723  C C   . THR A 1 90  ? 16.511 -21.010 -10.862 1.00 35.82  ? 90  THR A C   1 
ATOM 724  O O   . THR A 1 90  ? 17.011 -21.632 -11.775 1.00 35.97  ? 90  THR A O   1 
ATOM 725  C CB  . THR A 1 90  ? 17.394 -21.688 -8.718  1.00 37.46  ? 90  THR A CB  1 
ATOM 726  O OG1 . THR A 1 90  ? 18.187 -22.825 -9.050  1.00 39.65  ? 90  THR A OG1 1 
ATOM 727  C CG2 . THR A 1 90  ? 17.048 -21.794 -7.276  1.00 39.19  ? 90  THR A CG2 1 
ATOM 728  N N   . VAL A 1 91  ? 16.249 -19.715 -10.932 1.00 35.79  ? 91  VAL A N   1 
ATOM 729  C CA  . VAL A 1 91  ? 16.645 -18.850 -12.049 1.00 35.12  ? 91  VAL A CA  1 
ATOM 730  C C   . VAL A 1 91  ? 17.353 -17.605 -11.510 1.00 35.31  ? 91  VAL A C   1 
ATOM 731  O O   . VAL A 1 91  ? 16.849 -16.919 -10.632 1.00 36.35  ? 91  VAL A O   1 
ATOM 732  C CB  . VAL A 1 91  ? 15.424 -18.355 -12.877 1.00 34.89  ? 91  VAL A CB  1 
ATOM 733  C CG1 . VAL A 1 91  ? 15.885 -17.739 -14.177 1.00 36.02  ? 91  VAL A CG1 1 
ATOM 734  C CG2 . VAL A 1 91  ? 14.494 -19.477 -13.191 1.00 34.46  ? 91  VAL A CG2 1 
ATOM 735  N N   . PHE A 1 92  ? 18.518 -17.298 -12.045 1.00 35.06  ? 92  PHE A N   1 
ATOM 736  C CA  . PHE A 1 92  ? 19.267 -16.136 -11.582 1.00 34.81  ? 92  PHE A CA  1 
ATOM 737  C C   . PHE A 1 92  ? 20.084 -15.678 -12.761 1.00 34.35  ? 92  PHE A C   1 
ATOM 738  O O   . PHE A 1 92  ? 20.268 -16.477 -13.690 1.00 33.08  ? 92  PHE A O   1 
ATOM 739  C CB  . PHE A 1 92  ? 20.144 -16.513 -10.391 1.00 34.72  ? 92  PHE A CB  1 
ATOM 740  C CG  . PHE A 1 92  ? 20.910 -17.766 -10.599 1.00 32.70  ? 92  PHE A CG  1 
ATOM 741  C CD1 . PHE A 1 92  ? 22.212 -17.723 -11.086 1.00 31.85  ? 92  PHE A CD1 1 
ATOM 742  C CD2 . PHE A 1 92  ? 20.324 -19.002 -10.331 1.00 31.66  ? 92  PHE A CD2 1 
ATOM 743  C CE1 . PHE A 1 92  ? 22.906 -18.885 -11.301 1.00 30.19  ? 92  PHE A CE1 1 
ATOM 744  C CE2 . PHE A 1 92  ? 21.007 -20.180 -10.537 1.00 27.91  ? 92  PHE A CE2 1 
ATOM 745  C CZ  . PHE A 1 92  ? 22.289 -20.128 -11.022 1.00 29.66  ? 92  PHE A CZ  1 
ATOM 746  N N   . PRO A 1 93  ? 20.509 -14.391 -12.763 1.00 35.17  ? 93  PRO A N   1 
ATOM 747  C CA  . PRO A 1 93  ? 21.356 -13.809 -13.813 1.00 36.06  ? 93  PRO A CA  1 
ATOM 748  C C   . PRO A 1 93  ? 22.829 -14.073 -13.583 1.00 37.76  ? 93  PRO A C   1 
ATOM 749  O O   . PRO A 1 93  ? 23.238 -14.342 -12.439 1.00 39.29  ? 93  PRO A O   1 
ATOM 750  C CB  . PRO A 1 93  ? 21.106 -12.294 -13.686 1.00 36.85  ? 93  PRO A CB  1 
ATOM 751  C CG  . PRO A 1 93  ? 20.642 -12.073 -12.309 1.00 36.85  ? 93  PRO A CG  1 
ATOM 752  C CD  . PRO A 1 93  ? 19.939 -13.350 -11.883 1.00 35.93  ? 93  PRO A CD  1 
ATOM 753  N N   . LYS A 1 94  ? 23.627 -13.941 -14.646 1.00 38.37  ? 94  LYS A N   1 
ATOM 754  C CA  . LYS A 1 94  ? 25.057 -14.180 -14.577 1.00 38.46  ? 94  LYS A CA  1 
ATOM 755  C C   . LYS A 1 94  ? 25.777 -13.002 -13.941 1.00 40.43  ? 94  LYS A C   1 
ATOM 756  O O   . LYS A 1 94  ? 26.724 -13.198 -13.180 1.00 41.40  ? 94  LYS A O   1 
ATOM 757  C CB  . LYS A 1 94  ? 25.609 -14.474 -15.967 1.00 37.76  ? 94  LYS A CB  1 
ATOM 758  C CG  . LYS A 1 94  ? 26.922 -15.261 -15.997 1.00 38.43  ? 94  LYS A CG  1 
ATOM 759  C CD  . LYS A 1 94  ? 27.581 -15.268 -17.400 1.00 38.50  ? 94  LYS A CD  1 
ATOM 760  C CE  . LYS A 1 94  ? 29.111 -15.283 -17.361 1.00 38.28  ? 94  LYS A CE  1 
ATOM 761  N NZ  . LYS A 1 94  ? 29.673 -16.635 -16.998 1.00 39.62  ? 94  LYS A NZ  1 
ATOM 762  N N   . GLU A 1 95  ? 25.338 -11.780 -14.230 1.00 41.63  ? 95  GLU A N   1 
ATOM 763  C CA  . GLU A 1 95  ? 25.986 -10.581 -13.653 1.00 43.52  ? 95  GLU A CA  1 
ATOM 764  C C   . GLU A 1 95  ? 24.988 -9.786  -12.838 1.00 43.81  ? 95  GLU A C   1 
ATOM 765  O O   . GLU A 1 95  ? 23.803 -9.947  -13.030 1.00 42.77  ? 95  GLU A O   1 
ATOM 766  C CB  . GLU A 1 95  ? 26.569 -9.666  -14.744 1.00 44.72  ? 95  GLU A CB  1 
ATOM 767  C CG  . GLU A 1 95  ? 27.528 -10.325 -15.719 1.00 45.13  ? 95  GLU A CG  1 
ATOM 768  C CD  . GLU A 1 95  ? 28.797 -10.831 -15.048 1.00 48.50  ? 95  GLU A CD  1 
ATOM 769  O OE1 . GLU A 1 95  ? 29.244 -10.238 -14.025 1.00 51.27  ? 95  GLU A OE1 1 
ATOM 770  O OE2 . GLU A 1 95  ? 29.368 -11.822 -15.557 1.00 48.19  ? 95  GLU A OE2 1 
ATOM 771  N N   . PRO A 1 96  ? 25.472 -8.906  -11.940 1.00 45.68  ? 96  PRO A N   1 
ATOM 772  C CA  . PRO A 1 96  ? 24.546 -8.027  -11.248 1.00 46.68  ? 96  PRO A CA  1 
ATOM 773  C C   . PRO A 1 96  ? 23.778 -7.289  -12.321 1.00 47.37  ? 96  PRO A C   1 
ATOM 774  O O   . PRO A 1 96  ? 24.385 -6.651  -13.176 1.00 48.84  ? 96  PRO A O   1 
ATOM 775  C CB  . PRO A 1 96  ? 25.477 -7.062  -10.514 1.00 48.58  ? 96  PRO A CB  1 
ATOM 776  C CG  . PRO A 1 96  ? 26.768 -7.822  -10.367 1.00 47.63  ? 96  PRO A CG  1 
ATOM 777  C CD  . PRO A 1 96  ? 26.878 -8.555  -11.643 1.00 46.47  ? 96  PRO A CD  1 
ATOM 778  N N   . VAL A 1 97  ? 22.462 -7.429  -12.300 1.00 47.49  ? 97  VAL A N   1 
ATOM 779  C CA  . VAL A 1 97  ? 21.571 -6.856  -13.291 1.00 47.88  ? 97  VAL A CA  1 
ATOM 780  C C   . VAL A 1 97  ? 21.815 -5.377  -13.504 1.00 50.09  ? 97  VAL A C   1 
ATOM 781  O O   . VAL A 1 97  ? 21.808 -4.583  -12.555 1.00 51.05  ? 97  VAL A O   1 
ATOM 782  C CB  . VAL A 1 97  ? 20.119 -7.006  -12.836 1.00 47.76  ? 97  VAL A CB  1 
ATOM 783  C CG1 . VAL A 1 97  ? 19.132 -6.227  -13.770 1.00 48.00  ? 97  VAL A CG1 1 
ATOM 784  C CG2 . VAL A 1 97  ? 19.760 -8.457  -12.731 1.00 46.95  ? 97  VAL A CG2 1 
ATOM 785  N N   . GLU A 1 98  ? 22.028 -5.006  -14.758 1.00 51.00  ? 98  GLU A N   1 
ATOM 786  C CA  . GLU A 1 98  ? 22.079 -3.594  -15.091 1.00 53.62  ? 98  GLU A CA  1 
ATOM 787  C C   . GLU A 1 98  ? 21.277 -3.297  -16.354 1.00 53.18  ? 98  GLU A C   1 
ATOM 788  O O   . GLU A 1 98  ? 21.525 -3.848  -17.432 1.00 52.60  ? 98  GLU A O   1 
ATOM 789  C CB  . GLU A 1 98  ? 23.523 -3.092  -15.183 1.00 54.96  ? 98  GLU A CB  1 
ATOM 790  C CG  . GLU A 1 98  ? 23.689 -1.701  -14.621 1.00 59.77  ? 98  GLU A CG  1 
ATOM 791  C CD  . GLU A 1 98  ? 25.145 -1.262  -14.544 1.00 65.92  ? 98  GLU A CD  1 
ATOM 792  O OE1 . GLU A 1 98  ? 25.382 -0.022  -14.639 1.00 68.23  ? 98  GLU A OE1 1 
ATOM 793  O OE2 . GLU A 1 98  ? 26.044 -2.148  -14.388 1.00 65.62  ? 98  GLU A OE2 1 
ATOM 794  N N   . LEU A 1 99  ? 20.305 -2.422  -16.170 1.00 53.80  ? 99  LEU A N   1 
ATOM 795  C CA  . LEU A 1 99  ? 19.319 -2.056  -17.161 1.00 54.16  ? 99  LEU A CA  1 
ATOM 796  C C   . LEU A 1 99  ? 19.930 -1.756  -18.537 1.00 54.37  ? 99  LEU A C   1 
ATOM 797  O O   . LEU A 1 99  ? 21.026 -1.197  -18.626 1.00 55.82  ? 99  LEU A O   1 
ATOM 798  C CB  . LEU A 1 99  ? 18.642 -0.812  -16.621 1.00 56.16  ? 99  LEU A CB  1 
ATOM 799  C CG  . LEU A 1 99  ? 17.164 -0.494  -16.783 1.00 57.33  ? 99  LEU A CG  1 
ATOM 800  C CD1 . LEU A 1 99  ? 16.368 -1.126  -15.631 1.00 55.82  ? 99  LEU A CD1 1 
ATOM 801  C CD2 . LEU A 1 99  ? 17.025 1.066   -16.841 1.00 58.72  ? 99  LEU A CD2 1 
ATOM 802  N N   . GLY A 1 100 ? 19.231 -2.133  -19.608 1.00 53.29  ? 100 GLY A N   1 
ATOM 803  C CA  . GLY A 1 100 ? 19.691 -1.840  -20.965 1.00 53.03  ? 100 GLY A CA  1 
ATOM 804  C C   . GLY A 1 100 ? 21.024 -2.467  -21.300 1.00 52.56  ? 100 GLY A C   1 
ATOM 805  O O   . GLY A 1 100 ? 21.492 -2.361  -22.423 1.00 52.91  ? 100 GLY A O   1 
ATOM 806  N N   . GLN A 1 101 ? 21.630 -3.138  -20.328 1.00 52.03  ? 101 GLN A N   1 
ATOM 807  C CA  . GLN A 1 101 ? 22.977 -3.699  -20.479 1.00 52.47  ? 101 GLN A CA  1 
ATOM 808  C C   . GLN A 1 101 ? 22.995 -5.258  -20.615 1.00 50.18  ? 101 GLN A C   1 
ATOM 809  O O   . GLN A 1 101 ? 22.527 -5.958  -19.711 1.00 49.14  ? 101 GLN A O   1 
ATOM 810  C CB  . GLN A 1 101 ? 23.855 -3.212  -19.315 1.00 53.33  ? 101 GLN A CB  1 
ATOM 811  C CG  . GLN A 1 101 ? 25.314 -2.880  -19.684 1.00 57.64  ? 101 GLN A CG  1 
ATOM 812  C CD  . GLN A 1 101 ? 25.471 -1.716  -20.688 1.00 61.72  ? 101 GLN A CD  1 
ATOM 813  O OE1 . GLN A 1 101 ? 24.634 -0.810  -20.757 1.00 63.68  ? 101 GLN A OE1 1 
ATOM 814  N NE2 . GLN A 1 101 ? 26.564 -1.737  -21.451 1.00 63.26  ? 101 GLN A NE2 1 
ATOM 815  N N   . PRO A 1 102 ? 23.526 -5.791  -21.750 1.00 49.44  ? 102 PRO A N   1 
ATOM 816  C CA  . PRO A 1 102 ? 23.567 -7.244  -22.061 1.00 47.61  ? 102 PRO A CA  1 
ATOM 817  C C   . PRO A 1 102 ? 24.042 -8.180  -20.925 1.00 46.33  ? 102 PRO A C   1 
ATOM 818  O O   . PRO A 1 102 ? 25.042 -7.913  -20.239 1.00 46.49  ? 102 PRO A O   1 
ATOM 819  C CB  . PRO A 1 102 ? 24.504 -7.323  -23.276 1.00 48.08  ? 102 PRO A CB  1 
ATOM 820  C CG  . PRO A 1 102 ? 24.323 -5.983  -23.960 1.00 49.48  ? 102 PRO A CG  1 
ATOM 821  C CD  . PRO A 1 102 ? 24.111 -4.986  -22.847 1.00 50.68  ? 102 PRO A CD  1 
ATOM 822  N N   . ASN A 1 103 ? 23.301 -9.275  -20.751 1.00 44.64  ? 103 ASN A N   1 
ATOM 823  C CA  . ASN A 1 103 ? 23.456 -10.174 -19.612 1.00 42.93  ? 103 ASN A CA  1 
ATOM 824  C C   . ASN A 1 103 ? 23.052 -11.583 -20.028 1.00 41.16  ? 103 ASN A C   1 
ATOM 825  O O   . ASN A 1 103 ? 22.672 -11.814 -21.177 1.00 41.11  ? 103 ASN A O   1 
ATOM 826  C CB  . ASN A 1 103 ? 22.598 -9.673  -18.432 1.00 42.98  ? 103 ASN A CB  1 
ATOM 827  C CG  . ASN A 1 103 ? 23.142 -10.105 -17.055 1.00 42.13  ? 103 ASN A CG  1 
ATOM 828  O OD1 . ASN A 1 103 ? 23.666 -11.216 -16.888 1.00 38.49  ? 103 ASN A OD1 1 
ATOM 829  N ND2 . ASN A 1 103 ? 23.004 -9.221  -16.064 1.00 41.01  ? 103 ASN A ND2 1 
ATOM 830  N N   . THR A 1 104 ? 23.135 -12.517 -19.088 1.00 39.78  ? 104 THR A N   1 
ATOM 831  C CA  . THR A 1 104 ? 22.729 -13.892 -19.309 1.00 38.17  ? 104 THR A CA  1 
ATOM 832  C C   . THR A 1 104 ? 21.915 -14.429 -18.141 1.00 37.62  ? 104 THR A C   1 
ATOM 833  O O   . THR A 1 104 ? 22.341 -14.375 -16.983 1.00 37.62  ? 104 THR A O   1 
ATOM 834  C CB  . THR A 1 104 ? 23.926 -14.772 -19.477 1.00 37.33  ? 104 THR A CB  1 
ATOM 835  O OG1 . THR A 1 104 ? 24.753 -14.197 -20.475 1.00 38.91  ? 104 THR A OG1 1 
ATOM 836  C CG2 . THR A 1 104 ? 23.506 -16.166 -19.916 1.00 37.43  ? 104 THR A CG2 1 
ATOM 837  N N   . LEU A 1 105 ? 20.740 -14.956 -18.457 1.00 37.05  ? 105 LEU A N   1 
ATOM 838  C CA  . LEU A 1 105 ? 19.891 -15.544 -17.447 1.00 36.69  ? 105 LEU A CA  1 
ATOM 839  C C   . LEU A 1 105 ? 20.211 -17.019 -17.403 1.00 36.04  ? 105 LEU A C   1 
ATOM 840  O O   . LEU A 1 105 ? 20.434 -17.670 -18.443 1.00 36.05  ? 105 LEU A O   1 
ATOM 841  C CB  . LEU A 1 105 ? 18.426 -15.367 -17.809 1.00 36.63  ? 105 LEU A CB  1 
ATOM 842  C CG  . LEU A 1 105 ? 17.511 -14.691 -16.797 1.00 37.48  ? 105 LEU A CG  1 
ATOM 843  C CD1 . LEU A 1 105 ? 16.061 -14.956 -17.173 1.00 38.48  ? 105 LEU A CD1 1 
ATOM 844  C CD2 . LEU A 1 105 ? 17.787 -15.115 -15.363 1.00 37.51  ? 105 LEU A CD2 1 
ATOM 845  N N   . ILE A 1 106 ? 20.253 -17.547 -16.194 1.00 35.40  ? 106 ILE A N   1 
ATOM 846  C CA  . ILE A 1 106 ? 20.579 -18.935 -16.027 1.00 34.49  ? 106 ILE A CA  1 
ATOM 847  C C   . ILE A 1 106 ? 19.365 -19.598 -15.423 1.00 35.09  ? 106 ILE A C   1 
ATOM 848  O O   . ILE A 1 106 ? 18.692 -19.033 -14.564 1.00 36.89  ? 106 ILE A O   1 
ATOM 849  C CB  . ILE A 1 106 ? 21.788 -19.119 -15.097 1.00 34.08  ? 106 ILE A CB  1 
ATOM 850  C CG1 . ILE A 1 106 ? 22.991 -18.347 -15.641 1.00 33.32  ? 106 ILE A CG1 1 
ATOM 851  C CG2 . ILE A 1 106 ? 22.105 -20.602 -14.916 1.00 32.79  ? 106 ILE A CG2 1 
ATOM 852  C CD1 . ILE A 1 106 ? 24.189 -18.372 -14.749 1.00 32.66  ? 106 ILE A CD1 1 
ATOM 853  N N   . CYS A 1 107 ? 19.078 -20.804 -15.857 1.00 34.21  ? 107 CYS A N   1 
ATOM 854  C CA  . CYS A 1 107 ? 18.080 -21.552 -15.208 1.00 33.80  ? 107 CYS A CA  1 
ATOM 855  C C   . CYS A 1 107 ? 18.723 -22.844 -14.836 1.00 33.38  ? 107 CYS A C   1 
ATOM 856  O O   . CYS A 1 107 ? 19.161 -23.618 -15.698 1.00 32.58  ? 107 CYS A O   1 
ATOM 857  C CB  . CYS A 1 107 ? 16.940 -21.781 -16.159 1.00 33.98  ? 107 CYS A CB  1 
ATOM 858  S SG  . CYS A 1 107 ? 15.786 -22.912 -15.480 1.00 37.77  ? 107 CYS A SG  1 
ATOM 859  N N   . HIS A 1 108 ? 18.799 -23.065 -13.533 1.00 33.69  ? 108 HIS A N   1 
ATOM 860  C CA  . HIS A 1 108 ? 19.356 -24.282 -12.991 1.00 33.49  ? 108 HIS A CA  1 
ATOM 861  C C   . HIS A 1 108 ? 18.225 -25.222 -12.616 1.00 33.38  ? 108 HIS A C   1 
ATOM 862  O O   . HIS A 1 108 ? 17.440 -24.910 -11.715 1.00 34.36  ? 108 HIS A O   1 
ATOM 863  C CB  . HIS A 1 108 ? 20.165 -23.938 -11.751 1.00 34.20  ? 108 HIS A CB  1 
ATOM 864  C CG  . HIS A 1 108 ? 21.013 -25.058 -11.237 1.00 35.73  ? 108 HIS A CG  1 
ATOM 865  N ND1 . HIS A 1 108 ? 21.368 -25.168 -9.908  1.00 37.97  ? 108 HIS A ND1 1 
ATOM 866  C CD2 . HIS A 1 108 ? 21.609 -26.097 -11.873 1.00 37.55  ? 108 HIS A CD2 1 
ATOM 867  C CE1 . HIS A 1 108 ? 22.124 -26.240 -9.742  1.00 39.48  ? 108 HIS A CE1 1 
ATOM 868  N NE2 . HIS A 1 108 ? 22.286 -26.821 -10.921 1.00 39.66  ? 108 HIS A NE2 1 
ATOM 869  N N   . ILE A 1 109 ? 18.143 -26.361 -13.306 1.00 32.10  ? 109 ILE A N   1 
ATOM 870  C CA  . ILE A 1 109 ? 17.160 -27.414 -13.006 1.00 31.53  ? 109 ILE A CA  1 
ATOM 871  C C   . ILE A 1 109 ? 17.894 -28.547 -12.286 1.00 32.01  ? 109 ILE A C   1 
ATOM 872  O O   . ILE A 1 109 ? 18.896 -29.076 -12.830 1.00 31.79  ? 109 ILE A O   1 
ATOM 873  C CB  . ILE A 1 109 ? 16.503 -27.944 -14.316 1.00 30.95  ? 109 ILE A CB  1 
ATOM 874  C CG1 . ILE A 1 109 ? 15.890 -26.803 -15.129 1.00 30.40  ? 109 ILE A CG1 1 
ATOM 875  C CG2 . ILE A 1 109 ? 15.446 -28.936 -14.039 1.00 30.37  ? 109 ILE A CG2 1 
ATOM 876  C CD1 . ILE A 1 109 ? 16.756 -26.346 -16.335 1.00 28.92  ? 109 ILE A CD1 1 
ATOM 877  N N   . ASP A 1 110 ? 17.416 -28.915 -11.083 1.00 32.38  ? 110 ASP A N   1 
ATOM 878  C CA  . ASP A 1 110 ? 18.216 -29.735 -10.114 1.00 33.12  ? 110 ASP A CA  1 
ATOM 879  C C   . ASP A 1 110 ? 17.475 -30.944 -9.441  1.00 33.76  ? 110 ASP A C   1 
ATOM 880  O O   . ASP A 1 110 ? 16.236 -31.059 -9.487  1.00 34.38  ? 110 ASP A O   1 
ATOM 881  C CB  . ASP A 1 110 ? 18.824 -28.800 -9.056  1.00 33.00  ? 110 ASP A CB  1 
ATOM 882  C CG  . ASP A 1 110 ? 20.071 -29.359 -8.367  1.00 35.66  ? 110 ASP A CG  1 
ATOM 883  O OD1 . ASP A 1 110 ? 20.553 -30.469 -8.688  1.00 37.03  ? 110 ASP A OD1 1 
ATOM 884  O OD2 . ASP A 1 110 ? 20.576 -28.662 -7.452  1.00 37.65  ? 110 ASP A OD2 1 
ATOM 885  N N   . LYS A 1 111 ? 18.262 -31.847 -8.861  1.00 33.38  ? 111 LYS A N   1 
ATOM 886  C CA  . LYS A 1 111 ? 17.793 -33.011 -8.111  1.00 34.36  ? 111 LYS A CA  1 
ATOM 887  C C   . LYS A 1 111 ? 16.791 -33.943 -8.795  1.00 34.50  ? 111 LYS A C   1 
ATOM 888  O O   . LYS A 1 111 ? 16.016 -34.613 -8.109  1.00 35.77  ? 111 LYS A O   1 
ATOM 889  C CB  . LYS A 1 111 ? 17.266 -32.597 -6.738  1.00 35.20  ? 111 LYS A CB  1 
ATOM 890  C CG  . LYS A 1 111 ? 18.227 -31.777 -5.924  1.00 37.41  ? 111 LYS A CG  1 
ATOM 891  C CD  . LYS A 1 111 ? 17.614 -31.452 -4.577  1.00 43.72  ? 111 LYS A CD  1 
ATOM 892  C CE  . LYS A 1 111 ? 18.664 -31.077 -3.516  1.00 48.32  ? 111 LYS A CE  1 
ATOM 893  N NZ  . LYS A 1 111 ? 19.149 -29.661 -3.671  1.00 51.91  ? 111 LYS A NZ  1 
ATOM 894  N N   . PHE A 1 112 ? 16.804 -34.033 -10.122 1.00 33.76  ? 112 PHE A N   1 
ATOM 895  C CA  . PHE A 1 112 ? 15.807 -34.888 -10.797 1.00 33.46  ? 112 PHE A CA  1 
ATOM 896  C C   . PHE A 1 112 ? 16.331 -36.228 -11.285 1.00 32.71  ? 112 PHE A C   1 
ATOM 897  O O   . PHE A 1 112 ? 17.524 -36.454 -11.373 1.00 32.86  ? 112 PHE A O   1 
ATOM 898  C CB  . PHE A 1 112 ? 15.099 -34.144 -11.938 1.00 34.09  ? 112 PHE A CB  1 
ATOM 899  C CG  . PHE A 1 112 ? 16.018 -33.617 -12.990 1.00 33.88  ? 112 PHE A CG  1 
ATOM 900  C CD1 . PHE A 1 112 ? 16.206 -34.323 -14.174 1.00 35.41  ? 112 PHE A CD1 1 
ATOM 901  C CD2 . PHE A 1 112 ? 16.684 -32.404 -12.803 1.00 34.19  ? 112 PHE A CD2 1 
ATOM 902  C CE1 . PHE A 1 112 ? 17.068 -33.847 -15.172 1.00 36.11  ? 112 PHE A CE1 1 
ATOM 903  C CE2 . PHE A 1 112 ? 17.551 -31.910 -13.780 1.00 35.74  ? 112 PHE A CE2 1 
ATOM 904  C CZ  . PHE A 1 112 ? 17.754 -32.638 -14.974 1.00 35.89  ? 112 PHE A CZ  1 
ATOM 905  N N   . PHE A 1 113 ? 15.398 -37.131 -11.548 1.00 32.73  ? 113 PHE A N   1 
ATOM 906  C CA  . PHE A 1 113 ? 15.634 -38.430 -12.165 1.00 31.31  ? 113 PHE A CA  1 
ATOM 907  C C   . PHE A 1 113 ? 14.311 -38.814 -12.819 1.00 32.46  ? 113 PHE A C   1 
ATOM 908  O O   . PHE A 1 113 ? 13.264 -38.642 -12.181 1.00 33.85  ? 113 PHE A O   1 
ATOM 909  C CB  . PHE A 1 113 ? 16.000 -39.499 -11.136 1.00 30.57  ? 113 PHE A CB  1 
ATOM 910  C CG  . PHE A 1 113 ? 16.375 -40.797 -11.767 1.00 28.43  ? 113 PHE A CG  1 
ATOM 911  C CD1 . PHE A 1 113 ? 17.694 -41.103 -12.002 1.00 25.40  ? 113 PHE A CD1 1 
ATOM 912  C CD2 . PHE A 1 113 ? 15.397 -41.680 -12.216 1.00 31.22  ? 113 PHE A CD2 1 
ATOM 913  C CE1 . PHE A 1 113 ? 18.053 -42.273 -12.630 1.00 27.02  ? 113 PHE A CE1 1 
ATOM 914  C CE2 . PHE A 1 113 ? 15.746 -42.869 -12.860 1.00 31.27  ? 113 PHE A CE2 1 
ATOM 915  C CZ  . PHE A 1 113 ? 17.078 -43.162 -13.062 1.00 29.07  ? 113 PHE A CZ  1 
ATOM 916  N N   . PRO A 1 114 ? 14.333 -39.347 -14.065 1.00 32.45  ? 114 PRO A N   1 
ATOM 917  C CA  . PRO A 1 114 ? 15.498 -39.580 -14.922 1.00 31.91  ? 114 PRO A CA  1 
ATOM 918  C C   . PRO A 1 114 ? 15.755 -38.372 -15.790 1.00 31.23  ? 114 PRO A C   1 
ATOM 919  O O   . PRO A 1 114 ? 14.959 -37.443 -15.745 1.00 30.98  ? 114 PRO A O   1 
ATOM 920  C CB  . PRO A 1 114 ? 15.052 -40.774 -15.783 1.00 32.59  ? 114 PRO A CB  1 
ATOM 921  C CG  . PRO A 1 114 ? 13.620 -40.572 -15.949 1.00 33.08  ? 114 PRO A CG  1 
ATOM 922  C CD  . PRO A 1 114 ? 13.126 -39.986 -14.632 1.00 33.01  ? 114 PRO A CD  1 
ATOM 923  N N   . PRO A 1 115 ? 16.829 -38.407 -16.610 1.00 31.25  ? 115 PRO A N   1 
ATOM 924  C CA  . PRO A 1 115 ? 17.242 -37.313 -17.436 1.00 30.75  ? 115 PRO A CA  1 
ATOM 925  C C   . PRO A 1 115 ? 16.428 -37.337 -18.709 1.00 32.94  ? 115 PRO A C   1 
ATOM 926  O O   . PRO A 1 115 ? 16.954 -37.574 -19.805 1.00 33.67  ? 115 PRO A O   1 
ATOM 927  C CB  . PRO A 1 115 ? 18.705 -37.628 -17.724 1.00 30.47  ? 115 PRO A CB  1 
ATOM 928  C CG  . PRO A 1 115 ? 19.000 -38.956 -17.159 1.00 30.35  ? 115 PRO A CG  1 
ATOM 929  C CD  . PRO A 1 115 ? 17.677 -39.583 -16.870 1.00 31.90  ? 115 PRO A CD  1 
ATOM 930  N N   . VAL A 1 116 ? 15.123 -37.136 -18.535 1.00 34.67  ? 116 VAL A N   1 
ATOM 931  C CA  . VAL A 1 116 ? 14.184 -36.980 -19.609 1.00 36.35  ? 116 VAL A CA  1 
ATOM 932  C C   . VAL A 1 116 ? 13.359 -35.789 -19.195 1.00 37.35  ? 116 VAL A C   1 
ATOM 933  O O   . VAL A 1 116 ? 12.678 -35.817 -18.158 1.00 39.43  ? 116 VAL A O   1 
ATOM 934  C CB  . VAL A 1 116 ? 13.285 -38.174 -19.718 1.00 37.16  ? 116 VAL A CB  1 
ATOM 935  C CG1 . VAL A 1 116 ? 12.144 -37.841 -20.641 1.00 38.61  ? 116 VAL A CG1 1 
ATOM 936  C CG2 . VAL A 1 116 ? 14.081 -39.429 -20.182 1.00 38.29  ? 116 VAL A CG2 1 
ATOM 937  N N   . LEU A 1 117 ? 13.402 -34.742 -20.007 1.00 37.25  ? 117 LEU A N   1 
ATOM 938  C CA  . LEU A 1 117 ? 13.166 -33.409 -19.512 1.00 36.04  ? 117 LEU A CA  1 
ATOM 939  C C   . LEU A 1 117 ? 12.992 -32.455 -20.678 1.00 36.12  ? 117 LEU A C   1 
ATOM 940  O O   . LEU A 1 117 ? 13.826 -32.403 -21.571 1.00 35.87  ? 117 LEU A O   1 
ATOM 941  C CB  . LEU A 1 117 ? 14.406 -33.016 -18.712 1.00 34.82  ? 117 LEU A CB  1 
ATOM 942  C CG  . LEU A 1 117 ? 14.386 -32.037 -17.540 1.00 34.04  ? 117 LEU A CG  1 
ATOM 943  C CD1 . LEU A 1 117 ? 15.194 -30.776 -17.870 1.00 32.95  ? 117 LEU A CD1 1 
ATOM 944  C CD2 . LEU A 1 117 ? 12.998 -31.712 -17.108 1.00 33.08  ? 117 LEU A CD2 1 
ATOM 945  N N   . ASN A 1 118 ? 11.898 -31.707 -20.679 1.00 36.71  ? 118 ASN A N   1 
ATOM 946  C CA  . ASN A 1 118 ? 11.708 -30.640 -21.669 1.00 37.24  ? 118 ASN A CA  1 
ATOM 947  C C   . ASN A 1 118 ? 11.908 -29.277 -20.991 1.00 36.17  ? 118 ASN A C   1 
ATOM 948  O O   . ASN A 1 118 ? 11.433 -29.084 -19.878 1.00 36.21  ? 118 ASN A O   1 
ATOM 949  C CB  . ASN A 1 118 ? 10.353 -30.792 -22.418 1.00 37.85  ? 118 ASN A CB  1 
ATOM 950  C CG  . ASN A 1 118 ? 10.378 -31.948 -23.434 1.00 40.55  ? 118 ASN A CG  1 
ATOM 951  O OD1 . ASN A 1 118 ? 11.472 -32.424 -23.768 1.00 43.87  ? 118 ASN A OD1 1 
ATOM 952  N ND2 . ASN A 1 118 ? 9.194  -32.419 -23.922 1.00 42.60  ? 118 ASN A ND2 1 
ATOM 953  N N   . VAL A 1 119 ? 12.666 -28.371 -21.612 1.00 35.54  ? 119 VAL A N   1 
ATOM 954  C CA  . VAL A 1 119 ? 12.815 -27.011 -21.067 1.00 35.00  ? 119 VAL A CA  1 
ATOM 955  C C   . VAL A 1 119 ? 12.795 -25.931 -22.147 1.00 35.32  ? 119 VAL A C   1 
ATOM 956  O O   . VAL A 1 119 ? 13.430 -26.057 -23.187 1.00 35.41  ? 119 VAL A O   1 
ATOM 957  C CB  . VAL A 1 119 ? 14.108 -26.792 -20.217 1.00 34.24  ? 119 VAL A CB  1 
ATOM 958  C CG1 . VAL A 1 119 ? 13.974 -25.527 -19.375 1.00 35.12  ? 119 VAL A CG1 1 
ATOM 959  C CG2 . VAL A 1 119 ? 14.401 -27.966 -19.308 1.00 34.01  ? 119 VAL A CG2 1 
ATOM 960  N N   . THR A 1 120 ? 12.091 -24.844 -21.848 1.00 35.73  ? 120 THR A N   1 
ATOM 961  C CA  . THR A 1 120 ? 11.947 -23.724 -22.749 1.00 36.22  ? 120 THR A CA  1 
ATOM 962  C C   . THR A 1 120 ? 11.881 -22.487 -21.890 1.00 36.08  ? 120 THR A C   1 
ATOM 963  O O   . THR A 1 120 ? 11.410 -22.537 -20.762 1.00 35.86  ? 120 THR A O   1 
ATOM 964  C CB  . THR A 1 120 ? 10.608 -23.793 -23.527 1.00 37.71  ? 120 THR A CB  1 
ATOM 965  O OG1 . THR A 1 120 ? 9.548  -24.087 -22.608 1.00 38.21  ? 120 THR A OG1 1 
ATOM 966  C CG2 . THR A 1 120 ? 10.643 -24.860 -24.621 1.00 36.43  ? 120 THR A CG2 1 
ATOM 967  N N   . TRP A 1 121 ? 12.368 -21.380 -22.436 1.00 36.15  ? 121 TRP A N   1 
ATOM 968  C CA  . TRP A 1 121 ? 12.243 -20.082 -21.816 1.00 35.50  ? 121 TRP A CA  1 
ATOM 969  C C   . TRP A 1 121 ? 11.026 -19.363 -22.370 1.00 36.57  ? 121 TRP A C   1 
ATOM 970  O O   . TRP A 1 121 ? 10.632 -19.547 -23.520 1.00 36.92  ? 121 TRP A O   1 
ATOM 971  C CB  . TRP A 1 121 ? 13.444 -19.240 -22.184 1.00 35.22  ? 121 TRP A CB  1 
ATOM 972  C CG  . TRP A 1 121 ? 14.754 -19.611 -21.585 1.00 34.25  ? 121 TRP A CG  1 
ATOM 973  C CD1 . TRP A 1 121 ? 15.757 -20.335 -22.174 1.00 31.76  ? 121 TRP A CD1 1 
ATOM 974  C CD2 . TRP A 1 121 ? 15.248 -19.211 -20.301 1.00 33.57  ? 121 TRP A CD2 1 
ATOM 975  N NE1 . TRP A 1 121 ? 16.833 -20.417 -21.331 1.00 31.37  ? 121 TRP A NE1 1 
ATOM 976  C CE2 . TRP A 1 121 ? 16.550 -19.740 -20.173 1.00 33.11  ? 121 TRP A CE2 1 
ATOM 977  C CE3 . TRP A 1 121 ? 14.706 -18.481 -19.235 1.00 32.87  ? 121 TRP A CE3 1 
ATOM 978  C CZ2 . TRP A 1 121 ? 17.324 -19.554 -19.022 1.00 34.01  ? 121 TRP A CZ2 1 
ATOM 979  C CZ3 . TRP A 1 121 ? 15.476 -18.288 -18.098 1.00 34.59  ? 121 TRP A CZ3 1 
ATOM 980  C CH2 . TRP A 1 121 ? 16.776 -18.818 -18.003 1.00 34.15  ? 121 TRP A CH2 1 
ATOM 981  N N   . LEU A 1 122 ? 10.454 -18.497 -21.558 1.00 37.54  ? 122 LEU A N   1 
ATOM 982  C CA  . LEU A 1 122 ? 9.339  -17.678 -21.994 1.00 38.63  ? 122 LEU A CA  1 
ATOM 983  C C   . LEU A 1 122 ? 9.704  -16.263 -21.601 1.00 38.94  ? 122 LEU A C   1 
ATOM 984  O O   . LEU A 1 122 ? 10.209 -16.041 -20.490 1.00 38.25  ? 122 LEU A O   1 
ATOM 985  C CB  . LEU A 1 122 ? 8.048  -18.132 -21.314 1.00 39.10  ? 122 LEU A CB  1 
ATOM 986  C CG  . LEU A 1 122 ? 7.482  -19.564 -21.498 1.00 39.54  ? 122 LEU A CG  1 
ATOM 987  C CD1 . LEU A 1 122 ? 6.193  -19.731 -20.670 1.00 37.28  ? 122 LEU A CD1 1 
ATOM 988  C CD2 . LEU A 1 122 ? 7.182  -19.919 -22.961 1.00 40.06  ? 122 LEU A CD2 1 
ATOM 989  N N   . CYS A 1 123 ? 9.523  -15.335 -22.540 1.00 39.56  ? 123 CYS A N   1 
ATOM 990  C CA  . CYS A 1 123 ? 9.707  -13.908 -22.282 1.00 40.68  ? 123 CYS A CA  1 
ATOM 991  C C   . CYS A 1 123 ? 8.339  -13.262 -22.479 1.00 41.03  ? 123 CYS A C   1 
ATOM 992  O O   . CYS A 1 123 ? 7.717  -13.428 -23.518 1.00 42.06  ? 123 CYS A O   1 
ATOM 993  C CB  . CYS A 1 123 ? 10.797 -13.310 -23.195 1.00 41.06  ? 123 CYS A CB  1 
ATOM 994  S SG  . CYS A 1 123 ? 10.849 -11.466 -23.415 1.00 46.19  ? 123 CYS A SG  1 
ATOM 995  N N   . ASN A 1 124 ? 7.868  -12.553 -21.461 1.00 40.84  ? 124 ASN A N   1 
ATOM 996  C CA  . ASN A 1 124 ? 6.469  -12.109 -21.364 1.00 41.50  ? 124 ASN A CA  1 
ATOM 997  C C   . ASN A 1 124 ? 5.424  -13.145 -21.783 1.00 41.20  ? 124 ASN A C   1 
ATOM 998  O O   . ASN A 1 124 ? 4.387  -12.796 -22.342 1.00 42.30  ? 124 ASN A O   1 
ATOM 999  C CB  . ASN A 1 124 ? 6.242  -10.780 -22.077 1.00 42.51  ? 124 ASN A CB  1 
ATOM 1000 C CG  . ASN A 1 124 ? 7.289  -9.772  -21.729 1.00 44.05  ? 124 ASN A CG  1 
ATOM 1001 O OD1 . ASN A 1 124 ? 7.575  -9.525  -20.558 1.00 44.71  ? 124 ASN A OD1 1 
ATOM 1002 N ND2 . ASN A 1 124 ? 7.907  -9.206  -22.743 1.00 46.68  ? 124 ASN A ND2 1 
ATOM 1003 N N   . GLY A 1 125 ? 5.691  -14.417 -21.497 1.00 39.83  ? 125 GLY A N   1 
ATOM 1004 C CA  . GLY A 1 125 ? 4.743  -15.472 -21.830 1.00 38.56  ? 125 GLY A CA  1 
ATOM 1005 C C   . GLY A 1 125 ? 4.922  -16.023 -23.235 1.00 38.54  ? 125 GLY A C   1 
ATOM 1006 O O   . GLY A 1 125 ? 4.225  -16.973 -23.610 1.00 38.13  ? 125 GLY A O   1 
ATOM 1007 N N   . GLU A 1 126 ? 5.842  -15.467 -24.029 1.00 38.37  ? 126 GLU A N   1 
ATOM 1008 C CA  . GLU A 1 126 ? 6.074  -16.093 -25.333 1.00 39.56  ? 126 GLU A CA  1 
ATOM 1009 C C   . GLU A 1 126 ? 7.403  -16.799 -25.580 1.00 39.08  ? 126 GLU A C   1 
ATOM 1010 O O   . GLU A 1 126 ? 8.476  -16.262 -25.269 1.00 38.78  ? 126 GLU A O   1 
ATOM 1011 C CB  . GLU A 1 126 ? 5.610  -15.240 -26.517 1.00 40.93  ? 126 GLU A CB  1 
ATOM 1012 C CG  . GLU A 1 126 ? 6.570  -14.251 -27.038 1.00 43.85  ? 126 GLU A CG  1 
ATOM 1013 C CD  . GLU A 1 126 ? 6.103  -13.639 -28.339 1.00 47.24  ? 126 GLU A CD  1 
ATOM 1014 O OE1 . GLU A 1 126 ? 5.662  -12.484 -28.269 1.00 53.96  ? 126 GLU A OE1 1 
ATOM 1015 O OE2 . GLU A 1 126 ? 6.157  -14.283 -29.416 1.00 46.30  ? 126 GLU A OE2 1 
ATOM 1016 N N   . LEU A 1 127 ? 7.287  -18.008 -26.141 1.00 39.98  ? 127 LEU A N   1 
ATOM 1017 C CA  . LEU A 1 127 ? 8.401  -18.885 -26.468 1.00 40.14  ? 127 LEU A CA  1 
ATOM 1018 C C   . LEU A 1 127 ? 9.499  -18.152 -27.194 1.00 41.52  ? 127 LEU A C   1 
ATOM 1019 O O   . LEU A 1 127 ? 9.256  -17.389 -28.148 1.00 42.71  ? 127 LEU A O   1 
ATOM 1020 C CB  . LEU A 1 127 ? 7.950  -20.071 -27.311 1.00 40.82  ? 127 LEU A CB  1 
ATOM 1021 C CG  . LEU A 1 127 ? 9.060  -21.049 -27.719 1.00 40.32  ? 127 LEU A CG  1 
ATOM 1022 C CD1 . LEU A 1 127 ? 9.667  -21.748 -26.532 1.00 40.53  ? 127 LEU A CD1 1 
ATOM 1023 C CD2 . LEU A 1 127 ? 8.532  -22.052 -28.689 1.00 41.97  ? 127 LEU A CD2 1 
ATOM 1024 N N   . VAL A 1 128 ? 10.712 -18.402 -26.720 1.00 41.57  ? 128 VAL A N   1 
ATOM 1025 C CA  . VAL A 1 128 ? 11.871 -17.688 -27.159 1.00 42.71  ? 128 VAL A CA  1 
ATOM 1026 C C   . VAL A 1 128 ? 12.687 -18.675 -27.977 1.00 43.28  ? 128 VAL A C   1 
ATOM 1027 O O   . VAL A 1 128 ? 12.985 -19.758 -27.518 1.00 42.40  ? 128 VAL A O   1 
ATOM 1028 C CB  . VAL A 1 128 ? 12.652 -17.188 -25.936 1.00 42.33  ? 128 VAL A CB  1 
ATOM 1029 C CG1 . VAL A 1 128 ? 13.922 -16.410 -26.350 1.00 42.64  ? 128 VAL A CG1 1 
ATOM 1030 C CG2 . VAL A 1 128 ? 11.728 -16.361 -25.033 1.00 40.87  ? 128 VAL A CG2 1 
ATOM 1031 N N   . THR A 1 129 ? 13.048 -18.266 -29.190 1.00 45.24  ? 129 THR A N   1 
ATOM 1032 C CA  . THR A 1 129 ? 13.601 -19.157 -30.221 1.00 45.92  ? 129 THR A CA  1 
ATOM 1033 C C   . THR A 1 129 ? 15.092 -18.999 -30.499 1.00 45.83  ? 129 THR A C   1 
ATOM 1034 O O   . THR A 1 129 ? 15.694 -19.882 -31.111 1.00 45.97  ? 129 THR A O   1 
ATOM 1035 C CB  . THR A 1 129 ? 12.870 -18.944 -31.539 1.00 47.43  ? 129 THR A CB  1 
ATOM 1036 O OG1 . THR A 1 129 ? 12.288 -17.628 -31.546 1.00 48.15  ? 129 THR A OG1 1 
ATOM 1037 C CG2 . THR A 1 129 ? 11.784 -19.991 -31.696 1.00 48.30  ? 129 THR A CG2 1 
ATOM 1038 N N   . GLU A 1 130 ? 15.665 -17.861 -30.092 1.00 45.79  ? 130 GLU A N   1 
ATOM 1039 C CA  . GLU A 1 130 ? 17.101 -17.607 -30.208 1.00 45.26  ? 130 GLU A CA  1 
ATOM 1040 C C   . GLU A 1 130 ? 17.706 -16.970 -28.934 1.00 44.09  ? 130 GLU A C   1 
ATOM 1041 O O   . GLU A 1 130 ? 16.985 -16.430 -28.084 1.00 43.91  ? 130 GLU A O   1 
ATOM 1042 C CB  . GLU A 1 130 ? 17.429 -16.805 -31.492 1.00 46.48  ? 130 GLU A CB  1 
ATOM 1043 C CG  . GLU A 1 130 ? 16.677 -15.493 -31.679 1.00 50.05  ? 130 GLU A CG  1 
ATOM 1044 C CD  . GLU A 1 130 ? 15.269 -15.645 -32.307 1.00 53.89  ? 130 GLU A CD  1 
ATOM 1045 O OE1 . GLU A 1 130 ? 15.029 -16.588 -33.102 1.00 56.20  ? 130 GLU A OE1 1 
ATOM 1046 O OE2 . GLU A 1 130 ? 14.396 -14.795 -32.018 1.00 54.50  ? 130 GLU A OE2 1 
ATOM 1047 N N   . GLY A 1 131 ? 19.029 -17.046 -28.809 1.00 43.40  ? 131 GLY A N   1 
ATOM 1048 C CA  . GLY A 1 131 ? 19.755 -16.437 -27.696 1.00 42.85  ? 131 GLY A CA  1 
ATOM 1049 C C   . GLY A 1 131 ? 19.807 -17.386 -26.526 1.00 41.52  ? 131 GLY A C   1 
ATOM 1050 O O   . GLY A 1 131 ? 19.810 -16.968 -25.362 1.00 41.43  ? 131 GLY A O   1 
ATOM 1051 N N   . VAL A 1 132 ? 19.888 -18.672 -26.864 1.00 40.73  ? 132 VAL A N   1 
ATOM 1052 C CA  . VAL A 1 132 ? 19.500 -19.781 -25.985 1.00 38.87  ? 132 VAL A CA  1 
ATOM 1053 C C   . VAL A 1 132 ? 20.538 -20.905 -26.092 1.00 38.01  ? 132 VAL A C   1 
ATOM 1054 O O   . VAL A 1 132 ? 21.020 -21.227 -27.164 1.00 38.26  ? 132 VAL A O   1 
ATOM 1055 C CB  . VAL A 1 132 ? 18.023 -20.242 -26.363 1.00 39.23  ? 132 VAL A CB  1 
ATOM 1056 C CG1 . VAL A 1 132 ? 17.853 -21.766 -26.519 1.00 37.63  ? 132 VAL A CG1 1 
ATOM 1057 C CG2 . VAL A 1 132 ? 17.013 -19.646 -25.411 1.00 37.90  ? 132 VAL A CG2 1 
ATOM 1058 N N   . ALA A 1 133 ? 20.899 -21.478 -24.963 1.00 37.25  ? 133 ALA A N   1 
ATOM 1059 C CA  . ALA A 1 133 ? 21.898 -22.535 -24.932 1.00 36.71  ? 133 ALA A CA  1 
ATOM 1060 C C   . ALA A 1 133 ? 21.601 -23.489 -23.787 1.00 35.69  ? 133 ALA A C   1 
ATOM 1061 O O   . ALA A 1 133 ? 20.792 -23.177 -22.912 1.00 35.22  ? 133 ALA A O   1 
ATOM 1062 C CB  . ALA A 1 133 ? 23.281 -21.941 -24.790 1.00 36.93  ? 133 ALA A CB  1 
ATOM 1063 N N   . GLU A 1 134 ? 22.247 -24.649 -23.789 1.00 35.79  ? 134 GLU A N   1 
ATOM 1064 C CA  . GLU A 1 134 ? 22.014 -25.615 -22.708 1.00 36.52  ? 134 GLU A CA  1 
ATOM 1065 C C   . GLU A 1 134 ? 23.185 -26.547 -22.321 1.00 36.08  ? 134 GLU A C   1 
ATOM 1066 O O   . GLU A 1 134 ? 23.965 -26.986 -23.169 1.00 36.87  ? 134 GLU A O   1 
ATOM 1067 C CB  . GLU A 1 134 ? 20.743 -26.437 -22.999 1.00 37.13  ? 134 GLU A CB  1 
ATOM 1068 C CG  . GLU A 1 134 ? 20.858 -27.438 -24.152 1.00 38.71  ? 134 GLU A CG  1 
ATOM 1069 C CD  . GLU A 1 134 ? 19.502 -27.941 -24.580 1.00 42.06  ? 134 GLU A CD  1 
ATOM 1070 O OE1 . GLU A 1 134 ? 19.325 -29.180 -24.644 1.00 43.54  ? 134 GLU A OE1 1 
ATOM 1071 O OE2 . GLU A 1 134 ? 18.606 -27.096 -24.844 1.00 43.59  ? 134 GLU A OE2 1 
ATOM 1072 N N   . SER A 1 135 ? 23.275 -26.873 -21.038 1.00 35.30  ? 135 SER A N   1 
ATOM 1073 C CA  . SER A 1 135 ? 24.311 -27.779 -20.551 1.00 34.56  ? 135 SER A CA  1 
ATOM 1074 C C   . SER A 1 135 ? 23.910 -29.193 -20.907 1.00 34.59  ? 135 SER A C   1 
ATOM 1075 O O   . SER A 1 135 ? 22.770 -29.421 -21.288 1.00 35.27  ? 135 SER A O   1 
ATOM 1076 C CB  . SER A 1 135 ? 24.424 -27.664 -19.045 1.00 34.16  ? 135 SER A CB  1 
ATOM 1077 O OG  . SER A 1 135 ? 23.584 -28.608 -18.396 1.00 34.26  ? 135 SER A OG  1 
ATOM 1078 N N   . LEU A 1 136 ? 24.835 -30.134 -20.778 1.00 34.62  ? 136 LEU A N   1 
ATOM 1079 C CA  . LEU A 1 136 ? 24.523 -31.564 -20.859 1.00 35.19  ? 136 LEU A CA  1 
ATOM 1080 C C   . LEU A 1 136 ? 23.642 -31.951 -19.681 1.00 35.10  ? 136 LEU A C   1 
ATOM 1081 O O   . LEU A 1 136 ? 23.290 -31.094 -18.854 1.00 35.65  ? 136 LEU A O   1 
ATOM 1082 C CB  . LEU A 1 136 ? 25.831 -32.375 -20.842 1.00 35.77  ? 136 LEU A CB  1 
ATOM 1083 C CG  . LEU A 1 136 ? 26.624 -32.420 -22.167 1.00 38.69  ? 136 LEU A CG  1 
ATOM 1084 C CD1 . LEU A 1 136 ? 25.949 -33.377 -23.134 1.00 42.18  ? 136 LEU A CD1 1 
ATOM 1085 C CD2 . LEU A 1 136 ? 26.744 -31.039 -22.881 1.00 41.49  ? 136 LEU A CD2 1 
ATOM 1086 N N   . PHE A 1 137 ? 23.262 -33.217 -19.567 1.00 34.82  ? 137 PHE A N   1 
ATOM 1087 C CA  . PHE A 1 137 ? 22.645 -33.638 -18.302 1.00 34.35  ? 137 PHE A CA  1 
ATOM 1088 C C   . PHE A 1 137 ? 23.755 -33.921 -17.323 1.00 33.94  ? 137 PHE A C   1 
ATOM 1089 O O   . PHE A 1 137 ? 24.580 -34.782 -17.566 1.00 34.36  ? 137 PHE A O   1 
ATOM 1090 C CB  . PHE A 1 137 ? 21.778 -34.872 -18.472 1.00 34.15  ? 137 PHE A CB  1 
ATOM 1091 C CG  . PHE A 1 137 ? 20.450 -34.575 -19.064 1.00 35.29  ? 137 PHE A CG  1 
ATOM 1092 C CD1 . PHE A 1 137 ? 19.370 -34.246 -18.247 1.00 35.40  ? 137 PHE A CD1 1 
ATOM 1093 C CD2 . PHE A 1 137 ? 20.270 -34.596 -20.451 1.00 35.76  ? 137 PHE A CD2 1 
ATOM 1094 C CE1 . PHE A 1 137 ? 18.145 -33.971 -18.793 1.00 34.68  ? 137 PHE A CE1 1 
ATOM 1095 C CE2 . PHE A 1 137 ? 19.046 -34.302 -21.006 1.00 33.51  ? 137 PHE A CE2 1 
ATOM 1096 C CZ  . PHE A 1 137 ? 17.988 -34.001 -20.179 1.00 34.78  ? 137 PHE A CZ  1 
ATOM 1097 N N   . LEU A 1 138 ? 23.810 -33.193 -16.225 1.00 33.73  ? 138 LEU A N   1 
ATOM 1098 C CA  . LEU A 1 138 ? 24.966 -33.351 -15.341 1.00 33.81  ? 138 LEU A CA  1 
ATOM 1099 C C   . LEU A 1 138 ? 24.736 -34.335 -14.206 1.00 34.57  ? 138 LEU A C   1 
ATOM 1100 O O   . LEU A 1 138 ? 23.676 -34.340 -13.600 1.00 34.79  ? 138 LEU A O   1 
ATOM 1101 C CB  . LEU A 1 138 ? 25.447 -32.008 -14.820 1.00 32.78  ? 138 LEU A CB  1 
ATOM 1102 C CG  . LEU A 1 138 ? 25.600 -31.020 -15.960 1.00 31.34  ? 138 LEU A CG  1 
ATOM 1103 C CD1 . LEU A 1 138 ? 25.983 -29.677 -15.388 1.00 32.21  ? 138 LEU A CD1 1 
ATOM 1104 C CD2 . LEU A 1 138 ? 26.627 -31.488 -16.926 1.00 28.09  ? 138 LEU A CD2 1 
ATOM 1105 N N   . PRO A 1 139 ? 25.750 -35.170 -13.923 1.00 35.77  ? 139 PRO A N   1 
ATOM 1106 C CA  . PRO A 1 139 ? 25.727 -36.201 -12.864 1.00 36.28  ? 139 PRO A CA  1 
ATOM 1107 C C   . PRO A 1 139 ? 25.685 -35.598 -11.474 1.00 36.60  ? 139 PRO A C   1 
ATOM 1108 O O   . PRO A 1 139 ? 26.170 -34.488 -11.244 1.00 36.55  ? 139 PRO A O   1 
ATOM 1109 C CB  . PRO A 1 139 ? 27.093 -36.863 -13.011 1.00 36.70  ? 139 PRO A CB  1 
ATOM 1110 C CG  . PRO A 1 139 ? 27.984 -35.729 -13.545 1.00 36.30  ? 139 PRO A CG  1 
ATOM 1111 C CD  . PRO A 1 139 ? 27.100 -35.031 -14.528 1.00 35.27  ? 139 PRO A CD  1 
ATOM 1112 N N   . ARG A 1 140 ? 25.158 -36.367 -10.539 1.00 37.44  ? 140 ARG A N   1 
ATOM 1113 C CA  . ARG A 1 140 ? 25.059 -35.940 -9.163  1.00 37.91  ? 140 ARG A CA  1 
ATOM 1114 C C   . ARG A 1 140 ? 25.502 -37.069 -8.277  1.00 37.91  ? 140 ARG A C   1 
ATOM 1115 O O   . ARG A 1 140 ? 25.328 -38.226 -8.583  1.00 37.78  ? 140 ARG A O   1 
ATOM 1116 C CB  . ARG A 1 140 ? 23.621 -35.591 -8.830  1.00 38.52  ? 140 ARG A CB  1 
ATOM 1117 C CG  . ARG A 1 140 ? 23.395 -34.257 -8.191  1.00 40.32  ? 140 ARG A CG  1 
ATOM 1118 C CD  . ARG A 1 140 ? 21.903 -34.107 -7.887  1.00 44.91  ? 140 ARG A CD  1 
ATOM 1119 N NE  . ARG A 1 140 ? 21.618 -32.910 -7.106  1.00 49.54  ? 140 ARG A NE  1 
ATOM 1120 C CZ  . ARG A 1 140 ? 21.614 -32.855 -5.776  1.00 52.34  ? 140 ARG A CZ  1 
ATOM 1121 N NH1 . ARG A 1 140 ? 21.864 -33.930 -5.037  1.00 53.05  ? 140 ARG A NH1 1 
ATOM 1122 N NH2 . ARG A 1 140 ? 21.354 -31.708 -5.179  1.00 55.52  ? 140 ARG A NH2 1 
ATOM 1123 N N   . THR A 1 141 ? 26.097 -36.681 -7.171  1.00 38.86  ? 141 THR A N   1 
ATOM 1124 C CA  . THR A 1 141 ? 26.524 -37.554 -6.104  1.00 40.04  ? 141 THR A CA  1 
ATOM 1125 C C   . THR A 1 141 ? 25.488 -38.589 -5.641  1.00 40.12  ? 141 THR A C   1 
ATOM 1126 O O   . THR A 1 141 ? 25.817 -39.758 -5.491  1.00 40.58  ? 141 THR A O   1 
ATOM 1127 C CB  . THR A 1 141 ? 27.021 -36.664 -4.950  1.00 40.98  ? 141 THR A CB  1 
ATOM 1128 O OG1 . THR A 1 141 ? 28.429 -36.515 -5.111  1.00 41.48  ? 141 THR A OG1 1 
ATOM 1129 C CG2 . THR A 1 141 ? 26.711 -37.256 -3.542  1.00 43.66  ? 141 THR A CG2 1 
ATOM 1130 N N   . ASP A 1 142 ? 24.255 -38.152 -5.412  1.00 39.82  ? 142 ASP A N   1 
ATOM 1131 C CA  . ASP A 1 142 ? 23.164 -39.051 -5.025  1.00 40.34  ? 142 ASP A CA  1 
ATOM 1132 C C   . ASP A 1 142 ? 22.493 -39.755 -6.205  1.00 39.27  ? 142 ASP A C   1 
ATOM 1133 O O   . ASP A 1 142 ? 21.442 -40.347 -6.036  1.00 40.43  ? 142 ASP A O   1 
ATOM 1134 C CB  . ASP A 1 142 ? 22.099 -38.283 -4.248  1.00 40.75  ? 142 ASP A CB  1 
ATOM 1135 C CG  . ASP A 1 142 ? 21.541 -37.119 -5.024  1.00 41.20  ? 142 ASP A CG  1 
ATOM 1136 O OD1 . ASP A 1 142 ? 21.704 -37.070 -6.277  1.00 42.06  ? 142 ASP A OD1 1 
ATOM 1137 O OD2 . ASP A 1 142 ? 20.930 -36.245 -4.375  1.00 43.20  ? 142 ASP A OD2 1 
ATOM 1138 N N   . TYR A 1 143 ? 23.099 -39.666 -7.383  1.00 37.64  ? 143 TYR A N   1 
ATOM 1139 C CA  . TYR A 1 143 ? 22.676 -40.371 -8.597  1.00 37.09  ? 143 TYR A CA  1 
ATOM 1140 C C   . TYR A 1 143 ? 21.477 -39.759 -9.338  1.00 36.71  ? 143 TYR A C   1 
ATOM 1141 O O   . TYR A 1 143 ? 21.143 -40.212 -10.438 1.00 36.54  ? 143 TYR A O   1 
ATOM 1142 C CB  . TYR A 1 143 ? 22.585 -41.892 -8.388  1.00 38.18  ? 143 TYR A CB  1 
ATOM 1143 C CG  . TYR A 1 143 ? 23.804 -42.416 -7.671  1.00 38.43  ? 143 TYR A CG  1 
ATOM 1144 C CD1 . TYR A 1 143 ? 23.708 -42.908 -6.371  1.00 39.88  ? 143 TYR A CD1 1 
ATOM 1145 C CD2 . TYR A 1 143 ? 25.069 -42.360 -8.269  1.00 37.94  ? 143 TYR A CD2 1 
ATOM 1146 C CE1 . TYR A 1 143 ? 24.844 -43.359 -5.684  1.00 41.22  ? 143 TYR A CE1 1 
ATOM 1147 C CE2 . TYR A 1 143 ? 26.210 -42.819 -7.607  1.00 38.56  ? 143 TYR A CE2 1 
ATOM 1148 C CZ  . TYR A 1 143 ? 26.092 -43.309 -6.311  1.00 41.83  ? 143 TYR A CZ  1 
ATOM 1149 O OH  . TYR A 1 143 ? 27.213 -43.752 -5.631  1.00 44.35  ? 143 TYR A OH  1 
ATOM 1150 N N   . SER A 1 144 ? 20.871 -38.706 -8.767  1.00 36.27  ? 144 SER A N   1 
ATOM 1151 C CA  . SER A 1 144 ? 19.974 -37.815 -9.538  1.00 35.02  ? 144 SER A CA  1 
ATOM 1152 C C   . SER A 1 144 ? 20.791 -36.930 -10.522 1.00 33.43  ? 144 SER A C   1 
ATOM 1153 O O   . SER A 1 144 ? 21.968 -37.209 -10.778 1.00 33.01  ? 144 SER A O   1 
ATOM 1154 C CB  . SER A 1 144 ? 19.072 -36.989 -8.615  1.00 35.14  ? 144 SER A CB  1 
ATOM 1155 O OG  . SER A 1 144 ? 19.844 -36.083 -7.862  1.00 36.66  ? 144 SER A OG  1 
ATOM 1156 N N   . PHE A 1 145 ? 20.176 -35.893 -11.090 1.00 31.99  ? 145 PHE A N   1 
ATOM 1157 C CA  . PHE A 1 145 ? 20.807 -35.123 -12.162 1.00 30.17  ? 145 PHE A CA  1 
ATOM 1158 C C   . PHE A 1 145 ? 20.533 -33.619 -12.045 1.00 29.87  ? 145 PHE A C   1 
ATOM 1159 O O   . PHE A 1 145 ? 19.580 -33.187 -11.376 1.00 29.62  ? 145 PHE A O   1 
ATOM 1160 C CB  . PHE A 1 145 ? 20.319 -35.586 -13.543 1.00 29.91  ? 145 PHE A CB  1 
ATOM 1161 C CG  . PHE A 1 145 ? 20.930 -36.877 -14.037 1.00 28.28  ? 145 PHE A CG  1 
ATOM 1162 C CD1 . PHE A 1 145 ? 20.310 -38.104 -13.789 1.00 29.76  ? 145 PHE A CD1 1 
ATOM 1163 C CD2 . PHE A 1 145 ? 22.060 -36.870 -14.828 1.00 27.12  ? 145 PHE A CD2 1 
ATOM 1164 C CE1 . PHE A 1 145 ? 20.852 -39.315 -14.266 1.00 26.91  ? 145 PHE A CE1 1 
ATOM 1165 C CE2 . PHE A 1 145 ? 22.606 -38.091 -15.316 1.00 26.05  ? 145 PHE A CE2 1 
ATOM 1166 C CZ  . PHE A 1 145 ? 21.983 -39.306 -15.024 1.00 24.46  ? 145 PHE A CZ  1 
ATOM 1167 N N   . HIS A 1 146 ? 21.379 -32.826 -12.704 1.00 28.84  ? 146 HIS A N   1 
ATOM 1168 C CA  . HIS A 1 146 ? 21.084 -31.413 -12.885 1.00 28.29  ? 146 HIS A CA  1 
ATOM 1169 C C   . HIS A 1 146 ? 21.439 -30.930 -14.305 1.00 28.48  ? 146 HIS A C   1 
ATOM 1170 O O   . HIS A 1 146 ? 22.067 -31.659 -15.106 1.00 27.75  ? 146 HIS A O   1 
ATOM 1171 C CB  . HIS A 1 146 ? 21.628 -30.524 -11.740 1.00 28.05  ? 146 HIS A CB  1 
ATOM 1172 C CG  . HIS A 1 146 ? 23.115 -30.312 -11.739 1.00 26.59  ? 146 HIS A CG  1 
ATOM 1173 N ND1 . HIS A 1 146 ? 24.032 -31.339 -11.859 1.00 28.31  ? 146 HIS A ND1 1 
ATOM 1174 C CD2 . HIS A 1 146 ? 23.845 -29.187 -11.573 1.00 23.15  ? 146 HIS A CD2 1 
ATOM 1175 C CE1 . HIS A 1 146 ? 25.260 -30.857 -11.772 1.00 22.04  ? 146 HIS A CE1 1 
ATOM 1176 N NE2 . HIS A 1 146 ? 25.171 -29.553 -11.601 1.00 21.62  ? 146 HIS A NE2 1 
ATOM 1177 N N   . LYS A 1 147 ? 20.966 -29.730 -14.629 1.00 28.26  ? 147 LYS A N   1 
ATOM 1178 C CA  . LYS A 1 147 ? 21.150 -29.202 -15.942 1.00 28.50  ? 147 LYS A CA  1 
ATOM 1179 C C   . LYS A 1 147 ? 21.040 -27.696 -15.859 1.00 28.80  ? 147 LYS A C   1 
ATOM 1180 O O   . LYS A 1 147 ? 20.470 -27.186 -14.913 1.00 29.48  ? 147 LYS A O   1 
ATOM 1181 C CB  . LYS A 1 147 ? 20.069 -29.764 -16.842 1.00 28.68  ? 147 LYS A CB  1 
ATOM 1182 C CG  . LYS A 1 147 ? 20.388 -29.698 -18.334 1.00 30.34  ? 147 LYS A CG  1 
ATOM 1183 C CD  . LYS A 1 147 ? 19.169 -30.057 -19.196 1.00 29.38  ? 147 LYS A CD  1 
ATOM 1184 C CE  . LYS A 1 147 ? 19.598 -30.324 -20.627 1.00 31.08  ? 147 LYS A CE  1 
ATOM 1185 N NZ  . LYS A 1 147 ? 18.492 -30.020 -21.573 1.00 33.91  ? 147 LYS A NZ  1 
ATOM 1186 N N   . PHE A 1 148 ? 21.586 -27.001 -16.856 1.00 29.05  ? 148 PHE A N   1 
ATOM 1187 C CA  . PHE A 1 148 ? 21.516 -25.553 -16.980 1.00 29.18  ? 148 PHE A CA  1 
ATOM 1188 C C   . PHE A 1 148 ? 21.016 -25.212 -18.350 1.00 29.62  ? 148 PHE A C   1 
ATOM 1189 O O   . PHE A 1 148 ? 21.616 -25.671 -19.324 1.00 29.60  ? 148 PHE A O   1 
ATOM 1190 C CB  . PHE A 1 148 ? 22.921 -24.920 -16.928 1.00 28.95  ? 148 PHE A CB  1 
ATOM 1191 C CG  . PHE A 1 148 ? 23.670 -25.186 -15.665 1.00 29.00  ? 148 PHE A CG  1 
ATOM 1192 C CD1 . PHE A 1 148 ? 23.517 -24.346 -14.568 1.00 30.49  ? 148 PHE A CD1 1 
ATOM 1193 C CD2 . PHE A 1 148 ? 24.530 -26.273 -15.569 1.00 25.66  ? 148 PHE A CD2 1 
ATOM 1194 C CE1 . PHE A 1 148 ? 24.197 -24.592 -13.378 1.00 29.77  ? 148 PHE A CE1 1 
ATOM 1195 C CE2 . PHE A 1 148 ? 25.230 -26.514 -14.406 1.00 27.16  ? 148 PHE A CE2 1 
ATOM 1196 C CZ  . PHE A 1 148 ? 25.063 -25.670 -13.301 1.00 29.38  ? 148 PHE A CZ  1 
ATOM 1197 N N   . HIS A 1 149 ? 19.997 -24.344 -18.432 1.00 30.29  ? 149 HIS A N   1 
ATOM 1198 C CA  . HIS A 1 149 ? 19.746 -23.558 -19.656 1.00 31.15  ? 149 HIS A CA  1 
ATOM 1199 C C   . HIS A 1 149 ? 20.110 -22.086 -19.488 1.00 31.02  ? 149 HIS A C   1 
ATOM 1200 O O   . HIS A 1 149 ? 19.992 -21.550 -18.411 1.00 30.12  ? 149 HIS A O   1 
ATOM 1201 C CB  . HIS A 1 149 ? 18.294 -23.690 -20.134 1.00 31.51  ? 149 HIS A CB  1 
ATOM 1202 C CG  . HIS A 1 149 ? 17.972 -25.039 -20.688 1.00 33.06  ? 149 HIS A CG  1 
ATOM 1203 N ND1 . HIS A 1 149 ? 17.502 -25.224 -21.970 1.00 34.69  ? 149 HIS A ND1 1 
ATOM 1204 C CD2 . HIS A 1 149 ? 18.068 -26.277 -20.141 1.00 33.52  ? 149 HIS A CD2 1 
ATOM 1205 C CE1 . HIS A 1 149 ? 17.310 -26.516 -22.187 1.00 32.99  ? 149 HIS A CE1 1 
ATOM 1206 N NE2 . HIS A 1 149 ? 17.644 -27.176 -21.093 1.00 32.45  ? 149 HIS A NE2 1 
ATOM 1207 N N   . TYR A 1 150 ? 20.508 -21.456 -20.598 1.00 31.96  ? 150 TYR A N   1 
ATOM 1208 C CA  . TYR A 1 150 ? 20.942 -20.060 -20.662 1.00 32.13  ? 150 TYR A CA  1 
ATOM 1209 C C   . TYR A 1 150 ? 20.165 -19.275 -21.658 1.00 32.96  ? 150 TYR A C   1 
ATOM 1210 O O   . TYR A 1 150 ? 19.842 -19.777 -22.730 1.00 33.02  ? 150 TYR A O   1 
ATOM 1211 C CB  . TYR A 1 150 ? 22.369 -20.031 -21.132 1.00 32.17  ? 150 TYR A CB  1 
ATOM 1212 C CG  . TYR A 1 150 ? 23.241 -20.848 -20.224 1.00 32.52  ? 150 TYR A CG  1 
ATOM 1213 C CD1 . TYR A 1 150 ? 23.491 -20.415 -18.922 1.00 32.11  ? 150 TYR A CD1 1 
ATOM 1214 C CD2 . TYR A 1 150 ? 23.779 -22.070 -20.636 1.00 31.14  ? 150 TYR A CD2 1 
ATOM 1215 C CE1 . TYR A 1 150 ? 24.266 -21.149 -18.068 1.00 32.08  ? 150 TYR A CE1 1 
ATOM 1216 C CE2 . TYR A 1 150 ? 24.573 -22.821 -19.776 1.00 30.11  ? 150 TYR A CE2 1 
ATOM 1217 C CZ  . TYR A 1 150 ? 24.806 -22.349 -18.492 1.00 31.19  ? 150 TYR A CZ  1 
ATOM 1218 O OH  . TYR A 1 150 ? 25.578 -23.036 -17.601 1.00 31.57  ? 150 TYR A OH  1 
ATOM 1219 N N   . LEU A 1 151 ? 19.897 -18.019 -21.310 1.00 34.35  ? 151 LEU A N   1 
ATOM 1220 C CA  . LEU A 1 151 ? 19.270 -17.048 -22.207 1.00 35.15  ? 151 LEU A CA  1 
ATOM 1221 C C   . LEU A 1 151 ? 20.027 -15.725 -22.180 1.00 36.41  ? 151 LEU A C   1 
ATOM 1222 O O   . LEU A 1 151 ? 20.108 -15.114 -21.118 1.00 36.76  ? 151 LEU A O   1 
ATOM 1223 C CB  . LEU A 1 151 ? 17.823 -16.824 -21.780 1.00 35.04  ? 151 LEU A CB  1 
ATOM 1224 C CG  . LEU A 1 151 ? 17.000 -15.745 -22.488 1.00 36.33  ? 151 LEU A CG  1 
ATOM 1225 C CD1 . LEU A 1 151 ? 16.758 -16.079 -23.964 1.00 36.13  ? 151 LEU A CD1 1 
ATOM 1226 C CD2 . LEU A 1 151 ? 15.674 -15.556 -21.781 1.00 36.43  ? 151 LEU A CD2 1 
ATOM 1227 N N   . THR A 1 152 ? 20.592 -15.296 -23.318 1.00 37.66  ? 152 THR A N   1 
ATOM 1228 C CA  . THR A 1 152 ? 21.224 -13.960 -23.417 1.00 39.17  ? 152 THR A CA  1 
ATOM 1229 C C   . THR A 1 152 ? 20.156 -12.893 -23.663 1.00 40.32  ? 152 THR A C   1 
ATOM 1230 O O   . THR A 1 152 ? 19.239 -13.079 -24.478 1.00 41.02  ? 152 THR A O   1 
ATOM 1231 C CB  . THR A 1 152 ? 22.319 -13.876 -24.490 1.00 39.87  ? 152 THR A CB  1 
ATOM 1232 O OG1 . THR A 1 152 ? 21.782 -14.245 -25.753 1.00 41.22  ? 152 THR A OG1 1 
ATOM 1233 C CG2 . THR A 1 152 ? 23.485 -14.834 -24.174 1.00 40.09  ? 152 THR A CG2 1 
ATOM 1234 N N   . PHE A 1 153 ? 20.242 -11.776 -22.938 1.00 40.64  ? 153 PHE A N   1 
ATOM 1235 C CA  . PHE A 1 153 ? 19.141 -10.827 -22.937 1.00 40.14  ? 153 PHE A CA  1 
ATOM 1236 C C   . PHE A 1 153 ? 19.540 -9.463  -22.427 1.00 41.28  ? 153 PHE A C   1 
ATOM 1237 O O   . PHE A 1 153 ? 20.556 -9.317  -21.760 1.00 41.80  ? 153 PHE A O   1 
ATOM 1238 C CB  . PHE A 1 153 ? 18.015 -11.378 -22.067 1.00 39.40  ? 153 PHE A CB  1 
ATOM 1239 C CG  . PHE A 1 153 ? 18.252 -11.223 -20.599 1.00 37.14  ? 153 PHE A CG  1 
ATOM 1240 C CD1 . PHE A 1 153 ? 19.300 -11.878 -19.975 1.00 34.53  ? 153 PHE A CD1 1 
ATOM 1241 C CD2 . PHE A 1 153 ? 17.408 -10.424 -19.829 1.00 36.63  ? 153 PHE A CD2 1 
ATOM 1242 C CE1 . PHE A 1 153 ? 19.514 -11.726 -18.603 1.00 32.72  ? 153 PHE A CE1 1 
ATOM 1243 C CE2 . PHE A 1 153 ? 17.610 -10.272 -18.459 1.00 34.38  ? 153 PHE A CE2 1 
ATOM 1244 C CZ  . PHE A 1 153 ? 18.675 -10.925 -17.854 1.00 33.13  ? 153 PHE A CZ  1 
ATOM 1245 N N   . VAL A 1 154 ? 18.703 -8.480  -22.714 1.00 41.73  ? 154 VAL A N   1 
ATOM 1246 C CA  . VAL A 1 154 ? 18.922 -7.119  -22.264 1.00 42.85  ? 154 VAL A CA  1 
ATOM 1247 C C   . VAL A 1 154 ? 17.920 -6.775  -21.122 1.00 43.05  ? 154 VAL A C   1 
ATOM 1248 O O   . VAL A 1 154 ? 16.725 -6.534  -21.372 1.00 42.61  ? 154 VAL A O   1 
ATOM 1249 C CB  . VAL A 1 154 ? 18.836 -6.139  -23.475 1.00 44.38  ? 154 VAL A CB  1 
ATOM 1250 C CG1 . VAL A 1 154 ? 18.799 -4.690  -23.028 1.00 43.90  ? 154 VAL A CG1 1 
ATOM 1251 C CG2 . VAL A 1 154 ? 20.015 -6.394  -24.435 1.00 45.01  ? 154 VAL A CG2 1 
ATOM 1252 N N   . PRO A 1 155 ? 18.406 -6.760  -19.855 1.00 43.06  ? 155 PRO A N   1 
ATOM 1253 C CA  . PRO A 1 155 ? 17.543 -6.559  -18.690 1.00 42.97  ? 155 PRO A CA  1 
ATOM 1254 C C   . PRO A 1 155 ? 16.780 -5.271  -18.840 1.00 44.40  ? 155 PRO A C   1 
ATOM 1255 O O   . PRO A 1 155 ? 17.300 -4.282  -19.395 1.00 45.40  ? 155 PRO A O   1 
ATOM 1256 C CB  . PRO A 1 155 ? 18.519 -6.414  -17.523 1.00 42.58  ? 155 PRO A CB  1 
ATOM 1257 C CG  . PRO A 1 155 ? 19.763 -6.912  -18.012 1.00 43.43  ? 155 PRO A CG  1 
ATOM 1258 C CD  . PRO A 1 155 ? 19.820 -6.684  -19.479 1.00 43.25  ? 155 PRO A CD  1 
ATOM 1259 N N   . SER A 1 156 ? 15.555 -5.295  -18.335 1.00 44.95  ? 156 SER A N   1 
ATOM 1260 C CA  . SER A 1 156 ? 14.600 -4.228  -18.546 1.00 46.60  ? 156 SER A CA  1 
ATOM 1261 C C   . SER A 1 156 ? 13.488 -4.396  -17.551 1.00 46.97  ? 156 SER A C   1 
ATOM 1262 O O   . SER A 1 156 ? 13.096 -5.524  -17.232 1.00 47.02  ? 156 SER A O   1 
ATOM 1263 C CB  . SER A 1 156 ? 14.037 -4.339  -19.938 1.00 46.13  ? 156 SER A CB  1 
ATOM 1264 O OG  . SER A 1 156 ? 12.860 -3.602  -20.020 1.00 48.72  ? 156 SER A OG  1 
ATOM 1265 N N   . ALA A 1 157 ? 12.987 -3.276  -17.050 1.00 48.75  ? 157 ALA A N   1 
ATOM 1266 C CA  . ALA A 1 157 ? 11.894 -3.259  -16.088 1.00 49.16  ? 157 ALA A CA  1 
ATOM 1267 C C   . ALA A 1 157 ? 10.548 -3.690  -16.712 1.00 49.12  ? 157 ALA A C   1 
ATOM 1268 O O   . ALA A 1 157 ? 9.647  -4.180  -16.004 1.00 49.27  ? 157 ALA A O   1 
ATOM 1269 C CB  . ALA A 1 157 ? 11.782 -1.858  -15.450 1.00 50.37  ? 157 ALA A CB  1 
ATOM 1270 N N   . GLU A 1 158 ? 10.404 -3.507  -18.024 1.00 49.35  ? 158 GLU A N   1 
ATOM 1271 C CA  . GLU A 1 158 ? 9.122  -3.783  -18.691 1.00 49.74  ? 158 GLU A CA  1 
ATOM 1272 C C   . GLU A 1 158 ? 8.879  -5.283  -19.034 1.00 47.67  ? 158 GLU A C   1 
ATOM 1273 O O   . GLU A 1 158 ? 7.896  -5.599  -19.730 1.00 47.74  ? 158 GLU A O   1 
ATOM 1274 C CB  . GLU A 1 158 ? 8.911  -2.857  -19.925 1.00 51.52  ? 158 GLU A CB  1 
ATOM 1275 C CG  . GLU A 1 158 ? 9.453  -1.388  -19.765 1.00 56.54  ? 158 GLU A CG  1 
ATOM 1276 C CD  . GLU A 1 158 ? 8.430  -0.221  -20.082 1.00 62.72  ? 158 GLU A CD  1 
ATOM 1277 O OE1 . GLU A 1 158 ? 7.339  -0.412  -20.717 1.00 62.85  ? 158 GLU A OE1 1 
ATOM 1278 O OE2 . GLU A 1 158 ? 8.748  0.930   -19.675 1.00 64.76  ? 158 GLU A OE2 1 
ATOM 1279 N N   . ASP A 1 159 ? 9.722  -6.186  -18.505 1.00 45.61  ? 159 ASP A N   1 
ATOM 1280 C CA  . ASP A 1 159 ? 9.778  -7.594  -18.959 1.00 44.10  ? 159 ASP A CA  1 
ATOM 1281 C C   . ASP A 1 159 ? 9.904  -8.636  -17.873 1.00 42.99  ? 159 ASP A C   1 
ATOM 1282 O O   . ASP A 1 159 ? 10.687 -8.468  -16.955 1.00 43.88  ? 159 ASP A O   1 
ATOM 1283 C CB  . ASP A 1 159 ? 10.954 -7.800  -19.905 1.00 43.13  ? 159 ASP A CB  1 
ATOM 1284 C CG  . ASP A 1 159 ? 10.739 -7.136  -21.231 1.00 43.95  ? 159 ASP A CG  1 
ATOM 1285 O OD1 . ASP A 1 159 ? 9.567  -7.102  -21.663 1.00 42.18  ? 159 ASP A OD1 1 
ATOM 1286 O OD2 . ASP A 1 159 ? 11.727 -6.637  -21.830 1.00 44.05  ? 159 ASP A OD2 1 
ATOM 1287 N N   . PHE A 1 160 ? 9.144  -9.720  -17.983 1.00 41.91  ? 160 PHE A N   1 
ATOM 1288 C CA  . PHE A 1 160 ? 9.346  -10.877 -17.103 1.00 40.63  ? 160 PHE A CA  1 
ATOM 1289 C C   . PHE A 1 160 ? 9.756  -12.150 -17.880 1.00 39.74  ? 160 PHE A C   1 
ATOM 1290 O O   . PHE A 1 160 ? 9.475  -12.272 -19.084 1.00 39.61  ? 160 PHE A O   1 
ATOM 1291 C CB  . PHE A 1 160 ? 8.118  -11.127 -16.224 1.00 40.24  ? 160 PHE A CB  1 
ATOM 1292 C CG  . PHE A 1 160 ? 6.874  -11.444 -16.990 1.00 39.85  ? 160 PHE A CG  1 
ATOM 1293 C CD1 . PHE A 1 160 ? 6.580  -12.752 -17.364 1.00 36.96  ? 160 PHE A CD1 1 
ATOM 1294 C CD2 . PHE A 1 160 ? 5.958  -10.432 -17.309 1.00 42.69  ? 160 PHE A CD2 1 
ATOM 1295 C CE1 . PHE A 1 160 ? 5.406  -13.058 -18.068 1.00 36.44  ? 160 PHE A CE1 1 
ATOM 1296 C CE2 . PHE A 1 160 ? 4.754  -10.731 -18.017 1.00 41.63  ? 160 PHE A CE2 1 
ATOM 1297 C CZ  . PHE A 1 160 ? 4.499  -12.053 -18.405 1.00 38.40  ? 160 PHE A CZ  1 
ATOM 1298 N N   . TYR A 1 161 ? 10.419 -13.078 -17.190 1.00 38.94  ? 161 TYR A N   1 
ATOM 1299 C CA  . TYR A 1 161 ? 10.833 -14.352 -17.781 1.00 38.82  ? 161 TYR A CA  1 
ATOM 1300 C C   . TYR A 1 161 ? 10.370 -15.571 -16.958 1.00 38.95  ? 161 TYR A C   1 
ATOM 1301 O O   . TYR A 1 161 ? 10.206 -15.490 -15.747 1.00 39.64  ? 161 TYR A O   1 
ATOM 1302 C CB  . TYR A 1 161 ? 12.342 -14.359 -17.971 1.00 38.18  ? 161 TYR A CB  1 
ATOM 1303 C CG  . TYR A 1 161 ? 12.891 -13.231 -18.856 1.00 39.99  ? 161 TYR A CG  1 
ATOM 1304 C CD1 . TYR A 1 161 ? 13.155 -13.445 -20.227 1.00 40.19  ? 161 TYR A CD1 1 
ATOM 1305 C CD2 . TYR A 1 161 ? 13.151 -11.955 -18.328 1.00 40.46  ? 161 TYR A CD2 1 
ATOM 1306 C CE1 . TYR A 1 161 ? 13.636 -12.418 -21.045 1.00 39.74  ? 161 TYR A CE1 1 
ATOM 1307 C CE2 . TYR A 1 161 ? 13.646 -10.923 -19.137 1.00 41.28  ? 161 TYR A CE2 1 
ATOM 1308 C CZ  . TYR A 1 161 ? 13.883 -11.167 -20.497 1.00 41.88  ? 161 TYR A CZ  1 
ATOM 1309 O OH  . TYR A 1 161 ? 14.385 -10.155 -21.298 1.00 43.38  ? 161 TYR A OH  1 
ATOM 1310 N N   . ASP A 1 162 ? 10.114 -16.698 -17.609 1.00 39.34  ? 162 ASP A N   1 
ATOM 1311 C CA  . ASP A 1 162 ? 9.944  -17.960 -16.865 1.00 39.35  ? 162 ASP A CA  1 
ATOM 1312 C C   . ASP A 1 162 ? 10.788 -19.102 -17.457 1.00 38.42  ? 162 ASP A C   1 
ATOM 1313 O O   . ASP A 1 162 ? 10.872 -19.254 -18.683 1.00 38.14  ? 162 ASP A O   1 
ATOM 1314 C CB  . ASP A 1 162 ? 8.492  -18.411 -16.831 1.00 40.35  ? 162 ASP A CB  1 
ATOM 1315 C CG  . ASP A 1 162 ? 7.520  -17.272 -16.671 1.00 43.98  ? 162 ASP A CG  1 
ATOM 1316 O OD1 . ASP A 1 162 ? 7.040  -16.773 -17.713 1.00 47.93  ? 162 ASP A OD1 1 
ATOM 1317 O OD2 . ASP A 1 162 ? 7.229  -16.880 -15.517 1.00 47.39  ? 162 ASP A OD2 1 
ATOM 1318 N N   . CYS A 1 163 ? 11.421 -19.897 -16.594 1.00 37.49  ? 163 CYS A N   1 
ATOM 1319 C CA  . CYS A 1 163 ? 11.941 -21.203 -17.029 1.00 37.09  ? 163 CYS A CA  1 
ATOM 1320 C C   . CYS A 1 163 ? 10.760 -22.175 -16.949 1.00 37.33  ? 163 CYS A C   1 
ATOM 1321 O O   . CYS A 1 163 ? 10.133 -22.313 -15.883 1.00 37.79  ? 163 CYS A O   1 
ATOM 1322 C CB  . CYS A 1 163 ? 13.112 -21.664 -16.136 1.00 36.50  ? 163 CYS A CB  1 
ATOM 1323 S SG  . CYS A 1 163 ? 14.291 -22.917 -16.823 1.00 37.53  ? 163 CYS A SG  1 
ATOM 1324 N N   . ARG A 1 164 ? 10.427 -22.800 -18.074 1.00 37.30  ? 164 ARG A N   1 
ATOM 1325 C CA  . ARG A 1 164 ? 9.303  -23.718 -18.153 1.00 37.96  ? 164 ARG A CA  1 
ATOM 1326 C C   . ARG A 1 164 ? 9.801  -25.150 -18.300 1.00 38.30  ? 164 ARG A C   1 
ATOM 1327 O O   . ARG A 1 164 ? 10.487 -25.477 -19.269 1.00 38.02  ? 164 ARG A O   1 
ATOM 1328 C CB  . ARG A 1 164 ? 8.384  -23.345 -19.315 1.00 38.46  ? 164 ARG A CB  1 
ATOM 1329 C CG  . ARG A 1 164 ? 7.012  -24.024 -19.259 1.00 39.68  ? 164 ARG A CG  1 
ATOM 1330 C CD  . ARG A 1 164 ? 6.604  -24.605 -20.612 1.00 39.59  ? 164 ARG A CD  1 
ATOM 1331 N NE  . ARG A 1 164 ? 5.171  -24.848 -20.652 1.00 43.36  ? 164 ARG A NE  1 
ATOM 1332 C CZ  . ARG A 1 164 ? 4.588  -25.977 -21.058 1.00 46.31  ? 164 ARG A CZ  1 
ATOM 1333 N NH1 . ARG A 1 164 ? 5.303  -27.001 -21.510 1.00 45.26  ? 164 ARG A NH1 1 
ATOM 1334 N NH2 . ARG A 1 164 ? 3.264  -26.072 -21.051 1.00 47.90  ? 164 ARG A NH2 1 
ATOM 1335 N N   . VAL A 1 165 ? 9.432  -26.000 -17.343 1.00 39.14  ? 165 VAL A N   1 
ATOM 1336 C CA  . VAL A 1 165 ? 10.018 -27.346 -17.200 1.00 39.86  ? 165 VAL A CA  1 
ATOM 1337 C C   . VAL A 1 165 ? 8.972  -28.454 -17.270 1.00 40.80  ? 165 VAL A C   1 
ATOM 1338 O O   . VAL A 1 165 ? 7.821  -28.255 -16.872 1.00 42.77  ? 165 VAL A O   1 
ATOM 1339 C CB  . VAL A 1 165 ? 10.813 -27.468 -15.854 1.00 39.71  ? 165 VAL A CB  1 
ATOM 1340 C CG1 . VAL A 1 165 ? 11.537 -28.788 -15.756 1.00 39.67  ? 165 VAL A CG1 1 
ATOM 1341 C CG2 . VAL A 1 165 ? 11.831 -26.334 -15.730 1.00 40.00  ? 165 VAL A CG2 1 
ATOM 1342 N N   . GLU A 1 166 ? 9.363  -29.618 -17.767 1.00 40.71  ? 166 GLU A N   1 
ATOM 1343 C CA  . GLU A 1 166 ? 8.438  -30.728 -17.952 1.00 41.48  ? 166 GLU A CA  1 
ATOM 1344 C C   . GLU A 1 166 ? 9.171  -32.015 -17.619 1.00 41.36  ? 166 GLU A C   1 
ATOM 1345 O O   . GLU A 1 166 ? 10.237 -32.299 -18.177 1.00 40.77  ? 166 GLU A O   1 
ATOM 1346 C CB  . GLU A 1 166 ? 8.011  -30.813 -19.407 1.00 42.28  ? 166 GLU A CB  1 
ATOM 1347 C CG  . GLU A 1 166 ? 7.103  -29.732 -19.924 1.00 42.68  ? 166 GLU A CG  1 
ATOM 1348 C CD  . GLU A 1 166 ? 6.564  -30.099 -21.323 1.00 46.59  ? 166 GLU A CD  1 
ATOM 1349 O OE1 . GLU A 1 166 ? 7.359  -30.282 -22.286 1.00 44.03  ? 166 GLU A OE1 1 
ATOM 1350 O OE2 . GLU A 1 166 ? 5.324  -30.224 -21.451 1.00 50.42  ? 166 GLU A OE2 1 
ATOM 1351 N N   . HIS A 1 167 ? 8.594  -32.795 -16.722 1.00 41.86  ? 167 HIS A N   1 
ATOM 1352 C CA  . HIS A 1 167 ? 9.219  -34.008 -16.234 1.00 42.40  ? 167 HIS A CA  1 
ATOM 1353 C C   . HIS A 1 167 ? 8.172  -34.933 -15.626 1.00 43.31  ? 167 HIS A C   1 
ATOM 1354 O O   . HIS A 1 167 ? 7.204  -34.476 -15.044 1.00 44.71  ? 167 HIS A O   1 
ATOM 1355 C CB  . HIS A 1 167 ? 10.307 -33.672 -15.211 1.00 41.84  ? 167 HIS A CB  1 
ATOM 1356 C CG  . HIS A 1 167 ? 11.126 -34.850 -14.792 1.00 43.14  ? 167 HIS A CG  1 
ATOM 1357 N ND1 . HIS A 1 167 ? 11.053 -35.393 -13.527 1.00 45.19  ? 167 HIS A ND1 1 
ATOM 1358 C CD2 . HIS A 1 167 ? 12.008 -35.613 -15.480 1.00 43.84  ? 167 HIS A CD2 1 
ATOM 1359 C CE1 . HIS A 1 167 ? 11.877 -36.424 -13.446 1.00 44.70  ? 167 HIS A CE1 1 
ATOM 1360 N NE2 . HIS A 1 167 ? 12.472 -36.575 -14.615 1.00 44.58  ? 167 HIS A NE2 1 
ATOM 1361 N N   . TRP A 1 168 ? 8.373  -36.233 -15.759 1.00 44.04  ? 168 TRP A N   1 
ATOM 1362 C CA  . TRP A 1 168 ? 7.378  -37.220 -15.362 1.00 45.64  ? 168 TRP A CA  1 
ATOM 1363 C C   . TRP A 1 168 ? 7.024  -37.190 -13.873 1.00 46.47  ? 168 TRP A C   1 
ATOM 1364 O O   . TRP A 1 168 ? 6.021  -37.762 -13.468 1.00 48.40  ? 168 TRP A O   1 
ATOM 1365 C CB  . TRP A 1 168 ? 7.826  -38.634 -15.759 1.00 46.30  ? 168 TRP A CB  1 
ATOM 1366 C CG  . TRP A 1 168 ? 8.104  -38.854 -17.239 1.00 45.33  ? 168 TRP A CG  1 
ATOM 1367 C CD1 . TRP A 1 168 ? 7.556  -38.177 -18.302 1.00 43.85  ? 168 TRP A CD1 1 
ATOM 1368 C CD2 . TRP A 1 168 ? 8.976  -39.844 -17.800 1.00 45.10  ? 168 TRP A CD2 1 
ATOM 1369 N NE1 . TRP A 1 168 ? 8.049  -38.680 -19.489 1.00 43.04  ? 168 TRP A NE1 1 
ATOM 1370 C CE2 . TRP A 1 168 ? 8.926  -39.694 -19.213 1.00 43.74  ? 168 TRP A CE2 1 
ATOM 1371 C CE3 . TRP A 1 168 ? 9.828  -40.829 -17.243 1.00 45.96  ? 168 TRP A CE3 1 
ATOM 1372 C CZ2 . TRP A 1 168 ? 9.672  -40.495 -20.075 1.00 43.42  ? 168 TRP A CZ2 1 
ATOM 1373 C CZ3 . TRP A 1 168 ? 10.582 -41.639 -18.112 1.00 43.42  ? 168 TRP A CZ3 1 
ATOM 1374 C CH2 . TRP A 1 168 ? 10.490 -41.461 -19.511 1.00 45.01  ? 168 TRP A CH2 1 
ATOM 1375 N N   . GLY A 1 169 ? 7.832  -36.511 -13.064 1.00 46.01  ? 169 GLY A N   1 
ATOM 1376 C CA  . GLY A 1 169 ? 7.601  -36.430 -11.619 1.00 46.06  ? 169 GLY A CA  1 
ATOM 1377 C C   . GLY A 1 169 ? 6.732  -35.255 -11.257 1.00 46.33  ? 169 GLY A C   1 
ATOM 1378 O O   . GLY A 1 169 ? 6.352  -35.105 -10.091 1.00 46.72  ? 169 GLY A O   1 
ATOM 1379 N N   . LEU A 1 170 ? 6.433  -34.424 -12.259 1.00 46.09  ? 170 LEU A N   1 
ATOM 1380 C CA  . LEU A 1 170 ? 5.536  -33.276 -12.117 1.00 47.20  ? 170 LEU A CA  1 
ATOM 1381 C C   . LEU A 1 170 ? 4.148  -33.609 -12.672 1.00 49.62  ? 170 LEU A C   1 
ATOM 1382 O O   . LEU A 1 170 ? 4.030  -34.226 -13.743 1.00 50.29  ? 170 LEU A O   1 
ATOM 1383 C CB  . LEU A 1 170 ? 6.087  -32.077 -12.884 1.00 45.85  ? 170 LEU A CB  1 
ATOM 1384 C CG  . LEU A 1 170 ? 7.499  -31.527 -12.627 1.00 44.04  ? 170 LEU A CG  1 
ATOM 1385 C CD1 . LEU A 1 170 ? 8.059  -31.013 -13.905 1.00 39.99  ? 170 LEU A CD1 1 
ATOM 1386 C CD2 . LEU A 1 170 ? 7.504  -30.432 -11.545 1.00 43.50  ? 170 LEU A CD2 1 
ATOM 1387 N N   . ASP A 1 171 ? 3.101  -33.207 -11.955 1.00 51.28  ? 171 ASP A N   1 
ATOM 1388 C CA  . ASP A 1 171 ? 1.756  -33.325 -12.487 1.00 53.56  ? 171 ASP A CA  1 
ATOM 1389 C C   . ASP A 1 171 ? 1.610  -32.326 -13.627 1.00 53.50  ? 171 ASP A C   1 
ATOM 1390 O O   . ASP A 1 171 ? 1.257  -32.687 -14.753 1.00 54.64  ? 171 ASP A O   1 
ATOM 1391 C CB  . ASP A 1 171 ? 0.716  -33.059 -11.404 1.00 54.56  ? 171 ASP A CB  1 
ATOM 1392 C CG  . ASP A 1 171 ? 0.745  -34.100 -10.294 1.00 56.81  ? 171 ASP A CG  1 
ATOM 1393 O OD1 . ASP A 1 171 ? 0.760  -33.696 -9.112  1.00 58.90  ? 171 ASP A OD1 1 
ATOM 1394 O OD2 . ASP A 1 171 ? 0.734  -35.320 -10.593 1.00 57.88  ? 171 ASP A OD2 1 
ATOM 1395 N N   . GLN A 1 172 ? 1.937  -31.077 -13.322 1.00 52.93  ? 172 GLN A N   1 
ATOM 1396 C CA  . GLN A 1 172 ? 1.795  -29.949 -14.225 1.00 52.45  ? 172 GLN A CA  1 
ATOM 1397 C C   . GLN A 1 172 ? 3.171  -29.526 -14.700 1.00 50.31  ? 172 GLN A C   1 
ATOM 1398 O O   . GLN A 1 172 ? 4.158  -29.729 -13.999 1.00 49.37  ? 172 GLN A O   1 
ATOM 1399 C CB  . GLN A 1 172 ? 1.232  -28.764 -13.447 1.00 53.20  ? 172 GLN A CB  1 
ATOM 1400 C CG  . GLN A 1 172 ? 0.139  -29.104 -12.477 1.00 56.39  ? 172 GLN A CG  1 
ATOM 1401 C CD  . GLN A 1 172 ? -1.202 -29.022 -13.146 1.00 61.36  ? 172 GLN A CD  1 
ATOM 1402 O OE1 . GLN A 1 172 ? -1.287 -28.680 -14.334 1.00 62.27  ? 172 GLN A OE1 1 
ATOM 1403 N NE2 . GLN A 1 172 ? -2.272 -29.323 -12.397 1.00 63.56  ? 172 GLN A NE2 1 
ATOM 1404 N N   . PRO A 1 173 ? 3.245  -28.914 -15.887 1.00 49.45  ? 173 PRO A N   1 
ATOM 1405 C CA  . PRO A 1 173 ? 4.499  -28.247 -16.246 1.00 47.57  ? 173 PRO A CA  1 
ATOM 1406 C C   . PRO A 1 173 ? 4.827  -27.141 -15.249 1.00 46.56  ? 173 PRO A C   1 
ATOM 1407 O O   . PRO A 1 173 ? 3.932  -26.363 -14.897 1.00 47.02  ? 173 PRO A O   1 
ATOM 1408 C CB  . PRO A 1 173 ? 4.206  -27.656 -17.641 1.00 47.82  ? 173 PRO A CB  1 
ATOM 1409 C CG  . PRO A 1 173 ? 2.703  -27.857 -17.879 1.00 49.45  ? 173 PRO A CG  1 
ATOM 1410 C CD  . PRO A 1 173 ? 2.329  -29.035 -17.036 1.00 50.40  ? 173 PRO A CD  1 
ATOM 1411 N N   . LEU A 1 174 ? 6.090  -27.078 -14.808 1.00 44.91  ? 174 LEU A N   1 
ATOM 1412 C CA  . LEU A 1 174 ? 6.541  -26.088 -13.798 1.00 44.18  ? 174 LEU A CA  1 
ATOM 1413 C C   . LEU A 1 174 ? 7.180  -24.815 -14.387 1.00 43.11  ? 174 LEU A C   1 
ATOM 1414 O O   . LEU A 1 174 ? 8.076  -24.888 -15.233 1.00 42.21  ? 174 LEU A O   1 
ATOM 1415 C CB  . LEU A 1 174 ? 7.522  -26.743 -12.791 1.00 44.12  ? 174 LEU A CB  1 
ATOM 1416 C CG  . LEU A 1 174 ? 8.055  -25.877 -11.637 1.00 43.75  ? 174 LEU A CG  1 
ATOM 1417 C CD1 . LEU A 1 174 ? 6.929  -25.618 -10.661 1.00 46.37  ? 174 LEU A CD1 1 
ATOM 1418 C CD2 . LEU A 1 174 ? 9.235  -26.495 -10.916 1.00 41.67  ? 174 LEU A CD2 1 
ATOM 1419 N N   . LEU A 1 175 ? 6.737  -23.661 -13.906 1.00 43.19  ? 175 LEU A N   1 
ATOM 1420 C CA  . LEU A 1 175 ? 7.270  -22.367 -14.343 1.00 43.45  ? 175 LEU A CA  1 
ATOM 1421 C C   . LEU A 1 175 ? 8.001  -21.650 -13.210 1.00 43.58  ? 175 LEU A C   1 
ATOM 1422 O O   . LEU A 1 175 ? 7.516  -21.594 -12.098 1.00 44.14  ? 175 LEU A O   1 
ATOM 1423 C CB  . LEU A 1 175 ? 6.140  -21.451 -14.807 1.00 44.05  ? 175 LEU A CB  1 
ATOM 1424 C CG  . LEU A 1 175 ? 5.114  -21.776 -15.911 1.00 45.40  ? 175 LEU A CG  1 
ATOM 1425 C CD1 . LEU A 1 175 ? 5.449  -21.017 -17.198 1.00 43.89  ? 175 LEU A CD1 1 
ATOM 1426 C CD2 . LEU A 1 175 ? 4.831  -23.301 -16.167 1.00 44.24  ? 175 LEU A CD2 1 
ATOM 1427 N N   . LYS A 1 176 ? 9.167  -21.086 -13.481 1.00 43.50  ? 176 LYS A N   1 
ATOM 1428 C CA  . LYS A 1 176 ? 9.784  -20.235 -12.479 1.00 43.96  ? 176 LYS A CA  1 
ATOM 1429 C C   . LYS A 1 176 ? 9.809  -18.789 -12.927 1.00 43.91  ? 176 LYS A C   1 
ATOM 1430 O O   . LYS A 1 176 ? 10.329 -18.462 -13.986 1.00 43.99  ? 176 LYS A O   1 
ATOM 1431 C CB  . LYS A 1 176 ? 11.188 -20.734 -12.107 1.00 43.68  ? 176 LYS A CB  1 
ATOM 1432 C CG  . LYS A 1 176 ? 11.203 -21.613 -10.855 1.00 46.11  ? 176 LYS A CG  1 
ATOM 1433 C CD  . LYS A 1 176 ? 11.474 -20.804 -9.569  1.00 49.67  ? 176 LYS A CD  1 
ATOM 1434 C CE  . LYS A 1 176 ? 11.012 -21.567 -8.321  1.00 52.77  ? 176 LYS A CE  1 
ATOM 1435 N NZ  . LYS A 1 176 ? 11.565 -20.950 -7.078  1.00 54.89  ? 176 LYS A NZ  1 
ATOM 1436 N N   . HIS A 1 177 ? 9.233  -17.916 -12.126 1.00 44.40  ? 177 HIS A N   1 
ATOM 1437 C CA  . HIS A 1 177 ? 9.248  -16.524 -12.476 1.00 44.90  ? 177 HIS A CA  1 
ATOM 1438 C C   . HIS A 1 177 ? 10.606 -15.924 -12.136 1.00 44.77  ? 177 HIS A C   1 
ATOM 1439 O O   . HIS A 1 177 ? 11.269 -16.348 -11.208 1.00 44.21  ? 177 HIS A O   1 
ATOM 1440 C CB  . HIS A 1 177 ? 8.115  -15.788 -11.772 1.00 45.86  ? 177 HIS A CB  1 
ATOM 1441 C CG  . HIS A 1 177 ? 7.520  -14.676 -12.578 1.00 46.64  ? 177 HIS A CG  1 
ATOM 1442 N ND1 . HIS A 1 177 ? 7.765  -13.346 -12.312 1.00 47.72  ? 177 HIS A ND1 1 
ATOM 1443 C CD2 . HIS A 1 177 ? 6.675  -14.698 -13.635 1.00 48.10  ? 177 HIS A CD2 1 
ATOM 1444 C CE1 . HIS A 1 177 ? 7.097  -12.597 -13.168 1.00 48.95  ? 177 HIS A CE1 1 
ATOM 1445 N NE2 . HIS A 1 177 ? 6.429  -13.394 -13.983 1.00 50.10  ? 177 HIS A NE2 1 
ATOM 1446 N N   . TRP A 1 178 ? 11.033 -14.981 -12.962 1.00 45.59  ? 178 TRP A N   1 
ATOM 1447 C CA  . TRP A 1 178 ? 12.110 -14.069 -12.636 1.00 46.76  ? 178 TRP A CA  1 
ATOM 1448 C C   . TRP A 1 178 ? 11.808 -12.742 -13.317 1.00 49.05  ? 178 TRP A C   1 
ATOM 1449 O O   . TRP A 1 178 ? 11.292 -12.729 -14.433 1.00 48.91  ? 178 TRP A O   1 
ATOM 1450 C CB  . TRP A 1 178 ? 13.457 -14.604 -13.127 1.00 45.57  ? 178 TRP A CB  1 
ATOM 1451 C CG  . TRP A 1 178 ? 14.585 -13.715 -12.744 1.00 43.03  ? 178 TRP A CG  1 
ATOM 1452 C CD1 . TRP A 1 178 ? 15.316 -13.778 -11.600 1.00 41.65  ? 178 TRP A CD1 1 
ATOM 1453 C CD2 . TRP A 1 178 ? 15.103 -12.612 -13.494 1.00 42.96  ? 178 TRP A CD2 1 
ATOM 1454 N NE1 . TRP A 1 178 ? 16.259 -12.783 -11.584 1.00 42.22  ? 178 TRP A NE1 1 
ATOM 1455 C CE2 . TRP A 1 178 ? 16.155 -12.052 -12.735 1.00 42.65  ? 178 TRP A CE2 1 
ATOM 1456 C CE3 . TRP A 1 178 ? 14.775 -12.030 -14.735 1.00 44.41  ? 178 TRP A CE3 1 
ATOM 1457 C CZ2 . TRP A 1 178 ? 16.888 -10.942 -13.168 1.00 44.21  ? 178 TRP A CZ2 1 
ATOM 1458 C CZ3 . TRP A 1 178 ? 15.517 -10.910 -15.174 1.00 43.84  ? 178 TRP A CZ3 1 
ATOM 1459 C CH2 . TRP A 1 178 ? 16.556 -10.390 -14.391 1.00 45.24  ? 178 TRP A CH2 1 
ATOM 1460 N N   . GLU A 1 179 ? 12.133 -11.633 -12.653 1.00 51.63  ? 179 GLU A N   1 
ATOM 1461 C CA  . GLU A 1 179 ? 12.021 -10.302 -13.271 1.00 54.35  ? 179 GLU A CA  1 
ATOM 1462 C C   . GLU A 1 179 ? 13.002 -9.352  -12.600 1.00 56.50  ? 179 GLU A C   1 
ATOM 1463 O O   . GLU A 1 179 ? 13.368 -9.570  -11.447 1.00 57.10  ? 179 GLU A O   1 
ATOM 1464 C CB  . GLU A 1 179 ? 10.582 -9.759  -13.193 1.00 55.16  ? 179 GLU A CB  1 
ATOM 1465 C CG  . GLU A 1 179 ? 9.980  -9.696  -11.774 1.00 55.50  ? 179 GLU A CG  1 
ATOM 1466 C CD  . GLU A 1 179 ? 8.533  -9.211  -11.769 1.00 56.33  ? 179 GLU A CD  1 
ATOM 1467 O OE1 . GLU A 1 179 ? 7.630  -9.932  -12.259 1.00 56.34  ? 179 GLU A OE1 1 
ATOM 1468 O OE2 . GLU A 1 179 ? 8.294  -8.096  -11.266 1.00 57.83  ? 179 GLU A OE2 1 
ATOM 1469 N N   . ALA A 1 180 ? 13.445 -8.322  -13.324 1.00 58.86  ? 180 ALA A N   1 
ATOM 1470 C CA  . ALA A 1 180 ? 14.296 -7.258  -12.753 1.00 61.13  ? 180 ALA A CA  1 
ATOM 1471 C C   . ALA A 1 180 ? 13.723 -6.799  -11.419 1.00 63.10  ? 180 ALA A C   1 
ATOM 1472 O O   . ALA A 1 180 ? 12.782 -5.981  -11.371 1.00 63.78  ? 180 ALA A O   1 
ATOM 1473 C CB  . ALA A 1 180 ? 14.411 -6.083  -13.718 1.00 62.00  ? 180 ALA A CB  1 
ATOM 1474 N N   . GLN A 1 181 ? 14.288 -7.359  -10.346 1.00 64.34  ? 181 GLN A N   1 
ATOM 1475 C CA  . GLN A 1 181 ? 13.718 -7.246  -8.997  1.00 66.29  ? 181 GLN A CA  1 
ATOM 1476 C C   . GLN A 1 181 ? 13.684 -5.800  -8.543  1.00 68.09  ? 181 GLN A C   1 
ATOM 1477 O O   . GLN A 1 181 ? 12.625 -5.176  -8.624  1.00 68.91  ? 181 GLN A O   1 
ATOM 1478 C CB  . GLN A 1 181 ? 14.493 -8.108  -7.980  1.00 66.52  ? 181 GLN A CB  1 
ATOM 1479 C CG  . GLN A 1 181 ? 13.804 -8.232  -6.602  1.00 68.52  ? 181 GLN A CG  1 
ATOM 1480 C CD  . GLN A 1 181 ? 12.441 -8.954  -6.673  1.00 69.40  ? 181 GLN A CD  1 
ATOM 1481 O OE1 . GLN A 1 181 ? 11.426 -8.450  -6.165  1.00 70.30  ? 181 GLN A OE1 1 
ATOM 1482 N NE2 . GLN A 1 181 ? 12.420 -10.132 -7.307  1.00 65.73  ? 181 GLN A NE2 1 
ATOM 1483 N N   . ASN B 2 1   ? 49.482 -35.698 -24.558 1.00 58.79  ? -25 ASN B N   1 
ATOM 1484 C CA  . ASN B 2 1   ? 48.532 -34.616 -24.164 1.00 58.20  ? -25 ASN B CA  1 
ATOM 1485 C C   . ASN B 2 1   ? 47.138 -35.070 -24.577 1.00 57.75  ? -25 ASN B C   1 
ATOM 1486 O O   . ASN B 2 1   ? 46.237 -34.265 -24.840 1.00 57.88  ? -25 ASN B O   1 
ATOM 1487 C CB  . ASN B 2 1   ? 48.921 -33.303 -24.826 1.00 58.31  ? -25 ASN B CB  1 
ATOM 1488 C CG  . ASN B 2 1   ? 50.331 -33.342 -25.406 1.00 60.59  ? -25 ASN B CG  1 
ATOM 1489 O OD1 . ASN B 2 1   ? 51.320 -33.409 -24.664 1.00 63.54  ? -25 ASN B OD1 1 
ATOM 1490 N ND2 . ASN B 2 1   ? 50.432 -33.333 -26.739 1.00 61.40  ? -25 ASN B ND2 1 
ATOM 1491 N N   . LYS B 2 2   ? 46.983 -36.386 -24.650 1.00 56.75  ? -24 LYS B N   1 
ATOM 1492 C CA  . LYS B 2 2   ? 45.685 -36.990 -24.801 1.00 56.20  ? -24 LYS B CA  1 
ATOM 1493 C C   . LYS B 2 2   ? 45.282 -37.455 -23.410 1.00 55.04  ? -24 LYS B C   1 
ATOM 1494 O O   . LYS B 2 2   ? 46.115 -37.938 -22.647 1.00 54.45  ? -24 LYS B O   1 
ATOM 1495 C CB  . LYS B 2 2   ? 45.725 -38.183 -25.763 1.00 56.63  ? -24 LYS B CB  1 
ATOM 1496 C CG  . LYS B 2 2   ? 46.929 -38.230 -26.730 1.00 59.43  ? -24 LYS B CG  1 
ATOM 1497 C CD  . LYS B 2 2   ? 47.065 -39.605 -27.467 1.00 63.59  ? -24 LYS B CD  1 
ATOM 1498 C CE  . LYS B 2 2   ? 46.416 -39.597 -28.890 1.00 65.08  ? -24 LYS B CE  1 
ATOM 1499 N NZ  . LYS B 2 2   ? 45.003 -39.052 -28.948 1.00 64.77  ? -24 LYS B NZ  1 
ATOM 1500 N N   . PHE B 2 3   ? 44.006 -37.273 -23.086 1.00 54.13  ? -23 PHE B N   1 
ATOM 1501 C CA  . PHE B 2 3   ? 43.435 -37.736 -21.844 1.00 52.71  ? -23 PHE B CA  1 
ATOM 1502 C C   . PHE B 2 3   ? 43.341 -39.284 -21.879 1.00 53.98  ? -23 PHE B C   1 
ATOM 1503 O O   . PHE B 2 3   ? 43.184 -39.890 -22.944 1.00 53.09  ? -23 PHE B O   1 
ATOM 1504 C CB  . PHE B 2 3   ? 42.068 -37.042 -21.595 1.00 51.52  ? -23 PHE B CB  1 
ATOM 1505 C CG  . PHE B 2 3   ? 42.158 -35.784 -20.729 1.00 46.81  ? -23 PHE B CG  1 
ATOM 1506 C CD1 . PHE B 2 3   ? 42.520 -34.555 -21.271 1.00 42.50  ? -23 PHE B CD1 1 
ATOM 1507 C CD2 . PHE B 2 3   ? 41.885 -35.834 -19.370 1.00 42.03  ? -23 PHE B CD2 1 
ATOM 1508 C CE1 . PHE B 2 3   ? 42.618 -33.408 -20.463 1.00 41.19  ? -23 PHE B CE1 1 
ATOM 1509 C CE2 . PHE B 2 3   ? 42.004 -34.675 -18.555 1.00 42.12  ? -23 PHE B CE2 1 
ATOM 1510 C CZ  . PHE B 2 3   ? 42.365 -33.468 -19.095 1.00 38.89  ? -23 PHE B CZ  1 
ATOM 1511 N N   . ASP B 2 4   ? 43.485 -39.893 -20.698 1.00 55.77  ? -22 ASP B N   1 
ATOM 1512 C CA  . ASP B 2 4   ? 43.443 -41.341 -20.468 1.00 57.52  ? -22 ASP B CA  1 
ATOM 1513 C C   . ASP B 2 4   ? 42.036 -41.820 -20.084 1.00 58.00  ? -22 ASP B C   1 
ATOM 1514 O O   . ASP B 2 4   ? 41.279 -41.088 -19.448 1.00 57.48  ? -22 ASP B O   1 
ATOM 1515 C CB  . ASP B 2 4   ? 44.412 -41.706 -19.328 1.00 58.09  ? -22 ASP B CB  1 
ATOM 1516 C CG  . ASP B 2 4   ? 45.694 -42.400 -19.808 1.00 60.22  ? -22 ASP B CG  1 
ATOM 1517 O OD1 . ASP B 2 4   ? 46.593 -42.603 -18.947 1.00 61.55  ? -22 ASP B OD1 1 
ATOM 1518 O OD2 . ASP B 2 4   ? 45.803 -42.761 -21.011 1.00 62.08  ? -22 ASP B OD2 1 
ATOM 1519 N N   . THR B 2 5   ? 41.775 -43.094 -20.384 1.00 59.04  ? -21 THR B N   1 
ATOM 1520 C CA  . THR B 2 5   ? 40.452 -43.700 -20.513 1.00 60.08  ? -21 THR B CA  1 
ATOM 1521 C C   . THR B 2 5   ? 40.442 -45.079 -19.868 1.00 60.42  ? -21 THR B C   1 
ATOM 1522 O O   . THR B 2 5   ? 41.373 -45.851 -20.056 1.00 60.71  ? -21 THR B O   1 
ATOM 1523 C CB  . THR B 2 5   ? 40.159 -43.984 -22.041 1.00 60.68  ? -21 THR B CB  1 
ATOM 1524 O OG1 . THR B 2 5   ? 40.692 -42.928 -22.866 1.00 61.45  ? -21 THR B OG1 1 
ATOM 1525 C CG2 . THR B 2 5   ? 38.628 -44.243 -22.349 1.00 60.92  ? -21 THR B CG2 1 
ATOM 1526 N N   . GLN B 2 6   ? 39.386 -45.422 -19.145 1.00 61.03  ? -20 GLN B N   1 
ATOM 1527 C CA  . GLN B 2 6   ? 39.194 -46.810 -18.745 1.00 61.50  ? -20 GLN B CA  1 
ATOM 1528 C C   . GLN B 2 6   ? 37.913 -47.299 -19.368 1.00 62.22  ? -20 GLN B C   1 
ATOM 1529 O O   . GLN B 2 6   ? 36.962 -46.518 -19.513 1.00 62.50  ? -20 GLN B O   1 
ATOM 1530 C CB  . GLN B 2 6   ? 39.127 -46.982 -17.217 1.00 61.13  ? -20 GLN B CB  1 
ATOM 1531 C CG  . GLN B 2 6   ? 39.682 -48.341 -16.776 1.00 61.78  ? -20 GLN B CG  1 
ATOM 1532 C CD  . GLN B 2 6   ? 38.970 -48.978 -15.571 1.00 62.63  ? -20 GLN B CD  1 
ATOM 1533 O OE1 . GLN B 2 6   ? 39.270 -48.658 -14.421 1.00 62.15  ? -20 GLN B OE1 1 
ATOM 1534 N NE2 . GLN B 2 6   ? 38.060 -49.929 -15.840 1.00 62.08  ? -20 GLN B NE2 1 
ATOM 1535 N N   . LEU B 2 7   ? 37.881 -48.580 -19.744 1.00 62.88  ? -19 LEU B N   1 
ATOM 1536 C CA  . LEU B 2 7   ? 36.624 -49.236 -20.097 1.00 63.60  ? -19 LEU B CA  1 
ATOM 1537 C C   . LEU B 2 7   ? 35.950 -49.765 -18.833 1.00 63.99  ? -19 LEU B C   1 
ATOM 1538 O O   . LEU B 2 7   ? 36.626 -50.287 -17.948 1.00 63.88  ? -19 LEU B O   1 
ATOM 1539 C CB  . LEU B 2 7   ? 36.856 -50.365 -21.097 1.00 63.59  ? -19 LEU B CB  1 
ATOM 1540 C CG  . LEU B 2 7   ? 37.368 -49.997 -22.493 1.00 64.69  ? -19 LEU B CG  1 
ATOM 1541 C CD1 . LEU B 2 7   ? 37.505 -51.247 -23.389 1.00 65.25  ? -19 LEU B CD1 1 
ATOM 1542 C CD2 . LEU B 2 7   ? 36.482 -48.941 -23.165 1.00 64.51  ? -19 LEU B CD2 1 
ATOM 1543 N N   . PHE B 2 8   ? 34.631 -49.585 -18.737 1.00 64.92  ? -18 PHE B N   1 
ATOM 1544 C CA  . PHE B 2 8   ? 33.805 -50.177 -17.661 1.00 65.76  ? -18 PHE B CA  1 
ATOM 1545 C C   . PHE B 2 8   ? 33.762 -51.698 -17.950 1.00 66.89  ? -18 PHE B C   1 
ATOM 1546 O O   . PHE B 2 8   ? 34.161 -52.101 -19.036 1.00 66.87  ? -18 PHE B O   1 
ATOM 1547 C CB  . PHE B 2 8   ? 32.355 -49.601 -17.664 1.00 65.29  ? -18 PHE B CB  1 
ATOM 1548 C CG  . PHE B 2 8   ? 32.211 -48.147 -17.164 1.00 63.23  ? -18 PHE B CG  1 
ATOM 1549 C CD1 . PHE B 2 8   ? 32.088 -47.086 -18.068 1.00 61.66  ? -18 PHE B CD1 1 
ATOM 1550 C CD2 . PHE B 2 8   ? 32.110 -47.857 -15.803 1.00 61.02  ? -18 PHE B CD2 1 
ATOM 1551 C CE1 . PHE B 2 8   ? 31.925 -45.748 -17.622 1.00 61.02  ? -18 PHE B CE1 1 
ATOM 1552 C CE2 . PHE B 2 8   ? 31.941 -46.522 -15.345 1.00 60.75  ? -18 PHE B CE2 1 
ATOM 1553 C CZ  . PHE B 2 8   ? 31.846 -45.466 -16.259 1.00 60.23  ? -18 PHE B CZ  1 
ATOM 1554 N N   . HIS B 2 9   ? 33.272 -52.529 -17.023 1.00 68.68  ? -17 HIS B N   1 
ATOM 1555 C CA  . HIS B 2 9   ? 33.104 -53.982 -17.292 1.00 70.69  ? -17 HIS B CA  1 
ATOM 1556 C C   . HIS B 2 9   ? 31.805 -54.346 -17.958 1.00 71.50  ? -17 HIS B C   1 
ATOM 1557 O O   . HIS B 2 9   ? 30.810 -53.642 -17.828 1.00 71.41  ? -17 HIS B O   1 
ATOM 1558 C CB  . HIS B 2 9   ? 33.229 -54.840 -16.028 1.00 70.97  ? -17 HIS B CB  1 
ATOM 1559 C CG  . HIS B 2 9   ? 34.541 -54.690 -15.341 1.00 73.16  ? -17 HIS B CG  1 
ATOM 1560 N ND1 . HIS B 2 9   ? 34.657 -54.600 -13.970 1.00 74.76  ? -17 HIS B ND1 1 
ATOM 1561 C CD2 . HIS B 2 9   ? 35.793 -54.555 -15.840 1.00 74.57  ? -17 HIS B CD2 1 
ATOM 1562 C CE1 . HIS B 2 9   ? 35.929 -54.440 -13.652 1.00 75.58  ? -17 HIS B CE1 1 
ATOM 1563 N NE2 . HIS B 2 9   ? 36.639 -54.405 -14.768 1.00 76.23  ? -17 HIS B NE2 1 
ATOM 1564 N N   . THR B 2 10  ? 31.822 -55.478 -18.647 1.00 72.99  ? -16 THR B N   1 
ATOM 1565 C CA  . THR B 2 10  ? 30.618 -55.998 -19.257 1.00 75.10  ? -16 THR B CA  1 
ATOM 1566 C C   . THR B 2 10  ? 30.169 -57.259 -18.547 1.00 76.28  ? -16 THR B C   1 
ATOM 1567 O O   . THR B 2 10  ? 30.546 -58.379 -18.901 1.00 76.43  ? -16 THR B O   1 
ATOM 1568 C CB  . THR B 2 10  ? 30.794 -56.263 -20.746 1.00 74.98  ? -16 THR B CB  1 
ATOM 1569 O OG1 . THR B 2 10  ? 31.867 -55.457 -21.240 1.00 76.11  ? -16 THR B OG1 1 
ATOM 1570 C CG2 . THR B 2 10  ? 29.510 -55.916 -21.496 1.00 75.55  ? -16 THR B CG2 1 
ATOM 1571 N N   . ILE B 2 11  ? 29.348 -57.044 -17.536 1.00 78.00  ? -15 ILE B N   1 
ATOM 1572 C CA  . ILE B 2 11  ? 28.775 -58.107 -16.749 1.00 79.79  ? -15 ILE B CA  1 
ATOM 1573 C C   . ILE B 2 11  ? 28.201 -59.235 -17.608 1.00 81.19  ? -15 ILE B C   1 
ATOM 1574 O O   . ILE B 2 11  ? 27.629 -58.988 -18.677 1.00 81.19  ? -15 ILE B O   1 
ATOM 1575 C CB  . ILE B 2 11  ? 27.689 -57.544 -15.810 1.00 79.77  ? -15 ILE B CB  1 
ATOM 1576 C CG1 . ILE B 2 11  ? 28.233 -56.330 -15.033 1.00 78.88  ? -15 ILE B CG1 1 
ATOM 1577 C CG2 . ILE B 2 11  ? 27.170 -58.645 -14.879 1.00 80.27  ? -15 ILE B CG2 1 
ATOM 1578 C CD1 . ILE B 2 11  ? 27.170 -55.402 -14.520 1.00 76.76  ? -15 ILE B CD1 1 
ATOM 1579 N N   . THR B 2 12  ? 28.408 -60.471 -17.141 1.00 83.20  ? -14 THR B N   1 
ATOM 1580 C CA  . THR B 2 12  ? 27.722 -61.656 -17.674 1.00 84.93  ? -14 THR B CA  1 
ATOM 1581 C C   . THR B 2 12  ? 26.294 -61.702 -17.112 1.00 85.84  ? -14 THR B C   1 
ATOM 1582 O O   . THR B 2 12  ? 26.071 -61.555 -15.898 1.00 85.81  ? -14 THR B O   1 
ATOM 1583 C CB  . THR B 2 12  ? 28.465 -62.980 -17.341 1.00 85.02  ? -14 THR B CB  1 
ATOM 1584 O OG1 . THR B 2 12  ? 28.668 -63.079 -15.919 1.00 85.96  ? -14 THR B OG1 1 
ATOM 1585 C CG2 . THR B 2 12  ? 29.812 -63.055 -18.069 1.00 84.99  ? -14 THR B CG2 1 
ATOM 1586 N N   . GLY B 2 13  ? 25.340 -61.911 -18.012 1.00 86.99  ? -13 GLY B N   1 
ATOM 1587 C CA  . GLY B 2 13  ? 23.910 -61.782 -17.721 1.00 88.35  ? -13 GLY B CA  1 
ATOM 1588 C C   . GLY B 2 13  ? 23.238 -61.251 -18.983 1.00 89.40  ? -13 GLY B C   1 
ATOM 1589 O O   . GLY B 2 13  ? 22.026 -61.442 -19.199 1.00 89.43  ? -13 GLY B O   1 
ATOM 1590 N N   . GLY B 2 14  ? 24.039 -60.563 -19.808 1.00 90.11  ? -12 GLY B N   1 
ATOM 1591 C CA  . GLY B 2 14  ? 23.720 -60.342 -21.222 1.00 90.88  ? -12 GLY B CA  1 
ATOM 1592 C C   . GLY B 2 14  ? 23.982 -61.669 -21.908 1.00 91.34  ? -12 GLY B C   1 
ATOM 1593 O O   . GLY B 2 14  ? 23.854 -61.789 -23.134 1.00 91.39  ? -12 GLY B O   1 
ATOM 1594 N N   . SER B 2 15  ? 24.340 -62.654 -21.069 1.00 91.71  ? -11 SER B N   1 
ATOM 1595 C CA  . SER B 2 15  ? 24.693 -64.031 -21.432 1.00 92.10  ? -11 SER B CA  1 
ATOM 1596 C C   . SER B 2 15  ? 23.573 -64.754 -22.189 1.00 92.13  ? -11 SER B C   1 
ATOM 1597 O O   . SER B 2 15  ? 23.792 -65.214 -23.319 1.00 92.29  ? -11 SER B O   1 
ATOM 1598 C CB  . SER B 2 15  ? 25.088 -64.817 -20.165 1.00 92.11  ? -11 SER B CB  1 
ATOM 1599 O OG  . SER B 2 15  ? 25.657 -66.081 -20.479 1.00 92.56  ? -11 SER B OG  1 
ATOM 1600 N N   . SER B 2 26  ? 3.530  -42.865 -15.991 1.00 65.34  ? 3   SER B N   1 
ATOM 1601 C CA  . SER B 2 26  ? 4.675  -42.428 -16.841 1.00 62.95  ? 3   SER B CA  1 
ATOM 1602 C C   . SER B 2 26  ? 5.105  -43.639 -17.679 1.00 63.05  ? 3   SER B C   1 
ATOM 1603 O O   . SER B 2 26  ? 4.968  -44.773 -17.195 1.00 63.59  ? 3   SER B O   1 
ATOM 1604 C CB  . SER B 2 26  ? 5.825  -41.888 -15.967 1.00 60.28  ? 3   SER B CB  1 
ATOM 1605 O OG  . SER B 2 26  ? 6.611  -42.936 -15.396 1.00 58.55  ? 3   SER B OG  1 
ATOM 1606 N N   . PRO B 2 27  ? 5.621  -43.410 -18.931 1.00 62.34  ? 4   PRO B N   1 
ATOM 1607 C CA  . PRO B 2 27  ? 6.060  -44.550 -19.777 1.00 62.44  ? 4   PRO B CA  1 
ATOM 1608 C C   . PRO B 2 27  ? 7.350  -45.279 -19.243 1.00 60.14  ? 4   PRO B C   1 
ATOM 1609 O O   . PRO B 2 27  ? 8.109  -44.735 -18.409 1.00 58.45  ? 4   PRO B O   1 
ATOM 1610 C CB  . PRO B 2 27  ? 6.440  -43.859 -21.176 1.00 62.61  ? 4   PRO B CB  1 
ATOM 1611 C CG  . PRO B 2 27  ? 6.012  -42.385 -21.001 1.00 62.53  ? 4   PRO B CG  1 
ATOM 1612 C CD  . PRO B 2 27  ? 6.008  -42.093 -19.534 1.00 61.61  ? 4   PRO B CD  1 
ATOM 1613 N N   . GLU B 2 28  ? 7.589  -46.497 -19.730 1.00 60.32  ? 5   GLU B N   1 
ATOM 1614 C CA  . GLU B 2 28  ? 8.703  -47.341 -19.266 1.00 58.61  ? 5   GLU B CA  1 
ATOM 1615 C C   . GLU B 2 28  ? 10.084 -46.762 -19.563 1.00 56.10  ? 5   GLU B C   1 
ATOM 1616 O O   . GLU B 2 28  ? 10.380 -46.382 -20.700 1.00 56.32  ? 5   GLU B O   1 
ATOM 1617 C CB  . GLU B 2 28  ? 8.615  -48.732 -19.900 1.00 60.53  ? 5   GLU B CB  1 
ATOM 1618 C CG  . GLU B 2 28  ? 7.851  -49.791 -19.103 1.00 62.17  ? 5   GLU B CG  1 
ATOM 1619 C CD  . GLU B 2 28  ? 8.001  -51.170 -19.731 1.00 64.45  ? 5   GLU B CD  1 
ATOM 1620 O OE1 . GLU B 2 28  ? 9.092  -51.464 -20.288 1.00 61.35  ? 5   GLU B OE1 1 
ATOM 1621 O OE2 . GLU B 2 28  ? 7.022  -51.956 -19.672 1.00 67.65  ? 5   GLU B OE2 1 
ATOM 1622 N N   . ASN B 2 29  ? 10.935 -46.710 -18.544 1.00 53.72  ? 6   ASN B N   1 
ATOM 1623 C CA  . ASN B 2 29  ? 12.300 -46.256 -18.740 1.00 51.01  ? 6   ASN B CA  1 
ATOM 1624 C C   . ASN B 2 29  ? 13.273 -46.959 -17.831 1.00 49.84  ? 6   ASN B C   1 
ATOM 1625 O O   . ASN B 2 29  ? 13.099 -46.980 -16.612 1.00 50.30  ? 6   ASN B O   1 
ATOM 1626 C CB  . ASN B 2 29  ? 12.408 -44.748 -18.519 1.00 50.00  ? 6   ASN B CB  1 
ATOM 1627 C CG  . ASN B 2 29  ? 13.629 -44.146 -19.179 1.00 47.47  ? 6   ASN B CG  1 
ATOM 1628 O OD1 . ASN B 2 29  ? 14.433 -43.480 -18.527 1.00 47.69  ? 6   ASN B OD1 1 
ATOM 1629 N ND2 . ASN B 2 29  ? 13.788 -44.399 -20.466 1.00 45.45  ? 6   ASN B ND2 1 
ATOM 1630 N N   . TYR B 2 30  ? 14.320 -47.507 -18.426 1.00 48.73  ? 7   TYR B N   1 
ATOM 1631 C CA  . TYR B 2 30  ? 15.389 -48.102 -17.661 1.00 47.13  ? 7   TYR B CA  1 
ATOM 1632 C C   . TYR B 2 30  ? 16.691 -47.366 -17.908 1.00 45.15  ? 7   TYR B C   1 
ATOM 1633 O O   . TYR B 2 30  ? 16.939 -46.880 -19.008 1.00 44.88  ? 7   TYR B O   1 
ATOM 1634 C CB  . TYR B 2 30  ? 15.489 -49.590 -18.005 1.00 48.72  ? 7   TYR B CB  1 
ATOM 1635 C CG  . TYR B 2 30  ? 14.152 -50.291 -17.874 1.00 50.36  ? 7   TYR B CG  1 
ATOM 1636 C CD1 . TYR B 2 30  ? 13.400 -50.626 -19.004 1.00 52.32  ? 7   TYR B CD1 1 
ATOM 1637 C CD2 . TYR B 2 30  ? 13.627 -50.595 -16.618 1.00 49.80  ? 7   TYR B CD2 1 
ATOM 1638 C CE1 . TYR B 2 30  ? 12.162 -51.267 -18.878 1.00 53.98  ? 7   TYR B CE1 1 
ATOM 1639 C CE2 . TYR B 2 30  ? 12.409 -51.219 -16.486 1.00 52.66  ? 7   TYR B CE2 1 
ATOM 1640 C CZ  . TYR B 2 30  ? 11.682 -51.557 -17.614 1.00 54.23  ? 7   TYR B CZ  1 
ATOM 1641 O OH  . TYR B 2 30  ? 10.470 -52.176 -17.458 1.00 57.78  ? 7   TYR B OH  1 
ATOM 1642 N N   . LEU B 2 31  ? 17.506 -47.268 -16.865 1.00 44.09  ? 8   LEU B N   1 
ATOM 1643 C CA  . LEU B 2 31  ? 18.727 -46.468 -16.899 1.00 42.53  ? 8   LEU B CA  1 
ATOM 1644 C C   . LEU B 2 31  ? 19.931 -47.173 -16.216 1.00 42.80  ? 8   LEU B C   1 
ATOM 1645 O O   . LEU B 2 31  ? 19.807 -47.770 -15.118 1.00 43.52  ? 8   LEU B O   1 
ATOM 1646 C CB  . LEU B 2 31  ? 18.467 -45.067 -16.316 1.00 40.93  ? 8   LEU B CB  1 
ATOM 1647 C CG  . LEU B 2 31  ? 19.556 -44.023 -16.659 1.00 38.64  ? 8   LEU B CG  1 
ATOM 1648 C CD1 . LEU B 2 31  ? 19.016 -42.660 -16.901 1.00 36.49  ? 8   LEU B CD1 1 
ATOM 1649 C CD2 . LEU B 2 31  ? 20.598 -43.947 -15.611 1.00 33.80  ? 8   LEU B CD2 1 
ATOM 1650 N N   . PHE B 2 32  ? 21.074 -47.132 -16.902 1.00 42.16  ? 9   PHE B N   1 
ATOM 1651 C CA  . PHE B 2 32  ? 22.334 -47.635 -16.359 1.00 42.39  ? 9   PHE B CA  1 
ATOM 1652 C C   . PHE B 2 32  ? 23.380 -46.540 -16.345 1.00 41.18  ? 9   PHE B C   1 
ATOM 1653 O O   . PHE B 2 32  ? 23.580 -45.843 -17.350 1.00 41.00  ? 9   PHE B O   1 
ATOM 1654 C CB  . PHE B 2 32  ? 22.883 -48.847 -17.138 1.00 43.64  ? 9   PHE B CB  1 
ATOM 1655 C CG  . PHE B 2 32  ? 23.925 -49.616 -16.368 1.00 43.51  ? 9   PHE B CG  1 
ATOM 1656 C CD1 . PHE B 2 32  ? 23.555 -50.669 -15.545 1.00 42.46  ? 9   PHE B CD1 1 
ATOM 1657 C CD2 . PHE B 2 32  ? 25.273 -49.234 -16.412 1.00 45.01  ? 9   PHE B CD2 1 
ATOM 1658 C CE1 . PHE B 2 32  ? 24.498 -51.356 -14.801 1.00 45.12  ? 9   PHE B CE1 1 
ATOM 1659 C CE2 . PHE B 2 32  ? 26.253 -49.927 -15.659 1.00 45.23  ? 9   PHE B CE2 1 
ATOM 1660 C CZ  . PHE B 2 32  ? 25.856 -50.988 -14.857 1.00 45.37  ? 9   PHE B CZ  1 
ATOM 1661 N N   . GLN B 2 33  ? 24.032 -46.395 -15.194 1.00 40.91  ? 10  GLN B N   1 
ATOM 1662 C CA  . GLN B 2 33  ? 25.012 -45.334 -14.943 1.00 39.92  ? 10  GLN B CA  1 
ATOM 1663 C C   . GLN B 2 33  ? 26.305 -45.947 -14.484 1.00 40.11  ? 10  GLN B C   1 
ATOM 1664 O O   . GLN B 2 33  ? 26.314 -46.942 -13.779 1.00 40.52  ? 10  GLN B O   1 
ATOM 1665 C CB  . GLN B 2 33  ? 24.575 -44.440 -13.781 1.00 39.68  ? 10  GLN B CB  1 
ATOM 1666 C CG  . GLN B 2 33  ? 23.347 -43.635 -13.967 1.00 39.92  ? 10  GLN B CG  1 
ATOM 1667 C CD  . GLN B 2 33  ? 23.169 -42.621 -12.862 1.00 41.16  ? 10  GLN B CD  1 
ATOM 1668 O OE1 . GLN B 2 33  ? 24.025 -41.749 -12.675 1.00 41.64  ? 10  GLN B OE1 1 
ATOM 1669 N NE2 . GLN B 2 33  ? 22.050 -42.715 -12.126 1.00 40.89  ? 10  GLN B NE2 1 
ATOM 1670 N N   . GLY B 2 34  ? 27.393 -45.282 -14.823 1.00 40.35  ? 11  GLY B N   1 
ATOM 1671 C CA  . GLY B 2 34  ? 28.716 -45.633 -14.363 1.00 41.06  ? 11  GLY B CA  1 
ATOM 1672 C C   . GLY B 2 34  ? 29.448 -44.365 -13.986 1.00 41.09  ? 11  GLY B C   1 
ATOM 1673 O O   . GLY B 2 34  ? 29.123 -43.265 -14.455 1.00 40.57  ? 11  GLY B O   1 
ATOM 1674 N N   . ARG B 2 35  ? 30.445 -44.529 -13.132 1.00 42.41  ? 12  ARG B N   1 
ATOM 1675 C CA  . ARG B 2 35  ? 31.244 -43.442 -12.611 1.00 42.17  ? 12  ARG B CA  1 
ATOM 1676 C C   . ARG B 2 35  ? 32.600 -44.032 -12.514 1.00 43.34  ? 12  ARG B C   1 
ATOM 1677 O O   . ARG B 2 35  ? 32.743 -45.186 -12.126 1.00 45.54  ? 12  ARG B O   1 
ATOM 1678 C CB  . ARG B 2 35  ? 30.758 -43.029 -11.214 1.00 42.01  ? 12  ARG B CB  1 
ATOM 1679 C CG  . ARG B 2 35  ? 29.775 -41.860 -11.186 1.00 40.92  ? 12  ARG B CG  1 
ATOM 1680 C CD  . ARG B 2 35  ? 28.426 -42.222 -11.838 1.00 45.84  ? 12  ARG B CD  1 
ATOM 1681 N NE  . ARG B 2 35  ? 27.396 -41.164 -11.786 1.00 44.79  ? 12  ARG B NE  1 
ATOM 1682 C CZ  . ARG B 2 35  ? 27.597 -39.967 -11.251 1.00 45.27  ? 12  ARG B CZ  1 
ATOM 1683 N NH1 . ARG B 2 35  ? 28.801 -39.644 -10.734 1.00 43.00  ? 12  ARG B NH1 1 
ATOM 1684 N NH2 . ARG B 2 35  ? 26.600 -39.098 -11.234 1.00 44.67  ? 12  ARG B NH2 1 
ATOM 1685 N N   . GLN B 2 36  ? 33.595 -43.260 -12.903 1.00 43.38  ? 13  GLN B N   1 
ATOM 1686 C CA  . GLN B 2 36  ? 34.996 -43.609 -12.709 1.00 44.72  ? 13  GLN B CA  1 
ATOM 1687 C C   . GLN B 2 36  ? 35.673 -42.345 -12.161 1.00 45.04  ? 13  GLN B C   1 
ATOM 1688 O O   . GLN B 2 36  ? 36.061 -41.461 -12.922 1.00 43.72  ? 13  GLN B O   1 
ATOM 1689 C CB  . GLN B 2 36  ? 35.616 -44.032 -14.036 1.00 45.05  ? 13  GLN B CB  1 
ATOM 1690 C CG  . GLN B 2 36  ? 35.077 -45.344 -14.556 1.00 45.46  ? 13  GLN B CG  1 
ATOM 1691 C CD  . GLN B 2 36  ? 35.242 -45.486 -16.048 1.00 44.90  ? 13  GLN B CD  1 
ATOM 1692 O OE1 . GLN B 2 36  ? 35.316 -44.503 -16.745 1.00 45.32  ? 13  GLN B OE1 1 
ATOM 1693 N NE2 . GLN B 2 36  ? 35.271 -46.717 -16.544 1.00 47.04  ? 13  GLN B NE2 1 
ATOM 1694 N N   . GLU B 2 37  ? 35.781 -42.271 -10.834 1.00 46.52  ? 14  GLU B N   1 
ATOM 1695 C CA  . GLU B 2 37  ? 36.098 -41.038 -10.117 1.00 47.21  ? 14  GLU B CA  1 
ATOM 1696 C C   . GLU B 2 37  ? 37.489 -41.093 -9.513  1.00 48.98  ? 14  GLU B C   1 
ATOM 1697 O O   . GLU B 2 37  ? 37.836 -42.076 -8.858  1.00 50.77  ? 14  GLU B O   1 
ATOM 1698 C CB  . GLU B 2 37  ? 35.105 -40.845 -8.970  1.00 47.27  ? 14  GLU B CB  1 
ATOM 1699 C CG  . GLU B 2 37  ? 33.636 -41.118 -9.308  1.00 48.08  ? 14  GLU B CG  1 
ATOM 1700 C CD  . GLU B 2 37  ? 32.779 -41.250 -8.042  1.00 52.08  ? 14  GLU B CD  1 
ATOM 1701 O OE1 . GLU B 2 37  ? 31.546 -41.040 -8.132  1.00 52.44  ? 14  GLU B OE1 1 
ATOM 1702 O OE2 . GLU B 2 37  ? 33.338 -41.561 -6.954  1.00 53.08  ? 14  GLU B OE2 1 
ATOM 1703 N N   . CYS B 2 38  ? 38.279 -40.040 -9.706  1.00 49.08  ? 15  CYS B N   1 
ATOM 1704 C CA  . CYS B 2 38  ? 39.610 -39.969 -9.094  1.00 51.04  ? 15  CYS B CA  1 
ATOM 1705 C C   . CYS B 2 38  ? 39.636 -38.879 -8.006  1.00 51.39  ? 15  CYS B C   1 
ATOM 1706 O O   . CYS B 2 38  ? 39.219 -37.734 -8.240  1.00 50.79  ? 15  CYS B O   1 
ATOM 1707 C CB  . CYS B 2 38  ? 40.714 -39.771 -10.161 1.00 51.34  ? 15  CYS B CB  1 
ATOM 1708 S SG  . CYS B 2 38  ? 40.952 -41.192 -11.371 1.00 51.81  ? 15  CYS B SG  1 
ATOM 1709 N N   . TYR B 2 39  ? 40.072 -39.245 -6.807  1.00 52.79  ? 16  TYR B N   1 
ATOM 1710 C CA  . TYR B 2 39  ? 40.158 -38.283 -5.717  1.00 53.58  ? 16  TYR B CA  1 
ATOM 1711 C C   . TYR B 2 39  ? 41.612 -37.940 -5.468  1.00 56.08  ? 16  TYR B C   1 
ATOM 1712 O O   . TYR B 2 39  ? 42.479 -38.810 -5.552  1.00 57.25  ? 16  TYR B O   1 
ATOM 1713 C CB  . TYR B 2 39  ? 39.520 -38.831 -4.441  1.00 53.99  ? 16  TYR B CB  1 
ATOM 1714 C CG  . TYR B 2 39  ? 38.042 -39.104 -4.553  1.00 51.58  ? 16  TYR B CG  1 
ATOM 1715 C CD1 . TYR B 2 39  ? 37.578 -40.288 -5.127  1.00 51.35  ? 16  TYR B CD1 1 
ATOM 1716 C CD2 . TYR B 2 39  ? 37.100 -38.180 -4.086  1.00 49.71  ? 16  TYR B CD2 1 
ATOM 1717 C CE1 . TYR B 2 39  ? 36.211 -40.542 -5.252  1.00 50.02  ? 16  TYR B CE1 1 
ATOM 1718 C CE2 . TYR B 2 39  ? 35.730 -38.433 -4.197  1.00 48.55  ? 16  TYR B CE2 1 
ATOM 1719 C CZ  . TYR B 2 39  ? 35.305 -39.616 -4.782  1.00 48.65  ? 16  TYR B CZ  1 
ATOM 1720 O OH  . TYR B 2 39  ? 33.975 -39.890 -4.906  1.00 48.08  ? 16  TYR B OH  1 
ATOM 1721 N N   . ALA B 2 40  ? 41.874 -36.672 -5.164  1.00 57.23  ? 17  ALA B N   1 
ATOM 1722 C CA  . ALA B 2 40  ? 43.245 -36.201 -4.991  1.00 60.54  ? 17  ALA B CA  1 
ATOM 1723 C C   . ALA B 2 40  ? 43.468 -35.467 -3.669  1.00 62.88  ? 17  ALA B C   1 
ATOM 1724 O O   . ALA B 2 40  ? 43.365 -34.244 -3.629  1.00 62.50  ? 17  ALA B O   1 
ATOM 1725 C CB  . ALA B 2 40  ? 43.673 -35.336 -6.180  1.00 59.33  ? 17  ALA B CB  1 
ATOM 1726 N N   . PHE B 2 41  ? 43.760 -36.238 -2.609  1.00 66.15  ? 18  PHE B N   1 
ATOM 1727 C CA  . PHE B 2 41  ? 44.147 -35.740 -1.271  1.00 69.46  ? 18  PHE B CA  1 
ATOM 1728 C C   . PHE B 2 41  ? 45.661 -35.451 -1.255  1.00 71.69  ? 18  PHE B C   1 
ATOM 1729 O O   . PHE B 2 41  ? 46.422 -36.147 -1.934  1.00 72.54  ? 18  PHE B O   1 
ATOM 1730 C CB  . PHE B 2 41  ? 43.784 -36.786 -0.187  1.00 71.59  ? 18  PHE B CB  1 
ATOM 1731 C CG  . PHE B 2 41  ? 43.830 -36.262 1.269   1.00 76.11  ? 18  PHE B CG  1 
ATOM 1732 C CD1 . PHE B 2 41  ? 43.642 -34.894 1.576   1.00 77.84  ? 18  PHE B CD1 1 
ATOM 1733 C CD2 . PHE B 2 41  ? 44.001 -37.158 2.336   1.00 80.14  ? 18  PHE B CD2 1 
ATOM 1734 C CE1 . PHE B 2 41  ? 43.672 -34.431 2.912   1.00 80.11  ? 18  PHE B CE1 1 
ATOM 1735 C CE2 . PHE B 2 41  ? 44.029 -36.710 3.683   1.00 83.41  ? 18  PHE B CE2 1 
ATOM 1736 C CZ  . PHE B 2 41  ? 43.864 -35.348 3.969   1.00 83.65  ? 18  PHE B CZ  1 
ATOM 1737 N N   . ASN B 2 42  ? 46.092 -34.452 -0.473  1.00 72.85  ? 19  ASN B N   1 
ATOM 1738 C CA  . ASN B 2 42  ? 47.488 -33.947 -0.514  1.00 74.44  ? 19  ASN B CA  1 
ATOM 1739 C C   . ASN B 2 42  ? 48.484 -34.848 -1.251  1.00 75.59  ? 19  ASN B C   1 
ATOM 1740 O O   . ASN B 2 42  ? 49.116 -35.737 -0.659  1.00 77.89  ? 19  ASN B O   1 
ATOM 1741 C CB  . ASN B 2 42  ? 48.037 -33.429 0.855   1.00 76.89  ? 19  ASN B CB  1 
ATOM 1742 C CG  . ASN B 2 42  ? 47.777 -34.373 2.047   1.00 77.69  ? 19  ASN B CG  1 
ATOM 1743 O OD1 . ASN B 2 42  ? 46.910 -35.249 2.011   1.00 74.97  ? 19  ASN B OD1 1 
ATOM 1744 N ND2 . ASN B 2 42  ? 48.520 -34.149 3.132   1.00 78.92  ? 19  ASN B ND2 1 
ATOM 1745 N N   . GLY B 2 43  ? 48.566 -34.617 -2.564  1.00 73.78  ? 20  GLY B N   1 
ATOM 1746 C CA  . GLY B 2 43  ? 49.539 -35.279 -3.429  1.00 74.40  ? 20  GLY B CA  1 
ATOM 1747 C C   . GLY B 2 43  ? 49.347 -36.772 -3.607  1.00 74.39  ? 20  GLY B C   1 
ATOM 1748 O O   . GLY B 2 43  ? 50.323 -37.492 -3.776  1.00 76.43  ? 20  GLY B O   1 
ATOM 1749 N N   . THR B 2 44  ? 48.098 -37.243 -3.574  1.00 71.95  ? 21  THR B N   1 
ATOM 1750 C CA  . THR B 2 44  ? 47.818 -38.681 -3.717  1.00 71.46  ? 21  THR B CA  1 
ATOM 1751 C C   . THR B 2 44  ? 46.579 -38.969 -4.583  1.00 68.20  ? 21  THR B C   1 
ATOM 1752 O O   . THR B 2 44  ? 45.909 -38.041 -5.050  1.00 66.03  ? 21  THR B O   1 
ATOM 1753 C CB  . THR B 2 44  ? 47.769 -39.404 -2.338  1.00 73.47  ? 21  THR B CB  1 
ATOM 1754 O OG1 . THR B 2 44  ? 48.270 -40.730 -2.492  1.00 74.89  ? 21  THR B OG1 1 
ATOM 1755 C CG2 . THR B 2 44  ? 46.355 -39.451 -1.748  1.00 71.56  ? 21  THR B CG2 1 
ATOM 1756 N N   . GLN B 2 45  ? 46.280 -40.247 -4.807  1.00 67.57  ? 22  GLN B N   1 
ATOM 1757 C CA  . GLN B 2 45  ? 45.257 -40.606 -5.788  1.00 64.39  ? 22  GLN B CA  1 
ATOM 1758 C C   . GLN B 2 45  ? 44.451 -41.824 -5.341  1.00 63.86  ? 22  GLN B C   1 
ATOM 1759 O O   . GLN B 2 45  ? 45.005 -42.889 -5.096  1.00 65.47  ? 22  GLN B O   1 
ATOM 1760 C CB  . GLN B 2 45  ? 45.917 -40.829 -7.165  1.00 64.15  ? 22  GLN B CB  1 
ATOM 1761 C CG  . GLN B 2 45  ? 45.222 -40.164 -8.341  1.00 61.38  ? 22  GLN B CG  1 
ATOM 1762 C CD  . GLN B 2 45  ? 45.198 -38.633 -8.278  1.00 59.68  ? 22  GLN B CD  1 
ATOM 1763 O OE1 . GLN B 2 45  ? 44.126 -38.017 -8.195  1.00 58.18  ? 22  GLN B OE1 1 
ATOM 1764 N NE2 . GLN B 2 45  ? 46.368 -38.019 -8.346  1.00 58.94  ? 22  GLN B NE2 1 
ATOM 1765 N N   . ARG B 2 46  ? 43.139 -41.645 -5.212  1.00 61.64  ? 23  ARG B N   1 
ATOM 1766 C CA  . ARG B 2 46  ? 42.233 -42.739 -4.842  1.00 61.13  ? 23  ARG B CA  1 
ATOM 1767 C C   . ARG B 2 46  ? 41.253 -42.997 -5.979  1.00 58.48  ? 23  ARG B C   1 
ATOM 1768 O O   . ARG B 2 46  ? 40.664 -42.056 -6.504  1.00 56.51  ? 23  ARG B O   1 
ATOM 1769 C CB  . ARG B 2 46  ? 41.476 -42.395 -3.557  1.00 61.00  ? 23  ARG B CB  1 
ATOM 1770 C CG  . ARG B 2 46  ? 40.669 -43.546 -2.981  1.00 61.33  ? 23  ARG B CG  1 
ATOM 1771 C CD  . ARG B 2 46  ? 40.106 -43.168 -1.613  1.00 61.89  ? 23  ARG B CD  1 
ATOM 1772 N NE  . ARG B 2 46  ? 39.185 -44.176 -1.080  1.00 60.96  ? 23  ARG B NE  1 
ATOM 1773 C CZ  . ARG B 2 46  ? 38.166 -43.911 -0.260  1.00 58.41  ? 23  ARG B CZ  1 
ATOM 1774 N NH1 . ARG B 2 46  ? 37.922 -42.671 0.123   1.00 56.14  ? 23  ARG B NH1 1 
ATOM 1775 N NH2 . ARG B 2 46  ? 37.385 -44.889 0.183   1.00 58.22  ? 23  ARG B NH2 1 
ATOM 1776 N N   . PHE B 2 47  ? 41.082 -44.260 -6.363  1.00 58.42  ? 24  PHE B N   1 
ATOM 1777 C CA  . PHE B 2 47  ? 40.143 -44.583 -7.441  1.00 56.58  ? 24  PHE B CA  1 
ATOM 1778 C C   . PHE B 2 47  ? 38.857 -45.274 -6.973  1.00 55.80  ? 24  PHE B C   1 
ATOM 1779 O O   . PHE B 2 47  ? 38.931 -46.263 -6.211  1.00 57.82  ? 24  PHE B O   1 
ATOM 1780 C CB  . PHE B 2 47  ? 40.812 -45.428 -8.538  1.00 57.38  ? 24  PHE B CB  1 
ATOM 1781 C CG  . PHE B 2 47  ? 39.897 -45.719 -9.713  1.00 55.74  ? 24  PHE B CG  1 
ATOM 1782 C CD1 . PHE B 2 47  ? 39.517 -44.700 -10.587 1.00 53.45  ? 24  PHE B CD1 1 
ATOM 1783 C CD2 . PHE B 2 47  ? 39.404 -47.004 -9.932  1.00 56.33  ? 24  PHE B CD2 1 
ATOM 1784 C CE1 . PHE B 2 47  ? 38.668 -44.960 -11.677 1.00 52.15  ? 24  PHE B CE1 1 
ATOM 1785 C CE2 . PHE B 2 47  ? 38.560 -47.272 -11.018 1.00 55.45  ? 24  PHE B CE2 1 
ATOM 1786 C CZ  . PHE B 2 47  ? 38.189 -46.244 -11.889 1.00 52.46  ? 24  PHE B CZ  1 
ATOM 1787 N N   . LEU B 2 48  ? 37.702 -44.764 -7.434  1.00 52.63  ? 25  LEU B N   1 
ATOM 1788 C CA  . LEU B 2 48  ? 36.402 -45.452 -7.286  1.00 51.35  ? 25  LEU B CA  1 
ATOM 1789 C C   . LEU B 2 48  ? 35.728 -45.694 -8.615  1.00 49.62  ? 25  LEU B C   1 
ATOM 1790 O O   . LEU B 2 48  ? 35.497 -44.755 -9.366  1.00 48.59  ? 25  LEU B O   1 
ATOM 1791 C CB  . LEU B 2 48  ? 35.439 -44.677 -6.396  1.00 50.48  ? 25  LEU B CB  1 
ATOM 1792 C CG  . LEU B 2 48  ? 35.639 -44.871 -4.894  1.00 53.38  ? 25  LEU B CG  1 
ATOM 1793 C CD1 . LEU B 2 48  ? 36.572 -43.798 -4.316  1.00 54.83  ? 25  LEU B CD1 1 
ATOM 1794 C CD2 . LEU B 2 48  ? 34.320 -44.868 -4.162  1.00 51.83  ? 25  LEU B CD2 1 
ATOM 1795 N N   . GLU B 2 49  ? 35.415 -46.951 -8.914  1.00 49.78  ? 26  GLU B N   1 
ATOM 1796 C CA  . GLU B 2 49  ? 34.616 -47.275 -10.093 1.00 48.61  ? 26  GLU B CA  1 
ATOM 1797 C C   . GLU B 2 49  ? 33.235 -47.723 -9.647  1.00 48.09  ? 26  GLU B C   1 
ATOM 1798 O O   . GLU B 2 49  ? 33.111 -48.667 -8.873  1.00 49.66  ? 26  GLU B O   1 
ATOM 1799 C CB  . GLU B 2 49  ? 35.271 -48.364 -10.940 1.00 49.40  ? 26  GLU B CB  1 
ATOM 1800 C CG  . GLU B 2 49  ? 34.651 -48.430 -12.334 1.00 49.82  ? 26  GLU B CG  1 
ATOM 1801 C CD  . GLU B 2 49  ? 35.219 -49.519 -13.241 1.00 52.32  ? 26  GLU B CD  1 
ATOM 1802 O OE1 . GLU B 2 49  ? 35.075 -50.726 -12.937 1.00 51.46  ? 26  GLU B OE1 1 
ATOM 1803 O OE2 . GLU B 2 49  ? 35.788 -49.154 -14.291 1.00 53.38  ? 26  GLU B OE2 1 
ATOM 1804 N N   . ARG B 2 50  ? 32.193 -47.052 -10.112 1.00 46.16  ? 27  ARG B N   1 
ATOM 1805 C CA  . ARG B 2 50  ? 30.845 -47.376 -9.608  1.00 46.08  ? 27  ARG B CA  1 
ATOM 1806 C C   . ARG B 2 50  ? 29.886 -47.829 -10.715 1.00 45.59  ? 27  ARG B C   1 
ATOM 1807 O O   . ARG B 2 50  ? 29.918 -47.318 -11.830 1.00 44.41  ? 27  ARG B O   1 
ATOM 1808 C CB  . ARG B 2 50  ? 30.278 -46.211 -8.773  1.00 44.75  ? 27  ARG B CB  1 
ATOM 1809 C CG  . ARG B 2 50  ? 31.407 -45.379 -8.104  1.00 44.56  ? 27  ARG B CG  1 
ATOM 1810 C CD  . ARG B 2 50  ? 30.933 -44.111 -7.429  1.00 39.69  ? 27  ARG B CD  1 
ATOM 1811 N NE  . ARG B 2 50  ? 30.467 -44.461 -6.103  1.00 40.66  ? 27  ARG B NE  1 
ATOM 1812 C CZ  . ARG B 2 50  ? 30.864 -43.884 -4.979  1.00 41.13  ? 27  ARG B CZ  1 
ATOM 1813 N NH1 . ARG B 2 50  ? 31.726 -42.875 -5.002  1.00 37.22  ? 27  ARG B NH1 1 
ATOM 1814 N NH2 . ARG B 2 50  ? 30.370 -44.320 -3.822  1.00 45.51  ? 27  ARG B NH2 1 
ATOM 1815 N N   . TYR B 2 51  ? 29.065 -48.825 -10.406 1.00 46.60  ? 28  TYR B N   1 
ATOM 1816 C CA  . TYR B 2 51  ? 28.101 -49.342 -11.373 1.00 46.90  ? 28  TYR B CA  1 
ATOM 1817 C C   . TYR B 2 51  ? 26.688 -49.213 -10.797 1.00 46.70  ? 28  TYR B C   1 
ATOM 1818 O O   . TYR B 2 51  ? 26.380 -49.858 -9.792  1.00 47.67  ? 28  TYR B O   1 
ATOM 1819 C CB  . TYR B 2 51  ? 28.414 -50.811 -11.715 1.00 48.89  ? 28  TYR B CB  1 
ATOM 1820 C CG  . TYR B 2 51  ? 29.708 -51.007 -12.468 1.00 48.91  ? 28  TYR B CG  1 
ATOM 1821 C CD1 . TYR B 2 51  ? 30.917 -51.061 -11.791 1.00 50.62  ? 28  TYR B CD1 1 
ATOM 1822 C CD2 . TYR B 2 51  ? 29.724 -51.135 -13.845 1.00 49.08  ? 28  TYR B CD2 1 
ATOM 1823 C CE1 . TYR B 2 51  ? 32.104 -51.229 -12.455 1.00 50.41  ? 28  TYR B CE1 1 
ATOM 1824 C CE2 . TYR B 2 51  ? 30.915 -51.314 -14.527 1.00 49.85  ? 28  TYR B CE2 1 
ATOM 1825 C CZ  . TYR B 2 51  ? 32.102 -51.356 -13.817 1.00 50.51  ? 28  TYR B CZ  1 
ATOM 1826 O OH  . TYR B 2 51  ? 33.306 -51.509 -14.454 1.00 53.11  ? 28  TYR B OH  1 
ATOM 1827 N N   . ILE B 2 52  ? 25.853 -48.388 -11.446 1.00 45.21  ? 29  ILE B N   1 
ATOM 1828 C CA  . ILE B 2 52  ? 24.552 -47.942 -10.918 1.00 44.33  ? 29  ILE B CA  1 
ATOM 1829 C C   . ILE B 2 52  ? 23.399 -48.224 -11.880 1.00 44.78  ? 29  ILE B C   1 
ATOM 1830 O O   . ILE B 2 52  ? 23.457 -47.853 -13.076 1.00 43.75  ? 29  ILE B O   1 
ATOM 1831 C CB  . ILE B 2 52  ? 24.536 -46.400 -10.674 1.00 42.90  ? 29  ILE B CB  1 
ATOM 1832 C CG1 . ILE B 2 52  ? 25.651 -45.951 -9.740  1.00 41.56  ? 29  ILE B CG1 1 
ATOM 1833 C CG2 . ILE B 2 52  ? 23.204 -45.929 -10.156 1.00 43.23  ? 29  ILE B CG2 1 
ATOM 1834 C CD1 . ILE B 2 52  ? 26.703 -45.191 -10.456 1.00 38.98  ? 29  ILE B CD1 1 
ATOM 1835 N N   . TYR B 2 53  ? 22.336 -48.824 -11.336 1.00 45.49  ? 30  TYR B N   1 
ATOM 1836 C CA  . TYR B 2 53  ? 21.101 -49.093 -12.067 1.00 45.98  ? 30  TYR B CA  1 
ATOM 1837 C C   . TYR B 2 53  ? 19.949 -48.252 -11.555 1.00 45.63  ? 30  TYR B C   1 
ATOM 1838 O O   . TYR B 2 53  ? 19.555 -48.403 -10.398 1.00 45.91  ? 30  TYR B O   1 
ATOM 1839 C CB  . TYR B 2 53  ? 20.745 -50.556 -11.918 1.00 47.94  ? 30  TYR B CB  1 
ATOM 1840 C CG  . TYR B 2 53  ? 19.416 -50.906 -12.530 1.00 50.76  ? 30  TYR B CG  1 
ATOM 1841 C CD1 . TYR B 2 53  ? 19.250 -50.894 -13.919 1.00 51.75  ? 30  TYR B CD1 1 
ATOM 1842 C CD2 . TYR B 2 53  ? 18.307 -51.239 -11.724 1.00 52.86  ? 30  TYR B CD2 1 
ATOM 1843 C CE1 . TYR B 2 53  ? 18.024 -51.212 -14.496 1.00 54.42  ? 30  TYR B CE1 1 
ATOM 1844 C CE2 . TYR B 2 53  ? 17.069 -51.562 -12.298 1.00 54.29  ? 30  TYR B CE2 1 
ATOM 1845 C CZ  . TYR B 2 53  ? 16.942 -51.545 -13.686 1.00 54.85  ? 30  TYR B CZ  1 
ATOM 1846 O OH  . TYR B 2 53  ? 15.751 -51.858 -14.286 1.00 57.71  ? 30  TYR B OH  1 
ATOM 1847 N N   . ASN B 2 54  ? 19.380 -47.409 -12.423 1.00 45.55  ? 31  ASN B N   1 
ATOM 1848 C CA  . ASN B 2 54  ? 18.454 -46.347 -12.004 1.00 45.71  ? 31  ASN B CA  1 
ATOM 1849 C C   . ASN B 2 54  ? 18.805 -45.826 -10.629 1.00 45.83  ? 31  ASN B C   1 
ATOM 1850 O O   . ASN B 2 54  ? 18.189 -46.307 -9.678  1.00 48.27  ? 31  ASN B O   1 
ATOM 1851 C CB  . ASN B 2 54  ? 17.037 -46.885 -11.748 1.00 46.47  ? 31  ASN B CB  1 
ATOM 1852 C CG  . ASN B 2 54  ? 16.423 -47.570 -12.902 1.00 47.88  ? 31  ASN B CG  1 
ATOM 1853 O OD1 . ASN B 2 54  ? 16.431 -47.069 -14.018 1.00 49.91  ? 31  ASN B OD1 1 
ATOM 1854 N ND2 . ASN B 2 54  ? 15.800 -48.711 -12.631 1.00 49.01  ? 31  ASN B ND2 1 
ATOM 1855 N N   . ARG B 2 55  ? 19.734 -44.902 -10.430 1.00 44.36  ? 32  ARG B N   1 
ATOM 1856 C CA  . ARG B 2 55  ? 19.840 -44.323 -9.042  1.00 44.57  ? 32  ARG B CA  1 
ATOM 1857 C C   . ARG B 2 55  ? 20.313 -45.243 -7.901  1.00 45.59  ? 32  ARG B C   1 
ATOM 1858 O O   . ARG B 2 55  ? 20.432 -44.794 -6.750  1.00 45.82  ? 32  ARG B O   1 
ATOM 1859 C CB  . ARG B 2 55  ? 18.489 -43.768 -8.574  1.00 44.19  ? 32  ARG B CB  1 
ATOM 1860 C CG  . ARG B 2 55  ? 18.220 -42.391 -8.989  1.00 44.68  ? 32  ARG B CG  1 
ATOM 1861 C CD  . ARG B 2 55  ? 18.677 -41.433 -7.946  1.00 45.33  ? 32  ARG B CD  1 
ATOM 1862 N NE  . ARG B 2 55  ? 17.530 -40.818 -7.285  1.00 45.67  ? 32  ARG B NE  1 
ATOM 1863 C CZ  . ARG B 2 55  ? 17.625 -40.027 -6.224  1.00 43.65  ? 32  ARG B CZ  1 
ATOM 1864 N NH1 . ARG B 2 55  ? 18.802 -39.760 -5.686  1.00 39.11  ? 32  ARG B NH1 1 
ATOM 1865 N NH2 . ARG B 2 55  ? 16.534 -39.507 -5.705  1.00 45.10  ? 32  ARG B NH2 1 
ATOM 1866 N N   . GLU B 2 56  ? 20.535 -46.521 -8.209  1.00 46.43  ? 33  GLU B N   1 
ATOM 1867 C CA  . GLU B 2 56  ? 20.908 -47.507 -7.213  1.00 47.42  ? 33  GLU B CA  1 
ATOM 1868 C C   . GLU B 2 56  ? 22.307 -48.059 -7.465  1.00 46.79  ? 33  GLU B C   1 
ATOM 1869 O O   . GLU B 2 56  ? 22.485 -48.934 -8.301  1.00 46.97  ? 33  GLU B O   1 
ATOM 1870 C CB  . GLU B 2 56  ? 19.895 -48.656 -7.204  1.00 48.84  ? 33  GLU B CB  1 
ATOM 1871 C CG  . GLU B 2 56  ? 20.063 -49.559 -5.990  1.00 52.52  ? 33  GLU B CG  1 
ATOM 1872 C CD  . GLU B 2 56  ? 19.287 -50.867 -6.070  1.00 56.48  ? 33  GLU B CD  1 
ATOM 1873 O OE1 . GLU B 2 56  ? 18.142 -50.882 -6.593  1.00 57.92  ? 33  GLU B OE1 1 
ATOM 1874 O OE2 . GLU B 2 56  ? 19.829 -51.881 -5.581  1.00 56.70  ? 33  GLU B OE2 1 
ATOM 1875 N N   . GLU B 2 57  ? 23.302 -47.558 -6.736  1.00 46.24  ? 34  GLU B N   1 
ATOM 1876 C CA  . GLU B 2 57  ? 24.634 -48.151 -6.790  1.00 45.78  ? 34  GLU B CA  1 
ATOM 1877 C C   . GLU B 2 57  ? 24.544 -49.541 -6.196  1.00 47.16  ? 34  GLU B C   1 
ATOM 1878 O O   . GLU B 2 57  ? 24.113 -49.709 -5.034  1.00 48.22  ? 34  GLU B O   1 
ATOM 1879 C CB  . GLU B 2 57  ? 25.630 -47.304 -6.023  1.00 45.70  ? 34  GLU B CB  1 
ATOM 1880 C CG  . GLU B 2 57  ? 27.100 -47.580 -6.391  1.00 47.26  ? 34  GLU B CG  1 
ATOM 1881 C CD  . GLU B 2 57  ? 28.101 -46.925 -5.426  1.00 48.70  ? 34  GLU B CD  1 
ATOM 1882 O OE1 . GLU B 2 57  ? 29.266 -47.368 -5.403  1.00 48.96  ? 34  GLU B OE1 1 
ATOM 1883 O OE2 . GLU B 2 57  ? 27.728 -45.972 -4.692  1.00 48.59  ? 34  GLU B OE2 1 
ATOM 1884 N N   . PHE B 2 58  ? 24.904 -50.542 -6.996  1.00 46.81  ? 35  PHE B N   1 
ATOM 1885 C CA  . PHE B 2 58  ? 24.767 -51.931 -6.561  1.00 48.48  ? 35  PHE B CA  1 
ATOM 1886 C C   . PHE B 2 58  ? 26.098 -52.648 -6.415  1.00 50.21  ? 35  PHE B C   1 
ATOM 1887 O O   . PHE B 2 58  ? 26.193 -53.648 -5.689  1.00 52.04  ? 35  PHE B O   1 
ATOM 1888 C CB  . PHE B 2 58  ? 23.822 -52.706 -7.481  1.00 48.32  ? 35  PHE B CB  1 
ATOM 1889 C CG  . PHE B 2 58  ? 24.231 -52.696 -8.919  1.00 45.21  ? 35  PHE B CG  1 
ATOM 1890 C CD1 . PHE B 2 58  ? 25.063 -53.682 -9.425  1.00 43.87  ? 35  PHE B CD1 1 
ATOM 1891 C CD2 . PHE B 2 58  ? 23.768 -51.711 -9.776  1.00 43.57  ? 35  PHE B CD2 1 
ATOM 1892 C CE1 . PHE B 2 58  ? 25.442 -53.678 -10.757 1.00 43.22  ? 35  PHE B CE1 1 
ATOM 1893 C CE2 . PHE B 2 58  ? 24.149 -51.693 -11.126 1.00 41.75  ? 35  PHE B CE2 1 
ATOM 1894 C CZ  . PHE B 2 58  ? 24.992 -52.674 -11.610 1.00 41.42  ? 35  PHE B CZ  1 
ATOM 1895 N N   . VAL B 2 59  ? 27.110 -52.148 -7.129  1.00 49.71  ? 36  VAL B N   1 
ATOM 1896 C CA  . VAL B 2 59  ? 28.500 -52.563 -6.942  1.00 51.34  ? 36  VAL B CA  1 
ATOM 1897 C C   . VAL B 2 59  ? 29.516 -51.431 -7.226  1.00 51.09  ? 36  VAL B C   1 
ATOM 1898 O O   . VAL B 2 59  ? 29.226 -50.481 -7.975  1.00 49.52  ? 36  VAL B O   1 
ATOM 1899 C CB  . VAL B 2 59  ? 28.846 -53.872 -7.713  1.00 52.29  ? 36  VAL B CB  1 
ATOM 1900 C CG1 . VAL B 2 59  ? 29.083 -53.612 -9.189  1.00 50.68  ? 36  VAL B CG1 1 
ATOM 1901 C CG2 . VAL B 2 59  ? 30.057 -54.547 -7.097  1.00 53.73  ? 36  VAL B CG2 1 
ATOM 1902 N N   . ARG B 2 60  ? 30.713 -51.575 -6.638  1.00 53.20  ? 37  ARG B N   1 
ATOM 1903 C CA  . ARG B 2 60  ? 31.743 -50.535 -6.609  1.00 53.01  ? 37  ARG B CA  1 
ATOM 1904 C C   . ARG B 2 60  ? 33.111 -51.125 -6.390  1.00 54.86  ? 37  ARG B C   1 
ATOM 1905 O O   . ARG B 2 60  ? 33.283 -51.972 -5.532  1.00 56.94  ? 37  ARG B O   1 
ATOM 1906 C CB  . ARG B 2 60  ? 31.447 -49.584 -5.449  1.00 52.96  ? 37  ARG B CB  1 
ATOM 1907 C CG  . ARG B 2 60  ? 32.634 -48.823 -4.877  1.00 53.06  ? 37  ARG B CG  1 
ATOM 1908 C CD  . ARG B 2 60  ? 32.356 -48.380 -3.439  1.00 54.50  ? 37  ARG B CD  1 
ATOM 1909 N NE  . ARG B 2 60  ? 30.947 -48.083 -3.225  1.00 55.25  ? 37  ARG B NE  1 
ATOM 1910 C CZ  . ARG B 2 60  ? 30.427 -47.528 -2.136  1.00 57.49  ? 37  ARG B CZ  1 
ATOM 1911 N NH1 . ARG B 2 60  ? 31.192 -47.181 -1.109  1.00 58.88  ? 37  ARG B NH1 1 
ATOM 1912 N NH2 . ARG B 2 60  ? 29.112 -47.328 -2.074  1.00 57.51  ? 37  ARG B NH2 1 
ATOM 1913 N N   . PHE B 2 61  ? 34.091 -50.661 -7.152  1.00 55.27  ? 38  PHE B N   1 
ATOM 1914 C CA  . PHE B 2 61  ? 35.492 -50.910 -6.819  1.00 57.55  ? 38  PHE B CA  1 
ATOM 1915 C C   . PHE B 2 61  ? 36.146 -49.681 -6.171  1.00 57.68  ? 38  PHE B C   1 
ATOM 1916 O O   . PHE B 2 61  ? 36.337 -48.674 -6.830  1.00 56.70  ? 38  PHE B O   1 
ATOM 1917 C CB  . PHE B 2 61  ? 36.299 -51.308 -8.052  1.00 57.61  ? 38  PHE B CB  1 
ATOM 1918 C CG  . PHE B 2 61  ? 37.737 -51.565 -7.746  1.00 60.23  ? 38  PHE B CG  1 
ATOM 1919 C CD1 . PHE B 2 61  ? 38.216 -52.860 -7.656  1.00 63.71  ? 38  PHE B CD1 1 
ATOM 1920 C CD2 . PHE B 2 61  ? 38.607 -50.508 -7.492  1.00 60.99  ? 38  PHE B CD2 1 
ATOM 1921 C CE1 . PHE B 2 61  ? 39.554 -53.105 -7.336  1.00 66.42  ? 38  PHE B CE1 1 
ATOM 1922 C CE2 . PHE B 2 61  ? 39.931 -50.732 -7.168  1.00 63.89  ? 38  PHE B CE2 1 
ATOM 1923 C CZ  . PHE B 2 61  ? 40.411 -52.040 -7.090  1.00 66.85  ? 38  PHE B CZ  1 
ATOM 1924 N N   . ASP B 2 62  ? 36.494 -49.769 -4.892  1.00 59.93  ? 39  ASP B N   1 
ATOM 1925 C CA  . ASP B 2 62  ? 37.265 -48.725 -4.209  1.00 60.58  ? 39  ASP B CA  1 
ATOM 1926 C C   . ASP B 2 62  ? 38.692 -49.214 -4.039  1.00 62.75  ? 39  ASP B C   1 
ATOM 1927 O O   . ASP B 2 62  ? 38.911 -50.302 -3.512  1.00 64.65  ? 39  ASP B O   1 
ATOM 1928 C CB  . ASP B 2 62  ? 36.662 -48.424 -2.828  1.00 61.69  ? 39  ASP B CB  1 
ATOM 1929 C CG  . ASP B 2 62  ? 37.339 -47.242 -2.115  1.00 61.87  ? 39  ASP B CG  1 
ATOM 1930 O OD1 . ASP B 2 62  ? 38.578 -47.101 -2.172  1.00 61.79  ? 39  ASP B OD1 1 
ATOM 1931 O OD2 . ASP B 2 62  ? 36.608 -46.447 -1.482  1.00 61.99  ? 39  ASP B OD2 1 
ATOM 1932 N N   . SER B 2 63  ? 39.652 -48.393 -4.466  1.00 62.65  ? 40  SER B N   1 
ATOM 1933 C CA  . SER B 2 63  ? 41.067 -48.767 -4.440  1.00 64.72  ? 40  SER B CA  1 
ATOM 1934 C C   . SER B 2 63  ? 41.683 -48.842 -3.044  1.00 67.20  ? 40  SER B C   1 
ATOM 1935 O O   . SER B 2 63  ? 42.663 -49.573 -2.872  1.00 69.74  ? 40  SER B O   1 
ATOM 1936 C CB  . SER B 2 63  ? 41.901 -47.844 -5.319  1.00 63.70  ? 40  SER B CB  1 
ATOM 1937 O OG  . SER B 2 63  ? 42.371 -46.748 -4.560  1.00 64.18  ? 40  SER B OG  1 
ATOM 1938 N N   . ASP B 2 64  ? 41.145 -48.083 -2.079  1.00 66.77  ? 41  ASP B N   1 
ATOM 1939 C CA  . ASP B 2 64  ? 41.498 -48.242 -0.646  1.00 69.77  ? 41  ASP B CA  1 
ATOM 1940 C C   . ASP B 2 64  ? 41.160 -49.672 -0.199  1.00 71.65  ? 41  ASP B C   1 
ATOM 1941 O O   . ASP B 2 64  ? 42.035 -50.432 0.243   1.00 74.30  ? 41  ASP B O   1 
ATOM 1942 C CB  . ASP B 2 64  ? 40.754 -47.240 0.258   1.00 68.97  ? 41  ASP B CB  1 
ATOM 1943 C CG  . ASP B 2 64  ? 41.499 -45.902 0.446   1.00 70.13  ? 41  ASP B CG  1 
ATOM 1944 O OD1 . ASP B 2 64  ? 41.212 -45.244 1.471   1.00 70.43  ? 41  ASP B OD1 1 
ATOM 1945 O OD2 . ASP B 2 64  ? 42.342 -45.486 -0.400  1.00 71.77  ? 41  ASP B OD2 1 
ATOM 1946 N N   . VAL B 2 65  ? 39.880 -50.013 -0.330  1.00 70.18  ? 42  VAL B N   1 
ATOM 1947 C CA  . VAL B 2 65  ? 39.372 -51.371 -0.168  1.00 71.55  ? 42  VAL B CA  1 
ATOM 1948 C C   . VAL B 2 65  ? 40.213 -52.383 -0.952  1.00 73.01  ? 42  VAL B C   1 
ATOM 1949 O O   . VAL B 2 65  ? 40.627 -53.393 -0.398  1.00 76.07  ? 42  VAL B O   1 
ATOM 1950 C CB  . VAL B 2 65  ? 37.866 -51.464 -0.604  1.00 69.43  ? 42  VAL B CB  1 
ATOM 1951 C CG1 . VAL B 2 65  ? 37.354 -52.900 -0.518  1.00 70.52  ? 42  VAL B CG1 1 
ATOM 1952 C CG2 . VAL B 2 65  ? 36.992 -50.524 0.230   1.00 67.57  ? 42  VAL B CG2 1 
ATOM 1953 N N   . GLY B 2 66  ? 40.463 -52.119 -2.230  1.00 71.52  ? 43  GLY B N   1 
ATOM 1954 C CA  . GLY B 2 66  ? 41.336 -52.987 -3.035  1.00 73.56  ? 43  GLY B CA  1 
ATOM 1955 C C   . GLY B 2 66  ? 40.690 -54.038 -3.939  1.00 73.51  ? 43  GLY B C   1 
ATOM 1956 O O   . GLY B 2 66  ? 41.377 -54.671 -4.757  1.00 74.02  ? 43  GLY B O   1 
ATOM 1957 N N   . GLU B 2 67  ? 39.377 -54.231 -3.789  1.00 72.83  ? 44  GLU B N   1 
ATOM 1958 C CA  . GLU B 2 67  ? 38.597 -55.191 -4.595  1.00 72.71  ? 44  GLU B CA  1 
ATOM 1959 C C   . GLU B 2 67  ? 37.125 -54.784 -4.644  1.00 70.43  ? 44  GLU B C   1 
ATOM 1960 O O   . GLU B 2 67  ? 36.747 -53.746 -4.086  1.00 69.38  ? 44  GLU B O   1 
ATOM 1961 C CB  . GLU B 2 67  ? 38.750 -56.623 -4.062  1.00 75.86  ? 44  GLU B CB  1 
ATOM 1962 C CG  . GLU B 2 67  ? 38.878 -56.728 -2.536  1.00 79.30  ? 44  GLU B CG  1 
ATOM 1963 C CD  . GLU B 2 67  ? 38.664 -58.142 -2.006  1.00 83.80  ? 44  GLU B CD  1 
ATOM 1964 O OE1 . GLU B 2 67  ? 37.491 -58.581 -1.958  1.00 83.99  ? 44  GLU B OE1 1 
ATOM 1965 O OE2 . GLU B 2 67  ? 39.660 -58.799 -1.615  1.00 86.48  ? 44  GLU B OE2 1 
ATOM 1966 N N   . PHE B 2 68  ? 36.292 -55.588 -5.305  1.00 70.11  ? 45  PHE B N   1 
ATOM 1967 C CA  . PHE B 2 68  ? 34.878 -55.214 -5.499  1.00 68.15  ? 45  PHE B CA  1 
ATOM 1968 C C   . PHE B 2 68  ? 34.039 -55.386 -4.259  1.00 68.87  ? 45  PHE B C   1 
ATOM 1969 O O   . PHE B 2 68  ? 34.212 -56.351 -3.515  1.00 71.54  ? 45  PHE B O   1 
ATOM 1970 C CB  . PHE B 2 68  ? 34.261 -55.961 -6.672  1.00 67.40  ? 45  PHE B CB  1 
ATOM 1971 C CG  . PHE B 2 68  ? 34.764 -55.484 -8.000  1.00 66.57  ? 45  PHE B CG  1 
ATOM 1972 C CD1 . PHE B 2 68  ? 34.249 -54.321 -8.578  1.00 63.79  ? 45  PHE B CD1 1 
ATOM 1973 C CD2 . PHE B 2 68  ? 35.780 -56.166 -8.660  1.00 67.52  ? 45  PHE B CD2 1 
ATOM 1974 C CE1 . PHE B 2 68  ? 34.714 -53.860 -9.801  1.00 61.94  ? 45  PHE B CE1 1 
ATOM 1975 C CE2 . PHE B 2 68  ? 36.260 -55.706 -9.891  1.00 66.74  ? 45  PHE B CE2 1 
ATOM 1976 C CZ  . PHE B 2 68  ? 35.722 -54.549 -10.458 1.00 64.45  ? 45  PHE B CZ  1 
ATOM 1977 N N   . ARG B 2 69  ? 33.158 -54.423 -4.025  1.00 66.81  ? 46  ARG B N   1 
ATOM 1978 C CA  . ARG B 2 69  ? 32.224 -54.493 -2.917  1.00 67.75  ? 46  ARG B CA  1 
ATOM 1979 C C   . ARG B 2 69  ? 30.813 -54.293 -3.442  1.00 66.43  ? 46  ARG B C   1 
ATOM 1980 O O   . ARG B 2 69  ? 30.471 -53.224 -3.991  1.00 64.50  ? 46  ARG B O   1 
ATOM 1981 C CB  . ARG B 2 69  ? 32.539 -53.456 -1.835  1.00 67.74  ? 46  ARG B CB  1 
ATOM 1982 C CG  . ARG B 2 69  ? 33.816 -53.713 -1.051  1.00 70.70  ? 46  ARG B CG  1 
ATOM 1983 C CD  . ARG B 2 69  ? 33.610 -54.585 0.171   1.00 74.34  ? 46  ARG B CD  1 
ATOM 1984 N NE  . ARG B 2 69  ? 34.902 -54.915 0.792   1.00 77.98  ? 46  ARG B NE  1 
ATOM 1985 C CZ  . ARG B 2 69  ? 35.728 -55.903 0.380   1.00 80.93  ? 46  ARG B CZ  1 
ATOM 1986 N NH1 . ARG B 2 69  ? 35.391 -56.669 -0.652  1.00 81.44  ? 46  ARG B NH1 1 
ATOM 1987 N NH2 . ARG B 2 69  ? 36.892 -56.136 1.001   1.00 83.10  ? 46  ARG B NH2 1 
ATOM 1988 N N   . ALA B 2 70  ? 30.006 -55.341 -3.292  1.00 67.35  ? 47  ALA B N   1 
ATOM 1989 C CA  . ALA B 2 70  ? 28.602 -55.288 -3.631  1.00 66.01  ? 47  ALA B CA  1 
ATOM 1990 C C   . ALA B 2 70  ? 27.996 -54.325 -2.645  1.00 65.45  ? 47  ALA B C   1 
ATOM 1991 O O   . ALA B 2 70  ? 28.122 -54.529 -1.447  1.00 67.41  ? 47  ALA B O   1 
ATOM 1992 C CB  . ALA B 2 70  ? 27.980 -56.662 -3.473  1.00 67.49  ? 47  ALA B CB  1 
ATOM 1993 N N   . VAL B 2 71  ? 27.374 -53.264 -3.140  1.00 63.19  ? 48  VAL B N   1 
ATOM 1994 C CA  . VAL B 2 71  ? 26.701 -52.306 -2.274  1.00 62.79  ? 48  VAL B CA  1 
ATOM 1995 C C   . VAL B 2 71  ? 25.290 -52.788 -1.973  1.00 63.67  ? 48  VAL B C   1 
ATOM 1996 O O   . VAL B 2 71  ? 24.728 -52.463 -0.934  1.00 64.29  ? 48  VAL B O   1 
ATOM 1997 C CB  . VAL B 2 71  ? 26.643 -50.913 -2.913  1.00 60.46  ? 48  VAL B CB  1 
ATOM 1998 C CG1 . VAL B 2 71  ? 26.282 -49.849 -1.878  1.00 60.17  ? 48  VAL B CG1 1 
ATOM 1999 C CG2 . VAL B 2 71  ? 27.976 -50.574 -3.551  1.00 60.40  ? 48  VAL B CG2 1 
ATOM 2000 N N   . THR B 2 72  ? 24.740 -53.579 -2.891  1.00 64.24  ? 49  THR B N   1 
ATOM 2001 C CA  . THR B 2 72  ? 23.370 -54.099 -2.815  1.00 65.44  ? 49  THR B CA  1 
ATOM 2002 C C   . THR B 2 72  ? 23.393 -55.583 -3.123  1.00 67.04  ? 49  THR B C   1 
ATOM 2003 O O   . THR B 2 72  ? 24.322 -56.062 -3.762  1.00 66.89  ? 49  THR B O   1 
ATOM 2004 C CB  . THR B 2 72  ? 22.454 -53.380 -3.856  1.00 63.92  ? 49  THR B CB  1 
ATOM 2005 O OG1 . THR B 2 72  ? 22.031 -52.119 -3.333  1.00 63.32  ? 49  THR B OG1 1 
ATOM 2006 C CG2 . THR B 2 72  ? 21.200 -54.197 -4.178  1.00 65.99  ? 49  THR B CG2 1 
ATOM 2007 N N   . GLU B 2 73  ? 22.362 -56.310 -2.701  1.00 69.04  ? 50  GLU B N   1 
ATOM 2008 C CA  . GLU B 2 73  ? 22.272 -57.739 -3.021  1.00 71.25  ? 50  GLU B CA  1 
ATOM 2009 C C   . GLU B 2 73  ? 22.289 -58.064 -4.522  1.00 70.11  ? 50  GLU B C   1 
ATOM 2010 O O   . GLU B 2 73  ? 22.581 -59.203 -4.906  1.00 71.90  ? 50  GLU B O   1 
ATOM 2011 C CB  . GLU B 2 73  ? 21.077 -58.389 -2.325  1.00 73.38  ? 50  GLU B CB  1 
ATOM 2012 C CG  . GLU B 2 73  ? 21.465 -59.284 -1.131  1.00 77.33  ? 50  GLU B CG  1 
ATOM 2013 C CD  . GLU B 2 73  ? 21.980 -60.662 -1.562  1.00 81.00  ? 50  GLU B CD  1 
ATOM 2014 O OE1 . GLU B 2 73  ? 21.303 -61.327 -2.380  1.00 81.90  ? 50  GLU B OE1 1 
ATOM 2015 O OE2 . GLU B 2 73  ? 23.057 -61.088 -1.079  1.00 82.70  ? 50  GLU B OE2 1 
ATOM 2016 N N   . LEU B 2 74  ? 21.984 -57.068 -5.351  1.00 67.53  ? 51  LEU B N   1 
ATOM 2017 C CA  . LEU B 2 74  ? 22.161 -57.150 -6.802  1.00 66.43  ? 51  LEU B CA  1 
ATOM 2018 C C   . LEU B 2 74  ? 23.632 -57.181 -7.198  1.00 66.21  ? 51  LEU B C   1 
ATOM 2019 O O   . LEU B 2 74  ? 23.969 -57.396 -8.359  1.00 65.21  ? 51  LEU B O   1 
ATOM 2020 C CB  . LEU B 2 74  ? 21.549 -55.923 -7.480  1.00 64.33  ? 51  LEU B CB  1 
ATOM 2021 C CG  . LEU B 2 74  ? 20.146 -55.874 -8.063  1.00 63.14  ? 51  LEU B CG  1 
ATOM 2022 C CD1 . LEU B 2 74  ? 20.091 -54.585 -8.843  1.00 60.65  ? 51  LEU B CD1 1 
ATOM 2023 C CD2 . LEU B 2 74  ? 19.836 -57.047 -8.965  1.00 61.69  ? 51  LEU B CD2 1 
ATOM 2024 N N   . GLY B 2 75  ? 24.504 -56.919 -6.237  1.00 67.02  ? 52  GLY B N   1 
ATOM 2025 C CA  . GLY B 2 75  ? 25.931 -56.884 -6.503  1.00 67.72  ? 52  GLY B CA  1 
ATOM 2026 C C   . GLY B 2 75  ? 26.610 -58.227 -6.318  1.00 70.36  ? 52  GLY B C   1 
ATOM 2027 O O   . GLY B 2 75  ? 27.641 -58.477 -6.938  1.00 70.51  ? 52  GLY B O   1 
ATOM 2028 N N   . ARG B 2 76  ? 26.037 -59.083 -5.469  1.00 72.58  ? 53  ARG B N   1 
ATOM 2029 C CA  . ARG B 2 76  ? 26.578 -60.421 -5.207  1.00 75.67  ? 53  ARG B CA  1 
ATOM 2030 C C   . ARG B 2 76  ? 27.112 -61.157 -6.456  1.00 76.19  ? 53  ARG B C   1 
ATOM 2031 O O   . ARG B 2 76  ? 28.265 -61.572 -6.448  1.00 77.32  ? 53  ARG B O   1 
ATOM 2032 C CB  . ARG B 2 76  ? 25.566 -61.277 -4.429  1.00 77.72  ? 53  ARG B CB  1 
ATOM 2033 C CG  . ARG B 2 76  ? 25.759 -62.799 -4.557  1.00 81.05  ? 53  ARG B CG  1 
ATOM 2034 C CD  . ARG B 2 76  ? 26.306 -63.448 -3.291  1.00 84.60  ? 53  ARG B CD  1 
ATOM 2035 N NE  . ARG B 2 76  ? 25.419 -63.227 -2.129  1.00 86.94  ? 53  ARG B NE  1 
ATOM 2036 C CZ  . ARG B 2 76  ? 25.736 -62.482 -1.066  1.00 87.09  ? 53  ARG B CZ  1 
ATOM 2037 N NH1 . ARG B 2 76  ? 26.932 -61.887 -1.000  1.00 86.78  ? 53  ARG B NH1 1 
ATOM 2038 N NH2 . ARG B 2 76  ? 24.871 -62.384 -0.059  1.00 88.17  ? 53  ARG B NH2 1 
ATOM 2039 N N   . PRO B 2 77  ? 26.295 -61.305 -7.534  1.00 75.85  ? 54  PRO B N   1 
ATOM 2040 C CA  . PRO B 2 77  ? 26.802 -62.020 -8.721  1.00 76.23  ? 54  PRO B CA  1 
ATOM 2041 C C   . PRO B 2 77  ? 28.033 -61.399 -9.364  1.00 75.05  ? 54  PRO B C   1 
ATOM 2042 O O   . PRO B 2 77  ? 28.719 -62.055 -10.156 1.00 76.04  ? 54  PRO B O   1 
ATOM 2043 C CB  . PRO B 2 77  ? 25.624 -61.963 -9.696  1.00 75.46  ? 54  PRO B CB  1 
ATOM 2044 C CG  . PRO B 2 77  ? 24.429 -61.898 -8.809  1.00 76.20  ? 54  PRO B CG  1 
ATOM 2045 C CD  . PRO B 2 77  ? 24.860 -60.982 -7.688  1.00 75.26  ? 54  PRO B CD  1 
ATOM 2046 N N   . ASP B 2 78  ? 28.322 -60.154 -9.011  1.00 73.24  ? 55  ASP B N   1 
ATOM 2047 C CA  . ASP B 2 78  ? 29.470 -59.447 -9.571  1.00 71.98  ? 55  ASP B CA  1 
ATOM 2048 C C   . ASP B 2 78  ? 30.703 -59.487 -8.671  1.00 73.43  ? 55  ASP B C   1 
ATOM 2049 O O   . ASP B 2 78  ? 31.792 -59.833 -9.124  1.00 73.95  ? 55  ASP B O   1 
ATOM 2050 C CB  . ASP B 2 78  ? 29.081 -58.012 -9.921  1.00 69.22  ? 55  ASP B CB  1 
ATOM 2051 C CG  . ASP B 2 78  ? 28.012 -57.954 -10.985 1.00 67.44  ? 55  ASP B CG  1 
ATOM 2052 O OD1 . ASP B 2 78  ? 27.009 -57.242 -10.800 1.00 64.17  ? 55  ASP B OD1 1 
ATOM 2053 O OD2 . ASP B 2 78  ? 28.166 -58.656 -12.001 1.00 67.73  ? 55  ASP B OD2 1 
ATOM 2054 N N   . GLU B 2 79  ? 30.529 -59.141 -7.398  1.00 74.43  ? 56  GLU B N   1 
ATOM 2055 C CA  . GLU B 2 79  ? 31.625 -59.174 -6.449  1.00 76.61  ? 56  GLU B CA  1 
ATOM 2056 C C   . GLU B 2 79  ? 32.217 -60.571 -6.383  1.00 80.24  ? 56  GLU B C   1 
ATOM 2057 O O   . GLU B 2 79  ? 33.432 -60.729 -6.370  1.00 81.31  ? 56  GLU B O   1 
ATOM 2058 C CB  . GLU B 2 79  ? 31.176 -58.738 -5.062  1.00 76.68  ? 56  GLU B CB  1 
ATOM 2059 C CG  . GLU B 2 79  ? 32.332 -58.636 -4.104  1.00 77.75  ? 56  GLU B CG  1 
ATOM 2060 C CD  . GLU B 2 79  ? 31.906 -58.562 -2.669  1.00 79.36  ? 56  GLU B CD  1 
ATOM 2061 O OE1 . GLU B 2 79  ? 31.121 -57.663 -2.329  1.00 79.53  ? 56  GLU B OE1 1 
ATOM 2062 O OE2 . GLU B 2 79  ? 32.367 -59.399 -1.867  1.00 82.50  ? 56  GLU B OE2 1 
ATOM 2063 N N   . GLU B 2 80  ? 31.354 -61.582 -6.361  1.00 82.64  ? 57  GLU B N   1 
ATOM 2064 C CA  . GLU B 2 80  ? 31.818 -62.962 -6.335  1.00 86.59  ? 57  GLU B CA  1 
ATOM 2065 C C   . GLU B 2 80  ? 32.528 -63.394 -7.623  1.00 87.21  ? 57  GLU B C   1 
ATOM 2066 O O   . GLU B 2 80  ? 33.564 -64.050 -7.546  1.00 89.51  ? 57  GLU B O   1 
ATOM 2067 C CB  . GLU B 2 80  ? 30.694 -63.931 -5.961  1.00 88.04  ? 57  GLU B CB  1 
ATOM 2068 C CG  . GLU B 2 80  ? 29.616 -64.127 -7.022  1.00 88.78  ? 57  GLU B CG  1 
ATOM 2069 C CD  . GLU B 2 80  ? 28.523 -65.109 -6.581  1.00 93.27  ? 57  GLU B CD  1 
ATOM 2070 O OE1 . GLU B 2 80  ? 28.129 -65.089 -5.389  1.00 95.16  ? 57  GLU B OE1 1 
ATOM 2071 O OE2 . GLU B 2 80  ? 28.052 -65.904 -7.429  1.00 94.34  ? 57  GLU B OE2 1 
ATOM 2072 N N   . TYR B 2 81  ? 31.998 -63.024 -8.790  1.00 86.14  ? 58  TYR B N   1 
ATOM 2073 C CA  . TYR B 2 81  ? 32.597 -63.458 -10.058 1.00 87.20  ? 58  TYR B CA  1 
ATOM 2074 C C   . TYR B 2 81  ? 33.922 -62.787 -10.305 1.00 87.13  ? 58  TYR B C   1 
ATOM 2075 O O   . TYR B 2 81  ? 34.899 -63.426 -10.699 1.00 88.64  ? 58  TYR B O   1 
ATOM 2076 C CB  . TYR B 2 81  ? 31.699 -63.160 -11.266 1.00 85.63  ? 58  TYR B CB  1 
ATOM 2077 C CG  . TYR B 2 81  ? 32.293 -63.633 -12.603 1.00 86.63  ? 58  TYR B CG  1 
ATOM 2078 C CD1 . TYR B 2 81  ? 32.018 -64.920 -13.100 1.00 89.01  ? 58  TYR B CD1 1 
ATOM 2079 C CD2 . TYR B 2 81  ? 33.127 -62.803 -13.364 1.00 85.11  ? 58  TYR B CD2 1 
ATOM 2080 C CE1 . TYR B 2 81  ? 32.551 -65.360 -14.328 1.00 89.31  ? 58  TYR B CE1 1 
ATOM 2081 C CE2 . TYR B 2 81  ? 33.669 -63.236 -14.593 1.00 85.74  ? 58  TYR B CE2 1 
ATOM 2082 C CZ  . TYR B 2 81  ? 33.373 -64.512 -15.068 1.00 88.05  ? 58  TYR B CZ  1 
ATOM 2083 O OH  . TYR B 2 81  ? 33.897 -64.947 -16.269 1.00 87.69  ? 58  TYR B OH  1 
ATOM 2084 N N   . TRP B 2 82  ? 33.934 -61.480 -10.097 1.00 85.82  ? 59  TRP B N   1 
ATOM 2085 C CA  . TRP B 2 82  ? 35.041 -60.665 -10.548 1.00 85.58  ? 59  TRP B CA  1 
ATOM 2086 C C   . TRP B 2 82  ? 36.263 -60.789 -9.625  1.00 87.13  ? 59  TRP B C   1 
ATOM 2087 O O   . TRP B 2 82  ? 37.409 -60.692 -10.082 1.00 87.66  ? 59  TRP B O   1 
ATOM 2088 C CB  . TRP B 2 82  ? 34.576 -59.216 -10.782 1.00 83.40  ? 59  TRP B CB  1 
ATOM 2089 C CG  . TRP B 2 82  ? 34.100 -58.933 -12.227 1.00 84.16  ? 59  TRP B CG  1 
ATOM 2090 C CD1 . TRP B 2 82  ? 34.857 -58.419 -13.258 1.00 85.48  ? 59  TRP B CD1 1 
ATOM 2091 C CD2 . TRP B 2 82  ? 32.789 -59.152 -12.779 1.00 85.02  ? 59  TRP B CD2 1 
ATOM 2092 N NE1 . TRP B 2 82  ? 34.098 -58.309 -14.402 1.00 85.08  ? 59  TRP B NE1 1 
ATOM 2093 C CE2 . TRP B 2 82  ? 32.830 -58.752 -14.138 1.00 84.49  ? 59  TRP B CE2 1 
ATOM 2094 C CE3 . TRP B 2 82  ? 31.591 -59.660 -12.264 1.00 87.96  ? 59  TRP B CE3 1 
ATOM 2095 C CZ2 . TRP B 2 82  ? 31.721 -58.831 -14.978 1.00 84.82  ? 59  TRP B CZ2 1 
ATOM 2096 C CZ3 . TRP B 2 82  ? 30.476 -59.745 -13.111 1.00 88.25  ? 59  TRP B CZ3 1 
ATOM 2097 C CH2 . TRP B 2 82  ? 30.556 -59.329 -14.448 1.00 86.93  ? 59  TRP B CH2 1 
ATOM 2098 N N   . ASN B 2 83  ? 36.018 -61.053 -8.342  1.00 88.11  ? 60  ASN B N   1 
ATOM 2099 C CA  . ASN B 2 83  ? 37.106 -61.270 -7.378  1.00 90.10  ? 60  ASN B CA  1 
ATOM 2100 C C   . ASN B 2 83  ? 37.821 -62.631 -7.510  1.00 92.92  ? 60  ASN B C   1 
ATOM 2101 O O   . ASN B 2 83  ? 38.739 -62.945 -6.751  1.00 95.13  ? 60  ASN B O   1 
ATOM 2102 C CB  . ASN B 2 83  ? 36.627 -61.003 -5.943  1.00 90.55  ? 60  ASN B CB  1 
ATOM 2103 C CG  . ASN B 2 83  ? 36.410 -59.521 -5.664  1.00 87.99  ? 60  ASN B CG  1 
ATOM 2104 O OD1 . ASN B 2 83  ? 37.062 -58.659 -6.253  1.00 87.35  ? 60  ASN B OD1 1 
ATOM 2105 N ND2 . ASN B 2 83  ? 35.494 -59.220 -4.759  1.00 87.68  ? 60  ASN B ND2 1 
ATOM 2106 N N   . SER B 2 84  ? 37.380 -63.427 -8.477  1.00 92.97  ? 61  SER B N   1 
ATOM 2107 C CA  . SER B 2 84  ? 38.134 -64.575 -8.961  1.00 95.44  ? 61  SER B CA  1 
ATOM 2108 C C   . SER B 2 84  ? 38.331 -64.337 -10.456 1.00 94.13  ? 61  SER B C   1 
ATOM 2109 O O   . SER B 2 84  ? 37.555 -64.821 -11.293 1.00 93.51  ? 61  SER B O   1 
ATOM 2110 C CB  . SER B 2 84  ? 37.371 -65.869 -8.706  1.00 97.16  ? 61  SER B CB  1 
ATOM 2111 O OG  . SER B 2 84  ? 36.030 -65.746 -9.147  1.00 95.41  ? 61  SER B OG  1 
ATOM 2112 N N   . GLN B 2 85  ? 39.367 -63.566 -10.775 1.00 93.68  ? 62  GLN B N   1 
ATOM 2113 C CA  . GLN B 2 85  ? 39.523 -62.972 -12.101 1.00 92.24  ? 62  GLN B CA  1 
ATOM 2114 C C   . GLN B 2 85  ? 40.720 -62.008 -12.093 1.00 92.21  ? 62  GLN B C   1 
ATOM 2115 O O   . GLN B 2 85  ? 40.841 -61.134 -12.956 1.00 90.10  ? 62  GLN B O   1 
ATOM 2116 C CB  . GLN B 2 85  ? 38.235 -62.222 -12.472 1.00 89.20  ? 62  GLN B CB  1 
ATOM 2117 C CG  . GLN B 2 85  ? 38.101 -61.800 -13.923 1.00 87.46  ? 62  GLN B CG  1 
ATOM 2118 C CD  . GLN B 2 85  ? 37.978 -62.963 -14.876 1.00 88.17  ? 62  GLN B CD  1 
ATOM 2119 O OE1 . GLN B 2 85  ? 37.902 -64.121 -14.459 1.00 89.58  ? 62  GLN B OE1 1 
ATOM 2120 N NE2 . GLN B 2 85  ? 37.956 -62.659 -16.172 1.00 86.61  ? 62  GLN B NE2 1 
ATOM 2121 N N   . LYS B 2 86  ? 41.610 -62.224 -11.120 1.00 94.59  ? 63  LYS B N   1 
ATOM 2122 C CA  . LYS B 2 86  ? 42.735 -61.334 -10.770 1.00 94.98  ? 63  LYS B CA  1 
ATOM 2123 C C   . LYS B 2 86  ? 43.347 -60.435 -11.866 1.00 93.25  ? 63  LYS B C   1 
ATOM 2124 O O   . LYS B 2 86  ? 43.842 -59.351 -11.550 1.00 92.21  ? 63  LYS B O   1 
ATOM 2125 C CB  . LYS B 2 86  ? 43.834 -62.124 -10.030 1.00 98.57  ? 63  LYS B CB  1 
ATOM 2126 C CG  . LYS B 2 86  ? 44.623 -63.116 -10.894 1.00 102.48 ? 63  LYS B CG  1 
ATOM 2127 C CD  . LYS B 2 86  ? 43.843 -64.412 -11.226 1.00 104.99 ? 63  LYS B CD  1 
ATOM 2128 C CE  . LYS B 2 86  ? 44.241 -64.959 -12.613 1.00 106.17 ? 63  LYS B CE  1 
ATOM 2129 N NZ  . LYS B 2 86  ? 43.975 -63.974 -13.735 1.00 103.24 ? 63  LYS B NZ  1 
ATOM 2130 N N   . ASP B 2 87  ? 43.317 -60.877 -13.129 1.00 92.92  ? 64  ASP B N   1 
ATOM 2131 C CA  . ASP B 2 87  ? 43.841 -60.079 -14.262 1.00 91.43  ? 64  ASP B CA  1 
ATOM 2132 C C   . ASP B 2 87  ? 43.054 -58.790 -14.469 1.00 88.05  ? 64  ASP B C   1 
ATOM 2133 O O   . ASP B 2 87  ? 43.610 -57.771 -14.887 1.00 87.07  ? 64  ASP B O   1 
ATOM 2134 C CB  . ASP B 2 87  ? 43.872 -60.891 -15.567 1.00 92.33  ? 64  ASP B CB  1 
ATOM 2135 C CG  . ASP B 2 87  ? 42.546 -60.861 -16.317 1.00 89.86  ? 64  ASP B CG  1 
ATOM 2136 O OD1 . ASP B 2 87  ? 41.562 -61.488 -15.852 1.00 89.89  ? 64  ASP B OD1 1 
ATOM 2137 O OD2 . ASP B 2 87  ? 42.498 -60.208 -17.379 1.00 88.23  ? 64  ASP B OD2 1 
ATOM 2138 N N   . ILE B 2 88  ? 41.754 -58.871 -14.182 1.00 86.28  ? 65  ILE B N   1 
ATOM 2139 C CA  . ILE B 2 88  ? 40.847 -57.730 -14.160 1.00 82.94  ? 65  ILE B CA  1 
ATOM 2140 C C   . ILE B 2 88  ? 41.002 -56.948 -12.854 1.00 82.30  ? 65  ILE B C   1 
ATOM 2141 O O   . ILE B 2 88  ? 41.027 -55.718 -12.863 1.00 80.37  ? 65  ILE B O   1 
ATOM 2142 C CB  . ILE B 2 88  ? 39.372 -58.187 -14.421 1.00 81.85  ? 65  ILE B CB  1 
ATOM 2143 C CG1 . ILE B 2 88  ? 38.923 -57.752 -15.820 1.00 80.51  ? 65  ILE B CG1 1 
ATOM 2144 C CG2 . ILE B 2 88  ? 38.403 -57.636 -13.388 1.00 79.77  ? 65  ILE B CG2 1 
ATOM 2145 C CD1 . ILE B 2 88  ? 39.688 -58.412 -16.955 1.00 82.01  ? 65  ILE B CD1 1 
ATOM 2146 N N   . LEU B 2 89  ? 41.137 -57.673 -11.744 1.00 83.72  ? 66  LEU B N   1 
ATOM 2147 C CA  . LEU B 2 89  ? 41.280 -57.071 -10.420 1.00 83.45  ? 66  LEU B CA  1 
ATOM 2148 C C   . LEU B 2 89  ? 42.591 -56.302 -10.274 1.00 84.03  ? 66  LEU B C   1 
ATOM 2149 O O   . LEU B 2 89  ? 42.744 -55.500 -9.357  1.00 83.66  ? 66  LEU B O   1 
ATOM 2150 C CB  . LEU B 2 89  ? 41.172 -58.144 -9.331  1.00 85.51  ? 66  LEU B CB  1 
ATOM 2151 C CG  . LEU B 2 89  ? 41.163 -57.678 -7.876  1.00 85.17  ? 66  LEU B CG  1 
ATOM 2152 C CD1 . LEU B 2 89  ? 39.763 -57.332 -7.461  1.00 82.02  ? 66  LEU B CD1 1 
ATOM 2153 C CD2 . LEU B 2 89  ? 41.748 -58.745 -6.967  1.00 87.34  ? 66  LEU B CD2 1 
ATOM 2154 N N   . GLU B 2 90  ? 43.543 -56.553 -11.164 1.00 85.25  ? 67  GLU B N   1 
ATOM 2155 C CA  . GLU B 2 90  ? 44.819 -55.851 -11.081 1.00 86.42  ? 67  GLU B CA  1 
ATOM 2156 C C   . GLU B 2 90  ? 44.733 -54.569 -11.874 1.00 83.70  ? 67  GLU B C   1 
ATOM 2157 O O   . GLU B 2 90  ? 45.273 -53.546 -11.456 1.00 83.76  ? 67  GLU B O   1 
ATOM 2158 C CB  . GLU B 2 90  ? 46.031 -56.731 -11.467 1.00 89.53  ? 67  GLU B CB  1 
ATOM 2159 C CG  . GLU B 2 90  ? 45.991 -57.420 -12.837 1.00 90.99  ? 67  GLU B CG  1 
ATOM 2160 C CD  . GLU B 2 90  ? 47.169 -58.384 -13.070 1.00 96.34  ? 67  GLU B CD  1 
ATOM 2161 O OE1 . GLU B 2 90  ? 48.318 -58.060 -12.679 1.00 98.90  ? 67  GLU B OE1 1 
ATOM 2162 O OE2 . GLU B 2 90  ? 46.953 -59.467 -13.664 1.00 97.46  ? 67  GLU B OE2 1 
ATOM 2163 N N   . GLU B 2 91  ? 44.002 -54.618 -12.988 1.00 81.76  ? 68  GLU B N   1 
ATOM 2164 C CA  . GLU B 2 91  ? 43.767 -53.430 -13.827 1.00 78.85  ? 68  GLU B CA  1 
ATOM 2165 C C   . GLU B 2 91  ? 43.085 -52.320 -13.065 1.00 76.07  ? 68  GLU B C   1 
ATOM 2166 O O   . GLU B 2 91  ? 43.388 -51.153 -13.271 1.00 75.65  ? 68  GLU B O   1 
ATOM 2167 C CB  . GLU B 2 91  ? 42.928 -53.749 -15.062 1.00 77.78  ? 68  GLU B CB  1 
ATOM 2168 C CG  . GLU B 2 91  ? 43.187 -52.765 -16.201 1.00 77.75  ? 68  GLU B CG  1 
ATOM 2169 C CD  . GLU B 2 91  ? 41.953 -52.459 -17.012 1.00 76.59  ? 68  GLU B CD  1 
ATOM 2170 O OE1 . GLU B 2 91  ? 41.819 -51.302 -17.452 1.00 75.80  ? 68  GLU B OE1 1 
ATOM 2171 O OE2 . GLU B 2 91  ? 41.112 -53.363 -17.195 1.00 77.30  ? 68  GLU B OE2 1 
ATOM 2172 N N   . GLU B 2 92  ? 42.146 -52.685 -12.205 1.00 74.87  ? 69  GLU B N   1 
ATOM 2173 C CA  . GLU B 2 92  ? 41.510 -51.738 -11.302 1.00 72.26  ? 69  GLU B CA  1 
ATOM 2174 C C   . GLU B 2 92  ? 42.497 -51.281 -10.232 1.00 72.87  ? 69  GLU B C   1 
ATOM 2175 O O   . GLU B 2 92  ? 42.451 -50.126 -9.820  1.00 71.64  ? 69  GLU B O   1 
ATOM 2176 C CB  . GLU B 2 92  ? 40.290 -52.365 -10.646 1.00 72.02  ? 69  GLU B CB  1 
ATOM 2177 C CG  . GLU B 2 92  ? 39.232 -52.871 -11.631 1.00 71.80  ? 69  GLU B CG  1 
ATOM 2178 C CD  . GLU B 2 92  ? 38.276 -51.796 -12.120 1.00 68.38  ? 69  GLU B CD  1 
ATOM 2179 O OE1 . GLU B 2 92  ? 37.986 -51.781 -13.334 1.00 67.89  ? 69  GLU B OE1 1 
ATOM 2180 O OE2 . GLU B 2 92  ? 37.816 -50.980 -11.298 1.00 67.42  ? 69  GLU B OE2 1 
ATOM 2181 N N   . ARG B 2 93  ? 43.399 -52.173 -9.804  1.00 74.35  ? 70  ARG B N   1 
ATOM 2182 C CA  . ARG B 2 93  ? 44.428 -51.832 -8.796  1.00 75.33  ? 70  ARG B CA  1 
ATOM 2183 C C   . ARG B 2 93  ? 45.508 -50.816 -9.235  1.00 74.65  ? 70  ARG B C   1 
ATOM 2184 O O   . ARG B 2 93  ? 45.983 -50.005 -8.410  1.00 74.96  ? 70  ARG B O   1 
ATOM 2185 C CB  . ARG B 2 93  ? 45.096 -53.088 -8.242  1.00 78.37  ? 70  ARG B CB  1 
ATOM 2186 C CG  . ARG B 2 93  ? 44.384 -53.708 -7.048  1.00 79.39  ? 70  ARG B CG  1 
ATOM 2187 C CD  . ARG B 2 93  ? 45.388 -54.468 -6.189  1.00 83.54  ? 70  ARG B CD  1 
ATOM 2188 N NE  . ARG B 2 93  ? 44.747 -55.391 -5.251  1.00 86.64  ? 70  ARG B NE  1 
ATOM 2189 C CZ  . ARG B 2 93  ? 44.457 -56.665 -5.522  1.00 88.54  ? 70  ARG B CZ  1 
ATOM 2190 N NH1 . ARG B 2 93  ? 44.742 -57.180 -6.715  1.00 88.95  ? 70  ARG B NH1 1 
ATOM 2191 N NH2 . ARG B 2 93  ? 43.874 -57.431 -4.601  1.00 89.41  ? 70  ARG B NH2 1 
ATOM 2192 N N   . ALA B 2 94  ? 45.842 -50.850 -10.529 1.00 73.35  ? 71  ALA B N   1 
ATOM 2193 C CA  . ALA B 2 94  ? 46.837 -49.942 -11.136 1.00 72.80  ? 71  ALA B CA  1 
ATOM 2194 C C   . ALA B 2 94  ? 46.349 -48.525 -11.518 1.00 69.96  ? 71  ALA B C   1 
ATOM 2195 O O   . ALA B 2 94  ? 47.163 -47.608 -11.636 1.00 70.23  ? 71  ALA B O   1 
ATOM 2196 C CB  . ALA B 2 94  ? 47.461 -50.609 -12.343 1.00 73.74  ? 71  ALA B CB  1 
ATOM 2197 N N   . VAL B 2 95  ? 45.040 -48.353 -11.717 1.00 67.06  ? 72  VAL B N   1 
ATOM 2198 C CA  . VAL B 2 95  ? 44.472 -47.058 -12.111 1.00 64.58  ? 72  VAL B CA  1 
ATOM 2199 C C   . VAL B 2 95  ? 45.018 -45.832 -11.336 1.00 64.32  ? 72  VAL B C   1 
ATOM 2200 O O   . VAL B 2 95  ? 45.326 -44.815 -11.994 1.00 63.59  ? 72  VAL B O   1 
ATOM 2201 C CB  . VAL B 2 95  ? 42.895 -47.052 -12.081 1.00 62.49  ? 72  VAL B CB  1 
ATOM 2202 C CG1 . VAL B 2 95  ? 42.349 -45.714 -12.578 1.00 59.86  ? 72  VAL B CG1 1 
ATOM 2203 C CG2 . VAL B 2 95  ? 42.326 -48.204 -12.897 1.00 61.95  ? 72  VAL B CG2 1 
ATOM 2204 N N   . PRO B 2 96  ? 45.132 -45.917 -9.951  1.00 65.10  ? 73  PRO B N   1 
ATOM 2205 C CA  . PRO B 2 96  ? 45.385 -44.675 -9.196  1.00 64.82  ? 73  PRO B CA  1 
ATOM 2206 C C   . PRO B 2 96  ? 46.691 -44.023 -9.609  1.00 65.78  ? 73  PRO B C   1 
ATOM 2207 O O   . PRO B 2 96  ? 46.872 -42.814 -9.450  1.00 65.29  ? 73  PRO B O   1 
ATOM 2208 C CB  . PRO B 2 96  ? 45.475 -45.200 -7.736  1.00 66.43  ? 73  PRO B CB  1 
ATOM 2209 C CG  . PRO B 2 96  ? 44.536 -46.374 -7.678  1.00 66.60  ? 73  PRO B CG  1 
ATOM 2210 C CD  . PRO B 2 96  ? 44.754 -47.058 -9.021  1.00 66.16  ? 73  PRO B CD  1 
ATOM 2211 N N   . ASP B 2 97  ? 47.575 -44.840 -10.165 1.00 67.35  ? 74  ASP B N   1 
ATOM 2212 C CA  . ASP B 2 97  ? 48.901 -44.406 -10.526 1.00 69.09  ? 74  ASP B CA  1 
ATOM 2213 C C   . ASP B 2 97  ? 49.143 -44.471 -12.029 1.00 68.34  ? 74  ASP B C   1 
ATOM 2214 O O   . ASP B 2 97  ? 50.249 -44.208 -12.496 1.00 69.97  ? 74  ASP B O   1 
ATOM 2215 C CB  . ASP B 2 97  ? 49.933 -45.220 -9.748  1.00 72.62  ? 74  ASP B CB  1 
ATOM 2216 C CG  . ASP B 2 97  ? 49.818 -44.991 -8.236  1.00 75.05  ? 74  ASP B CG  1 
ATOM 2217 O OD1 . ASP B 2 97  ? 49.444 -43.864 -7.821  1.00 75.05  ? 74  ASP B OD1 1 
ATOM 2218 O OD2 . ASP B 2 97  ? 50.091 -45.935 -7.462  1.00 79.17  ? 74  ASP B OD2 1 
ATOM 2219 N N   . ARG B 2 98  ? 48.109 -44.828 -12.784 1.00 65.84  ? 75  ARG B N   1 
ATOM 2220 C CA  . ARG B 2 98  ? 48.103 -44.585 -14.229 1.00 64.29  ? 75  ARG B CA  1 
ATOM 2221 C C   . ARG B 2 98  ? 47.084 -43.471 -14.538 1.00 60.56  ? 75  ARG B C   1 
ATOM 2222 O O   . ARG B 2 98  ? 47.407 -42.292 -14.376 1.00 59.76  ? 75  ARG B O   1 
ATOM 2223 C CB  . ARG B 2 98  ? 47.820 -45.867 -15.020 1.00 64.84  ? 75  ARG B CB  1 
ATOM 2224 C CG  . ARG B 2 98  ? 48.846 -46.980 -14.819 1.00 70.24  ? 75  ARG B CG  1 
ATOM 2225 C CD  . ARG B 2 98  ? 49.682 -47.231 -16.094 1.00 76.55  ? 75  ARG B CD  1 
ATOM 2226 N NE  . ARG B 2 98  ? 50.357 -48.540 -16.091 1.00 82.05  ? 75  ARG B NE  1 
ATOM 2227 C CZ  . ARG B 2 98  ? 49.735 -49.723 -16.208 1.00 84.22  ? 75  ARG B CZ  1 
ATOM 2228 N NH1 . ARG B 2 98  ? 48.404 -49.796 -16.319 1.00 81.57  ? 75  ARG B NH1 1 
ATOM 2229 N NH2 . ARG B 2 98  ? 50.437 -50.851 -16.206 1.00 86.11  ? 75  ARG B NH2 1 
ATOM 2230 N N   . MET B 2 99  ? 45.864 -43.842 -14.932 1.00 57.36  ? 76  MET B N   1 
ATOM 2231 C CA  . MET B 2 99  ? 44.893 -42.877 -15.445 1.00 54.32  ? 76  MET B CA  1 
ATOM 2232 C C   . MET B 2 99  ? 44.716 -41.695 -14.512 1.00 53.28  ? 76  MET B C   1 
ATOM 2233 O O   . MET B 2 99  ? 44.812 -40.558 -14.949 1.00 52.19  ? 76  MET B O   1 
ATOM 2234 C CB  . MET B 2 99  ? 43.547 -43.548 -15.722 1.00 52.92  ? 76  MET B CB  1 
ATOM 2235 C CG  . MET B 2 99  ? 42.461 -42.655 -16.296 1.00 49.82  ? 76  MET B CG  1 
ATOM 2236 S SD  . MET B 2 99  ? 40.896 -43.551 -16.540 1.00 49.72  ? 76  MET B SD  1 
ATOM 2237 C CE  . MET B 2 99  ? 40.166 -43.448 -14.895 1.00 44.77  ? 76  MET B CE  1 
ATOM 2238 N N   . CYS B 2 100 ? 44.476 -41.961 -13.229 1.00 53.76  ? 77  CYS B N   1 
ATOM 2239 C CA  . CYS B 2 100 ? 44.187 -40.888 -12.270 1.00 53.08  ? 77  CYS B CA  1 
ATOM 2240 C C   . CYS B 2 100 ? 45.309 -39.885 -12.237 1.00 53.87  ? 77  CYS B C   1 
ATOM 2241 O O   . CYS B 2 100 ? 45.084 -38.679 -12.403 1.00 53.63  ? 77  CYS B O   1 
ATOM 2242 C CB  . CYS B 2 100 ? 43.970 -41.420 -10.862 1.00 53.67  ? 77  CYS B CB  1 
ATOM 2243 S SG  . CYS B 2 100 ? 42.490 -42.359 -10.635 1.00 54.02  ? 77  CYS B SG  1 
ATOM 2244 N N   . ARG B 2 101 ? 46.519 -40.375 -12.022 1.00 55.40  ? 78  ARG B N   1 
ATOM 2245 C CA  . ARG B 2 101 ? 47.652 -39.481 -11.959 1.00 56.33  ? 78  ARG B CA  1 
ATOM 2246 C C   . ARG B 2 101 ? 48.001 -38.893 -13.331 1.00 55.44  ? 78  ARG B C   1 
ATOM 2247 O O   . ARG B 2 101 ? 48.345 -37.721 -13.406 1.00 55.70  ? 78  ARG B O   1 
ATOM 2248 C CB  . ARG B 2 101 ? 48.860 -40.159 -11.319 1.00 59.33  ? 78  ARG B CB  1 
ATOM 2249 C CG  . ARG B 2 101 ? 49.729 -39.200 -10.544 1.00 61.94  ? 78  ARG B CG  1 
ATOM 2250 C CD  . ARG B 2 101 ? 50.807 -39.921 -9.784  1.00 66.97  ? 78  ARG B CD  1 
ATOM 2251 N NE  . ARG B 2 101 ? 50.274 -40.638 -8.634  1.00 70.49  ? 78  ARG B NE  1 
ATOM 2252 C CZ  . ARG B 2 101 ? 50.530 -40.332 -7.361  1.00 73.56  ? 78  ARG B CZ  1 
ATOM 2253 N NH1 . ARG B 2 101 ? 51.327 -39.311 -7.057  1.00 72.99  ? 78  ARG B NH1 1 
ATOM 2254 N NH2 . ARG B 2 101 ? 49.985 -41.062 -6.387  1.00 74.81  ? 78  ARG B NH2 1 
ATOM 2255 N N   . HIS B 2 102 ? 47.915 -39.682 -14.404 1.00 54.34  ? 79  HIS B N   1 
ATOM 2256 C CA  . HIS B 2 102 ? 48.114 -39.135 -15.745 1.00 53.27  ? 79  HIS B CA  1 
ATOM 2257 C C   . HIS B 2 102 ? 47.246 -37.880 -15.949 1.00 50.90  ? 79  HIS B C   1 
ATOM 2258 O O   . HIS B 2 102 ? 47.764 -36.777 -16.144 1.00 51.60  ? 79  HIS B O   1 
ATOM 2259 C CB  . HIS B 2 102 ? 47.831 -40.174 -16.841 1.00 53.03  ? 79  HIS B CB  1 
ATOM 2260 C CG  . HIS B 2 102 ? 47.983 -39.633 -18.234 1.00 53.66  ? 79  HIS B CG  1 
ATOM 2261 N ND1 . HIS B 2 102 ? 49.208 -39.484 -18.848 1.00 54.99  ? 79  HIS B ND1 1 
ATOM 2262 C CD2 . HIS B 2 102 ? 47.063 -39.194 -19.127 1.00 52.66  ? 79  HIS B CD2 1 
ATOM 2263 C CE1 . HIS B 2 102 ? 49.040 -38.980 -20.057 1.00 54.59  ? 79  HIS B CE1 1 
ATOM 2264 N NE2 . HIS B 2 102 ? 47.747 -38.792 -20.251 1.00 53.26  ? 79  HIS B NE2 1 
ATOM 2265 N N   . ASN B 2 103 ? 45.934 -38.045 -15.868 1.00 47.91  ? 80  ASN B N   1 
ATOM 2266 C CA  . ASN B 2 103 ? 45.015 -36.957 -16.189 1.00 45.51  ? 80  ASN B CA  1 
ATOM 2267 C C   . ASN B 2 103 ? 45.098 -35.775 -15.233 1.00 45.31  ? 80  ASN B C   1 
ATOM 2268 O O   . ASN B 2 103 ? 44.902 -34.626 -15.631 1.00 44.84  ? 80  ASN B O   1 
ATOM 2269 C CB  . ASN B 2 103 ? 43.586 -37.486 -16.316 1.00 42.71  ? 80  ASN B CB  1 
ATOM 2270 C CG  . ASN B 2 103 ? 43.449 -38.456 -17.458 1.00 42.80  ? 80  ASN B CG  1 
ATOM 2271 O OD1 . ASN B 2 103 ? 44.262 -38.435 -18.379 1.00 45.65  ? 80  ASN B OD1 1 
ATOM 2272 N ND2 . ASN B 2 103 ? 42.449 -39.321 -17.411 1.00 40.61  ? 80  ASN B ND2 1 
ATOM 2273 N N   . TYR B 2 104 ? 45.418 -36.054 -13.977 1.00 46.15  ? 81  TYR B N   1 
ATOM 2274 C CA  . TYR B 2 104 ? 45.433 -35.027 -12.971 1.00 45.63  ? 81  TYR B CA  1 
ATOM 2275 C C   . TYR B 2 104 ? 46.473 -33.971 -13.345 1.00 47.34  ? 81  TYR B C   1 
ATOM 2276 O O   . TYR B 2 104 ? 46.141 -32.788 -13.558 1.00 47.04  ? 81  TYR B O   1 
ATOM 2277 C CB  . TYR B 2 104 ? 45.734 -35.666 -11.635 1.00 46.41  ? 81  TYR B CB  1 
ATOM 2278 C CG  . TYR B 2 104 ? 45.817 -34.696 -10.491 1.00 46.72  ? 81  TYR B CG  1 
ATOM 2279 C CD1 . TYR B 2 104 ? 47.055 -34.402 -9.905  1.00 47.92  ? 81  TYR B CD1 1 
ATOM 2280 C CD2 . TYR B 2 104 ? 44.668 -34.066 -9.985  1.00 44.90  ? 81  TYR B CD2 1 
ATOM 2281 C CE1 . TYR B 2 104 ? 47.164 -33.524 -8.845  1.00 47.23  ? 81  TYR B CE1 1 
ATOM 2282 C CE2 . TYR B 2 104 ? 44.764 -33.172 -8.912  1.00 45.88  ? 81  TYR B CE2 1 
ATOM 2283 C CZ  . TYR B 2 104 ? 46.037 -32.918 -8.349  1.00 47.84  ? 81  TYR B CZ  1 
ATOM 2284 O OH  . TYR B 2 104 ? 46.195 -32.048 -7.306  1.00 49.07  ? 81  TYR B OH  1 
ATOM 2285 N N   . GLU B 2 105 ? 47.717 -34.416 -13.479 1.00 48.82  ? 82  GLU B N   1 
ATOM 2286 C CA  . GLU B 2 105 ? 48.814 -33.529 -13.743 1.00 50.44  ? 82  GLU B CA  1 
ATOM 2287 C C   . GLU B 2 105 ? 48.787 -33.043 -15.196 1.00 49.43  ? 82  GLU B C   1 
ATOM 2288 O O   . GLU B 2 105 ? 49.285 -31.950 -15.498 1.00 50.12  ? 82  GLU B O   1 
ATOM 2289 C CB  . GLU B 2 105 ? 50.152 -34.210 -13.404 1.00 53.30  ? 82  GLU B CB  1 
ATOM 2290 C CG  . GLU B 2 105 ? 51.124 -33.283 -12.687 1.00 57.38  ? 82  GLU B CG  1 
ATOM 2291 C CD  . GLU B 2 105 ? 52.548 -33.345 -13.260 1.00 65.59  ? 82  GLU B CD  1 
ATOM 2292 O OE1 . GLU B 2 105 ? 53.169 -34.435 -13.193 1.00 68.12  ? 82  GLU B OE1 1 
ATOM 2293 O OE2 . GLU B 2 105 ? 53.062 -32.302 -13.761 1.00 68.10  ? 82  GLU B OE2 1 
ATOM 2294 N N   . LEU B 2 106 ? 48.229 -33.855 -16.095 1.00 47.82  ? 83  LEU B N   1 
ATOM 2295 C CA  . LEU B 2 106 ? 48.028 -33.426 -17.483 1.00 46.69  ? 83  LEU B CA  1 
ATOM 2296 C C   . LEU B 2 106 ? 47.103 -32.232 -17.511 1.00 45.34  ? 83  LEU B C   1 
ATOM 2297 O O   . LEU B 2 106 ? 47.444 -31.201 -18.073 1.00 45.86  ? 83  LEU B O   1 
ATOM 2298 C CB  . LEU B 2 106 ? 47.420 -34.528 -18.350 1.00 45.67  ? 83  LEU B CB  1 
ATOM 2299 C CG  . LEU B 2 106 ? 47.404 -34.399 -19.877 1.00 43.66  ? 83  LEU B CG  1 
ATOM 2300 C CD1 . LEU B 2 106 ? 45.989 -34.623 -20.378 1.00 38.88  ? 83  LEU B CD1 1 
ATOM 2301 C CD2 . LEU B 2 106 ? 47.933 -33.044 -20.350 1.00 43.95  ? 83  LEU B CD2 1 
ATOM 2302 N N   . GLY B 2 107 ? 45.941 -32.372 -16.895 1.00 43.86  ? 84  GLY B N   1 
ATOM 2303 C CA  . GLY B 2 107 ? 44.935 -31.312 -16.923 1.00 43.84  ? 84  GLY B CA  1 
ATOM 2304 C C   . GLY B 2 107 ? 45.276 -30.064 -16.135 1.00 44.78  ? 84  GLY B C   1 
ATOM 2305 O O   . GLY B 2 107 ? 44.710 -29.010 -16.409 1.00 44.29  ? 84  GLY B O   1 
ATOM 2306 N N   . GLY B 2 108 ? 46.227 -30.193 -15.192 1.00 46.91  ? 85  GLY B N   1 
ATOM 2307 C CA  . GLY B 2 108 ? 46.616 -29.171 -14.195 1.00 47.39  ? 85  GLY B CA  1 
ATOM 2308 C C   . GLY B 2 108 ? 46.637 -27.689 -14.552 1.00 47.82  ? 85  GLY B C   1 
ATOM 2309 O O   . GLY B 2 108 ? 45.934 -26.889 -13.933 1.00 46.69  ? 85  GLY B O   1 
ATOM 2310 N N   . PRO B 2 109 ? 47.451 -27.303 -15.544 1.00 49.50  ? 86  PRO B N   1 
ATOM 2311 C CA  . PRO B 2 109 ? 47.671 -25.887 -15.899 1.00 50.49  ? 86  PRO B CA  1 
ATOM 2312 C C   . PRO B 2 109 ? 46.428 -25.091 -16.318 1.00 49.08  ? 86  PRO B C   1 
ATOM 2313 O O   . PRO B 2 109 ? 46.446 -23.860 -16.203 1.00 49.32  ? 86  PRO B O   1 
ATOM 2314 C CB  . PRO B 2 109 ? 48.652 -25.968 -17.068 1.00 52.02  ? 86  PRO B CB  1 
ATOM 2315 C CG  . PRO B 2 109 ? 48.462 -27.341 -17.605 1.00 51.38  ? 86  PRO B CG  1 
ATOM 2316 C CD  . PRO B 2 109 ? 48.213 -28.199 -16.425 1.00 50.50  ? 86  PRO B CD  1 
ATOM 2317 N N   . MET B 2 110 ? 45.383 -25.790 -16.790 1.00 47.73  ? 87  MET B N   1 
ATOM 2318 C CA  . MET B 2 110 ? 44.078 -25.183 -17.128 1.00 46.25  ? 87  MET B CA  1 
ATOM 2319 C C   . MET B 2 110 ? 42.964 -25.481 -16.111 1.00 44.85  ? 87  MET B C   1 
ATOM 2320 O O   . MET B 2 110 ? 41.800 -25.150 -16.350 1.00 42.68  ? 87  MET B O   1 
ATOM 2321 C CB  . MET B 2 110 ? 43.609 -25.636 -18.509 1.00 45.78  ? 87  MET B CB  1 
ATOM 2322 C CG  . MET B 2 110 ? 44.601 -25.342 -19.598 1.00 48.67  ? 87  MET B CG  1 
ATOM 2323 S SD  . MET B 2 110 ? 43.892 -24.577 -21.045 1.00 46.55  ? 87  MET B SD  1 
ATOM 2324 C CE  . MET B 2 110 ? 44.197 -22.878 -20.589 1.00 52.76  ? 87  MET B CE  1 
ATOM 2325 N N   . THR B 2 111 ? 43.337 -26.096 -14.990 1.00 45.58  ? 88  THR B N   1 
ATOM 2326 C CA  . THR B 2 111 ? 42.395 -26.555 -13.985 1.00 45.70  ? 88  THR B CA  1 
ATOM 2327 C C   . THR B 2 111 ? 42.785 -26.093 -12.574 1.00 47.20  ? 88  THR B C   1 
ATOM 2328 O O   . THR B 2 111 ? 42.245 -25.103 -12.064 1.00 47.00  ? 88  THR B O   1 
ATOM 2329 C CB  . THR B 2 111 ? 42.264 -28.104 -13.993 1.00 45.64  ? 88  THR B CB  1 
ATOM 2330 O OG1 . THR B 2 111 ? 43.574 -28.694 -14.013 1.00 48.57  ? 88  THR B OG1 1 
ATOM 2331 C CG2 . THR B 2 111 ? 41.419 -28.618 -15.195 1.00 43.59  ? 88  THR B CG2 1 
ATOM 2332 N N   . LEU B 2 112 ? 43.717 -26.820 -11.954 1.00 48.79  ? 89  LEU B N   1 
ATOM 2333 C CA  . LEU B 2 112 ? 44.272 -26.457 -10.666 1.00 50.25  ? 89  LEU B CA  1 
ATOM 2334 C C   . LEU B 2 112 ? 44.827 -25.068 -10.788 1.00 51.23  ? 89  LEU B C   1 
ATOM 2335 O O   . LEU B 2 112 ? 44.578 -24.222 -9.945  1.00 52.19  ? 89  LEU B O   1 
ATOM 2336 C CB  . LEU B 2 112 ? 45.421 -27.387 -10.284 1.00 52.37  ? 89  LEU B CB  1 
ATOM 2337 C CG  . LEU B 2 112 ? 45.224 -28.895 -10.070 1.00 53.40  ? 89  LEU B CG  1 
ATOM 2338 C CD1 . LEU B 2 112 ? 44.434 -29.553 -11.189 1.00 52.73  ? 89  LEU B CD1 1 
ATOM 2339 C CD2 . LEU B 2 112 ? 46.595 -29.554 -9.968  1.00 55.61  ? 89  LEU B CD2 1 
ATOM 2340 N N   . GLN B 2 113 ? 45.580 -24.825 -11.848 1.00 52.05  ? 90  GLN B N   1 
ATOM 2341 C CA  . GLN B 2 113 ? 46.162 -23.508 -12.054 1.00 53.10  ? 90  GLN B CA  1 
ATOM 2342 C C   . GLN B 2 113 ? 45.195 -22.472 -12.611 1.00 50.78  ? 90  GLN B C   1 
ATOM 2343 O O   . GLN B 2 113 ? 45.593 -21.351 -12.847 1.00 51.36  ? 90  GLN B O   1 
ATOM 2344 C CB  . GLN B 2 113 ? 47.411 -23.590 -12.944 1.00 55.19  ? 90  GLN B CB  1 
ATOM 2345 C CG  . GLN B 2 113 ? 48.740 -23.276 -12.208 1.00 60.21  ? 90  GLN B CG  1 
ATOM 2346 C CD  . GLN B 2 113 ? 49.403 -24.518 -11.623 1.00 64.80  ? 90  GLN B CD  1 
ATOM 2347 O OE1 . GLN B 2 113 ? 48.945 -25.655 -11.827 1.00 65.92  ? 90  GLN B OE1 1 
ATOM 2348 N NE2 . GLN B 2 113 ? 50.492 -24.309 -10.901 1.00 67.36  ? 90  GLN B NE2 1 
ATOM 2349 N N   . ARG B 2 114 ? 43.935 -22.837 -12.826 1.00 48.80  ? 91  ARG B N   1 
ATOM 2350 C CA  . ARG B 2 114 ? 42.977 -21.901 -13.453 1.00 47.27  ? 91  ARG B CA  1 
ATOM 2351 C C   . ARG B 2 114 ? 42.439 -20.890 -12.472 1.00 46.16  ? 91  ARG B C   1 
ATOM 2352 O O   . ARG B 2 114 ? 41.793 -21.234 -11.476 1.00 45.18  ? 91  ARG B O   1 
ATOM 2353 C CB  . ARG B 2 114 ? 41.809 -22.621 -14.135 1.00 46.12  ? 91  ARG B CB  1 
ATOM 2354 C CG  . ARG B 2 114 ? 40.856 -21.641 -14.773 1.00 46.10  ? 91  ARG B CG  1 
ATOM 2355 C CD  . ARG B 2 114 ? 39.887 -22.278 -15.717 1.00 47.12  ? 91  ARG B CD  1 
ATOM 2356 N NE  . ARG B 2 114 ? 38.556 -21.720 -15.472 1.00 48.53  ? 91  ARG B NE  1 
ATOM 2357 C CZ  . ARG B 2 114 ? 37.924 -20.843 -16.249 1.00 48.33  ? 91  ARG B CZ  1 
ATOM 2358 N NH1 . ARG B 2 114 ? 38.476 -20.387 -17.371 1.00 49.36  ? 91  ARG B NH1 1 
ATOM 2359 N NH2 . ARG B 2 114 ? 36.719 -20.427 -15.895 1.00 47.84  ? 91  ARG B NH2 1 
ATOM 2360 N N   . ARG B 2 115 ? 42.699 -19.632 -12.759 1.00 46.10  ? 92  ARG B N   1 
ATOM 2361 C CA  . ARG B 2 115 ? 42.387 -18.597 -11.800 1.00 46.16  ? 92  ARG B CA  1 
ATOM 2362 C C   . ARG B 2 115 ? 41.777 -17.451 -12.569 1.00 45.11  ? 92  ARG B C   1 
ATOM 2363 O O   . ARG B 2 115 ? 42.414 -16.858 -13.418 1.00 45.95  ? 92  ARG B O   1 
ATOM 2364 C CB  . ARG B 2 115 ? 43.642 -18.181 -11.006 1.00 48.39  ? 92  ARG B CB  1 
ATOM 2365 C CG  . ARG B 2 115 ? 44.276 -19.340 -10.165 1.00 50.43  ? 92  ARG B CG  1 
ATOM 2366 C CD  . ARG B 2 115 ? 45.056 -18.830 -8.927  1.00 57.53  ? 92  ARG B CD  1 
ATOM 2367 N NE  . ARG B 2 115 ? 46.195 -19.669 -8.497  1.00 60.06  ? 92  ARG B NE  1 
ATOM 2368 C CZ  . ARG B 2 115 ? 46.086 -20.910 -8.017  1.00 60.27  ? 92  ARG B CZ  1 
ATOM 2369 N NH1 . ARG B 2 115 ? 44.883 -21.490 -7.918  1.00 58.52  ? 92  ARG B NH1 1 
ATOM 2370 N NH2 . ARG B 2 115 ? 47.177 -21.577 -7.650  1.00 59.77  ? 92  ARG B NH2 1 
ATOM 2371 N N   . VAL B 2 116 ? 40.502 -17.199 -12.302 1.00 42.80  ? 93  VAL B N   1 
ATOM 2372 C CA  . VAL B 2 116 ? 39.756 -16.156 -12.970 1.00 41.20  ? 93  VAL B CA  1 
ATOM 2373 C C   . VAL B 2 116 ? 39.229 -15.244 -11.869 1.00 40.84  ? 93  VAL B C   1 
ATOM 2374 O O   . VAL B 2 116 ? 38.647 -15.720 -10.901 1.00 40.07  ? 93  VAL B O   1 
ATOM 2375 C CB  . VAL B 2 116 ? 38.626 -16.755 -13.820 1.00 39.48  ? 93  VAL B CB  1 
ATOM 2376 C CG1 . VAL B 2 116 ? 37.845 -15.679 -14.572 1.00 39.53  ? 93  VAL B CG1 1 
ATOM 2377 C CG2 . VAL B 2 116 ? 39.199 -17.734 -14.786 1.00 39.77  ? 93  VAL B CG2 1 
ATOM 2378 N N   . GLN B 2 117 ? 39.422 -13.945 -12.057 1.00 41.28  ? 94  GLN B N   1 
ATOM 2379 C CA  . GLN B 2 117 ? 39.256 -12.941 -11.028 1.00 42.45  ? 94  GLN B CA  1 
ATOM 2380 C C   . GLN B 2 117 ? 37.832 -12.525 -10.734 1.00 42.13  ? 94  GLN B C   1 
ATOM 2381 O O   . GLN B 2 117 ? 37.030 -12.344 -11.652 1.00 42.87  ? 94  GLN B O   1 
ATOM 2382 C CB  . GLN B 2 117 ? 39.998 -11.697 -11.452 1.00 44.56  ? 94  GLN B CB  1 
ATOM 2383 C CG  . GLN B 2 117 ? 41.442 -11.966 -11.748 1.00 45.42  ? 94  GLN B CG  1 
ATOM 2384 C CD  . GLN B 2 117 ? 42.283 -10.794 -11.433 1.00 47.37  ? 94  GLN B CD  1 
ATOM 2385 O OE1 . GLN B 2 117 ? 41.783 -9.698  -11.163 1.00 46.48  ? 94  GLN B OE1 1 
ATOM 2386 N NE2 . GLN B 2 117 ? 43.583 -11.001 -11.458 1.00 50.54  ? 94  GLN B NE2 1 
ATOM 2387 N N   . PRO B 2 118 ? 37.500 -12.348 -9.448  1.00 41.85  ? 95  PRO B N   1 
ATOM 2388 C CA  . PRO B 2 118 ? 36.120 -12.020 -9.170  1.00 41.07  ? 95  PRO B CA  1 
ATOM 2389 C C   . PRO B 2 118 ? 35.793 -10.597 -9.599  1.00 42.47  ? 95  PRO B C   1 
ATOM 2390 O O   . PRO B 2 118 ? 36.684 -9.739  -9.643  1.00 44.17  ? 95  PRO B O   1 
ATOM 2391 C CB  . PRO B 2 118 ? 36.039 -12.170 -7.651  1.00 41.38  ? 95  PRO B CB  1 
ATOM 2392 C CG  . PRO B 2 118 ? 37.415 -12.057 -7.167  1.00 41.76  ? 95  PRO B CG  1 
ATOM 2393 C CD  . PRO B 2 118 ? 38.282 -12.583 -8.224  1.00 42.22  ? 95  PRO B CD  1 
ATOM 2394 N N   . ARG B 2 119 ? 34.544 -10.351 -9.956  1.00 42.50  ? 96  ARG B N   1 
ATOM 2395 C CA  . ARG B 2 119 ? 34.090 -8.981  -10.151 1.00 45.38  ? 96  ARG B CA  1 
ATOM 2396 C C   . ARG B 2 119 ? 33.180 -8.686  -8.966  1.00 45.30  ? 96  ARG B C   1 
ATOM 2397 O O   . ARG B 2 119 ? 32.511 -9.594  -8.483  1.00 44.90  ? 96  ARG B O   1 
ATOM 2398 C CB  . ARG B 2 119 ? 33.395 -8.798  -11.516 1.00 45.71  ? 96  ARG B CB  1 
ATOM 2399 C CG  . ARG B 2 119 ? 33.995 -9.676  -12.634 1.00 49.28  ? 96  ARG B CG  1 
ATOM 2400 C CD  . ARG B 2 119 ? 33.558 -9.304  -14.068 1.00 55.68  ? 96  ARG B CD  1 
ATOM 2401 N NE  . ARG B 2 119 ? 34.146 -8.033  -14.490 1.00 62.34  ? 96  ARG B NE  1 
ATOM 2402 C CZ  . ARG B 2 119 ? 35.456 -7.798  -14.641 1.00 66.16  ? 96  ARG B CZ  1 
ATOM 2403 N NH1 . ARG B 2 119 ? 36.361 -8.755  -14.401 1.00 66.34  ? 96  ARG B NH1 1 
ATOM 2404 N NH2 . ARG B 2 119 ? 35.869 -6.589  -15.027 1.00 67.52  ? 96  ARG B NH2 1 
ATOM 2405 N N   . VAL B 2 120 ? 33.172 -7.445  -8.481  1.00 47.26  ? 97  VAL B N   1 
ATOM 2406 C CA  . VAL B 2 120 ? 32.456 -7.078  -7.217  1.00 48.20  ? 97  VAL B CA  1 
ATOM 2407 C C   . VAL B 2 120 ? 31.492 -5.882  -7.315  1.00 48.86  ? 97  VAL B C   1 
ATOM 2408 O O   . VAL B 2 120 ? 31.845 -4.815  -7.796  1.00 49.93  ? 97  VAL B O   1 
ATOM 2409 C CB  . VAL B 2 120 ? 33.446 -6.836  -6.042  1.00 48.92  ? 97  VAL B CB  1 
ATOM 2410 C CG1 . VAL B 2 120 ? 34.061 -8.130  -5.592  1.00 47.63  ? 97  VAL B CG1 1 
ATOM 2411 C CG2 . VAL B 2 120 ? 34.545 -5.884  -6.490  1.00 52.09  ? 97  VAL B CG2 1 
ATOM 2412 N N   . ASN B 2 121 ? 30.272 -6.072  -6.852  1.00 48.93  ? 98  ASN B N   1 
ATOM 2413 C CA  . ASN B 2 121 ? 29.290 -5.002  -6.873  1.00 50.87  ? 98  ASN B CA  1 
ATOM 2414 C C   . ASN B 2 121 ? 28.538 -4.907  -5.556  1.00 51.61  ? 98  ASN B C   1 
ATOM 2415 O O   . ASN B 2 121 ? 28.155 -5.921  -4.968  1.00 51.21  ? 98  ASN B O   1 
ATOM 2416 C CB  . ASN B 2 121 ? 28.328 -5.199  -8.054  1.00 50.72  ? 98  ASN B CB  1 
ATOM 2417 C CG  . ASN B 2 121 ? 27.013 -4.441  -7.886  1.00 52.76  ? 98  ASN B CG  1 
ATOM 2418 O OD1 . ASN B 2 121 ? 26.088 -4.919  -7.211  1.00 52.31  ? 98  ASN B OD1 1 
ATOM 2419 N ND2 . ASN B 2 121 ? 26.920 -3.259  -8.511  1.00 53.85  ? 98  ASN B ND2 1 
ATOM 2420 N N   . VAL B 2 122 ? 28.313 -3.684  -5.107  1.00 53.67  ? 99  VAL B N   1 
ATOM 2421 C CA  . VAL B 2 122 ? 27.679 -3.435  -3.832  1.00 55.02  ? 99  VAL B CA  1 
ATOM 2422 C C   . VAL B 2 122 ? 26.456 -2.556  -4.030  1.00 57.27  ? 99  VAL B C   1 
ATOM 2423 O O   . VAL B 2 122 ? 26.555 -1.513  -4.670  1.00 58.35  ? 99  VAL B O   1 
ATOM 2424 C CB  . VAL B 2 122 ? 28.651 -2.746  -2.864  1.00 56.09  ? 99  VAL B CB  1 
ATOM 2425 C CG1 . VAL B 2 122 ? 27.937 -2.313  -1.592  1.00 56.85  ? 99  VAL B CG1 1 
ATOM 2426 C CG2 . VAL B 2 122 ? 29.796 -3.670  -2.526  1.00 55.24  ? 99  VAL B CG2 1 
ATOM 2427 N N   . SER B 2 123 ? 25.320 -2.976  -3.465  1.00 58.50  ? 100 SER B N   1 
ATOM 2428 C CA  . SER B 2 123 ? 24.064 -2.254  -3.578  1.00 61.60  ? 100 SER B CA  1 
ATOM 2429 C C   . SER B 2 123 ? 23.220 -2.293  -2.297  1.00 64.44  ? 100 SER B C   1 
ATOM 2430 O O   . SER B 2 123 ? 23.284 -3.253  -1.536  1.00 63.85  ? 100 SER B O   1 
ATOM 2431 C CB  . SER B 2 123 ? 23.241 -2.846  -4.712  1.00 60.43  ? 100 SER B CB  1 
ATOM 2432 O OG  . SER B 2 123 ? 23.773 -2.480  -5.952  1.00 60.56  ? 100 SER B OG  1 
ATOM 2433 N N   . PRO B 2 124 ? 22.400 -1.255  -2.070  1.00 68.10  ? 101 PRO B N   1 
ATOM 2434 C CA  . PRO B 2 124 ? 21.404 -1.249  -0.998  1.00 70.66  ? 101 PRO B CA  1 
ATOM 2435 C C   . PRO B 2 124 ? 20.267 -2.258  -1.162  1.00 71.61  ? 101 PRO B C   1 
ATOM 2436 O O   . PRO B 2 124 ? 20.238 -3.008  -2.147  1.00 69.94  ? 101 PRO B O   1 
ATOM 2437 C CB  . PRO B 2 124 ? 20.825 0.166   -1.068  1.00 72.75  ? 101 PRO B CB  1 
ATOM 2438 C CG  . PRO B 2 124 ? 21.220 0.680   -2.408  1.00 72.65  ? 101 PRO B CG  1 
ATOM 2439 C CD  . PRO B 2 124 ? 22.550 0.084   -2.668  1.00 69.75  ? 101 PRO B CD  1 
ATOM 2440 N N   . SER B 2 125 ? 19.359 -2.267  -0.171  1.00 74.72  ? 102 SER B N   1 
ATOM 2441 C CA  . SER B 2 125 ? 18.100 -3.040  -0.198  1.00 76.66  ? 102 SER B CA  1 
ATOM 2442 C C   . SER B 2 125 ? 17.096 -2.645  0.901   1.00 79.98  ? 102 SER B C   1 
ATOM 2443 O O   . SER B 2 125 ? 16.427 -3.523  1.491   1.00 80.11  ? 102 SER B O   1 
ATOM 2444 C CB  . SER B 2 125 ? 18.369 -4.543  -0.136  1.00 74.53  ? 102 SER B CB  1 
ATOM 2445 O OG  . SER B 2 125 ? 18.677 -5.030  -1.420  1.00 73.24  ? 102 SER B OG  1 
ATOM 2446 N N   . LYS B 2 126 ? 16.976 -1.332  1.144   1.00 83.46  ? 103 LYS B N   1 
ATOM 2447 C CA  . LYS B 2 126 ? 16.155 -0.780  2.257   1.00 86.92  ? 103 LYS B CA  1 
ATOM 2448 C C   . LYS B 2 126 ? 14.620 -0.923  2.160   1.00 88.60  ? 103 LYS B C   1 
ATOM 2449 O O   . LYS B 2 126 ? 13.945 -0.933  3.192   1.00 90.43  ? 103 LYS B O   1 
ATOM 2450 C CB  . LYS B 2 126 ? 16.543 0.686   2.575   1.00 89.07  ? 103 LYS B CB  1 
ATOM 2451 C CG  . LYS B 2 126 ? 16.753 1.619   1.352   1.00 89.89  ? 103 LYS B CG  1 
ATOM 2452 C CD  . LYS B 2 126 ? 16.999 3.088   1.760   1.00 92.73  ? 103 LYS B CD  1 
ATOM 2453 C CE  . LYS B 2 126 ? 18.432 3.334   2.282   1.00 92.89  ? 103 LYS B CE  1 
ATOM 2454 N NZ  . LYS B 2 126 ? 19.522 2.874   1.348   1.00 90.02  ? 103 LYS B NZ  1 
ATOM 2455 N N   . LYS B 2 127 ? 14.084 -1.045  0.939   1.00 88.96  ? 104 LYS B N   1 
ATOM 2456 C CA  . LYS B 2 127 ? 12.620 -1.087  0.692   1.00 90.75  ? 104 LYS B CA  1 
ATOM 2457 C C   . LYS B 2 127 ? 12.126 -2.506  0.344   1.00 89.35  ? 104 LYS B C   1 
ATOM 2458 O O   . LYS B 2 127 ? 12.890 -3.472  0.405   1.00 87.53  ? 104 LYS B O   1 
ATOM 2459 C CB  . LYS B 2 127 ? 12.221 -0.090  -0.424  1.00 92.22  ? 104 LYS B CB  1 
ATOM 2460 C CG  . LYS B 2 127 ? 12.914 1.289   -0.358  1.00 93.98  ? 104 LYS B CG  1 
ATOM 2461 C CD  . LYS B 2 127 ? 13.118 1.920   -1.746  1.00 94.55  ? 104 LYS B CD  1 
ATOM 2462 C CE  . LYS B 2 127 ? 14.476 2.648   -1.858  1.00 95.34  ? 104 LYS B CE  1 
ATOM 2463 N NZ  . LYS B 2 127 ? 14.708 3.692   -0.792  1.00 96.73  ? 104 LYS B NZ  1 
ATOM 2464 N N   . GLY B 2 128 ? 10.851 -2.622  -0.028  1.00 90.51  ? 105 GLY B N   1 
ATOM 2465 C CA  . GLY B 2 128 ? 10.248 -3.915  -0.333  1.00 89.30  ? 105 GLY B CA  1 
ATOM 2466 C C   . GLY B 2 128 ? 9.402  -4.413  0.824   1.00 90.14  ? 105 GLY B C   1 
ATOM 2467 O O   . GLY B 2 128 ? 8.834  -3.617  1.570   1.00 91.76  ? 105 GLY B O   1 
ATOM 2468 N N   . HIS B 2 133 ? 13.926 -4.176  8.463   1.00 85.84  ? 110 HIS B N   1 
ATOM 2469 C CA  . HIS B 2 133 ? 15.329 -4.492  8.166   1.00 84.04  ? 110 HIS B CA  1 
ATOM 2470 C C   . HIS B 2 133 ? 16.104 -3.327  7.517   1.00 83.13  ? 110 HIS B C   1 
ATOM 2471 O O   . HIS B 2 133 ? 15.917 -2.156  7.901   1.00 85.02  ? 110 HIS B O   1 
ATOM 2472 C CB  . HIS B 2 133 ? 15.468 -5.799  7.355   1.00 82.16  ? 110 HIS B CB  1 
ATOM 2473 C CG  . HIS B 2 133 ? 14.510 -5.931  6.197   1.00 84.62  ? 110 HIS B CG  1 
ATOM 2474 N ND1 . HIS B 2 133 ? 13.143 -6.063  6.362   1.00 87.27  ? 110 HIS B ND1 1 
ATOM 2475 C CD2 . HIS B 2 133 ? 14.735 -6.014  4.860   1.00 84.48  ? 110 HIS B CD2 1 
ATOM 2476 C CE1 . HIS B 2 133 ? 12.568 -6.188  5.178   1.00 87.29  ? 110 HIS B CE1 1 
ATOM 2477 N NE2 . HIS B 2 133 ? 13.511 -6.168  4.252   1.00 85.72  ? 110 HIS B NE2 1 
ATOM 2478 N N   . ASN B 2 134 ? 16.975 -3.671  6.558   1.00 79.59  ? 111 ASN B N   1 
ATOM 2479 C CA  . ASN B 2 134 ? 17.852 -2.735  5.849   1.00 77.60  ? 111 ASN B CA  1 
ATOM 2480 C C   . ASN B 2 134 ? 19.176 -3.412  5.524   1.00 74.59  ? 111 ASN B C   1 
ATOM 2481 O O   . ASN B 2 134 ? 20.102 -3.419  6.346   1.00 74.66  ? 111 ASN B O   1 
ATOM 2482 C CB  . ASN B 2 134 ? 18.102 -1.444  6.634   1.00 79.94  ? 111 ASN B CB  1 
ATOM 2483 C CG  . ASN B 2 134 ? 18.433 -0.266  5.723   1.00 81.02  ? 111 ASN B CG  1 
ATOM 2484 O OD1 . ASN B 2 134 ? 18.976 -0.436  4.626   1.00 79.80  ? 111 ASN B OD1 1 
ATOM 2485 N ND2 . ASN B 2 134 ? 18.096 0.932   6.170   1.00 82.74  ? 111 ASN B ND2 1 
ATOM 2486 N N   . LEU B 2 135 ? 19.245 -3.967  4.310   1.00 71.10  ? 112 LEU B N   1 
ATOM 2487 C CA  . LEU B 2 135 ? 20.359 -4.805  3.860   1.00 67.37  ? 112 LEU B CA  1 
ATOM 2488 C C   . LEU B 2 135 ? 21.324 -4.112  2.913   1.00 65.44  ? 112 LEU B C   1 
ATOM 2489 O O   . LEU B 2 135 ? 20.952 -3.184  2.197   1.00 65.77  ? 112 LEU B O   1 
ATOM 2490 C CB  . LEU B 2 135 ? 19.838 -6.063  3.158   1.00 65.48  ? 112 LEU B CB  1 
ATOM 2491 C CG  . LEU B 2 135 ? 19.706 -7.358  3.949   1.00 65.59  ? 112 LEU B CG  1 
ATOM 2492 C CD1 . LEU B 2 135 ? 18.472 -7.360  4.879   1.00 66.96  ? 112 LEU B CD1 1 
ATOM 2493 C CD2 . LEU B 2 135 ? 19.633 -8.521  2.966   1.00 64.49  ? 112 LEU B CD2 1 
ATOM 2494 N N   . LEU B 2 136 ? 22.559 -4.609  2.918   1.00 62.53  ? 113 LEU B N   1 
ATOM 2495 C CA  . LEU B 2 136 ? 23.566 -4.259  1.944   1.00 60.11  ? 113 LEU B CA  1 
ATOM 2496 C C   . LEU B 2 136 ? 24.069 -5.557  1.287   1.00 56.65  ? 113 LEU B C   1 
ATOM 2497 O O   . LEU B 2 136 ? 24.336 -6.545  1.970   1.00 55.82  ? 113 LEU B O   1 
ATOM 2498 C CB  . LEU B 2 136 ? 24.697 -3.515  2.636   1.00 61.29  ? 113 LEU B CB  1 
ATOM 2499 C CG  . LEU B 2 136 ? 25.425 -2.413  1.870   1.00 62.49  ? 113 LEU B CG  1 
ATOM 2500 C CD1 . LEU B 2 136 ? 24.614 -1.114  1.683   1.00 63.24  ? 113 LEU B CD1 1 
ATOM 2501 C CD2 . LEU B 2 136 ? 26.698 -2.100  2.605   1.00 63.93  ? 113 LEU B CD2 1 
ATOM 2502 N N   . VAL B 2 137 ? 24.196 -5.539  -0.037  1.00 53.70  ? 114 VAL B N   1 
ATOM 2503 C CA  . VAL B 2 137 ? 24.429 -6.744  -0.821  1.00 50.19  ? 114 VAL B CA  1 
ATOM 2504 C C   . VAL B 2 137 ? 25.780 -6.755  -1.539  1.00 48.93  ? 114 VAL B C   1 
ATOM 2505 O O   . VAL B 2 137 ? 25.988 -6.008  -2.486  1.00 48.84  ? 114 VAL B O   1 
ATOM 2506 C CB  . VAL B 2 137 ? 23.305 -6.931  -1.859  1.00 49.39  ? 114 VAL B CB  1 
ATOM 2507 C CG1 . VAL B 2 137 ? 23.507 -8.200  -2.656  1.00 47.41  ? 114 VAL B CG1 1 
ATOM 2508 C CG2 . VAL B 2 137 ? 21.965 -6.986  -1.178  1.00 50.25  ? 114 VAL B CG2 1 
ATOM 2509 N N   . CYS B 2 138 ? 26.693 -7.611  -1.093  1.00 47.61  ? 115 CYS B N   1 
ATOM 2510 C CA  . CYS B 2 138 ? 27.956 -7.788  -1.790  1.00 46.49  ? 115 CYS B CA  1 
ATOM 2511 C C   . CYS B 2 138 ? 27.884 -8.962  -2.817  1.00 44.44  ? 115 CYS B C   1 
ATOM 2512 O O   . CYS B 2 138 ? 28.042 -10.139 -2.451  1.00 43.73  ? 115 CYS B O   1 
ATOM 2513 C CB  . CYS B 2 138 ? 29.136 -7.905  -0.796  1.00 47.35  ? 115 CYS B CB  1 
ATOM 2514 S SG  . CYS B 2 138 ? 30.756 -7.503  -1.533  1.00 47.76  ? 115 CYS B SG  1 
ATOM 2515 N N   . HIS B 2 139 ? 27.630 -8.615  -4.090  1.00 42.88  ? 116 HIS B N   1 
ATOM 2516 C CA  . HIS B 2 139 ? 27.505 -9.570  -5.208  1.00 40.35  ? 116 HIS B CA  1 
ATOM 2517 C C   . HIS B 2 139 ? 28.867 -9.726  -5.839  1.00 39.74  ? 116 HIS B C   1 
ATOM 2518 O O   . HIS B 2 139 ? 29.447 -8.752  -6.354  1.00 39.54  ? 116 HIS B O   1 
ATOM 2519 C CB  . HIS B 2 139 ? 26.584 -8.982  -6.275  1.00 40.86  ? 116 HIS B CB  1 
ATOM 2520 C CG  . HIS B 2 139 ? 25.846 -9.984  -7.113  1.00 39.71  ? 116 HIS B CG  1 
ATOM 2521 N ND1 . HIS B 2 139 ? 26.185 -11.321 -7.185  1.00 40.77  ? 116 HIS B ND1 1 
ATOM 2522 C CD2 . HIS B 2 139 ? 24.789 -9.825  -7.944  1.00 39.98  ? 116 HIS B CD2 1 
ATOM 2523 C CE1 . HIS B 2 139 ? 25.353 -11.946 -8.000  1.00 38.15  ? 116 HIS B CE1 1 
ATOM 2524 N NE2 . HIS B 2 139 ? 24.499 -11.061 -8.476  1.00 39.76  ? 116 HIS B NE2 1 
ATOM 2525 N N   . VAL B 2 140 ? 29.372 -10.952 -5.821  1.00 38.63  ? 117 VAL B N   1 
ATOM 2526 C CA  . VAL B 2 140 ? 30.708 -11.222 -6.350  1.00 38.79  ? 117 VAL B CA  1 
ATOM 2527 C C   . VAL B 2 140 ? 30.594 -12.180 -7.505  1.00 38.07  ? 117 VAL B C   1 
ATOM 2528 O O   . VAL B 2 140 ? 30.162 -13.321 -7.305  1.00 37.75  ? 117 VAL B O   1 
ATOM 2529 C CB  . VAL B 2 140 ? 31.647 -11.863 -5.269  1.00 38.88  ? 117 VAL B CB  1 
ATOM 2530 C CG1 . VAL B 2 140 ? 33.084 -11.993 -5.798  1.00 38.47  ? 117 VAL B CG1 1 
ATOM 2531 C CG2 . VAL B 2 140 ? 31.599 -11.093 -3.986  1.00 38.76  ? 117 VAL B CG2 1 
ATOM 2532 N N   . THR B 2 141 ? 30.993 -11.755 -8.699  1.00 38.64  ? 118 THR B N   1 
ATOM 2533 C CA  . THR B 2 141 ? 30.749 -12.601 -9.891  1.00 38.85  ? 118 THR B CA  1 
ATOM 2534 C C   . THR B 2 141 ? 31.967 -13.085 -10.677 1.00 39.22  ? 118 THR B C   1 
ATOM 2535 O O   . THR B 2 141 ? 33.015 -12.478 -10.609 1.00 40.75  ? 118 THR B O   1 
ATOM 2536 C CB  . THR B 2 141 ? 29.813 -11.918 -10.875 1.00 38.61  ? 118 THR B CB  1 
ATOM 2537 O OG1 . THR B 2 141 ? 30.104 -10.515 -10.915 1.00 41.77  ? 118 THR B OG1 1 
ATOM 2538 C CG2 . THR B 2 141 ? 28.424 -12.092 -10.430 1.00 38.53  ? 118 THR B CG2 1 
ATOM 2539 N N   . ASP B 2 142 ? 31.805 -14.170 -11.424 1.00 38.79  ? 119 ASP B N   1 
ATOM 2540 C CA  . ASP B 2 142 ? 32.708 -14.531 -12.518 1.00 39.85  ? 119 ASP B CA  1 
ATOM 2541 C C   . ASP B 2 142 ? 34.118 -14.938 -12.134 1.00 40.15  ? 119 ASP B C   1 
ATOM 2542 O O   . ASP B 2 142 ? 35.116 -14.524 -12.761 1.00 41.15  ? 119 ASP B O   1 
ATOM 2543 C CB  . ASP B 2 142 ? 32.708 -13.466 -13.622 1.00 41.34  ? 119 ASP B CB  1 
ATOM 2544 C CG  . ASP B 2 142 ? 31.617 -13.715 -14.653 1.00 44.51  ? 119 ASP B CG  1 
ATOM 2545 O OD1 . ASP B 2 142 ? 30.763 -14.625 -14.457 1.00 43.98  ? 119 ASP B OD1 1 
ATOM 2546 O OD2 . ASP B 2 142 ? 31.617 -13.000 -15.672 1.00 48.92  ? 119 ASP B OD2 1 
ATOM 2547 N N   . PHE B 2 143 ? 34.195 -15.781 -11.113 1.00 39.72  ? 120 PHE B N   1 
ATOM 2548 C CA  . PHE B 2 143 ? 35.481 -16.196 -10.589 1.00 39.87  ? 120 PHE B CA  1 
ATOM 2549 C C   . PHE B 2 143 ? 35.593 -17.691 -10.630 1.00 39.25  ? 120 PHE B C   1 
ATOM 2550 O O   . PHE B 2 143 ? 34.572 -18.412 -10.632 1.00 37.85  ? 120 PHE B O   1 
ATOM 2551 C CB  . PHE B 2 143 ? 35.725 -15.675 -9.160  1.00 40.00  ? 120 PHE B CB  1 
ATOM 2552 C CG  . PHE B 2 143 ? 34.713 -16.139 -8.139  1.00 37.98  ? 120 PHE B CG  1 
ATOM 2553 C CD1 . PHE B 2 143 ? 33.685 -15.303 -7.731  1.00 37.15  ? 120 PHE B CD1 1 
ATOM 2554 C CD2 . PHE B 2 143 ? 34.813 -17.396 -7.541  1.00 37.52  ? 120 PHE B CD2 1 
ATOM 2555 C CE1 . PHE B 2 143 ? 32.761 -15.728 -6.761  1.00 35.33  ? 120 PHE B CE1 1 
ATOM 2556 C CE2 . PHE B 2 143 ? 33.871 -17.827 -6.566  1.00 34.62  ? 120 PHE B CE2 1 
ATOM 2557 C CZ  . PHE B 2 143 ? 32.861 -16.990 -6.186  1.00 32.84  ? 120 PHE B CZ  1 
ATOM 2558 N N   . TYR B 2 144 ? 36.848 -18.135 -10.664 1.00 39.58  ? 121 TYR B N   1 
ATOM 2559 C CA  . TYR B 2 144 ? 37.184 -19.524 -10.491 1.00 39.37  ? 121 TYR B CA  1 
ATOM 2560 C C   . TYR B 2 144 ? 38.541 -19.583 -9.794  1.00 41.37  ? 121 TYR B C   1 
ATOM 2561 O O   . TYR B 2 144 ? 39.457 -18.836 -10.158 1.00 43.64  ? 121 TYR B O   1 
ATOM 2562 C CB  . TYR B 2 144 ? 37.220 -20.198 -11.854 1.00 38.46  ? 121 TYR B CB  1 
ATOM 2563 C CG  . TYR B 2 144 ? 37.452 -21.673 -11.784 1.00 36.89  ? 121 TYR B CG  1 
ATOM 2564 C CD1 . TYR B 2 144 ? 38.737 -22.175 -11.610 1.00 36.29  ? 121 TYR B CD1 1 
ATOM 2565 C CD2 . TYR B 2 144 ? 36.389 -22.576 -11.910 1.00 34.69  ? 121 TYR B CD2 1 
ATOM 2566 C CE1 . TYR B 2 144 ? 38.971 -23.538 -11.555 1.00 38.04  ? 121 TYR B CE1 1 
ATOM 2567 C CE2 . TYR B 2 144 ? 36.604 -23.975 -11.849 1.00 34.80  ? 121 TYR B CE2 1 
ATOM 2568 C CZ  . TYR B 2 144 ? 37.909 -24.437 -11.674 1.00 38.11  ? 121 TYR B CZ  1 
ATOM 2569 O OH  . TYR B 2 144 ? 38.180 -25.780 -11.599 1.00 39.24  ? 121 TYR B OH  1 
ATOM 2570 N N   . PRO B 2 145 ? 38.710 -20.484 -8.821  1.00 41.48  ? 122 PRO B N   1 
ATOM 2571 C CA  . PRO B 2 145 ? 37.796 -21.537 -8.410  1.00 41.02  ? 122 PRO B CA  1 
ATOM 2572 C C   . PRO B 2 145 ? 36.861 -21.165 -7.256  1.00 41.37  ? 122 PRO B C   1 
ATOM 2573 O O   . PRO B 2 145 ? 36.948 -20.070 -6.703  1.00 41.72  ? 122 PRO B O   1 
ATOM 2574 C CB  . PRO B 2 145 ? 38.752 -22.666 -7.991  1.00 41.76  ? 122 PRO B CB  1 
ATOM 2575 C CG  . PRO B 2 145 ? 39.993 -21.975 -7.547  1.00 42.34  ? 122 PRO B CG  1 
ATOM 2576 C CD  . PRO B 2 145 ? 40.019 -20.603 -8.161  1.00 42.17  ? 122 PRO B CD  1 
ATOM 2577 N N   . GLY B 2 146 ? 35.985 -22.104 -6.906  1.00 41.45  ? 123 GLY B N   1 
ATOM 2578 C CA  . GLY B 2 146 ? 34.926 -21.886 -5.927  1.00 41.65  ? 123 GLY B CA  1 
ATOM 2579 C C   . GLY B 2 146 ? 35.391 -21.351 -4.590  1.00 43.36  ? 123 GLY B C   1 
ATOM 2580 O O   . GLY B 2 146 ? 34.724 -20.506 -3.987  1.00 43.56  ? 123 GLY B O   1 
ATOM 2581 N N   . SER B 2 147 ? 36.540 -21.826 -4.130  1.00 44.43  ? 124 SER B N   1 
ATOM 2582 C CA  . SER B 2 147 ? 37.059 -21.381 -2.842  1.00 46.45  ? 124 SER B CA  1 
ATOM 2583 C C   . SER B 2 147 ? 37.283 -19.857 -2.830  1.00 46.44  ? 124 SER B C   1 
ATOM 2584 O O   . SER B 2 147 ? 37.981 -19.336 -3.679  1.00 46.71  ? 124 SER B O   1 
ATOM 2585 C CB  . SER B 2 147 ? 38.357 -22.141 -2.517  1.00 47.92  ? 124 SER B CB  1 
ATOM 2586 O OG  . SER B 2 147 ? 38.316 -22.679 -1.203  1.00 50.15  ? 124 SER B OG  1 
ATOM 2587 N N   . ILE B 2 148 ? 36.678 -19.160 -1.872  1.00 46.73  ? 125 ILE B N   1 
ATOM 2588 C CA  . ILE B 2 148 ? 36.743 -17.686 -1.777  1.00 47.23  ? 125 ILE B CA  1 
ATOM 2589 C C   . ILE B 2 148 ? 36.383 -17.228 -0.361  1.00 48.10  ? 125 ILE B C   1 
ATOM 2590 O O   . ILE B 2 148 ? 35.802 -17.994 0.408   1.00 48.24  ? 125 ILE B O   1 
ATOM 2591 C CB  . ILE B 2 148 ? 35.740 -17.035 -2.766  1.00 45.95  ? 125 ILE B CB  1 
ATOM 2592 C CG1 . ILE B 2 148 ? 36.103 -15.583 -3.056  1.00 46.85  ? 125 ILE B CG1 1 
ATOM 2593 C CG2 . ILE B 2 148 ? 34.301 -17.146 -2.231  1.00 45.93  ? 125 ILE B CG2 1 
ATOM 2594 C CD1 . ILE B 2 148 ? 35.165 -14.920 -4.025  1.00 43.93  ? 125 ILE B CD1 1 
ATOM 2595 N N   . GLN B 2 149 ? 36.703 -15.991 -0.005  1.00 49.23  ? 126 GLN B N   1 
ATOM 2596 C CA  . GLN B 2 149 ? 36.250 -15.471 1.293   1.00 50.84  ? 126 GLN B CA  1 
ATOM 2597 C C   . GLN B 2 149 ? 35.784 -14.031 1.168   1.00 50.81  ? 126 GLN B C   1 
ATOM 2598 O O   . GLN B 2 149 ? 36.499 -13.168 0.659   1.00 51.09  ? 126 GLN B O   1 
ATOM 2599 C CB  . GLN B 2 149 ? 37.329 -15.559 2.389   1.00 53.39  ? 126 GLN B CB  1 
ATOM 2600 C CG  . GLN B 2 149 ? 38.314 -16.740 2.354   1.00 55.20  ? 126 GLN B CG  1 
ATOM 2601 C CD  . GLN B 2 149 ? 39.523 -16.527 3.305   1.00 60.81  ? 126 GLN B CD  1 
ATOM 2602 O OE1 . GLN B 2 149 ? 39.418 -15.833 4.326   1.00 61.04  ? 126 GLN B OE1 1 
ATOM 2603 N NE2 . GLN B 2 149 ? 40.670 -17.137 2.966   1.00 61.84  ? 126 GLN B NE2 1 
ATOM 2604 N N   . VAL B 2 150 ? 34.570 -13.780 1.631   1.00 50.67  ? 127 VAL B N   1 
ATOM 2605 C CA  . VAL B 2 150 ? 33.956 -12.461 1.512   1.00 51.27  ? 127 VAL B CA  1 
ATOM 2606 C C   . VAL B 2 150 ? 33.644 -11.960 2.903   1.00 53.32  ? 127 VAL B C   1 
ATOM 2607 O O   . VAL B 2 150 ? 32.968 -12.636 3.676   1.00 53.56  ? 127 VAL B O   1 
ATOM 2608 C CB  . VAL B 2 150 ? 32.652 -12.475 0.643   1.00 49.51  ? 127 VAL B CB  1 
ATOM 2609 C CG1 . VAL B 2 150 ? 32.073 -11.070 0.528   1.00 49.63  ? 127 VAL B CG1 1 
ATOM 2610 C CG2 . VAL B 2 150 ? 32.924 -13.013 -0.758  1.00 47.11  ? 127 VAL B CG2 1 
ATOM 2611 N N   . ARG B 2 151 ? 34.133 -10.771 3.216   1.00 55.31  ? 128 ARG B N   1 
ATOM 2612 C CA  . ARG B 2 151 ? 34.037 -10.250 4.568   1.00 58.07  ? 128 ARG B CA  1 
ATOM 2613 C C   . ARG B 2 151 ? 33.490 -8.835  4.600   1.00 58.61  ? 128 ARG B C   1 
ATOM 2614 O O   . ARG B 2 151 ? 33.613 -8.084  3.637   1.00 58.73  ? 128 ARG B O   1 
ATOM 2615 C CB  . ARG B 2 151 ? 35.392 -10.355 5.275   1.00 60.30  ? 128 ARG B CB  1 
ATOM 2616 C CG  . ARG B 2 151 ? 35.562 -11.711 5.920   1.00 62.38  ? 128 ARG B CG  1 
ATOM 2617 C CD  . ARG B 2 151 ? 36.984 -12.042 6.322   1.00 67.61  ? 128 ARG B CD  1 
ATOM 2618 N NE  . ARG B 2 151 ? 37.122 -13.503 6.328   1.00 70.21  ? 128 ARG B NE  1 
ATOM 2619 C CZ  . ARG B 2 151 ? 38.191 -14.183 6.744   1.00 72.92  ? 128 ARG B CZ  1 
ATOM 2620 N NH1 . ARG B 2 151 ? 39.267 -13.560 7.214   1.00 75.11  ? 128 ARG B NH1 1 
ATOM 2621 N NH2 . ARG B 2 151 ? 38.177 -15.507 6.692   1.00 73.37  ? 128 ARG B NH2 1 
ATOM 2622 N N   . TRP B 2 152 ? 32.870 -8.480  5.715   1.00 59.41  ? 129 TRP B N   1 
ATOM 2623 C CA  . TRP B 2 152 ? 32.253 -7.177  5.836   1.00 59.52  ? 129 TRP B CA  1 
ATOM 2624 C C   . TRP B 2 152 ? 32.895 -6.321  6.917   1.00 62.45  ? 129 TRP B C   1 
ATOM 2625 O O   . TRP B 2 152 ? 33.207 -6.808  8.013   1.00 63.90  ? 129 TRP B O   1 
ATOM 2626 C CB  . TRP B 2 152 ? 30.777 -7.352  6.137   1.00 58.48  ? 129 TRP B CB  1 
ATOM 2627 C CG  . TRP B 2 152 ? 29.910 -7.387  4.937   1.00 53.75  ? 129 TRP B CG  1 
ATOM 2628 C CD1 . TRP B 2 152 ? 29.194 -8.444  4.482   1.00 49.11  ? 129 TRP B CD1 1 
ATOM 2629 C CD2 . TRP B 2 152 ? 29.647 -6.302  4.035   1.00 51.52  ? 129 TRP B CD2 1 
ATOM 2630 N NE1 . TRP B 2 152 ? 28.497 -8.096  3.354   1.00 46.82  ? 129 TRP B NE1 1 
ATOM 2631 C CE2 . TRP B 2 152 ? 28.754 -6.789  3.052   1.00 47.10  ? 129 TRP B CE2 1 
ATOM 2632 C CE3 . TRP B 2 152 ? 30.088 -4.971  3.958   1.00 50.72  ? 129 TRP B CE3 1 
ATOM 2633 C CZ2 . TRP B 2 152 ? 28.284 -6.003  2.012   1.00 45.95  ? 129 TRP B CZ2 1 
ATOM 2634 C CZ3 . TRP B 2 152 ? 29.618 -4.185  2.928   1.00 49.92  ? 129 TRP B CZ3 1 
ATOM 2635 C CH2 . TRP B 2 152 ? 28.722 -4.705  1.964   1.00 49.33  ? 129 TRP B CH2 1 
ATOM 2636 N N   . PHE B 2 153 ? 33.067 -5.040  6.619   1.00 63.44  ? 130 PHE B N   1 
ATOM 2637 C CA  . PHE B 2 153 ? 33.664 -4.130  7.582   1.00 66.47  ? 130 PHE B CA  1 
ATOM 2638 C C   . PHE B 2 153 ? 32.867 -2.844  7.769   1.00 68.02  ? 130 PHE B C   1 
ATOM 2639 O O   . PHE B 2 153 ? 32.405 -2.217  6.818   1.00 66.48  ? 130 PHE B O   1 
ATOM 2640 C CB  . PHE B 2 153 ? 35.131 -3.840  7.227   1.00 67.56  ? 130 PHE B CB  1 
ATOM 2641 C CG  . PHE B 2 153 ? 35.997 -5.075  7.197   1.00 66.99  ? 130 PHE B CG  1 
ATOM 2642 C CD1 . PHE B 2 153 ? 36.211 -5.767  6.008   1.00 65.68  ? 130 PHE B CD1 1 
ATOM 2643 C CD2 . PHE B 2 153 ? 36.577 -5.564  8.356   1.00 68.20  ? 130 PHE B CD2 1 
ATOM 2644 C CE1 . PHE B 2 153 ? 37.001 -6.924  5.982   1.00 64.81  ? 130 PHE B CE1 1 
ATOM 2645 C CE2 . PHE B 2 153 ? 37.372 -6.716  8.335   1.00 67.47  ? 130 PHE B CE2 1 
ATOM 2646 C CZ  . PHE B 2 153 ? 37.578 -7.396  7.155   1.00 65.68  ? 130 PHE B CZ  1 
ATOM 2647 N N   . LEU B 2 154 ? 32.711 -2.491  9.040   1.00 71.49  ? 131 LEU B N   1 
ATOM 2648 C CA  . LEU B 2 154 ? 31.993 -1.304  9.507   1.00 74.08  ? 131 LEU B CA  1 
ATOM 2649 C C   . LEU B 2 154 ? 33.020 -0.424  10.191  1.00 76.95  ? 131 LEU B C   1 
ATOM 2650 O O   . LEU B 2 154 ? 33.685 -0.895  11.111  1.00 78.71  ? 131 LEU B O   1 
ATOM 2651 C CB  . LEU B 2 154 ? 30.906 -1.742  10.512  1.00 74.79  ? 131 LEU B CB  1 
ATOM 2652 C CG  . LEU B 2 154 ? 30.118 -0.833  11.484  1.00 78.02  ? 131 LEU B CG  1 
ATOM 2653 C CD1 . LEU B 2 154 ? 30.872 -0.593  12.820  1.00 81.03  ? 131 LEU B CD1 1 
ATOM 2654 C CD2 . LEU B 2 154 ? 29.657 0.496   10.833  1.00 79.05  ? 131 LEU B CD2 1 
ATOM 2655 N N   . ASN B 2 155 ? 33.152 0.848   9.744   1.00 78.35  ? 132 ASN B N   1 
ATOM 2656 C CA  . ASN B 2 155 ? 34.255 1.741   10.254  1.00 81.29  ? 132 ASN B CA  1 
ATOM 2657 C C   . ASN B 2 155 ? 35.503 0.941   10.640  1.00 81.77  ? 132 ASN B C   1 
ATOM 2658 O O   . ASN B 2 155 ? 35.904 0.949   11.800  1.00 83.93  ? 132 ASN B O   1 
ATOM 2659 C CB  . ASN B 2 155 ? 33.820 2.618   11.507  1.00 84.12  ? 132 ASN B CB  1 
ATOM 2660 C CG  . ASN B 2 155 ? 32.582 3.455   11.228  1.00 85.33  ? 132 ASN B CG  1 
ATOM 2661 O OD1 . ASN B 2 155 ? 32.554 4.206   10.308  1.00 85.33  ? 132 ASN B OD1 1 
ATOM 2662 N ND2 . ASN B 2 155 ? 31.568 3.382   12.056  1.00 87.33  ? 132 ASN B ND2 1 
ATOM 2663 N N   . GLY B 2 156 ? 36.070 0.205   9.678   1.00 80.10  ? 133 GLY B N   1 
ATOM 2664 C CA  . GLY B 2 156 ? 37.267 -0.606  9.923   1.00 80.42  ? 133 GLY B CA  1 
ATOM 2665 C C   . GLY B 2 156 ? 37.075 -1.925  10.660  1.00 79.84  ? 133 GLY B C   1 
ATOM 2666 O O   . GLY B 2 156 ? 37.889 -2.837  10.502  1.00 79.49  ? 133 GLY B O   1 
ATOM 2667 N N   . GLN B 2 157 ? 36.023 -2.036  11.470  1.00 79.71  ? 134 GLN B N   1 
ATOM 2668 C CA  . GLN B 2 157 ? 35.800 -3.244  12.273  1.00 79.67  ? 134 GLN B CA  1 
ATOM 2669 C C   . GLN B 2 157 ? 35.071 -4.344  11.483  1.00 76.27  ? 134 GLN B C   1 
ATOM 2670 O O   . GLN B 2 157 ? 34.087 -4.069  10.786  1.00 74.51  ? 134 GLN B O   1 
ATOM 2671 C CB  . GLN B 2 157 ? 35.015 -2.919  13.563  1.00 81.97  ? 134 GLN B CB  1 
ATOM 2672 C CG  . GLN B 2 157 ? 35.270 -1.539  14.194  1.00 85.13  ? 134 GLN B CG  1 
ATOM 2673 C CD  . GLN B 2 157 ? 36.549 -1.465  15.032  1.00 89.40  ? 134 GLN B CD  1 
ATOM 2674 O OE1 . GLN B 2 157 ? 36.657 -0.633  15.942  1.00 92.75  ? 134 GLN B OE1 1 
ATOM 2675 N NE2 . GLN B 2 157 ? 37.530 -2.318  14.720  1.00 88.64  ? 134 GLN B NE2 1 
ATOM 2676 N N   . GLU B 2 158 ? 35.545 -5.586  11.608  1.00 75.29  ? 135 GLU B N   1 
ATOM 2677 C CA  . GLU B 2 158 ? 34.877 -6.730  10.978  1.00 72.10  ? 135 GLU B CA  1 
ATOM 2678 C C   . GLU B 2 158 ? 33.521 -6.993  11.614  1.00 71.76  ? 135 GLU B C   1 
ATOM 2679 O O   . GLU B 2 158 ? 33.353 -6.776  12.812  1.00 73.99  ? 135 GLU B O   1 
ATOM 2680 C CB  . GLU B 2 158 ? 35.727 -8.003  11.059  1.00 71.94  ? 135 GLU B CB  1 
ATOM 2681 C CG  . GLU B 2 158 ? 35.292 -9.069  10.033  1.00 69.17  ? 135 GLU B CG  1 
ATOM 2682 C CD  . GLU B 2 158 ? 35.875 -10.460 10.254  1.00 68.80  ? 135 GLU B CD  1 
ATOM 2683 O OE1 . GLU B 2 158 ? 35.362 -11.399 9.608   1.00 66.83  ? 135 GLU B OE1 1 
ATOM 2684 O OE2 . GLU B 2 158 ? 36.837 -10.623 11.040  1.00 70.44  ? 135 GLU B OE2 1 
ATOM 2685 N N   . GLU B 2 159 ? 32.570 -7.475  10.810  1.00 68.85  ? 136 GLU B N   1 
ATOM 2686 C CA  . GLU B 2 159 ? 31.222 -7.782  11.278  1.00 68.13  ? 136 GLU B CA  1 
ATOM 2687 C C   . GLU B 2 159 ? 30.878 -9.237  10.983  1.00 65.58  ? 136 GLU B C   1 
ATOM 2688 O O   . GLU B 2 159 ? 30.924 -9.645  9.823   1.00 63.55  ? 136 GLU B O   1 
ATOM 2689 C CB  . GLU B 2 159 ? 30.210 -6.859  10.594  1.00 67.47  ? 136 GLU B CB  1 
ATOM 2690 C CG  . GLU B 2 159 ? 30.441 -5.350  10.830  1.00 71.69  ? 136 GLU B CG  1 
ATOM 2691 C CD  . GLU B 2 159 ? 29.490 -4.733  11.877  1.00 76.30  ? 136 GLU B CD  1 
ATOM 2692 O OE1 . GLU B 2 159 ? 29.980 -4.099  12.854  1.00 78.60  ? 136 GLU B OE1 1 
ATOM 2693 O OE2 . GLU B 2 159 ? 28.251 -4.884  11.715  1.00 76.44  ? 136 GLU B OE2 1 
ATOM 2694 N N   . THR B 2 160 ? 30.551 -10.006 12.033  1.00 65.98  ? 137 THR B N   1 
ATOM 2695 C CA  . THR B 2 160 ? 30.080 -11.413 11.944  1.00 63.59  ? 137 THR B CA  1 
ATOM 2696 C C   . THR B 2 160 ? 28.567 -11.433 11.967  1.00 62.20  ? 137 THR B C   1 
ATOM 2697 O O   . THR B 2 160 ? 27.934 -12.206 11.233  1.00 59.94  ? 137 THR B O   1 
ATOM 2698 C CB  . THR B 2 160 ? 30.464 -12.266 13.195  1.00 65.83  ? 137 THR B CB  1 
ATOM 2699 O OG1 . THR B 2 160 ? 31.758 -11.904 13.683  1.00 68.25  ? 137 THR B OG1 1 
ATOM 2700 C CG2 . THR B 2 160 ? 30.389 -13.783 12.906  1.00 64.25  ? 137 THR B CG2 1 
ATOM 2701 N N   . ALA B 2 161 ? 28.016 -10.593 12.855  1.00 62.86  ? 138 ALA B N   1 
ATOM 2702 C CA  . ALA B 2 161 ? 26.590 -10.484 13.125  1.00 61.80  ? 138 ALA B CA  1 
ATOM 2703 C C   . ALA B 2 161 ? 25.799 -9.914  11.941  1.00 59.45  ? 138 ALA B C   1 
ATOM 2704 O O   . ALA B 2 161 ? 26.239 -8.986  11.278  1.00 58.79  ? 138 ALA B O   1 
ATOM 2705 C CB  . ALA B 2 161 ? 26.376 -9.646  14.361  1.00 64.04  ? 138 ALA B CB  1 
ATOM 2706 N N   . GLY B 2 162 ? 24.633 -10.490 11.679  1.00 58.21  ? 139 GLY B N   1 
ATOM 2707 C CA  . GLY B 2 162 ? 23.719 -9.966  10.676  1.00 56.89  ? 139 GLY B CA  1 
ATOM 2708 C C   . GLY B 2 162 ? 24.198 -10.270 9.281   1.00 54.78  ? 139 GLY B C   1 
ATOM 2709 O O   . GLY B 2 162 ? 23.854 -9.570  8.344   1.00 54.50  ? 139 GLY B O   1 
ATOM 2710 N N   . VAL B 2 163 ? 24.991 -11.325 9.135   1.00 53.93  ? 140 VAL B N   1 
ATOM 2711 C CA  . VAL B 2 163 ? 25.633 -11.616 7.864   1.00 51.93  ? 140 VAL B CA  1 
ATOM 2712 C C   . VAL B 2 163 ? 25.137 -12.949 7.286   1.00 50.97  ? 140 VAL B C   1 
ATOM 2713 O O   . VAL B 2 163 ? 25.283 -14.024 7.903   1.00 51.37  ? 140 VAL B O   1 
ATOM 2714 C CB  . VAL B 2 163 ? 27.181 -11.545 7.979   1.00 52.19  ? 140 VAL B CB  1 
ATOM 2715 C CG1 . VAL B 2 163 ? 27.868 -12.044 6.704   1.00 50.24  ? 140 VAL B CG1 1 
ATOM 2716 C CG2 . VAL B 2 163 ? 27.633 -10.124 8.295   1.00 52.87  ? 140 VAL B CG2 1 
ATOM 2717 N N   . VAL B 2 164 ? 24.534 -12.849 6.101   1.00 49.34  ? 141 VAL B N   1 
ATOM 2718 C CA  . VAL B 2 164 ? 24.049 -13.986 5.371   1.00 47.74  ? 141 VAL B CA  1 
ATOM 2719 C C   . VAL B 2 164 ? 24.748 -14.075 4.021   1.00 46.65  ? 141 VAL B C   1 
ATOM 2720 O O   . VAL B 2 164 ? 24.594 -13.208 3.164   1.00 46.31  ? 141 VAL B O   1 
ATOM 2721 C CB  . VAL B 2 164 ? 22.532 -13.893 5.137   1.00 47.79  ? 141 VAL B CB  1 
ATOM 2722 C CG1 . VAL B 2 164 ? 22.022 -15.189 4.542   1.00 45.80  ? 141 VAL B CG1 1 
ATOM 2723 C CG2 . VAL B 2 164 ? 21.804 -13.550 6.415   1.00 48.98  ? 141 VAL B CG2 1 
ATOM 2724 N N   . SER B 2 165 ? 25.522 -15.131 3.838   1.00 46.61  ? 142 SER B N   1 
ATOM 2725 C CA  . SER B 2 165 ? 26.085 -15.439 2.539   1.00 45.71  ? 142 SER B CA  1 
ATOM 2726 C C   . SER B 2 165 ? 25.278 -16.576 1.961   1.00 45.01  ? 142 SER B C   1 
ATOM 2727 O O   . SER B 2 165 ? 24.910 -17.506 2.680   1.00 46.08  ? 142 SER B O   1 
ATOM 2728 C CB  . SER B 2 165 ? 27.552 -15.840 2.660   1.00 46.19  ? 142 SER B CB  1 
ATOM 2729 O OG  . SER B 2 165 ? 27.701 -17.154 3.159   1.00 46.32  ? 142 SER B OG  1 
ATOM 2730 N N   . THR B 2 166 ? 24.978 -16.482 0.673   1.00 44.32  ? 143 THR B N   1 
ATOM 2731 C CA  . THR B 2 166 ? 24.256 -17.518 -0.057  1.00 43.76  ? 143 THR B CA  1 
ATOM 2732 C C   . THR B 2 166 ? 25.078 -18.768 -0.052  1.00 43.62  ? 143 THR B C   1 
ATOM 2733 O O   . THR B 2 166 ? 26.236 -18.744 0.362   1.00 44.53  ? 143 THR B O   1 
ATOM 2734 C CB  . THR B 2 166 ? 24.126 -17.149 -1.545  1.00 43.03  ? 143 THR B CB  1 
ATOM 2735 O OG1 . THR B 2 166 ? 25.378 -16.622 -2.041  1.00 42.35  ? 143 THR B OG1 1 
ATOM 2736 C CG2 . THR B 2 166 ? 23.029 -16.152 -1.736  1.00 43.87  ? 143 THR B CG2 1 
ATOM 2737 N N   . ASN B 2 167 ? 24.549 -19.864 -0.571  1.00 43.08  ? 144 ASN B N   1 
ATOM 2738 C CA  . ASN B 2 167 ? 25.493 -20.924 -0.871  1.00 43.31  ? 144 ASN B CA  1 
ATOM 2739 C C   . ASN B 2 167 ? 26.428 -20.451 -1.996  1.00 42.01  ? 144 ASN B C   1 
ATOM 2740 O O   . ASN B 2 167 ? 26.261 -19.353 -2.526  1.00 42.46  ? 144 ASN B O   1 
ATOM 2741 C CB  . ASN B 2 167 ? 24.803 -22.250 -1.182  1.00 43.16  ? 144 ASN B CB  1 
ATOM 2742 C CG  . ASN B 2 167 ? 25.435 -23.430 -0.394  1.00 47.04  ? 144 ASN B CG  1 
ATOM 2743 O OD1 . ASN B 2 167 ? 24.705 -24.295 0.124   1.00 49.58  ? 144 ASN B OD1 1 
ATOM 2744 N ND2 . ASN B 2 167 ? 26.801 -23.455 -0.292  1.00 46.28  ? 144 ASN B ND2 1 
ATOM 2745 N N   . LEU B 2 168 ? 27.437 -21.227 -2.343  1.00 40.88  ? 145 LEU B N   1 
ATOM 2746 C CA  . LEU B 2 168 ? 28.235 -20.847 -3.509  1.00 39.68  ? 145 LEU B CA  1 
ATOM 2747 C C   . LEU B 2 168 ? 27.460 -21.230 -4.776  1.00 38.25  ? 145 LEU B C   1 
ATOM 2748 O O   . LEU B 2 168 ? 26.976 -22.364 -4.900  1.00 38.14  ? 145 LEU B O   1 
ATOM 2749 C CB  . LEU B 2 168 ? 29.625 -21.490 -3.472  1.00 39.38  ? 145 LEU B CB  1 
ATOM 2750 C CG  . LEU B 2 168 ? 30.538 -21.218 -4.660  1.00 38.01  ? 145 LEU B CG  1 
ATOM 2751 C CD1 . LEU B 2 168 ? 31.434 -20.026 -4.404  1.00 37.80  ? 145 LEU B CD1 1 
ATOM 2752 C CD2 . LEU B 2 168 ? 31.361 -22.444 -4.831  1.00 38.04  ? 145 LEU B CD2 1 
ATOM 2753 N N   . ILE B 2 169 ? 27.319 -20.293 -5.702  1.00 37.43  ? 146 ILE B N   1 
ATOM 2754 C CA  . ILE B 2 169 ? 26.491 -20.553 -6.865  1.00 36.69  ? 146 ILE B CA  1 
ATOM 2755 C C   . ILE B 2 169 ? 27.337 -20.969 -8.060  1.00 36.54  ? 146 ILE B C   1 
ATOM 2756 O O   . ILE B 2 169 ? 28.303 -20.307 -8.404  1.00 37.48  ? 146 ILE B O   1 
ATOM 2757 C CB  . ILE B 2 169 ? 25.569 -19.359 -7.163  1.00 37.11  ? 146 ILE B CB  1 
ATOM 2758 C CG1 . ILE B 2 169 ? 24.778 -18.994 -5.896  1.00 37.82  ? 146 ILE B CG1 1 
ATOM 2759 C CG2 . ILE B 2 169 ? 24.604 -19.686 -8.310  1.00 35.24  ? 146 ILE B CG2 1 
ATOM 2760 C CD1 . ILE B 2 169 ? 24.016 -17.646 -5.931  1.00 37.49  ? 146 ILE B CD1 1 
ATOM 2761 N N   . ARG B 2 170 ? 26.986 -22.077 -8.689  1.00 36.61  ? 147 ARG B N   1 
ATOM 2762 C CA  . ARG B 2 170 ? 27.753 -22.572 -9.839  1.00 36.95  ? 147 ARG B CA  1 
ATOM 2763 C C   . ARG B 2 170 ? 27.090 -22.091 -11.134 1.00 36.81  ? 147 ARG B C   1 
ATOM 2764 O O   . ARG B 2 170 ? 25.921 -22.386 -11.384 1.00 36.92  ? 147 ARG B O   1 
ATOM 2765 C CB  . ARG B 2 170 ? 27.839 -24.111 -9.763  1.00 36.80  ? 147 ARG B CB  1 
ATOM 2766 C CG  . ARG B 2 170 ? 28.534 -24.821 -10.913 1.00 37.70  ? 147 ARG B CG  1 
ATOM 2767 C CD  . ARG B 2 170 ? 28.776 -26.302 -10.567 1.00 38.89  ? 147 ARG B CD  1 
ATOM 2768 N NE  . ARG B 2 170 ? 30.114 -26.537 -10.014 1.00 41.64  ? 147 ARG B NE  1 
ATOM 2769 C CZ  . ARG B 2 170 ? 30.343 -26.984 -8.787  1.00 41.62  ? 147 ARG B CZ  1 
ATOM 2770 N NH1 . ARG B 2 170 ? 29.322 -27.268 -7.994  1.00 43.96  ? 147 ARG B NH1 1 
ATOM 2771 N NH2 . ARG B 2 170 ? 31.579 -27.142 -8.358  1.00 39.80  ? 147 ARG B NH2 1 
ATOM 2772 N N   . ASN B 2 171 ? 27.812 -21.334 -11.949 1.00 36.92  ? 148 ASN B N   1 
ATOM 2773 C CA  . ASN B 2 171 ? 27.218 -20.832 -13.198 1.00 37.46  ? 148 ASN B CA  1 
ATOM 2774 C C   . ASN B 2 171 ? 27.064 -21.873 -14.285 1.00 37.12  ? 148 ASN B C   1 
ATOM 2775 O O   . ASN B 2 171 ? 26.292 -21.693 -15.212 1.00 38.18  ? 148 ASN B O   1 
ATOM 2776 C CB  . ASN B 2 171 ? 27.947 -19.602 -13.714 1.00 37.97  ? 148 ASN B CB  1 
ATOM 2777 C CG  . ASN B 2 171 ? 27.700 -18.376 -12.830 1.00 39.92  ? 148 ASN B CG  1 
ATOM 2778 O OD1 . ASN B 2 171 ? 26.610 -18.208 -12.279 1.00 39.40  ? 148 ASN B OD1 1 
ATOM 2779 N ND2 . ASN B 2 171 ? 28.711 -17.532 -12.678 1.00 41.52  ? 148 ASN B ND2 1 
ATOM 2780 N N   . GLY B 2 172 ? 27.770 -22.988 -14.152 1.00 36.75  ? 149 GLY B N   1 
ATOM 2781 C CA  . GLY B 2 172 ? 27.699 -24.045 -15.149 1.00 35.63  ? 149 GLY B CA  1 
ATOM 2782 C C   . GLY B 2 172 ? 28.653 -23.852 -16.308 1.00 36.02  ? 149 GLY B C   1 
ATOM 2783 O O   . GLY B 2 172 ? 28.754 -24.724 -17.155 1.00 36.63  ? 149 GLY B O   1 
ATOM 2784 N N   . ASP B 2 173 ? 29.375 -22.731 -16.348 1.00 36.05  ? 150 ASP B N   1 
ATOM 2785 C CA  . ASP B 2 173 ? 30.300 -22.468 -17.446 1.00 36.41  ? 150 ASP B CA  1 
ATOM 2786 C C   . ASP B 2 173 ? 31.710 -22.277 -16.930 1.00 35.79  ? 150 ASP B C   1 
ATOM 2787 O O   . ASP B 2 173 ? 32.485 -21.478 -17.476 1.00 37.23  ? 150 ASP B O   1 
ATOM 2788 C CB  . ASP B 2 173 ? 29.862 -21.235 -18.237 1.00 37.69  ? 150 ASP B CB  1 
ATOM 2789 C CG  . ASP B 2 173 ? 29.651 -20.036 -17.353 1.00 40.32  ? 150 ASP B CG  1 
ATOM 2790 O OD1 . ASP B 2 173 ? 29.935 -20.187 -16.140 1.00 42.96  ? 150 ASP B OD1 1 
ATOM 2791 O OD2 . ASP B 2 173 ? 29.208 -18.963 -17.852 1.00 41.56  ? 150 ASP B OD2 1 
ATOM 2792 N N   . TRP B 2 174 ? 32.055 -23.023 -15.893 1.00 33.69  ? 151 TRP B N   1 
ATOM 2793 C CA  . TRP B 2 174 ? 33.338 -22.824 -15.234 1.00 32.88  ? 151 TRP B CA  1 
ATOM 2794 C C   . TRP B 2 174 ? 33.494 -21.432 -14.540 1.00 32.95  ? 151 TRP B C   1 
ATOM 2795 O O   . TRP B 2 174 ? 34.599 -20.880 -14.460 1.00 33.66  ? 151 TRP B O   1 
ATOM 2796 C CB  . TRP B 2 174 ? 34.500 -23.151 -16.193 1.00 33.16  ? 151 TRP B CB  1 
ATOM 2797 C CG  . TRP B 2 174 ? 34.646 -24.602 -16.501 1.00 30.78  ? 151 TRP B CG  1 
ATOM 2798 C CD1 . TRP B 2 174 ? 33.821 -25.350 -17.266 1.00 30.36  ? 151 TRP B CD1 1 
ATOM 2799 C CD2 . TRP B 2 174 ? 35.697 -25.474 -16.083 1.00 29.71  ? 151 TRP B CD2 1 
ATOM 2800 N NE1 . TRP B 2 174 ? 34.271 -26.645 -17.341 1.00 28.75  ? 151 TRP B NE1 1 
ATOM 2801 C CE2 . TRP B 2 174 ? 35.428 -26.744 -16.625 1.00 29.55  ? 151 TRP B CE2 1 
ATOM 2802 C CE3 . TRP B 2 174 ? 36.849 -25.304 -15.320 1.00 30.52  ? 151 TRP B CE3 1 
ATOM 2803 C CZ2 . TRP B 2 174 ? 36.244 -27.843 -16.394 1.00 30.97  ? 151 TRP B CZ2 1 
ATOM 2804 C CZ3 . TRP B 2 174 ? 37.674 -26.390 -15.117 1.00 31.39  ? 151 TRP B CZ3 1 
ATOM 2805 C CH2 . TRP B 2 174 ? 37.360 -27.647 -15.636 1.00 31.34  ? 151 TRP B CH2 1 
ATOM 2806 N N   . THR B 2 175 ? 32.400 -20.869 -14.024 1.00 32.19  ? 152 THR B N   1 
ATOM 2807 C CA  . THR B 2 175 ? 32.514 -19.688 -13.155 1.00 32.56  ? 152 THR B CA  1 
ATOM 2808 C C   . THR B 2 175 ? 31.506 -19.799 -12.051 1.00 31.72  ? 152 THR B C   1 
ATOM 2809 O O   . THR B 2 175 ? 30.469 -20.366 -12.262 1.00 31.79  ? 152 THR B O   1 
ATOM 2810 C CB  . THR B 2 175 ? 32.252 -18.336 -13.850 1.00 33.53  ? 152 THR B CB  1 
ATOM 2811 O OG1 . THR B 2 175 ? 30.903 -18.299 -14.334 1.00 34.42  ? 152 THR B OG1 1 
ATOM 2812 C CG2 . THR B 2 175 ? 33.263 -18.014 -14.982 1.00 32.94  ? 152 THR B CG2 1 
ATOM 2813 N N   . PHE B 2 176 ? 31.826 -19.251 -10.880 1.00 31.75  ? 153 PHE B N   1 
ATOM 2814 C CA  . PHE B 2 176 ? 30.917 -19.202 -9.734  1.00 30.88  ? 153 PHE B CA  1 
ATOM 2815 C C   . PHE B 2 176 ? 30.516 -17.764 -9.444  1.00 31.00  ? 153 PHE B C   1 
ATOM 2816 O O   . PHE B 2 176 ? 31.111 -16.810 -9.971  1.00 31.08  ? 153 PHE B O   1 
ATOM 2817 C CB  . PHE B 2 176 ? 31.592 -19.726 -8.465  1.00 31.47  ? 153 PHE B CB  1 
ATOM 2818 C CG  . PHE B 2 176 ? 32.113 -21.123 -8.571  1.00 31.64  ? 153 PHE B CG  1 
ATOM 2819 C CD1 . PHE B 2 176 ? 33.365 -21.375 -9.149  1.00 33.44  ? 153 PHE B CD1 1 
ATOM 2820 C CD2 . PHE B 2 176 ? 31.387 -22.181 -8.062  1.00 30.80  ? 153 PHE B CD2 1 
ATOM 2821 C CE1 . PHE B 2 176 ? 33.866 -22.660 -9.228  1.00 31.95  ? 153 PHE B CE1 1 
ATOM 2822 C CE2 . PHE B 2 176 ? 31.872 -23.483 -8.149  1.00 30.98  ? 153 PHE B CE2 1 
ATOM 2823 C CZ  . PHE B 2 176 ? 33.110 -23.719 -8.727  1.00 32.75  ? 153 PHE B CZ  1 
ATOM 2824 N N   . GLN B 2 177 ? 29.515 -17.615 -8.586  1.00 30.11  ? 154 GLN B N   1 
ATOM 2825 C CA  . GLN B 2 177 ? 29.179 -16.327 -8.035  1.00 30.57  ? 154 GLN B CA  1 
ATOM 2826 C C   . GLN B 2 177 ? 28.731 -16.583 -6.626  1.00 31.22  ? 154 GLN B C   1 
ATOM 2827 O O   . GLN B 2 177 ? 28.350 -17.701 -6.280  1.00 31.07  ? 154 GLN B O   1 
ATOM 2828 C CB  . GLN B 2 177 ? 28.091 -15.645 -8.840  1.00 30.28  ? 154 GLN B CB  1 
ATOM 2829 C CG  . GLN B 2 177 ? 26.820 -16.492 -9.094  1.00 31.05  ? 154 GLN B CG  1 
ATOM 2830 C CD  . GLN B 2 177 ? 25.814 -15.751 -9.961  1.00 32.59  ? 154 GLN B CD  1 
ATOM 2831 O OE1 . GLN B 2 177 ? 25.186 -14.805 -9.530  1.00 34.78  ? 154 GLN B OE1 1 
ATOM 2832 N NE2 . GLN B 2 177 ? 25.695 -16.160 -11.209 1.00 36.82  ? 154 GLN B NE2 1 
ATOM 2833 N N   . ILE B 2 178 ? 28.806 -15.553 -5.800  1.00 32.71  ? 155 ILE B N   1 
ATOM 2834 C CA  . ILE B 2 178 ? 28.317 -15.635 -4.440  1.00 33.50  ? 155 ILE B CA  1 
ATOM 2835 C C   . ILE B 2 178 ? 27.765 -14.253 -4.034  1.00 35.03  ? 155 ILE B C   1 
ATOM 2836 O O   . ILE B 2 178 ? 28.202 -13.213 -4.579  1.00 35.12  ? 155 ILE B O   1 
ATOM 2837 C CB  . ILE B 2 178 ? 29.439 -16.091 -3.480  1.00 34.02  ? 155 ILE B CB  1 
ATOM 2838 C CG1 . ILE B 2 178 ? 28.884 -17.049 -2.420  1.00 34.35  ? 155 ILE B CG1 1 
ATOM 2839 C CG2 . ILE B 2 178 ? 30.096 -14.909 -2.826  1.00 33.89  ? 155 ILE B CG2 1 
ATOM 2840 C CD1 . ILE B 2 178 ? 29.852 -17.334 -1.265  1.00 33.09  ? 155 ILE B CD1 1 
ATOM 2841 N N   . LEU B 2 179 ? 26.797 -14.271 -3.107  1.00 35.73  ? 156 LEU B N   1 
ATOM 2842 C CA  . LEU B 2 179 ? 26.216 -13.059 -2.498  1.00 37.36  ? 156 LEU B CA  1 
ATOM 2843 C C   . LEU B 2 179 ? 26.276 -13.050 -0.955  1.00 38.48  ? 156 LEU B C   1 
ATOM 2844 O O   . LEU B 2 179 ? 25.779 -13.957 -0.290  1.00 38.48  ? 156 LEU B O   1 
ATOM 2845 C CB  . LEU B 2 179 ? 24.772 -12.866 -2.950  1.00 36.86  ? 156 LEU B CB  1 
ATOM 2846 C CG  . LEU B 2 179 ? 24.541 -12.523 -4.422  1.00 37.66  ? 156 LEU B CG  1 
ATOM 2847 C CD1 . LEU B 2 179 ? 24.241 -13.759 -5.265  1.00 39.25  ? 156 LEU B CD1 1 
ATOM 2848 C CD2 . LEU B 2 179 ? 23.392 -11.573 -4.564  1.00 40.00  ? 156 LEU B CD2 1 
ATOM 2849 N N   . VAL B 2 180 ? 26.888 -12.016 -0.403  1.00 39.69  ? 157 VAL B N   1 
ATOM 2850 C CA  . VAL B 2 180 ? 26.964 -11.831 1.032   1.00 41.31  ? 157 VAL B CA  1 
ATOM 2851 C C   . VAL B 2 180 ? 26.281 -10.513 1.398   1.00 43.16  ? 157 VAL B C   1 
ATOM 2852 O O   . VAL B 2 180 ? 26.721 -9.439  0.983   1.00 43.23  ? 157 VAL B O   1 
ATOM 2853 C CB  . VAL B 2 180 ? 28.434 -11.773 1.501   1.00 41.94  ? 157 VAL B CB  1 
ATOM 2854 C CG1 . VAL B 2 180 ? 28.517 -11.517 3.004   1.00 43.26  ? 157 VAL B CG1 1 
ATOM 2855 C CG2 . VAL B 2 180 ? 29.128 -13.048 1.158   1.00 40.34  ? 157 VAL B CG2 1 
ATOM 2856 N N   . MET B 2 181 ? 25.209 -10.602 2.172   1.00 44.54  ? 158 MET B N   1 
ATOM 2857 C CA  . MET B 2 181 ? 24.518 -9.416  2.620   1.00 47.34  ? 158 MET B CA  1 
ATOM 2858 C C   . MET B 2 181 ? 24.773 -9.122  4.077   1.00 49.29  ? 158 MET B C   1 
ATOM 2859 O O   . MET B 2 181 ? 25.060 -10.033 4.852   1.00 49.71  ? 158 MET B O   1 
ATOM 2860 C CB  . MET B 2 181 ? 23.015 -9.515  2.387   1.00 47.60  ? 158 MET B CB  1 
ATOM 2861 C CG  . MET B 2 181 ? 22.482 -10.878 2.095   1.00 48.98  ? 158 MET B CG  1 
ATOM 2862 S SD  . MET B 2 181 ? 22.404 -11.234 0.315   1.00 54.03  ? 158 MET B SD  1 
ATOM 2863 C CE  . MET B 2 181 ? 21.142 -12.523 0.326   1.00 47.80  ? 158 MET B CE  1 
ATOM 2864 N N   . LEU B 2 182 ? 24.654 -7.843  4.441   1.00 50.94  ? 159 LEU B N   1 
ATOM 2865 C CA  . LEU B 2 182 ? 24.762 -7.413  5.826   1.00 52.80  ? 159 LEU B CA  1 
ATOM 2866 C C   . LEU B 2 182 ? 23.586 -6.541  6.249   1.00 54.61  ? 159 LEU B C   1 
ATOM 2867 O O   . LEU B 2 182 ? 23.206 -5.609  5.551   1.00 54.30  ? 159 LEU B O   1 
ATOM 2868 C CB  . LEU B 2 182 ? 26.082 -6.672  6.027   1.00 53.61  ? 159 LEU B CB  1 
ATOM 2869 C CG  . LEU B 2 182 ? 26.279 -5.747  7.236   1.00 55.67  ? 159 LEU B CG  1 
ATOM 2870 C CD1 . LEU B 2 182 ? 26.805 -6.509  8.448   1.00 56.12  ? 159 LEU B CD1 1 
ATOM 2871 C CD2 . LEU B 2 182 ? 27.211 -4.602  6.879   1.00 54.06  ? 159 LEU B CD2 1 
ATOM 2872 N N   . GLU B 2 183 ? 23.020 -6.850  7.405   1.00 56.84  ? 160 GLU B N   1 
ATOM 2873 C CA  . GLU B 2 183 ? 21.949 -6.044  7.959   1.00 60.52  ? 160 GLU B CA  1 
ATOM 2874 C C   . GLU B 2 183 ? 22.626 -4.917  8.681   1.00 62.70  ? 160 GLU B C   1 
ATOM 2875 O O   . GLU B 2 183 ? 23.621 -5.147  9.353   1.00 63.77  ? 160 GLU B O   1 
ATOM 2876 C CB  . GLU B 2 183 ? 21.070 -6.878  8.903   1.00 61.84  ? 160 GLU B CB  1 
ATOM 2877 C CG  . GLU B 2 183 ? 19.746 -6.197  9.331   1.00 66.76  ? 160 GLU B CG  1 
ATOM 2878 C CD  . GLU B 2 183 ? 18.635 -7.193  9.752   1.00 70.34  ? 160 GLU B CD  1 
ATOM 2879 O OE1 . GLU B 2 183 ? 18.706 -8.382  9.366   1.00 70.28  ? 160 GLU B OE1 1 
ATOM 2880 O OE2 . GLU B 2 183 ? 17.678 -6.784  10.458  1.00 71.87  ? 160 GLU B OE2 1 
ATOM 2881 N N   . MET B 2 184 ? 22.114 -3.700  8.524   1.00 64.79  ? 161 MET B N   1 
ATOM 2882 C CA  . MET B 2 184 ? 22.787 -2.488  9.044   1.00 67.42  ? 161 MET B CA  1 
ATOM 2883 C C   . MET B 2 184 ? 21.833 -1.386  9.522   1.00 70.48  ? 161 MET B C   1 
ATOM 2884 O O   . MET B 2 184 ? 20.620 -1.447  9.307   1.00 70.18  ? 161 MET B O   1 
ATOM 2885 C CB  . MET B 2 184 ? 23.681 -1.893  7.962   1.00 66.21  ? 161 MET B CB  1 
ATOM 2886 C CG  . MET B 2 184 ? 22.891 -1.593  6.695   1.00 64.62  ? 161 MET B CG  1 
ATOM 2887 S SD  . MET B 2 184 ? 23.697 -0.519  5.517   1.00 63.19  ? 161 MET B SD  1 
ATOM 2888 C CE  . MET B 2 184 ? 22.328 -0.105  4.417   1.00 61.30  ? 161 MET B CE  1 
ATOM 2889 N N   . THR B 2 185 ? 22.417 -0.359  10.145  1.00 74.18  ? 162 THR B N   1 
ATOM 2890 C CA  . THR B 2 185 ? 21.695 0.840   10.609  1.00 77.59  ? 162 THR B CA  1 
ATOM 2891 C C   . THR B 2 185 ? 22.680 2.005   10.675  1.00 79.90  ? 162 THR B C   1 
ATOM 2892 O O   . THR B 2 185 ? 23.198 2.289   11.746  1.00 81.82  ? 162 THR B O   1 
ATOM 2893 C CB  . THR B 2 185 ? 21.074 0.664   12.029  1.00 79.48  ? 162 THR B CB  1 
ATOM 2894 O OG1 . THR B 2 185 ? 21.305 -0.660  12.525  1.00 78.17  ? 162 THR B OG1 1 
ATOM 2895 C CG2 . THR B 2 185 ? 19.578 0.971   12.022  1.00 80.57  ? 162 THR B CG2 1 
ATOM 2896 N N   . PRO B 2 186 ? 22.949 2.675   9.531   1.00 80.41  ? 163 PRO B N   1 
ATOM 2897 C CA  . PRO B 2 186 ? 23.980 3.748   9.423   1.00 82.54  ? 163 PRO B CA  1 
ATOM 2898 C C   . PRO B 2 186 ? 23.761 4.914   10.387  1.00 86.57  ? 163 PRO B C   1 
ATOM 2899 O O   . PRO B 2 186 ? 22.682 5.509   10.380  1.00 88.04  ? 163 PRO B O   1 
ATOM 2900 C CB  . PRO B 2 186 ? 23.828 4.250   7.981   1.00 81.41  ? 163 PRO B CB  1 
ATOM 2901 C CG  . PRO B 2 186 ? 22.496 3.686   7.491   1.00 79.84  ? 163 PRO B CG  1 
ATOM 2902 C CD  . PRO B 2 186 ? 22.281 2.417   8.239   1.00 78.37  ? 163 PRO B CD  1 
ATOM 2903 N N   . GLN B 2 187 ? 24.767 5.240   11.203  1.00 89.03  ? 164 GLN B N   1 
ATOM 2904 C CA  . GLN B 2 187 ? 24.593 6.271   12.235  1.00 92.83  ? 164 GLN B CA  1 
ATOM 2905 C C   . GLN B 2 187 ? 24.769 7.666   11.655  1.00 94.45  ? 164 GLN B C   1 
ATOM 2906 O O   . GLN B 2 187 ? 23.839 8.479   11.716  1.00 96.10  ? 164 GLN B O   1 
ATOM 2907 C CB  . GLN B 2 187 ? 25.533 6.061   13.436  1.00 94.56  ? 164 GLN B CB  1 
ATOM 2908 C CG  . GLN B 2 187 ? 24.981 6.576   14.788  1.00 98.21  ? 164 GLN B CG  1 
ATOM 2909 C CD  . GLN B 2 187 ? 25.082 8.107   14.988  1.00 102.43 ? 164 GLN B CD  1 
ATOM 2910 O OE1 . GLN B 2 187 ? 24.114 8.749   15.401  1.00 104.11 ? 164 GLN B OE1 1 
ATOM 2911 N NE2 . GLN B 2 187 ? 26.257 8.684   14.713  1.00 103.46 ? 164 GLN B NE2 1 
ATOM 2912 N N   . GLN B 2 188 ? 25.957 7.938   11.104  1.00 94.47  ? 165 GLN B N   1 
ATOM 2913 C CA  . GLN B 2 188 ? 26.320 9.283   10.608  1.00 96.09  ? 165 GLN B CA  1 
ATOM 2914 C C   . GLN B 2 188 ? 27.446 9.298   9.558   1.00 94.38  ? 165 GLN B C   1 
ATOM 2915 O O   . GLN B 2 188 ? 27.166 9.453   8.365   1.00 93.41  ? 165 GLN B O   1 
ATOM 2916 C CB  . GLN B 2 188 ? 26.633 10.241  11.766  1.00 99.49  ? 165 GLN B CB  1 
ATOM 2917 C CG  . GLN B 2 188 ? 27.101 11.643  11.336  1.00 103.35 ? 165 GLN B CG  1 
ATOM 2918 C CD  . GLN B 2 188 ? 26.027 12.463  10.617  1.00 105.14 ? 165 GLN B CD  1 
ATOM 2919 O OE1 . GLN B 2 188 ? 25.530 12.078  9.545   1.00 102.63 ? 165 GLN B OE1 1 
ATOM 2920 N NE2 . GLN B 2 188 ? 25.685 13.618  11.197  1.00 108.32 ? 165 GLN B NE2 1 
ATOM 2921 N N   . GLY B 2 189 ? 28.699 9.140   9.994   1.00 94.30  ? 166 GLY B N   1 
ATOM 2922 C CA  . GLY B 2 189 ? 29.854 9.171   9.077   1.00 92.86  ? 166 GLY B CA  1 
ATOM 2923 C C   . GLY B 2 189 ? 30.348 7.804   8.614   1.00 89.83  ? 166 GLY B C   1 
ATOM 2924 O O   . GLY B 2 189 ? 31.501 7.657   8.195   1.00 89.35  ? 166 GLY B O   1 
ATOM 2925 N N   . ASP B 2 190 ? 29.446 6.820   8.654   1.00 87.66  ? 167 ASP B N   1 
ATOM 2926 C CA  . ASP B 2 190 ? 29.780 5.388   8.558   1.00 84.88  ? 167 ASP B CA  1 
ATOM 2927 C C   . ASP B 2 190 ? 30.301 4.872   7.210   1.00 82.09  ? 167 ASP B C   1 
ATOM 2928 O O   . ASP B 2 190 ? 29.719 5.137   6.133   1.00 80.91  ? 167 ASP B O   1 
ATOM 2929 C CB  . ASP B 2 190 ? 28.581 4.540   9.016   1.00 83.69  ? 167 ASP B CB  1 
ATOM 2930 C CG  . ASP B 2 190 ? 28.225 4.776   10.476  1.00 86.00  ? 167 ASP B CG  1 
ATOM 2931 O OD1 . ASP B 2 190 ? 27.181 4.260   10.917  1.00 85.43  ? 167 ASP B OD1 1 
ATOM 2932 O OD2 . ASP B 2 190 ? 28.990 5.482   11.183  1.00 88.27  ? 167 ASP B OD2 1 
ATOM 2933 N N   . VAL B 2 191 ? 31.415 4.128   7.294   1.00 80.99  ? 168 VAL B N   1 
ATOM 2934 C CA  . VAL B 2 191 ? 31.976 3.476   6.121   1.00 78.38  ? 168 VAL B CA  1 
ATOM 2935 C C   . VAL B 2 191 ? 31.901 1.971   6.271   1.00 76.17  ? 168 VAL B C   1 
ATOM 2936 O O   . VAL B 2 191 ? 32.403 1.389   7.237   1.00 77.07  ? 168 VAL B O   1 
ATOM 2937 C CB  . VAL B 2 191 ? 33.419 3.974   5.775   1.00 79.49  ? 168 VAL B CB  1 
ATOM 2938 C CG1 . VAL B 2 191 ? 34.186 2.962   4.913   1.00 77.00  ? 168 VAL B CG1 1 
ATOM 2939 C CG2 . VAL B 2 191 ? 33.340 5.307   5.048   1.00 80.31  ? 168 VAL B CG2 1 
ATOM 2940 N N   . TYR B 2 192 ? 31.237 1.364   5.300   1.00 73.21  ? 169 TYR B N   1 
ATOM 2941 C CA  . TYR B 2 192 ? 31.121 -0.060  5.224   1.00 70.89  ? 169 TYR B CA  1 
ATOM 2942 C C   . TYR B 2 192 ? 31.984 -0.538  4.067   1.00 68.58  ? 169 TYR B C   1 
ATOM 2943 O O   . TYR B 2 192 ? 31.960 0.045   2.978   1.00 67.88  ? 169 TYR B O   1 
ATOM 2944 C CB  . TYR B 2 192 ? 29.650 -0.432  5.007   1.00 70.03  ? 169 TYR B CB  1 
ATOM 2945 C CG  . TYR B 2 192 ? 28.748 -0.075  6.178   1.00 72.97  ? 169 TYR B CG  1 
ATOM 2946 C CD1 . TYR B 2 192 ? 28.104 1.176   6.260   1.00 75.16  ? 169 TYR B CD1 1 
ATOM 2947 C CD2 . TYR B 2 192 ? 28.536 -0.991  7.209   1.00 74.33  ? 169 TYR B CD2 1 
ATOM 2948 C CE1 . TYR B 2 192 ? 27.262 1.491   7.348   1.00 76.73  ? 169 TYR B CE1 1 
ATOM 2949 C CE2 . TYR B 2 192 ? 27.706 -0.681  8.294   1.00 76.51  ? 169 TYR B CE2 1 
ATOM 2950 C CZ  . TYR B 2 192 ? 27.080 0.557   8.363   1.00 77.61  ? 169 TYR B CZ  1 
ATOM 2951 O OH  . TYR B 2 192 ? 26.267 0.826   9.448   1.00 80.56  ? 169 TYR B OH  1 
ATOM 2952 N N   . THR B 2 193 ? 32.746 -1.597  4.298   1.00 67.03  ? 170 THR B N   1 
ATOM 2953 C CA  . THR B 2 193 ? 33.607 -2.110  3.261   1.00 65.27  ? 170 THR B CA  1 
ATOM 2954 C C   . THR B 2 193 ? 33.438 -3.595  3.142   1.00 63.06  ? 170 THR B C   1 
ATOM 2955 O O   . THR B 2 193 ? 33.371 -4.306  4.147   1.00 63.14  ? 170 THR B O   1 
ATOM 2956 C CB  . THR B 2 193 ? 35.070 -1.807  3.553   1.00 67.15  ? 170 THR B CB  1 
ATOM 2957 O OG1 . THR B 2 193 ? 35.151 -0.807  4.577   1.00 69.99  ? 170 THR B OG1 1 
ATOM 2958 C CG2 . THR B 2 193 ? 35.773 -1.312  2.286   1.00 66.72  ? 170 THR B CG2 1 
ATOM 2959 N N   . CYS B 2 194 ? 33.348 -4.050  1.896   1.00 61.05  ? 171 CYS B N   1 
ATOM 2960 C CA  . CYS B 2 194 ? 33.256 -5.466  1.575   1.00 58.80  ? 171 CYS B CA  1 
ATOM 2961 C C   . CYS B 2 194 ? 34.594 -5.853  1.028   1.00 58.75  ? 171 CYS B C   1 
ATOM 2962 O O   . CYS B 2 194 ? 35.091 -5.197  0.109   1.00 59.59  ? 171 CYS B O   1 
ATOM 2963 C CB  . CYS B 2 194 ? 32.212 -5.710  0.490   1.00 56.96  ? 171 CYS B CB  1 
ATOM 2964 S SG  . CYS B 2 194 ? 32.117 -7.446  -0.021  1.00 54.95  ? 171 CYS B SG  1 
ATOM 2965 N N   . GLN B 2 195 ? 35.177 -6.914  1.569   1.00 58.20  ? 172 GLN B N   1 
ATOM 2966 C CA  . GLN B 2 195 ? 36.510 -7.345  1.160   1.00 58.01  ? 172 GLN B CA  1 
ATOM 2967 C C   . GLN B 2 195 ? 36.521 -8.775  0.692   1.00 56.02  ? 172 GLN B C   1 
ATOM 2968 O O   . GLN B 2 195 ? 35.913 -9.639  1.313   1.00 55.66  ? 172 GLN B O   1 
ATOM 2969 C CB  . GLN B 2 195 ? 37.499 -7.149  2.307   1.00 60.72  ? 172 GLN B CB  1 
ATOM 2970 C CG  . GLN B 2 195 ? 38.654 -8.150  2.348   1.00 61.52  ? 172 GLN B CG  1 
ATOM 2971 C CD  . GLN B 2 195 ? 39.734 -7.738  3.314   1.00 63.11  ? 172 GLN B CD  1 
ATOM 2972 O OE1 . GLN B 2 195 ? 40.350 -6.686  3.160   1.00 65.32  ? 172 GLN B OE1 1 
ATOM 2973 N NE2 . GLN B 2 195 ? 39.979 -8.569  4.316   1.00 64.09  ? 172 GLN B NE2 1 
ATOM 2974 N N   . VAL B 2 196 ? 37.211 -9.028  -0.412  1.00 55.17  ? 173 VAL B N   1 
ATOM 2975 C CA  . VAL B 2 196 ? 37.186 -10.364 -1.020  1.00 53.45  ? 173 VAL B CA  1 
ATOM 2976 C C   . VAL B 2 196 ? 38.597 -10.981 -1.127  1.00 54.37  ? 173 VAL B C   1 
ATOM 2977 O O   . VAL B 2 196 ? 39.514 -10.339 -1.611  1.00 55.11  ? 173 VAL B O   1 
ATOM 2978 C CB  . VAL B 2 196 ? 36.379 -10.392 -2.381  1.00 51.31  ? 173 VAL B CB  1 
ATOM 2979 C CG1 . VAL B 2 196 ? 35.028 -9.675  -2.242  1.00 50.06  ? 173 VAL B CG1 1 
ATOM 2980 C CG2 . VAL B 2 196 ? 37.150 -9.751  -3.500  1.00 51.65  ? 173 VAL B CG2 1 
ATOM 2981 N N   . GLU B 2 197 ? 38.756 -12.205 -0.621  1.00 54.86  ? 174 GLU B N   1 
ATOM 2982 C CA  . GLU B 2 197 ? 40.016 -12.946 -0.674  1.00 56.43  ? 174 GLU B CA  1 
ATOM 2983 C C   . GLU B 2 197 ? 39.831 -14.129 -1.609  1.00 54.57  ? 174 GLU B C   1 
ATOM 2984 O O   . GLU B 2 197 ? 38.949 -14.971 -1.376  1.00 53.73  ? 174 GLU B O   1 
ATOM 2985 C CB  . GLU B 2 197 ? 40.409 -13.494 0.712   1.00 58.55  ? 174 GLU B CB  1 
ATOM 2986 C CG  . GLU B 2 197 ? 40.449 -12.490 1.897   1.00 63.11  ? 174 GLU B CG  1 
ATOM 2987 C CD  . GLU B 2 197 ? 39.817 -13.061 3.200   1.00 66.44  ? 174 GLU B CD  1 
ATOM 2988 O OE1 . GLU B 2 197 ? 38.599 -13.390 3.204   1.00 65.83  ? 174 GLU B OE1 1 
ATOM 2989 O OE2 . GLU B 2 197 ? 40.534 -13.172 4.223   1.00 68.67  ? 174 GLU B OE2 1 
ATOM 2990 N N   . HIS B 2 198 ? 40.674 -14.209 -2.638  1.00 54.38  ? 175 HIS B N   1 
ATOM 2991 C CA  . HIS B 2 198 ? 40.599 -15.269 -3.642  1.00 53.04  ? 175 HIS B CA  1 
ATOM 2992 C C   . HIS B 2 198 ? 41.961 -15.518 -4.287  1.00 54.61  ? 175 HIS B C   1 
ATOM 2993 O O   . HIS B 2 198 ? 42.644 -14.567 -4.634  1.00 55.68  ? 175 HIS B O   1 
ATOM 2994 C CB  . HIS B 2 198 ? 39.566 -14.866 -4.714  1.00 51.42  ? 175 HIS B CB  1 
ATOM 2995 C CG  . HIS B 2 198 ? 39.239 -15.953 -5.689  1.00 47.71  ? 175 HIS B CG  1 
ATOM 2996 N ND1 . HIS B 2 198 ? 39.623 -15.901 -7.012  1.00 44.24  ? 175 HIS B ND1 1 
ATOM 2997 C CD2 . HIS B 2 198 ? 38.580 -17.127 -5.528  1.00 44.08  ? 175 HIS B CD2 1 
ATOM 2998 C CE1 . HIS B 2 198 ? 39.215 -16.999 -7.623  1.00 44.10  ? 175 HIS B CE1 1 
ATOM 2999 N NE2 . HIS B 2 198 ? 38.583 -17.762 -6.744  1.00 43.07  ? 175 HIS B NE2 1 
ATOM 3000 N N   . THR B 2 199 ? 42.338 -16.789 -4.460  1.00 55.51  ? 176 THR B N   1 
ATOM 3001 C CA  . THR B 2 199 ? 43.641 -17.191 -5.040  1.00 58.06  ? 176 THR B CA  1 
ATOM 3002 C C   . THR B 2 199 ? 44.002 -16.482 -6.338  1.00 58.72  ? 176 THR B C   1 
ATOM 3003 O O   . THR B 2 199 ? 45.173 -16.211 -6.577  1.00 60.85  ? 176 THR B O   1 
ATOM 3004 C CB  . THR B 2 199 ? 43.753 -18.709 -5.370  1.00 57.29  ? 176 THR B CB  1 
ATOM 3005 O OG1 . THR B 2 199 ? 42.764 -19.462 -4.665  1.00 58.95  ? 176 THR B OG1 1 
ATOM 3006 C CG2 . THR B 2 199 ? 45.151 -19.245 -5.030  1.00 59.85  ? 176 THR B CG2 1 
ATOM 3007 N N   . SER B 2 200 ? 43.017 -16.203 -7.190  1.00 57.93  ? 177 SER B N   1 
ATOM 3008 C CA  . SER B 2 200 ? 43.269 -15.447 -8.430  1.00 58.83  ? 177 SER B CA  1 
ATOM 3009 C C   . SER B 2 200 ? 43.912 -14.073 -8.195  1.00 60.83  ? 177 SER B C   1 
ATOM 3010 O O   . SER B 2 200 ? 44.435 -13.466 -9.129  1.00 61.10  ? 177 SER B O   1 
ATOM 3011 C CB  . SER B 2 200 ? 41.976 -15.291 -9.251  1.00 57.42  ? 177 SER B CB  1 
ATOM 3012 O OG  . SER B 2 200 ? 40.985 -14.544 -8.554  1.00 57.54  ? 177 SER B OG  1 
ATOM 3013 N N   . LEU B 2 201 ? 43.871 -13.612 -6.942  1.00 62.36  ? 178 LEU B N   1 
ATOM 3014 C CA  . LEU B 2 201 ? 44.340 -12.283 -6.542  1.00 64.99  ? 178 LEU B CA  1 
ATOM 3015 C C   . LEU B 2 201 ? 45.546 -12.269 -5.566  1.00 68.23  ? 178 LEU B C   1 
ATOM 3016 O O   . LEU B 2 201 ? 45.431 -12.588 -4.358  1.00 68.80  ? 178 LEU B O   1 
ATOM 3017 C CB  . LEU B 2 201 ? 43.192 -11.477 -5.916  1.00 64.04  ? 178 LEU B CB  1 
ATOM 3018 C CG  . LEU B 2 201 ? 41.852 -11.209 -6.598  1.00 61.30  ? 178 LEU B CG  1 
ATOM 3019 C CD1 . LEU B 2 201 ? 40.838 -10.910 -5.510  1.00 60.18  ? 178 LEU B CD1 1 
ATOM 3020 C CD2 . LEU B 2 201 ? 41.904 -10.071 -7.610  1.00 59.65  ? 178 LEU B CD2 1 
ATOM 3021 N N   . ASP B 2 202 ? 46.697 -11.863 -6.090  1.00 70.76  ? 179 ASP B N   1 
ATOM 3022 C CA  . ASP B 2 202 ? 47.846 -11.528 -5.252  1.00 74.37  ? 179 ASP B CA  1 
ATOM 3023 C C   . ASP B 2 202 ? 47.409 -10.755 -3.995  1.00 75.57  ? 179 ASP B C   1 
ATOM 3024 O O   . ASP B 2 202 ? 47.969 -10.955 -2.914  1.00 77.75  ? 179 ASP B O   1 
ATOM 3025 C CB  . ASP B 2 202 ? 48.852 -10.696 -6.062  1.00 76.30  ? 179 ASP B CB  1 
ATOM 3026 C CG  . ASP B 2 202 ? 48.172 -9.621  -6.910  1.00 76.16  ? 179 ASP B CG  1 
ATOM 3027 O OD1 . ASP B 2 202 ? 47.030 -9.867  -7.374  1.00 74.91  ? 179 ASP B OD1 1 
ATOM 3028 O OD2 . ASP B 2 202 ? 48.769 -8.539  -7.112  1.00 77.63  ? 179 ASP B OD2 1 
ATOM 3029 N N   . SER B 2 203 ? 46.396 -9.894  -4.149  1.00 74.66  ? 180 SER B N   1 
ATOM 3030 C CA  . SER B 2 203 ? 45.921 -8.990  -3.091  1.00 75.36  ? 180 SER B CA  1 
ATOM 3031 C C   . SER B 2 203 ? 44.380 -8.939  -2.981  1.00 73.07  ? 180 SER B C   1 
ATOM 3032 O O   . SER B 2 203 ? 43.700 -8.698  -3.994  1.00 71.78  ? 180 SER B O   1 
ATOM 3033 C CB  . SER B 2 203 ? 46.463 -7.581  -3.349  1.00 77.24  ? 180 SER B CB  1 
ATOM 3034 O OG  . SER B 2 203 ? 45.506 -6.592  -2.988  1.00 77.49  ? 180 SER B OG  1 
ATOM 3035 N N   . PRO B 2 204 ? 43.823 -9.158  -1.757  1.00 72.63  ? 181 PRO B N   1 
ATOM 3036 C CA  . PRO B 2 204 ? 42.366 -9.018  -1.514  1.00 70.23  ? 181 PRO B CA  1 
ATOM 3037 C C   . PRO B 2 204 ? 41.784 -7.686  -2.042  1.00 69.49  ? 181 PRO B C   1 
ATOM 3038 O O   . PRO B 2 204 ? 42.413 -6.635  -1.888  1.00 71.43  ? 181 PRO B O   1 
ATOM 3039 C CB  . PRO B 2 204 ? 42.252 -9.086  0.015   1.00 71.26  ? 181 PRO B CB  1 
ATOM 3040 C CG  . PRO B 2 204 ? 43.435 -9.867  0.460   1.00 72.97  ? 181 PRO B CG  1 
ATOM 3041 C CD  . PRO B 2 204 ? 44.533 -9.684  -0.570  1.00 74.29  ? 181 PRO B CD  1 
ATOM 3042 N N   . VAL B 2 205 ? 40.605 -7.751  -2.664  1.00 66.51  ? 182 VAL B N   1 
ATOM 3043 C CA  . VAL B 2 205 ? 39.947 -6.598  -3.314  1.00 65.24  ? 182 VAL B CA  1 
ATOM 3044 C C   . VAL B 2 205 ? 38.869 -6.019  -2.397  1.00 64.56  ? 182 VAL B C   1 
ATOM 3045 O O   . VAL B 2 205 ? 38.216 -6.765  -1.672  1.00 63.52  ? 182 VAL B O   1 
ATOM 3046 C CB  . VAL B 2 205 ? 39.328 -7.020  -4.696  1.00 63.27  ? 182 VAL B CB  1 
ATOM 3047 C CG1 . VAL B 2 205 ? 38.234 -6.051  -5.195  1.00 62.54  ? 182 VAL B CG1 1 
ATOM 3048 C CG2 . VAL B 2 205 ? 40.410 -7.178  -5.728  1.00 63.64  ? 182 VAL B CG2 1 
ATOM 3049 N N   . THR B 2 206 ? 38.690 -4.698  -2.432  1.00 64.95  ? 183 THR B N   1 
ATOM 3050 C CA  . THR B 2 206 ? 37.677 -4.023  -1.606  1.00 64.70  ? 183 THR B CA  1 
ATOM 3051 C C   . THR B 2 206 ? 36.858 -2.991  -2.376  1.00 65.07  ? 183 THR B C   1 
ATOM 3052 O O   . THR B 2 206 ? 37.352 -2.346  -3.313  1.00 65.77  ? 183 THR B O   1 
ATOM 3053 C CB  . THR B 2 206 ? 38.264 -3.340  -0.335  1.00 66.47  ? 183 THR B CB  1 
ATOM 3054 O OG1 . THR B 2 206 ? 39.307 -2.424  -0.701  1.00 67.56  ? 183 THR B OG1 1 
ATOM 3055 C CG2 . THR B 2 206 ? 38.782 -4.370  0.659   1.00 65.07  ? 183 THR B CG2 1 
ATOM 3056 N N   . VAL B 2 207 ? 35.602 -2.854  -1.967  1.00 64.71  ? 184 VAL B N   1 
ATOM 3057 C CA  . VAL B 2 207 ? 34.686 -1.874  -2.526  1.00 65.52  ? 184 VAL B CA  1 
ATOM 3058 C C   . VAL B 2 207 ? 33.801 -1.393  -1.382  1.00 66.62  ? 184 VAL B C   1 
ATOM 3059 O O   . VAL B 2 207 ? 33.349 -2.194  -0.556  1.00 65.62  ? 184 VAL B O   1 
ATOM 3060 C CB  . VAL B 2 207 ? 33.866 -2.456  -3.708  1.00 63.66  ? 184 VAL B CB  1 
ATOM 3061 C CG1 . VAL B 2 207 ? 33.517 -3.897  -3.438  1.00 62.57  ? 184 VAL B CG1 1 
ATOM 3062 C CG2 . VAL B 2 207 ? 32.605 -1.623  -4.000  1.00 63.76  ? 184 VAL B CG2 1 
ATOM 3063 N N   . GLU B 2 208 ? 33.584 -0.078  -1.349  1.00 68.73  ? 185 GLU B N   1 
ATOM 3064 C CA  . GLU B 2 208 ? 33.062 0.623   -0.178  1.00 70.76  ? 185 GLU B CA  1 
ATOM 3065 C C   . GLU B 2 208 ? 31.657 1.197   -0.360  1.00 71.07  ? 185 GLU B C   1 
ATOM 3066 O O   . GLU B 2 208 ? 31.241 1.532   -1.475  1.00 71.04  ? 185 GLU B O   1 
ATOM 3067 C CB  . GLU B 2 208 ? 34.009 1.762   0.207   1.00 73.23  ? 185 GLU B CB  1 
ATOM 3068 C CG  . GLU B 2 208 ? 34.083 2.912   -0.821  1.00 75.46  ? 185 GLU B CG  1 
ATOM 3069 C CD  . GLU B 2 208 ? 34.852 4.156   -0.324  1.00 80.30  ? 185 GLU B CD  1 
ATOM 3070 O OE1 . GLU B 2 208 ? 34.718 4.576   0.867   1.00 81.01  ? 185 GLU B OE1 1 
ATOM 3071 O OE2 . GLU B 2 208 ? 35.582 4.737   -1.160  1.00 82.63  ? 185 GLU B OE2 1 
ATOM 3072 N N   . TRP B 2 209 ? 30.930 1.309   0.746   1.00 71.63  ? 186 TRP B N   1 
ATOM 3073 C CA  . TRP B 2 209 ? 29.724 2.118   0.762   1.00 72.51  ? 186 TRP B CA  1 
ATOM 3074 C C   . TRP B 2 209 ? 29.886 3.196   1.805   1.00 74.59  ? 186 TRP B C   1 
ATOM 3075 O O   . TRP B 2 209 ? 30.024 2.904   3.005   1.00 75.10  ? 186 TRP B O   1 
ATOM 3076 C CB  . TRP B 2 209 ? 28.495 1.281   1.093   1.00 71.62  ? 186 TRP B CB  1 
ATOM 3077 C CG  . TRP B 2 209 ? 27.259 2.040   1.345   1.00 73.99  ? 186 TRP B CG  1 
ATOM 3078 C CD1 . TRP B 2 209 ? 26.862 2.484   2.536   1.00 76.34  ? 186 TRP B CD1 1 
ATOM 3079 C CD2 . TRP B 2 209 ? 26.240 2.328   0.391   1.00 75.27  ? 186 TRP B CD2 1 
ATOM 3080 N NE1 . TRP B 2 209 ? 25.660 3.089   2.367   1.00 77.99  ? 186 TRP B NE1 1 
ATOM 3081 C CE2 . TRP B 2 209 ? 25.251 2.942   1.063   1.00 77.69  ? 186 TRP B CE2 1 
ATOM 3082 C CE3 . TRP B 2 209 ? 26.072 2.087   -0.979  1.00 74.66  ? 186 TRP B CE3 1 
ATOM 3083 C CZ2 . TRP B 2 209 ? 24.099 3.372   0.415   1.00 78.82  ? 186 TRP B CZ2 1 
ATOM 3084 C CZ3 . TRP B 2 209 ? 24.935 2.543   -1.620  1.00 75.95  ? 186 TRP B CZ3 1 
ATOM 3085 C CH2 . TRP B 2 209 ? 23.961 3.205   -0.925  1.00 78.58  ? 186 TRP B CH2 1 
ATOM 3086 N N   . LYS B 2 210 ? 29.871 4.443   1.326   1.00 75.75  ? 187 LYS B N   1 
ATOM 3087 C CA  . LYS B 2 210 ? 29.832 5.598   2.202   1.00 77.85  ? 187 LYS B CA  1 
ATOM 3088 C C   . LYS B 2 210 ? 28.415 5.825   2.696   1.00 78.15  ? 187 LYS B C   1 
ATOM 3089 O O   . LYS B 2 210 ? 27.456 5.951   1.882   1.00 77.45  ? 187 LYS B O   1 
ATOM 3090 C CB  . LYS B 2 210 ? 30.343 6.837   1.477   1.00 79.39  ? 187 LYS B CB  1 
ATOM 3091 C CG  . LYS B 2 210 ? 31.807 7.175   1.740   1.00 79.97  ? 187 LYS B CG  1 
ATOM 3092 C CD  . LYS B 2 210 ? 32.157 8.506   1.067   1.00 80.58  ? 187 LYS B CD  1 
ATOM 3093 C CE  . LYS B 2 210 ? 33.419 9.154   1.628   1.00 81.67  ? 187 LYS B CE  1 
ATOM 3094 N NZ  . LYS B 2 210 ? 33.327 10.657  1.569   1.00 82.11  ? 187 LYS B NZ  1 
ATOM 3095 N N   . ALA B 2 211 ? 28.278 5.856   4.031   1.00 79.44  ? 188 ALA B N   1 
ATOM 3096 C CA  . ALA B 2 211 ? 26.963 6.028   4.610   1.00 80.51  ? 188 ALA B CA  1 
ATOM 3097 C C   . ALA B 2 211 ? 26.745 7.450   5.073   1.00 83.74  ? 188 ALA B C   1 
ATOM 3098 O O   . ALA B 2 211 ? 26.257 7.665   6.187   1.00 85.46  ? 188 ALA B O   1 
ATOM 3099 C CB  . ALA B 2 211 ? 26.765 5.067   5.757   1.00 80.03  ? 188 ALA B CB  1 
ATOM 3100 N N   . GLN B 2 212 ? 27.120 8.429   4.246   1.00 84.93  ? 189 GLN B N   1 
ATOM 3101 C CA  . GLN B 2 212 ? 26.676 9.798   4.516   1.00 88.08  ? 189 GLN B CA  1 
ATOM 3102 C C   . GLN B 2 212 ? 25.168 9.823   4.272   1.00 87.96  ? 189 GLN B C   1 
ATOM 3103 O O   . GLN B 2 212 ? 24.415 10.406  5.066   1.00 89.74  ? 189 GLN B O   1 
ATOM 3104 C CB  . GLN B 2 212 ? 27.424 10.871  3.686   1.00 89.56  ? 189 GLN B CB  1 
ATOM 3105 C CG  . GLN B 2 212 ? 26.838 12.308  3.825   1.00 92.69  ? 189 GLN B CG  1 
ATOM 3106 C CD  . GLN B 2 212 ? 27.877 13.436  3.747   1.00 95.95  ? 189 GLN B CD  1 
ATOM 3107 O OE1 . GLN B 2 212 ? 28.889 13.337  3.040   1.00 95.43  ? 189 GLN B OE1 1 
ATOM 3108 N NE2 . GLN B 2 212 ? 27.615 14.526  4.476   1.00 97.88  ? 189 GLN B NE2 1 
ATOM 3109 O OXT . GLN B 2 212 ? 24.692 9.217   3.297   1.00 85.89  ? 189 GLN B OXT 1 
ATOM 3110 N N   . ILE C 1 1   ? 48.874 7.962   -52.296 1.00 46.18  ? 1   ILE D N   1 
ATOM 3111 C CA  . ILE C 1 1   ? 50.040 8.813   -51.913 1.00 46.16  ? 1   ILE D CA  1 
ATOM 3112 C C   . ILE C 1 1   ? 51.350 8.017   -51.836 1.00 46.70  ? 1   ILE D C   1 
ATOM 3113 O O   . ILE C 1 1   ? 52.439 8.598   -51.975 1.00 48.01  ? 1   ILE D O   1 
ATOM 3114 C CB  . ILE C 1 1   ? 49.781 9.530   -50.572 1.00 45.23  ? 1   ILE D CB  1 
ATOM 3115 C CG1 . ILE C 1 1   ? 49.167 10.909  -50.804 1.00 44.96  ? 1   ILE D CG1 1 
ATOM 3116 C CG2 . ILE C 1 1   ? 51.052 9.675   -49.769 1.00 44.90  ? 1   ILE D CG2 1 
ATOM 3117 C CD1 . ILE C 1 1   ? 47.668 10.908  -50.888 1.00 44.89  ? 1   ILE D CD1 1 
ATOM 3118 N N   . LYS C 1 2   ? 51.258 6.699   -51.647 1.00 45.67  ? 2   LYS D N   1 
ATOM 3119 C CA  . LYS C 1 2   ? 52.456 5.841   -51.457 1.00 45.45  ? 2   LYS D CA  1 
ATOM 3120 C C   . LYS C 1 2   ? 52.995 6.144   -50.092 1.00 43.77  ? 2   LYS D C   1 
ATOM 3121 O O   . LYS C 1 2   ? 53.308 7.290   -49.771 1.00 43.47  ? 2   LYS D O   1 
ATOM 3122 C CB  . LYS C 1 2   ? 53.577 6.089   -52.478 1.00 47.01  ? 2   LYS D CB  1 
ATOM 3123 C CG  . LYS C 1 2   ? 53.441 5.387   -53.835 1.00 49.63  ? 2   LYS D CG  1 
ATOM 3124 C CD  . LYS C 1 2   ? 54.100 6.252   -54.895 1.00 53.96  ? 2   LYS D CD  1 
ATOM 3125 C CE  . LYS C 1 2   ? 53.334 7.590   -55.059 1.00 56.71  ? 2   LYS D CE  1 
ATOM 3126 N NZ  . LYS C 1 2   ? 54.215 8.813   -55.087 1.00 56.44  ? 2   LYS D NZ  1 
ATOM 3127 N N   . ALA C 1 3   ? 53.085 5.112   -49.279 1.00 41.62  ? 3   ALA D N   1 
ATOM 3128 C CA  . ALA C 1 3   ? 53.467 5.294   -47.922 1.00 39.64  ? 3   ALA D CA  1 
ATOM 3129 C C   . ALA C 1 3   ? 53.777 3.901   -47.423 1.00 39.47  ? 3   ALA D C   1 
ATOM 3130 O O   . ALA C 1 3   ? 53.143 2.921   -47.835 1.00 39.46  ? 3   ALA D O   1 
ATOM 3131 C CB  . ALA C 1 3   ? 52.329 5.916   -47.144 1.00 37.31  ? 3   ALA D CB  1 
ATOM 3132 N N   . ASP C 1 4   ? 54.764 3.789   -46.552 1.00 38.90  ? 4   ASP D N   1 
ATOM 3133 C CA  . ASP C 1 4   ? 54.978 2.502   -45.937 1.00 38.77  ? 4   ASP D CA  1 
ATOM 3134 C C   . ASP C 1 4   ? 53.721 2.196   -45.074 1.00 36.70  ? 4   ASP D C   1 
ATOM 3135 O O   . ASP C 1 4   ? 53.250 1.053   -45.028 1.00 37.05  ? 4   ASP D O   1 
ATOM 3136 C CB  . ASP C 1 4   ? 56.311 2.469   -45.177 1.00 39.51  ? 4   ASP D CB  1 
ATOM 3137 C CG  . ASP C 1 4   ? 57.525 2.871   -46.077 1.00 43.36  ? 4   ASP D CG  1 
ATOM 3138 O OD1 . ASP C 1 4   ? 57.951 2.075   -46.960 1.00 46.53  ? 4   ASP D OD1 1 
ATOM 3139 O OD2 . ASP C 1 4   ? 58.067 3.994   -45.902 1.00 43.36  ? 4   ASP D OD2 1 
ATOM 3140 N N   . HIS C 1 5   ? 53.153 3.239   -44.466 1.00 34.26  ? 5   HIS D N   1 
ATOM 3141 C CA  . HIS C 1 5   ? 52.022 3.129   -43.543 1.00 31.56  ? 5   HIS D CA  1 
ATOM 3142 C C   . HIS C 1 5   ? 51.155 4.397   -43.565 1.00 29.93  ? 5   HIS D C   1 
ATOM 3143 O O   . HIS C 1 5   ? 51.674 5.500   -43.645 1.00 28.64  ? 5   HIS D O   1 
ATOM 3144 C CB  . HIS C 1 5   ? 52.509 2.834   -42.101 1.00 31.37  ? 5   HIS D CB  1 
ATOM 3145 C CG  . HIS C 1 5   ? 53.415 1.640   -41.999 1.00 31.83  ? 5   HIS D CG  1 
ATOM 3146 N ND1 . HIS C 1 5   ? 52.952 0.373   -41.703 1.00 32.34  ? 5   HIS D ND1 1 
ATOM 3147 C CD2 . HIS C 1 5   ? 54.750 1.513   -42.195 1.00 27.83  ? 5   HIS D CD2 1 
ATOM 3148 C CE1 . HIS C 1 5   ? 53.967 -0.475  -41.706 1.00 30.07  ? 5   HIS D CE1 1 
ATOM 3149 N NE2 . HIS C 1 5   ? 55.065 0.193   -42.002 1.00 27.04  ? 5   HIS D NE2 1 
ATOM 3150 N N   . VAL C 1 6   ? 49.835 4.203   -43.505 1.00 29.42  ? 6   VAL D N   1 
ATOM 3151 C CA  . VAL C 1 6   ? 48.872 5.269   -43.251 1.00 29.90  ? 6   VAL D CA  1 
ATOM 3152 C C   . VAL C 1 6   ? 48.176 5.030   -41.908 1.00 30.84  ? 6   VAL D C   1 
ATOM 3153 O O   . VAL C 1 6   ? 47.425 4.068   -41.754 1.00 31.40  ? 6   VAL D O   1 
ATOM 3154 C CB  . VAL C 1 6   ? 47.738 5.345   -44.343 1.00 29.37  ? 6   VAL D CB  1 
ATOM 3155 C CG1 . VAL C 1 6   ? 46.909 6.603   -44.157 1.00 26.85  ? 6   VAL D CG1 1 
ATOM 3156 C CG2 . VAL C 1 6   ? 48.308 5.278   -45.732 1.00 28.88  ? 6   VAL D CG2 1 
ATOM 3157 N N   . SER C 1 7   ? 48.404 5.908   -40.942 1.00 32.16  ? 7   SER D N   1 
ATOM 3158 C CA  . SER C 1 7   ? 47.650 5.865   -39.677 1.00 32.62  ? 7   SER D CA  1 
ATOM 3159 C C   . SER C 1 7   ? 46.574 6.937   -39.726 1.00 32.35  ? 7   SER D C   1 
ATOM 3160 O O   . SER C 1 7   ? 46.900 8.133   -39.867 1.00 33.04  ? 7   SER D O   1 
ATOM 3161 C CB  . SER C 1 7   ? 48.582 6.158   -38.498 1.00 32.80  ? 7   SER D CB  1 
ATOM 3162 O OG  . SER C 1 7   ? 49.611 5.178   -38.428 1.00 35.08  ? 7   SER D OG  1 
ATOM 3163 N N   . THR C 1 8   ? 45.303 6.559   -39.618 1.00 31.52  ? 8   THR D N   1 
ATOM 3164 C CA  . THR C 1 8   ? 44.294 7.600   -39.704 1.00 32.07  ? 8   THR D CA  1 
ATOM 3165 C C   . THR C 1 8   ? 43.181 7.649   -38.641 1.00 31.58  ? 8   THR D C   1 
ATOM 3166 O O   . THR C 1 8   ? 42.656 6.632   -38.221 1.00 32.31  ? 8   THR D O   1 
ATOM 3167 C CB  . THR C 1 8   ? 43.640 7.688   -41.112 1.00 32.03  ? 8   THR D CB  1 
ATOM 3168 O OG1 . THR C 1 8   ? 42.548 6.798   -41.153 1.00 33.53  ? 8   THR D OG1 1 
ATOM 3169 C CG2 . THR C 1 8   ? 44.582 7.349   -42.246 1.00 32.00  ? 8   THR D CG2 1 
ATOM 3170 N N   . TYR C 1 9   ? 42.813 8.861   -38.247 1.00 31.29  ? 9   TYR D N   1 
ATOM 3171 C CA  . TYR C 1 9   ? 41.541 9.103   -37.569 1.00 31.32  ? 9   TYR D CA  1 
ATOM 3172 C C   . TYR C 1 9   ? 40.422 9.427   -38.555 1.00 31.28  ? 9   TYR D C   1 
ATOM 3173 O O   . TYR C 1 9   ? 40.546 10.349  -39.373 1.00 31.74  ? 9   TYR D O   1 
ATOM 3174 C CB  . TYR C 1 9   ? 41.663 10.260  -36.607 1.00 31.17  ? 9   TYR D CB  1 
ATOM 3175 C CG  . TYR C 1 9   ? 42.409 9.972   -35.319 1.00 30.76  ? 9   TYR D CG  1 
ATOM 3176 C CD1 . TYR C 1 9   ? 43.742 10.344  -35.182 1.00 28.76  ? 9   TYR D CD1 1 
ATOM 3177 C CD2 . TYR C 1 9   ? 41.765 9.360   -34.225 1.00 28.09  ? 9   TYR D CD2 1 
ATOM 3178 C CE1 . TYR C 1 9   ? 44.413 10.131  -34.017 1.00 30.05  ? 9   TYR D CE1 1 
ATOM 3179 C CE2 . TYR C 1 9   ? 42.440 9.123   -33.045 1.00 27.95  ? 9   TYR D CE2 1 
ATOM 3180 C CZ  . TYR C 1 9   ? 43.763 9.526   -32.943 1.00 31.47  ? 9   TYR D CZ  1 
ATOM 3181 O OH  . TYR C 1 9   ? 44.480 9.337   -31.770 1.00 35.86  ? 9   TYR D OH  1 
ATOM 3182 N N   . ALA C 1 10  ? 39.336 8.667   -38.469 1.00 30.95  ? 10  ALA D N   1 
ATOM 3183 C CA  . ALA C 1 10  ? 38.195 8.833   -39.352 1.00 30.96  ? 10  ALA D CA  1 
ATOM 3184 C C   . ALA C 1 10  ? 36.996 8.863   -38.472 1.00 32.11  ? 10  ALA D C   1 
ATOM 3185 O O   . ALA C 1 10  ? 36.841 7.985   -37.637 1.00 33.50  ? 10  ALA D O   1 
ATOM 3186 C CB  . ALA C 1 10  ? 38.079 7.674   -40.294 1.00 29.55  ? 10  ALA D CB  1 
ATOM 3187 N N   . ALA C 1 11  ? 36.135 9.858   -38.647 1.00 32.94  ? 11  ALA D N   1 
ATOM 3188 C CA  . ALA C 1 11  ? 34.918 9.946   -37.848 1.00 33.77  ? 11  ALA D CA  1 
ATOM 3189 C C   . ALA C 1 11  ? 33.792 10.518  -38.691 1.00 34.57  ? 11  ALA D C   1 
ATOM 3190 O O   . ALA C 1 11  ? 34.038 11.259  -39.661 1.00 35.02  ? 11  ALA D O   1 
ATOM 3191 C CB  . ALA C 1 11  ? 35.142 10.804  -36.617 1.00 33.83  ? 11  ALA D CB  1 
ATOM 3192 N N   . PHE C 1 12  ? 32.564 10.154  -38.331 1.00 34.58  ? 12  PHE D N   1 
ATOM 3193 C CA  . PHE C 1 12  ? 31.394 10.777  -38.914 1.00 35.24  ? 12  PHE D CA  1 
ATOM 3194 C C   . PHE C 1 12  ? 30.308 11.050  -37.850 1.00 36.39  ? 12  PHE D C   1 
ATOM 3195 O O   . PHE C 1 12  ? 30.373 10.614  -36.675 1.00 36.00  ? 12  PHE D O   1 
ATOM 3196 C CB  . PHE C 1 12  ? 30.840 9.942   -40.074 1.00 34.54  ? 12  PHE D CB  1 
ATOM 3197 C CG  . PHE C 1 12  ? 30.313 8.616   -39.646 1.00 35.25  ? 12  PHE D CG  1 
ATOM 3198 C CD1 . PHE C 1 12  ? 31.168 7.517   -39.544 1.00 34.03  ? 12  PHE D CD1 1 
ATOM 3199 C CD2 . PHE C 1 12  ? 28.963 8.465   -39.303 1.00 36.16  ? 12  PHE D CD2 1 
ATOM 3200 C CE1 . PHE C 1 12  ? 30.699 6.273   -39.123 1.00 34.17  ? 12  PHE D CE1 1 
ATOM 3201 C CE2 . PHE C 1 12  ? 28.459 7.237   -38.875 1.00 35.87  ? 12  PHE D CE2 1 
ATOM 3202 C CZ  . PHE C 1 12  ? 29.335 6.129   -38.779 1.00 37.52  ? 12  PHE D CZ  1 
ATOM 3203 N N   . VAL C 1 13  ? 29.308 11.792  -38.295 1.00 37.34  ? 13  VAL D N   1 
ATOM 3204 C CA  . VAL C 1 13  ? 28.190 12.177  -37.479 1.00 38.53  ? 13  VAL D CA  1 
ATOM 3205 C C   . VAL C 1 13  ? 27.127 12.256  -38.508 1.00 38.68  ? 13  VAL D C   1 
ATOM 3206 O O   . VAL C 1 13  ? 27.393 12.709  -39.608 1.00 38.43  ? 13  VAL D O   1 
ATOM 3207 C CB  . VAL C 1 13  ? 28.428 13.544  -36.801 1.00 39.32  ? 13  VAL D CB  1 
ATOM 3208 C CG1 . VAL C 1 13  ? 27.143 14.131  -36.350 1.00 42.84  ? 13  VAL D CG1 1 
ATOM 3209 C CG2 . VAL C 1 13  ? 29.299 13.369  -35.576 1.00 39.13  ? 13  VAL D CG2 1 
ATOM 3210 N N   . GLN C 1 14  ? 25.945 11.756  -38.179 1.00 40.12  ? 14  GLN D N   1 
ATOM 3211 C CA  . GLN C 1 14  ? 24.801 11.833  -39.085 1.00 41.74  ? 14  GLN D CA  1 
ATOM 3212 C C   . GLN C 1 14  ? 23.472 11.905  -38.313 1.00 44.18  ? 14  GLN D C   1 
ATOM 3213 O O   . GLN C 1 14  ? 23.450 11.802  -37.080 1.00 44.26  ? 14  GLN D O   1 
ATOM 3214 C CB  . GLN C 1 14  ? 24.809 10.628  -40.033 1.00 40.72  ? 14  GLN D CB  1 
ATOM 3215 C CG  . GLN C 1 14  ? 24.432 9.320   -39.348 1.00 39.58  ? 14  GLN D CG  1 
ATOM 3216 C CD  . GLN C 1 14  ? 24.494 8.147   -40.265 1.00 37.83  ? 14  GLN D CD  1 
ATOM 3217 O OE1 . GLN C 1 14  ? 24.278 8.275   -41.466 1.00 37.18  ? 14  GLN D OE1 1 
ATOM 3218 N NE2 . GLN C 1 14  ? 24.811 6.981   -39.710 1.00 38.42  ? 14  GLN D NE2 1 
ATOM 3219 N N   . THR C 1 15  ? 22.367 12.045  -39.038 1.00 46.35  ? 15  THR D N   1 
ATOM 3220 C CA  . THR C 1 15  ? 21.100 12.302  -38.386 1.00 50.23  ? 15  THR D CA  1 
ATOM 3221 C C   . THR C 1 15  ? 20.466 10.994  -37.893 1.00 51.35  ? 15  THR D C   1 
ATOM 3222 O O   . THR C 1 15  ? 19.777 10.948  -36.870 1.00 52.68  ? 15  THR D O   1 
ATOM 3223 C CB  . THR C 1 15  ? 20.140 13.093  -39.315 1.00 51.41  ? 15  THR D CB  1 
ATOM 3224 O OG1 . THR C 1 15  ? 19.861 12.320  -40.472 1.00 53.43  ? 15  THR D OG1 1 
ATOM 3225 C CG2 . THR C 1 15  ? 20.777 14.389  -39.793 1.00 51.62  ? 15  THR D CG2 1 
ATOM 3226 N N   . HIS C 1 16  ? 20.729 9.918   -38.615 1.00 51.43  ? 16  HIS D N   1 
ATOM 3227 C CA  . HIS C 1 16  ? 20.119 8.645   -38.288 1.00 52.38  ? 16  HIS D CA  1 
ATOM 3228 C C   . HIS C 1 16  ? 20.988 7.656   -37.461 1.00 51.78  ? 16  HIS D C   1 
ATOM 3229 O O   . HIS C 1 16  ? 22.217 7.794   -37.330 1.00 49.79  ? 16  HIS D O   1 
ATOM 3230 C CB  . HIS C 1 16  ? 19.597 7.982   -39.575 1.00 52.45  ? 16  HIS D CB  1 
ATOM 3231 C CG  . HIS C 1 16  ? 18.147 8.260   -39.855 1.00 55.04  ? 16  HIS D CG  1 
ATOM 3232 N ND1 . HIS C 1 16  ? 17.678 9.513   -40.194 1.00 55.43  ? 16  HIS D ND1 1 
ATOM 3233 C CD2 . HIS C 1 16  ? 17.064 7.441   -39.846 1.00 54.75  ? 16  HIS D CD2 1 
ATOM 3234 C CE1 . HIS C 1 16  ? 16.369 9.453   -40.372 1.00 56.90  ? 16  HIS D CE1 1 
ATOM 3235 N NE2 . HIS C 1 16  ? 15.974 8.207   -40.175 1.00 55.66  ? 16  HIS D NE2 1 
ATOM 3236 N N   . ARG C 1 17  ? 20.267 6.705   -36.861 1.00 53.18  ? 17  ARG D N   1 
ATOM 3237 C CA  . ARG C 1 17  ? 20.772 5.405   -36.388 1.00 53.21  ? 17  ARG D CA  1 
ATOM 3238 C C   . ARG C 1 17  ? 22.085 5.542   -35.640 1.00 51.50  ? 17  ARG D C   1 
ATOM 3239 O O   . ARG C 1 17  ? 22.052 6.119   -34.540 1.00 53.33  ? 17  ARG D O   1 
ATOM 3240 C CB  . ARG C 1 17  ? 20.813 4.382   -37.549 1.00 53.39  ? 17  ARG D CB  1 
ATOM 3241 C CG  . ARG C 1 17  ? 19.520 4.376   -38.444 1.00 57.85  ? 17  ARG D CG  1 
ATOM 3242 C CD  . ARG C 1 17  ? 18.167 4.269   -37.661 1.00 64.14  ? 17  ARG D CD  1 
ATOM 3243 N NE  . ARG C 1 17  ? 17.440 5.545   -37.565 1.00 68.81  ? 17  ARG D NE  1 
ATOM 3244 C CZ  . ARG C 1 17  ? 16.879 6.043   -36.457 1.00 71.91  ? 17  ARG D CZ  1 
ATOM 3245 N NH1 . ARG C 1 17  ? 16.928 5.379   -35.304 1.00 72.61  ? 17  ARG D NH1 1 
ATOM 3246 N NH2 . ARG C 1 17  ? 16.242 7.215   -36.510 1.00 73.67  ? 17  ARG D NH2 1 
ATOM 3247 N N   . PRO C 1 18  ? 23.236 5.056   -36.213 1.00 48.61  ? 18  PRO D N   1 
ATOM 3248 C CA  . PRO C 1 18  ? 24.495 5.346   -35.492 1.00 46.61  ? 18  PRO D CA  1 
ATOM 3249 C C   . PRO C 1 18  ? 24.853 6.838   -35.610 1.00 45.66  ? 18  PRO D C   1 
ATOM 3250 O O   . PRO C 1 18  ? 25.439 7.274   -36.596 1.00 44.95  ? 18  PRO D O   1 
ATOM 3251 C CB  . PRO C 1 18  ? 25.527 4.420   -36.165 1.00 45.15  ? 18  PRO D CB  1 
ATOM 3252 C CG  . PRO C 1 18  ? 24.964 4.103   -37.508 1.00 45.10  ? 18  PRO D CG  1 
ATOM 3253 C CD  . PRO C 1 18  ? 23.478 4.379   -37.506 1.00 46.98  ? 18  PRO D CD  1 
ATOM 3254 N N   . THR C 1 19  ? 24.443 7.597   -34.597 1.00 45.78  ? 19  THR D N   1 
ATOM 3255 C CA  . THR C 1 19  ? 24.543 9.065   -34.506 1.00 45.24  ? 19  THR D CA  1 
ATOM 3256 C C   . THR C 1 19  ? 25.899 9.629   -34.889 1.00 44.03  ? 19  THR D C   1 
ATOM 3257 O O   . THR C 1 19  ? 25.993 10.652  -35.598 1.00 44.05  ? 19  THR D O   1 
ATOM 3258 C CB  . THR C 1 19  ? 24.198 9.491   -33.055 1.00 46.28  ? 19  THR D CB  1 
ATOM 3259 O OG1 . THR C 1 19  ? 22.843 9.910   -33.021 1.00 46.87  ? 19  THR D OG1 1 
ATOM 3260 C CG2 . THR C 1 19  ? 25.088 10.626  -32.529 1.00 48.47  ? 19  THR D CG2 1 
ATOM 3261 N N   . GLY C 1 20  ? 26.936 8.955   -34.388 1.00 42.24  ? 20  GLY D N   1 
ATOM 3262 C CA  . GLY C 1 20  ? 28.312 9.348   -34.562 1.00 40.55  ? 20  GLY D CA  1 
ATOM 3263 C C   . GLY C 1 20  ? 29.221 8.146   -34.398 1.00 39.63  ? 20  GLY D C   1 
ATOM 3264 O O   . GLY C 1 20  ? 28.839 7.100   -33.844 1.00 39.72  ? 20  GLY D O   1 
ATOM 3265 N N   . GLU C 1 21  ? 30.439 8.285   -34.895 1.00 38.11  ? 21  GLU D N   1 
ATOM 3266 C CA  . GLU C 1 21  ? 31.444 7.274   -34.682 1.00 36.13  ? 21  GLU D CA  1 
ATOM 3267 C C   . GLU C 1 21  ? 32.771 7.968   -34.731 1.00 35.16  ? 21  GLU D C   1 
ATOM 3268 O O   . GLU C 1 21  ? 32.981 8.904   -35.512 1.00 34.48  ? 21  GLU D O   1 
ATOM 3269 C CB  . GLU C 1 21  ? 31.359 6.210   -35.767 1.00 35.76  ? 21  GLU D CB  1 
ATOM 3270 C CG  . GLU C 1 21  ? 32.232 4.991   -35.569 1.00 34.54  ? 21  GLU D CG  1 
ATOM 3271 C CD  . GLU C 1 21  ? 32.060 4.003   -36.699 1.00 33.15  ? 21  GLU D CD  1 
ATOM 3272 O OE1 . GLU C 1 21  ? 32.932 3.986   -37.600 1.00 30.95  ? 21  GLU D OE1 1 
ATOM 3273 O OE2 . GLU C 1 21  ? 31.043 3.260   -36.691 1.00 35.33  ? 21  GLU D OE2 1 
ATOM 3274 N N   . PHE C 1 22  ? 33.653 7.499   -33.862 1.00 34.56  ? 22  PHE D N   1 
ATOM 3275 C CA  . PHE C 1 22  ? 35.003 7.986   -33.767 1.00 33.40  ? 22  PHE D CA  1 
ATOM 3276 C C   . PHE C 1 22  ? 35.978 6.800   -33.587 1.00 33.02  ? 22  PHE D C   1 
ATOM 3277 O O   . PHE C 1 22  ? 35.971 6.097   -32.563 1.00 33.11  ? 22  PHE D O   1 
ATOM 3278 C CB  . PHE C 1 22  ? 35.114 9.001   -32.626 1.00 33.53  ? 22  PHE D CB  1 
ATOM 3279 C CG  . PHE C 1 22  ? 36.481 9.572   -32.482 1.00 32.83  ? 22  PHE D CG  1 
ATOM 3280 C CD1 . PHE C 1 22  ? 36.839 10.711  -33.171 1.00 30.83  ? 22  PHE D CD1 1 
ATOM 3281 C CD2 . PHE C 1 22  ? 37.436 8.934   -31.689 1.00 32.09  ? 22  PHE D CD2 1 
ATOM 3282 C CE1 . PHE C 1 22  ? 38.115 11.197  -33.074 1.00 30.49  ? 22  PHE D CE1 1 
ATOM 3283 C CE2 . PHE C 1 22  ? 38.704 9.435   -31.579 1.00 30.16  ? 22  PHE D CE2 1 
ATOM 3284 C CZ  . PHE C 1 22  ? 39.044 10.557  -32.279 1.00 28.71  ? 22  PHE D CZ  1 
ATOM 3285 N N   . MET C 1 23  ? 36.816 6.592   -34.591 1.00 32.25  ? 23  MET D N   1 
ATOM 3286 C CA  . MET C 1 23  ? 37.817 5.535   -34.539 1.00 32.82  ? 23  MET D CA  1 
ATOM 3287 C C   . MET C 1 23  ? 39.220 5.987   -35.013 1.00 31.67  ? 23  MET D C   1 
ATOM 3288 O O   . MET C 1 23  ? 39.381 7.056   -35.615 1.00 31.36  ? 23  MET D O   1 
ATOM 3289 C CB  . MET C 1 23  ? 37.349 4.368   -35.402 1.00 33.03  ? 23  MET D CB  1 
ATOM 3290 C CG  . MET C 1 23  ? 37.276 4.762   -36.874 1.00 36.83  ? 23  MET D CG  1 
ATOM 3291 S SD  . MET C 1 23  ? 37.673 3.453   -38.040 1.00 43.10  ? 23  MET D SD  1 
ATOM 3292 C CE  . MET C 1 23  ? 35.991 2.865   -38.166 1.00 40.71  ? 23  MET D CE  1 
ATOM 3293 N N   . PHE C 1 24  ? 40.220 5.145   -34.761 1.00 30.84  ? 24  PHE D N   1 
ATOM 3294 C CA  . PHE C 1 24  ? 41.575 5.316   -35.328 1.00 29.95  ? 24  PHE D CA  1 
ATOM 3295 C C   . PHE C 1 24  ? 41.929 4.032   -36.045 1.00 28.68  ? 24  PHE D C   1 
ATOM 3296 O O   . PHE C 1 24  ? 41.678 2.948   -35.519 1.00 28.32  ? 24  PHE D O   1 
ATOM 3297 C CB  . PHE C 1 24  ? 42.575 5.593   -34.203 1.00 30.47  ? 24  PHE D CB  1 
ATOM 3298 C CG  . PHE C 1 24  ? 44.026 5.630   -34.630 1.00 31.17  ? 24  PHE D CG  1 
ATOM 3299 C CD1 . PHE C 1 24  ? 44.593 6.784   -35.143 1.00 32.20  ? 24  PHE D CD1 1 
ATOM 3300 C CD2 . PHE C 1 24  ? 44.845 4.533   -34.435 1.00 33.80  ? 24  PHE D CD2 1 
ATOM 3301 C CE1 . PHE C 1 24  ? 45.947 6.827   -35.514 1.00 32.24  ? 24  PHE D CE1 1 
ATOM 3302 C CE2 . PHE C 1 24  ? 46.205 4.565   -34.790 1.00 35.46  ? 24  PHE D CE2 1 
ATOM 3303 C CZ  . PHE C 1 24  ? 46.756 5.726   -35.334 1.00 33.18  ? 24  PHE D CZ  1 
ATOM 3304 N N   . GLU C 1 25  ? 42.484 4.151   -37.242 1.00 27.99  ? 25  GLU D N   1 
ATOM 3305 C CA  . GLU C 1 25  ? 42.958 2.972   -37.956 1.00 28.38  ? 25  GLU D CA  1 
ATOM 3306 C C   . GLU C 1 25  ? 44.413 3.018   -38.412 1.00 28.59  ? 25  GLU D C   1 
ATOM 3307 O O   . GLU C 1 25  ? 44.960 4.080   -38.715 1.00 28.43  ? 25  GLU D O   1 
ATOM 3308 C CB  . GLU C 1 25  ? 42.088 2.668   -39.146 1.00 28.10  ? 25  GLU D CB  1 
ATOM 3309 C CG  . GLU C 1 25  ? 41.955 3.794   -40.122 1.00 30.33  ? 25  GLU D CG  1 
ATOM 3310 C CD  . GLU C 1 25  ? 41.261 3.354   -41.431 1.00 33.35  ? 25  GLU D CD  1 
ATOM 3311 O OE1 . GLU C 1 25  ? 41.375 4.076   -42.462 1.00 30.69  ? 25  GLU D OE1 1 
ATOM 3312 O OE2 . GLU C 1 25  ? 40.592 2.282   -41.417 1.00 35.38  ? 25  GLU D OE2 1 
ATOM 3313 N N   . PHE C 1 26  ? 45.030 1.836   -38.448 1.00 28.37  ? 26  PHE D N   1 
ATOM 3314 C CA  . PHE C 1 26  ? 46.371 1.686   -38.913 1.00 27.58  ? 26  PHE D CA  1 
ATOM 3315 C C   . PHE C 1 26  ? 46.357 0.766   -40.124 1.00 28.75  ? 26  PHE D C   1 
ATOM 3316 O O   . PHE C 1 26  ? 45.699 -0.281  -40.113 1.00 28.87  ? 26  PHE D O   1 
ATOM 3317 C CB  . PHE C 1 26  ? 47.246 1.136   -37.797 1.00 27.53  ? 26  PHE D CB  1 
ATOM 3318 C CG  . PHE C 1 26  ? 48.650 0.906   -38.218 1.00 26.96  ? 26  PHE D CG  1 
ATOM 3319 C CD1 . PHE C 1 26  ? 49.502 1.979   -38.439 1.00 27.15  ? 26  PHE D CD1 1 
ATOM 3320 C CD2 . PHE C 1 26  ? 49.105 -0.374  -38.451 1.00 25.93  ? 26  PHE D CD2 1 
ATOM 3321 C CE1 . PHE C 1 26  ? 50.776 1.777   -38.871 1.00 29.53  ? 26  PHE D CE1 1 
ATOM 3322 C CE2 . PHE C 1 26  ? 50.392 -0.595  -38.867 1.00 27.76  ? 26  PHE D CE2 1 
ATOM 3323 C CZ  . PHE C 1 26  ? 51.236 0.468   -39.084 1.00 29.67  ? 26  PHE D CZ  1 
ATOM 3324 N N   . ASP C 1 27  ? 47.079 1.158   -41.172 1.00 30.07  ? 27  ASP D N   1 
ATOM 3325 C CA  . ASP C 1 27  ? 46.985 0.512   -42.481 1.00 32.24  ? 27  ASP D CA  1 
ATOM 3326 C C   . ASP C 1 27  ? 45.650 -0.158  -42.741 1.00 32.44  ? 27  ASP D C   1 
ATOM 3327 O O   . ASP C 1 27  ? 45.593 -1.321  -43.118 1.00 33.52  ? 27  ASP D O   1 
ATOM 3328 C CB  . ASP C 1 27  ? 48.163 -0.438  -42.730 1.00 32.77  ? 27  ASP D CB  1 
ATOM 3329 C CG  . ASP C 1 27  ? 49.474 0.312   -42.834 1.00 36.32  ? 27  ASP D CG  1 
ATOM 3330 O OD1 . ASP C 1 27  ? 49.437 1.522   -43.195 1.00 37.35  ? 27  ASP D OD1 1 
ATOM 3331 O OD2 . ASP C 1 27  ? 50.536 -0.286  -42.534 1.00 40.13  ? 27  ASP D OD2 1 
ATOM 3332 N N   . GLU C 1 28  ? 44.587 0.589   -42.495 1.00 32.92  ? 28  GLU D N   1 
ATOM 3333 C CA  . GLU C 1 28  ? 43.235 0.208   -42.846 1.00 33.45  ? 28  GLU D CA  1 
ATOM 3334 C C   . GLU C 1 28  ? 42.500 -0.736  -41.863 1.00 32.60  ? 28  GLU D C   1 
ATOM 3335 O O   . GLU C 1 28  ? 41.379 -1.142  -42.141 1.00 31.48  ? 28  GLU D O   1 
ATOM 3336 C CB  . GLU C 1 28  ? 43.233 -0.387  -44.234 1.00 34.58  ? 28  GLU D CB  1 
ATOM 3337 C CG  . GLU C 1 28  ? 42.146 0.089   -45.100 1.00 39.74  ? 28  GLU D CG  1 
ATOM 3338 C CD  . GLU C 1 28  ? 42.635 1.185   -45.975 1.00 47.37  ? 28  GLU D CD  1 
ATOM 3339 O OE1 . GLU C 1 28  ? 43.089 0.888   -47.120 1.00 48.27  ? 28  GLU D OE1 1 
ATOM 3340 O OE2 . GLU C 1 28  ? 42.589 2.342   -45.487 1.00 51.46  ? 28  GLU D OE2 1 
ATOM 3341 N N   . ASP C 1 29  ? 43.090 -1.089  -40.729 1.00 32.16  ? 29  ASP D N   1 
ATOM 3342 C CA  . ASP C 1 29  ? 42.280 -1.795  -39.715 1.00 32.28  ? 29  ASP D CA  1 
ATOM 3343 C C   . ASP C 1 29  ? 42.061 -0.924  -38.487 1.00 32.42  ? 29  ASP D C   1 
ATOM 3344 O O   . ASP C 1 29  ? 42.998 -0.282  -37.998 1.00 33.93  ? 29  ASP D O   1 
ATOM 3345 C CB  . ASP C 1 29  ? 42.918 -3.120  -39.253 1.00 32.81  ? 29  ASP D CB  1 
ATOM 3346 C CG  . ASP C 1 29  ? 43.318 -4.027  -40.389 1.00 31.92  ? 29  ASP D CG  1 
ATOM 3347 O OD1 . ASP C 1 29  ? 42.462 -4.417  -41.193 1.00 32.75  ? 29  ASP D OD1 1 
ATOM 3348 O OD2 . ASP C 1 29  ? 44.499 -4.385  -40.449 1.00 33.39  ? 29  ASP D OD2 1 
ATOM 3349 N N   . GLU C 1 30  ? 40.844 -0.926  -37.969 1.00 31.62  ? 30  GLU D N   1 
ATOM 3350 C CA  . GLU C 1 30  ? 40.486 -0.167  -36.778 1.00 31.43  ? 30  GLU D CA  1 
ATOM 3351 C C   . GLU C 1 30  ? 41.292 -0.658  -35.588 1.00 31.55  ? 30  GLU D C   1 
ATOM 3352 O O   . GLU C 1 30  ? 41.257 -1.832  -35.280 1.00 32.77  ? 30  GLU D O   1 
ATOM 3353 C CB  . GLU C 1 30  ? 39.000 -0.387  -36.515 1.00 31.39  ? 30  GLU D CB  1 
ATOM 3354 C CG  . GLU C 1 30  ? 38.432 0.221   -35.235 1.00 33.65  ? 30  GLU D CG  1 
ATOM 3355 C CD  . GLU C 1 30  ? 38.550 -0.676  -34.037 1.00 36.84  ? 30  GLU D CD  1 
ATOM 3356 O OE1 . GLU C 1 30  ? 39.009 -0.159  -32.986 1.00 37.17  ? 30  GLU D OE1 1 
ATOM 3357 O OE2 . GLU C 1 30  ? 38.181 -1.888  -34.145 1.00 36.80  ? 30  GLU D OE2 1 
ATOM 3358 N N   . MET C 1 31  ? 42.003 0.238   -34.918 1.00 31.04  ? 31  MET D N   1 
ATOM 3359 C CA  . MET C 1 31  ? 42.878 -0.130  -33.833 1.00 30.91  ? 31  MET D CA  1 
ATOM 3360 C C   . MET C 1 31  ? 42.151 0.032   -32.518 1.00 31.98  ? 31  MET D C   1 
ATOM 3361 O O   . MET C 1 31  ? 42.309 -0.781  -31.600 1.00 32.92  ? 31  MET D O   1 
ATOM 3362 C CB  . MET C 1 31  ? 44.098 0.777   -33.815 1.00 30.95  ? 31  MET D CB  1 
ATOM 3363 C CG  . MET C 1 31  ? 45.011 0.539   -32.640 1.00 31.93  ? 31  MET D CG  1 
ATOM 3364 S SD  . MET C 1 31  ? 46.587 1.400   -32.724 1.00 35.47  ? 31  MET D SD  1 
ATOM 3365 C CE  . MET C 1 31  ? 47.406 0.491   -34.011 1.00 35.77  ? 31  MET D CE  1 
ATOM 3366 N N   . PHE C 1 32  ? 41.397 1.130   -32.421 1.00 31.63  ? 32  PHE D N   1 
ATOM 3367 C CA  . PHE C 1 32  ? 40.614 1.487   -31.247 1.00 30.96  ? 32  PHE D CA  1 
ATOM 3368 C C   . PHE C 1 32  ? 39.585 2.455   -31.735 1.00 31.02  ? 32  PHE D C   1 
ATOM 3369 O O   . PHE C 1 32  ? 39.718 2.987   -32.834 1.00 30.44  ? 32  PHE D O   1 
ATOM 3370 C CB  . PHE C 1 32  ? 41.453 2.095   -30.124 1.00 31.29  ? 32  PHE D CB  1 
ATOM 3371 C CG  . PHE C 1 32  ? 41.974 3.496   -30.398 1.00 29.78  ? 32  PHE D CG  1 
ATOM 3372 C CD1 . PHE C 1 32  ? 41.156 4.596   -30.275 1.00 28.69  ? 32  PHE D CD1 1 
ATOM 3373 C CD2 . PHE C 1 32  ? 43.308 3.700   -30.719 1.00 28.21  ? 32  PHE D CD2 1 
ATOM 3374 C CE1 . PHE C 1 32  ? 41.642 5.857   -30.518 1.00 29.99  ? 32  PHE D CE1 1 
ATOM 3375 C CE2 . PHE C 1 32  ? 43.807 4.955   -30.958 1.00 28.06  ? 32  PHE D CE2 1 
ATOM 3376 C CZ  . PHE C 1 32  ? 42.982 6.046   -30.851 1.00 28.39  ? 32  PHE D CZ  1 
ATOM 3377 N N   . TYR C 1 33  ? 38.542 2.640   -30.935 1.00 32.10  ? 33  TYR D N   1 
ATOM 3378 C CA  . TYR C 1 33  ? 37.485 3.592   -31.213 1.00 32.79  ? 33  TYR D CA  1 
ATOM 3379 C C   . TYR C 1 33  ? 36.932 4.048   -29.853 1.00 35.24  ? 33  TYR D C   1 
ATOM 3380 O O   . TYR C 1 33  ? 37.203 3.401   -28.812 1.00 36.25  ? 33  TYR D O   1 
ATOM 3381 C CB  . TYR C 1 33  ? 36.400 2.962   -32.085 1.00 31.81  ? 33  TYR D CB  1 
ATOM 3382 C CG  . TYR C 1 33  ? 35.518 1.945   -31.376 1.00 32.25  ? 33  TYR D CG  1 
ATOM 3383 C CD1 . TYR C 1 33  ? 34.276 2.324   -30.881 1.00 33.43  ? 33  TYR D CD1 1 
ATOM 3384 C CD2 . TYR C 1 33  ? 35.921 0.613   -31.213 1.00 32.05  ? 33  TYR D CD2 1 
ATOM 3385 C CE1 . TYR C 1 33  ? 33.442 1.431   -30.233 1.00 35.39  ? 33  TYR D CE1 1 
ATOM 3386 C CE2 . TYR C 1 33  ? 35.098 -0.308  -30.573 1.00 34.85  ? 33  TYR D CE2 1 
ATOM 3387 C CZ  . TYR C 1 33  ? 33.846 0.106   -30.068 1.00 37.03  ? 33  TYR D CZ  1 
ATOM 3388 O OH  . TYR C 1 33  ? 32.978 -0.777  -29.414 1.00 35.39  ? 33  TYR D OH  1 
ATOM 3389 N N   . VAL C 1 34  ? 36.174 5.148   -29.852 1.00 36.18  ? 34  VAL D N   1 
ATOM 3390 C CA  . VAL C 1 34  ? 35.574 5.646   -28.616 1.00 38.13  ? 34  VAL D CA  1 
ATOM 3391 C C   . VAL C 1 34  ? 34.106 5.247   -28.590 1.00 38.73  ? 34  VAL D C   1 
ATOM 3392 O O   . VAL C 1 34  ? 33.366 5.525   -29.530 1.00 38.40  ? 34  VAL D O   1 
ATOM 3393 C CB  . VAL C 1 34  ? 35.748 7.187   -28.456 1.00 38.55  ? 34  VAL D CB  1 
ATOM 3394 C CG1 . VAL C 1 34  ? 35.100 7.685   -27.162 1.00 39.54  ? 34  VAL D CG1 1 
ATOM 3395 C CG2 . VAL C 1 34  ? 37.232 7.548   -28.444 1.00 38.51  ? 34  VAL D CG2 1 
ATOM 3396 N N   . ASP C 1 35  ? 33.701 4.562   -27.527 1.00 40.35  ? 35  ASP D N   1 
ATOM 3397 C CA  . ASP C 1 35  ? 32.292 4.194   -27.347 1.00 41.94  ? 35  ASP D CA  1 
ATOM 3398 C C   . ASP C 1 35  ? 31.584 5.428   -26.830 1.00 43.18  ? 35  ASP D C   1 
ATOM 3399 O O   . ASP C 1 35  ? 31.917 5.929   -25.755 1.00 44.43  ? 35  ASP D O   1 
ATOM 3400 C CB  . ASP C 1 35  ? 32.127 2.995   -26.378 1.00 42.79  ? 35  ASP D CB  1 
ATOM 3401 C CG  . ASP C 1 35  ? 30.654 2.650   -26.093 1.00 43.55  ? 35  ASP D CG  1 
ATOM 3402 O OD1 . ASP C 1 35  ? 29.770 3.516   -26.250 1.00 46.02  ? 35  ASP D OD1 1 
ATOM 3403 O OD2 . ASP C 1 35  ? 30.373 1.506   -25.693 1.00 42.08  ? 35  ASP D OD2 1 
ATOM 3404 N N   . LEU C 1 36  ? 30.617 5.909   -27.602 1.00 43.28  ? 36  LEU D N   1 
ATOM 3405 C CA  . LEU C 1 36  ? 29.946 7.172   -27.293 1.00 44.66  ? 36  LEU D CA  1 
ATOM 3406 C C   . LEU C 1 36  ? 28.893 7.082   -26.186 1.00 46.83  ? 36  LEU D C   1 
ATOM 3407 O O   . LEU C 1 36  ? 28.599 8.090   -25.549 1.00 48.44  ? 36  LEU D O   1 
ATOM 3408 C CB  . LEU C 1 36  ? 29.382 7.820   -28.564 1.00 43.35  ? 36  LEU D CB  1 
ATOM 3409 C CG  . LEU C 1 36  ? 30.411 7.940   -29.717 1.00 42.33  ? 36  LEU D CG  1 
ATOM 3410 C CD1 . LEU C 1 36  ? 29.760 8.379   -31.043 1.00 41.07  ? 36  LEU D CD1 1 
ATOM 3411 C CD2 . LEU C 1 36  ? 31.667 8.818   -29.392 1.00 38.50  ? 36  LEU D CD2 1 
ATOM 3412 N N   . ASP C 1 37  ? 28.330 5.895   -25.950 1.00 47.74  ? 37  ASP D N   1 
ATOM 3413 C CA  . ASP C 1 37  ? 27.393 5.708   -24.820 1.00 50.49  ? 37  ASP D CA  1 
ATOM 3414 C C   . ASP C 1 37  ? 28.172 5.523   -23.512 1.00 51.48  ? 37  ASP D C   1 
ATOM 3415 O O   . ASP C 1 37  ? 28.015 6.280   -22.562 1.00 52.66  ? 37  ASP D O   1 
ATOM 3416 C CB  . ASP C 1 37  ? 26.411 4.541   -25.061 1.00 50.80  ? 37  ASP D CB  1 
ATOM 3417 C CG  . ASP C 1 37  ? 25.705 4.614   -26.445 1.00 51.76  ? 37  ASP D CG  1 
ATOM 3418 O OD1 . ASP C 1 37  ? 25.902 5.637   -27.147 1.00 53.30  ? 37  ASP D OD1 1 
ATOM 3419 O OD2 . ASP C 1 37  ? 24.955 3.661   -26.828 1.00 50.37  ? 37  ASP D OD2 1 
ATOM 3420 N N   . LYS C 1 38  ? 29.050 4.531   -23.498 1.00 51.19  ? 38  LYS D N   1 
ATOM 3421 C CA  . LYS C 1 38  ? 29.867 4.236   -22.333 1.00 52.89  ? 38  LYS D CA  1 
ATOM 3422 C C   . LYS C 1 38  ? 30.876 5.328   -22.039 1.00 53.21  ? 38  LYS D C   1 
ATOM 3423 O O   . LYS C 1 38  ? 31.394 5.411   -20.927 1.00 54.78  ? 38  LYS D O   1 
ATOM 3424 C CB  . LYS C 1 38  ? 30.576 2.889   -22.515 1.00 52.28  ? 38  LYS D CB  1 
ATOM 3425 C CG  . LYS C 1 38  ? 29.631 1.694   -22.408 1.00 53.53  ? 38  LYS D CG  1 
ATOM 3426 C CD  . LYS C 1 38  ? 30.366 0.396   -22.605 1.00 54.51  ? 38  LYS D CD  1 
ATOM 3427 C CE  . LYS C 1 38  ? 29.511 -0.766  -22.152 1.00 55.68  ? 38  LYS D CE  1 
ATOM 3428 N NZ  . LYS C 1 38  ? 30.394 -1.883  -21.682 1.00 56.23  ? 38  LYS D NZ  1 
ATOM 3429 N N   . LYS C 1 39  ? 31.126 6.166   -23.047 1.00 52.44  ? 39  LYS D N   1 
ATOM 3430 C CA  . LYS C 1 39  ? 32.155 7.221   -23.040 1.00 52.06  ? 39  LYS D CA  1 
ATOM 3431 C C   . LYS C 1 39  ? 33.574 6.768   -22.624 1.00 51.88  ? 39  LYS D C   1 
ATOM 3432 O O   . LYS C 1 39  ? 34.277 7.483   -21.912 1.00 52.96  ? 39  LYS D O   1 
ATOM 3433 C CB  . LYS C 1 39  ? 31.665 8.464   -22.279 1.00 53.63  ? 39  LYS D CB  1 
ATOM 3434 C CG  . LYS C 1 39  ? 30.553 9.249   -23.015 1.00 53.83  ? 39  LYS D CG  1 
ATOM 3435 C CD  . LYS C 1 39  ? 29.158 9.015   -22.437 1.00 55.69  ? 39  LYS D CD  1 
ATOM 3436 C CE  . LYS C 1 39  ? 28.097 9.846   -23.160 1.00 56.76  ? 39  LYS D CE  1 
ATOM 3437 N NZ  . LYS C 1 39  ? 26.793 9.108   -23.392 1.00 57.83  ? 39  LYS D NZ  1 
ATOM 3438 N N   . GLU C 1 40  ? 33.987 5.590   -23.095 1.00 50.84  ? 40  GLU D N   1 
ATOM 3439 C CA  . GLU C 1 40  ? 35.345 5.049   -22.842 1.00 50.95  ? 40  GLU D CA  1 
ATOM 3440 C C   . GLU C 1 40  ? 36.041 4.463   -24.087 1.00 48.72  ? 40  GLU D C   1 
ATOM 3441 O O   . GLU C 1 40  ? 35.368 4.029   -25.026 1.00 48.19  ? 40  GLU D O   1 
ATOM 3442 C CB  . GLU C 1 40  ? 35.342 4.028   -21.696 1.00 52.65  ? 40  GLU D CB  1 
ATOM 3443 C CG  . GLU C 1 40  ? 34.104 3.109   -21.567 1.00 55.08  ? 40  GLU D CG  1 
ATOM 3444 C CD  . GLU C 1 40  ? 33.824 2.706   -20.093 1.00 59.91  ? 40  GLU D CD  1 
ATOM 3445 O OE1 . GLU C 1 40  ? 34.492 3.262   -19.189 1.00 61.64  ? 40  GLU D OE1 1 
ATOM 3446 O OE2 . GLU C 1 40  ? 32.946 1.843   -19.832 1.00 60.71  ? 40  GLU D OE2 1 
ATOM 3447 N N   . THR C 1 41  ? 37.379 4.457   -24.102 1.00 47.92  ? 41  THR D N   1 
ATOM 3448 C CA  . THR C 1 41  ? 38.131 3.973   -25.277 1.00 45.61  ? 41  THR D CA  1 
ATOM 3449 C C   . THR C 1 41  ? 38.153 2.440   -25.345 1.00 44.98  ? 41  THR D C   1 
ATOM 3450 O O   . THR C 1 41  ? 38.481 1.791   -24.362 1.00 45.74  ? 41  THR D O   1 
ATOM 3451 C CB  . THR C 1 41  ? 39.580 4.551   -25.352 1.00 45.33  ? 41  THR D CB  1 
ATOM 3452 O OG1 . THR C 1 41  ? 39.550 5.991   -25.374 1.00 46.22  ? 41  THR D OG1 1 
ATOM 3453 C CG2 . THR C 1 41  ? 40.283 4.081   -26.619 1.00 43.32  ? 41  THR D CG2 1 
ATOM 3454 N N   . VAL C 1 42  ? 37.788 1.882   -26.507 1.00 43.53  ? 42  VAL D N   1 
ATOM 3455 C CA  . VAL C 1 42  ? 37.810 0.422   -26.767 1.00 42.69  ? 42  VAL D CA  1 
ATOM 3456 C C   . VAL C 1 42  ? 38.928 0.085   -27.750 1.00 41.38  ? 42  VAL D C   1 
ATOM 3457 O O   . VAL C 1 42  ? 39.070 0.742   -28.769 1.00 40.77  ? 42  VAL D O   1 
ATOM 3458 C CB  . VAL C 1 42  ? 36.430 -0.130  -27.317 1.00 42.36  ? 42  VAL D CB  1 
ATOM 3459 C CG1 . VAL C 1 42  ? 36.397 -1.648  -27.302 1.00 40.99  ? 42  VAL D CG1 1 
ATOM 3460 C CG2 . VAL C 1 42  ? 35.230 0.417   -26.507 1.00 43.22  ? 42  VAL D CG2 1 
ATOM 3461 N N   . TRP C 1 43  ? 39.719 -0.930  -27.418 1.00 41.74  ? 43  TRP D N   1 
ATOM 3462 C CA  . TRP C 1 43  ? 40.844 -1.403  -28.229 1.00 40.54  ? 43  TRP D CA  1 
ATOM 3463 C C   . TRP C 1 43  ? 40.456 -2.695  -28.899 1.00 40.62  ? 43  TRP D C   1 
ATOM 3464 O O   . TRP C 1 43  ? 39.775 -3.513  -28.305 1.00 41.50  ? 43  TRP D O   1 
ATOM 3465 C CB  . TRP C 1 43  ? 42.087 -1.630  -27.361 1.00 40.85  ? 43  TRP D CB  1 
ATOM 3466 C CG  . TRP C 1 43  ? 42.655 -0.337  -26.857 1.00 40.01  ? 43  TRP D CG  1 
ATOM 3467 C CD1 . TRP C 1 43  ? 42.289 0.314   -25.736 1.00 39.27  ? 43  TRP D CD1 1 
ATOM 3468 C CD2 . TRP C 1 43  ? 43.663 0.475   -27.483 1.00 38.35  ? 43  TRP D CD2 1 
ATOM 3469 N NE1 . TRP C 1 43  ? 42.998 1.473   -25.608 1.00 39.50  ? 43  TRP D NE1 1 
ATOM 3470 C CE2 . TRP C 1 43  ? 43.849 1.598   -26.673 1.00 40.14  ? 43  TRP D CE2 1 
ATOM 3471 C CE3 . TRP C 1 43  ? 44.417 0.363   -28.653 1.00 37.88  ? 43  TRP D CE3 1 
ATOM 3472 C CZ2 . TRP C 1 43  ? 44.773 2.614   -26.992 1.00 41.02  ? 43  TRP D CZ2 1 
ATOM 3473 C CZ3 . TRP C 1 43  ? 45.339 1.366   -28.968 1.00 36.91  ? 43  TRP D CZ3 1 
ATOM 3474 C CH2 . TRP C 1 43  ? 45.506 2.470   -28.146 1.00 38.65  ? 43  TRP D CH2 1 
ATOM 3475 N N   . HIS C 1 44  ? 40.895 -2.874  -30.139 1.00 40.45  ? 44  HIS D N   1 
ATOM 3476 C CA  . HIS C 1 44  ? 40.544 -4.028  -30.932 1.00 40.26  ? 44  HIS D CA  1 
ATOM 3477 C C   . HIS C 1 44  ? 41.266 -5.329  -30.564 1.00 41.48  ? 44  HIS D C   1 
ATOM 3478 O O   . HIS C 1 44  ? 40.700 -6.392  -30.734 1.00 42.31  ? 44  HIS D O   1 
ATOM 3479 C CB  . HIS C 1 44  ? 40.758 -3.723  -32.399 1.00 39.35  ? 44  HIS D CB  1 
ATOM 3480 C CG  . HIS C 1 44  ? 39.979 -4.622  -33.301 1.00 40.49  ? 44  HIS D CG  1 
ATOM 3481 N ND1 . HIS C 1 44  ? 40.352 -5.925  -33.553 1.00 41.05  ? 44  HIS D ND1 1 
ATOM 3482 C CD2 . HIS C 1 44  ? 38.826 -4.421  -33.982 1.00 39.35  ? 44  HIS D CD2 1 
ATOM 3483 C CE1 . HIS C 1 44  ? 39.466 -6.486  -34.354 1.00 39.81  ? 44  HIS D CE1 1 
ATOM 3484 N NE2 . HIS C 1 44  ? 38.535 -5.594  -34.632 1.00 39.36  ? 44  HIS D NE2 1 
ATOM 3485 N N   . LEU C 1 45  ? 42.508 -5.253  -30.094 1.00 42.66  ? 45  LEU D N   1 
ATOM 3486 C CA  . LEU C 1 45  ? 43.276 -6.424  -29.642 1.00 43.86  ? 45  LEU D CA  1 
ATOM 3487 C C   . LEU C 1 45  ? 43.790 -6.226  -28.220 1.00 45.91  ? 45  LEU D C   1 
ATOM 3488 O O   . LEU C 1 45  ? 44.464 -5.231  -27.911 1.00 46.01  ? 45  LEU D O   1 
ATOM 3489 C CB  . LEU C 1 45  ? 44.476 -6.698  -30.568 1.00 43.84  ? 45  LEU D CB  1 
ATOM 3490 C CG  . LEU C 1 45  ? 44.252 -6.872  -32.078 1.00 42.90  ? 45  LEU D CG  1 
ATOM 3491 C CD1 . LEU C 1 45  ? 45.550 -6.815  -32.848 1.00 42.38  ? 45  LEU D CD1 1 
ATOM 3492 C CD2 . LEU C 1 45  ? 43.512 -8.152  -32.383 1.00 42.09  ? 45  LEU D CD2 1 
ATOM 3493 N N   . GLU C 1 46  ? 43.484 -7.194  -27.365 1.00 47.92  ? 46  GLU D N   1 
ATOM 3494 C CA  . GLU C 1 46  ? 43.909 -7.222  -25.965 1.00 50.51  ? 46  GLU D CA  1 
ATOM 3495 C C   . GLU C 1 46  ? 45.280 -6.584  -25.743 1.00 51.09  ? 46  GLU D C   1 
ATOM 3496 O O   . GLU C 1 46  ? 45.445 -5.693  -24.908 1.00 52.07  ? 46  GLU D O   1 
ATOM 3497 C CB  . GLU C 1 46  ? 43.962 -8.675  -25.518 1.00 52.01  ? 46  GLU D CB  1 
ATOM 3498 C CG  . GLU C 1 46  ? 43.606 -8.943  -24.088 1.00 56.85  ? 46  GLU D CG  1 
ATOM 3499 C CD  . GLU C 1 46  ? 43.944 -10.370 -23.702 1.00 62.71  ? 46  GLU D CD  1 
ATOM 3500 O OE1 . GLU C 1 46  ? 45.149 -10.718 -23.747 1.00 65.50  ? 46  GLU D OE1 1 
ATOM 3501 O OE2 . GLU C 1 46  ? 43.013 -11.148 -23.358 1.00 64.95  ? 46  GLU D OE2 1 
ATOM 3502 N N   . GLU C 1 47  ? 46.264 -7.027  -26.506 1.00 51.00  ? 47  GLU D N   1 
ATOM 3503 C CA  . GLU C 1 47  ? 47.623 -6.555  -26.293 1.00 52.23  ? 47  GLU D CA  1 
ATOM 3504 C C   . GLU C 1 47  ? 47.837 -5.071  -26.565 1.00 50.94  ? 47  GLU D C   1 
ATOM 3505 O O   . GLU C 1 47  ? 48.764 -4.504  -26.018 1.00 52.23  ? 47  GLU D O   1 
ATOM 3506 C CB  . GLU C 1 47  ? 48.647 -7.394  -27.076 1.00 52.76  ? 47  GLU D CB  1 
ATOM 3507 C CG  . GLU C 1 47  ? 48.486 -7.294  -28.590 1.00 52.17  ? 47  GLU D CG  1 
ATOM 3508 C CD  . GLU C 1 47  ? 47.641 -8.409  -29.167 1.00 52.40  ? 47  GLU D CD  1 
ATOM 3509 O OE1 . GLU C 1 47  ? 47.958 -8.816  -30.312 1.00 53.95  ? 47  GLU D OE1 1 
ATOM 3510 O OE2 . GLU C 1 47  ? 46.681 -8.876  -28.493 1.00 50.70  ? 47  GLU D OE2 1 
ATOM 3511 N N   . PHE C 1 48  ? 47.019 -4.437  -27.401 1.00 49.32  ? 48  PHE D N   1 
ATOM 3512 C CA  . PHE C 1 48  ? 47.166 -2.983  -27.584 1.00 48.38  ? 48  PHE D CA  1 
ATOM 3513 C C   . PHE C 1 48  ? 46.711 -2.311  -26.310 1.00 49.02  ? 48  PHE D C   1 
ATOM 3514 O O   . PHE C 1 48  ? 47.438 -1.505  -25.744 1.00 50.46  ? 48  PHE D O   1 
ATOM 3515 C CB  . PHE C 1 48  ? 46.384 -2.416  -28.767 1.00 46.50  ? 48  PHE D CB  1 
ATOM 3516 C CG  . PHE C 1 48  ? 46.841 -2.910  -30.112 1.00 46.83  ? 48  PHE D CG  1 
ATOM 3517 C CD1 . PHE C 1 48  ? 45.962 -2.839  -31.224 1.00 48.29  ? 48  PHE D CD1 1 
ATOM 3518 C CD2 . PHE C 1 48  ? 48.113 -3.462  -30.289 1.00 45.74  ? 48  PHE D CD2 1 
ATOM 3519 C CE1 . PHE C 1 48  ? 46.370 -3.299  -32.498 1.00 46.88  ? 48  PHE D CE1 1 
ATOM 3520 C CE2 . PHE C 1 48  ? 48.532 -3.950  -31.531 1.00 45.19  ? 48  PHE D CE2 1 
ATOM 3521 C CZ  . PHE C 1 48  ? 47.674 -3.864  -32.640 1.00 47.24  ? 48  PHE D CZ  1 
ATOM 3522 N N   . GLY C 1 49  ? 45.528 -2.676  -25.836 1.00 48.74  ? 49  GLY D N   1 
ATOM 3523 C CA  . GLY C 1 49  ? 44.991 -2.132  -24.590 1.00 49.70  ? 49  GLY D CA  1 
ATOM 3524 C C   . GLY C 1 49  ? 46.024 -2.058  -23.489 1.00 50.94  ? 49  GLY D C   1 
ATOM 3525 O O   . GLY C 1 49  ? 46.285 -1.001  -22.938 1.00 50.99  ? 49  GLY D O   1 
ATOM 3526 N N   . GLN C 1 50  ? 46.640 -3.195  -23.205 1.00 52.20  ? 50  GLN D N   1 
ATOM 3527 C CA  . GLN C 1 50  ? 47.702 -3.279  -22.218 1.00 54.15  ? 50  GLN D CA  1 
ATOM 3528 C C   . GLN C 1 50  ? 48.828 -2.236  -22.414 1.00 54.08  ? 50  GLN D C   1 
ATOM 3529 O O   . GLN C 1 50  ? 49.331 -1.664  -21.424 1.00 55.70  ? 50  GLN D O   1 
ATOM 3530 C CB  . GLN C 1 50  ? 48.212 -4.722  -22.133 1.00 54.94  ? 50  GLN D CB  1 
ATOM 3531 C CG  . GLN C 1 50  ? 47.534 -5.518  -20.990 1.00 58.80  ? 50  GLN D CG  1 
ATOM 3532 C CD  . GLN C 1 50  ? 46.802 -6.791  -21.450 1.00 61.80  ? 50  GLN D CD  1 
ATOM 3533 O OE1 . GLN C 1 50  ? 47.418 -7.768  -21.885 1.00 62.97  ? 50  GLN D OE1 1 
ATOM 3534 N NE2 . GLN C 1 50  ? 45.475 -6.783  -21.331 1.00 62.73  ? 50  GLN D NE2 1 
ATOM 3535 N N   . ALA C 1 51  ? 49.168 -1.927  -23.669 1.00 52.05  ? 51  ALA D N   1 
ATOM 3536 C CA  . ALA C 1 51  ? 50.348 -1.088  -23.965 1.00 51.36  ? 51  ALA D CA  1 
ATOM 3537 C C   . ALA C 1 51  ? 50.057 0.411   -24.053 1.00 50.28  ? 51  ALA D C   1 
ATOM 3538 O O   . ALA C 1 51  ? 50.724 1.233   -23.415 1.00 51.51  ? 51  ALA D O   1 
ATOM 3539 C CB  . ALA C 1 51  ? 51.070 -1.578  -25.240 1.00 50.37  ? 51  ALA D CB  1 
ATOM 3540 N N   . PHE C 1 52  ? 49.060 0.779   -24.833 1.00 47.93  ? 52  PHE D N   1 
ATOM 3541 C CA  . PHE C 1 52  ? 48.842 2.185   -25.085 1.00 46.48  ? 52  PHE D CA  1 
ATOM 3542 C C   . PHE C 1 52  ? 47.536 2.611   -24.496 1.00 45.97  ? 52  PHE D C   1 
ATOM 3543 O O   . PHE C 1 52  ? 46.750 1.770   -24.066 1.00 45.70  ? 52  PHE D O   1 
ATOM 3544 C CB  . PHE C 1 52  ? 48.818 2.452   -26.588 1.00 45.09  ? 52  PHE D CB  1 
ATOM 3545 C CG  . PHE C 1 52  ? 49.798 1.637   -27.355 1.00 44.48  ? 52  PHE D CG  1 
ATOM 3546 C CD1 . PHE C 1 52  ? 51.171 1.856   -27.211 1.00 45.06  ? 52  PHE D CD1 1 
ATOM 3547 C CD2 . PHE C 1 52  ? 49.356 0.643   -28.214 1.00 42.30  ? 52  PHE D CD2 1 
ATOM 3548 C CE1 . PHE C 1 52  ? 52.094 1.103   -27.924 1.00 45.09  ? 52  PHE D CE1 1 
ATOM 3549 C CE2 . PHE C 1 52  ? 50.262 -0.110  -28.937 1.00 43.71  ? 52  PHE D CE2 1 
ATOM 3550 C CZ  . PHE C 1 52  ? 51.647 0.118   -28.783 1.00 45.16  ? 52  PHE D CZ  1 
ATOM 3551 N N   . SER C 1 53  ? 47.309 3.924   -24.493 1.00 45.33  ? 53  SER D N   1 
ATOM 3552 C CA  . SER C 1 53  ? 46.020 4.495   -24.128 1.00 44.81  ? 53  SER D CA  1 
ATOM 3553 C C   . SER C 1 53  ? 45.715 5.684   -25.027 1.00 43.61  ? 53  SER D C   1 
ATOM 3554 O O   . SER C 1 53  ? 46.579 6.123   -25.797 1.00 43.07  ? 53  SER D O   1 
ATOM 3555 C CB  . SER C 1 53  ? 45.987 4.887   -22.647 1.00 46.01  ? 53  SER D CB  1 
ATOM 3556 O OG  . SER C 1 53  ? 46.947 5.887   -22.372 1.00 47.70  ? 53  SER D OG  1 
ATOM 3557 N N   . PHE C 1 54  ? 44.478 6.172   -24.925 1.00 43.36  ? 54  PHE D N   1 
ATOM 3558 C CA  . PHE C 1 54  ? 43.966 7.330   -25.632 1.00 42.72  ? 54  PHE D CA  1 
ATOM 3559 C C   . PHE C 1 54  ? 42.839 7.899   -24.766 1.00 44.29  ? 54  PHE D C   1 
ATOM 3560 O O   . PHE C 1 54  ? 41.903 7.175   -24.411 1.00 44.11  ? 54  PHE D O   1 
ATOM 3561 C CB  . PHE C 1 54  ? 43.433 6.910   -27.018 1.00 41.60  ? 54  PHE D CB  1 
ATOM 3562 C CG  . PHE C 1 54  ? 42.668 8.003   -27.753 1.00 40.20  ? 54  PHE D CG  1 
ATOM 3563 C CD1 . PHE C 1 54  ? 43.340 8.968   -28.491 1.00 38.14  ? 54  PHE D CD1 1 
ATOM 3564 C CD2 . PHE C 1 54  ? 41.283 8.049   -27.704 1.00 41.07  ? 54  PHE D CD2 1 
ATOM 3565 C CE1 . PHE C 1 54  ? 42.659 9.948   -29.148 1.00 38.86  ? 54  PHE D CE1 1 
ATOM 3566 C CE2 . PHE C 1 54  ? 40.568 9.067   -28.375 1.00 41.26  ? 54  PHE D CE2 1 
ATOM 3567 C CZ  . PHE C 1 54  ? 41.256 10.002  -29.102 1.00 40.53  ? 54  PHE D CZ  1 
ATOM 3568 N N   . GLU C 1 55  ? 42.927 9.185   -24.427 1.00 45.83  ? 55  GLU D N   1 
ATOM 3569 C CA  . GLU C 1 55  ? 41.991 9.809   -23.481 1.00 48.10  ? 55  GLU D CA  1 
ATOM 3570 C C   . GLU C 1 55  ? 40.675 10.033  -24.198 1.00 47.15  ? 55  GLU D C   1 
ATOM 3571 O O   . GLU C 1 55  ? 40.549 10.951  -25.007 1.00 47.34  ? 55  GLU D O   1 
ATOM 3572 C CB  . GLU C 1 55  ? 42.526 11.147  -22.971 1.00 49.14  ? 55  GLU D CB  1 
ATOM 3573 C CG  . GLU C 1 55  ? 42.224 11.477  -21.487 1.00 56.08  ? 55  GLU D CG  1 
ATOM 3574 C CD  . GLU C 1 55  ? 40.962 10.780  -20.874 1.00 61.96  ? 55  GLU D CD  1 
ATOM 3575 O OE1 . GLU C 1 55  ? 39.817 10.990  -21.378 1.00 61.24  ? 55  GLU D OE1 1 
ATOM 3576 O OE2 . GLU C 1 55  ? 41.135 10.046  -19.851 1.00 63.85  ? 55  GLU D OE2 1 
ATOM 3577 N N   . ALA C 1 56  ? 39.700 9.182   -23.904 1.00 46.98  ? 56  ALA D N   1 
ATOM 3578 C CA  . ALA C 1 56  ? 38.410 9.172   -24.602 1.00 45.38  ? 56  ALA D CA  1 
ATOM 3579 C C   . ALA C 1 56  ? 37.825 10.550  -24.945 1.00 45.00  ? 56  ALA D C   1 
ATOM 3580 O O   . ALA C 1 56  ? 37.339 10.756  -26.048 1.00 43.62  ? 56  ALA D O   1 
ATOM 3581 C CB  . ALA C 1 56  ? 37.398 8.357   -23.798 1.00 46.01  ? 56  ALA D CB  1 
ATOM 3582 N N   . GLN C 1 57  ? 37.883 11.482  -24.005 1.00 46.40  ? 57  GLN D N   1 
ATOM 3583 C CA  . GLN C 1 57  ? 37.152 12.739  -24.110 1.00 47.37  ? 57  GLN D CA  1 
ATOM 3584 C C   . GLN C 1 57  ? 37.561 13.625  -25.317 1.00 46.07  ? 57  GLN D C   1 
ATOM 3585 O O   . GLN C 1 57  ? 36.909 14.622  -25.622 1.00 46.30  ? 57  GLN D O   1 
ATOM 3586 C CB  . GLN C 1 57  ? 37.217 13.493  -22.771 1.00 49.42  ? 57  GLN D CB  1 
ATOM 3587 C CG  . GLN C 1 57  ? 35.830 13.901  -22.240 1.00 52.92  ? 57  GLN D CG  1 
ATOM 3588 C CD  . GLN C 1 57  ? 35.769 14.204  -20.716 1.00 56.48  ? 57  GLN D CD  1 
ATOM 3589 O OE1 . GLN C 1 57  ? 36.350 13.501  -19.874 1.00 57.24  ? 57  GLN D OE1 1 
ATOM 3590 N NE2 . GLN C 1 57  ? 35.026 15.241  -20.373 1.00 56.77  ? 57  GLN D NE2 1 
ATOM 3591 N N   . GLY C 1 58  ? 38.622 13.239  -26.017 1.00 45.05  ? 58  GLY D N   1 
ATOM 3592 C CA  . GLY C 1 58  ? 39.030 13.915  -27.261 1.00 43.98  ? 58  GLY D CA  1 
ATOM 3593 C C   . GLY C 1 58  ? 38.221 13.543  -28.502 1.00 42.78  ? 58  GLY D C   1 
ATOM 3594 O O   . GLY C 1 58  ? 38.026 14.377  -29.393 1.00 42.85  ? 58  GLY D O   1 
ATOM 3595 N N   . GLY C 1 59  ? 37.779 12.285  -28.577 1.00 41.69  ? 59  GLY D N   1 
ATOM 3596 C CA  . GLY C 1 59  ? 36.843 11.840  -29.612 1.00 39.98  ? 59  GLY D CA  1 
ATOM 3597 C C   . GLY C 1 59  ? 35.474 12.470  -29.426 1.00 40.28  ? 59  GLY D C   1 
ATOM 3598 O O   . GLY C 1 59  ? 34.881 13.005  -30.373 1.00 39.73  ? 59  GLY D O   1 
ATOM 3599 N N   . LEU C 1 60  ? 34.988 12.428  -28.190 1.00 40.75  ? 60  LEU D N   1 
ATOM 3600 C CA  . LEU C 1 60  ? 33.758 13.105  -27.828 1.00 41.43  ? 60  LEU D CA  1 
ATOM 3601 C C   . LEU C 1 60  ? 33.795 14.550  -28.305 1.00 41.52  ? 60  LEU D C   1 
ATOM 3602 O O   . LEU C 1 60  ? 32.831 15.060  -28.898 1.00 41.56  ? 60  LEU D O   1 
ATOM 3603 C CB  . LEU C 1 60  ? 33.546 13.056  -26.318 1.00 42.89  ? 60  LEU D CB  1 
ATOM 3604 C CG  . LEU C 1 60  ? 33.373 11.678  -25.655 1.00 43.34  ? 60  LEU D CG  1 
ATOM 3605 C CD1 . LEU C 1 60  ? 33.169 11.845  -24.143 1.00 44.66  ? 60  LEU D CD1 1 
ATOM 3606 C CD2 . LEU C 1 60  ? 32.220 10.882  -26.249 1.00 40.55  ? 60  LEU D CD2 1 
ATOM 3607 N N   . ALA C 1 61  ? 34.928 15.198  -28.068 1.00 41.59  ? 61  ALA D N   1 
ATOM 3608 C CA  . ALA C 1 61  ? 35.100 16.588  -28.455 1.00 41.68  ? 61  ALA D CA  1 
ATOM 3609 C C   . ALA C 1 61  ? 34.987 16.684  -29.951 1.00 40.29  ? 61  ALA D C   1 
ATOM 3610 O O   . ALA C 1 61  ? 34.249 17.537  -30.460 1.00 40.65  ? 61  ALA D O   1 
ATOM 3611 C CB  . ALA C 1 61  ? 36.440 17.118  -27.998 1.00 41.94  ? 61  ALA D CB  1 
ATOM 3612 N N   . ASN C 1 62  ? 35.698 15.784  -30.642 1.00 38.94  ? 62  ASN D N   1 
ATOM 3613 C CA  . ASN C 1 62  ? 35.710 15.750  -32.110 1.00 37.35  ? 62  ASN D CA  1 
ATOM 3614 C C   . ASN C 1 62  ? 34.373 15.471  -32.742 1.00 36.12  ? 62  ASN D C   1 
ATOM 3615 O O   . ASN C 1 62  ? 34.052 16.056  -33.770 1.00 35.29  ? 62  ASN D O   1 
ATOM 3616 C CB  . ASN C 1 62  ? 36.817 14.848  -32.660 1.00 36.67  ? 62  ASN D CB  1 
ATOM 3617 C CG  . ASN C 1 62  ? 38.118 15.627  -32.885 1.00 39.03  ? 62  ASN D CG  1 
ATOM 3618 O OD1 . ASN C 1 62  ? 38.084 16.868  -32.980 1.00 41.39  ? 62  ASN D OD1 1 
ATOM 3619 N ND2 . ASN C 1 62  ? 39.263 14.923  -32.950 1.00 38.34  ? 62  ASN D ND2 1 
ATOM 3620 N N   . ILE C 1 63  ? 33.596 14.598  -32.103 1.00 35.75  ? 63  ILE D N   1 
ATOM 3621 C CA  . ILE C 1 63  ? 32.232 14.294  -32.544 1.00 35.48  ? 63  ILE D CA  1 
ATOM 3622 C C   . ILE C 1 63  ? 31.354 15.515  -32.378 1.00 36.77  ? 63  ILE D C   1 
ATOM 3623 O O   . ILE C 1 63  ? 30.477 15.773  -33.211 1.00 36.43  ? 63  ILE D O   1 
ATOM 3624 C CB  . ILE C 1 63  ? 31.611 13.108  -31.742 1.00 36.33  ? 63  ILE D CB  1 
ATOM 3625 C CG1 . ILE C 1 63  ? 32.341 11.796  -32.056 1.00 33.52  ? 63  ILE D CG1 1 
ATOM 3626 C CG2 . ILE C 1 63  ? 30.052 12.986  -31.974 1.00 35.05  ? 63  ILE D CG2 1 
ATOM 3627 C CD1 . ILE C 1 63  ? 32.213 11.343  -33.501 1.00 31.67  ? 63  ILE D CD1 1 
ATOM 3628 N N   . ALA C 1 64  ? 31.608 16.274  -31.307 1.00 38.07  ? 64  ALA D N   1 
ATOM 3629 C CA  . ALA C 1 64  ? 30.822 17.480  -31.009 1.00 39.42  ? 64  ALA D CA  1 
ATOM 3630 C C   . ALA C 1 64  ? 31.111 18.535  -32.031 1.00 39.17  ? 64  ALA D C   1 
ATOM 3631 O O   . ALA C 1 64  ? 30.206 19.241  -32.450 1.00 40.34  ? 64  ALA D O   1 
ATOM 3632 C CB  . ALA C 1 64  ? 31.135 18.017  -29.620 1.00 40.77  ? 64  ALA D CB  1 
ATOM 3633 N N   . ILE C 1 65  ? 32.386 18.647  -32.404 1.00 38.14  ? 65  ILE D N   1 
ATOM 3634 C CA  . ILE C 1 65  ? 32.811 19.532  -33.466 1.00 37.69  ? 65  ILE D CA  1 
ATOM 3635 C C   . ILE C 1 65  ? 32.140 19.071  -34.753 1.00 37.79  ? 65  ILE D C   1 
ATOM 3636 O O   . ILE C 1 65  ? 31.414 19.830  -35.356 1.00 38.83  ? 65  ILE D O   1 
ATOM 3637 C CB  . ILE C 1 65  ? 34.381 19.603  -33.579 1.00 37.25  ? 65  ILE D CB  1 
ATOM 3638 C CG1 . ILE C 1 65  ? 34.969 20.392  -32.392 1.00 37.18  ? 65  ILE D CG1 1 
ATOM 3639 C CG2 . ILE C 1 65  ? 34.837 20.237  -34.901 1.00 35.12  ? 65  ILE D CG2 1 
ATOM 3640 C CD1 . ILE C 1 65  ? 36.487 20.299  -32.256 1.00 36.73  ? 65  ILE D CD1 1 
ATOM 3641 N N   . LEU C 1 66  ? 32.339 17.821  -35.161 1.00 37.05  ? 66  LEU D N   1 
ATOM 3642 C CA  . LEU C 1 66  ? 31.723 17.350  -36.398 1.00 37.04  ? 66  LEU D CA  1 
ATOM 3643 C C   . LEU C 1 66  ? 30.231 17.580  -36.468 1.00 38.71  ? 66  LEU D C   1 
ATOM 3644 O O   . LEU C 1 66  ? 29.670 17.824  -37.565 1.00 38.86  ? 66  LEU D O   1 
ATOM 3645 C CB  . LEU C 1 66  ? 31.994 15.879  -36.619 1.00 35.90  ? 66  LEU D CB  1 
ATOM 3646 C CG  . LEU C 1 66  ? 33.437 15.610  -36.984 1.00 34.98  ? 66  LEU D CG  1 
ATOM 3647 C CD1 . LEU C 1 66  ? 33.507 14.196  -37.505 1.00 35.62  ? 66  LEU D CD1 1 
ATOM 3648 C CD2 . LEU C 1 66  ? 33.957 16.632  -38.011 1.00 33.40  ? 66  LEU D CD2 1 
ATOM 3649 N N   . ASN C 1 67  ? 29.586 17.469  -35.309 1.00 40.18  ? 67  ASN D N   1 
ATOM 3650 C CA  . ASN C 1 67  ? 28.149 17.751  -35.201 1.00 42.05  ? 67  ASN D CA  1 
ATOM 3651 C C   . ASN C 1 67  ? 27.843 19.185  -35.520 1.00 42.71  ? 67  ASN D C   1 
ATOM 3652 O O   . ASN C 1 67  ? 26.903 19.477  -36.225 1.00 43.13  ? 67  ASN D O   1 
ATOM 3653 C CB  . ASN C 1 67  ? 27.621 17.403  -33.814 1.00 43.54  ? 67  ASN D CB  1 
ATOM 3654 C CG  . ASN C 1 67  ? 27.095 16.008  -33.752 1.00 44.32  ? 67  ASN D CG  1 
ATOM 3655 O OD1 . ASN C 1 67  ? 26.094 15.692  -34.405 1.00 47.23  ? 67  ASN D OD1 1 
ATOM 3656 N ND2 . ASN C 1 67  ? 27.767 15.146  -32.998 1.00 45.09  ? 67  ASN D ND2 1 
ATOM 3657 N N   . ASN C 1 68  ? 28.676 20.076  -35.014 1.00 43.46  ? 68  ASN D N   1 
ATOM 3658 C CA  . ASN C 1 68  ? 28.608 21.476  -35.394 1.00 45.04  ? 68  ASN D CA  1 
ATOM 3659 C C   . ASN C 1 68  ? 28.826 21.712  -36.870 1.00 44.03  ? 68  ASN D C   1 
ATOM 3660 O O   . ASN C 1 68  ? 28.013 22.395  -37.505 1.00 45.58  ? 68  ASN D O   1 
ATOM 3661 C CB  . ASN C 1 68  ? 29.528 22.328  -34.523 1.00 45.82  ? 68  ASN D CB  1 
ATOM 3662 C CG  . ASN C 1 68  ? 29.080 22.335  -33.063 1.00 49.68  ? 68  ASN D CG  1 
ATOM 3663 O OD1 . ASN C 1 68  ? 29.867 22.615  -32.159 1.00 53.21  ? 68  ASN D OD1 1 
ATOM 3664 N ND2 . ASN C 1 68  ? 27.802 22.000  -32.827 1.00 53.39  ? 68  ASN D ND2 1 
ATOM 3665 N N   . ASN C 1 69  ? 29.865 21.115  -37.437 1.00 42.25  ? 69  ASN D N   1 
ATOM 3666 C CA  . ASN C 1 69  ? 30.082 21.248  -38.866 1.00 42.33  ? 69  ASN D CA  1 
ATOM 3667 C C   . ASN C 1 69  ? 28.881 20.748  -39.658 1.00 42.87  ? 69  ASN D C   1 
ATOM 3668 O O   . ASN C 1 69  ? 28.474 21.356  -40.653 1.00 42.71  ? 69  ASN D O   1 
ATOM 3669 C CB  . ASN C 1 69  ? 31.343 20.523  -39.297 1.00 41.26  ? 69  ASN D CB  1 
ATOM 3670 C CG  . ASN C 1 69  ? 32.610 21.207  -38.815 1.00 41.56  ? 69  ASN D CG  1 
ATOM 3671 O OD1 . ASN C 1 69  ? 33.707 20.661  -38.925 1.00 40.58  ? 69  ASN D OD1 1 
ATOM 3672 N ND2 . ASN C 1 69  ? 32.468 22.404  -38.288 1.00 43.70  ? 69  ASN D ND2 1 
ATOM 3673 N N   . LEU C 1 70  ? 28.298 19.644  -39.179 1.00 43.55  ? 70  LEU D N   1 
ATOM 3674 C CA  . LEU C 1 70  ? 27.152 19.024  -39.830 1.00 43.91  ? 70  LEU D CA  1 
ATOM 3675 C C   . LEU C 1 70  ? 26.040 20.043  -40.026 1.00 46.05  ? 70  LEU D C   1 
ATOM 3676 O O   . LEU C 1 70  ? 25.537 20.198  -41.143 1.00 47.00  ? 70  LEU D O   1 
ATOM 3677 C CB  . LEU C 1 70  ? 26.675 17.796  -39.044 1.00 43.57  ? 70  LEU D CB  1 
ATOM 3678 C CG  . LEU C 1 70  ? 25.434 17.016  -39.531 1.00 42.90  ? 70  LEU D CG  1 
ATOM 3679 C CD1 . LEU C 1 70  ? 25.654 16.413  -40.906 1.00 41.22  ? 70  LEU D CD1 1 
ATOM 3680 C CD2 . LEU C 1 70  ? 25.023 15.937  -38.532 1.00 39.16  ? 70  LEU D CD2 1 
ATOM 3681 N N   . ASN C 1 71  ? 25.688 20.756  -38.958 1.00 47.22  ? 71  ASN D N   1 
ATOM 3682 C CA  . ASN C 1 71  ? 24.639 21.767  -39.029 1.00 49.79  ? 71  ASN D CA  1 
ATOM 3683 C C   . ASN C 1 71  ? 24.994 22.897  -39.975 1.00 50.05  ? 71  ASN D C   1 
ATOM 3684 O O   . ASN C 1 71  ? 24.161 23.337  -40.765 1.00 50.85  ? 71  ASN D O   1 
ATOM 3685 C CB  . ASN C 1 71  ? 24.317 22.317  -37.637 1.00 51.64  ? 71  ASN D CB  1 
ATOM 3686 C CG  . ASN C 1 71  ? 23.752 21.251  -36.704 1.00 54.24  ? 71  ASN D CG  1 
ATOM 3687 O OD1 . ASN C 1 71  ? 24.144 21.171  -35.537 1.00 56.53  ? 71  ASN D OD1 1 
ATOM 3688 N ND2 . ASN C 1 71  ? 22.842 20.406  -37.225 1.00 55.83  ? 71  ASN D ND2 1 
ATOM 3689 N N   . THR C 1 72  ? 26.249 23.341  -39.894 1.00 49.10  ? 72  THR D N   1 
ATOM 3690 C CA  . THR C 1 72  ? 26.774 24.365  -40.766 1.00 49.03  ? 72  THR D CA  1 
ATOM 3691 C C   . THR C 1 72  ? 26.553 23.968  -42.207 1.00 48.61  ? 72  THR D C   1 
ATOM 3692 O O   . THR C 1 72  ? 26.106 24.767  -43.023 1.00 50.26  ? 72  THR D O   1 
ATOM 3693 C CB  . THR C 1 72  ? 28.272 24.607  -40.494 1.00 48.14  ? 72  THR D CB  1 
ATOM 3694 O OG1 . THR C 1 72  ? 28.448 24.877  -39.100 1.00 49.74  ? 72  THR D OG1 1 
ATOM 3695 C CG2 . THR C 1 72  ? 28.789 25.788  -41.293 1.00 46.86  ? 72  THR D CG2 1 
ATOM 3696 N N   . LEU C 1 73  ? 26.820 22.712  -42.510 1.00 47.33  ? 73  LEU D N   1 
ATOM 3697 C CA  . LEU C 1 73  ? 26.701 22.264  -43.882 1.00 47.23  ? 73  LEU D CA  1 
ATOM 3698 C C   . LEU C 1 73  ? 25.292 21.916  -44.365 1.00 48.36  ? 73  LEU D C   1 
ATOM 3699 O O   . LEU C 1 73  ? 24.999 22.032  -45.555 1.00 48.42  ? 73  LEU D O   1 
ATOM 3700 C CB  . LEU C 1 73  ? 27.750 21.204  -44.200 1.00 45.46  ? 73  LEU D CB  1 
ATOM 3701 C CG  . LEU C 1 73  ? 28.930 22.069  -44.643 1.00 45.24  ? 73  LEU D CG  1 
ATOM 3702 C CD1 . LEU C 1 73  ? 29.903 22.359  -43.492 1.00 41.75  ? 73  LEU D CD1 1 
ATOM 3703 C CD2 . LEU C 1 73  ? 29.607 21.485  -45.867 1.00 44.78  ? 73  LEU D CD2 1 
ATOM 3704 N N   . ILE C 1 74  ? 24.427 21.491  -43.451 1.00 49.09  ? 74  ILE D N   1 
ATOM 3705 C CA  . ILE C 1 74  ? 23.055 21.252  -43.827 1.00 51.28  ? 74  ILE D CA  1 
ATOM 3706 C C   . ILE C 1 74  ? 22.515 22.575  -44.373 1.00 53.46  ? 74  ILE D C   1 
ATOM 3707 O O   . ILE C 1 74  ? 21.797 22.593  -45.369 1.00 54.26  ? 74  ILE D O   1 
ATOM 3708 C CB  . ILE C 1 74  ? 22.197 20.708  -42.642 1.00 51.90  ? 74  ILE D CB  1 
ATOM 3709 C CG1 . ILE C 1 74  ? 22.607 19.266  -42.290 1.00 51.26  ? 74  ILE D CG1 1 
ATOM 3710 C CG2 . ILE C 1 74  ? 20.717 20.725  -42.983 1.00 52.46  ? 74  ILE D CG2 1 
ATOM 3711 C CD1 . ILE C 1 74  ? 21.970 18.685  -40.978 1.00 51.04  ? 74  ILE D CD1 1 
ATOM 3712 N N   . GLN C 1 75  ? 22.921 23.680  -43.751 1.00 54.74  ? 75  GLN D N   1 
ATOM 3713 C CA  . GLN C 1 75  ? 22.470 25.005  -44.182 1.00 57.23  ? 75  GLN D CA  1 
ATOM 3714 C C   . GLN C 1 75  ? 23.100 25.447  -45.505 1.00 56.80  ? 75  GLN D C   1 
ATOM 3715 O O   . GLN C 1 75  ? 22.393 25.951  -46.357 1.00 57.83  ? 75  GLN D O   1 
ATOM 3716 C CB  . GLN C 1 75  ? 22.694 26.091  -43.107 1.00 58.55  ? 75  GLN D CB  1 
ATOM 3717 C CG  . GLN C 1 75  ? 22.750 25.621  -41.639 1.00 60.15  ? 75  GLN D CG  1 
ATOM 3718 C CD  . GLN C 1 75  ? 21.455 24.966  -41.124 1.00 64.52  ? 75  GLN D CD  1 
ATOM 3719 O OE1 . GLN C 1 75  ? 20.352 25.322  -41.547 1.00 67.10  ? 75  GLN D OE1 1 
ATOM 3720 N NE2 . GLN C 1 75  ? 21.596 24.017  -40.183 1.00 63.42  ? 75  GLN D NE2 1 
ATOM 3721 N N   . ARG C 1 76  ? 24.410 25.267  -45.679 1.00 55.22  ? 76  ARG D N   1 
ATOM 3722 C CA  . ARG C 1 76  ? 25.070 25.732  -46.916 1.00 55.64  ? 76  ARG D CA  1 
ATOM 3723 C C   . ARG C 1 76  ? 24.665 24.935  -48.161 1.00 55.47  ? 76  ARG D C   1 
ATOM 3724 O O   . ARG C 1 76  ? 24.444 25.504  -49.232 1.00 56.31  ? 76  ARG D O   1 
ATOM 3725 C CB  . ARG C 1 76  ? 26.594 25.755  -46.791 1.00 54.11  ? 76  ARG D CB  1 
ATOM 3726 C CG  . ARG C 1 76  ? 27.117 26.562  -45.635 1.00 55.76  ? 76  ARG D CG  1 
ATOM 3727 C CD  . ARG C 1 76  ? 28.354 27.355  -46.036 1.00 57.93  ? 76  ARG D CD  1 
ATOM 3728 N NE  . ARG C 1 76  ? 29.417 26.533  -46.624 1.00 56.72  ? 76  ARG D NE  1 
ATOM 3729 C CZ  . ARG C 1 76  ? 30.594 26.286  -46.041 1.00 57.41  ? 76  ARG D CZ  1 
ATOM 3730 N NH1 . ARG C 1 76  ? 30.877 26.793  -44.842 1.00 57.77  ? 76  ARG D NH1 1 
ATOM 3731 N NH2 . ARG C 1 76  ? 31.505 25.537  -46.660 1.00 54.99  ? 76  ARG D NH2 1 
ATOM 3732 N N   . SER C 1 77  ? 24.568 23.620  -48.002 1.00 54.35  ? 77  SER D N   1 
ATOM 3733 C CA  . SER C 1 77  ? 24.192 22.719  -49.083 1.00 54.83  ? 77  SER D CA  1 
ATOM 3734 C C   . SER C 1 77  ? 22.724 22.894  -49.544 1.00 56.96  ? 77  SER D C   1 
ATOM 3735 O O   . SER C 1 77  ? 22.231 22.135  -50.406 1.00 56.89  ? 77  SER D O   1 
ATOM 3736 C CB  . SER C 1 77  ? 24.433 21.271  -48.635 1.00 53.30  ? 77  SER D CB  1 
ATOM 3737 O OG  . SER C 1 77  ? 23.577 20.920  -47.541 1.00 52.66  ? 77  SER D OG  1 
ATOM 3738 N N   . ASN C 1 78  ? 22.050 23.907  -48.973 1.00 58.77  ? 78  ASN D N   1 
ATOM 3739 C CA  . ASN C 1 78  ? 20.587 24.076  -49.070 1.00 60.97  ? 78  ASN D CA  1 
ATOM 3740 C C   . ASN C 1 78  ? 19.977 22.705  -48.885 1.00 60.57  ? 78  ASN D C   1 
ATOM 3741 O O   . ASN C 1 78  ? 19.309 22.184  -49.776 1.00 61.15  ? 78  ASN D O   1 
ATOM 3742 C CB  . ASN C 1 78  ? 20.121 24.723  -50.404 1.00 62.57  ? 78  ASN D CB  1 
ATOM 3743 C CG  . ASN C 1 78  ? 20.624 26.214  -50.574 1.00 65.19  ? 78  ASN D CG  1 
ATOM 3744 O OD1 . ASN C 1 78  ? 20.739 26.986  -49.613 1.00 67.42  ? 78  ASN D OD1 1 
ATOM 3745 N ND2 . ASN C 1 78  ? 21.039 26.588  -51.806 1.00 67.18  ? 78  ASN D ND2 1 
ATOM 3746 N N   . HIS C 1 79  ? 20.283 22.104  -47.736 1.00 59.82  ? 79  HIS D N   1 
ATOM 3747 C CA  . HIS C 1 79  ? 19.780 20.796  -47.361 1.00 59.64  ? 79  HIS D CA  1 
ATOM 3748 C C   . HIS C 1 79  ? 19.964 19.698  -48.404 1.00 58.51  ? 79  HIS D C   1 
ATOM 3749 O O   . HIS C 1 79  ? 18.997 19.064  -48.805 1.00 59.40  ? 79  HIS D O   1 
ATOM 3750 C CB  . HIS C 1 79  ? 18.303 20.922  -46.993 1.00 61.79  ? 79  HIS D CB  1 
ATOM 3751 C CG  . HIS C 1 79  ? 18.090 21.514  -45.626 1.00 65.57  ? 79  HIS D CG  1 
ATOM 3752 N ND1 . HIS C 1 79  ? 17.868 20.739  -44.500 1.00 68.01  ? 79  HIS D ND1 1 
ATOM 3753 C CD2 . HIS C 1 79  ? 18.061 22.800  -45.204 1.00 69.06  ? 79  HIS D CD2 1 
ATOM 3754 C CE1 . HIS C 1 79  ? 17.605 21.527  -43.443 1.00 69.32  ? 79  HIS D CE1 1 
ATOM 3755 N NE2 . HIS C 1 79  ? 17.700 22.781  -43.845 1.00 70.21  ? 79  HIS D NE2 1 
ATOM 3756 N N   . THR C 1 80  ? 21.195 19.456  -48.836 1.00 56.99  ? 80  THR D N   1 
ATOM 3757 C CA  . THR C 1 80  ? 21.428 18.387  -49.807 1.00 56.18  ? 80  THR D CA  1 
ATOM 3758 C C   . THR C 1 80  ? 21.573 16.993  -49.159 1.00 54.84  ? 80  THR D C   1 
ATOM 3759 O O   . THR C 1 80  ? 22.371 16.797  -48.238 1.00 53.55  ? 80  THR D O   1 
ATOM 3760 C CB  . THR C 1 80  ? 22.621 18.694  -50.755 1.00 55.80  ? 80  THR D CB  1 
ATOM 3761 O OG1 . THR C 1 80  ? 22.254 19.749  -51.661 1.00 56.72  ? 80  THR D OG1 1 
ATOM 3762 C CG2 . THR C 1 80  ? 23.031 17.430  -51.550 1.00 53.97  ? 80  THR D CG2 1 
ATOM 3763 N N   . GLN C 1 81  ? 20.766 16.048  -49.643 1.00 54.90  ? 81  GLN D N   1 
ATOM 3764 C CA  . GLN C 1 81  ? 20.912 14.630  -49.317 1.00 53.18  ? 81  GLN D CA  1 
ATOM 3765 C C   . GLN C 1 81  ? 21.556 13.872  -50.493 1.00 52.66  ? 81  GLN D C   1 
ATOM 3766 O O   . GLN C 1 81  ? 21.342 14.205  -51.679 1.00 53.45  ? 81  GLN D O   1 
ATOM 3767 C CB  . GLN C 1 81  ? 19.559 14.000  -48.939 1.00 53.66  ? 81  GLN D CB  1 
ATOM 3768 C CG  . GLN C 1 81  ? 19.690 12.582  -48.357 1.00 51.55  ? 81  GLN D CG  1 
ATOM 3769 C CD  . GLN C 1 81  ? 18.480 12.111  -47.557 1.00 50.36  ? 81  GLN D CD  1 
ATOM 3770 O OE1 . GLN C 1 81  ? 17.468 12.800  -47.457 1.00 52.78  ? 81  GLN D OE1 1 
ATOM 3771 N NE2 . GLN C 1 81  ? 18.594 10.932  -46.971 1.00 47.32  ? 81  GLN D NE2 1 
ATOM 3772 N N   . ALA C 1 82  ? 22.342 12.851  -50.153 1.00 50.56  ? 82  ALA D N   1 
ATOM 3773 C CA  . ALA C 1 82  ? 23.052 12.086  -51.160 1.00 49.52  ? 82  ALA D CA  1 
ATOM 3774 C C   . ALA C 1 82  ? 22.282 10.851  -51.592 1.00 49.37  ? 82  ALA D C   1 
ATOM 3775 O O   . ALA C 1 82  ? 21.618 10.212  -50.772 1.00 48.93  ? 82  ALA D O   1 
ATOM 3776 C CB  . ALA C 1 82  ? 24.395 11.697  -50.640 1.00 48.46  ? 82  ALA D CB  1 
ATOM 3777 N N   . THR C 1 83  ? 22.387 10.531  -52.883 1.00 49.43  ? 83  THR D N   1 
ATOM 3778 C CA  . THR C 1 83  ? 21.861 9.299   -53.460 1.00 49.36  ? 83  THR D CA  1 
ATOM 3779 C C   . THR C 1 83  ? 22.307 8.099   -52.607 1.00 48.08  ? 83  THR D C   1 
ATOM 3780 O O   . THR C 1 83  ? 23.429 8.094   -52.090 1.00 47.38  ? 83  THR D O   1 
ATOM 3781 C CB  . THR C 1 83  ? 22.363 9.109   -54.907 1.00 49.83  ? 83  THR D CB  1 
ATOM 3782 O OG1 . THR C 1 83  ? 23.796 9.081   -54.908 1.00 48.09  ? 83  THR D OG1 1 
ATOM 3783 C CG2 . THR C 1 83  ? 21.900 10.253  -55.784 1.00 50.94  ? 83  THR D CG2 1 
ATOM 3784 N N   . ASN C 1 84  ? 21.439 7.097   -52.467 1.00 47.55  ? 84  ASN D N   1 
ATOM 3785 C CA  . ASN C 1 84  ? 21.718 5.971   -51.590 1.00 46.00  ? 84  ASN D CA  1 
ATOM 3786 C C   . ASN C 1 84  ? 22.530 4.920   -52.321 1.00 45.70  ? 84  ASN D C   1 
ATOM 3787 O O   . ASN C 1 84  ? 22.073 4.378   -53.307 1.00 46.75  ? 84  ASN D O   1 
ATOM 3788 C CB  . ASN C 1 84  ? 20.411 5.349   -51.062 1.00 46.06  ? 84  ASN D CB  1 
ATOM 3789 C CG  . ASN C 1 84  ? 19.583 6.321   -50.214 1.00 45.64  ? 84  ASN D CG  1 
ATOM 3790 O OD1 . ASN C 1 84  ? 20.099 6.973   -49.282 1.00 42.85  ? 84  ASN D OD1 1 
ATOM 3791 N ND2 . ASN C 1 84  ? 18.286 6.424   -50.538 1.00 43.12  ? 84  ASN D ND2 1 
ATOM 3792 N N   . ASP C 1 85  ? 23.731 4.619   -51.831 1.00 45.03  ? 85  ASP D N   1 
ATOM 3793 C CA  . ASP C 1 85  ? 24.640 3.683   -52.525 1.00 44.65  ? 85  ASP D CA  1 
ATOM 3794 C C   . ASP C 1 85  ? 24.560 2.247   -52.012 1.00 43.77  ? 85  ASP D C   1 
ATOM 3795 O O   . ASP C 1 85  ? 24.881 1.994   -50.857 1.00 42.88  ? 85  ASP D O   1 
ATOM 3796 C CB  . ASP C 1 85  ? 26.069 4.227   -52.521 1.00 43.73  ? 85  ASP D CB  1 
ATOM 3797 C CG  . ASP C 1 85  ? 26.216 5.460   -53.425 1.00 44.88  ? 85  ASP D CG  1 
ATOM 3798 O OD1 . ASP C 1 85  ? 27.025 6.361   -53.117 1.00 43.35  ? 85  ASP D OD1 1 
ATOM 3799 O OD2 . ASP C 1 85  ? 25.496 5.526   -54.442 1.00 45.36  ? 85  ASP D OD2 1 
ATOM 3800 N N   . PRO C 1 86  ? 24.118 1.311   -52.879 1.00 44.20  ? 86  PRO D N   1 
ATOM 3801 C CA  . PRO C 1 86  ? 23.778 -0.032  -52.454 1.00 43.84  ? 86  PRO D CA  1 
ATOM 3802 C C   . PRO C 1 86  ? 25.010 -0.872  -52.151 1.00 43.01  ? 86  PRO D C   1 
ATOM 3803 O O   . PRO C 1 86  ? 26.062 -0.683  -52.765 1.00 42.87  ? 86  PRO D O   1 
ATOM 3804 C CB  . PRO C 1 86  ? 23.001 -0.606  -53.648 1.00 44.73  ? 86  PRO D CB  1 
ATOM 3805 C CG  . PRO C 1 86  ? 23.443 0.120   -54.784 1.00 45.09  ? 86  PRO D CG  1 
ATOM 3806 C CD  . PRO C 1 86  ? 23.932 1.474   -54.328 1.00 45.73  ? 86  PRO D CD  1 
ATOM 3807 N N   . PRO C 1 87  ? 24.876 -1.783  -51.183 1.00 42.55  ? 87  PRO D N   1 
ATOM 3808 C CA  . PRO C 1 87  ? 25.970 -2.592  -50.706 1.00 41.96  ? 87  PRO D CA  1 
ATOM 3809 C C   . PRO C 1 87  ? 26.270 -3.723  -51.648 1.00 42.82  ? 87  PRO D C   1 
ATOM 3810 O O   . PRO C 1 87  ? 25.389 -4.180  -52.349 1.00 43.71  ? 87  PRO D O   1 
ATOM 3811 C CB  . PRO C 1 87  ? 25.426 -3.164  -49.391 1.00 41.59  ? 87  PRO D CB  1 
ATOM 3812 C CG  . PRO C 1 87  ? 24.212 -2.359  -49.065 1.00 41.49  ? 87  PRO D CG  1 
ATOM 3813 C CD  . PRO C 1 87  ? 23.666 -1.953  -50.359 1.00 42.36  ? 87  PRO D CD  1 
ATOM 3814 N N   . GLU C 1 88  ? 27.521 -4.159  -51.648 1.00 43.25  ? 88  GLU D N   1 
ATOM 3815 C CA  . GLU C 1 88  ? 27.950 -5.387  -52.320 1.00 44.41  ? 88  GLU D CA  1 
ATOM 3816 C C   . GLU C 1 88  ? 28.345 -6.365  -51.199 1.00 43.05  ? 88  GLU D C   1 
ATOM 3817 O O   . GLU C 1 88  ? 29.009 -5.975  -50.207 1.00 42.15  ? 88  GLU D O   1 
ATOM 3818 C CB  . GLU C 1 88  ? 29.134 -5.077  -53.240 1.00 45.15  ? 88  GLU D CB  1 
ATOM 3819 C CG  . GLU C 1 88  ? 29.769 -6.264  -53.961 1.00 49.16  ? 88  GLU D CG  1 
ATOM 3820 C CD  . GLU C 1 88  ? 31.200 -5.955  -54.481 1.00 54.76  ? 88  GLU D CD  1 
ATOM 3821 O OE1 . GLU C 1 88  ? 32.064 -6.868  -54.406 1.00 55.97  ? 88  GLU D OE1 1 
ATOM 3822 O OE2 . GLU C 1 88  ? 31.466 -4.811  -54.946 1.00 55.16  ? 88  GLU D OE2 1 
ATOM 3823 N N   . VAL C 1 89  ? 27.911 -7.619  -51.321 1.00 42.43  ? 89  VAL D N   1 
ATOM 3824 C CA  . VAL C 1 89  ? 28.118 -8.564  -50.218 1.00 40.24  ? 89  VAL D CA  1 
ATOM 3825 C C   . VAL C 1 89  ? 28.751 -9.854  -50.639 1.00 40.09  ? 89  VAL D C   1 
ATOM 3826 O O   . VAL C 1 89  ? 28.344 -10.473 -51.619 1.00 41.28  ? 89  VAL D O   1 
ATOM 3827 C CB  . VAL C 1 89  ? 26.828 -8.936  -49.480 1.00 40.17  ? 89  VAL D CB  1 
ATOM 3828 C CG1 . VAL C 1 89  ? 27.172 -9.607  -48.157 1.00 38.83  ? 89  VAL D CG1 1 
ATOM 3829 C CG2 . VAL C 1 89  ? 25.930 -7.717  -49.271 1.00 39.68  ? 89  VAL D CG2 1 
ATOM 3830 N N   . THR C 1 90  ? 29.734 -10.261 -49.849 1.00 38.77  ? 90  THR D N   1 
ATOM 3831 C CA  . THR C 1 90  ? 30.311 -11.577 -49.917 1.00 38.73  ? 90  THR D CA  1 
ATOM 3832 C C   . THR C 1 90  ? 30.186 -12.269 -48.572 1.00 37.96  ? 90  THR D C   1 
ATOM 3833 O O   . THR C 1 90  ? 30.036 -11.621 -47.549 1.00 37.46  ? 90  THR D O   1 
ATOM 3834 C CB  . THR C 1 90  ? 31.745 -11.467 -50.258 1.00 38.67  ? 90  THR D CB  1 
ATOM 3835 O OG1 . THR C 1 90  ? 32.359 -10.574 -49.323 1.00 38.91  ? 90  THR D OG1 1 
ATOM 3836 C CG2 . THR C 1 90  ? 31.869 -10.914 -51.659 1.00 39.10  ? 90  THR D CG2 1 
ATOM 3837 N N   . VAL C 1 91  ? 30.234 -13.591 -48.591 1.00 38.55  ? 91  VAL D N   1 
ATOM 3838 C CA  . VAL C 1 91  ? 30.174 -14.393 -47.368 1.00 38.59  ? 91  VAL D CA  1 
ATOM 3839 C C   . VAL C 1 91  ? 31.217 -15.521 -47.430 1.00 38.81  ? 91  VAL D C   1 
ATOM 3840 O O   . VAL C 1 91  ? 31.225 -16.325 -48.384 1.00 39.89  ? 91  VAL D O   1 
ATOM 3841 C CB  . VAL C 1 91  ? 28.769 -15.013 -47.190 1.00 38.85  ? 91  VAL D CB  1 
ATOM 3842 C CG1 . VAL C 1 91  ? 28.717 -15.969 -46.013 1.00 38.62  ? 91  VAL D CG1 1 
ATOM 3843 C CG2 . VAL C 1 91  ? 27.721 -13.927 -47.022 1.00 40.03  ? 91  VAL D CG2 1 
ATOM 3844 N N   . PHE C 1 92  ? 32.086 -15.590 -46.425 1.00 37.56  ? 92  PHE D N   1 
ATOM 3845 C CA  . PHE C 1 92  ? 33.139 -16.616 -46.419 1.00 37.84  ? 92  PHE D CA  1 
ATOM 3846 C C   . PHE C 1 92  ? 33.523 -17.030 -44.990 1.00 37.42  ? 92  PHE D C   1 
ATOM 3847 O O   . PHE C 1 92  ? 33.245 -16.316 -44.025 1.00 36.70  ? 92  PHE D O   1 
ATOM 3848 C CB  . PHE C 1 92  ? 34.365 -16.100 -47.183 1.00 37.67  ? 92  PHE D CB  1 
ATOM 3849 C CG  . PHE C 1 92  ? 34.757 -14.725 -46.786 1.00 36.10  ? 92  PHE D CG  1 
ATOM 3850 C CD1 . PHE C 1 92  ? 35.698 -14.522 -45.783 1.00 35.67  ? 92  PHE D CD1 1 
ATOM 3851 C CD2 . PHE C 1 92  ? 34.129 -13.628 -47.353 1.00 35.69  ? 92  PHE D CD2 1 
ATOM 3852 C CE1 . PHE C 1 92  ? 36.013 -13.246 -45.362 1.00 35.49  ? 92  PHE D CE1 1 
ATOM 3853 C CE2 . PHE C 1 92  ? 34.452 -12.348 -46.951 1.00 34.93  ? 92  PHE D CE2 1 
ATOM 3854 C CZ  . PHE C 1 92  ? 35.387 -12.151 -45.954 1.00 34.20  ? 92  PHE D CZ  1 
ATOM 3855 N N   . PRO C 1 93  ? 34.150 -18.194 -44.843 1.00 38.04  ? 93  PRO D N   1 
ATOM 3856 C CA  . PRO C 1 93  ? 34.611 -18.453 -43.492 1.00 37.84  ? 93  PRO D CA  1 
ATOM 3857 C C   . PRO C 1 93  ? 36.035 -17.959 -43.329 1.00 38.24  ? 93  PRO D C   1 
ATOM 3858 O O   . PRO C 1 93  ? 36.747 -17.727 -44.328 1.00 38.12  ? 93  PRO D O   1 
ATOM 3859 C CB  . PRO C 1 93  ? 34.543 -19.986 -43.373 1.00 38.49  ? 93  PRO D CB  1 
ATOM 3860 C CG  . PRO C 1 93  ? 34.750 -20.470 -44.779 1.00 39.52  ? 93  PRO D CG  1 
ATOM 3861 C CD  . PRO C 1 93  ? 34.216 -19.390 -45.708 1.00 39.19  ? 93  PRO D CD  1 
ATOM 3862 N N   . LYS C 1 94  ? 36.437 -17.813 -42.070 1.00 38.25  ? 94  LYS D N   1 
ATOM 3863 C CA  . LYS C 1 94  ? 37.761 -17.360 -41.740 1.00 38.78  ? 94  LYS D CA  1 
ATOM 3864 C C   . LYS C 1 94  ? 38.786 -18.445 -41.992 1.00 41.50  ? 94  LYS D C   1 
ATOM 3865 O O   . LYS C 1 94  ? 39.900 -18.138 -42.396 1.00 42.54  ? 94  LYS D O   1 
ATOM 3866 C CB  . LYS C 1 94  ? 37.780 -16.910 -40.284 1.00 38.15  ? 94  LYS D CB  1 
ATOM 3867 C CG  . LYS C 1 94  ? 39.112 -16.513 -39.693 1.00 33.04  ? 94  LYS D CG  1 
ATOM 3868 C CD  . LYS C 1 94  ? 38.831 -16.036 -38.299 1.00 28.08  ? 94  LYS D CD  1 
ATOM 3869 C CE  . LYS C 1 94  ? 40.048 -16.005 -37.446 1.00 31.28  ? 94  LYS D CE  1 
ATOM 3870 N NZ  . LYS C 1 94  ? 40.903 -14.811 -37.743 1.00 31.23  ? 94  LYS D NZ  1 
ATOM 3871 N N   . GLU C 1 95  ? 38.386 -19.701 -41.785 1.00 43.79  ? 95  GLU D N   1 
ATOM 3872 C CA  . GLU C 1 95  ? 39.249 -20.869 -41.933 1.00 46.69  ? 95  GLU D CA  1 
ATOM 3873 C C   . GLU C 1 95  ? 38.732 -21.798 -43.017 1.00 47.91  ? 95  GLU D C   1 
ATOM 3874 O O   . GLU C 1 95  ? 37.536 -21.800 -43.292 1.00 47.41  ? 95  GLU D O   1 
ATOM 3875 C CB  . GLU C 1 95  ? 39.228 -21.673 -40.642 1.00 47.94  ? 95  GLU D CB  1 
ATOM 3876 C CG  . GLU C 1 95  ? 39.316 -20.851 -39.381 1.00 50.03  ? 95  GLU D CG  1 
ATOM 3877 C CD  . GLU C 1 95  ? 40.702 -20.342 -39.128 1.00 52.86  ? 95  GLU D CD  1 
ATOM 3878 O OE1 . GLU C 1 95  ? 41.660 -20.943 -39.668 1.00 55.40  ? 95  GLU D OE1 1 
ATOM 3879 O OE2 . GLU C 1 95  ? 40.826 -19.349 -38.379 1.00 54.16  ? 95  GLU D OE2 1 
ATOM 3880 N N   . PRO C 1 96  ? 39.623 -22.619 -43.615 1.00 49.76  ? 96  PRO D N   1 
ATOM 3881 C CA  . PRO C 1 96  ? 39.158 -23.658 -44.539 1.00 51.27  ? 96  PRO D CA  1 
ATOM 3882 C C   . PRO C 1 96  ? 38.195 -24.554 -43.798 1.00 52.13  ? 96  PRO D C   1 
ATOM 3883 O O   . PRO C 1 96  ? 38.466 -24.942 -42.669 1.00 52.56  ? 96  PRO D O   1 
ATOM 3884 C CB  . PRO C 1 96  ? 40.436 -24.449 -44.880 1.00 52.74  ? 96  PRO D CB  1 
ATOM 3885 C CG  . PRO C 1 96  ? 41.418 -24.121 -43.800 1.00 51.81  ? 96  PRO D CG  1 
ATOM 3886 C CD  . PRO C 1 96  ? 41.082 -22.699 -43.393 1.00 50.73  ? 96  PRO D CD  1 
ATOM 3887 N N   . VAL C 1 97  ? 37.062 -24.859 -44.408 1.00 53.04  ? 97  VAL D N   1 
ATOM 3888 C CA  . VAL C 1 97  ? 36.033 -25.587 -43.701 1.00 53.66  ? 97  VAL D CA  1 
ATOM 3889 C C   . VAL C 1 97  ? 36.369 -27.080 -43.554 1.00 56.27  ? 97  VAL D C   1 
ATOM 3890 O O   . VAL C 1 97  ? 36.564 -27.805 -44.549 1.00 57.55  ? 97  VAL D O   1 
ATOM 3891 C CB  . VAL C 1 97  ? 34.656 -25.349 -44.339 1.00 52.83  ? 97  VAL D CB  1 
ATOM 3892 C CG1 . VAL C 1 97  ? 33.657 -26.359 -43.848 1.00 52.87  ? 97  VAL D CG1 1 
ATOM 3893 C CG2 . VAL C 1 97  ? 34.179 -23.978 -43.996 1.00 51.10  ? 97  VAL D CG2 1 
ATOM 3894 N N   . GLU C 1 98  ? 36.441 -27.523 -42.301 1.00 57.34  ? 98  GLU D N   1 
ATOM 3895 C CA  . GLU C 1 98  ? 36.581 -28.937 -41.984 1.00 59.84  ? 98  GLU D CA  1 
ATOM 3896 C C   . GLU C 1 98  ? 35.400 -29.372 -41.141 1.00 59.41  ? 98  GLU D C   1 
ATOM 3897 O O   . GLU C 1 98  ? 35.034 -28.672 -40.198 1.00 58.95  ? 98  GLU D O   1 
ATOM 3898 C CB  . GLU C 1 98  ? 37.892 -29.192 -41.228 1.00 61.26  ? 98  GLU D CB  1 
ATOM 3899 C CG  . GLU C 1 98  ? 38.122 -30.656 -40.791 1.00 66.70  ? 98  GLU D CG  1 
ATOM 3900 C CD  . GLU C 1 98  ? 38.775 -30.771 -39.398 1.00 71.86  ? 98  GLU D CD  1 
ATOM 3901 O OE1 . GLU C 1 98  ? 38.429 -31.722 -38.638 1.00 73.18  ? 98  GLU D OE1 1 
ATOM 3902 O OE2 . GLU C 1 98  ? 39.623 -29.894 -39.069 1.00 73.49  ? 98  GLU D OE2 1 
ATOM 3903 N N   . LEU C 1 99  ? 34.809 -30.508 -41.529 1.00 60.26  ? 99  LEU D N   1 
ATOM 3904 C CA  . LEU C 1 99  ? 33.846 -31.319 -40.751 1.00 60.34  ? 99  LEU D CA  1 
ATOM 3905 C C   . LEU C 1 99  ? 33.935 -31.118 -39.230 1.00 59.56  ? 99  LEU D C   1 
ATOM 3906 O O   . LEU C 1 99  ? 35.015 -31.245 -38.635 1.00 60.29  ? 99  LEU D O   1 
ATOM 3907 C CB  . LEU C 1 99  ? 34.081 -32.807 -41.113 1.00 62.40  ? 99  LEU D CB  1 
ATOM 3908 C CG  . LEU C 1 99  ? 33.257 -34.059 -40.691 1.00 63.69  ? 99  LEU D CG  1 
ATOM 3909 C CD1 . LEU C 1 99  ? 33.151 -35.110 -41.818 1.00 61.69  ? 99  LEU D CD1 1 
ATOM 3910 C CD2 . LEU C 1 99  ? 33.778 -34.732 -39.405 1.00 64.15  ? 99  LEU D CD2 1 
ATOM 3911 N N   . GLY C 1 100 ? 32.803 -30.791 -38.619 1.00 58.26  ? 100 GLY D N   1 
ATOM 3912 C CA  . GLY C 1 100 ? 32.684 -30.613 -37.170 1.00 57.82  ? 100 GLY D CA  1 
ATOM 3913 C C   . GLY C 1 100 ? 33.789 -29.864 -36.433 1.00 57.40  ? 100 GLY D C   1 
ATOM 3914 O O   . GLY C 1 100 ? 34.132 -30.229 -35.309 1.00 58.22  ? 100 GLY D O   1 
ATOM 3915 N N   . GLN C 1 101 ? 34.344 -28.810 -37.036 1.00 56.07  ? 101 GLN D N   1 
ATOM 3916 C CA  . GLN C 1 101 ? 35.449 -28.065 -36.407 1.00 55.26  ? 101 GLN D CA  1 
ATOM 3917 C C   . GLN C 1 101 ? 35.147 -26.572 -36.229 1.00 52.99  ? 101 GLN D C   1 
ATOM 3918 O O   . GLN C 1 101 ? 35.111 -25.843 -37.228 1.00 52.76  ? 101 GLN D O   1 
ATOM 3919 C CB  . GLN C 1 101 ? 36.708 -28.215 -37.242 1.00 55.91  ? 101 GLN D CB  1 
ATOM 3920 C CG  . GLN C 1 101 ? 37.967 -27.759 -36.538 1.00 58.26  ? 101 GLN D CG  1 
ATOM 3921 C CD  . GLN C 1 101 ? 38.611 -28.886 -35.766 1.00 63.00  ? 101 GLN D CD  1 
ATOM 3922 O OE1 . GLN C 1 101 ? 38.229 -30.051 -35.912 1.00 65.41  ? 101 GLN D OE1 1 
ATOM 3923 N NE2 . GLN C 1 101 ? 39.599 -28.553 -34.944 1.00 64.93  ? 101 GLN D NE2 1 
ATOM 3924 N N   . PRO C 1 102 ? 34.962 -26.106 -34.970 1.00 51.53  ? 102 PRO D N   1 
ATOM 3925 C CA  . PRO C 1 102 ? 34.581 -24.702 -34.714 1.00 49.36  ? 102 PRO D CA  1 
ATOM 3926 C C   . PRO C 1 102 ? 35.310 -23.707 -35.635 1.00 47.59  ? 102 PRO D C   1 
ATOM 3927 O O   . PRO C 1 102 ? 36.542 -23.778 -35.787 1.00 48.15  ? 102 PRO D O   1 
ATOM 3928 C CB  . PRO C 1 102 ? 34.956 -24.482 -33.231 1.00 49.89  ? 102 PRO D CB  1 
ATOM 3929 C CG  . PRO C 1 102 ? 35.545 -25.808 -32.740 1.00 51.17  ? 102 PRO D CG  1 
ATOM 3930 C CD  . PRO C 1 102 ? 35.124 -26.862 -33.713 1.00 52.41  ? 102 PRO D CD  1 
ATOM 3931 N N   . ASN C 1 103 ? 34.535 -22.816 -36.256 1.00 45.18  ? 103 ASN D N   1 
ATOM 3932 C CA  . ASN C 1 103 ? 34.998 -21.889 -37.293 1.00 43.09  ? 103 ASN D CA  1 
ATOM 3933 C C   . ASN C 1 103 ? 34.262 -20.561 -37.147 1.00 41.93  ? 103 ASN D C   1 
ATOM 3934 O O   . ASN C 1 103 ? 33.522 -20.363 -36.177 1.00 41.88  ? 103 ASN D O   1 
ATOM 3935 C CB  . ASN C 1 103 ? 34.733 -22.476 -38.689 1.00 43.14  ? 103 ASN D CB  1 
ATOM 3936 C CG  . ASN C 1 103 ? 35.656 -21.914 -39.760 1.00 42.30  ? 103 ASN D CG  1 
ATOM 3937 O OD1 . ASN C 1 103 ? 36.099 -20.780 -39.687 1.00 39.62  ? 103 ASN D OD1 1 
ATOM 3938 N ND2 . ASN C 1 103 ? 35.946 -22.725 -40.766 1.00 43.99  ? 103 ASN D ND2 1 
ATOM 3939 N N   . THR C 1 104 ? 34.437 -19.665 -38.121 1.00 40.30  ? 104 THR D N   1 
ATOM 3940 C CA  . THR C 1 104 ? 33.826 -18.354 -38.071 1.00 38.72  ? 104 THR D CA  1 
ATOM 3941 C C   . THR C 1 104 ? 33.485 -17.828 -39.454 1.00 37.81  ? 104 THR D C   1 
ATOM 3942 O O   . THR C 1 104 ? 34.371 -17.594 -40.289 1.00 37.24  ? 104 THR D O   1 
ATOM 3943 C CB  . THR C 1 104 ? 34.735 -17.356 -37.326 1.00 38.44  ? 104 THR D CB  1 
ATOM 3944 O OG1 . THR C 1 104 ? 34.859 -17.797 -35.981 1.00 41.40  ? 104 THR D OG1 1 
ATOM 3945 C CG2 . THR C 1 104 ? 34.155 -15.950 -37.297 1.00 36.37  ? 104 THR D CG2 1 
ATOM 3946 N N   . LEU C 1 105 ? 32.183 -17.631 -39.654 1.00 37.15  ? 105 LEU D N   1 
ATOM 3947 C CA  . LEU C 1 105 ? 31.641 -17.018 -40.842 1.00 36.04  ? 105 LEU D CA  1 
ATOM 3948 C C   . LEU C 1 105 ? 31.754 -15.516 -40.840 1.00 35.17  ? 105 LEU D C   1 
ATOM 3949 O O   . LEU C 1 105 ? 31.415 -14.833 -39.854 1.00 35.08  ? 105 LEU D O   1 
ATOM 3950 C CB  . LEU C 1 105 ? 30.183 -17.376 -41.017 1.00 35.90  ? 105 LEU D CB  1 
ATOM 3951 C CG  . LEU C 1 105 ? 29.884 -18.417 -42.076 1.00 36.66  ? 105 LEU D CG  1 
ATOM 3952 C CD1 . LEU C 1 105 ? 28.387 -18.421 -42.341 1.00 36.54  ? 105 LEU D CD1 1 
ATOM 3953 C CD2 . LEU C 1 105 ? 30.684 -18.209 -43.371 1.00 36.65  ? 105 LEU D CD2 1 
ATOM 3954 N N   . ILE C 1 106 ? 32.186 -15.000 -41.983 1.00 34.30  ? 106 ILE D N   1 
ATOM 3955 C CA  . ILE C 1 106 ? 32.352 -13.582 -42.138 1.00 33.00  ? 106 ILE D CA  1 
ATOM 3956 C C   . ILE C 1 106 ? 31.444 -13.103 -43.246 1.00 33.29  ? 106 ILE D C   1 
ATOM 3957 O O   . ILE C 1 106 ? 31.354 -13.734 -44.325 1.00 33.79  ? 106 ILE D O   1 
ATOM 3958 C CB  . ILE C 1 106 ? 33.814 -13.232 -42.429 1.00 32.65  ? 106 ILE D CB  1 
ATOM 3959 C CG1 . ILE C 1 106 ? 34.701 -13.772 -41.315 1.00 30.78  ? 106 ILE D CG1 1 
ATOM 3960 C CG2 . ILE C 1 106 ? 33.989 -11.729 -42.537 1.00 30.76  ? 106 ILE D CG2 1 
ATOM 3961 C CD1 . ILE C 1 106 ? 36.055 -14.111 -41.758 1.00 28.24  ? 106 ILE D CD1 1 
ATOM 3962 N N   . CYS C 1 107 ? 30.753 -12.007 -42.965 1.00 32.56  ? 107 CYS D N   1 
ATOM 3963 C CA  . CYS C 1 107 ? 29.898 -11.418 -43.950 1.00 33.73  ? 107 CYS D CA  1 
ATOM 3964 C C   . CYS C 1 107 ? 30.349 -10.007 -44.124 1.00 33.38  ? 107 CYS D C   1 
ATOM 3965 O O   . CYS C 1 107 ? 30.223 -9.168  -43.213 1.00 33.18  ? 107 CYS D O   1 
ATOM 3966 C CB  . CYS C 1 107 ? 28.444 -11.461 -43.527 1.00 34.41  ? 107 CYS D CB  1 
ATOM 3967 S SG  . CYS C 1 107 ? 27.336 -10.554 -44.631 1.00 38.48  ? 107 CYS D SG  1 
ATOM 3968 N N   . HIS C 1 108 ? 30.906 -9.756  -45.304 1.00 33.36  ? 108 HIS D N   1 
ATOM 3969 C CA  . HIS C 1 108 ? 31.490 -8.474  -45.614 1.00 32.79  ? 108 HIS D CA  1 
ATOM 3970 C C   . HIS C 1 108 ? 30.501 -7.728  -46.499 1.00 32.58  ? 108 HIS D C   1 
ATOM 3971 O O   . HIS C 1 108 ? 30.053 -8.253  -47.502 1.00 32.66  ? 108 HIS D O   1 
ATOM 3972 C CB  . HIS C 1 108 ? 32.849 -8.697  -46.297 1.00 32.95  ? 108 HIS D CB  1 
ATOM 3973 C CG  . HIS C 1 108 ? 33.616 -7.442  -46.587 1.00 32.24  ? 108 HIS D CG  1 
ATOM 3974 N ND1 . HIS C 1 108 ? 34.489 -7.341  -47.648 1.00 34.46  ? 108 HIS D ND1 1 
ATOM 3975 C CD2 . HIS C 1 108 ? 33.678 -6.254  -45.942 1.00 32.52  ? 108 HIS D CD2 1 
ATOM 3976 C CE1 . HIS C 1 108 ? 35.042 -6.140  -47.652 1.00 33.20  ? 108 HIS D CE1 1 
ATOM 3977 N NE2 . HIS C 1 108 ? 34.568 -5.460  -46.628 1.00 30.79  ? 108 HIS D NE2 1 
ATOM 3978 N N   . ILE C 1 109 ? 30.146 -6.519  -46.073 1.00 32.40  ? 109 ILE D N   1 
ATOM 3979 C CA  . ILE C 1 109 ? 29.230 -5.613  -46.772 1.00 32.55  ? 109 ILE D CA  1 
ATOM 3980 C C   . ILE C 1 109 ? 30.039 -4.359  -47.141 1.00 32.25  ? 109 ILE D C   1 
ATOM 3981 O O   . ILE C 1 109 ? 30.721 -3.773  -46.288 1.00 31.55  ? 109 ILE D O   1 
ATOM 3982 C CB  . ILE C 1 109 ? 28.047 -5.219  -45.859 1.00 32.57  ? 109 ILE D CB  1 
ATOM 3983 C CG1 . ILE C 1 109 ? 27.340 -6.447  -45.298 1.00 33.81  ? 109 ILE D CG1 1 
ATOM 3984 C CG2 . ILE C 1 109 ? 27.030 -4.413  -46.593 1.00 33.54  ? 109 ILE D CG2 1 
ATOM 3985 C CD1 . ILE C 1 109 ? 27.694 -6.772  -43.846 1.00 34.77  ? 109 ILE D CD1 1 
ATOM 3986 N N   . ASP C 1 110 ? 29.964 -3.943  -48.400 1.00 32.60  ? 110 ASP D N   1 
ATOM 3987 C CA  . ASP C 1 110 ? 30.975 -3.053  -48.932 1.00 32.84  ? 110 ASP D CA  1 
ATOM 3988 C C   . ASP C 1 110 ? 30.412 -2.041  -49.970 1.00 33.28  ? 110 ASP D C   1 
ATOM 3989 O O   . ASP C 1 110 ? 29.393 -2.284  -50.585 1.00 33.99  ? 110 ASP D O   1 
ATOM 3990 C CB  . ASP C 1 110 ? 32.096 -3.941  -49.507 1.00 33.18  ? 110 ASP D CB  1 
ATOM 3991 C CG  . ASP C 1 110 ? 33.448 -3.229  -49.649 1.00 36.44  ? 110 ASP D CG  1 
ATOM 3992 O OD1 . ASP C 1 110 ? 33.734 -2.188  -48.975 1.00 39.75  ? 110 ASP D OD1 1 
ATOM 3993 O OD2 . ASP C 1 110 ? 34.253 -3.738  -50.467 1.00 39.45  ? 110 ASP D OD2 1 
ATOM 3994 N N   . LYS C 1 111 ? 31.078 -0.897  -50.106 1.00 33.58  ? 111 LYS D N   1 
ATOM 3995 C CA  . LYS C 1 111 ? 30.853 0.105   -51.155 1.00 34.91  ? 111 LYS D CA  1 
ATOM 3996 C C   . LYS C 1 111 ? 29.532 0.820   -51.039 1.00 35.09  ? 111 LYS D C   1 
ATOM 3997 O O   . LYS C 1 111 ? 28.982 1.299   -52.040 1.00 36.56  ? 111 LYS D O   1 
ATOM 3998 C CB  . LYS C 1 111 ? 31.025 -0.484  -52.571 1.00 36.34  ? 111 LYS D CB  1 
ATOM 3999 C CG  . LYS C 1 111 ? 32.353 -1.222  -52.813 1.00 38.24  ? 111 LYS D CG  1 
ATOM 4000 C CD  . LYS C 1 111 ? 32.567 -1.474  -54.314 1.00 44.19  ? 111 LYS D CD  1 
ATOM 4001 C CE  . LYS C 1 111 ? 33.936 -2.126  -54.633 1.00 46.76  ? 111 LYS D CE  1 
ATOM 4002 N NZ  . LYS C 1 111 ? 33.913 -3.635  -54.622 1.00 48.50  ? 111 LYS D NZ  1 
ATOM 4003 N N   . PHE C 1 112 ? 29.051 0.929   -49.809 1.00 33.99  ? 112 PHE D N   1 
ATOM 4004 C CA  . PHE C 1 112 ? 27.702 1.425   -49.540 1.00 33.64  ? 112 PHE D CA  1 
ATOM 4005 C C   . PHE C 1 112 ? 27.641 2.756   -48.797 1.00 33.35  ? 112 PHE D C   1 
ATOM 4006 O O   . PHE C 1 112 ? 28.532 3.088   -48.012 1.00 32.96  ? 112 PHE D O   1 
ATOM 4007 C CB  . PHE C 1 112 ? 26.920 0.380   -48.760 1.00 33.35  ? 112 PHE D CB  1 
ATOM 4008 C CG  . PHE C 1 112 ? 27.400 0.160   -47.342 1.00 30.82  ? 112 PHE D CG  1 
ATOM 4009 C CD1 . PHE C 1 112 ? 26.885 0.916   -46.288 1.00 30.46  ? 112 PHE D CD1 1 
ATOM 4010 C CD2 . PHE C 1 112 ? 28.294 -0.863  -47.049 1.00 29.19  ? 112 PHE D CD2 1 
ATOM 4011 C CE1 . PHE C 1 112 ? 27.302 0.677   -44.932 1.00 28.77  ? 112 PHE D CE1 1 
ATOM 4012 C CE2 . PHE C 1 112 ? 28.721 -1.107  -45.730 1.00 28.38  ? 112 PHE D CE2 1 
ATOM 4013 C CZ  . PHE C 1 112 ? 28.217 -0.327  -44.665 1.00 27.81  ? 112 PHE D CZ  1 
ATOM 4014 N N   . PHE C 1 113 ? 26.581 3.513   -49.045 1.00 33.40  ? 113 PHE D N   1 
ATOM 4015 C CA  . PHE C 1 113 ? 26.394 4.797   -48.387 1.00 33.06  ? 113 PHE D CA  1 
ATOM 4016 C C   . PHE C 1 113 ? 24.922 5.110   -48.405 1.00 33.88  ? 113 PHE D C   1 
ATOM 4017 O O   . PHE C 1 113 ? 24.302 4.958   -49.459 1.00 34.60  ? 113 PHE D O   1 
ATOM 4018 C CB  . PHE C 1 113 ? 27.143 5.919   -49.113 1.00 33.30  ? 113 PHE D CB  1 
ATOM 4019 C CG  . PHE C 1 113 ? 27.024 7.256   -48.423 1.00 33.64  ? 113 PHE D CG  1 
ATOM 4020 C CD1 . PHE C 1 113 ? 28.083 7.772   -47.691 1.00 32.68  ? 113 PHE D CD1 1 
ATOM 4021 C CD2 . PHE C 1 113 ? 25.852 7.986   -48.487 1.00 34.47  ? 113 PHE D CD2 1 
ATOM 4022 C CE1 . PHE C 1 113 ? 27.964 8.986   -47.033 1.00 31.79  ? 113 PHE D CE1 1 
ATOM 4023 C CE2 . PHE C 1 113 ? 25.740 9.201   -47.834 1.00 35.75  ? 113 PHE D CE2 1 
ATOM 4024 C CZ  . PHE C 1 113 ? 26.798 9.697   -47.106 1.00 32.81  ? 113 PHE D CZ  1 
ATOM 4025 N N   . PRO C 1 114 ? 24.357 5.586   -47.261 1.00 33.77  ? 114 PRO D N   1 
ATOM 4026 C CA  . PRO C 1 114 ? 25.023 5.927   -45.979 1.00 32.47  ? 114 PRO D CA  1 
ATOM 4027 C C   . PRO C 1 114 ? 25.280 4.732   -45.045 1.00 31.77  ? 114 PRO D C   1 
ATOM 4028 O O   . PRO C 1 114 ? 24.884 3.622   -45.339 1.00 31.75  ? 114 PRO D O   1 
ATOM 4029 C CB  . PRO C 1 114 ? 24.014 6.880   -45.314 1.00 33.41  ? 114 PRO D CB  1 
ATOM 4030 C CG  . PRO C 1 114 ? 22.667 6.417   -45.802 1.00 33.44  ? 114 PRO D CG  1 
ATOM 4031 C CD  . PRO C 1 114 ? 22.900 5.884   -47.219 1.00 34.24  ? 114 PRO D CD  1 
ATOM 4032 N N   . PRO C 1 115 ? 25.931 4.963   -43.907 1.00 31.68  ? 115 PRO D N   1 
ATOM 4033 C CA  . PRO C 1 115 ? 26.149 3.871   -42.993 1.00 31.13  ? 115 PRO D CA  1 
ATOM 4034 C C   . PRO C 1 115 ? 24.960 3.702   -42.073 1.00 32.03  ? 115 PRO D C   1 
ATOM 4035 O O   . PRO C 1 115 ? 24.995 4.101   -40.907 1.00 31.60  ? 115 PRO D O   1 
ATOM 4036 C CB  . PRO C 1 115 ? 27.392 4.303   -42.228 1.00 30.50  ? 115 PRO D CB  1 
ATOM 4037 C CG  . PRO C 1 115 ? 27.366 5.757   -42.239 1.00 31.67  ? 115 PRO D CG  1 
ATOM 4038 C CD  . PRO C 1 115 ? 26.666 6.176   -43.502 1.00 32.27  ? 115 PRO D CD  1 
ATOM 4039 N N   . VAL C 1 116 ? 23.896 3.139   -42.639 1.00 33.10  ? 116 VAL D N   1 
ATOM 4040 C CA  . VAL C 1 116 ? 22.692 2.773   -41.912 1.00 33.97  ? 116 VAL D CA  1 
ATOM 4041 C C   . VAL C 1 116 ? 22.283 1.411   -42.428 1.00 34.97  ? 116 VAL D C   1 
ATOM 4042 O O   . VAL C 1 116 ? 22.144 1.239   -43.647 1.00 36.09  ? 116 VAL D O   1 
ATOM 4043 C CB  . VAL C 1 116 ? 21.582 3.779   -42.124 1.00 34.67  ? 116 VAL D CB  1 
ATOM 4044 C CG1 . VAL C 1 116 ? 20.372 3.345   -41.362 1.00 34.29  ? 116 VAL D CG1 1 
ATOM 4045 C CG2 . VAL C 1 116 ? 22.038 5.186   -41.654 1.00 33.73  ? 116 VAL D CG2 1 
ATOM 4046 N N   . LEU C 1 117 ? 22.142 0.445   -41.511 1.00 35.16  ? 117 LEU D N   1 
ATOM 4047 C CA  . LEU C 1 117 ? 22.113 -0.970  -41.870 1.00 35.12  ? 117 LEU D CA  1 
ATOM 4048 C C   . LEU C 1 117 ? 21.238 -1.852  -41.003 1.00 36.38  ? 117 LEU D C   1 
ATOM 4049 O O   . LEU C 1 117 ? 21.128 -1.663  -39.784 1.00 37.04  ? 117 LEU D O   1 
ATOM 4050 C CB  . LEU C 1 117 ? 23.522 -1.554  -41.843 1.00 34.07  ? 117 LEU D CB  1 
ATOM 4051 C CG  . LEU C 1 117 ? 24.351 -1.649  -43.141 1.00 33.75  ? 117 LEU D CG  1 
ATOM 4052 C CD1 . LEU C 1 117 ? 25.341 -2.839  -43.091 1.00 31.49  ? 117 LEU D CD1 1 
ATOM 4053 C CD2 . LEU C 1 117 ? 23.498 -1.746  -44.379 1.00 33.61  ? 117 LEU D CD2 1 
ATOM 4054 N N   . ASN C 1 118 ? 20.610 -2.823  -41.650 1.00 37.04  ? 118 ASN D N   1 
ATOM 4055 C CA  . ASN C 1 118 ? 19.979 -3.909  -40.945 1.00 37.62  ? 118 ASN D CA  1 
ATOM 4056 C C   . ASN C 1 118 ? 20.609 -5.203  -41.508 1.00 38.15  ? 118 ASN D C   1 
ATOM 4057 O O   . ASN C 1 118 ? 20.468 -5.520  -42.708 1.00 38.84  ? 118 ASN D O   1 
ATOM 4058 C CB  . ASN C 1 118 ? 18.447 -3.814  -41.082 1.00 38.73  ? 118 ASN D CB  1 
ATOM 4059 C CG  . ASN C 1 118 ? 17.793 -2.803  -40.068 1.00 38.15  ? 118 ASN D CG  1 
ATOM 4060 O OD1 . ASN C 1 118 ? 18.444 -2.348  -39.136 1.00 38.04  ? 118 ASN D OD1 1 
ATOM 4061 N ND2 . ASN C 1 118 ? 16.511 -2.475  -40.266 1.00 34.81  ? 118 ASN D ND2 1 
ATOM 4062 N N   . VAL C 1 119 ? 21.394 -5.888  -40.662 1.00 37.91  ? 119 VAL D N   1 
ATOM 4063 C CA  . VAL C 1 119 ? 22.066 -7.163  -41.013 1.00 37.23  ? 119 VAL D CA  1 
ATOM 4064 C C   . VAL C 1 119 ? 21.699 -8.279  -40.041 1.00 38.04  ? 119 VAL D C   1 
ATOM 4065 O O   . VAL C 1 119 ? 21.847 -8.113  -38.834 1.00 38.29  ? 119 VAL D O   1 
ATOM 4066 C CB  . VAL C 1 119 ? 23.574 -7.085  -40.877 1.00 36.19  ? 119 VAL D CB  1 
ATOM 4067 C CG1 . VAL C 1 119 ? 24.235 -8.230  -41.646 1.00 35.38  ? 119 VAL D CG1 1 
ATOM 4068 C CG2 . VAL C 1 119 ? 24.097 -5.726  -41.293 1.00 35.56  ? 119 VAL D CG2 1 
ATOM 4069 N N   . THR C 1 120 ? 21.250 -9.421  -40.560 1.00 38.59  ? 120 THR D N   1 
ATOM 4070 C CA  . THR C 1 120 ? 20.893 -10.556 -39.719 1.00 38.77  ? 120 THR D CA  1 
ATOM 4071 C C   . THR C 1 120 ? 21.442 -11.868 -40.280 1.00 38.05  ? 120 THR D C   1 
ATOM 4072 O O   . THR C 1 120 ? 21.495 -12.059 -41.493 1.00 37.90  ? 120 THR D O   1 
ATOM 4073 C CB  . THR C 1 120 ? 19.354 -10.659 -39.515 1.00 40.31  ? 120 THR D CB  1 
ATOM 4074 O OG1 . THR C 1 120 ? 18.702 -10.654 -40.783 1.00 42.30  ? 120 THR D OG1 1 
ATOM 4075 C CG2 . THR C 1 120 ? 18.814 -9.461  -38.674 1.00 41.77  ? 120 THR D CG2 1 
ATOM 4076 N N   . TRP C 1 121 ? 21.858 -12.768 -39.393 1.00 37.31  ? 121 TRP D N   1 
ATOM 4077 C CA  . TRP C 1 121 ? 22.241 -14.093 -39.822 1.00 36.74  ? 121 TRP D CA  1 
ATOM 4078 C C   . TRP C 1 121 ? 21.040 -15.016 -39.779 1.00 37.64  ? 121 TRP D C   1 
ATOM 4079 O O   . TRP C 1 121 ? 20.264 -14.996 -38.824 1.00 37.66  ? 121 TRP D O   1 
ATOM 4080 C CB  . TRP C 1 121 ? 23.353 -14.690 -38.952 1.00 36.08  ? 121 TRP D CB  1 
ATOM 4081 C CG  . TRP C 1 121 ? 24.689 -14.067 -39.098 1.00 34.51  ? 121 TRP D CG  1 
ATOM 4082 C CD1 . TRP C 1 121 ? 25.225 -13.096 -38.303 1.00 33.97  ? 121 TRP D CD1 1 
ATOM 4083 C CD2 . TRP C 1 121 ? 25.685 -14.368 -40.091 1.00 34.10  ? 121 TRP D CD2 1 
ATOM 4084 N NE1 . TRP C 1 121 ? 26.480 -12.768 -38.738 1.00 33.77  ? 121 TRP D NE1 1 
ATOM 4085 C CE2 . TRP C 1 121 ? 26.793 -13.540 -39.831 1.00 33.35  ? 121 TRP D CE2 1 
ATOM 4086 C CE3 . TRP C 1 121 ? 25.739 -15.239 -41.192 1.00 35.16  ? 121 TRP D CE3 1 
ATOM 4087 C CZ2 . TRP C 1 121 ? 27.956 -13.566 -40.626 1.00 32.13  ? 121 TRP D CZ2 1 
ATOM 4088 C CZ3 . TRP C 1 121 ? 26.911 -15.272 -41.976 1.00 33.46  ? 121 TRP D CZ3 1 
ATOM 4089 C CH2 . TRP C 1 121 ? 27.998 -14.443 -41.675 1.00 31.57  ? 121 TRP D CH2 1 
ATOM 4090 N N   . LEU C 1 122 ? 20.924 -15.844 -40.814 1.00 38.22  ? 122 LEU D N   1 
ATOM 4091 C CA  . LEU C 1 122 ? 19.920 -16.888 -40.880 1.00 39.03  ? 122 LEU D CA  1 
ATOM 4092 C C   . LEU C 1 122 ? 20.619 -18.232 -41.046 1.00 39.27  ? 122 LEU D C   1 
ATOM 4093 O O   . LEU C 1 122 ? 21.631 -18.308 -41.731 1.00 39.15  ? 122 LEU D O   1 
ATOM 4094 C CB  . LEU C 1 122 ? 18.986 -16.608 -42.058 1.00 39.38  ? 122 LEU D CB  1 
ATOM 4095 C CG  . LEU C 1 122 ? 18.335 -15.218 -42.019 1.00 38.98  ? 122 LEU D CG  1 
ATOM 4096 C CD1 . LEU C 1 122 ? 17.710 -14.844 -43.339 1.00 39.54  ? 122 LEU D CD1 1 
ATOM 4097 C CD2 . LEU C 1 122 ? 17.297 -15.164 -40.933 1.00 39.56  ? 122 LEU D CD2 1 
ATOM 4098 N N   . CYS C 1 123 ? 20.097 -19.267 -40.394 1.00 40.05  ? 123 CYS D N   1 
ATOM 4099 C CA  . CYS C 1 123 ? 20.541 -20.643 -40.589 1.00 41.63  ? 123 CYS D CA  1 
ATOM 4100 C C   . CYS C 1 123 ? 19.299 -21.501 -40.793 1.00 42.97  ? 123 CYS D C   1 
ATOM 4101 O O   . CYS C 1 123 ? 18.425 -21.563 -39.920 1.00 43.47  ? 123 CYS D O   1 
ATOM 4102 C CB  . CYS C 1 123 ? 21.384 -21.156 -39.407 1.00 41.86  ? 123 CYS D CB  1 
ATOM 4103 S SG  . CYS C 1 123 ? 21.656 -22.996 -39.303 1.00 45.62  ? 123 CYS D SG  1 
ATOM 4104 N N   . ASN C 1 124 ? 19.229 -22.133 -41.970 1.00 43.86  ? 124 ASN D N   1 
ATOM 4105 C CA  . ASN C 1 124 ? 18.046 -22.813 -42.466 1.00 44.68  ? 124 ASN D CA  1 
ATOM 4106 C C   . ASN C 1 124 ? 16.803 -21.916 -42.491 1.00 44.99  ? 124 ASN D C   1 
ATOM 4107 O O   . ASN C 1 124 ? 15.657 -22.365 -42.287 1.00 46.33  ? 124 ASN D O   1 
ATOM 4108 C CB  . ASN C 1 124 ? 17.815 -24.081 -41.666 1.00 45.65  ? 124 ASN D CB  1 
ATOM 4109 C CG  . ASN C 1 124 ? 19.027 -24.963 -41.649 1.00 47.81  ? 124 ASN D CG  1 
ATOM 4110 O OD1 . ASN C 1 124 ? 19.556 -25.306 -42.700 1.00 50.64  ? 124 ASN D OD1 1 
ATOM 4111 N ND2 . ASN C 1 124 ? 19.503 -25.315 -40.452 1.00 49.96  ? 124 ASN D ND2 1 
ATOM 4112 N N   . GLY C 1 125 ? 17.020 -20.644 -42.763 1.00 43.84  ? 125 GLY D N   1 
ATOM 4113 C CA  . GLY C 1 125 ? 15.918 -19.693 -42.764 1.00 44.42  ? 125 GLY D CA  1 
ATOM 4114 C C   . GLY C 1 125 ? 15.481 -19.207 -41.396 1.00 44.11  ? 125 GLY D C   1 
ATOM 4115 O O   . GLY C 1 125 ? 14.596 -18.373 -41.288 1.00 43.89  ? 125 GLY D O   1 
ATOM 4116 N N   . GLU C 1 126 ? 16.110 -19.719 -40.346 1.00 44.14  ? 126 GLU D N   1 
ATOM 4117 C CA  . GLU C 1 126 ? 15.865 -19.200 -39.002 1.00 44.13  ? 126 GLU D CA  1 
ATOM 4118 C C   . GLU C 1 126 ? 16.968 -18.246 -38.516 1.00 42.96  ? 126 GLU D C   1 
ATOM 4119 O O   . GLU C 1 126 ? 18.152 -18.480 -38.749 1.00 42.04  ? 126 GLU D O   1 
ATOM 4120 C CB  . GLU C 1 126 ? 15.686 -20.352 -38.047 1.00 44.30  ? 126 GLU D CB  1 
ATOM 4121 C CG  . GLU C 1 126 ? 14.742 -21.378 -38.597 1.00 47.06  ? 126 GLU D CG  1 
ATOM 4122 C CD  . GLU C 1 126 ? 14.534 -22.547 -37.654 1.00 48.33  ? 126 GLU D CD  1 
ATOM 4123 O OE1 . GLU C 1 126 ? 14.918 -23.684 -38.018 1.00 47.96  ? 126 GLU D OE1 1 
ATOM 4124 O OE2 . GLU C 1 126 ? 14.004 -22.306 -36.547 1.00 48.53  ? 126 GLU D OE2 1 
ATOM 4125 N N   . LEU C 1 127 ? 16.547 -17.175 -37.847 1.00 43.08  ? 127 LEU D N   1 
ATOM 4126 C CA  . LEU C 1 127 ? 17.429 -16.127 -37.342 1.00 42.82  ? 127 LEU D CA  1 
ATOM 4127 C C   . LEU C 1 127 ? 18.407 -16.709 -36.327 1.00 43.12  ? 127 LEU D C   1 
ATOM 4128 O O   . LEU C 1 127 ? 18.059 -17.646 -35.607 1.00 44.19  ? 127 LEU D O   1 
ATOM 4129 C CB  . LEU C 1 127 ? 16.597 -15.035 -36.689 1.00 42.72  ? 127 LEU D CB  1 
ATOM 4130 C CG  . LEU C 1 127 ? 17.327 -13.982 -35.867 1.00 42.69  ? 127 LEU D CG  1 
ATOM 4131 C CD1 . LEU C 1 127 ? 17.743 -12.802 -36.745 1.00 42.30  ? 127 LEU D CD1 1 
ATOM 4132 C CD2 . LEU C 1 127 ? 16.439 -13.516 -34.730 1.00 43.36  ? 127 LEU D CD2 1 
ATOM 4133 N N   . VAL C 1 128 ? 19.633 -16.182 -36.299 1.00 42.62  ? 128 VAL D N   1 
ATOM 4134 C CA  . VAL C 1 128 ? 20.638 -16.607 -35.311 1.00 42.89  ? 128 VAL D CA  1 
ATOM 4135 C C   . VAL C 1 128 ? 21.192 -15.414 -34.526 1.00 43.05  ? 128 VAL D C   1 
ATOM 4136 O O   . VAL C 1 128 ? 21.413 -14.360 -35.079 1.00 42.14  ? 128 VAL D O   1 
ATOM 4137 C CB  . VAL C 1 128 ? 21.760 -17.484 -35.932 1.00 42.12  ? 128 VAL D CB  1 
ATOM 4138 C CG1 . VAL C 1 128 ? 22.749 -17.912 -34.877 1.00 42.20  ? 128 VAL D CG1 1 
ATOM 4139 C CG2 . VAL C 1 128 ? 21.170 -18.729 -36.560 1.00 41.71  ? 128 VAL D CG2 1 
ATOM 4140 N N   . THR C 1 129 ? 21.374 -15.611 -33.227 1.00 45.13  ? 129 THR D N   1 
ATOM 4141 C CA  . THR C 1 129 ? 21.793 -14.576 -32.297 1.00 46.61  ? 129 THR D CA  1 
ATOM 4142 C C   . THR C 1 129 ? 22.999 -14.992 -31.396 1.00 47.16  ? 129 THR D C   1 
ATOM 4143 O O   . THR C 1 129 ? 23.786 -14.152 -30.976 1.00 47.12  ? 129 THR D O   1 
ATOM 4144 C CB  . THR C 1 129 ? 20.545 -14.107 -31.513 1.00 48.11  ? 129 THR D CB  1 
ATOM 4145 O OG1 . THR C 1 129 ? 20.038 -12.940 -32.161 1.00 48.89  ? 129 THR D OG1 1 
ATOM 4146 C CG2 . THR C 1 129 ? 20.814 -13.819 -30.000 1.00 50.10  ? 129 THR D CG2 1 
ATOM 4147 N N   . GLU C 1 130 ? 23.145 -16.287 -31.124 1.00 48.06  ? 130 GLU D N   1 
ATOM 4148 C CA  . GLU C 1 130 ? 24.288 -16.801 -30.368 1.00 48.55  ? 130 GLU D CA  1 
ATOM 4149 C C   . GLU C 1 130 ? 25.578 -16.779 -31.178 1.00 47.20  ? 130 GLU D C   1 
ATOM 4150 O O   . GLU C 1 130 ? 25.563 -17.053 -32.384 1.00 47.15  ? 130 GLU D O   1 
ATOM 4151 C CB  . GLU C 1 130 ? 24.003 -18.230 -29.881 1.00 50.00  ? 130 GLU D CB  1 
ATOM 4152 C CG  . GLU C 1 130 ? 23.095 -18.273 -28.642 1.00 53.15  ? 130 GLU D CG  1 
ATOM 4153 C CD  . GLU C 1 130 ? 23.670 -17.466 -27.472 1.00 56.59  ? 130 GLU D CD  1 
ATOM 4154 O OE1 . GLU C 1 130 ? 24.851 -17.695 -27.133 1.00 57.63  ? 130 GLU D OE1 1 
ATOM 4155 O OE2 . GLU C 1 130 ? 22.955 -16.607 -26.899 1.00 58.47  ? 130 GLU D OE2 1 
ATOM 4156 N N   . GLY C 1 131 ? 26.685 -16.452 -30.503 1.00 46.48  ? 131 GLY D N   1 
ATOM 4157 C CA  . GLY C 1 131 ? 28.026 -16.428 -31.102 1.00 44.55  ? 131 GLY D CA  1 
ATOM 4158 C C   . GLY C 1 131 ? 28.152 -15.472 -32.270 1.00 42.79  ? 131 GLY D C   1 
ATOM 4159 O O   . GLY C 1 131 ? 28.797 -15.770 -33.293 1.00 42.43  ? 131 GLY D O   1 
ATOM 4160 N N   . VAL C 1 132 ? 27.546 -14.307 -32.083 1.00 41.81  ? 132 VAL D N   1 
ATOM 4161 C CA  . VAL C 1 132 ? 27.346 -13.305 -33.113 1.00 39.92  ? 132 VAL D CA  1 
ATOM 4162 C C   . VAL C 1 132 ? 28.173 -12.113 -32.674 1.00 39.06  ? 132 VAL D C   1 
ATOM 4163 O O   . VAL C 1 132 ? 28.367 -11.905 -31.482 1.00 39.94  ? 132 VAL D O   1 
ATOM 4164 C CB  . VAL C 1 132 ? 25.839 -12.951 -33.184 1.00 40.28  ? 132 VAL D CB  1 
ATOM 4165 C CG1 . VAL C 1 132 ? 25.592 -11.559 -33.655 1.00 39.66  ? 132 VAL D CG1 1 
ATOM 4166 C CG2 . VAL C 1 132 ? 25.095 -13.959 -34.054 1.00 40.73  ? 132 VAL D CG2 1 
ATOM 4167 N N   . ALA C 1 133 ? 28.701 -11.363 -33.632 1.00 37.15  ? 133 ALA D N   1 
ATOM 4168 C CA  . ALA C 1 133 ? 29.454 -10.155 -33.359 1.00 35.29  ? 133 ALA D CA  1 
ATOM 4169 C C   . ALA C 1 133 ? 29.541 -9.414  -34.693 1.00 34.20  ? 133 ALA D C   1 
ATOM 4170 O O   . ALA C 1 133 ? 29.161 -9.962  -35.741 1.00 33.13  ? 133 ALA D O   1 
ATOM 4171 C CB  . ALA C 1 133 ? 30.831 -10.490 -32.828 1.00 35.35  ? 133 ALA D CB  1 
ATOM 4172 N N   . GLU C 1 134 ? 30.015 -8.169  -34.644 1.00 33.28  ? 134 GLU D N   1 
ATOM 4173 C CA  . GLU C 1 134 ? 30.081 -7.323  -35.813 1.00 32.91  ? 134 GLU D CA  1 
ATOM 4174 C C   . GLU C 1 134 ? 31.197 -6.305  -35.620 1.00 32.66  ? 134 GLU D C   1 
ATOM 4175 O O   . GLU C 1 134 ? 31.708 -6.164  -34.520 1.00 33.52  ? 134 GLU D O   1 
ATOM 4176 C CB  . GLU C 1 134 ? 28.765 -6.580  -35.990 1.00 33.04  ? 134 GLU D CB  1 
ATOM 4177 C CG  . GLU C 1 134 ? 28.606 -5.391  -35.044 1.00 33.67  ? 134 GLU D CG  1 
ATOM 4178 C CD  . GLU C 1 134 ? 27.169 -4.823  -35.024 1.00 37.22  ? 134 GLU D CD  1 
ATOM 4179 O OE1 . GLU C 1 134 ? 27.013 -3.581  -35.241 1.00 36.76  ? 134 GLU D OE1 1 
ATOM 4180 O OE2 . GLU C 1 134 ? 26.209 -5.612  -34.782 1.00 35.57  ? 134 GLU D OE2 1 
ATOM 4181 N N   . SER C 1 135 ? 31.572 -5.598  -36.680 1.00 31.79  ? 135 SER D N   1 
ATOM 4182 C CA  . SER C 1 135 ? 32.502 -4.474  -36.552 1.00 31.83  ? 135 SER D CA  1 
ATOM 4183 C C   . SER C 1 135 ? 31.788 -3.091  -36.459 1.00 32.88  ? 135 SER D C   1 
ATOM 4184 O O   . SER C 1 135 ? 30.580 -3.000  -36.178 1.00 34.02  ? 135 SER D O   1 
ATOM 4185 C CB  . SER C 1 135 ? 33.510 -4.477  -37.703 1.00 30.39  ? 135 SER D CB  1 
ATOM 4186 O OG  . SER C 1 135 ? 32.976 -3.830  -38.836 1.00 28.21  ? 135 SER D OG  1 
ATOM 4187 N N   . LEU C 1 136 ? 32.562 -2.032  -36.663 1.00 32.47  ? 136 LEU D N   1 
ATOM 4188 C CA  . LEU C 1 136 ? 32.054 -0.683  -36.729 1.00 32.95  ? 136 LEU D CA  1 
ATOM 4189 C C   . LEU C 1 136 ? 31.890 -0.389  -38.217 1.00 32.45  ? 136 LEU D C   1 
ATOM 4190 O O   . LEU C 1 136 ? 32.295 -1.219  -39.050 1.00 32.07  ? 136 LEU D O   1 
ATOM 4191 C CB  . LEU C 1 136 ? 33.064 0.269   -36.093 1.00 33.44  ? 136 LEU D CB  1 
ATOM 4192 C CG  . LEU C 1 136 ? 33.175 0.415   -34.560 1.00 35.66  ? 136 LEU D CG  1 
ATOM 4193 C CD1 . LEU C 1 136 ? 32.124 1.377   -34.044 1.00 38.90  ? 136 LEU D CD1 1 
ATOM 4194 C CD2 . LEU C 1 136 ? 33.081 -0.902  -33.782 1.00 36.27  ? 136 LEU D CD2 1 
ATOM 4195 N N   . PHE C 1 137 ? 31.268 0.743   -38.558 1.00 31.49  ? 137 PHE D N   1 
ATOM 4196 C CA  . PHE C 1 137 ? 31.216 1.152   -39.952 1.00 30.51  ? 137 PHE D CA  1 
ATOM 4197 C C   . PHE C 1 137 ? 32.575 1.779   -40.250 1.00 29.87  ? 137 PHE D C   1 
ATOM 4198 O O   . PHE C 1 137 ? 32.904 2.840   -39.744 1.00 28.98  ? 137 PHE D O   1 
ATOM 4199 C CB  . PHE C 1 137 ? 30.072 2.141   -40.245 1.00 31.23  ? 137 PHE D CB  1 
ATOM 4200 C CG  . PHE C 1 137 ? 28.659 1.577   -39.998 1.00 31.40  ? 137 PHE D CG  1 
ATOM 4201 C CD1 . PHE C 1 137 ? 27.853 1.190   -41.068 1.00 27.77  ? 137 PHE D CD1 1 
ATOM 4202 C CD2 . PHE C 1 137 ? 28.144 1.459   -38.683 1.00 31.30  ? 137 PHE D CD2 1 
ATOM 4203 C CE1 . PHE C 1 137 ? 26.570 0.689   -40.852 1.00 29.64  ? 137 PHE D CE1 1 
ATOM 4204 C CE2 . PHE C 1 137 ? 26.850 0.946   -38.452 1.00 29.97  ? 137 PHE D CE2 1 
ATOM 4205 C CZ  . PHE C 1 137 ? 26.061 0.565   -39.547 1.00 30.21  ? 137 PHE D CZ  1 
ATOM 4206 N N   . LEU C 1 138 ? 33.348 1.069   -41.069 1.00 29.37  ? 138 LEU D N   1 
ATOM 4207 C CA  . LEU C 1 138 ? 34.723 1.359   -41.383 1.00 28.84  ? 138 LEU D CA  1 
ATOM 4208 C C   . LEU C 1 138 ? 34.745 2.190   -42.622 1.00 29.85  ? 138 LEU D C   1 
ATOM 4209 O O   . LEU C 1 138 ? 34.042 1.882   -43.564 1.00 31.34  ? 138 LEU D O   1 
ATOM 4210 C CB  . LEU C 1 138 ? 35.424 0.057   -41.689 1.00 28.34  ? 138 LEU D CB  1 
ATOM 4211 C CG  . LEU C 1 138 ? 35.351 -1.001  -40.587 1.00 28.88  ? 138 LEU D CG  1 
ATOM 4212 C CD1 . LEU C 1 138 ? 36.037 -2.291  -41.043 1.00 28.44  ? 138 LEU D CD1 1 
ATOM 4213 C CD2 . LEU C 1 138 ? 35.997 -0.424  -39.306 1.00 28.42  ? 138 LEU D CD2 1 
ATOM 4214 N N   . PRO C 1 139 ? 35.569 3.241   -42.643 1.00 30.39  ? 139 PRO D N   1 
ATOM 4215 C CA  . PRO C 1 139 ? 35.610 4.189   -43.740 1.00 30.54  ? 139 PRO D CA  1 
ATOM 4216 C C   . PRO C 1 139 ? 36.383 3.698   -44.940 1.00 31.47  ? 139 PRO D C   1 
ATOM 4217 O O   . PRO C 1 139 ? 37.365 2.972   -44.811 1.00 32.24  ? 139 PRO D O   1 
ATOM 4218 C CB  . PRO C 1 139 ? 36.410 5.327   -43.157 1.00 30.15  ? 139 PRO D CB  1 
ATOM 4219 C CG  . PRO C 1 139 ? 37.378 4.625   -42.243 1.00 30.82  ? 139 PRO D CG  1 
ATOM 4220 C CD  . PRO C 1 139 ? 36.556 3.574   -41.590 1.00 30.07  ? 139 PRO D CD  1 
ATOM 4221 N N   . ARG C 1 140 ? 35.969 4.149   -46.110 1.00 31.91  ? 140 ARG D N   1 
ATOM 4222 C CA  . ARG C 1 140 ? 36.763 3.975   -47.268 1.00 31.49  ? 140 ARG D CA  1 
ATOM 4223 C C   . ARG C 1 140 ? 37.303 5.300   -47.774 1.00 31.98  ? 140 ARG D C   1 
ATOM 4224 O O   . ARG C 1 140 ? 36.867 6.404   -47.427 1.00 31.43  ? 140 ARG D O   1 
ATOM 4225 C CB  . ARG C 1 140 ? 35.918 3.355   -48.356 1.00 32.54  ? 140 ARG D CB  1 
ATOM 4226 C CG  . ARG C 1 140 ? 35.786 1.886   -48.293 1.00 32.12  ? 140 ARG D CG  1 
ATOM 4227 C CD  . ARG C 1 140 ? 34.738 1.476   -49.285 1.00 35.03  ? 140 ARG D CD  1 
ATOM 4228 N NE  . ARG C 1 140 ? 35.261 0.474   -50.205 1.00 39.36  ? 140 ARG D NE  1 
ATOM 4229 C CZ  . ARG C 1 140 ? 35.601 0.717   -51.470 1.00 41.30  ? 140 ARG D CZ  1 
ATOM 4230 N NH1 . ARG C 1 140 ? 35.461 1.940   -51.967 1.00 42.95  ? 140 ARG D NH1 1 
ATOM 4231 N NH2 . ARG C 1 140 ? 36.069 -0.264  -52.248 1.00 42.36  ? 140 ARG D NH2 1 
ATOM 4232 N N   . THR C 1 141 ? 38.261 5.131   -48.657 1.00 32.56  ? 141 THR D N   1 
ATOM 4233 C CA  . THR C 1 141 ? 38.894 6.174   -49.384 1.00 32.84  ? 141 THR D CA  1 
ATOM 4234 C C   . THR C 1 141 ? 37.957 6.918   -50.313 1.00 33.83  ? 141 THR D C   1 
ATOM 4235 O O   . THR C 1 141 ? 38.166 8.122   -50.528 1.00 34.52  ? 141 THR D O   1 
ATOM 4236 C CB  . THR C 1 141 ? 40.005 5.541   -50.163 1.00 33.30  ? 141 THR D CB  1 
ATOM 4237 O OG1 . THR C 1 141 ? 41.122 5.413   -49.283 1.00 30.89  ? 141 THR D OG1 1 
ATOM 4238 C CG2 . THR C 1 141 ? 40.355 6.370   -51.408 1.00 35.95  ? 141 THR D CG2 1 
ATOM 4239 N N   . ASP C 1 142 ? 36.952 6.220   -50.876 1.00 33.93  ? 142 ASP D N   1 
ATOM 4240 C CA  . ASP C 1 142 ? 35.951 6.892   -51.729 1.00 34.21  ? 142 ASP D CA  1 
ATOM 4241 C C   . ASP C 1 142 ? 34.745 7.399   -50.917 1.00 34.31  ? 142 ASP D C   1 
ATOM 4242 O O   . ASP C 1 142 ? 33.674 7.736   -51.465 1.00 35.78  ? 142 ASP D O   1 
ATOM 4243 C CB  . ASP C 1 142 ? 35.560 6.069   -52.978 1.00 34.42  ? 142 ASP D CB  1 
ATOM 4244 C CG  . ASP C 1 142 ? 34.754 4.789   -52.672 1.00 34.48  ? 142 ASP D CG  1 
ATOM 4245 O OD1 . ASP C 1 142 ? 34.233 4.589   -51.556 1.00 33.91  ? 142 ASP D OD1 1 
ATOM 4246 O OD2 . ASP C 1 142 ? 34.628 3.949   -53.592 1.00 34.32  ? 142 ASP D OD2 1 
ATOM 4247 N N   . TYR C 1 143 ? 34.942 7.447   -49.602 1.00 33.06  ? 143 TYR D N   1 
ATOM 4248 C CA  . TYR C 1 143 ? 33.992 8.028   -48.647 1.00 32.94  ? 143 TYR D CA  1 
ATOM 4249 C C   . TYR C 1 143 ? 32.647 7.281   -48.538 1.00 33.01  ? 143 TYR D C   1 
ATOM 4250 O O   . TYR C 1 143 ? 31.695 7.769   -47.924 1.00 33.86  ? 143 TYR D O   1 
ATOM 4251 C CB  . TYR C 1 143 ? 33.852 9.533   -48.873 1.00 33.35  ? 143 TYR D CB  1 
ATOM 4252 C CG  . TYR C 1 143 ? 35.210 10.198  -49.166 1.00 35.51  ? 143 TYR D CG  1 
ATOM 4253 C CD1 . TYR C 1 143 ? 35.463 10.815  -50.399 1.00 36.61  ? 143 TYR D CD1 1 
ATOM 4254 C CD2 . TYR C 1 143 ? 36.253 10.168  -48.227 1.00 34.21  ? 143 TYR D CD2 1 
ATOM 4255 C CE1 . TYR C 1 143 ? 36.684 11.397  -50.664 1.00 36.87  ? 143 TYR D CE1 1 
ATOM 4256 C CE2 . TYR C 1 143 ? 37.472 10.742  -48.499 1.00 34.39  ? 143 TYR D CE2 1 
ATOM 4257 C CZ  . TYR C 1 143 ? 37.682 11.357  -49.715 1.00 36.53  ? 143 TYR D CZ  1 
ATOM 4258 O OH  . TYR C 1 143 ? 38.908 11.933  -49.998 1.00 38.77  ? 143 TYR D OH  1 
ATOM 4259 N N   . SER C 1 144 ? 32.595 6.077   -49.112 1.00 31.90  ? 144 SER D N   1 
ATOM 4260 C CA  . SER C 1 144 ? 31.570 5.116   -48.770 1.00 31.19  ? 144 SER D CA  1 
ATOM 4261 C C   . SER C 1 144 ? 32.071 4.352   -47.561 1.00 29.24  ? 144 SER D C   1 
ATOM 4262 O O   . SER C 1 144 ? 33.027 4.754   -46.946 1.00 28.91  ? 144 SER D O   1 
ATOM 4263 C CB  . SER C 1 144 ? 31.279 4.183   -49.947 1.00 31.78  ? 144 SER D CB  1 
ATOM 4264 O OG  . SER C 1 144 ? 32.481 3.602   -50.435 1.00 34.77  ? 144 SER D OG  1 
ATOM 4265 N N   . PHE C 1 145 ? 31.415 3.254   -47.223 1.00 29.00  ? 145 PHE D N   1 
ATOM 4266 C CA  . PHE C 1 145 ? 31.692 2.486   -46.010 1.00 27.74  ? 145 PHE D CA  1 
ATOM 4267 C C   . PHE C 1 145 ? 31.689 0.983   -46.216 1.00 28.30  ? 145 PHE D C   1 
ATOM 4268 O O   . PHE C 1 145 ? 31.011 0.468   -47.096 1.00 27.61  ? 145 PHE D O   1 
ATOM 4269 C CB  . PHE C 1 145 ? 30.613 2.772   -44.991 1.00 27.48  ? 145 PHE D CB  1 
ATOM 4270 C CG  . PHE C 1 145 ? 30.760 4.063   -44.344 1.00 26.40  ? 145 PHE D CG  1 
ATOM 4271 C CD1 . PHE C 1 145 ? 30.202 5.199   -44.913 1.00 26.13  ? 145 PHE D CD1 1 
ATOM 4272 C CD2 . PHE C 1 145 ? 31.489 4.177   -43.172 1.00 24.97  ? 145 PHE D CD2 1 
ATOM 4273 C CE1 . PHE C 1 145 ? 30.349 6.435   -44.320 1.00 22.36  ? 145 PHE D CE1 1 
ATOM 4274 C CE2 . PHE C 1 145 ? 31.630 5.411   -42.570 1.00 23.08  ? 145 PHE D CE2 1 
ATOM 4275 C CZ  . PHE C 1 145 ? 31.057 6.534   -43.143 1.00 21.33  ? 145 PHE D CZ  1 
ATOM 4276 N N   . HIS C 1 146 ? 32.446 0.277   -45.376 1.00 29.08  ? 146 HIS D N   1 
ATOM 4277 C CA  . HIS C 1 146 ? 32.247 -1.167  -45.256 1.00 30.04  ? 146 HIS D CA  1 
ATOM 4278 C C   . HIS C 1 146 ? 32.093 -1.593  -43.792 1.00 30.26  ? 146 HIS D C   1 
ATOM 4279 O O   . HIS C 1 146 ? 32.188 -0.768  -42.874 1.00 30.52  ? 146 HIS D O   1 
ATOM 4280 C CB  . HIS C 1 146 ? 33.275 -1.982  -46.043 1.00 29.23  ? 146 HIS D CB  1 
ATOM 4281 C CG  . HIS C 1 146 ? 34.653 -1.893  -45.506 1.00 29.77  ? 146 HIS D CG  1 
ATOM 4282 N ND1 . HIS C 1 146 ? 35.217 -0.705  -45.096 1.00 30.26  ? 146 HIS D ND1 1 
ATOM 4283 C CD2 . HIS C 1 146 ? 35.598 -2.846  -45.318 1.00 30.62  ? 146 HIS D CD2 1 
ATOM 4284 C CE1 . HIS C 1 146 ? 36.446 -0.937  -44.662 1.00 28.81  ? 146 HIS D CE1 1 
ATOM 4285 N NE2 . HIS C 1 146 ? 36.701 -2.228  -44.786 1.00 26.21  ? 146 HIS D NE2 1 
ATOM 4286 N N   . LYS C 1 147 ? 31.793 -2.870  -43.597 1.00 30.45  ? 147 LYS D N   1 
ATOM 4287 C CA  . LYS C 1 147 ? 31.415 -3.378  -42.310 1.00 30.13  ? 147 LYS D CA  1 
ATOM 4288 C C   . LYS C 1 147 ? 31.493 -4.889  -42.367 1.00 30.18  ? 147 LYS D C   1 
ATOM 4289 O O   . LYS C 1 147 ? 31.291 -5.463  -43.447 1.00 30.25  ? 147 LYS D O   1 
ATOM 4290 C CB  . LYS C 1 147 ? 29.979 -2.956  -41.988 1.00 30.35  ? 147 LYS D CB  1 
ATOM 4291 C CG  . LYS C 1 147 ? 29.431 -3.617  -40.726 1.00 29.87  ? 147 LYS D CG  1 
ATOM 4292 C CD  . LYS C 1 147 ? 28.381 -2.765  -40.039 1.00 29.60  ? 147 LYS D CD  1 
ATOM 4293 C CE  . LYS C 1 147 ? 28.575 -2.859  -38.541 1.00 28.99  ? 147 LYS D CE  1 
ATOM 4294 N NZ  . LYS C 1 147 ? 27.324 -2.696  -37.769 1.00 27.30  ? 147 LYS D NZ  1 
ATOM 4295 N N   . PHE C 1 148 ? 31.761 -5.519  -41.216 1.00 29.70  ? 148 PHE D N   1 
ATOM 4296 C CA  . PHE C 1 148 ? 31.768 -6.987  -41.121 1.00 30.45  ? 148 PHE D CA  1 
ATOM 4297 C C   . PHE C 1 148 ? 30.812 -7.479  -40.070 1.00 30.81  ? 148 PHE D C   1 
ATOM 4298 O O   . PHE C 1 148 ? 30.621 -6.800  -39.059 1.00 31.25  ? 148 PHE D O   1 
ATOM 4299 C CB  . PHE C 1 148 ? 33.132 -7.522  -40.705 1.00 30.06  ? 148 PHE D CB  1 
ATOM 4300 C CG  . PHE C 1 148 ? 34.236 -7.189  -41.639 1.00 30.05  ? 148 PHE D CG  1 
ATOM 4301 C CD1 . PHE C 1 148 ? 34.489 -7.997  -42.760 1.00 30.92  ? 148 PHE D CD1 1 
ATOM 4302 C CD2 . PHE C 1 148 ? 35.062 -6.101  -41.380 1.00 28.78  ? 148 PHE D CD2 1 
ATOM 4303 C CE1 . PHE C 1 148 ? 35.543 -7.704  -43.629 1.00 30.23  ? 148 PHE D CE1 1 
ATOM 4304 C CE2 . PHE C 1 148 ? 36.108 -5.788  -42.241 1.00 30.31  ? 148 PHE D CE2 1 
ATOM 4305 C CZ  . PHE C 1 148 ? 36.350 -6.606  -43.375 1.00 30.79  ? 148 PHE D CZ  1 
ATOM 4306 N N   . HIS C 1 149 ? 30.266 -8.680  -40.279 1.00 30.81  ? 149 HIS D N   1 
ATOM 4307 C CA  . HIS C 1 149 ? 29.560 -9.395  -39.226 1.00 30.77  ? 149 HIS D CA  1 
ATOM 4308 C C   . HIS C 1 149 ? 30.112 -10.783 -39.156 1.00 31.54  ? 149 HIS D C   1 
ATOM 4309 O O   . HIS C 1 149 ? 30.516 -11.339 -40.180 1.00 32.24  ? 149 HIS D O   1 
ATOM 4310 C CB  . HIS C 1 149 ? 28.063 -9.441  -39.505 1.00 31.20  ? 149 HIS D CB  1 
ATOM 4311 C CG  . HIS C 1 149 ? 27.353 -8.180  -39.138 1.00 29.65  ? 149 HIS D CG  1 
ATOM 4312 N ND1 . HIS C 1 149 ? 26.304 -8.155  -38.248 1.00 27.38  ? 149 HIS D ND1 1 
ATOM 4313 C CD2 . HIS C 1 149 ? 27.560 -6.894  -39.521 1.00 29.29  ? 149 HIS D CD2 1 
ATOM 4314 C CE1 . HIS C 1 149 ? 25.887 -6.908  -38.101 1.00 29.27  ? 149 HIS D CE1 1 
ATOM 4315 N NE2 . HIS C 1 149 ? 26.634 -6.122  -38.861 1.00 29.47  ? 149 HIS D NE2 1 
ATOM 4316 N N   . TYR C 1 150 ? 30.101 -11.346 -37.949 1.00 32.27  ? 150 TYR D N   1 
ATOM 4317 C CA  . TYR C 1 150 ? 30.747 -12.626 -37.645 1.00 32.54  ? 150 TYR D CA  1 
ATOM 4318 C C   . TYR C 1 150 ? 29.803 -13.562 -36.924 1.00 33.66  ? 150 TYR D C   1 
ATOM 4319 O O   . TYR C 1 150 ? 29.059 -13.140 -36.038 1.00 34.99  ? 150 TYR D O   1 
ATOM 4320 C CB  . TYR C 1 150 ? 31.973 -12.398 -36.746 1.00 32.43  ? 150 TYR D CB  1 
ATOM 4321 C CG  . TYR C 1 150 ? 32.997 -11.415 -37.288 1.00 29.91  ? 150 TYR D CG  1 
ATOM 4322 C CD1 . TYR C 1 150 ? 34.014 -11.845 -38.117 1.00 28.99  ? 150 TYR D CD1 1 
ATOM 4323 C CD2 . TYR C 1 150 ? 32.945 -10.066 -36.975 1.00 28.74  ? 150 TYR D CD2 1 
ATOM 4324 C CE1 . TYR C 1 150 ? 34.955 -10.961 -38.626 1.00 27.60  ? 150 TYR D CE1 1 
ATOM 4325 C CE2 . TYR C 1 150 ? 33.886 -9.168  -37.491 1.00 26.45  ? 150 TYR D CE2 1 
ATOM 4326 C CZ  . TYR C 1 150 ? 34.887 -9.646  -38.306 1.00 26.68  ? 150 TYR D CZ  1 
ATOM 4327 O OH  . TYR C 1 150 ? 35.819 -8.820  -38.839 1.00 27.13  ? 150 TYR D OH  1 
ATOM 4328 N N   . LEU C 1 151 ? 29.840 -14.837 -37.292 1.00 34.17  ? 151 LEU D N   1 
ATOM 4329 C CA  . LEU C 1 151 ? 29.062 -15.849 -36.613 1.00 34.20  ? 151 LEU D CA  1 
ATOM 4330 C C   . LEU C 1 151 ? 29.906 -17.086 -36.419 1.00 35.07  ? 151 LEU D C   1 
ATOM 4331 O O   . LEU C 1 151 ? 30.448 -17.641 -37.383 1.00 35.18  ? 151 LEU D O   1 
ATOM 4332 C CB  . LEU C 1 151 ? 27.859 -16.207 -37.452 1.00 34.84  ? 151 LEU D CB  1 
ATOM 4333 C CG  . LEU C 1 151 ? 27.021 -17.433 -37.062 1.00 34.71  ? 151 LEU D CG  1 
ATOM 4334 C CD1 . LEU C 1 151 ? 26.297 -17.222 -35.732 1.00 32.63  ? 151 LEU D CD1 1 
ATOM 4335 C CD2 . LEU C 1 151 ? 26.044 -17.693 -38.179 1.00 32.30  ? 151 LEU D CD2 1 
ATOM 4336 N N   . THR C 1 152 ? 30.015 -17.524 -35.172 1.00 35.68  ? 152 THR D N   1 
ATOM 4337 C CA  . THR C 1 152 ? 30.806 -18.695 -34.860 1.00 36.89  ? 152 THR D CA  1 
ATOM 4338 C C   . THR C 1 152 ? 29.957 -19.934 -35.115 1.00 38.01  ? 152 THR D C   1 
ATOM 4339 O O   . THR C 1 152 ? 28.763 -19.954 -34.833 1.00 38.58  ? 152 THR D O   1 
ATOM 4340 C CB  . THR C 1 152 ? 31.324 -18.676 -33.401 1.00 37.73  ? 152 THR D CB  1 
ATOM 4341 O OG1 . THR C 1 152 ? 30.205 -18.670 -32.511 1.00 40.18  ? 152 THR D OG1 1 
ATOM 4342 C CG2 . THR C 1 152 ? 32.220 -17.417 -33.127 1.00 36.47  ? 152 THR D CG2 1 
ATOM 4343 N N   . PHE C 1 153 ? 30.560 -20.972 -35.668 1.00 38.86  ? 153 PHE D N   1 
ATOM 4344 C CA  . PHE C 1 153 ? 29.775 -22.104 -36.039 1.00 39.44  ? 153 PHE D CA  1 
ATOM 4345 C C   . PHE C 1 153 ? 30.609 -23.379 -36.199 1.00 41.66  ? 153 PHE D C   1 
ATOM 4346 O O   . PHE C 1 153 ? 31.835 -23.331 -36.299 1.00 41.38  ? 153 PHE D O   1 
ATOM 4347 C CB  . PHE C 1 153 ? 28.987 -21.770 -37.299 1.00 38.45  ? 153 PHE D CB  1 
ATOM 4348 C CG  . PHE C 1 153 ? 29.769 -21.879 -38.564 1.00 37.51  ? 153 PHE D CG  1 
ATOM 4349 C CD1 . PHE C 1 153 ? 30.772 -20.963 -38.869 1.00 36.46  ? 153 PHE D CD1 1 
ATOM 4350 C CD2 . PHE C 1 153 ? 29.482 -22.898 -39.477 1.00 37.28  ? 153 PHE D CD2 1 
ATOM 4351 C CE1 . PHE C 1 153 ? 31.499 -21.074 -40.061 1.00 34.11  ? 153 PHE D CE1 1 
ATOM 4352 C CE2 . PHE C 1 153 ? 30.187 -23.016 -40.662 1.00 36.93  ? 153 PHE D CE2 1 
ATOM 4353 C CZ  . PHE C 1 153 ? 31.194 -22.092 -40.961 1.00 34.45  ? 153 PHE D CZ  1 
ATOM 4354 N N   . VAL C 1 154 ? 29.917 -24.516 -36.166 1.00 43.58  ? 154 VAL D N   1 
ATOM 4355 C CA  . VAL C 1 154 ? 30.526 -25.800 -36.403 1.00 45.60  ? 154 VAL D CA  1 
ATOM 4356 C C   . VAL C 1 154 ? 30.045 -26.290 -37.784 1.00 46.64  ? 154 VAL D C   1 
ATOM 4357 O O   . VAL C 1 154 ? 28.864 -26.618 -37.953 1.00 45.65  ? 154 VAL D O   1 
ATOM 4358 C CB  . VAL C 1 154 ? 30.175 -26.799 -35.266 1.00 46.88  ? 154 VAL D CB  1 
ATOM 4359 C CG1 . VAL C 1 154 ? 31.066 -28.064 -35.337 1.00 47.21  ? 154 VAL D CG1 1 
ATOM 4360 C CG2 . VAL C 1 154 ? 30.322 -26.111 -33.906 1.00 46.89  ? 154 VAL D CG2 1 
ATOM 4361 N N   . PRO C 1 155 ? 30.960 -26.292 -38.788 1.00 47.63  ? 155 PRO D N   1 
ATOM 4362 C CA  . PRO C 1 155 ? 30.608 -26.735 -40.133 1.00 48.85  ? 155 PRO D CA  1 
ATOM 4363 C C   . PRO C 1 155 ? 29.787 -28.027 -40.088 1.00 51.28  ? 155 PRO D C   1 
ATOM 4364 O O   . PRO C 1 155 ? 30.135 -28.958 -39.345 1.00 52.43  ? 155 PRO D O   1 
ATOM 4365 C CB  . PRO C 1 155 ? 31.973 -27.007 -40.778 1.00 49.04  ? 155 PRO D CB  1 
ATOM 4366 C CG  . PRO C 1 155 ? 32.906 -26.084 -40.083 1.00 47.83  ? 155 PRO D CG  1 
ATOM 4367 C CD  . PRO C 1 155 ? 32.368 -25.852 -38.702 1.00 47.04  ? 155 PRO D CD  1 
ATOM 4368 N N   . SER C 1 156 ? 28.699 -28.077 -40.854 1.00 52.30  ? 156 SER D N   1 
ATOM 4369 C CA  . SER C 1 156 ? 28.015 -29.331 -41.090 1.00 54.53  ? 156 SER D CA  1 
ATOM 4370 C C   . SER C 1 156 ? 27.313 -29.352 -42.450 1.00 55.84  ? 156 SER D C   1 
ATOM 4371 O O   . SER C 1 156 ? 26.750 -28.341 -42.873 1.00 55.26  ? 156 SER D O   1 
ATOM 4372 C CB  . SER C 1 156 ? 27.032 -29.634 -39.966 1.00 54.77  ? 156 SER D CB  1 
ATOM 4373 O OG  . SER C 1 156 ? 26.697 -31.014 -39.979 1.00 56.67  ? 156 SER D OG  1 
ATOM 4374 N N   . ALA C 1 157 ? 27.339 -30.514 -43.119 1.00 58.19  ? 157 ALA D N   1 
ATOM 4375 C CA  . ALA C 1 157 ? 26.775 -30.678 -44.476 1.00 59.40  ? 157 ALA D CA  1 
ATOM 4376 C C   . ALA C 1 157 ? 25.266 -30.461 -44.508 1.00 59.80  ? 157 ALA D C   1 
ATOM 4377 O O   . ALA C 1 157 ? 24.636 -30.514 -45.578 1.00 60.74  ? 157 ALA D O   1 
ATOM 4378 C CB  . ALA C 1 157 ? 27.138 -32.054 -45.066 1.00 60.41  ? 157 ALA D CB  1 
ATOM 4379 N N   . GLU C 1 158 ? 24.701 -30.205 -43.330 1.00 59.58  ? 158 GLU D N   1 
ATOM 4380 C CA  . GLU C 1 158 ? 23.262 -30.024 -43.160 1.00 59.86  ? 158 GLU D CA  1 
ATOM 4381 C C   . GLU C 1 158 ? 22.834 -28.565 -42.946 1.00 58.78  ? 158 GLU D C   1 
ATOM 4382 O O   . GLU C 1 158 ? 21.679 -28.224 -43.188 1.00 59.32  ? 158 GLU D O   1 
ATOM 4383 C CB  . GLU C 1 158 ? 22.733 -30.928 -42.031 1.00 60.69  ? 158 GLU D CB  1 
ATOM 4384 C CG  . GLU C 1 158 ? 23.765 -31.401 -40.979 1.00 61.64  ? 158 GLU D CG  1 
ATOM 4385 C CD  . GLU C 1 158 ? 23.774 -32.931 -40.789 1.00 64.84  ? 158 GLU D CD  1 
ATOM 4386 O OE1 . GLU C 1 158 ? 22.737 -33.575 -41.093 1.00 67.20  ? 158 GLU D OE1 1 
ATOM 4387 O OE2 . GLU C 1 158 ? 24.811 -33.500 -40.346 1.00 63.35  ? 158 GLU D OE2 1 
ATOM 4388 N N   . ASP C 1 159 ? 23.752 -27.707 -42.504 1.00 57.30  ? 159 ASP D N   1 
ATOM 4389 C CA  . ASP C 1 159 ? 23.408 -26.323 -42.227 1.00 55.58  ? 159 ASP D CA  1 
ATOM 4390 C C   . ASP C 1 159 ? 23.688 -25.452 -43.424 1.00 54.84  ? 159 ASP D C   1 
ATOM 4391 O O   . ASP C 1 159 ? 24.694 -25.637 -44.102 1.00 55.44  ? 159 ASP D O   1 
ATOM 4392 C CB  . ASP C 1 159 ? 24.186 -25.805 -41.022 1.00 55.05  ? 159 ASP D CB  1 
ATOM 4393 C CG  . ASP C 1 159 ? 23.799 -26.509 -39.745 1.00 56.99  ? 159 ASP D CG  1 
ATOM 4394 O OD1 . ASP C 1 159 ? 22.613 -26.872 -39.621 1.00 58.74  ? 159 ASP D OD1 1 
ATOM 4395 O OD2 . ASP C 1 159 ? 24.671 -26.718 -38.870 1.00 58.32  ? 159 ASP D OD2 1 
ATOM 4396 N N   . PHE C 1 160 ? 22.799 -24.498 -43.684 1.00 53.77  ? 160 PHE D N   1 
ATOM 4397 C CA  . PHE C 1 160 ? 23.030 -23.507 -44.732 1.00 52.56  ? 160 PHE D CA  1 
ATOM 4398 C C   . PHE C 1 160 ? 22.703 -22.050 -44.314 1.00 50.39  ? 160 PHE D C   1 
ATOM 4399 O O   . PHE C 1 160 ? 21.700 -21.771 -43.672 1.00 50.64  ? 160 PHE D O   1 
ATOM 4400 C CB  . PHE C 1 160 ? 22.362 -23.935 -46.050 1.00 53.82  ? 160 PHE D CB  1 
ATOM 4401 C CG  . PHE C 1 160 ? 20.864 -23.827 -46.053 1.00 56.07  ? 160 PHE D CG  1 
ATOM 4402 C CD1 . PHE C 1 160 ? 20.233 -22.607 -46.372 1.00 57.02  ? 160 PHE D CD1 1 
ATOM 4403 C CD2 . PHE C 1 160 ? 20.077 -24.953 -45.791 1.00 58.69  ? 160 PHE D CD2 1 
ATOM 4404 C CE1 . PHE C 1 160 ? 18.840 -22.503 -46.403 1.00 58.69  ? 160 PHE D CE1 1 
ATOM 4405 C CE2 . PHE C 1 160 ? 18.675 -24.875 -45.823 1.00 60.38  ? 160 PHE D CE2 1 
ATOM 4406 C CZ  . PHE C 1 160 ? 18.052 -23.644 -46.122 1.00 61.14  ? 160 PHE D CZ  1 
ATOM 4407 N N   . TYR C 1 161 ? 23.568 -21.121 -44.693 1.00 48.37  ? 161 TYR D N   1 
ATOM 4408 C CA  . TYR C 1 161 ? 23.578 -19.811 -44.068 1.00 45.68  ? 161 TYR D CA  1 
ATOM 4409 C C   . TYR C 1 161 ? 23.239 -18.669 -44.995 1.00 44.83  ? 161 TYR D C   1 
ATOM 4410 O O   . TYR C 1 161 ? 23.522 -18.695 -46.190 1.00 45.05  ? 161 TYR D O   1 
ATOM 4411 C CB  . TYR C 1 161 ? 24.935 -19.566 -43.423 1.00 44.72  ? 161 TYR D CB  1 
ATOM 4412 C CG  . TYR C 1 161 ? 25.173 -20.434 -42.233 1.00 42.85  ? 161 TYR D CG  1 
ATOM 4413 C CD1 . TYR C 1 161 ? 24.674 -20.075 -40.989 1.00 42.71  ? 161 TYR D CD1 1 
ATOM 4414 C CD2 . TYR C 1 161 ? 25.885 -21.621 -42.348 1.00 42.60  ? 161 TYR D CD2 1 
ATOM 4415 C CE1 . TYR C 1 161 ? 24.884 -20.875 -39.881 1.00 44.37  ? 161 TYR D CE1 1 
ATOM 4416 C CE2 . TYR C 1 161 ? 26.101 -22.434 -41.253 1.00 43.91  ? 161 TYR D CE2 1 
ATOM 4417 C CZ  . TYR C 1 161 ? 25.594 -22.055 -40.018 1.00 45.27  ? 161 TYR D CZ  1 
ATOM 4418 O OH  . TYR C 1 161 ? 25.796 -22.846 -38.907 1.00 48.30  ? 161 TYR D OH  1 
ATOM 4419 N N   . ASP C 1 162 ? 22.599 -17.671 -44.418 1.00 43.65  ? 162 ASP D N   1 
ATOM 4420 C CA  . ASP C 1 162 ? 22.353 -16.435 -45.120 1.00 42.80  ? 162 ASP D CA  1 
ATOM 4421 C C   . ASP C 1 162 ? 22.739 -15.269 -44.261 1.00 41.13  ? 162 ASP D C   1 
ATOM 4422 O O   . ASP C 1 162 ? 22.500 -15.228 -43.049 1.00 40.08  ? 162 ASP D O   1 
ATOM 4423 C CB  . ASP C 1 162 ? 20.889 -16.302 -45.535 1.00 43.68  ? 162 ASP D CB  1 
ATOM 4424 C CG  . ASP C 1 162 ? 20.506 -17.284 -46.604 1.00 45.16  ? 162 ASP D CG  1 
ATOM 4425 O OD1 . ASP C 1 162 ? 19.586 -18.099 -46.367 1.00 46.69  ? 162 ASP D OD1 1 
ATOM 4426 O OD2 . ASP C 1 162 ? 21.130 -17.240 -47.682 1.00 47.06  ? 162 ASP D OD2 1 
ATOM 4427 N N   . CYS C 1 163 ? 23.366 -14.329 -44.929 1.00 40.42  ? 163 CYS D N   1 
ATOM 4428 C CA  . CYS C 1 163 ? 23.604 -13.032 -44.379 1.00 40.15  ? 163 CYS D CA  1 
ATOM 4429 C C   . CYS C 1 163 ? 22.519 -12.173 -45.009 1.00 40.12  ? 163 CYS D C   1 
ATOM 4430 O O   . CYS C 1 163 ? 22.409 -12.110 -46.245 1.00 40.69  ? 163 CYS D O   1 
ATOM 4431 C CB  . CYS C 1 163 ? 25.001 -12.551 -44.784 1.00 39.42  ? 163 CYS D CB  1 
ATOM 4432 S SG  . CYS C 1 163 ? 25.436 -11.044 -43.961 1.00 41.79  ? 163 CYS D SG  1 
ATOM 4433 N N   . ARG C 1 164 ? 21.688 -11.549 -44.184 1.00 39.67  ? 164 ARG D N   1 
ATOM 4434 C CA  . ARG C 1 164 ? 20.686 -10.635 -44.720 1.00 40.02  ? 164 ARG D CA  1 
ATOM 4435 C C   . ARG C 1 164 ? 21.026 -9.147  -44.516 1.00 39.26  ? 164 ARG D C   1 
ATOM 4436 O O   . ARG C 1 164 ? 21.320 -8.690  -43.402 1.00 38.48  ? 164 ARG D O   1 
ATOM 4437 C CB  . ARG C 1 164 ? 19.319 -10.956 -44.152 1.00 40.83  ? 164 ARG D CB  1 
ATOM 4438 C CG  . ARG C 1 164 ? 18.267 -9.968  -44.578 1.00 42.38  ? 164 ARG D CG  1 
ATOM 4439 C CD  . ARG C 1 164 ? 16.934 -10.588 -44.586 1.00 43.92  ? 164 ARG D CD  1 
ATOM 4440 N NE  . ARG C 1 164 ? 16.098 -9.896  -43.627 1.00 48.39  ? 164 ARG D NE  1 
ATOM 4441 C CZ  . ARG C 1 164 ? 15.570 -10.455 -42.537 1.00 49.87  ? 164 ARG D CZ  1 
ATOM 4442 N NH1 . ARG C 1 164 ? 15.754 -11.738 -42.258 1.00 45.53  ? 164 ARG D NH1 1 
ATOM 4443 N NH2 . ARG C 1 164 ? 14.814 -9.713  -41.735 1.00 53.57  ? 164 ARG D NH2 1 
ATOM 4444 N N   . VAL C 1 165 ? 20.953 -8.384  -45.592 1.00 38.74  ? 165 VAL D N   1 
ATOM 4445 C CA  . VAL C 1 165 ? 21.341 -6.993  -45.497 1.00 38.47  ? 165 VAL D CA  1 
ATOM 4446 C C   . VAL C 1 165 ? 20.243 -6.069  -45.975 1.00 39.31  ? 165 VAL D C   1 
ATOM 4447 O O   . VAL C 1 165 ? 19.661 -6.276  -47.040 1.00 40.17  ? 165 VAL D O   1 
ATOM 4448 C CB  . VAL C 1 165 ? 22.611 -6.724  -46.322 1.00 38.12  ? 165 VAL D CB  1 
ATOM 4449 C CG1 . VAL C 1 165 ? 22.873 -5.242  -46.401 1.00 37.73  ? 165 VAL D CG1 1 
ATOM 4450 C CG2 . VAL C 1 165 ? 23.793 -7.481  -45.742 1.00 36.01  ? 165 VAL D CG2 1 
ATOM 4451 N N   . GLU C 1 166 ? 19.968 -5.038  -45.190 1.00 39.16  ? 166 GLU D N   1 
ATOM 4452 C CA  . GLU C 1 166 ? 19.015 -4.026  -45.616 1.00 40.02  ? 166 GLU D CA  1 
ATOM 4453 C C   . GLU C 1 166 ? 19.686 -2.659  -45.617 1.00 39.23  ? 166 GLU D C   1 
ATOM 4454 O O   . GLU C 1 166 ? 20.429 -2.317  -44.680 1.00 38.66  ? 166 GLU D O   1 
ATOM 4455 C CB  . GLU C 1 166 ? 17.816 -3.979  -44.693 1.00 40.90  ? 166 GLU D CB  1 
ATOM 4456 C CG  . GLU C 1 166 ? 17.108 -5.284  -44.468 1.00 42.74  ? 166 GLU D CG  1 
ATOM 4457 C CD  . GLU C 1 166 ? 16.158 -5.182  -43.281 1.00 47.51  ? 166 GLU D CD  1 
ATOM 4458 O OE1 . GLU C 1 166 ? 16.357 -5.932  -42.286 1.00 48.67  ? 166 GLU D OE1 1 
ATOM 4459 O OE2 . GLU C 1 166 ? 15.246 -4.310  -43.322 1.00 47.68  ? 166 GLU D OE2 1 
ATOM 4460 N N   . HIS C 1 167 ? 19.399 -1.884  -46.661 1.00 38.78  ? 167 HIS D N   1 
ATOM 4461 C CA  . HIS C 1 167 ? 19.947 -0.545  -46.833 1.00 37.71  ? 167 HIS D CA  1 
ATOM 4462 C C   . HIS C 1 167 ? 19.045 0.244   -47.799 1.00 38.25  ? 167 HIS D C   1 
ATOM 4463 O O   . HIS C 1 167 ? 18.613 -0.275  -48.824 1.00 39.30  ? 167 HIS D O   1 
ATOM 4464 C CB  . HIS C 1 167 ? 21.413 -0.649  -47.326 1.00 36.80  ? 167 HIS D CB  1 
ATOM 4465 C CG  . HIS C 1 167 ? 22.122 0.662   -47.500 1.00 36.26  ? 167 HIS D CG  1 
ATOM 4466 N ND1 . HIS C 1 167 ? 22.147 1.345   -48.702 1.00 38.36  ? 167 HIS D ND1 1 
ATOM 4467 C CD2 . HIS C 1 167 ? 22.869 1.393   -46.639 1.00 36.64  ? 167 HIS D CD2 1 
ATOM 4468 C CE1 . HIS C 1 167 ? 22.866 2.446   -48.568 1.00 38.39  ? 167 HIS D CE1 1 
ATOM 4469 N NE2 . HIS C 1 167 ? 23.315 2.500   -47.324 1.00 37.38  ? 167 HIS D NE2 1 
ATOM 4470 N N   . TRP C 1 168 ? 18.750 1.489   -47.459 1.00 37.74  ? 168 TRP D N   1 
ATOM 4471 C CA  . TRP C 1 168 ? 17.981 2.387   -48.337 1.00 38.65  ? 168 TRP D CA  1 
ATOM 4472 C C   . TRP C 1 168 ? 18.276 2.292   -49.847 1.00 38.90  ? 168 TRP D C   1 
ATOM 4473 O O   . TRP C 1 168 ? 17.430 2.655   -50.661 1.00 40.07  ? 168 TRP D O   1 
ATOM 4474 C CB  . TRP C 1 168 ? 18.118 3.844   -47.870 1.00 38.00  ? 168 TRP D CB  1 
ATOM 4475 C CG  . TRP C 1 168 ? 17.781 4.022   -46.436 1.00 37.39  ? 168 TRP D CG  1 
ATOM 4476 C CD1 . TRP C 1 168 ? 16.996 3.210   -45.679 1.00 37.38  ? 168 TRP D CD1 1 
ATOM 4477 C CD2 . TRP C 1 168 ? 18.203 5.094   -45.574 1.00 37.85  ? 168 TRP D CD2 1 
ATOM 4478 N NE1 . TRP C 1 168 ? 16.902 3.699   -44.387 1.00 39.39  ? 168 TRP D NE1 1 
ATOM 4479 C CE2 . TRP C 1 168 ? 17.627 4.860   -44.300 1.00 39.34  ? 168 TRP D CE2 1 
ATOM 4480 C CE3 . TRP C 1 168 ? 18.992 6.240   -45.759 1.00 36.42  ? 168 TRP D CE3 1 
ATOM 4481 C CZ2 . TRP C 1 168 ? 17.826 5.730   -43.203 1.00 40.63  ? 168 TRP D CZ2 1 
ATOM 4482 C CZ3 . TRP C 1 168 ? 19.194 7.100   -44.670 1.00 37.70  ? 168 TRP D CZ3 1 
ATOM 4483 C CH2 . TRP C 1 168 ? 18.623 6.832   -43.403 1.00 38.67  ? 168 TRP D CH2 1 
ATOM 4484 N N   . GLY C 1 169 ? 19.467 1.825   -50.214 1.00 38.40  ? 169 GLY D N   1 
ATOM 4485 C CA  . GLY C 1 169 ? 19.859 1.716   -51.626 1.00 39.05  ? 169 GLY D CA  1 
ATOM 4486 C C   . GLY C 1 169 ? 19.292 0.518   -52.373 1.00 40.18  ? 169 GLY D C   1 
ATOM 4487 O O   . GLY C 1 169 ? 19.293 0.507   -53.591 1.00 40.90  ? 169 GLY D O   1 
ATOM 4488 N N   . LEU C 1 170 ? 18.834 -0.497  -51.643 1.00 40.24  ? 170 LEU D N   1 
ATOM 4489 C CA  . LEU C 1 170 ? 18.245 -1.690  -52.230 1.00 41.61  ? 170 LEU D CA  1 
ATOM 4490 C C   . LEU C 1 170 ? 16.739 -1.596  -52.168 1.00 44.21  ? 170 LEU D C   1 
ATOM 4491 O O   . LEU C 1 170 ? 16.193 -1.083  -51.173 1.00 44.48  ? 170 LEU D O   1 
ATOM 4492 C CB  . LEU C 1 170 ? 18.649 -2.927  -51.448 1.00 39.92  ? 170 LEU D CB  1 
ATOM 4493 C CG  . LEU C 1 170 ? 20.134 -3.198  -51.259 1.00 37.83  ? 170 LEU D CG  1 
ATOM 4494 C CD1 . LEU C 1 170 ? 20.373 -4.110  -50.054 1.00 34.63  ? 170 LEU D CD1 1 
ATOM 4495 C CD2 . LEU C 1 170 ? 20.734 -3.773  -52.533 1.00 35.65  ? 170 LEU D CD2 1 
ATOM 4496 N N   . ASP C 1 171 ? 16.066 -2.088  -53.214 1.00 46.46  ? 171 ASP D N   1 
ATOM 4497 C CA  . ASP C 1 171 ? 14.606 -2.183  -53.169 1.00 48.82  ? 171 ASP D CA  1 
ATOM 4498 C C   . ASP C 1 171 ? 14.238 -3.091  -51.990 1.00 48.68  ? 171 ASP D C   1 
ATOM 4499 O O   . ASP C 1 171 ? 13.562 -2.658  -51.043 1.00 48.21  ? 171 ASP D O   1 
ATOM 4500 C CB  . ASP C 1 171 ? 14.018 -2.742  -54.474 1.00 50.24  ? 171 ASP D CB  1 
ATOM 4501 C CG  . ASP C 1 171 ? 14.349 -1.893  -55.702 1.00 53.04  ? 171 ASP D CG  1 
ATOM 4502 O OD1 . ASP C 1 171 ? 14.613 -2.523  -56.741 1.00 55.74  ? 171 ASP D OD1 1 
ATOM 4503 O OD2 . ASP C 1 171 ? 14.358 -0.627  -55.661 1.00 53.79  ? 171 ASP D OD2 1 
ATOM 4504 N N   . GLN C 1 172 ? 14.741 -4.330  -52.046 1.00 48.87  ? 172 GLN D N   1 
ATOM 4505 C CA  . GLN C 1 172 ? 14.494 -5.352  -51.038 1.00 49.16  ? 172 GLN D CA  1 
ATOM 4506 C C   . GLN C 1 172 ? 15.788 -5.877  -50.429 1.00 47.93  ? 172 GLN D C   1 
ATOM 4507 O O   . GLN C 1 172 ? 16.837 -5.798  -51.061 1.00 47.95  ? 172 GLN D O   1 
ATOM 4508 C CB  . GLN C 1 172 ? 13.727 -6.489  -51.670 1.00 50.36  ? 172 GLN D CB  1 
ATOM 4509 C CG  . GLN C 1 172 ? 14.290 -6.918  -53.011 1.00 53.18  ? 172 GLN D CG  1 
ATOM 4510 C CD  . GLN C 1 172 ? 13.194 -7.195  -54.007 1.00 57.21  ? 172 GLN D CD  1 
ATOM 4511 O OE1 . GLN C 1 172 ? 12.153 -6.530  -53.988 1.00 59.64  ? 172 GLN D OE1 1 
ATOM 4512 N NE2 . GLN C 1 172 ? 13.409 -8.179  -54.880 1.00 58.62  ? 172 GLN D NE2 1 
ATOM 4513 N N   . PRO C 1 173 ? 15.725 -6.431  -49.195 1.00 47.73  ? 173 PRO D N   1 
ATOM 4514 C CA  . PRO C 1 173 ? 16.928 -6.986  -48.573 1.00 46.24  ? 173 PRO D CA  1 
ATOM 4515 C C   . PRO C 1 173 ? 17.657 -7.968  -49.468 1.00 46.51  ? 173 PRO D C   1 
ATOM 4516 O O   . PRO C 1 173 ? 17.038 -8.660  -50.309 1.00 47.53  ? 173 PRO D O   1 
ATOM 4517 C CB  . PRO C 1 173 ? 16.398 -7.713  -47.341 1.00 45.77  ? 173 PRO D CB  1 
ATOM 4518 C CG  . PRO C 1 173 ? 14.922 -7.748  -47.485 1.00 47.41  ? 173 PRO D CG  1 
ATOM 4519 C CD  . PRO C 1 173 ? 14.558 -6.575  -48.310 1.00 48.51  ? 173 PRO D CD  1 
ATOM 4520 N N   . LEU C 1 174 ? 18.971 -7.996  -49.288 1.00 45.72  ? 174 LEU D N   1 
ATOM 4521 C CA  . LEU C 1 174 ? 19.849 -8.866  -50.037 1.00 46.33  ? 174 LEU D CA  1 
ATOM 4522 C C   . LEU C 1 174 ? 20.217 -10.089 -49.214 1.00 46.13  ? 174 LEU D C   1 
ATOM 4523 O O   . LEU C 1 174 ? 20.571 -9.966  -48.048 1.00 45.61  ? 174 LEU D O   1 
ATOM 4524 C CB  . LEU C 1 174 ? 21.105 -8.096  -50.415 1.00 45.50  ? 174 LEU D CB  1 
ATOM 4525 C CG  . LEU C 1 174 ? 21.948 -8.599  -51.591 1.00 47.20  ? 174 LEU D CG  1 
ATOM 4526 C CD1 . LEU C 1 174 ? 21.152 -8.586  -52.927 1.00 48.45  ? 174 LEU D CD1 1 
ATOM 4527 C CD2 . LEU C 1 174 ? 23.229 -7.760  -51.707 1.00 46.62  ? 174 LEU D CD2 1 
ATOM 4528 N N   . LEU C 1 175 ? 20.119 -11.270 -49.807 1.00 47.54  ? 175 LEU D N   1 
ATOM 4529 C CA  . LEU C 1 175 ? 20.602 -12.475 -49.141 1.00 48.31  ? 175 LEU D CA  1 
ATOM 4530 C C   . LEU C 1 175 ? 21.789 -13.060 -49.873 1.00 49.36  ? 175 LEU D C   1 
ATOM 4531 O O   . LEU C 1 175 ? 21.634 -13.539 -51.015 1.00 50.24  ? 175 LEU D O   1 
ATOM 4532 C CB  . LEU C 1 175 ? 19.534 -13.557 -49.114 1.00 49.02  ? 175 LEU D CB  1 
ATOM 4533 C CG  . LEU C 1 175 ? 18.353 -13.684 -48.169 1.00 49.24  ? 175 LEU D CG  1 
ATOM 4534 C CD1 . LEU C 1 175 ? 17.885 -12.345 -47.602 1.00 49.54  ? 175 LEU D CD1 1 
ATOM 4535 C CD2 . LEU C 1 175 ? 17.268 -14.381 -49.000 1.00 47.75  ? 175 LEU D CD2 1 
ATOM 4536 N N   . LYS C 1 176 ? 22.961 -13.046 -49.230 1.00 49.27  ? 176 LYS D N   1 
ATOM 4537 C CA  . LYS C 1 176 ? 24.072 -13.804 -49.769 1.00 50.67  ? 176 LYS D CA  1 
ATOM 4538 C C   . LYS C 1 176 ? 24.037 -15.147 -49.138 1.00 51.40  ? 176 LYS D C   1 
ATOM 4539 O O   . LYS C 1 176 ? 24.120 -15.262 -47.928 1.00 50.34  ? 176 LYS D O   1 
ATOM 4540 C CB  . LYS C 1 176 ? 25.431 -13.155 -49.552 1.00 49.82  ? 176 LYS D CB  1 
ATOM 4541 C CG  . LYS C 1 176 ? 26.012 -12.505 -50.794 1.00 51.91  ? 176 LYS D CG  1 
ATOM 4542 C CD  . LYS C 1 176 ? 26.280 -13.494 -51.942 1.00 55.82  ? 176 LYS D CD  1 
ATOM 4543 C CE  . LYS C 1 176 ? 26.944 -12.779 -53.128 1.00 56.76  ? 176 LYS D CE  1 
ATOM 4544 N NZ  . LYS C 1 176 ? 26.688 -13.499 -54.410 1.00 59.66  ? 176 LYS D NZ  1 
ATOM 4545 N N   . HIS C 1 177 ? 23.888 -16.155 -49.987 1.00 53.59  ? 177 HIS D N   1 
ATOM 4546 C CA  . HIS C 1 177 ? 23.814 -17.501 -49.542 1.00 55.16  ? 177 HIS D CA  1 
ATOM 4547 C C   . HIS C 1 177 ? 25.196 -18.055 -49.345 1.00 56.06  ? 177 HIS D C   1 
ATOM 4548 O O   . HIS C 1 177 ? 26.126 -17.663 -50.036 1.00 56.35  ? 177 HIS D O   1 
ATOM 4549 C CB  . HIS C 1 177 ? 23.080 -18.333 -50.560 1.00 56.58  ? 177 HIS D CB  1 
ATOM 4550 C CG  . HIS C 1 177 ? 22.417 -19.519 -49.959 1.00 56.94  ? 177 HIS D CG  1 
ATOM 4551 N ND1 . HIS C 1 177 ? 23.022 -20.753 -49.892 1.00 55.98  ? 177 HIS D ND1 1 
ATOM 4552 C CD2 . HIS C 1 177 ? 21.210 -19.651 -49.363 1.00 58.74  ? 177 HIS D CD2 1 
ATOM 4553 C CE1 . HIS C 1 177 ? 22.208 -21.599 -49.290 1.00 58.76  ? 177 HIS D CE1 1 
ATOM 4554 N NE2 . HIS C 1 177 ? 21.102 -20.955 -48.959 1.00 59.94  ? 177 HIS D NE2 1 
ATOM 4555 N N   . TRP C 1 178 ? 25.334 -18.964 -48.385 1.00 57.37  ? 178 TRP D N   1 
ATOM 4556 C CA  . TRP C 1 178 ? 26.570 -19.697 -48.223 1.00 58.95  ? 178 TRP D CA  1 
ATOM 4557 C C   . TRP C 1 178 ? 26.380 -21.057 -47.560 1.00 61.24  ? 178 TRP D C   1 
ATOM 4558 O O   . TRP C 1 178 ? 25.690 -21.195 -46.545 1.00 60.91  ? 178 TRP D O   1 
ATOM 4559 C CB  . TRP C 1 178 ? 27.594 -18.869 -47.465 1.00 57.82  ? 178 TRP D CB  1 
ATOM 4560 C CG  . TRP C 1 178 ? 28.913 -19.526 -47.384 1.00 57.63  ? 178 TRP D CG  1 
ATOM 4561 C CD1 . TRP C 1 178 ? 29.983 -19.321 -48.204 1.00 57.79  ? 178 TRP D CD1 1 
ATOM 4562 C CD2 . TRP C 1 178 ? 29.312 -20.523 -46.434 1.00 58.30  ? 178 TRP D CD2 1 
ATOM 4563 N NE1 . TRP C 1 178 ? 31.033 -20.125 -47.819 1.00 58.38  ? 178 TRP D NE1 1 
ATOM 4564 C CE2 . TRP C 1 178 ? 30.647 -20.875 -46.735 1.00 58.60  ? 178 TRP D CE2 1 
ATOM 4565 C CE3 . TRP C 1 178 ? 28.666 -21.160 -45.353 1.00 57.98  ? 178 TRP D CE3 1 
ATOM 4566 C CZ2 . TRP C 1 178 ? 31.352 -21.845 -46.000 1.00 58.79  ? 178 TRP D CZ2 1 
ATOM 4567 C CZ3 . TRP C 1 178 ? 29.367 -22.124 -44.622 1.00 57.83  ? 178 TRP D CZ3 1 
ATOM 4568 C CH2 . TRP C 1 178 ? 30.695 -22.455 -44.951 1.00 58.58  ? 178 TRP D CH2 1 
ATOM 4569 N N   . GLU C 1 179 ? 27.030 -22.058 -48.146 1.00 64.29  ? 179 GLU D N   1 
ATOM 4570 C CA  . GLU C 1 179 ? 27.002 -23.423 -47.644 1.00 66.79  ? 179 GLU D CA  1 
ATOM 4571 C C   . GLU C 1 179 ? 28.339 -24.118 -47.889 1.00 68.30  ? 179 GLU D C   1 
ATOM 4572 O O   . GLU C 1 179 ? 29.132 -23.699 -48.749 1.00 68.56  ? 179 GLU D O   1 
ATOM 4573 C CB  . GLU C 1 179 ? 25.880 -24.198 -48.334 1.00 68.21  ? 179 GLU D CB  1 
ATOM 4574 C CG  . GLU C 1 179 ? 25.968 -24.176 -49.871 1.00 70.71  ? 179 GLU D CG  1 
ATOM 4575 C CD  . GLU C 1 179 ? 24.615 -24.324 -50.543 1.00 73.55  ? 179 GLU D CD  1 
ATOM 4576 O OE1 . GLU C 1 179 ? 23.696 -23.532 -50.224 1.00 74.21  ? 179 GLU D OE1 1 
ATOM 4577 O OE2 . GLU C 1 179 ? 24.475 -25.220 -51.403 1.00 75.04  ? 179 GLU D OE2 1 
ATOM 4578 N N   . ALA C 1 180 ? 28.571 -25.188 -47.131 1.00 70.20  ? 180 ALA D N   1 
ATOM 4579 C CA  . ALA C 1 180 ? 29.741 -26.053 -47.300 1.00 72.29  ? 180 ALA D CA  1 
ATOM 4580 C C   . ALA C 1 180 ? 29.663 -26.905 -48.591 1.00 74.58  ? 180 ALA D C   1 
ATOM 4581 O O   . ALA C 1 180 ? 28.850 -27.835 -48.680 1.00 75.39  ? 180 ALA D O   1 
ATOM 4582 C CB  . ALA C 1 180 ? 29.908 -26.945 -46.061 1.00 72.34  ? 180 ALA D CB  1 
ATOM 4583 N N   . GLN C 1 181 ? 30.512 -26.572 -49.575 1.00 76.08  ? 181 GLN D N   1 
ATOM 4584 C CA  . GLN C 1 181 ? 30.622 -27.283 -50.887 1.00 78.51  ? 181 GLN D CA  1 
ATOM 4585 C C   . GLN C 1 181 ? 30.794 -28.819 -50.837 1.00 80.00  ? 181 GLN D C   1 
ATOM 4586 O O   . GLN C 1 181 ? 30.591 -29.520 -51.838 1.00 81.37  ? 181 GLN D O   1 
ATOM 4587 C CB  . GLN C 1 181 ? 31.765 -26.681 -51.739 1.00 79.11  ? 181 GLN D CB  1 
ATOM 4588 C CG  . GLN C 1 181 ? 31.337 -25.677 -52.810 1.00 79.83  ? 181 GLN D CG  1 
ATOM 4589 C CD  . GLN C 1 181 ? 30.649 -24.457 -52.227 1.00 79.41  ? 181 GLN D CD  1 
ATOM 4590 O OE1 . GLN C 1 181 ? 29.541 -24.549 -51.677 1.00 79.18  ? 181 GLN D OE1 1 
ATOM 4591 N NE2 . GLN C 1 181 ? 31.297 -23.300 -52.356 1.00 78.71  ? 181 GLN D NE2 1 
ATOM 4592 N N   . ASN D 2 1   ? 52.635 6.323   -23.279 1.00 56.92  ? -25 ASN E N   1 
ATOM 4593 C CA  . ASN D 2 1   ? 51.726 5.225   -23.699 1.00 56.91  ? -25 ASN E CA  1 
ATOM 4594 C C   . ASN D 2 1   ? 50.500 5.767   -24.405 1.00 56.17  ? -25 ASN E C   1 
ATOM 4595 O O   . ASN D 2 1   ? 49.696 5.009   -24.926 1.00 56.21  ? -25 ASN E O   1 
ATOM 4596 C CB  . ASN D 2 1   ? 51.275 4.415   -22.485 1.00 57.75  ? -25 ASN E CB  1 
ATOM 4597 C CG  . ASN D 2 1   ? 52.392 4.182   -21.481 1.00 60.55  ? -25 ASN E CG  1 
ATOM 4598 O OD1 . ASN D 2 1   ? 53.539 4.589   -21.702 1.00 64.33  ? -25 ASN E OD1 1 
ATOM 4599 N ND2 . ASN D 2 1   ? 52.061 3.536   -20.357 1.00 62.59  ? -25 ASN E ND2 1 
ATOM 4600 N N   . LYS D 2 2   ? 50.378 7.088   -24.428 1.00 55.67  ? -24 LYS E N   1 
ATOM 4601 C CA  . LYS D 2 2   ? 49.149 7.780   -24.811 1.00 55.17  ? -24 LYS E CA  1 
ATOM 4602 C C   . LYS D 2 2   ? 49.227 8.219   -26.256 1.00 54.41  ? -24 LYS E C   1 
ATOM 4603 O O   . LYS D 2 2   ? 50.207 8.845   -26.648 1.00 54.57  ? -24 LYS E O   1 
ATOM 4604 C CB  . LYS D 2 2   ? 48.943 9.002   -23.904 1.00 55.44  ? -24 LYS E CB  1 
ATOM 4605 C CG  . LYS D 2 2   ? 49.263 8.746   -22.378 1.00 58.03  ? -24 LYS E CG  1 
ATOM 4606 C CD  . LYS D 2 2   ? 49.017 9.980   -21.451 1.00 60.24  ? -24 LYS E CD  1 
ATOM 4607 C CE  . LYS D 2 2   ? 47.561 10.062  -20.866 1.00 61.56  ? -24 LYS E CE  1 
ATOM 4608 N NZ  . LYS D 2 2   ? 46.424 9.722   -21.830 1.00 61.17  ? -24 LYS E NZ  1 
ATOM 4609 N N   . PHE D 2 3   ? 48.213 7.885   -27.057 1.00 53.66  ? -23 PHE E N   1 
ATOM 4610 C CA  . PHE D 2 3   ? 48.136 8.372   -28.448 1.00 52.46  ? -23 PHE E CA  1 
ATOM 4611 C C   . PHE D 2 3   ? 47.669 9.843   -28.451 1.00 53.32  ? -23 PHE E C   1 
ATOM 4612 O O   . PHE D 2 3   ? 46.745 10.218  -27.710 1.00 53.32  ? -23 PHE E O   1 
ATOM 4613 C CB  . PHE D 2 3   ? 47.162 7.524   -29.283 1.00 51.45  ? -23 PHE E CB  1 
ATOM 4614 C CG  . PHE D 2 3   ? 47.778 6.318   -29.957 1.00 47.02  ? -23 PHE E CG  1 
ATOM 4615 C CD1 . PHE D 2 3   ? 48.000 5.132   -29.250 1.00 44.79  ? -23 PHE E CD1 1 
ATOM 4616 C CD2 . PHE D 2 3   ? 48.065 6.348   -31.315 1.00 43.57  ? -23 PHE E CD2 1 
ATOM 4617 C CE1 . PHE D 2 3   ? 48.554 4.003   -29.871 1.00 43.72  ? -23 PHE E CE1 1 
ATOM 4618 C CE2 . PHE D 2 3   ? 48.612 5.233   -31.975 1.00 43.87  ? -23 PHE E CE2 1 
ATOM 4619 C CZ  . PHE D 2 3   ? 48.869 4.042   -31.248 1.00 44.18  ? -23 PHE E CZ  1 
ATOM 4620 N N   . ASP D 2 4   ? 48.324 10.662  -29.272 1.00 53.84  ? -22 ASP E N   1 
ATOM 4621 C CA  . ASP D 2 4   ? 47.897 12.033  -29.574 1.00 54.48  ? -22 ASP E CA  1 
ATOM 4622 C C   . ASP D 2 4   ? 46.703 12.087  -30.537 1.00 54.27  ? -22 ASP E C   1 
ATOM 4623 O O   . ASP D 2 4   ? 46.601 11.243  -31.454 1.00 54.37  ? -22 ASP E O   1 
ATOM 4624 C CB  . ASP D 2 4   ? 49.043 12.780  -30.254 1.00 54.90  ? -22 ASP E CB  1 
ATOM 4625 C CG  . ASP D 2 4   ? 49.987 13.447  -29.272 1.00 57.82  ? -22 ASP E CG  1 
ATOM 4626 O OD1 . ASP D 2 4   ? 50.540 14.527  -29.644 1.00 58.99  ? -22 ASP E OD1 1 
ATOM 4627 O OD2 . ASP D 2 4   ? 50.173 12.904  -28.141 1.00 61.25  ? -22 ASP E OD2 1 
ATOM 4628 N N   . THR D 2 5   ? 45.830 13.088  -30.345 1.00 53.54  ? -21 THR E N   1 
ATOM 4629 C CA  . THR D 2 5   ? 44.809 13.466  -31.344 1.00 53.50  ? -21 THR E CA  1 
ATOM 4630 C C   . THR D 2 5   ? 44.925 14.928  -31.734 1.00 51.91  ? -21 THR E C   1 
ATOM 4631 O O   . THR D 2 5   ? 45.833 15.610  -31.292 1.00 52.11  ? -21 THR E O   1 
ATOM 4632 C CB  . THR D 2 5   ? 43.347 13.177  -30.863 1.00 54.68  ? -21 THR E CB  1 
ATOM 4633 O OG1 . THR D 2 5   ? 43.322 11.936  -30.131 1.00 58.60  ? -21 THR E OG1 1 
ATOM 4634 C CG2 . THR D 2 5   ? 42.320 13.090  -32.071 1.00 54.89  ? -21 THR E CG2 1 
ATOM 4635 N N   . GLN D 2 6   ? 44.025 15.381  -32.600 1.00 50.53  ? -20 GLN E N   1 
ATOM 4636 C CA  . GLN D 2 6   ? 43.887 16.780  -32.965 1.00 49.21  ? -20 GLN E CA  1 
ATOM 4637 C C   . GLN D 2 6   ? 42.408 17.104  -33.063 1.00 48.50  ? -20 GLN E C   1 
ATOM 4638 O O   . GLN D 2 6   ? 41.575 16.235  -33.346 1.00 47.36  ? -20 GLN E O   1 
ATOM 4639 C CB  . GLN D 2 6   ? 44.570 17.100  -34.301 1.00 49.04  ? -20 GLN E CB  1 
ATOM 4640 C CG  . GLN D 2 6   ? 44.782 18.589  -34.520 1.00 49.73  ? -20 GLN E CG  1 
ATOM 4641 C CD  . GLN D 2 6   ? 44.727 19.012  -35.989 1.00 53.39  ? -20 GLN E CD  1 
ATOM 4642 O OE1 . GLN D 2 6   ? 45.484 18.506  -36.810 1.00 53.57  ? -20 GLN E OE1 1 
ATOM 4643 N NE2 . GLN D 2 6   ? 43.834 19.967  -36.321 1.00 55.02  ? -20 GLN E NE2 1 
ATOM 4644 N N   . LEU D 2 7   ? 42.090 18.370  -32.814 1.00 48.10  ? -19 LEU E N   1 
ATOM 4645 C CA  . LEU D 2 7   ? 40.730 18.851  -32.940 1.00 47.27  ? -19 LEU E CA  1 
ATOM 4646 C C   . LEU D 2 7   ? 40.523 19.323  -34.375 1.00 47.20  ? -19 LEU E C   1 
ATOM 4647 O O   . LEU D 2 7   ? 41.381 20.026  -34.916 1.00 46.23  ? -19 LEU E O   1 
ATOM 4648 C CB  . LEU D 2 7   ? 40.447 19.949  -31.903 1.00 46.90  ? -19 LEU E CB  1 
ATOM 4649 C CG  . LEU D 2 7   ? 40.658 19.578  -30.421 1.00 46.36  ? -19 LEU E CG  1 
ATOM 4650 C CD1 . LEU D 2 7   ? 41.013 20.796  -29.568 1.00 46.78  ? -19 LEU E CD1 1 
ATOM 4651 C CD2 . LEU D 2 7   ? 39.485 18.817  -29.809 1.00 45.12  ? -19 LEU E CD2 1 
ATOM 4652 N N   . PHE D 2 8   ? 39.415 18.874  -34.992 1.00 47.21  ? -18 PHE E N   1 
ATOM 4653 C CA  . PHE D 2 8   ? 38.939 19.393  -36.273 1.00 47.43  ? -18 PHE E CA  1 
ATOM 4654 C C   . PHE D 2 8   ? 38.601 20.891  -36.047 1.00 48.40  ? -18 PHE E C   1 
ATOM 4655 O O   . PHE D 2 8   ? 38.383 21.318  -34.905 1.00 47.85  ? -18 PHE E O   1 
ATOM 4656 C CB  . PHE D 2 8   ? 37.665 18.631  -36.754 1.00 47.38  ? -18 PHE E CB  1 
ATOM 4657 C CG  . PHE D 2 8   ? 37.906 17.213  -37.348 1.00 45.88  ? -18 PHE E CG  1 
ATOM 4658 C CD1 . PHE D 2 8   ? 37.646 16.068  -36.599 1.00 42.89  ? -18 PHE E CD1 1 
ATOM 4659 C CD2 . PHE D 2 8   ? 38.332 17.041  -38.669 1.00 43.75  ? -18 PHE E CD2 1 
ATOM 4660 C CE1 . PHE D 2 8   ? 37.855 14.789  -37.142 1.00 43.96  ? -18 PHE E CE1 1 
ATOM 4661 C CE2 . PHE D 2 8   ? 38.538 15.762  -39.215 1.00 42.34  ? -18 PHE E CE2 1 
ATOM 4662 C CZ  . PHE D 2 8   ? 38.311 14.634  -38.453 1.00 42.03  ? -18 PHE E CZ  1 
ATOM 4663 N N   . HIS D 2 9   ? 38.571 21.679  -37.125 1.00 50.03  ? -17 HIS E N   1 
ATOM 4664 C CA  . HIS D 2 9   ? 37.976 23.034  -37.119 1.00 51.51  ? -17 HIS E CA  1 
ATOM 4665 C C   . HIS D 2 9   ? 36.511 23.009  -37.064 1.00 51.25  ? -17 HIS E C   1 
ATOM 4666 O O   . HIS D 2 9   ? 35.889 22.206  -37.748 1.00 50.08  ? -17 HIS E O   1 
ATOM 4667 C CB  . HIS D 2 9   ? 38.125 23.755  -38.449 1.00 52.40  ? -17 HIS E CB  1 
ATOM 4668 C CG  . HIS D 2 9   ? 39.523 23.950  -38.883 1.00 55.51  ? -17 HIS E CG  1 
ATOM 4669 N ND1 . HIS D 2 9   ? 39.853 24.170  -40.202 1.00 58.50  ? -17 HIS E ND1 1 
ATOM 4670 C CD2 . HIS D 2 9   ? 40.683 23.944  -38.191 1.00 59.07  ? -17 HIS E CD2 1 
ATOM 4671 C CE1 . HIS D 2 9   ? 41.161 24.309  -40.303 1.00 60.98  ? -17 HIS E CE1 1 
ATOM 4672 N NE2 . HIS D 2 9   ? 41.691 24.170  -39.099 1.00 62.72  ? -17 HIS E NE2 1 
ATOM 4673 N N   . THR D 2 10  ? 35.973 23.995  -36.356 1.00 52.54  ? -16 THR E N   1 
ATOM 4674 C CA  . THR D 2 10  ? 34.576 24.392  -36.514 1.00 53.97  ? -16 THR E CA  1 
ATOM 4675 C C   . THR D 2 10  ? 34.467 25.353  -37.667 1.00 54.93  ? -16 THR E C   1 
ATOM 4676 O O   . THR D 2 10  ? 34.800 26.522  -37.549 1.00 54.58  ? -16 THR E O   1 
ATOM 4677 C CB  . THR D 2 10  ? 34.002 25.097  -35.291 1.00 53.66  ? -16 THR E CB  1 
ATOM 4678 O OG1 . THR D 2 10  ? 34.947 26.062  -34.808 1.00 54.51  ? -16 THR E OG1 1 
ATOM 4679 C CG2 . THR D 2 10  ? 33.671 24.103  -34.215 1.00 54.19  ? -16 THR E CG2 1 
ATOM 4680 N N   . ILE D 2 11  ? 33.991 24.830  -38.784 1.00 56.66  ? -15 ILE E N   1 
ATOM 4681 C CA  . ILE D 2 11  ? 33.685 25.614  -39.952 1.00 58.30  ? -15 ILE E CA  1 
ATOM 4682 C C   . ILE D 2 11  ? 32.614 26.657  -39.596 1.00 60.22  ? -15 ILE E C   1 
ATOM 4683 O O   . ILE D 2 11  ? 31.664 26.363  -38.850 1.00 60.74  ? -15 ILE E O   1 
ATOM 4684 C CB  . ILE D 2 11  ? 33.238 24.678  -41.098 1.00 58.07  ? -15 ILE E CB  1 
ATOM 4685 C CG1 . ILE D 2 11  ? 34.427 23.880  -41.656 1.00 55.42  ? -15 ILE E CG1 1 
ATOM 4686 C CG2 . ILE D 2 11  ? 32.509 25.453  -42.207 1.00 58.81  ? -15 ILE E CG2 1 
ATOM 4687 C CD1 . ILE D 2 11  ? 33.971 22.750  -42.532 1.00 51.99  ? -15 ILE E CD1 1 
ATOM 4688 N N   . THR D 2 12  ? 32.799 27.874  -40.114 1.00 62.42  ? -14 THR E N   1 
ATOM 4689 C CA  . THR D 2 12  ? 31.894 29.004  -39.877 1.00 64.36  ? -14 THR E CA  1 
ATOM 4690 C C   . THR D 2 12  ? 30.919 29.180  -41.076 1.00 66.08  ? -14 THR E C   1 
ATOM 4691 O O   . THR D 2 12  ? 31.267 28.871  -42.212 1.00 65.86  ? -14 THR E O   1 
ATOM 4692 C CB  . THR D 2 12  ? 32.706 30.329  -39.610 1.00 64.26  ? -14 THR E CB  1 
ATOM 4693 O OG1 . THR D 2 12  ? 33.673 30.510  -40.640 1.00 64.27  ? -14 THR E OG1 1 
ATOM 4694 C CG2 . THR D 2 12  ? 33.456 30.328  -38.257 1.00 63.78  ? -14 THR E CG2 1 
ATOM 4695 N N   . GLY D 2 13  ? 29.705 29.674  -40.821 1.00 68.26  ? -13 GLY E N   1 
ATOM 4696 C CA  . GLY D 2 13  ? 28.736 29.951  -41.894 1.00 70.75  ? -13 GLY E CA  1 
ATOM 4697 C C   . GLY D 2 13  ? 27.299 29.778  -41.421 1.00 73.08  ? -13 GLY E C   1 
ATOM 4698 O O   . GLY D 2 13  ? 26.417 30.601  -41.734 1.00 73.32  ? -13 GLY E O   1 
ATOM 4699 N N   . GLY D 2 14  ? 27.059 28.697  -40.670 1.00 74.80  ? -12 GLY E N   1 
ATOM 4700 C CA  . GLY D 2 14  ? 25.774 28.454  -39.999 1.00 76.74  ? -12 GLY E CA  1 
ATOM 4701 C C   . GLY D 2 14  ? 25.636 29.364  -38.783 1.00 78.18  ? -12 GLY E C   1 
ATOM 4702 O O   . GLY D 2 14  ? 25.504 28.885  -37.639 1.00 78.59  ? -12 GLY E O   1 
ATOM 4703 N N   . SER D 2 15  ? 25.686 30.678  -39.047 1.00 78.98  ? -11 SER E N   1 
ATOM 4704 C CA  . SER D 2 15  ? 25.550 31.739  -38.037 1.00 79.71  ? -11 SER E CA  1 
ATOM 4705 C C   . SER D 2 15  ? 24.065 32.139  -37.880 1.00 79.81  ? -11 SER E C   1 
ATOM 4706 O O   . SER D 2 15  ? 23.152 31.370  -38.236 1.00 79.76  ? -11 SER E O   1 
ATOM 4707 C CB  . SER D 2 15  ? 26.436 32.955  -38.426 1.00 80.06  ? -11 SER E CB  1 
ATOM 4708 O OG  . SER D 2 15  ? 26.580 33.924  -37.383 1.00 80.18  ? -11 SER E OG  1 
ATOM 4709 N N   . SER D 2 26  ? 12.513 7.913   -49.474 1.00 68.52  ? 3   SER E N   1 
ATOM 4710 C CA  . SER D 2 26  ? 13.509 7.478   -48.430 1.00 66.25  ? 3   SER E CA  1 
ATOM 4711 C C   . SER D 2 26  ? 13.521 8.461   -47.254 1.00 65.54  ? 3   SER E C   1 
ATOM 4712 O O   . SER D 2 26  ? 13.236 9.634   -47.452 1.00 66.43  ? 3   SER E O   1 
ATOM 4713 C CB  . SER D 2 26  ? 14.922 7.324   -49.064 1.00 63.75  ? 3   SER E CB  1 
ATOM 4714 O OG  . SER D 2 26  ? 14.898 6.234   -50.010 1.00 65.57  ? 3   SER E OG  1 
ATOM 4715 N N   . PRO D 2 27  ? 13.888 7.996   -46.032 1.00 64.43  ? 4   PRO E N   1 
ATOM 4716 C CA  . PRO D 2 27  ? 13.884 8.923   -44.865 1.00 63.49  ? 4   PRO E CA  1 
ATOM 4717 C C   . PRO D 2 27  ? 14.999 10.043  -44.909 1.00 60.41  ? 4   PRO E C   1 
ATOM 4718 O O   . PRO D 2 27  ? 15.967 9.938   -45.677 1.00 58.70  ? 4   PRO E O   1 
ATOM 4719 C CB  . PRO D 2 27  ? 14.166 7.951   -43.660 1.00 63.09  ? 4   PRO E CB  1 
ATOM 4720 C CG  . PRO D 2 27  ? 14.183 6.492   -44.276 1.00 63.85  ? 4   PRO E CG  1 
ATOM 4721 C CD  . PRO D 2 27  ? 14.489 6.670   -45.717 1.00 63.57  ? 4   PRO E CD  1 
ATOM 4722 N N   . GLU D 2 28  ? 14.850 11.086  -44.083 1.00 59.41  ? 5   GLU E N   1 
ATOM 4723 C CA  . GLU D 2 28  ? 15.736 12.263  -44.082 1.00 57.05  ? 5   GLU E CA  1 
ATOM 4724 C C   . GLU D 2 28  ? 17.096 12.051  -43.372 1.00 53.90  ? 5   GLU E C   1 
ATOM 4725 O O   . GLU D 2 28  ? 17.188 12.002  -42.139 1.00 53.55  ? 5   GLU E O   1 
ATOM 4726 C CB  . GLU D 2 28  ? 14.997 13.470  -43.465 1.00 58.92  ? 5   GLU E CB  1 
ATOM 4727 C CG  . GLU D 2 28  ? 15.622 14.849  -43.717 1.00 58.87  ? 5   GLU E CG  1 
ATOM 4728 C CD  . GLU D 2 28  ? 14.630 15.992  -43.535 1.00 62.82  ? 5   GLU E CD  1 
ATOM 4729 O OE1 . GLU D 2 28  ? 15.030 17.083  -43.038 1.00 62.89  ? 5   GLU E OE1 1 
ATOM 4730 O OE2 . GLU D 2 28  ? 13.446 15.806  -43.898 1.00 65.70  ? 5   GLU E OE2 1 
ATOM 4731 N N   . ASN D 2 29  ? 18.163 11.972  -44.151 1.00 50.97  ? 6   ASN E N   1 
ATOM 4732 C CA  . ASN D 2 29  ? 19.474 11.796  -43.572 1.00 48.02  ? 6   ASN E CA  1 
ATOM 4733 C C   . ASN D 2 29  ? 20.549 12.707  -44.200 1.00 46.53  ? 6   ASN E C   1 
ATOM 4734 O O   . ASN D 2 29  ? 20.621 12.835  -45.420 1.00 46.43  ? 6   ASN E O   1 
ATOM 4735 C CB  . ASN D 2 29  ? 19.829 10.313  -43.659 1.00 47.06  ? 6   ASN E CB  1 
ATOM 4736 C CG  . ASN D 2 29  ? 21.064 9.945   -42.872 1.00 43.06  ? 6   ASN E CG  1 
ATOM 4737 O OD1 . ASN D 2 29  ? 22.048 9.508   -43.459 1.00 38.23  ? 6   ASN E OD1 1 
ATOM 4738 N ND2 . ASN D 2 29  ? 21.018 10.102  -41.544 1.00 40.31  ? 6   ASN E ND2 1 
ATOM 4739 N N   . TYR D 2 30  ? 21.350 13.366  -43.358 1.00 45.81  ? 7   TYR E N   1 
ATOM 4740 C CA  . TYR D 2 30  ? 22.544 14.142  -43.817 1.00 44.64  ? 7   TYR E CA  1 
ATOM 4741 C C   . TYR D 2 30  ? 23.785 13.741  -43.035 1.00 43.13  ? 7   TYR E C   1 
ATOM 4742 O O   . TYR D 2 30  ? 23.667 13.280  -41.916 1.00 44.12  ? 7   TYR E O   1 
ATOM 4743 C CB  . TYR D 2 30  ? 22.326 15.647  -43.650 1.00 44.93  ? 7   TYR E CB  1 
ATOM 4744 C CG  . TYR D 2 30  ? 20.966 16.129  -44.076 1.00 45.96  ? 7   TYR E CG  1 
ATOM 4745 C CD1 . TYR D 2 30  ? 19.981 16.402  -43.131 1.00 46.66  ? 7   TYR E CD1 1 
ATOM 4746 C CD2 . TYR D 2 30  ? 20.663 16.313  -45.420 1.00 46.25  ? 7   TYR E CD2 1 
ATOM 4747 C CE1 . TYR D 2 30  ? 18.728 16.838  -43.508 1.00 49.38  ? 7   TYR E CE1 1 
ATOM 4748 C CE2 . TYR D 2 30  ? 19.412 16.756  -45.815 1.00 49.00  ? 7   TYR E CE2 1 
ATOM 4749 C CZ  . TYR D 2 30  ? 18.436 17.018  -44.857 1.00 51.37  ? 7   TYR E CZ  1 
ATOM 4750 O OH  . TYR D 2 30  ? 17.179 17.482  -45.246 1.00 53.65  ? 7   TYR E OH  1 
ATOM 4751 N N   . LEU D 2 31  ? 24.980 13.913  -43.587 1.00 42.56  ? 8   LEU E N   1 
ATOM 4752 C CA  . LEU D 2 31  ? 26.173 13.382  -42.905 1.00 41.22  ? 8   LEU E CA  1 
ATOM 4753 C C   . LEU D 2 31  ? 27.450 14.194  -43.084 1.00 40.66  ? 8   LEU E C   1 
ATOM 4754 O O   . LEU D 2 31  ? 27.719 14.754  -44.151 1.00 40.55  ? 8   LEU E O   1 
ATOM 4755 C CB  . LEU D 2 31  ? 26.402 11.907  -43.285 1.00 40.17  ? 8   LEU E CB  1 
ATOM 4756 C CG  . LEU D 2 31  ? 27.706 11.168  -42.927 1.00 38.64  ? 8   LEU E CG  1 
ATOM 4757 C CD1 . LEU D 2 31  ? 27.549 9.673   -43.008 1.00 36.17  ? 8   LEU E CD1 1 
ATOM 4758 C CD2 . LEU D 2 31  ? 28.826 11.582  -43.839 1.00 36.26  ? 8   LEU E CD2 1 
ATOM 4759 N N   . PHE D 2 32  ? 28.254 14.207  -42.026 1.00 40.72  ? 9   PHE E N   1 
ATOM 4760 C CA  . PHE D 2 32  ? 29.585 14.777  -42.081 1.00 40.54  ? 9   PHE E CA  1 
ATOM 4761 C C   . PHE D 2 32  ? 30.640 13.748  -41.702 1.00 39.68  ? 9   PHE E C   1 
ATOM 4762 O O   . PHE D 2 32  ? 30.462 13.080  -40.701 1.00 40.14  ? 9   PHE E O   1 
ATOM 4763 C CB  . PHE D 2 32  ? 29.659 15.955  -41.123 1.00 41.16  ? 9   PHE E CB  1 
ATOM 4764 C CG  . PHE D 2 32  ? 30.692 16.927  -41.479 1.00 39.65  ? 9   PHE E CG  1 
ATOM 4765 C CD1 . PHE D 2 32  ? 30.452 17.863  -42.458 1.00 41.32  ? 9   PHE E CD1 1 
ATOM 4766 C CD2 . PHE D 2 32  ? 31.917 16.892  -40.859 1.00 39.63  ? 9   PHE E CD2 1 
ATOM 4767 C CE1 . PHE D 2 32  ? 31.431 18.804  -42.817 1.00 44.00  ? 9   PHE E CE1 1 
ATOM 4768 C CE2 . PHE D 2 32  ? 32.913 17.809  -41.198 1.00 42.00  ? 9   PHE E CE2 1 
ATOM 4769 C CZ  . PHE D 2 32  ? 32.669 18.782  -42.185 1.00 42.79  ? 9   PHE E CZ  1 
ATOM 4770 N N   . GLN D 2 33  ? 31.714 13.616  -42.496 1.00 38.98  ? 10  GLN E N   1 
ATOM 4771 C CA  . GLN D 2 33  ? 32.902 12.808  -42.110 1.00 38.59  ? 10  GLN E CA  1 
ATOM 4772 C C   . GLN D 2 33  ? 34.184 13.634  -42.204 1.00 38.00  ? 10  GLN E C   1 
ATOM 4773 O O   . GLN D 2 33  ? 34.261 14.565  -42.970 1.00 38.28  ? 10  GLN E O   1 
ATOM 4774 C CB  . GLN D 2 33  ? 33.130 11.592  -43.019 1.00 37.85  ? 10  GLN E CB  1 
ATOM 4775 C CG  . GLN D 2 33  ? 31.928 11.030  -43.719 1.00 40.73  ? 10  GLN E CG  1 
ATOM 4776 C CD  . GLN D 2 33  ? 32.281 10.251  -44.990 1.00 41.29  ? 10  GLN E CD  1 
ATOM 4777 O OE1 . GLN D 2 33  ? 33.134 9.354   -44.964 1.00 39.67  ? 10  GLN E OE1 1 
ATOM 4778 N NE2 . GLN D 2 33  ? 31.607 10.586  -46.108 1.00 41.20  ? 10  GLN E NE2 1 
ATOM 4779 N N   . GLY D 2 34  ? 35.210 13.255  -41.467 1.00 37.52  ? 11  GLY E N   1 
ATOM 4780 C CA  . GLY D 2 34  ? 36.486 13.920  -41.597 1.00 37.71  ? 11  GLY E CA  1 
ATOM 4781 C C   . GLY D 2 34  ? 37.587 12.883  -41.637 1.00 37.42  ? 11  GLY E C   1 
ATOM 4782 O O   . GLY D 2 34  ? 37.335 11.712  -41.331 1.00 37.45  ? 11  GLY E O   1 
ATOM 4783 N N   . ARG D 2 35  ? 38.790 13.295  -42.038 1.00 36.82  ? 12  ARG E N   1 
ATOM 4784 C CA  . ARG D 2 35  ? 39.962 12.431  -41.919 1.00 36.52  ? 12  ARG E CA  1 
ATOM 4785 C C   . ARG D 2 35  ? 41.096 13.242  -41.344 1.00 36.41  ? 12  ARG E C   1 
ATOM 4786 O O   . ARG D 2 35  ? 41.290 14.407  -41.696 1.00 36.44  ? 12  ARG E O   1 
ATOM 4787 C CB  . ARG D 2 35  ? 40.422 11.830  -43.264 1.00 36.05  ? 12  ARG E CB  1 
ATOM 4788 C CG  . ARG D 2 35  ? 39.381 11.005  -44.033 1.00 36.04  ? 12  ARG E CG  1 
ATOM 4789 C CD  . ARG D 2 35  ? 39.120 9.604   -43.449 1.00 39.60  ? 12  ARG E CD  1 
ATOM 4790 N NE  . ARG D 2 35  ? 37.672 9.385   -43.411 1.00 44.52  ? 12  ARG E NE  1 
ATOM 4791 C CZ  . ARG D 2 35  ? 36.976 8.631   -44.249 1.00 43.25  ? 12  ARG E CZ  1 
ATOM 4792 N NH1 . ARG D 2 35  ? 37.567 7.915   -45.190 1.00 45.40  ? 12  ARG E NH1 1 
ATOM 4793 N NH2 . ARG D 2 35  ? 35.678 8.597   -44.127 1.00 43.82  ? 12  ARG E NH2 1 
ATOM 4794 N N   . GLN D 2 36  ? 41.824 12.607  -40.444 1.00 36.02  ? 13  GLN E N   1 
ATOM 4795 C CA  . GLN D 2 36  ? 43.145 13.070  -40.034 1.00 36.63  ? 13  GLN E CA  1 
ATOM 4796 C C   . GLN D 2 36  ? 44.144 11.968  -40.430 1.00 35.88  ? 13  GLN E C   1 
ATOM 4797 O O   . GLN D 2 36  ? 44.277 10.971  -39.738 1.00 35.83  ? 13  GLN E O   1 
ATOM 4798 C CB  . GLN D 2 36  ? 43.137 13.399  -38.542 1.00 36.83  ? 13  GLN E CB  1 
ATOM 4799 C CG  . GLN D 2 36  ? 42.230 14.607  -38.272 1.00 38.71  ? 13  GLN E CG  1 
ATOM 4800 C CD  . GLN D 2 36  ? 41.669 14.734  -36.850 1.00 40.07  ? 13  GLN E CD  1 
ATOM 4801 O OE1 . GLN D 2 36  ? 41.493 13.748  -36.116 1.00 40.25  ? 13  GLN E OE1 1 
ATOM 4802 N NE2 . GLN D 2 36  ? 41.343 15.971  -36.477 1.00 39.73  ? 13  GLN E NE2 1 
ATOM 4803 N N   . GLU D 2 37  ? 44.782 12.127  -41.591 1.00 35.50  ? 14  GLU E N   1 
ATOM 4804 C CA  . GLU D 2 37  ? 45.622 11.072  -42.164 1.00 35.17  ? 14  GLU E CA  1 
ATOM 4805 C C   . GLU D 2 37  ? 47.124 11.340  -42.029 1.00 35.50  ? 14  GLU E C   1 
ATOM 4806 O O   . GLU D 2 37  ? 47.616 12.376  -42.452 1.00 35.51  ? 14  GLU E O   1 
ATOM 4807 C CB  . GLU D 2 37  ? 45.304 10.895  -43.620 1.00 34.58  ? 14  GLU E CB  1 
ATOM 4808 C CG  . GLU D 2 37  ? 43.932 10.369  -43.901 1.00 36.10  ? 14  GLU E CG  1 
ATOM 4809 C CD  . GLU D 2 37  ? 43.556 10.629  -45.346 1.00 37.86  ? 14  GLU E CD  1 
ATOM 4810 O OE1 . GLU D 2 37  ? 42.412 11.048  -45.597 1.00 42.10  ? 14  GLU E OE1 1 
ATOM 4811 O OE2 . GLU D 2 37  ? 44.417 10.463  -46.233 1.00 35.40  ? 14  GLU E OE2 1 
ATOM 4812 N N   . CYS D 2 38  ? 47.845 10.393  -41.441 1.00 35.56  ? 15  CYS E N   1 
ATOM 4813 C CA  . CYS D 2 38  ? 49.289 10.504  -41.339 1.00 36.73  ? 15  CYS E CA  1 
ATOM 4814 C C   . CYS D 2 38  ? 49.959 9.436   -42.161 1.00 36.42  ? 15  CYS E C   1 
ATOM 4815 O O   . CYS D 2 38  ? 49.778 8.251   -41.874 1.00 36.51  ? 15  CYS E O   1 
ATOM 4816 C CB  . CYS D 2 38  ? 49.729 10.329  -39.904 1.00 37.41  ? 15  CYS E CB  1 
ATOM 4817 S SG  . CYS D 2 38  ? 49.203 11.641  -38.845 1.00 40.02  ? 15  CYS E SG  1 
ATOM 4818 N N   . TYR D 2 39  ? 50.716 9.850   -43.179 1.00 36.46  ? 16  TYR E N   1 
ATOM 4819 C CA  . TYR D 2 39  ? 51.466 8.918   -44.012 1.00 36.42  ? 16  TYR E CA  1 
ATOM 4820 C C   . TYR D 2 39  ? 52.927 8.888   -43.617 1.00 37.55  ? 16  TYR E C   1 
ATOM 4821 O O   . TYR D 2 39  ? 53.580 9.940   -43.593 1.00 38.81  ? 16  TYR E O   1 
ATOM 4822 C CB  . TYR D 2 39  ? 51.392 9.342   -45.470 1.00 36.24  ? 16  TYR E CB  1 
ATOM 4823 C CG  . TYR D 2 39  ? 50.020 9.384   -46.030 1.00 35.58  ? 16  TYR E CG  1 
ATOM 4824 C CD1 . TYR D 2 39  ? 49.179 10.459  -45.761 1.00 37.47  ? 16  TYR E CD1 1 
ATOM 4825 C CD2 . TYR D 2 39  ? 49.550 8.358   -46.835 1.00 35.35  ? 16  TYR E CD2 1 
ATOM 4826 C CE1 . TYR D 2 39  ? 47.893 10.502  -46.257 1.00 37.70  ? 16  TYR E CE1 1 
ATOM 4827 C CE2 . TYR D 2 39  ? 48.273 8.395   -47.360 1.00 35.80  ? 16  TYR E CE2 1 
ATOM 4828 C CZ  . TYR D 2 39  ? 47.451 9.465   -47.065 1.00 37.07  ? 16  TYR E CZ  1 
ATOM 4829 O OH  . TYR D 2 39  ? 46.191 9.530   -47.577 1.00 38.63  ? 16  TYR E OH  1 
ATOM 4830 N N   . ALA D 2 40  ? 53.459 7.696   -43.355 1.00 37.41  ? 17  ALA E N   1 
ATOM 4831 C CA  . ALA D 2 40  ? 54.901 7.547   -43.054 1.00 38.37  ? 17  ALA E CA  1 
ATOM 4832 C C   . ALA D 2 40  ? 55.668 7.072   -44.292 1.00 39.10  ? 17  ALA E C   1 
ATOM 4833 O O   . ALA D 2 40  ? 55.307 6.046   -44.898 1.00 38.04  ? 17  ALA E O   1 
ATOM 4834 C CB  . ALA D 2 40  ? 55.082 6.594   -41.917 1.00 37.85  ? 17  ALA E CB  1 
ATOM 4835 N N   . PHE D 2 41  ? 56.723 7.799   -44.683 1.00 40.99  ? 18  PHE E N   1 
ATOM 4836 C CA  . PHE D 2 41  ? 57.339 7.514   -45.989 1.00 41.45  ? 18  PHE E CA  1 
ATOM 4837 C C   . PHE D 2 41  ? 58.906 7.452   -46.145 1.00 44.37  ? 18  PHE E C   1 
ATOM 4838 O O   . PHE D 2 41  ? 59.481 6.345   -46.044 1.00 45.74  ? 18  PHE E O   1 
ATOM 4839 C CB  . PHE D 2 41  ? 56.578 8.202   -47.146 1.00 39.88  ? 18  PHE E CB  1 
ATOM 4840 C CG  . PHE D 2 41  ? 57.050 7.780   -48.504 1.00 38.91  ? 18  PHE E CG  1 
ATOM 4841 C CD1 . PHE D 2 41  ? 57.231 6.427   -48.809 1.00 37.80  ? 18  PHE E CD1 1 
ATOM 4842 C CD2 . PHE D 2 41  ? 57.337 8.723   -49.481 1.00 38.38  ? 18  PHE E CD2 1 
ATOM 4843 C CE1 . PHE D 2 41  ? 57.696 6.020   -50.068 1.00 37.02  ? 18  PHE E CE1 1 
ATOM 4844 C CE2 . PHE D 2 41  ? 57.793 8.316   -50.744 1.00 38.78  ? 18  PHE E CE2 1 
ATOM 4845 C CZ  . PHE D 2 41  ? 57.960 6.967   -51.034 1.00 37.22  ? 18  PHE E CZ  1 
ATOM 4846 N N   . ASN D 2 42  ? 59.607 8.547   -46.461 1.00 45.61  ? 19  ASN E N   1 
ATOM 4847 C CA  . ASN D 2 42  ? 61.071 8.459   -46.325 1.00 47.97  ? 19  ASN E CA  1 
ATOM 4848 C C   . ASN D 2 42  ? 61.523 9.167   -45.077 1.00 48.98  ? 19  ASN E C   1 
ATOM 4849 O O   . ASN D 2 42  ? 61.774 10.368  -45.090 1.00 49.86  ? 19  ASN E O   1 
ATOM 4850 C CB  . ASN D 2 42  ? 61.928 8.784   -47.590 1.00 49.90  ? 19  ASN E CB  1 
ATOM 4851 C CG  . ASN D 2 42  ? 61.879 10.232  -48.013 1.00 51.48  ? 19  ASN E CG  1 
ATOM 4852 O OD1 . ASN D 2 42  ? 60.807 10.799  -48.115 1.00 54.95  ? 19  ASN E OD1 1 
ATOM 4853 N ND2 . ASN D 2 42  ? 63.035 10.824  -48.311 1.00 53.97  ? 19  ASN E ND2 1 
ATOM 4854 N N   . GLY D 2 43  ? 61.555 8.403   -43.987 1.00 48.71  ? 20  GLY E N   1 
ATOM 4855 C CA  . GLY D 2 43  ? 61.998 8.899   -42.680 1.00 50.33  ? 20  GLY E CA  1 
ATOM 4856 C C   . GLY D 2 43  ? 61.200 10.078  -42.177 1.00 49.55  ? 20  GLY E C   1 
ATOM 4857 O O   . GLY D 2 43  ? 61.622 10.777  -41.262 1.00 50.60  ? 20  GLY E O   1 
ATOM 4858 N N   . THR D 2 44  ? 60.042 10.286  -42.785 1.00 47.80  ? 21  THR E N   1 
ATOM 4859 C CA  . THR D 2 44  ? 59.229 11.461  -42.518 1.00 47.76  ? 21  THR E CA  1 
ATOM 4860 C C   . THR D 2 44  ? 57.691 11.241  -42.532 1.00 45.24  ? 21  THR E C   1 
ATOM 4861 O O   . THR D 2 44  ? 57.166 10.177  -42.886 1.00 43.63  ? 21  THR E O   1 
ATOM 4862 C CB  . THR D 2 44  ? 59.600 12.624  -43.486 1.00 49.18  ? 21  THR E CB  1 
ATOM 4863 O OG1 . THR D 2 44  ? 59.152 13.860  -42.920 1.00 50.52  ? 21  THR E OG1 1 
ATOM 4864 C CG2 . THR D 2 44  ? 58.989 12.425  -44.924 1.00 46.83  ? 21  THR E CG2 1 
ATOM 4865 N N   . GLN D 2 45  ? 56.986 12.292  -42.161 1.00 44.60  ? 22  GLN E N   1 
ATOM 4866 C CA  . GLN D 2 45  ? 55.565 12.204  -41.979 1.00 42.88  ? 22  GLN E CA  1 
ATOM 4867 C C   . GLN D 2 45  ? 54.829 13.247  -42.838 1.00 41.66  ? 22  GLN E C   1 
ATOM 4868 O O   . GLN D 2 45  ? 55.216 14.416  -42.907 1.00 42.65  ? 22  GLN E O   1 
ATOM 4869 C CB  . GLN D 2 45  ? 55.249 12.343  -40.490 1.00 42.86  ? 22  GLN E CB  1 
ATOM 4870 C CG  . GLN D 2 45  ? 54.106 11.472  -40.047 1.00 43.38  ? 22  GLN E CG  1 
ATOM 4871 C CD  . GLN D 2 45  ? 54.482 10.024  -39.817 1.00 43.57  ? 22  GLN E CD  1 
ATOM 4872 O OE1 . GLN D 2 45  ? 53.646 9.134   -39.968 1.00 46.05  ? 22  GLN E OE1 1 
ATOM 4873 N NE2 . GLN D 2 45  ? 55.714 9.780   -39.446 1.00 43.40  ? 22  GLN E NE2 1 
ATOM 4874 N N   . ARG D 2 46  ? 53.783 12.807  -43.512 1.00 39.61  ? 23  ARG E N   1 
ATOM 4875 C CA  . ARG D 2 46  ? 52.970 13.702  -44.320 1.00 39.00  ? 23  ARG E CA  1 
ATOM 4876 C C   . ARG D 2 46  ? 51.514 13.624  -43.830 1.00 37.65  ? 23  ARG E C   1 
ATOM 4877 O O   . ARG D 2 46  ? 50.957 12.527  -43.651 1.00 36.16  ? 23  ARG E O   1 
ATOM 4878 C CB  . ARG D 2 46  ? 53.087 13.302  -45.795 1.00 38.86  ? 23  ARG E CB  1 
ATOM 4879 C CG  . ARG D 2 46  ? 52.350 14.188  -46.727 1.00 37.98  ? 23  ARG E CG  1 
ATOM 4880 C CD  . ARG D 2 46  ? 52.441 13.691  -48.148 1.00 39.93  ? 23  ARG E CD  1 
ATOM 4881 N NE  . ARG D 2 46  ? 51.385 14.333  -48.931 1.00 40.89  ? 23  ARG E NE  1 
ATOM 4882 C CZ  . ARG D 2 46  ? 51.177 14.176  -50.235 1.00 39.34  ? 23  ARG E CZ  1 
ATOM 4883 N NH1 . ARG D 2 46  ? 51.978 13.401  -50.966 1.00 38.02  ? 23  ARG E NH1 1 
ATOM 4884 N NH2 . ARG D 2 46  ? 50.158 14.822  -50.800 1.00 36.02  ? 23  ARG E NH2 1 
ATOM 4885 N N   . PHE D 2 47  ? 50.914 14.794  -43.625 1.00 37.95  ? 24  PHE E N   1 
ATOM 4886 C CA  . PHE D 2 47  ? 49.594 14.927  -42.996 1.00 37.10  ? 24  PHE E CA  1 
ATOM 4887 C C   . PHE D 2 47  ? 48.448 15.429  -43.927 1.00 36.98  ? 24  PHE E C   1 
ATOM 4888 O O   . PHE D 2 47  ? 48.581 16.477  -44.580 1.00 37.61  ? 24  PHE E O   1 
ATOM 4889 C CB  . PHE D 2 47  ? 49.715 15.827  -41.756 1.00 37.07  ? 24  PHE E CB  1 
ATOM 4890 C CG  . PHE D 2 47  ? 48.402 16.105  -41.079 1.00 36.98  ? 24  PHE E CG  1 
ATOM 4891 C CD1 . PHE D 2 47  ? 47.652 15.071  -40.520 1.00 35.39  ? 24  PHE E CD1 1 
ATOM 4892 C CD2 . PHE D 2 47  ? 47.903 17.404  -41.004 1.00 38.63  ? 24  PHE E CD2 1 
ATOM 4893 C CE1 . PHE D 2 47  ? 46.429 15.320  -39.894 1.00 35.74  ? 24  PHE E CE1 1 
ATOM 4894 C CE2 . PHE D 2 47  ? 46.671 17.669  -40.376 1.00 36.25  ? 24  PHE E CE2 1 
ATOM 4895 C CZ  . PHE D 2 47  ? 45.936 16.618  -39.815 1.00 35.49  ? 24  PHE E CZ  1 
ATOM 4896 N N   . LEU D 2 48  ? 47.333 14.687  -43.986 1.00 36.36  ? 25  LEU E N   1 
ATOM 4897 C CA  . LEU D 2 48  ? 46.086 15.213  -44.598 1.00 36.67  ? 25  LEU E CA  1 
ATOM 4898 C C   . LEU D 2 48  ? 44.883 15.233  -43.660 1.00 37.01  ? 25  LEU E C   1 
ATOM 4899 O O   . LEU D 2 48  ? 44.562 14.232  -42.985 1.00 36.18  ? 25  LEU E O   1 
ATOM 4900 C CB  . LEU D 2 48  ? 45.693 14.514  -45.897 1.00 35.46  ? 25  LEU E CB  1 
ATOM 4901 C CG  . LEU D 2 48  ? 46.650 14.733  -47.070 1.00 37.87  ? 25  LEU E CG  1 
ATOM 4902 C CD1 . LEU D 2 48  ? 47.721 13.669  -47.077 1.00 37.90  ? 25  LEU E CD1 1 
ATOM 4903 C CD2 . LEU D 2 48  ? 45.911 14.680  -48.370 1.00 37.49  ? 25  LEU E CD2 1 
ATOM 4904 N N   . GLU D 2 49  ? 44.233 16.399  -43.633 1.00 37.77  ? 26  GLU E N   1 
ATOM 4905 C CA  . GLU D 2 49  ? 42.971 16.571  -42.946 1.00 37.97  ? 26  GLU E CA  1 
ATOM 4906 C C   . GLU D 2 49  ? 41.916 16.844  -44.002 1.00 37.68  ? 26  GLU E C   1 
ATOM 4907 O O   . GLU D 2 49  ? 42.085 17.754  -44.818 1.00 38.85  ? 26  GLU E O   1 
ATOM 4908 C CB  . GLU D 2 49  ? 43.028 17.728  -41.928 1.00 38.51  ? 26  GLU E CB  1 
ATOM 4909 C CG  . GLU D 2 49  ? 41.845 17.687  -40.951 1.00 40.38  ? 26  GLU E CG  1 
ATOM 4910 C CD  . GLU D 2 49  ? 42.037 18.496  -39.683 1.00 44.05  ? 26  GLU E CD  1 
ATOM 4911 O OE1 . GLU D 2 49  ? 41.927 19.746  -39.746 1.00 44.20  ? 26  GLU E OE1 1 
ATOM 4912 O OE2 . GLU D 2 49  ? 42.247 17.865  -38.614 1.00 45.05  ? 26  GLU E OE2 1 
ATOM 4913 N N   . ARG D 2 50  ? 40.831 16.070  -43.990 1.00 36.50  ? 27  ARG E N   1 
ATOM 4914 C CA  . ARG D 2 50  ? 39.778 16.239  -45.005 1.00 35.69  ? 27  ARG E CA  1 
ATOM 4915 C C   . ARG D 2 50  ? 38.440 16.549  -44.373 1.00 35.88  ? 27  ARG E C   1 
ATOM 4916 O O   . ARG D 2 50  ? 38.032 15.931  -43.394 1.00 36.10  ? 27  ARG E O   1 
ATOM 4917 C CB  . ARG D 2 50  ? 39.660 15.006  -45.905 1.00 34.20  ? 27  ARG E CB  1 
ATOM 4918 C CG  . ARG D 2 50  ? 40.961 14.287  -46.080 1.00 33.45  ? 27  ARG E CG  1 
ATOM 4919 C CD  . ARG D 2 50  ? 40.838 13.093  -46.955 1.00 31.91  ? 27  ARG E CD  1 
ATOM 4920 N NE  . ARG D 2 50  ? 41.367 13.380  -48.282 1.00 33.12  ? 27  ARG E NE  1 
ATOM 4921 C CZ  . ARG D 2 50  ? 42.389 12.742  -48.830 1.00 30.38  ? 27  ARG E CZ  1 
ATOM 4922 N NH1 . ARG D 2 50  ? 42.978 11.769  -48.160 1.00 25.64  ? 27  ARG E NH1 1 
ATOM 4923 N NH2 . ARG D 2 50  ? 42.802 13.079  -50.049 1.00 32.19  ? 27  ARG E NH2 1 
ATOM 4924 N N   . TYR D 2 51  ? 37.760 17.528  -44.930 1.00 36.22  ? 28  TYR E N   1 
ATOM 4925 C CA  . TYR D 2 51  ? 36.436 17.859  -44.470 1.00 35.92  ? 28  TYR E CA  1 
ATOM 4926 C C   . TYR D 2 51  ? 35.466 17.458  -45.579 1.00 35.90  ? 28  TYR E C   1 
ATOM 4927 O O   . TYR D 2 51  ? 35.600 17.894  -46.747 1.00 36.08  ? 28  TYR E O   1 
ATOM 4928 C CB  . TYR D 2 51  ? 36.367 19.354  -44.083 1.00 37.02  ? 28  TYR E CB  1 
ATOM 4929 C CG  . TYR D 2 51  ? 37.197 19.710  -42.855 1.00 35.97  ? 28  TYR E CG  1 
ATOM 4930 C CD1 . TYR D 2 51  ? 38.572 19.961  -42.974 1.00 37.32  ? 28  TYR E CD1 1 
ATOM 4931 C CD2 . TYR D 2 51  ? 36.617 19.807  -41.589 1.00 34.11  ? 28  TYR E CD2 1 
ATOM 4932 C CE1 . TYR D 2 51  ? 39.366 20.266  -41.861 1.00 35.89  ? 28  TYR E CE1 1 
ATOM 4933 C CE2 . TYR D 2 51  ? 37.398 20.122  -40.467 1.00 36.05  ? 28  TYR E CE2 1 
ATOM 4934 C CZ  . TYR D 2 51  ? 38.773 20.346  -40.616 1.00 36.14  ? 28  TYR E CZ  1 
ATOM 4935 O OH  . TYR D 2 51  ? 39.573 20.657  -39.540 1.00 35.89  ? 28  TYR E OH  1 
ATOM 4936 N N   . ILE D 2 52  ? 34.501 16.615  -45.210 1.00 35.40  ? 29  ILE E N   1 
ATOM 4937 C CA  . ILE D 2 52  ? 33.651 15.913  -46.177 1.00 35.42  ? 29  ILE E CA  1 
ATOM 4938 C C   . ILE D 2 52  ? 32.190 15.965  -45.780 1.00 36.65  ? 29  ILE E C   1 
ATOM 4939 O O   . ILE D 2 52  ? 31.826 15.644  -44.630 1.00 36.90  ? 29  ILE E O   1 
ATOM 4940 C CB  . ILE D 2 52  ? 34.043 14.431  -46.277 1.00 34.65  ? 29  ILE E CB  1 
ATOM 4941 C CG1 . ILE D 2 52  ? 35.544 14.269  -46.542 1.00 33.40  ? 29  ILE E CG1 1 
ATOM 4942 C CG2 . ILE D 2 52  ? 33.210 13.707  -47.355 1.00 36.41  ? 29  ILE E CG2 1 
ATOM 4943 C CD1 . ILE D 2 52  ? 36.154 13.121  -45.808 1.00 30.48  ? 29  ILE E CD1 1 
ATOM 4944 N N   . TYR D 2 53  ? 31.355 16.343  -46.744 1.00 37.68  ? 30  TYR E N   1 
ATOM 4945 C CA  . TYR D 2 53  ? 29.927 16.438  -46.555 1.00 39.15  ? 30  TYR E CA  1 
ATOM 4946 C C   . TYR D 2 53  ? 29.338 15.442  -47.514 1.00 39.68  ? 30  TYR E C   1 
ATOM 4947 O O   . TYR D 2 53  ? 29.649 15.525  -48.701 1.00 39.84  ? 30  TYR E O   1 
ATOM 4948 C CB  . TYR D 2 53  ? 29.434 17.843  -46.921 1.00 40.41  ? 30  TYR E CB  1 
ATOM 4949 C CG  . TYR D 2 53  ? 27.921 17.948  -46.867 1.00 42.53  ? 30  TYR E CG  1 
ATOM 4950 C CD1 . TYR D 2 53  ? 27.250 17.928  -45.639 1.00 43.14  ? 30  TYR E CD1 1 
ATOM 4951 C CD2 . TYR D 2 53  ? 27.159 18.043  -48.034 1.00 44.44  ? 30  TYR E CD2 1 
ATOM 4952 C CE1 . TYR D 2 53  ? 25.855 18.006  -45.565 1.00 45.91  ? 30  TYR E CE1 1 
ATOM 4953 C CE2 . TYR D 2 53  ? 25.739 18.123  -47.981 1.00 46.79  ? 30  TYR E CE2 1 
ATOM 4954 C CZ  . TYR D 2 53  ? 25.096 18.098  -46.738 1.00 47.61  ? 30  TYR E CZ  1 
ATOM 4955 O OH  . TYR D 2 53  ? 23.719 18.165  -46.646 1.00 46.11  ? 30  TYR E OH  1 
ATOM 4956 N N   . ASN D 2 54  ? 28.466 14.554  -47.016 1.00 40.14  ? 31  ASN E N   1 
ATOM 4957 C CA  . ASN D 2 54  ? 28.113 13.272  -47.681 1.00 40.82  ? 31  ASN E CA  1 
ATOM 4958 C C   . ASN D 2 54  ? 28.958 12.867  -48.913 1.00 40.50  ? 31  ASN E C   1 
ATOM 4959 O O   . ASN D 2 54  ? 28.621 13.311  -50.047 1.00 42.51  ? 31  ASN E O   1 
ATOM 4960 C CB  . ASN D 2 54  ? 26.652 13.208  -48.177 1.00 42.35  ? 31  ASN E CB  1 
ATOM 4961 C CG  . ASN D 2 54  ? 25.687 14.048  -47.389 1.00 44.59  ? 31  ASN E CG  1 
ATOM 4962 O OD1 . ASN D 2 54  ? 25.365 13.750  -46.242 1.00 44.78  ? 31  ASN E OD1 1 
ATOM 4963 N ND2 . ASN D 2 54  ? 25.137 15.066  -48.048 1.00 45.67  ? 31  ASN E ND2 1 
ATOM 4964 N N   . ARG D 2 55  ? 29.995 12.036  -48.764 1.00 38.00  ? 32  ARG E N   1 
ATOM 4965 C CA  . ARG D 2 55  ? 30.774 11.629  -49.977 1.00 37.47  ? 32  ARG E CA  1 
ATOM 4966 C C   . ARG D 2 55  ? 31.440 12.754  -50.777 1.00 38.35  ? 32  ARG E C   1 
ATOM 4967 O O   . ARG D 2 55  ? 32.209 12.499  -51.705 1.00 38.77  ? 32  ARG E O   1 
ATOM 4968 C CB  . ARG D 2 55  ? 29.886 10.897  -50.966 1.00 37.85  ? 32  ARG E CB  1 
ATOM 4969 C CG  . ARG D 2 55  ? 29.382 9.589   -50.490 1.00 37.56  ? 32  ARG E CG  1 
ATOM 4970 C CD  . ARG D 2 55  ? 30.295 8.576   -50.975 1.00 38.73  ? 32  ARG E CD  1 
ATOM 4971 N NE  . ARG D 2 55  ? 29.624 7.785   -51.972 1.00 42.09  ? 32  ARG E NE  1 
ATOM 4972 C CZ  . ARG D 2 55  ? 30.231 6.958   -52.812 1.00 42.98  ? 32  ARG E CZ  1 
ATOM 4973 N NH1 . ARG D 2 55  ? 31.569 6.842   -52.818 1.00 40.32  ? 32  ARG E NH1 1 
ATOM 4974 N NH2 . ARG D 2 55  ? 29.474 6.250   -53.646 1.00 43.18  ? 32  ARG E NH2 1 
ATOM 4975 N N   . GLU D 2 56  ? 31.116 13.995  -50.468 1.00 39.02  ? 33  GLU E N   1 
ATOM 4976 C CA  . GLU D 2 56  ? 31.736 15.065  -51.171 1.00 40.36  ? 33  GLU E CA  1 
ATOM 4977 C C   . GLU D 2 56  ? 32.755 15.749  -50.275 1.00 39.92  ? 33  GLU E C   1 
ATOM 4978 O O   . GLU D 2 56  ? 32.394 16.528  -49.384 1.00 40.33  ? 33  GLU E O   1 
ATOM 4979 C CB  . GLU D 2 56  ? 30.716 16.077  -51.679 1.00 41.89  ? 33  GLU E CB  1 
ATOM 4980 C CG  . GLU D 2 56  ? 31.342 16.915  -52.761 1.00 44.57  ? 33  GLU E CG  1 
ATOM 4981 C CD  . GLU D 2 56  ? 30.451 17.994  -53.274 1.00 49.60  ? 33  GLU E CD  1 
ATOM 4982 O OE1 . GLU D 2 56  ? 29.271 17.710  -53.596 1.00 53.77  ? 33  GLU E OE1 1 
ATOM 4983 O OE2 . GLU D 2 56  ? 30.940 19.131  -53.376 1.00 49.95  ? 33  GLU E OE2 1 
ATOM 4984 N N   . GLU D 2 57  ? 34.025 15.441  -50.514 1.00 39.24  ? 34  GLU E N   1 
ATOM 4985 C CA  . GLU D 2 57  ? 35.110 16.116  -49.841 1.00 39.09  ? 34  GLU E CA  1 
ATOM 4986 C C   . GLU D 2 57  ? 35.247 17.483  -50.481 1.00 39.63  ? 34  GLU E C   1 
ATOM 4987 O O   . GLU D 2 57  ? 35.436 17.592  -51.688 1.00 40.70  ? 34  GLU E O   1 
ATOM 4988 C CB  . GLU D 2 57  ? 36.389 15.317  -49.997 1.00 38.55  ? 34  GLU E CB  1 
ATOM 4989 C CG  . GLU D 2 57  ? 37.660 16.034  -49.529 1.00 40.06  ? 34  GLU E CG  1 
ATOM 4990 C CD  . GLU D 2 57  ? 38.879 15.352  -50.086 1.00 41.01  ? 34  GLU E CD  1 
ATOM 4991 O OE1 . GLU D 2 57  ? 39.950 15.385  -49.461 1.00 41.47  ? 34  GLU E OE1 1 
ATOM 4992 O OE2 . GLU D 2 57  ? 38.745 14.752  -51.166 1.00 43.56  ? 34  GLU E OE2 1 
ATOM 4993 N N   . PHE D 2 58  ? 35.127 18.529  -49.682 1.00 39.34  ? 35  PHE E N   1 
ATOM 4994 C CA  . PHE D 2 58  ? 34.994 19.863  -50.268 1.00 40.00  ? 35  PHE E CA  1 
ATOM 4995 C C   . PHE D 2 58  ? 36.117 20.819  -49.924 1.00 39.56  ? 35  PHE E C   1 
ATOM 4996 O O   . PHE D 2 58  ? 36.272 21.816  -50.624 1.00 40.91  ? 35  PHE E O   1 
ATOM 4997 C CB  . PHE D 2 58  ? 33.648 20.488  -49.915 1.00 40.63  ? 35  PHE E CB  1 
ATOM 4998 C CG  . PHE D 2 58  ? 33.439 20.689  -48.442 1.00 39.36  ? 35  PHE E CG  1 
ATOM 4999 C CD1 . PHE D 2 58  ? 33.716 21.927  -47.845 1.00 37.36  ? 35  PHE E CD1 1 
ATOM 5000 C CD2 . PHE D 2 58  ? 32.962 19.647  -47.646 1.00 37.23  ? 35  PHE E CD2 1 
ATOM 5001 C CE1 . PHE D 2 58  ? 33.513 22.128  -46.475 1.00 35.64  ? 35  PHE E CE1 1 
ATOM 5002 C CE2 . PHE D 2 58  ? 32.753 19.834  -46.270 1.00 37.27  ? 35  PHE E CE2 1 
ATOM 5003 C CZ  . PHE D 2 58  ? 33.030 21.086  -45.685 1.00 37.04  ? 35  PHE E CZ  1 
ATOM 5004 N N   . VAL D 2 59  ? 36.859 20.523  -48.851 1.00 38.06  ? 36  VAL E N   1 
ATOM 5005 C CA  . VAL D 2 59  ? 38.109 21.222  -48.497 1.00 38.15  ? 36  VAL E CA  1 
ATOM 5006 C C   . VAL D 2 59  ? 39.124 20.325  -47.751 1.00 37.31  ? 36  VAL E C   1 
ATOM 5007 O O   . VAL D 2 59  ? 38.763 19.322  -47.178 1.00 36.38  ? 36  VAL E O   1 
ATOM 5008 C CB  . VAL D 2 59  ? 37.860 22.579  -47.758 1.00 38.73  ? 36  VAL E CB  1 
ATOM 5009 C CG1 . VAL D 2 59  ? 37.311 22.370  -46.348 1.00 38.07  ? 36  VAL E CG1 1 
ATOM 5010 C CG2 . VAL D 2 59  ? 39.132 23.404  -47.704 1.00 39.04  ? 36  VAL E CG2 1 
ATOM 5011 N N   . ARG D 2 60  ? 40.393 20.710  -47.745 1.00 38.45  ? 37  ARG E N   1 
ATOM 5012 C CA  . ARG D 2 60  ? 41.467 19.774  -47.430 1.00 39.08  ? 37  ARG E CA  1 
ATOM 5013 C C   . ARG D 2 60  ? 42.770 20.500  -47.071 1.00 39.96  ? 37  ARG E C   1 
ATOM 5014 O O   . ARG D 2 60  ? 43.165 21.462  -47.763 1.00 42.20  ? 37  ARG E O   1 
ATOM 5015 C CB  . ARG D 2 60  ? 41.691 18.821  -48.629 1.00 39.16  ? 37  ARG E CB  1 
ATOM 5016 C CG  . ARG D 2 60  ? 42.947 17.953  -48.567 1.00 39.53  ? 37  ARG E CG  1 
ATOM 5017 C CD  . ARG D 2 60  ? 43.438 17.556  -49.963 1.00 40.79  ? 37  ARG E CD  1 
ATOM 5018 N NE  . ARG D 2 60  ? 42.493 16.659  -50.642 1.00 42.97  ? 37  ARG E NE  1 
ATOM 5019 C CZ  . ARG D 2 60  ? 42.343 16.576  -51.965 1.00 42.80  ? 37  ARG E CZ  1 
ATOM 5020 N NH1 . ARG D 2 60  ? 43.077 17.334  -52.766 1.00 43.29  ? 37  ARG E NH1 1 
ATOM 5021 N NH2 . ARG D 2 60  ? 41.451 15.747  -52.490 1.00 39.22  ? 37  ARG E NH2 1 
ATOM 5022 N N   . PHE D 2 61  ? 43.414 20.071  -45.983 1.00 38.81  ? 38  PHE E N   1 
ATOM 5023 C CA  . PHE D 2 61  ? 44.778 20.506  -45.692 1.00 39.33  ? 38  PHE E CA  1 
ATOM 5024 C C   . PHE D 2 61  ? 45.764 19.402  -46.047 1.00 38.83  ? 38  PHE E C   1 
ATOM 5025 O O   . PHE D 2 61  ? 45.618 18.255  -45.604 1.00 38.10  ? 38  PHE E O   1 
ATOM 5026 C CB  . PHE D 2 61  ? 44.976 20.871  -44.221 1.00 39.33  ? 38  PHE E CB  1 
ATOM 5027 C CG  . PHE D 2 61  ? 46.369 21.357  -43.909 1.00 39.94  ? 38  PHE E CG  1 
ATOM 5028 C CD1 . PHE D 2 61  ? 46.725 22.695  -44.128 1.00 40.30  ? 38  PHE E CD1 1 
ATOM 5029 C CD2 . PHE D 2 61  ? 47.335 20.484  -43.426 1.00 40.44  ? 38  PHE E CD2 1 
ATOM 5030 C CE1 . PHE D 2 61  ? 48.006 23.155  -43.855 1.00 39.78  ? 38  PHE E CE1 1 
ATOM 5031 C CE2 . PHE D 2 61  ? 48.641 20.949  -43.154 1.00 41.36  ? 38  PHE E CE2 1 
ATOM 5032 C CZ  . PHE D 2 61  ? 48.962 22.288  -43.365 1.00 40.56  ? 38  PHE E CZ  1 
ATOM 5033 N N   . ASP D 2 62  ? 46.762 19.750  -46.843 1.00 39.30  ? 39  ASP E N   1 
ATOM 5034 C CA  . ASP D 2 62  ? 47.795 18.808  -47.194 1.00 39.58  ? 39  ASP E CA  1 
ATOM 5035 C C   . ASP D 2 62  ? 49.130 19.452  -46.851 1.00 41.20  ? 39  ASP E C   1 
ATOM 5036 O O   . ASP D 2 62  ? 49.463 20.549  -47.339 1.00 42.54  ? 39  ASP E O   1 
ATOM 5037 C CB  . ASP D 2 62  ? 47.691 18.428  -48.670 1.00 39.51  ? 39  ASP E CB  1 
ATOM 5038 C CG  . ASP D 2 62  ? 48.775 17.478  -49.109 1.00 40.78  ? 39  ASP E CG  1 
ATOM 5039 O OD1 . ASP D 2 62  ? 49.836 17.397  -48.447 1.00 41.74  ? 39  ASP E OD1 1 
ATOM 5040 O OD2 . ASP D 2 62  ? 48.570 16.817  -50.142 1.00 40.91  ? 39  ASP E OD2 1 
ATOM 5041 N N   . SER D 2 63  ? 49.892 18.777  -45.996 1.00 41.24  ? 40  SER E N   1 
ATOM 5042 C CA  . SER D 2 63  ? 51.090 19.383  -45.468 1.00 43.01  ? 40  SER E CA  1 
ATOM 5043 C C   . SER D 2 63  ? 52.149 19.545  -46.569 1.00 44.62  ? 40  SER E C   1 
ATOM 5044 O O   . SER D 2 63  ? 52.950 20.471  -46.501 1.00 45.74  ? 40  SER E O   1 
ATOM 5045 C CB  . SER D 2 63  ? 51.588 18.677  -44.195 1.00 42.45  ? 40  SER E CB  1 
ATOM 5046 O OG  . SER D 2 63  ? 52.585 17.724  -44.453 1.00 42.98  ? 40  SER E OG  1 
ATOM 5047 N N   . ASP D 2 64  ? 52.101 18.699  -47.603 1.00 44.56  ? 41  ASP E N   1 
ATOM 5048 C CA  . ASP D 2 64  ? 52.859 18.958  -48.846 1.00 46.39  ? 41  ASP E CA  1 
ATOM 5049 C C   . ASP D 2 64  ? 52.407 20.236  -49.550 1.00 46.82  ? 41  ASP E C   1 
ATOM 5050 O O   . ASP D 2 64  ? 53.246 20.981  -50.029 1.00 48.23  ? 41  ASP E O   1 
ATOM 5051 C CB  . ASP D 2 64  ? 52.831 17.770  -49.826 1.00 46.18  ? 41  ASP E CB  1 
ATOM 5052 C CG  . ASP D 2 64  ? 53.910 16.718  -49.517 1.00 48.69  ? 41  ASP E CG  1 
ATOM 5053 O OD1 . ASP D 2 64  ? 54.301 15.950  -50.437 1.00 48.74  ? 41  ASP E OD1 1 
ATOM 5054 O OD2 . ASP D 2 64  ? 54.369 16.665  -48.344 1.00 52.25  ? 41  ASP E OD2 1 
ATOM 5055 N N   . VAL D 2 65  ? 51.099 20.494  -49.598 1.00 45.61  ? 42  VAL E N   1 
ATOM 5056 C CA  . VAL D 2 65  ? 50.599 21.759  -50.165 1.00 46.66  ? 42  VAL E CA  1 
ATOM 5057 C C   . VAL D 2 65  ? 50.888 22.984  -49.285 1.00 47.55  ? 42  VAL E C   1 
ATOM 5058 O O   . VAL D 2 65  ? 51.121 24.075  -49.808 1.00 49.02  ? 42  VAL E O   1 
ATOM 5059 C CB  . VAL D 2 65  ? 49.083 21.712  -50.552 1.00 45.78  ? 42  VAL E CB  1 
ATOM 5060 C CG1 . VAL D 2 65  ? 48.529 23.127  -50.798 1.00 46.51  ? 42  VAL E CG1 1 
ATOM 5061 C CG2 . VAL D 2 65  ? 48.881 20.873  -51.794 1.00 45.50  ? 42  VAL E CG2 1 
ATOM 5062 N N   . GLY D 2 66  ? 50.865 22.811  -47.964 1.00 46.73  ? 43  GLY E N   1 
ATOM 5063 C CA  . GLY D 2 66  ? 51.200 23.910  -47.054 1.00 47.20  ? 43  GLY E CA  1 
ATOM 5064 C C   . GLY D 2 66  ? 50.025 24.731  -46.554 1.00 47.17  ? 43  GLY E C   1 
ATOM 5065 O O   . GLY D 2 66  ? 50.105 25.366  -45.507 1.00 47.42  ? 43  GLY E O   1 
ATOM 5066 N N   . GLU D 2 67  ? 48.918 24.717  -47.291 1.00 46.96  ? 44  GLU E N   1 
ATOM 5067 C CA  . GLU D 2 67  ? 47.753 25.536  -46.942 1.00 47.36  ? 44  GLU E CA  1 
ATOM 5068 C C   . GLU D 2 67  ? 46.475 24.870  -47.423 1.00 45.64  ? 44  GLU E C   1 
ATOM 5069 O O   . GLU D 2 67  ? 46.547 23.836  -48.070 1.00 45.41  ? 44  GLU E O   1 
ATOM 5070 C CB  . GLU D 2 67  ? 47.895 26.973  -47.495 1.00 49.42  ? 44  GLU E CB  1 
ATOM 5071 C CG  . GLU D 2 67  ? 48.423 27.076  -48.935 1.00 52.28  ? 44  GLU E CG  1 
ATOM 5072 C CD  . GLU D 2 67  ? 48.122 28.419  -49.582 1.00 56.99  ? 44  GLU E CD  1 
ATOM 5073 O OE1 . GLU D 2 67  ? 47.267 28.441  -50.494 1.00 57.39  ? 44  GLU E OE1 1 
ATOM 5074 O OE2 . GLU D 2 67  ? 48.728 29.449  -49.184 1.00 59.66  ? 44  GLU E OE2 1 
ATOM 5075 N N   . PHE D 2 68  ? 45.314 25.455  -47.116 1.00 45.12  ? 45  PHE E N   1 
ATOM 5076 C CA  . PHE D 2 68  ? 44.034 24.851  -47.485 1.00 43.86  ? 45  PHE E CA  1 
ATOM 5077 C C   . PHE D 2 68  ? 43.684 24.949  -48.949 1.00 44.87  ? 45  PHE E C   1 
ATOM 5078 O O   . PHE D 2 68  ? 44.163 25.829  -49.663 1.00 46.55  ? 45  PHE E O   1 
ATOM 5079 C CB  . PHE D 2 68  ? 42.912 25.470  -46.681 1.00 43.81  ? 45  PHE E CB  1 
ATOM 5080 C CG  . PHE D 2 68  ? 42.948 25.107  -45.244 1.00 41.61  ? 45  PHE E CG  1 
ATOM 5081 C CD1 . PHE D 2 68  ? 42.220 24.029  -44.775 1.00 39.53  ? 45  PHE E CD1 1 
ATOM 5082 C CD2 . PHE D 2 68  ? 43.723 25.823  -44.363 1.00 41.52  ? 45  PHE E CD2 1 
ATOM 5083 C CE1 . PHE D 2 68  ? 42.255 23.668  -43.442 1.00 38.52  ? 45  PHE E CE1 1 
ATOM 5084 C CE2 . PHE D 2 68  ? 43.760 25.480  -43.027 1.00 41.98  ? 45  PHE E CE2 1 
ATOM 5085 C CZ  . PHE D 2 68  ? 43.030 24.392  -42.568 1.00 39.40  ? 45  PHE E CZ  1 
ATOM 5086 N N   . ARG D 2 69  ? 42.817 24.043  -49.386 1.00 44.55  ? 46  ARG E N   1 
ATOM 5087 C CA  . ARG D 2 69  ? 42.368 23.992  -50.771 1.00 45.45  ? 46  ARG E CA  1 
ATOM 5088 C C   . ARG D 2 69  ? 40.954 23.449  -50.843 1.00 45.75  ? 46  ARG E C   1 
ATOM 5089 O O   . ARG D 2 69  ? 40.682 22.329  -50.410 1.00 44.98  ? 46  ARG E O   1 
ATOM 5090 C CB  . ARG D 2 69  ? 43.285 23.089  -51.598 1.00 44.84  ? 46  ARG E CB  1 
ATOM 5091 C CG  . ARG D 2 69  ? 44.700 23.594  -51.746 1.00 45.52  ? 46  ARG E CG  1 
ATOM 5092 C CD  . ARG D 2 69  ? 44.805 24.672  -52.769 1.00 45.89  ? 46  ARG E CD  1 
ATOM 5093 N NE  . ARG D 2 69  ? 46.180 24.840  -53.231 1.00 49.01  ? 46  ARG E NE  1 
ATOM 5094 C CZ  . ARG D 2 69  ? 46.934 25.917  -52.995 1.00 50.29  ? 46  ARG E CZ  1 
ATOM 5095 N NH1 . ARG D 2 69  ? 46.456 26.936  -52.287 1.00 49.97  ? 46  ARG E NH1 1 
ATOM 5096 N NH2 . ARG D 2 69  ? 48.175 25.970  -53.461 1.00 49.34  ? 46  ARG E NH2 1 
ATOM 5097 N N   . ALA D 2 70  ? 40.042 24.253  -51.371 1.00 47.53  ? 47  ALA E N   1 
ATOM 5098 C CA  . ALA D 2 70  ? 38.703 23.766  -51.730 1.00 47.51  ? 47  ALA E CA  1 
ATOM 5099 C C   . ALA D 2 70  ? 38.831 22.700  -52.815 1.00 47.44  ? 47  ALA E C   1 
ATOM 5100 O O   . ALA D 2 70  ? 39.494 22.924  -53.833 1.00 48.18  ? 47  ALA E O   1 
ATOM 5101 C CB  . ALA D 2 70  ? 37.839 24.922  -52.238 1.00 48.59  ? 47  ALA E CB  1 
ATOM 5102 N N   . VAL D 2 71  ? 38.188 21.556  -52.597 1.00 46.73  ? 48  VAL E N   1 
ATOM 5103 C CA  . VAL D 2 71  ? 38.138 20.494  -53.595 1.00 46.85  ? 48  VAL E CA  1 
ATOM 5104 C C   . VAL D 2 71  ? 36.938 20.697  -54.509 1.00 48.23  ? 48  VAL E C   1 
ATOM 5105 O O   . VAL D 2 71  ? 37.067 20.629  -55.724 1.00 49.74  ? 48  VAL E O   1 
ATOM 5106 C CB  . VAL D 2 71  ? 38.194 19.093  -52.936 1.00 45.64  ? 48  VAL E CB  1 
ATOM 5107 C CG1 . VAL D 2 71  ? 38.092 17.972  -53.968 1.00 44.58  ? 48  VAL E CG1 1 
ATOM 5108 C CG2 . VAL D 2 71  ? 39.520 18.953  -52.137 1.00 45.07  ? 48  VAL E CG2 1 
ATOM 5109 N N   . THR D 2 72  ? 35.784 20.983  -53.921 1.00 48.62  ? 49  THR E N   1 
ATOM 5110 C CA  . THR D 2 72  ? 34.593 21.374  -54.667 1.00 49.78  ? 49  THR E CA  1 
ATOM 5111 C C   . THR D 2 72  ? 34.566 22.874  -54.598 1.00 50.67  ? 49  THR E C   1 
ATOM 5112 O O   . THR D 2 72  ? 35.321 23.449  -53.823 1.00 50.68  ? 49  THR E O   1 
ATOM 5113 C CB  . THR D 2 72  ? 33.306 20.871  -53.972 1.00 49.42  ? 49  THR E CB  1 
ATOM 5114 O OG1 . THR D 2 72  ? 33.326 19.451  -53.889 1.00 48.67  ? 49  THR E OG1 1 
ATOM 5115 C CG2 . THR D 2 72  ? 32.034 21.281  -54.765 1.00 54.03  ? 49  THR E CG2 1 
ATOM 5116 N N   . GLU D 2 73  ? 33.683 23.512  -55.364 1.00 52.15  ? 50  GLU E N   1 
ATOM 5117 C CA  . GLU D 2 73  ? 33.394 24.928  -55.148 1.00 53.63  ? 50  GLU E CA  1 
ATOM 5118 C C   . GLU D 2 73  ? 32.681 25.137  -53.805 1.00 52.18  ? 50  GLU E C   1 
ATOM 5119 O O   . GLU D 2 73  ? 32.681 26.243  -53.249 1.00 53.34  ? 50  GLU E O   1 
ATOM 5120 C CB  . GLU D 2 73  ? 32.571 25.535  -56.310 1.00 56.54  ? 50  GLU E CB  1 
ATOM 5121 C CG  . GLU D 2 73  ? 33.396 26.301  -57.397 1.00 60.13  ? 50  GLU E CG  1 
ATOM 5122 C CD  . GLU D 2 73  ? 33.816 27.725  -56.964 1.00 64.19  ? 50  GLU E CD  1 
ATOM 5123 O OE1 . GLU D 2 73  ? 34.792 27.874  -56.173 1.00 64.59  ? 50  GLU E OE1 1 
ATOM 5124 O OE2 . GLU D 2 73  ? 33.166 28.699  -57.424 1.00 66.57  ? 50  GLU E OE2 1 
ATOM 5125 N N   . LEU D 2 74  ? 32.091 24.074  -53.280 1.00 49.72  ? 51  LEU E N   1 
ATOM 5126 C CA  . LEU D 2 74  ? 31.382 24.140  -52.027 1.00 48.69  ? 51  LEU E CA  1 
ATOM 5127 C C   . LEU D 2 74  ? 32.325 24.518  -50.905 1.00 47.82  ? 51  LEU E C   1 
ATOM 5128 O O   . LEU D 2 74  ? 31.911 25.076  -49.891 1.00 47.53  ? 51  LEU E O   1 
ATOM 5129 C CB  . LEU D 2 74  ? 30.735 22.783  -51.743 1.00 47.80  ? 51  LEU E CB  1 
ATOM 5130 C CG  . LEU D 2 74  ? 29.733 22.604  -50.585 1.00 47.21  ? 51  LEU E CG  1 
ATOM 5131 C CD1 . LEU D 2 74  ? 30.416 22.011  -49.383 1.00 44.76  ? 51  LEU E CD1 1 
ATOM 5132 C CD2 . LEU D 2 74  ? 28.962 23.883  -50.205 1.00 46.27  ? 51  LEU E CD2 1 
ATOM 5133 N N   . GLY D 2 75  ? 33.601 24.209  -51.099 1.00 47.16  ? 52  GLY E N   1 
ATOM 5134 C CA  . GLY D 2 75  ? 34.569 24.307  -50.033 1.00 46.90  ? 52  GLY E CA  1 
ATOM 5135 C C   . GLY D 2 75  ? 35.261 25.633  -50.065 1.00 48.37  ? 52  GLY E C   1 
ATOM 5136 O O   . GLY D 2 75  ? 36.041 25.955  -49.153 1.00 47.68  ? 52  GLY E O   1 
ATOM 5137 N N   . ARG D 2 76  ? 34.933 26.393  -51.117 1.00 50.12  ? 53  ARG E N   1 
ATOM 5138 C CA  . ARG D 2 76  ? 35.590 27.647  -51.502 1.00 51.46  ? 53  ARG E CA  1 
ATOM 5139 C C   . ARG D 2 76  ? 35.602 28.780  -50.461 1.00 51.66  ? 53  ARG E C   1 
ATOM 5140 O O   . ARG D 2 76  ? 36.565 29.538  -50.412 1.00 52.75  ? 53  ARG E O   1 
ATOM 5141 C CB  . ARG D 2 76  ? 35.025 28.106  -52.847 1.00 53.19  ? 53  ARG E CB  1 
ATOM 5142 C CG  . ARG D 2 76  ? 35.274 29.549  -53.230 1.00 58.56  ? 53  ARG E CG  1 
ATOM 5143 C CD  . ARG D 2 76  ? 36.689 29.824  -53.754 1.00 63.93  ? 53  ARG E CD  1 
ATOM 5144 N NE  . ARG D 2 76  ? 37.074 28.919  -54.836 1.00 66.12  ? 53  ARG E NE  1 
ATOM 5145 C CZ  . ARG D 2 76  ? 38.215 28.236  -54.866 1.00 66.06  ? 53  ARG E CZ  1 
ATOM 5146 N NH1 . ARG D 2 76  ? 39.096 28.367  -53.870 1.00 65.79  ? 53  ARG E NH1 1 
ATOM 5147 N NH2 . ARG D 2 76  ? 38.477 27.436  -55.896 1.00 65.50  ? 53  ARG E NH2 1 
ATOM 5148 N N   . PRO D 2 77  ? 34.548 28.917  -49.627 1.00 51.53  ? 54  PRO E N   1 
ATOM 5149 C CA  . PRO D 2 77  ? 34.727 29.930  -48.574 1.00 51.72  ? 54  PRO E CA  1 
ATOM 5150 C C   . PRO D 2 77  ? 35.481 29.453  -47.312 1.00 50.32  ? 54  PRO E C   1 
ATOM 5151 O O   . PRO D 2 77  ? 35.863 30.268  -46.479 1.00 51.19  ? 54  PRO E O   1 
ATOM 5152 C CB  . PRO D 2 77  ? 33.298 30.373  -48.247 1.00 52.18  ? 54  PRO E CB  1 
ATOM 5153 C CG  . PRO D 2 77  ? 32.414 29.247  -48.710 1.00 52.07  ? 54  PRO E CG  1 
ATOM 5154 C CD  . PRO D 2 77  ? 33.183 28.346  -49.629 1.00 51.49  ? 54  PRO E CD  1 
ATOM 5155 N N   . ASP D 2 78  ? 35.705 28.154  -47.166 1.00 48.50  ? 55  ASP E N   1 
ATOM 5156 C CA  . ASP D 2 78  ? 36.579 27.676  -46.098 1.00 47.36  ? 55  ASP E CA  1 
ATOM 5157 C C   . ASP D 2 78  ? 38.058 27.873  -46.435 1.00 47.81  ? 55  ASP E C   1 
ATOM 5158 O O   . ASP D 2 78  ? 38.866 28.100  -45.536 1.00 47.20  ? 55  ASP E O   1 
ATOM 5159 C CB  . ASP D 2 78  ? 36.313 26.209  -45.814 1.00 45.89  ? 55  ASP E CB  1 
ATOM 5160 C CG  . ASP D 2 78  ? 34.883 25.946  -45.563 1.00 45.29  ? 55  ASP E CG  1 
ATOM 5161 O OD1 . ASP D 2 78  ? 34.269 25.327  -46.432 1.00 43.66  ? 55  ASP E OD1 1 
ATOM 5162 O OD2 . ASP D 2 78  ? 34.363 26.421  -44.528 1.00 47.47  ? 55  ASP E OD2 1 
ATOM 5163 N N   . GLU D 2 79  ? 38.403 27.776  -47.723 1.00 48.60  ? 56  GLU E N   1 
ATOM 5164 C CA  . GLU D 2 79  ? 39.758 28.069  -48.158 1.00 49.96  ? 56  GLU E CA  1 
ATOM 5165 C C   . GLU D 2 79  ? 40.146 29.516  -47.849 1.00 51.61  ? 56  GLU E C   1 
ATOM 5166 O O   . GLU D 2 79  ? 41.091 29.773  -47.087 1.00 52.02  ? 56  GLU E O   1 
ATOM 5167 C CB  . GLU D 2 79  ? 39.961 27.780  -49.646 1.00 50.56  ? 56  GLU E CB  1 
ATOM 5168 C CG  . GLU D 2 79  ? 41.448 27.838  -50.052 1.00 52.26  ? 56  GLU E CG  1 
ATOM 5169 C CD  . GLU D 2 79  ? 41.699 27.837  -51.558 1.00 54.42  ? 56  GLU E CD  1 
ATOM 5170 O OE1 . GLU D 2 79  ? 41.256 26.902  -52.259 1.00 52.79  ? 56  GLU E OE1 1 
ATOM 5171 O OE2 . GLU D 2 79  ? 42.382 28.771  -52.031 1.00 58.19  ? 56  GLU E OE2 1 
ATOM 5172 N N   . GLU D 2 80  ? 39.402 30.448  -48.436 1.00 53.03  ? 57  GLU E N   1 
ATOM 5173 C CA  . GLU D 2 80  ? 39.715 31.863  -48.368 1.00 54.50  ? 57  GLU E CA  1 
ATOM 5174 C C   . GLU D 2 80  ? 39.737 32.318  -46.923 1.00 53.72  ? 57  GLU E C   1 
ATOM 5175 O O   . GLU D 2 80  ? 40.666 33.001  -46.508 1.00 54.45  ? 57  GLU E O   1 
ATOM 5176 C CB  . GLU D 2 80  ? 38.715 32.667  -49.199 1.00 56.25  ? 57  GLU E CB  1 
ATOM 5177 C CG  . GLU D 2 80  ? 38.391 31.996  -50.545 1.00 60.21  ? 57  GLU E CG  1 
ATOM 5178 C CD  . GLU D 2 80  ? 38.088 32.978  -51.697 1.00 67.92  ? 57  GLU E CD  1 
ATOM 5179 O OE1 . GLU D 2 80  ? 37.953 34.208  -51.457 1.00 69.85  ? 57  GLU E OE1 1 
ATOM 5180 O OE2 . GLU D 2 80  ? 37.989 32.505  -52.860 1.00 70.05  ? 57  GLU E OE2 1 
ATOM 5181 N N   . TYR D 2 81  ? 38.742 31.898  -46.146 1.00 52.46  ? 58  TYR E N   1 
ATOM 5182 C CA  . TYR D 2 81  ? 38.665 32.296  -44.748 1.00 51.82  ? 58  TYR E CA  1 
ATOM 5183 C C   . TYR D 2 81  ? 39.833 31.795  -43.930 1.00 50.69  ? 58  TYR E C   1 
ATOM 5184 O O   . TYR D 2 81  ? 40.529 32.582  -43.289 1.00 51.40  ? 58  TYR E O   1 
ATOM 5185 C CB  . TYR D 2 81  ? 37.365 31.852  -44.079 1.00 51.06  ? 58  TYR E CB  1 
ATOM 5186 C CG  . TYR D 2 81  ? 37.383 32.217  -42.608 1.00 51.86  ? 58  TYR E CG  1 
ATOM 5187 C CD1 . TYR D 2 81  ? 37.254 33.558  -42.188 1.00 52.11  ? 58  TYR E CD1 1 
ATOM 5188 C CD2 . TYR D 2 81  ? 37.597 31.239  -41.634 1.00 50.21  ? 58  TYR E CD2 1 
ATOM 5189 C CE1 . TYR D 2 81  ? 37.303 33.894  -40.831 1.00 51.74  ? 58  TYR E CE1 1 
ATOM 5190 C CE2 . TYR D 2 81  ? 37.656 31.569  -40.281 1.00 50.36  ? 58  TYR E CE2 1 
ATOM 5191 C CZ  . TYR D 2 81  ? 37.504 32.891  -39.886 1.00 51.09  ? 58  TYR E CZ  1 
ATOM 5192 O OH  . TYR D 2 81  ? 37.546 33.179  -38.540 1.00 52.21  ? 58  TYR E OH  1 
ATOM 5193 N N   . TRP D 2 82  ? 40.039 30.482  -43.951 1.00 49.25  ? 59  TRP E N   1 
ATOM 5194 C CA  . TRP D 2 82  ? 41.074 29.845  -43.125 1.00 48.72  ? 59  TRP E CA  1 
ATOM 5195 C C   . TRP D 2 82  ? 42.559 30.005  -43.487 1.00 49.23  ? 59  TRP E C   1 
ATOM 5196 O O   . TRP D 2 82  ? 43.410 29.928  -42.567 1.00 48.60  ? 59  TRP E O   1 
ATOM 5197 C CB  . TRP D 2 82  ? 40.744 28.393  -42.848 1.00 46.99  ? 59  TRP E CB  1 
ATOM 5198 C CG  . TRP D 2 82  ? 40.149 28.328  -41.529 1.00 48.17  ? 59  TRP E CG  1 
ATOM 5199 C CD1 . TRP D 2 82  ? 40.766 28.616  -40.320 1.00 49.62  ? 59  TRP E CD1 1 
ATOM 5200 C CD2 . TRP D 2 82  ? 38.801 28.026  -41.230 1.00 47.10  ? 59  TRP E CD2 1 
ATOM 5201 N NE1 . TRP D 2 82  ? 39.866 28.487  -39.287 1.00 49.02  ? 59  TRP E NE1 1 
ATOM 5202 C CE2 . TRP D 2 82  ? 38.650 28.127  -39.815 1.00 48.62  ? 59  TRP E CE2 1 
ATOM 5203 C CE3 . TRP D 2 82  ? 37.705 27.685  -42.007 1.00 46.06  ? 59  TRP E CE3 1 
ATOM 5204 C CZ2 . TRP D 2 82  ? 37.448 27.893  -39.177 1.00 47.64  ? 59  TRP E CZ2 1 
ATOM 5205 C CZ3 . TRP D 2 82  ? 36.508 27.458  -41.375 1.00 50.35  ? 59  TRP E CZ3 1 
ATOM 5206 C CH2 . TRP D 2 82  ? 36.393 27.554  -39.965 1.00 49.71  ? 59  TRP E CH2 1 
ATOM 5207 N N   . ASN D 2 83  ? 42.846 30.237  -44.785 1.00 49.43  ? 60  ASN E N   1 
ATOM 5208 C CA  . ASN D 2 83  ? 44.181 30.644  -45.273 1.00 50.77  ? 60  ASN E CA  1 
ATOM 5209 C C   . ASN D 2 83  ? 44.655 32.015  -44.768 1.00 52.39  ? 60  ASN E C   1 
ATOM 5210 O O   . ASN D 2 83  ? 45.788 32.424  -45.027 1.00 53.29  ? 60  ASN E O   1 
ATOM 5211 C CB  . ASN D 2 83  ? 44.219 30.688  -46.797 1.00 51.53  ? 60  ASN E CB  1 
ATOM 5212 C CG  . ASN D 2 83  ? 44.303 29.324  -47.431 1.00 50.94  ? 60  ASN E CG  1 
ATOM 5213 O OD1 . ASN D 2 83  ? 44.425 28.303  -46.759 1.00 49.34  ? 60  ASN E OD1 1 
ATOM 5214 N ND2 . ASN D 2 83  ? 44.244 29.304  -48.758 1.00 53.38  ? 60  ASN E ND2 1 
ATOM 5215 N N   . SER D 2 84  ? 43.783 32.730  -44.069 1.00 52.67  ? 61  SER E N   1 
ATOM 5216 C CA  . SER D 2 84  ? 44.142 34.025  -43.524 1.00 54.47  ? 61  SER E CA  1 
ATOM 5217 C C   . SER D 2 84  ? 44.224 33.979  -42.004 1.00 54.58  ? 61  SER E C   1 
ATOM 5218 O O   . SER D 2 84  ? 44.556 34.972  -41.358 1.00 55.98  ? 61  SER E O   1 
ATOM 5219 C CB  . SER D 2 84  ? 43.166 35.104  -44.005 1.00 55.15  ? 61  SER E CB  1 
ATOM 5220 O OG  . SER D 2 84  ? 41.901 34.920  -43.426 1.00 54.02  ? 61  SER E OG  1 
ATOM 5221 N N   . GLN D 2 85  ? 43.922 32.821  -41.437 1.00 53.55  ? 62  GLN E N   1 
ATOM 5222 C CA  . GLN D 2 85  ? 44.066 32.623  -40.009 1.00 54.03  ? 62  GLN E CA  1 
ATOM 5223 C C   . GLN D 2 85  ? 45.422 31.980  -39.796 1.00 54.35  ? 62  GLN E C   1 
ATOM 5224 O O   . GLN D 2 85  ? 45.557 30.749  -39.697 1.00 52.80  ? 62  GLN E O   1 
ATOM 5225 C CB  . GLN D 2 85  ? 42.934 31.757  -39.464 1.00 53.05  ? 62  GLN E CB  1 
ATOM 5226 C CG  . GLN D 2 85  ? 42.217 32.367  -38.264 1.00 55.14  ? 62  GLN E CG  1 
ATOM 5227 C CD  . GLN D 2 85  ? 41.701 33.763  -38.546 1.00 58.46  ? 62  GLN E CD  1 
ATOM 5228 O OE1 . GLN D 2 85  ? 41.205 34.047  -39.642 1.00 58.49  ? 62  GLN E OE1 1 
ATOM 5229 N NE2 . GLN D 2 85  ? 41.827 34.652  -37.559 1.00 60.82  ? 62  GLN E NE2 1 
ATOM 5230 N N   . LYS D 2 86  ? 46.434 32.842  -39.749 1.00 56.30  ? 63  LYS E N   1 
ATOM 5231 C CA  . LYS D 2 86  ? 47.817 32.407  -39.690 1.00 57.20  ? 63  LYS E CA  1 
ATOM 5232 C C   . LYS D 2 86  ? 48.141 31.518  -38.495 1.00 56.30  ? 63  LYS E C   1 
ATOM 5233 O O   . LYS D 2 86  ? 48.896 30.556  -38.641 1.00 56.01  ? 63  LYS E O   1 
ATOM 5234 C CB  . LYS D 2 86  ? 48.780 33.587  -39.820 1.00 59.47  ? 63  LYS E CB  1 
ATOM 5235 C CG  . LYS D 2 86  ? 48.396 34.802  -39.003 1.00 63.88  ? 63  LYS E CG  1 
ATOM 5236 C CD  . LYS D 2 86  ? 47.637 35.857  -39.816 1.00 67.28  ? 63  LYS E CD  1 
ATOM 5237 C CE  . LYS D 2 86  ? 46.717 36.664  -38.910 1.00 68.40  ? 63  LYS E CE  1 
ATOM 5238 N NZ  . LYS D 2 86  ? 45.790 35.721  -38.205 1.00 67.05  ? 63  LYS E NZ  1 
ATOM 5239 N N   . ASP D 2 87  ? 47.544 31.798  -37.340 1.00 56.37  ? 64  ASP E N   1 
ATOM 5240 C CA  . ASP D 2 87  ? 47.728 30.937  -36.154 1.00 56.29  ? 64  ASP E CA  1 
ATOM 5241 C C   . ASP D 2 87  ? 47.248 29.500  -36.348 1.00 53.88  ? 64  ASP E C   1 
ATOM 5242 O O   . ASP D 2 87  ? 47.921 28.567  -35.944 1.00 53.84  ? 64  ASP E O   1 
ATOM 5243 C CB  . ASP D 2 87  ? 47.058 31.540  -34.923 1.00 57.27  ? 64  ASP E CB  1 
ATOM 5244 C CG  . ASP D 2 87  ? 45.556 31.703  -35.092 1.00 57.75  ? 64  ASP E CG  1 
ATOM 5245 O OD1 . ASP D 2 87  ? 45.100 32.274  -36.115 1.00 57.83  ? 64  ASP E OD1 1 
ATOM 5246 O OD2 . ASP D 2 87  ? 44.828 31.278  -34.174 1.00 59.00  ? 64  ASP E OD2 1 
ATOM 5247 N N   . ILE D 2 88  ? 46.084 29.333  -36.965 1.00 52.27  ? 65  ILE E N   1 
ATOM 5248 C CA  . ILE D 2 88  ? 45.543 28.016  -37.296 1.00 50.05  ? 65  ILE E CA  1 
ATOM 5249 C C   . ILE D 2 88  ? 46.367 27.294  -38.358 1.00 49.14  ? 65  ILE E C   1 
ATOM 5250 O O   . ILE D 2 88  ? 46.829 26.179  -38.160 1.00 48.42  ? 65  ILE E O   1 
ATOM 5251 C CB  . ILE D 2 88  ? 44.066 28.123  -37.745 1.00 49.25  ? 65  ILE E CB  1 
ATOM 5252 C CG1 . ILE D 2 88  ? 43.130 28.081  -36.520 1.00 50.06  ? 65  ILE E CG1 1 
ATOM 5253 C CG2 . ILE D 2 88  ? 43.699 26.978  -38.649 1.00 47.80  ? 65  ILE E CG2 1 
ATOM 5254 C CD1 . ILE D 2 88  ? 42.588 29.454  -36.054 1.00 52.97  ? 65  ILE E CD1 1 
ATOM 5255 N N   . LEU D 2 89  ? 46.544 27.947  -39.492 1.00 49.65  ? 66  LEU E N   1 
ATOM 5256 C CA  . LEU D 2 89  ? 47.463 27.511  -40.536 1.00 49.54  ? 66  LEU E CA  1 
ATOM 5257 C C   . LEU D 2 89  ? 48.823 26.905  -40.062 1.00 50.13  ? 66  LEU E C   1 
ATOM 5258 O O   . LEU D 2 89  ? 49.367 26.017  -40.703 1.00 49.11  ? 66  LEU E O   1 
ATOM 5259 C CB  . LEU D 2 89  ? 47.691 28.709  -41.454 1.00 50.51  ? 66  LEU E CB  1 
ATOM 5260 C CG  . LEU D 2 89  ? 48.092 28.434  -42.896 1.00 51.11  ? 66  LEU E CG  1 
ATOM 5261 C CD1 . LEU D 2 89  ? 46.958 27.760  -43.700 1.00 48.27  ? 66  LEU E CD1 1 
ATOM 5262 C CD2 . LEU D 2 89  ? 48.518 29.753  -43.526 1.00 52.58  ? 66  LEU E CD2 1 
ATOM 5263 N N   . GLU D 2 90  ? 49.378 27.388  -38.954 1.00 51.77  ? 67  GLU E N   1 
ATOM 5264 C CA  . GLU D 2 90  ? 50.642 26.840  -38.452 1.00 53.44  ? 67  GLU E CA  1 
ATOM 5265 C C   . GLU D 2 90  ? 50.363 25.642  -37.570 1.00 51.91  ? 67  GLU E C   1 
ATOM 5266 O O   . GLU D 2 90  ? 51.207 24.775  -37.392 1.00 51.56  ? 67  GLU E O   1 
ATOM 5267 C CB  . GLU D 2 90  ? 51.484 27.892  -37.692 1.00 55.79  ? 67  GLU E CB  1 
ATOM 5268 C CG  . GLU D 2 90  ? 50.853 28.320  -36.363 1.00 60.51  ? 67  GLU E CG  1 
ATOM 5269 C CD  . GLU D 2 90  ? 51.602 29.441  -35.627 1.00 68.89  ? 67  GLU E CD  1 
ATOM 5270 O OE1 . GLU D 2 90  ? 52.699 29.156  -35.067 1.00 72.16  ? 67  GLU E OE1 1 
ATOM 5271 O OE2 . GLU D 2 90  ? 51.076 30.595  -35.577 1.00 69.69  ? 67  GLU E OE2 1 
ATOM 5272 N N   . GLU D 2 91  ? 49.166 25.606  -37.015 1.00 51.38  ? 68  GLU E N   1 
ATOM 5273 C CA  . GLU D 2 91  ? 48.760 24.526  -36.141 1.00 51.27  ? 68  GLU E CA  1 
ATOM 5274 C C   . GLU D 2 91  ? 48.574 23.231  -36.947 1.00 48.76  ? 68  GLU E C   1 
ATOM 5275 O O   . GLU D 2 91  ? 48.863 22.142  -36.448 1.00 47.87  ? 68  GLU E O   1 
ATOM 5276 C CB  . GLU D 2 91  ? 47.507 24.947  -35.384 1.00 51.91  ? 68  GLU E CB  1 
ATOM 5277 C CG  . GLU D 2 91  ? 46.747 23.836  -34.673 1.00 55.68  ? 68  GLU E CG  1 
ATOM 5278 C CD  . GLU D 2 91  ? 45.560 24.376  -33.849 1.00 62.37  ? 68  GLU E CD  1 
ATOM 5279 O OE1 . GLU D 2 91  ? 44.720 23.540  -33.411 1.00 62.27  ? 68  GLU E OE1 1 
ATOM 5280 O OE2 . GLU D 2 91  ? 45.482 25.630  -33.636 1.00 65.02  ? 68  GLU E OE2 1 
ATOM 5281 N N   . GLU D 2 92  ? 48.135 23.367  -38.202 1.00 47.58  ? 69  GLU E N   1 
ATOM 5282 C CA  . GLU D 2 92  ? 48.097 22.240  -39.147 1.00 45.99  ? 69  GLU E CA  1 
ATOM 5283 C C   . GLU D 2 92  ? 49.497 21.886  -39.634 1.00 46.13  ? 69  GLU E C   1 
ATOM 5284 O O   . GLU D 2 92  ? 49.794 20.705  -39.808 1.00 46.17  ? 69  GLU E O   1 
ATOM 5285 C CB  . GLU D 2 92  ? 47.221 22.510  -40.373 1.00 44.96  ? 69  GLU E CB  1 
ATOM 5286 C CG  . GLU D 2 92  ? 45.883 23.178  -40.139 1.00 46.85  ? 69  GLU E CG  1 
ATOM 5287 C CD  . GLU D 2 92  ? 44.736 22.213  -39.805 1.00 49.39  ? 69  GLU E CD  1 
ATOM 5288 O OE1 . GLU D 2 92  ? 43.907 22.566  -38.931 1.00 50.86  ? 69  GLU E OE1 1 
ATOM 5289 O OE2 . GLU D 2 92  ? 44.639 21.116  -40.406 1.00 49.29  ? 69  GLU E OE2 1 
ATOM 5290 N N   . ARG D 2 93  ? 50.351 22.886  -39.858 1.00 46.77  ? 70  ARG E N   1 
ATOM 5291 C CA  . ARG D 2 93  ? 51.706 22.659  -40.389 1.00 47.36  ? 70  ARG E CA  1 
ATOM 5292 C C   . ARG D 2 93  ? 52.635 21.988  -39.395 1.00 47.64  ? 70  ARG E C   1 
ATOM 5293 O O   . ARG D 2 93  ? 53.635 21.372  -39.773 1.00 47.49  ? 70  ARG E O   1 
ATOM 5294 C CB  . ARG D 2 93  ? 52.339 23.975  -40.810 1.00 49.63  ? 70  ARG E CB  1 
ATOM 5295 C CG  . ARG D 2 93  ? 51.839 24.525  -42.134 1.00 50.07  ? 70  ARG E CG  1 
ATOM 5296 C CD  . ARG D 2 93  ? 52.366 25.917  -42.359 1.00 50.98  ? 70  ARG E CD  1 
ATOM 5297 N NE  . ARG D 2 93  ? 51.717 26.517  -43.520 1.00 53.49  ? 70  ARG E NE  1 
ATOM 5298 C CZ  . ARG D 2 93  ? 51.715 27.819  -43.807 1.00 55.22  ? 70  ARG E CZ  1 
ATOM 5299 N NH1 . ARG D 2 93  ? 52.340 28.689  -43.025 1.00 56.28  ? 70  ARG E NH1 1 
ATOM 5300 N NH2 . ARG D 2 93  ? 51.086 28.248  -44.885 1.00 55.52  ? 70  ARG E NH2 1 
ATOM 5301 N N   . ALA D 2 94  ? 52.276 22.114  -38.118 1.00 47.84  ? 71  ALA E N   1 
ATOM 5302 C CA  . ALA D 2 94  ? 53.020 21.535  -37.002 1.00 48.20  ? 71  ALA E CA  1 
ATOM 5303 C C   . ALA D 2 94  ? 52.725 20.068  -36.812 1.00 47.17  ? 71  ALA E C   1 
ATOM 5304 O O   . ALA D 2 94  ? 53.469 19.389  -36.108 1.00 48.37  ? 71  ALA E O   1 
ATOM 5305 C CB  . ALA D 2 94  ? 52.675 22.258  -35.744 1.00 48.90  ? 71  ALA E CB  1 
ATOM 5306 N N   . VAL D 2 95  ? 51.641 19.589  -37.428 1.00 45.04  ? 72  VAL E N   1 
ATOM 5307 C CA  . VAL D 2 95  ? 51.147 18.246  -37.190 1.00 43.60  ? 72  VAL E CA  1 
ATOM 5308 C C   . VAL D 2 95  ? 52.055 17.122  -37.656 1.00 43.89  ? 72  VAL E C   1 
ATOM 5309 O O   . VAL D 2 95  ? 52.049 16.074  -37.023 1.00 44.15  ? 72  VAL E O   1 
ATOM 5310 C CB  . VAL D 2 95  ? 49.753 17.984  -37.798 1.00 41.92  ? 72  VAL E CB  1 
ATOM 5311 C CG1 . VAL D 2 95  ? 49.416 16.493  -37.669 1.00 39.93  ? 72  VAL E CG1 1 
ATOM 5312 C CG2 . VAL D 2 95  ? 48.714 18.825  -37.132 1.00 40.19  ? 72  VAL E CG2 1 
ATOM 5313 N N   . PRO D 2 96  ? 52.780 17.293  -38.785 1.00 44.39  ? 73  PRO E N   1 
ATOM 5314 C CA  . PRO D 2 96  ? 53.661 16.161  -39.128 1.00 45.02  ? 73  PRO E CA  1 
ATOM 5315 C C   . PRO D 2 96  ? 54.813 15.918  -38.143 1.00 47.01  ? 73  PRO E C   1 
ATOM 5316 O O   . PRO D 2 96  ? 55.342 14.808  -38.098 1.00 48.03  ? 73  PRO E O   1 
ATOM 5317 C CB  . PRO D 2 96  ? 54.161 16.514  -40.532 1.00 44.30  ? 73  PRO E CB  1 
ATOM 5318 C CG  . PRO D 2 96  ? 53.034 17.298  -41.099 1.00 42.81  ? 73  PRO E CG  1 
ATOM 5319 C CD  . PRO D 2 96  ? 52.575 18.169  -39.955 1.00 44.09  ? 73  PRO E CD  1 
ATOM 5320 N N   . ASP D 2 97  ? 55.174 16.917  -37.345 1.00 49.00  ? 74  ASP E N   1 
ATOM 5321 C CA  . ASP D 2 97  ? 56.194 16.722  -36.288 1.00 51.43  ? 74  ASP E CA  1 
ATOM 5322 C C   . ASP D 2 97  ? 55.650 16.544  -34.848 1.00 51.23  ? 74  ASP E C   1 
ATOM 5323 O O   . ASP D 2 97  ? 56.401 16.189  -33.950 1.00 52.73  ? 74  ASP E O   1 
ATOM 5324 C CB  . ASP D 2 97  ? 57.277 17.806  -36.362 1.00 53.69  ? 74  ASP E CB  1 
ATOM 5325 C CG  . ASP D 2 97  ? 58.111 17.721  -37.653 1.00 56.73  ? 74  ASP E CG  1 
ATOM 5326 O OD1 . ASP D 2 97  ? 58.305 16.591  -38.196 1.00 57.66  ? 74  ASP E OD1 1 
ATOM 5327 O OD2 . ASP D 2 97  ? 58.581 18.792  -38.124 1.00 59.88  ? 74  ASP E OD2 1 
ATOM 5328 N N   . ARG D 2 98  ? 54.350 16.767  -34.643 1.00 49.81  ? 75  ARG E N   1 
ATOM 5329 C CA  . ARG D 2 98  ? 53.703 16.475  -33.359 1.00 49.42  ? 75  ARG E CA  1 
ATOM 5330 C C   . ARG D 2 98  ? 52.924 15.178  -33.451 1.00 47.84  ? 75  ARG E C   1 
ATOM 5331 O O   . ARG D 2 98  ? 53.526 14.117  -33.328 1.00 48.62  ? 75  ARG E O   1 
ATOM 5332 C CB  . ARG D 2 98  ? 52.837 17.634  -32.866 1.00 49.34  ? 75  ARG E CB  1 
ATOM 5333 C CG  . ARG D 2 98  ? 53.611 18.932  -32.768 1.00 51.73  ? 75  ARG E CG  1 
ATOM 5334 C CD  . ARG D 2 98  ? 52.864 20.090  -32.049 1.00 53.11  ? 75  ARG E CD  1 
ATOM 5335 N NE  . ARG D 2 98  ? 53.721 21.284  -32.071 1.00 55.90  ? 75  ARG E NE  1 
ATOM 5336 C CZ  . ARG D 2 98  ? 53.349 22.529  -32.385 1.00 56.57  ? 75  ARG E CZ  1 
ATOM 5337 N NH1 . ARG D 2 98  ? 52.090 22.830  -32.664 1.00 53.72  ? 75  ARG E NH1 1 
ATOM 5338 N NH2 . ARG D 2 98  ? 54.260 23.500  -32.388 1.00 59.86  ? 75  ARG E NH2 1 
ATOM 5339 N N   . MET D 2 99  ? 51.613 15.235  -33.701 1.00 46.15  ? 76  MET E N   1 
ATOM 5340 C CA  . MET D 2 99  ? 50.769 14.038  -33.613 1.00 44.15  ? 76  MET E CA  1 
ATOM 5341 C C   . MET D 2 99  ? 51.247 12.873  -34.474 1.00 43.43  ? 76  MET E C   1 
ATOM 5342 O O   . MET D 2 99  ? 51.371 11.759  -33.974 1.00 43.02  ? 76  MET E O   1 
ATOM 5343 C CB  . MET D 2 99  ? 49.311 14.372  -33.900 1.00 43.00  ? 76  MET E CB  1 
ATOM 5344 C CG  . MET D 2 99  ? 48.435 13.167  -34.130 1.00 41.13  ? 76  MET E CG  1 
ATOM 5345 S SD  . MET D 2 99  ? 46.792 13.597  -34.755 1.00 43.00  ? 76  MET E SD  1 
ATOM 5346 C CE  . MET D 2 99  ? 47.013 13.973  -36.497 1.00 33.62  ? 76  MET E CE  1 
ATOM 5347 N N   . CYS D 2 100 ? 51.531 13.118  -35.754 1.00 43.31  ? 77  CYS E N   1 
ATOM 5348 C CA  . CYS D 2 100 ? 52.011 12.035  -36.632 1.00 43.41  ? 77  CYS E CA  1 
ATOM 5349 C C   . CYS D 2 100 ? 53.298 11.383  -36.131 1.00 45.42  ? 77  CYS E C   1 
ATOM 5350 O O   . CYS D 2 100 ? 53.346 10.167  -36.013 1.00 45.62  ? 77  CYS E O   1 
ATOM 5351 C CB  . CYS D 2 100 ? 52.159 12.461  -38.087 1.00 42.37  ? 77  CYS E CB  1 
ATOM 5352 S SG  . CYS D 2 100 ? 50.669 13.080  -38.946 1.00 41.76  ? 77  CYS E SG  1 
ATOM 5353 N N   . ARG D 2 101 ? 54.318 12.179  -35.799 1.00 48.18  ? 78  ARG E N   1 
ATOM 5354 C CA  . ARG D 2 101 ? 55.549 11.624  -35.235 1.00 50.65  ? 78  ARG E CA  1 
ATOM 5355 C C   . ARG D 2 101 ? 55.295 10.928  -33.902 1.00 51.43  ? 78  ARG E C   1 
ATOM 5356 O O   . ARG D 2 101 ? 55.708 9.773   -33.729 1.00 52.12  ? 78  ARG E O   1 
ATOM 5357 C CB  . ARG D 2 101 ? 56.672 12.664  -35.119 1.00 53.39  ? 78  ARG E CB  1 
ATOM 5358 C CG  . ARG D 2 101 ? 58.082 12.062  -34.736 1.00 57.49  ? 78  ARG E CG  1 
ATOM 5359 C CD  . ARG D 2 101 ? 59.240 12.585  -35.632 1.00 64.11  ? 78  ARG E CD  1 
ATOM 5360 N NE  . ARG D 2 101 ? 58.757 13.144  -36.916 1.00 67.81  ? 78  ARG E NE  1 
ATOM 5361 C CZ  . ARG D 2 101 ? 58.500 12.470  -38.051 1.00 65.34  ? 78  ARG E CZ  1 
ATOM 5362 N NH1 . ARG D 2 101 ? 58.680 11.146  -38.152 1.00 61.03  ? 78  ARG E NH1 1 
ATOM 5363 N NH2 . ARG D 2 101 ? 58.046 13.154  -39.105 1.00 64.51  ? 78  ARG E NH2 1 
ATOM 5364 N N   . HIS D 2 102 ? 54.603 11.604  -32.981 1.00 51.63  ? 79  HIS E N   1 
ATOM 5365 C CA  . HIS D 2 102 ? 54.220 10.999  -31.695 1.00 52.46  ? 79  HIS E CA  1 
ATOM 5366 C C   . HIS D 2 102 ? 53.620 9.594   -31.830 1.00 50.90  ? 79  HIS E C   1 
ATOM 5367 O O   . HIS D 2 102 ? 54.166 8.655   -31.277 1.00 51.67  ? 79  HIS E O   1 
ATOM 5368 C CB  . HIS D 2 102 ? 53.283 11.909  -30.898 1.00 52.62  ? 79  HIS E CB  1 
ATOM 5369 C CG  . HIS D 2 102 ? 52.930 11.375  -29.544 1.00 55.56  ? 79  HIS E CG  1 
ATOM 5370 N ND1 . HIS D 2 102 ? 53.323 11.991  -28.372 1.00 58.86  ? 79  HIS E ND1 1 
ATOM 5371 C CD2 . HIS D 2 102 ? 52.228 10.275  -29.172 1.00 56.03  ? 79  HIS E CD2 1 
ATOM 5372 C CE1 . HIS D 2 102 ? 52.864 11.305  -27.339 1.00 59.43  ? 79  HIS E CE1 1 
ATOM 5373 N NE2 . HIS D 2 102 ? 52.201 10.257  -27.797 1.00 57.44  ? 79  HIS E NE2 1 
ATOM 5374 N N   . ASN D 2 103 ? 52.530 9.444   -32.578 1.00 49.30  ? 80  ASN E N   1 
ATOM 5375 C CA  . ASN D 2 103 ? 51.859 8.137   -32.692 1.00 48.84  ? 80  ASN E CA  1 
ATOM 5376 C C   . ASN D 2 103 ? 52.750 7.080   -33.392 1.00 49.60  ? 80  ASN E C   1 
ATOM 5377 O O   . ASN D 2 103 ? 52.677 5.878   -33.091 1.00 49.13  ? 80  ASN E O   1 
ATOM 5378 C CB  . ASN D 2 103 ? 50.487 8.223   -33.408 1.00 46.69  ? 80  ASN E CB  1 
ATOM 5379 C CG  . ASN D 2 103 ? 49.556 9.301   -32.842 1.00 45.82  ? 80  ASN E CG  1 
ATOM 5380 O OD1 . ASN D 2 103 ? 49.627 9.662   -31.674 1.00 47.48  ? 80  ASN E OD1 1 
ATOM 5381 N ND2 . ASN D 2 103 ? 48.660 9.796   -33.681 1.00 42.43  ? 80  ASN E ND2 1 
ATOM 5382 N N   . TYR D 2 104 ? 53.584 7.534   -34.327 1.00 50.61  ? 81  TYR E N   1 
ATOM 5383 C CA  . TYR D 2 104 ? 54.367 6.621   -35.146 1.00 51.48  ? 81  TYR E CA  1 
ATOM 5384 C C   . TYR D 2 104 ? 55.449 5.969   -34.307 1.00 53.97  ? 81  TYR E C   1 
ATOM 5385 O O   . TYR D 2 104 ? 55.637 4.753   -34.355 1.00 54.37  ? 81  TYR E O   1 
ATOM 5386 C CB  . TYR D 2 104 ? 54.988 7.366   -36.315 1.00 51.55  ? 81  TYR E CB  1 
ATOM 5387 C CG  . TYR D 2 104 ? 55.677 6.485   -37.329 1.00 53.00  ? 81  TYR E CG  1 
ATOM 5388 C CD1 . TYR D 2 104 ? 57.070 6.416   -37.397 1.00 56.71  ? 81  TYR E CD1 1 
ATOM 5389 C CD2 . TYR D 2 104 ? 54.937 5.724   -38.228 1.00 53.25  ? 81  TYR E CD2 1 
ATOM 5390 C CE1 . TYR D 2 104 ? 57.709 5.594   -38.349 1.00 58.54  ? 81  TYR E CE1 1 
ATOM 5391 C CE2 . TYR D 2 104 ? 55.552 4.910   -39.170 1.00 54.14  ? 81  TYR E CE2 1 
ATOM 5392 C CZ  . TYR D 2 104 ? 56.935 4.850   -39.241 1.00 57.62  ? 81  TYR E CZ  1 
ATOM 5393 O OH  . TYR D 2 104 ? 57.532 4.030   -40.200 1.00 59.47  ? 81  TYR E OH  1 
ATOM 5394 N N   . GLU D 2 105 ? 56.155 6.782   -33.532 1.00 56.14  ? 82  GLU E N   1 
ATOM 5395 C CA  . GLU D 2 105 ? 57.204 6.286   -32.668 1.00 58.81  ? 82  GLU E CA  1 
ATOM 5396 C C   . GLU D 2 105 ? 56.627 5.705   -31.400 1.00 59.57  ? 82  GLU E C   1 
ATOM 5397 O O   . GLU D 2 105 ? 57.368 5.190   -30.582 1.00 61.67  ? 82  GLU E O   1 
ATOM 5398 C CB  . GLU D 2 105 ? 58.148 7.415   -32.274 1.00 60.94  ? 82  GLU E CB  1 
ATOM 5399 C CG  . GLU D 2 105 ? 58.765 8.172   -33.430 1.00 62.33  ? 82  GLU E CG  1 
ATOM 5400 C CD  . GLU D 2 105 ? 60.114 8.722   -33.058 1.00 68.02  ? 82  GLU E CD  1 
ATOM 5401 O OE1 . GLU D 2 105 ? 60.261 9.962   -33.013 1.00 68.56  ? 82  GLU E OE1 1 
ATOM 5402 O OE2 . GLU D 2 105 ? 61.031 7.900   -32.779 1.00 72.01  ? 82  GLU E OE2 1 
ATOM 5403 N N   . LEU D 2 106 ? 55.315 5.819   -31.220 1.00 58.66  ? 83  LEU E N   1 
ATOM 5404 C CA  . LEU D 2 106 ? 54.648 5.295   -30.040 1.00 59.90  ? 83  LEU E CA  1 
ATOM 5405 C C   . LEU D 2 106 ? 54.170 3.884   -30.286 1.00 59.67  ? 83  LEU E C   1 
ATOM 5406 O O   . LEU D 2 106 ? 54.487 2.974   -29.534 1.00 61.70  ? 83  LEU E O   1 
ATOM 5407 C CB  . LEU D 2 106 ? 53.449 6.155   -29.694 1.00 59.02  ? 83  LEU E CB  1 
ATOM 5408 C CG  . LEU D 2 106 ? 52.799 6.155   -28.308 1.00 60.47  ? 83  LEU E CG  1 
ATOM 5409 C CD1 . LEU D 2 106 ? 51.283 6.005   -28.532 1.00 57.34  ? 83  LEU E CD1 1 
ATOM 5410 C CD2 . LEU D 2 106 ? 53.350 5.106   -27.304 1.00 60.21  ? 83  LEU E CD2 1 
ATOM 5411 N N   . GLY D 2 107 ? 53.387 3.704   -31.336 1.00 58.70  ? 84  GLY E N   1 
ATOM 5412 C CA  . GLY D 2 107 ? 52.940 2.380   -31.733 1.00 59.06  ? 84  GLY E CA  1 
ATOM 5413 C C   . GLY D 2 107 ? 54.152 1.546   -32.053 1.00 60.83  ? 84  GLY E C   1 
ATOM 5414 O O   . GLY D 2 107 ? 54.275 0.411   -31.577 1.00 61.92  ? 84  GLY E O   1 
ATOM 5415 N N   . GLY D 2 108 ? 55.030 2.120   -32.881 1.00 61.63  ? 85  GLY E N   1 
ATOM 5416 C CA  . GLY D 2 108 ? 56.412 1.640   -33.101 1.00 63.56  ? 85  GLY E CA  1 
ATOM 5417 C C   . GLY D 2 108 ? 56.609 0.137   -33.162 1.00 64.09  ? 85  GLY E C   1 
ATOM 5418 O O   . GLY D 2 108 ? 56.195 -0.510  -34.138 1.00 62.75  ? 85  GLY E O   1 
ATOM 5419 N N   . PRO D 2 109 ? 57.208 -0.435  -32.099 1.00 66.26  ? 86  PRO E N   1 
ATOM 5420 C CA  . PRO D 2 109 ? 57.575 -1.868  -32.054 1.00 66.69  ? 86  PRO E CA  1 
ATOM 5421 C C   . PRO D 2 109 ? 56.384 -2.789  -32.383 1.00 64.51  ? 86  PRO E C   1 
ATOM 5422 O O   . PRO D 2 109 ? 56.326 -3.398  -33.453 1.00 62.89  ? 86  PRO E O   1 
ATOM 5423 C CB  . PRO D 2 109 ? 58.044 -2.075  -30.591 1.00 69.04  ? 86  PRO E CB  1 
ATOM 5424 C CG  . PRO D 2 109 ? 57.398 -0.958  -29.795 1.00 69.09  ? 86  PRO E CG  1 
ATOM 5425 C CD  . PRO D 2 109 ? 57.346 0.215   -30.774 1.00 68.46  ? 86  PRO E CD  1 
ATOM 5426 N N   . MET D 2 110 ? 55.447 -2.852  -31.445 1.00 64.26  ? 87  MET E N   1 
ATOM 5427 C CA  . MET D 2 110 ? 54.191 -3.559  -31.582 1.00 62.52  ? 87  MET E CA  1 
ATOM 5428 C C   . MET D 2 110 ? 53.485 -3.340  -32.897 1.00 59.82  ? 87  MET E C   1 
ATOM 5429 O O   . MET D 2 110 ? 52.691 -4.175  -33.307 1.00 59.07  ? 87  MET E O   1 
ATOM 5430 C CB  . MET D 2 110 ? 53.227 -3.061  -30.516 1.00 63.23  ? 87  MET E CB  1 
ATOM 5431 C CG  . MET D 2 110 ? 53.730 -3.144  -29.108 1.00 64.95  ? 87  MET E CG  1 
ATOM 5432 S SD  . MET D 2 110 ? 52.320 -3.702  -28.187 1.00 64.81  ? 87  MET E SD  1 
ATOM 5433 C CE  . MET D 2 110 ? 52.231 -5.427  -28.693 1.00 63.80  ? 87  MET E CE  1 
ATOM 5434 N N   . THR D 2 111 ? 53.729 -2.209  -33.539 1.00 58.46  ? 88  THR E N   1 
ATOM 5435 C CA  . THR D 2 111 ? 52.844 -1.811  -34.623 1.00 56.14  ? 88  THR E CA  1 
ATOM 5436 C C   . THR D 2 111 ? 53.337 -2.175  -36.015 1.00 55.43  ? 88  THR E C   1 
ATOM 5437 O O   . THR D 2 111 ? 52.751 -3.024  -36.678 1.00 54.79  ? 88  THR E O   1 
ATOM 5438 C CB  . THR D 2 111 ? 52.498 -0.328  -34.541 1.00 55.76  ? 88  THR E CB  1 
ATOM 5439 O OG1 . THR D 2 111 ? 52.263 0.018   -33.166 1.00 56.01  ? 88  THR E OG1 1 
ATOM 5440 C CG2 . THR D 2 111 ? 51.262 -0.048  -35.376 1.00 52.33  ? 88  THR E CG2 1 
ATOM 5441 N N   . LEU D 2 112 ? 54.415 -1.527  -36.442 1.00 55.81  ? 89  LEU E N   1 
ATOM 5442 C CA  . LEU D 2 112 ? 54.921 -1.651  -37.808 1.00 54.79  ? 89  LEU E CA  1 
ATOM 5443 C C   . LEU D 2 112 ? 55.519 -3.012  -38.127 1.00 54.68  ? 89  LEU E C   1 
ATOM 5444 O O   . LEU D 2 112 ? 55.430 -3.455  -39.275 1.00 53.77  ? 89  LEU E O   1 
ATOM 5445 C CB  . LEU D 2 112 ? 55.989 -0.592  -38.073 1.00 56.00  ? 89  LEU E CB  1 
ATOM 5446 C CG  . LEU D 2 112 ? 55.726 0.910   -37.976 1.00 56.28  ? 89  LEU E CG  1 
ATOM 5447 C CD1 . LEU D 2 112 ? 55.057 1.328   -36.678 1.00 57.54  ? 89  LEU E CD1 1 
ATOM 5448 C CD2 . LEU D 2 112 ? 57.083 1.598   -38.102 1.00 59.80  ? 89  LEU E CD2 1 
ATOM 5449 N N   . GLN D 2 113 ? 56.156 -3.652  -37.136 1.00 55.24  ? 90  GLN E N   1 
ATOM 5450 C CA  . GLN D 2 113 ? 56.789 -4.965  -37.348 1.00 55.20  ? 90  GLN E CA  1 
ATOM 5451 C C   . GLN D 2 113 ? 55.922 -6.129  -36.837 1.00 53.18  ? 90  GLN E C   1 
ATOM 5452 O O   . GLN D 2 113 ? 56.453 -7.134  -36.353 1.00 54.12  ? 90  GLN E O   1 
ATOM 5453 C CB  . GLN D 2 113 ? 58.211 -5.050  -36.735 1.00 58.40  ? 90  GLN E CB  1 
ATOM 5454 C CG  . GLN D 2 113 ? 59.141 -3.835  -36.928 1.00 62.63  ? 90  GLN E CG  1 
ATOM 5455 C CD  . GLN D 2 113 ? 58.948 -2.759  -35.827 1.00 68.29  ? 90  GLN E CD  1 
ATOM 5456 O OE1 . GLN D 2 113 ? 57.826 -2.537  -35.333 1.00 69.02  ? 90  GLN E OE1 1 
ATOM 5457 N NE2 . GLN D 2 113 ? 60.042 -2.094  -35.447 1.00 69.71  ? 90  GLN E NE2 1 
ATOM 5458 N N   . ARG D 2 114 ? 54.596 -5.994  -36.951 1.00 49.73  ? 91  ARG E N   1 
ATOM 5459 C CA  . ARG D 2 114 ? 53.664 -7.045  -36.532 1.00 47.25  ? 91  ARG E CA  1 
ATOM 5460 C C   . ARG D 2 114 ? 53.533 -8.062  -37.626 1.00 45.70  ? 91  ARG E C   1 
ATOM 5461 O O   . ARG D 2 114 ? 53.211 -7.720  -38.766 1.00 43.93  ? 91  ARG E O   1 
ATOM 5462 C CB  . ARG D 2 114 ? 52.279 -6.478  -36.210 1.00 46.18  ? 91  ARG E CB  1 
ATOM 5463 C CG  . ARG D 2 114 ? 51.289 -7.538  -35.723 1.00 44.63  ? 91  ARG E CG  1 
ATOM 5464 C CD  . ARG D 2 114 ? 49.967 -6.945  -35.328 1.00 41.07  ? 91  ARG E CD  1 
ATOM 5465 N NE  . ARG D 2 114 ? 48.876 -7.714  -35.911 1.00 39.94  ? 91  ARG E NE  1 
ATOM 5466 C CZ  . ARG D 2 114 ? 48.118 -8.586  -35.248 1.00 41.73  ? 91  ARG E CZ  1 
ATOM 5467 N NH1 . ARG D 2 114 ? 48.292 -8.806  -33.937 1.00 43.25  ? 91  ARG E NH1 1 
ATOM 5468 N NH2 . ARG D 2 114 ? 47.171 -9.244  -35.904 1.00 39.75  ? 91  ARG E NH2 1 
ATOM 5469 N N   . ARG D 2 115 ? 53.788 -9.321  -37.291 1.00 45.98  ? 92  ARG E N   1 
ATOM 5470 C CA  . ARG D 2 115 ? 53.684 -10.373 -38.286 1.00 44.81  ? 92  ARG E CA  1 
ATOM 5471 C C   . ARG D 2 115 ? 53.096 -11.618 -37.675 1.00 44.96  ? 92  ARG E C   1 
ATOM 5472 O O   . ARG D 2 115 ? 53.572 -12.101 -36.664 1.00 46.71  ? 92  ARG E O   1 
ATOM 5473 C CB  . ARG D 2 115 ? 55.038 -10.672 -38.932 1.00 45.59  ? 92  ARG E CB  1 
ATOM 5474 C CG  . ARG D 2 115 ? 55.937 -9.473  -39.123 1.00 46.32  ? 92  ARG E CG  1 
ATOM 5475 C CD  . ARG D 2 115 ? 56.986 -9.710  -40.163 1.00 50.40  ? 92  ARG E CD  1 
ATOM 5476 N NE  . ARG D 2 115 ? 58.127 -8.797  -40.039 1.00 54.49  ? 92  ARG E NE  1 
ATOM 5477 C CZ  . ARG D 2 115 ? 58.182 -7.555  -40.536 1.00 55.84  ? 92  ARG E CZ  1 
ATOM 5478 N NH1 . ARG D 2 115 ? 57.150 -7.018  -41.203 1.00 51.91  ? 92  ARG E NH1 1 
ATOM 5479 N NH2 . ARG D 2 115 ? 59.287 -6.836  -40.349 1.00 58.83  ? 92  ARG E NH2 1 
ATOM 5480 N N   . VAL D 2 116 ? 52.030 -12.112 -38.286 1.00 43.86  ? 93  VAL E N   1 
ATOM 5481 C CA  . VAL D 2 116 ? 51.433 -13.392 -37.914 1.00 44.36  ? 93  VAL E CA  1 
ATOM 5482 C C   . VAL D 2 116 ? 51.635 -14.339 -39.082 1.00 44.55  ? 93  VAL E C   1 
ATOM 5483 O O   . VAL D 2 116 ? 51.273 -14.009 -40.219 1.00 44.05  ? 93  VAL E O   1 
ATOM 5484 C CB  . VAL D 2 116 ? 49.925 -13.272 -37.573 1.00 43.31  ? 93  VAL E CB  1 
ATOM 5485 C CG1 . VAL D 2 116 ? 49.392 -14.570 -37.046 1.00 43.80  ? 93  VAL E CG1 1 
ATOM 5486 C CG2 . VAL D 2 116 ? 49.693 -12.165 -36.556 1.00 43.04  ? 93  VAL E CG2 1 
ATOM 5487 N N   . GLN D 2 117 ? 52.245 -15.490 -38.801 1.00 45.93  ? 94  GLN E N   1 
ATOM 5488 C CA  . GLN D 2 117 ? 52.539 -16.500 -39.800 1.00 46.09  ? 94  GLN E CA  1 
ATOM 5489 C C   . GLN D 2 117 ? 51.252 -17.141 -40.341 1.00 45.60  ? 94  GLN E C   1 
ATOM 5490 O O   . GLN D 2 117 ? 50.353 -17.455 -39.554 1.00 45.80  ? 94  GLN E O   1 
ATOM 5491 C CB  . GLN D 2 117 ? 53.439 -17.561 -39.196 1.00 47.84  ? 94  GLN E CB  1 
ATOM 5492 C CG  . GLN D 2 117 ? 54.504 -17.011 -38.287 1.00 50.45  ? 94  GLN E CG  1 
ATOM 5493 C CD  . GLN D 2 117 ? 55.838 -17.730 -38.462 1.00 54.23  ? 94  GLN E CD  1 
ATOM 5494 O OE1 . GLN D 2 117 ? 55.952 -18.945 -38.257 1.00 55.05  ? 94  GLN E OE1 1 
ATOM 5495 N NE2 . GLN D 2 117 ? 56.862 -16.972 -38.834 1.00 55.32  ? 94  GLN E NE2 1 
ATOM 5496 N N   . PRO D 2 118 ? 51.163 -17.333 -41.684 1.00 45.06  ? 95  PRO E N   1 
ATOM 5497 C CA  . PRO D 2 118 ? 50.008 -17.889 -42.400 1.00 44.69  ? 95  PRO E CA  1 
ATOM 5498 C C   . PRO D 2 118 ? 49.846 -19.368 -42.202 1.00 46.45  ? 95  PRO E C   1 
ATOM 5499 O O   . PRO D 2 118 ? 50.787 -20.027 -41.731 1.00 47.93  ? 95  PRO E O   1 
ATOM 5500 C CB  . PRO D 2 118 ? 50.365 -17.653 -43.865 1.00 43.95  ? 95  PRO E CB  1 
ATOM 5501 C CG  . PRO D 2 118 ? 51.828 -17.677 -43.878 1.00 45.12  ? 95  PRO E CG  1 
ATOM 5502 C CD  . PRO D 2 118 ? 52.237 -16.971 -42.623 1.00 44.90  ? 95  PRO E CD  1 
ATOM 5503 N N   . ARG D 2 119 ? 48.675 -19.894 -42.579 1.00 46.68  ? 96  ARG E N   1 
ATOM 5504 C CA  . ARG D 2 119 ? 48.443 -21.350 -42.612 1.00 48.47  ? 96  ARG E CA  1 
ATOM 5505 C C   . ARG D 2 119 ? 47.979 -21.680 -44.009 1.00 47.77  ? 96  ARG E C   1 
ATOM 5506 O O   . ARG D 2 119 ? 47.174 -20.960 -44.587 1.00 46.63  ? 96  ARG E O   1 
ATOM 5507 C CB  . ARG D 2 119 ? 47.402 -21.798 -41.568 1.00 49.65  ? 96  ARG E CB  1 
ATOM 5508 C CG  . ARG D 2 119 ? 47.368 -20.921 -40.279 1.00 52.77  ? 96  ARG E CG  1 
ATOM 5509 C CD  . ARG D 2 119 ? 46.686 -21.582 -39.083 1.00 58.54  ? 96  ARG E CD  1 
ATOM 5510 N NE  . ARG D 2 119 ? 47.222 -22.929 -38.840 1.00 63.85  ? 96  ARG E NE  1 
ATOM 5511 C CZ  . ARG D 2 119 ? 47.719 -23.364 -37.685 1.00 66.34  ? 96  ARG E CZ  1 
ATOM 5512 N NH1 . ARG D 2 119 ? 47.756 -22.575 -36.610 1.00 67.67  ? 96  ARG E NH1 1 
ATOM 5513 N NH2 . ARG D 2 119 ? 48.173 -24.606 -37.609 1.00 67.36  ? 96  ARG E NH2 1 
ATOM 5514 N N   . VAL D 2 120 ? 48.493 -22.764 -44.568 1.00 49.07  ? 97  VAL E N   1 
ATOM 5515 C CA  . VAL D 2 120 ? 48.140 -23.114 -45.945 1.00 48.95  ? 97  VAL E CA  1 
ATOM 5516 C C   . VAL D 2 120 ? 47.480 -24.483 -46.066 1.00 50.44  ? 97  VAL E C   1 
ATOM 5517 O O   . VAL D 2 120 ? 47.824 -25.412 -45.361 1.00 51.19  ? 97  VAL E O   1 
ATOM 5518 C CB  . VAL D 2 120 ? 49.318 -22.826 -46.953 1.00 48.83  ? 97  VAL E CB  1 
ATOM 5519 C CG1 . VAL D 2 120 ? 50.662 -22.792 -46.243 1.00 49.24  ? 97  VAL E CG1 1 
ATOM 5520 C CG2 . VAL D 2 120 ? 49.310 -23.729 -48.167 1.00 47.83  ? 97  VAL E CG2 1 
ATOM 5521 N N   . ASN D 2 121 ? 46.488 -24.569 -46.947 1.00 51.06  ? 98  ASN E N   1 
ATOM 5522 C CA  . ASN D 2 121 ? 45.666 -25.748 -47.074 1.00 52.54  ? 98  ASN E CA  1 
ATOM 5523 C C   . ASN D 2 121 ? 45.325 -25.952 -48.533 1.00 53.14  ? 98  ASN E C   1 
ATOM 5524 O O   . ASN D 2 121 ? 44.756 -25.068 -49.147 1.00 52.68  ? 98  ASN E O   1 
ATOM 5525 C CB  . ASN D 2 121 ? 44.393 -25.567 -46.248 1.00 52.49  ? 98  ASN E CB  1 
ATOM 5526 C CG  . ASN D 2 121 ? 43.557 -26.837 -46.162 1.00 54.09  ? 98  ASN E CG  1 
ATOM 5527 O OD1 . ASN D 2 121 ? 42.834 -27.193 -47.098 1.00 52.94  ? 98  ASN E OD1 1 
ATOM 5528 N ND2 . ASN D 2 121 ? 43.643 -27.516 -45.024 1.00 54.62  ? 98  ASN E ND2 1 
ATOM 5529 N N   . VAL D 2 122 ? 45.679 -27.123 -49.069 1.00 55.45  ? 99  VAL E N   1 
ATOM 5530 C CA  . VAL D 2 122 ? 45.394 -27.525 -50.458 1.00 56.74  ? 99  VAL E CA  1 
ATOM 5531 C C   . VAL D 2 122 ? 44.254 -28.578 -50.519 1.00 59.21  ? 99  VAL E C   1 
ATOM 5532 O O   . VAL D 2 122 ? 44.230 -29.526 -49.746 1.00 60.39  ? 99  VAL E O   1 
ATOM 5533 C CB  . VAL D 2 122 ? 46.686 -28.049 -51.167 1.00 56.90  ? 99  VAL E CB  1 
ATOM 5534 C CG1 . VAL D 2 122 ? 46.360 -28.753 -52.438 1.00 58.23  ? 99  VAL E CG1 1 
ATOM 5535 C CG2 . VAL D 2 122 ? 47.649 -26.937 -51.458 1.00 54.90  ? 99  VAL E CG2 1 
ATOM 5536 N N   . SER D 2 123 ? 43.306 -28.373 -51.430 1.00 60.95  ? 100 SER E N   1 
ATOM 5537 C CA  . SER D 2 123 ? 42.134 -29.232 -51.619 1.00 64.09  ? 100 SER E CA  1 
ATOM 5538 C C   . SER D 2 123 ? 41.695 -29.096 -53.072 1.00 65.95  ? 100 SER E C   1 
ATOM 5539 O O   . SER D 2 123 ? 41.881 -28.029 -53.677 1.00 65.13  ? 100 SER E O   1 
ATOM 5540 C CB  . SER D 2 123 ? 40.959 -28.776 -50.740 1.00 63.96  ? 100 SER E CB  1 
ATOM 5541 O OG  . SER D 2 123 ? 41.338 -28.534 -49.401 1.00 63.70  ? 100 SER E OG  1 
ATOM 5542 N N   . PRO D 2 124 ? 41.102 -30.158 -53.644 1.00 69.11  ? 101 PRO E N   1 
ATOM 5543 C CA  . PRO D 2 124 ? 40.598 -30.103 -55.020 1.00 71.09  ? 101 PRO E CA  1 
ATOM 5544 C C   . PRO D 2 124 ? 39.189 -29.508 -55.191 1.00 72.95  ? 101 PRO E C   1 
ATOM 5545 O O   . PRO D 2 124 ? 38.580 -29.041 -54.226 1.00 72.76  ? 101 PRO E O   1 
ATOM 5546 C CB  . PRO D 2 124 ? 40.606 -31.575 -55.456 1.00 72.59  ? 101 PRO E CB  1 
ATOM 5547 C CG  . PRO D 2 124 ? 41.470 -32.282 -54.462 1.00 72.45  ? 101 PRO E CG  1 
ATOM 5548 C CD  . PRO D 2 124 ? 41.219 -31.549 -53.183 1.00 71.06  ? 101 PRO E CD  1 
ATOM 5549 N N   . SER D 2 125 ? 38.727 -29.503 -56.444 1.00 75.71  ? 102 SER E N   1 
ATOM 5550 C CA  . SER D 2 125 ? 37.349 -29.222 -56.852 1.00 78.27  ? 102 SER E CA  1 
ATOM 5551 C C   . SER D 2 125 ? 37.198 -29.611 -58.330 1.00 80.97  ? 102 SER E C   1 
ATOM 5552 O O   . SER D 2 125 ? 37.967 -29.147 -59.179 1.00 80.42  ? 102 SER E O   1 
ATOM 5553 C CB  . SER D 2 125 ? 36.979 -27.755 -56.633 1.00 76.84  ? 102 SER E CB  1 
ATOM 5554 O OG  . SER D 2 125 ? 36.395 -27.585 -55.357 1.00 76.79  ? 102 SER E OG  1 
ATOM 5555 N N   . LYS D 2 126 ? 36.231 -30.490 -58.616 1.00 84.62  ? 103 LYS E N   1 
ATOM 5556 C CA  . LYS D 2 126 ? 35.958 -30.999 -59.979 1.00 87.82  ? 103 LYS E CA  1 
ATOM 5557 C C   . LYS D 2 126 ? 34.743 -31.948 -60.049 1.00 91.12  ? 103 LYS E C   1 
ATOM 5558 O O   . LYS D 2 126 ? 34.519 -32.593 -61.096 1.00 93.10  ? 103 LYS E O   1 
ATOM 5559 C CB  . LYS D 2 126 ? 37.189 -31.712 -60.576 1.00 88.11  ? 103 LYS E CB  1 
ATOM 5560 C CG  . LYS D 2 126 ? 37.772 -32.851 -59.710 1.00 89.24  ? 103 LYS E CG  1 
ATOM 5561 C CD  . LYS D 2 126 ? 38.412 -33.950 -60.570 1.00 91.49  ? 103 LYS E CD  1 
ATOM 5562 C CE  . LYS D 2 126 ? 39.515 -34.706 -59.820 1.00 90.93  ? 103 LYS E CE  1 
ATOM 5563 N NZ  . LYS D 2 126 ? 39.989 -35.898 -60.589 1.00 91.15  ? 103 LYS E NZ  1 
ATOM 5564 N N   . LYS D 2 127 ? 33.964 -32.025 -58.956 1.00 92.15  ? 104 LYS E N   1 
ATOM 5565 C CA  . LYS D 2 127 ? 32.890 -33.055 -58.799 1.00 95.03  ? 104 LYS E CA  1 
ATOM 5566 C C   . LYS D 2 127 ? 31.495 -32.715 -59.380 1.00 96.60  ? 104 LYS E C   1 
ATOM 5567 O O   . LYS D 2 127 ? 30.954 -31.628 -59.148 1.00 95.81  ? 104 LYS E O   1 
ATOM 5568 C CB  . LYS D 2 127 ? 32.774 -33.525 -57.332 1.00 95.00  ? 104 LYS E CB  1 
ATOM 5569 C CG  . LYS D 2 127 ? 33.992 -34.311 -56.833 1.00 94.89  ? 104 LYS E CG  1 
ATOM 5570 C CD  . LYS D 2 127 ? 33.572 -35.581 -56.090 1.00 97.14  ? 104 LYS E CD  1 
ATOM 5571 C CE  . LYS D 2 127 ? 34.733 -36.574 -55.947 1.00 97.17  ? 104 LYS E CE  1 
ATOM 5572 N NZ  . LYS D 2 127 ? 35.138 -37.236 -57.232 1.00 97.12  ? 104 LYS E NZ  1 
ATOM 5573 N N   . GLY D 2 128 ? 30.933 -33.666 -60.129 1.00 99.04  ? 105 GLY E N   1 
ATOM 5574 C CA  . GLY D 2 128 ? 29.618 -33.515 -60.758 1.00 100.96 ? 105 GLY E CA  1 
ATOM 5575 C C   . GLY D 2 128 ? 28.973 -34.856 -61.066 1.00 103.83 ? 105 GLY E C   1 
ATOM 5576 O O   . GLY D 2 128 ? 29.396 -35.567 -61.987 1.00 104.75 ? 105 GLY E O   1 
ATOM 5577 N N   . HIS D 2 133 ? 35.711 -27.759 -65.130 1.00 77.53  ? 110 HIS E N   1 
ATOM 5578 C CA  . HIS D 2 133 ? 37.059 -27.503 -64.607 1.00 75.68  ? 110 HIS E CA  1 
ATOM 5579 C C   . HIS D 2 133 ? 37.844 -28.784 -64.191 1.00 75.37  ? 110 HIS E C   1 
ATOM 5580 O O   . HIS D 2 133 ? 37.722 -29.837 -64.836 1.00 77.45  ? 110 HIS E O   1 
ATOM 5581 C CB  . HIS D 2 133 ? 37.038 -26.428 -63.479 1.00 73.99  ? 110 HIS E CB  1 
ATOM 5582 C CG  . HIS D 2 133 ? 36.002 -26.651 -62.404 1.00 74.84  ? 110 HIS E CG  1 
ATOM 5583 N ND1 . HIS D 2 133 ? 35.178 -25.640 -61.945 1.00 75.47  ? 110 HIS E ND1 1 
ATOM 5584 C CD2 . HIS D 2 133 ? 35.676 -27.751 -61.682 1.00 75.82  ? 110 HIS E CD2 1 
ATOM 5585 C CE1 . HIS D 2 133 ? 34.386 -26.110 -60.997 1.00 75.28  ? 110 HIS E CE1 1 
ATOM 5586 N NE2 . HIS D 2 133 ? 34.667 -27.389 -60.820 1.00 76.54  ? 110 HIS E NE2 1 
ATOM 5587 N N   . ASN D 2 134 ? 38.636 -28.652 -63.121 1.00 72.46  ? 111 ASN E N   1 
ATOM 5588 C CA  . ASN D 2 134 ? 39.536 -29.655 -62.537 1.00 70.96  ? 111 ASN E CA  1 
ATOM 5589 C C   . ASN D 2 134 ? 40.580 -28.743 -61.906 1.00 67.66  ? 111 ASN E C   1 
ATOM 5590 O O   . ASN D 2 134 ? 41.428 -28.192 -62.598 1.00 67.33  ? 111 ASN E O   1 
ATOM 5591 C CB  . ASN D 2 134 ? 40.151 -30.582 -63.593 1.00 73.03  ? 111 ASN E CB  1 
ATOM 5592 C CG  . ASN D 2 134 ? 40.605 -31.934 -63.017 1.00 74.56  ? 111 ASN E CG  1 
ATOM 5593 O OD1 . ASN D 2 134 ? 40.587 -32.146 -61.799 1.00 74.34  ? 111 ASN E OD1 1 
ATOM 5594 N ND2 . ASN D 2 134 ? 41.023 -32.853 -63.904 1.00 75.02  ? 111 ASN E ND2 1 
ATOM 5595 N N   . LEU D 2 135 ? 40.486 -28.558 -60.594 1.00 64.83  ? 112 LEU E N   1 
ATOM 5596 C CA  . LEU D 2 135 ? 40.942 -27.329 -59.967 1.00 61.28  ? 112 LEU E CA  1 
ATOM 5597 C C   . LEU D 2 135 ? 41.475 -27.540 -58.548 1.00 59.24  ? 112 LEU E C   1 
ATOM 5598 O O   . LEU D 2 135 ? 40.765 -28.002 -57.668 1.00 59.33  ? 112 LEU E O   1 
ATOM 5599 C CB  . LEU D 2 135 ? 39.755 -26.371 -59.917 1.00 60.96  ? 112 LEU E CB  1 
ATOM 5600 C CG  . LEU D 2 135 ? 39.900 -24.863 -60.051 1.00 59.98  ? 112 LEU E CG  1 
ATOM 5601 C CD1 . LEU D 2 135 ? 40.012 -24.435 -61.525 1.00 61.07  ? 112 LEU E CD1 1 
ATOM 5602 C CD2 . LEU D 2 135 ? 38.688 -24.236 -59.406 1.00 59.75  ? 112 LEU E CD2 1 
ATOM 5603 N N   . LEU D 2 136 ? 42.728 -27.166 -58.334 1.00 56.89  ? 113 LEU E N   1 
ATOM 5604 C CA  . LEU D 2 136 ? 43.393 -27.306 -57.054 1.00 54.71  ? 113 LEU E CA  1 
ATOM 5605 C C   . LEU D 2 136 ? 43.386 -25.954 -56.319 1.00 52.27  ? 113 LEU E C   1 
ATOM 5606 O O   . LEU D 2 136 ? 43.710 -24.923 -56.921 1.00 51.38  ? 113 LEU E O   1 
ATOM 5607 C CB  . LEU D 2 136 ? 44.815 -27.754 -57.336 1.00 54.97  ? 113 LEU E CB  1 
ATOM 5608 C CG  . LEU D 2 136 ? 45.573 -28.658 -56.370 1.00 55.99  ? 113 LEU E CG  1 
ATOM 5609 C CD1 . LEU D 2 136 ? 44.819 -29.954 -56.085 1.00 57.85  ? 113 LEU E CD1 1 
ATOM 5610 C CD2 . LEU D 2 136 ? 46.930 -28.965 -56.958 1.00 55.36  ? 113 LEU E CD2 1 
ATOM 5611 N N   . VAL D 2 137 ? 43.007 -25.955 -55.036 1.00 50.27  ? 114 VAL E N   1 
ATOM 5612 C CA  . VAL D 2 137 ? 42.847 -24.701 -54.261 1.00 47.31  ? 114 VAL E CA  1 
ATOM 5613 C C   . VAL D 2 137 ? 43.875 -24.563 -53.133 1.00 45.87  ? 114 VAL E C   1 
ATOM 5614 O O   . VAL D 2 137 ? 44.024 -25.458 -52.311 1.00 46.26  ? 114 VAL E O   1 
ATOM 5615 C CB  . VAL D 2 137 ? 41.424 -24.580 -53.641 1.00 47.21  ? 114 VAL E CB  1 
ATOM 5616 C CG1 . VAL D 2 137 ? 41.244 -23.248 -52.955 1.00 45.24  ? 114 VAL E CG1 1 
ATOM 5617 C CG2 . VAL D 2 137 ? 40.355 -24.734 -54.702 1.00 48.56  ? 114 VAL E CG2 1 
ATOM 5618 N N   . CYS D 2 138 ? 44.574 -23.434 -53.088 1.00 43.93  ? 115 CYS E N   1 
ATOM 5619 C CA  . CYS D 2 138 ? 45.520 -23.152 -52.000 1.00 42.56  ? 115 CYS E CA  1 
ATOM 5620 C C   . CYS D 2 138 ? 44.977 -22.049 -51.076 1.00 40.97  ? 115 CYS E C   1 
ATOM 5621 O O   . CYS D 2 138 ? 45.192 -20.863 -51.295 1.00 40.19  ? 115 CYS E O   1 
ATOM 5622 C CB  . CYS D 2 138 ? 46.909 -22.794 -52.554 1.00 42.31  ? 115 CYS E CB  1 
ATOM 5623 S SG  . CYS D 2 138 ? 48.218 -22.561 -51.283 1.00 43.15  ? 115 CYS E SG  1 
ATOM 5624 N N   . HIS D 2 139 ? 44.253 -22.465 -50.047 1.00 40.66  ? 116 HIS E N   1 
ATOM 5625 C CA  . HIS D 2 139 ? 43.651 -21.560 -49.092 1.00 39.42  ? 116 HIS E CA  1 
ATOM 5626 C C   . HIS D 2 139 ? 44.731 -21.156 -48.116 1.00 38.80  ? 116 HIS E C   1 
ATOM 5627 O O   . HIS D 2 139 ? 45.291 -22.017 -47.411 1.00 40.17  ? 116 HIS E O   1 
ATOM 5628 C CB  . HIS D 2 139 ? 42.518 -22.266 -48.331 1.00 40.26  ? 116 HIS E CB  1 
ATOM 5629 C CG  . HIS D 2 139 ? 41.513 -21.337 -47.713 1.00 39.72  ? 116 HIS E CG  1 
ATOM 5630 N ND1 . HIS D 2 139 ? 41.772 -20.004 -47.458 1.00 37.67  ? 116 HIS E ND1 1 
ATOM 5631 C CD2 . HIS D 2 139 ? 40.251 -21.561 -47.277 1.00 39.78  ? 116 HIS E CD2 1 
ATOM 5632 C CE1 . HIS D 2 139 ? 40.703 -19.444 -46.922 1.00 36.28  ? 116 HIS E CE1 1 
ATOM 5633 N NE2 . HIS D 2 139 ? 39.766 -20.364 -46.804 1.00 37.97  ? 116 HIS E NE2 1 
ATOM 5634 N N   . VAL D 2 140 ? 45.023 -19.860 -48.074 1.00 36.97  ? 117 VAL E N   1 
ATOM 5635 C CA  . VAL D 2 140 ? 46.072 -19.314 -47.217 1.00 36.82  ? 117 VAL E CA  1 
ATOM 5636 C C   . VAL D 2 140 ? 45.453 -18.292 -46.248 1.00 36.49  ? 117 VAL E C   1 
ATOM 5637 O O   . VAL D 2 140 ? 44.803 -17.359 -46.701 1.00 36.74  ? 117 VAL E O   1 
ATOM 5638 C CB  . VAL D 2 140 ? 47.165 -18.662 -48.081 1.00 36.26  ? 117 VAL E CB  1 
ATOM 5639 C CG1 . VAL D 2 140 ? 48.278 -18.080 -47.220 1.00 36.23  ? 117 VAL E CG1 1 
ATOM 5640 C CG2 . VAL D 2 140 ? 47.714 -19.653 -49.067 1.00 36.87  ? 117 VAL E CG2 1 
ATOM 5641 N N   . THR D 2 141 ? 45.659 -18.457 -44.941 1.00 36.84  ? 118 THR E N   1 
ATOM 5642 C CA  . THR D 2 141 ? 44.854 -17.776 -43.926 1.00 37.11  ? 118 THR E CA  1 
ATOM 5643 C C   . THR D 2 141 ? 45.613 -17.212 -42.718 1.00 38.32  ? 118 THR E C   1 
ATOM 5644 O O   . THR D 2 141 ? 46.746 -17.588 -42.449 1.00 39.39  ? 118 THR E O   1 
ATOM 5645 C CB  . THR D 2 141 ? 43.837 -18.739 -43.313 1.00 37.80  ? 118 THR E CB  1 
ATOM 5646 O OG1 . THR D 2 141 ? 44.498 -19.944 -42.930 1.00 39.82  ? 118 THR E OG1 1 
ATOM 5647 C CG2 . THR D 2 141 ? 42.747 -19.072 -44.270 1.00 38.29  ? 118 THR E CG2 1 
ATOM 5648 N N   . ASP D 2 142 ? 44.954 -16.334 -41.956 1.00 38.75  ? 119 ASP E N   1 
ATOM 5649 C CA  . ASP D 2 142 ? 45.431 -15.935 -40.616 1.00 39.60  ? 119 ASP E CA  1 
ATOM 5650 C C   . ASP D 2 142 ? 46.802 -15.261 -40.584 1.00 39.21  ? 119 ASP E C   1 
ATOM 5651 O O   . ASP D 2 142 ? 47.532 -15.376 -39.593 1.00 40.02  ? 119 ASP E O   1 
ATOM 5652 C CB  . ASP D 2 142 ? 45.416 -17.134 -39.665 1.00 40.88  ? 119 ASP E CB  1 
ATOM 5653 C CG  . ASP D 2 142 ? 43.999 -17.589 -39.334 1.00 44.34  ? 119 ASP E CG  1 
ATOM 5654 O OD1 . ASP D 2 142 ? 43.037 -16.806 -39.558 1.00 46.14  ? 119 ASP E OD1 1 
ATOM 5655 O OD2 . ASP D 2 142 ? 43.831 -18.734 -38.855 1.00 47.59  ? 119 ASP E OD2 1 
ATOM 5656 N N   . PHE D 2 143 ? 47.145 -14.559 -41.660 1.00 37.34  ? 120 PHE E N   1 
ATOM 5657 C CA  . PHE D 2 143 ? 48.444 -13.911 -41.731 1.00 36.58  ? 120 PHE E CA  1 
ATOM 5658 C C   . PHE D 2 143 ? 48.318 -12.404 -41.625 1.00 35.10  ? 120 PHE E C   1 
ATOM 5659 O O   . PHE D 2 143 ? 47.295 -11.828 -41.944 1.00 34.69  ? 120 PHE E O   1 
ATOM 5660 C CB  . PHE D 2 143 ? 49.216 -14.316 -42.998 1.00 35.99  ? 120 PHE E CB  1 
ATOM 5661 C CG  . PHE D 2 143 ? 48.475 -14.038 -44.294 1.00 35.34  ? 120 PHE E CG  1 
ATOM 5662 C CD1 . PHE D 2 143 ? 47.639 -14.999 -44.862 1.00 35.73  ? 120 PHE E CD1 1 
ATOM 5663 C CD2 . PHE D 2 143 ? 48.611 -12.819 -44.945 1.00 34.40  ? 120 PHE E CD2 1 
ATOM 5664 C CE1 . PHE D 2 143 ? 46.986 -14.752 -46.062 1.00 33.68  ? 120 PHE E CE1 1 
ATOM 5665 C CE2 . PHE D 2 143 ? 47.952 -12.566 -46.140 1.00 32.11  ? 120 PHE E CE2 1 
ATOM 5666 C CZ  . PHE D 2 143 ? 47.146 -13.531 -46.695 1.00 32.70  ? 120 PHE E CZ  1 
ATOM 5667 N N   . TYR D 2 144 ? 49.369 -11.780 -41.140 1.00 34.98  ? 121 TYR E N   1 
ATOM 5668 C CA  . TYR D 2 144 ? 49.466 -10.349 -41.116 1.00 33.90  ? 121 TYR E CA  1 
ATOM 5669 C C   . TYR D 2 144 ? 50.950 -10.123 -41.358 1.00 34.39  ? 121 TYR E C   1 
ATOM 5670 O O   . TYR D 2 144 ? 51.748 -10.886 -40.838 1.00 35.04  ? 121 TYR E O   1 
ATOM 5671 C CB  . TYR D 2 144 ? 49.041 -9.813  -39.748 1.00 33.92  ? 121 TYR E CB  1 
ATOM 5672 C CG  . TYR D 2 144 ? 49.032 -8.310  -39.727 1.00 33.34  ? 121 TYR E CG  1 
ATOM 5673 C CD1 . TYR D 2 144 ? 50.154 -7.583  -39.293 1.00 32.56  ? 121 TYR E CD1 1 
ATOM 5674 C CD2 . TYR D 2 144 ? 47.922 -7.598  -40.202 1.00 30.02  ? 121 TYR E CD2 1 
ATOM 5675 C CE1 . TYR D 2 144 ? 50.148 -6.174  -39.325 1.00 30.92  ? 121 TYR E CE1 1 
ATOM 5676 C CE2 . TYR D 2 144 ? 47.894 -6.193  -40.214 1.00 26.96  ? 121 TYR E CE2 1 
ATOM 5677 C CZ  . TYR D 2 144 ? 48.992 -5.491  -39.778 1.00 27.96  ? 121 TYR E CZ  1 
ATOM 5678 O OH  . TYR D 2 144 ? 48.962 -4.121  -39.844 1.00 26.81  ? 121 TYR E OH  1 
ATOM 5679 N N   . PRO D 2 145 ? 51.331 -9.114  -42.167 1.00 34.02  ? 122 PRO E N   1 
ATOM 5680 C CA  . PRO D 2 145 ? 50.483 -8.191  -42.906 1.00 33.30  ? 122 PRO E CA  1 
ATOM 5681 C C   . PRO D 2 145 ? 50.076 -8.733  -44.295 1.00 33.34  ? 122 PRO E C   1 
ATOM 5682 O O   . PRO D 2 145 ? 50.197 -9.928  -44.568 1.00 34.27  ? 122 PRO E O   1 
ATOM 5683 C CB  . PRO D 2 145 ? 51.359 -6.919  -43.007 1.00 33.02  ? 122 PRO E CB  1 
ATOM 5684 C CG  . PRO D 2 145 ? 52.741 -7.363  -42.958 1.00 32.54  ? 122 PRO E CG  1 
ATOM 5685 C CD  . PRO D 2 145 ? 52.758 -8.759  -42.332 1.00 35.05  ? 122 PRO E CD  1 
ATOM 5686 N N   . GLY D 2 146 ? 49.611 -7.844  -45.149 1.00 33.12  ? 123 GLY E N   1 
ATOM 5687 C CA  . GLY D 2 146 ? 48.842 -8.215  -46.312 1.00 34.55  ? 123 GLY E CA  1 
ATOM 5688 C C   . GLY D 2 146 ? 49.644 -8.642  -47.510 1.00 36.06  ? 123 GLY E C   1 
ATOM 5689 O O   . GLY D 2 146 ? 49.241 -9.505  -48.260 1.00 36.99  ? 123 GLY E O   1 
ATOM 5690 N N   . SER D 2 147 ? 50.790 -8.038  -47.706 1.00 38.00  ? 124 SER E N   1 
ATOM 5691 C CA  . SER D 2 147 ? 51.669 -8.461  -48.776 1.00 39.75  ? 124 SER E CA  1 
ATOM 5692 C C   . SER D 2 147 ? 51.921 -9.937  -48.603 1.00 40.62  ? 124 SER E C   1 
ATOM 5693 O O   . SER D 2 147 ? 52.227 -10.373 -47.501 1.00 41.45  ? 124 SER E O   1 
ATOM 5694 C CB  . SER D 2 147 ? 52.991 -7.728  -48.664 1.00 40.53  ? 124 SER E CB  1 
ATOM 5695 O OG  . SER D 2 147 ? 53.310 -7.182  -49.910 1.00 42.84  ? 124 SER E OG  1 
ATOM 5696 N N   . ILE D 2 148 ? 51.788 -10.696 -49.687 1.00 41.31  ? 125 ILE E N   1 
ATOM 5697 C CA  . ILE D 2 148 ? 52.078 -12.129 -49.687 1.00 42.63  ? 125 ILE E CA  1 
ATOM 5698 C C   . ILE D 2 148 ? 52.361 -12.621 -51.117 1.00 43.57  ? 125 ILE E C   1 
ATOM 5699 O O   . ILE D 2 148 ? 51.751 -12.155 -52.066 1.00 43.15  ? 125 ILE E O   1 
ATOM 5700 C CB  . ILE D 2 148 ? 50.903 -12.927 -49.043 1.00 42.61  ? 125 ILE E CB  1 
ATOM 5701 C CG1 . ILE D 2 148 ? 51.333 -14.356 -48.698 1.00 44.32  ? 125 ILE E CG1 1 
ATOM 5702 C CG2 . ILE D 2 148 ? 49.635 -12.878 -49.922 1.00 41.28  ? 125 ILE E CG2 1 
ATOM 5703 C CD1 . ILE D 2 148 ? 50.772 -14.867 -47.371 1.00 45.57  ? 125 ILE E CD1 1 
ATOM 5704 N N   . GLN D 2 149 ? 53.281 -13.554 -51.282 1.00 44.95  ? 126 GLN E N   1 
ATOM 5705 C CA  . GLN D 2 149 ? 53.503 -14.090 -52.611 1.00 46.93  ? 126 GLN E CA  1 
ATOM 5706 C C   . GLN D 2 149 ? 53.132 -15.549 -52.614 1.00 46.66  ? 126 GLN E C   1 
ATOM 5707 O O   . GLN D 2 149 ? 53.557 -16.295 -51.734 1.00 47.51  ? 126 GLN E O   1 
ATOM 5708 C CB  . GLN D 2 149 ? 54.964 -13.953 -53.035 1.00 49.30  ? 126 GLN E CB  1 
ATOM 5709 C CG  . GLN D 2 149 ? 55.543 -12.524 -53.017 1.00 54.00  ? 126 GLN E CG  1 
ATOM 5710 C CD  . GLN D 2 149 ? 56.964 -12.499 -52.412 1.00 60.71  ? 126 GLN E CD  1 
ATOM 5711 O OE1 . GLN D 2 149 ? 57.980 -12.620 -53.137 1.00 63.19  ? 126 GLN E OE1 1 
ATOM 5712 N NE2 . GLN D 2 149 ? 57.033 -12.375 -51.068 1.00 60.29  ? 126 GLN E NE2 1 
ATOM 5713 N N   . VAL D 2 150 ? 52.345 -15.961 -53.600 1.00 45.66  ? 127 VAL E N   1 
ATOM 5714 C CA  . VAL D 2 150 ? 51.893 -17.342 -53.672 1.00 45.32  ? 127 VAL E CA  1 
ATOM 5715 C C   . VAL D 2 150 ? 52.170 -17.847 -55.066 1.00 46.55  ? 127 VAL E C   1 
ATOM 5716 O O   . VAL D 2 150 ? 51.629 -17.322 -56.033 1.00 46.74  ? 127 VAL E O   1 
ATOM 5717 C CB  . VAL D 2 150 ? 50.381 -17.486 -53.393 1.00 44.40  ? 127 VAL E CB  1 
ATOM 5718 C CG1 . VAL D 2 150 ? 49.958 -18.948 -53.494 1.00 44.82  ? 127 VAL E CG1 1 
ATOM 5719 C CG2 . VAL D 2 150 ? 50.020 -16.921 -52.037 1.00 41.70  ? 127 VAL E CG2 1 
ATOM 5720 N N   . ARG D 2 151 ? 53.004 -18.879 -55.153 1.00 47.54  ? 128 ARG E N   1 
ATOM 5721 C CA  . ARG D 2 151 ? 53.362 -19.492 -56.405 1.00 48.30  ? 128 ARG E CA  1 
ATOM 5722 C C   . ARG D 2 151 ? 52.916 -20.963 -56.457 1.00 48.92  ? 128 ARG E C   1 
ATOM 5723 O O   . ARG D 2 151 ? 52.740 -21.610 -55.411 1.00 48.87  ? 128 ARG E O   1 
ATOM 5724 C CB  . ARG D 2 151 ? 54.858 -19.298 -56.641 1.00 49.79  ? 128 ARG E CB  1 
ATOM 5725 C CG  . ARG D 2 151 ? 55.160 -17.875 -57.143 1.00 50.96  ? 128 ARG E CG  1 
ATOM 5726 C CD  . ARG D 2 151 ? 56.621 -17.399 -57.137 1.00 53.65  ? 128 ARG E CD  1 
ATOM 5727 N NE  . ARG D 2 151 ? 56.584 -15.947 -57.387 1.00 58.77  ? 128 ARG E NE  1 
ATOM 5728 C CZ  . ARG D 2 151 ? 57.617 -15.136 -57.660 1.00 61.18  ? 128 ARG E CZ  1 
ATOM 5729 N NH1 . ARG D 2 151 ? 58.863 -15.597 -57.739 1.00 63.49  ? 128 ARG E NH1 1 
ATOM 5730 N NH2 . ARG D 2 151 ? 57.394 -13.831 -57.852 1.00 60.73  ? 128 ARG E NH2 1 
ATOM 5731 N N   . TRP D 2 152 ? 52.699 -21.469 -57.674 1.00 49.33  ? 129 TRP E N   1 
ATOM 5732 C CA  . TRP D 2 152 ? 52.250 -22.839 -57.924 1.00 49.74  ? 129 TRP E CA  1 
ATOM 5733 C C   . TRP D 2 152 ? 53.277 -23.573 -58.762 1.00 51.77  ? 129 TRP E C   1 
ATOM 5734 O O   . TRP D 2 152 ? 53.726 -23.059 -59.798 1.00 52.26  ? 129 TRP E O   1 
ATOM 5735 C CB  . TRP D 2 152 ? 50.945 -22.826 -58.716 1.00 49.51  ? 129 TRP E CB  1 
ATOM 5736 C CG  . TRP D 2 152 ? 49.706 -22.934 -57.901 1.00 48.30  ? 129 TRP E CG  1 
ATOM 5737 C CD1 . TRP D 2 152 ? 48.725 -21.988 -57.765 1.00 47.31  ? 129 TRP E CD1 1 
ATOM 5738 C CD2 . TRP D 2 152 ? 49.301 -24.046 -57.108 1.00 47.22  ? 129 TRP E CD2 1 
ATOM 5739 N NE1 . TRP D 2 152 ? 47.737 -22.445 -56.931 1.00 46.27  ? 129 TRP E NE1 1 
ATOM 5740 C CE2 . TRP D 2 152 ? 48.068 -23.708 -56.514 1.00 47.26  ? 129 TRP E CE2 1 
ATOM 5741 C CE3 . TRP D 2 152 ? 49.864 -25.294 -56.834 1.00 47.74  ? 129 TRP E CE3 1 
ATOM 5742 C CZ2 . TRP D 2 152 ? 47.381 -24.582 -55.675 1.00 47.34  ? 129 TRP E CZ2 1 
ATOM 5743 C CZ3 . TRP D 2 152 ? 49.193 -26.152 -55.997 1.00 48.50  ? 129 TRP E CZ3 1 
ATOM 5744 C CH2 . TRP D 2 152 ? 47.961 -25.792 -55.423 1.00 47.87  ? 129 TRP E CH2 1 
ATOM 5745 N N   . PHE D 2 153 ? 53.627 -24.780 -58.339 1.00 52.79  ? 130 PHE E N   1 
ATOM 5746 C CA  . PHE D 2 153 ? 54.612 -25.571 -59.056 1.00 55.04  ? 130 PHE E CA  1 
ATOM 5747 C C   . PHE D 2 153 ? 54.048 -26.919 -59.443 1.00 56.58  ? 130 PHE E C   1 
ATOM 5748 O O   . PHE D 2 153 ? 53.285 -27.520 -58.682 1.00 56.53  ? 130 PHE E O   1 
ATOM 5749 C CB  . PHE D 2 153 ? 55.864 -25.768 -58.197 1.00 55.54  ? 130 PHE E CB  1 
ATOM 5750 C CG  . PHE D 2 153 ? 56.685 -24.525 -58.044 1.00 54.76  ? 130 PHE E CG  1 
ATOM 5751 C CD1 . PHE D 2 153 ? 56.304 -23.529 -57.142 1.00 52.29  ? 130 PHE E CD1 1 
ATOM 5752 C CD2 . PHE D 2 153 ? 57.826 -24.341 -58.816 1.00 54.94  ? 130 PHE E CD2 1 
ATOM 5753 C CE1 . PHE D 2 153 ? 57.049 -22.365 -57.011 1.00 52.85  ? 130 PHE E CE1 1 
ATOM 5754 C CE2 . PHE D 2 153 ? 58.582 -23.190 -58.700 1.00 55.37  ? 130 PHE E CE2 1 
ATOM 5755 C CZ  . PHE D 2 153 ? 58.197 -22.189 -57.794 1.00 54.89  ? 130 PHE E CZ  1 
ATOM 5756 N N   . LEU D 2 154 ? 54.416 -27.384 -60.631 1.00 58.36  ? 131 LEU E N   1 
ATOM 5757 C CA  . LEU D 2 154 ? 54.157 -28.762 -61.016 1.00 60.16  ? 131 LEU E CA  1 
ATOM 5758 C C   . LEU D 2 154 ? 55.496 -29.389 -61.313 1.00 62.18  ? 131 LEU E C   1 
ATOM 5759 O O   . LEU D 2 154 ? 56.317 -28.792 -62.014 1.00 63.31  ? 131 LEU E O   1 
ATOM 5760 C CB  . LEU D 2 154 ? 53.227 -28.841 -62.228 1.00 60.74  ? 131 LEU E CB  1 
ATOM 5761 C CG  . LEU D 2 154 ? 52.521 -30.154 -62.620 1.00 61.40  ? 131 LEU E CG  1 
ATOM 5762 C CD1 . LEU D 2 154 ? 53.059 -30.674 -63.925 1.00 63.06  ? 131 LEU E CD1 1 
ATOM 5763 C CD2 . LEU D 2 154 ? 52.568 -31.227 -61.527 1.00 61.36  ? 131 LEU E CD2 1 
ATOM 5764 N N   . ASN D 2 155 ? 55.727 -30.570 -60.741 1.00 63.37  ? 132 ASN E N   1 
ATOM 5765 C CA  . ASN D 2 155 ? 57.000 -31.295 -60.875 1.00 65.21  ? 132 ASN E CA  1 
ATOM 5766 C C   . ASN D 2 155 ? 58.267 -30.450 -60.655 1.00 65.32  ? 132 ASN E C   1 
ATOM 5767 O O   . ASN D 2 155 ? 59.321 -30.710 -61.231 1.00 66.97  ? 132 ASN E O   1 
ATOM 5768 C CB  . ASN D 2 155 ? 57.051 -32.036 -62.213 1.00 66.97  ? 132 ASN E CB  1 
ATOM 5769 C CG  . ASN D 2 155 ? 55.968 -33.087 -62.333 1.00 67.48  ? 132 ASN E CG  1 
ATOM 5770 O OD1 . ASN D 2 155 ? 55.586 -33.725 -61.345 1.00 66.26  ? 132 ASN E OD1 1 
ATOM 5771 N ND2 . ASN D 2 155 ? 55.461 -33.274 -63.554 1.00 68.91  ? 132 ASN E ND2 1 
ATOM 5772 N N   . GLY D 2 156 ? 58.153 -29.456 -59.789 1.00 63.83  ? 133 GLY E N   1 
ATOM 5773 C CA  . GLY D 2 156 ? 59.245 -28.547 -59.532 1.00 64.11  ? 133 GLY E CA  1 
ATOM 5774 C C   . GLY D 2 156 ? 59.554 -27.659 -60.715 1.00 64.50  ? 133 GLY E C   1 
ATOM 5775 O O   . GLY D 2 156 ? 60.720 -27.414 -61.001 1.00 66.14  ? 133 GLY E O   1 
ATOM 5776 N N   . GLN D 2 157 ? 58.518 -27.223 -61.433 1.00 63.50  ? 134 GLN E N   1 
ATOM 5777 C CA  . GLN D 2 157 ? 58.613 -26.061 -62.327 1.00 63.36  ? 134 GLN E CA  1 
ATOM 5778 C C   . GLN D 2 157 ? 57.352 -25.216 -62.149 1.00 61.24  ? 134 GLN E C   1 
ATOM 5779 O O   . GLN D 2 157 ? 56.245 -25.749 -62.047 1.00 60.56  ? 134 GLN E O   1 
ATOM 5780 C CB  . GLN D 2 157 ? 58.845 -26.448 -63.800 1.00 65.39  ? 134 GLN E CB  1 
ATOM 5781 C CG  . GLN D 2 157 ? 60.219 -27.124 -64.109 1.00 68.10  ? 134 GLN E CG  1 
ATOM 5782 C CD  . GLN D 2 157 ? 60.688 -26.961 -65.571 1.00 71.13  ? 134 GLN E CD  1 
ATOM 5783 O OE1 . GLN D 2 157 ? 60.894 -27.950 -66.293 1.00 71.22  ? 134 GLN E OE1 1 
ATOM 5784 N NE2 . GLN D 2 157 ? 60.873 -25.708 -66.002 1.00 71.53  ? 134 GLN E NE2 1 
ATOM 5785 N N   . GLU D 2 158 ? 57.531 -23.900 -62.075 1.00 60.16  ? 135 GLU E N   1 
ATOM 5786 C CA  . GLU D 2 158 ? 56.418 -22.995 -61.802 1.00 58.42  ? 135 GLU E CA  1 
ATOM 5787 C C   . GLU D 2 158 ? 55.374 -23.024 -62.907 1.00 58.66  ? 135 GLU E C   1 
ATOM 5788 O O   . GLU D 2 158 ? 55.701 -22.962 -64.083 1.00 60.03  ? 135 GLU E O   1 
ATOM 5789 C CB  . GLU D 2 158 ? 56.884 -21.549 -61.558 1.00 57.35  ? 135 GLU E CB  1 
ATOM 5790 C CG  . GLU D 2 158 ? 55.935 -20.757 -60.655 1.00 55.28  ? 135 GLU E CG  1 
ATOM 5791 C CD  . GLU D 2 158 ? 56.048 -19.244 -60.797 1.00 54.49  ? 135 GLU E CD  1 
ATOM 5792 O OE1 . GLU D 2 158 ? 55.101 -18.533 -60.393 1.00 52.60  ? 135 GLU E OE1 1 
ATOM 5793 O OE2 . GLU D 2 158 ? 57.076 -18.762 -61.304 1.00 56.07  ? 135 GLU E OE2 1 
ATOM 5794 N N   . GLU D 2 159 ? 54.115 -23.134 -62.505 1.00 57.91  ? 136 GLU E N   1 
ATOM 5795 C CA  . GLU D 2 159 ? 52.993 -22.960 -63.412 1.00 58.01  ? 136 GLU E CA  1 
ATOM 5796 C C   . GLU D 2 159 ? 52.372 -21.585 -63.218 1.00 56.36  ? 136 GLU E C   1 
ATOM 5797 O O   . GLU D 2 159 ? 52.011 -21.216 -62.097 1.00 55.61  ? 136 GLU E O   1 
ATOM 5798 C CB  . GLU D 2 159 ? 51.950 -24.064 -63.195 1.00 58.27  ? 136 GLU E CB  1 
ATOM 5799 C CG  . GLU D 2 159 ? 52.159 -25.292 -64.081 1.00 61.40  ? 136 GLU E CG  1 
ATOM 5800 C CD  . GLU D 2 159 ? 52.287 -24.930 -65.579 1.00 66.44  ? 136 GLU E CD  1 
ATOM 5801 O OE1 . GLU D 2 159 ? 52.933 -25.720 -66.322 1.00 68.24  ? 136 GLU E OE1 1 
ATOM 5802 O OE2 . GLU D 2 159 ? 51.753 -23.859 -66.012 1.00 66.12  ? 136 GLU E OE2 1 
ATOM 5803 N N   . THR D 2 160 ? 52.264 -20.828 -64.303 1.00 56.29  ? 137 THR E N   1 
ATOM 5804 C CA  . THR D 2 160 ? 51.668 -19.497 -64.261 1.00 54.65  ? 137 THR E CA  1 
ATOM 5805 C C   . THR D 2 160 ? 50.309 -19.434 -64.956 1.00 54.28  ? 137 THR E C   1 
ATOM 5806 O O   . THR D 2 160 ? 49.485 -18.578 -64.629 1.00 53.54  ? 137 THR E O   1 
ATOM 5807 C CB  . THR D 2 160 ? 52.552 -18.435 -64.944 1.00 55.61  ? 137 THR E CB  1 
ATOM 5808 O OG1 . THR D 2 160 ? 53.741 -19.034 -65.493 1.00 58.02  ? 137 THR E OG1 1 
ATOM 5809 C CG2 . THR D 2 160 ? 52.877 -17.300 -63.961 1.00 53.87  ? 137 THR E CG2 1 
ATOM 5810 N N   . ALA D 2 161 ? 50.098 -20.302 -65.947 1.00 54.86  ? 138 ALA E N   1 
ATOM 5811 C CA  . ALA D 2 161 ? 48.844 -20.373 -66.702 1.00 54.12  ? 138 ALA E CA  1 
ATOM 5812 C C   . ALA D 2 161 ? 47.676 -20.874 -65.858 1.00 52.64  ? 138 ALA E C   1 
ATOM 5813 O O   . ALA D 2 161 ? 47.828 -21.786 -65.049 1.00 51.54  ? 138 ALA E O   1 
ATOM 5814 C CB  . ALA D 2 161 ? 49.018 -21.267 -67.888 1.00 56.11  ? 138 ALA E CB  1 
ATOM 5815 N N   . GLY D 2 162 ? 46.507 -20.278 -66.074 1.00 51.94  ? 139 GLY E N   1 
ATOM 5816 C CA  . GLY D 2 162 ? 45.270 -20.754 -65.474 1.00 51.21  ? 139 GLY E CA  1 
ATOM 5817 C C   . GLY D 2 162 ? 45.369 -20.719 -63.975 1.00 49.47  ? 139 GLY E C   1 
ATOM 5818 O O   . GLY D 2 162 ? 45.101 -21.707 -63.298 1.00 49.43  ? 139 GLY E O   1 
ATOM 5819 N N   . VAL D 2 163 ? 45.790 -19.576 -63.459 1.00 47.83  ? 140 VAL E N   1 
ATOM 5820 C CA  . VAL D 2 163 ? 45.843 -19.386 -62.037 1.00 46.21  ? 140 VAL E CA  1 
ATOM 5821 C C   . VAL D 2 163 ? 44.927 -18.212 -61.761 1.00 45.97  ? 140 VAL E C   1 
ATOM 5822 O O   . VAL D 2 163 ? 45.008 -17.174 -62.418 1.00 46.40  ? 140 VAL E O   1 
ATOM 5823 C CB  . VAL D 2 163 ? 47.301 -19.175 -61.540 1.00 45.18  ? 140 VAL E CB  1 
ATOM 5824 C CG1 . VAL D 2 163 ? 47.336 -18.783 -60.089 1.00 43.94  ? 140 VAL E CG1 1 
ATOM 5825 C CG2 . VAL D 2 163 ? 48.082 -20.435 -61.691 1.00 45.18  ? 140 VAL E CG2 1 
ATOM 5826 N N   . VAL D 2 164 ? 44.011 -18.409 -60.829 1.00 45.85  ? 141 VAL E N   1 
ATOM 5827 C CA  . VAL D 2 164 ? 43.088 -17.366 -60.414 1.00 45.74  ? 141 VAL E CA  1 
ATOM 5828 C C   . VAL D 2 164 ? 43.338 -17.145 -58.939 1.00 44.94  ? 141 VAL E C   1 
ATOM 5829 O O   . VAL D 2 164 ? 43.350 -18.098 -58.150 1.00 44.82  ? 141 VAL E O   1 
ATOM 5830 C CB  . VAL D 2 164 ? 41.607 -17.807 -60.550 1.00 46.58  ? 141 VAL E CB  1 
ATOM 5831 C CG1 . VAL D 2 164 ? 40.654 -16.698 -60.087 1.00 45.33  ? 141 VAL E CG1 1 
ATOM 5832 C CG2 . VAL D 2 164 ? 41.291 -18.259 -61.960 1.00 48.19  ? 141 VAL E CG2 1 
ATOM 5833 N N   . SER D 2 165 ? 43.540 -15.895 -58.558 1.00 44.54  ? 142 SER E N   1 
ATOM 5834 C CA  . SER D 2 165 ? 43.552 -15.584 -57.142 1.00 44.10  ? 142 SER E CA  1 
ATOM 5835 C C   . SER D 2 165 ? 42.439 -14.600 -56.775 1.00 43.89  ? 142 SER E C   1 
ATOM 5836 O O   . SER D 2 165 ? 42.118 -13.666 -57.538 1.00 43.67  ? 142 SER E O   1 
ATOM 5837 C CB  . SER D 2 165 ? 44.934 -15.133 -56.669 1.00 43.66  ? 142 SER E CB  1 
ATOM 5838 O OG  . SER D 2 165 ? 45.253 -13.843 -57.127 1.00 43.76  ? 142 SER E OG  1 
ATOM 5839 N N   . THR D 2 166 ? 41.807 -14.863 -55.632 1.00 43.77  ? 143 THR E N   1 
ATOM 5840 C CA  . THR D 2 166 ? 40.866 -13.932 -55.063 1.00 43.63  ? 143 THR E CA  1 
ATOM 5841 C C   . THR D 2 166 ? 41.630 -12.642 -54.809 1.00 43.45  ? 143 THR E C   1 
ATOM 5842 O O   . THR D 2 166 ? 42.867 -12.663 -54.660 1.00 43.14  ? 143 THR E O   1 
ATOM 5843 C CB  . THR D 2 166 ? 40.307 -14.438 -53.728 1.00 43.53  ? 143 THR E CB  1 
ATOM 5844 O OG1 . THR D 2 166 ? 41.325 -14.406 -52.709 1.00 42.52  ? 143 THR E OG1 1 
ATOM 5845 C CG2 . THR D 2 166 ? 39.768 -15.837 -53.876 1.00 44.17  ? 143 THR E CG2 1 
ATOM 5846 N N   . ASN D 2 167 ? 40.924 -11.518 -54.760 1.00 43.61  ? 144 ASN E N   1 
ATOM 5847 C CA  . ASN D 2 167 ? 41.577 -10.331 -54.247 1.00 43.66  ? 144 ASN E CA  1 
ATOM 5848 C C   . ASN D 2 167 ? 41.908 -10.589 -52.774 1.00 42.57  ? 144 ASN E C   1 
ATOM 5849 O O   . ASN D 2 167 ? 41.472 -11.595 -52.198 1.00 42.82  ? 144 ASN E O   1 
ATOM 5850 C CB  . ASN D 2 167 ? 40.772 -9.032  -54.498 1.00 44.04  ? 144 ASN E CB  1 
ATOM 5851 C CG  . ASN D 2 167 ? 41.710 -7.797  -54.827 1.00 47.44  ? 144 ASN E CG  1 
ATOM 5852 O OD1 . ASN D 2 167 ? 41.457 -7.011  -55.794 1.00 50.28  ? 144 ASN E OD1 1 
ATOM 5853 N ND2 . ASN D 2 167 ? 42.804 -7.648  -54.035 1.00 44.45  ? 144 ASN E ND2 1 
ATOM 5854 N N   . LEU D 2 168 ? 42.722 -9.717  -52.191 1.00 41.80  ? 145 LEU E N   1 
ATOM 5855 C CA  . LEU D 2 168 ? 43.120 -9.837  -50.787 1.00 40.89  ? 145 LEU E CA  1 
ATOM 5856 C C   . LEU D 2 168 ? 41.932 -9.677  -49.833 1.00 40.35  ? 145 LEU E C   1 
ATOM 5857 O O   . LEU D 2 168 ? 41.141 -8.730  -49.913 1.00 39.84  ? 145 LEU E O   1 
ATOM 5858 C CB  . LEU D 2 168 ? 44.226 -8.851  -50.449 1.00 40.11  ? 145 LEU E CB  1 
ATOM 5859 C CG  . LEU D 2 168 ? 44.948 -9.133  -49.134 1.00 41.20  ? 145 LEU E CG  1 
ATOM 5860 C CD1 . LEU D 2 168 ? 45.540 -10.523 -49.118 1.00 41.45  ? 145 LEU E CD1 1 
ATOM 5861 C CD2 . LEU D 2 168 ? 46.031 -8.102  -48.868 1.00 40.95  ? 145 LEU E CD2 1 
ATOM 5862 N N   . ILE D 2 169 ? 41.797 -10.634 -48.935 1.00 40.10  ? 146 ILE E N   1 
ATOM 5863 C CA  . ILE D 2 169 ? 40.606 -10.665 -48.126 1.00 39.72  ? 146 ILE E CA  1 
ATOM 5864 C C   . ILE D 2 169 ? 40.913 -10.181 -46.730 1.00 39.32  ? 146 ILE E C   1 
ATOM 5865 O O   . ILE D 2 169 ? 41.648 -10.806 -45.970 1.00 39.42  ? 146 ILE E O   1 
ATOM 5866 C CB  . ILE D 2 169 ? 39.929 -12.044 -48.141 1.00 40.26  ? 146 ILE E CB  1 
ATOM 5867 C CG1 . ILE D 2 169 ? 39.332 -12.292 -49.534 1.00 39.76  ? 146 ILE E CG1 1 
ATOM 5868 C CG2 . ILE D 2 169 ? 38.842 -12.079 -47.100 1.00 39.48  ? 146 ILE E CG2 1 
ATOM 5869 C CD1 . ILE D 2 169 ? 38.800 -13.703 -49.762 1.00 39.23  ? 146 ILE E CD1 1 
ATOM 5870 N N   . ARG D 2 170 ? 40.364 -9.032  -46.410 1.00 38.84  ? 147 ARG E N   1 
ATOM 5871 C CA  . ARG D 2 170 ? 40.546 -8.526  -45.086 1.00 39.28  ? 147 ARG E CA  1 
ATOM 5872 C C   . ARG D 2 170 ? 39.576 -9.303  -44.213 1.00 40.14  ? 147 ARG E C   1 
ATOM 5873 O O   . ARG D 2 170 ? 38.396 -9.373  -44.538 1.00 41.32  ? 147 ARG E O   1 
ATOM 5874 C CB  . ARG D 2 170 ? 40.221 -7.051  -45.095 1.00 38.60  ? 147 ARG E CB  1 
ATOM 5875 C CG  . ARG D 2 170 ? 40.463 -6.374  -43.794 1.00 39.10  ? 147 ARG E CG  1 
ATOM 5876 C CD  . ARG D 2 170 ? 40.567 -4.893  -44.017 1.00 37.69  ? 147 ARG E CD  1 
ATOM 5877 N NE  . ARG D 2 170 ? 41.958 -4.469  -44.184 1.00 35.97  ? 147 ARG E NE  1 
ATOM 5878 C CZ  . ARG D 2 170 ? 42.446 -3.938  -45.288 1.00 34.73  ? 147 ARG E CZ  1 
ATOM 5879 N NH1 . ARG D 2 170 ? 41.650 -3.797  -46.356 1.00 38.39  ? 147 ARG E NH1 1 
ATOM 5880 N NH2 . ARG D 2 170 ? 43.708 -3.545  -45.322 1.00 30.72  ? 147 ARG E NH2 1 
ATOM 5881 N N   . ASN D 2 171 ? 40.036 -9.924  -43.136 1.00 40.11  ? 148 ASN E N   1 
ATOM 5882 C CA  . ASN D 2 171 ? 39.051 -10.534 -42.255 1.00 40.93  ? 148 ASN E CA  1 
ATOM 5883 C C   . ASN D 2 171 ? 38.422 -9.477  -41.348 1.00 41.10  ? 148 ASN E C   1 
ATOM 5884 O O   . ASN D 2 171 ? 37.373 -9.701  -40.771 1.00 42.75  ? 148 ASN E O   1 
ATOM 5885 C CB  . ASN D 2 171 ? 39.622 -11.685 -41.419 1.00 41.69  ? 148 ASN E CB  1 
ATOM 5886 C CG  . ASN D 2 171 ? 40.110 -12.869 -42.264 1.00 41.70  ? 148 ASN E CG  1 
ATOM 5887 O OD1 . ASN D 2 171 ? 39.451 -13.308 -43.209 1.00 39.46  ? 148 ASN E OD1 1 
ATOM 5888 N ND2 . ASN D 2 171 ? 41.275 -13.399 -41.901 1.00 41.18  ? 148 ASN E ND2 1 
ATOM 5889 N N   . GLY D 2 172 ? 39.056 -8.320  -41.221 1.00 40.52  ? 149 GLY E N   1 
ATOM 5890 C CA  . GLY D 2 172 ? 38.553 -7.265  -40.330 1.00 40.41  ? 149 GLY E CA  1 
ATOM 5891 C C   . GLY D 2 172 ? 38.871 -7.505  -38.852 1.00 41.50  ? 149 GLY E C   1 
ATOM 5892 O O   . GLY D 2 172 ? 38.362 -6.795  -37.976 1.00 42.58  ? 149 GLY E O   1 
ATOM 5893 N N   . ASP D 2 173 ? 39.689 -8.514  -38.564 1.00 41.07  ? 150 ASP E N   1 
ATOM 5894 C CA  . ASP D 2 173 ? 40.160 -8.761  -37.206 1.00 41.34  ? 150 ASP E CA  1 
ATOM 5895 C C   . ASP D 2 173 ? 41.682 -8.674  -37.174 1.00 39.89  ? 150 ASP E C   1 
ATOM 5896 O O   . ASP D 2 173 ? 42.322 -9.221  -36.286 1.00 40.69  ? 150 ASP E O   1 
ATOM 5897 C CB  . ASP D 2 173 ? 39.699 -10.133 -36.715 1.00 43.04  ? 150 ASP E CB  1 
ATOM 5898 C CG  . ASP D 2 173 ? 40.263 -11.289 -37.558 1.00 45.47  ? 150 ASP E CG  1 
ATOM 5899 O OD1 . ASP D 2 173 ? 40.366 -11.175 -38.804 1.00 46.47  ? 150 ASP E OD1 1 
ATOM 5900 O OD2 . ASP D 2 173 ? 40.610 -12.331 -36.966 1.00 49.93  ? 150 ASP E OD2 1 
ATOM 5901 N N   . TRP D 2 174 ? 42.258 -8.006  -38.170 1.00 37.16  ? 151 TRP E N   1 
ATOM 5902 C CA  . TRP D 2 174 ? 43.711 -7.876  -38.259 1.00 35.32  ? 151 TRP E CA  1 
ATOM 5903 C C   . TRP D 2 174 ? 44.360 -9.182  -38.706 1.00 34.59  ? 151 TRP E C   1 
ATOM 5904 O O   . TRP D 2 174 ? 45.516 -9.453  -38.389 1.00 35.45  ? 151 TRP E O   1 
ATOM 5905 C CB  . TRP D 2 174 ? 44.326 -7.399  -36.939 1.00 35.78  ? 151 TRP E CB  1 
ATOM 5906 C CG  . TRP D 2 174 ? 44.142 -5.927  -36.609 1.00 34.40  ? 151 TRP E CG  1 
ATOM 5907 C CD1 . TRP D 2 174 ? 42.986 -5.319  -36.210 1.00 33.63  ? 151 TRP E CD1 1 
ATOM 5908 C CD2 . TRP D 2 174 ? 45.159 -4.907  -36.572 1.00 31.87  ? 151 TRP E CD2 1 
ATOM 5909 N NE1 . TRP D 2 174 ? 43.211 -3.987  -35.955 1.00 32.60  ? 151 TRP E NE1 1 
ATOM 5910 C CE2 . TRP D 2 174 ? 44.531 -3.705  -36.175 1.00 31.29  ? 151 TRP E CE2 1 
ATOM 5911 C CE3 . TRP D 2 174 ? 46.536 -4.897  -36.822 1.00 32.58  ? 151 TRP E CE3 1 
ATOM 5912 C CZ2 . TRP D 2 174 ? 45.225 -2.503  -36.036 1.00 30.64  ? 151 TRP E CZ2 1 
ATOM 5913 C CZ3 . TRP D 2 174 ? 47.241 -3.694  -36.674 1.00 31.60  ? 151 TRP E CZ3 1 
ATOM 5914 C CH2 . TRP D 2 174 ? 46.576 -2.518  -36.285 1.00 31.09  ? 151 TRP E CH2 1 
ATOM 5915 N N   . THR D 2 175 ? 43.620 -9.991  -39.448 1.00 32.94  ? 152 THR E N   1 
ATOM 5916 C CA  . THR D 2 175 ? 44.247 -11.034 -40.223 1.00 31.48  ? 152 THR E CA  1 
ATOM 5917 C C   . THR D 2 175 ? 43.734 -10.945 -41.635 1.00 30.65  ? 152 THR E C   1 
ATOM 5918 O O   . THR D 2 175 ? 42.729 -10.270 -41.917 1.00 30.09  ? 152 THR E O   1 
ATOM 5919 C CB  . THR D 2 175 ? 43.935 -12.410 -39.685 1.00 32.48  ? 152 THR E CB  1 
ATOM 5920 O OG1 . THR D 2 175 ? 42.524 -12.498 -39.415 1.00 31.45  ? 152 THR E OG1 1 
ATOM 5921 C CG2 . THR D 2 175 ? 44.763 -12.694 -38.423 1.00 33.26  ? 152 THR E CG2 1 
ATOM 5922 N N   . PHE D 2 176 ? 44.429 -11.630 -42.523 1.00 30.08  ? 153 PHE E N   1 
ATOM 5923 C CA  . PHE D 2 176 ? 43.982 -11.756 -43.879 1.00 29.78  ? 153 PHE E CA  1 
ATOM 5924 C C   . PHE D 2 176 ? 43.934 -13.206 -44.282 1.00 30.44  ? 153 PHE E C   1 
ATOM 5925 O O   . PHE D 2 176 ? 44.563 -14.085 -43.643 1.00 31.61  ? 153 PHE E O   1 
ATOM 5926 C CB  . PHE D 2 176 ? 44.962 -11.090 -44.823 1.00 29.24  ? 153 PHE E CB  1 
ATOM 5927 C CG  . PHE D 2 176 ? 45.080 -9.609  -44.667 1.00 30.71  ? 153 PHE E CG  1 
ATOM 5928 C CD1 . PHE D 2 176 ? 46.046 -9.057  -43.831 1.00 32.19  ? 153 PHE E CD1 1 
ATOM 5929 C CD2 . PHE D 2 176 ? 44.285 -8.749  -45.420 1.00 32.99  ? 153 PHE E CD2 1 
ATOM 5930 C CE1 . PHE D 2 176 ? 46.192 -7.668  -43.721 1.00 31.14  ? 153 PHE E CE1 1 
ATOM 5931 C CE2 . PHE D 2 176 ? 44.436 -7.342  -45.325 1.00 33.17  ? 153 PHE E CE2 1 
ATOM 5932 C CZ  . PHE D 2 176 ? 45.385 -6.814  -44.469 1.00 32.46  ? 153 PHE E CZ  1 
ATOM 5933 N N   . GLN D 2 177 ? 43.209 -13.444 -45.369 1.00 29.99  ? 154 GLN E N   1 
ATOM 5934 C CA  . GLN D 2 177 ? 43.329 -14.671 -46.150 1.00 30.25  ? 154 GLN E CA  1 
ATOM 5935 C C   . GLN D 2 177 ? 43.311 -14.355 -47.664 1.00 30.70  ? 154 GLN E C   1 
ATOM 5936 O O   . GLN D 2 177 ? 43.158 -13.190 -48.087 1.00 30.26  ? 154 GLN E O   1 
ATOM 5937 C CB  . GLN D 2 177 ? 42.225 -15.669 -45.788 1.00 29.80  ? 154 GLN E CB  1 
ATOM 5938 C CG  . GLN D 2 177 ? 40.825 -15.102 -45.837 1.00 28.75  ? 154 GLN E CG  1 
ATOM 5939 C CD  . GLN D 2 177 ? 39.759 -16.146 -45.567 1.00 28.89  ? 154 GLN E CD  1 
ATOM 5940 O OE1 . GLN D 2 177 ? 39.774 -17.225 -46.152 1.00 28.74  ? 154 GLN E OE1 1 
ATOM 5941 N NE2 . GLN D 2 177 ? 38.822 -15.831 -44.667 1.00 29.80  ? 154 GLN E NE2 1 
ATOM 5942 N N   . ILE D 2 178 ? 43.451 -15.406 -48.463 1.00 31.31  ? 155 ILE E N   1 
ATOM 5943 C CA  . ILE D 2 178 ? 43.470 -15.315 -49.917 1.00 31.71  ? 155 ILE E CA  1 
ATOM 5944 C C   . ILE D 2 178 ? 43.421 -16.769 -50.390 1.00 32.60  ? 155 ILE E C   1 
ATOM 5945 O O   . ILE D 2 178 ? 43.840 -17.673 -49.674 1.00 32.80  ? 155 ILE E O   1 
ATOM 5946 C CB  . ILE D 2 178 ? 44.746 -14.570 -50.475 1.00 31.18  ? 155 ILE E CB  1 
ATOM 5947 C CG1 . ILE D 2 178 ? 44.624 -14.273 -51.960 1.00 32.26  ? 155 ILE E CG1 1 
ATOM 5948 C CG2 . ILE D 2 178 ? 46.032 -15.393 -50.282 1.00 32.00  ? 155 ILE E CG2 1 
ATOM 5949 C CD1 . ILE D 2 178 ? 45.902 -13.666 -52.567 1.00 35.22  ? 155 ILE E CD1 1 
ATOM 5950 N N   . LEU D 2 179 ? 42.874 -16.982 -51.578 1.00 32.85  ? 156 LEU E N   1 
ATOM 5951 C CA  . LEU D 2 179 ? 42.700 -18.293 -52.106 1.00 33.75  ? 156 LEU E CA  1 
ATOM 5952 C C   . LEU D 2 179 ? 43.207 -18.177 -53.514 1.00 34.81  ? 156 LEU E C   1 
ATOM 5953 O O   . LEU D 2 179 ? 42.826 -17.267 -54.234 1.00 34.54  ? 156 LEU E O   1 
ATOM 5954 C CB  . LEU D 2 179 ? 41.227 -18.681 -52.049 1.00 34.03  ? 156 LEU E CB  1 
ATOM 5955 C CG  . LEU D 2 179 ? 40.728 -19.157 -50.657 1.00 34.03  ? 156 LEU E CG  1 
ATOM 5956 C CD1 . LEU D 2 179 ? 40.299 -18.005 -49.755 1.00 31.20  ? 156 LEU E CD1 1 
ATOM 5957 C CD2 . LEU D 2 179 ? 39.584 -20.175 -50.760 1.00 33.21  ? 156 LEU E CD2 1 
ATOM 5958 N N   . VAL D 2 180 ? 44.159 -19.035 -53.867 1.00 36.31  ? 157 VAL E N   1 
ATOM 5959 C CA  . VAL D 2 180 ? 44.722 -19.057 -55.211 1.00 37.38  ? 157 VAL E CA  1 
ATOM 5960 C C   . VAL D 2 180 ? 44.422 -20.454 -55.704 1.00 39.91  ? 157 VAL E C   1 
ATOM 5961 O O   . VAL D 2 180 ? 44.694 -21.416 -54.988 1.00 40.80  ? 157 VAL E O   1 
ATOM 5962 C CB  . VAL D 2 180 ? 46.254 -18.852 -55.218 1.00 36.72  ? 157 VAL E CB  1 
ATOM 5963 C CG1 . VAL D 2 180 ? 46.731 -18.702 -56.626 1.00 36.71  ? 157 VAL E CG1 1 
ATOM 5964 C CG2 . VAL D 2 180 ? 46.665 -17.635 -54.397 1.00 34.09  ? 157 VAL E CG2 1 
ATOM 5965 N N   . MET D 2 181 ? 43.839 -20.577 -56.893 1.00 41.83  ? 158 MET E N   1 
ATOM 5966 C CA  . MET D 2 181 ? 43.445 -21.880 -57.378 1.00 44.57  ? 158 MET E CA  1 
ATOM 5967 C C   . MET D 2 181 ? 43.994 -22.101 -58.747 1.00 45.72  ? 158 MET E C   1 
ATOM 5968 O O   . MET D 2 181 ? 44.203 -21.150 -59.468 1.00 46.11  ? 158 MET E O   1 
ATOM 5969 C CB  . MET D 2 181 ? 41.937 -22.049 -57.371 1.00 45.70  ? 158 MET E CB  1 
ATOM 5970 C CG  . MET D 2 181 ? 41.153 -20.814 -57.681 1.00 49.05  ? 158 MET E CG  1 
ATOM 5971 S SD  . MET D 2 181 ? 40.440 -20.091 -56.170 1.00 56.16  ? 158 MET E SD  1 
ATOM 5972 C CE  . MET D 2 181 ? 38.836 -20.911 -56.099 1.00 55.84  ? 158 MET E CE  1 
ATOM 5973 N N   . LEU D 2 182 ? 44.220 -23.358 -59.107 1.00 47.47  ? 159 LEU E N   1 
ATOM 5974 C CA  . LEU D 2 182 ? 44.955 -23.682 -60.313 1.00 49.00  ? 159 LEU E CA  1 
ATOM 5975 C C   . LEU D 2 182 ? 44.273 -24.743 -61.126 1.00 51.64  ? 159 LEU E C   1 
ATOM 5976 O O   . LEU D 2 182 ? 44.115 -25.857 -60.659 1.00 52.41  ? 159 LEU E O   1 
ATOM 5977 C CB  . LEU D 2 182 ? 46.345 -24.162 -59.948 1.00 48.74  ? 159 LEU E CB  1 
ATOM 5978 C CG  . LEU D 2 182 ? 47.051 -25.113 -60.905 1.00 49.54  ? 159 LEU E CG  1 
ATOM 5979 C CD1 . LEU D 2 182 ? 47.521 -24.388 -62.117 1.00 49.83  ? 159 LEU E CD1 1 
ATOM 5980 C CD2 . LEU D 2 182 ? 48.233 -25.701 -60.203 1.00 49.96  ? 159 LEU E CD2 1 
ATOM 5981 N N   . GLU D 2 183 ? 43.889 -24.390 -62.349 1.00 53.92  ? 160 GLU E N   1 
ATOM 5982 C CA  . GLU D 2 183 ? 43.269 -25.313 -63.284 1.00 57.33  ? 160 GLU E CA  1 
ATOM 5983 C C   . GLU D 2 183 ? 44.331 -26.336 -63.614 1.00 59.11  ? 160 GLU E C   1 
ATOM 5984 O O   . GLU D 2 183 ? 45.459 -25.976 -63.918 1.00 59.50  ? 160 GLU E O   1 
ATOM 5985 C CB  . GLU D 2 183 ? 42.766 -24.549 -64.513 1.00 58.12  ? 160 GLU E CB  1 
ATOM 5986 C CG  . GLU D 2 183 ? 42.738 -25.323 -65.828 1.00 63.46  ? 160 GLU E CG  1 
ATOM 5987 C CD  . GLU D 2 183 ? 41.457 -26.120 -66.078 1.00 68.38  ? 160 GLU E CD  1 
ATOM 5988 O OE1 . GLU D 2 183 ? 40.353 -25.597 -65.783 1.00 70.56  ? 160 GLU E OE1 1 
ATOM 5989 O OE2 . GLU D 2 183 ? 41.555 -27.264 -66.593 1.00 70.02  ? 160 GLU E OE2 1 
ATOM 5990 N N   . MET D 2 184 ? 43.981 -27.611 -63.506 1.00 61.50  ? 161 MET E N   1 
ATOM 5991 C CA  . MET D 2 184 ? 44.954 -28.691 -63.599 1.00 63.78  ? 161 MET E CA  1 
ATOM 5992 C C   . MET D 2 184 ? 44.446 -29.857 -64.440 1.00 66.90  ? 161 MET E C   1 
ATOM 5993 O O   . MET D 2 184 ? 43.236 -30.084 -64.557 1.00 67.36  ? 161 MET E O   1 
ATOM 5994 C CB  . MET D 2 184 ? 45.334 -29.196 -62.200 1.00 63.07  ? 161 MET E CB  1 
ATOM 5995 C CG  . MET D 2 184 ? 44.158 -29.728 -61.364 1.00 64.34  ? 161 MET E CG  1 
ATOM 5996 S SD  . MET D 2 184 ? 44.630 -30.859 -60.019 1.00 68.37  ? 161 MET E SD  1 
ATOM 5997 C CE  . MET D 2 184 ? 43.045 -31.539 -59.544 1.00 65.54  ? 161 MET E CE  1 
ATOM 5998 N N   . THR D 2 185 ? 45.389 -30.588 -65.031 1.00 69.46  ? 162 THR E N   1 
ATOM 5999 C CA  . THR D 2 185 ? 45.094 -31.866 -65.677 1.00 72.75  ? 162 THR E CA  1 
ATOM 6000 C C   . THR D 2 185 ? 46.136 -32.904 -65.227 1.00 74.32  ? 162 THR E C   1 
ATOM 6001 O O   . THR D 2 185 ? 47.137 -33.131 -65.921 1.00 75.22  ? 162 THR E O   1 
ATOM 6002 C CB  . THR D 2 185 ? 45.047 -31.760 -67.223 1.00 74.41  ? 162 THR E CB  1 
ATOM 6003 O OG1 . THR D 2 185 ? 45.136 -30.386 -67.633 1.00 72.77  ? 162 THR E OG1 1 
ATOM 6004 C CG2 . THR D 2 185 ? 43.765 -32.408 -67.763 1.00 75.55  ? 162 THR E CG2 1 
ATOM 6005 N N   . PRO D 2 186 ? 45.910 -33.514 -64.043 1.00 75.12  ? 163 PRO E N   1 
ATOM 6006 C CA  . PRO D 2 186 ? 46.832 -34.472 -63.390 1.00 76.36  ? 163 PRO E CA  1 
ATOM 6007 C C   . PRO D 2 186 ? 47.177 -35.685 -64.261 1.00 79.34  ? 163 PRO E C   1 
ATOM 6008 O O   . PRO D 2 186 ? 46.461 -35.953 -65.229 1.00 80.98  ? 163 PRO E O   1 
ATOM 6009 C CB  . PRO D 2 186 ? 46.063 -34.899 -62.126 1.00 75.97  ? 163 PRO E CB  1 
ATOM 6010 C CG  . PRO D 2 186 ? 44.647 -34.399 -62.301 1.00 75.28  ? 163 PRO E CG  1 
ATOM 6011 C CD  . PRO D 2 186 ? 44.746 -33.206 -63.186 1.00 74.36  ? 163 PRO E CD  1 
ATOM 6012 N N   . GLN D 2 187 ? 48.248 -36.413 -63.910 1.00 80.66  ? 164 GLN E N   1 
ATOM 6013 C CA  . GLN D 2 187 ? 48.842 -37.451 -64.795 1.00 83.17  ? 164 GLN E CA  1 
ATOM 6014 C C   . GLN D 2 187 ? 49.136 -38.791 -64.123 1.00 84.44  ? 164 GLN E C   1 
ATOM 6015 O O   . GLN D 2 187 ? 49.173 -39.834 -64.792 1.00 86.40  ? 164 GLN E O   1 
ATOM 6016 C CB  . GLN D 2 187 ? 50.152 -36.941 -65.414 1.00 83.39  ? 164 GLN E CB  1 
ATOM 6017 C CG  . GLN D 2 187 ? 49.989 -35.896 -66.513 1.00 83.88  ? 164 GLN E CG  1 
ATOM 6018 C CD  . GLN D 2 187 ? 50.130 -36.478 -67.909 1.00 86.12  ? 164 GLN E CD  1 
ATOM 6019 O OE1 . GLN D 2 187 ? 49.453 -37.446 -68.274 1.00 87.62  ? 164 GLN E OE1 1 
ATOM 6020 N NE2 . GLN D 2 187 ? 51.017 -35.884 -68.699 1.00 85.63  ? 164 GLN E NE2 1 
ATOM 6021 N N   . GLN D 2 188 ? 49.395 -38.747 -62.818 1.00 83.47  ? 165 GLN E N   1 
ATOM 6022 C CA  . GLN D 2 188 ? 49.700 -39.938 -62.014 1.00 84.68  ? 165 GLN E CA  1 
ATOM 6023 C C   . GLN D 2 188 ? 50.957 -39.720 -61.175 1.00 84.05  ? 165 GLN E C   1 
ATOM 6024 O O   . GLN D 2 188 ? 50.872 -39.539 -59.941 1.00 83.11  ? 165 GLN E O   1 
ATOM 6025 C CB  . GLN D 2 188 ? 49.820 -41.216 -62.870 1.00 86.97  ? 165 GLN E CB  1 
ATOM 6026 C CG  . GLN D 2 188 ? 49.855 -42.521 -62.063 1.00 88.52  ? 165 GLN E CG  1 
ATOM 6027 C CD  . GLN D 2 188 ? 48.681 -42.685 -61.079 1.00 87.79  ? 165 GLN E CD  1 
ATOM 6028 O OE1 . GLN D 2 188 ? 48.082 -41.705 -60.601 1.00 83.53  ? 165 GLN E OE1 1 
ATOM 6029 N NE2 . GLN D 2 188 ? 48.361 -43.943 -60.767 1.00 88.59  ? 165 GLN E NE2 1 
ATOM 6030 N N   . GLY D 2 189 ? 52.115 -39.732 -61.845 1.00 84.51  ? 166 GLY E N   1 
ATOM 6031 C CA  . GLY D 2 189 ? 53.396 -39.450 -61.184 1.00 83.77  ? 166 GLY E CA  1 
ATOM 6032 C C   . GLY D 2 189 ? 53.690 -37.961 -61.037 1.00 81.49  ? 166 GLY E C   1 
ATOM 6033 O O   . GLY D 2 189 ? 54.753 -37.503 -61.468 1.00 81.97  ? 166 GLY E O   1 
ATOM 6034 N N   . ASP D 2 190 ? 52.763 -37.214 -60.417 1.00 78.99  ? 167 ASP E N   1 
ATOM 6035 C CA  . ASP D 2 190 ? 52.796 -35.735 -60.428 1.00 76.13  ? 167 ASP E CA  1 
ATOM 6036 C C   . ASP D 2 190 ? 52.634 -35.050 -59.076 1.00 73.45  ? 167 ASP E C   1 
ATOM 6037 O O   . ASP D 2 190 ? 51.629 -35.243 -58.380 1.00 72.58  ? 167 ASP E O   1 
ATOM 6038 C CB  . ASP D 2 190 ? 51.777 -35.159 -61.424 1.00 75.95  ? 167 ASP E CB  1 
ATOM 6039 C CG  . ASP D 2 190 ? 52.387 -34.887 -62.800 1.00 77.73  ? 167 ASP E CG  1 
ATOM 6040 O OD1 . ASP D 2 190 ? 51.623 -34.709 -63.775 1.00 79.49  ? 167 ASP E OD1 1 
ATOM 6041 O OD2 . ASP D 2 190 ? 53.630 -34.851 -62.915 1.00 78.40  ? 167 ASP E OD2 1 
ATOM 6042 N N   . VAL D 2 191 ? 53.648 -34.244 -58.745 1.00 71.54  ? 168 VAL E N   1 
ATOM 6043 C CA  . VAL D 2 191 ? 53.685 -33.413 -57.540 1.00 68.53  ? 168 VAL E CA  1 
ATOM 6044 C C   . VAL D 2 191 ? 53.380 -31.949 -57.869 1.00 66.09  ? 168 VAL E C   1 
ATOM 6045 O O   . VAL D 2 191 ? 54.163 -31.243 -58.527 1.00 65.24  ? 168 VAL E O   1 
ATOM 6046 C CB  . VAL D 2 191 ? 55.080 -33.461 -56.834 1.00 69.32  ? 168 VAL E CB  1 
ATOM 6047 C CG1 . VAL D 2 191 ? 55.046 -32.679 -55.506 1.00 67.05  ? 168 VAL E CG1 1 
ATOM 6048 C CG2 . VAL D 2 191 ? 55.568 -34.897 -56.633 1.00 69.93  ? 168 VAL E CG2 1 
ATOM 6049 N N   . TYR D 2 192 ? 52.231 -31.501 -57.396 1.00 64.17  ? 169 TYR E N   1 
ATOM 6050 C CA  . TYR D 2 192 ? 51.939 -30.076 -57.353 1.00 61.94  ? 169 TYR E CA  1 
ATOM 6051 C C   . TYR D 2 192 ? 52.425 -29.504 -56.014 1.00 60.22  ? 169 TYR E C   1 
ATOM 6052 O O   . TYR D 2 192 ? 52.265 -30.145 -54.959 1.00 59.99  ? 169 TYR E O   1 
ATOM 6053 C CB  . TYR D 2 192 ? 50.437 -29.857 -57.477 1.00 61.68  ? 169 TYR E CB  1 
ATOM 6054 C CG  . TYR D 2 192 ? 49.824 -30.286 -58.788 1.00 64.02  ? 169 TYR E CG  1 
ATOM 6055 C CD1 . TYR D 2 192 ? 49.558 -31.632 -59.061 1.00 67.03  ? 169 TYR E CD1 1 
ATOM 6056 C CD2 . TYR D 2 192 ? 49.480 -29.339 -59.751 1.00 64.28  ? 169 TYR E CD2 1 
ATOM 6057 C CE1 . TYR D 2 192 ? 48.982 -32.017 -60.282 1.00 68.98  ? 169 TYR E CE1 1 
ATOM 6058 C CE2 . TYR D 2 192 ? 48.906 -29.711 -60.965 1.00 66.39  ? 169 TYR E CE2 1 
ATOM 6059 C CZ  . TYR D 2 192 ? 48.660 -31.045 -61.227 1.00 68.65  ? 169 TYR E CZ  1 
ATOM 6060 O OH  . TYR D 2 192 ? 48.085 -31.389 -62.434 1.00 70.62  ? 169 TYR E OH  1 
ATOM 6061 N N   . THR D 2 193 ? 53.017 -28.313 -56.041 1.00 58.30  ? 170 THR E N   1 
ATOM 6062 C CA  . THR D 2 193 ? 53.335 -27.634 -54.787 1.00 56.75  ? 170 THR E CA  1 
ATOM 6063 C C   . THR D 2 193 ? 52.729 -26.249 -54.755 1.00 54.79  ? 170 THR E C   1 
ATOM 6064 O O   . THR D 2 193 ? 52.893 -25.478 -55.708 1.00 54.54  ? 170 THR E O   1 
ATOM 6065 C CB  . THR D 2 193 ? 54.850 -27.474 -54.547 1.00 57.42  ? 170 THR E CB  1 
ATOM 6066 O OG1 . THR D 2 193 ? 55.546 -28.618 -55.041 1.00 59.08  ? 170 THR E OG1 1 
ATOM 6067 C CG2 . THR D 2 193 ? 55.144 -27.291 -53.053 1.00 55.96  ? 170 THR E CG2 1 
ATOM 6068 N N   . CYS D 2 194 ? 52.037 -25.944 -53.656 1.00 53.42  ? 171 CYS E N   1 
ATOM 6069 C CA  . CYS D 2 194 ? 51.648 -24.566 -53.347 1.00 51.26  ? 171 CYS E CA  1 
ATOM 6070 C C   . CYS D 2 194 ? 52.705 -23.920 -52.471 1.00 50.42  ? 171 CYS E C   1 
ATOM 6071 O O   . CYS D 2 194 ? 53.047 -24.454 -51.424 1.00 50.67  ? 171 CYS E O   1 
ATOM 6072 C CB  . CYS D 2 194 ? 50.292 -24.472 -52.642 1.00 50.37  ? 171 CYS E CB  1 
ATOM 6073 S SG  . CYS D 2 194 ? 49.953 -22.718 -52.356 1.00 48.64  ? 171 CYS E SG  1 
ATOM 6074 N N   . GLN D 2 195 ? 53.215 -22.769 -52.892 1.00 49.15  ? 172 GLN E N   1 
ATOM 6075 C CA  . GLN D 2 195 ? 54.288 -22.134 -52.138 1.00 48.63  ? 172 GLN E CA  1 
ATOM 6076 C C   . GLN D 2 195 ? 54.008 -20.683 -51.742 1.00 47.50  ? 172 GLN E C   1 
ATOM 6077 O O   . GLN D 2 195 ? 53.796 -19.804 -52.599 1.00 46.80  ? 172 GLN E O   1 
ATOM 6078 C CB  . GLN D 2 195 ? 55.579 -22.240 -52.905 1.00 49.53  ? 172 GLN E CB  1 
ATOM 6079 C CG  . GLN D 2 195 ? 56.735 -21.508 -52.308 1.00 49.44  ? 172 GLN E CG  1 
ATOM 6080 C CD  . GLN D 2 195 ? 57.886 -21.463 -53.275 1.00 51.48  ? 172 GLN E CD  1 
ATOM 6081 O OE1 . GLN D 2 195 ? 58.550 -22.486 -53.504 1.00 53.20  ? 172 GLN E OE1 1 
ATOM 6082 N NE2 . GLN D 2 195 ? 58.120 -20.289 -53.880 1.00 49.54  ? 172 GLN E NE2 1 
ATOM 6083 N N   . VAL D 2 196 ? 54.007 -20.432 -50.430 1.00 46.76  ? 173 VAL E N   1 
ATOM 6084 C CA  . VAL D 2 196 ? 53.778 -19.082 -49.978 1.00 45.18  ? 173 VAL E CA  1 
ATOM 6085 C C   . VAL D 2 196 ? 55.051 -18.489 -49.399 1.00 45.92  ? 173 VAL E C   1 
ATOM 6086 O O   . VAL D 2 196 ? 55.818 -19.189 -48.760 1.00 47.48  ? 173 VAL E O   1 
ATOM 6087 C CB  . VAL D 2 196 ? 52.524 -18.954 -49.074 1.00 44.17  ? 173 VAL E CB  1 
ATOM 6088 C CG1 . VAL D 2 196 ? 51.747 -20.275 -49.036 1.00 42.29  ? 173 VAL E CG1 1 
ATOM 6089 C CG2 . VAL D 2 196 ? 52.883 -18.438 -47.691 1.00 44.71  ? 173 VAL E CG2 1 
ATOM 6090 N N   . GLU D 2 197 ? 55.282 -17.216 -49.700 1.00 45.51  ? 174 GLU E N   1 
ATOM 6091 C CA  . GLU D 2 197 ? 56.414 -16.457 -49.223 1.00 47.12  ? 174 GLU E CA  1 
ATOM 6092 C C   . GLU D 2 197 ? 55.849 -15.245 -48.446 1.00 45.48  ? 174 GLU E C   1 
ATOM 6093 O O   . GLU D 2 197 ? 54.955 -14.553 -48.921 1.00 44.48  ? 174 GLU E O   1 
ATOM 6094 C CB  . GLU D 2 197 ? 57.280 -16.015 -50.430 1.00 48.75  ? 174 GLU E CB  1 
ATOM 6095 C CG  . GLU D 2 197 ? 57.753 -17.166 -51.421 1.00 54.07  ? 174 GLU E CG  1 
ATOM 6096 C CD  . GLU D 2 197 ? 57.520 -16.861 -52.964 1.00 59.76  ? 174 GLU E CD  1 
ATOM 6097 O OE1 . GLU D 2 197 ? 56.846 -17.691 -53.639 1.00 60.10  ? 174 GLU E OE1 1 
ATOM 6098 O OE2 . GLU D 2 197 ? 57.998 -15.805 -53.496 1.00 60.84  ? 174 GLU E OE2 1 
ATOM 6099 N N   . HIS D 2 198 ? 56.353 -14.991 -47.251 1.00 45.57  ? 175 HIS E N   1 
ATOM 6100 C CA  . HIS D 2 198 ? 55.802 -13.932 -46.399 1.00 44.40  ? 175 HIS E CA  1 
ATOM 6101 C C   . HIS D 2 198 ? 56.907 -13.449 -45.454 1.00 46.44  ? 175 HIS E C   1 
ATOM 6102 O O   . HIS D 2 198 ? 57.766 -14.233 -45.062 1.00 47.92  ? 175 HIS E O   1 
ATOM 6103 C CB  . HIS D 2 198 ? 54.613 -14.494 -45.615 1.00 42.97  ? 175 HIS E CB  1 
ATOM 6104 C CG  . HIS D 2 198 ? 53.746 -13.463 -44.978 1.00 39.04  ? 175 HIS E CG  1 
ATOM 6105 N ND1 . HIS D 2 198 ? 53.795 -13.182 -43.630 1.00 37.64  ? 175 HIS E ND1 1 
ATOM 6106 C CD2 . HIS D 2 198 ? 52.786 -12.662 -45.495 1.00 35.46  ? 175 HIS E CD2 1 
ATOM 6107 C CE1 . HIS D 2 198 ? 52.919 -12.232 -43.351 1.00 37.21  ? 175 HIS E CE1 1 
ATOM 6108 N NE2 . HIS D 2 198 ? 52.299 -11.889 -44.467 1.00 33.26  ? 175 HIS E NE2 1 
ATOM 6109 N N   . THR D 2 199 ? 56.907 -12.167 -45.098 1.00 47.36  ? 176 THR E N   1 
ATOM 6110 C CA  . THR D 2 199 ? 57.942 -11.627 -44.182 1.00 49.56  ? 176 THR E CA  1 
ATOM 6111 C C   . THR D 2 199 ? 57.773 -12.103 -42.752 1.00 50.78  ? 176 THR E C   1 
ATOM 6112 O O   . THR D 2 199 ? 58.633 -11.845 -41.926 1.00 52.46  ? 176 THR E O   1 
ATOM 6113 C CB  . THR D 2 199 ? 57.987 -10.084 -44.128 1.00 48.89  ? 176 THR E CB  1 
ATOM 6114 O OG1 . THR D 2 199 ? 56.674 -9.583  -43.863 1.00 47.63  ? 176 THR E OG1 1 
ATOM 6115 C CG2 . THR D 2 199 ? 58.494 -9.498  -45.427 1.00 49.39  ? 176 THR E CG2 1 
ATOM 6116 N N   . SER D 2 200 ? 56.662 -12.773 -42.451 1.00 51.19  ? 177 SER E N   1 
ATOM 6117 C CA  . SER D 2 200 ? 56.506 -13.436 -41.153 1.00 53.09  ? 177 SER E CA  1 
ATOM 6118 C C   . SER D 2 200 ? 57.348 -14.717 -41.099 1.00 55.18  ? 177 SER E C   1 
ATOM 6119 O O   . SER D 2 200 ? 57.712 -15.186 -40.025 1.00 56.46  ? 177 SER E O   1 
ATOM 6120 C CB  . SER D 2 200 ? 55.029 -13.736 -40.861 1.00 52.18  ? 177 SER E CB  1 
ATOM 6121 O OG  . SER D 2 200 ? 54.672 -15.060 -41.237 1.00 53.40  ? 177 SER E OG  1 
ATOM 6122 N N   . LEU D 2 201 ? 57.663 -15.255 -42.275 1.00 56.07  ? 178 LEU E N   1 
ATOM 6123 C CA  . LEU D 2 201 ? 58.397 -16.506 -42.424 1.00 58.35  ? 178 LEU E CA  1 
ATOM 6124 C C   . LEU D 2 201 ? 59.767 -16.231 -42.997 1.00 59.86  ? 178 LEU E C   1 
ATOM 6125 O O   . LEU D 2 201 ? 59.896 -15.700 -44.100 1.00 59.50  ? 178 LEU E O   1 
ATOM 6126 C CB  . LEU D 2 201 ? 57.664 -17.431 -43.398 1.00 57.89  ? 178 LEU E CB  1 
ATOM 6127 C CG  . LEU D 2 201 ? 56.139 -17.525 -43.320 1.00 56.53  ? 178 LEU E CG  1 
ATOM 6128 C CD1 . LEU D 2 201 ? 55.527 -17.478 -44.721 1.00 56.20  ? 178 LEU E CD1 1 
ATOM 6129 C CD2 . LEU D 2 201 ? 55.741 -18.782 -42.591 1.00 56.76  ? 178 LEU E CD2 1 
ATOM 6130 N N   . ASP D 2 202 ? 60.791 -16.612 -42.257 1.00 62.34  ? 179 ASP E N   1 
ATOM 6131 C CA  . ASP D 2 202 ? 62.161 -16.542 -42.756 1.00 64.75  ? 179 ASP E CA  1 
ATOM 6132 C C   . ASP D 2 202 ? 62.519 -17.687 -43.727 1.00 65.20  ? 179 ASP E C   1 
ATOM 6133 O O   . ASP D 2 202 ? 63.672 -17.816 -44.123 1.00 66.84  ? 179 ASP E O   1 
ATOM 6134 C CB  . ASP D 2 202 ? 63.129 -16.561 -41.572 1.00 67.22  ? 179 ASP E CB  1 
ATOM 6135 C CG  . ASP D 2 202 ? 62.963 -17.797 -40.716 1.00 68.68  ? 179 ASP E CG  1 
ATOM 6136 O OD1 . ASP D 2 202 ? 61.855 -17.971 -40.168 1.00 68.22  ? 179 ASP E OD1 1 
ATOM 6137 O OD2 . ASP D 2 202 ? 63.933 -18.588 -40.598 1.00 71.48  ? 179 ASP E OD2 1 
ATOM 6138 N N   . SER D 2 203 ? 61.519 -18.483 -44.111 1.00 64.21  ? 180 SER E N   1 
ATOM 6139 C CA  . SER D 2 203 ? 61.680 -19.746 -44.832 1.00 64.63  ? 180 SER E CA  1 
ATOM 6140 C C   . SER D 2 203 ? 60.349 -20.123 -45.512 1.00 62.84  ? 180 SER E C   1 
ATOM 6141 O O   . SER D 2 203 ? 59.395 -20.452 -44.811 1.00 62.22  ? 180 SER E O   1 
ATOM 6142 C CB  . SER D 2 203 ? 62.113 -20.833 -43.824 1.00 66.44  ? 180 SER E CB  1 
ATOM 6143 O OG  . SER D 2 203 ? 61.889 -22.149 -44.296 1.00 66.66  ? 180 SER E OG  1 
ATOM 6144 N N   . PRO D 2 204 ? 60.280 -20.066 -46.869 1.00 62.63  ? 181 PRO E N   1 
ATOM 6145 C CA  . PRO D 2 204 ? 59.075 -20.331 -47.702 1.00 61.24  ? 181 PRO E CA  1 
ATOM 6146 C C   . PRO D 2 204 ? 58.333 -21.609 -47.334 1.00 61.05  ? 181 PRO E C   1 
ATOM 6147 O O   . PRO D 2 204 ? 58.923 -22.682 -47.377 1.00 62.15  ? 181 PRO E O   1 
ATOM 6148 C CB  . PRO D 2 204 ? 59.647 -20.496 -49.126 1.00 61.67  ? 181 PRO E CB  1 
ATOM 6149 C CG  . PRO D 2 204 ? 60.847 -19.673 -49.144 1.00 62.99  ? 181 PRO E CG  1 
ATOM 6150 C CD  . PRO D 2 204 ? 61.442 -19.750 -47.724 1.00 64.28  ? 181 PRO E CD  1 
ATOM 6151 N N   . VAL D 2 205 ? 57.049 -21.485 -46.999 1.00 59.63  ? 182 VAL E N   1 
ATOM 6152 C CA  . VAL D 2 205 ? 56.216 -22.633 -46.603 1.00 59.84  ? 182 VAL E CA  1 
ATOM 6153 C C   . VAL D 2 205 ? 55.638 -23.351 -47.832 1.00 59.58  ? 182 VAL E C   1 
ATOM 6154 O O   . VAL D 2 205 ? 54.904 -22.748 -48.627 1.00 58.93  ? 182 VAL E O   1 
ATOM 6155 C CB  . VAL D 2 205 ? 55.080 -22.193 -45.625 1.00 58.95  ? 182 VAL E CB  1 
ATOM 6156 C CG1 . VAL D 2 205 ? 54.101 -23.322 -45.349 1.00 58.38  ? 182 VAL E CG1 1 
ATOM 6157 C CG2 . VAL D 2 205 ? 55.675 -21.677 -44.310 1.00 60.06  ? 182 VAL E CG2 1 
ATOM 6158 N N   . THR D 2 206 ? 55.985 -24.624 -48.000 1.00 60.22  ? 183 THR E N   1 
ATOM 6159 C CA  . THR D 2 206 ? 55.482 -25.411 -49.123 1.00 59.98  ? 183 THR E CA  1 
ATOM 6160 C C   . THR D 2 206 ? 54.520 -26.461 -48.609 1.00 60.35  ? 183 THR E C   1 
ATOM 6161 O O   . THR D 2 206 ? 54.734 -27.029 -47.537 1.00 61.34  ? 183 THR E O   1 
ATOM 6162 C CB  . THR D 2 206 ? 56.607 -26.155 -49.876 1.00 61.27  ? 183 THR E CB  1 
ATOM 6163 O OG1 . THR D 2 206 ? 57.437 -26.861 -48.933 1.00 63.48  ? 183 THR E OG1 1 
ATOM 6164 C CG2 . THR D 2 206 ? 57.440 -25.206 -50.706 1.00 60.48  ? 183 THR E CG2 1 
ATOM 6165 N N   . VAL D 2 207 ? 53.452 -26.697 -49.362 1.00 59.94  ? 184 VAL E N   1 
ATOM 6166 C CA  . VAL D 2 207 ? 52.565 -27.823 -49.122 1.00 61.14  ? 184 VAL E CA  1 
ATOM 6167 C C   . VAL D 2 207 ? 52.156 -28.427 -50.454 1.00 62.61  ? 184 VAL E C   1 
ATOM 6168 O O   . VAL D 2 207 ? 51.687 -27.726 -51.371 1.00 61.35  ? 184 VAL E O   1 
ATOM 6169 C CB  . VAL D 2 207 ? 51.373 -27.521 -48.128 1.00 60.25  ? 184 VAL E CB  1 
ATOM 6170 C CG1 . VAL D 2 207 ? 51.410 -26.087 -47.617 1.00 58.79  ? 184 VAL E CG1 1 
ATOM 6171 C CG2 . VAL D 2 207 ? 49.991 -27.894 -48.693 1.00 59.14  ? 184 VAL E CG2 1 
ATOM 6172 N N   . GLU D 2 208 ? 52.379 -29.741 -50.538 1.00 65.35  ? 185 GLU E N   1 
ATOM 6173 C CA  . GLU D 2 208 ? 52.333 -30.470 -51.795 1.00 67.22  ? 185 GLU E CA  1 
ATOM 6174 C C   . GLU D 2 208 ? 51.082 -31.316 -51.948 1.00 68.33  ? 185 GLU E C   1 
ATOM 6175 O O   . GLU D 2 208 ? 50.341 -31.547 -50.986 1.00 67.92  ? 185 GLU E O   1 
ATOM 6176 C CB  . GLU D 2 208 ? 53.620 -31.282 -52.030 1.00 68.44  ? 185 GLU E CB  1 
ATOM 6177 C CG  . GLU D 2 208 ? 54.003 -32.279 -50.940 1.00 71.20  ? 185 GLU E CG  1 
ATOM 6178 C CD  . GLU D 2 208 ? 54.966 -33.385 -51.433 1.00 75.29  ? 185 GLU E CD  1 
ATOM 6179 O OE1 . GLU D 2 208 ? 55.670 -33.180 -52.456 1.00 75.04  ? 185 GLU E OE1 1 
ATOM 6180 O OE2 . GLU D 2 208 ? 55.014 -34.464 -50.791 1.00 76.14  ? 185 GLU E OE2 1 
ATOM 6181 N N   . TRP D 2 209 ? 50.845 -31.734 -53.189 1.00 70.00  ? 186 TRP E N   1 
ATOM 6182 C CA  . TRP D 2 209 ? 49.718 -32.581 -53.531 1.00 72.11  ? 186 TRP E CA  1 
ATOM 6183 C C   . TRP D 2 209 ? 50.069 -33.454 -54.720 1.00 73.68  ? 186 TRP E C   1 
ATOM 6184 O O   . TRP D 2 209 ? 50.502 -32.952 -55.769 1.00 73.54  ? 186 TRP E O   1 
ATOM 6185 C CB  . TRP D 2 209 ? 48.477 -31.752 -53.843 1.00 71.23  ? 186 TRP E CB  1 
ATOM 6186 C CG  . TRP D 2 209 ? 47.224 -32.578 -53.918 1.00 75.09  ? 186 TRP E CG  1 
ATOM 6187 C CD1 . TRP D 2 209 ? 46.646 -33.111 -55.049 1.00 76.99  ? 186 TRP E CD1 1 
ATOM 6188 C CD2 . TRP D 2 209 ? 46.391 -32.977 -52.812 1.00 79.65  ? 186 TRP E CD2 1 
ATOM 6189 N NE1 . TRP D 2 209 ? 45.506 -33.803 -54.711 1.00 79.95  ? 186 TRP E NE1 1 
ATOM 6190 C CE2 . TRP D 2 209 ? 45.323 -33.738 -53.348 1.00 81.64  ? 186 TRP E CE2 1 
ATOM 6191 C CE3 . TRP D 2 209 ? 46.440 -32.758 -51.411 1.00 82.03  ? 186 TRP E CE3 1 
ATOM 6192 C CZ2 . TRP D 2 209 ? 44.304 -34.296 -52.527 1.00 84.67  ? 186 TRP E CZ2 1 
ATOM 6193 C CZ3 . TRP D 2 209 ? 45.421 -33.313 -50.589 1.00 82.94  ? 186 TRP E CZ3 1 
ATOM 6194 C CH2 . TRP D 2 209 ? 44.374 -34.072 -51.157 1.00 84.95  ? 186 TRP E CH2 1 
ATOM 6195 N N   . LYS D 2 210 ? 49.876 -34.761 -54.537 1.00 75.84  ? 187 LYS E N   1 
ATOM 6196 C CA  . LYS D 2 210 ? 50.162 -35.766 -55.567 1.00 77.93  ? 187 LYS E CA  1 
ATOM 6197 C C   . LYS D 2 210 ? 48.865 -36.317 -56.156 1.00 78.88  ? 187 LYS E C   1 
ATOM 6198 O O   . LYS D 2 210 ? 47.933 -36.665 -55.422 1.00 78.79  ? 187 LYS E O   1 
ATOM 6199 C CB  . LYS D 2 210 ? 51.034 -36.900 -55.004 1.00 79.34  ? 187 LYS E CB  1 
ATOM 6200 C CG  . LYS D 2 210 ? 52.202 -36.387 -54.179 1.00 79.19  ? 187 LYS E CG  1 
ATOM 6201 C CD  . LYS D 2 210 ? 53.045 -37.487 -53.547 1.00 81.20  ? 187 LYS E CD  1 
ATOM 6202 C CE  . LYS D 2 210 ? 54.118 -36.855 -52.653 1.00 80.28  ? 187 LYS E CE  1 
ATOM 6203 N NZ  . LYS D 2 210 ? 55.252 -37.771 -52.351 1.00 81.68  ? 187 LYS E NZ  1 
ATOM 6204 N N   . ALA D 2 211 ? 48.827 -36.374 -57.487 1.00 80.00  ? 188 ALA E N   1 
ATOM 6205 C CA  . ALA D 2 211 ? 47.690 -36.904 -58.236 1.00 81.54  ? 188 ALA E CA  1 
ATOM 6206 C C   . ALA D 2 211 ? 47.581 -38.429 -58.101 1.00 84.01  ? 188 ALA E C   1 
ATOM 6207 O O   . ALA D 2 211 ? 47.364 -39.145 -59.088 1.00 85.58  ? 188 ALA E O   1 
ATOM 6208 C CB  . ALA D 2 211 ? 47.809 -36.510 -59.685 1.00 81.55  ? 188 ALA E CB  1 
ATOM 6209 N N   . GLN D 2 212 ? 47.749 -38.912 -56.872 1.00 84.64  ? 189 GLN E N   1 
ATOM 6210 C CA  . GLN D 2 212 ? 47.508 -40.312 -56.537 1.00 86.94  ? 189 GLN E CA  1 
ATOM 6211 C C   . GLN D 2 212 ? 46.171 -40.482 -55.788 1.00 87.29  ? 189 GLN E C   1 
ATOM 6212 O O   . GLN D 2 212 ? 45.559 -41.555 -55.873 1.00 89.14  ? 189 GLN E O   1 
ATOM 6213 C CB  . GLN D 2 212 ? 48.682 -40.892 -55.727 1.00 87.70  ? 189 GLN E CB  1 
ATOM 6214 C CG  . GLN D 2 212 ? 49.627 -41.825 -56.504 1.00 89.20  ? 189 GLN E CG  1 
ATOM 6215 C CD  . GLN D 2 212 ? 49.088 -43.249 -56.645 1.00 91.46  ? 189 GLN E CD  1 
ATOM 6216 O OE1 . GLN D 2 212 ? 48.685 -43.886 -55.665 1.00 91.99  ? 189 GLN E OE1 1 
ATOM 6217 N NE2 . GLN D 2 212 ? 49.091 -43.754 -57.869 1.00 92.61  ? 189 GLN E NE2 1 
ATOM 6218 O OXT . GLN D 2 212 ? 45.663 -39.574 -55.100 1.00 85.76  ? 189 GLN E OXT 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 1   ? 0.7282 1.0041 0.6131 0.0855  -0.0221 0.0704  1   ILE A N   
2    C CA  . ILE A 1   ? 0.7294 1.0143 0.6161 0.0935  -0.0211 0.0865  1   ILE A CA  
3    C C   . ILE A 1   ? 0.7421 1.0493 0.6302 0.0977  -0.0420 0.0811  1   ILE A C   
4    O O   . ILE A 1   ? 0.7591 1.0792 0.6426 0.1079  -0.0441 0.0934  1   ILE A O   
5    C CB  . ILE A 1   ? 0.7092 0.9811 0.6182 0.0869  -0.0108 0.0965  1   ILE A CB  
6    C CG1 . ILE A 1   ? 0.7023 0.9596 0.6047 0.0912  0.0100  0.1108  1   ILE A CG1 
7    C CG2 . ILE A 1   ? 0.7010 0.9855 0.6244 0.0897  -0.0188 0.1047  1   ILE A CG2 
8    C CD1 . ILE A 1   ? 0.6837 0.9220 0.5890 0.0824  0.0211  0.1038  1   ILE A CD1 
9    N N   . LYS A 2   ? 0.7291 1.0410 0.6245 0.0904  -0.0576 0.0626  2   LYS A N   
10   C CA  . LYS A 2   ? 0.7246 1.0563 0.6310 0.0906  -0.0794 0.0544  2   LYS A CA  
11   C C   . LYS A 2   ? 0.6924 1.0262 0.6311 0.0837  -0.0810 0.0620  2   LYS A C   
12   O O   . LYS A 2   ? 0.6966 1.0408 0.6391 0.0908  -0.0805 0.0762  2   LYS A O   
13   C CB  . LYS A 2   ? 0.7473 1.0993 0.6320 0.1060  -0.0882 0.0594  2   LYS A CB  
14   C CG  . LYS A 2   ? 0.7870 1.1387 0.6352 0.1173  -0.0836 0.0569  2   LYS A CG  
15   C CD  . LYS A 2   ? 0.8259 1.1951 0.6508 0.1354  -0.0855 0.0700  2   LYS A CD  
16   C CE  . LYS A 2   ? 0.8361 1.1987 0.6644 0.1406  -0.0662 0.0951  2   LYS A CE  
17   N NZ  . LYS A 2   ? 0.8810 1.2563 0.6821 0.1601  -0.0624 0.1105  2   LYS A NZ  
18   N N   . ALA A 3   ? 0.6539 0.9772 0.6150 0.0710  -0.0813 0.0539  3   ALA A N   
19   C CA  . ALA A 3   ? 0.6128 0.9382 0.6053 0.0645  -0.0828 0.0599  3   ALA A CA  
20   C C   . ALA A 3   ? 0.5906 0.9184 0.6058 0.0537  -0.0967 0.0437  3   ALA A C   
21   O O   . ALA A 3   ? 0.5963 0.9204 0.6019 0.0508  -0.1027 0.0281  3   ALA A O   
22   C CB  . ALA A 3   ? 0.5979 0.9037 0.5950 0.0613  -0.0635 0.0708  3   ALA A CB  
23   N N   . ASP A 4   ? 0.5605 0.8942 0.6073 0.0482  -0.1010 0.0475  4   ASP A N   
24   C CA  . ASP A 4   ? 0.5387 0.8723 0.6100 0.0375  -0.1117 0.0334  4   ASP A CA  
25   C C   . ASP A 4   ? 0.5052 0.8179 0.5836 0.0301  -0.0978 0.0345  4   ASP A C   
26   O O   . ASP A 4   ? 0.4933 0.7992 0.5811 0.0225  -0.1023 0.0217  4   ASP A O   
27   C CB  . ASP A 4   ? 0.5375 0.8892 0.6438 0.0345  -0.1243 0.0358  4   ASP A CB  
28   C CG  . ASP A 4   ? 0.5704 0.9455 0.6712 0.0416  -0.1422 0.0316  4   ASP A CG  
29   O OD1 . ASP A 4   ? 0.5780 0.9543 0.6485 0.0474  -0.1477 0.0215  4   ASP A OD1 
30   O OD2 . ASP A 4   ? 0.5997 0.9928 0.7257 0.0426  -0.1502 0.0389  4   ASP A OD2 
31   N N   . HIS A 5   ? 0.4845 0.7868 0.5571 0.0334  -0.0812 0.0494  5   HIS A N   
32   C CA  . HIS A 5   ? 0.4539 0.7382 0.5343 0.0283  -0.0679 0.0531  5   HIS A CA  
33   C C   . HIS A 5   ? 0.4504 0.7222 0.5128 0.0339  -0.0510 0.0651  5   HIS A C   
34   O O   . HIS A 5   ? 0.4573 0.7356 0.5134 0.0414  -0.0477 0.0765  5   HIS A O   
35   C CB  . HIS A 5   ? 0.4337 0.7229 0.5473 0.0243  -0.0689 0.0598  5   HIS A CB  
36   C CG  . HIS A 5   ? 0.4336 0.7337 0.5722 0.0173  -0.0846 0.0484  5   HIS A CG  
37   N ND1 . HIS A 5   ? 0.4440 0.7352 0.5852 0.0103  -0.0887 0.0339  5   HIS A ND1 
38   C CD2 . HIS A 5   ? 0.4401 0.7591 0.6047 0.0161  -0.0975 0.0489  5   HIS A CD2 
39   C CE1 . HIS A 5   ? 0.4387 0.7413 0.6065 0.0047  -0.1030 0.0256  5   HIS A CE1 
40   N NE2 . HIS A 5   ? 0.4546 0.7748 0.6379 0.0077  -0.1091 0.0341  5   HIS A NE2 
41   N N   . VAL A 6   ? 0.4391 0.6929 0.4952 0.0304  -0.0407 0.0623  6   VAL A N   
42   C CA  . VAL A 6   ? 0.4344 0.6742 0.4750 0.0343  -0.0256 0.0702  6   VAL A CA  
43   C C   . VAL A 6   ? 0.4215 0.6470 0.4717 0.0313  -0.0161 0.0733  6   VAL A C   
44   O O   . VAL A 6   ? 0.4191 0.6381 0.4747 0.0257  -0.0177 0.0647  6   VAL A O   
45   C CB  . VAL A 6   ? 0.4410 0.6739 0.4593 0.0345  -0.0228 0.0623  6   VAL A CB  
46   C CG1 . VAL A 6   ? 0.4621 0.6840 0.4662 0.0394  -0.0085 0.0716  6   VAL A CG1 
47   C CG2 . VAL A 6   ? 0.4584 0.7061 0.4666 0.0378  -0.0343 0.0565  6   VAL A CG2 
48   N N   . SER A 7   ? 0.4147 0.6358 0.4664 0.0364  -0.0064 0.0857  7   SER A N   
49   C CA  . SER A 7   ? 0.4005 0.6086 0.4577 0.0363  0.0031  0.0894  7   SER A CA  
50   C C   . SER A 7   ? 0.4083 0.6015 0.4490 0.0405  0.0153  0.0933  7   SER A C   
51   O O   . SER A 7   ? 0.4193 0.6136 0.4562 0.0466  0.0207  0.1032  7   SER A O   
52   C CB  . SER A 7   ? 0.3955 0.6113 0.4723 0.0396  0.0042  0.1008  7   SER A CB  
53   O OG  . SER A 7   ? 0.3847 0.6141 0.4825 0.0349  -0.0068 0.0978  7   SER A OG  
54   N N   . THR A 8   ? 0.4009 0.5800 0.4335 0.0374  0.0195  0.0853  8   THR A N   
55   C CA  . THR A 8   ? 0.4025 0.5678 0.4213 0.0393  0.0289  0.0851  8   THR A CA  
56   C C   . THR A 8   ? 0.3941 0.5444 0.4108 0.0391  0.0348  0.0810  8   THR A C   
57   O O   . THR A 8   ? 0.3923 0.5411 0.4116 0.0354  0.0308  0.0734  8   THR A O   
58   C CB  . THR A 8   ? 0.4089 0.5751 0.4173 0.0361  0.0268  0.0776  8   THR A CB  
59   O OG1 . THR A 8   ? 0.4089 0.5683 0.4158 0.0306  0.0251  0.0660  8   THR A OG1 
60   C CG2 . THR A 8   ? 0.4096 0.5931 0.4192 0.0360  0.0166  0.0769  8   THR A CG2 
61   N N   . TYR A 9   ? 0.3965 0.5355 0.4081 0.0441  0.0440  0.0863  9   TYR A N   
62   C CA  . TYR A 9   ? 0.4035 0.5270 0.4089 0.0447  0.0490  0.0801  9   TYR A CA  
63   C C   . TYR A 9   ? 0.4108 0.5270 0.4095 0.0400  0.0499  0.0711  9   TYR A C   
64   O O   . TYR A 9   ? 0.4269 0.5429 0.4234 0.0404  0.0539  0.0751  9   TYR A O   
65   C CB  . TYR A 9   ? 0.4069 0.5196 0.4091 0.0524  0.0585  0.0875  9   TYR A CB  
66   C CG  . TYR A 9   ? 0.3867 0.5044 0.3958 0.0584  0.0601  0.0965  9   TYR A CG  
67   C CD1 . TYR A 9   ? 0.3606 0.4898 0.3794 0.0624  0.0612  0.1093  9   TYR A CD1 
68   C CD2 . TYR A 9   ? 0.4082 0.5204 0.4152 0.0609  0.0609  0.0934  9   TYR A CD2 
69   C CE1 . TYR A 9   ? 0.3213 0.4564 0.3503 0.0679  0.0638  0.1189  9   TYR A CE1 
70   C CE2 . TYR A 9   ? 0.3774 0.4945 0.3924 0.0676  0.0647  0.1040  9   TYR A CE2 
71   C CZ  . TYR A 9   ? 0.3409 0.4694 0.3682 0.0705  0.0663  0.1166  9   TYR A CZ  
72   O OH  . TYR A 9   ? 0.3483 0.4828 0.3868 0.0766  0.0707  0.1276  9   TYR A OH  
73   N N   . ALA A 10  ? 0.4049 0.5162 0.4017 0.0359  0.0467  0.0600  10  ALA A N   
74   C CA  . ALA A 10  ? 0.4070 0.5125 0.4012 0.0311  0.0477  0.0514  10  ALA A CA  
75   C C   . ALA A 10  ? 0.4121 0.5051 0.4033 0.0314  0.0486  0.0425  10  ALA A C   
76   O O   . ALA A 10  ? 0.4128 0.5068 0.4029 0.0327  0.0443  0.0388  10  ALA A O   
77   C CB  . ALA A 10  ? 0.4025 0.5183 0.3989 0.0256  0.0407  0.0452  10  ALA A CB  
78   N N   . ALA A 11  ? 0.4215 0.5029 0.4121 0.0308  0.0542  0.0392  11  ALA A N   
79   C CA  . ALA A 11  ? 0.4338 0.5032 0.4216 0.0315  0.0537  0.0289  11  ALA A CA  
80   C C   . ALA A 11  ? 0.4483 0.5122 0.4429 0.0250  0.0550  0.0203  11  ALA A C   
81   O O   . ALA A 11  ? 0.4550 0.5196 0.4551 0.0224  0.0608  0.0258  11  ALA A O   
82   C CB  . ALA A 11  ? 0.4397 0.4971 0.4217 0.0389  0.0598  0.0328  11  ALA A CB  
83   N N   . PHE A 12  ? 0.4522 0.5120 0.4476 0.0230  0.0497  0.0076  12  PHE A N   
84   C CA  . PHE A 12  ? 0.4615 0.5163 0.4676 0.0165  0.0504  -0.0016 12  PHE A CA  
85   C C   . PHE A 12  ? 0.4783 0.5229 0.4833 0.0176  0.0455  -0.0154 12  PHE A C   
86   O O   . PHE A 12  ? 0.4791 0.5225 0.4721 0.0239  0.0405  -0.0185 12  PHE A O   
87   C CB  . PHE A 12  ? 0.4476 0.5147 0.4615 0.0102  0.0471  -0.0041 12  PHE A CB  
88   C CG  . PHE A 12  ? 0.4159 0.4899 0.4279 0.0100  0.0373  -0.0133 12  PHE A CG  
89   C CD1 . PHE A 12  ? 0.3967 0.4819 0.4040 0.0113  0.0332  -0.0091 12  PHE A CD1 
90   C CD2 . PHE A 12  ? 0.3803 0.4498 0.3963 0.0087  0.0318  -0.0263 12  PHE A CD2 
91   C CE1 . PHE A 12  ? 0.3670 0.4576 0.3734 0.0118  0.0254  -0.0161 12  PHE A CE1 
92   C CE2 . PHE A 12  ? 0.3704 0.4471 0.3840 0.0100  0.0228  -0.0335 12  PHE A CE2 
93   C CZ  . PHE A 12  ? 0.3668 0.4536 0.3756 0.0117  0.0204  -0.0277 12  PHE A CZ  
94   N N   . VAL A 13  ? 0.4854 0.5236 0.5039 0.0116  0.0468  -0.0236 13  VAL A N   
95   C CA  . VAL A 13  ? 0.4967 0.5230 0.5170 0.0120  0.0426  -0.0378 13  VAL A CA  
96   C C   . VAL A 13  ? 0.4928 0.5204 0.5350 0.0024  0.0416  -0.0466 13  VAL A C   
97   O O   . VAL A 13  ? 0.4897 0.5187 0.5453 -0.0028 0.0501  -0.0388 13  VAL A O   
98   C CB  . VAL A 13  ? 0.5124 0.5220 0.5275 0.0172  0.0506  -0.0340 13  VAL A CB  
99   C CG1 . VAL A 13  ? 0.5300 0.5263 0.5634 0.0111  0.0560  -0.0402 13  VAL A CG1 
100  C CG2 . VAL A 13  ? 0.5311 0.5339 0.5273 0.0268  0.0457  -0.0400 13  VAL A CG2 
101  N N   . GLN A 14  ? 0.5002 0.5295 0.5468 0.0007  0.0312  -0.0619 14  GLN A N   
102  C CA  . GLN A 14  ? 0.5048 0.5381 0.5762 -0.0088 0.0294  -0.0703 14  GLN A CA  
103  C C   . GLN A 14  ? 0.5302 0.5600 0.6053 -0.0087 0.0171  -0.0895 14  GLN A C   
104  O O   . GLN A 14  ? 0.5409 0.5693 0.5953 -0.0003 0.0091  -0.0952 14  GLN A O   
105  C CB  . GLN A 14  ? 0.4793 0.5304 0.5563 -0.0123 0.0284  -0.0653 14  GLN A CB  
106  C CG  . GLN A 14  ? 0.4513 0.5133 0.5175 -0.0082 0.0163  -0.0720 14  GLN A CG  
107  C CD  . GLN A 14  ? 0.4449 0.5221 0.5137 -0.0102 0.0168  -0.0655 14  GLN A CD  
108  O OE1 . GLN A 14  ? 0.3975 0.4798 0.4826 -0.0164 0.0230  -0.0622 14  GLN A OE1 
109  N NE2 . GLN A 14  ? 0.4531 0.5371 0.5059 -0.0041 0.0111  -0.0634 14  GLN A NE2 
110  N N   . THR A 15  ? 0.5451 0.5746 0.6472 -0.0176 0.0157  -0.0993 15  THR A N   
111  C CA  . THR A 15  ? 0.5654 0.5939 0.6749 -0.0185 0.0018  -0.1196 15  THR A CA  
112  C C   . THR A 15  ? 0.5620 0.6069 0.6599 -0.0138 -0.0112 -0.1250 15  THR A C   
113  O O   . THR A 15  ? 0.5814 0.6248 0.6652 -0.0070 -0.0230 -0.1375 15  THR A O   
114  C CB  . THR A 15  ? 0.5715 0.5968 0.7191 -0.0304 0.0027  -0.1296 15  THR A CB  
115  O OG1 . THR A 15  ? 0.5656 0.6089 0.7329 -0.0364 -0.0023 -0.1324 15  THR A OG1 
116  C CG2 . THR A 15  ? 0.5648 0.5796 0.7278 -0.0358 0.0202  -0.1162 15  THR A CG2 
117  N N   . HIS A 16  ? 0.5527 0.6127 0.6545 -0.0160 -0.0086 -0.1154 16  HIS A N   
118  C CA  . HIS A 16  ? 0.5603 0.6360 0.6584 -0.0128 -0.0203 -0.1212 16  HIS A CA  
119  C C   . HIS A 16  ? 0.5599 0.6400 0.6289 -0.0022 -0.0230 -0.1137 16  HIS A C   
120  O O   . HIS A 16  ? 0.5555 0.6294 0.6076 0.0022  -0.0150 -0.1016 16  HIS A O   
121  C CB  . HIS A 16  ? 0.5478 0.6383 0.6693 -0.0206 -0.0175 -0.1175 16  HIS A CB  
122  C CG  . HIS A 16  ? 0.5680 0.6636 0.7204 -0.0285 -0.0240 -0.1313 16  HIS A CG  
123  N ND1 . HIS A 16  ? 0.5891 0.6758 0.7671 -0.0373 -0.0173 -0.1339 16  HIS A ND1 
124  C CD2 . HIS A 16  ? 0.5888 0.6980 0.7531 -0.0288 -0.0369 -0.1429 16  HIS A CD2 
125  C CE1 . HIS A 16  ? 0.6116 0.7064 0.8181 -0.0436 -0.0259 -0.1473 16  HIS A CE1 
126  N NE2 . HIS A 16  ? 0.5987 0.7080 0.7970 -0.0384 -0.0384 -0.1532 16  HIS A NE2 
127  N N   . ARG A 17  ? 0.5671 0.6585 0.6332 0.0020  -0.0346 -0.1213 17  ARG A N   
128  C CA  . ARG A 17  ? 0.5598 0.6611 0.6103 0.0091  -0.0361 -0.1129 17  ARG A CA  
129  C C   . ARG A 17  ? 0.5495 0.6432 0.5734 0.0186  -0.0316 -0.1027 17  ARG A C   
130  O O   . ARG A 17  ? 0.5801 0.6697 0.5865 0.0281  -0.0384 -0.1088 17  ARG A O   
131  C CB  . ARG A 17  ? 0.5525 0.6658 0.6188 0.0026  -0.0309 -0.1050 17  ARG A CB  
132  C CG  . ARG A 17  ? 0.5738 0.6993 0.6663 -0.0037 -0.0377 -0.1157 17  ARG A CG  
133  C CD  . ARG A 17  ? 0.6145 0.7442 0.7065 0.0013  -0.0533 -0.1314 17  ARG A CD  
134  N NE  . ARG A 17  ? 0.6635 0.7811 0.7581 -0.0006 -0.0566 -0.1425 17  ARG A NE  
135  C CZ  . ARG A 17  ? 0.6989 0.8141 0.7824 0.0064  -0.0694 -0.1563 17  ARG A CZ  
136  N NH1 . ARG A 17  ? 0.7006 0.8261 0.7691 0.0167  -0.0802 -0.1595 17  ARG A NH1 
137  N NH2 . ARG A 17  ? 0.7077 0.8098 0.7945 0.0041  -0.0713 -0.1670 17  ARG A NH2 
138  N N   . PRO A 18  ? 0.5172 0.6104 0.5378 0.0171  -0.0211 -0.0876 18  PRO A N   
139  C CA  . PRO A 18  ? 0.5022 0.5864 0.5034 0.0241  -0.0146 -0.0770 18  PRO A CA  
140  C C   . PRO A 18  ? 0.4901 0.5614 0.4938 0.0207  -0.0065 -0.0751 18  PRO A C   
141  O O   . PRO A 18  ? 0.4784 0.5497 0.4915 0.0145  0.0020  -0.0665 18  PRO A O   
142  C CB  . PRO A 18  ? 0.4843 0.5764 0.4850 0.0234  -0.0093 -0.0636 18  PRO A CB  
143  C CG  . PRO A 18  ? 0.4744 0.5750 0.4943 0.0140  -0.0086 -0.0655 18  PRO A CG  
144  C CD  . PRO A 18  ? 0.4999 0.6029 0.5328 0.0107  -0.0163 -0.0800 18  PRO A CD  
145  N N   . THR A 19  ? 0.4919 0.5522 0.4858 0.0262  -0.0092 -0.0832 19  THR A N   
146  C CA  . THR A 19  ? 0.4871 0.5332 0.4860 0.0232  -0.0032 -0.0856 19  THR A CA  
147  C C   . THR A 19  ? 0.4814 0.5206 0.4728 0.0256  0.0088  -0.0703 19  THR A C   
148  O O   . THR A 19  ? 0.4887 0.5175 0.4880 0.0220  0.0161  -0.0687 19  THR A O   
149  C CB  . THR A 19  ? 0.5093 0.5455 0.4977 0.0298  -0.0112 -0.1009 19  THR A CB  
150  O OG1 . THR A 19  ? 0.5100 0.5438 0.5203 0.0209  -0.0165 -0.1156 19  THR A OG1 
151  C CG2 . THR A 19  ? 0.5339 0.5544 0.5049 0.0381  -0.0040 -0.0967 19  THR A CG2 
152  N N   . GLY A 20  ? 0.4740 0.5193 0.4523 0.0319  0.0110  -0.0585 20  GLY A N   
153  C CA  . GLY A 20  ? 0.4669 0.5092 0.4402 0.0345  0.0210  -0.0433 20  GLY A CA  
154  C C   . GLY A 20  ? 0.4539 0.5069 0.4206 0.0385  0.0218  -0.0310 20  GLY A C   
155  O O   . GLY A 20  ? 0.4454 0.5033 0.4033 0.0444  0.0164  -0.0326 20  GLY A O   
156  N N   . GLU A 21  ? 0.4441 0.5010 0.4160 0.0357  0.0285  -0.0185 21  GLU A N   
157  C CA  . GLU A 21  ? 0.4348 0.5015 0.4045 0.0386  0.0292  -0.0069 21  GLU A CA  
158  C C   . GLU A 21  ? 0.4305 0.4955 0.3999 0.0410  0.0371  0.0059  21  GLU A C   
159  O O   . GLU A 21  ? 0.4367 0.4986 0.4118 0.0371  0.0418  0.0084  21  GLU A O   
160  C CB  . GLU A 21  ? 0.4148 0.4937 0.3950 0.0310  0.0255  -0.0070 21  GLU A CB  
161  C CG  . GLU A 21  ? 0.3932 0.4815 0.3734 0.0334  0.0230  -0.0003 21  GLU A CG  
162  C CD  . GLU A 21  ? 0.4148 0.5124 0.4036 0.0272  0.0178  -0.0052 21  GLU A CD  
163  O OE1 . GLU A 21  ? 0.4146 0.5195 0.4092 0.0238  0.0182  0.0004  21  GLU A OE1 
164  O OE2 . GLU A 21  ? 0.3888 0.4868 0.3788 0.0260  0.0130  -0.0151 21  GLU A OE2 
165  N N   . PHE A 22  ? 0.4260 0.4939 0.3903 0.0480  0.0390  0.0150  22  PHE A N   
166  C CA  . PHE A 22  ? 0.4182 0.4878 0.3849 0.0508  0.0455  0.0283  22  PHE A CA  
167  C C   . PHE A 22  ? 0.4126 0.4953 0.3865 0.0509  0.0435  0.0372  22  PHE A C   
168  O O   . PHE A 22  ? 0.4081 0.4920 0.3788 0.0565  0.0428  0.0394  22  PHE A O   
169  C CB  . PHE A 22  ? 0.4316 0.4899 0.3875 0.0610  0.0519  0.0312  22  PHE A CB  
170  C CG  . PHE A 22  ? 0.4391 0.4991 0.3990 0.0647  0.0595  0.0453  22  PHE A CG  
171  C CD1 . PHE A 22  ? 0.4569 0.5100 0.4189 0.0634  0.0650  0.0473  22  PHE A CD1 
172  C CD2 . PHE A 22  ? 0.4251 0.4947 0.3896 0.0693  0.0614  0.0574  22  PHE A CD2 
173  C CE1 . PHE A 22  ? 0.4855 0.5419 0.4520 0.0676  0.0716  0.0611  22  PHE A CE1 
174  C CE2 . PHE A 22  ? 0.4385 0.5122 0.4097 0.0725  0.0675  0.0705  22  PHE A CE2 
175  C CZ  . PHE A 22  ? 0.4690 0.5364 0.4401 0.0722  0.0723  0.0724  22  PHE A CZ  
176  N N   . MET A 23  ? 0.4065 0.4986 0.3905 0.0452  0.0426  0.0427  23  MET A N   
177  C CA  . MET A 23  ? 0.4036 0.5079 0.3976 0.0440  0.0392  0.0492  23  MET A CA  
178  C C   . MET A 23  ? 0.3930 0.5068 0.3963 0.0425  0.0399  0.0588  23  MET A C   
179  O O   . MET A 23  ? 0.3998 0.5110 0.4003 0.0428  0.0436  0.0616  23  MET A O   
180  C CB  . MET A 23  ? 0.4005 0.5102 0.3985 0.0373  0.0319  0.0403  23  MET A CB  
181  C CG  . MET A 23  ? 0.4225 0.5361 0.4226 0.0303  0.0297  0.0360  23  MET A CG  
182  S SD  . MET A 23  ? 0.5094 0.6336 0.5178 0.0241  0.0218  0.0305  23  MET A SD  
183  C CE  . MET A 23  ? 0.4542 0.5722 0.4577 0.0222  0.0200  0.0183  23  MET A CE  
184  N N   . PHE A 24  ? 0.3816 0.5065 0.3970 0.0409  0.0358  0.0636  24  PHE A N   
185  C CA  . PHE A 24  ? 0.3681 0.5048 0.3946 0.0395  0.0337  0.0714  24  PHE A CA  
186  C C   . PHE A 24  ? 0.3604 0.5079 0.3993 0.0335  0.0251  0.0677  24  PHE A C   
187  O O   . PHE A 24  ? 0.3476 0.4941 0.3922 0.0330  0.0236  0.0657  24  PHE A O   
188  C CB  . PHE A 24  ? 0.3769 0.5153 0.4103 0.0465  0.0397  0.0840  24  PHE A CB  
189  C CG  . PHE A 24  ? 0.3590 0.5122 0.4083 0.0454  0.0361  0.0924  24  PHE A CG  
190  C CD1 . PHE A 24  ? 0.3577 0.5145 0.4051 0.0478  0.0381  0.0984  24  PHE A CD1 
191  C CD2 . PHE A 24  ? 0.3517 0.5156 0.4199 0.0424  0.0308  0.0947  24  PHE A CD2 
192  C CE1 . PHE A 24  ? 0.3509 0.5234 0.4132 0.0476  0.0334  0.1059  24  PHE A CE1 
193  C CE2 . PHE A 24  ? 0.3446 0.5237 0.4305 0.0410  0.0258  0.1012  24  PHE A CE2 
194  C CZ  . PHE A 24  ? 0.3512 0.5354 0.4333 0.0438  0.0265  0.1066  24  PHE A CZ  
195  N N   . GLU A 25  ? 0.3641 0.5214 0.4065 0.0297  0.0193  0.0667  25  GLU A N   
196  C CA  . GLU A 25  ? 0.3718 0.5379 0.4238 0.0238  0.0100  0.0599  25  GLU A CA  
197  C C   . GLU A 25  ? 0.3698 0.5502 0.4339 0.0229  0.0035  0.0642  25  GLU A C   
198  O O   . GLU A 25  ? 0.3772 0.5619 0.4380 0.0264  0.0055  0.0711  25  GLU A O   
199  C CB  . GLU A 25  ? 0.3770 0.5404 0.4175 0.0197  0.0069  0.0484  25  GLU A CB  
200  C CG  . GLU A 25  ? 0.4276 0.5921 0.4561 0.0209  0.0091  0.0492  25  GLU A CG  
201  C CD  . GLU A 25  ? 0.5125 0.6758 0.5316 0.0174  0.0073  0.0391  25  GLU A CD  
202  O OE1 . GLU A 25  ? 0.5602 0.7229 0.5694 0.0190  0.0113  0.0408  25  GLU A OE1 
203  O OE2 . GLU A 25  ? 0.5228 0.6855 0.5450 0.0138  0.0029  0.0303  25  GLU A OE2 
204  N N   . PHE A 26  ? 0.3740 0.5619 0.4531 0.0182  -0.0049 0.0595  26  PHE A N   
205  C CA  . PHE A 26  ? 0.3765 0.5795 0.4687 0.0165  -0.0142 0.0603  26  PHE A CA  
206  C C   . PHE A 26  ? 0.3956 0.6029 0.4850 0.0114  -0.0248 0.0464  26  PHE A C   
207  O O   . PHE A 26  ? 0.3933 0.5973 0.4919 0.0069  -0.0284 0.0386  26  PHE A O   
208  C CB  . PHE A 26  ? 0.3667 0.5757 0.4855 0.0156  -0.0152 0.0675  26  PHE A CB  
209  C CG  . PHE A 26  ? 0.3658 0.5914 0.5030 0.0128  -0.0266 0.0665  26  PHE A CG  
210  C CD1 . PHE A 26  ? 0.3516 0.5885 0.4906 0.0171  -0.0277 0.0752  26  PHE A CD1 
211  C CD2 . PHE A 26  ? 0.3860 0.6162 0.5392 0.0060  -0.0372 0.0560  26  PHE A CD2 
212  C CE1 . PHE A 26  ? 0.3695 0.6239 0.5258 0.0149  -0.0404 0.0733  26  PHE A CE1 
213  C CE2 . PHE A 26  ? 0.3967 0.6431 0.5679 0.0031  -0.0502 0.0527  26  PHE A CE2 
214  C CZ  . PHE A 26  ? 0.3927 0.6521 0.5653 0.0076  -0.0523 0.0612  26  PHE A CZ  
215  N N   . ASP A 27  ? 0.4145 0.6290 0.4906 0.0132  -0.0293 0.0437  27  ASP A N   
216  C CA  . ASP A 27  ? 0.4347 0.6521 0.5020 0.0105  -0.0377 0.0302  27  ASP A CA  
217  C C   . ASP A 27  ? 0.4273 0.6314 0.4866 0.0080  -0.0326 0.0226  27  ASP A C   
218  O O   . ASP A 27  ? 0.4280 0.6309 0.4946 0.0038  -0.0383 0.0126  27  ASP A O   
219  C CB  . ASP A 27  ? 0.4395 0.6674 0.5265 0.0061  -0.0513 0.0224  27  ASP A CB  
220  C CG  . ASP A 27  ? 0.4865 0.7310 0.5813 0.0086  -0.0599 0.0271  27  ASP A CG  
221  O OD1 . ASP A 27  ? 0.5181 0.7660 0.5999 0.0148  -0.0547 0.0368  27  ASP A OD1 
222  O OD2 . ASP A 27  ? 0.5226 0.7772 0.6386 0.0045  -0.0719 0.0211  27  ASP A OD2 
223  N N   . GLU A 28  ? 0.4371 0.6312 0.4837 0.0105  -0.0219 0.0273  28  GLU A N   
224  C CA  . GLU A 28  ? 0.4363 0.6204 0.4730 0.0089  -0.0176 0.0197  28  GLU A CA  
225  C C   . GLU A 28  ? 0.4156 0.5913 0.4628 0.0071  -0.0148 0.0192  28  GLU A C   
226  O O   . GLU A 28  ? 0.4127 0.5802 0.4529 0.0067  -0.0107 0.0147  28  GLU A O   
227  C CB  . GLU A 28  ? 0.4504 0.6390 0.4816 0.0070  -0.0249 0.0077  28  GLU A CB  
228  C CG  . GLU A 28  ? 0.5255 0.7112 0.5384 0.0089  -0.0198 0.0039  28  GLU A CG  
229  C CD  . GLU A 28  ? 0.6062 0.7981 0.6061 0.0139  -0.0172 0.0109  28  GLU A CD  
230  O OE1 . GLU A 28  ? 0.6471 0.8448 0.6344 0.0166  -0.0200 0.0060  28  GLU A OE1 
231  O OE2 . GLU A 28  ? 0.6250 0.8153 0.6262 0.0163  -0.0116 0.0217  28  GLU A OE2 
232  N N   . ASP A 29  ? 0.3977 0.5761 0.4622 0.0066  -0.0169 0.0246  29  ASP A N   
233  C CA  . ASP A 29  ? 0.3801 0.5512 0.4544 0.0066  -0.0134 0.0261  29  ASP A CA  
234  C C   . ASP A 29  ? 0.3741 0.5395 0.4447 0.0120  -0.0042 0.0370  29  ASP A C   
235  O O   . ASP A 29  ? 0.3779 0.5480 0.4549 0.0145  -0.0024 0.0465  29  ASP A O   
236  C CB  . ASP A 29  ? 0.3699 0.5463 0.4680 0.0033  -0.0193 0.0263  29  ASP A CB  
237  C CG  . ASP A 29  ? 0.3790 0.5559 0.4810 -0.0016 -0.0274 0.0128  29  ASP A CG  
238  O OD1 . ASP A 29  ? 0.4182 0.5891 0.5062 -0.0016 -0.0261 0.0049  29  ASP A OD1 
239  O OD2 . ASP A 29  ? 0.3467 0.5297 0.4670 -0.0054 -0.0352 0.0096  29  ASP A OD2 
240  N N   . GLU A 30  ? 0.3618 0.5173 0.4218 0.0144  0.0010  0.0350  30  GLU A N   
241  C CA  . GLU A 30  ? 0.3622 0.5109 0.4166 0.0208  0.0090  0.0430  30  GLU A CA  
242  C C   . GLU A 30  ? 0.3596 0.5111 0.4301 0.0238  0.0116  0.0536  30  GLU A C   
243  O O   . GLU A 30  ? 0.3690 0.5210 0.4520 0.0223  0.0096  0.0528  30  GLU A O   
244  C CB  . GLU A 30  ? 0.3593 0.4989 0.4025 0.0231  0.0113  0.0371  30  GLU A CB  
245  C CG  . GLU A 30  ? 0.3906 0.5222 0.4237 0.0309  0.0184  0.0427  30  GLU A CG  
246  C CD  . GLU A 30  ? 0.4642 0.5934 0.5017 0.0369  0.0215  0.0487  30  GLU A CD  
247  O OE1 . GLU A 30  ? 0.5026 0.6310 0.5419 0.0435  0.0278  0.0595  30  GLU A OE1 
248  O OE2 . GLU A 30  ? 0.4791 0.6073 0.5180 0.0364  0.0188  0.0436  30  GLU A OE2 
249  N N   . MET A 31  ? 0.3415 0.4944 0.4133 0.0286  0.0169  0.0642  31  MET A N   
250  C CA  . MET A 31  ? 0.3200 0.4762 0.4090 0.0325  0.0215  0.0763  31  MET A CA  
251  C C   . MET A 31  ? 0.3243 0.4706 0.4012 0.0422  0.0315  0.0828  31  MET A C   
252  O O   . MET A 31  ? 0.3085 0.4533 0.3936 0.0462  0.0357  0.0890  31  MET A O   
253  C CB  . MET A 31  ? 0.3158 0.4824 0.4175 0.0323  0.0209  0.0847  31  MET A CB  
254  C CG  . MET A 31  ? 0.2905 0.4620 0.4128 0.0368  0.0271  0.0991  31  MET A CG  
255  S SD  . MET A 31  ? 0.2326 0.4204 0.3751 0.0356  0.0238  0.1080  31  MET A SD  
256  C CE  . MET A 31  ? 0.1551 0.3520 0.3354 0.0352  0.0266  0.1202  31  MET A CE  
257  N N   . PHE A 32  ? 0.3306 0.4697 0.3878 0.0466  0.0354  0.0812  32  PHE A N   
258  C CA  . PHE A 32  ? 0.3465 0.4749 0.3869 0.0561  0.0426  0.0828  32  PHE A CA  
259  C C   . PHE A 32  ? 0.3607 0.4796 0.3798 0.0563  0.0415  0.0717  32  PHE A C   
260  O O   . PHE A 32  ? 0.3445 0.4649 0.3624 0.0497  0.0376  0.0656  32  PHE A O   
261  C CB  . PHE A 32  ? 0.3516 0.4799 0.3950 0.0654  0.0524  0.0970  32  PHE A CB  
262  C CG  . PHE A 32  ? 0.3583 0.4872 0.3992 0.0663  0.0551  0.1007  32  PHE A CG  
263  C CD1 . PHE A 32  ? 0.3796 0.4969 0.3998 0.0724  0.0600  0.0974  32  PHE A CD1 
264  C CD2 . PHE A 32  ? 0.3587 0.5002 0.4192 0.0618  0.0527  0.1077  32  PHE A CD2 
265  C CE1 . PHE A 32  ? 0.4045 0.5212 0.4236 0.0740  0.0638  0.1020  32  PHE A CE1 
266  C CE2 . PHE A 32  ? 0.3614 0.5044 0.4200 0.0641  0.0556  0.1128  32  PHE A CE2 
267  C CZ  . PHE A 32  ? 0.3958 0.5258 0.4338 0.0703  0.0620  0.1106  32  PHE A CZ  
268  N N   . TYR A 33  ? 0.3855 0.4950 0.3886 0.0644  0.0451  0.0694  33  TYR A N   
269  C CA  . TYR A 33  ? 0.4060 0.5053 0.3910 0.0658  0.0447  0.0591  33  TYR A CA  
270  C C   . TYR A 33  ? 0.4290 0.5185 0.3968 0.0784  0.0509  0.0608  33  TYR A C   
271  O O   . TYR A 33  ? 0.4395 0.5302 0.4068 0.0870  0.0558  0.0699  33  TYR A O   
272  C CB  . TYR A 33  ? 0.4051 0.5039 0.3871 0.0591  0.0368  0.0453  33  TYR A CB  
273  C CG  . TYR A 33  ? 0.4227 0.5207 0.3990 0.0642  0.0343  0.0420  33  TYR A CG  
274  C CD1 . TYR A 33  ? 0.4618 0.5516 0.4203 0.0722  0.0341  0.0351  33  TYR A CD1 
275  C CD2 . TYR A 33  ? 0.4379 0.5431 0.4267 0.0617  0.0319  0.0452  33  TYR A CD2 
276  C CE1 . TYR A 33  ? 0.4829 0.5733 0.4345 0.0786  0.0313  0.0329  33  TYR A CE1 
277  C CE2 . TYR A 33  ? 0.4644 0.5688 0.4480 0.0677  0.0306  0.0439  33  TYR A CE2 
278  C CZ  . TYR A 33  ? 0.4753 0.5730 0.4397 0.0766  0.0303  0.0384  33  TYR A CZ  
279  O OH  . TYR A 33  ? 0.4893 0.5878 0.4476 0.0838  0.0285  0.0378  33  TYR A OH  
280  N N   . VAL A 34  ? 0.4430 0.5223 0.3972 0.0801  0.0512  0.0522  34  VAL A N   
281  C CA  . VAL A 34  ? 0.4744 0.5428 0.4092 0.0924  0.0556  0.0503  34  VAL A CA  
282  C C   . VAL A 34  ? 0.4898 0.5538 0.4117 0.0934  0.0477  0.0352  34  VAL A C   
283  O O   . VAL A 34  ? 0.4817 0.5424 0.4044 0.0858  0.0420  0.0228  34  VAL A O   
284  C CB  . VAL A 34  ? 0.4818 0.5399 0.4100 0.0954  0.0615  0.0499  34  VAL A CB  
285  C CG1 . VAL A 34  ? 0.5057 0.5515 0.4119 0.1088  0.0652  0.0455  34  VAL A CG1 
286  C CG2 . VAL A 34  ? 0.4691 0.5331 0.4099 0.0963  0.0692  0.0657  34  VAL A CG2 
287  N N   . ASP A 35  ? 0.5164 0.5814 0.4281 0.1033  0.0477  0.0372  35  ASP A N   
288  C CA  . ASP A 35  ? 0.5498 0.6123 0.4482 0.1064  0.0394  0.0234  35  ASP A CA  
289  C C   . ASP A 35  ? 0.5848 0.6344 0.4644 0.1129  0.0386  0.0117  35  ASP A C   
290  O O   . ASP A 35  ? 0.6120 0.6547 0.4751 0.1264  0.0454  0.0165  35  ASP A O   
291  C CB  . ASP A 35  ? 0.5591 0.6259 0.4493 0.1178  0.0408  0.0307  35  ASP A CB  
292  C CG  . ASP A 35  ? 0.6016 0.6676 0.4762 0.1233  0.0313  0.0170  35  ASP A CG  
293  O OD1 . ASP A 35  ? 0.6254 0.6832 0.4848 0.1269  0.0268  0.0035  35  ASP A OD1 
294  O OD2 . ASP A 35  ? 0.6294 0.7031 0.5079 0.1244  0.0280  0.0193  35  ASP A OD2 
295  N N   . LEU A 36  ? 0.5941 0.6401 0.4773 0.1038  0.0308  -0.0038 36  LEU A N   
296  C CA  . LEU A 36  ? 0.6234 0.6558 0.4942 0.1075  0.0296  -0.0165 36  LEU A CA  
297  C C   . LEU A 36  ? 0.6622 0.6897 0.5097 0.1205  0.0233  -0.0282 36  LEU A C   
298  O O   . LEU A 36  ? 0.6938 0.7085 0.5277 0.1265  0.0231  -0.0385 36  LEU A O   
299  C CB  . LEU A 36  ? 0.6134 0.6432 0.5001 0.0931  0.0247  -0.0282 36  LEU A CB  
300  C CG  . LEU A 36  ? 0.5936 0.6289 0.5009 0.0811  0.0300  -0.0178 36  LEU A CG  
301  C CD1 . LEU A 36  ? 0.5808 0.6145 0.5030 0.0685  0.0258  -0.0287 36  LEU A CD1 
302  C CD2 . LEU A 36  ? 0.5986 0.6280 0.5048 0.0852  0.0411  -0.0052 36  LEU A CD2 
303  N N   . ASP A 37  ? 0.6741 0.7110 0.5159 0.1259  0.0181  -0.0271 37  ASP A N   
304  C CA  . ASP A 37  ? 0.7189 0.7528 0.5345 0.1418  0.0128  -0.0354 37  ASP A CA  
305  C C   . ASP A 37  ? 0.7307 0.7632 0.5281 0.1590  0.0241  -0.0193 37  ASP A C   
306  O O   . ASP A 37  ? 0.7596 0.7813 0.5355 0.1718  0.0282  -0.0221 37  ASP A O   
307  C CB  . ASP A 37  ? 0.7273 0.7720 0.5441 0.1409  0.0005  -0.0440 37  ASP A CB  
308  C CG  . ASP A 37  ? 0.7703 0.8150 0.6010 0.1277  -0.0117 -0.0638 37  ASP A CG  
309  O OD1 . ASP A 37  ? 0.8089 0.8427 0.6432 0.1220  -0.0114 -0.0732 37  ASP A OD1 
310  O OD2 . ASP A 37  ? 0.8138 0.8696 0.6539 0.1231  -0.0210 -0.0692 37  ASP A OD2 
311  N N   . LYS A 38  ? 0.7152 0.7581 0.5223 0.1597  0.0296  -0.0025 38  LYS A N   
312  C CA  . LYS A 38  ? 0.7291 0.7721 0.5257 0.1747  0.0427  0.0163  38  LYS A CA  
313  C C   . LYS A 38  ? 0.7252 0.7598 0.5219 0.1772  0.0548  0.0248  38  LYS A C   
314  O O   . LYS A 38  ? 0.7376 0.7698 0.5210 0.1925  0.0661  0.0379  38  LYS A O   
315  C CB  . LYS A 38  ? 0.7131 0.7680 0.5302 0.1703  0.0473  0.0331  38  LYS A CB  
316  C CG  . LYS A 38  ? 0.7555 0.8157 0.5592 0.1846  0.0475  0.0395  38  LYS A CG  
317  C CD  . LYS A 38  ? 0.7880 0.8586 0.6180 0.1766  0.0505  0.0534  38  LYS A CD  
318  C CE  . LYS A 38  ? 0.8068 0.8832 0.6275 0.1875  0.0475  0.0562  38  LYS A CE  
319  N NZ  . LYS A 38  ? 0.7601 0.8444 0.6046 0.1725  0.0396  0.0523  38  LYS A NZ  
320  N N   . LYS A 39  ? 0.7046 0.7352 0.5168 0.1629  0.0532  0.0188  39  LYS A N   
321  C CA  . LYS A 39  ? 0.6973 0.7213 0.5140 0.1635  0.0644  0.0276  39  LYS A CA  
322  C C   . LYS A 39  ? 0.6806 0.7136 0.5132 0.1652  0.0765  0.0510  39  LYS A C   
323  O O   . LYS A 39  ? 0.6868 0.7155 0.5158 0.1741  0.0881  0.0618  39  LYS A O   
324  C CB  . LYS A 39  ? 0.7265 0.7353 0.5156 0.1789  0.0683  0.0201  39  LYS A CB  
325  C CG  . LYS A 39  ? 0.7455 0.7423 0.5295 0.1725  0.0586  -0.0025 39  LYS A CG  
326  C CD  . LYS A 39  ? 0.7628 0.7554 0.5230 0.1814  0.0467  -0.0217 39  LYS A CD  
327  C CE  . LYS A 39  ? 0.7639 0.7499 0.5331 0.1681  0.0342  -0.0441 39  LYS A CE  
328  N NZ  . LYS A 39  ? 0.8229 0.7974 0.5663 0.1794  0.0249  -0.0657 39  LYS A NZ  
329  N N   . GLU A 40  ? 0.6513 0.6968 0.5038 0.1564  0.0738  0.0583  40  GLU A N   
330  C CA  . GLU A 40  ? 0.6317 0.6865 0.5034 0.1570  0.0838  0.0790  40  GLU A CA  
331  C C   . GLU A 40  ? 0.5806 0.6453 0.4818 0.1386  0.0787  0.0807  40  GLU A C   
332  O O   . GLU A 40  ? 0.5727 0.6382 0.4774 0.1272  0.0682  0.0674  40  GLU A O   
333  C CB  . GLU A 40  ? 0.6523 0.7115 0.5171 0.1701  0.0891  0.0901  40  GLU A CB  
334  C CG  . GLU A 40  ? 0.7211 0.7759 0.5720 0.1895  0.1048  0.1055  40  GLU A CG  
335  C CD  . GLU A 40  ? 0.8162 0.8646 0.6327 0.2099  0.1067  0.1027  40  GLU A CD  
336  O OE1 . GLU A 40  ? 0.8360 0.8882 0.6467 0.2106  0.0988  0.0973  40  GLU A OE1 
337  O OE2 . GLU A 40  ? 0.8304 0.8704 0.6246 0.2262  0.1161  0.1059  40  GLU A OE2 
338  N N   . THR A 41  ? 0.5468 0.6195 0.4693 0.1361  0.0860  0.0964  41  THR A N   
339  C CA  . THR A 41  ? 0.5030 0.5861 0.4520 0.1202  0.0802  0.0976  41  THR A CA  
340  C C   . THR A 41  ? 0.4884 0.5792 0.4496 0.1179  0.0775  0.1013  41  THR A C   
341  O O   . THR A 41  ? 0.5007 0.5928 0.4628 0.1282  0.0857  0.1137  41  THR A O   
342  C CB  . THR A 41  ? 0.4990 0.5895 0.4689 0.1183  0.0871  0.1121  41  THR A CB  
343  O OG1 . THR A 41  ? 0.4943 0.5771 0.4534 0.1227  0.0919  0.1114  41  THR A OG1 
344  C CG2 . THR A 41  ? 0.4382 0.5402 0.4331 0.1023  0.0786  0.1107  41  THR A CG2 
345  N N   . VAL A 42  ? 0.4605 0.5555 0.4310 0.1052  0.0671  0.0912  42  VAL A N   
346  C CA  . VAL A 42  ? 0.4340 0.5359 0.4203 0.1009  0.0641  0.0940  42  VAL A CA  
347  C C   . VAL A 42  ? 0.4081 0.5196 0.4218 0.0877  0.0604  0.0967  42  VAL A C   
348  O O   . VAL A 42  ? 0.3934 0.5065 0.4086 0.0779  0.0537  0.0876  42  VAL A O   
349  C CB  . VAL A 42  ? 0.4474 0.5472 0.4232 0.0977  0.0546  0.0793  42  VAL A CB  
350  C CG1 . VAL A 42  ? 0.4296 0.5358 0.4239 0.0927  0.0519  0.0822  42  VAL A CG1 
351  C CG2 . VAL A 42  ? 0.4642 0.5562 0.4126 0.1115  0.0557  0.0750  42  VAL A CG2 
352  N N   . TRP A 43  ? 0.3961 0.5140 0.4315 0.0883  0.0652  0.1096  43  TRP A N   
353  C CA  . TRP A 43  ? 0.3714 0.4992 0.4353 0.0766  0.0606  0.1115  43  TRP A CA  
354  C C   . TRP A 43  ? 0.3701 0.4994 0.4439 0.0688  0.0528  0.1034  43  TRP A C   
355  O O   . TRP A 43  ? 0.3613 0.4869 0.4324 0.0744  0.0556  0.1057  43  TRP A O   
356  C CB  . TRP A 43  ? 0.3668 0.5008 0.4536 0.0807  0.0696  0.1290  43  TRP A CB  
357  C CG  . TRP A 43  ? 0.3626 0.4967 0.4432 0.0870  0.0764  0.1365  43  TRP A CG  
358  C CD1 . TRP A 43  ? 0.3298 0.4566 0.3914 0.1012  0.0873  0.1440  43  TRP A CD1 
359  C CD2 . TRP A 43  ? 0.3298 0.4715 0.4215 0.0803  0.0728  0.1367  43  TRP A CD2 
360  N NE1 . TRP A 43  ? 0.3446 0.4731 0.4062 0.1033  0.0913  0.1488  43  TRP A NE1 
361  C CE2 . TRP A 43  ? 0.3439 0.4820 0.4244 0.0908  0.0826  0.1453  43  TRP A CE2 
362  C CE3 . TRP A 43  ? 0.3043 0.4554 0.4125 0.0678  0.0621  0.1304  43  TRP A CE3 
363  C CZ2 . TRP A 43  ? 0.3557 0.4998 0.4433 0.0888  0.0825  0.1489  43  TRP A CZ2 
364  C CZ3 . TRP A 43  ? 0.2986 0.4567 0.4124 0.0664  0.0613  0.1340  43  TRP A CZ3 
365  C CH2 . TRP A 43  ? 0.3441 0.4987 0.4486 0.0766  0.0715  0.1436  43  TRP A CH2 
366  N N   . HIS A 44  ? 0.3718 0.5066 0.4564 0.0567  0.0435  0.0943  44  HIS A N   
367  C CA  . HIS A 44  ? 0.3660 0.5012 0.4563 0.0492  0.0355  0.0838  44  HIS A CA  
368  C C   . HIS A 44  ? 0.3790 0.5163 0.4941 0.0483  0.0376  0.0908  44  HIS A C   
369  O O   . HIS A 44  ? 0.3805 0.5139 0.4954 0.0484  0.0359  0.0863  44  HIS A O   
370  C CB  . HIS A 44  ? 0.3531 0.4938 0.4471 0.0382  0.0258  0.0727  44  HIS A CB  
371  C CG  . HIS A 44  ? 0.3302 0.4691 0.4211 0.0328  0.0189  0.0598  44  HIS A CG  
372  N ND1 . HIS A 44  ? 0.3393 0.4787 0.4478 0.0295  0.0165  0.0586  44  HIS A ND1 
373  C CD2 . HIS A 44  ? 0.2844 0.4201 0.3576 0.0311  0.0151  0.0483  44  HIS A CD2 
374  C CE1 . HIS A 44  ? 0.3250 0.4620 0.4253 0.0263  0.0114  0.0467  44  HIS A CE1 
375  N NE2 . HIS A 44  ? 0.2872 0.4226 0.3668 0.0271  0.0105  0.0406  44  HIS A NE2 
376  N N   . LEU A 45  ? 0.3823 0.5260 0.5216 0.0469  0.0409  0.1018  45  LEU A N   
377  C CA  . LEU A 45  ? 0.3952 0.5403 0.5631 0.0464  0.0450  0.1111  45  LEU A CA  
378  C C   . LEU A 45  ? 0.4222 0.5678 0.5956 0.0571  0.0585  0.1299  45  LEU A C   
379  O O   . LEU A 45  ? 0.4272 0.5773 0.5989 0.0592  0.0613  0.1354  45  LEU A O   
380  C CB  . LEU A 45  ? 0.3852 0.5390 0.5833 0.0342  0.0363  0.1066  45  LEU A CB  
381  C CG  . LEU A 45  ? 0.3778 0.5325 0.5727 0.0239  0.0229  0.0880  45  LEU A CG  
382  C CD1 . LEU A 45  ? 0.3714 0.5337 0.6004 0.0141  0.0154  0.0853  45  LEU A CD1 
383  C CD2 . LEU A 45  ? 0.3547 0.5003 0.5361 0.0254  0.0223  0.0799  45  LEU A CD2 
384  N N   . GLU A 46  ? 0.4504 0.5914 0.6301 0.0651  0.0680  0.1409  46  GLU A N   
385  C CA  . GLU A 46  ? 0.4851 0.6254 0.6634 0.0782  0.0827  0.1593  46  GLU A CA  
386  C C   . GLU A 46  ? 0.4859 0.6363 0.6972 0.0746  0.0870  0.1716  46  GLU A C   
387  O O   . GLU A 46  ? 0.4944 0.6468 0.6989 0.0833  0.0959  0.1824  46  GLU A O   
388  C CB  . GLU A 46  ? 0.5067 0.6403 0.6834 0.0890  0.0926  0.1697  46  GLU A CB  
389  C CG  . GLU A 46  ? 0.5594 0.6957 0.7655 0.0957  0.1077  0.1921  46  GLU A CG  
390  C CD  . GLU A 46  ? 0.6328 0.7637 0.8534 0.0983  0.1127  0.1984  46  GLU A CD  
391  O OE1 . GLU A 46  ? 0.6524 0.7861 0.9118 0.0960  0.1208  0.2122  46  GLU A OE1 
392  O OE2 . GLU A 46  ? 0.6673 0.7915 0.8625 0.1024  0.1084  0.1893  46  GLU A OE2 
393  N N   . GLU A 47  ? 0.4814 0.6386 0.7285 0.0619  0.0799  0.1687  47  GLU A N   
394  C CA  . GLU A 47  ? 0.4835 0.6529 0.7668 0.0565  0.0807  0.1779  47  GLU A CA  
395  C C   . GLU A 47  ? 0.4685 0.6446 0.7368 0.0565  0.0767  0.1750  47  GLU A C   
396  O O   . GLU A 47  ? 0.4734 0.6585 0.7609 0.0592  0.0830  0.1881  47  GLU A O   
397  C CB  . GLU A 47  ? 0.4859 0.6612 0.8098 0.0416  0.0702  0.1708  47  GLU A CB  
398  C CG  . GLU A 47  ? 0.5172 0.6914 0.8285 0.0298  0.0518  0.1466  47  GLU A CG  
399  C CD  . GLU A 47  ? 0.5460 0.7281 0.8962 0.0153  0.0390  0.1371  47  GLU A CD  
400  O OE1 . GLU A 47  ? 0.5198 0.7069 0.8615 0.0073  0.0241  0.1205  47  GLU A OE1 
401  O OE2 . GLU A 47  ? 0.5666 0.7494 0.9559 0.0124  0.0438  0.1458  47  GLU A OE2 
402  N N   . PHE A 48  ? 0.4487 0.6205 0.6843 0.0544  0.0674  0.1592  48  PHE A N   
403  C CA  . PHE A 48  ? 0.4308 0.6051 0.6465 0.0570  0.0662  0.1575  48  PHE A CA  
404  C C   . PHE A 48  ? 0.4338 0.6026 0.6322 0.0722  0.0815  0.1714  48  PHE A C   
405  O O   . PHE A 48  ? 0.4312 0.6057 0.6331 0.0762  0.0863  0.1799  48  PHE A O   
406  C CB  . PHE A 48  ? 0.4264 0.5938 0.6085 0.0539  0.0568  0.1396  48  PHE A CB  
407  C CG  . PHE A 48  ? 0.4150 0.5879 0.6055 0.0408  0.0418  0.1245  48  PHE A CG  
408  C CD1 . PHE A 48  ? 0.4296 0.5955 0.5951 0.0377  0.0349  0.1091  48  PHE A CD1 
409  C CD2 . PHE A 48  ? 0.4028 0.5882 0.6253 0.0322  0.0344  0.1250  48  PHE A CD2 
410  C CE1 . PHE A 48  ? 0.4186 0.5890 0.5886 0.0274  0.0223  0.0953  48  PHE A CE1 
411  C CE2 . PHE A 48  ? 0.3869 0.5768 0.6130 0.0218  0.0201  0.1096  48  PHE A CE2 
412  C CZ  . PHE A 48  ? 0.4134 0.5954 0.6117 0.0200  0.0147  0.0952  48  PHE A CZ  
413  N N   . GLY A 49  ? 0.4377 0.5955 0.6157 0.0816  0.0888  0.1731  49  GLY A N   
414  C CA  . GLY A 49  ? 0.4585 0.6084 0.6096 0.0976  0.1014  0.1816  49  GLY A CA  
415  C C   . GLY A 49  ? 0.4731 0.6288 0.6455 0.1066  0.1164  0.2031  49  GLY A C   
416  O O   . GLY A 49  ? 0.4815 0.6344 0.6374 0.1182  0.1260  0.2106  49  GLY A O   
417  N N   . GLN A 50  ? 0.4721 0.6360 0.6837 0.1007  0.1182  0.2126  50  GLN A N   
418  C CA  . GLN A 50  ? 0.4806 0.6515 0.7208 0.1080  0.1332  0.2346  50  GLN A CA  
419  C C   . GLN A 50  ? 0.4683 0.6533 0.7354 0.1020  0.1309  0.2396  50  GLN A C   
420  O O   . GLN A 50  ? 0.4771 0.6698 0.7695 0.1085  0.1439  0.2587  50  GLN A O   
421  C CB  . GLN A 50  ? 0.4860 0.6583 0.7592 0.1044  0.1371  0.2429  50  GLN A CB  
422  C CG  . GLN A 50  ? 0.5430 0.7035 0.7919 0.1200  0.1499  0.2513  50  GLN A CG  
423  C CD  . GLN A 50  ? 0.5952 0.7499 0.8492 0.1142  0.1440  0.2441  50  GLN A CD  
424  O OE1 . GLN A 50  ? 0.6188 0.7755 0.9080 0.1122  0.1508  0.2559  50  GLN A OE1 
425  N NE2 . GLN A 50  ? 0.6225 0.7696 0.8427 0.1121  0.1323  0.2253  50  GLN A NE2 
426  N N   . ALA A 51  ? 0.4430 0.6323 0.7053 0.0908  0.1151  0.2237  51  ALA A N   
427  C CA  . ALA A 51  ? 0.4260 0.6295 0.7100 0.0869  0.1121  0.2285  51  ALA A CA  
428  C C   . ALA A 51  ? 0.4261 0.6253 0.6764 0.0929  0.1118  0.2235  51  ALA A C   
429  O O   . ALA A 51  ? 0.4258 0.6295 0.6804 0.1016  0.1218  0.2365  51  ALA A O   
430  C CB  . ALA A 51  ? 0.4127 0.6286 0.7275 0.0699  0.0948  0.2179  51  ALA A CB  
431  N N   . PHE A 52  ? 0.4231 0.6131 0.6417 0.0886  0.1014  0.2054  52  PHE A N   
432  C CA  . PHE A 52  ? 0.4206 0.6053 0.6104 0.0927  0.1004  0.1996  52  PHE A CA  
433  C C   . PHE A 52  ? 0.4322 0.5990 0.5824 0.1045  0.1088  0.1962  52  PHE A C   
434  O O   . PHE A 52  ? 0.4446 0.6037 0.5852 0.1082  0.1119  0.1950  52  PHE A O   
435  C CB  . PHE A 52  ? 0.4137 0.6009 0.5966 0.0802  0.0838  0.1823  52  PHE A CB  
436  C CG  . PHE A 52  ? 0.4073 0.6095 0.6237 0.0674  0.0715  0.1793  52  PHE A CG  
437  C CD1 . PHE A 52  ? 0.4103 0.6294 0.6600 0.0656  0.0707  0.1900  52  PHE A CD1 
438  C CD2 . PHE A 52  ? 0.4093 0.6090 0.6248 0.0576  0.0604  0.1650  52  PHE A CD2 
439  C CE1 . PHE A 52  ? 0.4250 0.6582 0.7066 0.0537  0.0576  0.1850  52  PHE A CE1 
440  C CE2 . PHE A 52  ? 0.4193 0.6316 0.6648 0.0462  0.0484  0.1601  52  PHE A CE2 
441  C CZ  . PHE A 52  ? 0.4289 0.6580 0.7073 0.0440  0.0462  0.1692  52  PHE A CZ  
442  N N   . SER A 53  ? 0.4408 0.6010 0.5687 0.1109  0.1122  0.1944  53  SER A N   
443  C CA  . SER A 53  ? 0.4561 0.5987 0.5453 0.1201  0.1163  0.1861  53  SER A CA  
444  C C   . SER A 53  ? 0.4587 0.5948 0.5288 0.1167  0.1103  0.1742  53  SER A C   
445  O O   . SER A 53  ? 0.4428 0.5886 0.5281 0.1106  0.1060  0.1765  53  SER A O   
446  C CB  . SER A 53  ? 0.4719 0.6087 0.5513 0.1376  0.1332  0.2000  53  SER A CB  
447  O OG  . SER A 53  ? 0.4967 0.6386 0.5858 0.1423  0.1402  0.2106  53  SER A OG  
448  N N   . PHE A 54  ? 0.4728 0.5932 0.5114 0.1207  0.1096  0.1616  54  PHE A N   
449  C CA  . PHE A 54  ? 0.4835 0.5944 0.5040 0.1190  0.1065  0.1508  54  PHE A CA  
450  C C   . PHE A 54  ? 0.5134 0.6063 0.5032 0.1314  0.1135  0.1449  54  PHE A C   
451  O O   . PHE A 54  ? 0.5275 0.6136 0.5016 0.1353  0.1122  0.1381  54  PHE A O   
452  C CB  . PHE A 54  ? 0.4651 0.5762 0.4835 0.1054  0.0930  0.1353  54  PHE A CB  
453  C CG  . PHE A 54  ? 0.4668 0.5684 0.4706 0.1031  0.0911  0.1257  54  PHE A CG  
454  C CD1 . PHE A 54  ? 0.4633 0.5711 0.4776 0.1000  0.0911  0.1312  54  PHE A CD1 
455  C CD2 . PHE A 54  ? 0.4921 0.5788 0.4730 0.1045  0.0893  0.1115  54  PHE A CD2 
456  C CE1 . PHE A 54  ? 0.4724 0.5703 0.4748 0.0984  0.0910  0.1241  54  PHE A CE1 
457  C CE2 . PHE A 54  ? 0.4897 0.5663 0.4609 0.1017  0.0884  0.1028  54  PHE A CE2 
458  C CZ  . PHE A 54  ? 0.4801 0.5616 0.4620 0.0988  0.0902  0.1099  54  PHE A CZ  
459  N N   . GLU A 55  ? 0.5365 0.6214 0.5174 0.1379  0.1203  0.1468  55  GLU A N   
460  C CA  . GLU A 55  ? 0.5712 0.6375 0.5228 0.1496  0.1260  0.1388  55  GLU A CA  
461  C C   . GLU A 55  ? 0.5706 0.6252 0.5048 0.1425  0.1156  0.1178  55  GLU A C   
462  O O   . GLU A 55  ? 0.5677 0.6179 0.5034 0.1346  0.1115  0.1104  55  GLU A O   
463  C CB  . GLU A 55  ? 0.5853 0.6455 0.5344 0.1596  0.1375  0.1475  55  GLU A CB  
464  C CG  . GLU A 55  ? 0.6652 0.7310 0.6200 0.1738  0.1514  0.1660  55  GLU A CG  
465  C CD  . GLU A 55  ? 0.7794 0.8390 0.7138 0.1859  0.1559  0.1649  55  GLU A CD  
466  O OE1 . GLU A 55  ? 0.8171 0.8593 0.7203 0.1962  0.1577  0.1533  55  GLU A OE1 
467  O OE2 . GLU A 55  ? 0.7723 0.8440 0.7219 0.1857  0.1574  0.1757  55  GLU A OE2 
468  N N   . ALA A 56  ? 0.5829 0.6332 0.5016 0.1463  0.1120  0.1096  56  ALA A N   
469  C CA  . ALA A 56  ? 0.5836 0.6267 0.4900 0.1395  0.1008  0.0902  56  ALA A CA  
470  C C   . ALA A 56  ? 0.5962 0.6241 0.4911 0.1383  0.0996  0.0771  56  ALA A C   
471  O O   . ALA A 56  ? 0.5928 0.6191 0.4910 0.1270  0.0907  0.0647  56  ALA A O   
472  C CB  . ALA A 56  ? 0.5925 0.6324 0.4801 0.1489  0.0990  0.0850  56  ALA A CB  
473  N N   . GLN A 57  ? 0.6216 0.6380 0.5044 0.1501  0.1093  0.0801  57  GLN A N   
474  C CA  . GLN A 57  ? 0.6376 0.6365 0.5097 0.1500  0.1090  0.0665  57  GLN A CA  
475  C C   . GLN A 57  ? 0.6131 0.6154 0.5049 0.1362  0.1067  0.0677  57  GLN A C   
476  O O   . GLN A 57  ? 0.6243 0.6149 0.5142 0.1306  0.1035  0.0550  57  GLN A O   
477  C CB  . GLN A 57  ? 0.6650 0.6509 0.5236 0.1654  0.1215  0.0716  57  GLN A CB  
478  C CG  . GLN A 57  ? 0.7182 0.6999 0.5540 0.1825  0.1267  0.0727  57  GLN A CG  
479  C CD  . GLN A 57  ? 0.7577 0.7514 0.6028 0.1917  0.1389  0.0957  57  GLN A CD  
480  O OE1 . GLN A 57  ? 0.7549 0.7664 0.6219 0.1839  0.1372  0.1079  57  GLN A OE1 
481  N NE2 . GLN A 57  ? 0.7710 0.7548 0.6004 0.2088  0.1514  0.1014  57  GLN A NE2 
482  N N   . GLY A 58  ? 0.5868 0.6054 0.4983 0.1314  0.1085  0.0832  58  GLY A N   
483  C CA  . GLY A 58  ? 0.5772 0.6007 0.5052 0.1213  0.1074  0.0870  58  GLY A CA  
484  C C   . GLY A 58  ? 0.5702 0.5949 0.5014 0.1082  0.0967  0.0737  58  GLY A C   
485  O O   . GLY A 58  ? 0.5727 0.5946 0.5109 0.1008  0.0961  0.0712  58  GLY A O   
486  N N   . GLY A 59  ? 0.5647 0.5935 0.4909 0.1064  0.0893  0.0661  59  GLY A N   
487  C CA  . GLY A 59  ? 0.5490 0.5791 0.4775 0.0954  0.0792  0.0526  59  GLY A CA  
488  C C   . GLY A 59  ? 0.5617 0.5758 0.4783 0.0957  0.0761  0.0351  59  GLY A C   
489  O O   . GLY A 59  ? 0.5554 0.5675 0.4798 0.0857  0.0716  0.0262  59  GLY A O   
490  N N   . LEU A 60  ? 0.5819 0.5849 0.4803 0.1075  0.0783  0.0297  60  LEU A N   
491  C CA  . LEU A 60  ? 0.6025 0.5902 0.4895 0.1083  0.0734  0.0104  60  LEU A CA  
492  C C   . LEU A 60  ? 0.6115 0.5847 0.5049 0.1050  0.0789  0.0071  60  LEU A C   
493  O O   . LEU A 60  ? 0.6180 0.5836 0.5178 0.0968  0.0738  -0.0067 60  LEU A O   
494  C CB  . LEU A 60  ? 0.6257 0.6045 0.4884 0.1237  0.0741  0.0047  60  LEU A CB  
495  C CG  . LEU A 60  ? 0.6256 0.6152 0.4775 0.1319  0.0718  0.0096  60  LEU A CG  
496  C CD1 . LEU A 60  ? 0.6391 0.6199 0.4694 0.1503  0.0809  0.0148  60  LEU A CD1 
497  C CD2 . LEU A 60  ? 0.6129 0.6048 0.4583 0.1291  0.0588  -0.0066 60  LEU A CD2 
498  N N   . ALA A 61  ? 0.6074 0.5774 0.5014 0.1117  0.0899  0.0208  61  ALA A N   
499  C CA  . ALA A 61  ? 0.6143 0.5726 0.5171 0.1091  0.0972  0.0226  61  ALA A CA  
500  C C   . ALA A 61  ? 0.5929 0.5575 0.5155 0.0946  0.0946  0.0237  61  ALA A C   
501  O O   . ALA A 61  ? 0.6102 0.5618 0.5395 0.0890  0.0951  0.0139  61  ALA A O   
502  C CB  . ALA A 61  ? 0.6185 0.5777 0.5214 0.1187  0.1090  0.0406  61  ALA A CB  
503  N N   . ASN A 62  ? 0.5577 0.5416 0.4903 0.0891  0.0924  0.0353  62  ASN A N   
504  C CA  . ASN A 62  ? 0.5376 0.5289 0.4857 0.0772  0.0901  0.0367  62  ASN A CA  
505  C C   . ASN A 62  ? 0.5371 0.5251 0.4894 0.0677  0.0820  0.0199  62  ASN A C   
506  O O   . ASN A 62  ? 0.5302 0.5171 0.4954 0.0592  0.0835  0.0189  62  ASN A O   
507  C CB  . ASN A 62  ? 0.5126 0.5252 0.4680 0.0741  0.0874  0.0495  62  ASN A CB  
508  C CG  . ASN A 62  ? 0.5175 0.5355 0.4778 0.0796  0.0954  0.0672  62  ASN A CG  
509  O OD1 . ASN A 62  ? 0.5197 0.5329 0.4859 0.0789  0.1017  0.0729  62  ASN A OD1 
510  N ND2 . ASN A 62  ? 0.5170 0.5461 0.4767 0.0853  0.0954  0.0767  62  ASN A ND2 
511  N N   . ILE A 63  ? 0.5383 0.5255 0.4805 0.0700  0.0742  0.0077  63  ILE A N   
512  C CA  . ILE A 63  ? 0.5360 0.5212 0.4826 0.0624  0.0653  -0.0092 63  ILE A CA  
513  C C   . ILE A 63  ? 0.5616 0.5272 0.5120 0.0611  0.0674  -0.0217 63  ILE A C   
514  O O   . ILE A 63  ? 0.5615 0.5244 0.5289 0.0512  0.0676  -0.0266 63  ILE A O   
515  C CB  . ILE A 63  ? 0.5348 0.5262 0.4684 0.0673  0.0559  -0.0173 63  ILE A CB  
516  C CG1 . ILE A 63  ? 0.5184 0.5286 0.4552 0.0653  0.0539  -0.0057 63  ILE A CG1 
517  C CG2 . ILE A 63  ? 0.5277 0.5172 0.4654 0.0613  0.0457  -0.0358 63  ILE A CG2 
518  C CD1 . ILE A 63  ? 0.5055 0.5254 0.4595 0.0546  0.0557  0.0020  63  ILE A CD1 
519  N N   . ALA A 64  ? 0.5836 0.5351 0.5192 0.0716  0.0700  -0.0265 64  ALA A N   
520  C CA  . ALA A 64  ? 0.6036 0.5338 0.5424 0.0718  0.0729  -0.0384 64  ALA A CA  
521  C C   . ALA A 64  ? 0.5984 0.5236 0.5571 0.0645  0.0830  -0.0287 64  ALA A C   
522  O O   . ALA A 64  ? 0.6056 0.5199 0.5797 0.0568  0.0830  -0.0389 64  ALA A O   
523  C CB  . ALA A 64  ? 0.6176 0.5338 0.5358 0.0864  0.0777  -0.0398 64  ALA A CB  
524  N N   . ILE A 65  ? 0.5935 0.5279 0.5531 0.0671  0.0913  -0.0085 65  ILE A N   
525  C CA  . ILE A 65  ? 0.5992 0.5302 0.5742 0.0632  0.1019  0.0038  65  ILE A CA  
526  C C   . ILE A 65  ? 0.5896 0.5290 0.5824 0.0506  0.0992  0.0023  65  ILE A C   
527  O O   . ILE A 65  ? 0.6051 0.5341 0.6139 0.0456  0.1064  0.0029  65  ILE A O   
528  C CB  . ILE A 65  ? 0.5974 0.5401 0.5686 0.0699  0.1094  0.0259  65  ILE A CB  
529  C CG1 . ILE A 65  ? 0.6026 0.5352 0.5600 0.0832  0.1156  0.0299  65  ILE A CG1 
530  C CG2 . ILE A 65  ? 0.5863 0.5306 0.5727 0.0660  0.1188  0.0402  65  ILE A CG2 
531  C CD1 . ILE A 65  ? 0.6079 0.5498 0.5673 0.0897  0.1245  0.0517  65  ILE A CD1 
532  N N   . LEU A 66  ? 0.5719 0.5295 0.5630 0.0462  0.0899  0.0006  66  LEU A N   
533  C CA  . LEU A 66  ? 0.5621 0.5291 0.5691 0.0351  0.0873  -0.0012 66  LEU A CA  
534  C C   . LEU A 66  ? 0.5734 0.5303 0.5942 0.0274  0.0827  -0.0195 66  LEU A C   
535  O O   . LEU A 66  ? 0.5776 0.5355 0.6173 0.0191  0.0866  -0.0183 66  LEU A O   
536  C CB  . LEU A 66  ? 0.5389 0.5273 0.5408 0.0331  0.0792  0.0020  66  LEU A CB  
537  C CG  . LEU A 66  ? 0.5399 0.5427 0.5352 0.0374  0.0819  0.0194  66  LEU A CG  
538  C CD1 . LEU A 66  ? 0.5161 0.5371 0.5105 0.0334  0.0732  0.0186  66  LEU A CD1 
539  C CD2 . LEU A 66  ? 0.5609 0.5642 0.5638 0.0373  0.0922  0.0342  66  LEU A CD2 
540  N N   . ASN A 67  ? 0.5851 0.5333 0.5974 0.0306  0.0745  -0.0360 67  ASN A N   
541  C CA  . ASN A 67  ? 0.6068 0.5444 0.6343 0.0236  0.0689  -0.0551 67  ASN A CA  
542  C C   . ASN A 67  ? 0.6332 0.5511 0.6781 0.0206  0.0797  -0.0551 67  ASN A C   
543  O O   . ASN A 67  ? 0.6388 0.5533 0.7082 0.0107  0.0800  -0.0621 67  ASN A O   
544  C CB  . ASN A 67  ? 0.6218 0.5535 0.6334 0.0298  0.0570  -0.0738 67  ASN A CB  
545  C CG  . ASN A 67  ? 0.6130 0.5630 0.6107 0.0325  0.0462  -0.0752 67  ASN A CG  
546  O OD1 . ASN A 67  ? 0.5715 0.5362 0.5811 0.0247  0.0411  -0.0757 67  ASN A OD1 
547  N ND2 . ASN A 67  ? 0.6257 0.5750 0.5983 0.0446  0.0439  -0.0746 67  ASN A ND2 
548  N N   . ASN A 68  ? 0.6560 0.5607 0.6904 0.0294  0.0890  -0.0469 68  ASN A N   
549  C CA  . ASN A 68  ? 0.6849 0.5704 0.7365 0.0275  0.1016  -0.0433 68  ASN A CA  
550  C C   . ASN A 68  ? 0.6693 0.5644 0.7407 0.0199  0.1109  -0.0273 68  ASN A C   
551  O O   . ASN A 68  ? 0.6782 0.5645 0.7752 0.0114  0.1160  -0.0309 68  ASN A O   
552  C CB  . ASN A 68  ? 0.7020 0.5744 0.7386 0.0396  0.1115  -0.0335 68  ASN A CB  
553  C CG  . ASN A 68  ? 0.7695 0.6311 0.7836 0.0494  0.1041  -0.0488 68  ASN A CG  
554  O OD1 . ASN A 68  ? 0.8114 0.6670 0.8082 0.0613  0.1108  -0.0403 68  ASN A OD1 
555  N ND2 . ASN A 68  ? 0.7967 0.6570 0.8105 0.0455  0.0903  -0.0711 68  ASN A ND2 
556  N N   . ASN A 69  ? 0.6424 0.5561 0.7025 0.0232  0.1129  -0.0101 69  ASN A N   
557  C CA  . ASN A 69  ? 0.6261 0.5506 0.6997 0.0181  0.1207  0.0047  69  ASN A CA  
558  C C   . ASN A 69  ? 0.6164 0.5493 0.7082 0.0069  0.1151  -0.0051 69  ASN A C   
559  O O   . ASN A 69  ? 0.6211 0.5542 0.7324 0.0015  0.1248  0.0032  69  ASN A O   
560  C CB  . ASN A 69  ? 0.6090 0.5525 0.6657 0.0243  0.1213  0.0220  69  ASN A CB  
561  C CG  . ASN A 69  ? 0.6347 0.5718 0.6788 0.0352  0.1287  0.0347  69  ASN A CG  
562  O OD1 . ASN A 69  ? 0.6630 0.6148 0.6931 0.0410  0.1262  0.0451  69  ASN A OD1 
563  N ND2 . ASN A 69  ? 0.6443 0.5597 0.6955 0.0382  0.1379  0.0338  69  ASN A ND2 
564  N N   . LEU A 70  ? 0.5986 0.5386 0.6851 0.0042  0.1005  -0.0216 70  LEU A N   
565  C CA  . LEU A 70  ? 0.5895 0.5377 0.6954 -0.0060 0.0945  -0.0320 70  LEU A CA  
566  C C   . LEU A 70  ? 0.6137 0.5448 0.7483 -0.0136 0.0988  -0.0423 70  LEU A C   
567  O O   . LEU A 70  ? 0.6085 0.5418 0.7679 -0.0211 0.1070  -0.0367 70  LEU A O   
568  C CB  . LEU A 70  ? 0.5779 0.5365 0.6724 -0.0059 0.0777  -0.0475 70  LEU A CB  
569  C CG  . LEU A 70  ? 0.5763 0.5498 0.6879 -0.0148 0.0710  -0.0546 70  LEU A CG  
570  C CD1 . LEU A 70  ? 0.5636 0.5498 0.6846 -0.0184 0.0812  -0.0377 70  LEU A CD1 
571  C CD2 . LEU A 70  ? 0.5593 0.5463 0.6548 -0.0120 0.0557  -0.0646 70  LEU A CD2 
572  N N   . ASN A 71  ? 0.6350 0.5487 0.7666 -0.0111 0.0938  -0.0574 71  ASN A N   
573  C CA  . ASN A 71  ? 0.6637 0.5583 0.8230 -0.0180 0.0968  -0.0696 71  ASN A CA  
574  C C   . ASN A 71  ? 0.6652 0.5504 0.8457 -0.0206 0.1162  -0.0518 71  ASN A C   
575  O O   . ASN A 71  ? 0.6703 0.5531 0.8834 -0.0304 0.1216  -0.0533 71  ASN A O   
576  C CB  . ASN A 71  ? 0.6937 0.5684 0.8397 -0.0115 0.0910  -0.0855 71  ASN A CB  
577  C CG  . ASN A 71  ? 0.7152 0.5990 0.8388 -0.0072 0.0723  -0.1028 71  ASN A CG  
578  O OD1 . ASN A 71  ? 0.7222 0.6097 0.8146 0.0038  0.0701  -0.0978 71  ASN A OD1 
579  N ND2 . ASN A 71  ? 0.7164 0.6045 0.8569 -0.0151 0.0592  -0.1225 71  ASN A ND2 
580  N N   . THR A 72  ? 0.6607 0.5423 0.8234 -0.0112 0.1270  -0.0336 72  THR A N   
581  C CA  . THR A 72  ? 0.6672 0.5392 0.8448 -0.0103 0.1462  -0.0144 72  THR A CA  
582  C C   . THR A 72  ? 0.6574 0.5459 0.8494 -0.0153 0.1546  0.0014  72  THR A C   
583  O O   . THR A 72  ? 0.6686 0.5492 0.8803 -0.0163 0.1712  0.0158  72  THR A O   
584  C CB  . THR A 72  ? 0.6693 0.5387 0.8216 0.0024  0.1535  0.0019  72  THR A CB  
585  O OG1 . THR A 72  ? 0.6835 0.5381 0.8209 0.0083  0.1467  -0.0122 72  THR A OG1 
586  C CG2 . THR A 72  ? 0.6690 0.5267 0.8358 0.0052  0.1734  0.0219  72  THR A CG2 
587  N N   . LEU A 73  ? 0.6293 0.5401 0.8111 -0.0173 0.1443  -0.0008 73  LEU A N   
588  C CA  . LEU A 73  ? 0.6131 0.5393 0.8055 -0.0205 0.1523  0.0130  73  LEU A CA  
589  C C   . LEU A 73  ? 0.6138 0.5473 0.8321 -0.0317 0.1464  -0.0001 73  LEU A C   
590  O O   . LEU A 73  ? 0.6217 0.5641 0.8566 -0.0353 0.1561  0.0106  73  LEU A O   
591  C CB  . LEU A 73  ? 0.5899 0.5363 0.7527 -0.0128 0.1494  0.0261  73  LEU A CB  
592  C CG  . LEU A 73  ? 0.5840 0.5258 0.7379 -0.0035 0.1640  0.0479  73  LEU A CG  
593  C CD1 . LEU A 73  ? 0.5965 0.5304 0.7286 0.0052  0.1602  0.0480  73  LEU A CD1 
594  C CD2 . LEU A 73  ? 0.5534 0.5153 0.6942 0.0008  0.1671  0.0636  73  LEU A CD2 
595  N N   . ILE A 74  ? 0.6126 0.5431 0.8342 -0.0364 0.1308  -0.0229 74  ILE A N   
596  C CA  . ILE A 74  ? 0.6091 0.5424 0.8632 -0.0478 0.1255  -0.0373 74  ILE A CA  
597  C C   . ILE A 74  ? 0.6344 0.5484 0.9246 -0.0538 0.1408  -0.0338 74  ILE A C   
598  O O   . ILE A 74  ? 0.6370 0.5562 0.9573 -0.0606 0.1513  -0.0260 74  ILE A O   
599  C CB  . ILE A 74  ? 0.6109 0.5442 0.8595 -0.0499 0.1044  -0.0634 74  ILE A CB  
600  C CG1 . ILE A 74  ? 0.5932 0.5465 0.8096 -0.0438 0.0919  -0.0638 74  ILE A CG1 
601  C CG2 . ILE A 74  ? 0.5955 0.5299 0.8828 -0.0619 0.0984  -0.0799 74  ILE A CG2 
602  C CD1 . ILE A 74  ? 0.5907 0.5426 0.7880 -0.0400 0.0732  -0.0840 74  ILE A CD1 
603  N N   . GLN A 75  ? 0.6511 0.5427 0.9383 -0.0504 0.1435  -0.0378 75  GLN A N   
604  C CA  . GLN A 75  ? 0.6751 0.5449 0.9959 -0.0551 0.1586  -0.0343 75  GLN A CA  
605  C C   . GLN A 75  ? 0.6772 0.5503 1.0081 -0.0528 0.1807  -0.0063 75  GLN A C   
606  O O   . GLN A 75  ? 0.6872 0.5599 1.0547 -0.0610 0.1911  -0.0019 75  GLN A O   
607  C CB  . GLN A 75  ? 0.6972 0.5419 1.0067 -0.0489 0.1596  -0.0406 75  GLN A CB  
608  C CG  . GLN A 75  ? 0.7070 0.5420 1.0142 -0.0516 0.1402  -0.0708 75  GLN A CG  
609  C CD  . GLN A 75  ? 0.7062 0.5512 1.0438 -0.0643 0.1277  -0.0896 75  GLN A CD  
610  O OE1 . GLN A 75  ? 0.7079 0.5427 1.0884 -0.0747 0.1339  -0.0945 75  GLN A OE1 
611  N NE2 . GLN A 75  ? 0.6893 0.5552 1.0071 -0.0632 0.1106  -0.0992 75  GLN A NE2 
612  N N   . ARG A 76  ? 0.6802 0.5577 0.9800 -0.0411 0.1882  0.0132  76  ARG A N   
613  C CA  . ARG A 76  ? 0.6985 0.5750 1.0086 -0.0373 0.2102  0.0395  76  ARG A CA  
614  C C   . ARG A 76  ? 0.6912 0.5903 1.0066 -0.0391 0.2154  0.0515  76  ARG A C   
615  O O   . ARG A 76  ? 0.7021 0.5992 1.0387 -0.0391 0.2345  0.0693  76  ARG A O   
616  C CB  . ARG A 76  ? 0.7021 0.5711 0.9857 -0.0238 0.2199  0.0577  76  ARG A CB  
617  C CG  . ARG A 76  ? 0.7032 0.5937 0.9488 -0.0131 0.2172  0.0727  76  ARG A CG  
618  C CD  . ARG A 76  ? 0.7302 0.6115 0.9512 -0.0015 0.2190  0.0807  76  ARG A CD  
619  N NE  . ARG A 76  ? 0.7290 0.6264 0.9246 0.0101  0.2247  0.1032  76  ARG A NE  
620  C CZ  . ARG A 76  ? 0.7350 0.6341 0.9046 0.0207  0.2219  0.1102  76  ARG A CZ  
621  N NH1 . ARG A 76  ? 0.7253 0.6105 0.8886 0.0220  0.2149  0.0974  76  ARG A NH1 
622  N NH2 . ARG A 76  ? 0.7310 0.6468 0.8807 0.0306  0.2258  0.1297  76  ARG A NH2 
623  N N   . SER A 77  ? 0.6778 0.5972 0.9754 -0.0404 0.1992  0.0412  77  SER A N   
624  C CA  . SER A 77  ? 0.6709 0.6120 0.9714 -0.0417 0.2025  0.0498  77  SER A CA  
625  C C   . SER A 77  ? 0.6832 0.6238 1.0289 -0.0535 0.2083  0.0442  77  SER A C   
626  O O   . SER A 77  ? 0.6831 0.6390 1.0372 -0.0539 0.2166  0.0550  77  SER A O   
627  C CB  . SER A 77  ? 0.6479 0.6088 0.9194 -0.0401 0.1833  0.0388  77  SER A CB  
628  O OG  . SER A 77  ? 0.6454 0.6075 0.9319 -0.0495 0.1670  0.0149  77  SER A OG  
629  N N   . ASN A 78  ? 0.7009 0.6244 1.0761 -0.0627 0.2039  0.0272  78  ASN A N   
630  C CA  . ASN A 78  ? 0.7155 0.6392 1.1380 -0.0760 0.2037  0.0155  78  ASN A CA  
631  C C   . ASN A 78  ? 0.6992 0.6420 1.1187 -0.0815 0.1825  -0.0044 78  ASN A C   
632  O O   . ASN A 78  ? 0.7003 0.6526 1.1547 -0.0906 0.1827  -0.0096 78  ASN A O   
633  C CB  . ASN A 78  ? 0.7198 0.6476 1.1733 -0.0777 0.2274  0.0375  78  ASN A CB  
634  C CG  . ASN A 78  ? 0.7588 0.6630 1.2375 -0.0774 0.2483  0.0513  78  ASN A CG  
635  O OD1 . ASN A 78  ? 0.7745 0.6585 1.2458 -0.0755 0.2454  0.0448  78  ASN A OD1 
636  N ND2 . ASN A 78  ? 0.7883 0.6941 1.2975 -0.0785 0.2707  0.0715  78  ASN A ND2 
637  N N   . HIS A 79  ? 0.6885 0.6374 1.0683 -0.0754 0.1650  -0.0145 79  HIS A N   
638  C CA  . HIS A 79  ? 0.6733 0.6398 1.0464 -0.0786 0.1445  -0.0327 79  HIS A CA  
639  C C   . HIS A 79  ? 0.6477 0.6381 1.0109 -0.0759 0.1469  -0.0214 79  HIS A C   
640  O O   . HIS A 79  ? 0.6326 0.6373 1.0136 -0.0821 0.1386  -0.0316 79  HIS A O   
641  C CB  . HIS A 79  ? 0.6828 0.6465 1.0976 -0.0911 0.1342  -0.0547 79  HIS A CB  
642  C CG  . HIS A 79  ? 0.7169 0.6627 1.1274 -0.0920 0.1201  -0.0761 79  HIS A CG  
643  N ND1 . HIS A 79  ? 0.7196 0.6722 1.1186 -0.0925 0.0968  -0.0993 79  HIS A ND1 
644  C CD2 . HIS A 79  ? 0.7333 0.6542 1.1472 -0.0910 0.1262  -0.0777 79  HIS A CD2 
645  C CE1 . HIS A 79  ? 0.7404 0.6734 1.1346 -0.0915 0.0891  -0.1149 79  HIS A CE1 
646  N NE2 . HIS A 79  ? 0.7472 0.6603 1.1508 -0.0909 0.1066  -0.1027 79  HIS A NE2 
647  N N   . THR A 80  ? 0.6388 0.6335 0.9731 -0.0661 0.1576  -0.0014 80  THR A N   
648  C CA  . THR A 80  ? 0.6224 0.6380 0.9449 -0.0623 0.1608  0.0090  80  THR A CA  
649  C C   . THR A 80  ? 0.6003 0.6292 0.8940 -0.0596 0.1408  -0.0038 80  THR A C   
650  O O   . THR A 80  ? 0.5972 0.6222 0.8597 -0.0534 0.1319  -0.0064 80  THR A O   
651  C CB  . THR A 80  ? 0.6299 0.6466 0.9308 -0.0519 0.1781  0.0340  80  THR A CB  
652  O OG1 . THR A 80  ? 0.6599 0.6665 0.9912 -0.0539 0.1992  0.0484  80  THR A OG1 
653  C CG2 . THR A 80  ? 0.6113 0.6493 0.8930 -0.0464 0.1784  0.0415  80  THR A CG2 
654  N N   . GLN A 81  ? 0.5836 0.6282 0.8910 -0.0641 0.1344  -0.0115 81  GLN A N   
655  C CA  . GLN A 81  ? 0.5598 0.6188 0.8426 -0.0607 0.1190  -0.0199 81  GLN A CA  
656  C C   . GLN A 81  ? 0.5518 0.6244 0.8184 -0.0542 0.1288  -0.0041 81  GLN A C   
657  O O   . GLN A 81  ? 0.5537 0.6302 0.8398 -0.0552 0.1445  0.0077  81  GLN A O   
658  C CB  . GLN A 81  ? 0.5556 0.6239 0.8637 -0.0685 0.1062  -0.0376 81  GLN A CB  
659  C CG  . GLN A 81  ? 0.5501 0.6292 0.8330 -0.0646 0.0877  -0.0492 81  GLN A CG  
660  C CD  . GLN A 81  ? 0.5592 0.6450 0.8655 -0.0711 0.0725  -0.0686 81  GLN A CD  
661  O OE1 . GLN A 81  ? 0.5790 0.6565 0.9144 -0.0784 0.0705  -0.0787 81  GLN A OE1 
662  N NE2 . GLN A 81  ? 0.5237 0.6249 0.8187 -0.0682 0.0612  -0.0744 81  GLN A NE2 
663  N N   . ALA A 82  ? 0.5359 0.6152 0.7670 -0.0470 0.1200  -0.0038 82  ALA A N   
664  C CA  . ALA A 82  ? 0.5243 0.6162 0.7352 -0.0399 0.1257  0.0078  82  ALA A CA  
665  C C   . ALA A 82  ? 0.5148 0.6223 0.7382 -0.0426 0.1225  0.0016  82  ALA A C   
666  O O   . ALA A 82  ? 0.5101 0.6210 0.7459 -0.0478 0.1096  -0.0134 82  ALA A O   
667  C CB  . ALA A 82  ? 0.5134 0.6064 0.6873 -0.0328 0.1155  0.0076  82  ALA A CB  
668  N N   . THR A 83  ? 0.5126 0.6298 0.7313 -0.0378 0.1338  0.0129  83  THR A N   
669  C CA  . THR A 83  ? 0.5144 0.6464 0.7410 -0.0385 0.1310  0.0075  83  THR A CA  
670  C C   . THR A 83  ? 0.5039 0.6417 0.7046 -0.0353 0.1135  -0.0032 83  THR A C   
671  O O   . THR A 83  ? 0.5049 0.6379 0.6773 -0.0305 0.1079  -0.0016 83  THR A O   
672  C CB  . THR A 83  ? 0.5279 0.6686 0.7524 -0.0321 0.1485  0.0223  83  THR A CB  
673  O OG1 . THR A 83  ? 0.5308 0.6728 0.7170 -0.0223 0.1483  0.0293  83  THR A OG1 
674  C CG2 . THR A 83  ? 0.5466 0.6808 0.7962 -0.0337 0.1687  0.0366  83  THR A CG2 
675  N N   . ASN A 84  ? 0.5025 0.6509 0.7151 -0.0379 0.1057  -0.0134 84  ASN A N   
676  C CA  . ASN A 84  ? 0.4870 0.6407 0.6800 -0.0350 0.0902  -0.0231 84  ASN A CA  
677  C C   . ASN A 84  ? 0.4835 0.6442 0.6524 -0.0273 0.0935  -0.0173 84  ASN A C   
678  O O   . ASN A 84  ? 0.4860 0.6562 0.6635 -0.0257 0.1004  -0.0154 84  ASN A O   
679  C CB  . ASN A 84  ? 0.4811 0.6436 0.6973 -0.0397 0.0804  -0.0358 84  ASN A CB  
680  C CG  . ASN A 84  ? 0.4920 0.6476 0.7240 -0.0459 0.0706  -0.0464 84  ASN A CG  
681  O OD1 . ASN A 84  ? 0.5108 0.6594 0.7241 -0.0439 0.0594  -0.0522 84  ASN A OD1 
682  N ND2 . ASN A 84  ? 0.5162 0.6735 0.7833 -0.0530 0.0749  -0.0491 84  ASN A ND2 
683  N N   . ASP A 85  ? 0.4803 0.6362 0.6202 -0.0224 0.0884  -0.0150 85  ASP A N   
684  C CA  . ASP A 85  ? 0.4729 0.6344 0.5887 -0.0153 0.0887  -0.0119 85  ASP A CA  
685  C C   . ASP A 85  ? 0.4529 0.6191 0.5633 -0.0149 0.0751  -0.0230 85  ASP A C   
686  O O   . ASP A 85  ? 0.4407 0.6022 0.5448 -0.0161 0.0638  -0.0285 85  ASP A O   
687  C CB  . ASP A 85  ? 0.4855 0.6409 0.5767 -0.0106 0.0891  -0.0042 85  ASP A CB  
688  C CG  . ASP A 85  ? 0.5186 0.6694 0.6132 -0.0090 0.1038  0.0089  85  ASP A CG  
689  O OD1 . ASP A 85  ? 0.5585 0.6999 0.6536 -0.0107 0.1038  0.0122  85  ASP A OD1 
690  O OD2 . ASP A 85  ? 0.5543 0.7105 0.6506 -0.0051 0.1165  0.0166  85  ASP A OD2 
691  N N   . PRO A 86  ? 0.4436 0.6188 0.5569 -0.0123 0.0774  -0.0256 86  PRO A N   
692  C CA  . PRO A 86  ? 0.4293 0.6091 0.5419 -0.0115 0.0664  -0.0354 86  PRO A CA  
693  C C   . PRO A 86  ? 0.4258 0.6030 0.5134 -0.0070 0.0584  -0.0373 86  PRO A C   
694  O O   . PRO A 86  ? 0.4355 0.6117 0.5054 -0.0027 0.0629  -0.0321 86  PRO A O   
695  C CB  . PRO A 86  ? 0.4293 0.6189 0.5542 -0.0094 0.0748  -0.0354 86  PRO A CB  
696  C CG  . PRO A 86  ? 0.4349 0.6245 0.5535 -0.0059 0.0896  -0.0249 86  PRO A CG  
697  C CD  . PRO A 86  ? 0.4486 0.6300 0.5681 -0.0093 0.0923  -0.0184 86  PRO A CD  
698  N N   . PRO A 87  ? 0.4167 0.5931 0.5037 -0.0074 0.0466  -0.0446 87  PRO A N   
699  C CA  . PRO A 87  ? 0.4136 0.5875 0.4827 -0.0037 0.0394  -0.0467 87  PRO A CA  
700  C C   . PRO A 87  ? 0.4246 0.6029 0.4869 0.0009  0.0420  -0.0496 87  PRO A C   
701  O O   . PRO A 87  ? 0.4190 0.6034 0.4928 0.0019  0.0465  -0.0523 87  PRO A O   
702  C CB  . PRO A 87  ? 0.3924 0.5650 0.4675 -0.0046 0.0287  -0.0524 87  PRO A CB  
703  C CG  . PRO A 87  ? 0.3844 0.5622 0.4795 -0.0073 0.0294  -0.0558 87  PRO A CG  
704  C CD  . PRO A 87  ? 0.4076 0.5853 0.5110 -0.0107 0.0391  -0.0508 87  PRO A CD  
705  N N   . GLU A 88  ? 0.4387 0.6140 0.4830 0.0038  0.0389  -0.0495 88  GLU A N   
706  C CA  . GLU A 88  ? 0.4563 0.6329 0.4916 0.0083  0.0373  -0.0553 88  GLU A CA  
707  C C   . GLU A 88  ? 0.4398 0.6117 0.4757 0.0073  0.0261  -0.0600 88  GLU A C   
708  O O   . GLU A 88  ? 0.4388 0.6066 0.4711 0.0052  0.0209  -0.0566 88  GLU A O   
709  C CB  . GLU A 88  ? 0.4716 0.6485 0.4872 0.0125  0.0405  -0.0527 88  GLU A CB  
710  C CG  . GLU A 88  ? 0.5379 0.7139 0.5404 0.0171  0.0353  -0.0608 88  GLU A CG  
711  C CD  . GLU A 88  ? 0.6375 0.8122 0.6233 0.0185  0.0290  -0.0601 88  GLU A CD  
712  O OE1 . GLU A 88  ? 0.6714 0.8428 0.6562 0.0176  0.0190  -0.0665 88  GLU A OE1 
713  O OE2 . GLU A 88  ? 0.6670 0.8443 0.6427 0.0207  0.0340  -0.0525 88  GLU A OE2 
714  N N   . VAL A 89  ? 0.4277 0.5999 0.4694 0.0093  0.0236  -0.0664 89  VAL A N   
715  C CA  . VAL A 89  ? 0.4155 0.5831 0.4617 0.0090  0.0149  -0.0692 89  VAL A CA  
716  C C   . VAL A 89  ? 0.4188 0.5826 0.4607 0.0120  0.0117  -0.0761 89  VAL A C   
717  O O   . VAL A 89  ? 0.4365 0.6022 0.4779 0.0155  0.0158  -0.0813 89  VAL A O   
718  C CB  . VAL A 89  ? 0.4108 0.5812 0.4722 0.0092  0.0138  -0.0700 89  VAL A CB  
719  C CG1 . VAL A 89  ? 0.4219 0.5873 0.4865 0.0105  0.0063  -0.0702 89  VAL A CG1 
720  C CG2 . VAL A 89  ? 0.3993 0.5732 0.4676 0.0060  0.0157  -0.0660 89  VAL A CG2 
721  N N   . THR A 90  ? 0.4070 0.5651 0.4476 0.0107  0.0047  -0.0762 90  THR A N   
722  C CA  . THR A 90  ? 0.4071 0.5599 0.4487 0.0124  0.0004  -0.0833 90  THR A CA  
723  C C   . THR A 90  ? 0.3864 0.5341 0.4406 0.0117  -0.0040 -0.0804 90  THR A C   
724  O O   . THR A 90  ? 0.3875 0.5355 0.4437 0.0099  -0.0054 -0.0731 90  THR A O   
725  C CB  . THR A 90  ? 0.4136 0.5647 0.4451 0.0112  -0.0043 -0.0856 90  THR A CB  
726  O OG1 . THR A 90  ? 0.4416 0.5951 0.4697 0.0083  -0.0050 -0.0771 90  THR A OG1 
727  C CG2 . THR A 90  ? 0.4393 0.5935 0.4562 0.0148  -0.0011 -0.0916 90  THR A CG2 
728  N N   . VAL A 91  ? 0.3850 0.5277 0.4471 0.0140  -0.0053 -0.0856 91  VAL A N   
729  C CA  . VAL A 91  ? 0.3743 0.5111 0.4491 0.0147  -0.0082 -0.0819 91  VAL A CA  
730  C C   . VAL A 91  ? 0.3776 0.5059 0.4582 0.0140  -0.0118 -0.0886 91  VAL A C   
731  O O   . VAL A 91  ? 0.3922 0.5179 0.4711 0.0161  -0.0110 -0.0982 91  VAL A O   
732  C CB  . VAL A 91  ? 0.3678 0.5060 0.4519 0.0195  -0.0053 -0.0806 91  VAL A CB  
733  C CG1 . VAL A 91  ? 0.3804 0.5138 0.4745 0.0217  -0.0072 -0.0733 91  VAL A CG1 
734  C CG2 . VAL A 91  ? 0.3602 0.5077 0.4415 0.0199  -0.0027 -0.0778 91  VAL A CG2 
735  N N   . PHE A 92  ? 0.3731 0.4969 0.4622 0.0114  -0.0155 -0.0839 92  PHE A N   
736  C CA  . PHE A 92  ? 0.3692 0.4847 0.4687 0.0095  -0.0196 -0.0907 92  PHE A CA  
737  C C   . PHE A 92  ? 0.3595 0.4702 0.4755 0.0087  -0.0198 -0.0805 92  PHE A C   
738  O O   . PHE A 92  ? 0.3429 0.4578 0.4561 0.0096  -0.0177 -0.0696 92  PHE A O   
739  C CB  . PHE A 92  ? 0.3703 0.4885 0.4606 0.0056  -0.0254 -0.0977 92  PHE A CB  
740  C CG  . PHE A 92  ? 0.3446 0.4701 0.4277 0.0031  -0.0264 -0.0888 92  PHE A CG  
741  C CD1 . PHE A 92  ? 0.3303 0.4549 0.4249 -0.0005 -0.0301 -0.0824 92  PHE A CD1 
742  C CD2 . PHE A 92  ? 0.3343 0.4673 0.4012 0.0045  -0.0225 -0.0859 92  PHE A CD2 
743  C CE1 . PHE A 92  ? 0.3093 0.4403 0.3974 -0.0019 -0.0301 -0.0738 92  PHE A CE1 
744  C CE2 . PHE A 92  ? 0.2871 0.4254 0.3479 0.0026  -0.0225 -0.0776 92  PHE A CE2 
745  C CZ  . PHE A 92  ? 0.3065 0.4438 0.3768 -0.0002 -0.0264 -0.0717 92  PHE A CZ  
746  N N   . PRO A 93  ? 0.3672 0.4683 0.5009 0.0079  -0.0212 -0.0839 93  PRO A N   
747  C CA  . PRO A 93  ? 0.3738 0.4694 0.5271 0.0076  -0.0197 -0.0732 93  PRO A CA  
748  C C   . PRO A 93  ? 0.3922 0.4894 0.5532 0.0013  -0.0246 -0.0711 93  PRO A C   
749  O O   . PRO A 93  ? 0.4127 0.5133 0.5670 -0.0029 -0.0312 -0.0815 93  PRO A O   
750  C CB  . PRO A 93  ? 0.3817 0.4653 0.5531 0.0088  -0.0186 -0.0794 93  PRO A CB  
751  C CG  . PRO A 93  ? 0.3853 0.4677 0.5472 0.0074  -0.0228 -0.0966 93  PRO A CG  
752  C CD  . PRO A 93  ? 0.3781 0.4720 0.5149 0.0091  -0.0222 -0.0976 93  PRO A CD  
753  N N   . LYS A 94  ? 0.3955 0.4910 0.5714 0.0017  -0.0213 -0.0576 94  LYS A N   
754  C CA  . LYS A 94  ? 0.3918 0.4901 0.5794 -0.0037 -0.0248 -0.0532 94  LYS A CA  
755  C C   . LYS A 94  ? 0.4107 0.5020 0.6233 -0.0094 -0.0301 -0.0620 94  LYS A C   
756  O O   . LYS A 94  ? 0.4197 0.5157 0.6377 -0.0154 -0.0379 -0.0679 94  LYS A O   
757  C CB  . LYS A 94  ? 0.3804 0.4796 0.5748 0.0002  -0.0177 -0.0346 94  LYS A CB  
758  C CG  . LYS A 94  ? 0.3852 0.4916 0.5834 -0.0035 -0.0196 -0.0274 94  LYS A CG  
759  C CD  . LYS A 94  ? 0.3828 0.4880 0.5922 0.0014  -0.0108 -0.0083 94  LYS A CD  
760  C CE  . LYS A 94  ? 0.3714 0.4803 0.6028 -0.0035 -0.0119 -0.0014 94  LYS A CE  
761  N NZ  . LYS A 94  ? 0.3902 0.5094 0.6058 -0.0051 -0.0155 -0.0005 94  LYS A NZ  
762  N N   . GLU A 95  ? 0.4242 0.5043 0.6533 -0.0075 -0.0264 -0.0635 95  GLU A N   
763  C CA  . GLU A 95  ? 0.4421 0.5130 0.6986 -0.0135 -0.0314 -0.0734 95  GLU A CA  
764  C C   . GLU A 95  ? 0.4503 0.5126 0.7015 -0.0120 -0.0335 -0.0901 95  GLU A C   
765  O O   . GLU A 95  ? 0.4431 0.5055 0.6766 -0.0055 -0.0284 -0.0894 95  GLU A O   
766  C CB  . GLU A 95  ? 0.4493 0.5115 0.7381 -0.0129 -0.0235 -0.0590 95  GLU A CB  
767  C CG  . GLU A 95  ? 0.4499 0.5193 0.7455 -0.0122 -0.0184 -0.0398 95  GLU A CG  
768  C CD  . GLU A 95  ? 0.4866 0.5649 0.7914 -0.0205 -0.0273 -0.0437 95  GLU A CD  
769  O OE1 . GLU A 95  ? 0.5173 0.5934 0.8374 -0.0280 -0.0372 -0.0593 95  GLU A OE1 
770  O OE2 . GLU A 95  ? 0.4820 0.5699 0.7790 -0.0190 -0.0247 -0.0314 95  GLU A OE2 
771  N N   . PRO A 96  ? 0.4709 0.5259 0.7391 -0.0178 -0.0414 -0.1057 96  PRO A N   
772  C CA  . PRO A 96  ? 0.4881 0.5324 0.7530 -0.0152 -0.0422 -0.1216 96  PRO A CA  
773  C C   . PRO A 96  ? 0.4963 0.5308 0.7726 -0.0086 -0.0303 -0.1098 96  PRO A C   
774  O O   . PRO A 96  ? 0.5080 0.5356 0.8123 -0.0097 -0.0251 -0.0979 96  PRO A O   
775  C CB  . PRO A 96  ? 0.5062 0.5418 0.7976 -0.0229 -0.0516 -0.1365 96  PRO A CB  
776  C CG  . PRO A 96  ? 0.4883 0.5364 0.7851 -0.0297 -0.0596 -0.1330 96  PRO A CG  
777  C CD  . PRO A 96  ? 0.4717 0.5267 0.7673 -0.0265 -0.0493 -0.1091 96  PRO A CD  
778  N N   . VAL A 97  ? 0.5046 0.5399 0.7599 -0.0011 -0.0255 -0.1115 97  VAL A N   
779  C CA  . VAL A 97  ? 0.5096 0.5387 0.7711 0.0070  -0.0149 -0.1002 97  VAL A CA  
780  C C   . VAL A 97  ? 0.5327 0.5443 0.8263 0.0066  -0.0112 -0.1012 97  VAL A C   
781  O O   . VAL A 97  ? 0.5457 0.5466 0.8476 0.0035  -0.0161 -0.1190 97  VAL A O   
782  C CB  . VAL A 97  ? 0.5148 0.5465 0.7534 0.0139  -0.0127 -0.1081 97  VAL A CB  
783  C CG1 . VAL A 97  ? 0.5169 0.5421 0.7647 0.0232  -0.0028 -0.0982 97  VAL A CG1 
784  C CG2 . VAL A 97  ? 0.5084 0.5567 0.7189 0.0146  -0.0144 -0.1052 97  VAL A CG2 
785  N N   . GLU A 98  ? 0.5394 0.5473 0.8510 0.0106  -0.0022 -0.0819 98  GLU A N   
786  C CA  . GLU A 98  ? 0.5681 0.5584 0.9109 0.0123  0.0043  -0.0795 98  GLU A CA  
787  C C   . GLU A 98  ? 0.5629 0.5517 0.9058 0.0244  0.0166  -0.0602 98  GLU A C   
788  O O   . GLU A 98  ? 0.5542 0.5514 0.8931 0.0289  0.0218  -0.0411 98  GLU A O   
789  C CB  . GLU A 98  ? 0.5759 0.5593 0.9531 0.0033  0.0028  -0.0763 98  GLU A CB  
790  C CG  . GLU A 98  ? 0.6330 0.5969 1.0413 -0.0009 0.0020  -0.0896 98  GLU A CG  
791  C CD  . GLU A 98  ? 0.7000 0.6588 1.1459 -0.0118 -0.0019 -0.0898 98  GLU A CD  
792  O OE1 . GLU A 98  ? 0.7233 0.6641 1.2051 -0.0138 0.0027  -0.0910 98  GLU A OE1 
793  O OE2 . GLU A 98  ? 0.6931 0.6655 1.1346 -0.0183 -0.0091 -0.0885 98  GLU A OE2 
794  N N   . LEU A 99  ? 0.5731 0.5516 0.9195 0.0305  0.0207  -0.0662 99  LEU A N   
795  C CA  . LEU A 99  ? 0.5785 0.5564 0.9229 0.0434  0.0309  -0.0514 99  LEU A CA  
796  C C   . LEU A 99  ? 0.5759 0.5514 0.9385 0.0489  0.0408  -0.0266 99  LEU A C   
797  O O   . LEU A 99  ? 0.5881 0.5535 0.9792 0.0427  0.0432  -0.0224 99  LEU A O   
798  C CB  . LEU A 99  ? 0.6045 0.5657 0.9635 0.0465  0.0342  -0.0626 99  LEU A CB  
799  C CG  . LEU A 99  ? 0.6229 0.5848 0.9705 0.0587  0.0398  -0.0618 99  LEU A CG  
800  C CD1 . LEU A 99  ? 0.6097 0.5804 0.9309 0.0568  0.0322  -0.0815 99  LEU A CD1 
801  C CD2 . LEU A 99  ? 0.6379 0.5773 1.0159 0.0630  0.0483  -0.0617 99  LEU A CD2 
802  N N   . GLY A 100 ? 0.5643 0.5495 0.9110 0.0610  0.0466  -0.0102 100 GLY A N   
803  C CA  . GLY A 100 ? 0.5575 0.5409 0.9165 0.0696  0.0572  0.0146  100 GLY A CA  
804  C C   . GLY A 100 ? 0.5482 0.5366 0.9123 0.0630  0.0567  0.0236  100 GLY A C   
805  O O   . GLY A 100 ? 0.5501 0.5386 0.9216 0.0707  0.0662  0.0450  100 GLY A O   
806  N N   . GLN A 101 ? 0.5415 0.5347 0.9007 0.0501  0.0462  0.0080  101 GLN A N   
807  C CA  . GLN A 101 ? 0.5427 0.5407 0.9104 0.0426  0.0448  0.0146  101 GLN A CA  
808  C C   . GLN A 101 ? 0.5186 0.5350 0.8528 0.0425  0.0386  0.0153  101 GLN A C   
809  O O   . GLN A 101 ? 0.5101 0.5337 0.8234 0.0374  0.0289  -0.0014 101 GLN A O   
810  C CB  . GLN A 101 ? 0.5479 0.5373 0.9410 0.0280  0.0373  -0.0023 101 GLN A CB  
811  C CG  . GLN A 101 ? 0.5924 0.5776 1.0201 0.0217  0.0417  0.0095  101 GLN A CG  
812  C CD  . GLN A 101 ? 0.6381 0.6095 1.0976 0.0294  0.0571  0.0295  101 GLN A CD  
813  O OE1 . GLN A 101 ? 0.6649 0.6244 1.1304 0.0357  0.0625  0.0286  101 GLN A OE1 
814  N NE2 . GLN A 101 ? 0.6500 0.6227 1.1308 0.0293  0.0653  0.0486  101 GLN A NE2 
815  N N   . PRO A 102 ? 0.5088 0.5317 0.8381 0.0490  0.0452  0.0350  102 PRO A N   
816  C CA  . PRO A 102 ? 0.4906 0.5289 0.7894 0.0506  0.0410  0.0374  102 PRO A CA  
817  C C   . PRO A 102 ? 0.4751 0.5209 0.7644 0.0379  0.0295  0.0211  102 PRO A C   
818  O O   . PRO A 102 ? 0.4712 0.5135 0.7818 0.0276  0.0259  0.0154  102 PRO A O   
819  C CB  . PRO A 102 ? 0.4936 0.5327 0.8006 0.0575  0.0513  0.0603  102 PRO A CB  
820  C CG  . PRO A 102 ? 0.5076 0.5344 0.8378 0.0662  0.0630  0.0739  102 PRO A CG  
821  C CD  . PRO A 102 ? 0.5192 0.5341 0.8724 0.0568  0.0587  0.0572  102 PRO A CD  
822  N N   . ASN A 103 ? 0.4603 0.5170 0.7187 0.0393  0.0236  0.0140  103 ASN A N   
823  C CA  . ASN A 103 ? 0.4408 0.5046 0.6858 0.0295  0.0136  -0.0015 103 ASN A CA  
824  C C   . ASN A 103 ? 0.4242 0.5002 0.6395 0.0334  0.0118  0.0013  103 ASN A C   
825  O O   . ASN A 103 ? 0.4259 0.5048 0.6311 0.0434  0.0170  0.0133  103 ASN A O   
826  C CB  . ASN A 103 ? 0.4434 0.5032 0.6867 0.0256  0.0079  -0.0205 103 ASN A CB  
827  C CG  . ASN A 103 ? 0.4325 0.4954 0.6727 0.0148  -0.0019 -0.0367 103 ASN A CG  
828  O OD1 . ASN A 103 ? 0.3876 0.4602 0.6147 0.0114  -0.0057 -0.0359 103 ASN A OD1 
829  N ND2 . ASN A 103 ? 0.4174 0.4720 0.6688 0.0105  -0.0059 -0.0518 103 ASN A ND2 
830  N N   . THR A 104 ? 0.4090 0.4919 0.6105 0.0261  0.0043  -0.0102 104 THR A N   
831  C CA  . THR A 104 ? 0.3938 0.4869 0.5696 0.0282  0.0024  -0.0098 104 THR A CA  
832  C C   . THR A 104 ? 0.3901 0.4881 0.5513 0.0235  -0.0038 -0.0255 104 THR A C   
833  O O   . THR A 104 ? 0.3893 0.4866 0.5536 0.0161  -0.0088 -0.0359 104 THR A O   
834  C CB  . THR A 104 ? 0.3822 0.4798 0.5562 0.0250  0.0021  -0.0028 104 THR A CB  
835  O OG1 . THR A 104 ? 0.3983 0.4914 0.5886 0.0295  0.0092  0.0126  104 THR A OG1 
836  C CG2 . THR A 104 ? 0.3892 0.4949 0.5381 0.0286  0.0014  -0.0010 104 THR A CG2 
837  N N   . LEU A 105 ? 0.3862 0.4896 0.5318 0.0286  -0.0034 -0.0270 105 LEU A N   
838  C CA  . LEU A 105 ? 0.3841 0.4930 0.5170 0.0252  -0.0070 -0.0394 105 LEU A CA  
839  C C   . LEU A 105 ? 0.3784 0.4949 0.4959 0.0224  -0.0089 -0.0379 105 LEU A C   
840  O O   . LEU A 105 ? 0.3797 0.4987 0.4912 0.0263  -0.0072 -0.0286 105 LEU A O   
841  C CB  . LEU A 105 ? 0.3837 0.4958 0.5124 0.0317  -0.0054 -0.0414 105 LEU A CB  
842  C CG  . LEU A 105 ? 0.3940 0.5044 0.5258 0.0310  -0.0056 -0.0533 105 LEU A CG  
843  C CD1 . LEU A 105 ? 0.4059 0.5241 0.5322 0.0369  -0.0044 -0.0541 105 LEU A CD1 
844  C CD2 . LEU A 105 ? 0.3964 0.5079 0.5208 0.0239  -0.0087 -0.0645 105 LEU A CD2 
845  N N   . ILE A 106 ? 0.3717 0.4913 0.4820 0.0166  -0.0120 -0.0470 106 ILE A N   
846  C CA  . ILE A 106 ? 0.3626 0.4883 0.4597 0.0140  -0.0129 -0.0453 106 ILE A CA  
847  C C   . ILE A 106 ? 0.3719 0.5033 0.4580 0.0139  -0.0123 -0.0525 106 ILE A C   
848  O O   . ILE A 106 ? 0.3945 0.5255 0.4816 0.0136  -0.0123 -0.0611 106 ILE A O   
849  C CB  . ILE A 106 ? 0.3568 0.4829 0.4551 0.0081  -0.0164 -0.0474 106 ILE A CB  
850  C CG1 . ILE A 106 ? 0.3432 0.4643 0.4585 0.0073  -0.0166 -0.0402 106 ILE A CG1 
851  C CG2 . ILE A 106 ? 0.3431 0.4752 0.4276 0.0064  -0.0162 -0.0443 106 ILE A CG2 
852  C CD1 . ILE A 106 ? 0.3323 0.4552 0.4536 0.0014  -0.0217 -0.0432 106 ILE A CD1 
853  N N   . CYS A 107 ? 0.3622 0.4985 0.4391 0.0144  -0.0113 -0.0492 107 CYS A N   
854  C CA  . CYS A 107 ? 0.3574 0.4992 0.4275 0.0131  -0.0098 -0.0548 107 CYS A CA  
855  C C   . CYS A 107 ? 0.3545 0.4986 0.4153 0.0097  -0.0093 -0.0521 107 CYS A C   
856  O O   . CYS A 107 ? 0.3455 0.4891 0.4032 0.0104  -0.0092 -0.0458 107 CYS A O   
857  C CB  . CYS A 107 ? 0.3578 0.5035 0.4298 0.0171  -0.0092 -0.0541 107 CYS A CB  
858  S SG  . CYS A 107 ? 0.4043 0.5577 0.4730 0.0145  -0.0067 -0.0593 107 CYS A SG  
859  N N   . HIS A 108 ? 0.3597 0.5058 0.4148 0.0070  -0.0087 -0.0567 108 HIS A N   
860  C CA  . HIS A 108 ? 0.3592 0.5079 0.4052 0.0046  -0.0073 -0.0535 108 HIS A CA  
861  C C   . HIS A 108 ? 0.3577 0.5107 0.3999 0.0044  -0.0022 -0.0551 108 HIS A C   
862  O O   . HIS A 108 ? 0.3696 0.5253 0.4107 0.0052  0.0004  -0.0605 108 HIS A O   
863  C CB  . HIS A 108 ? 0.3697 0.5190 0.4109 0.0032  -0.0099 -0.0569 108 HIS A CB  
864  C CG  . HIS A 108 ? 0.3910 0.5432 0.4232 0.0020  -0.0094 -0.0518 108 HIS A CG  
865  N ND1 . HIS A 108 ? 0.4214 0.5773 0.4440 0.0024  -0.0106 -0.0551 108 HIS A ND1 
866  C CD2 . HIS A 108 ? 0.4147 0.5666 0.4454 0.0015  -0.0078 -0.0435 108 HIS A CD2 
867  C CE1 . HIS A 108 ? 0.4418 0.6003 0.4582 0.0022  -0.0096 -0.0480 108 HIS A CE1 
868  N NE2 . HIS A 108 ? 0.4432 0.5987 0.4651 0.0013  -0.0075 -0.0410 108 HIS A NE2 
869  N N   . ILE A 109 ? 0.3416 0.4949 0.3833 0.0036  -0.0004 -0.0505 109 ILE A N   
870  C CA  . ILE A 109 ? 0.3329 0.4898 0.3754 0.0023  0.0049  -0.0511 109 ILE A CA  
871  C C   . ILE A 109 ? 0.3420 0.4983 0.3760 0.0007  0.0086  -0.0458 109 ILE A C   
872  O O   . ILE A 109 ? 0.3415 0.4942 0.3722 0.0005  0.0070  -0.0405 109 ILE A O   
873  C CB  . ILE A 109 ? 0.3231 0.4799 0.3729 0.0024  0.0035  -0.0512 109 ILE A CB  
874  C CG1 . ILE A 109 ? 0.3134 0.4716 0.3702 0.0057  -0.0009 -0.0547 109 ILE A CG1 
875  C CG2 . ILE A 109 ? 0.3123 0.4730 0.3687 0.0000  0.0082  -0.0528 109 ILE A CG2 
876  C CD1 . ILE A 109 ? 0.2972 0.4505 0.3512 0.0091  -0.0055 -0.0506 109 ILE A CD1 
877  N N   . ASP A 110 ? 0.3467 0.5067 0.3770 0.0009  0.0145  -0.0461 110 ASP A N   
878  C CA  . ASP A 110 ? 0.3596 0.5200 0.3789 0.0016  0.0181  -0.0403 110 ASP A CA  
879  C C   . ASP A 110 ? 0.3667 0.5292 0.3866 0.0015  0.0283  -0.0359 110 ASP A C   
880  O O   . ASP A 110 ? 0.3703 0.5353 0.4006 0.0005  0.0331  -0.0383 110 ASP A O   
881  C CB  . ASP A 110 ? 0.3606 0.5235 0.3697 0.0043  0.0145  -0.0438 110 ASP A CB  
882  C CG  . ASP A 110 ? 0.3976 0.5619 0.3955 0.0057  0.0133  -0.0381 110 ASP A CG  
883  O OD1 . ASP A 110 ? 0.4156 0.5782 0.4131 0.0050  0.0162  -0.0302 110 ASP A OD1 
884  O OD2 . ASP A 110 ? 0.4246 0.5921 0.4140 0.0082  0.0088  -0.0422 110 ASP A OD2 
885  N N   . LYS A 111 ? 0.3651 0.5269 0.3762 0.0028  0.0319  -0.0285 111 LYS A N   
886  C CA  . LYS A 111 ? 0.3773 0.5400 0.3882 0.0039  0.0429  -0.0216 111 LYS A CA  
887  C C   . LYS A 111 ? 0.3743 0.5342 0.4025 -0.0003 0.0490  -0.0207 111 LYS A C   
888  O O   . LYS A 111 ? 0.3879 0.5497 0.4216 0.0001  0.0594  -0.0164 111 LYS A O   
889  C CB  . LYS A 111 ? 0.3890 0.5579 0.3907 0.0088  0.0486  -0.0222 111 LYS A CB  
890  C CG  . LYS A 111 ? 0.4218 0.5938 0.4059 0.0134  0.0418  -0.0248 111 LYS A CG  
891  C CD  . LYS A 111 ? 0.5038 0.6813 0.4760 0.0199  0.0482  -0.0261 111 LYS A CD  
892  C CE  . LYS A 111 ? 0.5679 0.7494 0.5186 0.0262  0.0424  -0.0271 111 LYS A CE  
893  N NZ  . LYS A 111 ? 0.6140 0.7950 0.5632 0.0251  0.0294  -0.0392 111 LYS A NZ  
894  N N   . PHE A 112 ? 0.3634 0.5188 0.4006 -0.0040 0.0429  -0.0245 112 PHE A N   
895  C CA  . PHE A 112 ? 0.3544 0.5077 0.4094 -0.0082 0.0464  -0.0263 112 PHE A CA  
896  C C   . PHE A 112 ? 0.3468 0.4917 0.4045 -0.0101 0.0493  -0.0215 112 PHE A C   
897  O O   . PHE A 112 ? 0.3541 0.4946 0.3999 -0.0078 0.0474  -0.0168 112 PHE A O   
898  C CB  . PHE A 112 ? 0.3582 0.5135 0.4235 -0.0100 0.0378  -0.0358 112 PHE A CB  
899  C CG  . PHE A 112 ? 0.3598 0.5109 0.4165 -0.0084 0.0281  -0.0379 112 PHE A CG  
900  C CD1 . PHE A 112 ? 0.3802 0.5252 0.4398 -0.0094 0.0244  -0.0395 112 PHE A CD1 
901  C CD2 . PHE A 112 ? 0.3666 0.5194 0.4129 -0.0054 0.0231  -0.0383 112 PHE A CD2 
902  C CE1 . PHE A 112 ? 0.3933 0.5347 0.4439 -0.0064 0.0171  -0.0399 112 PHE A CE1 
903  C CE2 . PHE A 112 ? 0.3893 0.5385 0.4304 -0.0036 0.0159  -0.0383 112 PHE A CE2 
904  C CZ  . PHE A 112 ? 0.3926 0.5363 0.4349 -0.0035 0.0136  -0.0382 112 PHE A CZ  
905  N N   . PHE A 113 ? 0.3416 0.4845 0.4173 -0.0142 0.0543  -0.0229 113 PHE A N   
906  C CA  . PHE A 113 ? 0.3245 0.4577 0.4075 -0.0168 0.0567  -0.0213 113 PHE A CA  
907  C C   . PHE A 113 ? 0.3307 0.4648 0.4379 -0.0224 0.0557  -0.0298 113 PHE A C   
908  O O   . PHE A 113 ? 0.3411 0.4829 0.4621 -0.0242 0.0614  -0.0297 113 PHE A O   
909  C CB  . PHE A 113 ? 0.3168 0.4459 0.3986 -0.0155 0.0695  -0.0095 113 PHE A CB  
910  C CG  . PHE A 113 ? 0.2914 0.4085 0.3801 -0.0176 0.0723  -0.0078 113 PHE A CG  
911  C CD1 . PHE A 113 ? 0.2605 0.3710 0.3337 -0.0138 0.0706  -0.0027 113 PHE A CD1 
912  C CD2 . PHE A 113 ? 0.3205 0.4328 0.4331 -0.0235 0.0757  -0.0126 113 PHE A CD2 
913  C CE1 . PHE A 113 ? 0.2833 0.3814 0.3619 -0.0148 0.0733  -0.0019 113 PHE A CE1 
914  C CE2 . PHE A 113 ? 0.3233 0.4224 0.4426 -0.0254 0.0775  -0.0131 113 PHE A CE2 
915  C CZ  . PHE A 113 ? 0.3041 0.3956 0.4050 -0.0206 0.0767  -0.0076 113 PHE A CZ  
916  N N   . PRO A 114 ? 0.3310 0.4581 0.4439 -0.0247 0.0486  -0.0373 114 PRO A N   
917  C CA  . PRO A 114 ? 0.3324 0.4503 0.4296 -0.0215 0.0429  -0.0376 114 PRO A CA  
918  C C   . PRO A 114 ? 0.3265 0.4487 0.4115 -0.0178 0.0312  -0.0435 114 PRO A C   
919  O O   . PRO A 114 ? 0.3184 0.4499 0.4089 -0.0181 0.0274  -0.0481 114 PRO A O   
920  C CB  . PRO A 114 ? 0.3390 0.4477 0.4516 -0.0256 0.0419  -0.0449 114 PRO A CB  
921  C CG  . PRO A 114 ? 0.3350 0.4520 0.4697 -0.0304 0.0387  -0.0538 114 PRO A CG  
922  C CD  . PRO A 114 ? 0.3293 0.4567 0.4683 -0.0307 0.0473  -0.0460 114 PRO A CD  
923  N N   . PRO A 115 ? 0.3341 0.4493 0.4040 -0.0136 0.0267  -0.0428 115 PRO A N   
924  C CA  . PRO A 115 ? 0.3308 0.4489 0.3888 -0.0088 0.0178  -0.0454 115 PRO A CA  
925  C C   . PRO A 115 ? 0.3565 0.4746 0.4203 -0.0082 0.0090  -0.0568 115 PRO A C   
926  O O   . PRO A 115 ? 0.3713 0.4830 0.4249 -0.0036 0.0042  -0.0596 115 PRO A O   
927  C CB  . PRO A 115 ? 0.3350 0.4453 0.3776 -0.0042 0.0194  -0.0381 115 PRO A CB  
928  C CG  . PRO A 115 ? 0.3348 0.4374 0.3809 -0.0064 0.0280  -0.0330 115 PRO A CG  
929  C CD  . PRO A 115 ? 0.3479 0.4513 0.4130 -0.0125 0.0309  -0.0389 115 PRO A CD  
930  N N   . VAL A 116 ? 0.3702 0.4964 0.4507 -0.0122 0.0071  -0.0633 116 VAL A N   
931  C CA  . VAL A 116 ? 0.3874 0.5179 0.4759 -0.0114 -0.0029 -0.0748 116 VAL A CA  
932  C C   . VAL A 116 ? 0.3934 0.5365 0.4892 -0.0114 -0.0047 -0.0754 116 VAL A C   
933  O O   . VAL A 116 ? 0.4132 0.5619 0.5232 -0.0161 0.0020  -0.0733 116 VAL A O   
934  C CB  . VAL A 116 ? 0.3915 0.5198 0.5008 -0.0178 -0.0027 -0.0827 116 VAL A CB  
935  C CG1 . VAL A 116 ? 0.4029 0.5402 0.5240 -0.0174 -0.0145 -0.0953 116 VAL A CG1 
936  C CG2 . VAL A 116 ? 0.4130 0.5263 0.5157 -0.0174 -0.0006 -0.0834 116 VAL A CG2 
937  N N   . LEU A 117 ? 0.3939 0.5412 0.4803 -0.0051 -0.0128 -0.0776 117 LEU A N   
938  C CA  . LEU A 117 ? 0.3759 0.5313 0.4621 -0.0031 -0.0124 -0.0744 117 LEU A CA  
939  C C   . LEU A 117 ? 0.3778 0.5373 0.4575 0.0044  -0.0219 -0.0778 117 LEU A C   
940  O O   . LEU A 117 ? 0.3818 0.5352 0.4458 0.0104  -0.0251 -0.0759 117 LEU A O   
941  C CB  . LEU A 117 ? 0.3669 0.5170 0.4390 -0.0021 -0.0058 -0.0644 117 LEU A CB  
942  C CG  . LEU A 117 ? 0.3553 0.5103 0.4278 -0.0027 -0.0011 -0.0603 117 LEU A CG  
943  C CD1 . LEU A 117 ? 0.3456 0.4995 0.4068 0.0026  -0.0046 -0.0568 117 LEU A CD1 
944  C CD2 . LEU A 117 ? 0.3346 0.4991 0.4233 -0.0048 -0.0003 -0.0652 117 LEU A CD2 
945  N N   . ASN A 118 ? 0.3776 0.5478 0.4695 0.0052  -0.0254 -0.0819 118 ASN A N   
946  C CA  . ASN A 118 ? 0.3848 0.5598 0.4705 0.0137  -0.0333 -0.0830 118 ASN A CA  
947  C C   . ASN A 118 ? 0.3712 0.5479 0.4551 0.0158  -0.0288 -0.0765 118 ASN A C   
948  O O   . ASN A 118 ? 0.3670 0.5475 0.4614 0.0111  -0.0230 -0.0762 118 ASN A O   
949  C CB  . ASN A 118 ? 0.3839 0.5700 0.4843 0.0149  -0.0428 -0.0932 118 ASN A CB  
950  C CG  . ASN A 118 ? 0.4205 0.6029 0.5173 0.0156  -0.0505 -0.1014 118 ASN A CG  
951  O OD1 . ASN A 118 ? 0.4722 0.6431 0.5516 0.0178  -0.0485 -0.0981 118 ASN A OD1 
952  N ND2 . ASN A 118 ? 0.4376 0.6295 0.5517 0.0139  -0.0595 -0.1126 118 ASN A ND2 
953  N N   . VAL A 119 ? 0.3689 0.5418 0.4397 0.0231  -0.0304 -0.0710 119 VAL A N   
954  C CA  . VAL A 119 ? 0.3615 0.5349 0.4336 0.0253  -0.0269 -0.0661 119 VAL A CA  
955  C C   . VAL A 119 ? 0.3667 0.5414 0.4340 0.0353  -0.0314 -0.0629 119 VAL A C   
956  O O   . VAL A 119 ? 0.3732 0.5440 0.4282 0.0417  -0.0341 -0.0595 119 VAL A O   
957  C CB  . VAL A 119 ? 0.3573 0.5220 0.4216 0.0222  -0.0203 -0.0592 119 VAL A CB  
958  C CG1 . VAL A 119 ? 0.3663 0.5319 0.4362 0.0222  -0.0172 -0.0583 119 VAL A CG1 
959  C CG2 . VAL A 119 ? 0.3555 0.5175 0.4194 0.0147  -0.0155 -0.0597 119 VAL A CG2 
960  N N   . THR A 120 ? 0.3669 0.5469 0.4438 0.0376  -0.0309 -0.0632 120 THR A N   
961  C CA  . THR A 120 ? 0.3732 0.5548 0.4483 0.0477  -0.0338 -0.0590 120 THR A CA  
962  C C   . THR A 120 ? 0.3692 0.5488 0.4528 0.0471  -0.0283 -0.0566 120 THR A C   
963  O O   . THR A 120 ? 0.3628 0.5446 0.4550 0.0407  -0.0248 -0.0612 120 THR A O   
964  C CB  . THR A 120 ? 0.3853 0.5796 0.4678 0.0531  -0.0419 -0.0650 120 THR A CB  
965  O OG1 . THR A 120 ? 0.3833 0.5857 0.4828 0.0459  -0.0409 -0.0720 120 THR A OG1 
966  C CG2 . THR A 120 ? 0.3719 0.5680 0.4444 0.0562  -0.0496 -0.0690 120 THR A CG2 
967  N N   . TRP A 121 ? 0.3726 0.5473 0.4536 0.0545  -0.0270 -0.0492 121 TRP A N   
968  C CA  . TRP A 121 ? 0.3623 0.5337 0.4529 0.0556  -0.0226 -0.0476 121 TRP A CA  
969  C C   . TRP A 121 ? 0.3702 0.5503 0.4691 0.0640  -0.0255 -0.0483 121 TRP A C   
970  O O   . TRP A 121 ? 0.3738 0.5606 0.4683 0.0720  -0.0312 -0.0465 121 TRP A O   
971  C CB  . TRP A 121 ? 0.3634 0.5241 0.4507 0.0593  -0.0188 -0.0382 121 TRP A CB  
972  C CG  . TRP A 121 ? 0.3554 0.5077 0.4384 0.0519  -0.0156 -0.0362 121 TRP A CG  
973  C CD1 . TRP A 121 ? 0.3284 0.4773 0.4012 0.0523  -0.0156 -0.0306 121 TRP A CD1 
974  C CD2 . TRP A 121 ? 0.3466 0.4933 0.4355 0.0443  -0.0124 -0.0396 121 TRP A CD2 
975  N NE1 . TRP A 121 ? 0.3250 0.4678 0.3991 0.0450  -0.0126 -0.0296 121 TRP A NE1 
976  C CE2 . TRP A 121 ? 0.3445 0.4860 0.4278 0.0399  -0.0113 -0.0356 121 TRP A CE2 
977  C CE3 . TRP A 121 ? 0.3352 0.4810 0.4325 0.0415  -0.0106 -0.0464 121 TRP A CE3 
978  C CZ2 . TRP A 121 ? 0.3562 0.4931 0.4428 0.0327  -0.0100 -0.0385 121 TRP A CZ2 
979  C CZ3 . TRP A 121 ? 0.3588 0.4986 0.4570 0.0348  -0.0090 -0.0500 121 TRP A CZ3 
980  C CH2 . TRP A 121 ? 0.3561 0.4922 0.4493 0.0303  -0.0094 -0.0462 121 TRP A CH2 
981  N N   . LEU A 122 ? 0.3785 0.5587 0.4890 0.0633  -0.0217 -0.0509 122 LEU A N   
982  C CA  . LEU A 122 ? 0.3865 0.5745 0.5069 0.0720  -0.0232 -0.0503 122 LEU A CA  
983  C C   . LEU A 122 ? 0.3920 0.5691 0.5186 0.0751  -0.0167 -0.0461 122 LEU A C   
984  O O   . LEU A 122 ? 0.3856 0.5540 0.5138 0.0678  -0.0119 -0.0499 122 LEU A O   
985  C CB  . LEU A 122 ? 0.3843 0.5846 0.5166 0.0682  -0.0242 -0.0590 122 LEU A CB  
986  C CG  . LEU A 122 ? 0.3857 0.5973 0.5192 0.0631  -0.0302 -0.0652 122 LEU A CG  
987  C CD1 . LEU A 122 ? 0.3474 0.5705 0.4984 0.0597  -0.0281 -0.0717 122 LEU A CD1 
988  C CD2 . LEU A 122 ? 0.3909 0.6111 0.5199 0.0711  -0.0400 -0.0641 122 LEU A CD2 
989  N N   . CYS A 123 ? 0.3990 0.5758 0.5283 0.0863  -0.0166 -0.0382 123 CYS A N   
990  C CA  . CYS A 123 ? 0.4135 0.5795 0.5525 0.0905  -0.0100 -0.0338 123 CYS A CA  
991  C C   . CYS A 123 ? 0.4111 0.5867 0.5611 0.0994  -0.0106 -0.0344 123 CYS A C   
992  O O   . CYS A 123 ? 0.4210 0.6082 0.5689 0.1085  -0.0161 -0.0303 123 CYS A O   
993  C CB  . CYS A 123 ? 0.4231 0.5786 0.5584 0.0968  -0.0069 -0.0212 123 CYS A CB  
994  S SG  . CYS A 123 ? 0.4870 0.6302 0.6378 0.1065  0.0014  -0.0116 123 CYS A SG  
995  N N   . ASN A 124 ? 0.4064 0.5780 0.5675 0.0973  -0.0054 -0.0400 124 ASN A N   
996  C CA  . ASN A 124 ? 0.4070 0.5895 0.5805 0.1039  -0.0052 -0.0425 124 ASN A CA  
997  C C   . ASN A 124 ? 0.3958 0.5990 0.5706 0.1047  -0.0130 -0.0462 124 ASN A C   
998  O O   . ASN A 124 ? 0.4025 0.6181 0.5867 0.1141  -0.0159 -0.0440 124 ASN A O   
999  C CB  . ASN A 124 ? 0.4186 0.5966 0.6003 0.1170  -0.0017 -0.0330 124 ASN A CB  
1000 C CG  . ASN A 124 ? 0.4441 0.6009 0.6287 0.1156  0.0059  -0.0295 124 ASN A CG  
1001 O OD1 . ASN A 124 ? 0.4548 0.6014 0.6426 0.1075  0.0100  -0.0382 124 ASN A OD1 
1002 N ND2 . ASN A 124 ? 0.4799 0.6301 0.6635 0.1236  0.0077  -0.0170 124 ASN A ND2 
1003 N N   . GLY A 125 ? 0.3796 0.5866 0.5471 0.0948  -0.0165 -0.0519 125 GLY A N   
1004 C CA  . GLY A 125 ? 0.3558 0.5812 0.5281 0.0936  -0.0241 -0.0568 125 GLY A CA  
1005 C C   . GLY A 125 ? 0.3567 0.5887 0.5189 0.0995  -0.0338 -0.0531 125 GLY A C   
1006 O O   . GLY A 125 ? 0.3454 0.5920 0.5115 0.0980  -0.0419 -0.0587 125 GLY A O   
1007 N N   . GLU A 126 ? 0.3621 0.5838 0.5119 0.1065  -0.0329 -0.0439 126 GLU A N   
1008 C CA  . GLU A 126 ? 0.3799 0.6075 0.5158 0.1131  -0.0415 -0.0409 126 GLU A CA  
1009 C C   . GLU A 126 ? 0.3835 0.5997 0.5018 0.1084  -0.0408 -0.0385 126 GLU A C   
1010 O O   . GLU A 126 ? 0.3860 0.5871 0.5004 0.1063  -0.0329 -0.0322 126 GLU A O   
1011 C CB  . GLU A 126 ? 0.3954 0.6299 0.5298 0.1302  -0.0451 -0.0321 126 GLU A CB  
1012 C CG  . GLU A 126 ? 0.4400 0.6603 0.5659 0.1389  -0.0377 -0.0186 126 GLU A CG  
1013 C CD  . GLU A 126 ? 0.4817 0.7108 0.6023 0.1576  -0.0419 -0.0089 126 GLU A CD  
1014 O OE1 . GLU A 126 ? 0.5634 0.7912 0.6958 0.1654  -0.0364 -0.0023 126 GLU A OE1 
1015 O OE2 . GLU A 126 ? 0.4725 0.7097 0.5769 0.1654  -0.0503 -0.0079 126 GLU A OE2 
1016 N N   . LEU A 127 ? 0.3950 0.6192 0.5049 0.1068  -0.0494 -0.0443 127 LEU A N   
1017 C CA  . LEU A 127 ? 0.4056 0.6212 0.4985 0.1032  -0.0498 -0.0434 127 LEU A CA  
1018 C C   . LEU A 127 ? 0.4312 0.6355 0.5109 0.1125  -0.0443 -0.0303 127 LEU A C   
1019 O O   . LEU A 127 ? 0.4464 0.6542 0.5221 0.1267  -0.0455 -0.0222 127 LEU A O   
1020 C CB  . LEU A 127 ? 0.4131 0.6395 0.4982 0.1052  -0.0613 -0.0513 127 LEU A CB  
1021 C CG  . LEU A 127 ? 0.4161 0.6332 0.4825 0.1028  -0.0615 -0.0510 127 LEU A CG  
1022 C CD1 . LEU A 127 ? 0.4202 0.6285 0.4911 0.0875  -0.0551 -0.0547 127 LEU A CD1 
1023 C CD2 . LEU A 127 ? 0.4364 0.6635 0.4947 0.1073  -0.0739 -0.0598 127 LEU A CD2 
1024 N N   . VAL A 128 ? 0.4378 0.6292 0.5122 0.1047  -0.0378 -0.0274 128 VAL A N   
1025 C CA  . VAL A 128 ? 0.4584 0.6379 0.5264 0.1106  -0.0303 -0.0144 128 VAL A CA  
1026 C C   . VAL A 128 ? 0.4727 0.6501 0.5216 0.1134  -0.0324 -0.0120 128 VAL A C   
1027 O O   . VAL A 128 ? 0.4632 0.6394 0.5084 0.1036  -0.0343 -0.0195 128 VAL A O   
1028 C CB  . VAL A 128 ? 0.4538 0.6213 0.5333 0.0994  -0.0219 -0.0137 128 VAL A CB  
1029 C CG1 . VAL A 128 ? 0.4620 0.6172 0.5408 0.1040  -0.0137 0.0001  128 VAL A CG1 
1030 C CG2 . VAL A 128 ? 0.4290 0.5985 0.5254 0.0965  -0.0204 -0.0192 128 VAL A CG2 
1031 N N   . THR A 129 ? 0.5021 0.6786 0.5384 0.1281  -0.0310 -0.0008 129 THR A N   
1032 C CA  . THR A 129 ? 0.5180 0.6944 0.5322 0.1356  -0.0339 0.0011  129 THR A CA  
1033 C C   . THR A 129 ? 0.5234 0.6875 0.5305 0.1381  -0.0234 0.0145  129 THR A C   
1034 O O   . THR A 129 ? 0.5316 0.6938 0.5213 0.1417  -0.0242 0.0150  129 THR A O   
1035 C CB  . THR A 129 ? 0.5385 0.7250 0.5387 0.1537  -0.0407 0.0039  129 THR A CB  
1036 O OG1 . THR A 129 ? 0.5425 0.7317 0.5553 0.1609  -0.0375 0.0115  129 THR A OG1 
1037 C CG2 . THR A 129 ? 0.5463 0.7458 0.5431 0.1514  -0.0550 -0.0129 129 THR A CG2 
1038 N N   . GLU A 130 ? 0.5206 0.6764 0.5427 0.1369  -0.0135 0.0253  130 GLU A N   
1039 C CA  . GLU A 130 ? 0.5173 0.6621 0.5404 0.1373  -0.0028 0.0385  130 GLU A CA  
1040 C C   . GLU A 130 ? 0.4974 0.6336 0.5442 0.1229  0.0032  0.0384  130 GLU A C   
1041 O O   . GLU A 130 ? 0.4900 0.6272 0.5512 0.1162  0.0010  0.0307  130 GLU A O   
1042 C CB  . GLU A 130 ? 0.5362 0.6790 0.5510 0.1562  0.0046  0.0565  130 GLU A CB  
1043 C CG  . GLU A 130 ? 0.5770 0.7213 0.6034 0.1649  0.0070  0.0633  130 GLU A CG  
1044 C CD  . GLU A 130 ? 0.6252 0.7832 0.6393 0.1755  -0.0040 0.0562  130 GLU A CD  
1045 O OE1 . GLU A 130 ? 0.6595 0.8251 0.6509 0.1831  -0.0120 0.0511  130 GLU A OE1 
1046 O OE2 . GLU A 130 ? 0.6272 0.7884 0.6551 0.1769  -0.0050 0.0552  130 GLU A OE2 
1047 N N   . GLY A 131 ? 0.4898 0.6183 0.5407 0.1189  0.0104  0.0464  131 GLY A N   
1048 C CA  . GLY A 131 ? 0.4779 0.5987 0.5514 0.1064  0.0149  0.0463  131 GLY A CA  
1049 C C   . GLY A 131 ? 0.4605 0.5834 0.5338 0.0914  0.0089  0.0320  131 GLY A C   
1050 O O   . GLY A 131 ? 0.4553 0.5754 0.5435 0.0806  0.0080  0.0248  131 GLY A O   
1051 N N   . VAL A 132 ? 0.4550 0.5819 0.5104 0.0918  0.0052  0.0284  132 VAL A N   
1052 C CA  . VAL A 132 ? 0.4318 0.5627 0.4825 0.0809  -0.0014 0.0144  132 VAL A CA  
1053 C C   . VAL A 132 ? 0.4249 0.5537 0.4656 0.0784  0.0002  0.0168  132 VAL A C   
1054 O O   . VAL A 132 ? 0.4326 0.5602 0.4608 0.0882  0.0031  0.0250  132 VAL A O   
1055 C CB  . VAL A 132 ? 0.4365 0.5763 0.4776 0.0850  -0.0094 0.0044  132 VAL A CB  
1056 C CG1 . VAL A 132 ? 0.4198 0.5632 0.4467 0.0824  -0.0149 -0.0039 132 VAL A CG1 
1057 C CG2 . VAL A 132 ? 0.4140 0.5572 0.4689 0.0788  -0.0120 -0.0044 132 VAL A CG2 
1058 N N   . ALA A 133 ? 0.4137 0.5421 0.4595 0.0664  -0.0011 0.0103  133 ALA A N   
1059 C CA  . ALA A 133 ? 0.4100 0.5363 0.4484 0.0637  0.0008  0.0129  133 ALA A CA  
1060 C C   . ALA A 133 ? 0.3965 0.5253 0.4343 0.0527  -0.0032 0.0017  133 ALA A C   
1061 O O   . ALA A 133 ? 0.3873 0.5189 0.4321 0.0467  -0.0063 -0.0067 133 ALA A O   
1062 C CB  . ALA A 133 ? 0.4100 0.5321 0.4610 0.0624  0.0073  0.0241  133 ALA A CB  
1063 N N   . GLU A 134 ? 0.4011 0.5285 0.4302 0.0510  -0.0022 0.0025  134 GLU A N   
1064 C CA  . GLU A 134 ? 0.4099 0.5391 0.4385 0.0415  -0.0045 -0.0060 134 GLU A CA  
1065 C C   . GLU A 134 ? 0.4062 0.5330 0.4319 0.0382  -0.0013 -0.0014 134 GLU A C   
1066 O O   . GLU A 134 ? 0.4196 0.5431 0.4380 0.0443  0.0021  0.0059  134 GLU A O   
1067 C CB  . GLU A 134 ? 0.4193 0.5512 0.4402 0.0421  -0.0089 -0.0158 134 GLU A CB  
1068 C CG  . GLU A 134 ? 0.4452 0.5742 0.4515 0.0491  -0.0096 -0.0155 134 GLU A CG  
1069 C CD  . GLU A 134 ? 0.4873 0.6203 0.4904 0.0503  -0.0161 -0.0265 134 GLU A CD  
1070 O OE1 . GLU A 134 ? 0.5084 0.6393 0.5065 0.0479  -0.0176 -0.0326 134 GLU A OE1 
1071 O OE2 . GLU A 134 ? 0.5034 0.6417 0.5110 0.0535  -0.0197 -0.0291 134 GLU A OE2 
1072 N N   . SER A 135 ? 0.3940 0.5228 0.4243 0.0296  -0.0021 -0.0056 135 SER A N   
1073 C CA  . SER A 135 ? 0.3857 0.5137 0.4138 0.0268  0.0005  -0.0012 135 SER A CA  
1074 C C   . SER A 135 ? 0.3907 0.5159 0.4074 0.0279  0.0013  -0.0045 135 SER A C   
1075 O O   . SER A 135 ? 0.4005 0.5258 0.4138 0.0288  -0.0013 -0.0120 135 SER A O   
1076 C CB  . SER A 135 ? 0.3771 0.5091 0.4116 0.0190  -0.0012 -0.0049 135 SER A CB  
1077 O OG  . SER A 135 ? 0.3800 0.5131 0.4087 0.0154  -0.0012 -0.0116 135 SER A OG  
1078 N N   . LEU A 136 ? 0.3933 0.5160 0.4060 0.0279  0.0048  0.0007  136 LEU A N   
1079 C CA  . LEU A 136 ? 0.4047 0.5232 0.4092 0.0275  0.0064  -0.0029 136 LEU A CA  
1080 C C   . LEU A 136 ? 0.4011 0.5226 0.4100 0.0199  0.0054  -0.0099 136 LEU A C   
1081 O O   . LEU A 136 ? 0.4041 0.5310 0.4196 0.0161  0.0034  -0.0124 136 LEU A O   
1082 C CB  . LEU A 136 ? 0.4142 0.5295 0.4155 0.0296  0.0114  0.0060  136 LEU A CB  
1083 C CG  . LEU A 136 ? 0.4551 0.5656 0.4491 0.0390  0.0148  0.0131  136 LEU A CG  
1084 C CD1 . LEU A 136 ? 0.5062 0.6092 0.4873 0.0439  0.0144  0.0061  136 LEU A CD1 
1085 C CD2 . LEU A 136 ? 0.4884 0.6015 0.4863 0.0439  0.0140  0.0176  136 LEU A CD2 
1086 N N   . PHE A 137 ? 0.3998 0.5173 0.4058 0.0181  0.0077  -0.0131 137 PHE A N   
1087 C CA  . PHE A 137 ? 0.3911 0.5118 0.4023 0.0117  0.0096  -0.0161 137 PHE A CA  
1088 C C   . PHE A 137 ? 0.3859 0.5081 0.3956 0.0108  0.0132  -0.0078 137 PHE A C   
1089 O O   . PHE A 137 ? 0.3941 0.5116 0.3998 0.0132  0.0168  -0.0019 137 PHE A O   
1090 C CB  . PHE A 137 ? 0.3896 0.5054 0.4026 0.0095  0.0117  -0.0217 137 PHE A CB  
1091 C CG  . PHE A 137 ? 0.4014 0.5195 0.4199 0.0088  0.0068  -0.0316 137 PHE A CG  
1092 C CD1 . PHE A 137 ? 0.3974 0.5220 0.4257 0.0040  0.0069  -0.0361 137 PHE A CD1 
1093 C CD2 . PHE A 137 ? 0.4103 0.5249 0.4236 0.0140  0.0020  -0.0362 137 PHE A CD2 
1094 C CE1 . PHE A 137 ? 0.3844 0.5130 0.4204 0.0035  0.0021  -0.0447 137 PHE A CE1 
1095 C CE2 . PHE A 137 ? 0.3786 0.4974 0.3974 0.0141  -0.0040 -0.0455 137 PHE A CE2 
1096 C CZ  . PHE A 137 ? 0.3879 0.5140 0.4195 0.0084  -0.0041 -0.0496 137 PHE A CZ  
1097 N N   . LEU A 138 ? 0.3799 0.5091 0.3926 0.0080  0.0118  -0.0076 138 LEU A N   
1098 C CA  . LEU A 138 ? 0.3803 0.5130 0.3911 0.0083  0.0129  -0.0002 138 LEU A CA  
1099 C C   . LEU A 138 ? 0.3907 0.5245 0.3982 0.0068  0.0179  0.0017  138 LEU A C   
1100 O O   . LEU A 138 ? 0.3926 0.5281 0.4012 0.0044  0.0195  -0.0033 138 LEU A O   
1101 C CB  . LEU A 138 ? 0.3636 0.5031 0.3788 0.0074  0.0074  -0.0010 138 LEU A CB  
1102 C CG  . LEU A 138 ? 0.3443 0.4817 0.3649 0.0094  0.0045  -0.0013 138 LEU A CG  
1103 C CD1 . LEU A 138 ? 0.3508 0.4935 0.3794 0.0075  -0.0006 -0.0031 138 LEU A CD1 
1104 C CD2 . LEU A 138 ? 0.3047 0.4384 0.3244 0.0137  0.0072  0.0072  138 LEU A CD2 
1105 N N   . PRO A 139 ? 0.4073 0.5404 0.4114 0.0092  0.0212  0.0103  139 PRO A N   
1106 C CA  . PRO A 139 ? 0.4148 0.5486 0.4150 0.0097  0.0273  0.0154  139 PRO A CA  
1107 C C   . PRO A 139 ? 0.4170 0.5606 0.4132 0.0096  0.0250  0.0147  139 PRO A C   
1108 O O   . PRO A 139 ? 0.4138 0.5640 0.4107 0.0094  0.0176  0.0119  139 PRO A O   
1109 C CB  . PRO A 139 ? 0.4212 0.5541 0.4193 0.0137  0.0292  0.0254  139 PRO A CB  
1110 C CG  . PRO A 139 ? 0.4131 0.5510 0.4153 0.0144  0.0220  0.0256  139 PRO A CG  
1111 C CD  . PRO A 139 ? 0.4006 0.5339 0.4056 0.0125  0.0196  0.0173  139 PRO A CD  
1112 N N   . ARG A 140 ? 0.4288 0.5730 0.4209 0.0105  0.0317  0.0176  140 ARG A N   
1113 C CA  . ARG A 140 ? 0.4343 0.5875 0.4186 0.0126  0.0308  0.0173  140 ARG A CA  
1114 C C   . ARG A 140 ? 0.4363 0.5910 0.4132 0.0174  0.0380  0.0281  140 ARG A C   
1115 O O   . ARG A 140 ? 0.4360 0.5829 0.4164 0.0177  0.0466  0.0342  140 ARG A O   
1116 C CB  . ARG A 140 ? 0.4414 0.5947 0.4275 0.0103  0.0340  0.0101  140 ARG A CB  
1117 C CG  . ARG A 140 ? 0.4632 0.6236 0.4451 0.0106  0.0273  0.0019  140 ARG A CG  
1118 C CD  . ARG A 140 ? 0.5205 0.6807 0.5053 0.0094  0.0330  -0.0034 140 ARG A CD  
1119 N NE  . ARG A 140 ? 0.5791 0.7454 0.5578 0.0112  0.0284  -0.0111 140 ARG A NE  
1120 C CZ  . ARG A 140 ? 0.6171 0.7894 0.5822 0.0166  0.0307  -0.0102 140 ARG A CZ  
1121 N NH1 . ARG A 140 ? 0.6283 0.8024 0.5848 0.0211  0.0383  -0.0002 140 ARG A NH1 
1122 N NH2 . ARG A 140 ? 0.6580 0.8342 0.6173 0.0184  0.0257  -0.0194 140 ARG A NH2 
1123 N N   . THR A 141 ? 0.4483 0.6131 0.4151 0.0218  0.0338  0.0301  141 THR A N   
1124 C CA  . THR A 141 ? 0.4652 0.6347 0.4215 0.0287  0.0395  0.0406  141 THR A CA  
1125 C C   . THR A 141 ? 0.4685 0.6323 0.4237 0.0304  0.0537  0.0468  141 THR A C   
1126 O O   . THR A 141 ? 0.4756 0.6356 0.4305 0.0341  0.0623  0.0582  141 THR A O   
1127 C CB  . THR A 141 ? 0.4769 0.6595 0.4207 0.0332  0.0302  0.0370  141 THR A CB  
1128 O OG1 . THR A 141 ? 0.4803 0.6692 0.4264 0.0346  0.0212  0.0402  141 THR A OG1 
1129 C CG2 . THR A 141 ? 0.5144 0.7029 0.4417 0.0418  0.0377  0.0441  141 THR A CG2 
1130 N N   . ASP A 142 ? 0.4642 0.6276 0.4211 0.0280  0.0568  0.0399  142 ASP A N   
1131 C CA  . ASP A 142 ? 0.4709 0.6296 0.4322 0.0286  0.0711  0.0456  142 ASP A CA  
1132 C C   . ASP A 142 ? 0.4551 0.6017 0.4354 0.0214  0.0764  0.0437  142 ASP A C   
1133 O O   . ASP A 142 ? 0.4678 0.6105 0.4579 0.0197  0.0869  0.0457  142 ASP A O   
1134 C CB  . ASP A 142 ? 0.4758 0.6403 0.4324 0.0298  0.0731  0.0394  142 ASP A CB  
1135 C CG  . ASP A 142 ? 0.4787 0.6428 0.4438 0.0232  0.0641  0.0253  142 ASP A CG  
1136 O OD1 . ASP A 142 ? 0.4877 0.6457 0.4645 0.0171  0.0588  0.0208  142 ASP A OD1 
1137 O OD2 . ASP A 142 ? 0.5042 0.6741 0.4632 0.0252  0.0629  0.0188  142 ASP A OD2 
1138 N N   . TYR A 143 ? 0.4343 0.5755 0.4202 0.0176  0.0689  0.0395  143 TYR A N   
1139 C CA  . TYR A 143 ? 0.4264 0.5558 0.4270 0.0122  0.0716  0.0365  143 TYR A CA  
1140 C C   . TYR A 143 ? 0.4181 0.5463 0.4304 0.0059  0.0679  0.0241  143 TYR A C   
1141 O O   . TYR A 143 ? 0.4151 0.5348 0.4382 0.0019  0.0671  0.0191  143 TYR A O   
1142 C CB  . TYR A 143 ? 0.4411 0.5615 0.4482 0.0136  0.0847  0.0467  143 TYR A CB  
1143 C CG  . TYR A 143 ? 0.4474 0.5705 0.4423 0.0213  0.0877  0.0597  143 TYR A CG  
1144 C CD1 . TYR A 143 ? 0.4665 0.5943 0.4544 0.0276  0.0975  0.0710  143 TYR A CD1 
1145 C CD2 . TYR A 143 ? 0.4429 0.5656 0.4330 0.0235  0.0807  0.0614  143 TYR A CD2 
1146 C CE1 . TYR A 143 ? 0.4862 0.6183 0.4617 0.0361  0.0991  0.0834  143 TYR A CE1 
1147 C CE2 . TYR A 143 ? 0.4525 0.5797 0.4331 0.0310  0.0826  0.0736  143 TYR A CE2 
1148 C CZ  . TYR A 143 ? 0.4947 0.6271 0.4676 0.0374  0.0911  0.0842  143 TYR A CZ  
1149 O OH  . TYR A 143 ? 0.5280 0.6666 0.4907 0.0461  0.0920  0.0967  143 TYR A OH  
1150 N N   . SER A 144 ? 0.4106 0.5476 0.4199 0.0058  0.0647  0.0186  144 SER A N   
1151 C CA  . SER A 144 ? 0.3915 0.5295 0.4097 0.0012  0.0582  0.0068  144 SER A CA  
1152 C C   . SER A 144 ? 0.3729 0.5105 0.3869 0.0009  0.0464  0.0015  144 SER A C   
1153 O O   . SER A 144 ? 0.3704 0.5056 0.3783 0.0033  0.0443  0.0068  144 SER A O   
1154 C CB  . SER A 144 ? 0.3905 0.5370 0.4075 0.0022  0.0600  0.0032  144 SER A CB  
1155 O OG  . SER A 144 ? 0.4128 0.5659 0.4140 0.0066  0.0543  0.0031  144 SER A OG  
1156 N N   . PHE A 145 ? 0.3523 0.4924 0.3709 -0.0012 0.0397  -0.0077 145 PHE A N   
1157 C CA  . PHE A 145 ? 0.3302 0.4687 0.3475 -0.0009 0.0306  -0.0114 145 PHE A CA  
1158 C C   . PHE A 145 ? 0.3245 0.4689 0.3415 -0.0008 0.0241  -0.0180 145 PHE A C   
1159 O O   . PHE A 145 ? 0.3190 0.4680 0.3386 -0.0014 0.0261  -0.0221 145 PHE A O   
1160 C CB  . PHE A 145 ? 0.3265 0.4582 0.3516 -0.0026 0.0290  -0.0160 145 PHE A CB  
1161 C CG  . PHE A 145 ? 0.3092 0.4322 0.3332 -0.0018 0.0330  -0.0111 145 PHE A CG  
1162 C CD1 . PHE A 145 ? 0.3269 0.4448 0.3589 -0.0043 0.0406  -0.0100 145 PHE A CD1 
1163 C CD2 . PHE A 145 ? 0.2980 0.4170 0.3153 0.0015  0.0298  -0.0078 145 PHE A CD2 
1164 C CE1 . PHE A 145 ? 0.2943 0.4021 0.3263 -0.0033 0.0447  -0.0063 145 PHE A CE1 
1165 C CE2 . PHE A 145 ? 0.2881 0.3977 0.3038 0.0033  0.0342  -0.0037 145 PHE A CE2 
1166 C CZ  . PHE A 145 ? 0.2677 0.3712 0.2905 0.0007  0.0414  -0.0036 145 PHE A CZ  
1167 N N   . HIS A 146 ? 0.3122 0.4560 0.3275 0.0004  0.0173  -0.0182 146 HIS A N   
1168 C CA  . HIS A 146 ? 0.3033 0.4499 0.3219 0.0005  0.0115  -0.0244 146 HIS A CA  
1169 C C   . HIS A 146 ? 0.3058 0.4486 0.3278 0.0019  0.0069  -0.0244 146 HIS A C   
1170 O O   . HIS A 146 ? 0.2987 0.4369 0.3186 0.0035  0.0078  -0.0197 146 HIS A O   
1171 C CB  . HIS A 146 ? 0.3000 0.4518 0.3139 0.0012  0.0084  -0.0257 146 HIS A CB  
1172 C CG  . HIS A 146 ? 0.2819 0.4345 0.2940 0.0021  0.0040  -0.0208 146 HIS A CG  
1173 N ND1 . HIS A 146 ? 0.3052 0.4566 0.3140 0.0033  0.0063  -0.0124 146 HIS A ND1 
1174 C CD2 . HIS A 146 ? 0.2364 0.3913 0.2520 0.0020  -0.0026 -0.0231 146 HIS A CD2 
1175 C CE1 . HIS A 146 ? 0.2240 0.3785 0.2348 0.0040  0.0013  -0.0093 146 HIS A CE1 
1176 N NE2 . HIS A 146 ? 0.2163 0.3729 0.2322 0.0027  -0.0044 -0.0160 146 HIS A NE2 
1177 N N   . LYS A 147 ? 0.3009 0.4452 0.3278 0.0026  0.0030  -0.0293 147 LYS A N   
1178 C CA  . LYS A 147 ? 0.3041 0.4453 0.3337 0.0055  -0.0002 -0.0283 147 LYS A CA  
1179 C C   . LYS A 147 ? 0.3053 0.4481 0.3408 0.0063  -0.0036 -0.0313 147 LYS A C   
1180 O O   . LYS A 147 ? 0.3124 0.4583 0.3496 0.0045  -0.0037 -0.0366 147 LYS A O   
1181 C CB  . LYS A 147 ? 0.3063 0.4463 0.3372 0.0065  -0.0002 -0.0324 147 LYS A CB  
1182 C CG  . LYS A 147 ? 0.3296 0.4657 0.3575 0.0118  -0.0027 -0.0300 147 LYS A CG  
1183 C CD  . LYS A 147 ? 0.3166 0.4536 0.3461 0.0135  -0.0055 -0.0369 147 LYS A CD  
1184 C CE  . LYS A 147 ? 0.3425 0.4749 0.3637 0.0202  -0.0076 -0.0347 147 LYS A CE  
1185 N NZ  . LYS A 147 ? 0.3767 0.5126 0.3991 0.0244  -0.0132 -0.0413 147 LYS A NZ  
1186 N N   . PHE A 148 ? 0.3084 0.4484 0.3471 0.0097  -0.0055 -0.0273 148 PHE A N   
1187 C CA  . PHE A 148 ? 0.3074 0.4470 0.3544 0.0111  -0.0077 -0.0286 148 PHE A CA  
1188 C C   . PHE A 148 ? 0.3133 0.4511 0.3611 0.0169  -0.0080 -0.0266 148 PHE A C   
1189 O O   . PHE A 148 ? 0.3155 0.4506 0.3585 0.0209  -0.0068 -0.0202 148 PHE A O   
1190 C CB  . PHE A 148 ? 0.3029 0.4406 0.3563 0.0107  -0.0086 -0.0226 148 PHE A CB  
1191 C CG  . PHE A 148 ? 0.3027 0.4436 0.3554 0.0062  -0.0102 -0.0239 148 PHE A CG  
1192 C CD1 . PHE A 148 ? 0.3199 0.4624 0.3764 0.0034  -0.0135 -0.0315 148 PHE A CD1 
1193 C CD2 . PHE A 148 ? 0.2618 0.4040 0.3090 0.0058  -0.0087 -0.0179 148 PHE A CD2 
1194 C CE1 . PHE A 148 ? 0.3105 0.4571 0.3637 0.0006  -0.0163 -0.0337 148 PHE A CE1 
1195 C CE2 . PHE A 148 ? 0.2799 0.4265 0.3257 0.0030  -0.0109 -0.0185 148 PHE A CE2 
1196 C CZ  . PHE A 148 ? 0.3063 0.4557 0.3544 0.0006  -0.0153 -0.0267 148 PHE A CZ  
1197 N N   . HIS A 149 ? 0.3195 0.4587 0.3726 0.0187  -0.0093 -0.0314 149 HIS A N   
1198 C CA  . HIS A 149 ? 0.3300 0.4678 0.3858 0.0259  -0.0098 -0.0276 149 HIS A CA  
1199 C C   . HIS A 149 ? 0.3257 0.4600 0.3929 0.0268  -0.0091 -0.0252 149 HIS A C   
1200 O O   . HIS A 149 ? 0.3123 0.4465 0.3855 0.0222  -0.0098 -0.0312 149 HIS A O   
1201 C CB  . HIS A 149 ? 0.3333 0.4759 0.3881 0.0291  -0.0122 -0.0334 149 HIS A CB  
1202 C CG  . HIS A 149 ? 0.3551 0.4997 0.4014 0.0295  -0.0138 -0.0355 149 HIS A CG  
1203 N ND1 . HIS A 149 ? 0.3770 0.5232 0.4178 0.0369  -0.0171 -0.0354 149 HIS A ND1 
1204 C CD2 . HIS A 149 ? 0.3622 0.5067 0.4046 0.0240  -0.0127 -0.0382 149 HIS A CD2 
1205 C CE1 . HIS A 149 ? 0.3574 0.5039 0.3922 0.0351  -0.0187 -0.0395 149 HIS A CE1 
1206 N NE2 . HIS A 149 ? 0.3503 0.4953 0.3872 0.0271  -0.0154 -0.0406 149 HIS A NE2 
1207 N N   . TYR A 150 ? 0.3377 0.4688 0.4078 0.0336  -0.0072 -0.0166 150 TYR A N   
1208 C CA  . TYR A 150 ? 0.3368 0.4630 0.4211 0.0353  -0.0050 -0.0120 150 TYR A CA  
1209 C C   . TYR A 150 ? 0.3469 0.4726 0.4329 0.0445  -0.0037 -0.0081 150 TYR A C   
1210 O O   . TYR A 150 ? 0.3504 0.4788 0.4253 0.0520  -0.0039 -0.0041 150 TYR A O   
1211 C CB  . TYR A 150 ? 0.3369 0.4595 0.4259 0.0363  -0.0015 -0.0009 150 TYR A CB  
1212 C CG  . TYR A 150 ? 0.3412 0.4656 0.4288 0.0285  -0.0032 -0.0033 150 TYR A CG  
1213 C CD1 . TYR A 150 ? 0.3329 0.4575 0.4295 0.0207  -0.0064 -0.0108 150 TYR A CD1 
1214 C CD2 . TYR A 150 ? 0.3270 0.4531 0.4031 0.0298  -0.0019 0.0014  150 TYR A CD2 
1215 C CE1 . TYR A 150 ? 0.3323 0.4601 0.4264 0.0150  -0.0087 -0.0126 150 TYR A CE1 
1216 C CE2 . TYR A 150 ? 0.3135 0.4418 0.3887 0.0236  -0.0031 0.0003  150 TYR A CE2 
1217 C CZ  . TYR A 150 ? 0.3237 0.4537 0.4078 0.0164  -0.0068 -0.0064 150 TYR A CZ  
1218 O OH  . TYR A 150 ? 0.3278 0.4615 0.4103 0.0115  -0.0089 -0.0073 150 TYR A OH  
1219 N N   . LEU A 151 ? 0.3612 0.4831 0.4609 0.0446  -0.0025 -0.0095 151 LEU A N   
1220 C CA  . LEU A 151 ? 0.3703 0.4906 0.4748 0.0542  0.0000  -0.0037 151 LEU A CA  
1221 C C   . LEU A 151 ? 0.3829 0.4940 0.5066 0.0546  0.0050  0.0032  151 LEU A C   
1222 O O   . LEU A 151 ? 0.3847 0.4916 0.5204 0.0474  0.0039  -0.0048 151 LEU A O   
1223 C CB  . LEU A 151 ? 0.3672 0.4923 0.4718 0.0548  -0.0031 -0.0136 151 LEU A CB  
1224 C CG  . LEU A 151 ? 0.3815 0.5060 0.4927 0.0648  -0.0011 -0.0091 151 LEU A CG  
1225 C CD1 . LEU A 151 ? 0.3812 0.5110 0.4807 0.0766  -0.0016 0.0000  151 LEU A CD1 
1226 C CD2 . LEU A 151 ? 0.3800 0.5098 0.4945 0.0635  -0.0037 -0.0201 151 LEU A CD2 
1227 N N   . THR A 152 ? 0.3987 0.5064 0.5257 0.0632  0.0109  0.0177  152 THR A N   
1228 C CA  . THR A 152 ? 0.4135 0.5118 0.5632 0.0645  0.0173  0.0262  152 THR A CA  
1229 C C   . THR A 152 ? 0.4268 0.5223 0.5830 0.0719  0.0193  0.0265  152 THR A C   
1230 O O   . THR A 152 ? 0.4381 0.5396 0.5807 0.0820  0.0186  0.0294  152 THR A O   
1231 C CB  . THR A 152 ? 0.4219 0.5173 0.5756 0.0714  0.0252  0.0441  152 THR A CB  
1232 O OG1 . THR A 152 ? 0.4439 0.5440 0.5784 0.0850  0.0272  0.0526  152 THR A OG1 
1233 C CG2 . THR A 152 ? 0.4247 0.5225 0.5761 0.0639  0.0241  0.0446  152 THR A CG2 
1234 N N   . PHE A 153 ? 0.4268 0.5133 0.6040 0.0671  0.0211  0.0223  153 PHE A N   
1235 C CA  . PHE A 153 ? 0.4194 0.5029 0.6028 0.0730  0.0226  0.0198  153 PHE A CA  
1236 C C   . PHE A 153 ? 0.4294 0.4993 0.6396 0.0696  0.0271  0.0193  153 PHE A C   
1237 O O   . PHE A 153 ? 0.4333 0.4974 0.6574 0.0597  0.0262  0.0155  153 PHE A O   
1238 C CB  . PHE A 153 ? 0.4116 0.5027 0.5827 0.0688  0.0153  0.0035  153 PHE A CB  
1239 C CG  . PHE A 153 ? 0.3820 0.4685 0.5605 0.0569  0.0118  -0.0113 153 PHE A CG  
1240 C CD1 . PHE A 153 ? 0.3494 0.4363 0.5264 0.0472  0.0084  -0.0151 153 PHE A CD1 
1241 C CD2 . PHE A 153 ? 0.3747 0.4568 0.5604 0.0567  0.0117  -0.0217 153 PHE A CD2 
1242 C CE1 . PHE A 153 ? 0.3261 0.4098 0.5074 0.0378  0.0041  -0.0294 153 PHE A CE1 
1243 C CE2 . PHE A 153 ? 0.3465 0.4242 0.5357 0.0474  0.0081  -0.0365 153 PHE A CE2 
1244 C CZ  . PHE A 153 ? 0.3312 0.4100 0.5174 0.0382  0.0038  -0.0404 153 PHE A CZ  
1245 N N   . VAL A 154 ? 0.4341 0.4992 0.6524 0.0778  0.0313  0.0221  154 VAL A N   
1246 C CA  . VAL A 154 ? 0.4443 0.4945 0.6893 0.0756  0.0362  0.0207  154 VAL A CA  
1247 C C   . VAL A 154 ? 0.4477 0.4960 0.6922 0.0718  0.0315  0.0022  154 VAL A C   
1248 O O   . VAL A 154 ? 0.4428 0.4949 0.6812 0.0806  0.0326  0.0021  154 VAL A O   
1249 C CB  . VAL A 154 ? 0.4617 0.5054 0.7193 0.0894  0.0471  0.0403  154 VAL A CB  
1250 C CG1 . VAL A 154 ? 0.4517 0.4787 0.7377 0.0884  0.0528  0.0381  154 VAL A CG1 
1251 C CG2 . VAL A 154 ? 0.4685 0.5122 0.7293 0.0925  0.0535  0.0585  154 VAL A CG2 
1252 N N   . PRO A 155 ? 0.4475 0.4908 0.6978 0.0595  0.0262  -0.0136 155 PRO A N   
1253 C CA  . PRO A 155 ? 0.4483 0.4904 0.6940 0.0565  0.0221  -0.0319 155 PRO A CA  
1254 C C   . PRO A 155 ? 0.4650 0.4962 0.7259 0.0644  0.0285  -0.0307 155 PRO A C   
1255 O O   . PRO A 155 ? 0.4743 0.4931 0.7576 0.0674  0.0353  -0.0205 155 PRO A O   
1256 C CB  . PRO A 155 ? 0.4427 0.4773 0.6976 0.0442  0.0166  -0.0457 155 PRO A CB  
1257 C CG  . PRO A 155 ? 0.4510 0.4883 0.7107 0.0396  0.0160  -0.0356 155 PRO A CG  
1258 C CD  . PRO A 155 ? 0.4468 0.4838 0.7125 0.0495  0.0247  -0.0145 155 PRO A CD  
1259 N N   . SER A 156 ? 0.4738 0.5097 0.7243 0.0682  0.0273  -0.0404 156 SER A N   
1260 C CA  . SER A 156 ? 0.4934 0.5223 0.7548 0.0780  0.0336  -0.0385 156 SER A CA  
1261 C C   . SER A 156 ? 0.5002 0.5343 0.7502 0.0782  0.0310  -0.0541 156 SER A C   
1262 O O   . SER A 156 ? 0.5023 0.5512 0.7331 0.0754  0.0259  -0.0591 156 SER A O   
1263 C CB  . SER A 156 ? 0.4857 0.5241 0.7429 0.0906  0.0377  -0.0202 156 SER A CB  
1264 O OG  . SER A 156 ? 0.5172 0.5546 0.7794 0.1007  0.0418  -0.0200 156 SER A OG  
1265 N N   . ALA A 157 ? 0.5226 0.5440 0.7856 0.0819  0.0354  -0.0613 157 ALA A N   
1266 C CA  . ALA A 157 ? 0.5298 0.5543 0.7840 0.0841  0.0352  -0.0755 157 ALA A CA  
1267 C C   . ALA A 157 ? 0.5262 0.5680 0.7720 0.0943  0.0371  -0.0676 157 ALA A C   
1268 O O   . ALA A 157 ? 0.5285 0.5804 0.7633 0.0948  0.0360  -0.0771 157 ALA A O   
1269 C CB  . ALA A 157 ? 0.5460 0.5500 0.8177 0.0863  0.0402  -0.0854 157 ALA A CB  
1270 N N   . GLU A 158 ? 0.5257 0.5717 0.7775 0.1031  0.0399  -0.0503 158 GLU A N   
1271 C CA  . GLU A 158 ? 0.5266 0.5896 0.7736 0.1140  0.0402  -0.0431 158 GLU A CA  
1272 C C   . GLU A 158 ? 0.4993 0.5839 0.7280 0.1110  0.0326  -0.0417 158 GLU A C   
1273 O O   . GLU A 158 ? 0.4958 0.5962 0.7220 0.1195  0.0309  -0.0356 158 GLU A O   
1274 C CB  . GLU A 158 ? 0.5461 0.6053 0.8063 0.1276  0.0463  -0.0255 158 GLU A CB  
1275 C CG  . GLU A 158 ? 0.6106 0.6450 0.8929 0.1294  0.0549  -0.0238 158 GLU A CG  
1276 C CD  . GLU A 158 ? 0.6855 0.7147 0.9828 0.1440  0.0631  -0.0174 158 GLU A CD  
1277 O OE1 . GLU A 158 ? 0.6831 0.7292 0.9756 0.1556  0.0625  -0.0097 158 GLU A OE1 
1278 O OE2 . GLU A 158 ? 0.7125 0.7199 1.0283 0.1440  0.0701  -0.0206 158 GLU A OE2 
1279 N N   . ASP A 159 ? 0.4768 0.5620 0.6942 0.0992  0.0278  -0.0483 159 ASP A N   
1280 C CA  . ASP A 159 ? 0.4574 0.5589 0.6592 0.0958  0.0213  -0.0454 159 ASP A CA  
1281 C C   . ASP A 159 ? 0.4456 0.5525 0.6352 0.0848  0.0174  -0.0578 159 ASP A C   
1282 O O   . ASP A 159 ? 0.4608 0.5569 0.6497 0.0771  0.0176  -0.0660 159 ASP A O   
1283 C CB  . ASP A 159 ? 0.4472 0.5448 0.6466 0.0950  0.0203  -0.0336 159 ASP A CB  
1284 C CG  . ASP A 159 ? 0.4555 0.5534 0.6612 0.1081  0.0238  -0.0178 159 ASP A CG  
1285 O OD1 . ASP A 159 ? 0.4293 0.5389 0.6345 0.1174  0.0228  -0.0157 159 ASP A OD1 
1286 O OD2 . ASP A 159 ? 0.4581 0.5453 0.6703 0.1098  0.0279  -0.0070 159 ASP A OD2 
1287 N N   . PHE A 160 ? 0.4292 0.5530 0.6101 0.0846  0.0138  -0.0589 160 PHE A N   
1288 C CA  . PHE A 160 ? 0.4152 0.5446 0.5840 0.0747  0.0110  -0.0674 160 PHE A CA  
1289 C C   . PHE A 160 ? 0.4041 0.5431 0.5626 0.0714  0.0054  -0.0615 160 PHE A C   
1290 O O   . PHE A 160 ? 0.3999 0.5461 0.5590 0.0781  0.0028  -0.0529 160 PHE A O   
1291 C CB  . PHE A 160 ? 0.4068 0.5458 0.5765 0.0755  0.0136  -0.0759 160 PHE A CB  
1292 C CG  . PHE A 160 ? 0.3941 0.5497 0.5704 0.0823  0.0121  -0.0713 160 PHE A CG  
1293 C CD1 . PHE A 160 ? 0.3542 0.5245 0.5257 0.0787  0.0071  -0.0702 160 PHE A CD1 
1294 C CD2 . PHE A 160 ? 0.4252 0.5823 0.6145 0.0925  0.0153  -0.0686 160 PHE A CD2 
1295 C CE1 . PHE A 160 ? 0.3390 0.5261 0.5194 0.0845  0.0039  -0.0677 160 PHE A CE1 
1296 C CE2 . PHE A 160 ? 0.4029 0.5783 0.6003 0.0994  0.0125  -0.0648 160 PHE A CE2 
1297 C CZ  . PHE A 160 ? 0.3583 0.5491 0.5516 0.0949  0.0060  -0.0648 160 PHE A CZ  
1298 N N   . TYR A 161 ? 0.3974 0.5364 0.5456 0.0621  0.0037  -0.0663 161 TYR A N   
1299 C CA  . TYR A 161 ? 0.3968 0.5432 0.5351 0.0585  -0.0008 -0.0622 161 TYR A CA  
1300 C C   . TYR A 161 ? 0.3975 0.5533 0.5292 0.0520  -0.0013 -0.0691 161 TYR A C   
1301 O O   . TYR A 161 ? 0.4074 0.5611 0.5378 0.0487  0.0021  -0.0765 161 TYR A O   
1302 C CB  . TYR A 161 ? 0.3936 0.5298 0.5273 0.0543  -0.0016 -0.0575 161 TYR A CB  
1303 C CG  . TYR A 161 ? 0.4166 0.5434 0.5593 0.0607  0.0005  -0.0481 161 TYR A CG  
1304 C CD1 . TYR A 161 ? 0.4194 0.5490 0.5585 0.0671  -0.0005 -0.0366 161 TYR A CD1 
1305 C CD2 . TYR A 161 ? 0.4227 0.5370 0.5775 0.0610  0.0043  -0.0506 161 TYR A CD2 
1306 C CE1 . TYR A 161 ? 0.4137 0.5349 0.5613 0.0744  0.0034  -0.0258 161 TYR A CE1 
1307 C CE2 . TYR A 161 ? 0.4325 0.5372 0.5988 0.0668  0.0078  -0.0407 161 TYR A CE2 
1308 C CZ  . TYR A 161 ? 0.4399 0.5486 0.6026 0.0737  0.0081  -0.0272 161 TYR A CZ  
1309 O OH  . TYR A 161 ? 0.4582 0.5575 0.6324 0.0807  0.0134  -0.0152 161 TYR A OH  
1310 N N   . ASP A 162 ? 0.4004 0.5660 0.5282 0.0509  -0.0051 -0.0667 162 ASP A N   
1311 C CA  . ASP A 162 ? 0.4002 0.5720 0.5229 0.0437  -0.0045 -0.0713 162 ASP A CA  
1312 C C   . ASP A 162 ? 0.3917 0.5633 0.5047 0.0396  -0.0084 -0.0675 162 ASP A C   
1313 O O   . ASP A 162 ? 0.3880 0.5616 0.4994 0.0439  -0.0128 -0.0627 162 ASP A O   
1314 C CB  . ASP A 162 ? 0.4048 0.5905 0.5377 0.0451  -0.0041 -0.0746 162 ASP A CB  
1315 C CG  . ASP A 162 ? 0.4461 0.6344 0.5907 0.0520  -0.0011 -0.0763 162 ASP A CG  
1316 O OD1 . ASP A 162 ? 0.4921 0.6851 0.6437 0.0592  -0.0048 -0.0724 162 ASP A OD1 
1317 O OD2 . ASP A 162 ? 0.4896 0.6754 0.6355 0.0513  0.0052  -0.0812 162 ASP A OD2 
1318 N N   . CYS A 163 ? 0.3835 0.5524 0.4886 0.0325  -0.0064 -0.0694 163 CYS A N   
1319 C CA  . CYS A 163 ? 0.3805 0.5508 0.4781 0.0286  -0.0088 -0.0668 163 CYS A CA  
1320 C C   . CYS A 163 ? 0.3775 0.5586 0.4822 0.0266  -0.0086 -0.0706 163 CYS A C   
1321 O O   . CYS A 163 ? 0.3805 0.5654 0.4898 0.0240  -0.0033 -0.0742 163 CYS A O   
1322 C CB  . CYS A 163 ? 0.3784 0.5421 0.4662 0.0228  -0.0066 -0.0662 163 CYS A CB  
1323 S SG  . CYS A 163 ? 0.3961 0.5565 0.4735 0.0198  -0.0089 -0.0602 163 CYS A SG  
1324 N N   . ARG A 164 ? 0.3747 0.5610 0.4815 0.0284  -0.0141 -0.0700 164 ARG A N   
1325 C CA  . ARG A 164 ? 0.3757 0.5728 0.4938 0.0259  -0.0155 -0.0744 164 ARG A CA  
1326 C C   . ARG A 164 ? 0.3826 0.5772 0.4954 0.0202  -0.0163 -0.0746 164 ARG A C   
1327 O O   . ARG A 164 ? 0.3837 0.5739 0.4868 0.0224  -0.0213 -0.0727 164 ARG A O   
1328 C CB  . ARG A 164 ? 0.3760 0.5824 0.5029 0.0327  -0.0229 -0.0761 164 ARG A CB  
1329 C CG  . ARG A 164 ? 0.3805 0.6009 0.5263 0.0301  -0.0247 -0.0819 164 ARG A CG  
1330 C CD  . ARG A 164 ? 0.3759 0.6038 0.5245 0.0332  -0.0358 -0.0855 164 ARG A CD  
1331 N NE  . ARG A 164 ? 0.4107 0.6543 0.5823 0.0324  -0.0392 -0.0912 164 ARG A NE  
1332 C CZ  . ARG A 164 ? 0.4413 0.6928 0.6255 0.0278  -0.0453 -0.0978 164 ARG A CZ  
1333 N NH1 . ARG A 164 ? 0.4342 0.6778 0.6077 0.0243  -0.0487 -0.1000 164 ARG A NH1 
1334 N NH2 . ARG A 164 ? 0.4478 0.7151 0.6572 0.0270  -0.0484 -0.1027 164 ARG A NH2 
1335 N N   . VAL A 165 ? 0.3902 0.5873 0.5096 0.0139  -0.0105 -0.0763 165 VAL A N   
1336 C CA  . VAL A 165 ? 0.4026 0.5948 0.5172 0.0082  -0.0086 -0.0751 165 VAL A CA  
1337 C C   . VAL A 165 ? 0.4060 0.6059 0.5383 0.0035  -0.0085 -0.0794 165 VAL A C   
1338 O O   . VAL A 165 ? 0.4219 0.6316 0.5714 0.0029  -0.0060 -0.0819 165 VAL A O   
1339 C CB  . VAL A 165 ? 0.4060 0.5919 0.5108 0.0050  0.0000  -0.0709 165 VAL A CB  
1340 C CG1 . VAL A 165 ? 0.4095 0.5896 0.5083 0.0006  0.0023  -0.0679 165 VAL A CG1 
1341 C CG2 . VAL A 165 ? 0.4165 0.5954 0.5080 0.0086  -0.0012 -0.0682 165 VAL A CG2 
1342 N N   . GLU A 166 ? 0.4071 0.6024 0.5375 0.0001  -0.0108 -0.0804 166 GLU A N   
1343 C CA  . GLU A 166 ? 0.4084 0.6093 0.5584 -0.0051 -0.0118 -0.0857 166 GLU A CA  
1344 C C   . GLU A 166 ? 0.4116 0.6027 0.5572 -0.0104 -0.0063 -0.0829 166 GLU A C   
1345 O O   . GLU A 166 ? 0.4131 0.5945 0.5416 -0.0086 -0.0093 -0.0813 166 GLU A O   
1346 C CB  . GLU A 166 ? 0.4158 0.6213 0.5696 -0.0018 -0.0247 -0.0933 166 GLU A CB  
1347 C CG  . GLU A 166 ? 0.4141 0.6315 0.5760 0.0042  -0.0315 -0.0964 166 GLU A CG  
1348 C CD  . GLU A 166 ? 0.4597 0.6837 0.6268 0.0074  -0.0454 -0.1053 166 GLU A CD  
1349 O OE1 . GLU A 166 ? 0.4363 0.6527 0.5841 0.0122  -0.0517 -0.1062 166 GLU A OE1 
1350 O OE2 . GLU A 166 ? 0.4957 0.7332 0.6866 0.0057  -0.0501 -0.1117 166 GLU A OE2 
1351 N N   . HIS A 167 ? 0.4117 0.6051 0.5735 -0.0163 0.0026  -0.0813 167 HIS A N   
1352 C CA  . HIS A 167 ? 0.4225 0.6064 0.5820 -0.0207 0.0101  -0.0767 167 HIS A CA  
1353 C C   . HIS A 167 ? 0.4232 0.6122 0.6102 -0.0271 0.0183  -0.0767 167 HIS A C   
1354 O O   . HIS A 167 ? 0.4323 0.6317 0.6346 -0.0274 0.0229  -0.0762 167 HIS A O   
1355 C CB  . HIS A 167 ? 0.4246 0.6022 0.5629 -0.0182 0.0181  -0.0674 167 HIS A CB  
1356 C CG  . HIS A 167 ? 0.4463 0.6141 0.5786 -0.0208 0.0251  -0.0613 167 HIS A CG  
1357 N ND1 . HIS A 167 ? 0.4712 0.6389 0.6068 -0.0224 0.0378  -0.0536 167 HIS A ND1 
1358 C CD2 . HIS A 167 ? 0.4615 0.6193 0.5849 -0.0210 0.0220  -0.0611 167 HIS A CD2 
1359 C CE1 . HIS A 167 ? 0.4702 0.6284 0.5996 -0.0236 0.0419  -0.0484 167 HIS A CE1 
1360 N NE2 . HIS A 167 ? 0.4733 0.6251 0.5956 -0.0230 0.0325  -0.0532 167 HIS A NE2 
1361 N N   . TRP A 168 ? 0.4326 0.6136 0.6272 -0.0321 0.0210  -0.0768 168 TRP A N   
1362 C CA  . TRP A 168 ? 0.4412 0.6258 0.6671 -0.0390 0.0284  -0.0771 168 TRP A CA  
1363 C C   . TRP A 168 ? 0.4481 0.6370 0.6806 -0.0391 0.0450  -0.0660 168 TRP A C   
1364 O O   . TRP A 168 ? 0.4607 0.6557 0.7226 -0.0439 0.0528  -0.0647 168 TRP A O   
1365 C CB  . TRP A 168 ? 0.4520 0.6238 0.6832 -0.0438 0.0292  -0.0786 168 TRP A CB  
1366 C CG  . TRP A 168 ? 0.4435 0.6102 0.6685 -0.0431 0.0136  -0.0908 168 TRP A CG  
1367 C CD1 . TRP A 168 ? 0.4213 0.5968 0.6480 -0.0403 -0.0012 -0.1018 168 TRP A CD1 
1368 C CD2 . TRP A 168 ? 0.4489 0.6005 0.6640 -0.0436 0.0121  -0.0928 168 TRP A CD2 
1369 N NE1 . TRP A 168 ? 0.4174 0.5843 0.6335 -0.0385 -0.0121 -0.1107 168 TRP A NE1 
1370 C CE2 . TRP A 168 ? 0.4338 0.5855 0.6427 -0.0406 -0.0041 -0.1058 168 TRP A CE2 
1371 C CE3 . TRP A 168 ? 0.4664 0.6042 0.6755 -0.0450 0.0231  -0.0842 168 TRP A CE3 
1372 C CZ2 . TRP A 168 ? 0.4383 0.5763 0.6349 -0.0390 -0.0092 -0.1114 168 TRP A CZ2 
1373 C CZ3 . TRP A 168 ? 0.4423 0.5661 0.6412 -0.0441 0.0182  -0.0894 168 TRP A CZ3 
1374 C CH2 . TRP A 168 ? 0.4645 0.5884 0.6571 -0.0411 0.0023  -0.1034 168 TRP A CH2 
1375 N N   . GLY A 169 ? 0.4520 0.6383 0.6580 -0.0333 0.0503  -0.0582 169 GLY A N   
1376 C CA  . GLY A 169 ? 0.4515 0.6415 0.6570 -0.0308 0.0657  -0.0480 169 GLY A CA  
1377 C C   . GLY A 169 ? 0.4494 0.6516 0.6596 -0.0271 0.0662  -0.0501 169 GLY A C   
1378 O O   . GLY A 169 ? 0.4526 0.6593 0.6634 -0.0239 0.0792  -0.0428 169 GLY A O   
1379 N N   . LEU A 170 ? 0.4440 0.6512 0.6562 -0.0263 0.0527  -0.0596 170 LEU A N   
1380 C CA  . LEU A 170 ? 0.4517 0.6706 0.6712 -0.0224 0.0518  -0.0627 170 LEU A CA  
1381 C C   . LEU A 170 ? 0.4661 0.6972 0.7222 -0.0270 0.0491  -0.0682 170 LEU A C   
1382 O O   . LEU A 170 ? 0.4705 0.7011 0.7391 -0.0317 0.0386  -0.0754 170 LEU A O   
1383 C CB  . LEU A 170 ? 0.4417 0.6588 0.6415 -0.0174 0.0389  -0.0683 170 LEU A CB  
1384 C CG  . LEU A 170 ? 0.4333 0.6396 0.6006 -0.0132 0.0372  -0.0653 170 LEU A CG  
1385 C CD1 . LEU A 170 ? 0.3864 0.5891 0.5439 -0.0114 0.0235  -0.0705 170 LEU A CD1 
1386 C CD2 . LEU A 170 ? 0.4300 0.6382 0.5847 -0.0074 0.0436  -0.0630 170 LEU A CD2 
1387 N N   . ASP A 171 ? 0.4772 0.7199 0.7511 -0.0253 0.0583  -0.0653 171 ASP A N   
1388 C CA  . ASP A 171 ? 0.4890 0.7462 0.7999 -0.0289 0.0546  -0.0707 171 ASP A CA  
1389 C C   . ASP A 171 ? 0.4879 0.7508 0.7940 -0.0250 0.0375  -0.0802 171 ASP A C   
1390 O O   . ASP A 171 ? 0.4957 0.7633 0.8171 -0.0284 0.0243  -0.0888 171 ASP A O   
1391 C CB  . ASP A 171 ? 0.4913 0.7600 0.8216 -0.0264 0.0701  -0.0638 171 ASP A CB  
1392 C CG  . ASP A 171 ? 0.5189 0.7833 0.8564 -0.0290 0.0887  -0.0526 171 ASP A CG  
1393 O OD1 . ASP A 171 ? 0.5498 0.8144 0.8738 -0.0223 0.1031  -0.0440 171 ASP A OD1 
1394 O OD2 . ASP A 171 ? 0.5274 0.7879 0.8840 -0.0369 0.0894  -0.0523 171 ASP A OD2 
1395 N N   . GLN A 172 ? 0.4887 0.7502 0.7723 -0.0172 0.0379  -0.0786 172 GLN A N   
1396 C CA  . GLN A 172 ? 0.4829 0.7492 0.7608 -0.0114 0.0250  -0.0847 172 GLN A CA  
1397 C C   . GLN A 172 ? 0.4719 0.7240 0.7158 -0.0082 0.0176  -0.0851 172 GLN A C   
1398 O O   . GLN A 172 ? 0.4708 0.7113 0.6939 -0.0086 0.0244  -0.0800 172 GLN A O   
1399 C CB  . GLN A 172 ? 0.4902 0.7630 0.7680 -0.0044 0.0329  -0.0818 172 GLN A CB  
1400 C CG  . GLN A 172 ? 0.5183 0.8021 0.8222 -0.0057 0.0472  -0.0772 172 GLN A CG  
1401 C CD  . GLN A 172 ? 0.5632 0.8653 0.9030 -0.0065 0.0411  -0.0817 172 GLN A CD  
1402 O OE1 . GLN A 172 ? 0.5726 0.8790 0.9142 -0.0052 0.0253  -0.0887 172 GLN A OE1 
1403 N NE2 . GLN A 172 ? 0.5772 0.8914 0.9463 -0.0078 0.0538  -0.0772 172 GLN A NE2 
1404 N N   . PRO A 173 ? 0.4621 0.7160 0.7008 -0.0041 0.0040  -0.0903 173 PRO A N   
1405 C CA  . PRO A 173 ? 0.4525 0.6939 0.6609 0.0005  -0.0006 -0.0887 173 PRO A CA  
1406 C C   . PRO A 173 ? 0.4458 0.6827 0.6404 0.0052  0.0077  -0.0844 173 PRO A C   
1407 O O   . PRO A 173 ? 0.4450 0.6904 0.6512 0.0091  0.0111  -0.0850 173 PRO A O   
1408 C CB  . PRO A 173 ? 0.4532 0.7006 0.6630 0.0062  -0.0146 -0.0937 173 PRO A CB  
1409 C CG  . PRO A 173 ? 0.4574 0.7226 0.6988 0.0050  -0.0180 -0.0987 173 PRO A CG  
1410 C CD  . PRO A 173 ? 0.4630 0.7295 0.7225 -0.0039 -0.0085 -0.0977 173 PRO A CD  
1411 N N   . LEU A 174 ? 0.4371 0.6611 0.6081 0.0051  0.0104  -0.0809 174 LEU A N   
1412 C CA  . LEU A 174 ? 0.4346 0.6529 0.5910 0.0091  0.0169  -0.0788 174 LEU A CA  
1413 C C   . LEU A 174 ? 0.4273 0.6392 0.5713 0.0146  0.0101  -0.0796 174 LEU A C   
1414 O O   . LEU A 174 ? 0.4215 0.6269 0.5552 0.0146  0.0032  -0.0784 174 LEU A O   
1415 C CB  . LEU A 174 ? 0.4422 0.6517 0.5823 0.0060  0.0240  -0.0746 174 LEU A CB  
1416 C CG  . LEU A 174 ? 0.4450 0.6489 0.5683 0.0100  0.0295  -0.0742 174 LEU A CG  
1417 C CD1 . LEU A 174 ? 0.4724 0.6841 0.6052 0.0131  0.0396  -0.0747 174 LEU A CD1 
1418 C CD2 . LEU A 174 ? 0.4275 0.6235 0.5322 0.0080  0.0324  -0.0704 174 LEU A CD2 
1419 N N   . LEU A 175 ? 0.4273 0.6404 0.5731 0.0197  0.0133  -0.0811 175 LEU A N   
1420 C CA  . LEU A 175 ? 0.4357 0.6417 0.5735 0.0251  0.0088  -0.0815 175 LEU A CA  
1421 C C   . LEU A 175 ? 0.4452 0.6413 0.5692 0.0260  0.0139  -0.0827 175 LEU A C   
1422 O O   . LEU A 175 ? 0.4517 0.6499 0.5755 0.0269  0.0217  -0.0848 175 LEU A O   
1423 C CB  . LEU A 175 ? 0.4355 0.6497 0.5885 0.0314  0.0074  -0.0831 175 LEU A CB  
1424 C CG  . LEU A 175 ? 0.4423 0.6699 0.6127 0.0333  0.0007  -0.0837 175 LEU A CG  
1425 C CD1 . LEU A 175 ? 0.4255 0.6507 0.5913 0.0398  -0.0081 -0.0816 175 LEU A CD1 
1426 C CD2 . LEU A 175 ? 0.4224 0.6573 0.6013 0.0263  -0.0017 -0.0849 175 LEU A CD2 
1427 N N   . LYS A 176 ? 0.4516 0.6371 0.5643 0.0263  0.0096  -0.0818 176 LYS A N   
1428 C CA  . LYS A 176 ? 0.4636 0.6402 0.5665 0.0276  0.0123  -0.0853 176 LYS A CA  
1429 C C   . LYS A 176 ? 0.4632 0.6336 0.5714 0.0327  0.0098  -0.0868 176 LYS A C   
1430 O O   . LYS A 176 ? 0.4649 0.6315 0.5752 0.0338  0.0047  -0.0826 176 LYS A O   
1431 C CB  . LYS A 176 ? 0.4672 0.6366 0.5557 0.0230  0.0101  -0.0837 176 LYS A CB  
1432 C CG  . LYS A 176 ? 0.5003 0.6725 0.5791 0.0208  0.0161  -0.0845 176 LYS A CG  
1433 C CD  . LYS A 176 ? 0.5507 0.7179 0.6185 0.0238  0.0186  -0.0911 176 LYS A CD  
1434 C CE  . LYS A 176 ? 0.5912 0.7638 0.6500 0.0252  0.0271  -0.0911 176 LYS A CE  
1435 N NZ  . LYS A 176 ? 0.6253 0.7927 0.6674 0.0288  0.0275  -0.0980 176 LYS A NZ  
1436 N N   . HIS A 177 ? 0.4693 0.6379 0.5797 0.0368  0.0145  -0.0923 177 HIS A N   
1437 C CA  . HIS A 177 ? 0.4762 0.6370 0.5930 0.0418  0.0133  -0.0939 177 HIS A CA  
1438 C C   . HIS A 177 ? 0.4816 0.6289 0.5906 0.0392  0.0101  -0.0966 177 HIS A C   
1439 O O   . HIS A 177 ? 0.4792 0.6241 0.5763 0.0354  0.0100  -0.1005 177 HIS A O   
1440 C CB  . HIS A 177 ? 0.4855 0.6484 0.6086 0.0479  0.0199  -0.0994 177 HIS A CB  
1441 C CG  . HIS A 177 ? 0.4912 0.6528 0.6282 0.0548  0.0195  -0.0976 177 HIS A CG  
1442 N ND1 . HIS A 177 ? 0.5084 0.6571 0.6476 0.0589  0.0210  -0.1019 177 HIS A ND1 
1443 C CD2 . HIS A 177 ? 0.5021 0.6737 0.6519 0.0590  0.0176  -0.0919 177 HIS A CD2 
1444 C CE1 . HIS A 177 ? 0.5189 0.6693 0.6718 0.0657  0.0213  -0.0975 177 HIS A CE1 
1445 N NE2 . HIS A 177 ? 0.5266 0.6918 0.6852 0.0663  0.0188  -0.0913 177 HIS A NE2 
1446 N N   . TRP A 178 ? 0.4918 0.6312 0.6091 0.0415  0.0074  -0.0935 178 TRP A N   
1447 C CA  . TRP A 178 ? 0.5110 0.6369 0.6289 0.0398  0.0052  -0.0971 178 TRP A CA  
1448 C C   . TRP A 178 ? 0.5376 0.6559 0.6703 0.0459  0.0068  -0.0950 178 TRP A C   
1449 O O   . TRP A 178 ? 0.5317 0.6553 0.6714 0.0506  0.0070  -0.0865 178 TRP A O   
1450 C CB  . TRP A 178 ? 0.4978 0.6213 0.6124 0.0342  0.0003  -0.0911 178 TRP A CB  
1451 C CG  . TRP A 178 ? 0.4681 0.5793 0.5874 0.0313  -0.0025 -0.0952 178 TRP A CG  
1452 C CD1 . TRP A 178 ? 0.4544 0.5623 0.5659 0.0268  -0.0056 -0.1040 178 TRP A CD1 
1453 C CD2 . TRP A 178 ? 0.4655 0.5665 0.6005 0.0330  -0.0026 -0.0907 178 TRP A CD2 
1454 N NE1 . TRP A 178 ? 0.4614 0.5581 0.5847 0.0245  -0.0089 -0.1069 178 TRP A NE1 
1455 C CE2 . TRP A 178 ? 0.4632 0.5548 0.6023 0.0279  -0.0062 -0.0982 178 TRP A CE2 
1456 C CE3 . TRP A 178 ? 0.4805 0.5797 0.6272 0.0390  0.0002  -0.0807 178 TRP A CE3 
1457 C CZ2 . TRP A 178 ? 0.4807 0.5603 0.6386 0.0274  -0.0065 -0.0960 178 TRP A CZ2 
1458 C CZ3 . TRP A 178 ? 0.4719 0.5587 0.6350 0.0397  0.0013  -0.0767 178 TRP A CZ3 
1459 C CH2 . TRP A 178 ? 0.4906 0.5676 0.6608 0.0333  -0.0017 -0.0844 178 TRP A CH2 
1460 N N   . GLU A 179 ? 0.5729 0.6785 0.7102 0.0465  0.0076  -0.1029 179 GLU A N   
1461 C CA  . GLU A 179 ? 0.6054 0.7005 0.7591 0.0520  0.0099  -0.1002 179 GLU A CA  
1462 C C   . GLU A 179 ? 0.6360 0.7151 0.7958 0.0483  0.0080  -0.1089 179 GLU A C   
1463 O O   . GLU A 179 ? 0.6477 0.7250 0.7968 0.0440  0.0052  -0.1204 179 GLU A O   
1464 C CB  . GLU A 179 ? 0.6127 0.7112 0.7718 0.0605  0.0156  -0.1024 179 GLU A CB  
1465 C CG  . GLU A 179 ? 0.6202 0.7183 0.7705 0.0614  0.0189  -0.1158 179 GLU A CG  
1466 C CD  . GLU A 179 ? 0.6265 0.7296 0.7843 0.0705  0.0256  -0.1162 179 GLU A CD  
1467 O OE1 . GLU A 179 ? 0.6208 0.7396 0.7804 0.0730  0.0268  -0.1095 179 GLU A OE1 
1468 O OE2 . GLU A 179 ? 0.6476 0.7388 0.8109 0.0754  0.0295  -0.1237 179 GLU A OE2 
1469 N N   . ALA A 180 ? 0.6639 0.7314 0.8412 0.0502  0.0094  -0.1033 180 ALA A N   
1470 C CA  . ALA A 180 ? 0.6941 0.7448 0.8839 0.0465  0.0077  -0.1123 180 ALA A CA  
1471 C C   . ALA A 180 ? 0.7233 0.7683 0.9057 0.0482  0.0082  -0.1300 180 ALA A C   
1472 O O   . ALA A 180 ? 0.7317 0.7711 0.9205 0.0557  0.0140  -0.1329 180 ALA A O   
1473 C CB  . ALA A 180 ? 0.7013 0.7400 0.9143 0.0512  0.0126  -0.1029 180 ALA A CB  
1474 N N   . GLN A 181 ? 0.7432 0.7905 0.9109 0.0425  0.0023  -0.1413 181 GLN A N   
1475 C CA  . GLN A 181 ? 0.7735 0.8193 0.9259 0.0455  0.0027  -0.1576 181 GLN A CA  
1476 C C   . GLN A 181 ? 0.7983 0.8254 0.9633 0.0484  0.0037  -0.1705 181 GLN A C   
1477 O O   . GLN A 181 ? 0.8085 0.8319 0.9779 0.0566  0.0111  -0.1709 181 GLN A O   
1478 C CB  . GLN A 181 ? 0.7809 0.8326 0.9139 0.0398  -0.0045 -0.1661 181 GLN A CB  
1479 C CG  . GLN A 181 ? 0.8129 0.8665 0.9239 0.0453  -0.0026 -0.1804 181 GLN A CG  
1480 C CD  . GLN A 181 ? 0.8228 0.8898 0.9241 0.0517  0.0069  -0.1727 181 GLN A CD  
1481 O OE1 . GLN A 181 ? 0.8361 0.9007 0.9342 0.0597  0.0137  -0.1792 181 GLN A OE1 
1482 N NE2 . GLN A 181 ? 0.7727 0.8536 0.8713 0.0484  0.0073  -0.1593 181 GLN A NE2 
1600 N N   . SER B 26  ? 0.4994 0.6956 1.2875 -0.0867 -0.0735 -0.2567 3   SER B N   
1601 C CA  . SER B 26  ? 0.4976 0.6766 1.2175 -0.0748 -0.0970 -0.2368 3   SER B CA  
1602 C C   . SER B 26  ? 0.5132 0.6748 1.2074 -0.0814 -0.0966 -0.2398 3   SER B C   
1603 O O   . SER B 26  ? 0.5171 0.6713 1.2278 -0.0940 -0.0668 -0.2454 3   SER B O   
1604 C CB  . SER B 26  ? 0.4862 0.6486 1.1557 -0.0693 -0.0783 -0.2078 3   SER B CB  
1605 O OG  . SER B 26  ? 0.4811 0.6221 1.1215 -0.0769 -0.0461 -0.1944 3   SER B OG  
1606 N N   . PRO B 27  ? 0.5215 0.6735 1.1737 -0.0734 -0.1275 -0.2363 4   PRO B N   
1607 C CA  . PRO B 27  ? 0.5383 0.6712 1.1629 -0.0802 -0.1260 -0.2402 4   PRO B CA  
1608 C C   . PRO B 27  ? 0.5343 0.6392 1.1114 -0.0825 -0.0923 -0.2166 4   PRO B C   
1609 O O   . PRO B 27  ? 0.5231 0.6223 1.0753 -0.0764 -0.0780 -0.1940 4   PRO B O   
1610 C CB  . PRO B 27  ? 0.5582 0.6832 1.1374 -0.0688 -0.1667 -0.2377 4   PRO B CB  
1611 C CG  . PRO B 27  ? 0.5462 0.6894 1.1403 -0.0563 -0.1898 -0.2346 4   PRO B CG  
1612 C CD  . PRO B 27  ? 0.5237 0.6753 1.1418 -0.0579 -0.1594 -0.2247 4   PRO B CD  
1613 N N   . GLU B 28  ? 0.5458 0.6338 1.1121 -0.0911 -0.0807 -0.2226 5   GLU B N   
1614 C CA  . GLU B 28  ? 0.5450 0.6069 1.0751 -0.0931 -0.0486 -0.2026 5   GLU B CA  
1615 C C   . GLU B 28  ? 0.5394 0.5848 1.0072 -0.0811 -0.0552 -0.1769 5   GLU B C   
1616 O O   . GLU B 28  ? 0.5546 0.5937 0.9915 -0.0757 -0.0810 -0.1788 5   GLU B O   
1617 C CB  . GLU B 28  ? 0.5736 0.6195 1.1067 -0.1044 -0.0374 -0.2171 5   GLU B CB  
1618 C CG  . GLU B 28  ? 0.5780 0.6250 1.1593 -0.1185 -0.0058 -0.2304 5   GLU B CG  
1619 C CD  . GLU B 28  ? 0.6162 0.6413 1.1913 -0.1289 0.0086  -0.2410 5   GLU B CD  
1620 O OE1 . GLU B 28  ? 0.6014 0.6032 1.1265 -0.1237 0.0100  -0.2266 5   GLU B OE1 
1621 O OE2 . GLU B 28  ? 0.6390 0.6698 1.2614 -0.1428 0.0197  -0.2647 5   GLU B OE2 
1622 N N   . ASN B 29  ? 0.5183 0.5559 0.9670 -0.0773 -0.0314 -0.1535 6   ASN B N   
1623 C CA  . ASN B 29  ? 0.5064 0.5300 0.9019 -0.0672 -0.0340 -0.1298 6   ASN B CA  
1624 C C   . ASN B 29  ? 0.5023 0.5109 0.8803 -0.0668 -0.0023 -0.1087 6   ASN B C   
1625 O O   . ASN B 29  ? 0.5009 0.5149 0.8954 -0.0686 0.0167  -0.1015 6   ASN B O   
1626 C CB  . ASN B 29  ? 0.4922 0.5296 0.8781 -0.0575 -0.0531 -0.1206 6   ASN B CB  
1627 C CG  . ASN B 29  ? 0.4820 0.5059 0.8156 -0.0482 -0.0646 -0.1036 6   ASN B CG  
1628 O OD1 . ASN B 29  ? 0.4912 0.5159 0.8051 -0.0421 -0.0586 -0.0844 6   ASN B OD1 
1629 N ND2 . ASN B 29  ? 0.4687 0.4792 0.7790 -0.0479 -0.0798 -0.1112 6   ASN B ND2 
1630 N N   . TYR B 30  ? 0.5067 0.4953 0.8494 -0.0637 0.0031  -0.0983 7   TYR B N   
1631 C CA  . TYR B 30  ? 0.4974 0.4720 0.8212 -0.0603 0.0291  -0.0759 7   TYR B CA  
1632 C C   . TYR B 30  ? 0.4870 0.4580 0.7703 -0.0496 0.0205  -0.0560 7   TYR B C   
1633 O O   . TYR B 30  ? 0.4922 0.4593 0.7537 -0.0467 0.0010  -0.0606 7   TYR B O   
1634 C CB  . TYR B 30  ? 0.5236 0.4769 0.8506 -0.0666 0.0498  -0.0813 7   TYR B CB  
1635 C CG  . TYR B 30  ? 0.5288 0.4859 0.8987 -0.0791 0.0578  -0.1045 7   TYR B CG  
1636 C CD1 . TYR B 30  ? 0.5491 0.5062 0.9325 -0.0870 0.0430  -0.1300 7   TYR B CD1 
1637 C CD2 . TYR B 30  ? 0.5116 0.4723 0.9083 -0.0838 0.0801  -0.1018 7   TYR B CD2 
1638 C CE1 . TYR B 30  ? 0.5531 0.5165 0.9816 -0.0996 0.0503  -0.1533 7   TYR B CE1 
1639 C CE2 . TYR B 30  ? 0.5325 0.4966 0.9718 -0.0963 0.0900  -0.1240 7   TYR B CE2 
1640 C CZ  . TYR B 30  ? 0.5451 0.5122 1.0031 -0.1044 0.0750  -0.1501 7   TYR B CZ  
1641 O OH  . TYR B 30  ? 0.5723 0.5454 1.0778 -0.1178 0.0852  -0.1738 7   TYR B OH  
1642 N N   . LEU B 31  ? 0.4769 0.4486 0.7498 -0.0441 0.0351  -0.0343 8   LEU B N   
1643 C CA  . LEU B 31  ? 0.4672 0.4403 0.7085 -0.0347 0.0278  -0.0157 8   LEU B CA  
1644 C C   . LEU B 31  ? 0.4784 0.4417 0.7061 -0.0291 0.0493  0.0066  8   LEU B C   
1645 O O   . LEU B 31  ? 0.4842 0.4459 0.7235 -0.0302 0.0676  0.0146  8   LEU B O   
1646 C CB  . LEU B 31  ? 0.4398 0.4325 0.6830 -0.0322 0.0129  -0.0131 8   LEU B CB  
1647 C CG  . LEU B 31  ? 0.4203 0.4151 0.6326 -0.0243 0.0001  0.0001  8   LEU B CG  
1648 C CD1 . LEU B 31  ? 0.3891 0.3958 0.6016 -0.0231 -0.0222 -0.0074 8   LEU B CD1 
1649 C CD2 . LEU B 31  ? 0.3614 0.3602 0.5627 -0.0196 0.0127  0.0214  8   LEU B CD2 
1650 N N   . PHE B 32  ? 0.4812 0.4363 0.6844 -0.0230 0.0472  0.0160  9   PHE B N   
1651 C CA  . PHE B 32  ? 0.4894 0.4390 0.6821 -0.0154 0.0631  0.0375  9   PHE B CA  
1652 C C   . PHE B 32  ? 0.4768 0.4378 0.6502 -0.0084 0.0515  0.0506  9   PHE B C   
1653 O O   . PHE B 32  ? 0.4801 0.4396 0.6381 -0.0083 0.0377  0.0440  9   PHE B O   
1654 C CB  . PHE B 32  ? 0.5141 0.4415 0.7025 -0.0144 0.0782  0.0371  9   PHE B CB  
1655 C CG  . PHE B 32  ? 0.5145 0.4359 0.7028 -0.0061 0.0975  0.0586  9   PHE B CG  
1656 C CD1 . PHE B 32  ? 0.4998 0.4109 0.7025 -0.0071 0.1168  0.0632  9   PHE B CD1 
1657 C CD2 . PHE B 32  ? 0.5363 0.4629 0.7111 0.0031  0.0957  0.0747  9   PHE B CD2 
1658 C CE1 . PHE B 32  ? 0.5363 0.4406 0.7373 0.0024  0.1323  0.0848  9   PHE B CE1 
1659 C CE2 . PHE B 32  ? 0.5388 0.4626 0.7171 0.0126  0.1106  0.0953  9   PHE B CE2 
1660 C CZ  . PHE B 32  ? 0.5406 0.4527 0.7305 0.0130  0.1278  0.1010  9   PHE B CZ  
1661 N N   . GLN B 33  ? 0.4701 0.4414 0.6430 -0.0032 0.0574  0.0686  10  GLN B N   
1662 C CA  . GLN B 33  ? 0.4572 0.4431 0.6164 0.0022  0.0473  0.0808  10  GLN B CA  
1663 C C   . GLN B 33  ? 0.4606 0.4458 0.6175 0.0107  0.0591  0.1003  10  GLN B C   
1664 O O   . GLN B 33  ? 0.4654 0.4438 0.6303 0.0133  0.0734  0.1090  10  GLN B O   
1665 C CB  . GLN B 33  ? 0.4475 0.4508 0.6095 0.0003  0.0402  0.0839  10  GLN B CB  
1666 C CG  . GLN B 33  ? 0.4462 0.4551 0.6155 -0.0064 0.0278  0.0670  10  GLN B CG  
1667 C CD  . GLN B 33  ? 0.4564 0.4817 0.6256 -0.0076 0.0223  0.0712  10  GLN B CD  
1668 O OE1 . GLN B 33  ? 0.4637 0.4989 0.6195 -0.0045 0.0147  0.0802  10  GLN B OE1 
1669 N NE2 . GLN B 33  ? 0.4471 0.4746 0.6320 -0.0133 0.0276  0.0634  10  GLN B NE2 
1670 N N   . GLY B 34  ? 0.4642 0.4575 0.6115 0.0152  0.0526  0.1074  11  GLY B N   
1671 C CA  . GLY B 34  ? 0.4703 0.4697 0.6201 0.0241  0.0598  0.1256  11  GLY B CA  
1672 C C   . GLY B 34  ? 0.4657 0.4864 0.6092 0.0252  0.0466  0.1319  11  GLY B C   
1673 O O   . GLY B 34  ? 0.4608 0.4856 0.5950 0.0198  0.0345  0.1218  11  GLY B O   
1674 N N   . ARG B 35  ? 0.4761 0.5099 0.6253 0.0325  0.0485  0.1487  12  ARG B N   
1675 C CA  . ARG B 35  ? 0.4664 0.5227 0.6130 0.0333  0.0367  0.1553  12  ARG B CA  
1676 C C   . ARG B 35  ? 0.4748 0.5382 0.6339 0.0432  0.0426  0.1697  12  ARG B C   
1677 O O   . ARG B 35  ? 0.5024 0.5580 0.6698 0.0505  0.0527  0.1799  12  ARG B O   
1678 C CB  . ARG B 35  ? 0.4620 0.5307 0.6034 0.0310  0.0296  0.1604  12  ARG B CB  
1679 C CG  . ARG B 35  ? 0.4501 0.5223 0.5825 0.0214  0.0194  0.1467  12  ARG B CG  
1680 C CD  . ARG B 35  ? 0.5177 0.5720 0.6519 0.0161  0.0235  0.1316  12  ARG B CD  
1681 N NE  . ARG B 35  ? 0.5043 0.5624 0.6353 0.0085  0.0135  0.1184  12  ARG B NE  
1682 C CZ  . ARG B 35  ? 0.5076 0.5803 0.6320 0.0059  0.0037  0.1191  12  ARG B CZ  
1683 N NH1 . ARG B 35  ? 0.4755 0.5624 0.5958 0.0091  0.0009  0.1312  12  ARG B NH1 
1684 N NH2 . ARG B 35  ? 0.4997 0.5733 0.6242 0.0000  -0.0034 0.1068  12  ARG B NH2 
1685 N N   . GLN B 36  ? 0.4695 0.5466 0.6322 0.0436  0.0375  0.1702  13  GLN B N   
1686 C CA  . GLN B 36  ? 0.4756 0.5669 0.6568 0.0530  0.0405  0.1832  13  GLN B CA  
1687 C C   . GLN B 36  ? 0.4701 0.5886 0.6526 0.0498  0.0261  0.1848  13  GLN B C   
1688 O O   . GLN B 36  ? 0.4530 0.5743 0.6341 0.0443  0.0248  0.1762  13  GLN B O   
1689 C CB  . GLN B 36  ? 0.4815 0.5590 0.6711 0.0550  0.0541  0.1781  13  GLN B CB  
1690 C CG  . GLN B 36  ? 0.4955 0.5463 0.6854 0.0579  0.0695  0.1760  13  GLN B CG  
1691 C CD  . GLN B 36  ? 0.4970 0.5271 0.6819 0.0544  0.0815  0.1639  13  GLN B CD  
1692 O OE1 . GLN B 36  ? 0.5068 0.5365 0.6788 0.0474  0.0766  0.1543  13  GLN B OE1 
1693 N NE2 . GLN B 36  ? 0.5286 0.5381 0.7205 0.0588  0.0982  0.1639  13  GLN B NE2 
1694 N N   . GLU B 37  ? 0.4832 0.6190 0.6655 0.0526  0.0160  0.1955  14  GLU B N   
1695 C CA  . GLU B 37  ? 0.4856 0.6449 0.6633 0.0468  0.0009  0.1945  14  GLU B CA  
1696 C C   . GLU B 37  ? 0.4921 0.6784 0.6904 0.0546  -0.0063 0.2068  14  GLU B C   
1697 O O   . GLU B 37  ? 0.5112 0.7001 0.7176 0.0655  -0.0062 0.2213  14  GLU B O   
1698 C CB  . GLU B 37  ? 0.4933 0.6516 0.6513 0.0425  -0.0061 0.1955  14  GLU B CB  
1699 C CG  . GLU B 37  ? 0.5162 0.6497 0.6609 0.0371  0.0017  0.1855  14  GLU B CG  
1700 C CD  . GLU B 37  ? 0.5727 0.7036 0.7025 0.0347  -0.0002 0.1894  14  GLU B CD  
1701 O OE1 . GLU B 37  ? 0.5844 0.7023 0.7058 0.0273  0.0031  0.1781  14  GLU B OE1 
1702 O OE2 . GLU B 37  ? 0.5831 0.7243 0.7093 0.0403  -0.0048 0.2036  14  GLU B OE2 
1703 N N   . CYS B 38  ? 0.4837 0.6898 0.6914 0.0491  -0.0130 0.2010  15  CYS B N   
1704 C CA  . CYS B 38  ? 0.4901 0.7270 0.7221 0.0552  -0.0226 0.2103  15  CYS B CA  
1705 C C   . CYS B 38  ? 0.4911 0.7500 0.7114 0.0470  -0.0404 0.2083  15  CYS B C   
1706 O O   . CYS B 38  ? 0.4886 0.7455 0.6956 0.0347  -0.0421 0.1952  15  CYS B O   
1707 C CB  . CYS B 38  ? 0.4818 0.7267 0.7421 0.0556  -0.0135 0.2050  15  CYS B CB  
1708 S SG  . CYS B 38  ? 0.4902 0.7106 0.7678 0.0665  0.0096  0.2082  15  CYS B SG  
1709 N N   . TYR B 39  ? 0.5023 0.7792 0.7244 0.0541  -0.0537 0.2212  16  TYR B N   
1710 C CA  . TYR B 39  ? 0.5099 0.8073 0.7186 0.0461  -0.0711 0.2191  16  TYR B CA  
1711 C C   . TYR B 39  ? 0.5193 0.8527 0.7589 0.0487  -0.0839 0.2215  16  TYR B C   
1712 O O   . TYR B 39  ? 0.5211 0.8655 0.7887 0.0620  -0.0843 0.2327  16  TYR B O   
1713 C CB  . TYR B 39  ? 0.5270 0.8168 0.7075 0.0500  -0.0787 0.2306  16  TYR B CB  
1714 C CG  . TYR B 39  ? 0.5165 0.7736 0.6699 0.0457  -0.0659 0.2263  16  TYR B CG  
1715 C CD1 . TYR B 39  ? 0.5204 0.7533 0.6774 0.0540  -0.0508 0.2319  16  TYR B CD1 
1716 C CD2 . TYR B 39  ? 0.5036 0.7542 0.6308 0.0327  -0.0679 0.2154  16  TYR B CD2 
1717 C CE1 . TYR B 39  ? 0.5194 0.7246 0.6566 0.0490  -0.0391 0.2260  16  TYR B CE1 
1718 C CE2 . TYR B 39  ? 0.5042 0.7274 0.6132 0.0288  -0.0558 0.2101  16  TYR B CE2 
1719 C CZ  . TYR B 39  ? 0.5105 0.7124 0.6257 0.0368  -0.0422 0.2152  16  TYR B CZ  
1720 O OH  . TYR B 39  ? 0.5156 0.6931 0.6180 0.0322  -0.0306 0.2085  16  TYR B OH  
1721 N N   . ALA B 40  ? 0.5284 0.8803 0.7659 0.0359  -0.0938 0.2102  17  ALA B N   
1722 C CA  . ALA B 40  ? 0.5468 0.9354 0.8179 0.0354  -0.1055 0.2086  17  ALA B CA  
1723 C C   . ALA B 40  ? 0.5730 0.9857 0.8303 0.0283  -0.1278 0.2073  17  ALA B C   
1724 O O   . ALA B 40  ? 0.5691 0.9872 0.8184 0.0129  -0.1297 0.1926  17  ALA B O   
1725 C CB  . ALA B 40  ? 0.5243 0.9139 0.8163 0.0253  -0.0923 0.1931  17  ALA B CB  
1726 N N   . PHE B 41  ? 0.6122 1.0366 0.8645 0.0397  -0.1442 0.2230  18  PHE B N   
1727 C CA  . PHE B 41  ? 0.6506 1.0998 0.8889 0.0355  -0.1690 0.2244  18  PHE B CA  
1728 C C   . PHE B 41  ? 0.6483 1.1413 0.9343 0.0375  -0.1843 0.2220  18  PHE B C   
1729 O O   . PHE B 41  ? 0.6420 1.1449 0.9694 0.0497  -0.1787 0.2282  18  PHE B O   
1730 C CB  . PHE B 41  ? 0.6916 1.1292 0.8991 0.0485  -0.1795 0.2442  18  PHE B CB  
1731 C CG  . PHE B 41  ? 0.7556 1.2067 0.9293 0.0420  -0.2031 0.2452  18  PHE B CG  
1732 C CD1 . PHE B 41  ? 0.7799 1.2394 0.9382 0.0221  -0.2075 0.2265  18  PHE B CD1 
1733 C CD2 . PHE B 41  ? 0.8141 1.2647 0.9664 0.0557  -0.2197 0.2651  18  PHE B CD2 
1734 C CE1 . PHE B 41  ? 0.8170 1.2863 0.9405 0.0150  -0.2281 0.2261  18  PHE B CE1 
1735 C CE2 . PHE B 41  ? 0.8653 1.3245 0.9793 0.0495  -0.2416 0.2662  18  PHE B CE2 
1736 C CZ  . PHE B 41  ? 0.8699 1.3389 0.9694 0.0285  -0.2456 0.2459  18  PHE B CZ  
1737 N N   . ASN B 42  ? 0.6555 1.1748 0.9378 0.0253  -0.2029 0.2121  19  ASN B N   
1738 C CA  . ASN B 42  ? 0.6443 1.2078 0.9761 0.0226  -0.2164 0.2042  19  ASN B CA  
1739 C C   . ASN B 42  ? 0.6348 1.2151 1.0223 0.0391  -0.2119 0.2131  19  ASN B C   
1740 O O   . ASN B 42  ? 0.6520 1.2512 1.0563 0.0561  -0.2296 0.2291  19  ASN B O   
1741 C CB  . ASN B 42  ? 0.6678 1.2639 0.9897 0.0170  -0.2481 0.2024  19  ASN B CB  
1742 C CG  . ASN B 42  ? 0.6924 1.2821 0.9775 0.0314  -0.2680 0.2232  19  ASN B CG  
1743 O OD1 . ASN B 42  ? 0.6794 1.2342 0.9349 0.0414  -0.2559 0.2371  19  ASN B OD1 
1744 N ND2 . ASN B 42  ? 0.6973 1.3196 0.9818 0.0311  -0.2989 0.2246  19  ASN B ND2 
1745 N N   . GLY B 43  ? 0.6068 1.1765 1.0198 0.0342  -0.1866 0.2028  20  GLY B N   
1746 C CA  . GLY B 43  ? 0.5914 1.1753 1.0603 0.0460  -0.1762 0.2063  20  GLY B CA  
1747 C C   . GLY B 43  ? 0.5970 1.1620 1.0675 0.0676  -0.1697 0.2262  20  GLY B C   
1748 O O   . GLY B 43  ? 0.5997 1.1864 1.1179 0.0821  -0.1722 0.2342  20  GLY B O   
1749 N N   . THR B 44  ? 0.5959 1.1206 1.0175 0.0695  -0.1601 0.2334  21  THR B N   
1750 C CA  . THR B 44  ? 0.5978 1.0999 1.0173 0.0887  -0.1517 0.2517  21  THR B CA  
1751 C C   . THR B 44  ? 0.5830 1.0382 0.9701 0.0847  -0.1255 0.2485  21  THR B C   
1752 O O   . THR B 44  ? 0.5679 1.0082 0.9329 0.0683  -0.1157 0.2332  21  THR B O   
1753 C CB  . THR B 44  ? 0.6290 1.1364 1.0261 0.1023  -0.1759 0.2715  21  THR B CB  
1754 O OG1 . THR B 44  ? 0.6382 1.1439 1.0634 0.1243  -0.1730 0.2893  21  THR B OG1 
1755 C CG2 . THR B 44  ? 0.6383 1.1093 0.9714 0.0965  -0.1731 0.2751  21  THR B CG2 
1756 N N   . GLN B 45  ? 0.5832 1.0152 0.9689 0.0997  -0.1146 0.2624  22  GLN B N   
1757 C CA  . GLN B 45  ? 0.5636 0.9546 0.9282 0.0963  -0.0893 0.2574  22  GLN B CA  
1758 C C   . GLN B 45  ? 0.5753 0.9375 0.9137 0.1083  -0.0854 0.2734  22  GLN B C   
1759 O O   . GLN B 45  ? 0.5879 0.9531 0.9464 0.1257  -0.0872 0.2894  22  GLN B O   
1760 C CB  . GLN B 45  ? 0.5485 0.9371 0.9518 0.0984  -0.0681 0.2502  22  GLN B CB  
1761 C CG  . GLN B 45  ? 0.5284 0.8905 0.9131 0.0834  -0.0482 0.2329  22  GLN B CG  
1762 C CD  . GLN B 45  ? 0.5062 0.8812 0.8802 0.0653  -0.0555 0.2174  22  GLN B CD  
1763 O OE1 . GLN B 45  ? 0.5065 0.8624 0.8418 0.0545  -0.0559 0.2102  22  GLN B OE1 
1764 N NE2 . GLN B 45  ? 0.4739 0.8806 0.8848 0.0620  -0.0599 0.2114  22  GLN B NE2 
1765 N N   . ARG B 46  ? 0.5710 0.9048 0.8662 0.0988  -0.0794 0.2686  23  ARG B N   
1766 C CA  . ARG B 46  ? 0.5838 0.8863 0.8527 0.1069  -0.0716 0.2809  23  ARG B CA  
1767 C C   . ARG B 46  ? 0.5646 0.8333 0.8241 0.1006  -0.0479 0.2699  23  ARG B C   
1768 O O   . ARG B 46  ? 0.5458 0.8091 0.7923 0.0859  -0.0440 0.2534  23  ARG B O   
1769 C CB  . ARG B 46  ? 0.5978 0.8959 0.8240 0.1010  -0.0850 0.2848  23  ARG B CB  
1770 C CG  . ARG B 46  ? 0.6215 0.8883 0.8206 0.1098  -0.0772 0.2995  23  ARG B CG  
1771 C CD  . ARG B 46  ? 0.6437 0.9078 0.8001 0.1041  -0.0906 0.3041  23  ARG B CD  
1772 N NE  . ARG B 46  ? 0.6538 0.8827 0.7797 0.1094  -0.0789 0.3159  23  ARG B NE  
1773 C CZ  . ARG B 46  ? 0.6413 0.8522 0.7259 0.0996  -0.0770 0.3138  23  ARG B CZ  
1774 N NH1 . ARG B 46  ? 0.6135 0.8380 0.6817 0.0847  -0.0866 0.3003  23  ARG B NH1 
1775 N NH2 . ARG B 46  ? 0.6581 0.8356 0.7182 0.1043  -0.0633 0.3246  23  ARG B NH2 
1776 N N   . PHE B 47  ? 0.5694 0.8150 0.8354 0.1117  -0.0327 0.2787  24  PHE B N   
1777 C CA  . PHE B 47  ? 0.5598 0.7733 0.8166 0.1054  -0.0115 0.2673  24  PHE B CA  
1778 C C   . PHE B 47  ? 0.5703 0.7534 0.7965 0.1045  -0.0038 0.2711  24  PHE B C   
1779 O O   . PHE B 47  ? 0.5998 0.7743 0.8226 0.1166  -0.0035 0.2883  24  PHE B O   
1780 C CB  . PHE B 47  ? 0.5623 0.7675 0.8505 0.1145  0.0059  0.2679  24  PHE B CB  
1781 C CG  . PHE B 47  ? 0.5564 0.7289 0.8326 0.1068  0.0261  0.2542  24  PHE B CG  
1782 C CD1 . PHE B 47  ? 0.5321 0.7013 0.7974 0.0923  0.0281  0.2358  24  PHE B CD1 
1783 C CD2 . PHE B 47  ? 0.5742 0.7177 0.8484 0.1139  0.0422  0.2597  24  PHE B CD2 
1784 C CE1 . PHE B 47  ? 0.5301 0.6694 0.7819 0.0856  0.0434  0.2230  24  PHE B CE1 
1785 C CE2 . PHE B 47  ? 0.5763 0.6911 0.8396 0.1057  0.0589  0.2453  24  PHE B CE2 
1786 C CZ  . PHE B 47  ? 0.5429 0.6563 0.7942 0.0918  0.0580  0.2269  24  PHE B CZ  
1787 N N   . LEU B 48  ? 0.5426 0.7089 0.7483 0.0907  0.0027  0.2552  25  LEU B N   
1788 C CA  . LEU B 48  ? 0.5435 0.6795 0.7282 0.0878  0.0147  0.2539  25  LEU B CA  
1789 C C   . LEU B 48  ? 0.5276 0.6415 0.7161 0.0816  0.0305  0.2385  25  LEU B C   
1790 O O   . LEU B 48  ? 0.5142 0.6318 0.7001 0.0714  0.0278  0.2230  25  LEU B O   
1791 C CB  . LEU B 48  ? 0.5418 0.6779 0.6982 0.0767  0.0065  0.2487  25  LEU B CB  
1792 C CG  . LEU B 48  ? 0.5825 0.7246 0.7212 0.0825  -0.0038 0.2654  25  LEU B CG  
1793 C CD1 . LEU B 48  ? 0.5892 0.7647 0.7292 0.0808  -0.0251 0.2668  25  LEU B CD1 
1794 C CD2 . LEU B 48  ? 0.5794 0.7014 0.6887 0.0738  0.0023  0.2619  25  LEU B CD2 
1795 N N   . GLU B 49  ? 0.5363 0.6257 0.7293 0.0876  0.0469  0.2426  26  GLU B N   
1796 C CA  . GLU B 49  ? 0.5296 0.5954 0.7220 0.0804  0.0612  0.2266  26  GLU B CA  
1797 C C   . GLU B 49  ? 0.5354 0.5801 0.7116 0.0741  0.0683  0.2224  26  GLU B C   
1798 O O   . GLU B 49  ? 0.5604 0.5924 0.7339 0.0810  0.0762  0.2356  26  GLU B O   
1799 C CB  . GLU B 49  ? 0.5377 0.5893 0.7499 0.0896  0.0775  0.2300  26  GLU B CB  
1800 C CG  . GLU B 49  ? 0.5511 0.5822 0.7599 0.0802  0.0887  0.2105  26  GLU B CG  
1801 C CD  . GLU B 49  ? 0.5835 0.5961 0.8085 0.0872  0.1078  0.2110  26  GLU B CD  
1802 O OE1 . GLU B 49  ? 0.5765 0.5710 0.8078 0.0945  0.1211  0.2196  26  GLU B OE1 
1803 O OE2 . GLU B 49  ? 0.5949 0.6083 0.8250 0.0848  0.1113  0.2019  26  GLU B OE2 
1804 N N   . ARG B 50  ? 0.5156 0.5560 0.6823 0.0614  0.0660  0.2044  27  ARG B N   
1805 C CA  . ARG B 50  ? 0.5233 0.5477 0.6799 0.0542  0.0726  0.1986  27  ARG B CA  
1806 C C   . ARG B 50  ? 0.5221 0.5261 0.6840 0.0467  0.0831  0.1804  27  ARG B C   
1807 O O   . ARG B 50  ? 0.5062 0.5115 0.6695 0.0423  0.0784  0.1672  27  ARG B O   
1808 C CB  . ARG B 50  ? 0.5062 0.5455 0.6487 0.0460  0.0595  0.1943  27  ARG B CB  
1809 C CG  . ARG B 50  ? 0.4965 0.5617 0.6348 0.0506  0.0439  0.2058  27  ARG B CG  
1810 C CD  . ARG B 50  ? 0.4348 0.5142 0.5590 0.0413  0.0316  0.1989  27  ARG B CD  
1811 N NE  . ARG B 50  ? 0.4547 0.5273 0.5628 0.0412  0.0351  0.2083  27  ARG B NE  
1812 C CZ  . ARG B 50  ? 0.4613 0.5479 0.5534 0.0411  0.0244  0.2169  27  ARG B CZ  
1813 N NH1 . ARG B 50  ? 0.4031 0.5140 0.4972 0.0404  0.0087  0.2162  27  ARG B NH1 
1814 N NH2 . ARG B 50  ? 0.5277 0.6016 0.5998 0.0407  0.0304  0.2255  27  ARG B NH2 
1815 N N   . TYR B 51  ? 0.5413 0.5246 0.7047 0.0449  0.0978  0.1797  28  TYR B N   
1816 C CA  . TYR B 51  ? 0.5489 0.5137 0.7195 0.0367  0.1075  0.1611  28  TYR B CA  
1817 C C   . TYR B 51  ? 0.5479 0.5086 0.7180 0.0263  0.1097  0.1502  28  TYR B C   
1818 O O   . TYR B 51  ? 0.5645 0.5146 0.7320 0.0273  0.1217  0.1598  28  TYR B O   
1819 C CB  . TYR B 51  ? 0.5789 0.5199 0.7589 0.0430  0.1275  0.1669  28  TYR B CB  
1820 C CG  . TYR B 51  ? 0.5765 0.5193 0.7624 0.0524  0.1288  0.1737  28  TYR B CG  
1821 C CD1 . TYR B 51  ? 0.5931 0.5479 0.7822 0.0654  0.1260  0.1949  28  TYR B CD1 
1822 C CD2 . TYR B 51  ? 0.5813 0.5137 0.7698 0.0481  0.1328  0.1584  28  TYR B CD2 
1823 C CE1 . TYR B 51  ? 0.5855 0.5440 0.7860 0.0740  0.1286  0.2001  28  TYR B CE1 
1824 C CE2 . TYR B 51  ? 0.5891 0.5213 0.7835 0.0560  0.1373  0.1638  28  TYR B CE2 
1825 C CZ  . TYR B 51  ? 0.5898 0.5363 0.7932 0.0689  0.1359  0.1845  28  TYR B CZ  
1826 O OH  . TYR B 51  ? 0.6179 0.5668 0.8332 0.0769  0.1414  0.1892  28  TYR B OH  
1827 N N   . ILE B 52  ? 0.5257 0.4936 0.6984 0.0166  0.0987  0.1305  29  ILE B N   
1828 C CA  . ILE B 52  ? 0.5120 0.4832 0.6892 0.0068  0.0971  0.1182  29  ILE B CA  
1829 C C   . ILE B 52  ? 0.5154 0.4777 0.7082 -0.0025 0.0987  0.0949  29  ILE B C   
1830 O O   . ILE B 52  ? 0.5021 0.4660 0.6941 -0.0038 0.0871  0.0833  29  ILE B O   
1831 C CB  . ILE B 52  ? 0.4889 0.4826 0.6585 0.0044  0.0777  0.1151  29  ILE B CB  
1832 C CG1 . ILE B 52  ? 0.4726 0.4792 0.6273 0.0117  0.0726  0.1349  29  ILE B CG1 
1833 C CG2 . ILE B 52  ? 0.4889 0.4863 0.6672 -0.0051 0.0775  0.1015  29  ILE B CG2 
1834 C CD1 . ILE B 52  ? 0.4372 0.4570 0.5870 0.0161  0.0589  0.1373  29  ILE B CD1 
1835 N N   . TYR B 53  ? 0.5232 0.4759 0.7291 -0.0097 0.1123  0.0875  30  TYR B N   
1836 C CA  . TYR B 53  ? 0.5241 0.4719 0.7509 -0.0199 0.1133  0.0635  30  TYR B CA  
1837 C C   . TYR B 53  ? 0.5104 0.4723 0.7509 -0.0280 0.1066  0.0504  30  TYR B C   
1838 O O   . TYR B 53  ? 0.5141 0.4733 0.7569 -0.0308 0.1203  0.0559  30  TYR B O   
1839 C CB  . TYR B 53  ? 0.5530 0.4773 0.7912 -0.0232 0.1379  0.0625  30  TYR B CB  
1840 C CG  . TYR B 53  ? 0.5812 0.5020 0.8454 -0.0355 0.1405  0.0363  30  TYR B CG  
1841 C CD1 . TYR B 53  ? 0.5922 0.5132 0.8609 -0.0385 0.1275  0.0188  30  TYR B CD1 
1842 C CD2 . TYR B 53  ? 0.6023 0.5194 0.8867 -0.0448 0.1558  0.0278  30  TYR B CD2 
1843 C CE1 . TYR B 53  ? 0.6177 0.5379 0.9120 -0.0500 0.1266  -0.0066 30  TYR B CE1 
1844 C CE2 . TYR B 53  ? 0.6101 0.5274 0.9251 -0.0568 0.1575  0.0015  30  TYR B CE2 
1845 C CZ  . TYR B 53  ? 0.6145 0.5347 0.9349 -0.0590 0.1412  -0.0156 30  TYR B CZ  
1846 O OH  . TYR B 53  ? 0.6397 0.5623 0.9908 -0.0707 0.1393  -0.0425 30  TYR B OH  
1847 N N   . ASN B 54  ? 0.5022 0.4769 0.7517 -0.0314 0.0869  0.0329  31  ASN B N   
1848 C CA  . ASN B 54  ? 0.4940 0.4858 0.7571 -0.0363 0.0765  0.0219  31  ASN B CA  
1849 C C   . ASN B 54  ? 0.4980 0.4956 0.7478 -0.0342 0.0829  0.0377  31  ASN B C   
1850 O O   . ASN B 54  ? 0.5280 0.5189 0.7872 -0.0396 0.1013  0.0375  31  ASN B O   
1851 C CB  . ASN B 54  ? 0.4932 0.4829 0.7897 -0.0468 0.0886  0.0033  31  ASN B CB  
1852 C CG  . ASN B 54  ? 0.5066 0.4905 0.8223 -0.0520 0.0852  -0.0161 31  ASN B CG  
1853 O OD1 . ASN B 54  ? 0.5314 0.5213 0.8437 -0.0501 0.0635  -0.0257 31  ASN B OD1 
1854 N ND2 . ASN B 54  ? 0.5184 0.4893 0.8544 -0.0598 0.1069  -0.0237 31  ASN B ND2 
1855 N N   . ARG B 55  ? 0.4832 0.4912 0.7110 -0.0277 0.0706  0.0506  32  ARG B N   
1856 C CA  . ARG B 55  ? 0.4877 0.5020 0.7039 -0.0283 0.0758  0.0613  32  ARG B CA  
1857 C C   . ARG B 55  ? 0.5105 0.5108 0.7111 -0.0263 0.0957  0.0797  32  ARG B C   
1858 O O   . ARG B 55  ? 0.5176 0.5207 0.7028 -0.0271 0.0993  0.0888  32  ARG B O   
1859 C CB  . ARG B 55  ? 0.4731 0.4943 0.7115 -0.0371 0.0784  0.0444  32  ARG B CB  
1860 C CG  . ARG B 55  ? 0.4719 0.5098 0.7158 -0.0370 0.0582  0.0342  32  ARG B CG  
1861 C CD  . ARG B 55  ? 0.4840 0.5299 0.7086 -0.0364 0.0570  0.0444  32  ARG B CD  
1862 N NE  . ARG B 55  ? 0.4800 0.5316 0.7238 -0.0437 0.0626  0.0308  32  ARG B NE  
1863 C CZ  . ARG B 55  ? 0.4576 0.5133 0.6876 -0.0463 0.0663  0.0353  32  ARG B CZ  
1864 N NH1 . ARG B 55  ? 0.4109 0.4674 0.6078 -0.0423 0.0630  0.0529  32  ARG B NH1 
1865 N NH2 . ARG B 55  ? 0.4678 0.5273 0.7186 -0.0531 0.0736  0.0210  32  ARG B NH2 
1866 N N   . GLU B 56  ? 0.5260 0.5091 0.7290 -0.0238 0.1089  0.0847  33  GLU B N   
1867 C CA  . GLU B 56  ? 0.5495 0.5145 0.7379 -0.0206 0.1285  0.1027  33  GLU B CA  
1868 C C   . GLU B 56  ? 0.5482 0.5086 0.7210 -0.0085 0.1260  0.1223  33  GLU B C   
1869 O O   . GLU B 56  ? 0.5512 0.4998 0.7335 -0.0060 0.1322  0.1202  33  GLU B O   
1870 C CB  . GLU B 56  ? 0.5679 0.5122 0.7757 -0.0283 0.1514  0.0924  33  GLU B CB  
1871 C CG  . GLU B 56  ? 0.6282 0.5494 0.8177 -0.0264 0.1743  0.1106  33  GLU B CG  
1872 C CD  . GLU B 56  ? 0.6812 0.5768 0.8879 -0.0328 0.2002  0.1032  33  GLU B CD  
1873 O OE1 . GLU B 56  ? 0.6881 0.5870 0.9256 -0.0441 0.2041  0.0791  33  GLU B OE1 
1874 O OE2 . GLU B 56  ? 0.6974 0.5693 0.8878 -0.0265 0.2166  0.1216  33  GLU B OE2 
1875 N N   . GLU B 57  ? 0.5454 0.5154 0.6961 -0.0011 0.1173  0.1404  34  GLU B N   
1876 C CA  . GLU B 57  ? 0.5441 0.5110 0.6845 0.0114  0.1162  0.1603  34  GLU B CA  
1877 C C   . GLU B 57  ? 0.5719 0.5118 0.7082 0.0150  0.1384  0.1727  34  GLU B C   
1878 O O   . GLU B 57  ? 0.5941 0.5226 0.7153 0.0124  0.1492  0.1800  34  GLU B O   
1879 C CB  . GLU B 57  ? 0.5435 0.5288 0.6642 0.0175  0.1008  0.1755  34  GLU B CB  
1880 C CG  . GLU B 57  ? 0.5611 0.5536 0.6812 0.0305  0.0931  0.1912  34  GLU B CG  
1881 C CD  . GLU B 57  ? 0.5792 0.5898 0.6814 0.0366  0.0786  0.2076  34  GLU B CD  
1882 O OE1 . GLU B 57  ? 0.5807 0.5956 0.6841 0.0486  0.0748  0.2237  34  GLU B OE1 
1883 O OE2 . GLU B 57  ? 0.5789 0.5999 0.6676 0.0294  0.0710  0.2035  34  GLU B OE2 
1884 N N   . PHE B 58  ? 0.5682 0.4943 0.7160 0.0204  0.1473  0.1744  35  PHE B N   
1885 C CA  . PHE B 58  ? 0.5999 0.4960 0.7462 0.0237  0.1709  0.1849  35  PHE B CA  
1886 C C   . PHE B 58  ? 0.6267 0.5158 0.7652 0.0402  0.1721  0.2090  35  PHE B C   
1887 O O   . PHE B 58  ? 0.6614 0.5258 0.7899 0.0466  0.1886  0.2253  35  PHE B O   
1888 C CB  . PHE B 58  ? 0.5958 0.4750 0.7653 0.0144  0.1865  0.1646  35  PHE B CB  
1889 C CG  . PHE B 58  ? 0.5493 0.4355 0.7331 0.0158  0.1777  0.1533  35  PHE B CG  
1890 C CD1 . PHE B 58  ? 0.5365 0.4070 0.7235 0.0252  0.1878  0.1630  35  PHE B CD1 
1891 C CD2 . PHE B 58  ? 0.5192 0.4246 0.7115 0.0078  0.1604  0.1329  35  PHE B CD2 
1892 C CE1 . PHE B 58  ? 0.5241 0.3976 0.7205 0.0254  0.1822  0.1516  35  PHE B CE1 
1893 C CE2 . PHE B 58  ? 0.4935 0.4009 0.6920 0.0086  0.1528  0.1227  35  PHE B CE2 
1894 C CZ  . PHE B 58  ? 0.4943 0.3856 0.6939 0.0167  0.1645  0.1316  35  PHE B CZ  
1895 N N   . VAL B 59  ? 0.6116 0.5211 0.7562 0.0474  0.1555  0.2109  36  VAL B N   
1896 C CA  . VAL B 59  ? 0.6321 0.5441 0.7744 0.0639  0.1518  0.2333  36  VAL B CA  
1897 C C   . VAL B 59  ? 0.6174 0.5625 0.7614 0.0682  0.1281  0.2349  36  VAL B C   
1898 O O   . VAL B 59  ? 0.5904 0.5513 0.7398 0.0590  0.1174  0.2169  36  VAL B O   
1899 C CB  . VAL B 59  ? 0.6464 0.5352 0.8051 0.0712  0.1700  0.2360  36  VAL B CB  
1900 C CG1 . VAL B 59  ? 0.6173 0.5148 0.7934 0.0677  0.1659  0.2186  36  VAL B CG1 
1901 C CG2 . VAL B 59  ? 0.6671 0.5514 0.8231 0.0901  0.1710  0.2635  36  VAL B CG2 
1902 N N   . ARG B 60  ? 0.6420 0.5964 0.7829 0.0825  0.1203  0.2565  37  ARG B N   
1903 C CA  . ARG B 60  ? 0.6281 0.6150 0.7711 0.0866  0.0983  0.2605  37  ARG B CA  
1904 C C   . ARG B 60  ? 0.6458 0.6389 0.7997 0.1044  0.0949  0.2816  37  ARG B C   
1905 O O   . ARG B 60  ? 0.6803 0.6583 0.8250 0.1149  0.1004  0.3006  37  ARG B O   
1906 C CB  . ARG B 60  ? 0.6306 0.6314 0.7501 0.0808  0.0844  0.2632  37  ARG B CB  
1907 C CG  . ARG B 60  ? 0.6230 0.6534 0.7394 0.0880  0.0627  0.2751  37  ARG B CG  
1908 C CD  . ARG B 60  ? 0.6508 0.6835 0.7364 0.0852  0.0540  0.2838  37  ARG B CD  
1909 N NE  . ARG B 60  ? 0.6701 0.6880 0.7412 0.0704  0.0642  0.2691  37  ARG B NE  
1910 C CZ  . ARG B 60  ? 0.7077 0.7247 0.7518 0.0631  0.0609  0.2697  37  ARG B CZ  
1911 N NH1 . ARG B 60  ? 0.7283 0.7578 0.7512 0.0686  0.0455  0.2845  37  ARG B NH1 
1912 N NH2 . ARG B 60  ? 0.7143 0.7177 0.7532 0.0498  0.0734  0.2542  37  ARG B NH2 
1913 N N   . PHE B 61  ? 0.6371 0.6519 0.8110 0.1082  0.0860  0.2785  38  PHE B N   
1914 C CA  . PHE B 61  ? 0.6552 0.6867 0.8446 0.1248  0.0771  0.2974  38  PHE B CA  
1915 C C   . PHE B 61  ? 0.6467 0.7136 0.8314 0.1234  0.0522  0.3000  38  PHE B C   
1916 O O   . PHE B 61  ? 0.6251 0.7112 0.8179 0.1147  0.0446  0.2854  38  PHE B O   
1917 C CB  . PHE B 61  ? 0.6453 0.6778 0.8658 0.1308  0.0867  0.2928  38  PHE B CB  
1918 C CG  . PHE B 61  ? 0.6639 0.7161 0.9083 0.1482  0.0782  0.3107  38  PHE B CG  
1919 C CD1 . PHE B 61  ? 0.7087 0.7433 0.9685 0.1648  0.0909  0.3269  38  PHE B CD1 
1920 C CD2 . PHE B 61  ? 0.6582 0.7472 0.9118 0.1485  0.0571  0.3113  38  PHE B CD2 
1921 C CE1 . PHE B 61  ? 0.7272 0.7824 1.0139 0.1827  0.0812  0.3441  38  PHE B CE1 
1922 C CE2 . PHE B 61  ? 0.6785 0.7898 0.9593 0.1646  0.0473  0.3268  38  PHE B CE2 
1923 C CZ  . PHE B 61  ? 0.7153 0.8106 1.0140 0.1826  0.0586  0.3436  38  PHE B CZ  
1924 N N   . ASP B 62  ? 0.6779 0.7515 0.8476 0.1318  0.0397  0.3184  39  ASP B N   
1925 C CA  . ASP B 62  ? 0.6756 0.7837 0.8425 0.1318  0.0148  0.3220  39  ASP B CA  
1926 C C   . ASP B 62  ? 0.6878 0.8146 0.8817 0.1506  0.0047  0.3398  39  ASP B C   
1927 O O   . ASP B 62  ? 0.7180 0.8285 0.9099 0.1657  0.0088  0.3592  39  ASP B O   
1928 C CB  . ASP B 62  ? 0.7045 0.8076 0.8317 0.1273  0.0054  0.3293  39  ASP B CB  
1929 C CG  . ASP B 62  ? 0.6976 0.8354 0.8179 0.1239  -0.0205 0.3293  39  ASP B CG  
1930 O OD1 . ASP B 62  ? 0.6789 0.8446 0.8243 0.1335  -0.0353 0.3360  39  ASP B OD1 
1931 O OD2 . ASP B 62  ? 0.7090 0.8462 0.8000 0.1108  -0.0253 0.3213  39  ASP B OD2 
1932 N N   . SER B 63  ? 0.6665 0.8271 0.8867 0.1496  -0.0081 0.3329  40  SER B N   
1933 C CA  . SER B 63  ? 0.6728 0.8569 0.9293 0.1667  -0.0177 0.3462  40  SER B CA  
1934 C C   . SER B 63  ? 0.7023 0.9032 0.9479 0.1788  -0.0419 0.3668  40  SER B C   
1935 O O   . SER B 63  ? 0.7222 0.9327 0.9950 0.1979  -0.0477 0.3834  40  SER B O   
1936 C CB  . SER B 63  ? 0.6384 0.8534 0.9286 0.1604  -0.0219 0.3311  40  SER B CB  
1937 O OG  . SER B 63  ? 0.6348 0.8833 0.9206 0.1549  -0.0465 0.3295  40  SER B OG  
1938 N N   . ASP B 64  ? 0.7085 0.9132 0.9155 0.1684  -0.0563 0.3652  41  ASP B N   
1939 C CA  . ASP B 64  ? 0.7527 0.9638 0.9344 0.1785  -0.0783 0.3853  41  ASP B CA  
1940 C C   . ASP B 64  ? 0.7950 0.9682 0.9592 0.1941  -0.0658 0.4070  41  ASP B C   
1941 O O   . ASP B 64  ? 0.8224 1.0004 1.0001 0.2147  -0.0764 0.4282  41  ASP B O   
1942 C CB  . ASP B 64  ? 0.7577 0.9695 0.8933 0.1617  -0.0893 0.3774  41  ASP B CB  
1943 C CG  . ASP B 64  ? 0.7542 1.0092 0.9013 0.1525  -0.1133 0.3658  41  ASP B CG  
1944 O OD1 . ASP B 64  ? 0.7694 1.0281 0.8787 0.1440  -0.1279 0.3653  41  ASP B OD1 
1945 O OD2 . ASP B 64  ? 0.7507 1.0339 0.9424 0.1525  -0.1160 0.3562  41  ASP B OD2 
1946 N N   . VAL B 65  ? 0.7982 0.9338 0.9344 0.1841  -0.0429 0.4009  42  VAL B N   
1947 C CA  . VAL B 65  ? 0.8342 0.9276 0.9569 0.1947  -0.0226 0.4162  42  VAL B CA  
1948 C C   . VAL B 65  ? 0.8384 0.9300 1.0057 0.2130  -0.0129 0.4255  42  VAL B C   
1949 O O   . VAL B 65  ? 0.8832 0.9588 1.0483 0.2322  -0.0134 0.4490  42  VAL B O   
1950 C CB  . VAL B 65  ? 0.8254 0.8849 0.9279 0.1771  0.0043  0.3996  42  VAL B CB  
1951 C CG1 . VAL B 65  ? 0.8571 0.8720 0.9502 0.1865  0.0285  0.4133  42  VAL B CG1 
1952 C CG2 . VAL B 65  ? 0.8161 0.8749 0.8765 0.1600  -0.0024 0.3908  42  VAL B CG2 
1953 N N   . GLY B 66  ? 0.8022 0.9073 1.0081 0.2073  -0.0031 0.4076  43  GLY B N   
1954 C CA  . GLY B 66  ? 0.8126 0.9181 1.0641 0.2234  0.0077  0.4138  43  GLY B CA  
1955 C C   . GLY B 66  ? 0.8229 0.8888 1.0814 0.2230  0.0405  0.4087  43  GLY B C   
1956 O O   . GLY B 66  ? 0.8167 0.8818 1.1139 0.2336  0.0527  0.4095  43  GLY B O   
1957 N N   . GLU B 67  ? 0.8370 0.8702 1.0601 0.2103  0.0556  0.4022  44  GLU B N   
1958 C CA  . GLU B 67  ? 0.8472 0.8417 1.0736 0.2065  0.0865  0.3943  44  GLU B CA  
1959 C C   . GLU B 67  ? 0.8347 0.8112 1.0301 0.1846  0.0965  0.3759  44  GLU B C   
1960 O O   . GLU B 67  ? 0.8233 0.8168 0.9961 0.1732  0.0807  0.3696  44  GLU B O   
1961 C CB  . GLU B 67  ? 0.8991 0.8602 1.1232 0.2255  0.0998  0.4185  44  GLU B CB  
1962 C CG  . GLU B 67  ? 0.9550 0.9126 1.1455 0.2367  0.0823  0.4437  44  GLU B CG  
1963 C CD  . GLU B 67  ? 1.0319 0.9442 1.2079 0.2517  0.1007  0.4659  44  GLU B CD  
1964 O OE1 . GLU B 67  ? 1.0551 0.9304 1.2057 0.2398  0.1235  0.4596  44  GLU B OE1 
1965 O OE2 . GLU B 67  ? 1.0606 0.9739 1.2514 0.2754  0.0924  0.4897  44  GLU B OE2 
1966 N N   . PHE B 68  ? 0.8413 0.7843 1.0381 0.1784  0.1227  0.3662  45  PHE B N   
1967 C CA  . PHE B 68  ? 0.8280 0.7570 1.0044 0.1573  0.1323  0.3455  45  PHE B CA  
1968 C C   . PHE B 68  ? 0.8559 0.7646 0.9963 0.1539  0.1350  0.3553  45  PHE B C   
1969 O O   . PHE B 68  ? 0.9018 0.7859 1.0306 0.1670  0.1432  0.3769  45  PHE B O   
1970 C CB  . PHE B 68  ? 0.8220 0.7249 1.0141 0.1499  0.1575  0.3286  45  PHE B CB  
1971 C CG  . PHE B 68  ? 0.7971 0.7182 1.0143 0.1459  0.1553  0.3114  45  PHE B CG  
1972 C CD1 . PHE B 68  ? 0.7575 0.6967 0.9693 0.1292  0.1449  0.2895  45  PHE B CD1 
1973 C CD2 . PHE B 68  ? 0.8005 0.7192 1.0458 0.1592  0.1643  0.3176  45  PHE B CD2 
1974 C CE1 . PHE B 68  ? 0.7244 0.6759 0.9532 0.1253  0.1438  0.2746  45  PHE B CE1 
1975 C CE2 . PHE B 68  ? 0.7795 0.7120 1.0444 0.1544  0.1648  0.3013  45  PHE B CE2 
1976 C CZ  . PHE B 68  ? 0.7491 0.6967 1.0031 0.1372  0.1544  0.2801  45  PHE B CZ  
1977 N N   . ARG B 69  ? 0.8329 0.7507 0.9548 0.1367  0.1286  0.3400  46  ARG B N   
1978 C CA  . ARG B 69  ? 0.8632 0.7603 0.9507 0.1300  0.1350  0.3449  46  ARG B CA  
1979 C C   . ARG B 69  ? 0.8499 0.7351 0.9389 0.1097  0.1504  0.3192  46  ARG B C   
1980 O O   . ARG B 69  ? 0.8152 0.7238 0.9118 0.0972  0.1396  0.2989  46  ARG B O   
1981 C CB  . ARG B 69  ? 0.8640 0.7847 0.9251 0.1294  0.1108  0.3528  46  ARG B CB  
1982 C CG  . ARG B 69  ? 0.9004 0.8311 0.9547 0.1494  0.0932  0.3799  46  ARG B CG  
1983 C CD  . ARG B 69  ? 0.9703 0.8664 0.9878 0.1584  0.1015  0.4034  46  ARG B CD  
1984 N NE  . ARG B 69  ? 1.0136 0.9200 1.0291 0.1805  0.0820  0.4301  46  ARG B NE  
1985 C CZ  . ARG B 69  ? 1.0443 0.9436 1.0870 0.1997  0.0866  0.4450  46  ARG B CZ  
1986 N NH1 . ARG B 69  ? 1.0481 0.9278 1.1184 0.1982  0.1116  0.4352  46  ARG B NH1 
1987 N NH2 . ARG B 69  ? 1.0673 0.9793 1.1107 0.2206  0.0658  0.4692  46  ARG B NH2 
1988 N N   . ALA B 70  ? 0.8757 0.7239 0.9595 0.1070  0.1759  0.3201  47  ALA B N   
1989 C CA  . ALA B 70  ? 0.8617 0.6970 0.9492 0.0881  0.1919  0.2966  47  ALA B CA  
1990 C C   . ALA B 70  ? 0.8600 0.7049 0.9218 0.0780  0.1832  0.2937  47  ALA B C   
1991 O O   . ALA B 70  ? 0.8999 0.7306 0.9310 0.0835  0.1847  0.3128  47  ALA B O   
1992 C CB  . ALA B 70  ? 0.8953 0.6876 0.9814 0.0881  0.2222  0.3011  47  ALA B CB  
1993 N N   . VAL B 71  ? 0.8204 0.6878 0.8927 0.0639  0.1738  0.2705  48  VAL B N   
1994 C CA  . VAL B 71  ? 0.8194 0.6951 0.8712 0.0528  0.1682  0.2644  48  VAL B CA  
1995 C C   . VAL B 71  ? 0.8399 0.6884 0.8909 0.0393  0.1938  0.2523  48  VAL B C   
1996 O O   . VAL B 71  ? 0.8585 0.6988 0.8856 0.0324  0.1995  0.2540  48  VAL B O   
1997 C CB  . VAL B 71  ? 0.7738 0.6845 0.8390 0.0445  0.1474  0.2453  48  VAL B CB  
1998 C CG1 . VAL B 71  ? 0.7745 0.6961 0.8157 0.0365  0.1387  0.2435  48  VAL B CG1 
1999 C CG2 . VAL B 71  ? 0.7613 0.6965 0.8373 0.0559  0.1275  0.2524  48  VAL B CG2 
2000 N N   . THR B 72  ? 0.8430 0.6771 0.9208 0.0349  0.2101  0.2390  49  THR B N   
2001 C CA  . THR B 72  ? 0.8625 0.6736 0.9504 0.0205  0.2354  0.2230  49  THR B CA  
2002 C C   . THR B 72  ? 0.8910 0.6686 0.9876 0.0252  0.2592  0.2294  49  THR B C   
2003 O O   . THR B 72  ? 0.8862 0.6645 0.9908 0.0373  0.2541  0.2386  49  THR B O   
2004 C CB  . THR B 72  ? 0.8250 0.6579 0.9457 0.0063  0.2283  0.1913  49  THR B CB  
2005 O OG1 . THR B 72  ? 0.8129 0.6670 0.9259 -0.0013 0.2156  0.1831  49  THR B OG1 
2006 C CG2 . THR B 72  ? 0.8505 0.6617 0.9953 -0.0068 0.2537  0.1721  49  THR B CG2 
2007 N N   . GLU B 73  ? 0.9260 0.6737 1.0236 0.0149  0.2872  0.2232  50  GLU B N   
2008 C CA  . GLU B 73  ? 0.9621 0.6750 1.0702 0.0171  0.3132  0.2266  50  GLU B CA  
2009 C C   . GLU B 73  ? 0.9327 0.6543 1.0767 0.0147  0.3108  0.2075  50  GLU B C   
2010 O O   . GLU B 73  ? 0.9616 0.6574 1.1130 0.0203  0.3279  0.2133  50  GLU B O   
2011 C CB  . GLU B 73  ? 1.0011 0.6804 1.1064 0.0036  0.3458  0.2201  50  GLU B CB  
2012 C CG  . GLU B 73  ? 1.0780 0.7157 1.1445 0.0141  0.3660  0.2506  50  GLU B CG  
2013 C CD  . GLU B 73  ? 1.1328 0.7387 1.2063 0.0250  0.3838  0.2630  50  GLU B CD  
2014 O OE1 . GLU B 73  ? 1.1373 0.7315 1.2430 0.0141  0.4025  0.2423  50  GLU B OE1 
2015 O OE2 . GLU B 73  ? 1.1673 0.7598 1.2152 0.0445  0.3788  0.2929  50  GLU B OE2 
2016 N N   . LEU B 74  ? 0.8825 0.6375 1.0459 0.0065  0.2901  0.1852  51  LEU B N   
2017 C CA  . LEU B 74  ? 0.8564 0.6228 1.0449 0.0054  0.2814  0.1684  51  LEU B CA  
2018 C C   . LEU B 74  ? 0.8537 0.6279 1.0340 0.0228  0.2677  0.1868  51  LEU B C   
2019 O O   . LEU B 74  ? 0.8348 0.6121 1.0307 0.0238  0.2644  0.1767  51  LEU B O   
2020 C CB  . LEU B 74  ? 0.8136 0.6134 1.0174 -0.0055 0.2590  0.1438  51  LEU B CB  
2021 C CG  . LEU B 74  ? 0.7878 0.5907 1.0205 -0.0233 0.2641  0.1126  51  LEU B CG  
2022 C CD1 . LEU B 74  ? 0.7425 0.5797 0.9823 -0.0257 0.2342  0.0975  51  LEU B CD1 
2023 C CD2 . LEU B 74  ? 0.7698 0.5509 1.0230 -0.0288 0.2815  0.0989  51  LEU B CD2 
2024 N N   . GLY B 75  ? 0.8706 0.6491 1.0268 0.0359  0.2590  0.2126  52  GLY B N   
2025 C CA  . GLY B 75  ? 0.8766 0.6668 1.0298 0.0530  0.2448  0.2302  52  GLY B CA  
2026 C C   . GLY B 75  ? 0.9206 0.6801 1.0726 0.0673  0.2636  0.2510  52  GLY B C   
2027 O O   . GLY B 75  ? 0.9171 0.6819 1.0799 0.0794  0.2586  0.2584  52  GLY B O   
2028 N N   . ARG B 76  ? 0.9642 0.6900 1.1035 0.0660  0.2867  0.2603  53  ARG B N   
2029 C CA  . ARG B 76  ? 1.0163 0.7065 1.1523 0.0800  0.3074  0.2814  53  ARG B CA  
2030 C C   . ARG B 76  ? 1.0161 0.6993 1.1795 0.0852  0.3158  0.2744  53  ARG B C   
2031 O O   . ARG B 76  ? 1.0306 0.7114 1.1958 0.1038  0.3128  0.2949  53  ARG B O   
2032 C CB  . ARG B 76  ? 1.0601 0.7095 1.1834 0.0718  0.3374  0.2834  53  ARG B CB  
2033 C CG  . ARG B 76  ? 1.1149 0.7204 1.2441 0.0801  0.3667  0.2946  53  ARG B CG  
2034 C CD  . ARG B 76  ? 1.1811 0.7557 1.2776 0.0975  0.3752  0.3300  53  ARG B CD  
2035 N NE  . ARG B 76  ? 1.2263 0.7849 1.2922 0.0873  0.3848  0.3332  53  ARG B NE  
2036 C CZ  . ARG B 76  ? 1.2356 0.8063 1.2671 0.0933  0.3661  0.3506  53  ARG B CZ  
2037 N NH1 . ARG B 76  ? 1.2232 0.8247 1.2495 0.1098  0.3352  0.3664  53  ARG B NH1 
2038 N NH2 . ARG B 76  ? 1.2659 0.8158 1.2684 0.0825  0.3803  0.3517  53  ARG B NH2 
2039 N N   . PRO B 77  ? 1.0055 0.6859 1.1907 0.0688  0.3255  0.2450  54  PRO B N   
2040 C CA  . PRO B 77  ? 1.0065 0.6767 1.2131 0.0725  0.3351  0.2373  54  PRO B CA  
2041 C C   . PRO B 77  ? 0.9798 0.6790 1.1928 0.0844  0.3133  0.2424  54  PRO B C   
2042 O O   . PRO B 77  ? 0.9910 0.6792 1.2190 0.0919  0.3231  0.2427  54  PRO B O   
2043 C CB  . PRO B 77  ? 0.9912 0.6613 1.2144 0.0504  0.3411  0.2021  54  PRO B CB  
2044 C CG  . PRO B 77  ? 1.0059 0.6673 1.2221 0.0376  0.3504  0.1968  54  PRO B CG  
2045 C CD  . PRO B 77  ? 0.9950 0.6771 1.1874 0.0466  0.3309  0.2178  54  PRO B CD  
2046 N N   . ASP B 78  ? 0.9485 0.6829 1.1512 0.0856  0.2862  0.2459  55  ASP B N   
2047 C CA  . ASP B 78  ? 0.9205 0.6843 1.1303 0.0950  0.2657  0.2496  55  ASP B CA  
2048 C C   . ASP B 78  ? 0.9377 0.7103 1.1421 0.1163  0.2559  0.2806  55  ASP B C   
2049 O O   . ASP B 78  ? 0.9379 0.7133 1.1586 0.1300  0.2566  0.2898  55  ASP B O   
2050 C CB  . ASP B 78  ? 0.8758 0.6733 1.0811 0.0825  0.2418  0.2315  55  ASP B CB  
2051 C CG  . ASP B 78  ? 0.8523 0.6443 1.0660 0.0641  0.2470  0.2009  55  ASP B CG  
2052 O OD1 . ASP B 78  ? 0.8088 0.6118 1.0177 0.0509  0.2383  0.1866  55  ASP B OD1 
2053 O OD2 . ASP B 78  ? 0.8573 0.6331 1.0832 0.0631  0.2600  0.1907  55  ASP B OD2 
2054 N N   . GLU B 79  ? 0.9565 0.7330 1.1384 0.1188  0.2469  0.2959  56  GLU B N   
2055 C CA  . GLU B 79  ? 0.9844 0.7690 1.1575 0.1386  0.2343  0.3254  56  GLU B CA  
2056 C C   . GLU B 79  ? 1.0377 0.7905 1.2205 0.1560  0.2542  0.3447  56  GLU B C   
2057 O O   . GLU B 79  ? 1.0427 0.8072 1.2394 0.1745  0.2452  0.3618  56  GLU B O   
2058 C CB  . GLU B 79  ? 0.9964 0.7808 1.1364 0.1366  0.2256  0.3376  56  GLU B CB  
2059 C CG  . GLU B 79  ? 1.0096 0.8069 1.1377 0.1565  0.2067  0.3665  56  GLU B CG  
2060 C CD  . GLU B 79  ? 1.0480 0.8314 1.1361 0.1566  0.2041  0.3824  56  GLU B CD  
2061 O OE1 . GLU B 79  ? 1.0521 0.8467 1.1230 0.1406  0.1976  0.3689  56  GLU B OE1 
2062 O OE2 . GLU B 79  ? 1.1008 0.8604 1.1732 0.1732  0.2087  0.4089  56  GLU B OE2 
2063 N N   . GLU B 80  ? 1.0828 0.7954 1.2615 0.1498  0.2820  0.3411  57  GLU B N   
2064 C CA  . GLU B 80  ? 1.1418 0.8185 1.3298 0.1654  0.3046  0.3583  57  GLU B CA  
2065 C C   . GLU B 80  ? 1.1378 0.8161 1.3598 0.1706  0.3130  0.3486  57  GLU B C   
2066 O O   . GLU B 80  ? 1.1646 0.8356 1.4008 0.1914  0.3165  0.3689  57  GLU B O   
2067 C CB  . GLU B 80  ? 1.1800 0.8104 1.3546 0.1560  0.3350  0.3559  57  GLU B CB  
2068 C CG  . GLU B 80  ? 1.1875 0.8073 1.3785 0.1334  0.3536  0.3222  57  GLU B CG  
2069 C CD  . GLU B 80  ? 1.2626 0.8371 1.4442 0.1233  0.3853  0.3196  57  GLU B CD  
2070 O OE1 . GLU B 80  ? 1.3002 0.8611 1.4542 0.1240  0.3878  0.3348  57  GLU B OE1 
2071 O OE2 . GLU B 80  ? 1.2775 0.8284 1.4784 0.1138  0.4090  0.3013  57  GLU B OE2 
2072 N N   . TYR B 81  ? 1.1172 0.8043 1.3516 0.1526  0.3159  0.3183  58  TYR B N   
2073 C CA  . TYR B 81  ? 1.1229 0.8062 1.3841 0.1552  0.3271  0.3068  58  TYR B CA  
2074 C C   . TYR B 81  ? 1.1052 0.8236 1.3819 0.1688  0.3066  0.3157  58  TYR B C   
2075 O O   . TYR B 81  ? 1.1188 0.8306 1.4187 0.1841  0.3164  0.3251  58  TYR B O   
2076 C CB  . TYR B 81  ? 1.1018 0.7854 1.3665 0.1319  0.3323  0.2717  58  TYR B CB  
2077 C CG  . TYR B 81  ? 1.1103 0.7850 1.3962 0.1329  0.3460  0.2584  58  TYR B CG  
2078 C CD1 . TYR B 81  ? 1.1507 0.7847 1.4467 0.1309  0.3772  0.2515  58  TYR B CD1 
2079 C CD2 . TYR B 81  ? 1.0783 0.7825 1.3729 0.1350  0.3302  0.2521  58  TYR B CD2 
2080 C CE1 . TYR B 81  ? 1.1524 0.7756 1.4651 0.1308  0.3917  0.2379  58  TYR B CE1 
2081 C CE2 . TYR B 81  ? 1.0848 0.7775 1.3955 0.1349  0.3455  0.2393  58  TYR B CE2 
2082 C CZ  . TYR B 81  ? 1.1249 0.7771 1.4437 0.1327  0.3760  0.2320  58  TYR B CZ  
2083 O OH  . TYR B 81  ? 1.1206 0.7589 1.4525 0.1317  0.3929  0.2182  58  TYR B OH  
2084 N N   . TRP B 82  ? 1.0796 0.8352 1.3459 0.1625  0.2795  0.3112  59  TRP B N   
2085 C CA  . TRP B 82  ? 1.0592 0.8506 1.3419 0.1693  0.2610  0.3117  59  TRP B CA  
2086 C C   . TRP B 82  ? 1.0703 0.8768 1.3634 0.1932  0.2482  0.3419  59  TRP B C   
2087 O O   . TRP B 82  ? 1.0616 0.8871 1.3820 0.2048  0.2437  0.3460  59  TRP B O   
2088 C CB  . TRP B 82  ? 1.0257 0.8484 1.2945 0.1525  0.2387  0.2934  59  TRP B CB  
2089 C CG  . TRP B 82  ? 1.0354 0.8546 1.3076 0.1354  0.2457  0.2635  59  TRP B CG  
2090 C CD1 . TRP B 82  ? 1.0426 0.8776 1.3275 0.1348  0.2418  0.2532  59  TRP B CD1 
2091 C CD2 . TRP B 82  ? 1.0570 0.8550 1.3182 0.1170  0.2570  0.2407  59  TRP B CD2 
2092 N NE1 . TRP B 82  ? 1.0445 0.8667 1.3213 0.1177  0.2491  0.2267  59  TRP B NE1 
2093 C CE2 . TRP B 82  ? 1.0482 0.8497 1.3125 0.1068  0.2569  0.2182  59  TRP B CE2 
2094 C CE3 . TRP B 82  ? 1.1054 0.8812 1.3554 0.1077  0.2678  0.2364  59  TRP B CE3 
2095 C CZ2 . TRP B 82  ? 1.0605 0.8461 1.3162 0.0888  0.2634  0.1922  59  TRP B CZ2 
2096 C CZ3 . TRP B 82  ? 1.1143 0.8768 1.3620 0.0889  0.2758  0.2090  59  TRP B CZ3 
2097 C CH2 . TRP B 82  ? 1.0948 0.8632 1.3449 0.0802  0.2717  0.1875  59  TRP B CH2 
2098 N N   . ASN B 83  ? 1.0931 0.8897 1.3651 0.2008  0.2432  0.3626  60  ASN B N   
2099 C CA  . ASN B 83  ? 1.1129 0.9202 1.3905 0.2248  0.2290  0.3930  60  ASN B CA  
2100 C C   . ASN B 83  ? 1.1496 0.9292 1.4519 0.2459  0.2492  0.4105  60  ASN B C   
2101 O O   . ASN B 83  ? 1.1727 0.9586 1.4833 0.2685  0.2377  0.4370  60  ASN B O   
2102 C CB  . ASN B 83  ? 1.1320 0.9368 1.3714 0.2255  0.2147  0.4097  60  ASN B CB  
2103 C CG  . ASN B 83  ? 1.0925 0.9352 1.3154 0.2115  0.1882  0.3983  60  ASN B CG  
2104 O OD1 . ASN B 83  ? 1.0659 0.9442 1.3088 0.2094  0.1727  0.3880  60  ASN B OD1 
2105 N ND2 . ASN B 83  ? 1.1040 0.9370 1.2903 0.2016  0.1850  0.3997  60  ASN B ND2 
2106 N N   . SER B 84  ? 1.1565 0.9052 1.4707 0.2384  0.2785  0.3948  61  SER B N   
2107 C CA  . SER B 84  ? 1.1849 0.9109 1.5304 0.2555  0.3004  0.4038  61  SER B CA  
2108 C C   . SER B 84  ? 1.1573 0.8921 1.5272 0.2437  0.3113  0.3763  61  SER B C   
2109 O O   . SER B 84  ? 1.1603 0.8665 1.5263 0.2284  0.3351  0.3553  61  SER B O   
2110 C CB  . SER B 84  ? 1.2289 0.9011 1.5615 0.2563  0.3303  0.4100  61  SER B CB  
2111 O OG  . SER B 84  ? 1.2189 0.8748 1.5313 0.2299  0.3431  0.3839  61  SER B OG  
2112 N N   . GLN B 85  ? 1.1307 0.9046 1.5239 0.2500  0.2937  0.3759  62  GLN B N   
2113 C CA  . GLN B 85  ? 1.1035 0.8913 1.5097 0.2357  0.2983  0.3491  62  GLN B CA  
2114 C C   . GLN B 85  ? 1.0795 0.9144 1.5098 0.2443  0.2752  0.3541  62  GLN B C   
2115 O O   . GLN B 85  ? 1.0455 0.8997 1.4781 0.2308  0.2710  0.3339  62  GLN B O   
2116 C CB  . GLN B 85  ? 1.0767 0.8634 1.4492 0.2087  0.2938  0.3242  62  GLN B CB  
2117 C CG  . GLN B 85  ? 1.0538 0.8410 1.4285 0.1916  0.3024  0.2948  62  GLN B CG  
2118 C CD  . GLN B 85  ? 1.0724 0.8199 1.4578 0.1896  0.3355  0.2831  62  GLN B CD  
2119 O OE1 . GLN B 85  ? 1.0979 0.8153 1.4903 0.2001  0.3541  0.2960  62  GLN B OE1 
2120 N NE2 . GLN B 85  ? 1.0540 0.7986 1.4381 0.1757  0.3439  0.2582  62  GLN B NE2 
2121 N N   . LYS B 86  ? 1.0983 0.9491 1.5466 0.2672  0.2610  0.3813  63  LYS B N   
2122 C CA  . LYS B 86  ? 1.0791 0.9784 1.5514 0.2772  0.2340  0.3900  63  LYS B CA  
2123 C C   . LYS B 86  ? 1.0402 0.9677 1.5353 0.2667  0.2335  0.3685  63  LYS B C   
2124 O O   . LYS B 86  ? 1.0118 0.9798 1.5120 0.2648  0.2085  0.3686  63  LYS B O   
2125 C CB  . LYS B 86  ? 1.1115 1.0160 1.6175 0.3074  0.2291  0.4193  63  LYS B CB  
2126 C CG  . LYS B 86  ? 1.1514 1.0391 1.7031 0.3212  0.2570  0.4190  63  LYS B CG  
2127 C CD  . LYS B 86  ? 1.2066 1.0375 1.7451 0.3201  0.2911  0.4175  63  LYS B CD  
2128 C CE  . LYS B 86  ? 1.2168 1.0299 1.7874 0.3175  0.3238  0.3989  63  LYS B CE  
2129 N NZ  . LYS B 86  ? 1.1784 1.0056 1.7388 0.2921  0.3258  0.3675  63  LYS B NZ  
2130 N N   . ASP B 87  ? 1.0399 0.9442 1.5465 0.2592  0.2619  0.3499  64  ASP B N   
2131 C CA  . ASP B 87  ? 1.0099 0.9325 1.5316 0.2477  0.2662  0.3286  64  ASP B CA  
2132 C C   . ASP B 87  ? 0.9749 0.9114 1.4591 0.2244  0.2495  0.3104  64  ASP B C   
2133 O O   . ASP B 87  ? 0.9501 0.9149 1.4434 0.2177  0.2399  0.3006  64  ASP B O   
2134 C CB  . ASP B 87  ? 1.0292 0.9167 1.5621 0.2432  0.3021  0.3119  64  ASP B CB  
2135 C CG  . ASP B 87  ? 1.0232 0.8788 1.5122 0.2194  0.3137  0.2885  64  ASP B CG  
2136 O OD1 . ASP B 87  ? 1.0401 0.8696 1.5057 0.2167  0.3176  0.2921  64  ASP B OD1 
2137 O OD2 . ASP B 87  ? 1.0059 0.8622 1.4843 0.2033  0.3189  0.2664  64  ASP B OD2 
2138 N N   . ILE B 88  ? 0.9730 0.8878 1.4174 0.2123  0.2479  0.3057  65  ILE B N   
2139 C CA  . ILE B 88  ? 0.9389 0.8651 1.3475 0.1925  0.2302  0.2915  65  ILE B CA  
2140 C C   . ILE B 88  ? 0.9218 0.8814 1.3237 0.1978  0.1998  0.3077  65  ILE B C   
2141 O O   . ILE B 88  ? 0.8915 0.8783 1.2841 0.1874  0.1815  0.2991  65  ILE B O   
2142 C CB  . ILE B 88  ? 0.9482 0.8384 1.3233 0.1772  0.2424  0.2779  65  ILE B CB  
2143 C CG1 . ILE B 88  ? 0.9398 0.8185 1.3006 0.1582  0.2519  0.2497  65  ILE B CG1 
2144 C CG2 . ILE B 88  ? 0.9292 0.8272 1.2743 0.1699  0.2227  0.2821  65  ILE B CG2 
2145 C CD1 . ILE B 88  ? 0.9574 0.8183 1.3402 0.1619  0.2775  0.2417  65  ILE B CD1 
2146 N N   . LEU B 89  ? 0.9403 0.8954 1.3453 0.2142  0.1953  0.3312  66  LEU B N   
2147 C CA  . LEU B 89  ? 0.9318 0.9136 1.3252 0.2202  0.1669  0.3481  66  LEU B CA  
2148 C C   . LEU B 89  ? 0.9138 0.9401 1.3388 0.2290  0.1471  0.3536  66  LEU B C   
2149 O O   . LEU B 89  ? 0.9031 0.9578 1.3177 0.2291  0.1209  0.3612  66  LEU B O   
2150 C CB  . LEU B 89  ? 0.9676 0.9280 1.3535 0.2371  0.1688  0.3734  66  LEU B CB  
2151 C CG  . LEU B 89  ? 0.9651 0.9434 1.3277 0.2429  0.1413  0.3920  66  LEU B CG  
2152 C CD1 . LEU B 89  ? 0.9461 0.9070 1.2632 0.2247  0.1413  0.3832  66  LEU B CD1 
2153 C CD2 . LEU B 89  ? 0.9940 0.9597 1.3649 0.2680  0.1401  0.4218  66  LEU B CD2 
2154 N N   . GLU B 90  ? 0.9139 0.9463 1.3787 0.2357  0.1607  0.3488  67  GLU B N   
2155 C CA  . GLU B 90  ? 0.9020 0.9778 1.4039 0.2433  0.1444  0.3520  67  GLU B CA  
2156 C C   . GLU B 90  ? 0.8645 0.9573 1.3583 0.2225  0.1414  0.3286  67  GLU B C   
2157 O O   . GLU B 90  ? 0.8501 0.9801 1.3522 0.2200  0.1194  0.3285  67  GLU B O   
2158 C CB  . GLU B 90  ? 0.9222 1.0010 1.4785 0.2635  0.1592  0.3611  67  GLU B CB  
2159 C CG  . GLU B 90  ? 0.9473 0.9937 1.5163 0.2589  0.1951  0.3453  67  GLU B CG  
2160 C CD  . GLU B 90  ? 0.9960 1.0434 1.6212 0.2812  0.2111  0.3564  67  GLU B CD  
2161 O OE1 . GLU B 90  ? 1.0009 1.0878 1.6690 0.2947  0.1953  0.3659  67  GLU B OE1 
2162 O OE2 . GLU B 90  ? 1.0216 1.0306 1.6508 0.2852  0.2400  0.3545  67  GLU B OE2 
2163 N N   . GLU B 91  ? 0.8564 0.9197 1.3305 0.2071  0.1626  0.3088  68  GLU B N   
2164 C CA  . GLU B 91  ? 0.8225 0.8934 1.2802 0.1869  0.1611  0.2866  68  GLU B CA  
2165 C C   . GLU B 91  ? 0.7922 0.8807 1.2174 0.1754  0.1356  0.2849  68  GLU B C   
2166 O O   . GLU B 91  ? 0.7791 0.8910 1.2042 0.1656  0.1246  0.2751  68  GLU B O   
2167 C CB  . GLU B 91  ? 0.8299 0.8619 1.2635 0.1730  0.1849  0.2669  68  GLU B CB  
2168 C CG  . GLU B 91  ? 0.8297 0.8661 1.2585 0.1582  0.1902  0.2466  68  GLU B CG  
2169 C CD  . GLU B 91  ? 0.8393 0.8470 1.2238 0.1394  0.1952  0.2272  68  GLU B CD  
2170 O OE1 . GLU B 91  ? 0.8326 0.8490 1.1987 0.1263  0.1864  0.2147  68  GLU B OE1 
2171 O OE2 . GLU B 91  ? 0.8638 0.8405 1.2327 0.1379  0.2072  0.2243  68  GLU B OE2 
2172 N N   . GLU B 92  ? 0.7910 0.8656 1.1883 0.1759  0.1286  0.2936  69  GLU B N   
2173 C CA  . GLU B 92  ? 0.7627 0.8527 1.1303 0.1669  0.1055  0.2941  69  GLU B CA  
2174 C C   . GLU B 92  ? 0.7515 0.8798 1.1372 0.1778  0.0815  0.3099  69  GLU B C   
2175 O O   . GLU B 92  ? 0.7322 0.8844 1.1054 0.1681  0.0625  0.3046  69  GLU B O   
2176 C CB  . GLU B 92  ? 0.7794 0.8418 1.1151 0.1650  0.1084  0.2995  69  GLU B CB  
2177 C CG  . GLU B 92  ? 0.7942 0.8202 1.1139 0.1535  0.1302  0.2827  69  GLU B CG  
2178 C CD  . GLU B 92  ? 0.7596 0.7860 1.0526 0.1334  0.1236  0.2619  69  GLU B CD  
2179 O OE1 . GLU B 92  ? 0.7598 0.7701 1.0498 0.1241  0.1363  0.2443  69  GLU B OE1 
2180 O OE2 . GLU B 92  ? 0.7486 0.7900 1.0229 0.1274  0.1058  0.2631  69  GLU B OE2 
2181 N N   . ARG B 93  ? 0.7581 0.8924 1.1744 0.1981  0.0817  0.3285  70  ARG B N   
2182 C CA  . ARG B 93  ? 0.7505 0.9234 1.1883 0.2107  0.0562  0.3440  70  ARG B CA  
2183 C C   . ARG B 93  ? 0.7170 0.9296 1.1899 0.2064  0.0473  0.3334  70  ARG B C   
2184 O O   . ARG B 93  ? 0.7082 0.9555 1.1844 0.2061  0.0216  0.3374  70  ARG B O   
2185 C CB  . ARG B 93  ? 0.7822 0.9501 1.2452 0.2355  0.0574  0.3677  70  ARG B CB  
2186 C CG  . ARG B 93  ? 0.8147 0.9614 1.2405 0.2430  0.0491  0.3869  70  ARG B CG  
2187 C CD  . ARG B 93  ? 0.8545 1.0136 1.3061 0.2692  0.0353  0.4134  70  ARG B CD  
2188 N NE  . ARG B 93  ? 0.9165 1.0423 1.3332 0.2795  0.0363  0.4340  70  ARG B NE  
2189 C CZ  . ARG B 93  ? 0.9530 1.0390 1.3719 0.2898  0.0610  0.4428  70  ARG B CZ  
2190 N NH1 . ARG B 93  ? 0.9502 1.0253 1.4041 0.2910  0.0865  0.4319  70  ARG B NH1 
2191 N NH2 . ARG B 93  ? 0.9864 1.0406 1.3703 0.2982  0.0622  0.4619  70  ARG B NH2 
2192 N N   . ALA B 94  ? 0.6955 0.9003 1.1911 0.2016  0.0698  0.3187  71  ALA B N   
2193 C CA  . ALA B 94  ? 0.6670 0.9027 1.1964 0.1956  0.0689  0.3062  71  ALA B CA  
2194 C C   . ALA B 94  ? 0.6386 0.8800 1.1396 0.1728  0.0635  0.2867  71  ALA B C   
2195 O O   . ALA B 94  ? 0.6238 0.8959 1.1486 0.1675  0.0561  0.2792  71  ALA B O   
2196 C CB  . ALA B 94  ? 0.6721 0.8935 1.2362 0.2004  0.0981  0.2992  71  ALA B CB  
2197 N N   . VAL B 95  ? 0.6276 0.8396 1.0809 0.1598  0.0676  0.2784  72  VAL B N   
2198 C CA  . VAL B 95  ? 0.6055 0.8182 1.0301 0.1398  0.0630  0.2609  72  VAL B CA  
2199 C C   . VAL B 95  ? 0.5867 0.8389 1.0183 0.1344  0.0389  0.2603  72  VAL B C   
2200 O O   . VAL B 95  ? 0.5733 0.8343 1.0086 0.1220  0.0420  0.2456  72  VAL B O   
2201 C CB  . VAL B 95  ? 0.6060 0.7875 0.9808 0.1292  0.0639  0.2550  72  VAL B CB  
2202 C CG1 . VAL B 95  ? 0.5814 0.7626 0.9303 0.1105  0.0594  0.2373  72  VAL B CG1 
2203 C CG2 . VAL B 95  ? 0.6141 0.7573 0.9823 0.1318  0.0874  0.2524  72  VAL B CG2 
2204 N N   . PRO B 96  ? 0.5901 0.8634 1.0202 0.1430  0.0157  0.2757  73  PRO B N   
2205 C CA  . PRO B 96  ? 0.5773 0.8827 1.0027 0.1340  -0.0076 0.2718  73  PRO B CA  
2206 C C   . PRO B 96  ? 0.5634 0.9021 1.0339 0.1324  -0.0086 0.2642  73  PRO B C   
2207 O O   . PRO B 96  ? 0.5513 0.9106 1.0190 0.1194  -0.0196 0.2536  73  PRO B O   
2208 C CB  . PRO B 96  ? 0.5952 0.9139 1.0150 0.1473  -0.0295 0.2919  73  PRO B CB  
2209 C CG  . PRO B 96  ? 0.6186 0.8987 1.0131 0.1548  -0.0166 0.3019  73  PRO B CG  
2210 C CD  . PRO B 96  ? 0.6117 0.8718 1.0304 0.1579  0.0106  0.2954  73  PRO B CD  
2211 N N   . ASP B 97  ? 0.5679 0.9100 1.0811 0.1450  0.0052  0.2687  74  ASP B N   
2212 C CA  . ASP B 97  ? 0.5616 0.9366 1.1268 0.1457  0.0067  0.2624  74  ASP B CA  
2213 C C   . ASP B 97  ? 0.5545 0.9082 1.1340 0.1396  0.0386  0.2484  74  ASP B C   
2214 O O   . ASP B 97  ? 0.5524 0.9282 1.1779 0.1396  0.0470  0.2417  74  ASP B O   
2215 C CB  . ASP B 97  ? 0.5807 0.9858 1.1930 0.1672  -0.0073 0.2800  74  ASP B CB  
2216 C CG  . ASP B 97  ? 0.6097 1.0379 1.2041 0.1717  -0.0416 0.2929  74  ASP B CG  
2217 O OD1 . ASP B 97  ? 0.6155 1.0540 1.1821 0.1557  -0.0558 0.2834  74  ASP B OD1 
2218 O OD2 . ASP B 97  ? 0.6564 1.0900 1.2618 0.1912  -0.0540 0.3126  74  ASP B OD2 
2219 N N   . ARG B 98  ? 0.5505 0.8607 1.0904 0.1339  0.0567  0.2431  75  ARG B N   
2220 C CA  . ARG B 98  ? 0.5414 0.8258 1.0757 0.1227  0.0841  0.2266  75  ARG B CA  
2221 C C   . ARG B 98  ? 0.5175 0.7836 1.0000 0.1034  0.0805  0.2134  75  ARG B C   
2222 O O   . ARG B 98  ? 0.4996 0.7866 0.9843 0.0927  0.0709  0.2057  75  ARG B O   
2223 C CB  . ARG B 98  ? 0.5614 0.8091 1.0932 0.1308  0.1088  0.2286  75  ARG B CB  
2224 C CG  . ARG B 98  ? 0.6069 0.8691 1.1927 0.1509  0.1158  0.2413  75  ARG B CG  
2225 C CD  . ARG B 98  ? 0.6798 0.9311 1.2976 0.1500  0.1475  0.2300  75  ARG B CD  
2226 N NE  . ARG B 98  ? 0.7349 0.9856 1.3969 0.1698  0.1607  0.2413  75  ARG B NE  
2227 C CZ  . ARG B 98  ? 0.7789 0.9961 1.4250 0.1786  0.1724  0.2484  75  ARG B CZ  
2228 N NH1 . ARG B 98  ? 0.7757 0.9593 1.3644 0.1690  0.1717  0.2450  75  ARG B NH1 
2229 N NH2 . ARG B 98  ? 0.7882 1.0053 1.4782 0.1971  0.1854  0.2587  75  ARG B NH2 
2230 N N   . MET B 99  ? 0.5039 0.7326 0.9429 0.0996  0.0871  0.2107  76  MET B N   
2231 C CA  . MET B 99  ? 0.4878 0.6951 0.8811 0.0831  0.0862  0.1973  76  MET B CA  
2232 C C   . MET B 99  ? 0.4698 0.7022 0.8523 0.0751  0.0626  0.1966  76  MET B C   
2233 O O   . MET B 99  ? 0.4590 0.6923 0.8317 0.0625  0.0636  0.1851  76  MET B O   
2234 C CB  . MET B 99  ? 0.4951 0.6660 0.8497 0.0822  0.0906  0.1962  76  MET B CB  
2235 C CG  . MET B 99  ? 0.4785 0.6265 0.7881 0.0674  0.0881  0.1827  76  MET B CG  
2236 S SD  . MET B 99  ? 0.5014 0.6124 0.7753 0.0670  0.0912  0.1804  76  MET B SD  
2237 C CE  . MET B 99  ? 0.4343 0.5653 0.7015 0.0698  0.0676  0.1914  76  MET B CE  
2238 N N   . CYS B 100 ? 0.4699 0.7203 0.8524 0.0822  0.0428  0.2089  77  CYS B N   
2239 C CA  . CYS B 100 ? 0.4599 0.7304 0.8263 0.0739  0.0209  0.2075  77  CYS B CA  
2240 C C   . CYS B 100 ? 0.4498 0.7520 0.8451 0.0676  0.0161  0.2010  77  CYS B C   
2241 O O   . CYS B 100 ? 0.4526 0.7545 0.8304 0.0535  0.0133  0.1894  77  CYS B O   
2242 C CB  . CYS B 100 ? 0.4636 0.7487 0.8269 0.0835  0.0019  0.2228  77  CYS B CB  
2243 S SG  . CYS B 100 ? 0.4927 0.7420 0.8180 0.0869  0.0060  0.2288  77  CYS B SG  
2244 N N   . ARG B 101 ? 0.4445 0.7739 0.8864 0.0783  0.0154  0.2081  78  ARG B N   
2245 C CA  . ARG B 101 ? 0.4333 0.7967 0.9104 0.0721  0.0110  0.2008  78  ARG B CA  
2246 C C   . ARG B 101 ? 0.4260 0.7726 0.9079 0.0608  0.0359  0.1854  78  ARG B C   
2247 O O   . ARG B 101 ? 0.4243 0.7831 0.9090 0.0475  0.0343  0.1743  78  ARG B O   
2248 C CB  . ARG B 101 ? 0.4407 0.8416 0.9719 0.0874  0.0012  0.2122  78  ARG B CB  
2249 C CG  . ARG B 101 ? 0.4495 0.8952 1.0088 0.0814  -0.0190 0.2077  78  ARG B CG  
2250 C CD  . ARG B 101 ? 0.4832 0.9675 1.0937 0.0986  -0.0347 0.2204  78  ARG B CD  
2251 N NE  . ARG B 101 ? 0.5360 1.0200 1.1224 0.1113  -0.0566 0.2384  78  ARG B NE  
2252 C CZ  . ARG B 101 ? 0.5645 1.0798 1.1507 0.1135  -0.0869 0.2449  78  ARG B CZ  
2253 N NH1 . ARG B 101 ? 0.5358 1.0888 1.1487 0.1033  -0.1005 0.2338  78  ARG B NH1 
2254 N NH2 . ARG B 101 ? 0.5927 1.0996 1.1499 0.1253  -0.1031 0.2623  78  ARG B NH2 
2255 N N   . HIS B 102 ? 0.4229 0.7390 0.9029 0.0650  0.0598  0.1842  79  HIS B N   
2256 C CA  . HIS B 102 ? 0.4200 0.7118 0.8922 0.0534  0.0847  0.1698  79  HIS B CA  
2257 C C   . HIS B 102 ? 0.4121 0.6852 0.8366 0.0372  0.0797  0.1595  79  HIS B C   
2258 O O   . HIS B 102 ? 0.4156 0.6981 0.8467 0.0254  0.0828  0.1497  79  HIS B O   
2259 C CB  . HIS B 102 ? 0.4338 0.6870 0.8942 0.0588  0.1093  0.1693  79  HIS B CB  
2260 C CG  . HIS B 102 ? 0.4578 0.6803 0.9008 0.0465  0.1351  0.1549  79  HIS B CG  
2261 N ND1 . HIS B 102 ? 0.4586 0.6903 0.9404 0.0442  0.1560  0.1482  79  HIS B ND1 
2262 C CD2 . HIS B 102 ? 0.4768 0.6580 0.8660 0.0360  0.1432  0.1460  79  HIS B CD2 
2263 C CE1 . HIS B 102 ? 0.4771 0.6715 0.9256 0.0321  0.1777  0.1363  79  HIS B CE1 
2264 N NE2 . HIS B 102 ? 0.4899 0.6532 0.8807 0.0276  0.1688  0.1353  79  HIS B NE2 
2265 N N   . ASN B 103 ? 0.3979 0.6453 0.7773 0.0368  0.0722  0.1615  80  ASN B N   
2266 C CA  . ASN B 103 ? 0.3897 0.6149 0.7244 0.0236  0.0688  0.1521  80  ASN B CA  
2267 C C   . ASN B 103 ? 0.3777 0.6300 0.7140 0.0152  0.0500  0.1495  80  ASN B C   
2268 O O   . ASN B 103 ? 0.3826 0.6230 0.6980 0.0029  0.0527  0.1395  80  ASN B O   
2269 C CB  . ASN B 103 ? 0.3782 0.5727 0.6718 0.0261  0.0648  0.1539  80  ASN B CB  
2270 C CG  . ASN B 103 ? 0.3931 0.5550 0.6781 0.0303  0.0853  0.1521  80  ASN B CG  
2271 O OD1 . ASN B 103 ? 0.4283 0.5811 0.7249 0.0280  0.1049  0.1466  80  ASN B OD1 
2272 N ND2 . ASN B 103 ? 0.3781 0.5214 0.6434 0.0357  0.0825  0.1556  80  ASN B ND2 
2273 N N   . TYR B 104 ? 0.3689 0.6560 0.7287 0.0220  0.0314  0.1585  81  TYR B N   
2274 C CA  . TYR B 104 ? 0.3546 0.6667 0.7124 0.0138  0.0122  0.1557  81  TYR B CA  
2275 C C   . TYR B 104 ? 0.3628 0.6907 0.7454 0.0024  0.0200  0.1444  81  TYR B C   
2276 O O   . TYR B 104 ? 0.3705 0.6867 0.7300 -0.0110 0.0215  0.1341  81  TYR B O   
2277 C CB  . TYR B 104 ? 0.3469 0.6918 0.7249 0.0244  -0.0083 0.1682  81  TYR B CB  
2278 C CG  . TYR B 104 ? 0.3425 0.7149 0.7177 0.0160  -0.0295 0.1652  81  TYR B CG  
2279 C CD1 . TYR B 104 ? 0.3300 0.7440 0.7466 0.0155  -0.0404 0.1644  81  TYR B CD1 
2280 C CD2 . TYR B 104 ? 0.3384 0.6961 0.6715 0.0082  -0.0387 0.1620  81  TYR B CD2 
2281 C CE1 . TYR B 104 ? 0.3141 0.7535 0.7269 0.0068  -0.0606 0.1602  81  TYR B CE1 
2282 C CE2 . TYR B 104 ? 0.3444 0.7257 0.6733 -0.0004 -0.0566 0.1580  81  TYR B CE2 
2283 C CZ  . TYR B 104 ? 0.3428 0.7648 0.7103 -0.0014 -0.0679 0.1571  81  TYR B CZ  
2284 O OH  . TYR B 104 ? 0.3517 0.7976 0.7150 -0.0110 -0.0861 0.1516  81  TYR B OH  
2285 N N   . GLU B 105 ? 0.3573 0.7095 0.7883 0.0078  0.0271  0.1458  82  GLU B N   
2286 C CA  . GLU B 105 ? 0.3601 0.7324 0.8242 -0.0028 0.0354  0.1347  82  GLU B CA  
2287 C C   . GLU B 105 ? 0.3665 0.7002 0.8117 -0.0126 0.0641  0.1240  82  GLU B C   
2288 O O   . GLU B 105 ? 0.3724 0.7081 0.8238 -0.0264 0.0730  0.1124  82  GLU B O   
2289 C CB  . GLU B 105 ? 0.3613 0.7745 0.8894 0.0072  0.0334  0.1392  82  GLU B CB  
2290 C CG  . GLU B 105 ? 0.3854 0.8428 0.9522 -0.0022 0.0204  0.1309  82  GLU B CG  
2291 C CD  . GLU B 105 ? 0.4604 0.9415 1.0903 -0.0028 0.0380  0.1236  82  GLU B CD  
2292 O OE1 . GLU B 105 ? 0.4729 0.9720 1.1435 0.0130  0.0381  0.1326  82  GLU B OE1 
2293 O OE2 . GLU B 105 ? 0.4883 0.9697 1.1294 -0.0189 0.0528  0.1086  82  GLU B OE2 
2294 N N   . LEU B 106 ? 0.3663 0.6634 0.7871 -0.0061 0.0791  0.1275  83  LEU B N   
2295 C CA  . LEU B 106 ? 0.3771 0.6305 0.7665 -0.0150 0.1042  0.1183  83  LEU B CA  
2296 C C   . LEU B 106 ? 0.3831 0.6144 0.7252 -0.0265 0.0967  0.1123  83  LEU B C   
2297 O O   . LEU B 106 ? 0.3965 0.6150 0.7310 -0.0389 0.1097  0.1028  83  LEU B O   
2298 C CB  . LEU B 106 ? 0.3848 0.6015 0.7490 -0.0063 0.1171  0.1226  83  LEU B CB  
2299 C CG  . LEU B 106 ? 0.3848 0.5552 0.7189 -0.0130 0.1452  0.1142  83  LEU B CG  
2300 C CD1 . LEU B 106 ? 0.3573 0.4867 0.6331 -0.0118 0.1402  0.1151  83  LEU B CD1 
2301 C CD2 . LEU B 106 ? 0.3928 0.5556 0.7215 -0.0283 0.1578  0.1034  83  LEU B CD2 
2302 N N   . GLY B 107 ? 0.3761 0.6021 0.6882 -0.0224 0.0771  0.1179  84  GLY B N   
2303 C CA  . GLY B 107 ? 0.3980 0.6015 0.6664 -0.0312 0.0695  0.1127  84  GLY B CA  
2304 C C   . GLY B 107 ? 0.3983 0.6257 0.6773 -0.0423 0.0595  0.1064  84  GLY B C   
2305 O O   . GLY B 107 ? 0.4102 0.6148 0.6577 -0.0514 0.0605  0.1000  84  GLY B O   
2306 N N   . GLY B 108 ? 0.3953 0.6677 0.7193 -0.0413 0.0500  0.1080  85  GLY B N   
2307 C CA  . GLY B 108 ? 0.3858 0.6893 0.7254 -0.0515 0.0361  0.1019  85  GLY B CA  
2308 C C   . GLY B 108 ? 0.4019 0.6896 0.7254 -0.0678 0.0452  0.0894  85  GLY B C   
2309 O O   . GLY B 108 ? 0.3964 0.6814 0.6963 -0.0741 0.0327  0.0862  85  GLY B O   
2310 N N   . PRO B 109 ? 0.4232 0.6982 0.7593 -0.0752 0.0690  0.0821  86  PRO B N   
2311 C CA  . PRO B 109 ? 0.4443 0.7039 0.7700 -0.0915 0.0813  0.0701  86  PRO B CA  
2312 C C   . PRO B 109 ? 0.4608 0.6753 0.7286 -0.0951 0.0815  0.0691  86  PRO B C   
2313 O O   . PRO B 109 ? 0.4692 0.6767 0.7282 -0.1077 0.0845  0.0605  86  PRO B O   
2314 C CB  . PRO B 109 ? 0.4625 0.7077 0.8065 -0.0955 0.1111  0.0652  86  PRO B CB  
2315 C CG  . PRO B 109 ? 0.4591 0.6931 0.8000 -0.0807 0.1155  0.0750  86  PRO B CG  
2316 C CD  . PRO B 109 ? 0.4294 0.7001 0.7894 -0.0688 0.0888  0.0843  86  PRO B CD  
2317 N N   . MET B 110 ? 0.4653 0.6508 0.6975 -0.0841 0.0781  0.0771  87  MET B N   
2318 C CA  . MET B 110 ? 0.4766 0.6230 0.6576 -0.0843 0.0735  0.0772  87  MET B CA  
2319 C C   . MET B 110 ? 0.4584 0.6174 0.6285 -0.0773 0.0490  0.0822  87  MET B C   
2320 O O   . MET B 110 ? 0.4524 0.5828 0.5863 -0.0752 0.0434  0.0826  87  MET B O   
2321 C CB  . MET B 110 ? 0.4980 0.5983 0.6430 -0.0785 0.0873  0.0804  87  MET B CB  
2322 C CG  . MET B 110 ? 0.5411 0.6203 0.6878 -0.0859 0.1148  0.0755  87  MET B CG  
2323 S SD  . MET B 110 ? 0.5586 0.5699 0.6403 -0.0889 0.1293  0.0741  87  MET B SD  
2324 C CE  . MET B 110 ? 0.6362 0.6482 0.7202 -0.1038 0.1327  0.0660  87  MET B CE  
2325 N N   . THR B 111 ? 0.4431 0.6439 0.6450 -0.0737 0.0350  0.0859  88  THR B N   
2326 C CA  . THR B 111 ? 0.4436 0.6564 0.6365 -0.0669 0.0149  0.0915  88  THR B CA  
2327 C C   . THR B 111 ? 0.4429 0.6944 0.6562 -0.0733 -0.0005 0.0886  88  THR B C   
2328 O O   . THR B 111 ? 0.4474 0.6944 0.6439 -0.0815 -0.0065 0.0821  88  THR B O   
2329 C CB  . THR B 111 ? 0.4381 0.6566 0.6396 -0.0528 0.0118  0.1023  88  THR B CB  
2330 O OG1 . THR B 111 ? 0.4532 0.6978 0.6945 -0.0502 0.0182  0.1048  88  THR B OG1 
2331 C CG2 . THR B 111 ? 0.4360 0.6132 0.6069 -0.0464 0.0214  0.1043  88  THR B CG2 
2332 N N   . LEU B 112 ? 0.4390 0.7272 0.6877 -0.0691 -0.0072 0.0933  89  LEU B N   
2333 C CA  . LEU B 112 ? 0.4376 0.7649 0.7069 -0.0749 -0.0234 0.0904  89  LEU B CA  
2334 C C   . LEU B 112 ? 0.4472 0.7762 0.7233 -0.0914 -0.0158 0.0764  89  LEU B C   
2335 O O   . LEU B 112 ? 0.4595 0.7971 0.7264 -0.1009 -0.0258 0.0693  89  LEU B O   
2336 C CB  . LEU B 112 ? 0.4375 0.8025 0.7498 -0.0672 -0.0297 0.0969  89  LEU B CB  
2337 C CG  . LEU B 112 ? 0.4477 0.8172 0.7641 -0.0498 -0.0365 0.1121  89  LEU B CG  
2338 C CD1 . LEU B 112 ? 0.4602 0.7899 0.7532 -0.0420 -0.0211 0.1167  89  LEU B CD1 
2339 C CD2 . LEU B 112 ? 0.4471 0.8520 0.8139 -0.0434 -0.0381 0.1161  89  LEU B CD2 
2340 N N   . GLN B 113 ? 0.4560 0.7744 0.7473 -0.0956 0.0040  0.0716  90  GLN B N   
2341 C CA  . GLN B 113 ? 0.4674 0.7838 0.7664 -0.1122 0.0153  0.0579  90  GLN B CA  
2342 C C   . GLN B 113 ? 0.4675 0.7392 0.7228 -0.1187 0.0248  0.0530  90  GLN B C   
2343 O O   . GLN B 113 ? 0.4773 0.7401 0.7341 -0.1323 0.0366  0.0424  90  GLN B O   
2344 C CB  . GLN B 113 ? 0.4805 0.8019 0.8146 -0.1158 0.0359  0.0537  90  GLN B CB  
2345 C CG  . GLN B 113 ? 0.5096 0.8807 0.8974 -0.1253 0.0303  0.0444  90  GLN B CG  
2346 C CD  . GLN B 113 ? 0.5403 0.9535 0.9682 -0.1123 0.0151  0.0532  90  GLN B CD  
2347 O OE1 . GLN B 113 ? 0.5612 0.9647 0.9786 -0.0965 0.0123  0.0665  90  GLN B OE1 
2348 N NE2 . GLN B 113 ? 0.5413 1.0012 1.0169 -0.1187 0.0048  0.0457  90  GLN B NE2 
2349 N N   . ARG B 114 ? 0.4640 0.7074 0.6826 -0.1089 0.0198  0.0605  91  ARG B N   
2350 C CA  . ARG B 114 ? 0.4727 0.6722 0.6514 -0.1124 0.0274  0.0571  91  ARG B CA  
2351 C C   . ARG B 114 ? 0.4601 0.6647 0.6289 -0.1211 0.0170  0.0496  91  ARG B C   
2352 O O   . ARG B 114 ? 0.4438 0.6645 0.6085 -0.1170 0.0002  0.0523  91  ARG B O   
2353 C CB  . ARG B 114 ? 0.4794 0.6470 0.6258 -0.0989 0.0253  0.0661  91  ARG B CB  
2354 C CG  . ARG B 114 ? 0.5062 0.6308 0.6146 -0.1009 0.0301  0.0629  91  ARG B CG  
2355 C CD  . ARG B 114 ? 0.5402 0.6313 0.6187 -0.0888 0.0296  0.0699  91  ARG B CD  
2356 N NE  . ARG B 114 ? 0.5724 0.6453 0.6262 -0.0860 0.0186  0.0687  91  ARG B NE  
2357 C CZ  . ARG B 114 ? 0.5931 0.6266 0.6165 -0.0859 0.0229  0.0668  91  ARG B CZ  
2358 N NH1 . ARG B 114 ? 0.6220 0.6248 0.6285 -0.0893 0.0392  0.0666  91  ARG B NH1 
2359 N NH2 . ARG B 114 ? 0.5949 0.6183 0.6045 -0.0820 0.0113  0.0655  91  ARG B NH2 
2360 N N   . ARG B 115 ? 0.4668 0.6546 0.6301 -0.1337 0.0293  0.0398  92  ARG B N   
2361 C CA  . ARG B 115 ? 0.4668 0.6612 0.6257 -0.1443 0.0224  0.0303  92  ARG B CA  
2362 C C   . ARG B 115 ? 0.4793 0.6271 0.6077 -0.1485 0.0360  0.0263  92  ARG B C   
2363 O O   . ARG B 115 ? 0.4967 0.6242 0.6249 -0.1555 0.0546  0.0225  92  ARG B O   
2364 C CB  . ARG B 115 ? 0.4694 0.7042 0.6652 -0.1588 0.0209  0.0196  92  ARG B CB  
2365 C CG  . ARG B 115 ? 0.4688 0.7519 0.6956 -0.1527 0.0035  0.0250  92  ARG B CG  
2366 C CD  . ARG B 115 ? 0.5360 0.8612 0.7888 -0.1662 -0.0090 0.0137  92  ARG B CD  
2367 N NE  . ARG B 115 ? 0.5387 0.9101 0.8332 -0.1634 -0.0199 0.0161  92  ARG B NE  
2368 C CZ  . ARG B 115 ? 0.5332 0.9247 0.8321 -0.1488 -0.0363 0.0289  92  ARG B CZ  
2369 N NH1 . ARG B 115 ? 0.5298 0.8993 0.7943 -0.1370 -0.0420 0.0396  92  ARG B NH1 
2370 N NH2 . ARG B 115 ? 0.4996 0.9324 0.8390 -0.1456 -0.0464 0.0310  92  ARG B NH2 
2371 N N   . VAL B 116 ? 0.4649 0.5939 0.5674 -0.1428 0.0274  0.0278  93  VAL B N   
2372 C CA  . VAL B 116 ? 0.4695 0.5534 0.5424 -0.1433 0.0367  0.0258  93  VAL B CA  
2373 C C   . VAL B 116 ? 0.4633 0.5536 0.5350 -0.1515 0.0306  0.0162  93  VAL B C   
2374 O O   . VAL B 116 ? 0.4452 0.5573 0.5200 -0.1479 0.0157  0.0167  93  VAL B O   
2375 C CB  . VAL B 116 ? 0.4674 0.5203 0.5125 -0.1267 0.0318  0.0364  93  VAL B CB  
2376 C CG1 . VAL B 116 ? 0.4945 0.4992 0.5083 -0.1248 0.0388  0.0357  93  VAL B CG1 
2377 C CG2 . VAL B 116 ? 0.4717 0.5211 0.5182 -0.1201 0.0381  0.0443  93  VAL B CG2 
2378 N N   . GLN B 117 ? 0.4786 0.5461 0.5436 -0.1627 0.0441  0.0074  94  GLN B N   
2379 C CA  . GLN B 117 ? 0.4901 0.5645 0.5585 -0.1749 0.0433  -0.0050 94  GLN B CA  
2380 C C   . GLN B 117 ? 0.5005 0.5522 0.5479 -0.1676 0.0373  -0.0048 94  GLN B C   
2381 O O   . GLN B 117 ? 0.5299 0.5435 0.5554 -0.1562 0.0404  0.0022  94  GLN B O   
2382 C CB  . GLN B 117 ? 0.5234 0.5768 0.5930 -0.1897 0.0634  -0.0147 94  GLN B CB  
2383 C CG  . GLN B 117 ? 0.5179 0.5936 0.6140 -0.1991 0.0727  -0.0176 94  GLN B CG  
2384 C CD  . GLN B 117 ? 0.5366 0.6148 0.6483 -0.2197 0.0870  -0.0334 94  GLN B CD  
2385 O OE1 . GLN B 117 ? 0.5379 0.5926 0.6353 -0.2267 0.0934  -0.0412 94  GLN B OE1 
2386 N NE2 . GLN B 117 ? 0.5563 0.6634 0.7004 -0.2301 0.0932  -0.0393 94  GLN B NE2 
2387 N N   . PRO B 118 ? 0.4874 0.5616 0.5411 -0.1740 0.0287  -0.0132 95  PRO B N   
2388 C CA  . PRO B 118 ? 0.4896 0.5432 0.5278 -0.1665 0.0249  -0.0136 95  PRO B CA  
2389 C C   . PRO B 118 ? 0.5248 0.5383 0.5504 -0.1708 0.0394  -0.0201 95  PRO B C   
2390 O O   . PRO B 118 ? 0.5462 0.5552 0.5768 -0.1854 0.0525  -0.0288 95  PRO B O   
2391 C CB  . PRO B 118 ? 0.4794 0.5667 0.5261 -0.1751 0.0155  -0.0222 95  PRO B CB  
2392 C CG  . PRO B 118 ? 0.4682 0.5861 0.5322 -0.1907 0.0163  -0.0299 95  PRO B CG  
2393 C CD  . PRO B 118 ? 0.4706 0.5894 0.5443 -0.1863 0.0205  -0.0214 95  PRO B CD  
2394 N N   . ARG B 119 ? 0.5401 0.5237 0.5512 -0.1580 0.0374  -0.0159 96  ARG B N   
2395 C CA  . ARG B 119 ? 0.5925 0.5386 0.5931 -0.1607 0.0496  -0.0222 96  ARG B CA  
2396 C C   . ARG B 119 ? 0.5863 0.5420 0.5929 -0.1629 0.0456  -0.0318 96  ARG B C   
2397 O O   . ARG B 119 ? 0.5729 0.5488 0.5843 -0.1548 0.0330  -0.0284 96  ARG B O   
2398 C CB  . ARG B 119 ? 0.6186 0.5198 0.5984 -0.1437 0.0506  -0.0102 96  ARG B CB  
2399 C CG  . ARG B 119 ? 0.6679 0.5660 0.6385 -0.1367 0.0488  0.0021  96  ARG B CG  
2400 C CD  . ARG B 119 ? 0.7755 0.6229 0.7173 -0.1234 0.0523  0.0128  96  ARG B CD  
2401 N NE  . ARG B 119 ? 0.8757 0.6882 0.8047 -0.1332 0.0721  0.0092  96  ARG B NE  
2402 C CZ  . ARG B 119 ? 0.9213 0.7376 0.8548 -0.1487 0.0886  0.0049  96  ARG B CZ  
2403 N NH1 . ARG B 119 ? 0.9039 0.7600 0.8567 -0.1553 0.0861  0.0039  96  ARG B NH1 
2404 N NH2 . ARG B 119 ? 0.9547 0.7347 0.8759 -0.1576 0.1085  0.0011  96  ARG B NH2 
2405 N N   . VAL B 120 ? 0.6163 0.5567 0.6228 -0.1746 0.0582  -0.0444 97  VAL B N   
2406 C CA  . VAL B 120 ? 0.6231 0.5732 0.6350 -0.1807 0.0583  -0.0569 97  VAL B CA  
2407 C C   . VAL B 120 ? 0.6460 0.5567 0.6538 -0.1766 0.0695  -0.0625 97  VAL B C   
2408 O O   . VAL B 120 ? 0.6716 0.5522 0.6733 -0.1821 0.0837  -0.0658 97  VAL B O   
2409 C CB  . VAL B 120 ? 0.6192 0.6008 0.6386 -0.2036 0.0616  -0.0720 97  VAL B CB  
2410 C CG1 . VAL B 120 ? 0.5863 0.6113 0.6124 -0.2045 0.0463  -0.0668 97  VAL B CG1 
2411 C CG2 . VAL B 120 ? 0.6634 0.6315 0.6843 -0.2180 0.0764  -0.0788 97  VAL B CG2 
2412 N N   . ASN B 121 ? 0.6454 0.5558 0.6581 -0.1668 0.0641  -0.0636 98  ASN B N   
2413 C CA  . ASN B 121 ? 0.6808 0.5568 0.6952 -0.1611 0.0740  -0.0692 98  ASN B CA  
2414 C C   . ASN B 121 ? 0.6822 0.5722 0.7065 -0.1673 0.0773  -0.0829 98  ASN B C   
2415 O O   . ASN B 121 ? 0.6663 0.5841 0.6954 -0.1646 0.0672  -0.0815 98  ASN B O   
2416 C CB  . ASN B 121 ? 0.6885 0.5377 0.7010 -0.1367 0.0649  -0.0545 98  ASN B CB  
2417 C CG  . ASN B 121 ? 0.7189 0.5434 0.7422 -0.1260 0.0691  -0.0596 98  ASN B CG  
2418 O OD1 . ASN B 121 ? 0.7023 0.5439 0.7413 -0.1211 0.0639  -0.0640 98  ASN B OD1 
2419 N ND2 . ASN B 121 ? 0.7490 0.5318 0.7654 -0.1220 0.0797  -0.0587 98  ASN B ND2 
2420 N N   . VAL B 122 ? 0.7153 0.5828 0.7411 -0.1758 0.0936  -0.0962 99  VAL B N   
2421 C CA  . VAL B 122 ? 0.7275 0.6033 0.7599 -0.1846 0.1014  -0.1118 99  VAL B CA  
2422 C C   . VAL B 122 ? 0.7636 0.6045 0.8081 -0.1721 0.1114  -0.1151 99  VAL B C   
2423 O O   . VAL B 122 ? 0.7896 0.5957 0.8316 -0.1699 0.1217  -0.1147 99  VAL B O   
2424 C CB  . VAL B 122 ? 0.7407 0.6258 0.7648 -0.2111 0.1137  -0.1295 99  VAL B CB  
2425 C CG1 . VAL B 122 ? 0.7497 0.6346 0.7757 -0.2209 0.1253  -0.1472 99  VAL B CG1 
2426 C CG2 . VAL B 122 ? 0.7189 0.6438 0.7360 -0.2224 0.1011  -0.1271 99  VAL B CG2 
2427 N N   . SER B 123 ? 0.7717 0.6209 0.8303 -0.1640 0.1095  -0.1185 100 SER B N   
2428 C CA  . SER B 123 ? 0.8138 0.6351 0.8916 -0.1505 0.1179  -0.1224 100 SER B CA  
2429 C C   . SER B 123 ? 0.8419 0.6742 0.9323 -0.1573 0.1290  -0.1384 100 SER B C   
2430 O O   . SER B 123 ? 0.8261 0.6888 0.9113 -0.1648 0.1239  -0.1405 100 SER B O   
2431 C CB  . SER B 123 ? 0.7970 0.6118 0.8874 -0.1242 0.1005  -0.1055 100 SER B CB  
2432 O OG  . SER B 123 ? 0.8113 0.6017 0.8881 -0.1158 0.0950  -0.0923 100 SER B OG  
2433 N N   . PRO B 124 ? 0.8919 0.6968 0.9988 -0.1541 0.1454  -0.1493 101 PRO B N   
2434 C CA  . PRO B 124 ? 0.9170 0.7268 1.0407 -0.1573 0.1587  -0.1643 101 PRO B CA  
2435 C C   . PRO B 124 ? 0.9156 0.7413 1.0642 -0.1391 0.1471  -0.1573 101 PRO B C   
2436 O O   . PRO B 124 ? 0.8905 0.7244 1.0424 -0.1232 0.1264  -0.1404 101 PRO B O   
2437 C CB  . PRO B 124 ? 0.9508 0.7222 1.0910 -0.1532 0.1778  -0.1742 101 PRO B CB  
2438 C CG  . PRO B 124 ? 0.9596 0.7055 1.0953 -0.1398 0.1688  -0.1588 101 PRO B CG  
2439 C CD  . PRO B 124 ? 0.9259 0.6914 1.0327 -0.1517 0.1572  -0.1504 101 PRO B CD  
2440 N N   . SER B 125 ? 0.9481 0.7774 1.1135 -0.1431 0.1622  -0.1720 102 SER B N   
2441 C CA  . SER B 125 ? 0.9578 0.7992 1.1557 -0.1273 0.1575  -0.1703 102 SER B CA  
2442 C C   . SER B 125 ? 0.9946 0.8298 1.2143 -0.1334 0.1824  -0.1903 102 SER B C   
2443 O O   . SER B 125 ? 0.9863 0.8401 1.2176 -0.1341 0.1856  -0.1944 102 SER B O   
2444 C CB  . SER B 125 ? 0.9241 0.7983 1.1096 -0.1284 0.1412  -0.1600 102 SER B CB  
2445 O OG  . SER B 125 ? 0.9070 0.7844 1.0916 -0.1128 0.1175  -0.1411 102 SER B OG  
2446 N N   . LYS B 126 ? 1.0461 0.8529 1.2720 -0.1378 0.2020  -0.2030 103 LYS B N   
2447 C CA  . LYS B 126 ? 1.0879 0.8839 1.3307 -0.1469 0.2308  -0.2249 103 LYS B CA  
2448 C C   . LYS B 126 ? 1.0914 0.8870 1.3878 -0.1278 0.2362  -0.2291 103 LYS B C   
2449 O O   . LYS B 126 ? 1.1104 0.9068 1.4189 -0.1373 0.2593  -0.2463 103 LYS B O   
2450 C CB  . LYS B 126 ? 1.1290 0.8931 1.3620 -0.1589 0.2523  -0.2387 103 LYS B CB  
2451 C CG  . LYS B 126 ? 1.1455 0.8819 1.3880 -0.1429 0.2440  -0.2271 103 LYS B CG  
2452 C CD  . LYS B 126 ? 1.1949 0.8963 1.4320 -0.1552 0.2701  -0.2430 103 LYS B CD  
2453 C CE  . LYS B 126 ? 1.2119 0.9159 1.4017 -0.1834 0.2750  -0.2499 103 LYS B CE  
2454 N NZ  . LYS B 126 ? 1.1796 0.8951 1.3456 -0.1813 0.2503  -0.2305 103 LYS B NZ  
2455 N N   . LYS B 127 ? 1.0857 0.8805 1.4137 -0.1017 0.2151  -0.2142 104 LYS B N   
2456 C CA  . LYS B 127 ? 1.0886 0.8843 1.4752 -0.0808 0.2161  -0.2180 104 LYS B CA  
2457 C C   . LYS B 127 ? 1.0545 0.8821 1.4582 -0.0707 0.1960  -0.2086 104 LYS B C   
2458 O O   . LYS B 127 ? 1.0366 0.8839 1.4051 -0.0806 0.1843  -0.1997 104 LYS B O   
2459 C CB  . LYS B 127 ? 1.1067 0.8756 1.5214 -0.0567 0.2060  -0.2098 104 LYS B CB  
2460 C CG  . LYS B 127 ? 1.1486 0.8819 1.5401 -0.0652 0.2220  -0.2142 104 LYS B CG  
2461 C CD  . LYS B 127 ? 1.1646 0.8726 1.5551 -0.0438 0.2019  -0.1956 104 LYS B CD  
2462 C CE  . LYS B 127 ? 1.1988 0.8840 1.5397 -0.0599 0.2081  -0.1922 104 LYS B CE  
2463 N NZ  . LYS B 127 ? 1.2260 0.8903 1.5592 -0.0809 0.2419  -0.2133 104 LYS B NZ  
2464 N N   . GLY B 128 ? 1.0486 0.8814 1.5089 -0.0508 0.1920  -0.2112 105 GLY B N   
2465 C CA  . GLY B 128 ? 1.0156 0.8778 1.4995 -0.0417 0.1754  -0.2056 105 GLY B CA  
2466 C C   . GLY B 128 ? 1.0129 0.8890 1.5231 -0.0528 0.2011  -0.2241 105 GLY B C   
2467 O O   . GLY B 128 ? 1.0307 0.8922 1.5636 -0.0577 0.2287  -0.2416 105 GLY B O   
2468 N N   . HIS B 133 ? 1.0776 0.9211 1.2628 -0.2200 0.3223  -0.2872 110 HIS B N   
2469 C CA  . HIS B 133 ? 1.0649 0.9225 1.2055 -0.2262 0.2958  -0.2721 110 HIS B CA  
2470 C C   . HIS B 133 ? 1.0584 0.9033 1.1969 -0.2257 0.2880  -0.2715 110 HIS B C   
2471 O O   . HIS B 133 ? 1.0888 0.9094 1.2322 -0.2337 0.3099  -0.2887 110 HIS B O   
2472 C CB  . HIS B 133 ? 1.0301 0.9142 1.1773 -0.2109 0.2673  -0.2493 110 HIS B CB  
2473 C CG  . HIS B 133 ? 1.0404 0.9281 1.2467 -0.1849 0.2570  -0.2411 110 HIS B CG  
2474 N ND1 . HIS B 133 ? 1.0595 0.9444 1.3120 -0.1763 0.2740  -0.2510 110 HIS B ND1 
2475 C CD2 . HIS B 133 ? 1.0299 0.9248 1.2552 -0.1660 0.2303  -0.2241 110 HIS B CD2 
2476 C CE1 . HIS B 133 ? 1.0418 0.9338 1.3410 -0.1527 0.2559  -0.2408 110 HIS B CE1 
2477 N NE2 . HIS B 133 ? 1.0266 0.9232 1.3070 -0.1461 0.2292  -0.2240 110 HIS B NE2 
2478 N N   . ASN B 134 ? 1.0114 0.8709 1.1417 -0.2172 0.2591  -0.2522 111 ASN B N   
2479 C CA  . ASN B 134 ? 0.9918 0.8405 1.1159 -0.2173 0.2500  -0.2486 111 ASN B CA  
2480 C C   . ASN B 134 ? 0.9575 0.8287 1.0477 -0.2225 0.2246  -0.2331 111 ASN B C   
2481 O O   . ASN B 134 ? 0.9694 0.8480 1.0194 -0.2436 0.2255  -0.2397 111 ASN B O   
2482 C CB  . ASN B 134 ? 1.0349 0.8591 1.1433 -0.2366 0.2745  -0.2701 111 ASN B CB  
2483 C CG  . ASN B 134 ? 1.0509 0.8529 1.1745 -0.2295 0.2734  -0.2683 111 ASN B CG  
2484 O OD1 . ASN B 134 ? 1.0324 0.8405 1.1591 -0.2172 0.2512  -0.2503 111 ASN B OD1 
2485 N ND2 . ASN B 134 ? 1.0795 0.8530 1.2113 -0.2373 0.2993  -0.2870 111 ASN B ND2 
2486 N N   . LEU B 135 ? 0.9041 0.7856 1.0119 -0.2029 0.2017  -0.2132 112 LEU B N   
2487 C CA  . LEU B 135 ? 0.8571 0.7617 0.9411 -0.2037 0.1775  -0.1965 112 LEU B CA  
2488 C C   . LEU B 135 ? 0.8368 0.7333 0.9163 -0.2020 0.1671  -0.1891 112 LEU B C   
2489 O O   . LEU B 135 ? 0.8421 0.7142 0.9427 -0.1917 0.1724  -0.1898 112 LEU B O   
2490 C CB  . LEU B 135 ? 0.8211 0.7431 0.9237 -0.1846 0.1600  -0.1794 112 LEU B CB  
2491 C CG  . LEU B 135 ? 0.8204 0.7640 0.9077 -0.1899 0.1583  -0.1767 112 LEU B CG  
2492 C CD1 . LEU B 135 ? 0.8360 0.7706 0.9376 -0.1931 0.1819  -0.1918 112 LEU B CD1 
2493 C CD2 . LEU B 135 ? 0.7963 0.7569 0.8973 -0.1721 0.1363  -0.1571 112 LEU B CD2 
2494 N N   . LEU B 136 ? 0.8023 0.7189 0.8547 -0.2118 0.1525  -0.1816 113 LEU B N   
2495 C CA  . LEU B 136 ? 0.7737 0.6880 0.8221 -0.2099 0.1410  -0.1719 113 LEU B CA  
2496 C C   . LEU B 136 ? 0.7227 0.6626 0.7671 -0.1999 0.1177  -0.1521 113 LEU B C   
2497 O O   . LEU B 136 ? 0.7090 0.6736 0.7382 -0.2061 0.1106  -0.1496 113 LEU B O   
2498 C CB  . LEU B 136 ? 0.7966 0.7120 0.8203 -0.2342 0.1483  -0.1854 113 LEU B CB  
2499 C CG  . LEU B 136 ? 0.8176 0.7128 0.8438 -0.2375 0.1525  -0.1867 113 LEU B CG  
2500 C CD1 . LEU B 136 ? 0.8344 0.6908 0.8778 -0.2330 0.1732  -0.1969 113 LEU B CD1 
2501 C CD2 . LEU B 136 ? 0.8389 0.7486 0.8415 -0.2629 0.1535  -0.1987 113 LEU B CD2 
2502 N N   . VAL B 137 ? 0.6844 0.6155 0.7403 -0.1843 0.1069  -0.1379 114 VAL B N   
2503 C CA  . VAL B 137 ? 0.6336 0.5831 0.6904 -0.1715 0.0871  -0.1195 114 VAL B CA  
2504 C C   . VAL B 137 ? 0.6200 0.5755 0.6636 -0.1755 0.0775  -0.1103 114 VAL B C   
2505 O O   . VAL B 137 ? 0.6255 0.5582 0.6720 -0.1700 0.0794  -0.1065 114 VAL B O   
2506 C CB  . VAL B 137 ? 0.6200 0.5550 0.7014 -0.1476 0.0806  -0.1099 114 VAL B CB  
2507 C CG1 . VAL B 137 ? 0.5894 0.5419 0.6702 -0.1356 0.0613  -0.0926 114 VAL B CG1 
2508 C CG2 . VAL B 137 ? 0.6249 0.5576 0.7268 -0.1433 0.0906  -0.1197 114 VAL B CG2 
2509 N N   . CYS B 138 ? 0.5981 0.5830 0.6277 -0.1847 0.0678  -0.1065 115 CYS B N   
2510 C CA  . CYS B 138 ? 0.5828 0.5776 0.6061 -0.1873 0.0587  -0.0976 115 CYS B CA  
2511 C C   . CYS B 138 ? 0.5522 0.5552 0.5811 -0.1692 0.0433  -0.0786 115 CYS B C   
2512 O O   . CYS B 138 ? 0.5357 0.5643 0.5616 -0.1678 0.0331  -0.0718 115 CYS B O   
2513 C CB  . CYS B 138 ? 0.5893 0.6115 0.5981 -0.2078 0.0562  -0.1054 115 CYS B CB  
2514 S SG  . CYS B 138 ? 0.5923 0.6209 0.6015 -0.2172 0.0535  -0.1031 115 CYS B SG  
2515 N N   . HIS B 139 ? 0.5387 0.5170 0.5734 -0.1555 0.0422  -0.0702 116 HIS B N   
2516 C CA  . HIS B 139 ? 0.5056 0.4848 0.5428 -0.1384 0.0288  -0.0538 116 HIS B CA  
2517 C C   . HIS B 139 ? 0.4987 0.4845 0.5267 -0.1438 0.0258  -0.0467 116 HIS B C   
2518 O O   . HIS B 139 ? 0.5048 0.4701 0.5273 -0.1492 0.0346  -0.0491 116 HIS B O   
2519 C CB  . HIS B 139 ? 0.5213 0.4666 0.5647 -0.1217 0.0287  -0.0493 116 HIS B CB  
2520 C CG  . HIS B 139 ? 0.5042 0.4504 0.5541 -0.1029 0.0142  -0.0372 116 HIS B CG  
2521 N ND1 . HIS B 139 ? 0.5100 0.4810 0.5580 -0.1008 0.0037  -0.0287 116 HIS B ND1 
2522 C CD2 . HIS B 139 ? 0.5119 0.4363 0.5707 -0.0853 0.0077  -0.0329 116 HIS B CD2 
2523 C CE1 . HIS B 139 ? 0.4766 0.4411 0.5317 -0.0841 -0.0073 -0.0209 116 HIS B CE1 
2524 N NE2 . HIS B 139 ? 0.5037 0.4413 0.5655 -0.0744 -0.0064 -0.0234 116 HIS B NE2 
2525 N N   . VAL B 140 ? 0.4758 0.4884 0.5034 -0.1420 0.0152  -0.0381 117 VAL B N   
2526 C CA  . VAL B 140 ? 0.4754 0.4989 0.4994 -0.1471 0.0131  -0.0320 117 VAL B CA  
2527 C C   . VAL B 140 ? 0.4682 0.4870 0.4912 -0.1312 0.0042  -0.0171 117 VAL B C   
2528 O O   . VAL B 140 ? 0.4572 0.4929 0.4843 -0.1234 -0.0052 -0.0110 117 VAL B O   
2529 C CB  . VAL B 140 ? 0.4631 0.5255 0.4888 -0.1601 0.0078  -0.0351 117 VAL B CB  
2530 C CG1 . VAL B 140 ? 0.4523 0.5276 0.4819 -0.1663 0.0072  -0.0313 117 VAL B CG1 
2531 C CG2 . VAL B 140 ? 0.4606 0.5292 0.4829 -0.1758 0.0142  -0.0507 117 VAL B CG2 
2532 N N   . THR B 141 ? 0.4862 0.4805 0.5014 -0.1271 0.0083  -0.0114 118 THR B N   
2533 C CA  . THR B 141 ? 0.4944 0.4779 0.5037 -0.1115 0.0002  0.0018  118 THR B CA  
2534 C C   . THR B 141 ? 0.4994 0.4869 0.5037 -0.1137 0.0023  0.0093  118 THR B C   
2535 O O   . THR B 141 ? 0.5178 0.5074 0.5233 -0.1265 0.0124  0.0046  118 THR B O   
2536 C CB  . THR B 141 ? 0.5083 0.4516 0.5070 -0.0986 0.0000  0.0051  118 THR B CB  
2537 O OG1 . THR B 141 ? 0.5588 0.4773 0.5508 -0.1067 0.0132  -0.0014 118 THR B OG1 
2538 C CG2 . THR B 141 ? 0.5030 0.4479 0.5130 -0.0890 -0.0077 0.0022  118 THR B CG2 
2539 N N   . ASP B 142 ? 0.4949 0.4831 0.4958 -0.1018 -0.0058 0.0198  119 ASP B N   
2540 C CA  . ASP B 142 ? 0.5146 0.4932 0.5063 -0.1004 -0.0013 0.0275  119 ASP B CA  
2541 C C   . ASP B 142 ? 0.5036 0.5125 0.5095 -0.1120 0.0039  0.0264  119 ASP B C   
2542 O O   . ASP B 142 ? 0.5205 0.5193 0.5235 -0.1189 0.0157  0.0262  119 ASP B O   
2543 C CB  . ASP B 142 ? 0.5557 0.4897 0.5255 -0.0984 0.0082  0.0292  119 ASP B CB  
2544 C CG  . ASP B 142 ? 0.6121 0.5158 0.5632 -0.0809 -0.0017 0.0373  119 ASP B CG  
2545 O OD1 . ASP B 142 ? 0.5977 0.5162 0.5572 -0.0713 -0.0153 0.0394  119 ASP B OD1 
2546 O OD2 . ASP B 142 ? 0.6892 0.5532 0.6163 -0.0770 0.0039  0.0414  119 ASP B OD2 
2547 N N   . PHE B 143 ? 0.4806 0.5261 0.5024 -0.1137 -0.0048 0.0258  120 PHE B N   
2548 C CA  . PHE B 143 ? 0.4655 0.5447 0.5048 -0.1233 -0.0038 0.0247  120 PHE B CA  
2549 C C   . PHE B 143 ? 0.4480 0.5479 0.4953 -0.1138 -0.0125 0.0346  120 PHE B C   
2550 O O   . PHE B 143 ? 0.4336 0.5292 0.4752 -0.1027 -0.0205 0.0397  120 PHE B O   
2551 C CB  . PHE B 143 ? 0.4550 0.5603 0.5045 -0.1367 -0.0064 0.0140  120 PHE B CB  
2552 C CG  . PHE B 143 ? 0.4264 0.5434 0.4733 -0.1326 -0.0165 0.0135  120 PHE B CG  
2553 C CD1 . PHE B 143 ? 0.4247 0.5238 0.4630 -0.1341 -0.0139 0.0058  120 PHE B CD1 
2554 C CD2 . PHE B 143 ? 0.4090 0.5537 0.4628 -0.1278 -0.0269 0.0204  120 PHE B CD2 
2555 C CE1 . PHE B 143 ? 0.3988 0.5077 0.4357 -0.1316 -0.0200 0.0041  120 PHE B CE1 
2556 C CE2 . PHE B 143 ? 0.3716 0.5236 0.4202 -0.1251 -0.0333 0.0199  120 PHE B CE2 
2557 C CZ  . PHE B 143 ? 0.3575 0.4920 0.3981 -0.1277 -0.0291 0.0112  120 PHE B CZ  
2558 N N   . TYR B 144 ? 0.4393 0.5617 0.5029 -0.1183 -0.0100 0.0364  121 TYR B N   
2559 C CA  . TYR B 144 ? 0.4241 0.5714 0.5005 -0.1108 -0.0175 0.0452  121 TYR B CA  
2560 C C   . TYR B 144 ? 0.4288 0.6129 0.5303 -0.1205 -0.0189 0.0420  121 TYR B C   
2561 O O   . TYR B 144 ? 0.4544 0.6379 0.5658 -0.1305 -0.0087 0.0356  121 TYR B O   
2562 C CB  . TYR B 144 ? 0.4221 0.5478 0.4916 -0.1006 -0.0113 0.0535  121 TYR B CB  
2563 C CG  . TYR B 144 ? 0.3913 0.5371 0.4734 -0.0914 -0.0171 0.0627  121 TYR B CG  
2564 C CD1 . TYR B 144 ? 0.3661 0.5398 0.4731 -0.0941 -0.0151 0.0648  121 TYR B CD1 
2565 C CD2 . TYR B 144 ? 0.3699 0.5064 0.4418 -0.0797 -0.0240 0.0689  121 TYR B CD2 
2566 C CE1 . TYR B 144 ? 0.3785 0.5686 0.4982 -0.0844 -0.0195 0.0742  121 TYR B CE1 
2567 C CE2 . TYR B 144 ? 0.3623 0.5144 0.4455 -0.0713 -0.0274 0.0776  121 TYR B CE2 
2568 C CZ  . TYR B 144 ? 0.3881 0.5658 0.4943 -0.0732 -0.0249 0.0808  121 TYR B CZ  
2569 O OH  . TYR B 144 ? 0.3932 0.5851 0.5124 -0.0640 -0.0274 0.0899  121 TYR B OH  
2570 N N   . PRO B 145 ? 0.4158 0.6316 0.5287 -0.1175 -0.0315 0.0465  122 PRO B N   
2571 C CA  . PRO B 145 ? 0.4126 0.6297 0.5164 -0.1061 -0.0408 0.0552  122 PRO B CA  
2572 C C   . PRO B 145 ? 0.4213 0.6398 0.5109 -0.1101 -0.0477 0.0500  122 PRO B C   
2573 O O   . PRO B 145 ? 0.4264 0.6462 0.5127 -0.1221 -0.0462 0.0391  122 PRO B O   
2574 C CB  . PRO B 145 ? 0.4040 0.6539 0.5289 -0.1014 -0.0484 0.0636  122 PRO B CB  
2575 C CG  . PRO B 145 ? 0.3960 0.6719 0.5410 -0.1139 -0.0496 0.0556  122 PRO B CG  
2576 C CD  . PRO B 145 ? 0.4032 0.6568 0.5422 -0.1249 -0.0367 0.0442  122 PRO B CD  
2577 N N   . GLY B 146 ? 0.4253 0.6423 0.5071 -0.1006 -0.0532 0.0570  123 GLY B N   
2578 C CA  . GLY B 146 ? 0.4340 0.6469 0.5014 -0.1031 -0.0561 0.0525  123 GLY B CA  
2579 C C   . GLY B 146 ? 0.4498 0.6841 0.5137 -0.1155 -0.0616 0.0453  123 GLY B C   
2580 O O   . GLY B 146 ? 0.4595 0.6842 0.5112 -0.1233 -0.0586 0.0353  123 GLY B O   
2581 N N   . SER B 147 ? 0.4500 0.7131 0.5251 -0.1173 -0.0702 0.0497  124 SER B N   
2582 C CA  . SER B 147 ? 0.4699 0.7554 0.5398 -0.1292 -0.0789 0.0428  124 SER B CA  
2583 C C   . SER B 147 ? 0.4715 0.7514 0.5416 -0.1447 -0.0722 0.0264  124 SER B C   
2584 O O   . SER B 147 ? 0.4701 0.7485 0.5563 -0.1481 -0.0659 0.0229  124 SER B O   
2585 C CB  . SER B 147 ? 0.4713 0.7907 0.5589 -0.1267 -0.0916 0.0506  124 SER B CB  
2586 O OG  . SER B 147 ? 0.4996 0.8347 0.5713 -0.1269 -0.1046 0.0549  124 SER B OG  
2587 N N   . ILE B 148 ? 0.4833 0.7575 0.5346 -0.1545 -0.0715 0.0161  125 ILE B N   
2588 C CA  . ILE B 148 ? 0.4936 0.7580 0.5428 -0.1697 -0.0631 -0.0006 125 ILE B CA  
2589 C C   . ILE B 148 ? 0.5103 0.7791 0.5380 -0.1818 -0.0663 -0.0113 125 ILE B C   
2590 O O   . ILE B 148 ? 0.5172 0.7880 0.5278 -0.1768 -0.0717 -0.0051 125 ILE B O   
2591 C CB  . ILE B 148 ? 0.4908 0.7181 0.5369 -0.1649 -0.0484 -0.0031 125 ILE B CB  
2592 C CG1 . ILE B 148 ? 0.5052 0.7198 0.5551 -0.1781 -0.0376 -0.0171 125 ILE B CG1 
2593 C CG2 . ILE B 148 ? 0.5022 0.7117 0.5311 -0.1604 -0.0452 -0.0041 125 ILE B CG2 
2594 C CD1 . ILE B 148 ? 0.4825 0.6590 0.5276 -0.1717 -0.0250 -0.0179 125 ILE B CD1 
2595 N N   . GLN B 149 ? 0.5255 0.7932 0.5517 -0.1982 -0.0613 -0.0277 126 GLN B N   
2596 C CA  . GLN B 149 ? 0.5546 0.8206 0.5565 -0.2107 -0.0614 -0.0399 126 GLN B CA  
2597 C C   . GLN B 149 ? 0.5636 0.8039 0.5630 -0.2222 -0.0449 -0.0566 126 GLN B C   
2598 O O   . GLN B 149 ? 0.5623 0.8022 0.5767 -0.2311 -0.0394 -0.0651 126 GLN B O   
2599 C CB  . GLN B 149 ? 0.5775 0.8772 0.5739 -0.2228 -0.0780 -0.0451 126 GLN B CB  
2600 C CG  . GLN B 149 ? 0.5848 0.9168 0.5956 -0.2133 -0.0965 -0.0302 126 GLN B CG  
2601 C CD  . GLN B 149 ? 0.6435 1.0109 0.6561 -0.2270 -0.1146 -0.0390 126 GLN B CD  
2602 O OE1 . GLN B 149 ? 0.6542 1.0214 0.6436 -0.2424 -0.1166 -0.0533 126 GLN B OE1 
2603 N NE2 . GLN B 149 ? 0.6367 1.0349 0.6780 -0.2214 -0.1281 -0.0310 126 GLN B NE2 
2604 N N   . VAL B 150 ? 0.5752 0.7929 0.5572 -0.2217 -0.0353 -0.0614 127 VAL B N   
2605 C CA  . VAL B 150 ? 0.5926 0.7820 0.5733 -0.2298 -0.0182 -0.0762 127 VAL B CA  
2606 C C   . VAL B 150 ? 0.6269 0.8155 0.5837 -0.2452 -0.0147 -0.0915 127 VAL B C   
2607 O O   . VAL B 150 ? 0.6361 0.8245 0.5743 -0.2419 -0.0165 -0.0880 127 VAL B O   
2608 C CB  . VAL B 150 ? 0.5786 0.7370 0.5657 -0.2138 -0.0071 -0.0699 127 VAL B CB  
2609 C CG1 . VAL B 150 ? 0.5895 0.7184 0.5777 -0.2208 0.0098  -0.0844 127 VAL B CG1 
2610 C CG2 . VAL B 150 ? 0.5431 0.6992 0.5476 -0.1988 -0.0111 -0.0550 127 VAL B CG2 
2611 N N   . ARG B 151 ? 0.6534 0.8389 0.6092 -0.2629 -0.0078 -0.1091 128 ARG B N   
2612 C CA  . ARG B 151 ? 0.6965 0.8829 0.6270 -0.2806 -0.0053 -0.1259 128 ARG B CA  
2613 C C   . ARG B 151 ? 0.7136 0.8697 0.6439 -0.2917 0.0160  -0.1444 128 ARG B C   
2614 O O   . ARG B 151 ? 0.7135 0.8538 0.6640 -0.2900 0.0258  -0.1462 128 ARG B O   
2615 C CB  . ARG B 151 ? 0.7150 0.9362 0.6398 -0.2951 -0.0233 -0.1315 128 ARG B CB  
2616 C CG  . ARG B 151 ? 0.7391 0.9839 0.6473 -0.2869 -0.0428 -0.1169 128 ARG B CG  
2617 C CD  . ARG B 151 ? 0.7907 1.0747 0.7035 -0.2944 -0.0657 -0.1167 128 ARG B CD  
2618 N NE  . ARG B 151 ? 0.8184 1.1202 0.7291 -0.2773 -0.0825 -0.0949 128 ARG B NE  
2619 C CZ  . ARG B 151 ? 0.8403 1.1769 0.7533 -0.2769 -0.1060 -0.0883 128 ARG B CZ  
2620 N NH1 . ARG B 151 ? 0.8577 1.2195 0.7767 -0.2936 -0.1180 -0.1028 128 ARG B NH1 
2621 N NH2 . ARG B 151 ? 0.8434 1.1898 0.7544 -0.2595 -0.1178 -0.0674 128 ARG B NH2 
2622 N N   . TRP B 152 ? 0.7355 0.8806 0.6411 -0.3027 0.0246  -0.1579 129 TRP B N   
2623 C CA  . TRP B 152 ? 0.7471 0.8615 0.6528 -0.3125 0.0469  -0.1761 129 TRP B CA  
2624 C C   . TRP B 152 ? 0.7893 0.9089 0.6746 -0.3385 0.0494  -0.1989 129 TRP B C   
2625 O O   . TRP B 152 ? 0.8108 0.9490 0.6680 -0.3484 0.0375  -0.2026 129 TRP B O   
2626 C CB  . TRP B 152 ? 0.7444 0.8346 0.6429 -0.3031 0.0611  -0.1755 129 TRP B CB  
2627 C CG  . TRP B 152 ? 0.6821 0.7520 0.6080 -0.2823 0.0684  -0.1638 129 TRP B CG  
2628 C CD1 . TRP B 152 ? 0.6199 0.6917 0.5543 -0.2628 0.0626  -0.1470 129 TRP B CD1 
2629 C CD2 . TRP B 152 ? 0.6559 0.6988 0.6029 -0.2786 0.0821  -0.1683 129 TRP B CD2 
2630 N NE1 . TRP B 152 ? 0.5898 0.6398 0.5495 -0.2474 0.0697  -0.1414 129 TRP B NE1 
2631 C CE2 . TRP B 152 ? 0.5973 0.6283 0.5639 -0.2557 0.0813  -0.1531 129 TRP B CE2 
2632 C CE3 . TRP B 152 ? 0.6501 0.6765 0.6005 -0.2925 0.0949  -0.1837 129 TRP B CE3 
2633 C CZ2 . TRP B 152 ? 0.5854 0.5884 0.5719 -0.2449 0.0906  -0.1514 129 TRP B CZ2 
2634 C CZ3 . TRP B 152 ? 0.6434 0.6396 0.6138 -0.2819 0.1068  -0.1815 129 TRP B CZ3 
2635 C CH2 . TRP B 152 ? 0.6343 0.6189 0.6213 -0.2576 0.1035  -0.1648 129 TRP B CH2 
2636 N N   . PHE B 153 ? 0.8041 0.9049 0.7013 -0.3498 0.0650  -0.2143 130 PHE B N   
2637 C CA  . PHE B 153 ? 0.8473 0.9508 0.7275 -0.3763 0.0693  -0.2387 130 PHE B CA  
2638 C C   . PHE B 153 ? 0.8806 0.9449 0.7589 -0.3854 0.0976  -0.2577 130 PHE B C   
2639 O O   . PHE B 153 ? 0.8623 0.8995 0.7641 -0.3755 0.1131  -0.2548 130 PHE B O   
2640 C CB  . PHE B 153 ? 0.8467 0.9761 0.7443 -0.3881 0.0573  -0.2433 130 PHE B CB  
2641 C CG  . PHE B 153 ? 0.8245 0.9953 0.7256 -0.3807 0.0291  -0.2270 130 PHE B CG  
2642 C CD1 . PHE B 153 ? 0.7964 0.9750 0.7242 -0.3610 0.0223  -0.2058 130 PHE B CD1 
2643 C CD2 . PHE B 153 ? 0.8385 1.0386 0.7145 -0.3924 0.0093  -0.2326 130 PHE B CD2 
2644 C CE1 . PHE B 153 ? 0.7710 0.9867 0.7046 -0.3533 -0.0020 -0.1909 130 PHE B CE1 
2645 C CE2 . PHE B 153 ? 0.8149 1.0526 0.6962 -0.3835 -0.0174 -0.2164 130 PHE B CE2 
2646 C CZ  . PHE B 153 ? 0.7793 1.0249 0.6913 -0.3639 -0.0221 -0.1958 130 PHE B CZ  
2647 N N   . LEU B 154 ? 0.9360 0.9964 0.7838 -0.4042 0.1038  -0.2770 131 LEU B N   
2648 C CA  . LEU B 154 ? 0.9833 1.0077 0.8238 -0.4167 0.1316  -0.2989 131 LEU B CA  
2649 C C   . LEU B 154 ? 1.0213 1.0540 0.8486 -0.4457 0.1316  -0.3235 131 LEU B C   
2650 O O   . LEU B 154 ? 1.0434 1.1039 0.8435 -0.4592 0.1129  -0.3292 131 LEU B O   
2651 C CB  . LEU B 154 ? 1.0061 1.0181 0.8174 -0.4157 0.1405  -0.3021 131 LEU B CB  
2652 C CG  . LEU B 154 ? 1.0649 1.0446 0.8548 -0.4318 0.1680  -0.3268 131 LEU B CG  
2653 C CD1 . LEU B 154 ? 1.1136 1.1053 0.8599 -0.4607 0.1619  -0.3485 131 LEU B CD1 
2654 C CD2 . LEU B 154 ? 1.0801 1.0239 0.8997 -0.4314 0.1949  -0.3383 131 LEU B CD2 
2655 N N   . ASN B 155 ? 1.0409 1.0490 0.8871 -0.4554 0.1519  -0.3383 132 ASN B N   
2656 C CA  . ASN B 155 ? 1.0769 1.0944 0.9175 -0.4847 0.1523  -0.3633 132 ASN B CA  
2657 C C   . ASN B 155 ? 1.0689 1.1362 0.9018 -0.4933 0.1195  -0.3604 132 ASN B C   
2658 O O   . ASN B 155 ? 1.1014 1.1844 0.9032 -0.5134 0.1094  -0.3772 132 ASN B O   
2659 C CB  . ASN B 155 ? 1.1313 1.1252 0.9398 -0.5086 0.1722  -0.3929 132 ASN B CB  
2660 C CG  . ASN B 155 ? 1.1594 1.1042 0.9786 -0.5007 0.2060  -0.3979 132 ASN B CG  
2661 O OD1 . ASN B 155 ? 1.1571 1.0794 1.0055 -0.4950 0.2208  -0.3965 132 ASN B OD1 
2662 N ND2 . ASN B 155 ? 1.1991 1.1250 0.9941 -0.5011 0.2196  -0.4050 132 ASN B ND2 
2663 N N   . GLY B 156 ? 1.0307 1.1220 0.8907 -0.4769 0.1023  -0.3386 133 GLY B N   
2664 C CA  . GLY B 156 ? 1.0180 1.1582 0.8793 -0.4814 0.0707  -0.3336 133 GLY B CA  
2665 C C   . GLY B 156 ? 1.0125 1.1764 0.8447 -0.4713 0.0469  -0.3188 133 GLY B C   
2666 O O   . GLY B 156 ? 0.9923 1.1936 0.8344 -0.4641 0.0207  -0.3048 133 GLY B O   
2667 N N   . GLN B 157 ? 1.0301 1.1713 0.8271 -0.4707 0.0571  -0.3220 134 GLN B N   
2668 C CA  . GLN B 157 ? 1.0356 1.1933 0.7983 -0.4631 0.0378  -0.3091 134 GLN B CA  
2669 C C   . GLN B 157 ? 0.9887 1.1433 0.7658 -0.4331 0.0358  -0.2796 134 GLN B C   
2670 O O   . GLN B 157 ? 0.9706 1.0950 0.7653 -0.4201 0.0575  -0.2745 134 GLN B O   
2671 C CB  . GLN B 157 ? 1.0892 1.2219 0.8033 -0.4778 0.0518  -0.3266 134 GLN B CB  
2672 C CG  . GLN B 157 ? 1.1385 1.2556 0.8403 -0.5069 0.0677  -0.3596 134 GLN B CG  
2673 C CD  . GLN B 157 ? 1.1879 1.3396 0.8692 -0.5299 0.0416  -0.3753 134 GLN B CD  
2674 O OE1 . GLN B 157 ? 1.2436 1.3842 0.8961 -0.5554 0.0497  -0.4025 134 GLN B OE1 
2675 N NE2 . GLN B 157 ? 1.1585 1.3527 0.8565 -0.5213 0.0099  -0.3592 134 GLN B NE2 
2676 N N   . GLU B 158 ? 0.9685 1.1538 0.7385 -0.4222 0.0094  -0.2608 135 GLU B N   
2677 C CA  . GLU B 158 ? 0.9255 1.1088 0.7053 -0.3955 0.0066  -0.2340 135 GLU B CA  
2678 C C   . GLU B 158 ? 0.9410 1.0946 0.6910 -0.3909 0.0237  -0.2334 135 GLU B C   
2679 O O   . GLU B 158 ? 0.9856 1.1311 0.6945 -0.4070 0.0272  -0.2480 135 GLU B O   
2680 C CB  . GLU B 158 ? 0.9114 1.1328 0.6890 -0.3857 -0.0245 -0.2149 135 GLU B CB  
2681 C CG  . GLU B 158 ? 0.8682 1.0900 0.6700 -0.3583 -0.0266 -0.1879 135 GLU B CG  
2682 C CD  . GLU B 158 ? 0.8561 1.1082 0.6498 -0.3463 -0.0535 -0.1674 135 GLU B CD  
2683 O OE1 . GLU B 158 ? 0.8285 1.0765 0.6342 -0.3253 -0.0530 -0.1468 135 GLU B OE1 
2684 O OE2 . GLU B 158 ? 0.8733 1.1528 0.6504 -0.3570 -0.0755 -0.1718 135 GLU B OE2 
2685 N N   . GLU B 159 ? 0.9025 1.0402 0.6734 -0.3694 0.0344  -0.2174 136 GLU B N   
2686 C CA  . GLU B 159 ? 0.9082 1.0193 0.6610 -0.3632 0.0524  -0.2163 136 GLU B CA  
2687 C C   . GLU B 159 ? 0.8720 0.9932 0.6267 -0.3419 0.0410  -0.1910 136 GLU B C   
2688 O O   . GLU B 159 ? 0.8321 0.9607 0.6220 -0.3243 0.0351  -0.1751 136 GLU B O   
2689 C CB  . GLU B 159 ? 0.9010 0.9797 0.6829 -0.3580 0.0796  -0.2243 136 GLU B CB  
2690 C CG  . GLU B 159 ? 0.9599 1.0218 0.7422 -0.3782 0.0958  -0.2498 136 GLU B CG  
2691 C CD  . GLU B 159 ? 1.0373 1.0690 0.7929 -0.3915 0.1214  -0.2700 136 GLU B CD  
2692 O OE1 . GLU B 159 ? 1.0772 1.1075 0.8016 -0.4152 0.1238  -0.2907 136 GLU B OE1 
2693 O OE2 . GLU B 159 ? 1.0425 1.0520 0.8099 -0.3786 0.1393  -0.2663 136 GLU B OE2 
2694 N N   . THR B 160 ? 0.8912 1.0103 0.6056 -0.3444 0.0388  -0.1877 137 THR B N   
2695 C CA  . THR B 160 ? 0.8612 0.9837 0.5712 -0.3261 0.0326  -0.1652 137 THR B CA  
2696 C C   . THR B 160 ? 0.8522 0.9438 0.5673 -0.3195 0.0599  -0.1680 137 THR B C   
2697 O O   . THR B 160 ? 0.8156 0.9056 0.5561 -0.3007 0.0617  -0.1525 137 THR B O   
2698 C CB  . THR B 160 ? 0.9045 1.0354 0.5612 -0.3327 0.0181  -0.1597 137 THR B CB  
2699 O OG1 . THR B 160 ? 0.9328 1.0879 0.5725 -0.3472 -0.0039 -0.1673 137 THR B OG1 
2700 C CG2 . THR B 160 ? 0.8805 1.0219 0.5390 -0.3124 0.0054  -0.1331 137 THR B CG2 
2701 N N   . ALA B 161 ? 0.8765 0.9444 0.5675 -0.3362 0.0811  -0.1892 138 ALA B N   
2702 C CA  . ALA B 161 ? 0.8724 0.9101 0.5657 -0.3342 0.1104  -0.1968 138 ALA B CA  
2703 C C   . ALA B 161 ? 0.8277 0.8539 0.5771 -0.3203 0.1243  -0.1980 138 ALA B C   
2704 O O   . ALA B 161 ? 0.8107 0.8385 0.5844 -0.3221 0.1224  -0.2045 138 ALA B O   
2705 C CB  . ALA B 161 ? 0.9215 0.9374 0.5744 -0.3572 0.1293  -0.2208 138 ALA B CB  
2706 N N   . GLY B 162 ? 0.8093 0.8236 0.5789 -0.3064 0.1378  -0.1914 139 GLY B N   
2707 C CA  . GLY B 162 ? 0.7797 0.7813 0.6006 -0.2927 0.1509  -0.1937 139 GLY B CA  
2708 C C   . GLY B 162 ? 0.7355 0.7547 0.5913 -0.2750 0.1298  -0.1761 139 GLY B C   
2709 O O   . GLY B 162 ? 0.7228 0.7329 0.6151 -0.2659 0.1342  -0.1781 139 GLY B O   
2710 N N   . VAL B 163 ? 0.7212 0.7637 0.5644 -0.2696 0.1074  -0.1584 140 VAL B N   
2711 C CA  . VAL B 163 ? 0.6809 0.7404 0.5517 -0.2554 0.0877  -0.1427 140 VAL B CA  
2712 C C   . VAL B 163 ? 0.6612 0.7282 0.5475 -0.2366 0.0803  -0.1237 140 VAL B C   
2713 O O   . VAL B 163 ? 0.6712 0.7475 0.5332 -0.2366 0.0741  -0.1140 140 VAL B O   
2714 C CB  . VAL B 163 ? 0.6827 0.7652 0.5352 -0.2653 0.0673  -0.1399 140 VAL B CB  
2715 C CG1 . VAL B 163 ? 0.6432 0.7434 0.5225 -0.2504 0.0488  -0.1224 140 VAL B CG1 
2716 C CG2 . VAL B 163 ? 0.6961 0.7701 0.5429 -0.2832 0.0756  -0.1602 140 VAL B CG2 
2717 N N   . VAL B 164 ? 0.6296 0.6903 0.5550 -0.2208 0.0812  -0.1189 141 VAL B N   
2718 C CA  . VAL B 164 ? 0.6006 0.6676 0.5458 -0.2033 0.0739  -0.1032 141 VAL B CA  
2719 C C   . VAL B 164 ? 0.5766 0.6539 0.5420 -0.1913 0.0562  -0.0904 141 VAL B C   
2720 O O   . VAL B 164 ? 0.5688 0.6347 0.5559 -0.1862 0.0580  -0.0942 141 VAL B O   
2721 C CB  . VAL B 164 ? 0.5969 0.6465 0.5724 -0.1941 0.0904  -0.1098 141 VAL B CB  
2722 C CG1 . VAL B 164 ? 0.5631 0.6207 0.5562 -0.1786 0.0831  -0.0954 141 VAL B CG1 
2723 C CG2 . VAL B 164 ? 0.6223 0.6571 0.5815 -0.2074 0.1133  -0.1260 141 VAL B CG2 
2724 N N   . SER B 165 ? 0.5728 0.6691 0.5292 -0.1866 0.0401  -0.0750 142 SER B N   
2725 C CA  . SER B 165 ? 0.5524 0.6570 0.5276 -0.1742 0.0257  -0.0620 142 SER B CA  
2726 C C   . SER B 165 ? 0.5381 0.6422 0.5299 -0.1584 0.0235  -0.0508 142 SER B C   
2727 O O   . SER B 165 ? 0.5542 0.6620 0.5347 -0.1587 0.0266  -0.0470 142 SER B O   
2728 C CB  . SER B 165 ? 0.5560 0.6833 0.5156 -0.1793 0.0101  -0.0534 142 SER B CB  
2729 O OG  . SER B 165 ? 0.5578 0.6986 0.5036 -0.1754 0.0026  -0.0412 142 SER B OG  
2730 N N   . THR B 166 ? 0.5234 0.6205 0.5400 -0.1454 0.0188  -0.0462 143 THR B N   
2731 C CA  . THR B 166 ? 0.5103 0.6074 0.5452 -0.1305 0.0145  -0.0368 143 THR B CA  
2732 C C   . THR B 166 ? 0.5067 0.6212 0.5294 -0.1278 0.0036  -0.0221 143 THR B C   
2733 O O   . THR B 166 ? 0.5200 0.6476 0.5245 -0.1356 -0.0028 -0.0186 143 THR B O   
2734 C CB  . THR B 166 ? 0.4975 0.5846 0.5529 -0.1178 0.0067  -0.0330 143 THR B CB  
2735 O OG1 . THR B 166 ? 0.4914 0.5814 0.5364 -0.1216 -0.0003 -0.0290 143 THR B OG1 
2736 C CG2 . THR B 166 ? 0.5080 0.5762 0.5828 -0.1144 0.0154  -0.0447 143 THR B CG2 
2737 N N   . ASN B 167 ? 0.4954 0.6109 0.5306 -0.1164 0.0005  -0.0135 144 ASN B N   
2738 C CA  . ASN B 167 ? 0.4961 0.6259 0.5235 -0.1118 -0.0107 0.0014  144 ASN B CA  
2739 C C   . ASN B 167 ? 0.4772 0.6089 0.5100 -0.1082 -0.0205 0.0058  144 ASN B C   
2740 O O   . ASN B 167 ? 0.4846 0.6040 0.5246 -0.1089 -0.0184 -0.0018 144 ASN B O   
2741 C CB  . ASN B 167 ? 0.4908 0.6200 0.5291 -0.1015 -0.0105 0.0093  144 ASN B CB  
2742 C CG  . ASN B 167 ? 0.5425 0.6835 0.5613 -0.1030 -0.0125 0.0211  144 ASN B CG  
2743 O OD1 . ASN B 167 ? 0.5768 0.7132 0.5940 -0.1016 -0.0044 0.0230  144 ASN B OD1 
2744 N ND2 . ASN B 167 ? 0.5325 0.6882 0.5377 -0.1056 -0.0230 0.0290  144 ASN B ND2 
2745 N N   . LEU B 168 ? 0.4597 0.6047 0.4888 -0.1048 -0.0296 0.0178  145 LEU B N   
2746 C CA  . LEU B 168 ? 0.4429 0.5864 0.4785 -0.1012 -0.0355 0.0215  145 LEU B CA  
2747 C C   . LEU B 168 ? 0.4254 0.5536 0.4745 -0.0880 -0.0373 0.0249  145 LEU B C   
2748 O O   . LEU B 168 ? 0.4215 0.5516 0.4760 -0.0805 -0.0388 0.0310  145 LEU B O   
2749 C CB  . LEU B 168 ? 0.4338 0.5975 0.4651 -0.1023 -0.0432 0.0316  145 LEU B CB  
2750 C CG  . LEU B 168 ? 0.4143 0.5767 0.4533 -0.0995 -0.0462 0.0354  145 LEU B CG  
2751 C CD1 . LEU B 168 ? 0.4108 0.5783 0.4471 -0.1119 -0.0446 0.0272  145 LEU B CD1 
2752 C CD2 . LEU B 168 ? 0.4079 0.5867 0.4509 -0.0934 -0.0522 0.0480  145 LEU B CD2 
2753 N N   . ILE B 169 ? 0.4192 0.5307 0.4722 -0.0854 -0.0375 0.0208  146 ILE B N   
2754 C CA  . ILE B 169 ? 0.4121 0.5074 0.4745 -0.0729 -0.0416 0.0228  146 ILE B CA  
2755 C C   . ILE B 169 ? 0.4133 0.5048 0.4702 -0.0672 -0.0471 0.0324  146 ILE B C   
2756 O O   . ILE B 169 ? 0.4288 0.5174 0.4779 -0.0719 -0.0455 0.0333  146 ILE B O   
2757 C CB  . ILE B 169 ? 0.4221 0.4971 0.4910 -0.0707 -0.0395 0.0133  146 ILE B CB  
2758 C CG1 . ILE B 169 ? 0.4274 0.5066 0.5032 -0.0776 -0.0307 0.0026  146 ILE B CG1 
2759 C CG2 . ILE B 169 ? 0.3998 0.4600 0.4792 -0.0567 -0.0475 0.0150  146 ILE B CG2 
2760 C CD1 . ILE B 169 ? 0.4265 0.4873 0.5109 -0.0774 -0.0255 -0.0084 146 ILE B CD1 
2761 N N   . ARG B 170 ? 0.4130 0.5036 0.4744 -0.0580 -0.0518 0.0385  147 ARG B N   
2762 C CA  . ARG B 170 ? 0.4215 0.5063 0.4761 -0.0528 -0.0550 0.0469  147 ARG B CA  
2763 C C   . ARG B 170 ? 0.4302 0.4885 0.4798 -0.0442 -0.0602 0.0451  147 ARG B C   
2764 O O   . ARG B 170 ? 0.4310 0.4825 0.4893 -0.0370 -0.0658 0.0417  147 ARG B O   
2765 C CB  . ARG B 170 ? 0.4136 0.5111 0.4734 -0.0482 -0.0562 0.0544  147 ARG B CB  
2766 C CG  . ARG B 170 ? 0.4290 0.5200 0.4835 -0.0425 -0.0574 0.0622  147 ARG B CG  
2767 C CD  . ARG B 170 ? 0.4367 0.5425 0.4983 -0.0395 -0.0561 0.0697  147 ARG B CD  
2768 N NE  . ARG B 170 ? 0.4649 0.5899 0.5275 -0.0438 -0.0533 0.0767  147 ARG B NE  
2769 C CZ  . ARG B 170 ? 0.4569 0.6014 0.5232 -0.0469 -0.0532 0.0801  147 ARG B CZ  
2770 N NH1 . ARG B 170 ? 0.4862 0.6308 0.5532 -0.0471 -0.0524 0.0773  147 ARG B NH1 
2771 N NH2 . ARG B 170 ? 0.4267 0.5897 0.4957 -0.0496 -0.0538 0.0862  147 ARG B NH2 
2772 N N   . ASN B 171 ? 0.4417 0.4839 0.4770 -0.0452 -0.0585 0.0471  148 ASN B N   
2773 C CA  . ASN B 171 ? 0.4624 0.4749 0.4859 -0.0364 -0.0645 0.0470  148 ASN B CA  
2774 C C   . ASN B 171 ? 0.4638 0.4670 0.4797 -0.0277 -0.0710 0.0523  148 ASN B C   
2775 O O   . ASN B 171 ? 0.4872 0.4687 0.4945 -0.0190 -0.0800 0.0514  148 ASN B O   
2776 C CB  . ASN B 171 ? 0.4815 0.4733 0.4878 -0.0406 -0.0584 0.0474  148 ASN B CB  
2777 C CG  . ASN B 171 ? 0.5040 0.4959 0.5171 -0.0472 -0.0535 0.0395  148 ASN B CG  
2778 O OD1 . ASN B 171 ? 0.4918 0.4866 0.5188 -0.0441 -0.0572 0.0334  148 ASN B OD1 
2779 N ND2 . ASN B 171 ? 0.5276 0.5167 0.5334 -0.0573 -0.0436 0.0382  148 ASN B ND2 
2780 N N   . GLY B 172 ? 0.4524 0.4720 0.4717 -0.0297 -0.0671 0.0575  149 GLY B N   
2781 C CA  . GLY B 172 ? 0.4439 0.4542 0.4557 -0.0228 -0.0708 0.0615  149 GLY B CA  
2782 C C   . GLY B 172 ? 0.4637 0.4529 0.4519 -0.0228 -0.0657 0.0665  149 GLY B C   
2783 O O   . GLY B 172 ? 0.4778 0.4575 0.4564 -0.0185 -0.0663 0.0695  149 GLY B O   
2784 N N   . ASP B 173 ? 0.4705 0.4506 0.4487 -0.0286 -0.0586 0.0667  150 ASP B N   
2785 C CA  . ASP B 173 ? 0.4908 0.4473 0.4454 -0.0300 -0.0501 0.0708  150 ASP B CA  
2786 C C   . ASP B 173 ? 0.4734 0.4479 0.4385 -0.0404 -0.0363 0.0722  150 ASP B C   
2787 O O   . ASP B 173 ? 0.5022 0.4589 0.4533 -0.0456 -0.0260 0.0726  150 ASP B O   
2788 C CB  . ASP B 173 ? 0.5275 0.4480 0.4566 -0.0269 -0.0529 0.0698  150 ASP B CB  
2789 C CG  . ASP B 173 ? 0.5555 0.4811 0.4954 -0.0318 -0.0517 0.0650  150 ASP B CG  
2790 O OD1 . ASP B 173 ? 0.5702 0.5278 0.5345 -0.0390 -0.0483 0.0619  150 ASP B OD1 
2791 O OD2 . ASP B 173 ? 0.5866 0.4831 0.5092 -0.0284 -0.0540 0.0643  150 ASP B OD2 
2792 N N   . TRP B 174 ? 0.4270 0.4360 0.4169 -0.0434 -0.0362 0.0730  151 TRP B N   
2793 C CA  . TRP B 174 ? 0.4039 0.4361 0.4092 -0.0529 -0.0272 0.0732  151 TRP B CA  
2794 C C   . TRP B 174 ? 0.4032 0.4380 0.4107 -0.0626 -0.0247 0.0666  151 TRP B C   
2795 O O   . TRP B 174 ? 0.4081 0.4495 0.4214 -0.0718 -0.0152 0.0646  151 TRP B O   
2796 C CB  . TRP B 174 ? 0.4119 0.4355 0.4126 -0.0543 -0.0149 0.0771  151 TRP B CB  
2797 C CG  . TRP B 174 ? 0.3769 0.4082 0.3844 -0.0474 -0.0147 0.0827  151 TRP B CG  
2798 C CD1 . TRP B 174 ? 0.3828 0.3950 0.3756 -0.0388 -0.0195 0.0843  151 TRP B CD1 
2799 C CD2 . TRP B 174 ? 0.3459 0.4050 0.3778 -0.0485 -0.0092 0.0868  151 TRP B CD2 
2800 N NE1 . TRP B 174 ? 0.3542 0.3786 0.3594 -0.0351 -0.0155 0.0889  151 TRP B NE1 
2801 C CE2 . TRP B 174 ? 0.3467 0.3996 0.3766 -0.0400 -0.0091 0.0913  151 TRP B CE2 
2802 C CE3 . TRP B 174 ? 0.3380 0.4269 0.3948 -0.0554 -0.0051 0.0868  151 TRP B CE3 
2803 C CZ2 . TRP B 174 ? 0.3502 0.4242 0.4023 -0.0372 -0.0039 0.0968  151 TRP B CZ2 
2804 C CZ3 . TRP B 174 ? 0.3336 0.4454 0.4136 -0.0520 -0.0022 0.0924  151 TRP B CZ3 
2805 C CH2 . TRP B 174 ? 0.3366 0.4401 0.4141 -0.0425 -0.0011 0.0979  151 TRP B CH2 
2806 N N   . THR B 175 ? 0.3958 0.4259 0.4014 -0.0611 -0.0320 0.0619  152 THR B N   
2807 C CA  . THR B 175 ? 0.3969 0.4330 0.4074 -0.0710 -0.0289 0.0544  152 THR B CA  
2808 C C   . THR B 175 ? 0.3781 0.4288 0.3985 -0.0700 -0.0366 0.0501  152 THR B C   
2809 O O   . THR B 175 ? 0.3811 0.4254 0.4013 -0.0607 -0.0436 0.0515  152 THR B O   
2810 C CB  . THR B 175 ? 0.4267 0.4280 0.4193 -0.0719 -0.0238 0.0509  152 THR B CB  
2811 O OG1 . THR B 175 ? 0.4486 0.4279 0.4313 -0.0603 -0.0332 0.0515  152 THR B OG1 
2812 C CG2 . THR B 175 ? 0.4318 0.4108 0.4090 -0.0748 -0.0120 0.0543  152 THR B CG2 
2813 N N   . PHE B 176 ? 0.3692 0.4390 0.3982 -0.0806 -0.0343 0.0439  153 PHE B N   
2814 C CA  . PHE B 176 ? 0.3526 0.4331 0.3875 -0.0821 -0.0380 0.0382  153 PHE B CA  
2815 C C   . PHE B 176 ? 0.3606 0.4256 0.3918 -0.0885 -0.0328 0.0282  153 PHE B C   
2816 O O   . PHE B 176 ? 0.3691 0.4184 0.3935 -0.0935 -0.0260 0.0260  153 PHE B O   
2817 C CB  . PHE B 176 ? 0.3464 0.4599 0.3893 -0.0902 -0.0396 0.0382  153 PHE B CB  
2818 C CG  . PHE B 176 ? 0.3409 0.4716 0.3898 -0.0842 -0.0439 0.0486  153 PHE B CG  
2819 C CD1 . PHE B 176 ? 0.3593 0.4979 0.4134 -0.0853 -0.0417 0.0536  153 PHE B CD1 
2820 C CD2 . PHE B 176 ? 0.3268 0.4654 0.3781 -0.0779 -0.0483 0.0528  153 PHE B CD2 
2821 C CE1 . PHE B 176 ? 0.3325 0.4865 0.3950 -0.0790 -0.0446 0.0631  153 PHE B CE1 
2822 C CE2 . PHE B 176 ? 0.3227 0.4746 0.3797 -0.0718 -0.0510 0.0628  153 PHE B CE2 
2823 C CZ  . PHE B 176 ? 0.3405 0.5003 0.4034 -0.0718 -0.0496 0.0682  153 PHE B CZ  
2824 N N   . GLN B 177 ? 0.3467 0.4144 0.3829 -0.0887 -0.0337 0.0219  154 GLN B N   
2825 C CA  . GLN B 177 ? 0.3563 0.4134 0.3917 -0.0963 -0.0269 0.0110  154 GLN B CA  
2826 C C   . GLN B 177 ? 0.3567 0.4328 0.3967 -0.1027 -0.0259 0.0046  154 GLN B C   
2827 O O   . GLN B 177 ? 0.3490 0.4387 0.3928 -0.0978 -0.0305 0.0094  154 GLN B O   
2828 C CB  . GLN B 177 ? 0.3630 0.3895 0.3981 -0.0859 -0.0273 0.0093  154 GLN B CB  
2829 C CG  . GLN B 177 ? 0.3698 0.3950 0.4151 -0.0725 -0.0359 0.0119  154 GLN B CG  
2830 C CD  . GLN B 177 ? 0.3983 0.3945 0.4454 -0.0610 -0.0396 0.0103  154 GLN B CD  
2831 O OE1 . GLN B 177 ? 0.4270 0.4130 0.4816 -0.0621 -0.0346 0.0020  154 GLN B OE1 
2832 N NE2 . GLN B 177 ? 0.4595 0.4408 0.4985 -0.0496 -0.0487 0.0184  154 GLN B NE2 
2833 N N   . ILE B 178 ? 0.3769 0.4518 0.4142 -0.1145 -0.0183 -0.0065 155 ILE B N   
2834 C CA  . ILE B 178 ? 0.3832 0.4702 0.4195 -0.1220 -0.0149 -0.0144 155 ILE B CA  
2835 C C   . ILE B 178 ? 0.4085 0.4770 0.4453 -0.1290 -0.0039 -0.0283 155 ILE B C   
2836 O O   . ILE B 178 ? 0.4156 0.4681 0.4507 -0.1324 0.0008  -0.0317 155 ILE B O   
2837 C CB  . ILE B 178 ? 0.3835 0.4984 0.4106 -0.1337 -0.0185 -0.0135 155 ILE B CB  
2838 C CG1 . ILE B 178 ? 0.3852 0.5133 0.4067 -0.1335 -0.0200 -0.0120 155 ILE B CG1 
2839 C CG2 . ILE B 178 ? 0.3837 0.4999 0.4042 -0.1501 -0.0123 -0.0260 155 ILE B CG2 
2840 C CD1 . ILE B 178 ? 0.3660 0.5183 0.3731 -0.1454 -0.0247 -0.0124 155 ILE B CD1 
2841 N N   . LEU B 179 ? 0.4165 0.4850 0.4560 -0.1310 0.0021  -0.0363 156 LEU B N   
2842 C CA  . LEU B 179 ? 0.4419 0.4945 0.4830 -0.1387 0.0151  -0.0512 156 LEU B CA  
2843 C C   . LEU B 179 ? 0.4566 0.5217 0.4839 -0.1543 0.0227  -0.0617 156 LEU B C   
2844 O O   . LEU B 179 ? 0.4542 0.5295 0.4784 -0.1531 0.0226  -0.0598 156 LEU B O   
2845 C CB  . LEU B 179 ? 0.4353 0.4688 0.4962 -0.1253 0.0184  -0.0537 156 LEU B CB  
2846 C CG  . LEU B 179 ? 0.4491 0.4623 0.5194 -0.1103 0.0114  -0.0462 156 LEU B CG  
2847 C CD1 . LEU B 179 ? 0.4647 0.4852 0.5415 -0.0959 -0.0021 -0.0336 156 LEU B CD1 
2848 C CD2 . LEU B 179 ? 0.4807 0.4708 0.5684 -0.1030 0.0183  -0.0546 156 LEU B CD2 
2849 N N   . VAL B 180 ? 0.4764 0.5384 0.4931 -0.1694 0.0299  -0.0732 157 VAL B N   
2850 C CA  . VAL B 180 ? 0.5004 0.5701 0.4991 -0.1858 0.0373  -0.0853 157 VAL B CA  
2851 C C   . VAL B 180 ? 0.5305 0.5761 0.5332 -0.1929 0.0550  -0.1025 157 VAL B C   
2852 O O   . VAL B 180 ? 0.5347 0.5672 0.5406 -0.1979 0.0598  -0.1085 157 VAL B O   
2853 C CB  . VAL B 180 ? 0.5071 0.5978 0.4885 -0.2005 0.0290  -0.0866 157 VAL B CB  
2854 C CG1 . VAL B 180 ? 0.5300 0.6265 0.4872 -0.2184 0.0348  -0.1002 157 VAL B CG1 
2855 C CG2 . VAL B 180 ? 0.4792 0.5933 0.4602 -0.1925 0.0126  -0.0698 157 VAL B CG2 
2856 N N   . MET B 181 ? 0.5502 0.5884 0.5536 -0.1936 0.0666  -0.1105 158 MET B N   
2857 C CA  . MET B 181 ? 0.5915 0.6070 0.6004 -0.2004 0.0856  -0.1277 158 MET B CA  
2858 C C   . MET B 181 ? 0.6246 0.6429 0.6054 -0.2214 0.0963  -0.1429 158 MET B C   
2859 O O   . MET B 181 ? 0.6317 0.6672 0.5899 -0.2271 0.0902  -0.1390 158 MET B O   
2860 C CB  . MET B 181 ? 0.5904 0.5915 0.6264 -0.1861 0.0947  -0.1294 158 MET B CB  
2861 C CG  . MET B 181 ? 0.6001 0.6148 0.6460 -0.1728 0.0849  -0.1164 158 MET B CG  
2862 S SD  . MET B 181 ? 0.6563 0.6695 0.7273 -0.1501 0.0665  -0.0993 158 MET B SD  
2863 C CE  . MET B 181 ? 0.5673 0.5889 0.6600 -0.1373 0.0653  -0.0948 158 MET B CE  
2864 N N   . LEU B 182 ? 0.6521 0.6510 0.6323 -0.2326 0.1125  -0.1601 159 LEU B N   
2865 C CA  . LEU B 182 ? 0.6861 0.6820 0.6382 -0.2537 0.1257  -0.1779 159 LEU B CA  
2866 C C   . LEU B 182 ? 0.7140 0.6822 0.6787 -0.2557 0.1513  -0.1948 159 LEU B C   
2867 O O   . LEU B 182 ? 0.7081 0.6563 0.6986 -0.2485 0.1596  -0.1988 159 LEU B O   
2868 C CB  . LEU B 182 ? 0.7001 0.7027 0.6341 -0.2714 0.1207  -0.1859 159 LEU B CB  
2869 C CG  . LEU B 182 ? 0.7381 0.7307 0.6464 -0.2955 0.1360  -0.2092 159 LEU B CG  
2870 C CD1 . LEU B 182 ? 0.7506 0.7633 0.6186 -0.3096 0.1267  -0.2110 159 LEU B CD1 
2871 C CD2 . LEU B 182 ? 0.7181 0.7054 0.6304 -0.3073 0.1374  -0.2189 159 LEU B CD2 
2872 N N   . GLU B 183 ? 0.7496 0.7149 0.6953 -0.2652 0.1645  -0.2046 160 GLU B N   
2873 C CA  . GLU B 183 ? 0.8012 0.7406 0.7577 -0.2695 0.1920  -0.2231 160 GLU B CA  
2874 C C   . GLU B 183 ? 0.8411 0.7691 0.7721 -0.2920 0.2030  -0.2422 160 GLU B C   
2875 O O   . GLU B 183 ? 0.8622 0.8052 0.7556 -0.3080 0.1926  -0.2441 160 GLU B O   
2876 C CB  . GLU B 183 ? 0.8222 0.7607 0.7667 -0.2718 0.2048  -0.2264 160 GLU B CB  
2877 C CG  . GLU B 183 ? 0.8855 0.7980 0.8532 -0.2721 0.2356  -0.2444 160 GLU B CG  
2878 C CD  . GLU B 183 ? 0.9274 0.8406 0.9046 -0.2657 0.2472  -0.2426 160 GLU B CD  
2879 O OE1 . GLU B 183 ? 0.9199 0.8519 0.8985 -0.2549 0.2299  -0.2248 160 GLU B OE1 
2880 O OE2 . GLU B 183 ? 0.9506 0.8442 0.9359 -0.2718 0.2756  -0.2599 160 GLU B OE2 
2881 N N   . MET B 184 ? 0.8692 0.7710 0.8217 -0.2928 0.2228  -0.2565 161 MET B N   
2882 C CA  . MET B 184 ? 0.9136 0.8013 0.8468 -0.3141 0.2345  -0.2758 161 MET B CA  
2883 C C   . MET B 184 ? 0.9590 0.8133 0.9056 -0.3196 0.2668  -0.2974 161 MET B C   
2884 O O   . MET B 184 ? 0.9485 0.7905 0.9276 -0.3043 0.2797  -0.2968 161 MET B O   
2885 C CB  . MET B 184 ? 0.8930 0.7819 0.8407 -0.3100 0.2215  -0.2683 161 MET B CB  
2886 C CG  . MET B 184 ? 0.8637 0.7358 0.8558 -0.2850 0.2231  -0.2571 161 MET B CG  
2887 S SD  . MET B 184 ? 0.8464 0.7025 0.8522 -0.2819 0.2194  -0.2529 161 MET B SD  
2888 C CE  . MET B 184 ? 0.8164 0.6443 0.8685 -0.2525 0.2265  -0.2440 161 MET B CE  
2889 N N   . THR B 185 ? 1.0178 0.8584 0.9424 -0.3417 0.2796  -0.3173 162 THR B N   
2890 C CA  . THR B 185 ? 1.0690 0.8750 1.0041 -0.3497 0.3122  -0.3401 162 THR B CA  
2891 C C   . THR B 185 ? 1.1068 0.9011 1.0279 -0.3689 0.3170  -0.3549 162 THR B C   
2892 O O   . THR B 185 ? 1.1444 0.9379 1.0267 -0.3945 0.3244  -0.3737 162 THR B O   
2893 C CB  . THR B 185 ? 1.1059 0.9025 1.0114 -0.3662 0.3346  -0.3587 162 THR B CB  
2894 O OG1 . THR B 185 ? 1.0913 0.9137 0.9652 -0.3680 0.3174  -0.3470 162 THR B OG1 
2895 C CG2 . THR B 185 ? 1.1147 0.8868 1.0597 -0.3531 0.3623  -0.3662 162 THR B CG2 
2896 N N   . PRO B 186 ? 1.1069 0.8908 1.0576 -0.3572 0.3129  -0.3467 163 PRO B N   
2897 C CA  . PRO B 186 ? 1.1406 0.9136 1.0819 -0.3748 0.3170  -0.3586 163 PRO B CA  
2898 C C   . PRO B 186 ? 1.2059 0.9487 1.1347 -0.3969 0.3485  -0.3886 163 PRO B C   
2899 O O   . PRO B 186 ? 1.2260 0.9390 1.1799 -0.3876 0.3729  -0.3961 163 PRO B O   
2900 C CB  . PRO B 186 ? 1.1192 0.8748 1.0992 -0.3522 0.3146  -0.3429 163 PRO B CB  
2901 C CG  . PRO B 186 ? 1.0899 0.8414 1.1024 -0.3240 0.3142  -0.3287 163 PRO B CG  
2902 C CD  . PRO B 186 ? 1.0680 0.8485 1.0612 -0.3265 0.3038  -0.3251 163 PRO B CD  
2903 N N   . GLN B 187 ? 1.2467 0.9972 1.1388 -0.4258 0.3479  -0.4065 164 GLN B N   
2904 C CA  . GLN B 187 ? 1.3104 1.0328 1.1838 -0.4500 0.3778  -0.4375 164 GLN B CA  
2905 C C   . GLN B 187 ? 1.3339 1.0233 1.2313 -0.4532 0.3973  -0.4480 164 GLN B C   
2906 O O   . GLN B 187 ? 1.3601 1.0132 1.2781 -0.4483 0.4265  -0.4591 164 GLN B O   
2907 C CB  . GLN B 187 ? 1.3433 1.0859 1.1637 -0.4811 0.3688  -0.4548 164 GLN B CB  
2908 C CG  . GLN B 187 ? 1.4086 1.1260 1.1971 -0.5033 0.3981  -0.4841 164 GLN B CG  
2909 C CD  . GLN B 187 ? 1.4724 1.1534 1.2659 -0.5222 0.4281  -0.5117 164 GLN B CD  
2910 O OE1 . GLN B 187 ? 1.5028 1.1488 1.3042 -0.5234 0.4612  -0.5277 164 GLN B OE1 
2911 N NE2 . GLN B 187 ? 1.4839 1.1727 1.2745 -0.5376 0.4180  -0.5184 164 GLN B NE2 
2912 N N   . GLN B 188 ? 1.3309 1.0317 1.2269 -0.4614 0.3826  -0.4447 165 GLN B N   
2913 C CA  . GLN B 188 ? 1.3566 1.0249 1.2694 -0.4689 0.4019  -0.4561 165 GLN B CA  
2914 C C   . GLN B 188 ? 1.3266 1.0090 1.2503 -0.4664 0.3826  -0.4413 165 GLN B C   
2915 O O   . GLN B 188 ? 1.3101 0.9759 1.2630 -0.4427 0.3820  -0.4216 165 GLN B O   
2916 C CB  . GLN B 188 ? 1.4146 1.0651 1.3006 -0.5028 0.4258  -0.4914 165 GLN B CB  
2917 C CG  . GLN B 188 ? 1.4699 1.0859 1.3712 -0.5143 0.4477  -0.5057 165 GLN B CG  
2918 C CD  . GLN B 188 ? 1.4958 1.0646 1.4344 -0.4915 0.4742  -0.5001 165 GLN B CD  
2919 O OE1 . GLN B 188 ? 1.4551 1.0222 1.4223 -0.4603 0.4630  -0.4727 165 GLN B OE1 
2920 N NE2 . GLN B 188 ? 1.5494 1.0787 1.4878 -0.5068 0.5088  -0.5264 165 GLN B NE2 
2921 N N   . GLY B 189 ? 1.3234 1.0355 1.2240 -0.4905 0.3672  -0.4510 166 GLY B N   
2922 C CA  . GLY B 189 ? 1.2961 1.0233 1.2089 -0.4916 0.3516  -0.4403 166 GLY B CA  
2923 C C   . GLY B 189 ? 1.2429 1.0150 1.1554 -0.4776 0.3165  -0.4150 166 GLY B C   
2924 O O   . GLY B 189 ? 1.2276 1.0234 1.1438 -0.4854 0.3008  -0.4111 166 GLY B O   
2925 N N   . ASP B 190 ? 1.2124 0.9944 1.1239 -0.4565 0.3062  -0.3982 167 ASP B N   
2926 C CA  . ASP B 190 ? 1.1652 0.9906 1.0693 -0.4458 0.2744  -0.3777 167 ASP B CA  
2927 C C   . ASP B 190 ? 1.1178 0.9567 1.0445 -0.4266 0.2558  -0.3517 167 ASP B C   
2928 O O   . ASP B 190 ? 1.1038 0.9162 1.0542 -0.4049 0.2634  -0.3369 167 ASP B O   
2929 C CB  . ASP B 190 ? 1.1518 0.9787 1.0491 -0.4302 0.2736  -0.3693 167 ASP B CB  
2930 C CG  . ASP B 190 ? 1.1939 1.0142 1.0595 -0.4515 0.2885  -0.3940 167 ASP B CG  
2931 O OD1 . ASP B 190 ? 1.1902 1.0047 1.0509 -0.4415 0.2951  -0.3912 167 ASP B OD1 
2932 O OD2 . ASP B 190 ? 1.2297 1.0495 1.0747 -0.4792 0.2944  -0.4173 167 ASP B OD2 
2933 N N   . VAL B 191 ? 1.0931 0.9730 1.0112 -0.4349 0.2311  -0.3467 168 VAL B N   
2934 C CA  . VAL B 191 ? 1.0481 0.9450 0.9848 -0.4182 0.2130  -0.3229 168 VAL B CA  
2935 C C   . VAL B 191 ? 1.0109 0.9441 0.9393 -0.4047 0.1868  -0.3042 168 VAL B C   
2936 O O   . VAL B 191 ? 1.0190 0.9835 0.9259 -0.4181 0.1717  -0.3109 168 VAL B O   
2937 C CB  . VAL B 191 ? 1.0550 0.9650 1.0004 -0.4365 0.2100  -0.3309 168 VAL B CB  
2938 C CG1 . VAL B 191 ? 1.0085 0.9503 0.9670 -0.4236 0.1862  -0.3084 168 VAL B CG1 
2939 C CG2 . VAL B 191 ? 1.0751 0.9400 1.0361 -0.4387 0.2369  -0.3379 168 VAL B CG2 
2940 N N   . TYR B 192 ? 0.9704 0.8966 0.9148 -0.3775 0.1816  -0.2809 169 TYR B N   
2941 C CA  . TYR B 192 ? 0.9322 0.8880 0.8733 -0.3621 0.1590  -0.2612 169 TYR B CA  
2942 C C   . TYR B 192 ? 0.8922 0.8638 0.8497 -0.3519 0.1438  -0.2430 169 TYR B C   
2943 O O   . TYR B 192 ? 0.8862 0.8325 0.8603 -0.3428 0.1532  -0.2364 169 TYR B O   
2944 C CB  . TYR B 192 ? 0.9253 0.8615 0.8739 -0.3397 0.1654  -0.2505 169 TYR B CB  
2945 C CG  . TYR B 192 ? 0.9723 0.8937 0.9064 -0.3492 0.1827  -0.2684 169 TYR B CG  
2946 C CD1 . TYR B 192 ? 1.0097 0.8933 0.9525 -0.3535 0.2091  -0.2843 169 TYR B CD1 
2947 C CD2 . TYR B 192 ? 0.9905 0.9329 0.9009 -0.3538 0.1744  -0.2694 169 TYR B CD2 
2948 C CE1 . TYR B 192 ? 1.0388 0.9075 0.9691 -0.3627 0.2277  -0.3020 169 TYR B CE1 
2949 C CE2 . TYR B 192 ? 1.0292 0.9550 0.9229 -0.3636 0.1930  -0.2865 169 TYR B CE2 
2950 C CZ  . TYR B 192 ? 1.0514 0.9414 0.9561 -0.3684 0.2200  -0.3034 169 TYR B CZ  
2951 O OH  . TYR B 192 ? 1.0997 0.9730 0.9884 -0.3786 0.2405  -0.3211 169 TYR B OH  
2952 N N   . THR B 193 ? 0.8613 0.8724 0.8130 -0.3531 0.1211  -0.2345 170 THR B N   
2953 C CA  . THR B 193 ? 0.8280 0.8558 0.7963 -0.3444 0.1080  -0.2185 170 THR B CA  
2954 C C   . THR B 193 ? 0.7920 0.8454 0.7585 -0.3268 0.0874  -0.1979 170 THR B C   
2955 O O   . THR B 193 ? 0.7915 0.8672 0.7404 -0.3310 0.0761  -0.1994 170 THR B O   
2956 C CB  . THR B 193 ? 0.8416 0.8960 0.8137 -0.3664 0.1015  -0.2310 170 THR B CB  
2957 O OG1 . THR B 193 ? 0.8846 0.9310 0.8435 -0.3903 0.1137  -0.2569 170 THR B OG1 
2958 C CG2 . THR B 193 ? 0.8327 0.8749 0.8274 -0.3643 0.1093  -0.2257 170 THR B CG2 
2959 N N   . CYS B 194 ? 0.7635 0.8105 0.7456 -0.3073 0.0836  -0.1788 171 CYS B N   
2960 C CA  . CYS B 194 ? 0.7272 0.7960 0.7110 -0.2898 0.0654  -0.1585 171 CYS B CA  
2961 C C   . CYS B 194 ? 0.7138 0.8084 0.7100 -0.2928 0.0538  -0.1519 171 CYS B C   
2962 O O   . CYS B 194 ? 0.7254 0.8046 0.7344 -0.2943 0.0632  -0.1521 171 CYS B O   
2963 C CB  . CYS B 194 ? 0.7095 0.7520 0.7027 -0.2661 0.0692  -0.1428 171 CYS B CB  
2964 S SG  . CYS B 194 ? 0.6748 0.7415 0.6716 -0.2454 0.0488  -0.1190 171 CYS B SG  
2965 N N   . GLN B 195 ? 0.6957 0.8273 0.6885 -0.2932 0.0347  -0.1458 172 GLN B N   
2966 C CA  . GLN B 195 ? 0.6777 0.8390 0.6872 -0.2963 0.0227  -0.1407 172 GLN B CA  
2967 C C   . GLN B 195 ? 0.6449 0.8241 0.6596 -0.2771 0.0074  -0.1191 172 GLN B C   
2968 O O   . GLN B 195 ? 0.6422 0.8298 0.6427 -0.2691 -0.0020 -0.1119 172 GLN B O   
2969 C CB  . GLN B 195 ? 0.7025 0.8964 0.7083 -0.3179 0.0122  -0.1567 172 GLN B CB  
2970 C CG  . GLN B 195 ? 0.6932 0.9307 0.7134 -0.3161 -0.0096 -0.1478 172 GLN B CG  
2971 C CD  . GLN B 195 ? 0.7021 0.9712 0.7247 -0.3385 -0.0204 -0.1660 172 GLN B CD  
2972 O OE1 . GLN B 195 ? 0.7264 0.9921 0.7633 -0.3555 -0.0096 -0.1827 172 GLN B OE1 
2973 N NE2 . GLN B 195 ? 0.7092 1.0087 0.7172 -0.3389 -0.0424 -0.1630 172 GLN B NE2 
2974 N N   . VAL B 196 ? 0.6264 0.8091 0.6607 -0.2701 0.0070  -0.1093 173 VAL B N   
2975 C CA  . VAL B 196 ? 0.5986 0.7932 0.6389 -0.2510 -0.0045 -0.0888 173 VAL B CA  
2976 C C   . VAL B 196 ? 0.5909 0.8228 0.6521 -0.2543 -0.0169 -0.0851 173 VAL B C   
2977 O O   . VAL B 196 ? 0.5934 0.8280 0.6727 -0.2645 -0.0095 -0.0926 173 VAL B O   
2978 C CB  . VAL B 196 ? 0.5831 0.7420 0.6244 -0.2332 0.0059  -0.0764 173 VAL B CB  
2979 C CG1 . VAL B 196 ? 0.5834 0.7080 0.6108 -0.2300 0.0171  -0.0819 173 VAL B CG1 
2980 C CG2 . VAL B 196 ? 0.5879 0.7324 0.6422 -0.2365 0.0175  -0.0770 173 VAL B CG2 
2981 N N   . GLU B 197 ? 0.5882 0.8482 0.6481 -0.2459 -0.0347 -0.0741 174 GLU B N   
2982 C CA  . GLU B 197 ? 0.5879 0.8854 0.6707 -0.2454 -0.0486 -0.0685 174 GLU B CA  
2983 C C   . GLU B 197 ? 0.5630 0.8572 0.6532 -0.2244 -0.0507 -0.0481 174 GLU B C   
2984 O O   . GLU B 197 ? 0.5600 0.8478 0.6337 -0.2115 -0.0562 -0.0369 174 GLU B O   
2985 C CB  . GLU B 197 ? 0.6062 0.9386 0.6799 -0.2510 -0.0697 -0.0705 174 GLU B CB  
2986 C CG  . GLU B 197 ? 0.6683 1.0046 0.7250 -0.2721 -0.0710 -0.0912 174 GLU B CG  
2987 C CD  . GLU B 197 ? 0.7204 1.0617 0.7425 -0.2711 -0.0838 -0.0889 174 GLU B CD  
2988 O OE1 . GLU B 197 ? 0.7284 1.0434 0.7296 -0.2605 -0.0757 -0.0811 174 GLU B OE1 
2989 O OE2 . GLU B 197 ? 0.7411 1.1119 0.7562 -0.2813 -0.1018 -0.0952 174 GLU B OE2 
2990 N N   . HIS B 198 ? 0.5510 0.8491 0.6660 -0.2221 -0.0450 -0.0444 175 HIS B N   
2991 C CA  . HIS B 198 ? 0.5335 0.8260 0.6558 -0.2038 -0.0444 -0.0269 175 HIS B CA  
2992 C C   . HIS B 198 ? 0.5350 0.8495 0.6905 -0.2056 -0.0430 -0.0258 175 HIS B C   
2993 O O   . HIS B 198 ? 0.5445 0.8564 0.7145 -0.2191 -0.0314 -0.0377 175 HIS B O   
2994 C CB  . HIS B 198 ? 0.5336 0.7803 0.6398 -0.1955 -0.0285 -0.0231 175 HIS B CB  
2995 C CG  . HIS B 198 ? 0.4903 0.7263 0.5963 -0.1770 -0.0286 -0.0065 175 HIS B CG  
2996 N ND1 . HIS B 198 ? 0.4501 0.6676 0.5631 -0.1728 -0.0164 -0.0021 175 HIS B ND1 
2997 C CD2 . HIS B 198 ? 0.4455 0.6853 0.5440 -0.1627 -0.0382 0.0059  175 HIS B CD2 
2998 C CE1 . HIS B 198 ? 0.4518 0.6629 0.5609 -0.1568 -0.0197 0.0117  175 HIS B CE1 
2999 N NE2 . HIS B 198 ? 0.4363 0.6615 0.5386 -0.1504 -0.0328 0.0166  175 HIS B NE2 
3000 N N   . THR B 199 ? 0.5351 0.8697 0.7043 -0.1923 -0.0528 -0.0119 176 THR B N   
3001 C CA  . THR B 199 ? 0.5471 0.9058 0.7530 -0.1919 -0.0514 -0.0100 176 THR B CA  
3002 C C   . THR B 199 ? 0.5611 0.8937 0.7765 -0.1969 -0.0281 -0.0147 176 THR B C   
3003 O O   . THR B 199 ? 0.5707 0.9230 0.8183 -0.2063 -0.0224 -0.0224 176 THR B O   
3004 C CB  . THR B 199 ? 0.5301 0.9006 0.7460 -0.1729 -0.0591 0.0080  176 THR B CB  
3005 O OG1 . THR B 199 ? 0.5611 0.9279 0.7508 -0.1623 -0.0716 0.0180  176 THR B OG1 
3006 C CG2 . THR B 199 ? 0.5336 0.9501 0.7904 -0.1740 -0.0707 0.0080  176 THR B CG2 
3007 N N   . SER B 200 ? 0.5751 0.8631 0.7628 -0.1904 -0.0148 -0.0101 177 SER B N   
3008 C CA  . SER B 200 ? 0.5978 0.8528 0.7848 -0.1949 0.0080  -0.0136 177 SER B CA  
3009 C C   . SER B 200 ? 0.6194 0.8745 0.8174 -0.2159 0.0193  -0.0315 177 SER B C   
3010 O O   . SER B 200 ? 0.6279 0.8617 0.8318 -0.2224 0.0396  -0.0356 177 SER B O   
3011 C CB  . SER B 200 ? 0.6085 0.8144 0.7589 -0.1838 0.0160  -0.0057 177 SER B CB  
3012 O OG  . SER B 200 ? 0.6218 0.8137 0.7507 -0.1874 0.0122  -0.0119 177 SER B OG  
3013 N N   . LEU B 201 ? 0.6311 0.9084 0.8298 -0.2269 0.0071  -0.0425 178 LEU B N   
3014 C CA  . LEU B 201 ? 0.6618 0.9392 0.8682 -0.2482 0.0164  -0.0617 178 LEU B CA  
3015 C C   . LEU B 201 ? 0.6735 1.0035 0.9152 -0.2630 0.0030  -0.0747 178 LEU B C   
3016 O O   . LEU B 201 ? 0.6725 1.0316 0.9101 -0.2643 -0.0186 -0.0770 178 LEU B O   
3017 C CB  . LEU B 201 ? 0.6691 0.9210 0.8430 -0.2518 0.0165  -0.0678 178 LEU B CB  
3018 C CG  . LEU B 201 ? 0.6622 0.8642 0.8026 -0.2396 0.0264  -0.0593 178 LEU B CG  
3019 C CD1 . LEU B 201 ? 0.6560 0.8552 0.7754 -0.2412 0.0177  -0.0647 178 LEU B CD1 
3020 C CD2 . LEU B 201 ? 0.6581 0.8170 0.7912 -0.2458 0.0507  -0.0641 178 LEU B CD2 
3021 N N   . ASP B 202 ? 0.6908 1.0315 0.9664 -0.2746 0.0161  -0.0841 179 ASP B N   
3022 C CA  . ASP B 202 ? 0.7087 1.0957 1.0214 -0.2926 0.0063  -0.1013 179 ASP B CA  
3023 C C   . ASP B 202 ? 0.7287 1.1212 1.0214 -0.3064 -0.0050 -0.1157 179 ASP B C   
3024 O O   . ASP B 202 ? 0.7366 1.1730 1.0447 -0.3139 -0.0271 -0.1239 179 ASP B O   
3025 C CB  . ASP B 202 ? 0.7247 1.1054 1.0691 -0.3087 0.0316  -0.1147 179 ASP B CB  
3026 C CG  . ASP B 202 ? 0.7538 1.0736 1.0665 -0.3132 0.0601  -0.1167 179 ASP B CG  
3027 O OD1 . ASP B 202 ? 0.7639 1.0452 1.0372 -0.2969 0.0623  -0.1016 179 ASP B OD1 
3028 O OD2 . ASP B 202 ? 0.7708 1.0805 1.0983 -0.3327 0.0798  -0.1333 179 ASP B OD2 
3029 N N   . SER B 203 ? 0.7443 1.0910 1.0015 -0.3090 0.0100  -0.1184 180 SER B N   
3030 C CA  . SER B 203 ? 0.7615 1.1037 0.9979 -0.3237 0.0065  -0.1342 180 SER B CA  
3031 C C   . SER B 203 ? 0.7606 1.0633 0.9524 -0.3117 0.0087  -0.1251 180 SER B C   
3032 O O   . SER B 203 ? 0.7640 1.0232 0.9403 -0.3017 0.0262  -0.1161 180 SER B O   
3033 C CB  . SER B 203 ? 0.7865 1.1121 1.0362 -0.3463 0.0293  -0.1547 180 SER B CB  
3034 O OG  . SER B 203 ? 0.8128 1.1016 1.0298 -0.3531 0.0398  -0.1632 180 SER B OG  
3035 N N   . PRO B 204 ? 0.7573 1.0743 0.9282 -0.3125 -0.0088 -0.1278 181 PRO B N   
3036 C CA  . PRO B 204 ? 0.7510 1.0331 0.8844 -0.3039 -0.0049 -0.1230 181 PRO B CA  
3037 C C   . PRO B 204 ? 0.7614 0.9960 0.8831 -0.3110 0.0204  -0.1325 181 PRO B C   
3038 O O   . PRO B 204 ? 0.7826 1.0160 0.9154 -0.3309 0.0316  -0.1507 181 PRO B O   
3039 C CB  . PRO B 204 ? 0.7610 1.0681 0.8784 -0.3137 -0.0226 -0.1330 181 PRO B CB  
3040 C CG  . PRO B 204 ? 0.7577 1.1155 0.8992 -0.3160 -0.0445 -0.1319 181 PRO B CG  
3041 C CD  . PRO B 204 ? 0.7582 1.1251 0.9393 -0.3196 -0.0344 -0.1336 181 PRO B CD  
3042 N N   . VAL B 205 ? 0.7432 0.9395 0.8443 -0.2945 0.0287  -0.1202 182 VAL B N   
3043 C CA  . VAL B 205 ? 0.7476 0.8945 0.8367 -0.2957 0.0512  -0.1245 182 VAL B CA  
3044 C C   . VAL B 205 ? 0.7517 0.8819 0.8193 -0.2991 0.0535  -0.1340 182 VAL B C   
3045 O O   . VAL B 205 ? 0.7381 0.8820 0.7935 -0.2914 0.0398  -0.1290 182 VAL B O   
3046 C CB  . VAL B 205 ? 0.7363 0.8501 0.8175 -0.2737 0.0575  -0.1046 182 VAL B CB  
3047 C CG1 . VAL B 205 ? 0.7509 0.8126 0.8127 -0.2678 0.0735  -0.1046 182 VAL B CG1 
3048 C CG2 . VAL B 205 ? 0.7342 0.8506 0.8332 -0.2747 0.0650  -0.0997 182 VAL B CG2 
3049 N N   . THR B 206 ? 0.7687 0.8673 0.8320 -0.3109 0.0727  -0.1478 183 THR B N   
3050 C CA  . THR B 206 ? 0.7780 0.8567 0.8235 -0.3150 0.0792  -0.1587 183 THR B CA  
3051 C C   . THR B 206 ? 0.8028 0.8282 0.8412 -0.3086 0.1005  -0.1582 183 THR B C   
3052 O O   . THR B 206 ? 0.8177 0.8192 0.8622 -0.3110 0.1150  -0.1573 183 THR B O   
3053 C CB  . THR B 206 ? 0.7938 0.8928 0.8389 -0.3413 0.0795  -0.1831 183 THR B CB  
3054 O OG1 . THR B 206 ? 0.8031 0.8985 0.8652 -0.3592 0.0931  -0.1962 183 THR B OG1 
3055 C CG2 . THR B 206 ? 0.7599 0.9084 0.8040 -0.3451 0.0548  -0.1830 183 THR B CG2 
3056 N N   . VAL B 207 ? 0.8090 0.8151 0.8345 -0.2999 0.1027  -0.1584 184 VAL B N   
3057 C CA  . VAL B 207 ? 0.8374 0.7944 0.8577 -0.2920 0.1206  -0.1584 184 VAL B CA  
3058 C C   . VAL B 207 ? 0.8561 0.8066 0.8685 -0.2984 0.1266  -0.1732 184 VAL B C   
3059 O O   . VAL B 207 ? 0.8375 0.8120 0.8439 -0.2958 0.1143  -0.1727 184 VAL B O   
3060 C CB  . VAL B 207 ? 0.8220 0.7572 0.8398 -0.2645 0.1152  -0.1359 184 VAL B CB  
3061 C CG1 . VAL B 207 ? 0.7972 0.7651 0.8151 -0.2520 0.0943  -0.1241 184 VAL B CG1 
3062 C CG2 . VAL B 207 ? 0.8397 0.7301 0.8531 -0.2524 0.1274  -0.1355 184 VAL B CG2 
3063 N N   . GLU B 208 ? 0.8948 0.8102 0.9064 -0.3073 0.1477  -0.1864 185 GLU B N   
3064 C CA  . GLU B 208 ? 0.9251 0.8335 0.9301 -0.3210 0.1588  -0.2066 185 GLU B CA  
3065 C C   . GLU B 208 ? 0.9422 0.8102 0.9481 -0.3056 0.1722  -0.2050 185 GLU B C   
3066 O O   . GLU B 208 ? 0.9511 0.7860 0.9622 -0.2884 0.1777  -0.1919 185 GLU B O   
3067 C CB  . GLU B 208 ? 0.9580 0.8602 0.9642 -0.3479 0.1747  -0.2285 185 GLU B CB  
3068 C CG  . GLU B 208 ? 0.9999 0.8550 1.0120 -0.3462 0.1967  -0.2275 185 GLU B CG  
3069 C CD  . GLU B 208 ? 1.0645 0.9080 1.0787 -0.3746 0.2171  -0.2526 185 GLU B CD  
3070 O OE1 . GLU B 208 ? 1.0732 0.9237 1.0810 -0.3924 0.2224  -0.2740 185 GLU B OE1 
3071 O OE2 . GLU B 208 ? 1.0981 0.9223 1.1192 -0.3797 0.2295  -0.2514 185 GLU B OE2 
3072 N N   . TRP B 209 ? 0.9504 0.8204 0.9507 -0.3117 0.1774  -0.2184 186 TRP B N   
3073 C CA  . TRP B 209 ? 0.9725 0.8039 0.9787 -0.3025 0.1952  -0.2234 186 TRP B CA  
3074 C C   . TRP B 209 ? 1.0053 0.8245 1.0044 -0.3272 0.2155  -0.2501 186 TRP B C   
3075 O O   . TRP B 209 ? 1.0080 0.8518 0.9936 -0.3437 0.2127  -0.2644 186 TRP B O   
3076 C CB  . TRP B 209 ? 0.9572 0.7969 0.9673 -0.2855 0.1873  -0.2162 186 TRP B CB  
3077 C CG  . TRP B 209 ? 0.9944 0.8016 1.0152 -0.2783 0.2057  -0.2249 186 TRP B CG  
3078 C CD1 . TRP B 209 ? 1.0274 0.8310 1.0423 -0.2933 0.2212  -0.2456 186 TRP B CD1 
3079 C CD2 . TRP B 209 ? 1.0146 0.7909 1.0546 -0.2530 0.2086  -0.2125 186 TRP B CD2 
3080 N NE1 . TRP B 209 ? 1.0527 0.8242 1.0862 -0.2790 0.2363  -0.2475 186 TRP B NE1 
3081 C CE2 . TRP B 209 ? 1.0481 0.8052 1.0984 -0.2531 0.2264  -0.2265 186 TRP B CE2 
3082 C CE3 . TRP B 209 ? 1.0083 0.7717 1.0567 -0.2298 0.1965  -0.1907 186 TRP B CE3 
3083 C CZ2 . TRP B 209 ? 1.0646 0.7915 1.1386 -0.2299 0.2320  -0.2196 186 TRP B CZ2 
3084 C CZ3 . TRP B 209 ? 1.0292 0.7607 1.0959 -0.2074 0.2007  -0.1837 186 TRP B CZ3 
3085 C CH2 . TRP B 209 ? 1.0631 0.7773 1.1452 -0.2070 0.2181  -0.1981 186 TRP B CH2 
3086 N N   . LYS B 210 ? 1.0313 0.8099 1.0370 -0.3296 0.2364  -0.2564 187 LYS B N   
3087 C CA  . LYS B 210 ? 1.0663 0.8238 1.0679 -0.3507 0.2602  -0.2822 187 LYS B CA  
3088 C C   . LYS B 210 ? 1.0751 0.8113 1.0828 -0.3396 0.2726  -0.2874 187 LYS B C   
3089 O O   . LYS B 210 ? 1.0698 0.7790 1.0940 -0.3141 0.2752  -0.2729 187 LYS B O   
3090 C CB  . LYS B 210 ? 1.0969 0.8155 1.1041 -0.3569 0.2801  -0.2865 187 LYS B CB  
3091 C CG  . LYS B 210 ? 1.1002 0.8366 1.1017 -0.3856 0.2823  -0.3016 187 LYS B CG  
3092 C CD  . LYS B 210 ? 1.1215 0.8114 1.1290 -0.3923 0.3080  -0.3075 187 LYS B CD  
3093 C CE  . LYS B 210 ? 1.1321 0.8334 1.1377 -0.4266 0.3182  -0.3321 187 LYS B CE  
3094 N NZ  . LYS B 210 ? 1.1540 0.8032 1.1625 -0.4380 0.3514  -0.3482 187 LYS B NZ  
3095 N N   . ALA B 211 ? 1.0917 0.8404 1.0861 -0.3585 0.2797  -0.3083 188 ALA B N   
3096 C CA  . ALA B 211 ? 1.1092 0.8397 1.1102 -0.3505 0.2944  -0.3157 188 ALA B CA  
3097 C C   . ALA B 211 ? 1.1624 0.8537 1.1656 -0.3650 0.3256  -0.3391 188 ALA B C   
3098 O O   . ALA B 211 ? 1.1885 0.8762 1.1823 -0.3782 0.3405  -0.3589 188 ALA B O   
3099 C CB  . ALA B 211 ? 1.0983 0.8619 1.0806 -0.3592 0.2850  -0.3221 188 ALA B CB  
3100 N N   . GLN B 212 ? 1.1849 0.8440 1.1980 -0.3638 0.3375  -0.3375 189 GLN B N   
3101 C CA  . GLN B 212 ? 1.2374 0.8510 1.2583 -0.3711 0.3694  -0.3561 189 GLN B CA  
3102 C C   . GLN B 212 ? 1.2354 0.8259 1.2808 -0.3433 0.3767  -0.3472 189 GLN B C   
3103 O O   . GLN B 212 ? 1.2626 0.8332 1.3138 -0.3490 0.3997  -0.3658 189 GLN B O   
3104 C CB  . GLN B 212 ? 1.2662 0.8459 1.2909 -0.3764 0.3830  -0.3561 189 GLN B CB  
3105 C CG  . GLN B 212 ? 1.3202 0.8455 1.3561 -0.3790 0.4177  -0.3720 189 GLN B CG  
3106 C CD  . GLN B 212 ? 1.3724 0.8723 1.4010 -0.4035 0.4380  -0.3880 189 GLN B CD  
3107 O OE1 . GLN B 212 ? 1.3648 0.8727 1.3886 -0.4081 0.4284  -0.3786 189 GLN B OE1 
3108 N NE2 . GLN B 212 ? 1.4073 0.8749 1.4367 -0.4199 0.4686  -0.4134 189 GLN B NE2 
3109 O OXT . GLN B 212 ? 1.2031 0.7966 1.2637 -0.3153 0.3591  -0.3223 189 GLN B OXT 
3110 N N   . ILE C 1   ? 0.5626 0.6209 0.5709 -0.0577 0.0358  0.0200  1   ILE D N   
3111 C CA  . ILE C 1   ? 0.5534 0.6135 0.5869 -0.0535 0.0356  0.0235  1   ILE D CA  
3112 C C   . ILE C 1   ? 0.5544 0.6133 0.6068 -0.0515 0.0491  0.0163  1   ILE D C   
3113 O O   . ILE C 1   ? 0.5641 0.6247 0.6354 -0.0516 0.0538  0.0191  1   ILE D O   
3114 C CB  . ILE C 1   ? 0.5359 0.5968 0.5858 -0.0434 0.0198  0.0265  1   ILE D CB  
3115 C CG1 . ILE C 1   ? 0.5327 0.5958 0.5799 -0.0456 0.0091  0.0361  1   ILE D CG1 
3116 C CG2 . ILE C 1   ? 0.5224 0.5831 0.6004 -0.0368 0.0199  0.0250  1   ILE D CG2 
3117 C CD1 . ILE C 1   ? 0.5376 0.6010 0.5672 -0.0473 0.0008  0.0383  1   ILE D CD1 
3118 N N   . LYS C 2   ? 0.5429 0.5991 0.5935 -0.0499 0.0555  0.0076  2   LYS D N   
3119 C CA  . LYS C 2   ? 0.5324 0.5873 0.6073 -0.0469 0.0674  0.0007  2   LYS D CA  
3120 C C   . LYS C 2   ? 0.5017 0.5573 0.6042 -0.0367 0.0551  0.0036  2   LYS D C   
3121 O O   . LYS C 2   ? 0.4938 0.5515 0.6063 -0.0345 0.0464  0.0103  2   LYS D O   
3122 C CB  . LYS C 2   ? 0.5490 0.6048 0.6325 -0.0537 0.0840  -0.0001 2   LYS D CB  
3123 C CG  . LYS C 2   ? 0.5910 0.6441 0.6505 -0.0650 0.1024  -0.0072 2   LYS D CG  
3124 C CD  . LYS C 2   ? 0.6468 0.7017 0.7017 -0.0741 0.1133  -0.0028 2   LYS D CD  
3125 C CE  . LYS C 2   ? 0.6867 0.7443 0.7237 -0.0772 0.0978  0.0100  2   LYS D CE  
3126 N NZ  . LYS C 2   ? 0.6754 0.7366 0.7324 -0.0769 0.0966  0.0190  2   LYS D NZ  
3127 N N   . ALA C 3   ? 0.4715 0.5247 0.5854 -0.0311 0.0533  -0.0010 3   ALA D N   
3128 C CA  . ALA C 3   ? 0.4397 0.4924 0.5740 -0.0228 0.0396  0.0022  3   ALA D CA  
3129 C C   . ALA C 3   ? 0.4337 0.4835 0.5823 -0.0195 0.0430  -0.0030 3   ALA D C   
3130 O O   . ALA C 3   ? 0.4390 0.4869 0.5735 -0.0221 0.0503  -0.0086 3   ALA D O   
3131 C CB  . ALA C 3   ? 0.4162 0.4687 0.5325 -0.0197 0.0239  0.0058  3   ALA D CB  
3132 N N   . ASP C 4   ? 0.4168 0.4659 0.5953 -0.0144 0.0368  -0.0006 4   ASP D N   
3133 C CA  . ASP C 4   ? 0.4111 0.4571 0.6048 -0.0111 0.0364  -0.0032 4   ASP D CA  
3134 C C   . ASP C 4   ? 0.3938 0.4376 0.5630 -0.0087 0.0241  -0.0021 4   ASP D C   
3135 O O   . ASP C 4   ? 0.4004 0.4419 0.5652 -0.0089 0.0277  -0.0057 4   ASP D O   
3136 C CB  . ASP C 4   ? 0.4075 0.4532 0.6404 -0.0069 0.0301  0.0009  4   ASP D CB  
3137 C CG  . ASP C 4   ? 0.4464 0.4951 0.7059 -0.0095 0.0439  0.0000  4   ASP D CG  
3138 O OD1 . ASP C 4   ? 0.4826 0.5313 0.7543 -0.0125 0.0625  -0.0067 4   ASP D OD1 
3139 O OD2 . ASP C 4   ? 0.4424 0.4933 0.7116 -0.0088 0.0370  0.0054  4   ASP D OD2 
3140 N N   . HIS C 5   ? 0.3679 0.4122 0.5216 -0.0071 0.0112  0.0023  5   HIS D N   
3141 C CA  . HIS C 5   ? 0.3414 0.3838 0.4740 -0.0048 0.0002  0.0034  5   HIS D CA  
3142 C C   . HIS C 5   ? 0.3270 0.3712 0.4389 -0.0054 -0.0058 0.0052  5   HIS D C   
3143 O O   . HIS C 5   ? 0.3076 0.3532 0.4275 -0.0053 -0.0092 0.0079  5   HIS D O   
3144 C CB  . HIS C 5   ? 0.3358 0.3745 0.4815 -0.0006 -0.0136 0.0074  5   HIS D CB  
3145 C CG  . HIS C 5   ? 0.3333 0.3702 0.5057 0.0002  -0.0102 0.0075  5   HIS D CG  
3146 N ND1 . HIS C 5   ? 0.3415 0.3758 0.5115 0.0005  -0.0091 0.0065  5   HIS D ND1 
3147 C CD2 . HIS C 5   ? 0.2714 0.3088 0.4772 0.0008  -0.0071 0.0088  5   HIS D CD2 
3148 C CE1 . HIS C 5   ? 0.3027 0.3357 0.5042 0.0013  -0.0060 0.0071  5   HIS D CE1 
3149 N NE2 . HIS C 5   ? 0.2561 0.2911 0.4804 0.0016  -0.0045 0.0084  5   HIS D NE2 
3150 N N   . VAL C 6   ? 0.3283 0.3724 0.4172 -0.0061 -0.0069 0.0038  6   VAL D N   
3151 C CA  . VAL C 6   ? 0.3391 0.3843 0.4125 -0.0056 -0.0140 0.0054  6   VAL D CA  
3152 C C   . VAL C 6   ? 0.3553 0.3973 0.4193 -0.0021 -0.0230 0.0051  6   VAL D C   
3153 O O   . VAL C 6   ? 0.3660 0.4073 0.4198 -0.0024 -0.0205 0.0035  6   VAL D O   
3154 C CB  . VAL C 6   ? 0.3376 0.3857 0.3926 -0.0102 -0.0079 0.0048  6   VAL D CB  
3155 C CG1 . VAL C 6   ? 0.3075 0.3572 0.3553 -0.0095 -0.0154 0.0076  6   VAL D CG1 
3156 C CG2 . VAL C 6   ? 0.3300 0.3800 0.3871 -0.0158 0.0030  0.0044  6   VAL D CG2 
3157 N N   . SER C 7   ? 0.3720 0.4118 0.4383 0.0005  -0.0328 0.0063  7   SER D N   
3158 C CA  . SER C 7   ? 0.3835 0.4197 0.4361 0.0025  -0.0400 0.0051  7   SER D CA  
3159 C C   . SER C 7   ? 0.3831 0.4210 0.4252 0.0027  -0.0407 0.0034  7   SER D C   
3160 O O   . SER C 7   ? 0.3891 0.4274 0.4388 0.0031  -0.0442 0.0039  7   SER D O   
3161 C CB  . SER C 7   ? 0.3851 0.4163 0.4449 0.0040  -0.0509 0.0064  7   SER D CB  
3162 O OG  . SER C 7   ? 0.4094 0.4392 0.4845 0.0038  -0.0517 0.0093  7   SER D OG  
3163 N N   . THR C 8   ? 0.3769 0.4156 0.4050 0.0024  -0.0377 0.0017  8   THR D N   
3164 C CA  . THR C 8   ? 0.3846 0.4252 0.4088 0.0028  -0.0382 0.0005  8   THR D CA  
3165 C C   . THR C 8   ? 0.3830 0.4212 0.3955 0.0043  -0.0389 -0.0032 8   THR D C   
3166 O O   . THR C 8   ? 0.3958 0.4332 0.3985 0.0039  -0.0361 -0.0037 8   THR D O   
3167 C CB  . THR C 8   ? 0.3821 0.4282 0.4068 -0.0002 -0.0329 0.0031  8   THR D CB  
3168 O OG1 . THR C 8   ? 0.4041 0.4514 0.4186 -0.0012 -0.0291 0.0023  8   THR D OG1 
3169 C CG2 . THR C 8   ? 0.3791 0.4270 0.4098 -0.0034 -0.0285 0.0057  8   THR D CG2 
3170 N N   . TYR C 9   ? 0.3788 0.4160 0.3941 0.0057  -0.0416 -0.0060 9   TYR D N   
3171 C CA  . TYR C 9   ? 0.3817 0.4182 0.3900 0.0067  -0.0388 -0.0102 9   TYR D CA  
3172 C C   . TYR C 9   ? 0.3766 0.4192 0.3926 0.0061  -0.0352 -0.0079 9   TYR D C   
3173 O O   . TYR C 9   ? 0.3774 0.4228 0.4059 0.0056  -0.0376 -0.0049 9   TYR D O   
3174 C CB  . TYR C 9   ? 0.3811 0.4125 0.3906 0.0083  -0.0424 -0.0160 9   TYR D CB  
3175 C CG  . TYR C 9   ? 0.3829 0.4067 0.3792 0.0076  -0.0471 -0.0193 9   TYR D CG  
3176 C CD1 . TYR C 9   ? 0.3566 0.3770 0.3590 0.0073  -0.0552 -0.0180 9   TYR D CD1 
3177 C CD2 . TYR C 9   ? 0.3566 0.3763 0.3345 0.0064  -0.0440 -0.0230 9   TYR D CD2 
3178 C CE1 . TYR C 9   ? 0.3793 0.3923 0.3701 0.0056  -0.0618 -0.0199 9   TYR D CE1 
3179 C CE2 . TYR C 9   ? 0.3624 0.3743 0.3252 0.0042  -0.0498 -0.0248 9   TYR D CE2 
3180 C CZ  . TYR C 9   ? 0.4060 0.4144 0.3753 0.0037  -0.0597 -0.0231 9   TYR D CZ  
3181 O OH  . TYR C 9   ? 0.4692 0.4693 0.4241 0.0004  -0.0683 -0.0238 9   TYR D OH  
3182 N N   . ALA C 10  ? 0.3740 0.4186 0.3836 0.0055  -0.0302 -0.0083 10  ALA D N   
3183 C CA  . ALA C 10  ? 0.3695 0.4197 0.3872 0.0042  -0.0283 -0.0052 10  ALA D CA  
3184 C C   . ALA C 10  ? 0.3842 0.4341 0.4017 0.0059  -0.0236 -0.0096 10  ALA D C   
3185 O O   . ALA C 10  ? 0.4069 0.4541 0.4116 0.0060  -0.0198 -0.0123 10  ALA D O   
3186 C CB  . ALA C 10  ? 0.3525 0.4059 0.3644 0.0008  -0.0265 -0.0008 10  ALA D CB  
3187 N N   . ALA C 11  ? 0.3886 0.4410 0.4218 0.0069  -0.0235 -0.0101 11  ALA D N   
3188 C CA  . ALA C 11  ? 0.3976 0.4501 0.4352 0.0085  -0.0169 -0.0151 11  ALA D CA  
3189 C C   . ALA C 11  ? 0.3982 0.4568 0.4584 0.0080  -0.0180 -0.0105 11  ALA D C   
3190 O O   . ALA C 11  ? 0.3988 0.4601 0.4716 0.0068  -0.0250 -0.0046 11  ALA D O   
3191 C CB  . ALA C 11  ? 0.4010 0.4472 0.4371 0.0110  -0.0141 -0.0243 11  ALA D CB  
3192 N N   . PHE C 12  ? 0.3954 0.4565 0.4618 0.0084  -0.0116 -0.0122 12  PHE D N   
3193 C CA  . PHE C 12  ? 0.3930 0.4596 0.4862 0.0084  -0.0128 -0.0083 12  PHE D CA  
3194 C C   . PHE C 12  ? 0.4035 0.4697 0.5096 0.0113  -0.0021 -0.0163 12  PHE D C   
3195 O O   . PHE C 12  ? 0.4058 0.4672 0.4949 0.0123  0.0071  -0.0246 12  PHE D O   
3196 C CB  . PHE C 12  ? 0.3819 0.4542 0.4762 0.0040  -0.0179 0.0012  12  PHE D CB  
3197 C CG  . PHE C 12  ? 0.3949 0.4677 0.4767 0.0031  -0.0114 -0.0005 12  PHE D CG  
3198 C CD1 . PHE C 12  ? 0.3889 0.4585 0.4456 0.0016  -0.0106 -0.0011 12  PHE D CD1 
3199 C CD2 . PHE C 12  ? 0.3998 0.4761 0.4980 0.0037  -0.0055 -0.0012 12  PHE D CD2 
3200 C CE1 . PHE C 12  ? 0.3940 0.4636 0.4407 0.0006  -0.0050 -0.0019 12  PHE D CE1 
3201 C CE2 . PHE C 12  ? 0.3995 0.4762 0.4874 0.0026  0.0008  -0.0022 12  PHE D CE2 
3202 C CZ  . PHE C 12  ? 0.4305 0.5036 0.4916 0.0010  0.0007  -0.0023 12  PHE D CZ  
3203 N N   . VAL C 13  ? 0.4035 0.4743 0.5408 0.0119  -0.0033 -0.0133 13  VAL D N   
3204 C CA  . VAL C 13  ? 0.4115 0.4829 0.5695 0.0146  0.0077  -0.0204 13  VAL D CA  
3205 C C   . VAL C 13  ? 0.4009 0.4802 0.5887 0.0129  0.0012  -0.0101 13  VAL D C   
3206 O O   . VAL C 13  ? 0.3937 0.4756 0.5908 0.0106  -0.0115 -0.0004 13  VAL D O   
3207 C CB  . VAL C 13  ? 0.4184 0.4848 0.5908 0.0181  0.0116  -0.0299 13  VAL D CB  
3208 C CG1 . VAL C 13  ? 0.4511 0.5197 0.6567 0.0206  0.0217  -0.0354 13  VAL D CG1 
3209 C CG2 . VAL C 13  ? 0.4295 0.4872 0.5701 0.0187  0.0189  -0.0414 13  VAL D CG2 
3210 N N   . GLN C 14  ? 0.4133 0.4963 0.6149 0.0131  0.0093  -0.0111 14  GLN D N   
3211 C CA  . GLN C 14  ? 0.4201 0.5107 0.6550 0.0111  0.0024  -0.0009 14  GLN D CA  
3212 C C   . GLN C 14  ? 0.4402 0.5338 0.7046 0.0138  0.0159  -0.0067 14  GLN D C   
3213 O O   . GLN C 14  ? 0.4463 0.5356 0.6998 0.0164  0.0319  -0.0191 14  GLN D O   
3214 C CB  . GLN C 14  ? 0.4123 0.5061 0.6289 0.0057  -0.0069 0.0092  14  GLN D CB  
3215 C CG  . GLN C 14  ? 0.4036 0.4972 0.6028 0.0053  0.0036  0.0049  14  GLN D CG  
3216 C CD  . GLN C 14  ? 0.3866 0.4822 0.5687 -0.0001 -0.0052 0.0132  14  GLN D CD  
3217 O OE1 . GLN C 14  ? 0.3739 0.4729 0.5658 -0.0045 -0.0186 0.0232  14  GLN D OE1 
3218 N NE2 . GLN C 14  ? 0.4038 0.4966 0.5593 -0.0006 0.0018  0.0092  14  GLN D NE2 
3219 N N   . THR C 15  ? 0.4531 0.5539 0.7541 0.0123  0.0096  0.0026  15  THR D N   
3220 C CA  . THR C 15  ? 0.4887 0.5929 0.8271 0.0152  0.0225  -0.0024 15  THR D CA  
3221 C C   . THR C 15  ? 0.5063 0.6126 0.8322 0.0137  0.0329  -0.0042 15  THR D C   
3222 O O   . THR C 15  ? 0.5193 0.6255 0.8569 0.0161  0.0510  -0.0137 15  THR D O   
3223 C CB  . THR C 15  ? 0.4838 0.5950 0.8746 0.0144  0.0105  0.0092  15  THR D CB  
3224 O OG1 . THR C 15  ? 0.5090 0.6252 0.8960 0.0083  -0.0059 0.0241  15  THR D OG1 
3225 C CG2 . THR C 15  ? 0.4829 0.5917 0.8869 0.0155  -0.0002 0.0122  15  THR D CG2 
3226 N N   . HIS C 16  ? 0.5149 0.6227 0.8163 0.0091  0.0224  0.0046  16  HIS D N   
3227 C CA  . HIS C 16  ? 0.5292 0.6392 0.8218 0.0071  0.0298  0.0048  16  HIS D CA  
3228 C C   . HIS C 16  ? 0.5395 0.6431 0.7847 0.0067  0.0389  -0.0024 16  HIS D C   
3229 O O   . HIS C 16  ? 0.5266 0.6240 0.7410 0.0072  0.0360  -0.0059 16  HIS D O   
3230 C CB  . HIS C 16  ? 0.5250 0.6406 0.8272 0.0015  0.0131  0.0189  16  HIS D CB  
3231 C CG  . HIS C 16  ? 0.5385 0.6618 0.8910 0.0010  0.0116  0.0252  16  HIS D CG  
3232 N ND1 . HIS C 16  ? 0.5284 0.6549 0.9227 0.0028  0.0058  0.0290  16  HIS D ND1 
3233 C CD2 . HIS C 16  ? 0.5268 0.6554 0.8980 -0.0011 0.0145  0.0291  16  HIS D CD2 
3234 C CE1 . HIS C 16  ? 0.5302 0.6637 0.9679 0.0019  0.0052  0.0351  16  HIS D CE1 
3235 N NE2 . HIS C 16  ? 0.5185 0.6535 0.9427 -0.0006 0.0103  0.0352  16  HIS D NE2 
3236 N N   . ARG C 17  ? 0.5569 0.6623 0.8012 0.0057  0.0501  -0.0039 17  ARG D N   
3237 C CA  . ARG C 17  ? 0.5712 0.6727 0.7778 0.0034  0.0544  -0.0050 17  ARG D CA  
3238 C C   . ARG C 17  ? 0.5649 0.6579 0.7338 0.0047  0.0578  -0.0127 17  ARG D C   
3239 O O   . ARG C 17  ? 0.5902 0.6794 0.7567 0.0069  0.0715  -0.0226 17  ARG D O   
3240 C CB  . ARG C 17  ? 0.5748 0.6791 0.7746 -0.0012 0.0394  0.0056  17  ARG D CB  
3241 C CG  . ARG C 17  ? 0.6155 0.7280 0.8547 -0.0037 0.0315  0.0147  17  ARG D CG  
3242 C CD  . ARG C 17  ? 0.6828 0.8003 0.9539 -0.0022 0.0466  0.0124  17  ARG D CD  
3243 N NE  . ARG C 17  ? 0.7268 0.8481 1.0396 0.0012  0.0504  0.0107  17  ARG D NE  
3244 C CZ  . ARG C 17  ? 0.7601 0.8815 1.0906 0.0049  0.0700  0.0012  17  ARG D CZ  
3245 N NH1 . ARG C 17  ? 0.7781 0.8959 1.0850 0.0050  0.0878  -0.0067 17  ARG D NH1 
3246 N NH2 . ARG C 17  ? 0.7670 0.8919 1.1403 0.0080  0.0722  -0.0002 17  ARG D NH2 
3247 N N   . PRO C 18  ? 0.5389 0.6285 0.6797 0.0029  0.0459  -0.0087 18  PRO D N   
3248 C CA  . PRO C 18  ? 0.5261 0.6078 0.6370 0.0043  0.0477  -0.0155 18  PRO D CA  
3249 C C   . PRO C 18  ? 0.5101 0.5904 0.6344 0.0074  0.0447  -0.0197 18  PRO D C   
3250 O O   . PRO C 18  ? 0.4998 0.5810 0.6272 0.0071  0.0317  -0.0144 18  PRO D O   
3251 C CB  . PRO C 18  ? 0.5167 0.5962 0.6027 0.0017  0.0365  -0.0097 18  PRO D CB  
3252 C CG  . PRO C 18  ? 0.5082 0.5939 0.6116 -0.0010 0.0261  -0.0009 18  PRO D CG  
3253 C CD  . PRO C 18  ? 0.5186 0.6107 0.6556 -0.0007 0.0309  0.0007  18  PRO D CD  
3254 N N   . THR C 19  ? 0.5094 0.5873 0.6425 0.0097  0.0577  -0.0294 19  THR D N   
3255 C CA  . THR C 19  ? 0.4969 0.5730 0.6492 0.0129  0.0583  -0.0356 19  THR D CA  
3256 C C   . THR C 19  ? 0.4883 0.5599 0.6246 0.0135  0.0463  -0.0350 19  THR D C   
3257 O O   . THR C 19  ? 0.4806 0.5539 0.6393 0.0150  0.0380  -0.0323 19  THR D O   
3258 C CB  . THR C 19  ? 0.5132 0.5838 0.6616 0.0140  0.0773  -0.0497 19  THR D CB  
3259 O OG1 . THR C 19  ? 0.5055 0.5817 0.6936 0.0157  0.0874  -0.0517 19  THR D OG1 
3260 C CG2 . THR C 19  ? 0.5465 0.6092 0.6858 0.0157  0.0774  -0.0597 19  THR D CG2 
3261 N N   . GLY C 20  ? 0.4800 0.5455 0.5794 0.0118  0.0453  -0.0368 20  GLY D N   
3262 C CA  . GLY C 20  ? 0.4659 0.5266 0.5482 0.0120  0.0355  -0.0368 20  GLY D CA  
3263 C C   . GLY C 20  ? 0.4664 0.5237 0.5158 0.0094  0.0317  -0.0334 20  GLY D C   
3264 O O   . GLY C 20  ? 0.4721 0.5290 0.5080 0.0075  0.0384  -0.0331 20  GLY D O   
3265 N N   . GLU C 21  ? 0.4513 0.5063 0.4906 0.0093  0.0211  -0.0304 21  GLU D N   
3266 C CA  . GLU C 21  ? 0.4363 0.4874 0.4492 0.0073  0.0173  -0.0278 21  GLU D CA  
3267 C C   . GLU C 21  ? 0.4276 0.4742 0.4340 0.0081  0.0092  -0.0291 21  GLU D C   
3268 O O   . GLU C 21  ? 0.4127 0.4616 0.4357 0.0095  0.0035  -0.0274 21  GLU D O   
3269 C CB  . GLU C 21  ? 0.4293 0.4855 0.4438 0.0053  0.0121  -0.0189 21  GLU D CB  
3270 C CG  . GLU C 21  ? 0.4222 0.4749 0.4153 0.0033  0.0096  -0.0160 21  GLU D CG  
3271 C CD  . GLU C 21  ? 0.4018 0.4590 0.3989 0.0011  0.0060  -0.0093 21  GLU D CD  
3272 O OE1 . GLU C 21  ? 0.3742 0.4315 0.3705 0.0002  -0.0008 -0.0063 21  GLU D OE1 
3273 O OE2 . GLU C 21  ? 0.4269 0.4872 0.4282 -0.0003 0.0105  -0.0074 21  GLU D OE2 
3274 N N   . PHE C 22  ? 0.4299 0.4699 0.4133 0.0067  0.0082  -0.0312 22  PHE D N   
3275 C CA  . PHE C 22  ? 0.4192 0.4542 0.3955 0.0069  -0.0002 -0.0319 22  PHE D CA  
3276 C C   . PHE C 22  ? 0.4212 0.4533 0.3799 0.0047  -0.0054 -0.0268 22  PHE D C   
3277 O O   . PHE C 22  ? 0.4301 0.4575 0.3703 0.0023  -0.0029 -0.0277 22  PHE D O   
3278 C CB  . PHE C 22  ? 0.4254 0.4533 0.3951 0.0070  0.0027  -0.0419 22  PHE D CB  
3279 C CG  . PHE C 22  ? 0.4202 0.4426 0.3846 0.0069  -0.0070 -0.0428 22  PHE D CG  
3280 C CD1 . PHE C 22  ? 0.3878 0.4119 0.3717 0.0093  -0.0120 -0.0432 22  PHE D CD1 
3281 C CD2 . PHE C 22  ? 0.4205 0.4364 0.3626 0.0040  -0.0124 -0.0418 22  PHE D CD2 
3282 C CE1 . PHE C 22  ? 0.3858 0.4053 0.3673 0.0090  -0.0210 -0.0433 22  PHE D CE1 
3283 C CE2 . PHE C 22  ? 0.3980 0.4093 0.3387 0.0036  -0.0224 -0.0418 22  PHE D CE2 
3284 C CZ  . PHE C 22  ? 0.3724 0.3856 0.3330 0.0063  -0.0262 -0.0428 22  PHE D CZ  
3285 N N   . MET C 23  ? 0.4082 0.4430 0.3742 0.0050  -0.0123 -0.0211 23  MET D N   
3286 C CA  . MET C 23  ? 0.4194 0.4516 0.3761 0.0035  -0.0172 -0.0163 23  MET D CA  
3287 C C   . MET C 23  ? 0.4029 0.4338 0.3665 0.0041  -0.0253 -0.0144 23  MET D C   
3288 O O   . MET C 23  ? 0.3942 0.4272 0.3699 0.0055  -0.0272 -0.0155 23  MET D O   
3289 C CB  . MET C 23  ? 0.4190 0.4563 0.3798 0.0024  -0.0144 -0.0112 23  MET D CB  
3290 C CG  . MET C 23  ? 0.4602 0.5033 0.4358 0.0026  -0.0156 -0.0088 23  MET D CG  
3291 S SD  . MET C 23  ? 0.5382 0.5839 0.5156 0.0001  -0.0157 -0.0039 23  MET D SD  
3292 C CE  . MET C 23  ? 0.5062 0.5560 0.4844 -0.0013 -0.0101 -0.0033 23  MET D CE  
3293 N N   . PHE C 24  ? 0.3952 0.4229 0.3539 0.0029  -0.0300 -0.0107 24  PHE D N   
3294 C CA  . PHE C 24  ? 0.3803 0.4077 0.3500 0.0034  -0.0363 -0.0079 24  PHE D CA  
3295 C C   . PHE C 24  ? 0.3616 0.3914 0.3368 0.0024  -0.0346 -0.0032 24  PHE D C   
3296 O O   . PHE C 24  ? 0.3602 0.3881 0.3279 0.0012  -0.0336 -0.0011 24  PHE D O   
3297 C CB  . PHE C 24  ? 0.3914 0.4116 0.3546 0.0025  -0.0449 -0.0085 24  PHE D CB  
3298 C CG  . PHE C 24  ? 0.3957 0.4154 0.3734 0.0028  -0.0518 -0.0047 24  PHE D CG  
3299 C CD1 . PHE C 24  ? 0.4040 0.4250 0.3944 0.0042  -0.0544 -0.0061 24  PHE D CD1 
3300 C CD2 . PHE C 24  ? 0.4284 0.4461 0.4097 0.0016  -0.0559 0.0006  24  PHE D CD2 
3301 C CE1 . PHE C 24  ? 0.3994 0.4202 0.4055 0.0043  -0.0598 -0.0025 24  PHE D CE1 
3302 C CE2 . PHE C 24  ? 0.4435 0.4609 0.4429 0.0020  -0.0615 0.0040  24  PHE D CE2 
3303 C CZ  . PHE C 24  ? 0.4100 0.4292 0.4215 0.0033  -0.0630 0.0022  24  PHE D CZ  
3304 N N   . GLU C 25  ? 0.3473 0.3808 0.3354 0.0025  -0.0335 -0.0017 25  GLU D N   
3305 C CA  . GLU C 25  ? 0.3497 0.3843 0.3445 0.0012  -0.0304 0.0008  25  GLU D CA  
3306 C C   . GLU C 25  ? 0.3475 0.3815 0.3574 0.0014  -0.0326 0.0024  25  GLU D C   
3307 O O   . GLU C 25  ? 0.3428 0.3777 0.3596 0.0020  -0.0349 0.0021  25  GLU D O   
3308 C CB  . GLU C 25  ? 0.3446 0.3841 0.3391 -0.0006 -0.0235 0.0002  25  GLU D CB  
3309 C CG  . GLU C 25  ? 0.3702 0.4135 0.3688 -0.0014 -0.0229 -0.0001 25  GLU D CG  
3310 C CD  . GLU C 25  ? 0.4078 0.4550 0.4043 -0.0052 -0.0177 0.0004  25  GLU D CD  
3311 O OE1 . GLU C 25  ? 0.3723 0.4223 0.3714 -0.0077 -0.0173 0.0019  25  GLU D OE1 
3312 O OE2 . GLU C 25  ? 0.4352 0.4824 0.4266 -0.0065 -0.0145 -0.0002 25  GLU D OE2 
3313 N N   . PHE C 26  ? 0.3426 0.3750 0.3604 0.0008  -0.0315 0.0043  26  PHE D N   
3314 C CA  . PHE C 26  ? 0.3264 0.3585 0.3630 0.0009  -0.0314 0.0055  26  PHE D CA  
3315 C C   . PHE C 26  ? 0.3382 0.3726 0.3814 -0.0011 -0.0209 0.0033  26  PHE D C   
3316 O O   . PHE C 26  ? 0.3416 0.3753 0.3798 -0.0021 -0.0176 0.0027  26  PHE D O   
3317 C CB  . PHE C 26  ? 0.3246 0.3517 0.3696 0.0017  -0.0402 0.0098  26  PHE D CB  
3318 C CG  . PHE C 26  ? 0.3089 0.3360 0.3795 0.0020  -0.0403 0.0115  26  PHE D CG  
3319 C CD1 . PHE C 26  ? 0.3072 0.3353 0.3889 0.0027  -0.0431 0.0117  26  PHE D CD1 
3320 C CD2 . PHE C 26  ? 0.2907 0.3168 0.3776 0.0017  -0.0364 0.0128  26  PHE D CD2 
3321 C CE1 . PHE C 26  ? 0.3284 0.3571 0.4367 0.0030  -0.0415 0.0132  26  PHE D CE1 
3322 C CE2 . PHE C 26  ? 0.3045 0.3308 0.4195 0.0022  -0.0346 0.0138  26  PHE D CE2 
3323 C CZ  . PHE C 26  ? 0.3245 0.3523 0.4506 0.0028  -0.0368 0.0141  26  PHE D CZ  
3324 N N   . ASP C 27  ? 0.3506 0.3874 0.4045 -0.0024 -0.0152 0.0017  27  ASP D N   
3325 C CA  . ASP C 27  ? 0.3772 0.4157 0.4319 -0.0060 -0.0036 -0.0022 27  ASP D CA  
3326 C C   . ASP C 27  ? 0.3852 0.4241 0.4232 -0.0082 -0.0005 -0.0043 27  ASP D C   
3327 O O   . ASP C 27  ? 0.3983 0.4356 0.4396 -0.0100 0.0058  -0.0072 27  ASP D O   
3328 C CB  . ASP C 27  ? 0.3772 0.4136 0.4544 -0.0061 0.0023  -0.0037 27  ASP D CB  
3329 C CG  . ASP C 27  ? 0.4154 0.4526 0.5118 -0.0050 0.0017  -0.0020 27  ASP D CG  
3330 O OD1 . ASP C 27  ? 0.4299 0.4697 0.5196 -0.0059 0.0005  -0.0011 27  ASP D OD1 
3331 O OD2 . ASP C 27  ? 0.4561 0.4914 0.5771 -0.0034 0.0016  -0.0010 27  ASP D OD2 
3332 N N   . GLU C 28  ? 0.3955 0.4364 0.4187 -0.0080 -0.0051 -0.0028 28  GLU D N   
3333 C CA  . GLU C 28  ? 0.4063 0.4488 0.4159 -0.0105 -0.0030 -0.0039 28  GLU D CA  
3334 C C   . GLU C 28  ? 0.3975 0.4379 0.4032 -0.0087 -0.0051 -0.0031 28  GLU D C   
3335 O O   . GLU C 28  ? 0.3857 0.4275 0.3830 -0.0108 -0.0032 -0.0038 28  GLU D O   
3336 C CB  . GLU C 28  ? 0.4213 0.4641 0.4283 -0.0159 0.0057  -0.0077 28  GLU D CB  
3337 C CG  . GLU C 28  ? 0.4905 0.5362 0.4833 -0.0205 0.0055  -0.0072 28  GLU D CG  
3338 C CD  . GLU C 28  ? 0.5869 0.6346 0.5782 -0.0236 0.0061  -0.0056 28  GLU D CD  
3339 O OE1 . GLU C 28  ? 0.6000 0.6468 0.5873 -0.0295 0.0138  -0.0086 28  GLU D OE1 
3340 O OE2 . GLU C 28  ? 0.6371 0.6869 0.6315 -0.0205 -0.0004 -0.0017 28  GLU D OE2 
3341 N N   . ASP C 29  ? 0.3910 0.4281 0.4028 -0.0057 -0.0097 -0.0007 29  ASP D N   
3342 C CA  . ASP C 29  ? 0.3955 0.4309 0.4001 -0.0050 -0.0122 0.0016  29  ASP D CA  
3343 C C   . ASP C 29  ? 0.4007 0.4349 0.3962 -0.0028 -0.0188 0.0038  29  ASP D C   
3344 O O   . ASP C 29  ? 0.4193 0.4513 0.4188 -0.0014 -0.0245 0.0049  29  ASP D O   
3345 C CB  . ASP C 29  ? 0.3999 0.4312 0.4156 -0.0049 -0.0127 0.0039  29  ASP D CB  
3346 C CG  . ASP C 29  ? 0.3846 0.4156 0.4127 -0.0069 -0.0048 0.0000  29  ASP D CG  
3347 O OD1 . ASP C 29  ? 0.3968 0.4294 0.4182 -0.0098 0.0009  -0.0037 29  ASP D OD1 
3348 O OD2 . ASP C 29  ? 0.3980 0.4269 0.4439 -0.0061 -0.0044 0.0002  29  ASP D OD2 
3349 N N   . GLU C 30  ? 0.3943 0.4293 0.3780 -0.0031 -0.0178 0.0038  30  GLU D N   
3350 C CA  . GLU C 30  ? 0.3961 0.4291 0.3688 -0.0020 -0.0214 0.0040  30  GLU D CA  
3351 C C   . GLU C 30  ? 0.4008 0.4279 0.3702 -0.0024 -0.0279 0.0079  30  GLU D C   
3352 O O   . GLU C 30  ? 0.4166 0.4418 0.3868 -0.0038 -0.0279 0.0116  30  GLU D O   
3353 C CB  . GLU C 30  ? 0.3978 0.4330 0.3619 -0.0028 -0.0164 0.0032  30  GLU D CB  
3354 C CG  . GLU C 30  ? 0.4315 0.4642 0.3826 -0.0026 -0.0165 0.0020  30  GLU D CG  
3355 C CD  . GLU C 30  ? 0.4774 0.5049 0.4174 -0.0047 -0.0183 0.0059  30  GLU D CD  
3356 O OE1 . GLU C 30  ? 0.4872 0.5096 0.4156 -0.0056 -0.0229 0.0056  30  GLU D OE1 
3357 O OE2 . GLU C 30  ? 0.4760 0.5041 0.4182 -0.0062 -0.0158 0.0095  30  GLU D OE2 
3358 N N   . MET C 31  ? 0.3964 0.4203 0.3627 -0.0018 -0.0345 0.0075  31  MET D N   
3359 C CA  . MET C 31  ? 0.3979 0.4155 0.3610 -0.0034 -0.0435 0.0123  31  MET D CA  
3360 C C   . MET C 31  ? 0.4206 0.4339 0.3606 -0.0059 -0.0447 0.0122  31  MET D C   
3361 O O   . MET C 31  ? 0.4369 0.4454 0.3683 -0.0091 -0.0496 0.0180  31  MET D O   
3362 C CB  . MET C 31  ? 0.3961 0.4119 0.3681 -0.0024 -0.0511 0.0119  31  MET D CB  
3363 C CG  . MET C 31  ? 0.4120 0.4207 0.3804 -0.0049 -0.0632 0.0175  31  MET D CG  
3364 S SD  . MET C 31  ? 0.4516 0.4584 0.4378 -0.0040 -0.0736 0.0185  31  MET D SD  
3365 C CE  . MET C 31  ? 0.4431 0.4548 0.4612 -0.0017 -0.0685 0.0213  31  MET D CE  
3366 N N   . PHE C 32  ? 0.4187 0.4332 0.3497 -0.0051 -0.0401 0.0056  32  PHE D N   
3367 C CA  . PHE C 32  ? 0.4189 0.4293 0.3281 -0.0076 -0.0377 0.0025  32  PHE D CA  
3368 C C   . PHE C 32  ? 0.4170 0.4321 0.3294 -0.0051 -0.0288 -0.0049 32  PHE D C   
3369 O O   . PHE C 32  ? 0.4025 0.4227 0.3313 -0.0021 -0.0282 -0.0063 32  PHE D O   
3370 C CB  . PHE C 32  ? 0.4305 0.4327 0.3254 -0.0106 -0.0474 0.0019  32  PHE D CB  
3371 C CG  . PHE C 32  ? 0.4091 0.4110 0.3113 -0.0083 -0.0506 -0.0043 32  PHE D CG  
3372 C CD1 . PHE C 32  ? 0.3969 0.3992 0.2941 -0.0072 -0.0436 -0.0131 32  PHE D CD1 
3373 C CD2 . PHE C 32  ? 0.3848 0.3856 0.3014 -0.0074 -0.0606 -0.0011 32  PHE D CD2 
3374 C CE1 . PHE C 32  ? 0.4105 0.4121 0.3168 -0.0052 -0.0471 -0.0183 32  PHE D CE1 
3375 C CE2 . PHE C 32  ? 0.3803 0.3808 0.3050 -0.0056 -0.0639 -0.0059 32  PHE D CE2 
3376 C CZ  . PHE C 32  ? 0.3863 0.3869 0.3054 -0.0045 -0.0576 -0.0144 32  PHE D CZ  
3377 N N   . TYR C 33  ? 0.4361 0.4496 0.3341 -0.0068 -0.0216 -0.0089 33  TYR D N   
3378 C CA  . TYR C 33  ? 0.4413 0.4588 0.3456 -0.0045 -0.0128 -0.0161 33  TYR D CA  
3379 C C   . TYR C 33  ? 0.4814 0.4926 0.3650 -0.0077 -0.0071 -0.0226 33  TYR D C   
3380 O O   . TYR C 33  ? 0.5036 0.5083 0.3656 -0.0125 -0.0094 -0.0198 33  TYR D O   
3381 C CB  . TYR C 33  ? 0.4221 0.4473 0.3391 -0.0032 -0.0054 -0.0136 33  TYR D CB  
3382 C CG  . TYR C 33  ? 0.4317 0.4563 0.3374 -0.0061 0.0016  -0.0113 33  TYR D CG  
3383 C CD1 . TYR C 33  ? 0.4470 0.4728 0.3506 -0.0066 0.0125  -0.0164 33  TYR D CD1 
3384 C CD2 . TYR C 33  ? 0.4316 0.4544 0.3317 -0.0086 -0.0021 -0.0037 33  TYR D CD2 
3385 C CE1 . TYR C 33  ? 0.4749 0.5006 0.3692 -0.0097 0.0202  -0.0140 33  TYR D CE1 
3386 C CE2 . TYR C 33  ? 0.4704 0.4926 0.3612 -0.0117 0.0042  -0.0005 33  TYR D CE2 
3387 C CZ  . TYR C 33  ? 0.4988 0.5226 0.3855 -0.0124 0.0158  -0.0056 33  TYR D CZ  
3388 O OH  . TYR C 33  ? 0.4809 0.5046 0.3592 -0.0160 0.0236  -0.0023 33  TYR D OH  
3389 N N   . VAL C 34  ? 0.4906 0.5031 0.3809 -0.0057 0.0005  -0.0311 34  VAL D N   
3390 C CA  . VAL C 34  ? 0.5235 0.5297 0.3955 -0.0090 0.0091  -0.0398 34  VAL D CA  
3391 C C   . VAL C 34  ? 0.5276 0.5389 0.4050 -0.0089 0.0233  -0.0410 34  VAL D C   
3392 O O   . VAL C 34  ? 0.5124 0.5317 0.4149 -0.0048 0.0273  -0.0410 34  VAL D O   
3393 C CB  . VAL C 34  ? 0.5281 0.5308 0.4059 -0.0073 0.0094  -0.0503 34  VAL D CB  
3394 C CG1 . VAL C 34  ? 0.5499 0.5449 0.4076 -0.0114 0.0207  -0.0616 34  VAL D CG1 
3395 C CG2 . VAL C 34  ? 0.5307 0.5282 0.4043 -0.0078 -0.0053 -0.0484 34  VAL D CG2 
3396 N N   . ASP C 35  ? 0.5574 0.5641 0.4117 -0.0141 0.0300  -0.0409 35  ASP D N   
3397 C CA  . ASP C 35  ? 0.5745 0.5855 0.4337 -0.0147 0.0452  -0.0425 35  ASP D CA  
3398 C C   . ASP C 35  ? 0.5897 0.5984 0.4524 -0.0142 0.0576  -0.0559 35  ASP D C   
3399 O O   . ASP C 35  ? 0.6169 0.6162 0.4550 -0.0187 0.0603  -0.0639 35  ASP D O   
3400 C CB  . ASP C 35  ? 0.5954 0.6022 0.4283 -0.0213 0.0488  -0.0367 35  ASP D CB  
3401 C CG  . ASP C 35  ? 0.6018 0.6128 0.4400 -0.0226 0.0662  -0.0387 35  ASP D CG  
3402 O OD1 . ASP C 35  ? 0.6258 0.6404 0.4823 -0.0195 0.0774  -0.0475 35  ASP D OD1 
3403 O OD2 . ASP C 35  ? 0.5872 0.5980 0.4137 -0.0267 0.0687  -0.0309 35  ASP D OD2 
3404 N N   . LEU C 36  ? 0.5777 0.5947 0.4720 -0.0094 0.0648  -0.0583 36  LEU D N   
3405 C CA  . LEU C 36  ? 0.5911 0.6068 0.4990 -0.0076 0.0762  -0.0711 36  LEU D CA  
3406 C C   . LEU C 36  ? 0.6233 0.6359 0.5202 -0.0117 0.0960  -0.0794 36  LEU D C   
3407 O O   . LEU C 36  ? 0.6453 0.6528 0.5425 -0.0123 0.1068  -0.0928 36  LEU D O   
3408 C CB  . LEU C 36  ? 0.5574 0.5827 0.5071 -0.0012 0.0741  -0.0692 36  LEU D CB  
3409 C CG  . LEU C 36  ? 0.5404 0.5687 0.4992 0.0018  0.0562  -0.0610 36  LEU D CG  
3410 C CD1 . LEU C 36  ? 0.5086 0.5467 0.5050 0.0062  0.0530  -0.0561 36  LEU D CD1 
3411 C CD2 . LEU C 36  ? 0.4987 0.5191 0.4451 0.0017  0.0472  -0.0662 36  LEU D CD2 
3412 N N   . ASP C 37  ? 0.6368 0.6521 0.5248 -0.0149 0.1018  -0.0723 37  ASP D N   
3413 C CA  . ASP C 37  ? 0.6776 0.6895 0.5511 -0.0202 0.1218  -0.0793 37  ASP D CA  
3414 C C   . ASP C 37  ? 0.7107 0.7097 0.5356 -0.0288 0.1215  -0.0826 37  ASP D C   
3415 O O   . ASP C 37  ? 0.7341 0.7249 0.5419 -0.0329 0.1335  -0.0961 37  ASP D O   
3416 C CB  . ASP C 37  ? 0.6750 0.6950 0.5602 -0.0208 0.1289  -0.0698 37  ASP D CB  
3417 C CG  . ASP C 37  ? 0.6675 0.6999 0.5990 -0.0136 0.1251  -0.0644 37  ASP D CG  
3418 O OD1 . ASP C 37  ? 0.6789 0.7134 0.6330 -0.0085 0.1188  -0.0682 37  ASP D OD1 
3419 O OD2 . ASP C 37  ? 0.6432 0.6826 0.5882 -0.0138 0.1276  -0.0559 37  ASP D OD2 
3420 N N   . LYS C 38  ? 0.7148 0.7117 0.5186 -0.0319 0.1066  -0.0703 38  LYS D N   
3421 C CA  . LYS C 38  ? 0.7553 0.7402 0.5140 -0.0409 0.1018  -0.0696 38  LYS D CA  
3422 C C   . LYS C 38  ? 0.7666 0.7427 0.5123 -0.0416 0.0924  -0.0786 38  LYS D C   
3423 O O   . LYS C 38  ? 0.8033 0.7676 0.5103 -0.0503 0.0910  -0.0824 38  LYS D O   
3424 C CB  . LYS C 38  ? 0.7508 0.7366 0.4992 -0.0431 0.0862  -0.0525 38  LYS D CB  
3425 C CG  . LYS C 38  ? 0.7643 0.7552 0.5144 -0.0457 0.0961  -0.0438 38  LYS D CG  
3426 C CD  . LYS C 38  ? 0.7787 0.7698 0.5226 -0.0476 0.0803  -0.0273 38  LYS D CD  
3427 C CE  . LYS C 38  ? 0.7953 0.7882 0.5322 -0.0528 0.0904  -0.0190 38  LYS D CE  
3428 N NZ  . LYS C 38  ? 0.8117 0.7987 0.5262 -0.0591 0.0757  -0.0044 38  LYS D NZ  
3429 N N   . LYS C 39  ? 0.7443 0.7257 0.5223 -0.0333 0.0857  -0.0815 39  LYS D N   
3430 C CA  . LYS C 39  ? 0.7427 0.7177 0.5177 -0.0323 0.0743  -0.0883 39  LYS D CA  
3431 C C   . LYS C 39  ? 0.7525 0.7195 0.4990 -0.0376 0.0548  -0.0801 39  LYS D C   
3432 O O   . LYS C 39  ? 0.7768 0.7334 0.5020 -0.0421 0.0493  -0.0879 39  LYS D O   
3433 C CB  . LYS C 39  ? 0.7668 0.7344 0.5365 -0.0344 0.0892  -0.1072 39  LYS D CB  
3434 C CG  . LYS C 39  ? 0.7517 0.7283 0.5653 -0.0264 0.1028  -0.1147 39  LYS D CG  
3435 C CD  . LYS C 39  ? 0.7743 0.7525 0.5892 -0.0289 0.1266  -0.1213 39  LYS D CD  
3436 C CE  . LYS C 39  ? 0.7686 0.7556 0.6325 -0.0211 0.1383  -0.1280 39  LYS D CE  
3437 N NZ  . LYS C 39  ? 0.7719 0.7686 0.6569 -0.0198 0.1523  -0.1229 39  LYS D NZ  
3438 N N   . GLU C 40  ? 0.7369 0.7087 0.4861 -0.0370 0.0439  -0.0647 40  GLU D N   
3439 C CA  . GLU C 40  ? 0.7462 0.7121 0.4777 -0.0410 0.0242  -0.0545 40  GLU D CA  
3440 C C   . GLU C 40  ? 0.7054 0.6799 0.4658 -0.0343 0.0107  -0.0424 40  GLU D C   
3441 O O   . GLU C 40  ? 0.6871 0.6716 0.4723 -0.0288 0.0166  -0.0387 40  GLU D O   
3442 C CB  . GLU C 40  ? 0.7825 0.7409 0.4771 -0.0512 0.0237  -0.0473 40  GLU D CB  
3443 C CG  . GLU C 40  ? 0.8118 0.7755 0.5056 -0.0527 0.0395  -0.0434 40  GLU D CG  
3444 C CD  . GLU C 40  ? 0.8914 0.8445 0.5404 -0.0651 0.0464  -0.0436 40  GLU D CD  
3445 O OE1 . GLU C 40  ? 0.9278 0.8691 0.5453 -0.0727 0.0400  -0.0489 40  GLU D OE1 
3446 O OE2 . GLU C 40  ? 0.9022 0.8582 0.5461 -0.0682 0.0579  -0.0382 40  GLU D OE2 
3447 N N   . THR C 41  ? 0.6977 0.6679 0.4553 -0.0354 -0.0069 -0.0368 41  THR D N   
3448 C CA  . THR C 41  ? 0.6567 0.6342 0.4423 -0.0294 -0.0178 -0.0271 41  THR D CA  
3449 C C   . THR C 41  ? 0.6479 0.6279 0.4331 -0.0313 -0.0210 -0.0138 41  THR D C   
3450 O O   . THR C 41  ? 0.6681 0.6407 0.4293 -0.0386 -0.0271 -0.0075 41  THR D O   
3451 C CB  . THR C 41  ? 0.6531 0.6262 0.4430 -0.0292 -0.0344 -0.0259 41  THR D CB  
3452 O OG1 . THR C 41  ? 0.6636 0.6346 0.4578 -0.0270 -0.0316 -0.0381 41  THR D OG1 
3453 C CG2 . THR C 41  ? 0.6148 0.5958 0.4354 -0.0232 -0.0418 -0.0174 41  THR D CG2 
3454 N N   . VAL C 42  ? 0.6175 0.6072 0.4292 -0.0255 -0.0173 -0.0097 42  VAL D N   
3455 C CA  . VAL C 42  ? 0.6039 0.5964 0.4217 -0.0263 -0.0199 0.0018  42  VAL D CA  
3456 C C   . VAL C 42  ? 0.5783 0.5739 0.4199 -0.0223 -0.0310 0.0077  42  VAL D C   
3457 O O   . VAL C 42  ? 0.5624 0.5633 0.4234 -0.0170 -0.0300 0.0032  42  VAL D O   
3458 C CB  . VAL C 42  ? 0.5933 0.5938 0.4224 -0.0240 -0.0060 0.0014  42  VAL D CB  
3459 C CG1 . VAL C 42  ? 0.5751 0.5762 0.4061 -0.0265 -0.0083 0.0127  42  VAL D CG1 
3460 C CG2 . VAL C 42  ? 0.6100 0.6090 0.4231 -0.0267 0.0084  -0.0067 42  VAL D CG2 
3461 N N   . TRP C 43  ? 0.5844 0.5763 0.4251 -0.0255 -0.0412 0.0181  43  TRP D N   
3462 C CA  . TRP C 43  ? 0.5603 0.5543 0.4256 -0.0224 -0.0507 0.0239  43  TRP D CA  
3463 C C   . TRP C 43  ? 0.5544 0.5532 0.4357 -0.0210 -0.0462 0.0296  43  TRP D C   
3464 O O   . TRP C 43  ? 0.5698 0.5671 0.4399 -0.0247 -0.0429 0.0345  43  TRP D O   
3465 C CB  . TRP C 43  ? 0.5691 0.5550 0.4280 -0.0271 -0.0668 0.0320  43  TRP D CB  
3466 C CG  . TRP C 43  ? 0.5641 0.5449 0.4111 -0.0284 -0.0733 0.0258  43  TRP D CG  
3467 C CD1 . TRP C 43  ? 0.5673 0.5411 0.3836 -0.0340 -0.0729 0.0210  43  TRP D CD1 
3468 C CD2 . TRP C 43  ? 0.5361 0.5184 0.4025 -0.0245 -0.0800 0.0228  43  TRP D CD2 
3469 N NE1 . TRP C 43  ? 0.5718 0.5419 0.3870 -0.0338 -0.0799 0.0148  43  TRP D NE1 
3470 C CE2 . TRP C 43  ? 0.5676 0.5432 0.4144 -0.0278 -0.0846 0.0165  43  TRP D CE2 
3471 C CE3 . TRP C 43  ? 0.5177 0.5057 0.4157 -0.0191 -0.0814 0.0245  43  TRP D CE3 
3472 C CZ2 . TRP C 43  ? 0.5745 0.5494 0.4346 -0.0254 -0.0920 0.0127  43  TRP D CZ2 
3473 C CZ3 . TRP C 43  ? 0.5014 0.4892 0.4119 -0.0169 -0.0877 0.0211  43  TRP D CZ3 
3474 C CH2 . TRP C 43  ? 0.5315 0.5130 0.4241 -0.0199 -0.0935 0.0158  43  TRP D CH2 
3475 N N   . HIS C 44  ? 0.5420 0.5461 0.4490 -0.0163 -0.0455 0.0287  44  HIS D N   
3476 C CA  . HIS C 44  ? 0.5327 0.5408 0.4561 -0.0150 -0.0405 0.0316  44  HIS D CA  
3477 C C   . HIS C 44  ? 0.5462 0.5502 0.4796 -0.0175 -0.0484 0.0419  44  HIS D C   
3478 O O   . HIS C 44  ? 0.5542 0.5595 0.4937 -0.0184 -0.0441 0.0454  44  HIS D O   
3479 C CB  . HIS C 44  ? 0.5125 0.5265 0.4562 -0.0105 -0.0360 0.0257  44  HIS D CB  
3480 C CG  . HIS C 44  ? 0.5220 0.5404 0.4761 -0.0100 -0.0278 0.0249  44  HIS D CG  
3481 N ND1 . HIS C 44  ? 0.5246 0.5417 0.4936 -0.0108 -0.0289 0.0296  44  HIS D ND1 
3482 C CD2 . HIS C 44  ? 0.5062 0.5299 0.4592 -0.0092 -0.0192 0.0199  44  HIS D CD2 
3483 C CE1 . HIS C 44  ? 0.5058 0.5266 0.4800 -0.0108 -0.0210 0.0267  44  HIS D CE1 
3484 N NE2 . HIS C 44  ? 0.5019 0.5270 0.4664 -0.0100 -0.0158 0.0213  44  HIS D NE2 
3485 N N   . LEU C 45  ? 0.5611 0.5603 0.4996 -0.0188 -0.0606 0.0472  45  LEU D N   
3486 C CA  . LEU C 45  ? 0.5734 0.5682 0.5251 -0.0216 -0.0706 0.0587  45  LEU D CA  
3487 C C   . LEU C 45  ? 0.6087 0.5955 0.5402 -0.0277 -0.0846 0.0671  45  LEU D C   
3488 O O   . LEU C 45  ? 0.6131 0.5972 0.5379 -0.0282 -0.0919 0.0646  45  LEU D O   
3489 C CB  . LEU C 45  ? 0.5609 0.5574 0.5472 -0.0177 -0.0738 0.0588  45  LEU D CB  
3490 C CG  . LEU C 45  ? 0.5404 0.5433 0.5465 -0.0129 -0.0610 0.0500  45  LEU D CG  
3491 C CD1 . LEU C 45  ? 0.5237 0.5275 0.5592 -0.0100 -0.0629 0.0485  45  LEU D CD1 
3492 C CD2 . LEU C 45  ? 0.5273 0.5312 0.5409 -0.0137 -0.0543 0.0519  45  LEU D CD2 
3493 N N   . GLU C 46  ? 0.6388 0.6214 0.5604 -0.0333 -0.0889 0.0776  46  GLU D N   
3494 C CA  . GLU C 46  ? 0.6821 0.6559 0.5810 -0.0414 -0.1034 0.0881  46  GLU D CA  
3495 C C   . GLU C 46  ? 0.6880 0.6578 0.5954 -0.0421 -0.1189 0.0905  46  GLU D C   
3496 O O   . GLU C 46  ? 0.7112 0.6755 0.5917 -0.0468 -0.1258 0.0888  46  GLU D O   
3497 C CB  . GLU C 46  ? 0.6990 0.6698 0.6075 -0.0459 -0.1102 0.1030  46  GLU D CB  
3498 C CG  . GLU C 46  ? 0.7745 0.7375 0.6480 -0.0561 -0.1176 0.1136  46  GLU D CG  
3499 C CD  . GLU C 46  ? 0.8443 0.8038 0.7346 -0.0606 -0.1285 0.1312  46  GLU D CD  
3500 O OE1 . GLU C 46  ? 0.8713 0.8283 0.7891 -0.0604 -0.1438 0.1400  46  GLU D OE1 
3501 O OE2 . GLU C 46  ? 0.8764 0.8357 0.7555 -0.0643 -0.1219 0.1367  46  GLU D OE2 
3502 N N   . GLU C 47  ? 0.6731 0.6455 0.6194 -0.0376 -0.1238 0.0936  47  GLU D N   
3503 C CA  . GLU C 47  ? 0.6848 0.6538 0.6458 -0.0383 -0.1395 0.0978  47  GLU D CA  
3504 C C   . GLU C 47  ? 0.6710 0.6414 0.6232 -0.0354 -0.1370 0.0858  47  GLU D C   
3505 O O   . GLU C 47  ? 0.6891 0.6546 0.6408 -0.0385 -0.1517 0.0893  47  GLU D O   
3506 C CB  . GLU C 47  ? 0.6743 0.6460 0.6843 -0.0340 -0.1432 0.1033  47  GLU D CB  
3507 C CG  . GLU C 47  ? 0.6561 0.6362 0.6900 -0.0255 -0.1254 0.0906  47  GLU D CG  
3508 C CD  . GLU C 47  ? 0.6551 0.6385 0.6975 -0.0237 -0.1129 0.0897  47  GLU D CD  
3509 O OE1 . GLU C 47  ? 0.6628 0.6505 0.7364 -0.0187 -0.1037 0.0841  47  GLU D OE1 
3510 O OE2 . GLU C 47  ? 0.6422 0.6235 0.6606 -0.0279 -0.1118 0.0940  47  GLU D OE2 
3511 N N   . PHE C 48  ? 0.6499 0.6267 0.5972 -0.0300 -0.1202 0.0725  48  PHE D N   
3512 C CA  . PHE C 48  ? 0.6406 0.6182 0.5794 -0.0278 -0.1185 0.0621  48  PHE D CA  
3513 C C   . PHE C 48  ? 0.6647 0.6348 0.5631 -0.0346 -0.1234 0.0606  48  PHE D C   
3514 O O   . PHE C 48  ? 0.6873 0.6519 0.5780 -0.0377 -0.1351 0.0601  48  PHE D O   
3515 C CB  . PHE C 48  ? 0.6123 0.5981 0.5562 -0.0213 -0.1009 0.0498  48  PHE D CB  
3516 C CG  . PHE C 48  ? 0.6026 0.5951 0.5814 -0.0157 -0.0944 0.0487  48  PHE D CG  
3517 C CD1 . PHE C 48  ? 0.6180 0.6174 0.5996 -0.0116 -0.0788 0.0404  48  PHE D CD1 
3518 C CD2 . PHE C 48  ? 0.5792 0.5705 0.5883 -0.0152 -0.1033 0.0558  48  PHE D CD2 
3519 C CE1 . PHE C 48  ? 0.5891 0.5935 0.5985 -0.0080 -0.0716 0.0382  48  PHE D CE1 
3520 C CE2 . PHE C 48  ? 0.5597 0.5565 0.6006 -0.0107 -0.0947 0.0532  48  PHE D CE2 
3521 C CZ  . PHE C 48  ? 0.5845 0.5874 0.6232 -0.0075 -0.0785 0.0439  48  PHE D CZ  
3522 N N   . GLY C 49  ? 0.6699 0.6392 0.5430 -0.0377 -0.1144 0.0597  49  GLY D N   
3523 C CA  . GLY C 49  ? 0.6983 0.6599 0.5301 -0.0452 -0.1157 0.0572  49  GLY D CA  
3524 C C   . GLY C 49  ? 0.7221 0.6735 0.5399 -0.0536 -0.1364 0.0661  49  GLY D C   
3525 O O   . GLY C 49  ? 0.7311 0.6767 0.5296 -0.0570 -0.1416 0.0595  49  GLY D O   
3526 N N   . GLN C 50  ? 0.7347 0.6837 0.5652 -0.0572 -0.1492 0.0814  50  GLN D N   
3527 C CA  . GLN C 50  ? 0.7651 0.7045 0.5878 -0.0658 -0.1722 0.0931  50  GLN D CA  
3528 C C   . GLN C 50  ? 0.7596 0.6976 0.5975 -0.0637 -0.1836 0.0887  50  GLN D C   
3529 O O   . GLN C 50  ? 0.7914 0.7199 0.6049 -0.0721 -0.1989 0.0907  50  GLN D O   
3530 C CB  . GLN C 50  ? 0.7673 0.7063 0.6140 -0.0680 -0.1836 0.1111  50  GLN D CB  
3531 C CG  . GLN C 50  ? 0.8303 0.7623 0.6416 -0.0787 -0.1871 0.1220  50  GLN D CG  
3532 C CD  . GLN C 50  ? 0.8608 0.7986 0.6888 -0.0755 -0.1760 0.1280  50  GLN D CD  
3533 O OE1 . GLN C 50  ? 0.8621 0.8022 0.7282 -0.0728 -0.1832 0.1387  50  GLN D OE1 
3534 N NE2 . GLN C 50  ? 0.8808 0.8205 0.6820 -0.0763 -0.1581 0.1208  50  GLN D NE2 
3535 N N   . ALA C 51  ? 0.7185 0.6656 0.5934 -0.0534 -0.1755 0.0821  51  ALA D N   
3536 C CA  . ALA C 51  ? 0.7023 0.6491 0.5999 -0.0511 -0.1863 0.0802  51  ALA D CA  
3537 C C   . ALA C 51  ? 0.6944 0.6409 0.5751 -0.0492 -0.1793 0.0647  51  ALA D C   
3538 O O   . ALA C 51  ? 0.7158 0.6552 0.5863 -0.0540 -0.1930 0.0636  51  ALA D O   
3539 C CB  . ALA C 51  ? 0.6696 0.6255 0.6189 -0.0423 -0.1824 0.0827  51  ALA D CB  
3540 N N   . PHE C 52  ? 0.6628 0.6164 0.5419 -0.0427 -0.1590 0.0532  52  PHE D N   
3541 C CA  . PHE C 52  ? 0.6464 0.6007 0.5190 -0.0397 -0.1523 0.0395  52  PHE D CA  
3542 C C   . PHE C 52  ? 0.6533 0.6045 0.4889 -0.0427 -0.1400 0.0296  52  PHE D C   
3543 O O   . PHE C 52  ? 0.6562 0.6065 0.4737 -0.0460 -0.1343 0.0334  52  PHE D O   
3544 C CB  . PHE C 52  ? 0.6140 0.5793 0.5199 -0.0299 -0.1394 0.0340  52  PHE D CB  
3545 C CG  . PHE C 52  ? 0.5919 0.5622 0.5361 -0.0264 -0.1440 0.0432  52  PHE D CG  
3546 C CD1 . PHE C 52  ? 0.5929 0.5603 0.5588 -0.0276 -0.1598 0.0492  52  PHE D CD1 
3547 C CD2 . PHE C 52  ? 0.5566 0.5338 0.5167 -0.0222 -0.1322 0.0452  52  PHE D CD2 
3548 C CE1 . PHE C 52  ? 0.5784 0.5505 0.5842 -0.0243 -0.1622 0.0569  52  PHE D CE1 
3549 C CE2 . PHE C 52  ? 0.5609 0.5420 0.5578 -0.0192 -0.1342 0.0517  52  PHE D CE2 
3550 C CZ  . PHE C 52  ? 0.5721 0.5508 0.5930 -0.0201 -0.1487 0.0576  52  PHE D CZ  
3551 N N   . SER C 53  ? 0.6484 0.5981 0.4757 -0.0414 -0.1352 0.0169  53  SER D N   
3552 C CA  . SER C 53  ? 0.6512 0.5994 0.4518 -0.0424 -0.1199 0.0049  53  SER D CA  
3553 C C   . SER C 53  ? 0.6279 0.5820 0.4469 -0.0348 -0.1095 -0.0069 53  SER D C   
3554 O O   . SER C 53  ? 0.6105 0.5685 0.4574 -0.0302 -0.1156 -0.0055 53  SER D O   
3555 C CB  . SER C 53  ? 0.6847 0.6196 0.4439 -0.0531 -0.1270 0.0010  53  SER D CB  
3556 O OG  . SER C 53  ? 0.7078 0.6363 0.4684 -0.0552 -0.1403 -0.0031 53  SER D OG  
3557 N N   . PHE C 54  ? 0.6290 0.5840 0.4344 -0.0339 -0.0938 -0.0175 54  PHE D N   
3558 C CA  . PHE C 54  ? 0.6142 0.5739 0.4351 -0.0278 -0.0833 -0.0286 54  PHE D CA  
3559 C C   . PHE C 54  ? 0.6448 0.5988 0.4392 -0.0314 -0.0709 -0.0409 54  PHE D C   
3560 O O   . PHE C 54  ? 0.6473 0.6022 0.4263 -0.0336 -0.0606 -0.0401 54  PHE D O   
3561 C CB  . PHE C 54  ? 0.5864 0.5588 0.4354 -0.0199 -0.0731 -0.0250 54  PHE D CB  
3562 C CG  . PHE C 54  ? 0.5617 0.5395 0.4262 -0.0144 -0.0620 -0.0344 54  PHE D CG  
3563 C CD1 . PHE C 54  ? 0.5272 0.5075 0.4145 -0.0106 -0.0669 -0.0360 54  PHE D CD1 
3564 C CD2 . PHE C 54  ? 0.5736 0.5542 0.4326 -0.0135 -0.0472 -0.0404 54  PHE D CD2 
3565 C CE1 . PHE C 54  ? 0.5296 0.5144 0.4325 -0.0063 -0.0585 -0.0427 54  PHE D CE1 
3566 C CE2 . PHE C 54  ? 0.5682 0.5538 0.4459 -0.0087 -0.0385 -0.0477 54  PHE D CE2 
3567 C CZ  . PHE C 54  ? 0.5511 0.5387 0.4503 -0.0052 -0.0447 -0.0483 54  PHE D CZ  
3568 N N   . GLU C 55  ? 0.6674 0.6156 0.4584 -0.0322 -0.0709 -0.0528 55  GLU D N   
3569 C CA  . GLU C 55  ? 0.7072 0.6478 0.4725 -0.0367 -0.0587 -0.0669 55  GLU D CA  
3570 C C   . GLU C 55  ? 0.6857 0.6355 0.4702 -0.0299 -0.0398 -0.0725 55  GLU D C   
3571 O O   . GLU C 55  ? 0.6771 0.6321 0.4894 -0.0235 -0.0367 -0.0774 55  GLU D O   
3572 C CB  . GLU C 55  ? 0.7253 0.6563 0.4854 -0.0393 -0.0645 -0.0790 55  GLU D CB  
3573 C CG  . GLU C 55  ? 0.8325 0.7488 0.5495 -0.0499 -0.0609 -0.0910 55  GLU D CG  
3574 C CD  . GLU C 55  ? 0.9155 0.8313 0.6073 -0.0540 -0.0430 -0.0939 55  GLU D CD  
3575 O OE1 . GLU C 55  ? 0.8978 0.8214 0.6076 -0.0478 -0.0246 -0.1001 55  GLU D OE1 
3576 O OE2 . GLU C 55  ? 0.9549 0.8621 0.6090 -0.0641 -0.0481 -0.0893 55  GLU D OE2 
3577 N N   . ALA C 56  ? 0.6873 0.6393 0.4586 -0.0319 -0.0280 -0.0707 56  ALA D N   
3578 C CA  . ALA C 56  ? 0.6569 0.6187 0.4487 -0.0259 -0.0114 -0.0734 56  ALA D CA  
3579 C C   . ALA C 56  ? 0.6444 0.6077 0.4579 -0.0211 -0.0020 -0.0863 56  ALA D C   
3580 O O   . ALA C 56  ? 0.6129 0.5863 0.4581 -0.0141 0.0020  -0.0838 56  ALA D O   
3581 C CB  . ALA C 56  ? 0.6735 0.6335 0.4413 -0.0312 0.0018  -0.0740 56  ALA D CB  
3582 N N   . GLN C 57  ? 0.6713 0.6239 0.4679 -0.0255 0.0009  -0.0999 57  GLN D N   
3583 C CA  . GLN C 57  ? 0.6771 0.6295 0.4935 -0.0219 0.0129  -0.1141 57  GLN D CA  
3584 C C   . GLN C 57  ? 0.6450 0.6044 0.5012 -0.0139 0.0051  -0.1116 57  GLN D C   
3585 O O   . GLN C 57  ? 0.6390 0.6002 0.5201 -0.0098 0.0138  -0.1203 57  GLN D O   
3586 C CB  . GLN C 57  ? 0.7180 0.6555 0.5044 -0.0295 0.0178  -0.1306 57  GLN D CB  
3587 C CG  . GLN C 57  ? 0.7629 0.6987 0.5491 -0.0304 0.0415  -0.1455 57  GLN D CG  
3588 C CD  . GLN C 57  ? 0.8278 0.7476 0.5705 -0.0412 0.0500  -0.1614 57  GLN D CD  
3589 O OE1 . GLN C 57  ? 0.8541 0.7656 0.5553 -0.0504 0.0420  -0.1569 57  GLN D OE1 
3590 N NE2 . GLN C 57  ? 0.8297 0.7448 0.5824 -0.0407 0.0669  -0.1799 57  GLN D NE2 
3591 N N   . GLY C 58  ? 0.6282 0.5914 0.4920 -0.0121 -0.0106 -0.0990 58  GLY D N   
3592 C CA  . GLY C 58  ? 0.6002 0.5710 0.4997 -0.0056 -0.0175 -0.0939 58  GLY D CA  
3593 C C   . GLY C 58  ? 0.5717 0.5556 0.4980 0.0001  -0.0117 -0.0854 58  GLY D C   
3594 O O   . GLY C 58  ? 0.5608 0.5502 0.5170 0.0047  -0.0119 -0.0848 58  GLY D O   
3595 N N   . GLY C 59  ? 0.5599 0.5484 0.4757 -0.0009 -0.0079 -0.0779 59  GLY D N   
3596 C CA  . GLY C 59  ? 0.5276 0.5272 0.4645 0.0030  -0.0016 -0.0711 59  GLY D CA  
3597 C C   . GLY C 59  ? 0.5261 0.5273 0.4770 0.0047  0.0127  -0.0801 59  GLY D C   
3598 O O   . GLY C 59  ? 0.5066 0.5152 0.4879 0.0088  0.0142  -0.0777 59  GLY D O   
3599 N N   . LEU C 60  ? 0.5417 0.5355 0.4709 0.0008  0.0232  -0.0903 60  LEU D N   
3600 C CA  . LEU C 60  ? 0.5458 0.5395 0.4888 0.0019  0.0391  -0.1015 60  LEU D CA  
3601 C C   . LEU C 60  ? 0.5365 0.5303 0.5107 0.0062  0.0371  -0.1076 60  LEU D C   
3602 O O   . LEU C 60  ? 0.5238 0.5242 0.5312 0.0103  0.0439  -0.1082 60  LEU D O   
3603 C CB  . LEU C 60  ? 0.5790 0.5617 0.4888 -0.0044 0.0502  -0.1141 60  LEU D CB  
3604 C CG  . LEU C 60  ? 0.5960 0.5774 0.4734 -0.0099 0.0539  -0.1084 60  LEU D CG  
3605 C CD1 . LEU C 60  ? 0.6285 0.5975 0.4708 -0.0177 0.0655  -0.1219 60  LEU D CD1 
3606 C CD2 . LEU C 60  ? 0.5509 0.5431 0.4467 -0.0071 0.0632  -0.1011 60  LEU D CD2 
3607 N N   . ALA C 61  ? 0.5426 0.5291 0.5085 0.0050  0.0266  -0.1109 61  ALA D N   
3608 C CA  . ALA C 61  ? 0.5345 0.5198 0.5292 0.0084  0.0235  -0.1164 61  ALA D CA  
3609 C C   . ALA C 61  ? 0.5017 0.4988 0.5302 0.0134  0.0161  -0.1028 61  ALA D C   
3610 O O   . ALA C 61  ? 0.4936 0.4947 0.5561 0.0170  0.0201  -0.1045 61  ALA D O   
3611 C CB  . ALA C 61  ? 0.5462 0.5221 0.5255 0.0057  0.0114  -0.1203 61  ALA D CB  
3612 N N   . ASN C 62  ? 0.4861 0.4883 0.5052 0.0130  0.0056  -0.0893 62  ASN D N   
3613 C CA  . ASN C 62  ? 0.4542 0.4667 0.4981 0.0158  -0.0019 -0.0757 62  ASN D CA  
3614 C C   . ASN C 62  ? 0.4291 0.4503 0.4930 0.0176  0.0053  -0.0712 62  ASN D C   
3615 O O   . ASN C 62  ? 0.4068 0.4344 0.4997 0.0197  0.0010  -0.0644 62  ASN D O   
3616 C CB  . ASN C 62  ? 0.4499 0.4647 0.4788 0.0143  -0.0126 -0.0645 62  ASN D CB  
3617 C CG  . ASN C 62  ? 0.4791 0.4904 0.5135 0.0144  -0.0239 -0.0633 62  ASN D CG  
3618 O OD1 . ASN C 62  ? 0.5027 0.5122 0.5578 0.0162  -0.0251 -0.0678 62  ASN D OD1 
3619 N ND2 . ASN C 62  ? 0.4758 0.4860 0.4950 0.0126  -0.0321 -0.0572 62  ASN D ND2 
3620 N N   . ILE C 63  ? 0.4294 0.4506 0.4784 0.0161  0.0157  -0.0743 63  ILE D N   
3621 C CA  . ILE C 63  ? 0.4165 0.4457 0.4858 0.0175  0.0236  -0.0710 63  ILE D CA  
3622 C C   . ILE C 63  ? 0.4223 0.4512 0.5237 0.0202  0.0314  -0.0795 63  ILE D C   
3623 O O   . ILE C 63  ? 0.4045 0.4412 0.5383 0.0223  0.0310  -0.0731 63  ILE D O   
3624 C CB  . ILE C 63  ? 0.4352 0.4636 0.4815 0.0148  0.0344  -0.0733 63  ILE D CB  
3625 C CG1 . ILE C 63  ? 0.4072 0.4372 0.4291 0.0124  0.0263  -0.0631 63  ILE D CG1 
3626 C CG2 . ILE C 63  ? 0.4079 0.4437 0.4804 0.0163  0.0452  -0.0728 63  ILE D CG2 
3627 C CD1 . ILE C 63  ? 0.3753 0.4145 0.4137 0.0134  0.0181  -0.0502 63  ILE D CD1 
3628 N N   . ALA C 64  ? 0.4446 0.4639 0.5380 0.0198  0.0379  -0.0940 64  ALA D N   
3629 C CA  . ALA C 64  ? 0.4518 0.4691 0.5769 0.0223  0.0476  -0.1052 64  ALA D CA  
3630 C C   . ALA C 64  ? 0.4359 0.4567 0.5956 0.0255  0.0357  -0.0983 64  ALA D C   
3631 O O   . ALA C 64  ? 0.4361 0.4613 0.6355 0.0283  0.0389  -0.0979 64  ALA D O   
3632 C CB  . ALA C 64  ? 0.4802 0.4847 0.5840 0.0199  0.0572  -0.1237 64  ALA D CB  
3633 N N   . ILE C 65  ? 0.4281 0.4467 0.5742 0.0246  0.0218  -0.0925 65  ILE D N   
3634 C CA  . ILE C 65  ? 0.4118 0.4341 0.5862 0.0264  0.0092  -0.0832 65  ILE D CA  
3635 C C   . ILE C 65  ? 0.4029 0.4367 0.5964 0.0266  0.0036  -0.0669 65  ILE D C   
3636 O O   . ILE C 65  ? 0.4020 0.4403 0.6329 0.0284  0.0019  -0.0626 65  ILE D O   
3637 C CB  . ILE C 65  ? 0.4146 0.4325 0.5683 0.0247  -0.0033 -0.0799 65  ILE D CB  
3638 C CG1 . ILE C 65  ? 0.4211 0.4269 0.5646 0.0241  -0.0004 -0.0961 65  ILE D CG1 
3639 C CG2 . ILE C 65  ? 0.3772 0.4010 0.5562 0.0254  -0.0164 -0.0660 65  ILE D CG2 
3640 C CD1 . ILE C 65  ? 0.4249 0.4254 0.5452 0.0217  -0.0121 -0.0940 65  ILE D CD1 
3641 N N   . LEU C 66  ? 0.4002 0.4383 0.5692 0.0242  0.0004  -0.0580 66  LEU D N   
3642 C CA  . LEU C 66  ? 0.3921 0.4400 0.5755 0.0231  -0.0056 -0.0433 66  LEU D CA  
3643 C C   . LEU C 66  ? 0.4007 0.4536 0.6163 0.0246  0.0011  -0.0434 66  LEU D C   
3644 O O   . LEU C 66  ? 0.3914 0.4515 0.6336 0.0237  -0.0073 -0.0310 66  LEU D O   
3645 C CB  . LEU C 66  ? 0.3871 0.4375 0.5394 0.0202  -0.0066 -0.0373 66  LEU D CB  
3646 C CG  . LEU C 66  ? 0.3837 0.4318 0.5137 0.0184  -0.0156 -0.0326 66  LEU D CG  
3647 C CD1 . LEU C 66  ? 0.3974 0.4495 0.5067 0.0156  -0.0169 -0.0250 66  LEU D CD1 
3648 C CD2 . LEU C 66  ? 0.3560 0.4063 0.5067 0.0180  -0.0265 -0.0242 66  LEU D CD2 
3649 N N   . ASN C 67  ? 0.4216 0.4707 0.6345 0.0261  0.0160  -0.0567 67  ASN D N   
3650 C CA  . ASN C 67  ? 0.4321 0.4854 0.6801 0.0280  0.0255  -0.0593 67  ASN D CA  
3651 C C   . ASN C 67  ? 0.4257 0.4792 0.7181 0.0308  0.0224  -0.0598 67  ASN D C   
3652 O O   . ASN C 67  ? 0.4160 0.4765 0.7463 0.0315  0.0189  -0.0511 67  ASN D O   
3653 C CB  . ASN C 67  ? 0.4574 0.5055 0.6913 0.0283  0.0447  -0.0751 67  ASN D CB  
3654 C CG  . ASN C 67  ? 0.4723 0.5248 0.6867 0.0260  0.0496  -0.0704 67  ASN D CG  
3655 O OD1 . ASN C 67  ? 0.4979 0.5588 0.7377 0.0262  0.0488  -0.0618 67  ASN D OD1 
3656 N ND2 . ASN C 67  ? 0.4984 0.5454 0.6694 0.0235  0.0532  -0.0749 67  ASN D ND2 
3657 N N   . ASN C 68  ? 0.4390 0.4844 0.7278 0.0320  0.0222  -0.0692 68  ASN D N   
3658 C CA  . ASN C 68  ? 0.4453 0.4901 0.7760 0.0344  0.0167  -0.0685 68  ASN D CA  
3659 C C   . ASN C 68  ? 0.4240 0.4762 0.7726 0.0327  -0.0021 -0.0480 68  ASN D C   
3660 O O   . ASN C 68  ? 0.4272 0.4845 0.8201 0.0336  -0.0069 -0.0400 68  ASN D O   
3661 C CB  . ASN C 68  ? 0.4623 0.4960 0.7828 0.0354  0.0198  -0.0834 68  ASN D CB  
3662 C CG  . ASN C 68  ? 0.5176 0.5431 0.8269 0.0360  0.0399  -0.1050 68  ASN D CG  
3663 O OD1 . ASN C 68  ? 0.5743 0.5894 0.8581 0.0348  0.0435  -0.1185 68  ASN D OD1 
3664 N ND2 . ASN C 68  ? 0.5571 0.5868 0.8845 0.0371  0.0531  -0.1082 68  ASN D ND2 
3665 N N   . ASN C 69  ? 0.4123 0.4652 0.7276 0.0295  -0.0126 -0.0389 69  ASN D N   
3666 C CA  . ASN C 69  ? 0.4076 0.4670 0.7336 0.0263  -0.0290 -0.0196 69  ASN D CA  
3667 C C   . ASN C 69  ? 0.4053 0.4735 0.7501 0.0241  -0.0325 -0.0075 69  ASN D C   
3668 O O   . ASN C 69  ? 0.3914 0.4645 0.7670 0.0220  -0.0445 0.0066  69  ASN D O   
3669 C CB  . ASN C 69  ? 0.4078 0.4665 0.6934 0.0228  -0.0360 -0.0137 69  ASN D CB  
3670 C CG  . ASN C 69  ? 0.4174 0.4686 0.6930 0.0240  -0.0376 -0.0209 69  ASN D CG  
3671 O OD1 . ASN C 69  ? 0.4157 0.4652 0.6610 0.0220  -0.0412 -0.0190 69  ASN D OD1 
3672 N ND2 . ASN C 69  ? 0.4368 0.4833 0.7404 0.0272  -0.0352 -0.0294 69  ASN D ND2 
3673 N N   . LEU C 70  ? 0.4194 0.4892 0.7463 0.0241  -0.0228 -0.0125 70  LEU D N   
3674 C CA  . LEU C 70  ? 0.4160 0.4938 0.7584 0.0217  -0.0257 -0.0021 70  LEU D CA  
3675 C C   . LEU C 70  ? 0.4234 0.5047 0.8215 0.0237  -0.0273 0.0014  70  LEU D C   
3676 O O   . LEU C 70  ? 0.4258 0.5133 0.8468 0.0200  -0.0415 0.0181  70  LEU D O   
3677 C CB  . LEU C 70  ? 0.4195 0.4974 0.7385 0.0222  -0.0123 -0.0107 70  LEU D CB  
3678 C CG  . LEU C 70  ? 0.4035 0.4891 0.7376 0.0199  -0.0131 -0.0021 70  LEU D CG  
3679 C CD1 . LEU C 70  ? 0.3851 0.4754 0.7056 0.0136  -0.0298 0.0149  70  LEU D CD1 
3680 C CD2 . LEU C 70  ? 0.3635 0.4480 0.6764 0.0210  0.0028  -0.0126 70  LEU D CD2 
3681 N N   . ASN C 71  ? 0.4323 0.5091 0.8526 0.0290  -0.0133 -0.0142 71  ASN D N   
3682 C CA  . ASN C 71  ? 0.4444 0.5240 0.9236 0.0317  -0.0125 -0.0130 71  ASN D CA  
3683 C C   . ASN C 71  ? 0.4375 0.5180 0.9460 0.0304  -0.0300 0.0004  71  ASN D C   
3684 O O   . ASN C 71  ? 0.4313 0.5179 0.9827 0.0289  -0.0407 0.0144  71  ASN D O   
3685 C CB  . ASN C 71  ? 0.4652 0.5381 0.9588 0.0372  0.0086  -0.0354 71  ASN D CB  
3686 C CG  . ASN C 71  ? 0.5059 0.5785 0.9764 0.0376  0.0270  -0.0471 71  ASN D CG  
3687 O OD1 . ASN C 71  ? 0.5468 0.6113 0.9900 0.0389  0.0424  -0.0650 71  ASN D OD1 
3688 N ND2 . ASN C 71  ? 0.5203 0.6013 0.9998 0.0355  0.0245  -0.0362 71  ASN D ND2 
3689 N N   . THR C 72  ? 0.4353 0.5096 0.9206 0.0304  -0.0336 -0.0029 72  THR D N   
3690 C CA  . THR C 72  ? 0.4273 0.5018 0.9338 0.0284  -0.0498 0.0100  72  THR D CA  
3691 C C   . THR C 72  ? 0.4195 0.5019 0.9256 0.0215  -0.0682 0.0338  72  THR D C   
3692 O O   . THR C 72  ? 0.4260 0.5119 0.9716 0.0191  -0.0818 0.0488  72  THR D O   
3693 C CB  . THR C 72  ? 0.4298 0.4971 0.9022 0.0285  -0.0507 0.0037  72  THR D CB  
3694 O OG1 . THR C 72  ? 0.4546 0.5135 0.9216 0.0335  -0.0341 -0.0191 72  THR D OG1 
3695 C CG2 . THR C 72  ? 0.4048 0.4717 0.9040 0.0267  -0.0656 0.0161  72  THR D CG2 
3696 N N   . LEU C 73  ? 0.4173 0.5019 0.8791 0.0175  -0.0689 0.0371  73  LEU D N   
3697 C CA  . LEU C 73  ? 0.4169 0.5074 0.8704 0.0094  -0.0857 0.0578  73  LEU D CA  
3698 C C   . LEU C 73  ? 0.4192 0.5168 0.9013 0.0067  -0.0913 0.0682  73  LEU D C   
3699 O O   . LEU C 73  ? 0.4151 0.5171 0.9074 -0.0006 -0.1091 0.0877  73  LEU D O   
3700 C CB  . LEU C 73  ? 0.4140 0.5031 0.8104 0.0051  -0.0860 0.0583  73  LEU D CB  
3701 C CG  . LEU C 73  ? 0.4138 0.4995 0.8056 0.0033  -0.0940 0.0637  73  LEU D CG  
3702 C CD1 . LEU C 73  ? 0.3766 0.4550 0.7545 0.0097  -0.0820 0.0457  73  LEU D CD1 
3703 C CD2 . LEU C 73  ? 0.4185 0.5063 0.7765 -0.0056 -0.1050 0.0781  73  LEU D CD2 
3704 N N   . ILE C 74  ? 0.4241 0.5226 0.9187 0.0117  -0.0766 0.0557  74  ILE D N   
3705 C CA  . ILE C 74  ? 0.4379 0.5432 0.9673 0.0098  -0.0814 0.0649  74  ILE D CA  
3706 C C   . ILE C 74  ? 0.4453 0.5530 1.0331 0.0095  -0.0944 0.0775  74  ILE D C   
3707 O O   . ILE C 74  ? 0.4457 0.5591 1.0568 0.0033  -0.1116 0.0964  74  ILE D O   
3708 C CB  . ILE C 74  ? 0.4423 0.5481 0.9816 0.0159  -0.0605 0.0482  74  ILE D CB  
3709 C CG1 . ILE C 74  ? 0.4531 0.5576 0.9368 0.0145  -0.0516 0.0409  74  ILE D CG1 
3710 C CG2 . ILE C 74  ? 0.4300 0.5433 1.0199 0.0149  -0.0652 0.0579  74  ILE D CG2 
3711 C CD1 . ILE C 74  ? 0.4508 0.5543 0.9343 0.0198  -0.0288 0.0232  74  ILE D CD1 
3712 N N   . GLN C 75  ? 0.4557 0.5584 1.0658 0.0153  -0.0877 0.0676  75  GLN D N   
3713 C CA  . GLN C 75  ? 0.4669 0.5709 1.1367 0.0157  -0.0992 0.0784  75  GLN D CA  
3714 C C   . GLN C 75  ? 0.4636 0.5687 1.1260 0.0073  -0.1231 0.1011  75  GLN D C   
3715 O O   . GLN C 75  ? 0.4617 0.5714 1.1641 0.0026  -0.1405 0.1204  75  GLN D O   
3716 C CB  . GLN C 75  ? 0.4763 0.5736 1.1749 0.0242  -0.0843 0.0597  75  GLN D CB  
3717 C CG  . GLN C 75  ? 0.5058 0.5977 1.1820 0.0310  -0.0577 0.0324  75  GLN D CG  
3718 C CD  . GLN C 75  ? 0.5527 0.6492 1.2495 0.0333  -0.0443 0.0259  75  GLN D CD  
3719 O OE1 . GLN C 75  ? 0.5651 0.6677 1.3167 0.0332  -0.0506 0.0363  75  GLN D OE1 
3720 N NE2 . GLN C 75  ? 0.5537 0.6474 1.2087 0.0353  -0.0258 0.0091  75  GLN D NE2 
3721 N N   . ARG C 76  ? 0.4614 0.5622 1.0745 0.0049  -0.1240 0.0997  76  ARG D N   
3722 C CA  . ARG C 76  ? 0.4693 0.5707 1.0740 -0.0037 -0.1444 0.1206  76  ARG D CA  
3723 C C   . ARG C 76  ? 0.4720 0.5789 1.0565 -0.0149 -0.1611 0.1409  76  ARG D C   
3724 O O   . ARG C 76  ? 0.4755 0.5848 1.0794 -0.0231 -0.1813 0.1629  76  ARG D O   
3725 C CB  . ARG C 76  ? 0.4666 0.5623 1.0270 -0.0037 -0.1398 0.1137  76  ARG D CB  
3726 C CG  . ARG C 76  ? 0.4847 0.5738 1.0600 0.0055  -0.1260 0.0945  76  ARG D CG  
3727 C CD  . ARG C 76  ? 0.5164 0.6016 1.0831 0.0031  -0.1338 0.1005  76  ARG D CD  
3728 N NE  . ARG C 76  ? 0.5199 0.6050 1.0302 -0.0031 -0.1363 0.1054  76  ARG D NE  
3729 C CZ  . ARG C 76  ? 0.5419 0.6219 1.0174 -0.0002 -0.1265 0.0922  76  ARG D CZ  
3730 N NH1 . ARG C 76  ? 0.5448 0.6188 1.0315 0.0080  -0.1146 0.0731  76  ARG D NH1 
3731 N NH2 . ARG C 76  ? 0.5262 0.6068 0.9565 -0.0062 -0.1286 0.0977  76  ARG D NH2 
3732 N N   . SER C 77  ? 0.4706 0.5786 1.0157 -0.0159 -0.1529 0.1334  77  SER D N   
3733 C CA  . SER C 77  ? 0.4837 0.5955 1.0043 -0.0266 -0.1665 0.1489  77  SER D CA  
3734 C C   . SER C 77  ? 0.4924 0.6102 1.0616 -0.0301 -0.1803 0.1635  77  SER D C   
3735 O O   . SER C 77  ? 0.4958 0.6167 1.0490 -0.0396 -0.1930 0.1763  77  SER D O   
3736 C CB  . SER C 77  ? 0.4809 0.5918 0.9525 -0.0254 -0.1523 0.1346  77  SER D CB  
3737 O OG  . SER C 77  ? 0.4650 0.5775 0.9585 -0.0169 -0.1370 0.1198  77  SER D OG  
3738 N N   . ASN C 78  ? 0.4946 0.6136 1.1247 -0.0228 -0.1779 0.1613  78  ASN D N   
3739 C CA  . ASN C 78  ? 0.5015 0.6264 1.1887 -0.0228 -0.1856 0.1704  78  ASN D CA  
3740 C C   . ASN C 78  ? 0.5033 0.6313 1.1667 -0.0238 -0.1783 0.1641  78  ASN D C   
3741 O O   . ASN C 78  ? 0.5093 0.6414 1.1728 -0.0331 -0.1951 0.1804  78  ASN D O   
3742 C CB  . ASN C 78  ? 0.5107 0.6390 1.2276 -0.0341 -0.2152 0.1999  78  ASN D CB  
3743 C CG  . ASN C 78  ? 0.5333 0.6588 1.2847 -0.0329 -0.2236 0.2082  78  ASN D CG  
3744 O OD1 . ASN C 78  ? 0.5516 0.6744 1.3356 -0.0220 -0.2087 0.1929  78  ASN D OD1 
3745 N ND2 . ASN C 78  ? 0.5632 0.6883 1.3009 -0.0450 -0.2466 0.2317  78  ASN D ND2 
3746 N N   . HIS C 79  ? 0.5028 0.6281 1.1421 -0.0152 -0.1540 0.1407  79  HIS D N   
3747 C CA  . HIS C 79  ? 0.5072 0.6348 1.1239 -0.0148 -0.1435 0.1321  79  HIS D CA  
3748 C C   . HIS C 79  ? 0.5084 0.6369 1.0776 -0.0259 -0.1572 0.1439  79  HIS D C   
3749 O O   . HIS C 79  ? 0.5142 0.6473 1.0953 -0.0307 -0.1652 0.1523  79  HIS D O   
3750 C CB  . HIS C 79  ? 0.5123 0.6457 1.1896 -0.0111 -0.1407 0.1330  79  HIS D CB  
3751 C CG  . HIS C 79  ? 0.5500 0.6813 1.2600 0.0008  -0.1168 0.1123  79  HIS D CG  
3752 N ND1 . HIS C 79  ? 0.5862 0.7167 1.2811 0.0070  -0.0928 0.0925  79  HIS D ND1 
3753 C CD2 . HIS C 79  ? 0.5796 0.7089 1.3354 0.0069  -0.1127 0.1079  79  HIS D CD2 
3754 C CE1 . HIS C 79  ? 0.5915 0.7196 1.3228 0.0158  -0.0743 0.0766  79  HIS D CE1 
3755 N NE2 . HIS C 79  ? 0.5900 0.7173 1.3605 0.0163  -0.0857 0.0849  79  HIS D NE2 
3756 N N   . THR C 80  ? 0.5083 0.6322 1.0250 -0.0302 -0.1592 0.1439  80  THR D N   
3757 C CA  . THR C 80  ? 0.5139 0.6375 0.9832 -0.0412 -0.1694 0.1524  80  THR D CA  
3758 C C   . THR C 80  ? 0.5101 0.6325 0.9409 -0.0380 -0.1525 0.1362  80  THR D C   
3759 O O   . THR C 80  ? 0.5028 0.6213 0.9108 -0.0304 -0.1346 0.1193  80  THR D O   
3760 C CB  . THR C 80  ? 0.5230 0.6425 0.9545 -0.0494 -0.1800 0.1617  80  THR D CB  
3761 O OG1 . THR C 80  ? 0.5230 0.6445 0.9875 -0.0566 -0.2014 0.1828  80  THR D OG1 
3762 C CG2 . THR C 80  ? 0.5194 0.6369 0.8941 -0.0596 -0.1835 0.1637  80  THR D CG2 
3763 N N   . GLN C 81  ? 0.5115 0.6368 0.9376 -0.0444 -0.1597 0.1423  81  GLN D N   
3764 C CA  . GLN C 81  ? 0.5033 0.6271 0.8902 -0.0443 -0.1481 0.1309  81  GLN D CA  
3765 C C   . GLN C 81  ? 0.5146 0.6350 0.8514 -0.0564 -0.1595 0.1383  81  GLN D C   
3766 O O   . GLN C 81  ? 0.5240 0.6450 0.8618 -0.0676 -0.1799 0.1556  81  GLN D O   
3767 C CB  . GLN C 81  ? 0.4977 0.6267 0.9146 -0.0427 -0.1455 0.1301  81  GLN D CB  
3768 C CG  . GLN C 81  ? 0.4831 0.6105 0.8651 -0.0406 -0.1304 0.1166  81  GLN D CG  
3769 C CD  . GLN C 81  ? 0.4553 0.5875 0.8707 -0.0355 -0.1202 0.1114  81  GLN D CD  
3770 O OE1 . GLN C 81  ? 0.4668 0.6041 0.9344 -0.0335 -0.1241 0.1175  81  GLN D OE1 
3771 N NE2 . GLN C 81  ? 0.4265 0.5572 0.8141 -0.0335 -0.1066 0.1003  81  GLN D NE2 
3772 N N   . ALA C 82  ? 0.5038 0.6203 0.7971 -0.0548 -0.1460 0.1253  82  ALA D N   
3773 C CA  . ALA C 82  ? 0.5079 0.6204 0.7533 -0.0654 -0.1523 0.1285  82  ALA D CA  
3774 C C   . ALA C 82  ? 0.5097 0.6228 0.7432 -0.0725 -0.1572 0.1300  82  ALA D C   
3775 O O   . ALA C 82  ? 0.4986 0.6142 0.7465 -0.0661 -0.1473 0.1218  82  ALA D O   
3776 C CB  . ALA C 82  ? 0.5082 0.6157 0.7172 -0.0602 -0.1362 0.1143  82  ALA D CB  
3777 N N   . THR C 83  ? 0.5206 0.6310 0.7267 -0.0863 -0.1722 0.1402  83  THR D N   
3778 C CA  . THR C 83  ? 0.5270 0.6360 0.7125 -0.0953 -0.1777 0.1406  83  THR D CA  
3779 C C   . THR C 83  ? 0.5191 0.6256 0.6822 -0.0879 -0.1575 0.1224  83  THR D C   
3780 O O   . THR C 83  ? 0.5179 0.6213 0.6609 -0.0815 -0.1431 0.1118  83  THR D O   
3781 C CB  . THR C 83  ? 0.5485 0.6520 0.6927 -0.1117 -0.1915 0.1493  83  THR D CB  
3782 O OG1 . THR C 83  ? 0.5401 0.6386 0.6483 -0.1101 -0.1785 0.1401  83  THR D OG1 
3783 C CG2 . THR C 83  ? 0.5552 0.6606 0.7196 -0.1207 -0.2136 0.1696  83  THR D CG2 
3784 N N   . ASN C 84  ? 0.5100 0.6179 0.6787 -0.0892 -0.1574 0.1200  84  ASN D N   
3785 C CA  . ASN C 84  ? 0.4959 0.6020 0.6498 -0.0821 -0.1393 0.1048  84  ASN D CA  
3786 C C   . ASN C 84  ? 0.5102 0.6093 0.6170 -0.0905 -0.1378 0.0990  84  ASN D C   
3787 O O   . ASN C 84  ? 0.5285 0.6254 0.6223 -0.1024 -0.1504 0.1046  84  ASN D O   
3788 C CB  . ASN C 84  ? 0.4852 0.5960 0.6690 -0.0796 -0.1386 0.1048  84  ASN D CB  
3789 C CG  . ASN C 84  ? 0.4608 0.5785 0.6948 -0.0704 -0.1357 0.1079  84  ASN D CG  
3790 O OD1 . ASN C 84  ? 0.4229 0.5409 0.6645 -0.0602 -0.1223 0.1004  84  ASN D OD1 
3791 N ND2 . ASN C 84  ? 0.4151 0.5380 0.6852 -0.0746 -0.1484 0.1186  84  ASN D ND2 
3792 N N   . ASP C 85  ? 0.5111 0.6062 0.5937 -0.0846 -0.1224 0.0873  85  ASP D N   
3793 C CA  . ASP C 85  ? 0.5225 0.6105 0.5633 -0.0920 -0.1187 0.0804  85  ASP D CA  
3794 C C   . ASP C 85  ? 0.5151 0.6007 0.5470 -0.0894 -0.1079 0.0694  85  ASP D C   
3795 O O   . ASP C 85  ? 0.5013 0.5877 0.5402 -0.0784 -0.0940 0.0611  85  ASP D O   
3796 C CB  . ASP C 85  ? 0.5184 0.6032 0.5399 -0.0892 -0.1103 0.0762  85  ASP D CB  
3797 C CG  . ASP C 85  ? 0.5326 0.6181 0.5543 -0.0964 -0.1233 0.0886  85  ASP D CG  
3798 O OD1 . ASP C 85  ? 0.5119 0.5979 0.5372 -0.0908 -0.1187 0.0886  85  ASP D OD1 
3799 O OD2 . ASP C 85  ? 0.5398 0.6252 0.5587 -0.1083 -0.1393 0.0993  85  ASP D OD2 
3800 N N   . PRO C 86  ? 0.5271 0.6092 0.5431 -0.1004 -0.1153 0.0697  86  PRO D N   
3801 C CA  . PRO C 86  ? 0.5236 0.6038 0.5383 -0.0989 -0.1081 0.0614  86  PRO D CA  
3802 C C   . PRO C 86  ? 0.5234 0.5976 0.5133 -0.0953 -0.0923 0.0482  86  PRO D C   
3803 O O   . PRO C 86  ? 0.5313 0.6009 0.4966 -0.0994 -0.0897 0.0452  86  PRO D O   
3804 C CB  . PRO C 86  ? 0.5394 0.6166 0.5433 -0.1136 -0.1234 0.0663  86  PRO D CB  
3805 C CG  . PRO C 86  ? 0.5523 0.6264 0.5346 -0.1242 -0.1337 0.0728  86  PRO D CG  
3806 C CD  . PRO C 86  ? 0.5540 0.6327 0.5507 -0.1159 -0.1315 0.0781  86  PRO D CD  
3807 N N   . PRO C 87  ? 0.5144 0.5889 0.5133 -0.0879 -0.0817 0.0412  87  PRO D N   
3808 C CA  . PRO C 87  ? 0.5138 0.5833 0.4972 -0.0831 -0.0674 0.0302  87  PRO D CA  
3809 C C   . PRO C 87  ? 0.5351 0.5971 0.4948 -0.0930 -0.0672 0.0233  87  PRO D C   
3810 O O   . PRO C 87  ? 0.5472 0.6080 0.5055 -0.1020 -0.0769 0.0258  87  PRO D O   
3811 C CB  . PRO C 87  ? 0.5010 0.5738 0.5053 -0.0737 -0.0594 0.0282  87  PRO D CB  
3812 C CG  . PRO C 87  ? 0.4880 0.5682 0.5201 -0.0715 -0.0664 0.0372  87  PRO D CG  
3813 C CD  . PRO C 87  ? 0.4999 0.5803 0.5291 -0.0826 -0.0822 0.0448  87  PRO D CD  
3814 N N   . GLU C 88  ? 0.5480 0.6045 0.4907 -0.0914 -0.0560 0.0142  88  GLU D N   
3815 C CA  . GLU C 88  ? 0.5718 0.6202 0.4956 -0.0987 -0.0509 0.0042  88  GLU D CA  
3816 C C   . GLU C 88  ? 0.5509 0.5981 0.4866 -0.0890 -0.0388 -0.0026 88  GLU D C   
3817 O O   . GLU C 88  ? 0.5356 0.5854 0.4803 -0.0787 -0.0316 -0.0023 88  GLU D O   
3818 C CB  . GLU C 88  ? 0.5913 0.6343 0.4898 -0.1049 -0.0464 -0.0007 88  GLU D CB  
3819 C CG  . GLU C 88  ? 0.6518 0.6855 0.5307 -0.1124 -0.0377 -0.0135 88  GLU D CG  
3820 C CD  . GLU C 88  ? 0.7300 0.7594 0.5912 -0.1143 -0.0270 -0.0199 88  GLU D CD  
3821 O OE1 . GLU C 88  ? 0.7477 0.7715 0.6074 -0.1127 -0.0138 -0.0313 88  GLU D OE1 
3822 O OE2 . GLU C 88  ? 0.7373 0.7691 0.5893 -0.1174 -0.0314 -0.0131 88  GLU D OE2 
3823 N N   . VAL C 89  ? 0.5441 0.5872 0.4809 -0.0928 -0.0376 -0.0079 89  VAL D N   
3824 C CA  . VAL C 89  ? 0.5117 0.5541 0.4630 -0.0843 -0.0282 -0.0117 89  VAL D CA  
3825 C C   . VAL C 89  ? 0.5154 0.5491 0.4587 -0.0884 -0.0206 -0.0228 89  VAL D C   
3826 O O   . VAL C 89  ? 0.5358 0.5643 0.4684 -0.0987 -0.0244 -0.0278 89  VAL D O   
3827 C CB  . VAL C 89  ? 0.5022 0.5494 0.4745 -0.0815 -0.0323 -0.0056 89  VAL D CB  
3828 C CG1 . VAL C 89  ? 0.4809 0.5283 0.4664 -0.0719 -0.0224 -0.0067 89  VAL D CG1 
3829 C CG2 . VAL C 89  ? 0.4893 0.5449 0.4735 -0.0796 -0.0407 0.0048  89  VAL D CG2 
3830 N N   . THR C 90  ? 0.4969 0.5288 0.4474 -0.0804 -0.0103 -0.0266 90  THR D N   
3831 C CA  . THR C 90  ? 0.4979 0.5223 0.4512 -0.0815 -0.0020 -0.0361 90  THR D CA  
3832 C C   . THR C 90  ? 0.4805 0.5067 0.4552 -0.0727 0.0013  -0.0321 90  THR D C   
3833 O O   . THR C 90  ? 0.4694 0.5018 0.4521 -0.0651 0.0000  -0.0238 90  THR D O   
3834 C CB  . THR C 90  ? 0.5013 0.5213 0.4467 -0.0809 0.0073  -0.0435 90  THR D CB  
3835 O OG1 . THR C 90  ? 0.5001 0.5255 0.4527 -0.0713 0.0085  -0.0368 90  THR D OG1 
3836 C CG2 . THR C 90  ? 0.5158 0.5328 0.4369 -0.0916 0.0055  -0.0479 90  THR D CG2 
3837 N N   . VAL C 91  ? 0.4871 0.5072 0.4702 -0.0746 0.0055  -0.0382 91  VAL D N   
3838 C CA  . VAL C 91  ? 0.4807 0.5014 0.4840 -0.0676 0.0083  -0.0336 91  VAL D CA  
3839 C C   . VAL C 91  ? 0.4832 0.4957 0.4957 -0.0672 0.0167  -0.0421 91  VAL D C   
3840 O O   . VAL C 91  ? 0.5001 0.5055 0.5101 -0.0745 0.0194  -0.0525 91  VAL D O   
3841 C CB  . VAL C 91  ? 0.4800 0.5027 0.4934 -0.0705 0.0028  -0.0292 91  VAL D CB  
3842 C CG1 . VAL C 91  ? 0.4708 0.4929 0.5037 -0.0650 0.0064  -0.0243 91  VAL D CG1 
3843 C CG2 . VAL C 91  ? 0.4928 0.5240 0.5043 -0.0701 -0.0046 -0.0203 91  VAL D CG2 
3844 N N   . PHE C 92  ? 0.4633 0.4762 0.4876 -0.0593 0.0205  -0.0379 92  PHE D N   
3845 C CA  . PHE C 92  ? 0.4643 0.4699 0.5037 -0.0582 0.0278  -0.0446 92  PHE D CA  
3846 C C   . PHE C 92  ? 0.4522 0.4588 0.5105 -0.0505 0.0271  -0.0346 92  PHE D C   
3847 O O   . PHE C 92  ? 0.4426 0.4552 0.4969 -0.0459 0.0227  -0.0241 92  PHE D O   
3848 C CB  . PHE C 92  ? 0.4657 0.4684 0.4971 -0.0592 0.0344  -0.0531 92  PHE D CB  
3849 C CG  . PHE C 92  ? 0.4470 0.4562 0.4684 -0.0544 0.0315  -0.0462 92  PHE D CG  
3850 C CD1 . PHE C 92  ? 0.4371 0.4476 0.4708 -0.0468 0.0321  -0.0403 92  PHE D CD1 
3851 C CD2 . PHE C 92  ? 0.4470 0.4608 0.4484 -0.0579 0.0267  -0.0445 92  PHE D CD2 
3852 C CE1 . PHE C 92  ? 0.4360 0.4519 0.4607 -0.0426 0.0288  -0.0342 92  PHE D CE1 
3853 C CE2 . PHE C 92  ? 0.4376 0.4571 0.4324 -0.0533 0.0238  -0.0382 92  PHE D CE2 
3854 C CZ  . PHE C 92  ? 0.4244 0.4448 0.4302 -0.0457 0.0252  -0.0337 92  PHE D CZ  
3855 N N   . PRO C 93  ? 0.4554 0.4556 0.5344 -0.0499 0.0313  -0.0377 93  PRO D N   
3856 C CA  . PRO C 93  ? 0.4474 0.4485 0.5420 -0.0435 0.0286  -0.0262 93  PRO D CA  
3857 C C   . PRO C 93  ? 0.4511 0.4513 0.5505 -0.0392 0.0308  -0.0267 93  PRO D C   
3858 O O   . PRO C 93  ? 0.4513 0.4489 0.5481 -0.0412 0.0372  -0.0377 93  PRO D O   
3859 C CB  . PRO C 93  ? 0.4495 0.4441 0.5688 -0.0451 0.0303  -0.0272 93  PRO D CB  
3860 C CG  . PRO C 93  ? 0.4645 0.4526 0.5846 -0.0509 0.0376  -0.0439 93  PRO D CG  
3861 C CD  . PRO C 93  ? 0.4689 0.4608 0.5595 -0.0553 0.0370  -0.0496 93  PRO D CD  
3862 N N   . LYS C 94  ? 0.4484 0.4505 0.5545 -0.0341 0.0256  -0.0146 94  LYS D N   
3863 C CA  . LYS C 94  ? 0.4529 0.4543 0.5664 -0.0300 0.0252  -0.0128 94  LYS D CA  
3864 C C   . LYS C 94  ? 0.4794 0.4740 0.6233 -0.0297 0.0298  -0.0175 94  LYS D C   
3865 O O   . LYS C 94  ? 0.4902 0.4834 0.6428 -0.0282 0.0341  -0.0229 94  LYS D O   
3866 C CB  . LYS C 94  ? 0.4454 0.4500 0.5542 -0.0263 0.0166  0.0019  94  LYS D CB  
3867 C CG  . LYS C 94  ? 0.3780 0.3815 0.4961 -0.0224 0.0127  0.0069  94  LYS D CG  
3868 C CD  . LYS C 94  ? 0.3188 0.3246 0.4236 -0.0210 0.0039  0.0203  94  LYS D CD  
3869 C CE  . LYS C 94  ? 0.3561 0.3592 0.4734 -0.0186 -0.0036 0.0288  94  LYS D CE  
3870 N NZ  . LYS C 94  ? 0.3568 0.3622 0.4677 -0.0162 -0.0038 0.0244  94  LYS D NZ  
3871 N N   . GLU C 95  ? 0.5038 0.4941 0.6660 -0.0313 0.0296  -0.0157 95  GLU D N   
3872 C CA  . GLU C 95  ? 0.5312 0.5144 0.7283 -0.0309 0.0336  -0.0194 95  GLU D CA  
3873 C C   . GLU C 95  ? 0.5463 0.5240 0.7501 -0.0360 0.0421  -0.0336 95  GLU D C   
3874 O O   . GLU C 95  ? 0.5455 0.5249 0.7309 -0.0398 0.0409  -0.0351 95  GLU D O   
3875 C CB  . GLU C 95  ? 0.5410 0.5227 0.7579 -0.0289 0.0245  -0.0034 95  GLU D CB  
3876 C CG  . GLU C 95  ? 0.5709 0.5574 0.7727 -0.0261 0.0140  0.0124  95  GLU D CG  
3877 C CD  . GLU C 95  ? 0.6029 0.5890 0.8164 -0.0225 0.0113  0.0149  95  GLU D CD  
3878 O OE1 . GLU C 95  ? 0.6265 0.6080 0.8705 -0.0216 0.0165  0.0081  95  GLU D OE1 
3879 O OE2 . GLU C 95  ? 0.6245 0.6146 0.8186 -0.0208 0.0042  0.0233  95  GLU D OE2 
3880 N N   . PRO C 96  ? 0.5626 0.5332 0.7949 -0.0365 0.0508  -0.0442 96  PRO D N   
3881 C CA  . PRO C 96  ? 0.5811 0.5445 0.8225 -0.0420 0.0589  -0.0583 96  PRO D CA  
3882 C C   . PRO C 96  ? 0.5887 0.5514 0.8405 -0.0426 0.0509  -0.0478 96  PRO D C   
3883 O O   . PRO C 96  ? 0.5873 0.5506 0.8592 -0.0387 0.0432  -0.0326 96  PRO D O   
3884 C CB  . PRO C 96  ? 0.5892 0.5452 0.8694 -0.0405 0.0686  -0.0676 96  PRO D CB  
3885 C CG  . PRO C 96  ? 0.5699 0.5293 0.8694 -0.0337 0.0610  -0.0524 96  PRO D CG  
3886 C CD  . PRO C 96  ? 0.5659 0.5342 0.8275 -0.0322 0.0533  -0.0434 96  PRO D CD  
3887 N N   . VAL C 97  ? 0.6055 0.5670 0.8428 -0.0482 0.0520  -0.0548 97  VAL D N   
3888 C CA  . VAL C 97  ? 0.6106 0.5726 0.8555 -0.0492 0.0445  -0.0438 97  VAL D CA  
3889 C C   . VAL C 97  ? 0.6327 0.5862 0.9190 -0.0494 0.0465  -0.0450 97  VAL D C   
3890 O O   . VAL C 97  ? 0.6472 0.5924 0.9470 -0.0533 0.0557  -0.0622 97  VAL D O   
3891 C CB  . VAL C 97  ? 0.6083 0.5727 0.8265 -0.0551 0.0431  -0.0490 97  VAL D CB  
3892 C CG1 . VAL C 97  ? 0.6041 0.5671 0.8377 -0.0572 0.0381  -0.0415 97  VAL D CG1 
3893 C CG2 . VAL C 97  ? 0.5936 0.5677 0.7802 -0.0533 0.0376  -0.0405 97  VAL D CG2 
3894 N N   . GLU C 98  ? 0.6394 0.5942 0.9451 -0.0458 0.0380  -0.0265 98  GLU D N   
3895 C CA  . GLU C 98  ? 0.6599 0.6075 1.0064 -0.0462 0.0370  -0.0230 98  GLU D CA  
3896 C C   . GLU C 98  ? 0.6543 0.6048 0.9981 -0.0481 0.0284  -0.0075 98  GLU D C   
3897 O O   . GLU C 98  ? 0.6531 0.6110 0.9759 -0.0464 0.0211  0.0082  98  GLU D O   
3898 C CB  . GLU C 98  ? 0.6678 0.6133 1.0467 -0.0411 0.0336  -0.0127 98  GLU D CB  
3899 C CG  . GLU C 98  ? 0.7231 0.6612 1.1501 -0.0412 0.0307  -0.0059 98  GLU D CG  
3900 C CD  . GLU C 98  ? 0.7814 0.7211 1.2277 -0.0377 0.0178  0.0182  98  GLU D CD  
3901 O OE1 . GLU C 98  ? 0.7914 0.7284 1.2606 -0.0392 0.0099  0.0331  98  GLU D OE1 
3902 O OE2 . GLU C 98  ? 0.8037 0.7472 1.2412 -0.0343 0.0147  0.0230  98  GLU D OE2 
3903 N N   . LEU C 99  ? 0.6602 0.6046 1.0250 -0.0521 0.0305  -0.0132 99  LEU D N   
3904 C CA  . LEU C 99  ? 0.6569 0.6016 1.0339 -0.0543 0.0235  0.0015  99  LEU D CA  
3905 C C   . LEU C 99  ? 0.6457 0.5958 1.0216 -0.0514 0.0135  0.0269  99  LEU D C   
3906 O O   . LEU C 99  ? 0.6492 0.5972 1.0443 -0.0480 0.0096  0.0357  99  LEU D O   
3907 C CB  . LEU C 99  ? 0.6718 0.6058 1.0934 -0.0563 0.0265  -0.0054 99  LEU D CB  
3908 C CG  . LEU C 99  ? 0.6802 0.6103 1.1293 -0.0597 0.0219  0.0037  99  LEU D CG  
3909 C CD1 . LEU C 99  ? 0.6499 0.5693 1.1247 -0.0640 0.0296  -0.0173 99  LEU D CD1 
3910 C CD2 . LEU C 99  ? 0.6759 0.6049 1.1568 -0.0571 0.0131  0.0268  99  LEU D CD2 
3911 N N   . GLY C 100 ? 0.6346 0.5913 0.9878 -0.0534 0.0096  0.0383  100 GLY D N   
3912 C CA  . GLY C 100 ? 0.6299 0.5913 0.9756 -0.0527 0.0016  0.0617  100 GLY D CA  
3913 C C   . GLY C 100 ? 0.6272 0.5903 0.9636 -0.0489 -0.0034 0.0710  100 GLY D C   
3914 O O   . GLY C 100 ? 0.6346 0.5965 0.9809 -0.0494 -0.0117 0.0900  100 GLY D O   
3915 N N   . GLN C 101 ? 0.6160 0.5817 0.9329 -0.0459 0.0005  0.0587  101 GLN D N   
3916 C CA  . GLN C 101 ? 0.6076 0.5746 0.9175 -0.0423 -0.0047 0.0662  101 GLN D CA  
3917 C C   . GLN C 101 ? 0.5904 0.5653 0.8577 -0.0410 -0.0040 0.0654  101 GLN D C   
3918 O O   . GLN C 101 ? 0.5916 0.5689 0.8441 -0.0399 0.0027  0.0495  101 GLN D O   
3919 C CB  . GLN C 101 ? 0.6092 0.5711 0.9441 -0.0393 -0.0004 0.0529  101 GLN D CB  
3920 C CG  . GLN C 101 ? 0.6368 0.5987 0.9781 -0.0360 -0.0077 0.0629  101 GLN D CG  
3921 C CD  . GLN C 101 ? 0.6854 0.6412 1.0671 -0.0364 -0.0167 0.0784  101 GLN D CD  
3922 O OE1 . GLN C 101 ? 0.7083 0.6593 1.1177 -0.0386 -0.0156 0.0789  101 GLN D OE1 
3923 N NE2 . GLN C 101 ? 0.7080 0.6637 1.0952 -0.0348 -0.0268 0.0918  101 GLN D NE2 
3924 N N   . PRO C 102 ? 0.5773 0.5557 0.8247 -0.0418 -0.0108 0.0823  102 PRO D N   
3925 C CA  . PRO C 102 ? 0.5606 0.5459 0.7691 -0.0408 -0.0094 0.0812  102 PRO D CA  
3926 C C   . PRO C 102 ? 0.5406 0.5276 0.7402 -0.0370 -0.0055 0.0660  102 PRO D C   
3927 O O   . PRO C 102 ? 0.5431 0.5264 0.7600 -0.0346 -0.0078 0.0642  102 PRO D O   
3928 C CB  . PRO C 102 ? 0.5714 0.5564 0.7678 -0.0422 -0.0186 0.1003  102 PRO D CB  
3929 C CG  . PRO C 102 ? 0.5785 0.5566 0.8091 -0.0442 -0.0263 0.1131  102 PRO D CG  
3930 C CD  . PRO C 102 ? 0.5855 0.5607 0.8452 -0.0445 -0.0201 0.1032  102 PRO D CD  
3931 N N   . ASN C 103 ? 0.5162 0.5086 0.6917 -0.0370 0.0002  0.0560  103 ASN D N   
3932 C CA  . ASN C 103 ? 0.4926 0.4869 0.6578 -0.0347 0.0048  0.0412  103 ASN D CA  
3933 C C   . ASN C 103 ? 0.4862 0.4877 0.6192 -0.0342 0.0057  0.0407  103 ASN D C   
3934 O O   . ASN C 103 ? 0.4888 0.4935 0.6087 -0.0353 0.0039  0.0511  103 ASN D O   
3935 C CB  . ASN C 103 ? 0.4902 0.4816 0.6675 -0.0369 0.0117  0.0255  103 ASN D CB  
3936 C CG  . ASN C 103 ? 0.4806 0.4705 0.6562 -0.0356 0.0169  0.0111  103 ASN D CG  
3937 O OD1 . ASN C 103 ? 0.4510 0.4448 0.6094 -0.0331 0.0161  0.0110  103 ASN D OD1 
3938 N ND2 . ASN C 103 ? 0.4977 0.4817 0.6918 -0.0377 0.0232  -0.0015 103 ASN D ND2 
3939 N N   . THR C 104 ? 0.4686 0.4725 0.5899 -0.0331 0.0094  0.0287  104 THR D N   
3940 C CA  . THR C 104 ? 0.4550 0.4655 0.5505 -0.0324 0.0099  0.0277  104 THR D CA  
3941 C C   . THR C 104 ? 0.4453 0.4579 0.5332 -0.0340 0.0140  0.0145  104 THR D C   
3942 O O   . THR C 104 ? 0.4384 0.4487 0.5279 -0.0335 0.0163  0.0056  104 THR D O   
3943 C CB  . THR C 104 ? 0.4551 0.4667 0.5388 -0.0289 0.0061  0.0325  104 THR D CB  
3944 O OG1 . THR C 104 ? 0.4928 0.5023 0.5779 -0.0293 0.0010  0.0462  104 THR D OG1 
3945 C CG2 . THR C 104 ? 0.4347 0.4525 0.4946 -0.0278 0.0072  0.0304  104 THR D CG2 
3946 N N   . LEU C 105 ? 0.4383 0.4553 0.5179 -0.0365 0.0146  0.0144  105 LEU D N   
3947 C CA  . LEU C 105 ? 0.4268 0.4465 0.4962 -0.0392 0.0158  0.0050  105 LEU D CA  
3948 C C   . LEU C 105 ? 0.4200 0.4449 0.4716 -0.0367 0.0147  0.0049  105 LEU D C   
3949 O O   . LEU C 105 ? 0.4198 0.4489 0.4640 -0.0339 0.0136  0.0123  105 LEU D O   
3950 C CB  . LEU C 105 ? 0.4231 0.4457 0.4950 -0.0431 0.0150  0.0065  105 LEU D CB  
3951 C CG  . LEU C 105 ? 0.4311 0.4486 0.5133 -0.0486 0.0156  -0.0020 105 LEU D CG  
3952 C CD1 . LEU C 105 ? 0.4280 0.4499 0.5104 -0.0527 0.0129  -0.0002 105 LEU D CD1 
3953 C CD2 . LEU C 105 ? 0.4349 0.4481 0.5097 -0.0513 0.0177  -0.0150 105 LEU D CD2 
3954 N N   . ILE C 106 ? 0.4115 0.4357 0.4560 -0.0385 0.0155  -0.0042 106 ILE D N   
3955 C CA  . ILE C 106 ? 0.3984 0.4271 0.4284 -0.0367 0.0141  -0.0045 106 ILE D CA  
3956 C C   . ILE C 106 ? 0.4039 0.4355 0.4254 -0.0417 0.0121  -0.0089 106 ILE D C   
3957 O O   . ILE C 106 ? 0.4116 0.4392 0.4331 -0.0475 0.0128  -0.0164 106 ILE D O   
3958 C CB  . ILE C 106 ? 0.3953 0.4209 0.4245 -0.0346 0.0160  -0.0090 106 ILE D CB  
3959 C CG1 . ILE C 106 ? 0.3687 0.3911 0.4096 -0.0304 0.0155  -0.0031 106 ILE D CG1 
3960 C CG2 . ILE C 106 ? 0.3744 0.4046 0.3899 -0.0327 0.0140  -0.0085 106 ILE D CG2 
3961 C CD1 . ILE C 106 ? 0.3345 0.3520 0.3864 -0.0296 0.0185  -0.0085 106 ILE D CD1 
3962 N N   . CYS C 107 ? 0.3947 0.4326 0.4098 -0.0402 0.0092  -0.0043 107 CYS D N   
3963 C CA  . CYS C 107 ? 0.4104 0.4516 0.4197 -0.0450 0.0050  -0.0060 107 CYS D CA  
3964 C C   . CYS C 107 ? 0.4081 0.4524 0.4077 -0.0429 0.0032  -0.0055 107 CYS D C   
3965 O O   . CYS C 107 ? 0.4039 0.4524 0.4045 -0.0377 0.0032  -0.0004 107 CYS D O   
3966 C CB  . CYS C 107 ? 0.4144 0.4607 0.4325 -0.0457 0.0027  0.0000  107 CYS D CB  
3967 S SG  . CYS C 107 ? 0.4649 0.5163 0.4809 -0.0514 -0.0053 0.0009  107 CYS D SG  
3968 N N   . HIS C 108 ? 0.4120 0.4538 0.4018 -0.0475 0.0024  -0.0112 108 HIS D N   
3969 C CA  . HIS C 108 ? 0.4069 0.4510 0.3879 -0.0463 0.0009  -0.0107 108 HIS D CA  
3970 C C   . HIS C 108 ? 0.4046 0.4525 0.3806 -0.0520 -0.0065 -0.0081 108 HIS D C   
3971 O O   . HIS C 108 ? 0.4084 0.4537 0.3787 -0.0599 -0.0094 -0.0111 108 HIS D O   
3972 C CB  . HIS C 108 ? 0.4130 0.4516 0.3874 -0.0481 0.0059  -0.0179 108 HIS D CB  
3973 C CG  . HIS C 108 ? 0.4059 0.4463 0.3727 -0.0469 0.0054  -0.0171 108 HIS D CG  
3974 N ND1 . HIS C 108 ? 0.4384 0.4753 0.3956 -0.0519 0.0091  -0.0230 108 HIS D ND1 
3975 C CD2 . HIS C 108 ? 0.4074 0.4524 0.3756 -0.0417 0.0023  -0.0116 108 HIS D CD2 
3976 C CE1 . HIS C 108 ? 0.4226 0.4623 0.3764 -0.0496 0.0077  -0.0200 108 HIS D CE1 
3977 N NE2 . HIS C 108 ? 0.3881 0.4326 0.3490 -0.0433 0.0031  -0.0133 108 HIS D NE2 
3978 N N   . ILE C 109 ? 0.3993 0.4528 0.3787 -0.0483 -0.0100 -0.0023 109 ILE D N   
3979 C CA  . ILE C 109 ? 0.3995 0.4575 0.3797 -0.0527 -0.0184 0.0026  109 ILE D CA  
3980 C C   . ILE C 109 ? 0.3980 0.4569 0.3706 -0.0520 -0.0200 0.0037  109 ILE D C   
3981 O O   . ILE C 109 ? 0.3878 0.4475 0.3635 -0.0448 -0.0162 0.0039  109 ILE D O   
3982 C CB  . ILE C 109 ? 0.3918 0.4561 0.3896 -0.0482 -0.0199 0.0087  109 ILE D CB  
3983 C CG1 . ILE C 109 ? 0.4047 0.4684 0.4115 -0.0480 -0.0166 0.0085  109 ILE D CG1 
3984 C CG2 . ILE C 109 ? 0.4001 0.4691 0.4052 -0.0529 -0.0296 0.0146  109 ILE D CG2 
3985 C CD1 . ILE C 109 ? 0.4157 0.4789 0.4264 -0.0405 -0.0080 0.0085  109 ILE D CD1 
3986 N N   . ASP C 110 ? 0.4061 0.4643 0.3682 -0.0602 -0.0263 0.0049  110 ASP D N   
3987 C CA  . ASP C 110 ? 0.4130 0.4702 0.3646 -0.0613 -0.0260 0.0047  110 ASP D CA  
3988 C C   . ASP C 110 ? 0.4192 0.4790 0.3662 -0.0689 -0.0369 0.0120  110 ASP D C   
3989 O O   . ASP C 110 ? 0.4281 0.4885 0.3749 -0.0760 -0.0451 0.0155  110 ASP D O   
3990 C CB  . ASP C 110 ? 0.4243 0.4747 0.3615 -0.0650 -0.0178 -0.0041 110 ASP D CB  
3991 C CG  . ASP C 110 ? 0.4679 0.5171 0.3993 -0.0631 -0.0128 -0.0057 110 ASP D CG  
3992 O OD1 . ASP C 110 ? 0.5057 0.5587 0.4457 -0.0564 -0.0143 -0.0012 110 ASP D OD1 
3993 O OD2 . ASP C 110 ? 0.5120 0.5560 0.4310 -0.0688 -0.0064 -0.0124 110 ASP D OD2 
3994 N N   . LYS C 111 ? 0.4231 0.4844 0.3685 -0.0675 -0.0380 0.0153  111 LYS D N   
3995 C CA  . LYS C 111 ? 0.4415 0.5042 0.3806 -0.0755 -0.0480 0.0232  111 LYS D CA  
3996 C C   . LYS C 111 ? 0.4355 0.5040 0.3937 -0.0755 -0.0596 0.0329  111 LYS D C   
3997 O O   . LYS C 111 ? 0.4552 0.5244 0.4093 -0.0848 -0.0713 0.0409  111 LYS D O   
3998 C CB  . LYS C 111 ? 0.4702 0.5272 0.3833 -0.0890 -0.0497 0.0207  111 LYS D CB  
3999 C CG  . LYS C 111 ? 0.5018 0.5526 0.3985 -0.0900 -0.0362 0.0098  111 LYS D CG  
4000 C CD  . LYS C 111 ? 0.5886 0.6334 0.4569 -0.1049 -0.0370 0.0075  111 LYS D CD  
4001 C CE  . LYS C 111 ? 0.6278 0.6664 0.4825 -0.1063 -0.0212 -0.0044 111 LYS D CE  
4002 N NZ  . LYS C 111 ? 0.6527 0.6855 0.5046 -0.1077 -0.0131 -0.0161 111 LYS D NZ  
4003 N N   . PHE C 112 ? 0.4130 0.4855 0.3929 -0.0654 -0.0562 0.0325  112 PHE D N   
4004 C CA  . PHE C 112 ? 0.3987 0.4768 0.4028 -0.0643 -0.0641 0.0399  112 PHE D CA  
4005 C C   . PHE C 112 ? 0.3864 0.4689 0.4120 -0.0563 -0.0643 0.0436  112 PHE D C   
4006 O O   . PHE C 112 ? 0.3824 0.4637 0.4062 -0.0489 -0.0558 0.0384  112 PHE D O   
4007 C CB  . PHE C 112 ? 0.3912 0.4704 0.4057 -0.0607 -0.0590 0.0361  112 PHE D CB  
4008 C CG  . PHE C 112 ? 0.3577 0.4366 0.3768 -0.0499 -0.0462 0.0295  112 PHE D CG  
4009 C CD1 . PHE C 112 ? 0.3447 0.4279 0.3848 -0.0422 -0.0429 0.0308  112 PHE D CD1 
4010 C CD2 . PHE C 112 ? 0.3441 0.4179 0.3473 -0.0485 -0.0375 0.0220  112 PHE D CD2 
4011 C CE1 . PHE C 112 ? 0.3238 0.4057 0.3636 -0.0340 -0.0315 0.0247  112 PHE D CE1 
4012 C CE2 . PHE C 112 ? 0.3331 0.4061 0.3393 -0.0400 -0.0279 0.0176  112 PHE D CE2 
4013 C CZ  . PHE C 112 ? 0.3192 0.3961 0.3413 -0.0332 -0.0252 0.0191  112 PHE D CZ  
4014 N N   . PHE C 113 ? 0.3779 0.4653 0.4258 -0.0582 -0.0744 0.0525  113 PHE D N   
4015 C CA  . PHE C 113 ? 0.3639 0.4552 0.4370 -0.0511 -0.0744 0.0555  113 PHE D CA  
4016 C C   . PHE C 113 ? 0.3620 0.4589 0.4665 -0.0521 -0.0823 0.0631  113 PHE D C   
4017 O O   . PHE C 113 ? 0.3708 0.4685 0.4754 -0.0616 -0.0955 0.0716  113 PHE D O   
4018 C CB  . PHE C 113 ? 0.3689 0.4593 0.4370 -0.0543 -0.0814 0.0614  113 PHE D CB  
4019 C CG  . PHE C 113 ? 0.3630 0.4564 0.4587 -0.0468 -0.0812 0.0633  113 PHE D CG  
4020 C CD1 . PHE C 113 ? 0.3533 0.4442 0.4442 -0.0397 -0.0725 0.0565  113 PHE D CD1 
4021 C CD2 . PHE C 113 ? 0.3608 0.4592 0.4896 -0.0470 -0.0897 0.0716  113 PHE D CD2 
4022 C CE1 . PHE C 113 ? 0.3330 0.4257 0.4491 -0.0331 -0.0718 0.0566  113 PHE D CE1 
4023 C CE2 . PHE C 113 ? 0.3669 0.4675 0.5238 -0.0399 -0.0880 0.0718  113 PHE D CE2 
4024 C CZ  . PHE C 113 ? 0.3334 0.4308 0.4826 -0.0331 -0.0787 0.0637  113 PHE D CZ  
4025 N N   . PRO C 114 ? 0.3502 0.4506 0.4823 -0.0430 -0.0746 0.0601  114 PRO D N   
4026 C CA  . PRO C 114 ? 0.3345 0.4332 0.4660 -0.0330 -0.0604 0.0503  114 PRO D CA  
4027 C C   . PRO C 114 ? 0.3322 0.4280 0.4467 -0.0292 -0.0473 0.0407  114 PRO D C   
4028 O O   . PRO C 114 ? 0.3345 0.4302 0.4415 -0.0333 -0.0481 0.0411  114 PRO D O   
4029 C CB  . PRO C 114 ? 0.3319 0.4354 0.5022 -0.0276 -0.0585 0.0517  114 PRO D CB  
4030 C CG  . PRO C 114 ? 0.3236 0.4319 0.5152 -0.0325 -0.0659 0.0592  114 PRO D CG  
4031 C CD  . PRO C 114 ? 0.3418 0.4483 0.5109 -0.0433 -0.0803 0.0669  114 PRO D CD  
4032 N N   . PRO C 115 ? 0.3338 0.4270 0.4429 -0.0219 -0.0362 0.0326  115 PRO D N   
4033 C CA  . PRO C 115 ? 0.3328 0.4232 0.4267 -0.0191 -0.0254 0.0256  115 PRO D CA  
4034 C C   . PRO C 115 ? 0.3363 0.4301 0.4505 -0.0159 -0.0171 0.0239  115 PRO D C   
4035 O O   . PRO C 115 ? 0.3303 0.4229 0.4475 -0.0104 -0.0066 0.0176  115 PRO D O   
4036 C CB  . PRO C 115 ? 0.3315 0.4171 0.4101 -0.0142 -0.0195 0.0191  115 PRO D CB  
4037 C CG  . PRO C 115 ? 0.3401 0.4272 0.4361 -0.0116 -0.0225 0.0202  115 PRO D CG  
4038 C CD  . PRO C 115 ? 0.3407 0.4323 0.4531 -0.0172 -0.0346 0.0299  115 PRO D CD  
4039 N N   . VAL C 116 ? 0.3438 0.4417 0.4720 -0.0202 -0.0219 0.0294  116 VAL D N   
4040 C CA  . VAL C 116 ? 0.3465 0.4483 0.4960 -0.0184 -0.0139 0.0289  116 VAL D CA  
4041 C C   . VAL C 116 ? 0.3613 0.4633 0.5039 -0.0239 -0.0175 0.0321  116 VAL D C   
4042 O O   . VAL C 116 ? 0.3757 0.4782 0.5172 -0.0305 -0.0306 0.0381  116 VAL D O   
4043 C CB  . VAL C 116 ? 0.3406 0.4485 0.5283 -0.0179 -0.0178 0.0339  116 VAL D CB  
4044 C CG1 . VAL C 116 ? 0.3265 0.4386 0.5378 -0.0161 -0.0075 0.0328  116 VAL D CG1 
4045 C CG2 . VAL C 116 ? 0.3261 0.4329 0.5225 -0.0125 -0.0143 0.0300  116 VAL D CG2 
4046 N N   . LEU C 117 ? 0.3665 0.4671 0.5023 -0.0220 -0.0064 0.0280  117 LEU D N   
4047 C CA  . LEU C 117 ? 0.3708 0.4694 0.4942 -0.0266 -0.0085 0.0292  117 LEU D CA  
4048 C C   . LEU C 117 ? 0.3825 0.4831 0.5167 -0.0258 0.0016  0.0289  117 LEU D C   
4049 O O   . LEU C 117 ? 0.3901 0.4909 0.5262 -0.0211 0.0146  0.0252  117 LEU D O   
4050 C CB  . LEU C 117 ? 0.3704 0.4621 0.4619 -0.0265 -0.0072 0.0246  117 LEU D CB  
4051 C CG  . LEU C 117 ? 0.3732 0.4615 0.4476 -0.0317 -0.0179 0.0254  117 LEU D CG  
4052 C CD1 . LEU C 117 ? 0.3543 0.4363 0.4060 -0.0327 -0.0143 0.0209  117 LEU D CD1 
4053 C CD2 . LEU C 117 ? 0.3671 0.4581 0.4518 -0.0393 -0.0299 0.0312  117 LEU D CD2 
4054 N N   . ASN C 118 ? 0.3884 0.4903 0.5287 -0.0312 -0.0045 0.0329  118 ASN D N   
4055 C CA  . ASN C 118 ? 0.3936 0.4961 0.5399 -0.0314 0.0041  0.0332  118 ASN D CA  
4056 C C   . ASN C 118 ? 0.4091 0.5059 0.5344 -0.0360 -0.0010 0.0322  118 ASN D C   
4057 O O   . ASN C 118 ? 0.4183 0.5143 0.5431 -0.0422 -0.0130 0.0343  118 ASN D O   
4058 C CB  . ASN C 118 ? 0.3931 0.5031 0.5756 -0.0333 0.0028  0.0387  118 ASN D CB  
4059 C CG  . ASN C 118 ? 0.3761 0.4911 0.5822 -0.0275 0.0154  0.0372  118 ASN D CG  
4060 O OD1 . ASN C 118 ? 0.3808 0.4928 0.5719 -0.0227 0.0264  0.0313  118 ASN D OD1 
4061 N ND2 . ASN C 118 ? 0.3188 0.4410 0.5628 -0.0285 0.0139  0.0421  118 ASN D ND2 
4062 N N   . VAL C 119 ? 0.4139 0.5058 0.5206 -0.0334 0.0078  0.0289  119 VAL D N   
4063 C CA  . VAL C 119 ? 0.4128 0.4986 0.5034 -0.0366 0.0052  0.0273  119 VAL D CA  
4064 C C   . VAL C 119 ? 0.4220 0.5070 0.5163 -0.0362 0.0142  0.0292  119 VAL D C   
4065 O O   . VAL C 119 ? 0.4269 0.5116 0.5164 -0.0323 0.0243  0.0293  119 VAL D O   
4066 C CB  . VAL C 119 ? 0.4097 0.4893 0.4761 -0.0341 0.0063  0.0229  119 VAL D CB  
4067 C CG1 . VAL C 119 ? 0.4050 0.4787 0.4606 -0.0384 0.0019  0.0203  119 VAL D CG1 
4068 C CG2 . VAL C 119 ? 0.4030 0.4837 0.4645 -0.0322 0.0020  0.0213  119 VAL D CG2 
4069 N N   . THR C 120 ? 0.4270 0.5108 0.5284 -0.0411 0.0102  0.0307  120 THR D N   
4070 C CA  . THR C 120 ? 0.4279 0.5107 0.5347 -0.0415 0.0177  0.0337  120 THR D CA  
4071 C C   . THR C 120 ? 0.4232 0.4994 0.5232 -0.0454 0.0129  0.0319  120 THR D C   
4072 O O   . THR C 120 ? 0.4224 0.4964 0.5212 -0.0500 0.0036  0.0286  120 THR D O   
4073 C CB  . THR C 120 ? 0.4358 0.5257 0.5702 -0.0432 0.0206  0.0388  120 THR D CB  
4074 O OG1 . THR C 120 ? 0.4557 0.5477 0.6038 -0.0484 0.0083  0.0395  120 THR D OG1 
4075 C CG2 . THR C 120 ? 0.4489 0.5448 0.5932 -0.0387 0.0300  0.0396  120 THR D CG2 
4076 N N   . TRP C 121 ? 0.4167 0.4890 0.5121 -0.0442 0.0194  0.0339  121 TRP D N   
4077 C CA  . TRP C 121 ? 0.4113 0.4773 0.5072 -0.0477 0.0160  0.0325  121 TRP D CA  
4078 C C   . TRP C 121 ? 0.4150 0.4834 0.5319 -0.0516 0.0165  0.0371  121 TRP D C   
4079 O O   . TRP C 121 ? 0.4102 0.4833 0.5373 -0.0504 0.0241  0.0433  121 TRP D O   
4080 C CB  . TRP C 121 ? 0.4087 0.4687 0.4933 -0.0450 0.0205  0.0339  121 TRP D CB  
4081 C CG  . TRP C 121 ? 0.3960 0.4523 0.4631 -0.0419 0.0187  0.0292  121 TRP D CG  
4082 C CD1 . TRP C 121 ? 0.3930 0.4504 0.4475 -0.0375 0.0220  0.0303  121 TRP D CD1 
4083 C CD2 . TRP C 121 ? 0.3946 0.4452 0.4559 -0.0433 0.0139  0.0222  121 TRP D CD2 
4084 N NE1 . TRP C 121 ? 0.3955 0.4488 0.4386 -0.0358 0.0185  0.0254  121 TRP D NE1 
4085 C CE2 . TRP C 121 ? 0.3901 0.4394 0.4375 -0.0392 0.0145  0.0204  121 TRP D CE2 
4086 C CE3 . TRP C 121 ? 0.4078 0.4538 0.4742 -0.0482 0.0100  0.0164  121 TRP D CE3 
4087 C CZ2 . TRP C 121 ? 0.3786 0.4229 0.4193 -0.0395 0.0120  0.0138  121 TRP D CZ2 
4088 C CZ3 . TRP C 121 ? 0.3912 0.4315 0.4485 -0.0488 0.0087  0.0086  121 TRP D CZ3 
4089 C CH2 . TRP C 121 ? 0.3712 0.4112 0.4170 -0.0443 0.0101  0.0078  121 TRP D CH2 
4090 N N   . LEU C 122 ? 0.4216 0.4862 0.5442 -0.0569 0.0090  0.0334  122 LEU D N   
4091 C CA  . LEU C 122 ? 0.4249 0.4900 0.5680 -0.0614 0.0079  0.0369  122 LEU D CA  
4092 C C   . LEU C 122 ? 0.4311 0.4874 0.5734 -0.0637 0.0071  0.0338  122 LEU D C   
4093 O O   . LEU C 122 ? 0.4363 0.4863 0.5651 -0.0643 0.0040  0.0260  122 LEU D O   
4094 C CB  . LEU C 122 ? 0.4248 0.4929 0.5785 -0.0671 -0.0024 0.0349  122 LEU D CB  
4095 C CG  . LEU C 122 ? 0.4150 0.4917 0.5742 -0.0649 -0.0032 0.0382  122 LEU D CG  
4096 C CD1 . LEU C 122 ? 0.4197 0.4977 0.5847 -0.0714 -0.0168 0.0367  122 LEU D CD1 
4097 C CD2 . LEU C 122 ? 0.4127 0.4968 0.5935 -0.0623 0.0061  0.0461  122 LEU D CD2 
4098 N N   . CYS C 123 ? 0.4358 0.4917 0.5944 -0.0650 0.0108  0.0400  123 CYS D N   
4099 C CA  . CYS C 123 ? 0.4561 0.5038 0.6217 -0.0679 0.0093  0.0378  123 CYS D CA  
4100 C C   . CYS C 123 ? 0.4646 0.5138 0.6543 -0.0733 0.0066  0.0412  123 CYS D C   
4101 O O   . CYS C 123 ? 0.4643 0.5196 0.6679 -0.0726 0.0121  0.0508  123 CYS D O   
4102 C CB  . CYS C 123 ? 0.4613 0.5055 0.6237 -0.0640 0.0159  0.0442  123 CYS D CB  
4103 S SG  . CYS C 123 ? 0.5052 0.5405 0.6875 -0.0673 0.0151  0.0462  123 CYS D SG  
4104 N N   . ASN C 124 ? 0.4764 0.5197 0.6703 -0.0793 -0.0015 0.0326  124 ASN D N   
4105 C CA  . ASN C 124 ? 0.4794 0.5235 0.6948 -0.0858 -0.0074 0.0336  124 ASN D CA  
4106 C C   . ASN C 124 ? 0.4765 0.5309 0.7022 -0.0867 -0.0102 0.0397  124 ASN D C   
4107 O O   . ASN C 124 ? 0.4837 0.5425 0.7343 -0.0896 -0.0111 0.0463  124 ASN D O   
4108 C CB  . ASN C 124 ? 0.4856 0.5273 0.7217 -0.0861 -0.0026 0.0407  124 ASN D CB  
4109 C CG  . ASN C 124 ? 0.5178 0.5493 0.7494 -0.0852 -0.0007 0.0356  124 ASN D CG  
4110 O OD1 . ASN C 124 ? 0.5583 0.5818 0.7839 -0.0888 -0.0056 0.0233  124 ASN D OD1 
4111 N ND2 . ASN C 124 ? 0.5441 0.5755 0.7786 -0.0808 0.0065  0.0450  124 ASN D ND2 
4112 N N   . GLY C 125 ? 0.4658 0.5242 0.6759 -0.0842 -0.0119 0.0376  125 GLY D N   
4113 C CA  . GLY C 125 ? 0.4654 0.5337 0.6887 -0.0843 -0.0143 0.0435  125 GLY D CA  
4114 C C   . GLY C 125 ? 0.4553 0.5319 0.6890 -0.0780 -0.0015 0.0528  125 GLY D C   
4115 O O   . GLY C 125 ? 0.4447 0.5298 0.6930 -0.0772 -0.0010 0.0572  125 GLY D O   
4116 N N   . GLU C 126 ? 0.4589 0.5327 0.6854 -0.0742 0.0090  0.0558  126 GLU D N   
4117 C CA  . GLU C 126 ? 0.4564 0.5364 0.6841 -0.0692 0.0224  0.0633  126 GLU D CA  
4118 C C   . GLU C 126 ? 0.4512 0.5299 0.6513 -0.0634 0.0272  0.0603  126 GLU D C   
4119 O O   . GLU C 126 ? 0.4483 0.5196 0.6295 -0.0624 0.0239  0.0554  126 GLU D O   
4120 C CB  . GLU C 126 ? 0.4558 0.5341 0.6934 -0.0703 0.0303  0.0711  126 GLU D CB  
4121 C CG  . GLU C 126 ? 0.4816 0.5599 0.7466 -0.0763 0.0243  0.0733  126 GLU D CG  
4122 C CD  . GLU C 126 ? 0.4941 0.5707 0.7715 -0.0779 0.0320  0.0824  126 GLU D CD  
4123 O OE1 . GLU C 126 ? 0.4905 0.5594 0.7725 -0.0809 0.0262  0.0808  126 GLU D OE1 
4124 O OE2 . GLU C 126 ? 0.4930 0.5756 0.7752 -0.0764 0.0445  0.0908  126 GLU D OE2 
4125 N N   . LEU C 127 ? 0.4502 0.5357 0.6508 -0.0598 0.0354  0.0627  127 LEU D N   
4126 C CA  . LEU C 127 ? 0.4551 0.5399 0.6320 -0.0547 0.0400  0.0596  127 LEU D CA  
4127 C C   . LEU C 127 ? 0.4675 0.5460 0.6249 -0.0532 0.0462  0.0626  127 LEU D C   
4128 O O   . LEU C 127 ? 0.4787 0.5564 0.6437 -0.0555 0.0518  0.0697  127 LEU D O   
4129 C CB  . LEU C 127 ? 0.4480 0.5409 0.6344 -0.0520 0.0498  0.0615  127 LEU D CB  
4130 C CG  . LEU C 127 ? 0.4553 0.5475 0.6191 -0.0472 0.0578  0.0587  127 LEU D CG  
4131 C CD1 . LEU C 127 ? 0.4520 0.5451 0.6101 -0.0446 0.0493  0.0521  127 LEU D CD1 
4132 C CD2 . LEU C 127 ? 0.4588 0.5567 0.6321 -0.0462 0.0738  0.0619  127 LEU D CD2 
4133 N N   . VAL C 128 ? 0.4704 0.5444 0.6044 -0.0500 0.0439  0.0581  128 VAL D N   
4134 C CA  . VAL C 128 ? 0.4820 0.5500 0.5977 -0.0488 0.0475  0.0619  128 VAL D CA  
4135 C C   . VAL C 128 ? 0.4910 0.5594 0.5852 -0.0450 0.0529  0.0603  128 VAL D C   
4136 O O   . VAL C 128 ? 0.4805 0.5509 0.5699 -0.0423 0.0499  0.0538  128 VAL D O   
4137 C CB  . VAL C 128 ? 0.4762 0.5361 0.5880 -0.0495 0.0386  0.0592  128 VAL D CB  
4138 C CG1 . VAL C 128 ? 0.4839 0.5379 0.5817 -0.0487 0.0406  0.0652  128 VAL D CG1 
4139 C CG2 . VAL C 128 ? 0.4645 0.5227 0.5976 -0.0539 0.0347  0.0602  128 VAL D CG2 
4140 N N   . THR C 129 ? 0.5225 0.5886 0.6037 -0.0459 0.0606  0.0668  129 THR D N   
4141 C CA  . THR C 129 ? 0.5488 0.6142 0.6078 -0.0438 0.0669  0.0654  129 THR D CA  
4142 C C   . THR C 129 ? 0.5663 0.6237 0.6020 -0.0450 0.0643  0.0708  129 THR D C   
4143 O O   . THR C 129 ? 0.5734 0.6280 0.5888 -0.0431 0.0635  0.0677  129 THR D O   
4144 C CB  . THR C 129 ? 0.5639 0.6354 0.6289 -0.0452 0.0812  0.0671  129 THR D CB  
4145 O OG1 . THR C 129 ? 0.5680 0.6454 0.6442 -0.0417 0.0819  0.0593  129 THR D OG1 
4146 C CG2 . THR C 129 ? 0.5991 0.6669 0.6376 -0.0473 0.0919  0.0705  129 THR D CG2 
4147 N N   . GLU C 130 ? 0.5772 0.6306 0.6182 -0.0485 0.0616  0.0793  130 GLU D N   
4148 C CA  . GLU C 130 ? 0.5915 0.6371 0.6162 -0.0502 0.0562  0.0864  130 GLU D CA  
4149 C C   . GLU C 130 ? 0.5756 0.6168 0.6009 -0.0467 0.0445  0.0811  130 GLU D C   
4150 O O   . GLU C 130 ? 0.5689 0.6112 0.6115 -0.0449 0.0400  0.0747  130 GLU D O   
4151 C CB  . GLU C 130 ? 0.6073 0.6501 0.6426 -0.0552 0.0563  0.0985  130 GLU D CB  
4152 C CG  . GLU C 130 ? 0.6500 0.6946 0.6748 -0.0604 0.0686  0.1070  130 GLU D CG  
4153 C CD  . GLU C 130 ? 0.7062 0.7470 0.6969 -0.0623 0.0720  0.1088  130 GLU D CD  
4154 O OE1 . GLU C 130 ? 0.7263 0.7600 0.7036 -0.0633 0.0618  0.1137  130 GLU D OE1 
4155 O OE2 . GLU C 130 ? 0.7329 0.7771 0.7114 -0.0633 0.0846  0.1049  130 GLU D OE2 
4156 N N   . GLY C 131 ? 0.5747 0.6106 0.5808 -0.0464 0.0400  0.0837  131 GLY D N   
4157 C CA  . GLY C 131 ? 0.5511 0.5825 0.5590 -0.0433 0.0298  0.0800  131 GLY D CA  
4158 C C   . GLY C 131 ? 0.5266 0.5617 0.5377 -0.0387 0.0289  0.0672  131 GLY D C   
4159 O O   . GLY C 131 ? 0.5186 0.5519 0.5417 -0.0368 0.0233  0.0618  131 GLY D O   
4160 N N   . VAL C 132 ? 0.5161 0.5560 0.5165 -0.0373 0.0349  0.0626  132 VAL D N   
4161 C CA  . VAL C 132 ? 0.4892 0.5338 0.4938 -0.0339 0.0348  0.0524  132 VAL D CA  
4162 C C   . VAL C 132 ? 0.4851 0.5280 0.4711 -0.0313 0.0334  0.0490  132 VAL D C   
4163 O O   . VAL C 132 ? 0.5029 0.5428 0.4719 -0.0329 0.0358  0.0533  132 VAL D O   
4164 C CB  . VAL C 132 ? 0.4883 0.5401 0.5021 -0.0347 0.0430  0.0511  132 VAL D CB  
4165 C CG1 . VAL C 132 ? 0.4793 0.5357 0.4921 -0.0315 0.0442  0.0434  132 VAL D CG1 
4166 C CG2 . VAL C 132 ? 0.4861 0.5399 0.5217 -0.0370 0.0412  0.0519  132 VAL D CG2 
4167 N N   . ALA C 133 ? 0.4598 0.5038 0.4480 -0.0281 0.0290  0.0414  133 ALA D N   
4168 C CA  . ALA C 133 ? 0.4412 0.4841 0.4154 -0.0254 0.0272  0.0375  133 ALA D CA  
4169 C C   . ALA C 133 ? 0.4234 0.4700 0.4061 -0.0229 0.0241  0.0298  133 ALA D C   
4170 O O   . ALA C 133 ? 0.4049 0.4534 0.4007 -0.0241 0.0226  0.0281  133 ALA D O   
4171 C CB  . ALA C 133 ? 0.4472 0.4833 0.4126 -0.0255 0.0202  0.0414  133 ALA D CB  
4172 N N   . GLU C 134 ? 0.4144 0.4614 0.3888 -0.0202 0.0230  0.0255  134 GLU D N   
4173 C CA  . GLU C 134 ? 0.4064 0.4568 0.3871 -0.0185 0.0200  0.0198  134 GLU D CA  
4174 C C   . GLU C 134 ? 0.4075 0.4553 0.3783 -0.0158 0.0163  0.0169  134 GLU D C   
4175 O O   . GLU C 134 ? 0.4237 0.4675 0.3825 -0.0155 0.0164  0.0188  134 GLU D O   
4176 C CB  . GLU C 134 ? 0.4032 0.4599 0.3923 -0.0183 0.0244  0.0181  134 GLU D CB  
4177 C CG  . GLU C 134 ? 0.4135 0.4707 0.3951 -0.0160 0.0293  0.0157  134 GLU D CG  
4178 C CD  . GLU C 134 ? 0.4517 0.5151 0.4475 -0.0158 0.0361  0.0145  134 GLU D CD  
4179 O OE1 . GLU C 134 ? 0.4430 0.5090 0.4445 -0.0135 0.0361  0.0105  134 GLU D OE1 
4180 O OE2 . GLU C 134 ? 0.4272 0.4930 0.4312 -0.0181 0.0414  0.0179  134 GLU D OE2 
4181 N N   . SER C 135 ? 0.3944 0.4440 0.3695 -0.0147 0.0127  0.0129  135 SER D N   
4182 C CA  . SER C 135 ? 0.3974 0.4456 0.3662 -0.0121 0.0095  0.0102  135 SER D CA  
4183 C C   . SER C 135 ? 0.4089 0.4610 0.3794 -0.0103 0.0118  0.0071  135 SER D C   
4184 O O   . SER C 135 ? 0.4204 0.4759 0.3964 -0.0107 0.0171  0.0073  135 SER D O   
4185 C CB  . SER C 135 ? 0.3782 0.4254 0.3510 -0.0122 0.0049  0.0081  135 SER D CB  
4186 O OG  . SER C 135 ? 0.3472 0.3990 0.3256 -0.0133 0.0041  0.0059  135 SER D OG  
4187 N N   . LEU C 136 ? 0.4046 0.4559 0.3733 -0.0083 0.0081  0.0044  136 LEU D N   
4188 C CA  . LEU C 136 ? 0.4077 0.4621 0.3821 -0.0064 0.0090  0.0015  136 LEU D CA  
4189 C C   . LEU C 136 ? 0.3962 0.4550 0.3816 -0.0078 0.0045  0.0024  136 LEU D C   
4190 O O   . LEU C 136 ? 0.3921 0.4502 0.3763 -0.0103 0.0020  0.0037  136 LEU D O   
4191 C CB  . LEU C 136 ? 0.4180 0.4683 0.3843 -0.0042 0.0065  -0.0015 136 LEU D CB  
4192 C CG  . LEU C 136 ? 0.4527 0.4977 0.4046 -0.0040 0.0100  -0.0036 136 LEU D CG  
4193 C CD1 . LEU C 136 ? 0.4916 0.5386 0.4478 -0.0030 0.0173  -0.0085 136 LEU D CD1 
4194 C CD2 . LEU C 136 ? 0.4649 0.5069 0.4061 -0.0067 0.0124  0.0006  136 LEU D CD2 
4195 N N   . PHE C 137 ? 0.3792 0.4419 0.3753 -0.0069 0.0036  0.0018  137 PHE D N   
4196 C CA  . PHE C 137 ? 0.3632 0.4292 0.3669 -0.0094 -0.0026 0.0042  137 PHE D CA  
4197 C C   . PHE C 137 ? 0.3582 0.4213 0.3556 -0.0085 -0.0065 0.0031  137 PHE D C   
4198 O O   . PHE C 137 ? 0.3464 0.4086 0.3461 -0.0055 -0.0070 0.0012  137 PHE D O   
4199 C CB  . PHE C 137 ? 0.3647 0.4359 0.3862 -0.0093 -0.0041 0.0060  137 PHE D CB  
4200 C CG  . PHE C 137 ? 0.3616 0.4366 0.3949 -0.0103 0.0000  0.0076  137 PHE D CG  
4201 C CD1 . PHE C 137 ? 0.3112 0.3900 0.3541 -0.0149 -0.0056 0.0124  137 PHE D CD1 
4202 C CD2 . PHE C 137 ? 0.3602 0.4345 0.3944 -0.0074 0.0095  0.0044  137 PHE D CD2 
4203 C CE1 . PHE C 137 ? 0.3288 0.4114 0.3859 -0.0159 -0.0026 0.0143  137 PHE D CE1 
4204 C CE2 . PHE C 137 ? 0.3377 0.4159 0.3851 -0.0085 0.0145  0.0061  137 PHE D CE2 
4205 C CZ  . PHE C 137 ? 0.3347 0.4174 0.3957 -0.0124 0.0081  0.0113  137 PHE D CZ  
4206 N N   . LEU C 138 ? 0.3546 0.4160 0.3453 -0.0114 -0.0084 0.0037  138 LEU D N   
4207 C CA  . LEU C 138 ? 0.3504 0.4090 0.3364 -0.0111 -0.0103 0.0028  138 LEU D CA  
4208 C C   . LEU C 138 ? 0.3612 0.4225 0.3505 -0.0144 -0.0145 0.0052  138 LEU D C   
4209 O O   . LEU C 138 ? 0.3793 0.4429 0.3686 -0.0193 -0.0164 0.0075  138 LEU D O   
4210 C CB  . LEU C 138 ? 0.3470 0.4023 0.3274 -0.0132 -0.0080 0.0016  138 LEU D CB  
4211 C CG  . LEU C 138 ? 0.3557 0.4081 0.3336 -0.0113 -0.0049 0.0013  138 LEU D CG  
4212 C CD1 . LEU C 138 ? 0.3512 0.4003 0.3290 -0.0136 -0.0030 0.0003  138 LEU D CD1 
4213 C CD2 . LEU C 138 ? 0.3519 0.4013 0.3267 -0.0073 -0.0061 0.0010  138 LEU D CD2 
4214 N N   . PRO C 139 ? 0.3674 0.4281 0.3590 -0.0127 -0.0169 0.0054  139 PRO D N   
4215 C CA  . PRO C 139 ? 0.3673 0.4306 0.3627 -0.0161 -0.0215 0.0093  139 PRO D CA  
4216 C C   . PRO C 139 ? 0.3825 0.4446 0.3686 -0.0218 -0.0205 0.0098  139 PRO D C   
4217 O O   . PRO C 139 ? 0.3949 0.4537 0.3764 -0.0212 -0.0160 0.0062  139 PRO D O   
4218 C CB  . PRO C 139 ? 0.3607 0.4227 0.3620 -0.0118 -0.0232 0.0084  139 PRO D CB  
4219 C CG  . PRO C 139 ? 0.3727 0.4303 0.3679 -0.0086 -0.0197 0.0042  139 PRO D CG  
4220 C CD  . PRO C 139 ? 0.3648 0.4219 0.3557 -0.0080 -0.0163 0.0026  139 PRO D CD  
4221 N N   . ARG C 140 ? 0.3880 0.4524 0.3722 -0.0280 -0.0248 0.0145  140 ARG D N   
4222 C CA  . ARG C 140 ? 0.3868 0.4495 0.3601 -0.0345 -0.0230 0.0149  140 ARG D CA  
4223 C C   . ARG C 140 ? 0.3912 0.4554 0.3684 -0.0361 -0.0270 0.0201  140 ARG D C   
4224 O O   . ARG C 140 ? 0.3793 0.4460 0.3689 -0.0331 -0.0329 0.0244  140 ARG D O   
4225 C CB  . ARG C 140 ? 0.4037 0.4666 0.3661 -0.0432 -0.0253 0.0167  140 ARG D CB  
4226 C CG  . ARG C 140 ? 0.4016 0.4617 0.3570 -0.0444 -0.0196 0.0106  140 ARG D CG  
4227 C CD  . ARG C 140 ? 0.4415 0.5018 0.3879 -0.0533 -0.0246 0.0131  140 ARG D CD  
4228 N NE  . ARG C 140 ? 0.5035 0.5589 0.4332 -0.0608 -0.0184 0.0071  140 ARG D NE  
4229 C CZ  . ARG C 140 ? 0.5342 0.5875 0.4475 -0.0706 -0.0187 0.0081  140 ARG D CZ  
4230 N NH1 . ARG C 140 ? 0.5544 0.6106 0.4668 -0.0740 -0.0264 0.0167  140 ARG D NH1 
4231 N NH2 . ARG C 140 ? 0.5546 0.6025 0.4523 -0.0776 -0.0107 0.0003  140 ARG D NH2 
4232 N N   . THR C 141 ? 0.4026 0.4648 0.3698 -0.0414 -0.0226 0.0193  141 THR D N   
4233 C CA  . THR C 141 ? 0.4059 0.4689 0.3731 -0.0452 -0.0246 0.0247  141 THR D CA  
4234 C C   . THR C 141 ? 0.4185 0.4841 0.3827 -0.0527 -0.0339 0.0341  141 THR D C   
4235 O O   . THR C 141 ? 0.4238 0.4912 0.3964 -0.0533 -0.0392 0.0410  141 THR D O   
4236 C CB  . THR C 141 ? 0.4166 0.4765 0.3720 -0.0505 -0.0150 0.0205  141 THR D CB  
4237 O OG1 . THR C 141 ? 0.3826 0.4411 0.3498 -0.0429 -0.0095 0.0155  141 THR D OG1 
4238 C CG2 . THR C 141 ? 0.4531 0.5136 0.3994 -0.0596 -0.0162 0.0273  141 THR D CG2 
4239 N N   . ASP C 142 ? 0.4233 0.4889 0.3770 -0.0589 -0.0369 0.0351  142 ASP D N   
4240 C CA  . ASP C 142 ? 0.4263 0.4942 0.3792 -0.0667 -0.0487 0.0456  142 ASP D CA  
4241 C C   . ASP C 142 ? 0.4186 0.4905 0.3943 -0.0603 -0.0568 0.0494  142 ASP D C   
4242 O O   . ASP C 142 ? 0.4347 0.5091 0.4157 -0.0658 -0.0674 0.0580  142 ASP D O   
4243 C CB  . ASP C 142 ? 0.4380 0.5032 0.3665 -0.0795 -0.0500 0.0464  142 ASP D CB  
4244 C CG  . ASP C 142 ? 0.4402 0.5042 0.3656 -0.0788 -0.0482 0.0398  142 ASP D CG  
4245 O OD1 . ASP C 142 ? 0.4265 0.4927 0.3692 -0.0694 -0.0478 0.0371  142 ASP D OD1 
4246 O OD2 . ASP C 142 ? 0.4465 0.5067 0.3507 -0.0887 -0.0470 0.0372  142 ASP D OD2 
4247 N N   . TYR C 143 ? 0.3980 0.4703 0.3879 -0.0493 -0.0515 0.0430  143 TYR D N   
4248 C CA  . TYR C 143 ? 0.3877 0.4632 0.4005 -0.0421 -0.0552 0.0439  143 TYR D CA  
4249 C C   . TYR C 143 ? 0.3867 0.4641 0.4036 -0.0432 -0.0574 0.0441  143 TYR D C   
4250 O O   . TYR C 143 ? 0.3893 0.4698 0.4275 -0.0388 -0.0602 0.0458  143 TYR D O   
4251 C CB  . TYR C 143 ? 0.3861 0.4640 0.4172 -0.0422 -0.0637 0.0524  143 TYR D CB  
4252 C CG  . TYR C 143 ? 0.4158 0.4917 0.4416 -0.0428 -0.0618 0.0534  143 TYR D CG  
4253 C CD1 . TYR C 143 ? 0.4316 0.5080 0.4513 -0.0520 -0.0684 0.0635  143 TYR D CD1 
4254 C CD2 . TYR C 143 ? 0.4001 0.4735 0.4264 -0.0353 -0.0539 0.0449  143 TYR D CD2 
4255 C CE1 . TYR C 143 ? 0.4366 0.5115 0.4531 -0.0528 -0.0656 0.0646  143 TYR D CE1 
4256 C CE2 . TYR C 143 ? 0.4033 0.4752 0.4280 -0.0360 -0.0524 0.0461  143 TYR D CE2 
4257 C CZ  . TYR C 143 ? 0.4315 0.5044 0.4520 -0.0445 -0.0574 0.0557  143 TYR D CZ  
4258 O OH  . TYR C 143 ? 0.4602 0.5320 0.4807 -0.0456 -0.0549 0.0574  143 TYR D OH  
4259 N N   . SER C 144 ? 0.3794 0.4548 0.3779 -0.0491 -0.0552 0.0416  144 SER D N   
4260 C CA  . SER C 144 ? 0.3690 0.4453 0.3706 -0.0486 -0.0544 0.0392  144 SER D CA  
4261 C C   . SER C 144 ? 0.3458 0.4198 0.3456 -0.0404 -0.0433 0.0296  144 SER D C   
4262 O O   . SER C 144 ? 0.3420 0.4144 0.3419 -0.0349 -0.0387 0.0261  144 SER D O   
4263 C CB  . SER C 144 ? 0.3835 0.4576 0.3663 -0.0594 -0.0578 0.0405  144 SER D CB  
4264 O OG  . SER C 144 ? 0.4303 0.4996 0.3912 -0.0628 -0.0504 0.0345  144 SER D OG  
4265 N N   . PHE C 145 ? 0.3431 0.4169 0.3419 -0.0402 -0.0402 0.0264  145 PHE D N   
4266 C CA  . PHE C 145 ? 0.3279 0.3997 0.3264 -0.0333 -0.0312 0.0195  145 PHE D CA  
4267 C C   . PHE C 145 ? 0.3398 0.4085 0.3271 -0.0365 -0.0272 0.0155  145 PHE D C   
4268 O O   . PHE C 145 ? 0.3322 0.4012 0.3158 -0.0436 -0.0314 0.0174  145 PHE D O   
4269 C CB  . PHE C 145 ? 0.3176 0.3928 0.3336 -0.0279 -0.0301 0.0201  145 PHE D CB  
4270 C CG  . PHE C 145 ? 0.2995 0.3759 0.3275 -0.0225 -0.0301 0.0203  145 PHE D CG  
4271 C CD1 . PHE C 145 ? 0.2897 0.3697 0.3333 -0.0242 -0.0377 0.0265  145 PHE D CD1 
4272 C CD2 . PHE C 145 ? 0.2836 0.3570 0.3079 -0.0162 -0.0235 0.0144  145 PHE D CD2 
4273 C CE1 . PHE C 145 ? 0.2372 0.3178 0.2947 -0.0191 -0.0374 0.0258  145 PHE D CE1 
4274 C CE2 . PHE C 145 ? 0.2562 0.3297 0.2910 -0.0117 -0.0235 0.0132  145 PHE D CE2 
4275 C CZ  . PHE C 145 ? 0.2270 0.3041 0.2794 -0.0128 -0.0298 0.0183  145 PHE D CZ  
4276 N N   . HIS C 146 ? 0.3521 0.4175 0.3353 -0.0318 -0.0198 0.0101  146 HIS D N   
4277 C CA  . HIS C 146 ? 0.3663 0.4292 0.3457 -0.0333 -0.0158 0.0068  146 HIS D CA  
4278 C C   . HIS C 146 ? 0.3673 0.4297 0.3526 -0.0267 -0.0108 0.0057  146 HIS D C   
4279 O O   . HIS C 146 ? 0.3689 0.4324 0.3585 -0.0215 -0.0099 0.0062  146 HIS D O   
4280 C CB  . HIS C 146 ? 0.3617 0.4196 0.3294 -0.0376 -0.0121 0.0020  146 HIS D CB  
4281 C CG  . HIS C 146 ? 0.3696 0.4245 0.3368 -0.0328 -0.0073 -0.0009 146 HIS D CG  
4282 N ND1 . HIS C 146 ? 0.3742 0.4307 0.3447 -0.0286 -0.0091 0.0012  146 HIS D ND1 
4283 C CD2 . HIS C 146 ? 0.3820 0.4325 0.3490 -0.0317 -0.0016 -0.0053 146 HIS D CD2 
4284 C CE1 . HIS C 146 ? 0.3567 0.4099 0.3281 -0.0254 -0.0053 -0.0016 146 HIS D CE1 
4285 N NE2 . HIS C 146 ? 0.3252 0.3750 0.2957 -0.0270 -0.0008 -0.0052 146 HIS D NE2 
4286 N N   . LYS C 147 ? 0.3706 0.4311 0.3554 -0.0280 -0.0077 0.0043  147 LYS D N   
4287 C CA  . LYS C 147 ? 0.3651 0.4254 0.3543 -0.0238 -0.0035 0.0050  147 LYS D CA  
4288 C C   . LYS C 147 ? 0.3673 0.4240 0.3555 -0.0261 -0.0008 0.0035  147 LYS D C   
4289 O O   . LYS C 147 ? 0.3691 0.4247 0.3558 -0.0317 -0.0025 0.0016  147 LYS D O   
4290 C CB  . LYS C 147 ? 0.3625 0.4279 0.3626 -0.0234 -0.0039 0.0082  147 LYS D CB  
4291 C CG  . LYS C 147 ? 0.3554 0.4207 0.3587 -0.0207 0.0023  0.0090  147 LYS D CG  
4292 C CD  . LYS C 147 ? 0.3469 0.4168 0.3612 -0.0182 0.0052  0.0104  147 LYS D CD  
4293 C CE  . LYS C 147 ? 0.3422 0.4095 0.3497 -0.0147 0.0127  0.0093  147 LYS D CE  
4294 N NZ  . LYS C 147 ? 0.3160 0.3869 0.3342 -0.0139 0.0199  0.0100  147 LYS D NZ  
4295 N N   . PHE C 148 ? 0.3619 0.4161 0.3505 -0.0228 0.0029  0.0045  148 PHE D N   
4296 C CA  . PHE C 148 ? 0.3716 0.4222 0.3632 -0.0247 0.0052  0.0043  148 PHE D CA  
4297 C C   . PHE C 148 ? 0.3742 0.4263 0.3703 -0.0237 0.0080  0.0087  148 PHE D C   
4298 O O   . PHE C 148 ? 0.3801 0.4338 0.3733 -0.0206 0.0100  0.0109  148 PHE D O   
4299 C CB  . PHE C 148 ? 0.3687 0.4140 0.3594 -0.0226 0.0063  0.0035  148 PHE D CB  
4300 C CG  . PHE C 148 ? 0.3700 0.4133 0.3587 -0.0235 0.0059  -0.0011 148 PHE D CG  
4301 C CD1 . PHE C 148 ? 0.3813 0.4217 0.3719 -0.0280 0.0081  -0.0063 148 PHE D CD1 
4302 C CD2 . PHE C 148 ? 0.3548 0.3986 0.3400 -0.0203 0.0042  -0.0008 148 PHE D CD2 
4303 C CE1 . PHE C 148 ? 0.3740 0.4122 0.3623 -0.0295 0.0101  -0.0112 148 PHE D CE1 
4304 C CE2 . PHE C 148 ? 0.3748 0.4171 0.3598 -0.0213 0.0049  -0.0045 148 PHE D CE2 
4305 C CZ  . PHE C 148 ? 0.3814 0.4210 0.3676 -0.0261 0.0087  -0.0098 148 PHE D CZ  
4306 N N   . HIS C 149 ? 0.3724 0.4233 0.3751 -0.0269 0.0090  0.0094  149 HIS D N   
4307 C CA  . HIS C 149 ? 0.3702 0.4215 0.3776 -0.0265 0.0125  0.0144  149 HIS D CA  
4308 C C   . HIS C 149 ? 0.3803 0.4261 0.3922 -0.0280 0.0128  0.0152  149 HIS D C   
4309 O O   . HIS C 149 ? 0.3889 0.4317 0.4043 -0.0306 0.0114  0.0103  149 HIS D O   
4310 C CB  . HIS C 149 ? 0.3705 0.4270 0.3878 -0.0291 0.0132  0.0161  149 HIS D CB  
4311 C CG  . HIS C 149 ? 0.3486 0.4106 0.3675 -0.0268 0.0148  0.0171  149 HIS D CG  
4312 N ND1 . HIS C 149 ? 0.3161 0.3818 0.3424 -0.0262 0.0208  0.0206  149 HIS D ND1 
4313 C CD2 . HIS C 149 ? 0.3440 0.4084 0.3604 -0.0251 0.0122  0.0148  149 HIS D CD2 
4314 C CE1 . HIS C 149 ? 0.3376 0.4075 0.3672 -0.0239 0.0223  0.0195  149 HIS D CE1 
4315 N NE2 . HIS C 149 ? 0.3422 0.4113 0.3663 -0.0231 0.0164  0.0164  149 HIS D NE2 
4316 N N   . TYR C 150 ? 0.3901 0.4341 0.4021 -0.0270 0.0151  0.0213  150 TYR D N   
4317 C CA  . TYR C 150 ? 0.3931 0.4313 0.4119 -0.0279 0.0143  0.0244  150 TYR D CA  
4318 C C   . TYR C 150 ? 0.4049 0.4435 0.4304 -0.0302 0.0170  0.0313  150 TYR D C   
4319 O O   . TYR C 150 ? 0.4228 0.4646 0.4421 -0.0301 0.0206  0.0358  150 TYR D O   
4320 C CB  . TYR C 150 ? 0.3954 0.4297 0.4071 -0.0253 0.0118  0.0280  150 TYR D CB  
4321 C CG  . TYR C 150 ? 0.3653 0.3994 0.3719 -0.0228 0.0093  0.0224  150 TYR D CG  
4322 C CD1 . TYR C 150 ? 0.3518 0.3823 0.3674 -0.0228 0.0082  0.0178  150 TYR D CD1 
4323 C CD2 . TYR C 150 ? 0.3534 0.3905 0.3479 -0.0206 0.0091  0.0213  150 TYR D CD2 
4324 C CE1 . TYR C 150 ? 0.3353 0.3658 0.3475 -0.0209 0.0070  0.0131  150 TYR D CE1 
4325 C CE2 . TYR C 150 ? 0.3255 0.3624 0.3170 -0.0185 0.0067  0.0168  150 TYR D CE2 
4326 C CZ  . TYR C 150 ? 0.3265 0.3604 0.3267 -0.0188 0.0057  0.0133  150 TYR D CZ  
4327 O OH  . TYR C 150 ? 0.3328 0.3666 0.3315 -0.0173 0.0044  0.0093  150 TYR D OH  
4328 N N   . LEU C 151 ? 0.4080 0.4429 0.4472 -0.0327 0.0161  0.0317  151 LEU D N   
4329 C CA  . LEU C 151 ? 0.4056 0.4401 0.4536 -0.0352 0.0182  0.0393  151 LEU D CA  
4330 C C   . LEU C 151 ? 0.4148 0.4425 0.4751 -0.0360 0.0154  0.0429  151 LEU D C   
4331 O O   . LEU C 151 ? 0.4137 0.4376 0.4854 -0.0366 0.0141  0.0359  151 LEU D O   
4332 C CB  . LEU C 151 ? 0.4090 0.4468 0.4681 -0.0384 0.0193  0.0359  151 LEU D CB  
4333 C CG  . LEU C 151 ? 0.4026 0.4397 0.4766 -0.0417 0.0211  0.0424  151 LEU D CG  
4334 C CD1 . LEU C 151 ? 0.3768 0.4176 0.4453 -0.0418 0.0264  0.0523  151 LEU D CD1 
4335 C CD2 . LEU C 151 ? 0.3675 0.4069 0.4529 -0.0452 0.0198  0.0367  151 LEU D CD2 
4336 N N   . THR C 152 ? 0.4239 0.4495 0.4823 -0.0367 0.0148  0.0540  152 THR D N   
4337 C CA  . THR C 152 ? 0.4365 0.4554 0.5097 -0.0378 0.0107  0.0601  152 THR D CA  
4338 C C   . THR C 152 ? 0.4446 0.4626 0.5369 -0.0412 0.0124  0.0623  152 THR D C   
4339 O O   . THR C 152 ? 0.4511 0.4734 0.5413 -0.0434 0.0164  0.0658  152 THR D O   
4340 C CB  . THR C 152 ? 0.4518 0.4680 0.5139 -0.0386 0.0069  0.0731  152 THR D CB  
4341 O OG1 . THR C 152 ? 0.4854 0.5048 0.5366 -0.0417 0.0117  0.0809  152 THR D OG1 
4342 C CG2 . THR C 152 ? 0.4420 0.4584 0.4854 -0.0356 0.0040  0.0704  152 THR D CG2 
4343 N N   . PHE C 153 ? 0.4503 0.4625 0.5639 -0.0417 0.0100  0.0597  153 PHE D N   
4344 C CA  . PHE C 153 ? 0.4516 0.4623 0.5845 -0.0451 0.0114  0.0597  153 PHE D CA  
4345 C C   . PHE C 153 ? 0.4736 0.4762 0.6331 -0.0457 0.0084  0.0605  153 PHE D C   
4346 O O   . PHE C 153 ? 0.4694 0.4681 0.6346 -0.0431 0.0060  0.0582  153 PHE D O   
4347 C CB  . PHE C 153 ? 0.4387 0.4525 0.5698 -0.0464 0.0143  0.0468  153 PHE D CB  
4348 C CG  . PHE C 153 ? 0.4263 0.4355 0.5632 -0.0463 0.0143  0.0327  153 PHE D CG  
4349 C CD1 . PHE C 153 ? 0.4171 0.4264 0.5418 -0.0431 0.0143  0.0268  153 PHE D CD1 
4350 C CD2 . PHE C 153 ? 0.4193 0.4237 0.5735 -0.0501 0.0151  0.0245  153 PHE D CD2 
4351 C CE1 . PHE C 153 ? 0.3873 0.3921 0.5166 -0.0439 0.0165  0.0134  153 PHE D CE1 
4352 C CE2 . PHE C 153 ? 0.4157 0.4148 0.5726 -0.0512 0.0172  0.0100  153 PHE D CE2 
4353 C CZ  . PHE C 153 ? 0.3885 0.3881 0.5324 -0.0482 0.0185  0.0045  153 PHE D CZ  
4354 N N   . VAL C 154 ? 0.4922 0.4926 0.6709 -0.0491 0.0086  0.0646  154 VAL D N   
4355 C CA  . VAL C 154 ? 0.5104 0.5030 0.7193 -0.0500 0.0065  0.0643  154 VAL D CA  
4356 C C   . VAL C 154 ? 0.5204 0.5104 0.7411 -0.0524 0.0103  0.0481  154 VAL D C   
4357 O O   . VAL C 154 ? 0.5064 0.4986 0.7293 -0.0559 0.0113  0.0484  154 VAL D O   
4358 C CB  . VAL C 154 ? 0.5224 0.5130 0.7459 -0.0529 0.0030  0.0824  154 VAL D CB  
4359 C CG1 . VAL C 154 ? 0.5176 0.4995 0.7766 -0.0531 -0.0010 0.0846  154 VAL D CG1 
4360 C CG2 . VAL C 154 ? 0.5290 0.5230 0.7295 -0.0528 0.0000  0.0977  154 VAL D CG2 
4361 N N   . PRO C 155 ? 0.5326 0.5176 0.7595 -0.0513 0.0127  0.0335  155 PRO D N   
4362 C CA  . PRO C 155 ? 0.5472 0.5282 0.7807 -0.0550 0.0165  0.0165  155 PRO D CA  
4363 C C   . PRO C 155 ? 0.5713 0.5484 0.8287 -0.0592 0.0155  0.0195  155 PRO D C   
4364 O O   . PRO C 155 ? 0.5790 0.5520 0.8611 -0.0585 0.0131  0.0299  155 PRO D O   
4365 C CB  . PRO C 155 ? 0.5473 0.5210 0.7950 -0.0533 0.0203  0.0049  155 PRO D CB  
4366 C CG  . PRO C 155 ? 0.5345 0.5119 0.7709 -0.0482 0.0182  0.0126  155 PRO D CG  
4367 C CD  . PRO C 155 ? 0.5257 0.5086 0.7530 -0.0471 0.0122  0.0319  155 PRO D CD  
4368 N N   . SER C 156 ? 0.5858 0.5641 0.8373 -0.0639 0.0160  0.0116  156 SER D N   
4369 C CA  . SER C 156 ? 0.6076 0.5807 0.8837 -0.0685 0.0151  0.0102  156 SER D CA  
4370 C C   . SER C 156 ? 0.6277 0.5982 0.8959 -0.0747 0.0157  -0.0068 156 SER D C   
4371 O O   . SER C 156 ? 0.6267 0.6034 0.8697 -0.0760 0.0143  -0.0098 156 SER D O   
4372 C CB  . SER C 156 ? 0.6065 0.5851 0.8895 -0.0691 0.0120  0.0288  156 SER D CB  
4373 O OG  . SER C 156 ? 0.6223 0.5945 0.9365 -0.0727 0.0108  0.0303  156 SER D OG  
4374 N N   . ALA C 157 ? 0.6531 0.6140 0.9438 -0.0791 0.0170  -0.0176 157 ALA D N   
4375 C CA  . ALA C 157 ? 0.6730 0.6287 0.9554 -0.0868 0.0170  -0.0356 157 ALA D CA  
4376 C C   . ALA C 157 ? 0.6782 0.6406 0.9533 -0.0912 0.0104  -0.0295 157 ALA D C   
4377 O O   . ALA C 157 ? 0.6942 0.6532 0.9604 -0.0987 0.0074  -0.0417 157 ALA D O   
4378 C CB  . ALA C 157 ? 0.6806 0.6233 0.9913 -0.0908 0.0205  -0.0488 157 ALA D CB  
4379 N N   . GLU C 158 ? 0.6712 0.6427 0.9500 -0.0873 0.0082  -0.0104 158 GLU D N   
4380 C CA  . GLU C 158 ? 0.6723 0.6513 0.9509 -0.0906 0.0035  -0.0021 158 GLU D CA  
4381 C C   . GLU C 158 ? 0.6635 0.6537 0.9163 -0.0880 0.0025  0.0039  158 GLU D C   
4382 O O   . GLU C 158 ? 0.6690 0.6650 0.9200 -0.0916 -0.0017 0.0062  158 GLU D O   
4383 C CB  . GLU C 158 ? 0.6732 0.6539 0.9789 -0.0897 0.0034  0.0145  158 GLU D CB  
4384 C CG  . GLU C 158 ? 0.6820 0.6599 1.0003 -0.0843 0.0066  0.0252  158 GLU D CG  
4385 C CD  . GLU C 158 ? 0.7132 0.6827 1.0677 -0.0869 0.0056  0.0282  158 GLU D CD  
4386 O OE1 . GLU C 158 ? 0.7382 0.7068 1.1081 -0.0923 0.0029  0.0275  158 GLU D OE1 
4387 O OE2 . GLU C 158 ? 0.6910 0.6546 1.0614 -0.0838 0.0068  0.0317  158 GLU D OE2 
4388 N N   . ASP C 159 ? 0.6494 0.6425 0.8852 -0.0819 0.0060  0.0064  159 ASP D N   
4389 C CA  . ASP C 159 ? 0.6316 0.6347 0.8455 -0.0790 0.0057  0.0118  159 ASP D CA  
4390 C C   . ASP C 159 ? 0.6300 0.6322 0.8215 -0.0813 0.0035  -0.0016 159 ASP D C   
4391 O O   . ASP C 159 ? 0.6420 0.6366 0.8279 -0.0820 0.0057  -0.0134 159 ASP D O   
4392 C CB  . ASP C 159 ? 0.6262 0.6328 0.8325 -0.0719 0.0098  0.0227  159 ASP D CB  
4393 C CG  . ASP C 159 ? 0.6448 0.6532 0.8675 -0.0709 0.0116  0.0386  159 ASP D CG  
4394 O OD1 . ASP C 159 ? 0.6617 0.6736 0.8966 -0.0743 0.0110  0.0439  159 ASP D OD1 
4395 O OD2 . ASP C 159 ? 0.6620 0.6680 0.8860 -0.0674 0.0131  0.0465  159 ASP D OD2 
4396 N N   . PHE C 160 ? 0.6177 0.6276 0.7978 -0.0829 -0.0004 0.0006  160 PHE D N   
4397 C CA  . PHE C 160 ? 0.6100 0.6202 0.7669 -0.0854 -0.0037 -0.0090 160 PHE D CA  
4398 C C   . PHE C 160 ? 0.5835 0.6041 0.7271 -0.0812 -0.0045 -0.0011 160 PHE D C   
4399 O O   . PHE C 160 ? 0.5807 0.6091 0.7341 -0.0799 -0.0051 0.0090  160 PHE D O   
4400 C CB  . PHE C 160 ? 0.6280 0.6329 0.7838 -0.0954 -0.0110 -0.0195 160 PHE D CB  
4401 C CG  . PHE C 160 ? 0.6505 0.6622 0.8178 -0.0994 -0.0185 -0.0117 160 PHE D CG  
4402 C CD1 . PHE C 160 ? 0.6636 0.6832 0.8199 -0.1005 -0.0246 -0.0079 160 PHE D CD1 
4403 C CD2 . PHE C 160 ? 0.6759 0.6859 0.8682 -0.1024 -0.0201 -0.0081 160 PHE D CD2 
4404 C CE1 . PHE C 160 ? 0.6773 0.7034 0.8494 -0.1042 -0.0320 -0.0004 160 PHE D CE1 
4405 C CE2 . PHE C 160 ? 0.6902 0.7067 0.8971 -0.1064 -0.0271 -0.0008 160 PHE D CE2 
4406 C CZ  . PHE C 160 ? 0.7002 0.7250 0.8979 -0.1072 -0.0330 0.0031  160 PHE D CZ  
4407 N N   . TYR C 161 ? 0.5648 0.5852 0.6879 -0.0791 -0.0036 -0.0063 161 TYR D N   
4408 C CA  . TYR C 161 ? 0.5313 0.5601 0.6442 -0.0733 -0.0023 0.0010  161 TYR D CA  
4409 C C   . TYR C 161 ? 0.5242 0.5567 0.6224 -0.0766 -0.0086 -0.0021 161 TYR D C   
4410 O O   . TYR C 161 ? 0.5329 0.5600 0.6188 -0.0829 -0.0127 -0.0117 161 TYR D O   
4411 C CB  . TYR C 161 ? 0.5227 0.5493 0.6272 -0.0667 0.0038  0.0011  161 TYR D CB  
4412 C CG  . TYR C 161 ? 0.4948 0.5198 0.6135 -0.0630 0.0083  0.0091  161 TYR D CG  
4413 C CD1 . TYR C 161 ? 0.4901 0.5216 0.6110 -0.0591 0.0111  0.0210  161 TYR D CD1 
4414 C CD2 . TYR C 161 ? 0.4906 0.5071 0.6210 -0.0640 0.0100  0.0049  161 TYR D CD2 
4415 C CE1 . TYR C 161 ? 0.5085 0.5379 0.6394 -0.0572 0.0144  0.0298  161 TYR D CE1 
4416 C CE2 . TYR C 161 ? 0.5027 0.5175 0.6479 -0.0613 0.0124  0.0143  161 TYR D CE2 
4417 C CZ  . TYR C 161 ? 0.5185 0.5397 0.6620 -0.0583 0.0141  0.0275  161 TYR D CZ  
4418 O OH  . TYR C 161 ? 0.5537 0.5729 0.7085 -0.0571 0.0157  0.0384  161 TYR D OH  
4419 N N   . ASP C 162 ? 0.5056 0.5470 0.6058 -0.0730 -0.0091 0.0063  162 ASP D N   
4420 C CA  . ASP C 162 ? 0.4971 0.5428 0.5864 -0.0749 -0.0153 0.0057  162 ASP D CA  
4421 C C   . ASP C 162 ? 0.4758 0.5274 0.5596 -0.0670 -0.0103 0.0107  162 ASP D C   
4422 O O   . ASP C 162 ? 0.4582 0.5138 0.5508 -0.0615 -0.0037 0.0175  162 ASP D O   
4423 C CB  . ASP C 162 ? 0.5015 0.5526 0.6055 -0.0802 -0.0237 0.0106  162 ASP D CB  
4424 C CG  . ASP C 162 ? 0.5220 0.5665 0.6274 -0.0899 -0.0315 0.0045  162 ASP D CG  
4425 O OD1 . ASP C 162 ? 0.5342 0.5797 0.6601 -0.0923 -0.0331 0.0082  162 ASP D OD1 
4426 O OD2 . ASP C 162 ? 0.5549 0.5927 0.6404 -0.0957 -0.0355 -0.0044 162 ASP D OD2 
4427 N N   . CYS C 163 ? 0.4724 0.5235 0.5397 -0.0674 -0.0133 0.0068  163 CYS D N   
4428 C CA  . CYS C 163 ? 0.4687 0.5254 0.5313 -0.0614 -0.0111 0.0106  163 CYS D CA  
4429 C C   . CYS C 163 ? 0.4640 0.5267 0.5338 -0.0652 -0.0197 0.0146  163 CYS D C   
4430 O O   . CYS C 163 ? 0.4747 0.5349 0.5366 -0.0728 -0.0288 0.0116  163 CYS D O   
4431 C CB  . CYS C 163 ? 0.4675 0.5197 0.5105 -0.0600 -0.0098 0.0046  163 CYS D CB  
4432 S SG  . CYS C 163 ? 0.4974 0.5550 0.5355 -0.0522 -0.0067 0.0087  163 CYS D SG  
4433 N N   . ARG C 164 ? 0.4504 0.5207 0.5362 -0.0609 -0.0171 0.0215  164 ARG D N   
4434 C CA  . ARG C 164 ? 0.4484 0.5251 0.5471 -0.0637 -0.0254 0.0263  164 ARG D CA  
4435 C C   . ARG C 164 ? 0.4386 0.5193 0.5337 -0.0587 -0.0247 0.0278  164 ARG D C   
4436 O O   . ARG C 164 ? 0.4278 0.5105 0.5237 -0.0514 -0.0148 0.0282  164 ARG D O   
4437 C CB  . ARG C 164 ? 0.4473 0.5302 0.5738 -0.0636 -0.0237 0.0326  164 ARG D CB  
4438 C CG  . ARG C 164 ? 0.4577 0.5479 0.6045 -0.0655 -0.0319 0.0386  164 ARG D CG  
4439 C CD  . ARG C 164 ? 0.4666 0.5610 0.6412 -0.0693 -0.0352 0.0440  164 ARG D CD  
4440 N NE  . ARG C 164 ? 0.5115 0.6145 0.7126 -0.0636 -0.0266 0.0492  164 ARG D NE  
4441 C CZ  . ARG C 164 ? 0.5243 0.6302 0.7404 -0.0602 -0.0138 0.0512  164 ARG D CZ  
4442 N NH1 . ARG C 164 ? 0.4730 0.5743 0.6825 -0.0618 -0.0098 0.0500  164 ARG D NH1 
4443 N NH2 . ARG C 164 ? 0.5607 0.6741 0.8005 -0.0556 -0.0046 0.0547  164 ARG D NH2 
4444 N N   . VAL C 165 ? 0.4331 0.5144 0.5244 -0.0636 -0.0357 0.0290  165 VAL D N   
4445 C CA  . VAL C 165 ? 0.4293 0.5137 0.5185 -0.0595 -0.0360 0.0306  165 VAL D CA  
4446 C C   . VAL C 165 ? 0.4305 0.5215 0.5417 -0.0622 -0.0461 0.0382  165 VAL D C   
4447 O O   . VAL C 165 ? 0.4406 0.5312 0.5544 -0.0709 -0.0591 0.0416  165 VAL D O   
4448 C CB  . VAL C 165 ? 0.4360 0.5145 0.4980 -0.0622 -0.0392 0.0258  165 VAL D CB  
4449 C CG1 . VAL C 165 ? 0.4296 0.5115 0.4924 -0.0594 -0.0422 0.0289  165 VAL D CG1 
4450 C CG2 . VAL C 165 ? 0.4166 0.4891 0.4624 -0.0581 -0.0288 0.0189  165 VAL D CG2 
4451 N N   . GLU C 166 ? 0.4211 0.5178 0.5491 -0.0554 -0.0407 0.0408  166 GLU D N   
4452 C CA  . GLU C 166 ? 0.4213 0.5243 0.5751 -0.0571 -0.0501 0.0483  166 GLU D CA  
4453 C C   . GLU C 166 ? 0.4125 0.5161 0.5621 -0.0532 -0.0507 0.0484  166 GLU D C   
4454 O O   . GLU C 166 ? 0.4087 0.5109 0.5494 -0.0457 -0.0387 0.0430  166 GLU D O   
4455 C CB  . GLU C 166 ? 0.4185 0.5286 0.6070 -0.0528 -0.0424 0.0515  166 GLU D CB  
4456 C CG  . GLU C 166 ? 0.4389 0.5492 0.6360 -0.0555 -0.0395 0.0519  166 GLU D CG  
4457 C CD  . GLU C 166 ? 0.4870 0.6038 0.7144 -0.0497 -0.0259 0.0535  166 GLU D CD  
4458 O OE1 . GLU C 166 ? 0.5051 0.6201 0.7241 -0.0463 -0.0119 0.0496  166 GLU D OE1 
4459 O OE2 . GLU C 166 ? 0.4760 0.5996 0.7361 -0.0488 -0.0287 0.0586  166 GLU D OE2 
4460 N N   . HIS C 167 ? 0.4040 0.5093 0.5604 -0.0590 -0.0656 0.0554  167 HIS D N   
4461 C CA  . HIS C 167 ? 0.3902 0.4963 0.5462 -0.0566 -0.0687 0.0575  167 HIS D CA  
4462 C C   . HIS C 167 ? 0.3877 0.4981 0.5673 -0.0633 -0.0864 0.0690  167 HIS D C   
4463 O O   . HIS C 167 ? 0.4032 0.5122 0.5778 -0.0734 -0.1003 0.0743  167 HIS D O   
4464 C CB  . HIS C 167 ? 0.3939 0.4928 0.5114 -0.0587 -0.0683 0.0521  167 HIS D CB  
4465 C CG  . HIS C 167 ? 0.3881 0.4871 0.5027 -0.0564 -0.0709 0.0540  167 HIS D CG  
4466 N ND1 . HIS C 167 ? 0.4160 0.5147 0.5268 -0.0645 -0.0858 0.0620  167 HIS D ND1 
4467 C CD2 . HIS C 167 ? 0.3933 0.4919 0.5068 -0.0480 -0.0609 0.0493  167 HIS D CD2 
4468 C CE1 . HIS C 167 ? 0.4166 0.5154 0.5267 -0.0604 -0.0844 0.0624  167 HIS D CE1 
4469 N NE2 . HIS C 167 ? 0.4031 0.5017 0.5152 -0.0502 -0.0696 0.0542  167 HIS D NE2 
4470 N N   . TRP C 168 ? 0.3708 0.4859 0.5772 -0.0583 -0.0865 0.0731  168 TRP D N   
4471 C CA  . TRP C 168 ? 0.3721 0.4914 0.6050 -0.0641 -0.1045 0.0857  168 TRP D CA  
4472 C C   . TRP C 168 ? 0.3851 0.5001 0.5926 -0.0771 -0.1239 0.0932  168 TRP D C   
4473 O O   . TRP C 168 ? 0.3924 0.5102 0.6199 -0.0850 -0.1419 0.1054  168 TRP D O   
4474 C CB  . TRP C 168 ? 0.3551 0.4774 0.6111 -0.0569 -0.1013 0.0872  168 TRP D CB  
4475 C CG  . TRP C 168 ? 0.3385 0.4641 0.6179 -0.0458 -0.0820 0.0790  168 TRP D CG  
4476 C CD1 . TRP C 168 ? 0.3326 0.4611 0.6267 -0.0430 -0.0711 0.0752  168 TRP D CD1 
4477 C CD2 . TRP C 168 ? 0.3409 0.4667 0.6307 -0.0369 -0.0706 0.0731  168 TRP D CD2 
4478 N NE1 . TRP C 168 ? 0.3520 0.4821 0.6624 -0.0334 -0.0526 0.0671  168 TRP D NE1 
4479 C CE2 . TRP C 168 ? 0.3527 0.4810 0.6608 -0.0295 -0.0522 0.0651  168 TRP D CE2 
4480 C CE3 . TRP C 168 ? 0.3248 0.4485 0.6107 -0.0350 -0.0741 0.0738  168 TRP D CE3 
4481 C CZ2 . TRP C 168 ? 0.3654 0.4934 0.6850 -0.0209 -0.0368 0.0565  168 TRP D CZ2 
4482 C CZ3 . TRP C 168 ? 0.3361 0.4598 0.6364 -0.0257 -0.0598 0.0654  168 TRP D CZ3 
4483 C CH2 . TRP C 168 ? 0.3429 0.4682 0.6581 -0.0190 -0.0412 0.0562  168 TRP D CH2 
4484 N N   . GLY C 169 ? 0.3956 0.5035 0.5599 -0.0800 -0.1202 0.0863  169 GLY D N   
4485 C CA  . GLY C 169 ? 0.4157 0.5183 0.5499 -0.0932 -0.1353 0.0914  169 GLY D CA  
4486 C C   . GLY C 169 ? 0.4354 0.5345 0.5567 -0.1041 -0.1443 0.0917  169 GLY D C   
4487 O O   . GLY C 169 ? 0.4526 0.5477 0.5539 -0.1171 -0.1598 0.0978  169 GLY D O   
4488 N N   . LEU C 170 ? 0.4325 0.5327 0.5635 -0.0995 -0.1345 0.0851  170 LEU D N   
4489 C CA  . LEU C 170 ? 0.4537 0.5506 0.5768 -0.1089 -0.1421 0.0844  170 LEU D CA  
4490 C C   . LEU C 170 ? 0.4701 0.5740 0.6357 -0.1106 -0.1533 0.0947  170 LEU D C   
4491 O O   . LEU C 170 ? 0.4587 0.5701 0.6611 -0.1002 -0.1448 0.0966  170 LEU D O   
4492 C CB  . LEU C 170 ? 0.4373 0.5309 0.5487 -0.1030 -0.1247 0.0717  170 LEU D CB  
4493 C CG  . LEU C 170 ? 0.4245 0.5116 0.5014 -0.0991 -0.1108 0.0604  170 LEU D CG  
4494 C CD1 . LEU C 170 ? 0.3828 0.4695 0.4633 -0.0894 -0.0931 0.0513  170 LEU D CD1 
4495 C CD2 . LEU C 170 ? 0.4123 0.4905 0.4518 -0.1118 -0.1179 0.0564  170 LEU D CD2 
4496 N N   . ASP C 171 ? 0.5008 0.6021 0.6624 -0.1240 -0.1717 0.1011  171 ASP D N   
4497 C CA  . ASP C 171 ? 0.5142 0.6221 0.7188 -0.1264 -0.1831 0.1109  171 ASP D CA  
4498 C C   . ASP C 171 ? 0.5050 0.6161 0.7285 -0.1165 -0.1648 0.1025  171 ASP D C   
4499 O O   . ASP C 171 ? 0.4828 0.6021 0.7469 -0.1070 -0.1562 0.1053  171 ASP D O   
4500 C CB  . ASP C 171 ? 0.5380 0.6409 0.7300 -0.1438 -0.2065 0.1177  171 ASP D CB  
4501 C CG  . ASP C 171 ? 0.5825 0.6814 0.7514 -0.1561 -0.2260 0.1274  171 ASP D CG  
4502 O OD1 . ASP C 171 ? 0.6327 0.7226 0.7625 -0.1702 -0.2364 0.1251  171 ASP D OD1 
4503 O OD2 . ASP C 171 ? 0.5840 0.6880 0.7720 -0.1526 -0.2309 0.1371  171 ASP D OD2 
4504 N N   . GLN C 172 ? 0.5199 0.6238 0.7130 -0.1192 -0.1577 0.0920  172 GLN D N   
4505 C CA  . GLN C 172 ? 0.5192 0.6244 0.7241 -0.1119 -0.1416 0.0847  172 GLN D CA  
4506 C C   . GLN C 172 ? 0.5166 0.6159 0.6888 -0.1049 -0.1225 0.0716  172 GLN D C   
4507 O O   . GLN C 172 ? 0.5310 0.6235 0.6674 -0.1087 -0.1237 0.0666  172 GLN D O   
4508 C CB  . GLN C 172 ? 0.5348 0.6368 0.7420 -0.1224 -0.1533 0.0857  172 GLN D CB  
4509 C CG  . GLN C 172 ? 0.5881 0.6797 0.7530 -0.1365 -0.1668 0.0822  172 GLN D CG  
4510 C CD  . GLN C 172 ? 0.6356 0.7263 0.8120 -0.1507 -0.1905 0.0912  172 GLN D CD  
4511 O OE1 . GLN C 172 ? 0.6506 0.7494 0.8661 -0.1511 -0.2023 0.1041  172 GLN D OE1 
4512 N NE2 . GLN C 172 ? 0.6675 0.7480 0.8118 -0.1628 -0.1977 0.0842  172 GLN D NE2 
4513 N N   . PRO C 173 ? 0.5089 0.6108 0.6939 -0.0952 -0.1048 0.0667  173 PRO D N   
4514 C CA  . PRO C 173 ? 0.5012 0.5975 0.6584 -0.0890 -0.0886 0.0560  173 PRO D CA  
4515 C C   . PRO C 173 ? 0.5192 0.6055 0.6426 -0.0975 -0.0926 0.0484  173 PRO D C   
4516 O O   . PRO C 173 ? 0.5331 0.6163 0.6564 -0.1078 -0.1047 0.0496  173 PRO D O   
4517 C CB  . PRO C 173 ? 0.4869 0.5868 0.6654 -0.0820 -0.0744 0.0548  173 PRO D CB  
4518 C CG  . PRO C 173 ? 0.4931 0.5996 0.7086 -0.0857 -0.0832 0.0634  173 PRO D CG  
4519 C CD  . PRO C 173 ? 0.5024 0.6123 0.7284 -0.0901 -0.0988 0.0714  173 PRO D CD  
4520 N N   . LEU C 174 ? 0.5200 0.6010 0.6163 -0.0935 -0.0824 0.0404  174 LEU D N   
4521 C CA  . LEU C 174 ? 0.5412 0.6125 0.6067 -0.1001 -0.0821 0.0312  174 LEU D CA  
4522 C C   . LEU C 174 ? 0.5397 0.6074 0.6058 -0.0948 -0.0686 0.0240  174 LEU D C   
4523 O O   . LEU C 174 ? 0.5296 0.6003 0.6030 -0.0846 -0.0563 0.0240  174 LEU D O   
4524 C CB  . LEU C 174 ? 0.5405 0.6084 0.5798 -0.0993 -0.0793 0.0275  174 LEU D CB  
4525 C CG  . LEU C 174 ? 0.5766 0.6346 0.5824 -0.1093 -0.0816 0.0191  174 LEU D CG  
4526 C CD1 . LEU C 174 ? 0.5961 0.6514 0.5934 -0.1242 -0.0998 0.0232  174 LEU D CD1 
4527 C CD2 . LEU C 174 ? 0.5764 0.6327 0.5623 -0.1062 -0.0755 0.0163  174 LEU D CD2 
4528 N N   . LEU C 175 ? 0.5622 0.6231 0.6210 -0.1025 -0.0715 0.0183  175 LEU D N   
4529 C CA  . LEU C 175 ? 0.5734 0.6296 0.6327 -0.0983 -0.0596 0.0115  175 LEU D CA  
4530 C C   . LEU C 175 ? 0.5991 0.6450 0.6314 -0.1029 -0.0558 -0.0001 175 LEU D C   
4531 O O   . LEU C 175 ? 0.6170 0.6562 0.6357 -0.1141 -0.0638 -0.0056 175 LEU D O   
4532 C CB  . LEU C 175 ? 0.5759 0.6318 0.6547 -0.1028 -0.0636 0.0130  175 LEU D CB  
4533 C CG  . LEU C 175 ? 0.5649 0.6292 0.6768 -0.0982 -0.0619 0.0220  175 LEU D CG  
4534 C CD1 . LEU C 175 ? 0.5603 0.6347 0.6874 -0.0919 -0.0614 0.0308  175 LEU D CD1 
4535 C CD2 . LEU C 175 ? 0.5426 0.6052 0.6664 -0.1089 -0.0752 0.0235  175 LEU D CD2 
4536 N N   . LYS C 176 ? 0.6010 0.6451 0.6260 -0.0949 -0.0437 -0.0043 176 LYS D N   
4537 C CA  . LYS C 176 ? 0.6279 0.6622 0.6353 -0.0981 -0.0374 -0.0160 176 LYS D CA  
4538 C C   . LYS C 176 ? 0.6333 0.6640 0.6558 -0.0955 -0.0308 -0.0191 176 LYS D C   
4539 O O   . LYS C 176 ? 0.6137 0.6483 0.6508 -0.0865 -0.0240 -0.0137 176 LYS D O   
4540 C CB  . LYS C 176 ? 0.6217 0.6552 0.6160 -0.0920 -0.0289 -0.0190 176 LYS D CB  
4541 C CG  . LYS C 176 ? 0.6579 0.6875 0.6270 -0.0999 -0.0322 -0.0240 176 LYS D CG  
4542 C CD  . LYS C 176 ? 0.7165 0.7353 0.6691 -0.1111 -0.0313 -0.0363 176 LYS D CD  
4543 C CE  . LYS C 176 ? 0.7394 0.7542 0.6631 -0.1196 -0.0325 -0.0410 176 LYS D CE  
4544 N NZ  . LYS C 176 ? 0.7861 0.7912 0.6896 -0.1344 -0.0364 -0.0507 176 LYS D NZ  
4545 N N   . HIS C 177 ? 0.6651 0.6877 0.6832 -0.1045 -0.0333 -0.0275 177 HIS D N   
4546 C CA  . HIS C 177 ? 0.6812 0.6991 0.7154 -0.1035 -0.0282 -0.0310 177 HIS D CA  
4547 C C   . HIS C 177 ? 0.6960 0.7071 0.7268 -0.0993 -0.0164 -0.0396 177 HIS D C   
4548 O O   . HIS C 177 ? 0.7075 0.7143 0.7193 -0.1017 -0.0129 -0.0474 177 HIS D O   
4549 C CB  . HIS C 177 ? 0.7021 0.7133 0.7344 -0.1154 -0.0362 -0.0376 177 HIS D CB  
4550 C CG  . HIS C 177 ? 0.6985 0.7088 0.7562 -0.1144 -0.0353 -0.0356 177 HIS D CG  
4551 N ND1 . HIS C 177 ? 0.6868 0.6883 0.7517 -0.1145 -0.0275 -0.0446 177 HIS D ND1 
4552 C CD2 . HIS C 177 ? 0.7114 0.7287 0.7918 -0.1131 -0.0406 -0.0250 177 HIS D CD2 
4553 C CE1 . HIS C 177 ? 0.7134 0.7162 0.8029 -0.1136 -0.0290 -0.0390 177 HIS D CE1 
4554 N NE2 . HIS C 177 ? 0.7221 0.7347 0.8208 -0.1129 -0.0364 -0.0272 177 HIS D NE2 
4555 N N   . TRP C 178 ? 0.7062 0.7164 0.7573 -0.0934 -0.0104 -0.0372 178 TRP D N   
4556 C CA  . TRP C 178 ? 0.7273 0.7301 0.7823 -0.0903 -0.0006 -0.0449 178 TRP D CA  
4557 C C   . TRP C 178 ? 0.7492 0.7483 0.8293 -0.0886 0.0022  -0.0435 178 TRP D C   
4558 O O   . TRP C 178 ? 0.7380 0.7430 0.8334 -0.0842 0.0006  -0.0317 178 TRP D O   
4559 C CB  . TRP C 178 ? 0.7129 0.7198 0.7642 -0.0812 0.0048  -0.0401 178 TRP D CB  
4560 C CG  . TRP C 178 ? 0.7107 0.7104 0.7686 -0.0783 0.0137  -0.0474 178 TRP D CG  
4561 C CD1 . TRP C 178 ? 0.7185 0.7129 0.7645 -0.0806 0.0196  -0.0585 178 TRP D CD1 
4562 C CD2 . TRP C 178 ? 0.7122 0.7093 0.7935 -0.0730 0.0178  -0.0436 178 TRP D CD2 
4563 N NE1 . TRP C 178 ? 0.7219 0.7107 0.7856 -0.0764 0.0276  -0.0624 178 TRP D NE1 
4564 C CE2 . TRP C 178 ? 0.7169 0.7070 0.8026 -0.0718 0.0255  -0.0528 178 TRP D CE2 
4565 C CE3 . TRP C 178 ? 0.7011 0.7008 0.8011 -0.0698 0.0157  -0.0325 178 TRP D CE3 
4566 C CZ2 . TRP C 178 ? 0.7124 0.6982 0.8232 -0.0672 0.0296  -0.0506 178 TRP D CZ2 
4567 C CZ3 . TRP C 178 ? 0.6937 0.6888 0.8148 -0.0659 0.0195  -0.0298 178 TRP D CZ3 
4568 C CH2 . TRP C 178 ? 0.7033 0.6916 0.8308 -0.0645 0.0256  -0.0385 178 TRP D CH2 
4569 N N   . GLU C 179 ? 0.7897 0.7785 0.8744 -0.0924 0.0075  -0.0559 179 GLU D N   
4570 C CA  . GLU C 179 ? 0.8144 0.7979 0.9254 -0.0913 0.0104  -0.0559 179 GLU D CA  
4571 C C   . GLU C 179 ? 0.8339 0.8079 0.9531 -0.0901 0.0200  -0.0673 179 GLU D C   
4572 O O   . GLU C 179 ? 0.8443 0.8142 0.9465 -0.0930 0.0251  -0.0789 179 GLU D O   
4573 C CB  . GLU C 179 ? 0.8322 0.8115 0.9481 -0.1005 0.0042  -0.0608 179 GLU D CB  
4574 C CG  . GLU C 179 ? 0.8741 0.8450 0.9675 -0.1116 0.0031  -0.0776 179 GLU D CG  
4575 C CD  . GLU C 179 ? 0.9116 0.8823 1.0006 -0.1214 -0.0084 -0.0779 179 GLU D CD  
4576 O OE1 . GLU C 179 ? 0.9171 0.8978 1.0047 -0.1202 -0.0170 -0.0652 179 GLU D OE1 
4577 O OE2 . GLU C 179 ? 0.9343 0.8945 1.0223 -0.1307 -0.0090 -0.0912 179 GLU D OE2 
4578 N N   . ALA C 180 ? 0.8498 0.8204 0.9972 -0.0864 0.0228  -0.0634 180 ALA D N   
4579 C CA  . ALA C 180 ? 0.8734 0.8345 1.0389 -0.0852 0.0316  -0.0736 180 ALA D CA  
4580 C C   . ALA C 180 ? 0.9063 0.8557 1.0715 -0.0949 0.0357  -0.0934 180 ALA D C   
4581 O O   . ALA C 180 ? 0.9133 0.8586 1.0926 -0.0995 0.0321  -0.0948 180 ALA D O   
4582 C CB  . ALA C 180 ? 0.8631 0.8242 1.0613 -0.0790 0.0311  -0.0609 180 ALA D CB  
4583 N N   . GLN C 181 ? 0.9328 0.8766 1.0813 -0.0986 0.0438  -0.1089 181 GLN D N   
4584 C CA  . GLN C 181 ? 0.9699 0.9011 1.1121 -0.1091 0.0506  -0.1309 181 GLN D CA  
4585 C C   . GLN C 181 ? 0.9806 0.9011 1.1579 -0.1101 0.0562  -0.1397 181 GLN D C   
4586 O O   . GLN C 181 ? 1.0031 0.9125 1.1762 -0.1198 0.0601  -0.1576 181 GLN D O   
4587 C CB  . GLN C 181 ? 0.9854 0.9125 1.1078 -0.1114 0.0620  -0.1448 181 GLN D CB  
4588 C CG  . GLN C 181 ? 1.0088 0.9369 1.0876 -0.1209 0.0583  -0.1504 181 GLN D CG  
4589 C CD  . GLN C 181 ? 1.0040 0.9457 1.0677 -0.1165 0.0458  -0.1313 181 GLN D CD  
4590 O OE1 . GLN C 181 ? 0.9967 0.9440 1.0677 -0.1155 0.0347  -0.1193 181 GLN D OE1 
4591 N NE2 . GLN C 181 ? 0.9998 0.9466 1.0442 -0.1141 0.0483  -0.1289 181 GLN D NE2 
4709 N N   . SER D 26  ? 0.3994 0.7308 1.4731 0.0156  -0.1258 -0.0397 3   SER E N   
4710 C CA  . SER D 26  ? 0.3980 0.7045 1.4147 0.0073  -0.0868 -0.0317 3   SER E CA  
4711 C C   . SER D 26  ? 0.3940 0.6889 1.4073 0.0145  -0.0556 -0.0251 3   SER E C   
4712 O O   . SER D 26  ? 0.4004 0.6985 1.4251 0.0268  -0.0695 -0.0220 3   SER E O   
4713 C CB  . SER D 26  ? 0.4040 0.6876 1.3307 0.0053  -0.1026 -0.0217 3   SER E CB  
4714 O OG  . SER D 26  ? 0.4237 0.7151 1.3524 -0.0028 -0.1250 -0.0291 3   SER E OG  
4715 N N   . PRO D 27  ? 0.3925 0.6704 1.3850 0.0078  -0.0140 -0.0227 4   PRO E N   
4716 C CA  . PRO D 27  ? 0.3877 0.6513 1.3734 0.0152  0.0165  -0.0175 4   PRO E CA  
4717 C C   . PRO D 27  ? 0.3806 0.6213 1.2934 0.0239  0.0061  -0.0050 4   PRO E C   
4718 O O   . PRO D 27  ? 0.3802 0.6121 1.2382 0.0220  -0.0169 0.0009  4   PRO E O   
4719 C CB  . PRO D 27  ? 0.3954 0.6404 1.3614 0.0053  0.0600  -0.0176 4   PRO E CB  
4720 C CG  . PRO D 27  ? 0.3994 0.6532 1.3734 -0.0077 0.0511  -0.0237 4   PRO E CG  
4721 C CD  . PRO D 27  ? 0.3966 0.6621 1.3568 -0.0052 0.0042  -0.0231 4   PRO E CD  
4722 N N   . GLU D 28  ? 0.3709 0.6013 1.2851 0.0327  0.0246  -0.0019 5   GLU E N   
4723 C CA  . GLU D 28  ? 0.3666 0.5768 1.2242 0.0410  0.0158  0.0081  5   GLU E CA  
4724 C C   . GLU D 28  ? 0.3628 0.5436 1.1415 0.0359  0.0336  0.0154  5   GLU E C   
4725 O O   . GLU D 28  ? 0.3685 0.5323 1.1338 0.0355  0.0671  0.0151  5   GLU E O   
4726 C CB  . GLU D 28  ? 0.3788 0.5885 1.2715 0.0528  0.0284  0.0072  5   GLU E CB  
4727 C CG  . GLU D 28  ? 0.3972 0.5906 1.2490 0.0629  0.0121  0.0160  5   GLU E CG  
4728 C CD  . GLU D 28  ? 0.4278 0.6283 1.3307 0.0762  0.0132  0.0135  5   GLU E CD  
4729 O OE1 . GLU D 28  ? 0.4458 0.6254 1.3183 0.0836  0.0212  0.0189  5   GLU E OE1 
4730 O OE2 . GLU D 28  ? 0.4310 0.6583 1.4069 0.0794  0.0054  0.0055  5   GLU E OE2 
4731 N N   . ASN D 29  ? 0.3458 0.5192 1.0715 0.0331  0.0107  0.0216  6   ASN E N   
4732 C CA  . ASN D 29  ? 0.3396 0.4887 0.9964 0.0290  0.0233  0.0275  6   ASN E CA  
4733 C C   . ASN D 29  ? 0.3418 0.4787 0.9473 0.0325  0.0012  0.0360  6   ASN E C   
4734 O O   . ASN D 29  ? 0.3378 0.4837 0.9424 0.0332  -0.0280 0.0384  6   ASN E O   
4735 C CB  . ASN D 29  ? 0.3315 0.4821 0.9746 0.0182  0.0281  0.0250  6   ASN E CB  
4736 C CG  . ASN D 29  ? 0.3102 0.4363 0.8895 0.0147  0.0450  0.0294  6   ASN E CG  
4737 O OD1 . ASN D 29  ? 0.2638 0.3862 0.8026 0.0103  0.0305  0.0329  6   ASN E OD1 
4738 N ND2 . ASN D 29  ? 0.2846 0.3929 0.8541 0.0174  0.0754  0.0288  6   ASN E ND2 
4739 N N   . TYR D 30  ? 0.3540 0.4688 0.9176 0.0349  0.0157  0.0401  7   TYR E N   
4740 C CA  . TYR D 30  ? 0.3610 0.4619 0.8733 0.0358  -0.0003 0.0476  7   TYR E CA  
4741 C C   . TYR D 30  ? 0.3661 0.4482 0.8245 0.0306  0.0143  0.0491  7   TYR E C   
4742 O O   . TYR D 30  ? 0.3826 0.4556 0.8382 0.0300  0.0390  0.0453  7   TYR E O   
4743 C CB  . TYR D 30  ? 0.3658 0.4575 0.8837 0.0452  -0.0024 0.0505  7   TYR E CB  
4744 C CG  . TYR D 30  ? 0.3537 0.4620 0.9307 0.0532  -0.0114 0.0478  7   TYR E CG  
4745 C CD1 . TYR D 30  ? 0.3481 0.4584 0.9662 0.0588  0.0108  0.0422  7   TYR E CD1 
4746 C CD2 . TYR D 30  ? 0.3484 0.4691 0.9400 0.0561  -0.0423 0.0505  7   TYR E CD2 
4747 C CE1 . TYR D 30  ? 0.3566 0.4845 1.0351 0.0669  0.0024  0.0388  7   TYR E CE1 
4748 C CE2 . TYR D 30  ? 0.3590 0.4956 1.0070 0.0650  -0.0537 0.0472  7   TYR E CE2 
4749 C CZ  . TYR D 30  ? 0.3716 0.5137 1.0666 0.0703  -0.0315 0.0411  7   TYR E CZ  
4750 O OH  . TYR D 30  ? 0.3737 0.5338 1.1309 0.0800  -0.0434 0.0370  7   TYR E OH  
4751 N N   . LEU D 31  ? 0.3757 0.4505 0.7910 0.0275  0.0001  0.0542  8   LEU E N   
4752 C CA  . LEU D 31  ? 0.3788 0.4393 0.7480 0.0228  0.0111  0.0542  8   LEU E CA  
4753 C C   . LEU D 31  ? 0.3897 0.4376 0.7178 0.0221  0.0016  0.0588  8   LEU E C   
4754 O O   . LEU D 31  ? 0.3884 0.4397 0.7125 0.0217  -0.0174 0.0638  8   LEU E O   
4755 C CB  . LEU D 31  ? 0.3644 0.4338 0.7280 0.0155  0.0096  0.0526  8   LEU E CB  
4756 C CG  . LEU D 31  ? 0.3640 0.4226 0.6815 0.0109  0.0143  0.0530  8   LEU E CG  
4757 C CD1 . LEU D 31  ? 0.3292 0.3940 0.6510 0.0056  0.0197  0.0501  8   LEU E CD1 
4758 C CD2 . LEU D 31  ? 0.3436 0.4019 0.6321 0.0084  -0.0045 0.0579  8   LEU E CD2 
4759 N N   . PHE D 32  ? 0.4063 0.4380 0.7028 0.0219  0.0151  0.0567  9   PHE E N   
4760 C CA  . PHE D 32  ? 0.4199 0.4409 0.6796 0.0196  0.0075  0.0589  9   PHE E CA  
4761 C C   . PHE D 32  ? 0.4207 0.4383 0.6486 0.0152  0.0114  0.0567  9   PHE E C   
4762 O O   . PHE D 32  ? 0.4315 0.4411 0.6527 0.0171  0.0270  0.0526  9   PHE E O   
4763 C CB  . PHE D 32  ? 0.4365 0.4395 0.6880 0.0249  0.0164  0.0568  9   PHE E CB  
4764 C CG  . PHE D 32  ? 0.4272 0.4222 0.6573 0.0226  0.0051  0.0594  9   PHE E CG  
4765 C CD1 . PHE D 32  ? 0.4430 0.4406 0.6864 0.0234  -0.0079 0.0651  9   PHE E CD1 
4766 C CD2 . PHE D 32  ? 0.4413 0.4255 0.6387 0.0197  0.0068  0.0561  9   PHE E CD2 
4767 C CE1 . PHE D 32  ? 0.4868 0.4744 0.7106 0.0203  -0.0161 0.0681  9   PHE E CE1 
4768 C CE2 . PHE D 32  ? 0.4785 0.4562 0.6611 0.0162  -0.0028 0.0576  9   PHE E CE2 
4769 C CZ  . PHE D 32  ? 0.4838 0.4625 0.6796 0.0159  -0.0128 0.0640  9   PHE E CZ  
4770 N N   . GLN D 33  ? 0.4170 0.4389 0.6252 0.0099  -0.0018 0.0595  10  GLN E N   
4771 C CA  . GLN D 33  ? 0.4233 0.4415 0.6013 0.0069  0.0001  0.0569  10  GLN E CA  
4772 C C   . GLN D 33  ? 0.4249 0.4372 0.5817 0.0045  -0.0079 0.0572  10  GLN E C   
4773 O O   . GLN D 33  ? 0.4259 0.4395 0.5890 0.0027  -0.0167 0.0614  10  GLN E O   
4774 C CB  . GLN D 33  ? 0.4100 0.4414 0.5867 0.0020  -0.0065 0.0585  10  GLN E CB  
4775 C CG  . GLN D 33  ? 0.4328 0.4765 0.6384 0.0013  -0.0089 0.0596  10  GLN E CG  
4776 C CD  . GLN D 33  ? 0.4377 0.4925 0.6387 -0.0040 -0.0218 0.0618  10  GLN E CD  
4777 O OE1 . GLN D 33  ? 0.4241 0.4786 0.6046 -0.0068 -0.0202 0.0604  10  GLN E OE1 
4778 N NE2 . GLN D 33  ? 0.4277 0.4909 0.6467 -0.0043 -0.0353 0.0650  10  GLN E NE2 
4779 N N   . GLY D 34  ? 0.4291 0.4347 0.5618 0.0044  -0.0053 0.0527  11  GLY E N   
4780 C CA  . GLY D 34  ? 0.4368 0.4402 0.5557 0.0008  -0.0134 0.0515  11  GLY E CA  
4781 C C   . GLY D 34  ? 0.4367 0.4461 0.5391 -0.0015 -0.0164 0.0489  11  GLY E C   
4782 O O   . GLY D 34  ? 0.4386 0.4490 0.5353 0.0009  -0.0110 0.0477  11  GLY E O   
4783 N N   . ARG D 35  ? 0.4295 0.4428 0.5265 -0.0063 -0.0241 0.0480  12  ARG E N   
4784 C CA  . ARG D 35  ? 0.4282 0.4472 0.5123 -0.0073 -0.0272 0.0438  12  ARG E CA  
4785 C C   . ARG D 35  ? 0.4302 0.4443 0.5091 -0.0084 -0.0323 0.0373  12  ARG E C   
4786 O O   . ARG D 35  ? 0.4281 0.4403 0.5163 -0.0129 -0.0349 0.0385  12  ARG E O   
4787 C CB  . ARG D 35  ? 0.4158 0.4496 0.5042 -0.0133 -0.0313 0.0484  12  ARG E CB  
4788 C CG  . ARG D 35  ? 0.4117 0.4513 0.5063 -0.0133 -0.0295 0.0538  12  ARG E CG  
4789 C CD  . ARG D 35  ? 0.4597 0.4987 0.5463 -0.0091 -0.0240 0.0508  12  ARG E CD  
4790 N NE  . ARG D 35  ? 0.5183 0.5555 0.6178 -0.0072 -0.0187 0.0531  12  ARG E NE  
4791 C CZ  . ARG D 35  ? 0.4962 0.5413 0.6057 -0.0095 -0.0200 0.0558  12  ARG E CZ  
4792 N NH1 . ARG D 35  ? 0.5229 0.5760 0.6261 -0.0133 -0.0253 0.0569  12  ARG E NH1 
4793 N NH2 . ARG D 35  ? 0.4975 0.5422 0.6251 -0.0079 -0.0157 0.0566  12  ARG E NH2 
4794 N N   . GLN D 36  ? 0.4313 0.4421 0.4953 -0.0038 -0.0344 0.0300  13  GLN E N   
4795 C CA  . GLN D 36  ? 0.4393 0.4509 0.5018 -0.0052 -0.0430 0.0220  13  GLN E CA  
4796 C C   . GLN D 36  ? 0.4251 0.4512 0.4871 -0.0058 -0.0473 0.0201  13  GLN E C   
4797 O O   . GLN D 36  ? 0.4313 0.4530 0.4771 0.0017  -0.0480 0.0167  13  GLN E O   
4798 C CB  . GLN D 36  ? 0.4543 0.4465 0.4984 0.0028  -0.0447 0.0135  13  GLN E CB  
4799 C CG  . GLN D 36  ? 0.4816 0.4600 0.5294 0.0027  -0.0395 0.0150  13  GLN E CG  
4800 C CD  . GLN D 36  ? 0.5145 0.4687 0.5392 0.0125  -0.0347 0.0093  13  GLN E CD  
4801 O OE1 . GLN D 36  ? 0.5272 0.4719 0.5302 0.0204  -0.0306 0.0076  13  GLN E OE1 
4802 N NE2 . GLN D 36  ? 0.5137 0.4549 0.5408 0.0123  -0.0334 0.0067  13  GLN E NE2 
4803 N N   . GLU D 37  ? 0.4099 0.4510 0.4880 -0.0142 -0.0484 0.0232  14  GLU E N   
4804 C CA  . GLU D 37  ? 0.4002 0.4557 0.4804 -0.0150 -0.0498 0.0225  14  GLU E CA  
4805 C C   . GLU D 37  ? 0.3966 0.4624 0.4897 -0.0177 -0.0570 0.0138  14  GLU E C   
4806 O O   . GLU D 37  ? 0.3899 0.4594 0.4998 -0.0257 -0.0571 0.0130  14  GLU E O   
4807 C CB  . GLU D 37  ? 0.3874 0.4516 0.4748 -0.0218 -0.0442 0.0316  14  GLU E CB  
4808 C CG  . GLU D 37  ? 0.4109 0.4698 0.4908 -0.0193 -0.0396 0.0386  14  GLU E CG  
4809 C CD  . GLU D 37  ? 0.4300 0.4930 0.5156 -0.0259 -0.0376 0.0471  14  GLU E CD  
4810 O OE1 . GLU D 37  ? 0.4850 0.5419 0.5726 -0.0256 -0.0370 0.0525  14  GLU E OE1 
4811 O OE2 . GLU D 37  ? 0.3954 0.4665 0.4832 -0.0309 -0.0368 0.0480  14  GLU E OE2 
4812 N N   . CYS D 38  ? 0.3980 0.4680 0.4850 -0.0107 -0.0629 0.0070  15  CYS E N   
4813 C CA  . CYS D 38  ? 0.4025 0.4858 0.5073 -0.0122 -0.0711 -0.0025 15  CYS E CA  
4814 C C   . CYS D 38  ? 0.3904 0.4900 0.5032 -0.0126 -0.0681 -0.0013 15  CYS E C   
4815 O O   . CYS D 38  ? 0.3981 0.4947 0.4943 -0.0041 -0.0688 -0.0008 15  CYS E O   
4816 C CB  . CYS D 38  ? 0.4182 0.4926 0.5104 -0.0016 -0.0841 -0.0135 15  CYS E CB  
4817 S SG  . CYS D 38  ? 0.4616 0.5153 0.5436 -0.0005 -0.0887 -0.0181 15  CYS E SG  
4818 N N   . TYR D 39  ? 0.3781 0.4922 0.5149 -0.0224 -0.0631 -0.0007 16  TYR E N   
4819 C CA  . TYR D 39  ? 0.3693 0.4987 0.5157 -0.0232 -0.0582 -0.0005 16  TYR E CA  
4820 C C   . TYR D 39  ? 0.3695 0.5151 0.5421 -0.0218 -0.0664 -0.0128 16  TYR E C   
4821 O O   . TYR D 39  ? 0.3752 0.5270 0.5725 -0.0294 -0.0681 -0.0183 16  TYR E O   
4822 C CB  . TYR D 39  ? 0.3632 0.4961 0.5176 -0.0344 -0.0448 0.0083  16  TYR E CB  
4823 C CG  . TYR D 39  ? 0.3666 0.4858 0.4994 -0.0357 -0.0391 0.0197  16  TYR E CG  
4824 C CD1 . TYR D 39  ? 0.3961 0.5026 0.5248 -0.0381 -0.0402 0.0235  16  TYR E CD1 
4825 C CD2 . TYR D 39  ? 0.3687 0.4874 0.4869 -0.0341 -0.0335 0.0258  16  TYR E CD2 
4826 C CE1 . TYR D 39  ? 0.4078 0.5034 0.5211 -0.0382 -0.0368 0.0331  16  TYR E CE1 
4827 C CE2 . TYR D 39  ? 0.3835 0.4910 0.4856 -0.0351 -0.0309 0.0349  16  TYR E CE2 
4828 C CZ  . TYR D 39  ? 0.4034 0.5004 0.5046 -0.0368 -0.0329 0.0385  16  TYR E CZ  
4829 O OH  . TYR D 39  ? 0.4299 0.5177 0.5201 -0.0369 -0.0320 0.0465  16  TYR E OH  
4830 N N   . ALA D 40  ? 0.3661 0.5190 0.5363 -0.0124 -0.0714 -0.0174 17  ALA E N   
4831 C CA  . ALA D 40  ? 0.3621 0.5337 0.5623 -0.0096 -0.0804 -0.0299 17  ALA E CA  
4832 C C   . ALA D 40  ? 0.3577 0.5474 0.5807 -0.0154 -0.0673 -0.0284 17  ALA E C   
4833 O O   . ALA D 40  ? 0.3509 0.5380 0.5564 -0.0121 -0.0591 -0.0217 17  ALA E O   
4834 C CB  . ALA D 40  ? 0.3629 0.5290 0.5461 0.0063  -0.0957 -0.0367 17  ALA E CB  
4835 N N   . PHE D 41  ? 0.3628 0.5696 0.6250 -0.0244 -0.0639 -0.0350 18  PHE E N   
4836 C CA  . PHE D 41  ? 0.3580 0.5778 0.6392 -0.0318 -0.0458 -0.0319 18  PHE E CA  
4837 C C   . PHE D 41  ? 0.3696 0.6160 0.7003 -0.0337 -0.0446 -0.0442 18  PHE E C   
4838 O O   . PHE D 41  ? 0.3811 0.6387 0.7183 -0.0235 -0.0486 -0.0495 18  PHE E O   
4839 C CB  . PHE D 41  ? 0.3474 0.5542 0.6137 -0.0441 -0.0277 -0.0185 18  PHE E CB  
4840 C CG  . PHE D 41  ? 0.3310 0.5438 0.6036 -0.0498 -0.0079 -0.0138 18  PHE E CG  
4841 C CD1 . PHE D 41  ? 0.3183 0.5362 0.5818 -0.0414 -0.0053 -0.0142 18  PHE E CD1 
4842 C CD2 . PHE D 41  ? 0.3208 0.5314 0.6061 -0.0631 0.0094  -0.0091 18  PHE E CD2 
4843 C CE1 . PHE D 41  ? 0.3062 0.5275 0.5730 -0.0460 0.0141  -0.0107 18  PHE E CE1 
4844 C CE2 . PHE D 41  ? 0.3250 0.5373 0.6112 -0.0676 0.0298  -0.0047 18  PHE E CE2 
4845 C CZ  . PHE D 41  ? 0.3066 0.5244 0.5831 -0.0590 0.0319  -0.0058 18  PHE E CZ  
4846 N N   . ASN D 42  ? 0.3697 0.6260 0.7372 -0.0463 -0.0374 -0.0488 19  ASN E N   
4847 C CA  . ASN D 42  ? 0.3728 0.6564 0.7934 -0.0464 -0.0405 -0.0634 19  ASN E CA  
4848 C C   . ASN D 42  ? 0.3754 0.6656 0.8200 -0.0443 -0.0637 -0.0776 19  ASN E C   
4849 O O   . ASN D 42  ? 0.3778 0.6692 0.8473 -0.0567 -0.0608 -0.0813 19  ASN E O   
4850 C CB  . ASN D 42  ? 0.3805 0.6777 0.8377 -0.0599 -0.0143 -0.0627 19  ASN E CB  
4851 C CG  . ASN D 42  ? 0.3988 0.6880 0.8693 -0.0767 -0.0015 -0.0592 19  ASN E CG  
4852 O OD1 . ASN D 42  ? 0.4628 0.7286 0.8965 -0.0802 0.0002  -0.0480 19  ASN E OD1 
4853 N ND2 . ASN D 42  ? 0.4059 0.7138 0.9308 -0.0874 0.0091  -0.0685 19  ASN E ND2 
4854 N N   . GLY D 43  ? 0.3763 0.6666 0.8078 -0.0280 -0.0870 -0.0851 20  GLY E N   
4855 C CA  . GLY D 43  ? 0.3907 0.6842 0.8375 -0.0222 -0.1138 -0.1001 20  GLY E CA  
4856 C C   . GLY D 43  ? 0.3946 0.6672 0.8208 -0.0290 -0.1182 -0.0976 20  GLY E C   
4857 O O   . GLY D 43  ? 0.4016 0.6759 0.8451 -0.0284 -0.1372 -0.1108 20  GLY E O   
4858 N N   . THR D 44  ? 0.3914 0.6438 0.7810 -0.0347 -0.1015 -0.0813 21  THR E N   
4859 C CA  . THR D 44  ? 0.4032 0.6357 0.7758 -0.0422 -0.1010 -0.0770 21  THR E CA  
4860 C C   . THR D 44  ? 0.3983 0.6043 0.7161 -0.0378 -0.0952 -0.0617 21  THR E C   
4861 O O   . THR D 44  ? 0.3881 0.5901 0.6797 -0.0308 -0.0892 -0.0529 21  THR E O   
4862 C CB  . THR D 44  ? 0.4082 0.6461 0.8142 -0.0613 -0.0822 -0.0746 21  THR E CB  
4863 O OG1 . THR D 44  ? 0.4323 0.6540 0.8332 -0.0672 -0.0883 -0.0765 21  THR E OG1 
4864 C CG2 . THR D 44  ? 0.3874 0.6175 0.7743 -0.0686 -0.0555 -0.0567 21  THR E CG2 
4865 N N   . GLN D 45  ? 0.4006 0.5889 0.7051 -0.0425 -0.0967 -0.0594 22  GLN E N   
4866 C CA  . GLN D 45  ? 0.4015 0.5663 0.6615 -0.0376 -0.0936 -0.0478 22  GLN E CA  
4867 C C   . GLN D 45  ? 0.3908 0.5442 0.6479 -0.0500 -0.0776 -0.0363 22  GLN E C   
4868 O O   . GLN D 45  ? 0.3958 0.5488 0.6758 -0.0603 -0.0759 -0.0402 22  GLN E O   
4869 C CB  . GLN D 45  ? 0.4139 0.5628 0.6516 -0.0266 -0.1125 -0.0562 22  GLN E CB  
4870 C CG  . GLN D 45  ? 0.4418 0.5722 0.6345 -0.0147 -0.1119 -0.0479 22  GLN E CG  
4871 C CD  . GLN D 45  ? 0.4455 0.5821 0.6278 -0.0024 -0.1178 -0.0499 22  GLN E CD  
4872 O OE1 . GLN D 45  ? 0.4896 0.6163 0.6437 0.0034  -0.1102 -0.0404 22  GLN E OE1 
4873 N NE2 . GLN D 45  ? 0.4301 0.5824 0.6365 0.0020  -0.1316 -0.0627 22  GLN E NE2 
4874 N N   . ARG D 46  ? 0.3773 0.5206 0.6071 -0.0488 -0.0666 -0.0223 23  ARG E N   
4875 C CA  . ARG D 46  ? 0.3767 0.5067 0.5986 -0.0577 -0.0541 -0.0105 23  ARG E CA  
4876 C C   . ARG D 46  ? 0.3770 0.4881 0.5654 -0.0500 -0.0569 -0.0034 23  ARG E C   
4877 O O   . ARG D 46  ? 0.3656 0.4752 0.5332 -0.0411 -0.0585 -0.0004 23  ARG E O   
4878 C CB  . ARG D 46  ? 0.3725 0.5083 0.5958 -0.0641 -0.0378 -0.0005 23  ARG E CB  
4879 C CG  . ARG D 46  ? 0.3701 0.4903 0.5828 -0.0720 -0.0262 0.0119  23  ARG E CG  
4880 C CD  . ARG D 46  ? 0.3967 0.5182 0.6023 -0.0762 -0.0115 0.0214  23  ARG E CD  
4881 N NE  . ARG D 46  ? 0.4230 0.5246 0.6061 -0.0791 -0.0052 0.0347  23  ARG E NE  
4882 C CZ  . ARG D 46  ? 0.4114 0.5050 0.5784 -0.0823 0.0063  0.0452  23  ARG E CZ  
4883 N NH1 . ARG D 46  ? 0.3902 0.4936 0.5609 -0.0842 0.0160  0.0443  23  ARG E NH1 
4884 N NH2 . ARG D 46  ? 0.3829 0.4568 0.5287 -0.0828 0.0076  0.0563  23  ARG E NH2 
4885 N N   . PHE D 47  ? 0.3867 0.4828 0.5723 -0.0538 -0.0563 -0.0010 24  PHE E N   
4886 C CA  . PHE D 47  ? 0.3903 0.4686 0.5508 -0.0466 -0.0586 0.0034  24  PHE E CA  
4887 C C   . PHE D 47  ? 0.3957 0.4628 0.5467 -0.0503 -0.0487 0.0173  24  PHE E C   
4888 O O   . PHE D 47  ? 0.4018 0.4636 0.5634 -0.0590 -0.0430 0.0214  24  PHE E O   
4889 C CB  . PHE D 47  ? 0.3933 0.4603 0.5550 -0.0444 -0.0684 -0.0071 24  PHE E CB  
4890 C CG  . PHE D 47  ? 0.4066 0.4536 0.5447 -0.0374 -0.0679 -0.0033 24  PHE E CG  
4891 C CD1 . PHE D 47  ? 0.3962 0.4378 0.5106 -0.0266 -0.0683 -0.0015 24  PHE E CD1 
4892 C CD2 . PHE D 47  ? 0.4316 0.4638 0.5723 -0.0415 -0.0654 -0.0017 24  PHE E CD2 
4893 C CE1 . PHE D 47  ? 0.4127 0.4361 0.5089 -0.0203 -0.0648 0.0016  24  PHE E CE1 
4894 C CE2 . PHE D 47  ? 0.4137 0.4279 0.5356 -0.0342 -0.0633 0.0013  24  PHE E CE2 
4895 C CZ  . PHE D 47  ? 0.4124 0.4229 0.5131 -0.0238 -0.0624 0.0028  24  PHE E CZ  
4896 N N   . LEU D 48  ? 0.3957 0.4581 0.5277 -0.0434 -0.0471 0.0242  25  LEU E N   
4897 C CA  . LEU D 48  ? 0.4060 0.4569 0.5304 -0.0440 -0.0421 0.0352  25  LEU E CA  
4898 C C   . LEU D 48  ? 0.4182 0.4571 0.5310 -0.0356 -0.0439 0.0350  25  LEU E C   
4899 O O   . LEU D 48  ? 0.4110 0.4508 0.5127 -0.0280 -0.0451 0.0321  25  LEU E O   
4900 C CB  . LEU D 48  ? 0.3913 0.4469 0.5091 -0.0457 -0.0371 0.0451  25  LEU E CB  
4901 C CG  . LEU D 48  ? 0.4177 0.4786 0.5427 -0.0546 -0.0308 0.0484  25  LEU E CG  
4902 C CD1 . LEU D 48  ? 0.4109 0.4879 0.5414 -0.0545 -0.0302 0.0419  25  LEU E CD1 
4903 C CD2 . LEU D 48  ? 0.4195 0.4733 0.5314 -0.0560 -0.0267 0.0602  25  LEU E CD2 
4904 N N   . GLU D 49  ? 0.4311 0.4571 0.5469 -0.0367 -0.0425 0.0383  26  GLU E N   
4905 C CA  . GLU D 49  ? 0.4398 0.4541 0.5488 -0.0293 -0.0412 0.0396  26  GLU E CA  
4906 C C   . GLU D 49  ? 0.4356 0.4478 0.5482 -0.0299 -0.0385 0.0509  26  GLU E C   
4907 O O   . GLU D 49  ? 0.4504 0.4577 0.5682 -0.0355 -0.0381 0.0564  26  GLU E O   
4908 C CB  . GLU D 49  ? 0.4515 0.4508 0.5611 -0.0280 -0.0428 0.0326  26  GLU E CB  
4909 C CG  . GLU D 49  ? 0.4827 0.4691 0.5824 -0.0185 -0.0391 0.0314  26  GLU E CG  
4910 C CD  . GLU D 49  ? 0.5375 0.5069 0.6294 -0.0150 -0.0409 0.0215  26  GLU E CD  
4911 O OE1 . GLU D 49  ? 0.5404 0.4990 0.6399 -0.0180 -0.0405 0.0217  26  GLU E OE1 
4912 O OE2 . GLU D 49  ? 0.5576 0.5214 0.6326 -0.0084 -0.0426 0.0136  26  GLU E OE2 
4913 N N   . ARG D 50  ? 0.4208 0.4351 0.5309 -0.0241 -0.0370 0.0541  27  ARG E N   
4914 C CA  . ARG D 50  ? 0.4087 0.4226 0.5246 -0.0235 -0.0378 0.0636  27  ARG E CA  
4915 C C   . ARG D 50  ? 0.4109 0.4176 0.5348 -0.0163 -0.0353 0.0638  27  ARG E C   
4916 O O   . ARG D 50  ? 0.4145 0.4205 0.5366 -0.0112 -0.0305 0.0587  27  ARG E O   
4917 C CB  . ARG D 50  ? 0.3872 0.4130 0.4993 -0.0245 -0.0395 0.0672  27  ARG E CB  
4918 C CG  . ARG D 50  ? 0.3773 0.4119 0.4817 -0.0289 -0.0390 0.0636  27  ARG E CG  
4919 C CD  . ARG D 50  ? 0.3567 0.4003 0.4554 -0.0294 -0.0399 0.0666  27  ARG E CD  
4920 N NE  . ARG D 50  ? 0.3741 0.4172 0.4672 -0.0352 -0.0407 0.0727  27  ARG E NE  
4921 C CZ  . ARG D 50  ? 0.3392 0.3891 0.4258 -0.0392 -0.0380 0.0715  27  ARG E CZ  
4922 N NH1 . ARG D 50  ? 0.2760 0.3353 0.3628 -0.0374 -0.0366 0.0644  27  ARG E NH1 
4923 N NH2 . ARG D 50  ? 0.3664 0.4117 0.4449 -0.0442 -0.0360 0.0777  27  ARG E NH2 
4924 N N   . TYR D 51  ? 0.4147 0.4142 0.5472 -0.0154 -0.0376 0.0699  28  TYR E N   
4925 C CA  . TYR D 51  ? 0.4081 0.4027 0.5539 -0.0081 -0.0351 0.0704  28  TYR E CA  
4926 C C   . TYR D 51  ? 0.4014 0.4044 0.5582 -0.0061 -0.0416 0.0775  28  TYR E C   
4927 O O   . TYR D 51  ? 0.4060 0.4064 0.5586 -0.0085 -0.0492 0.0847  28  TYR E O   
4928 C CB  . TYR D 51  ? 0.4264 0.4047 0.5756 -0.0065 -0.0338 0.0703  28  TYR E CB  
4929 C CG  . TYR D 51  ? 0.4196 0.3885 0.5585 -0.0075 -0.0291 0.0609  28  TYR E CG  
4930 C CD1 . TYR D 51  ? 0.4398 0.4082 0.5700 -0.0151 -0.0321 0.0580  28  TYR E CD1 
4931 C CD2 . TYR D 51  ? 0.3996 0.3588 0.5375 -0.0006 -0.0218 0.0543  28  TYR E CD2 
4932 C CE1 . TYR D 51  ? 0.4270 0.3875 0.5493 -0.0157 -0.0314 0.0478  28  TYR E CE1 
4933 C CE2 . TYR D 51  ? 0.4329 0.3804 0.5563 -0.0005 -0.0199 0.0448  28  TYR E CE2 
4934 C CZ  . TYR D 51  ? 0.4359 0.3849 0.5523 -0.0080 -0.0265 0.0412  28  TYR E CZ  
4935 O OH  . TYR D 51  ? 0.4403 0.3787 0.5445 -0.0078 -0.0282 0.0303  28  TYR E OH  
4936 N N   . ILE D 52  ? 0.3881 0.3992 0.5577 -0.0018 -0.0384 0.0749  29  ILE E N   
4937 C CA  . ILE D 52  ? 0.3805 0.4029 0.5625 -0.0007 -0.0460 0.0786  29  ILE E CA  
4938 C C   . ILE D 52  ? 0.3853 0.4111 0.5959 0.0061  -0.0433 0.0770  29  ILE E C   
4939 O O   . ILE D 52  ? 0.3865 0.4111 0.6043 0.0087  -0.0305 0.0712  29  ILE E O   
4940 C CB  . ILE D 52  ? 0.3701 0.4032 0.5433 -0.0045 -0.0445 0.0756  29  ILE E CB  
4941 C CG1 . ILE D 52  ? 0.3628 0.3947 0.5117 -0.0106 -0.0450 0.0756  29  ILE E CG1 
4942 C CG2 . ILE D 52  ? 0.3849 0.4285 0.5701 -0.0043 -0.0543 0.0782  29  ILE E CG2 
4943 C CD1 . ILE D 52  ? 0.3275 0.3641 0.4664 -0.0117 -0.0382 0.0696  29  ILE E CD1 
4944 N N   . TYR D 53  ? 0.3920 0.4211 0.6187 0.0094  -0.0552 0.0819  30  TYR E N   
4945 C CA  . TYR D 53  ? 0.3969 0.4324 0.6583 0.0162  -0.0553 0.0801  30  TYR E CA  
4946 C C   . TYR D 53  ? 0.3945 0.4447 0.6686 0.0152  -0.0671 0.0801  30  TYR E C   
4947 O O   . TYR D 53  ? 0.4021 0.4505 0.6609 0.0139  -0.0822 0.0854  30  TYR E O   
4948 C CB  . TYR D 53  ? 0.4126 0.4385 0.6841 0.0228  -0.0632 0.0851  30  TYR E CB  
4949 C CG  . TYR D 53  ? 0.4223 0.4578 0.7357 0.0310  -0.0657 0.0830  30  TYR E CG  
4950 C CD1 . TYR D 53  ? 0.4216 0.4588 0.7586 0.0346  -0.0482 0.0765  30  TYR E CD1 
4951 C CD2 . TYR D 53  ? 0.4388 0.4810 0.7686 0.0357  -0.0854 0.0867  30  TYR E CD2 
4952 C CE1 . TYR D 53  ? 0.4382 0.4862 0.8200 0.0418  -0.0482 0.0736  30  TYR E CE1 
4953 C CE2 . TYR D 53  ? 0.4492 0.5035 0.8251 0.0438  -0.0894 0.0833  30  TYR E CE2 
4954 C CZ  . TYR D 53  ? 0.4486 0.5071 0.8532 0.0463  -0.0696 0.0765  30  TYR E CZ  
4955 O OH  . TYR D 53  ? 0.4082 0.4803 0.8636 0.0538  -0.0706 0.0723  30  TYR E OH  
4956 N N   . ASN D 54  ? 0.3871 0.4495 0.6887 0.0158  -0.0598 0.0740  31  ASN E N   
4957 C CA  . ASN D 54  ? 0.3880 0.4641 0.6990 0.0120  -0.0672 0.0712  31  ASN E CA  
4958 C C   . ASN D 54  ? 0.3948 0.4694 0.6747 0.0074  -0.0822 0.0753  31  ASN E C   
4959 O O   . ASN D 54  ? 0.4206 0.4942 0.7006 0.0106  -0.1010 0.0795  31  ASN E O   
4960 C CB  . ASN D 54  ? 0.3878 0.4778 0.7434 0.0168  -0.0784 0.0685  31  ASN E CB  
4961 C CG  . ASN D 54  ? 0.4041 0.4949 0.7950 0.0240  -0.0693 0.0665  31  ASN E CG  
4962 O OD1 . ASN D 54  ? 0.4015 0.4927 0.8072 0.0238  -0.0483 0.0615  31  ASN E OD1 
4963 N ND2 . ASN D 54  ? 0.4134 0.5033 0.8185 0.0315  -0.0853 0.0703  31  ASN E ND2 
4964 N N   . ARG D 55  ? 0.3727 0.4456 0.6255 0.0011  -0.0750 0.0741  32  ARG E N   
4965 C CA  . ARG D 55  ? 0.3763 0.4470 0.6003 -0.0029 -0.0871 0.0775  32  ARG E CA  
4966 C C   . ARG D 55  ? 0.4002 0.4577 0.5993 -0.0019 -0.0958 0.0855  32  ARG E C   
4967 O O   . ARG D 55  ? 0.4166 0.4687 0.5878 -0.0054 -0.1015 0.0888  32  ARG E O   
4968 C CB  . ARG D 55  ? 0.3731 0.4529 0.6121 -0.0024 -0.1028 0.0752  32  ARG E CB  
4969 C CG  . ARG D 55  ? 0.3589 0.4501 0.6183 -0.0058 -0.0953 0.0675  32  ARG E CG  
4970 C CD  . ARG D 55  ? 0.3841 0.4732 0.6142 -0.0114 -0.0954 0.0666  32  ARG E CD  
4971 N NE  . ARG D 55  ? 0.4213 0.5168 0.6610 -0.0126 -0.1109 0.0629  32  ARG E NE  
4972 C CZ  . ARG D 55  ? 0.4427 0.5347 0.6558 -0.0164 -0.1171 0.0620  32  ARG E CZ  
4973 N NH1 . ARG D 55  ? 0.4237 0.5073 0.6011 -0.0192 -0.1084 0.0653  32  ARG E NH1 
4974 N NH2 . ARG D 55  ? 0.4395 0.5366 0.6644 -0.0171 -0.1325 0.0569  32  ARG E NH2 
4975 N N   . GLU D 56  ? 0.4079 0.4581 0.6165 0.0029  -0.0956 0.0888  33  GLU E N   
4976 C CA  . GLU D 56  ? 0.4380 0.4726 0.6230 0.0034  -0.1014 0.0967  33  GLU E CA  
4977 C C   . GLU D 56  ? 0.4392 0.4653 0.6124 -0.0001 -0.0868 0.0967  33  GLU E C   
4978 O O   . GLU D 56  ? 0.4405 0.4629 0.6289 0.0036  -0.0803 0.0951  33  GLU E O   
4979 C CB  . GLU D 56  ? 0.4546 0.4827 0.6545 0.0120  -0.1147 0.1015  33  GLU E CB  
4980 C CG  . GLU D 56  ? 0.5060 0.5143 0.6733 0.0124  -0.1230 0.1110  33  GLU E CG  
4981 C CD  . GLU D 56  ? 0.5705 0.5676 0.7465 0.0222  -0.1368 0.1169  33  GLU E CD  
4982 O OE1 . GLU D 56  ? 0.6118 0.6187 0.8125 0.0292  -0.1515 0.1144  33  GLU E OE1 
4983 O OE2 . GLU D 56  ? 0.5870 0.5648 0.7462 0.0230  -0.1335 0.1238  33  GLU E OE2 
4984 N N   . GLU D 57  ? 0.4400 0.4632 0.5876 -0.0069 -0.0820 0.0974  34  GLU E N   
4985 C CA  . GLU D 57  ? 0.4441 0.4596 0.5814 -0.0109 -0.0713 0.0966  34  GLU E CA  
4986 C C   . GLU D 57  ? 0.4598 0.4579 0.5881 -0.0101 -0.0752 0.1045  34  GLU E C   
4987 O O   . GLU D 57  ? 0.4823 0.4718 0.5923 -0.0110 -0.0821 0.1115  34  GLU E O   
4988 C CB  . GLU D 57  ? 0.4420 0.4621 0.5606 -0.0181 -0.0659 0.0943  34  GLU E CB  
4989 C CG  . GLU D 57  ? 0.4661 0.4796 0.5764 -0.0233 -0.0575 0.0929  34  GLU E CG  
4990 C CD  . GLU D 57  ? 0.4818 0.4998 0.5764 -0.0298 -0.0539 0.0923  34  GLU E CD  
4991 O OE1 . GLU D 57  ? 0.4867 0.5077 0.5813 -0.0340 -0.0472 0.0871  34  GLU E OE1 
4992 O OE2 . GLU D 57  ? 0.5179 0.5364 0.6007 -0.0302 -0.0586 0.0964  34  GLU E OE2 
4993 N N   . PHE D 58  ? 0.4555 0.4453 0.5939 -0.0079 -0.0703 0.1036  35  PHE E N   
4994 C CA  . PHE D 58  ? 0.4720 0.4428 0.6049 -0.0054 -0.0745 0.1116  35  PHE E CA  
4995 C C   . PHE D 58  ? 0.4743 0.4315 0.5972 -0.0119 -0.0651 0.1117  35  PHE E C   
4996 O O   . PHE D 58  ? 0.5014 0.4398 0.6132 -0.0121 -0.0667 0.1197  35  PHE E O   
4997 C CB  . PHE D 58  ? 0.4730 0.4416 0.6292 0.0045  -0.0796 0.1120  35  PHE E CB  
4998 C CG  . PHE D 58  ? 0.4498 0.4217 0.6239 0.0062  -0.0687 0.1036  35  PHE E CG  
4999 C CD1 . PHE D 58  ? 0.4301 0.3857 0.6037 0.0067  -0.0626 0.1033  35  PHE E CD1 
5000 C CD2 . PHE D 58  ? 0.4125 0.4005 0.6014 0.0076  -0.0635 0.0960  35  PHE E CD2 
5001 C CE1 . PHE D 58  ? 0.4047 0.3596 0.5899 0.0092  -0.0525 0.0949  35  PHE E CE1 
5002 C CE2 . PHE D 58  ? 0.4102 0.3964 0.6096 0.0102  -0.0517 0.0886  35  PHE E CE2 
5003 C CZ  . PHE D 58  ? 0.4139 0.3833 0.6102 0.0113  -0.0468 0.0878  35  PHE E CZ  
5004 N N   . VAL D 59  ? 0.4514 0.4164 0.5782 -0.0166 -0.0562 0.1027  36  VAL E N   
5005 C CA  . VAL D 59  ? 0.4573 0.4138 0.5782 -0.0245 -0.0485 0.0999  36  VAL E CA  
5006 C C   . VAL D 59  ? 0.4421 0.4132 0.5624 -0.0299 -0.0435 0.0902  36  VAL E C   
5007 O O   . VAL D 59  ? 0.4249 0.4087 0.5488 -0.0262 -0.0439 0.0850  36  VAL E O   
5008 C CB  . VAL D 59  ? 0.4674 0.4074 0.5969 -0.0220 -0.0457 0.0983  36  VAL E CB  
5009 C CG1 . VAL D 59  ? 0.4530 0.3986 0.5948 -0.0164 -0.0427 0.0886  36  VAL E CG1 
5010 C CG2 . VAL D 59  ? 0.4767 0.4055 0.6013 -0.0316 -0.0395 0.0966  36  VAL E CG2 
5011 N N   . ARG D 60  ? 0.4584 0.4268 0.5758 -0.0382 -0.0386 0.0874  37  ARG E N   
5012 C CA  . ARG D 60  ? 0.4615 0.4450 0.5782 -0.0431 -0.0362 0.0799  37  ARG E CA  
5013 C C   . ARG D 60  ? 0.4716 0.4518 0.5951 -0.0515 -0.0319 0.0736  37  ARG E C   
5014 O O   . ARG D 60  ? 0.5042 0.4715 0.6277 -0.0577 -0.0275 0.0791  37  ARG E O   
5015 C CB  . ARG D 60  ? 0.4634 0.4553 0.5694 -0.0454 -0.0363 0.0858  37  ARG E CB  
5016 C CG  . ARG D 60  ? 0.4631 0.4694 0.5695 -0.0509 -0.0324 0.0793  37  ARG E CG  
5017 C CD  . ARG D 60  ? 0.4831 0.4893 0.5774 -0.0556 -0.0283 0.0864  37  ARG E CD  
5018 N NE  . ARG D 60  ? 0.5141 0.5226 0.5959 -0.0500 -0.0339 0.0916  37  ARG E NE  
5019 C CZ  . ARG D 60  ? 0.5209 0.5204 0.5850 -0.0507 -0.0341 0.1003  37  ARG E CZ  
5020 N NH1 . ARG D 60  ? 0.5349 0.5207 0.5894 -0.0569 -0.0263 0.1061  37  ARG E NH1 
5021 N NH2 . ARG D 60  ? 0.4778 0.4799 0.5326 -0.0454 -0.0419 0.1028  37  ARG E NH2 
5022 N N   . PHE D 61  ? 0.4518 0.4416 0.5811 -0.0515 -0.0334 0.0619  38  PHE E N   
5023 C CA  . PHE D 61  ? 0.4539 0.4462 0.5943 -0.0598 -0.0318 0.0537  38  PHE E CA  
5024 C C   . PHE D 61  ? 0.4403 0.4515 0.5834 -0.0632 -0.0307 0.0504  38  PHE E C   
5025 O O   . PHE D 61  ? 0.4293 0.4518 0.5665 -0.0569 -0.0347 0.0467  38  PHE E O   
5026 C CB  . PHE D 61  ? 0.4535 0.4422 0.5987 -0.0569 -0.0371 0.0409  38  PHE E CB  
5027 C CG  . PHE D 61  ? 0.4546 0.4470 0.6159 -0.0656 -0.0383 0.0305  38  PHE E CG  
5028 C CD1 . PHE D 61  ? 0.4600 0.4386 0.6328 -0.0740 -0.0344 0.0306  38  PHE E CD1 
5029 C CD2 . PHE D 61  ? 0.4532 0.4626 0.6208 -0.0655 -0.0437 0.0203  38  PHE E CD2 
5030 C CE1 . PHE D 61  ? 0.4449 0.4281 0.6384 -0.0833 -0.0354 0.0198  38  PHE E CE1 
5031 C CE2 . PHE D 61  ? 0.4556 0.4711 0.6447 -0.0736 -0.0465 0.0092  38  PHE E CE2 
5032 C CZ  . PHE D 61  ? 0.4448 0.4479 0.6485 -0.0832 -0.0421 0.0086  38  PHE E CZ  
5033 N N   . ASP D 62  ? 0.4426 0.4556 0.5950 -0.0729 -0.0239 0.0519  39  ASP E N   
5034 C CA  . ASP D 62  ? 0.4379 0.4687 0.5972 -0.0763 -0.0211 0.0480  39  ASP E CA  
5035 C C   . ASP D 62  ? 0.4482 0.4844 0.6330 -0.0854 -0.0190 0.0378  39  ASP E C   
5036 O O   . ASP D 62  ? 0.4659 0.4904 0.6599 -0.0944 -0.0110 0.0410  39  ASP E O   
5037 C CB  . ASP D 62  ? 0.4421 0.4707 0.5884 -0.0790 -0.0123 0.0599  39  ASP E CB  
5038 C CG  . ASP D 62  ? 0.4501 0.4958 0.6038 -0.0825 -0.0068 0.0560  39  ASP E CG  
5039 O OD1 . ASP D 62  ? 0.4501 0.5097 0.6262 -0.0855 -0.0083 0.0445  39  ASP E OD1 
5040 O OD2 . ASP D 62  ? 0.4575 0.5022 0.5949 -0.0817 -0.0017 0.0639  39  ASP E OD2 
5041 N N   . SER D 63  ? 0.4389 0.4919 0.6361 -0.0829 -0.0268 0.0252  40  SER E N   
5042 C CA  . SER D 63  ? 0.4495 0.5095 0.6753 -0.0902 -0.0292 0.0125  40  SER E CA  
5043 C C   . SER D 63  ? 0.4601 0.5280 0.7073 -0.1021 -0.0151 0.0146  40  SER E C   
5044 O O   . SER D 63  ? 0.4659 0.5329 0.7392 -0.1122 -0.0113 0.0082  40  SER E O   
5045 C CB  . SER D 63  ? 0.4361 0.5093 0.6676 -0.0824 -0.0446 -0.0024 40  SER E CB  
5046 O OG  . SER D 63  ? 0.4304 0.5251 0.6775 -0.0827 -0.0445 -0.0077 40  SER E OG  
5047 N N   . ASP D 64  ? 0.4616 0.5347 0.6969 -0.1014 -0.0058 0.0237  41  ASP E N   
5048 C CA  . ASP D 64  ? 0.4814 0.5537 0.7273 -0.1123 0.0126  0.0296  41  ASP E CA  
5049 C C   . ASP D 64  ? 0.4991 0.5452 0.7348 -0.1195 0.0236  0.0410  41  ASP E C   
5050 O O   . ASP D 64  ? 0.5118 0.5534 0.7672 -0.1311 0.0373  0.0405  41  ASP E O   
5051 C CB  . ASP D 64  ? 0.4824 0.5613 0.7110 -0.1088 0.0204  0.0370  41  ASP E CB  
5052 C CG  . ASP D 64  ? 0.4974 0.6030 0.7494 -0.1070 0.0184  0.0252  41  ASP E CG  
5053 O OD1 . ASP D 64  ? 0.4975 0.6091 0.7454 -0.1078 0.0300  0.0291  41  ASP E OD1 
5054 O OD2 . ASP D 64  ? 0.5309 0.6500 0.8042 -0.1040 0.0045  0.0117  41  ASP E OD2 
5055 N N   . VAL D 65  ? 0.4994 0.5274 0.7061 -0.1123 0.0180  0.0508  42  VAL E N   
5056 C CA  . VAL D 65  ? 0.5257 0.5261 0.7212 -0.1169 0.0257  0.0615  42  VAL E CA  
5057 C C   . VAL D 65  ? 0.5322 0.5248 0.7499 -0.1227 0.0228  0.0529  42  VAL E C   
5058 O O   . VAL D 65  ? 0.5559 0.5291 0.7775 -0.1316 0.0345  0.0583  42  VAL E O   
5059 C CB  . VAL D 65  ? 0.5315 0.5152 0.6928 -0.1065 0.0194  0.0744  42  VAL E CB  
5060 C CG1 . VAL D 65  ? 0.5530 0.5080 0.7063 -0.1086 0.0228  0.0829  42  VAL E CG1 
5061 C CG2 . VAL D 65  ? 0.5367 0.5185 0.6734 -0.1041 0.0255  0.0849  42  VAL E CG2 
5062 N N   . GLY D 66  ? 0.5140 0.5185 0.7431 -0.1174 0.0076  0.0397  43  GLY E N   
5063 C CA  . GLY D 66  ? 0.5157 0.5126 0.7650 -0.1226 0.0028  0.0291  43  GLY E CA  
5064 C C   . GLY D 66  ? 0.5289 0.5032 0.7601 -0.1161 -0.0032 0.0331  43  GLY E C   
5065 O O   . GLY D 66  ? 0.5304 0.4996 0.7718 -0.1161 -0.0116 0.0219  43  GLY E O   
5066 N N   . GLU D 67  ? 0.5398 0.5000 0.7446 -0.1097 0.0001  0.0484  44  GLU E N   
5067 C CA  . GLU D 67  ? 0.5566 0.4953 0.7474 -0.1028 -0.0042 0.0533  44  GLU E CA  
5068 C C   . GLU D 67  ? 0.5435 0.4809 0.7097 -0.0912 -0.0077 0.0651  44  GLU E C   
5069 O O   . GLU D 67  ? 0.5389 0.4896 0.6970 -0.0897 -0.0065 0.0694  44  GLU E O   
5070 C CB  . GLU D 67  ? 0.5904 0.5026 0.7846 -0.1114 0.0062  0.0598  44  GLU E CB  
5071 C CG  . GLU D 67  ? 0.6313 0.5350 0.8201 -0.1200 0.0219  0.0720  44  GLU E CG  
5072 C CD  . GLU D 67  ? 0.7055 0.5751 0.8846 -0.1239 0.0318  0.0834  44  GLU E CD  
5073 O OE1 . GLU D 67  ? 0.7255 0.5785 0.8767 -0.1168 0.0333  0.0988  44  GLU E OE1 
5074 O OE2 . GLU D 67  ? 0.7367 0.5947 0.9354 -0.1335 0.0371  0.0767  44  GLU E OE2 
5075 N N   . PHE D 68  ? 0.5454 0.4670 0.7020 -0.0829 -0.0121 0.0694  45  PHE E N   
5076 C CA  . PHE D 68  ? 0.5346 0.4571 0.6747 -0.0716 -0.0171 0.0786  45  PHE E CA  
5077 C C   . PHE D 68  ? 0.5568 0.4674 0.6805 -0.0716 -0.0130 0.0941  45  PHE E C   
5078 O O   . PHE D 68  ? 0.5854 0.4776 0.7058 -0.0787 -0.0046 0.1006  45  PHE E O   
5079 C CB  . PHE D 68  ? 0.5381 0.4485 0.6780 -0.0623 -0.0222 0.0773  45  PHE E CB  
5080 C CG  . PHE D 68  ? 0.5050 0.4248 0.6512 -0.0583 -0.0270 0.0634  45  PHE E CG  
5081 C CD1 . PHE D 68  ? 0.4760 0.4090 0.6168 -0.0492 -0.0311 0.0615  45  PHE E CD1 
5082 C CD2 . PHE D 68  ? 0.5029 0.4162 0.6586 -0.0637 -0.0273 0.0517  45  PHE E CD2 
5083 C CE1 . PHE D 68  ? 0.4623 0.3990 0.6024 -0.0446 -0.0341 0.0495  45  PHE E CE1 
5084 C CE2 . PHE D 68  ? 0.5074 0.4252 0.6623 -0.0586 -0.0330 0.0386  45  PHE E CE2 
5085 C CZ  . PHE D 68  ? 0.4747 0.4030 0.6195 -0.0486 -0.0357 0.0381  45  PHE E CZ  
5086 N N   . ARG D 69  ? 0.5540 0.4729 0.6659 -0.0632 -0.0193 0.0997  46  ARG E N   
5087 C CA  . ARG D 69  ? 0.5761 0.4831 0.6676 -0.0608 -0.0193 0.1135  46  ARG E CA  
5088 C C   . ARG D 69  ? 0.5798 0.4916 0.6667 -0.0485 -0.0311 0.1171  46  ARG E C   
5089 O O   . ARG D 69  ? 0.5615 0.4939 0.6537 -0.0451 -0.0356 0.1111  46  ARG E O   
5090 C CB  . ARG D 69  ? 0.5682 0.4851 0.6504 -0.0674 -0.0129 0.1148  46  ARG E CB  
5091 C CG  . ARG D 69  ? 0.5754 0.4884 0.6660 -0.0802 0.0008  0.1120  46  ARG E CG  
5092 C CD  . ARG D 69  ? 0.5955 0.4783 0.6700 -0.0842 0.0103  0.1243  46  ARG E CD  
5093 N NE  . ARG D 69  ? 0.6337 0.5142 0.7142 -0.0973 0.0271  0.1232  46  ARG E NE  
5094 C CZ  . ARG D 69  ? 0.6486 0.5169 0.7454 -0.1074 0.0378  0.1206  46  ARG E CZ  
5095 N NH1 . ARG D 69  ? 0.6459 0.5014 0.7513 -0.1055 0.0327  0.1187  46  ARG E NH1 
5096 N NH2 . ARG D 69  ? 0.6330 0.5019 0.7398 -0.1197 0.0546  0.1190  46  ARG E NH2 
5097 N N   . ALA D 70  ? 0.6116 0.5038 0.6906 -0.0417 -0.0361 0.1266  47  ALA E N   
5098 C CA  . ALA D 70  ? 0.6108 0.5070 0.6874 -0.0302 -0.0487 0.1310  47  ALA E CA  
5099 C C   . ALA D 70  ? 0.6140 0.5168 0.6718 -0.0308 -0.0522 0.1354  47  ALA E C   
5100 O O   . ALA D 70  ? 0.6361 0.5231 0.6713 -0.0357 -0.0468 0.1431  47  ALA E O   
5101 C CB  . ALA D 70  ? 0.6346 0.5061 0.7054 -0.0221 -0.0547 0.1410  47  ALA E CB  
5102 N N   . VAL D 71  ? 0.5953 0.5188 0.6613 -0.0261 -0.0599 0.1304  48  VAL E N   
5103 C CA  . VAL D 71  ? 0.6008 0.5297 0.6494 -0.0256 -0.0654 0.1333  48  VAL E CA  
5104 C C   . VAL D 71  ? 0.6256 0.5425 0.6644 -0.0154 -0.0808 0.1414  48  VAL E C   
5105 O O   . VAL D 71  ? 0.6593 0.5609 0.6695 -0.0147 -0.0848 0.1493  48  VAL E O   
5106 C CB  . VAL D 71  ? 0.5722 0.5279 0.6338 -0.0269 -0.0650 0.1231  48  VAL E CB  
5107 C CG1 . VAL D 71  ? 0.5632 0.5233 0.6072 -0.0262 -0.0712 0.1251  48  VAL E CG1 
5108 C CG2 . VAL D 71  ? 0.5600 0.5247 0.6278 -0.0357 -0.0520 0.1155  48  VAL E CG2 
5109 N N   . THR D 72  ? 0.6209 0.5432 0.6831 -0.0069 -0.0895 0.1392  49  THR E N   
5110 C CA  . THR D 72  ? 0.6399 0.5514 0.7002 0.0042  -0.1062 0.1460  49  THR E CA  
5111 C C   . THR D 72  ? 0.6599 0.5475 0.7177 0.0073  -0.1034 0.1528  49  THR E C   
5112 O O   . THR D 72  ? 0.6590 0.5436 0.7228 0.0005  -0.0894 0.1498  49  THR E O   
5113 C CB  . THR D 72  ? 0.6162 0.5494 0.7123 0.0119  -0.1152 0.1384  49  THR E CB  
5114 O OG1 . THR D 72  ? 0.5977 0.5525 0.6991 0.0082  -0.1156 0.1312  49  THR E OG1 
5115 C CG2 . THR D 72  ? 0.6759 0.6005 0.7765 0.0246  -0.1355 0.1441  49  THR E CG2 
5116 N N   . GLU D 73  ? 0.6871 0.5571 0.7371 0.0182  -0.1180 0.1611  50  GLU E N   
5117 C CA  . GLU D 73  ? 0.7118 0.5601 0.7659 0.0238  -0.1170 0.1667  50  GLU E CA  
5118 C C   . GLU D 73  ? 0.6739 0.5395 0.7693 0.0278  -0.1142 0.1574  50  GLU E C   
5119 O O   . GLU D 73  ? 0.6908 0.5420 0.7939 0.0295  -0.1076 0.1584  50  GLU E O   
5120 C CB  . GLU D 73  ? 0.7635 0.5870 0.7979 0.0369  -0.1354 0.1781  50  GLU E CB  
5121 C CG  . GLU D 73  ? 0.8377 0.6223 0.8245 0.0344  -0.1301 0.1916  50  GLU E CG  
5122 C CD  . GLU D 73  ? 0.8976 0.6573 0.8842 0.0321  -0.1167 0.1965  50  GLU E CD  
5123 O OE1 . GLU D 73  ? 0.8971 0.6629 0.8939 0.0192  -0.0975 0.1906  50  GLU E OE1 
5124 O OE2 . GLU D 73  ? 0.9400 0.6728 0.9164 0.0437  -0.1264 0.2057  50  GLU E OE2 
5125 N N   . LEU D 74  ? 0.6247 0.5189 0.7454 0.0291  -0.1176 0.1482  51  LEU E N   
5126 C CA  . LEU D 74  ? 0.5945 0.5039 0.7518 0.0330  -0.1123 0.1393  51  LEU E CA  
5127 C C   . LEU D 74  ? 0.5844 0.4912 0.7414 0.0242  -0.0938 0.1334  51  LEU E C   
5128 O O   . LEU D 74  ? 0.5742 0.4803 0.7515 0.0280  -0.0872 0.1281  51  LEU E O   
5129 C CB  . LEU D 74  ? 0.5660 0.5043 0.7460 0.0336  -0.1160 0.1309  51  LEU E CB  
5130 C CG  . LEU D 74  ? 0.5391 0.4947 0.7598 0.0391  -0.1106 0.1218  51  LEU E CG  
5131 C CD1 . LEU D 74  ? 0.5046 0.4701 0.7261 0.0307  -0.0925 0.1129  51  LEU E CD1 
5132 C CD2 . LEU D 74  ? 0.5249 0.4679 0.7651 0.0493  -0.1109 0.1236  51  LEU E CD2 
5133 N N   . GLY D 75  ? 0.5843 0.4890 0.7185 0.0129  -0.0860 0.1335  52  GLY E N   
5134 C CA  . GLY D 75  ? 0.5796 0.4869 0.7156 0.0041  -0.0716 0.1255  52  GLY E CA  
5135 C C   . GLY D 75  ? 0.6100 0.4924 0.7353 0.0000  -0.0650 0.1295  52  GLY E C   
5136 O O   . GLY D 75  ? 0.6005 0.4816 0.7295 -0.0068 -0.0549 0.1219  52  GLY E O   
5137 N N   . ARG D 76  ? 0.6439 0.5049 0.7555 0.0049  -0.0718 0.1411  53  ARG E N   
5138 C CA  . ARG D 76  ? 0.6761 0.5075 0.7715 0.0007  -0.0654 0.1483  53  ARG E CA  
5139 C C   . ARG D 76  ? 0.6780 0.4966 0.7882 0.0008  -0.0577 0.1431  53  ARG E C   
5140 O O   . ARG D 76  ? 0.7002 0.5018 0.8022 -0.0085 -0.0478 0.1434  53  ARG E O   
5141 C CB  . ARG D 76  ? 0.7128 0.5216 0.7868 0.0091  -0.0762 0.1625  53  ARG E CB  
5142 C CG  . ARG D 76  ? 0.7981 0.5703 0.8566 0.0095  -0.0712 0.1720  53  ARG E CG  
5143 C CD  . ARG D 76  ? 0.8797 0.6348 0.9145 -0.0048 -0.0563 0.1763  53  ARG E CD  
5144 N NE  . ARG D 76  ? 0.9150 0.6729 0.9242 -0.0077 -0.0581 0.1819  53  ARG E NE  
5145 C CZ  . ARG D 76  ? 0.9113 0.6819 0.9166 -0.0206 -0.0463 0.1773  53  ARG E CZ  
5146 N NH1 . ARG D 76  ? 0.8968 0.6793 0.9235 -0.0317 -0.0340 0.1667  53  ARG E NH1 
5147 N NH2 . ARG D 76  ? 0.9128 0.6831 0.8926 -0.0217 -0.0476 0.1827  53  ARG E NH2 
5148 N N   . PRO D 77  ? 0.6665 0.4920 0.7995 0.0109  -0.0611 0.1376  54  PRO E N   
5149 C CA  . PRO D 77  ? 0.6703 0.4819 0.8130 0.0098  -0.0520 0.1308  54  PRO E CA  
5150 C C   . PRO D 77  ? 0.6453 0.4717 0.7951 0.0013  -0.0429 0.1163  54  PRO E C   
5151 O O   . PRO D 77  ? 0.6597 0.4726 0.8126 -0.0017 -0.0360 0.1094  54  PRO E O   
5152 C CB  . PRO D 77  ? 0.6704 0.4793 0.8329 0.0250  -0.0576 0.1313  54  PRO E CB  
5153 C CG  . PRO D 77  ? 0.6577 0.4905 0.8303 0.0322  -0.0684 0.1328  54  PRO E CG  
5154 C CD  . PRO D 77  ? 0.6544 0.4960 0.8060 0.0235  -0.0718 0.1372  54  PRO E CD  
5155 N N   . ASP D 78  ? 0.6137 0.4652 0.7640 -0.0018 -0.0438 0.1114  55  ASP E N   
5156 C CA  . ASP D 78  ? 0.5952 0.4577 0.7465 -0.0094 -0.0371 0.0987  55  ASP E CA  
5157 C C   . ASP D 78  ? 0.6059 0.4639 0.7468 -0.0230 -0.0329 0.0979  55  ASP E C   
5158 O O   . ASP D 78  ? 0.5976 0.4545 0.7415 -0.0293 -0.0287 0.0872  55  ASP E O   
5159 C CB  . ASP D 78  ? 0.5668 0.4552 0.7215 -0.0073 -0.0390 0.0941  55  ASP E CB  
5160 C CG  . ASP D 78  ? 0.5521 0.4468 0.7220 0.0045  -0.0413 0.0946  55  ASP E CG  
5161 O OD1 . ASP D 78  ? 0.5267 0.4321 0.7000 0.0081  -0.0487 0.1012  55  ASP E OD1 
5162 O OD2 . ASP D 78  ? 0.5789 0.4665 0.7583 0.0103  -0.0356 0.0881  55  ASP E OD2 
5163 N N   . GLU D 79  ? 0.6209 0.4757 0.7500 -0.0273 -0.0341 0.1086  56  GLU E N   
5164 C CA  . GLU D 79  ? 0.6426 0.4908 0.7649 -0.0404 -0.0268 0.1090  56  GLU E CA  
5165 C C   . GLU D 79  ? 0.6706 0.4933 0.7968 -0.0452 -0.0206 0.1077  56  GLU E C   
5166 O O   . GLU D 79  ? 0.6722 0.4964 0.8080 -0.0542 -0.0161 0.0965  56  GLU E O   
5167 C CB  . GLU D 79  ? 0.6578 0.5012 0.7620 -0.0429 -0.0265 0.1218  56  GLU E CB  
5168 C CG  . GLU D 79  ? 0.6810 0.5226 0.7820 -0.0575 -0.0154 0.1207  56  GLU E CG  
5169 C CD  . GLU D 79  ? 0.7213 0.5479 0.7987 -0.0601 -0.0107 0.1347  56  GLU E CD  
5170 O OE1 . GLU D 79  ? 0.7021 0.5380 0.7656 -0.0546 -0.0170 0.1399  56  GLU E OE1 
5171 O OE2 . GLU D 79  ? 0.7786 0.5822 0.8503 -0.0683 0.0004  0.1399  56  GLU E OE2 
5172 N N   . GLU D 80  ? 0.6991 0.4976 0.8183 -0.0386 -0.0218 0.1186  57  GLU E N   
5173 C CA  . GLU D 80  ? 0.7275 0.4964 0.8470 -0.0429 -0.0150 0.1200  57  GLU E CA  
5174 C C   . GLU D 80  ? 0.7123 0.4811 0.8477 -0.0428 -0.0141 0.1052  57  GLU E C   
5175 O O   . GLU D 80  ? 0.7231 0.4812 0.8646 -0.0535 -0.0079 0.0977  57  GLU E O   
5176 C CB  . GLU D 80  ? 0.7623 0.5051 0.8698 -0.0320 -0.0188 0.1347  57  GLU E CB  
5177 C CG  . GLU D 80  ? 0.8185 0.5632 0.9061 -0.0274 -0.0248 0.1482  57  GLU E CG  
5178 C CD  . GLU D 80  ? 0.9359 0.6439 1.0006 -0.0225 -0.0249 0.1647  57  GLU E CD  
5179 O OE1 . GLU D 80  ? 0.9688 0.6496 1.0354 -0.0208 -0.0208 0.1668  57  GLU E OE1 
5180 O OE2 . GLU D 80  ? 0.9722 0.6758 1.0137 -0.0196 -0.0292 0.1758  57  GLU E OE2 
5181 N N   . TYR D 81  ? 0.6903 0.4707 0.8324 -0.0312 -0.0198 0.1000  58  TYR E N   
5182 C CA  . TYR D 81  ? 0.6806 0.4569 0.8316 -0.0291 -0.0182 0.0860  58  TYR E CA  
5183 C C   . TYR D 81  ? 0.6605 0.4509 0.8144 -0.0395 -0.0173 0.0715  58  TYR E C   
5184 O O   . TYR D 81  ? 0.6728 0.4494 0.8308 -0.0465 -0.0149 0.0617  58  TYR E O   
5185 C CB  . TYR D 81  ? 0.6660 0.4514 0.8229 -0.0146 -0.0211 0.0834  58  TYR E CB  
5186 C CG  . TYR D 81  ? 0.6778 0.4554 0.8374 -0.0125 -0.0173 0.0683  58  TYR E CG  
5187 C CD1 . TYR D 81  ? 0.6899 0.4392 0.8510 -0.0110 -0.0135 0.0653  58  TYR E CD1 
5188 C CD2 . TYR D 81  ? 0.6520 0.4470 0.8088 -0.0122 -0.0176 0.0568  58  TYR E CD2 
5189 C CE1 . TYR D 81  ? 0.6893 0.4283 0.8484 -0.0089 -0.0104 0.0504  58  TYR E CE1 
5190 C CE2 . TYR D 81  ? 0.6592 0.4426 0.8115 -0.0095 -0.0147 0.0427  58  TYR E CE2 
5191 C CZ  . TYR D 81  ? 0.6775 0.4332 0.8306 -0.0079 -0.0112 0.0391  58  TYR E CZ  
5192 O OH  . TYR D 81  ? 0.6992 0.4411 0.8437 -0.0046 -0.0086 0.0243  58  TYR E OH  
5193 N N   . TRP D 82  ? 0.6340 0.4509 0.7863 -0.0399 -0.0205 0.0695  59  TRP E N   
5194 C CA  . TRP D 82  ? 0.6214 0.4536 0.7760 -0.0468 -0.0223 0.0555  59  TRP E CA  
5195 C C   . TRP D 82  ? 0.6243 0.4599 0.7862 -0.0619 -0.0203 0.0516  59  TRP E C   
5196 O O   . TRP D 82  ? 0.6125 0.4536 0.7806 -0.0669 -0.0238 0.0367  59  TRP E O   
5197 C CB  . TRP D 82  ? 0.5928 0.4495 0.7430 -0.0405 -0.0259 0.0536  59  TRP E CB  
5198 C CG  . TRP D 82  ? 0.6106 0.4628 0.7570 -0.0315 -0.0263 0.0435  59  TRP E CG  
5199 C CD1 . TRP D 82  ? 0.6329 0.4770 0.7753 -0.0331 -0.0282 0.0284  59  TRP E CD1 
5200 C CD2 . TRP D 82  ? 0.5973 0.4495 0.7428 -0.0190 -0.0241 0.0467  59  TRP E CD2 
5201 N NE1 . TRP D 82  ? 0.6308 0.4672 0.7644 -0.0217 -0.0257 0.0229  59  TRP E NE1 
5202 C CE2 . TRP D 82  ? 0.6224 0.4646 0.7604 -0.0134 -0.0218 0.0340  59  TRP E CE2 
5203 C CE3 . TRP D 82  ? 0.5798 0.4391 0.7312 -0.0120 -0.0239 0.0582  59  TRP E CE3 
5204 C CZ2 . TRP D 82  ? 0.6114 0.4502 0.7483 -0.0015 -0.0159 0.0334  59  TRP E CZ2 
5205 C CZ3 . TRP D 82  ? 0.6326 0.4918 0.7886 -0.0006 -0.0202 0.0567  59  TRP E CZ3 
5206 C CH2 . TRP D 82  ? 0.6301 0.4792 0.7793 0.0043  -0.0145 0.0447  59  TRP E CH2 
5207 N N   . ASN D 83  ? 0.6289 0.4596 0.7897 -0.0684 -0.0148 0.0641  60  ASN E N   
5208 C CA  . ASN D 83  ? 0.6433 0.4714 0.8143 -0.0837 -0.0081 0.0623  60  ASN E CA  
5209 C C   . ASN D 83  ? 0.6678 0.4726 0.8500 -0.0914 -0.0045 0.0547  60  ASN E C   
5210 O O   . ASN D 83  ? 0.6751 0.4777 0.8718 -0.1053 0.0017  0.0507  60  ASN E O   
5211 C CB  . ASN D 83  ? 0.6590 0.4792 0.8197 -0.0873 0.0000  0.0792  60  ASN E CB  
5212 C CG  . ASN D 83  ? 0.6461 0.4902 0.7992 -0.0856 -0.0016 0.0838  60  ASN E CG  
5213 O OD1 . ASN D 83  ? 0.6162 0.4844 0.7741 -0.0827 -0.0081 0.0744  60  ASN E OD1 
5214 N ND2 . ASN D 83  ? 0.6853 0.5197 0.8233 -0.0869 0.0045  0.0984  60  ASN E ND2 
5215 N N   . SER D 84  ? 0.6790 0.4657 0.8565 -0.0827 -0.0074 0.0524  61  SER E N   
5216 C CA  . SER D 84  ? 0.7071 0.4692 0.8934 -0.0889 -0.0047 0.0441  61  SER E CA  
5217 C C   . SER D 84  ? 0.7065 0.4717 0.8955 -0.0854 -0.0135 0.0249  61  SER E C   
5218 O O   . SER D 84  ? 0.7286 0.4742 0.9242 -0.0902 -0.0137 0.0143  61  SER E O   
5219 C CB  . SER D 84  ? 0.7292 0.4603 0.9060 -0.0821 0.0004  0.0568  61  SER E CB  
5220 O OG  . SER D 84  ? 0.7178 0.4486 0.8860 -0.0660 -0.0050 0.0572  61  SER E OG  
5221 N N   . GLN D 85  ? 0.6889 0.4758 0.8701 -0.0767 -0.0205 0.0204  62  GLN E N   
5222 C CA  . GLN D 85  ? 0.6959 0.4841 0.8727 -0.0723 -0.0289 0.0026  62  GLN E CA  
5223 C C   . GLN D 85  ? 0.6887 0.4984 0.8778 -0.0821 -0.0359 -0.0092 62  GLN E C   
5224 O O   . GLN D 85  ? 0.6630 0.4959 0.8472 -0.0781 -0.0407 -0.0101 62  GLN E O   
5225 C CB  . GLN D 85  ? 0.6869 0.4821 0.8465 -0.0566 -0.0305 0.0046  62  GLN E CB  
5226 C CG  . GLN D 85  ? 0.7250 0.4977 0.8725 -0.0467 -0.0305 -0.0049 62  GLN E CG  
5227 C CD  . GLN D 85  ? 0.7748 0.5195 0.9269 -0.0466 -0.0240 0.0003  62  GLN E CD  
5228 O OE1 . GLN D 85  ? 0.7742 0.5163 0.9317 -0.0462 -0.0186 0.0161  62  GLN E OE1 
5229 N NE2 . GLN D 85  ? 0.8142 0.5352 0.9616 -0.0462 -0.0253 -0.0133 62  GLN E NE2 
5230 N N   . LYS D 86  ? 0.7101 0.5112 0.9178 -0.0953 -0.0363 -0.0185 63  LYS E N   
5231 C CA  . LYS D 86  ? 0.7074 0.5296 0.9362 -0.1064 -0.0424 -0.0300 63  LYS E CA  
5232 C C   . LYS D 86  ? 0.6939 0.5306 0.9148 -0.0990 -0.0579 -0.0462 63  LYS E C   
5233 O O   . LYS D 86  ? 0.6783 0.5409 0.9091 -0.1014 -0.0630 -0.0494 63  LYS E O   
5234 C CB  . LYS D 86  ? 0.7318 0.5408 0.9871 -0.1226 -0.0392 -0.0382 63  LYS E CB  
5235 C CG  . LYS D 86  ? 0.8001 0.5776 1.0494 -0.1210 -0.0416 -0.0472 63  LYS E CG  
5236 C CD  . LYS D 86  ? 0.8544 0.6037 1.0984 -0.1219 -0.0269 -0.0311 63  LYS E CD  
5237 C CE  . LYS D 86  ? 0.8841 0.6046 1.1102 -0.1114 -0.0294 -0.0364 63  LYS E CE  
5238 N NZ  . LYS D 86  ? 0.8721 0.6022 1.0733 -0.0940 -0.0358 -0.0366 63  LYS E NZ  
5239 N N   . ASP D 87  ? 0.7079 0.5261 0.9079 -0.0887 -0.0646 -0.0556 64  ASP E N   
5240 C CA  . ASP D 87  ? 0.7103 0.5355 0.8929 -0.0789 -0.0789 -0.0696 64  ASP E CA  
5241 C C   . ASP D 87  ? 0.6783 0.5237 0.8452 -0.0688 -0.0774 -0.0599 64  ASP E C   
5242 O O   . ASP D 87  ? 0.6726 0.5351 0.8380 -0.0666 -0.0880 -0.0680 64  ASP E O   
5243 C CB  . ASP D 87  ? 0.7413 0.5368 0.8978 -0.0686 -0.0828 -0.0799 64  ASP E CB  
5244 C CG  . ASP D 87  ? 0.7588 0.5391 0.8965 -0.0578 -0.0689 -0.0654 64  ASP E CG  
5245 O OD1 . ASP D 87  ? 0.7566 0.5335 0.9070 -0.0622 -0.0575 -0.0509 64  ASP E OD1 
5246 O OD2 . ASP D 87  ? 0.7873 0.5574 0.8972 -0.0442 -0.0694 -0.0690 64  ASP E OD2 
5247 N N   . ILE D 88  ? 0.6623 0.5050 0.8188 -0.0625 -0.0653 -0.0430 65  ILE E N   
5248 C CA  . ILE D 88  ? 0.6317 0.4930 0.7771 -0.0546 -0.0624 -0.0328 65  ILE E CA  
5249 C C   . ILE D 88  ? 0.6051 0.4931 0.7689 -0.0634 -0.0618 -0.0266 65  ILE E C   
5250 O O   . ILE D 88  ? 0.5909 0.4973 0.7515 -0.0605 -0.0679 -0.0304 65  ILE E O   
5251 C CB  . ILE D 88  ? 0.6277 0.4799 0.7635 -0.0463 -0.0508 -0.0175 65  ILE E CB  
5252 C CG1 . ILE D 88  ? 0.6519 0.4863 0.7640 -0.0327 -0.0497 -0.0237 65  ILE E CG1 
5253 C CG2 . ILE D 88  ? 0.6019 0.4760 0.7381 -0.0442 -0.0468 -0.0044 65  ILE E CG2 
5254 C CD1 . ILE D 88  ? 0.6993 0.5043 0.8088 -0.0305 -0.0454 -0.0273 65  ILE E CD1 
5255 N N   . LEU D 89  ? 0.6062 0.4934 0.7871 -0.0737 -0.0532 -0.0167 66  LEU E N   
5256 C CA  . LEU D 89  ? 0.5918 0.4992 0.7914 -0.0841 -0.0496 -0.0120 66  LEU E CA  
5257 C C   . LEU D 89  ? 0.5868 0.5149 0.8031 -0.0890 -0.0599 -0.0272 66  LEU E C   
5258 O O   . LEU D 89  ? 0.5637 0.5135 0.7888 -0.0918 -0.0580 -0.0237 66  LEU E O   
5259 C CB  . LEU D 89  ? 0.6039 0.4968 0.8185 -0.0958 -0.0390 -0.0046 66  LEU E CB  
5260 C CG  . LEU D 89  ? 0.6053 0.5082 0.8283 -0.1042 -0.0278 0.0087  66  LEU E CG  
5261 C CD1 . LEU D 89  ? 0.5763 0.4805 0.7772 -0.0946 -0.0235 0.0258  66  LEU E CD1 
5262 C CD2 . LEU D 89  ? 0.6259 0.5087 0.8631 -0.1167 -0.0170 0.0124  66  LEU E CD2 
5263 N N   . GLU D 90  ? 0.6082 0.5292 0.8296 -0.0896 -0.0716 -0.0447 67  GLU E N   
5264 C CA  . GLU D 90  ? 0.6169 0.5575 0.8561 -0.0926 -0.0849 -0.0605 67  GLU E CA  
5265 C C   . GLU D 90  ? 0.6042 0.5510 0.8170 -0.0776 -0.0961 -0.0651 67  GLU E C   
5266 O O   . GLU D 90  ? 0.5902 0.5570 0.8120 -0.0762 -0.1057 -0.0728 67  GLU E O   
5267 C CB  . GLU D 90  ? 0.6433 0.5738 0.9025 -0.1005 -0.0956 -0.0793 67  GLU E CB  
5268 C CG  . GLU D 90  ? 0.7214 0.6263 0.9514 -0.0896 -0.1063 -0.0897 67  GLU E CG  
5269 C CD  . GLU D 90  ? 0.8265 0.7173 1.0736 -0.0975 -0.1178 -0.1090 67  GLU E CD  
5270 O OE1 . GLU D 90  ? 0.8573 0.7623 1.1220 -0.0996 -0.1352 -0.1265 67  GLU E OE1 
5271 O OE2 . GLU D 90  ? 0.8466 0.7116 1.0896 -0.1007 -0.1107 -0.1076 67  GLU E OE2 
5272 N N   . GLU D 91  ? 0.6146 0.5426 0.7952 -0.0659 -0.0937 -0.0603 68  GLU E N   
5273 C CA  . GLU D 91  ? 0.6234 0.5507 0.7741 -0.0513 -0.1005 -0.0633 68  GLU E CA  
5274 C C   . GLU D 91  ? 0.5849 0.5337 0.7341 -0.0487 -0.0939 -0.0507 68  GLU E C   
5275 O O   . GLU D 91  ? 0.5748 0.5324 0.7115 -0.0406 -0.1019 -0.0553 68  GLU E O   
5276 C CB  . GLU D 91  ? 0.6507 0.5503 0.7711 -0.0410 -0.0954 -0.0614 68  GLU E CB  
5277 C CG  . GLU D 91  ? 0.7115 0.6060 0.7983 -0.0260 -0.0944 -0.0591 68  GLU E CG  
5278 C CD  . GLU D 91  ? 0.8149 0.6799 0.8749 -0.0164 -0.0868 -0.0591 68  GLU E CD  
5279 O OE1 . GLU D 91  ? 0.8240 0.6829 0.8591 -0.0051 -0.0799 -0.0543 68  GLU E OE1 
5280 O OE2 . GLU D 91  ? 0.8530 0.6999 0.9177 -0.0201 -0.0863 -0.0642 68  GLU E OE2 
5281 N N   . GLU D 92  ? 0.5641 0.5191 0.7246 -0.0552 -0.0803 -0.0354 69  GLU E N   
5282 C CA  . GLU D 92  ? 0.5367 0.5119 0.6989 -0.0550 -0.0743 -0.0244 69  GLU E CA  
5283 C C   . GLU D 92  ? 0.5223 0.5199 0.7107 -0.0638 -0.0781 -0.0302 69  GLU E C   
5284 O O   . GLU D 92  ? 0.5179 0.5324 0.7041 -0.0597 -0.0799 -0.0292 69  GLU E O   
5285 C CB  . GLU D 92  ? 0.5242 0.4967 0.6872 -0.0585 -0.0608 -0.0070 69  GLU E CB  
5286 C CG  . GLU D 92  ? 0.5600 0.5115 0.7087 -0.0522 -0.0557 -0.0006 69  GLU E CG  
5287 C CD  . GLU D 92  ? 0.5989 0.5504 0.7274 -0.0401 -0.0533 0.0047  69  GLU E CD  
5288 O OE1 . GLU D 92  ? 0.6276 0.5620 0.7430 -0.0322 -0.0520 0.0019  69  GLU E OE1 
5289 O OE2 . GLU D 92  ? 0.5931 0.5602 0.7195 -0.0388 -0.0515 0.0112  69  GLU E OE2 
5290 N N   . ARG D 93  ? 0.5214 0.5190 0.7366 -0.0757 -0.0780 -0.0364 70  ARG E N   
5291 C CA  . ARG D 93  ? 0.5105 0.5305 0.7584 -0.0855 -0.0785 -0.0424 70  ARG E CA  
5292 C C   . ARG D 93  ? 0.5070 0.5408 0.7624 -0.0798 -0.0965 -0.0595 70  ARG E C   
5293 O O   . ARG D 93  ? 0.4892 0.5462 0.7690 -0.0834 -0.0981 -0.0639 70  ARG E O   
5294 C CB  . ARG D 93  ? 0.5316 0.5455 0.8089 -0.1005 -0.0721 -0.0455 70  ARG E CB  
5295 C CG  . ARG D 93  ? 0.5409 0.5448 0.8168 -0.1084 -0.0527 -0.0277 70  ARG E CG  
5296 C CD  . ARG D 93  ? 0.5486 0.5394 0.8488 -0.1222 -0.0459 -0.0312 70  ARG E CD  
5297 N NE  . ARG D 93  ? 0.5899 0.5632 0.8792 -0.1268 -0.0285 -0.0129 70  ARG E NE  
5298 C CZ  . ARG D 93  ? 0.6166 0.5679 0.9139 -0.1360 -0.0197 -0.0101 70  ARG E CZ  
5299 N NH1 . ARG D 93  ? 0.6245 0.5697 0.9441 -0.1431 -0.0261 -0.0253 70  ARG E NH1 
5300 N NH2 . ARG D 93  ? 0.6315 0.5650 0.9131 -0.1375 -0.0053 0.0078  70  ARG E NH2 
5301 N N   . ALA D 94  ? 0.5225 0.5402 0.7551 -0.0697 -0.1100 -0.0692 71  ALA E N   
5302 C CA  . ALA D 94  ? 0.5262 0.5495 0.7558 -0.0610 -0.1306 -0.0859 71  ALA E CA  
5303 C C   . ALA D 94  ? 0.5194 0.5495 0.7232 -0.0476 -0.1330 -0.0810 71  ALA E C   
5304 O O   . ALA D 94  ? 0.5323 0.5702 0.7353 -0.0397 -0.1495 -0.0928 71  ALA E O   
5305 C CB  . ALA D 94  ? 0.5513 0.5485 0.7582 -0.0545 -0.1425 -0.0972 71  ALA E CB  
5306 N N   . VAL D 95  ? 0.5007 0.5266 0.6841 -0.0446 -0.1177 -0.0642 72  VAL E N   
5307 C CA  . VAL D 95  ? 0.4915 0.5183 0.6470 -0.0321 -0.1178 -0.0587 72  VAL E CA  
5308 C C   . VAL D 95  ? 0.4817 0.5333 0.6527 -0.0313 -0.1211 -0.0601 72  VAL E C   
5309 O O   . VAL D 95  ? 0.4928 0.5428 0.6420 -0.0190 -0.1288 -0.0626 72  VAL E O   
5310 C CB  . VAL D 95  ? 0.4795 0.4979 0.6153 -0.0302 -0.1010 -0.0415 72  VAL E CB  
5311 C CG1 . VAL D 95  ? 0.4602 0.4827 0.5742 -0.0195 -0.1001 -0.0368 72  VAL E CG1 
5312 C CG2 . VAL D 95  ? 0.4728 0.4655 0.5886 -0.0264 -0.0978 -0.0406 72  VAL E CG2 
5313 N N   . PRO D 96  ? 0.4694 0.5417 0.6756 -0.0435 -0.1133 -0.0573 73  PRO E N   
5314 C CA  . PRO D 96  ? 0.4648 0.5601 0.6855 -0.0409 -0.1163 -0.0600 73  PRO E CA  
5315 C C   . PRO D 96  ? 0.4823 0.5868 0.7169 -0.0344 -0.1379 -0.0784 73  PRO E C   
5316 O O   . PRO D 96  ? 0.4904 0.6083 0.7262 -0.0265 -0.1440 -0.0810 73  PRO E O   
5317 C CB  . PRO D 96  ? 0.4394 0.5508 0.6931 -0.0557 -0.1005 -0.0533 73  PRO E CB  
5318 C CG  . PRO D 96  ? 0.4318 0.5251 0.6697 -0.0611 -0.0867 -0.0398 73  PRO E CG  
5319 C CD  . PRO D 96  ? 0.4595 0.5322 0.6836 -0.0574 -0.0968 -0.0470 73  PRO E CD  
5320 N N   . ASP D 97  ? 0.5074 0.6033 0.7509 -0.0367 -0.1509 -0.0914 74  ASP E N   
5321 C CA  . ASP D 97  ? 0.5333 0.6347 0.7861 -0.0286 -0.1761 -0.1106 74  ASP E CA  
5322 C C   . ASP D 97  ? 0.5564 0.6294 0.7606 -0.0121 -0.1925 -0.1171 74  ASP E C   
5323 O O   . ASP D 97  ? 0.5761 0.6497 0.7777 -0.0018 -0.2153 -0.1317 74  ASP E O   
5324 C CB  . ASP D 97  ? 0.5407 0.6558 0.8435 -0.0420 -0.1834 -0.1251 74  ASP E CB  
5325 C CG  . ASP D 97  ? 0.5526 0.6975 0.9053 -0.0556 -0.1683 -0.1218 74  ASP E CG  
5326 O OD1 . ASP D 97  ? 0.5587 0.7196 0.9126 -0.0507 -0.1626 -0.1155 74  ASP E OD1 
5327 O OD2 . ASP D 97  ? 0.5783 0.7286 0.9684 -0.0715 -0.1609 -0.1255 74  ASP E OD2 
5328 N N   . ARG D 98  ? 0.5599 0.6072 0.7254 -0.0089 -0.1807 -0.1062 75  ARG E N   
5329 C CA  . ARG D 98  ? 0.5823 0.5992 0.6963 0.0072  -0.1900 -0.1095 75  ARG E CA  
5330 C C   . ARG D 98  ? 0.5753 0.5865 0.6561 0.0177  -0.1790 -0.0962 75  ARG E C   
5331 O O   . ARG D 98  ? 0.5826 0.6037 0.6610 0.0263  -0.1882 -0.0989 75  ARG E O   
5332 C CB  . ARG D 98  ? 0.5970 0.5865 0.6913 0.0049  -0.1846 -0.1096 75  ARG E CB  
5333 C CG  . ARG D 98  ? 0.6152 0.6079 0.7426 -0.0063 -0.1953 -0.1235 75  ARG E CG  
5334 C CD  . ARG D 98  ? 0.6512 0.6120 0.7548 -0.0061 -0.1939 -0.1272 75  ARG E CD  
5335 N NE  . ARG D 98  ? 0.6720 0.6384 0.8134 -0.0187 -0.2040 -0.1412 75  ARG E NE  
5336 C CZ  . ARG D 98  ? 0.6796 0.6355 0.8342 -0.0302 -0.1934 -0.1392 75  ARG E CZ  
5337 N NH1 . ARG D 98  ? 0.6566 0.5954 0.7892 -0.0295 -0.1737 -0.1244 75  ARG E NH1 
5338 N NH2 . ARG D 98  ? 0.7069 0.6688 0.8988 -0.0421 -0.2033 -0.1532 75  ARG E NH2 
5339 N N   . MET D 99  ? 0.5660 0.5624 0.6250 0.0170  -0.1596 -0.0822 76  MET E N   
5340 C CA  . MET D 99  ? 0.5551 0.5415 0.5810 0.0272  -0.1491 -0.0711 76  MET E CA  
5341 C C   . MET D 99  ? 0.5322 0.5432 0.5746 0.0266  -0.1462 -0.0653 76  MET E C   
5342 O O   . MET D 99  ? 0.5371 0.5418 0.5557 0.0389  -0.1515 -0.0659 76  MET E O   
5343 C CB  . MET D 99  ? 0.5496 0.5220 0.5620 0.0242  -0.1284 -0.0579 76  MET E CB  
5344 C CG  . MET D 99  ? 0.5339 0.5028 0.5260 0.0303  -0.1145 -0.0457 76  MET E CG  
5345 S SD  . MET D 99  ? 0.5595 0.5215 0.5526 0.0243  -0.0915 -0.0310 76  MET E SD  
5346 C CE  . MET D 99  ? 0.4162 0.4084 0.4529 0.0082  -0.0856 -0.0223 76  MET E CE  
5347 N N   . CYS D 100 ? 0.5098 0.5457 0.5900 0.0130  -0.1372 -0.0596 77  CYS E N   
5348 C CA  . CYS D 100 ? 0.4985 0.5566 0.5941 0.0122  -0.1330 -0.0547 77  CYS E CA  
5349 C C   . CYS D 100 ? 0.5169 0.5868 0.6220 0.0205  -0.1515 -0.0673 77  CYS E C   
5350 O O   . CYS D 100 ? 0.5252 0.5946 0.6136 0.0307  -0.1528 -0.0649 77  CYS E O   
5351 C CB  . CYS D 100 ? 0.4670 0.5458 0.5972 -0.0032 -0.1194 -0.0470 77  CYS E CB  
5352 S SG  . CYS D 100 ? 0.4658 0.5337 0.5873 -0.0118 -0.0994 -0.0306 77  CYS E SG  
5353 N N   . ARG D 101 ? 0.5395 0.6189 0.6721 0.0168  -0.1667 -0.0814 78  ARG E N   
5354 C CA  . ARG D 101 ? 0.5626 0.6538 0.7079 0.0261  -0.1880 -0.0955 78  ARG E CA  
5355 C C   . ARG D 101 ? 0.5981 0.6621 0.6939 0.0456  -0.2030 -0.0999 78  ARG E C   
5356 O O   . ARG D 101 ? 0.6090 0.6761 0.6950 0.0575  -0.2102 -0.1007 78  ARG E O   
5357 C CB  . ARG D 101 ? 0.5771 0.6847 0.7668 0.0174  -0.2026 -0.1115 78  ARG E CB  
5358 C CG  . ARG D 101 ? 0.6129 0.7412 0.8301 0.0260  -0.2256 -0.1274 78  ARG E CG  
5359 C CD  . ARG D 101 ? 0.6622 0.8260 0.9479 0.0106  -0.2230 -0.1351 78  ARG E CD  
5360 N NE  . ARG D 101 ? 0.7010 0.8716 1.0038 -0.0072 -0.1946 -0.1211 78  ARG E NE  
5361 C CZ  . ARG D 101 ? 0.6655 0.8464 0.9706 -0.0114 -0.1733 -0.1071 78  ARG E CZ  
5362 N NH1 . ARG D 101 ? 0.6119 0.8001 0.9070 -0.0001 -0.1745 -0.1044 78  ARG E NH1 
5363 N NH2 . ARG D 101 ? 0.6517 0.8329 0.9667 -0.0266 -0.1509 -0.0957 78  ARG E NH2 
5364 N N   . HIS D 102 ? 0.6218 0.6564 0.6837 0.0496  -0.2061 -0.1021 79  HIS E N   
5365 C CA  . HIS D 102 ? 0.6622 0.6632 0.6678 0.0685  -0.2162 -0.1046 79  HIS E CA  
5366 C C   . HIS D 102 ? 0.6556 0.6477 0.6308 0.0780  -0.2035 -0.0916 79  HIS E C   
5367 O O   . HIS D 102 ? 0.6736 0.6596 0.6300 0.0926  -0.2172 -0.0961 79  HIS E O   
5368 C CB  . HIS D 102 ? 0.6867 0.6550 0.6577 0.0695  -0.2118 -0.1048 79  HIS E CB  
5369 C CG  . HIS D 102 ? 0.7576 0.6866 0.6668 0.0889  -0.2204 -0.1079 79  HIS E CG  
5370 N ND1 . HIS D 102 ? 0.8155 0.7211 0.6999 0.0979  -0.2418 -0.1231 79  HIS E ND1 
5371 C CD2 . HIS D 102 ? 0.7860 0.6922 0.6507 0.1012  -0.2097 -0.0980 79  HIS E CD2 
5372 C CE1 . HIS D 102 ? 0.8557 0.7236 0.6789 0.1157  -0.2433 -0.1216 79  HIS E CE1 
5373 N NE2 . HIS D 102 ? 0.8344 0.7021 0.6458 0.1176  -0.2230 -0.1061 79  HIS E NE2 
5374 N N   . ASN D 103 ? 0.6364 0.6279 0.6086 0.0701  -0.1785 -0.0763 80  ASN E N   
5375 C CA  . ASN D 103 ? 0.6434 0.6245 0.5879 0.0777  -0.1651 -0.0646 80  ASN E CA  
5376 C C   . ASN D 103 ? 0.6369 0.6430 0.6046 0.0795  -0.1694 -0.0645 80  ASN E C   
5377 O O   . ASN D 103 ? 0.6442 0.6379 0.5846 0.0917  -0.1689 -0.0608 80  ASN E O   
5378 C CB  . ASN D 103 ? 0.6177 0.5956 0.5606 0.0679  -0.1391 -0.0496 80  ASN E CB  
5379 C CG  . ASN D 103 ? 0.6195 0.5754 0.5460 0.0656  -0.1321 -0.0491 80  ASN E CG  
5380 O OD1 . ASN D 103 ? 0.6588 0.5896 0.5554 0.0752  -0.1423 -0.0574 80  ASN E OD1 
5381 N ND2 . ASN D 103 ? 0.5680 0.5317 0.5124 0.0538  -0.1149 -0.0394 80  ASN E ND2 
5382 N N   . TYR D 104 ? 0.6219 0.6614 0.6396 0.0676  -0.1718 -0.0684 81  TYR E N   
5383 C CA  . TYR D 104 ? 0.6157 0.6804 0.6599 0.0675  -0.1714 -0.0678 81  TYR E CA  
5384 C C   . TYR D 104 ? 0.6491 0.7133 0.6884 0.0836  -0.1950 -0.0800 81  TYR E C   
5385 O O   . TYR D 104 ? 0.6585 0.7215 0.6858 0.0939  -0.1952 -0.0769 81  TYR E O   
5386 C CB  . TYR D 104 ? 0.5880 0.6851 0.6855 0.0505  -0.1654 -0.0693 81  TYR E CB  
5387 C CG  . TYR D 104 ? 0.5888 0.7110 0.7138 0.0485  -0.1591 -0.0671 81  TYR E CG  
5388 C CD1 . TYR D 104 ? 0.6145 0.7615 0.7786 0.0501  -0.1725 -0.0795 81  TYR E CD1 
5389 C CD2 . TYR D 104 ? 0.5960 0.7174 0.7098 0.0451  -0.1398 -0.0537 81  TYR E CD2 
5390 C CE1 . TYR D 104 ? 0.6215 0.7911 0.8118 0.0488  -0.1643 -0.0778 81  TYR E CE1 
5391 C CE2 . TYR D 104 ? 0.5934 0.7349 0.7289 0.0437  -0.1330 -0.0522 81  TYR E CE2 
5392 C CZ  . TYR D 104 ? 0.6169 0.7822 0.7901 0.0456  -0.1439 -0.0638 81  TYR E CZ  
5393 O OH  . TYR D 104 ? 0.6268 0.8112 0.8217 0.0446  -0.1346 -0.0624 81  TYR E OH  
5394 N N   . GLU D 105 ? 0.6736 0.7375 0.7220 0.0864  -0.2163 -0.0943 82  GLU E N   
5395 C CA  . GLU D 105 ? 0.7089 0.7717 0.7538 0.1030  -0.2435 -0.1079 82  GLU E CA  
5396 C C   . GLU D 105 ? 0.7550 0.7752 0.7332 0.1221  -0.2516 -0.1064 82  GLU E C   
5397 O O   . GLU D 105 ? 0.7898 0.8010 0.7524 0.1392  -0.2752 -0.1162 82  GLU E O   
5398 C CB  . GLU D 105 ? 0.7196 0.7964 0.7994 0.0986  -0.2654 -0.1255 82  GLU E CB  
5399 C CG  . GLU D 105 ? 0.7021 0.8174 0.8487 0.0785  -0.2563 -0.1283 82  GLU E CG  
5400 C CD  . GLU D 105 ? 0.7519 0.8887 0.9440 0.0789  -0.2823 -0.1487 82  GLU E CD  
5401 O OE1 . GLU D 105 ? 0.7491 0.8903 0.9656 0.0664  -0.2853 -0.1565 82  GLU E OE1 
5402 O OE2 . GLU D 105 ? 0.7943 0.9431 0.9987 0.0922  -0.3009 -0.1576 82  GLU E OE2 
5403 N N   . LEU D 106 ? 0.7657 0.7584 0.7047 0.1198  -0.2320 -0.0946 83  LEU E N   
5404 C CA  . LEU D 106 ? 0.8185 0.7664 0.6910 0.1368  -0.2334 -0.0916 83  LEU E CA  
5405 C C   . LEU D 106 ? 0.8275 0.7644 0.6752 0.1443  -0.2181 -0.0788 83  LEU E C   
5406 O O   . LEU D 106 ? 0.8728 0.7874 0.6843 0.1626  -0.2298 -0.0805 83  LEU E O   
5407 C CB  . LEU D 106 ? 0.8243 0.7476 0.6707 0.1303  -0.2173 -0.0860 83  LEU E CB  
5408 C CG  . LEU D 106 ? 0.8815 0.7551 0.6610 0.1455  -0.2191 -0.0868 83  LEU E CG  
5409 C CD1 . LEU D 106 ? 0.8549 0.7106 0.6131 0.1393  -0.1864 -0.0709 83  LEU E CD1 
5410 C CD2 . LEU D 106 ? 0.9035 0.7488 0.6354 0.1688  -0.2375 -0.0912 83  LEU E CD2 
5411 N N   . GLY D 107 ? 0.8047 0.7551 0.6704 0.1304  -0.1925 -0.0661 84  GLY E N   
5412 C CA  . GLY D 107 ? 0.8168 0.7605 0.6668 0.1345  -0.1771 -0.0547 84  GLY E CA  
5413 C C   . GLY D 107 ? 0.8248 0.7893 0.6970 0.1423  -0.1919 -0.0605 84  GLY E C   
5414 O O   . GLY D 107 ? 0.8562 0.8004 0.6962 0.1580  -0.1955 -0.0583 84  GLY E O   
5415 N N   . GLY D 108 ? 0.8032 0.8071 0.7312 0.1313  -0.1987 -0.0676 85  GLY E N   
5416 C CA  . GLY D 108 ? 0.8079 0.8375 0.7694 0.1382  -0.2167 -0.0776 85  GLY E CA  
5417 C C   . GLY D 108 ? 0.8232 0.8450 0.7670 0.1520  -0.2153 -0.0729 85  GLY E C   
5418 O O   . GLY D 108 ? 0.8001 0.8309 0.7530 0.1442  -0.1947 -0.0629 85  GLY E O   
5419 N N   . PRO D 109 ? 0.8671 0.8687 0.7818 0.1733  -0.2378 -0.0801 86  PRO E N   
5420 C CA  . PRO D 109 ? 0.8812 0.8736 0.7793 0.1894  -0.2406 -0.0772 86  PRO E CA  
5421 C C   . PRO D 109 ? 0.8735 0.8416 0.7361 0.1870  -0.2125 -0.0606 86  PRO E C   
5422 O O   . PRO D 109 ? 0.8387 0.8254 0.7254 0.1789  -0.1965 -0.0546 86  PRO E O   
5423 C CB  . PRO D 109 ? 0.9365 0.8965 0.7902 0.2134  -0.2689 -0.0857 86  PRO E CB  
5424 C CG  . PRO D 109 ? 0.9541 0.8916 0.7794 0.2095  -0.2710 -0.0877 86  PRO E CG  
5425 C CD  . PRO D 109 ? 0.9142 0.8904 0.7967 0.1848  -0.2602 -0.0896 86  PRO E CD  
5426 N N   . MET D 110 ? 0.9034 0.8289 0.7093 0.1939  -0.2066 -0.0543 87  MET E N   
5427 C CA  . MET D 110 ? 0.9012 0.8003 0.6737 0.1905  -0.1793 -0.0397 87  MET E CA  
5428 C C   . MET D 110 ? 0.8460 0.7716 0.6552 0.1682  -0.1554 -0.0320 87  MET E C   
5429 O O   . MET D 110 ? 0.8449 0.7586 0.6408 0.1649  -0.1352 -0.0218 87  MET E O   
5430 C CB  . MET D 110 ? 0.9402 0.7994 0.6629 0.1938  -0.1731 -0.0362 87  MET E CB  
5431 C CG  . MET D 110 ? 0.9902 0.8138 0.6638 0.2161  -0.1957 -0.0432 87  MET E CG  
5432 S SD  . MET D 110 ? 1.0330 0.7963 0.6332 0.2234  -0.1706 -0.0300 87  MET E SD  
5433 C CE  . MET D 110 ? 1.0267 0.7801 0.6173 0.2295  -0.1557 -0.0194 87  MET E CE  
5434 N N   . THR D 111 ? 0.8032 0.7617 0.6562 0.1531  -0.1577 -0.0369 88  THR E N   
5435 C CA  . THR D 111 ? 0.7606 0.7352 0.6371 0.1331  -0.1357 -0.0287 88  THR E CA  
5436 C C   . THR D 111 ? 0.7263 0.7348 0.6451 0.1231  -0.1291 -0.0279 88  THR E C   
5437 O O   . THR D 111 ? 0.7211 0.7260 0.6346 0.1193  -0.1128 -0.0197 88  THR E O   
5438 C CB  . THR D 111 ? 0.7489 0.7307 0.6391 0.1214  -0.1363 -0.0313 88  THR E CB  
5439 O OG1 . THR D 111 ? 0.7765 0.7258 0.6259 0.1330  -0.1454 -0.0347 88  THR E OG1 
5440 C CG2 . THR D 111 ? 0.7016 0.6867 0.5999 0.1052  -0.1132 -0.0207 88  THR E CG2 
5441 N N   . LEU D 112 ? 0.7067 0.7466 0.6673 0.1187  -0.1409 -0.0370 89  LEU E N   
5442 C CA  . LEU D 112 ? 0.6690 0.7411 0.6715 0.1076  -0.1322 -0.0367 89  LEU E CA  
5443 C C   . LEU D 112 ? 0.6668 0.7414 0.6696 0.1180  -0.1319 -0.0370 89  LEU E C   
5444 O O   . LEU D 112 ? 0.6455 0.7334 0.6642 0.1093  -0.1170 -0.0324 89  LEU E O   
5445 C CB  . LEU D 112 ? 0.6588 0.7616 0.7072 0.1007  -0.1433 -0.0472 89  LEU E CB  
5446 C CG  . LEU D 112 ? 0.6563 0.7641 0.7181 0.0883  -0.1445 -0.0493 89  LEU E CG  
5447 C CD1 . LEU D 112 ? 0.6954 0.7729 0.7179 0.0959  -0.1532 -0.0499 89  LEU E CD1 
5448 C CD2 . LEU D 112 ? 0.6751 0.8123 0.7848 0.0854  -0.1583 -0.0624 89  LEU E CD2 
5449 N N   . GLN D 113 ? 0.6846 0.7453 0.6689 0.1372  -0.1492 -0.0429 90  GLN E N   
5450 C CA  . GLN D 113 ? 0.6840 0.7451 0.6682 0.1497  -0.1508 -0.0437 90  GLN E CA  
5451 C C   . GLN D 113 ? 0.6889 0.7108 0.6210 0.1602  -0.1420 -0.0343 90  GLN E C   
5452 O O   . GLN D 113 ? 0.7114 0.7190 0.6260 0.1779  -0.1512 -0.0361 90  GLN E O   
5453 C CB  . GLN D 113 ? 0.7136 0.7876 0.7178 0.1658  -0.1767 -0.0571 90  GLN E CB  
5454 C CG  . GLN D 113 ? 0.7380 0.8472 0.7943 0.1573  -0.1890 -0.0691 90  GLN E CG  
5455 C CD  . GLN D 113 ? 0.8198 0.9155 0.8596 0.1587  -0.2055 -0.0744 90  GLN E CD  
5456 O OE1 . GLN D 113 ? 0.8529 0.9193 0.8503 0.1566  -0.1975 -0.0662 90  GLN E OE1 
5457 N NE2 . GLN D 113 ? 0.8190 0.9357 0.8939 0.1622  -0.2279 -0.0890 90  GLN E NE2 
5458 N N   . ARG D 114 ? 0.6586 0.6629 0.5681 0.1494  -0.1239 -0.0243 91  ARG E N   
5459 C CA  . ARG D 114 ? 0.6543 0.6216 0.5192 0.1560  -0.1112 -0.0151 91  ARG E CA  
5460 C C   . ARG D 114 ? 0.6287 0.6030 0.5046 0.1508  -0.0961 -0.0106 91  ARG E C   
5461 O O   . ARG D 114 ? 0.5898 0.5863 0.4931 0.1341  -0.0843 -0.0085 91  ARG E O   
5462 C CB  . ARG D 114 ? 0.6547 0.6023 0.4975 0.1461  -0.0970 -0.0075 91  ARG E CB  
5463 C CG  . ARG D 114 ? 0.6625 0.5707 0.4624 0.1519  -0.0812 0.0015  91  ARG E CG  
5464 C CD  . ARG D 114 ? 0.6291 0.5192 0.4121 0.1431  -0.0666 0.0077  91  ARG E CD  
5465 N NE  . ARG D 114 ? 0.6190 0.4992 0.3994 0.1337  -0.0443 0.0160  91  ARG E NE  
5466 C CZ  . ARG D 114 ? 0.6664 0.5089 0.4104 0.1400  -0.0302 0.0224  91  ARG E CZ  
5467 N NH1 . ARG D 114 ? 0.7126 0.5190 0.4120 0.1569  -0.0349 0.0228  91  ARG E NH1 
5468 N NH2 . ARG D 114 ? 0.6401 0.4789 0.3912 0.1292  -0.0110 0.0281  91  ARG E NH2 
5469 N N   . ARG D 115 ? 0.6475 0.6002 0.4993 0.1657  -0.0969 -0.0092 92  ARG E N   
5470 C CA  . ARG D 115 ? 0.6292 0.5848 0.4886 0.1618  -0.0828 -0.0058 92  ARG E CA  
5471 C C   . ARG D 115 ? 0.6597 0.5737 0.4751 0.1729  -0.0740 0.0010  92  ARG E C   
5472 O O   . ARG D 115 ? 0.6994 0.5893 0.4860 0.1920  -0.0856 -0.0001 92  ARG E O   
5473 C CB  . ARG D 115 ? 0.6179 0.6023 0.5119 0.1677  -0.0922 -0.0141 92  ARG E CB  
5474 C CG  . ARG D 115 ? 0.6014 0.6218 0.5366 0.1628  -0.1054 -0.0230 92  ARG E CG  
5475 C CD  . ARG D 115 ? 0.6284 0.6810 0.6058 0.1611  -0.1044 -0.0294 92  ARG E CD  
5476 N NE  . ARG D 115 ? 0.6565 0.7399 0.6741 0.1625  -0.1205 -0.0401 92  ARG E NE  
5477 C CZ  . ARG D 115 ? 0.6549 0.7633 0.7036 0.1464  -0.1180 -0.0425 92  ARG E CZ  
5478 N NH1 . ARG D 115 ? 0.6078 0.7142 0.6503 0.1285  -0.1015 -0.0345 92  ARG E NH1 
5479 N NH2 . ARG D 115 ? 0.6711 0.8058 0.7585 0.1485  -0.1329 -0.0535 92  ARG E NH2 
5480 N N   . VAL D 116 ? 0.6510 0.5549 0.4607 0.1606  -0.0536 0.0079  93  VAL E N   
5481 C CA  . VAL D 116 ? 0.6821 0.5474 0.4561 0.1679  -0.0410 0.0144  93  VAL E CA  
5482 C C   . VAL D 116 ? 0.6750 0.5509 0.4667 0.1633  -0.0324 0.0134  93  VAL E C   
5483 O O   . VAL D 116 ? 0.6513 0.5514 0.4708 0.1462  -0.0244 0.0127  93  VAL E O   
5484 C CB  . VAL D 116 ? 0.6837 0.5247 0.4374 0.1571  -0.0227 0.0223  93  VAL E CB  
5485 C CG1 . VAL D 116 ? 0.7169 0.5145 0.4329 0.1654  -0.0088 0.0286  93  VAL E CG1 
5486 C CG2 . VAL D 116 ? 0.6872 0.5211 0.4270 0.1593  -0.0294 0.0224  93  VAL E CG2 
5487 N N   . GLN D 117 ? 0.7053 0.5614 0.4787 0.1798  -0.0351 0.0130  94  GLN E N   
5488 C CA  . GLN D 117 ? 0.7015 0.5626 0.4872 0.1787  -0.0274 0.0113  94  GLN E CA  
5489 C C   . GLN D 117 ? 0.7048 0.5473 0.4806 0.1642  -0.0059 0.0170  94  GLN E C   
5490 O O   . GLN D 117 ? 0.7286 0.5373 0.4744 0.1651  0.0038  0.0236  94  GLN E O   
5491 C CB  . GLN D 117 ? 0.7378 0.5771 0.5027 0.2020  -0.0361 0.0100  94  GLN E CB  
5492 C CG  . GLN D 117 ? 0.7684 0.6151 0.5334 0.2195  -0.0598 0.0047  94  GLN E CG  
5493 C CD  . GLN D 117 ? 0.8080 0.6646 0.5878 0.2373  -0.0725 -0.0021 94  GLN E CD  
5494 O OE1 . GLN D 117 ? 0.8366 0.6638 0.5914 0.2511  -0.0690 0.0006  94  GLN E OE1 
5495 N NE2 . GLN D 117 ? 0.7938 0.6917 0.6164 0.2373  -0.0866 -0.0114 94  GLN E NE2 
5496 N N   . PRO D 118 ? 0.6824 0.5458 0.4837 0.1509  0.0017  0.0140  95  PRO E N   
5497 C CA  . PRO D 118 ? 0.6823 0.5340 0.4818 0.1356  0.0187  0.0168  95  PRO E CA  
5498 C C   . PRO D 118 ? 0.7251 0.5407 0.4992 0.1439  0.0289  0.0189  95  PRO E C   
5499 O O   . PRO D 118 ? 0.7527 0.5558 0.5128 0.1625  0.0221  0.0179  95  PRO E O   
5500 C CB  . PRO D 118 ? 0.6519 0.5362 0.4820 0.1243  0.0185  0.0110  95  PRO E CB  
5501 C CG  . PRO D 118 ? 0.6574 0.5583 0.4988 0.1385  0.0073  0.0056  95  PRO E CG  
5502 C CD  . PRO D 118 ? 0.6572 0.5572 0.4917 0.1500  -0.0062 0.0067  95  PRO E CD  
5503 N N   . ARG D 119 ? 0.7347 0.5339 0.5051 0.1304  0.0443  0.0214  96  ARG E N   
5504 C CA  . ARG D 119 ? 0.7754 0.5405 0.5260 0.1346  0.0564  0.0224  96  ARG E CA  
5505 C C   . ARG D 119 ? 0.7551 0.5334 0.5266 0.1181  0.0632  0.0171  96  ARG E C   
5506 O O   . ARG D 119 ? 0.7280 0.5249 0.5188 0.1010  0.0644  0.0162  96  ARG E O   
5507 C CB  . ARG D 119 ? 0.8131 0.5373 0.5360 0.1347  0.0707  0.0300  96  ARG E CB  
5508 C CG  . ARG D 119 ? 0.8611 0.5776 0.5664 0.1430  0.0654  0.0354  96  ARG E CG  
5509 C CD  . ARG D 119 ? 0.9639 0.6303 0.6302 0.1501  0.0807  0.0435  96  ARG E CD  
5510 N NE  . ARG D 119 ? 1.0521 0.6838 0.6902 0.1656  0.0844  0.0453  96  ARG E NE  
5511 C CZ  . ARG D 119 ? 1.1098 0.7047 0.7060 0.1869  0.0817  0.0507  96  ARG E CZ  
5512 N NH1 . ARG D 119 ? 1.1370 0.7229 0.7113 0.1956  0.0751  0.0545  96  ARG E NH1 
5513 N NH2 . ARG D 119 ? 1.1405 0.7047 0.7140 0.2002  0.0852  0.0521  96  ARG E NH2 
5514 N N   . VAL D 120 ? 0.7769 0.5444 0.5431 0.1239  0.0664  0.0132  97  VAL E N   
5515 C CA  . VAL D 120 ? 0.7668 0.5444 0.5485 0.1095  0.0714  0.0068  97  VAL E CA  
5516 C C   . VAL D 120 ? 0.8028 0.5443 0.5694 0.1065  0.0853  0.0061  97  VAL E C   
5517 O O   . VAL D 120 ? 0.8303 0.5408 0.5740 0.1206  0.0904  0.0091  97  VAL E O   
5518 C CB  . VAL D 120 ? 0.7494 0.5579 0.5480 0.1131  0.0629  0.0000  97  VAL E CB  
5519 C CG1 . VAL D 120 ? 0.7539 0.5674 0.5496 0.1341  0.0536  0.0003  97  VAL E CG1 
5520 C CG2 . VAL D 120 ? 0.7386 0.5411 0.5375 0.1075  0.0699  -0.0070 97  VAL E CG2 
5521 N N   . ASN D 121 ? 0.8052 0.5498 0.5852 0.0877  0.0906  0.0019  98  ASN E N   
5522 C CA  . ASN D 121 ? 0.8374 0.5496 0.6092 0.0808  0.1038  0.0000  98  ASN E CA  
5523 C C   . ASN D 121 ? 0.8360 0.5605 0.6228 0.0662  0.1019  -0.0097 98  ASN E C   
5524 O O   . ASN D 121 ? 0.8154 0.5650 0.6212 0.0526  0.0952  -0.0121 98  ASN E O   
5525 C CB  . ASN D 121 ? 0.8414 0.5379 0.6152 0.0710  0.1137  0.0057  98  ASN E CB  
5526 C CG  . ASN D 121 ? 0.8769 0.5352 0.6432 0.0644  0.1302  0.0045  98  ASN E CG  
5527 O OD1 . ASN D 121 ? 0.8557 0.5165 0.6392 0.0487  0.1322  -0.0033 98  ASN E OD1 
5528 N ND2 . ASN D 121 ? 0.9049 0.5258 0.6445 0.0765  0.1420  0.0120  98  ASN E ND2 
5529 N N   . VAL D 122 ? 0.8758 0.5799 0.6511 0.0702  0.1073  -0.0154 99  VAL E N   
5530 C CA  . VAL D 122 ? 0.8888 0.5963 0.6708 0.0581  0.1060  -0.0260 99  VAL E CA  
5531 C C   . VAL D 122 ? 0.9309 0.6065 0.7123 0.0460  0.1167  -0.0301 99  VAL E C   
5532 O O   . VAL D 122 ? 0.9620 0.6041 0.7285 0.0532  0.1286  -0.0265 99  VAL E O   
5533 C CB  . VAL D 122 ? 0.8941 0.6029 0.6649 0.0710  0.1046  -0.0315 99  VAL E CB  
5534 C CG1 . VAL D 122 ? 0.9149 0.6143 0.6832 0.0607  0.1064  -0.0426 99  VAL E CG1 
5535 C CG2 . VAL D 122 ? 0.8535 0.5987 0.6339 0.0770  0.0947  -0.0306 99  VAL E CG2 
5536 N N   . SER D 123 ? 0.9438 0.6297 0.7425 0.0277  0.1119  -0.0378 100 SER E N   
5537 C CA  . SER D 123 ? 0.9885 0.6505 0.7959 0.0130  0.1194  -0.0442 100 SER E CA  
5538 C C   . SER D 123 ? 1.0037 0.6803 0.8217 -0.0010 0.1071  -0.0566 100 SER E C   
5539 O O   . SER D 123 ? 0.9811 0.6885 0.8050 -0.0029 0.0940  -0.0570 100 SER E O   
5540 C CB  . SER D 123 ? 0.9801 0.6422 0.8077 0.0025  0.1253  -0.0384 100 SER E CB  
5541 O OG  . SER D 123 ? 0.9840 0.6374 0.7989 0.0155  0.1337  -0.0261 100 SER E OG  
5542 N N   . PRO D 124 ? 1.0516 0.7042 0.8703 -0.0106 0.1107  -0.0671 101 PRO E N   
5543 C CA  . PRO D 124 ? 1.0713 0.7331 0.8968 -0.0237 0.0969  -0.0804 101 PRO E CA  
5544 C C   . PRO D 124 ? 1.0788 0.7560 0.9369 -0.0421 0.0875  -0.0845 101 PRO E C   
5545 O O   . PRO D 124 ? 1.0675 0.7512 0.9459 -0.0454 0.0935  -0.0765 101 PRO E O   
5546 C CB  . PRO D 124 ? 1.1068 0.7327 0.9186 -0.0250 0.1047  -0.0907 101 PRO E CB  
5547 C CG  . PRO D 124 ? 1.1193 0.7216 0.9118 -0.0083 0.1212  -0.0816 101 PRO E CG  
5548 C CD  . PRO D 124 ? 1.0945 0.7070 0.8987 -0.0055 0.1265  -0.0679 101 PRO E CD  
5549 N N   . SER D 125 ? 1.1108 0.7934 0.9723 -0.0526 0.0721  -0.0974 102 SER E N   
5550 C CA  . SER D 125 ? 1.1292 0.8218 1.0228 -0.0703 0.0598  -0.1060 102 SER E CA  
5551 C C   . SER D 125 ? 1.1697 0.8557 1.0510 -0.0769 0.0430  -0.1223 102 SER E C   
5552 O O   . SER D 125 ? 1.1689 0.8637 1.0231 -0.0696 0.0333  -0.1231 102 SER E O   
5553 C CB  . SER D 125 ? 1.0930 0.8201 1.0064 -0.0722 0.0493  -0.0982 102 SER E CB  
5554 O OG  . SER D 125 ? 1.0837 0.8119 1.0222 -0.0746 0.0630  -0.0893 102 SER E OG  
5555 N N   . LYS D 126 ? 1.2157 0.8838 1.1156 -0.0906 0.0408  -0.1355 103 LYS E N   
5556 C CA  . LYS D 126 ? 1.2641 0.9206 1.1522 -0.0979 0.0236  -0.1534 103 LYS E CA  
5557 C C   . LYS D 126 ? 1.3011 0.9397 1.2215 -0.1150 0.0220  -0.1682 103 LYS E C   
5558 O O   . LYS D 126 ? 1.3352 0.9575 1.2447 -0.1212 0.0089  -0.1849 103 LYS E O   
5559 C CB  . LYS D 126 ? 1.2909 0.9246 1.1322 -0.0854 0.0299  -0.1563 103 LYS E CB  
5560 C CG  . LYS D 126 ? 1.3181 0.9227 1.1500 -0.0776 0.0548  -0.1516 103 LYS E CG  
5561 C CD  . LYS D 126 ? 1.3682 0.9420 1.1659 -0.0728 0.0572  -0.1635 103 LYS E CD  
5562 C CE  . LYS D 126 ? 1.3753 0.9278 1.1517 -0.0566 0.0798  -0.1544 103 LYS E CE  
5563 N NZ  . LYS D 126 ? 1.3989 0.9175 1.1467 -0.0530 0.0841  -0.1672 103 LYS E NZ  
5564 N N   . LYS D 127 ? 1.3004 0.9409 1.2600 -0.1228 0.0359  -0.1627 104 LYS E N   
5565 C CA  . LYS D 127 ? 1.3320 0.9520 1.3268 -0.1393 0.0422  -0.1751 104 LYS E CA  
5566 C C   . LYS D 127 ? 1.3295 0.9687 1.3721 -0.1574 0.0200  -0.1900 104 LYS E C   
5567 O O   . LYS D 127 ? 1.2996 0.9702 1.3703 -0.1597 0.0110  -0.1845 104 LYS E O   
5568 C CB  . LYS D 127 ? 1.3320 0.9354 1.3422 -0.1389 0.0732  -0.1627 104 LYS E CB  
5569 C CG  . LYS D 127 ? 1.3557 0.9284 1.3213 -0.1228 0.0940  -0.1532 104 LYS E CG  
5570 C CD  . LYS D 127 ? 1.3933 0.9273 1.3702 -0.1296 0.1189  -0.1546 104 LYS E CD  
5571 C CE  . LYS D 127 ? 1.4212 0.9193 1.3516 -0.1142 0.1338  -0.1504 104 LYS E CE  
5572 N NZ  . LYS D 127 ? 1.4329 0.9176 1.3396 -0.1141 0.1198  -0.1665 104 LYS E NZ  
5573 N N   . GLY D 128 ? 1.3637 0.9833 1.4162 -0.1694 0.0104  -0.2096 105 GLY E N   
5574 C CA  . GLY D 128 ? 1.3669 1.0020 1.4669 -0.1865 -0.0136 -0.2272 105 GLY E CA  
5575 C C   . GLY D 128 ? 1.4061 1.0120 1.5271 -0.2017 -0.0120 -0.2467 105 GLY E C   
5576 O O   . GLY D 128 ? 1.4375 1.0196 1.5231 -0.2000 -0.0224 -0.2594 105 GLY E O   
5577 N N   . HIS D 133 ? 1.1481 0.8473 0.9504 -0.0976 -0.0778 -0.1793 110 HIS E N   
5578 C CA  . HIS D 133 ? 1.1309 0.8340 0.9105 -0.0838 -0.0550 -0.1639 110 HIS E CA  
5579 C C   . HIS D 133 ? 1.1397 0.8179 0.9060 -0.0781 -0.0317 -0.1653 110 HIS E C   
5580 O O   . HIS D 133 ? 1.1806 0.8312 0.9308 -0.0816 -0.0341 -0.1799 110 HIS E O   
5581 C CB  . HIS D 133 ? 1.0888 0.8231 0.8993 -0.0815 -0.0477 -0.1465 110 HIS E CB  
5582 C CG  . HIS D 133 ? 1.0800 0.8224 0.9412 -0.0914 -0.0434 -0.1456 110 HIS E CG  
5583 N ND1 . HIS D 133 ? 1.0673 0.8361 0.9642 -0.0967 -0.0523 -0.1397 110 HIS E ND1 
5584 C CD2 . HIS D 133 ? 1.0913 0.8169 0.9725 -0.0966 -0.0287 -0.1492 110 HIS E CD2 
5585 C CE1 . HIS D 133 ? 1.0514 0.8200 0.9888 -0.1050 -0.0423 -0.1401 110 HIS E CE1 
5586 N NE2 . HIS D 133 ? 1.0795 0.8212 1.0075 -0.1054 -0.0276 -0.1456 110 HIS E NE2 
5587 N N   . ASN D 134 ? 1.0979 0.7852 0.8703 -0.0687 -0.0109 -0.1505 111 ASN E N   
5588 C CA  . ASN D 134 ? 1.0892 0.7570 0.8497 -0.0592 0.0116  -0.1477 111 ASN E CA  
5589 C C   . ASN D 134 ? 1.0413 0.7317 0.7978 -0.0462 0.0220  -0.1311 111 ASN E C   
5590 O O   . ASN D 134 ? 1.0434 0.7406 0.7741 -0.0383 0.0208  -0.1293 111 ASN E O   
5591 C CB  . ASN D 134 ? 1.1382 0.7770 0.8595 -0.0547 0.0134  -0.1602 111 ASN E CB  
5592 C CG  . ASN D 134 ? 1.1681 0.7792 0.8857 -0.0493 0.0332  -0.1621 111 ASN E CG  
5593 O OD1 . ASN D 134 ? 1.1573 0.7700 0.8970 -0.0470 0.0466  -0.1523 111 ASN E OD1 
5594 N ND2 . ASN D 134 ? 1.1939 0.7765 0.8799 -0.0462 0.0354  -0.1747 111 ASN E ND2 
5595 N N   . LEU D 135 ? 0.9932 0.6942 0.7756 -0.0443 0.0322  -0.1196 112 LEU E N   
5596 C CA  . LEU D 135 ? 0.9359 0.6657 0.7269 -0.0377 0.0333  -0.1053 112 LEU E CA  
5597 C C   . LEU D 135 ? 0.9072 0.6362 0.7075 -0.0279 0.0503  -0.0936 112 LEU E C   
5598 O O   . LEU D 135 ? 0.9054 0.6243 0.7246 -0.0328 0.0571  -0.0917 112 LEU E O   
5599 C CB  . LEU D 135 ? 0.9156 0.6660 0.7345 -0.0497 0.0183  -0.1042 112 LEU E CB  
5600 C CG  . LEU D 135 ? 0.8926 0.6722 0.7142 -0.0479 0.0086  -0.0955 112 LEU E CG  
5601 C CD1 . LEU D 135 ? 0.9154 0.6947 0.7103 -0.0493 -0.0066 -0.1027 112 LEU E CD1 
5602 C CD2 . LEU D 135 ? 0.8719 0.6675 0.7309 -0.0577 0.0014  -0.0923 112 LEU E CD2 
5603 N N   . LEU D 136 ? 0.8786 0.6177 0.6654 -0.0138 0.0570  -0.0859 113 LEU E N   
5604 C CA  . LEU D 136 ? 0.8499 0.5881 0.6406 -0.0015 0.0696  -0.0754 113 LEU E CA  
5605 C C   . LEU D 136 ? 0.8037 0.5710 0.6112 -0.0004 0.0651  -0.0640 113 LEU E C   
5606 O O   . LEU D 136 ? 0.7853 0.5752 0.5918 -0.0009 0.0568  -0.0626 113 LEU E O   
5607 C CB  . LEU D 136 ? 0.8622 0.5948 0.6316 0.0139  0.0776  -0.0762 113 LEU E CB  
5608 C CG  . LEU D 136 ? 0.8833 0.5977 0.6466 0.0289  0.0908  -0.0718 113 LEU E CG  
5609 C CD1 . LEU D 136 ? 0.9194 0.5988 0.6797 0.0239  0.0984  -0.0766 113 LEU E CD1 
5610 C CD2 . LEU D 136 ? 0.8806 0.5950 0.6278 0.0428  0.0961  -0.0752 113 LEU E CD2 
5611 N N   . VAL D 137 ? 0.7752 0.5390 0.5959 0.0011  0.0716  -0.0561 114 VAL E N   
5612 C CA  . VAL D 137 ? 0.7244 0.5123 0.5609 0.0012  0.0676  -0.0462 114 VAL E CA  
5613 C C   . VAL D 137 ? 0.7081 0.4973 0.5375 0.0175  0.0745  -0.0367 114 VAL E C   
5614 O O   . VAL D 137 ? 0.7241 0.4893 0.5444 0.0254  0.0848  -0.0341 114 VAL E O   
5615 C CB  . VAL D 137 ? 0.7167 0.5013 0.5759 -0.0112 0.0686  -0.0447 114 VAL E CB  
5616 C CG1 . VAL D 137 ? 0.6787 0.4874 0.5527 -0.0111 0.0644  -0.0356 114 VAL E CG1 
5617 C CG2 . VAL D 137 ? 0.7297 0.5142 0.6013 -0.0270 0.0588  -0.0555 114 VAL E CG2 
5618 N N   . CYS D 138 ? 0.6734 0.4891 0.5066 0.0228  0.0681  -0.0318 115 CYS E N   
5619 C CA  . CYS D 138 ? 0.6556 0.4759 0.4857 0.0379  0.0707  -0.0240 115 CYS E CA  
5620 C C   . CYS D 138 ? 0.6265 0.4606 0.4698 0.0349  0.0670  -0.0161 115 CYS E C   
5621 O O   . CYS D 138 ? 0.6044 0.4645 0.4579 0.0326  0.0590  -0.0140 115 CYS E O   
5622 C CB  . CYS D 138 ? 0.6472 0.4860 0.4743 0.0479  0.0676  -0.0257 115 CYS E CB  
5623 S SG  . CYS D 138 ? 0.6555 0.5012 0.4828 0.0683  0.0671  -0.0192 115 CYS E SG  
5624 N N   . HIS D 139 ? 0.6298 0.4436 0.4716 0.0346  0.0747  -0.0119 116 HIS E N   
5625 C CA  . HIS D 139 ? 0.6086 0.4292 0.4599 0.0322  0.0745  -0.0048 116 HIS E CA  
5626 C C   . HIS D 139 ? 0.6035 0.4274 0.4433 0.0488  0.0721  0.0012  116 HIS E C   
5627 O O   . HIS D 139 ? 0.6350 0.4357 0.4558 0.0621  0.0778  0.0033  116 HIS E O   
5628 C CB  . HIS D 139 ? 0.6284 0.4213 0.4800 0.0266  0.0873  -0.0027 116 HIS E CB  
5629 C CG  . HIS D 139 ? 0.6129 0.4146 0.4815 0.0184  0.0888  0.0018  116 HIS E CG  
5630 N ND1 . HIS D 139 ? 0.5764 0.4029 0.4519 0.0205  0.0798  0.0059  116 HIS E ND1 
5631 C CD2 . HIS D 139 ? 0.6138 0.4018 0.4957 0.0081  0.0996  0.0024  116 HIS E CD2 
5632 C CE1 . HIS D 139 ? 0.5534 0.3810 0.4441 0.0125  0.0844  0.0089  116 HIS E CE1 
5633 N NE2 . HIS D 139 ? 0.5803 0.3857 0.4767 0.0048  0.0969  0.0068  116 HIS E NE2 
5634 N N   . VAL D 140 ? 0.5674 0.4187 0.4186 0.0483  0.0628  0.0035  117 VAL E N   
5635 C CA  . VAL D 140 ? 0.5651 0.4240 0.4101 0.0628  0.0571  0.0074  117 VAL E CA  
5636 C C   . VAL D 140 ? 0.5582 0.4208 0.4073 0.0605  0.0557  0.0133  117 VAL E C   
5637 O O   . VAL D 140 ? 0.5493 0.4308 0.4161 0.0483  0.0521  0.0132  117 VAL E O   
5638 C CB  . VAL D 140 ? 0.5442 0.4327 0.4008 0.0648  0.0479  0.0035  117 VAL E CB  
5639 C CG1 . VAL D 140 ? 0.5401 0.4394 0.3970 0.0790  0.0402  0.0056  117 VAL E CG1 
5640 C CG2 . VAL D 140 ? 0.5554 0.4385 0.4069 0.0669  0.0516  -0.0027 117 VAL E CG2 
5641 N N   . THR D 141 ? 0.5755 0.4182 0.4060 0.0729  0.0583  0.0182  118 THR E N   
5642 C CA  . THR D 141 ? 0.5826 0.4173 0.4100 0.0708  0.0622  0.0237  118 THR E CA  
5643 C C   . THR D 141 ? 0.6050 0.4355 0.4154 0.0861  0.0549  0.0273  118 THR E C   
5644 O O   . THR D 141 ? 0.6239 0.4511 0.4218 0.1011  0.0474  0.0259  118 THR E O   
5645 C CB  . THR D 141 ? 0.6080 0.4068 0.4213 0.0685  0.0792  0.0272  118 THR E CB  
5646 O OG1 . THR D 141 ? 0.6517 0.4222 0.4389 0.0823  0.0835  0.0280  118 THR E OG1 
5647 C CG2 . THR D 141 ? 0.6056 0.4084 0.4408 0.0507  0.0860  0.0233  118 THR E CG2 
5648 N N   . ASP D 142 ? 0.6114 0.4401 0.4210 0.0831  0.0568  0.0311  119 ASP E N   
5649 C CA  . ASP D 142 ? 0.6354 0.4489 0.4203 0.0980  0.0521  0.0345  119 ASP E CA  
5650 C C   . ASP D 142 ? 0.6210 0.4580 0.4110 0.1085  0.0327  0.0305  119 ASP E C   
5651 O O   . ASP D 142 ? 0.6445 0.4655 0.4106 0.1254  0.0250  0.0311  119 ASP E O   
5652 C CB  . ASP D 142 ? 0.6788 0.4480 0.4264 0.1113  0.0624  0.0389  119 ASP E CB  
5653 C CG  . ASP D 142 ? 0.7338 0.4756 0.4753 0.1014  0.0844  0.0436  119 ASP E CG  
5654 O OD1 . ASP D 142 ? 0.7438 0.5008 0.5086 0.0869  0.0895  0.0436  119 ASP E OD1 
5655 O OD2 . ASP D 142 ? 0.7961 0.5006 0.5116 0.1080  0.0973  0.0471  119 ASP E OD2 
5656 N N   . PHE D 143 ? 0.5748 0.4480 0.3958 0.0988  0.0249  0.0261  120 PHE E N   
5657 C CA  . PHE D 143 ? 0.5529 0.4508 0.3861 0.1065  0.0089  0.0214  120 PHE E CA  
5658 C C   . PHE D 143 ? 0.5212 0.4411 0.3713 0.0990  0.0018  0.0210  120 PHE E C   
5659 O O   . PHE D 143 ? 0.5111 0.4359 0.3712 0.0855  0.0084  0.0236  120 PHE E O   
5660 C CB  . PHE D 143 ? 0.5314 0.4511 0.3849 0.1039  0.0071  0.0162  120 PHE E CB  
5661 C CG  . PHE D 143 ? 0.5113 0.4472 0.3843 0.0854  0.0139  0.0158  120 PHE E CG  
5662 C CD1 . PHE D 143 ? 0.5235 0.4436 0.3903 0.0782  0.0250  0.0165  120 PHE E CD1 
5663 C CD2 . PHE D 143 ? 0.4822 0.4469 0.3781 0.0756  0.0083  0.0144  120 PHE E CD2 
5664 C CE1 . PHE D 143 ? 0.4878 0.4215 0.3703 0.0627  0.0278  0.0149  120 PHE E CE1 
5665 C CE2 . PHE D 143 ? 0.4452 0.4212 0.3537 0.0607  0.0126  0.0143  120 PHE E CE2 
5666 C CZ  . PHE D 143 ? 0.4601 0.4209 0.3614 0.0547  0.0211  0.0142  120 PHE E CZ  
5667 N N   . TYR D 144 ? 0.5142 0.4464 0.3684 0.1085  -0.0126 0.0171  121 TYR E N   
5668 C CA  . TYR D 144 ? 0.4869 0.4414 0.3599 0.1017  -0.0206 0.0154  121 TYR E CA  
5669 C C   . TYR D 144 ? 0.4783 0.4569 0.3715 0.1089  -0.0343 0.0082  121 TYR E C   
5670 O O   . TYR D 144 ? 0.4936 0.4622 0.3754 0.1244  -0.0413 0.0054  121 TYR E O   
5671 C CB  . TYR D 144 ? 0.5019 0.4353 0.3516 0.1084  -0.0