data_4P5Q
# 
_entry.id   4P5Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4P5Q         
WWPDB D_1000200680 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4P5Q 
_pdbx_database_status.recvd_initial_deposition_date   2014-03-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dong, J.'     1 
'Caflisch, A.' 2 
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.book_id_ISBN              . 
_citation.book_publisher            ? 
_citation.book_publisher_city       . 
_citation.book_title                . 
_citation.coordinate_linkage        . 
_citation.country                   US 
_citation.database_id_Medline       . 
_citation.details                   . 
_citation.id                        primary 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_full              . 
_citation.journal_issue             . 
_citation.journal_volume            57 
_citation.language                  . 
_citation.page_first                6834 
_citation.page_last                 ? 
_citation.title                     
;Pyrrolo[3,2-b]quinoxaline Derivatives as Types I1/2 and II Eph Tyrosine Kinase Inhibitors: Structure-Based Design, Synthesis, and in Vivo Validation.
;
_citation.year                      2014 
_citation.database_id_CSD           . 
_citation.pdbx_database_id_DOI      10.1021/jm5009242 
_citation.pdbx_database_id_PubMed   25076195 
_citation.unpublished_flag          . 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Unzue, A.'    1 
primary 'Dong, J.'     2 
primary 'Lafleur, K.'  3 
primary 'Zhao, H.'     4 
primary 'Frugier, E.'  5 
primary 'Caflisch, A.' 6 
primary 'Nevado, C.'   7 
# 
_cell.entry_id           4P5Q 
_cell.length_a           53.374 
_cell.length_b           38.196 
_cell.length_c           75.771 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.61 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4P5Q 
_symmetry.cell_setting                     . 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            . 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   . 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ephrin type-A receptor 3'                                                                 40458.180 1   
2.7.10.1 ? 'Kinase domain, Residues 606-947' ? 
2 non-polymer syn '2-amino-1-(2-chlorophenyl)-N-(3-ethoxypropyl)-1H-pyrrolo[2,3-b]quinoxaline-3-carboxamide' 423.895   1   ? ? ? ? 
3 water       nat water                                                                                      18.015    263 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;EPH-like kinase 4, hEK4, HEK, Human embryo kinase, Tyrosine-protein kinase TYRO4, Tyrosine-protein kinase receptor ETK1, Eph-like tyrosine kinase 1, EPH receptor A3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRD
LAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYW
EMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQS
NVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKIS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRD
LAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYW
EMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQS
NVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKIS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  THR n 
1 21  GLN n 
1 22  THR n 
1 23  VAL n 
1 24  HIS n 
1 25  GLU n 
1 26  PHE n 
1 27  ALA n 
1 28  LYS n 
1 29  GLU n 
1 30  LEU n 
1 31  ASP n 
1 32  ALA n 
1 33  THR n 
1 34  ASN n 
1 35  ILE n 
1 36  SER n 
1 37  ILE n 
1 38  ASP n 
1 39  LYS n 
1 40  VAL n 
1 41  VAL n 
1 42  GLY n 
1 43  ALA n 
1 44  GLY n 
1 45  GLU n 
1 46  PHE n 
1 47  GLY n 
1 48  GLU n 
1 49  VAL n 
1 50  CYS n 
1 51  SER n 
1 52  GLY n 
1 53  ARG n 
1 54  LEU n 
1 55  LYS n 
1 56  LEU n 
1 57  PRO n 
1 58  SER n 
1 59  LYS n 
1 60  LYS n 
1 61  GLU n 
1 62  ILE n 
1 63  SER n 
1 64  VAL n 
1 65  ALA n 
1 66  ILE n 
1 67  LYS n 
1 68  THR n 
1 69  LEU n 
1 70  LYS n 
1 71  VAL n 
1 72  GLY n 
1 73  TYR n 
1 74  THR n 
1 75  GLU n 
1 76  LYS n 
1 77  GLN n 
1 78  ARG n 
1 79  ARG n 
1 80  ASP n 
1 81  PHE n 
1 82  LEU n 
1 83  GLY n 
1 84  GLU n 
1 85  ALA n 
1 86  SER n 
1 87  ILE n 
1 88  MET n 
1 89  GLY n 
1 90  GLN n 
1 91  PHE n 
1 92  ASP n 
1 93  HIS n 
1 94  PRO n 
1 95  ASN n 
1 96  ILE n 
1 97  ILE n 
1 98  ARG n 
1 99  LEU n 
1 100 GLU n 
1 101 GLY n 
1 102 VAL n 
1 103 VAL n 
1 104 THR n 
1 105 LYS n 
1 106 SER n 
1 107 LYS n 
1 108 PRO n 
1 109 VAL n 
1 110 MET n 
1 111 ILE n 
1 112 VAL n 
1 113 THR n 
1 114 GLU n 
1 115 TYR n 
1 116 MET n 
1 117 GLU n 
1 118 ASN n 
1 119 GLY n 
1 120 SER n 
1 121 LEU n 
1 122 ASP n 
1 123 SER n 
1 124 PHE n 
1 125 LEU n 
1 126 ARG n 
1 127 LYS n 
1 128 HIS n 
1 129 ASP n 
1 130 ALA n 
1 131 GLN n 
1 132 PHE n 
1 133 THR n 
1 134 VAL n 
1 135 ILE n 
1 136 GLN n 
1 137 LEU n 
1 138 VAL n 
1 139 GLY n 
1 140 MET n 
1 141 LEU n 
1 142 ARG n 
1 143 GLY n 
1 144 ILE n 
1 145 ALA n 
1 146 SER n 
1 147 GLY n 
1 148 MET n 
1 149 LYS n 
1 150 TYR n 
1 151 LEU n 
1 152 SER n 
1 153 ASP n 
1 154 MET n 
1 155 GLY n 
1 156 TYR n 
1 157 VAL n 
1 158 HIS n 
1 159 ARG n 
1 160 ASP n 
1 161 LEU n 
1 162 ALA n 
1 163 ALA n 
1 164 ARG n 
1 165 ASN n 
1 166 ILE n 
1 167 LEU n 
1 168 ILE n 
1 169 ASN n 
1 170 SER n 
1 171 ASN n 
1 172 LEU n 
1 173 VAL n 
1 174 CYS n 
1 175 LYS n 
1 176 VAL n 
1 177 SER n 
1 178 ASP n 
1 179 PHE n 
1 180 GLY n 
1 181 LEU n 
1 182 SER n 
1 183 ARG n 
1 184 VAL n 
1 185 LEU n 
1 186 GLU n 
1 187 ASP n 
1 188 ASP n 
1 189 PRO n 
1 190 GLU n 
1 191 ALA n 
1 192 ALA n 
1 193 TYR n 
1 194 THR n 
1 195 THR n 
1 196 ARG n 
1 197 GLY n 
1 198 GLY n 
1 199 LYS n 
1 200 ILE n 
1 201 PRO n 
1 202 ILE n 
1 203 ARG n 
1 204 TRP n 
1 205 THR n 
1 206 SER n 
1 207 PRO n 
1 208 GLU n 
1 209 ALA n 
1 210 ILE n 
1 211 ALA n 
1 212 TYR n 
1 213 ARG n 
1 214 LYS n 
1 215 PHE n 
1 216 THR n 
1 217 SER n 
1 218 ALA n 
1 219 SER n 
1 220 ASP n 
1 221 VAL n 
1 222 TRP n 
1 223 SER n 
1 224 TYR n 
1 225 GLY n 
1 226 ILE n 
1 227 VAL n 
1 228 LEU n 
1 229 TRP n 
1 230 GLU n 
1 231 VAL n 
1 232 MET n 
1 233 SER n 
1 234 TYR n 
1 235 GLY n 
1 236 GLU n 
1 237 ARG n 
1 238 PRO n 
1 239 TYR n 
1 240 TRP n 
1 241 GLU n 
1 242 MET n 
1 243 SER n 
1 244 ASN n 
1 245 GLN n 
1 246 ASP n 
1 247 VAL n 
1 248 ILE n 
1 249 LYS n 
1 250 ALA n 
1 251 VAL n 
1 252 ASP n 
1 253 GLU n 
1 254 GLY n 
1 255 TYR n 
1 256 ARG n 
1 257 LEU n 
1 258 PRO n 
1 259 PRO n 
1 260 PRO n 
1 261 MET n 
1 262 ASP n 
1 263 CYS n 
1 264 PRO n 
1 265 ALA n 
1 266 ALA n 
1 267 LEU n 
1 268 TYR n 
1 269 GLN n 
1 270 LEU n 
1 271 MET n 
1 272 LEU n 
1 273 ASP n 
1 274 CYS n 
1 275 TRP n 
1 276 GLN n 
1 277 LYS n 
1 278 ASP n 
1 279 ARG n 
1 280 ASN n 
1 281 ASN n 
1 282 ARG n 
1 283 PRO n 
1 284 LYS n 
1 285 PHE n 
1 286 GLU n 
1 287 GLN n 
1 288 ILE n 
1 289 VAL n 
1 290 SER n 
1 291 ILE n 
1 292 LEU n 
1 293 ASP n 
1 294 LYS n 
1 295 LEU n 
1 296 ILE n 
1 297 ARG n 
1 298 ASN n 
1 299 PRO n 
1 300 GLY n 
1 301 SER n 
1 302 LEU n 
1 303 LYS n 
1 304 ILE n 
1 305 ILE n 
1 306 THR n 
1 307 SER n 
1 308 ALA n 
1 309 ALA n 
1 310 ALA n 
1 311 ARG n 
1 312 PRO n 
1 313 SER n 
1 314 ASN n 
1 315 LEU n 
1 316 LEU n 
1 317 LEU n 
1 318 ASP n 
1 319 GLN n 
1 320 SER n 
1 321 ASN n 
1 322 VAL n 
1 323 ASP n 
1 324 ILE n 
1 325 THR n 
1 326 THR n 
1 327 PHE n 
1 328 ARG n 
1 329 THR n 
1 330 THR n 
1 331 GLY n 
1 332 ASP n 
1 333 TRP n 
1 334 LEU n 
1 335 ASN n 
1 336 GLY n 
1 337 VAL n 
1 338 TRP n 
1 339 THR n 
1 340 ALA n 
1 341 HIS n 
1 342 CYS n 
1 343 LYS n 
1 344 GLU n 
1 345 ILE n 
1 346 PHE n 
1 347 THR n 
1 348 GLY n 
1 349 VAL n 
1 350 GLU n 
1 351 TYR n 
1 352 SER n 
1 353 SER n 
1 354 CYS n 
1 355 ASP n 
1 356 THR n 
1 357 ILE n 
1 358 ALA n 
1 359 LYS n 
1 360 ILE n 
1 361 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   361 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'EPHA3, ETK, ETK1, HEK, TYRO4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       p28-LIC-Thrombin 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EPHA3_HUMAN 
_struct_ref.pdbx_db_accession          P29320 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRL
EGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDF
GLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPP
PMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWT
AHCKEIFTGVEYSSCDTIAKIS
;
_struct_ref.pdbx_align_begin           606 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4P5Q 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 361 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29320 
_struct_ref_seq.db_align_beg                  606 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  947 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       606 
_struct_ref_seq.pdbx_auth_seq_align_end       947 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4P5Q MET A 1  ? UNP P29320 ?   ?   'initiating methionine' 587 1  
1 4P5Q GLY A 2  ? UNP P29320 ?   ?   'expression tag'        588 2  
1 4P5Q SER A 3  ? UNP P29320 ?   ?   'expression tag'        589 3  
1 4P5Q SER A 4  ? UNP P29320 ?   ?   'expression tag'        590 4  
1 4P5Q HIS A 5  ? UNP P29320 ?   ?   'expression tag'        591 5  
1 4P5Q HIS A 6  ? UNP P29320 ?   ?   'expression tag'        592 6  
1 4P5Q HIS A 7  ? UNP P29320 ?   ?   'expression tag'        593 7  
1 4P5Q HIS A 8  ? UNP P29320 ?   ?   'expression tag'        594 8  
1 4P5Q HIS A 9  ? UNP P29320 ?   ?   'expression tag'        595 9  
1 4P5Q HIS A 10 ? UNP P29320 ?   ?   'expression tag'        596 10 
1 4P5Q SER A 11 ? UNP P29320 ?   ?   'expression tag'        597 11 
1 4P5Q SER A 12 ? UNP P29320 ?   ?   'expression tag'        598 12 
1 4P5Q GLY A 13 ? UNP P29320 ?   ?   'expression tag'        599 13 
1 4P5Q LEU A 14 ? UNP P29320 ?   ?   'expression tag'        600 14 
1 4P5Q VAL A 15 ? UNP P29320 ?   ?   'expression tag'        601 15 
1 4P5Q PRO A 16 ? UNP P29320 ?   ?   'expression tag'        602 16 
1 4P5Q ARG A 17 ? UNP P29320 ?   ?   'expression tag'        603 17 
1 4P5Q GLY A 18 ? UNP P29320 ?   ?   'expression tag'        604 18 
1 4P5Q SER A 19 ? UNP P29320 ?   ?   'expression tag'        605 19 
1 4P5Q THR A 22 ? UNP P29320 ALA 608 conflict                608 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                    ? 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                                   ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                 ? 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                            ? 
'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                   ? 
'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                  ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                            ? 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                                    ? 
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                  ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                      ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                 ? 
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                    ? 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                                     ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                                 ? 
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                              ? 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                                    ? 
'C5 H9 N O2'       115.130 
Q0B non-polymer         . '2-amino-1-(2-chlorophenyl)-N-(3-ethoxypropyl)-1H-pyrrolo[2,3-b]quinoxaline-3-carboxamide' ? 
'C22 H22 Cl N5 O2' 423.895 
SER 'L-peptide linking' y SERINE                                                                                     ? 
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                                  ? 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                 ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                   ? 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                                     ? 
'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4P5Q 
_exptl.crystals_number            1 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            1.87 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         34.22 
_exptl_crystal.description                 . 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    '0.1M sodium cacodylate pH 6.5, 0.15M ammonium sulf ate, 22.5% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2013-02-22 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    . 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99989 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        0.99989 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            . 
_reflns.entry_id                         4P5Q 
_reflns.data_reduction_details           . 
_reflns.data_reduction_method            . 
_reflns.d_resolution_high                1.350 
_reflns.d_resolution_low                 47.480 
_reflns.details                          . 
_reflns.limit_h_max                      . 
_reflns.limit_h_min                      . 
_reflns.limit_k_max                      . 
_reflns.limit_k_min                      . 
_reflns.limit_l_max                      . 
_reflns.limit_l_min                      . 
_reflns.number_all                       . 
_reflns.number_obs                       64017 
_reflns.observed_criterion               . 
_reflns.observed_criterion_F_max         . 
_reflns.observed_criterion_F_min         . 
_reflns.observed_criterion_I_max         . 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_sigma_F       . 
_reflns.observed_criterion_sigma_I       . 
_reflns.percent_possible_obs             97.100 
_reflns.R_free_details                   . 
_reflns.Rmerge_F_all                     . 
_reflns.Rmerge_F_obs                     . 
_reflns.Friedel_coverage                 . 
_reflns.number_gt                        . 
_reflns.threshold_expression             . 
_reflns.pdbx_redundancy                  4.100 
_reflns.pdbx_Rmerge_I_obs                0.049 
_reflns.pdbx_Rmerge_I_all                . 
_reflns.pdbx_Rsym_value                  . 
_reflns.pdbx_netI_over_av_sigmaI         . 
_reflns.pdbx_netI_over_sigmaI            15.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.pdbx_chi_squared                 . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_res_high_opt              . 
_reflns.pdbx_d_res_low_opt               . 
_reflns.pdbx_d_res_opt_method            . 
_reflns.phase_calculation_details        . 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_Rpim_I_all                  0.028 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_number_measured_all         261570 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.350 1.370  . 2.100  12017 . . 2998 . 93.200 . . . . 0.705 . . . . . . . . 4.000 . . . . . 0.398 0 1 1 
7.390 47.480 . 34.100 590   . . 205  . 45.300 . . . . 0.027 . . . . . . . . 2.900 . . . . . 0.018 0 2 1 
# 
_refine.aniso_B[1][1]                            . 
_refine.aniso_B[1][2]                            . 
_refine.aniso_B[1][3]                            . 
_refine.aniso_B[2][2]                            . 
_refine.aniso_B[2][3]                            . 
_refine.aniso_B[3][3]                            . 
_refine.B_iso_max                                . 
_refine.B_iso_mean                               . 
_refine.B_iso_min                                . 
_refine.correlation_coeff_Fo_to_Fc               . 
_refine.correlation_coeff_Fo_to_Fc_free          . 
_refine.details                                  . 
_refine.diff_density_max                         . 
_refine.diff_density_max_esd                     . 
_refine.diff_density_min                         . 
_refine.diff_density_min_esd                     . 
_refine.diff_density_rms                         . 
_refine.diff_density_rms_esd                     . 
_refine.entry_id                                 4P5Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 . 
_refine.ls_abs_structure_Flack                   . 
_refine.ls_abs_structure_Flack_esd               . 
_refine.ls_abs_structure_Rogers                  . 
_refine.ls_abs_structure_Rogers_esd              . 
_refine.ls_d_res_high                            1.35 
_refine.ls_d_res_low                             39.189 
_refine.ls_extinction_coef                       . 
_refine.ls_extinction_coef_esd                   . 
_refine.ls_extinction_expression                 . 
_refine.ls_extinction_method                     . 
_refine.ls_goodness_of_fit_all                   . 
_refine.ls_goodness_of_fit_all_esd               . 
_refine.ls_goodness_of_fit_obs                   . 
_refine.ls_goodness_of_fit_obs_esd               . 
_refine.ls_hydrogen_treatment                    . 
_refine.ls_matrix_type                           . 
_refine.ls_number_constraints                    . 
_refine.ls_number_parameters                     . 
_refine.ls_number_reflns_all                     . 
_refine.ls_number_reflns_obs                     63995 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_number_reflns_R_work                  . 
_refine.ls_number_restraints                     . 
_refine.ls_percent_reflns_obs                    96.69 
_refine.ls_percent_reflns_R_free                 3.13 
_refine.ls_R_factor_all                          . 
_refine.ls_R_factor_obs                          0.1580 
_refine.ls_R_factor_R_free                       0.1819 
_refine.ls_R_factor_R_free_error                 . 
_refine.ls_R_factor_R_free_error_details         . 
_refine.ls_R_factor_R_work                       0.1572 
_refine.ls_R_Fsqd_factor_obs                     . 
_refine.ls_R_I_factor_obs                        . 
_refine.ls_redundancy_reflns_all                 . 
_refine.ls_redundancy_reflns_obs                 . 
_refine.ls_restrained_S_all                      . 
_refine.ls_restrained_S_obs                      . 
_refine.ls_shift_over_esd_max                    . 
_refine.ls_shift_over_esd_mean                   . 
_refine.ls_structure_factor_coef                 . 
_refine.ls_weighting_details                     . 
_refine.ls_weighting_scheme                      . 
_refine.ls_wR_factor_all                         . 
_refine.ls_wR_factor_obs                         . 
_refine.ls_wR_factor_R_free                      . 
_refine.ls_wR_factor_R_work                      . 
_refine.occupancy_max                            . 
_refine.occupancy_min                            . 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 . 
_refine.solvent_model_param_ksol                 . 
_refine.ls_R_factor_gt                           . 
_refine.ls_goodness_of_fit_gt                    . 
_refine.ls_goodness_of_fit_ref                   . 
_refine.ls_shift_over_su_max                     . 
_refine.ls_shift_over_su_max_lt                  . 
_refine.ls_shift_over_su_mean                    . 
_refine.ls_shift_over_su_mean_lt                 . 
_refine.pdbx_ls_sigma_I                          . 
_refine.pdbx_ls_sigma_F                          1.89 
_refine.pdbx_ls_sigma_Fsqd                       . 
_refine.pdbx_data_cutoff_high_absF               . 
_refine.pdbx_data_cutoff_high_rms_absF           . 
_refine.pdbx_data_cutoff_low_absF                . 
_refine.pdbx_isotropic_thermal_model             . 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2QOB 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            . 
_refine.pdbx_stereochem_target_val_spec_case     . 
_refine.pdbx_overall_ESU_R                       . 
_refine.pdbx_overall_ESU_R_Free                  . 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             . 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        . 
_refine.pdbx_density_correlation                 . 
_refine.pdbx_pd_number_of_powder_patterns        . 
_refine.pdbx_pd_number_of_points                 . 
_refine.pdbx_pd_meas_number_of_points            . 
_refine.pdbx_pd_proc_ls_prof_R_factor            . 
_refine.pdbx_pd_proc_ls_prof_wR_factor           . 
_refine.pdbx_pd_Marquardt_correlation_coeff      . 
_refine.pdbx_pd_Fsqrd_R_factor                   . 
_refine.pdbx_pd_ls_matrix_band_width             . 
_refine.pdbx_overall_phase_error                 17.44 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   . 
_refine.pdbx_overall_SU_R_free_Blow_DPI          . 
_refine.pdbx_overall_SU_R_Blow_DPI               . 
_refine.pdbx_TLS_residual_ADP_flag               . 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             . 
_refine.overall_SU_ML                            0.11 
_refine.overall_SU_R_Cruickshank_DPI             . 
_refine.overall_SU_R_free                        . 
_refine.overall_FOM_free_R_set                   . 
_refine.overall_FOM_work_R_set                   . 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2174 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             263 
_refine_hist.number_atoms_total               2467 
_refine_hist.d_res_high                       1.35 
_refine_hist.d_res_low                        39.189 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' . 0.005  . 2336 . f_bond_d           . . 
'X-RAY DIFFRACTION' . 1.257  . 3171 . f_angle_d          . . 
'X-RAY DIFFRACTION' . 14.467 . 880  . f_dihedral_angle_d . . 
'X-RAY DIFFRACTION' . 0.037  . 344  . f_chiral_restr     . . 
'X-RAY DIFFRACTION' . 0.004  . 406  . f_plane_restr      . . 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 1.3493 1.3830  . . 136 4220 94.00 . . . 0.2690 . 0.2412 . . . . . . . . 
'X-RAY DIFFRACTION' 1.3830 1.4204  . . 144 4445 97.00 . . . 0.2173 . 0.2029 . . . . . . . . 
'X-RAY DIFFRACTION' 1.4204 1.4622  . . 143 4435 97.00 . . . 0.2045 . 0.1731 . . . . . . . . 
'X-RAY DIFFRACTION' 1.4622 1.5094  . . 143 4437 97.00 . . . 0.2032 . 0.1578 . . . . . . . . 
'X-RAY DIFFRACTION' 1.5094 1.5633  . . 143 4429 98.00 . . . 0.2043 . 0.1520 . . . . . . . . 
'X-RAY DIFFRACTION' 1.5633 1.6259  . . 143 4455 98.00 . . . 0.1876 . 0.1427 . . . . . . . . 
'X-RAY DIFFRACTION' 1.6259 1.6999  . . 146 4486 98.00 . . . 0.1821 . 0.1355 . . . . . . . . 
'X-RAY DIFFRACTION' 1.6999 1.7895  . . 144 4498 98.00 . . . 0.1587 . 0.1360 . . . . . . . . 
'X-RAY DIFFRACTION' 1.7895 1.9017  . . 146 4533 99.00 . . . 0.1991 . 0.1405 . . . . . . . . 
'X-RAY DIFFRACTION' 1.9017 2.0485  . . 146 4528 99.00 . . . 0.1779 . 0.1402 . . . . . . . . 
'X-RAY DIFFRACTION' 2.0485 2.2546  . . 146 4529 99.00 . . . 0.1761 . 0.1423 . . . . . . . . 
'X-RAY DIFFRACTION' 2.2546 2.5808  . . 148 4544 99.00 . . . 0.2053 . 0.1505 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5808 3.2513  . . 148 4583 99.00 . . . 0.1489 . 0.1604 . . . . . . . . 
'X-RAY DIFFRACTION' 3.2513 39.2058 . . 124 3873 82.00 . . . 0.1799 . 0.1742 . . . . . . . . 
# 
_struct.entry_id                     4P5Q 
_struct.title                        'Human EphA3 Kinase domain in complex with quinoxaline derivatives' 
_struct.pdbx_descriptor              'EPH receptor A3 (E.C.2.7.10.1)' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4P5Q 
_struct_keywords.text            'TRANSFERASE, TRANSFERASE INHIBITOR' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 31  ? THR A 33  ? ASP A 617 THR A 619 5 ? 3  
HELX_P HELX_P2  AA2 THR A 74  ? GLY A 89  ? THR A 660 GLY A 675 1 ? 16 
HELX_P HELX_P3  AA3 SER A 120 ? LYS A 127 ? SER A 706 LYS A 713 1 ? 8  
HELX_P HELX_P4  AA4 THR A 133 ? MET A 154 ? THR A 719 MET A 740 1 ? 22 
HELX_P HELX_P5  AA5 ALA A 162 ? ARG A 164 ? ALA A 748 ARG A 750 5 ? 3  
HELX_P HELX_P6  AA6 PRO A 201 ? THR A 205 ? PRO A 787 THR A 791 5 ? 5  
HELX_P HELX_P7  AA7 SER A 206 ? ARG A 213 ? SER A 792 ARG A 799 1 ? 8  
HELX_P HELX_P8  AA8 THR A 216 ? SER A 233 ? THR A 802 SER A 819 1 ? 18 
HELX_P HELX_P9  AA9 SER A 243 ? GLU A 253 ? SER A 829 GLU A 839 1 ? 11 
HELX_P HELX_P10 AB1 PRO A 264 ? TRP A 275 ? PRO A 850 TRP A 861 1 ? 12 
HELX_P HELX_P11 AB2 ASP A 278 ? ARG A 282 ? ASP A 864 ARG A 868 5 ? 5  
HELX_P HELX_P12 AB3 LYS A 284 ? ASN A 298 ? LYS A 870 ASN A 884 1 ? 15 
HELX_P HELX_P13 AB4 PRO A 299 ? ILE A 304 ? PRO A 885 ILE A 890 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           107 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            693 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    108 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     694 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       4.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 35  ? ALA A 43  ? ILE A 621 ALA A 629 
AA1 2 GLU A 48  ? LYS A 55  ? GLU A 634 LYS A 641 
AA1 3 GLU A 61  ? THR A 68  ? GLU A 647 THR A 654 
AA1 4 MET A 110 ? GLU A 114 ? MET A 696 GLU A 700 
AA1 5 LEU A 99  ? VAL A 103 ? LEU A 685 VAL A 689 
AA2 1 ILE A 166 ? ILE A 168 ? ILE A 752 ILE A 754 
AA2 2 CYS A 174 ? VAL A 176 ? CYS A 760 VAL A 762 
AA3 1 TYR A 255 ? ARG A 256 ? TYR A 841 ARG A 842 
AA3 2 LEU A 316 ? LEU A 317 ? LEU A 902 LEU A 903 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 42  ? N GLY A 628 O VAL A 49  ? O VAL A 635 
AA1 2 3 N CYS A 50  ? N CYS A 636 O ILE A 66  ? O ILE A 652 
AA1 3 4 N LYS A 67  ? N LYS A 653 O ILE A 111 ? O ILE A 697 
AA1 4 5 O VAL A 112 ? O VAL A 698 N GLY A 101 ? N GLY A 687 
AA2 1 2 N LEU A 167 ? N LEU A 753 O LYS A 175 ? O LYS A 761 
AA3 1 2 N ARG A 256 ? N ARG A 842 O LEU A 316 ? O LEU A 902 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    Q0B 
_struct_site.pdbx_auth_seq_id     1001 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'binding site for residue Q0B A 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 VAL A 49  ? VAL A 635 . ? 1_555 ? 
2  AC1 12 ALA A 65  ? ALA A 651 . ? 1_555 ? 
3  AC1 12 LYS A 67  ? LYS A 653 . ? 1_555 ? 
4  AC1 12 MET A 88  ? MET A 674 . ? 1_555 ? 
5  AC1 12 THR A 113 ? THR A 699 . ? 1_555 ? 
6  AC1 12 GLU A 114 ? GLU A 700 . ? 1_555 ? 
7  AC1 12 TYR A 115 ? TYR A 701 . ? 1_555 ? 
8  AC1 12 MET A 116 ? MET A 702 . ? 1_555 ? 
9  AC1 12 GLU A 117 ? GLU A 703 . ? 1_555 ? 
10 AC1 12 GLY A 119 ? GLY A 705 . ? 1_555 ? 
11 AC1 12 LEU A 167 ? LEU A 753 . ? 1_555 ? 
12 AC1 12 SER A 177 ? SER A 763 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4P5Q 
_atom_sites.fract_transf_matrix[1][1]   0.018736 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003850 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026181 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013473 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 23  ? 9.704   7.170   -13.766 1.00 54.10 ? 609  VAL A N   1 
ATOM   2    C  CA  . VAL A 1 23  ? 9.035   6.008   -13.194 1.00 53.17 ? 609  VAL A CA  1 
ATOM   3    C  C   . VAL A 1 23  ? 9.117   6.039   -11.667 1.00 52.77 ? 609  VAL A C   1 
ATOM   4    O  O   . VAL A 1 23  ? 8.278   5.463   -10.978 1.00 52.10 ? 609  VAL A O   1 
ATOM   5    C  CB  . VAL A 1 23  ? 9.638   4.681   -13.737 1.00 52.49 ? 609  VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 23  ? 11.054  4.472   -13.220 1.00 52.56 ? 609  VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 23  ? 8.754   3.492   -13.371 1.00 51.68 ? 609  VAL A CG2 1 
ATOM   8    N  N   . HIS A 1 24  ? 10.112  6.746   -11.141 1.00 52.55 ? 610  HIS A N   1 
ATOM   9    C  CA  . HIS A 1 24  ? 10.333  6.779   -9.701  1.00 52.60 ? 610  HIS A CA  1 
ATOM   10   C  C   . HIS A 1 24  ? 9.419   7.766   -8.982  1.00 51.92 ? 610  HIS A C   1 
ATOM   11   O  O   . HIS A 1 24  ? 9.447   7.859   -7.756  1.00 51.78 ? 610  HIS A O   1 
ATOM   12   C  CB  . HIS A 1 24  ? 11.797  7.099   -9.395  1.00 53.37 ? 610  HIS A CB  1 
ATOM   13   C  CG  . HIS A 1 24  ? 12.697  5.905   -9.462  1.00 54.78 ? 610  HIS A CG  1 
ATOM   14   N  ND1 . HIS A 1 24  ? 14.064  6.008   -9.608  1.00 55.32 ? 610  HIS A ND1 1 
ATOM   15   C  CD2 . HIS A 1 24  ? 12.425  4.580   -9.399  1.00 54.45 ? 610  HIS A CD2 1 
ATOM   16   C  CE1 . HIS A 1 24  ? 14.594  4.798   -9.634  1.00 55.08 ? 610  HIS A CE1 1 
ATOM   17   N  NE2 . HIS A 1 24  ? 13.620  3.913   -9.510  1.00 54.08 ? 610  HIS A NE2 1 
ATOM   18   N  N   . GLU A 1 25  ? 8.610   8.499   -9.740  1.00 50.81 ? 611  GLU A N   1 
ATOM   19   C  CA  . GLU A 1 25  ? 7.582   9.337   -9.137  1.00 49.63 ? 611  GLU A CA  1 
ATOM   20   C  C   . GLU A 1 25  ? 6.479   8.460   -8.555  1.00 47.59 ? 611  GLU A C   1 
ATOM   21   O  O   . GLU A 1 25  ? 5.882   8.792   -7.531  1.00 48.14 ? 611  GLU A O   1 
ATOM   22   C  CB  . GLU A 1 25  ? 6.992   10.316  -10.155 1.00 52.03 ? 611  GLU A CB  1 
ATOM   23   C  CG  . GLU A 1 25  ? 5.770   11.069  -9.631  1.00 54.09 ? 611  GLU A CG  1 
ATOM   24   C  CD  . GLU A 1 25  ? 5.306   12.178  -10.555 1.00 55.90 ? 611  GLU A CD  1 
ATOM   25   O  OE1 . GLU A 1 25  ? 5.948   12.392  -11.604 1.00 56.24 ? 611  GLU A OE1 1 
ATOM   26   O  OE2 . GLU A 1 25  ? 4.294   12.835  -10.227 1.00 56.79 ? 611  GLU A OE2 1 
ATOM   27   N  N   . PHE A 1 26  ? 6.225   7.329   -9.208  1.00 43.74 ? 612  PHE A N   1 
ATOM   28   C  CA  . PHE A 1 26  ? 5.123   6.456   -8.817  1.00 42.54 ? 612  PHE A CA  1 
ATOM   29   C  C   . PHE A 1 26  ? 5.546   5.030   -8.484  1.00 39.85 ? 612  PHE A C   1 
ATOM   30   O  O   . PHE A 1 26  ? 4.717   4.225   -8.062  1.00 41.72 ? 612  PHE A O   1 
ATOM   31   C  CB  . PHE A 1 26  ? 4.073   6.413   -9.926  1.00 43.70 ? 612  PHE A CB  1 
ATOM   32   C  CG  . PHE A 1 26  ? 3.523   7.755   -10.285 1.00 44.89 ? 612  PHE A CG  1 
ATOM   33   C  CD1 . PHE A 1 26  ? 2.651   8.405   -9.432  1.00 45.60 ? 612  PHE A CD1 1 
ATOM   34   C  CD2 . PHE A 1 26  ? 3.874   8.366   -11.477 1.00 45.93 ? 612  PHE A CD2 1 
ATOM   35   C  CE1 . PHE A 1 26  ? 2.137   9.645   -9.761  1.00 45.80 ? 612  PHE A CE1 1 
ATOM   36   C  CE2 . PHE A 1 26  ? 3.363   9.606   -11.812 1.00 46.50 ? 612  PHE A CE2 1 
ATOM   37   C  CZ  . PHE A 1 26  ? 2.494   10.246  -10.953 1.00 46.42 ? 612  PHE A CZ  1 
ATOM   38   N  N   . ALA A 1 27  ? 6.822   4.712   -8.683  1.00 35.41 ? 613  ALA A N   1 
ATOM   39   C  CA  . ALA A 1 27  ? 7.321   3.367   -8.416  1.00 32.96 ? 613  ALA A CA  1 
ATOM   40   C  C   . ALA A 1 27  ? 8.553   3.419   -7.532  1.00 32.33 ? 613  ALA A C   1 
ATOM   41   O  O   . ALA A 1 27  ? 9.535   4.085   -7.863  1.00 33.26 ? 613  ALA A O   1 
ATOM   42   C  CB  . ALA A 1 27  ? 7.639   2.643   -9.716  1.00 31.25 ? 613  ALA A CB  1 
ATOM   43   N  N   . LYS A 1 28  ? 8.508   2.716   -6.407  1.00 29.27 ? 614  LYS A N   1 
ATOM   44   C  CA  . LYS A 1 28  ? 9.666   2.683   -5.541  1.00 29.00 ? 614  LYS A CA  1 
ATOM   45   C  C   . LYS A 1 28  ? 10.735  1.789   -6.148  1.00 24.12 ? 614  LYS A C   1 
ATOM   46   O  O   . LYS A 1 28  ? 10.438  0.785   -6.800  1.00 22.80 ? 614  LYS A O   1 
ATOM   47   C  CB  . LYS A 1 28  ? 9.290   2.216   -4.131  1.00 33.16 ? 614  LYS A CB  1 
ATOM   48   C  CG  . LYS A 1 28  ? 8.761   0.804   -4.044  1.00 36.39 ? 614  LYS A CG  1 
ATOM   49   C  CD  . LYS A 1 28  ? 8.366   0.459   -2.613  1.00 38.56 ? 614  LYS A CD  1 
ATOM   50   C  CE  . LYS A 1 28  ? 6.926   0.854   -2.312  1.00 40.56 ? 614  LYS A CE  1 
ATOM   51   N  NZ  . LYS A 1 28  ? 6.300   -0.026  -1.280  1.00 41.93 ? 614  LYS A NZ  1 
ATOM   52   N  N   . GLU A 1 29  ? 11.986  2.181   -5.946  1.00 24.38 ? 615  GLU A N   1 
ATOM   53   C  CA  . GLU A 1 29  ? 13.119  1.383   -6.373  1.00 22.81 ? 615  GLU A CA  1 
ATOM   54   C  C   . GLU A 1 29  ? 13.373  0.295   -5.333  1.00 23.41 ? 615  GLU A C   1 
ATOM   55   O  O   . GLU A 1 29  ? 13.585  0.589   -4.158  1.00 26.28 ? 615  GLU A O   1 
ATOM   56   C  CB  . GLU A 1 29  ? 14.357  2.268   -6.555  1.00 22.98 ? 615  GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 29  ? 15.610  1.529   -7.002  1.00 24.02 ? 615  GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 29  ? 15.601  1.166   -8.480  1.00 24.01 ? 615  GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 29  ? 14.800  1.744   -9.247  1.00 25.10 ? 615  GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 29  ? 16.403  0.291   -8.871  1.00 23.23 ? 615  GLU A OE2 1 
ATOM   61   N  N   . LEU A 1 30  ? 13.335  -0.959  -5.763  1.00 19.52 ? 616  LEU A N   1 
ATOM   62   C  CA  . LEU A 1 30  ? 13.555  -2.088  -4.861  1.00 19.64 ? 616  LEU A CA  1 
ATOM   63   C  C   . LEU A 1 30  ? 15.014  -2.523  -4.890  1.00 21.72 ? 616  LEU A C   1 
ATOM   64   O  O   . LEU A 1 30  ? 15.684  -2.395  -5.913  1.00 25.31 ? 616  LEU A O   1 
ATOM   65   C  CB  . LEU A 1 30  ? 12.659  -3.262  -5.248  1.00 18.11 ? 616  LEU A CB  1 
ATOM   66   C  CG  . LEU A 1 30  ? 11.158  -2.983  -5.262  1.00 17.50 ? 616  LEU A CG  1 
ATOM   67   C  CD1 . LEU A 1 30  ? 10.405  -4.149  -5.883  1.00 17.10 ? 616  LEU A CD1 1 
ATOM   68   C  CD2 . LEU A 1 30  ? 10.651  -2.702  -3.850  1.00 18.64 ? 616  LEU A CD2 1 
ATOM   69   N  N   . ASP A 1 31  ? 15.503  -3.029  -3.764  1.00 22.71 ? 617  ASP A N   1 
ATOM   70   C  CA  . ASP A 1 31  ? 16.845  -3.589  -3.694  1.00 25.89 ? 617  ASP A CA  1 
ATOM   71   C  C   . ASP A 1 31  ? 16.807  -5.030  -4.213  1.00 26.02 ? 617  ASP A C   1 
ATOM   72   O  O   . ASP A 1 31  ? 16.028  -5.842  -3.721  1.00 25.20 ? 617  ASP A O   1 
ATOM   73   C  CB  . ASP A 1 31  ? 17.355  -3.534  -2.250  1.00 29.10 ? 617  ASP A CB  1 
ATOM   74   C  CG  . ASP A 1 31  ? 18.845  -3.797  -2.132  1.00 34.13 ? 617  ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1 31  ? 19.405  -4.541  -2.964  1.00 35.18 ? 617  ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1 31  ? 19.454  -3.258  -1.184  1.00 36.88 ? 617  ASP A OD2 1 
ATOM   77   N  N   . ALA A 1 32  ? 17.645  -5.344  -5.201  1.00 25.17 ? 618  ALA A N   1 
ATOM   78   C  CA  . ALA A 1 32  ? 17.687  -6.690  -5.781  1.00 26.64 ? 618  ALA A CA  1 
ATOM   79   C  C   . ALA A 1 32  ? 17.972  -7.772  -4.735  1.00 25.37 ? 618  ALA A C   1 
ATOM   80   O  O   . ALA A 1 32  ? 17.588  -8.931  -4.905  1.00 25.76 ? 618  ALA A O   1 
ATOM   81   C  CB  . ALA A 1 32  ? 18.730  -6.755  -6.897  1.00 28.51 ? 618  ALA A CB  1 
ATOM   82   N  N   . THR A 1 33  ? 18.640  -7.393  -3.651  1.00 24.26 ? 619  THR A N   1 
ATOM   83   C  CA  . THR A 1 33  ? 18.945  -8.350  -2.598  1.00 25.15 ? 619  THR A CA  1 
ATOM   84   C  C   . THR A 1 33  ? 17.689  -8.807  -1.857  1.00 22.71 ? 619  THR A C   1 
ATOM   85   O  O   . THR A 1 33  ? 17.702  -9.840  -1.184  1.00 23.32 ? 619  THR A O   1 
ATOM   86   C  CB  . THR A 1 33  ? 19.962  -7.768  -1.590  1.00 29.65 ? 619  THR A CB  1 
ATOM   87   O  OG1 . THR A 1 33  ? 19.334  -6.766  -0.783  1.00 33.40 ? 619  THR A OG1 1 
ATOM   88   C  CG2 . THR A 1 33  ? 21.131  -7.153  -2.328  1.00 31.94 ? 619  THR A CG2 1 
ATOM   89   N  N   . ASN A 1 34  ? 16.604  -8.053  -2.007  1.00 19.37 ? 620  ASN A N   1 
ATOM   90   C  CA  . ASN A 1 34  ? 15.340  -8.381  -1.353  1.00 18.16 ? 620  ASN A CA  1 
ATOM   91   C  C   . ASN A 1 34  ? 14.398  -9.214  -2.214  1.00 17.42 ? 620  ASN A C   1 
ATOM   92   O  O   . ASN A 1 34  ? 13.284  -9.531  -1.798  1.00 17.23 ? 620  ASN A O   1 
ATOM   93   C  CB  . ASN A 1 34  ? 14.634  -7.099  -0.926  1.00 18.12 ? 620  ASN A CB  1 
ATOM   94   C  CG  . ASN A 1 34  ? 15.312  -6.447  0.250   1.00 21.79 ? 620  ASN A CG  1 
ATOM   95   O  OD1 . ASN A 1 34  ? 15.843  -7.132  1.122   1.00 24.82 ? 620  ASN A OD1 1 
ATOM   96   N  ND2 . ASN A 1 34  ? 15.312  -5.118  0.275   1.00 22.19 ? 620  ASN A ND2 1 
ATOM   97   N  N   . ILE A 1 35  ? 14.848  -9.568  -3.413  1.00 17.61 ? 621  ILE A N   1 
ATOM   98   C  CA  . ILE A 1 35  ? 14.029  -10.332 -4.349  1.00 18.66 ? 621  ILE A CA  1 
ATOM   99   C  C   . ILE A 1 35  ? 14.622  -11.718 -4.567  1.00 20.97 ? 621  ILE A C   1 
ATOM   100  O  O   . ILE A 1 35  ? 15.808  -11.854 -4.865  1.00 23.94 ? 621  ILE A O   1 
ATOM   101  C  CB  . ILE A 1 35  ? 13.906  -9.605  -5.707  1.00 19.88 ? 621  ILE A CB  1 
ATOM   102  C  CG1 . ILE A 1 35  ? 13.229  -8.249  -5.519  1.00 19.86 ? 621  ILE A CG1 1 
ATOM   103  C  CG2 . ILE A 1 35  ? 13.139  -10.454 -6.723  1.00 22.26 ? 621  ILE A CG2 1 
ATOM   104  C  CD1 . ILE A 1 35  ? 13.299  -7.370  -6.740  1.00 20.86 ? 621  ILE A CD1 1 
ATOM   105  N  N   . SER A 1 36  ? 13.803  -12.749 -4.392  1.00 20.98 ? 622  SER A N   1 
ATOM   106  C  CA  . SER A 1 36  ? 14.201  -14.091 -4.783  1.00 22.87 ? 622  SER A CA  1 
ATOM   107  C  C   . SER A 1 36  ? 13.380  -14.495 -5.994  1.00 23.99 ? 622  SER A C   1 
ATOM   108  O  O   . SER A 1 36  ? 12.176  -14.262 -6.046  1.00 23.96 ? 622  SER A O   1 
ATOM   109  C  CB  . SER A 1 36  ? 14.017  -15.091 -3.641  1.00 26.50 ? 622  SER A CB  1 
ATOM   110  O  OG  . SER A 1 36  ? 12.650  -15.311 -3.357  1.00 30.22 ? 622  SER A OG  1 
ATOM   111  N  N   . ILE A 1 37  ? 14.043  -15.062 -6.989  1.00 27.74 ? 623  ILE A N   1 
ATOM   112  C  CA  . ILE A 1 37  ? 13.346  -15.520 -8.172  1.00 32.23 ? 623  ILE A CA  1 
ATOM   113  C  C   . ILE A 1 37  ? 13.319  -17.024 -8.106  1.00 34.51 ? 623  ILE A C   1 
ATOM   114  O  O   . ILE A 1 37  ? 14.350  -17.663 -7.897  1.00 35.43 ? 623  ILE A O   1 
ATOM   115  C  CB  . ILE A 1 37  ? 14.022  -15.021 -9.454  1.00 35.69 ? 623  ILE A CB  1 
ATOM   116  C  CG1 . ILE A 1 37  ? 13.633  -13.557 -9.675  1.00 37.23 ? 623  ILE A CG1 1 
ATOM   117  C  CG2 . ILE A 1 37  ? 13.603  -15.868 -10.645 1.00 36.68 ? 623  ILE A CG2 1 
ATOM   118  C  CD1 . ILE A 1 37  ? 14.649  -12.754 -10.417 1.00 39.17 ? 623  ILE A CD1 1 
ATOM   119  N  N   . ASP A 1 38  ? 12.122  -17.554 -8.152  1.00 34.37 ? 624  ASP A N   1 
ATOM   120  C  CA  . ASP A 1 38  ? 11.937  -18.955 -7.962  1.00 38.34 ? 624  ASP A CA  1 
ATOM   121  C  C   . ASP A 1 38  ? 11.684  -19.725 -9.271  1.00 39.33 ? 624  ASP A C   1 
ATOM   122  O  O   . ASP A 1 38  ? 12.280  -20.737 -9.476  1.00 40.31 ? 624  ASP A O   1 
ATOM   123  C  CB  . ASP A 1 38  ? 10.984  -19.181 -6.808  1.00 42.10 ? 624  ASP A CB  1 
ATOM   124  C  CG  . ASP A 1 38  ? 11.608  -18.714 -5.422  1.00 46.35 ? 624  ASP A CG  1 
ATOM   125  O  OD1 . ASP A 1 38  ? 12.590  -19.308 -4.984  1.00 48.23 ? 624  ASP A OD1 1 
ATOM   126  O  OD2 . ASP A 1 38  ? 11.185  -17.749 -4.761  1.00 47.00 ? 624  ASP A OD2 1 
ATOM   127  N  N   . LYS A 1 39  ? 10.915  -19.196 -10.196 1.00 39.21 ? 625  LYS A N   1 
ATOM   128  C  CA  . LYS A 1 39  ? 10.548  -19.893 -11.430 1.00 41.20 ? 625  LYS A CA  1 
ATOM   129  C  C   . LYS A 1 39  ? 10.057  -18.957 -12.534 1.00 39.97 ? 625  LYS A C   1 
ATOM   130  O  O   . LYS A 1 39  ? 9.405   -17.958 -12.254 1.00 37.40 ? 625  LYS A O   1 
ATOM   131  C  CB  . LYS A 1 39  ? 9.470   -20.940 -11.132 1.00 45.82 ? 625  LYS A CB  1 
ATOM   132  C  CG  . LYS A 1 39  ? 9.016   -21.746 -12.337 1.00 49.46 ? 625  LYS A CG  1 
ATOM   133  C  CD  . LYS A 1 39  ? 7.904   -22.711 -11.962 1.00 51.64 ? 625  LYS A CD  1 
ATOM   134  C  CE  . LYS A 1 39  ? 6.800   -22.002 -11.200 1.00 52.85 ? 625  LYS A CE  1 
ATOM   135  N  NZ  . LYS A 1 39  ? 5.726   -22.947 -10.791 1.00 53.50 ? 625  LYS A NZ  1 
ATOM   136  N  N   . VAL A 1 40  ? 10.377  -19.284 -13.785 1.00 40.40 ? 626  VAL A N   1 
ATOM   137  C  CA  . VAL A 1 40  ? 9.781   -18.605 -14.934 1.00 41.17 ? 626  VAL A CA  1 
ATOM   138  C  C   . VAL A 1 40  ? 8.378   -19.153 -15.179 1.00 40.84 ? 626  VAL A C   1 
ATOM   139  O  O   . VAL A 1 40  ? 8.200   -20.360 -15.335 1.00 41.40 ? 626  VAL A O   1 
ATOM   140  C  CB  . VAL A 1 40  ? 10.629  -18.781 -16.212 1.00 42.34 ? 626  VAL A CB  1 
ATOM   141  C  CG1 . VAL A 1 40  ? 9.897   -18.206 -17.419 1.00 43.29 ? 626  VAL A CG1 1 
ATOM   142  C  CG2 . VAL A 1 40  ? 11.985  -18.120 -16.045 1.00 41.96 ? 626  VAL A CG2 1 
ATOM   143  N  N   . VAL A 1 41  ? 7.384   -18.270 -15.218 1.00 40.75 ? 627  VAL A N   1 
ATOM   144  C  CA  . VAL A 1 41  ? 5.992   -18.701 -15.302 1.00 40.96 ? 627  VAL A CA  1 
ATOM   145  C  C   . VAL A 1 41  ? 5.295   -18.244 -16.578 1.00 41.82 ? 627  VAL A C   1 
ATOM   146  O  O   . VAL A 1 41  ? 4.153   -18.622 -16.834 1.00 42.88 ? 627  VAL A O   1 
ATOM   147  C  CB  . VAL A 1 41  ? 5.176   -18.191 -14.099 1.00 41.08 ? 627  VAL A CB  1 
ATOM   148  C  CG1 . VAL A 1 41  ? 5.806   -18.659 -12.799 1.00 41.80 ? 627  VAL A CG1 1 
ATOM   149  C  CG2 . VAL A 1 41  ? 5.071   -16.676 -14.132 1.00 41.26 ? 627  VAL A CG2 1 
ATOM   150  N  N   . GLY A 1 42  ? 5.975   -17.430 -17.377 1.00 41.81 ? 628  GLY A N   1 
ATOM   151  C  CA  . GLY A 1 42  ? 5.384   -16.945 -18.609 1.00 43.06 ? 628  GLY A CA  1 
ATOM   152  C  C   . GLY A 1 42  ? 6.331   -16.157 -19.487 1.00 42.97 ? 628  GLY A C   1 
ATOM   153  O  O   . GLY A 1 42  ? 7.395   -15.722 -19.049 1.00 42.13 ? 628  GLY A O   1 
ATOM   154  N  N   . ALA A 1 43  ? 5.938   -15.984 -20.742 1.00 43.95 ? 629  ALA A N   1 
ATOM   155  C  CA  . ALA A 1 43  ? 6.689   -15.163 -21.678 1.00 44.48 ? 629  ALA A CA  1 
ATOM   156  C  C   . ALA A 1 43  ? 5.948   -13.851 -21.889 1.00 44.95 ? 629  ALA A C   1 
ATOM   157  O  O   . ALA A 1 43  ? 4.795   -13.845 -22.317 1.00 46.04 ? 629  ALA A O   1 
ATOM   158  C  CB  . ALA A 1 43  ? 6.886   -15.893 -22.999 1.00 44.97 ? 629  ALA A CB  1 
ATOM   159  N  N   . GLY A 1 44  ? 6.604   -12.741 -21.569 1.00 44.64 ? 630  GLY A N   1 
ATOM   160  C  CA  . GLY A 1 44  ? 5.994   -11.433 -21.718 1.00 44.92 ? 630  GLY A CA  1 
ATOM   161  C  C   . GLY A 1 44  ? 6.464   -10.731 -22.978 1.00 45.29 ? 630  GLY A C   1 
ATOM   162  O  O   . GLY A 1 44  ? 7.360   -11.216 -23.671 1.00 45.73 ? 630  GLY A O   1 
ATOM   163  N  N   . GLU A 1 45  ? 5.858   -9.584  -23.271 1.00 44.83 ? 631  GLU A N   1 
ATOM   164  C  CA  . GLU A 1 45  ? 6.208   -8.807  -24.454 1.00 44.88 ? 631  GLU A CA  1 
ATOM   165  C  C   . GLU A 1 45  ? 7.672   -8.377  -24.448 1.00 41.13 ? 631  GLU A C   1 
ATOM   166  O  O   . GLU A 1 45  ? 8.333   -8.374  -25.488 1.00 40.85 ? 631  GLU A O   1 
ATOM   167  C  CB  . GLU A 1 45  ? 5.312   -7.571  -24.565 1.00 49.15 ? 631  GLU A CB  1 
ATOM   168  C  CG  . GLU A 1 45  ? 5.694   -6.640  -25.707 1.00 53.13 ? 631  GLU A CG  1 
ATOM   169  C  CD  . GLU A 1 45  ? 4.721   -5.490  -25.888 1.00 56.89 ? 631  GLU A CD  1 
ATOM   170  O  OE1 . GLU A 1 45  ? 3.846   -5.299  -25.017 1.00 58.37 ? 631  GLU A OE1 1 
ATOM   171  O  OE2 . GLU A 1 45  ? 4.835   -4.774  -26.906 1.00 58.00 ? 631  GLU A OE2 1 
ATOM   172  N  N   . PHE A 1 46  ? 8.176   -8.023  -23.270 1.00 38.38 ? 632  PHE A N   1 
ATOM   173  C  CA  . PHE A 1 46  ? 9.505   -7.433  -23.152 1.00 37.10 ? 632  PHE A CA  1 
ATOM   174  C  C   . PHE A 1 46  ? 10.531  -8.375  -22.540 1.00 35.18 ? 632  PHE A C   1 
ATOM   175  O  O   . PHE A 1 46  ? 11.697  -8.016  -22.406 1.00 33.11 ? 632  PHE A O   1 
ATOM   176  C  CB  . PHE A 1 46  ? 9.441   -6.156  -22.314 1.00 37.77 ? 632  PHE A CB  1 
ATOM   177  C  CG  . PHE A 1 46  ? 8.666   -5.046  -22.961 1.00 38.24 ? 632  PHE A CG  1 
ATOM   178  C  CD1 . PHE A 1 46  ? 9.281   -4.185  -23.852 1.00 38.32 ? 632  PHE A CD1 1 
ATOM   179  C  CD2 . PHE A 1 46  ? 7.324   -4.862  -22.671 1.00 38.73 ? 632  PHE A CD2 1 
ATOM   180  C  CE1 . PHE A 1 46  ? 8.570   -3.162  -24.447 1.00 39.57 ? 632  PHE A CE1 1 
ATOM   181  C  CE2 . PHE A 1 46  ? 6.604   -3.842  -23.265 1.00 39.24 ? 632  PHE A CE2 1 
ATOM   182  C  CZ  . PHE A 1 46  ? 7.227   -2.989  -24.152 1.00 39.89 ? 632  PHE A CZ  1 
ATOM   183  N  N   . GLY A 1 47  ? 10.096  -9.569  -22.159 1.00 35.03 ? 633  GLY A N   1 
ATOM   184  C  CA  . GLY A 1 47  ? 10.976  -10.524 -21.510 1.00 36.12 ? 633  GLY A CA  1 
ATOM   185  C  C   . GLY A 1 47  ? 10.209  -11.538 -20.682 1.00 37.10 ? 633  GLY A C   1 
ATOM   186  O  O   . GLY A 1 47  ? 8.977   -11.543 -20.675 1.00 37.34 ? 633  GLY A O   1 
ATOM   187  N  N   . GLU A 1 48  ? 10.937  -12.397 -19.979 1.00 38.22 ? 634  GLU A N   1 
ATOM   188  C  CA  . GLU A 1 48  ? 10.314  -13.462 -19.200 1.00 40.04 ? 634  GLU A CA  1 
ATOM   189  C  C   . GLU A 1 48  ? 9.575   -12.926 -17.982 1.00 34.99 ? 634  GLU A C   1 
ATOM   190  O  O   . GLU A 1 48  ? 9.954   -11.905 -17.408 1.00 33.11 ? 634  GLU A O   1 
ATOM   191  C  CB  . GLU A 1 48  ? 11.364  -14.485 -18.757 1.00 47.19 ? 634  GLU A CB  1 
ATOM   192  C  CG  . GLU A 1 48  ? 11.726  -15.507 -19.825 1.00 54.13 ? 634  GLU A CG  1 
ATOM   193  C  CD  . GLU A 1 48  ? 12.987  -16.287 -19.490 1.00 60.36 ? 634  GLU A CD  1 
ATOM   194  O  OE1 . GLU A 1 48  ? 14.033  -15.652 -19.236 1.00 62.31 ? 634  GLU A OE1 1 
ATOM   195  O  OE2 . GLU A 1 48  ? 12.933  -17.537 -19.483 1.00 62.53 ? 634  GLU A OE2 1 
ATOM   196  N  N   . VAL A 1 49  ? 8.509   -13.622 -17.602 1.00 32.11 ? 635  VAL A N   1 
ATOM   197  C  CA  . VAL A 1 49  ? 7.813   -13.332 -16.362 1.00 30.46 ? 635  VAL A CA  1 
ATOM   198  C  C   . VAL A 1 49  ? 8.107   -14.458 -15.385 1.00 28.02 ? 635  VAL A C   1 
ATOM   199  O  O   . VAL A 1 49  ? 8.024   -15.640 -15.735 1.00 28.24 ? 635  VAL A O   1 
ATOM   200  C  CB  . VAL A 1 49  ? 6.299   -13.179 -16.571 1.00 32.93 ? 635  VAL A CB  1 
ATOM   201  C  CG1 . VAL A 1 49  ? 5.626   -12.742 -15.267 1.00 32.79 ? 635  VAL A CG1 1 
ATOM   202  C  CG2 . VAL A 1 49  ? 6.018   -12.180 -17.689 1.00 33.63 ? 635  VAL A CG2 1 
ATOM   203  N  N   . CYS A 1 50  ? 8.479   -14.083 -14.169 1.00 27.48 ? 636  CYS A N   1 
ATOM   204  C  CA  . CYS A 1 50  ? 8.870   -15.039 -13.148 1.00 27.41 ? 636  CYS A CA  1 
ATOM   205  C  C   . CYS A 1 50  ? 7.975   -14.907 -11.932 1.00 23.96 ? 636  CYS A C   1 
ATOM   206  O  O   . CYS A 1 50  ? 7.292   -13.904 -11.758 1.00 23.50 ? 636  CYS A O   1 
ATOM   207  C  CB  . CYS A 1 50  ? 10.332  -14.833 -12.729 1.00 31.18 ? 636  CYS A CB  1 
ATOM   208  S  SG  . CYS A 1 50  ? 11.566  -14.952 -14.053 1.00 36.58 ? 636  CYS A SG  1 
ATOM   209  N  N   . SER A 1 51  ? 7.977   -15.924 -11.086 1.00 23.01 ? 637  SER A N   1 
ATOM   210  C  CA  . SER A 1 51  ? 7.396   -15.781 -9.764  1.00 22.34 ? 637  SER A CA  1 
ATOM   211  C  C   . SER A 1 51  ? 8.525   -15.815 -8.748  1.00 20.40 ? 637  SER A C   1 
ATOM   212  O  O   . SER A 1 51  ? 9.616   -16.303 -9.040  1.00 22.23 ? 637  SER A O   1 
ATOM   213  C  CB  . SER A 1 51  ? 6.376   -16.876 -9.484  1.00 27.47 ? 637  SER A CB  1 
ATOM   214  O  OG  . SER A 1 51  ? 6.998   -18.142 -9.472  1.00 29.22 ? 637  SER A OG  1 
ATOM   215  N  N   . GLY A 1 52  ? 8.269   -15.288 -7.561  1.00 17.81 ? 638  GLY A N   1 
ATOM   216  C  CA  . GLY A 1 52  ? 9.288   -15.258 -6.533  1.00 18.38 ? 638  GLY A CA  1 
ATOM   217  C  C   . GLY A 1 52  ? 8.774   -14.606 -5.271  1.00 16.00 ? 638  GLY A C   1 
ATOM   218  O  O   . GLY A 1 52  ? 7.566   -14.589 -5.008  1.00 16.12 ? 638  GLY A O   1 
ATOM   219  N  N   . ARG A 1 53  ? 9.695   -14.059 -4.492  1.00 16.76 ? 639  ARG A N   1 
ATOM   220  C  CA  . ARG A 1 53  ? 9.383   -13.492 -3.204  1.00 15.79 ? 639  ARG A CA  1 
ATOM   221  C  C   . ARG A 1 53  ? 10.077  -12.144 -3.030  1.00 15.13 ? 639  ARG A C   1 
ATOM   222  O  O   . ARG A 1 53  ? 11.083  -11.944 -3.546  1.00 16.79 ? 639  ARG A O   1 
ATOM   223  C  CB  . ARG A 1 53  ? 9.802   -14.435 -2.068  1.00 18.51 ? 639  ARG A CB  1 
ATOM   224  C  CG  . ARG A 1 53  ? 9.261   -15.852 -2.180  1.00 23.08 ? 639  ARG A CG  1 
ATOM   225  C  CD  . ARG A 1 53  ? 7.860   -15.960 -1.673  1.00 27.30 ? 639  ARG A CD  1 
ATOM   226  N  NE  . ARG A 1 53  ? 7.832   -15.931 -0.233  1.00 30.52 ? 639  ARG A NE  1 
ATOM   227  C  CZ  . ARG A 1 53  ? 6.734   -15.984 0.473   1.00 34.43 ? 639  ARG A CZ  1 
ATOM   228  N  NH1 . ARG A 1 53  ? 5.578   -16.095 -0.122  1.00 36.64 ? 639  ARG A NH1 1 
ATOM   229  N  NH2 . ARG A 1 53  ? 6.797   -15.929 1.786   1.00 35.35 ? 639  ARG A NH2 1 
ATOM   230  N  N   . LEU A 1 54  ? 9.427   -11.263 -2.295  1.00 13.77 ? 640  LEU A N   1 
ATOM   231  C  CA  . LEU A 1 54  ? 9.972   -9.948  -1.997  1.00 13.94 ? 640  LEU A CA  1 
ATOM   232  C  C   . LEU A 1 54  ? 9.971   -9.757  -0.498  1.00 13.47 ? 640  LEU A C   1 
ATOM   233  O  O   . LEU A 1 54  ? 8.940   -9.965  0.151   1.00 14.32 ? 640  LEU A O   1 
ATOM   234  C  CB  . LEU A 1 54  ? 9.146   -8.841  -2.658  1.00 14.14 ? 640  LEU A CB  1 
ATOM   235  C  CG  . LEU A 1 54  ? 9.517   -7.398  -2.288  1.00 13.16 ? 640  LEU A CG  1 
ATOM   236  C  CD1 . LEU A 1 54  ? 10.915  -7.066  -2.776  1.00 15.20 ? 640  LEU A CD1 1 
ATOM   237  C  CD2 . LEU A 1 54  ? 8.487   -6.414  -2.825  1.00 14.44 ? 640  LEU A CD2 1 
ATOM   238  N  N   . LYS A 1 55  ? 11.122  -9.376  0.047   1.00 13.32 ? 641  LYS A N   1 
ATOM   239  C  CA  . LYS A 1 55  ? 11.212  -9.012  1.447   1.00 14.37 ? 641  LYS A CA  1 
ATOM   240  C  C   . LYS A 1 55  ? 10.981  -7.512  1.578   1.00 14.83 ? 641  LYS A C   1 
ATOM   241  O  O   . LYS A 1 55  ? 11.720  -6.705  1.008   1.00 15.98 ? 641  LYS A O   1 
ATOM   242  C  CB  . LYS A 1 55  ? 12.570  -9.408  2.023   1.00 16.65 ? 641  LYS A CB  1 
ATOM   243  C  CG  . LYS A 1 55  ? 12.613  -9.390  3.557   1.00 20.53 ? 641  LYS A CG  1 
ATOM   244  C  CD  . LYS A 1 55  ? 13.729  -10.290 4.113   1.00 21.77 ? 641  LYS A CD  1 
ATOM   245  C  CE  . LYS A 1 55  ? 13.682  -10.421 5.642   1.00 19.98 ? 641  LYS A CE  1 
ATOM   246  N  NZ  . LYS A 1 55  ? 12.608  -11.339 6.153   1.00 17.69 ? 641  LYS A NZ  1 
ATOM   247  N  N   . LEU A 1 56  ? 9.955   -7.159  2.293   1.00 14.05 ? 642  LEU A N   1 
ATOM   248  C  CA  . LEU A 1 56  ? 9.573   -5.755  2.524   1.00 14.55 ? 642  LEU A CA  1 
ATOM   249  C  C   . LEU A 1 56  ? 10.455  -5.102  3.595   1.00 15.27 ? 642  LEU A C   1 
ATOM   250  O  O   . LEU A 1 56  ? 11.127  -5.764  4.288   1.00 15.70 ? 642  LEU A O   1 
ATOM   251  C  CB  . LEU A 1 56  ? 8.116   -5.656  2.898   1.00 15.27 ? 642  LEU A CB  1 
ATOM   252  C  CG  . LEU A 1 56  ? 7.151   -6.256  1.881   1.00 16.54 ? 642  LEU A CG  1 
ATOM   253  C  CD1 . LEU A 1 56  ? 5.755   -6.322  2.413   1.00 18.81 ? 642  LEU A CD1 1 
ATOM   254  C  CD2 . LEU A 1 56  ? 7.203   -5.524  0.546   1.00 17.69 ? 642  LEU A CD2 1 
ATOM   255  N  N   . PRO A 1 57  ? 10.456  -3.773  3.680   1.00 16.35 ? 643  PRO A N   1 
ATOM   256  C  CA  . PRO A 1 57  ? 11.333  -3.118  4.664   1.00 17.09 ? 643  PRO A CA  1 
ATOM   257  C  C   . PRO A 1 57  ? 11.026  -3.551  6.098   1.00 16.74 ? 643  PRO A C   1 
ATOM   258  O  O   . PRO A 1 57  ? 11.920  -3.554  6.944   1.00 19.04 ? 643  PRO A O   1 
ATOM   259  C  CB  . PRO A 1 57  ? 11.032  -1.629  4.458   1.00 17.83 ? 643  PRO A CB  1 
ATOM   260  C  CG  . PRO A 1 57  ? 10.606  -1.551  3.015   1.00 17.55 ? 643  PRO A CG  1 
ATOM   261  C  CD  . PRO A 1 57  ? 9.793   -2.791  2.804   1.00 17.15 ? 643  PRO A CD  1 
ATOM   262  N  N   . SER A 1 58  ? 9.772   -3.915  6.344   1.00 16.16 ? 644  SER A N   1 
ATOM   263  C  CA  . SER A 1 58  ? 9.311   -4.445  7.631   1.00 16.37 ? 644  SER A CA  1 
ATOM   264  C  C   . SER A 1 58  ? 9.787   -5.867  7.913   1.00 15.72 ? 644  SER A C   1 
ATOM   265  O  O   . SER A 1 58  ? 9.482   -6.407  8.975   1.00 18.41 ? 644  SER A O   1 
ATOM   266  C  CB  . SER A 1 58  ? 7.791   -4.460  7.661   1.00 18.38 ? 644  SER A CB  1 
ATOM   267  O  OG  . SER A 1 58  ? 7.336   -5.408  6.704   1.00 18.62 ? 644  SER A OG  1 
ATOM   268  N  N   . LYS A 1 59  ? 10.477  -6.467  6.936   1.00 15.22 ? 645  LYS A N   1 
ATOM   269  C  CA  . LYS A 1 59  ? 10.966  -7.863  6.952   1.00 14.53 ? 645  LYS A CA  1 
ATOM   270  C  C   . LYS A 1 59  ? 9.899   -8.884  6.553   1.00 15.50 ? 645  LYS A C   1 
ATOM   271  O  O   . LYS A 1 59  ? 10.207  -10.065 6.378   1.00 15.75 ? 645  LYS A O   1 
ATOM   272  C  CB  . LYS A 1 59  ? 11.550  -8.270  8.316   1.00 17.02 ? 645  LYS A CB  1 
ATOM   273  C  CG  . LYS A 1 59  ? 12.576  -7.315  8.890   1.00 18.76 ? 645  LYS A CG  1 
ATOM   274  C  CD  . LYS A 1 59  ? 13.721  -7.045  7.928   1.00 20.44 ? 645  LYS A CD  1 
ATOM   275  C  CE  . LYS A 1 59  ? 14.843  -6.313  8.651   1.00 23.92 ? 645  LYS A CE  1 
ATOM   276  N  NZ  . LYS A 1 59  ? 15.895  -5.843  7.715   1.00 26.02 ? 645  LYS A NZ  1 
ATOM   277  N  N   . LYS A 1 60  ? 8.649   -8.453  6.413   1.00 14.75 ? 646  LYS A N   1 
ATOM   278  C  CA  . LYS A 1 60  ? 7.611   -9.351  5.904   1.00 16.18 ? 646  LYS A CA  1 
ATOM   279  C  C   . LYS A 1 60  ? 7.975   -9.820  4.500   1.00 14.97 ? 646  LYS A C   1 
ATOM   280  O  O   . LYS A 1 60  ? 8.469   -9.029  3.693   1.00 16.50 ? 646  LYS A O   1 
ATOM   281  C  CB  . LYS A 1 60  ? 6.254   -8.653  5.889   1.00 17.34 ? 646  LYS A CB  1 
ATOM   282  C  CG  . LYS A 1 60  ? 5.099   -9.552  5.480   1.00 20.08 ? 646  LYS A CG  1 
ATOM   283  C  CD  . LYS A 1 60  ? 3.777   -8.827  5.622   1.00 25.33 ? 646  LYS A CD  1 
ATOM   284  C  CE  . LYS A 1 60  ? 2.623   -9.651  5.076   1.00 30.90 ? 646  LYS A CE  1 
ATOM   285  N  NZ  . LYS A 1 60  ? 1.338   -8.897  5.158   1.00 35.10 ? 646  LYS A NZ  1 
ATOM   286  N  N   . GLU A 1 61  ? 7.746   -11.098 4.218   1.00 14.60 ? 647  GLU A N   1 
ATOM   287  C  CA  . GLU A 1 61  ? 8.017   -11.662 2.905   1.00 15.30 ? 647  GLU A CA  1 
ATOM   288  C  C   . GLU A 1 61  ? 6.710   -11.987 2.193   1.00 15.34 ? 647  GLU A C   1 
ATOM   289  O  O   . GLU A 1 61  ? 5.843   -12.647 2.761   1.00 17.13 ? 647  GLU A O   1 
ATOM   290  C  CB  . GLU A 1 61  ? 8.879   -12.922 3.031   1.00 16.77 ? 647  GLU A CB  1 
ATOM   291  C  CG  . GLU A 1 61  ? 10.304  -12.608 3.464   1.00 19.17 ? 647  GLU A CG  1 
ATOM   292  C  CD  . GLU A 1 61  ? 11.062  -13.802 4.014   1.00 21.25 ? 647  GLU A CD  1 
ATOM   293  O  OE1 . GLU A 1 61  ? 10.661  -14.950 3.730   1.00 23.50 ? 647  GLU A OE1 1 
ATOM   294  O  OE2 . GLU A 1 61  ? 12.074  -13.586 4.721   1.00 21.30 ? 647  GLU A OE2 1 
ATOM   295  N  N   . ILE A 1 62  ? 6.574   -11.534 0.956   1.00 14.66 ? 648  ILE A N   1 
ATOM   296  C  CA  . ILE A 1 62  ? 5.369   -11.737 0.170   1.00 14.26 ? 648  ILE A CA  1 
ATOM   297  C  C   . ILE A 1 62  ? 5.709   -12.401 -1.155  1.00 14.66 ? 648  ILE A C   1 
ATOM   298  O  O   . ILE A 1 62  ? 6.762   -12.301 -1.631  1.00 14.97 ? 648  ILE A O   1 
ATOM   299  C  CB  . ILE A 1 62  ? 4.600   -10.416 -0.078  1.00 15.17 ? 648  ILE A CB  1 
ATOM   300  C  CG1 . ILE A 1 62  ? 5.470   -9.408  -0.821  1.00 14.71 ? 648  ILE A CG1 1 
ATOM   301  C  CG2 . ILE A 1 62  ? 4.125   -9.873  1.234   1.00 17.17 ? 648  ILE A CG2 1 
ATOM   302  C  CD1 . ILE A 1 62  ? 4.711   -8.185  -1.327  1.00 15.84 ? 648  ILE A CD1 1 
ATOM   303  N  N   . SER A 1 63  ? 4.713   -13.105 -1.694  1.00 15.10 ? 649  SER A N   1 
ATOM   304  C  CA  . SER A 1 63  ? 4.851   -13.658 -3.031  1.00 15.54 ? 649  SER A CA  1 
ATOM   305  C  C   . SER A 1 63  ? 4.642   -12.564 -4.052  1.00 14.66 ? 649  SER A C   1 
ATOM   306  O  O   . SER A 1 63  ? 3.766   -11.703 -3.885  1.00 16.77 ? 649  SER A O   1 
ATOM   307  C  CB  . SER A 1 63  ? 3.852   -14.782 -3.273  1.00 18.90 ? 649  SER A CB  1 
ATOM   308  O  OG  . SER A 1 63  ? 4.168   -15.913 -2.481  1.00 22.49 ? 649  SER A OG  1 
ATOM   309  N  N   . VAL A 1 64  ? 5.452   -12.594 -5.102  1.00 13.57 ? 650  VAL A N   1 
ATOM   310  C  CA  . VAL A 1 64  ? 5.348   -11.595 -6.154  1.00 13.45 ? 650  VAL A CA  1 
ATOM   311  C  C   . VAL A 1 64  ? 5.485   -12.209 -7.533  1.00 13.15 ? 650  VAL A C   1 
ATOM   312  O  O   . VAL A 1 64  ? 6.035   -13.305 -7.692  1.00 14.24 ? 650  VAL A O   1 
ATOM   313  C  CB  . VAL A 1 64  ? 6.423   -10.501 -6.007  1.00 12.72 ? 650  VAL A CB  1 
ATOM   314  C  CG1 . VAL A 1 64  ? 6.149   -9.635  -4.784  1.00 14.05 ? 650  VAL A CG1 1 
ATOM   315  C  CG2 . VAL A 1 64  ? 7.821   -11.119 -5.915  1.00 14.01 ? 650  VAL A CG2 1 
ATOM   316  N  N   . ALA A 1 65  ? 4.964   -11.486 -8.519  1.00 13.79 ? 651  ALA A N   1 
ATOM   317  C  CA  . ALA A 1 65  ? 5.248   -11.763 -9.915  1.00 14.44 ? 651  ALA A CA  1 
ATOM   318  C  C   . ALA A 1 65  ? 6.330   -10.802 -10.351 1.00 14.89 ? 651  ALA A C   1 
ATOM   319  O  O   . ALA A 1 65  ? 6.356   -9.652  -9.910  1.00 14.55 ? 651  ALA A O   1 
ATOM   320  C  CB  . ALA A 1 65  ? 4.015   -11.602 -10.767 1.00 16.11 ? 651  ALA A CB  1 
ATOM   321  N  N   . ILE A 1 66  ? 7.242   -11.270 -11.191 1.00 16.58 ? 652  ILE A N   1 
ATOM   322  C  CA  . ILE A 1 66  ? 8.363   -10.451 -11.610 1.00 20.20 ? 652  ILE A CA  1 
ATOM   323  C  C   . ILE A 1 66  ? 8.500   -10.450 -13.120 1.00 21.49 ? 652  ILE A C   1 
ATOM   324  O  O   . ILE A 1 66  ? 8.806   -11.474 -13.713 1.00 23.84 ? 652  ILE A O   1 
ATOM   325  C  CB  . ILE A 1 66  ? 9.674   -10.948 -10.990 1.00 22.70 ? 652  ILE A CB  1 
ATOM   326  C  CG1 . ILE A 1 66  ? 9.546   -11.026 -9.468  1.00 22.83 ? 652  ILE A CG1 1 
ATOM   327  C  CG2 . ILE A 1 66  ? 10.829  -10.044 -11.404 1.00 24.88 ? 652  ILE A CG2 1 
ATOM   328  C  CD1 . ILE A 1 66  ? 10.449  -12.054 -8.839  1.00 24.36 ? 652  ILE A CD1 1 
ATOM   329  N  N   . LYS A 1 67  ? 8.253   -9.301  -13.736 1.00 20.23 ? 653  LYS A N   1 
ATOM   330  C  CA  . LYS A 1 67  ? 8.519   -9.132  -15.155 1.00 21.90 ? 653  LYS A CA  1 
ATOM   331  C  C   . LYS A 1 67  ? 9.930   -8.634  -15.351 1.00 20.39 ? 653  LYS A C   1 
ATOM   332  O  O   . LYS A 1 67  ? 10.350  -7.669  -14.711 1.00 20.27 ? 653  LYS A O   1 
ATOM   333  C  CB  . LYS A 1 67  ? 7.537   -8.158  -15.786 1.00 26.40 ? 653  LYS A CB  1 
ATOM   334  C  CG  . LYS A 1 67  ? 6.190   -8.766  -16.100 1.00 32.84 ? 653  LYS A CG  1 
ATOM   335  C  CD  . LYS A 1 67  ? 5.207   -7.677  -16.424 1.00 37.36 ? 653  LYS A CD  1 
ATOM   336  C  CE  . LYS A 1 67  ? 5.455   -7.091  -17.782 1.00 40.06 ? 653  LYS A CE  1 
ATOM   337  N  NZ  . LYS A 1 67  ? 4.204   -7.111  -18.577 1.00 42.34 ? 653  LYS A NZ  1 
ATOM   338  N  N   . THR A 1 68  ? 10.661  -9.292  -16.243 1.00 21.01 ? 654  THR A N   1 
ATOM   339  C  CA  . THR A 1 68  ? 12.018  -8.885  -16.549 1.00 22.63 ? 654  THR A CA  1 
ATOM   340  C  C   . THR A 1 68  ? 12.096  -8.299  -17.949 1.00 22.85 ? 654  THR A C   1 
ATOM   341  O  O   . THR A 1 68  ? 11.343  -8.676  -18.849 1.00 24.46 ? 654  THR A O   1 
ATOM   342  C  CB  . THR A 1 68  ? 13.010  -10.058 -16.431 1.00 24.03 ? 654  THR A CB  1 
ATOM   343  O  OG1 . THR A 1 68  ? 12.757  -11.007 -17.473 1.00 26.18 ? 654  THR A OG1 1 
ATOM   344  C  CG2 . THR A 1 68  ? 12.873  -10.737 -15.071 1.00 25.26 ? 654  THR A CG2 1 
ATOM   345  N  N   . LEU A 1 69  ? 13.008  -7.354  -18.115 1.00 22.56 ? 655  LEU A N   1 
ATOM   346  C  CA  . LEU A 1 69  ? 13.305  -6.798  -19.421 1.00 23.36 ? 655  LEU A CA  1 
ATOM   347  C  C   . LEU A 1 69  ? 14.423  -7.622  -20.046 1.00 23.97 ? 655  LEU A C   1 
ATOM   348  O  O   . LEU A 1 69  ? 15.470  -7.807  -19.435 1.00 23.36 ? 655  LEU A O   1 
ATOM   349  C  CB  . LEU A 1 69  ? 13.705  -5.332  -19.288 1.00 23.65 ? 655  LEU A CB  1 
ATOM   350  C  CG  . LEU A 1 69  ? 14.072  -4.542  -20.539 1.00 24.39 ? 655  LEU A CG  1 
ATOM   351  C  CD1 . LEU A 1 69  ? 12.895  -4.485  -21.505 1.00 25.17 ? 655  LEU A CD1 1 
ATOM   352  C  CD2 . LEU A 1 69  ? 14.507  -3.147  -20.114 1.00 25.19 ? 655  LEU A CD2 1 
ATOM   353  N  N   . LYS A 1 70  ? 14.193  -8.130  -21.253 1.00 25.57 ? 656  LYS A N   1 
ATOM   354  C  CA  . LYS A 1 70  ? 15.147  -9.026  -21.908 1.00 27.90 ? 656  LYS A CA  1 
ATOM   355  C  C   . LYS A 1 70  ? 16.521  -8.387  -22.098 1.00 26.55 ? 656  LYS A C   1 
ATOM   356  O  O   . LYS A 1 70  ? 16.627  -7.178  -22.303 1.00 24.78 ? 656  LYS A O   1 
ATOM   357  C  CB  . LYS A 1 70  ? 14.595  -9.471  -23.265 1.00 32.63 ? 656  LYS A CB  1 
ATOM   358  C  CG  . LYS A 1 70  ? 14.510  -8.343  -24.270 1.00 37.10 ? 656  LYS A CG  1 
ATOM   359  C  CD  . LYS A 1 70  ? 13.700  -8.725  -25.491 1.00 41.21 ? 656  LYS A CD  1 
ATOM   360  C  CE  . LYS A 1 70  ? 13.023  -7.495  -26.051 1.00 43.82 ? 656  LYS A CE  1 
ATOM   361  N  NZ  . LYS A 1 70  ? 12.368  -6.724  -24.954 1.00 45.27 ? 656  LYS A NZ  1 
ATOM   362  N  N   A VAL A 1 71  ? 17.565  -9.207  -22.034 0.22 26.78 ? 657  VAL A N   1 
ATOM   363  N  N   B VAL A 1 71  ? 17.572  -9.198  -22.011 0.78 26.17 ? 657  VAL A N   1 
ATOM   364  C  CA  A VAL A 1 71  ? 18.931  -8.742  -22.251 0.22 27.05 ? 657  VAL A CA  1 
ATOM   365  C  CA  B VAL A 1 71  ? 18.915  -8.685  -22.235 0.78 27.36 ? 657  VAL A CA  1 
ATOM   366  C  C   A VAL A 1 71  ? 19.090  -8.204  -23.675 0.22 26.90 ? 657  VAL A C   1 
ATOM   367  C  C   B VAL A 1 71  ? 19.006  -8.136  -23.653 0.78 27.24 ? 657  VAL A C   1 
ATOM   368  O  O   A VAL A 1 71  ? 18.559  -8.785  -24.622 0.22 27.16 ? 657  VAL A O   1 
ATOM   369  O  O   B VAL A 1 71  ? 18.342  -8.628  -24.567 0.78 27.48 ? 657  VAL A O   1 
ATOM   370  C  CB  A VAL A 1 71  ? 19.950  -9.875  -22.004 0.22 27.61 ? 657  VAL A CB  1 
ATOM   371  C  CB  B VAL A 1 71  ? 20.005  -9.760  -22.017 0.78 29.93 ? 657  VAL A CB  1 
ATOM   372  C  CG1 A VAL A 1 71  ? 21.373  -9.346  -22.054 0.22 27.11 ? 657  VAL A CG1 1 
ATOM   373  C  CG1 B VAL A 1 71  ? 19.929  -10.322 -20.604 0.78 32.04 ? 657  VAL A CG1 1 
ATOM   374  C  CG2 A VAL A 1 71  ? 19.681  -10.540 -20.662 0.22 28.44 ? 657  VAL A CG2 1 
ATOM   375  C  CG2 B VAL A 1 71  ? 19.892  -10.870 -23.054 0.78 29.85 ? 657  VAL A CG2 1 
ATOM   376  N  N   . GLY A 1 72  ? 19.807  -7.092  -23.824 1.00 26.41 ? 658  GLY A N   1 
ATOM   377  C  CA  . GLY A 1 72  ? 19.996  -6.489  -25.130 1.00 27.29 ? 658  GLY A CA  1 
ATOM   378  C  C   . GLY A 1 72  ? 18.841  -5.601  -25.554 1.00 28.45 ? 658  GLY A C   1 
ATOM   379  O  O   . GLY A 1 72  ? 18.677  -5.300  -26.738 1.00 30.26 ? 658  GLY A O   1 
ATOM   380  N  N   . TYR A 1 73  ? 18.038  -5.181  -24.584 1.00 27.48 ? 659  TYR A N   1 
ATOM   381  C  CA  . TYR A 1 73  ? 16.925  -4.276  -24.841 1.00 26.66 ? 659  TYR A CA  1 
ATOM   382  C  C   . TYR A 1 73  ? 17.408  -2.963  -25.442 1.00 29.08 ? 659  TYR A C   1 
ATOM   383  O  O   . TYR A 1 73  ? 18.527  -2.522  -25.175 1.00 30.57 ? 659  TYR A O   1 
ATOM   384  C  CB  . TYR A 1 73  ? 16.153  -3.993  -23.548 1.00 25.24 ? 659  TYR A CB  1 
ATOM   385  C  CG  . TYR A 1 73  ? 16.993  -3.328  -22.480 1.00 24.70 ? 659  TYR A CG  1 
ATOM   386  C  CD1 . TYR A 1 73  ? 17.103  -1.944  -22.410 1.00 24.71 ? 659  TYR A CD1 1 
ATOM   387  C  CD2 . TYR A 1 73  ? 17.678  -4.086  -21.541 1.00 25.55 ? 659  TYR A CD2 1 
ATOM   388  C  CE1 . TYR A 1 73  ? 17.869  -1.338  -21.444 1.00 26.60 ? 659  TYR A CE1 1 
ATOM   389  C  CE2 . TYR A 1 73  ? 18.453  -3.486  -20.568 1.00 26.28 ? 659  TYR A CE2 1 
ATOM   390  C  CZ  . TYR A 1 73  ? 18.542  -2.111  -20.523 1.00 27.87 ? 659  TYR A CZ  1 
ATOM   391  O  OH  . TYR A 1 73  ? 19.309  -1.512  -19.552 1.00 31.60 ? 659  TYR A OH  1 
ATOM   392  N  N   . THR A 1 74  ? 16.555  -2.341  -26.249 1.00 31.52 ? 660  THR A N   1 
ATOM   393  C  CA  . THR A 1 74  ? 16.802  -0.989  -26.733 1.00 33.66 ? 660  THR A CA  1 
ATOM   394  C  C   . THR A 1 74  ? 16.312  0.024   -25.704 1.00 35.56 ? 660  THR A C   1 
ATOM   395  O  O   . THR A 1 74  ? 15.532  -0.316  -24.813 1.00 35.20 ? 660  THR A O   1 
ATOM   396  C  CB  . THR A 1 74  ? 16.085  -0.717  -28.065 1.00 35.47 ? 660  THR A CB  1 
ATOM   397  O  OG1 . THR A 1 74  ? 14.671  -0.866  -27.881 1.00 36.87 ? 660  THR A OG1 1 
ATOM   398  C  CG2 . THR A 1 74  ? 16.559  -1.678  -29.149 1.00 35.50 ? 660  THR A CG2 1 
ATOM   399  N  N   . GLU A 1 75  ? 16.749  1.273   -25.836 1.00 37.86 ? 661  GLU A N   1 
ATOM   400  C  CA  . GLU A 1 75  ? 16.295  2.325   -24.932 1.00 40.27 ? 661  GLU A CA  1 
ATOM   401  C  C   . GLU A 1 75  ? 14.787  2.539   -25.039 1.00 39.93 ? 661  GLU A C   1 
ATOM   402  O  O   . GLU A 1 75  ? 14.129  2.841   -24.042 1.00 38.60 ? 661  GLU A O   1 
ATOM   403  C  CB  . GLU A 1 75  ? 17.030  3.639   -25.205 1.00 43.35 ? 661  GLU A CB  1 
ATOM   404  C  CG  . GLU A 1 75  ? 18.197  3.893   -24.263 1.00 47.17 ? 661  GLU A CG  1 
ATOM   405  C  CD  . GLU A 1 75  ? 17.838  3.645   -22.804 1.00 49.42 ? 661  GLU A CD  1 
ATOM   406  O  OE1 . GLU A 1 75  ? 16.910  4.304   -22.292 1.00 50.47 ? 661  GLU A OE1 1 
ATOM   407  O  OE2 . GLU A 1 75  ? 18.490  2.790   -22.168 1.00 50.28 ? 661  GLU A OE2 1 
ATOM   408  N  N   . LYS A 1 76  ? 14.241  2.370   -26.240 1.00 39.68 ? 662  LYS A N   1 
ATOM   409  C  CA  . LYS A 1 76  ? 12.803  2.511   -26.433 1.00 39.44 ? 662  LYS A CA  1 
ATOM   410  C  C   . LYS A 1 76  ? 12.050  1.394   -25.708 1.00 37.19 ? 662  LYS A C   1 
ATOM   411  O  O   . LYS A 1 76  ? 11.027  1.644   -25.068 1.00 37.36 ? 662  LYS A O   1 
ATOM   412  C  CB  . LYS A 1 76  ? 12.448  2.521   -27.921 1.00 42.44 ? 662  LYS A CB  1 
ATOM   413  C  CG  . LYS A 1 76  ? 10.955  2.555   -28.189 1.00 46.21 ? 662  LYS A CG  1 
ATOM   414  C  CD  . LYS A 1 76  ? 10.656  2.864   -29.645 1.00 49.76 ? 662  LYS A CD  1 
ATOM   415  C  CE  . LYS A 1 76  ? 9.449   3.787   -29.777 1.00 53.07 ? 662  LYS A CE  1 
ATOM   416  N  NZ  . LYS A 1 76  ? 9.743   5.183   -29.334 1.00 54.85 ? 662  LYS A NZ  1 
ATOM   417  N  N   . GLN A 1 77  ? 12.560  0.167   -25.799 1.00 34.60 ? 663  GLN A N   1 
ATOM   418  C  CA  . GLN A 1 77  ? 11.947  -0.957  -25.088 1.00 32.55 ? 663  GLN A CA  1 
ATOM   419  C  C   . GLN A 1 77  ? 11.954  -0.734  -23.581 1.00 30.88 ? 663  GLN A C   1 
ATOM   420  O  O   . GLN A 1 77  ? 10.975  -1.028  -22.907 1.00 30.70 ? 663  GLN A O   1 
ATOM   421  C  CB  . GLN A 1 77  ? 12.649  -2.275  -25.426 1.00 33.50 ? 663  GLN A CB  1 
ATOM   422  C  CG  . GLN A 1 77  ? 12.342  -2.763  -26.834 1.00 36.58 ? 663  GLN A CG  1 
ATOM   423  C  CD  . GLN A 1 77  ? 13.189  -3.947  -27.250 1.00 39.28 ? 663  GLN A CD  1 
ATOM   424  O  OE1 . GLN A 1 77  ? 14.361  -4.047  -26.888 1.00 39.50 ? 663  GLN A OE1 1 
ATOM   425  N  NE2 . GLN A 1 77  ? 12.604  -4.844  -28.035 1.00 40.91 ? 663  GLN A NE2 1 
ATOM   426  N  N   . ARG A 1 78  ? 13.058  -0.205  -23.065 1.00 30.04 ? 664  ARG A N   1 
ATOM   427  C  CA  . ARG A 1 78  ? 13.160  0.118   -21.649 1.00 30.29 ? 664  ARG A CA  1 
ATOM   428  C  C   . ARG A 1 78  ? 12.099  1.142   -21.251 1.00 31.27 ? 664  ARG A C   1 
ATOM   429  O  O   . ARG A 1 78  ? 11.472  1.020   -20.204 1.00 29.58 ? 664  ARG A O   1 
ATOM   430  C  CB  . ARG A 1 78  ? 14.555  0.647   -21.315 1.00 30.92 ? 664  ARG A CB  1 
ATOM   431  C  CG  . ARG A 1 78  ? 14.763  0.919   -19.838 1.00 33.60 ? 664  ARG A CG  1 
ATOM   432  C  CD  . ARG A 1 78  ? 16.038  1.703   -19.595 1.00 38.01 ? 664  ARG A CD  1 
ATOM   433  N  NE  . ARG A 1 78  ? 16.387  1.716   -18.182 1.00 41.98 ? 664  ARG A NE  1 
ATOM   434  C  CZ  . ARG A 1 78  ? 15.995  2.653   -17.324 1.00 44.51 ? 664  ARG A CZ  1 
ATOM   435  N  NH1 . ARG A 1 78  ? 15.232  3.658   -17.737 1.00 45.03 ? 664  ARG A NH1 1 
ATOM   436  N  NH2 . ARG A 1 78  ? 16.362  2.580   -16.052 1.00 45.06 ? 664  ARG A NH2 1 
ATOM   437  N  N   . ARG A 1 79  ? 11.899  2.162   -22.069 1.00 34.06 ? 665  ARG A N   1 
ATOM   438  C  CA  . ARG A 1 79  ? 10.868  3.160   -21.831 1.00 36.02 ? 665  ARG A CA  1 
ATOM   439  C  C   . ARG A 1 79  ? 9.466   2.628   -21.845 1.00 34.62 ? 665  ARG A C   1 
ATOM   440  O  O   . ARG A 1 79  ? 8.692   2.964   -21.001 1.00 34.04 ? 665  ARG A O   1 
ATOM   441  C  CB  . ARG A 1 79  ? 10.899  4.213   -22.942 1.00 39.75 ? 665  ARG A CB  1 
ATOM   442  C  CG  . ARG A 1 79  ? 11.932  5.279   -22.795 1.00 45.57 ? 665  ARG A CG  1 
ATOM   443  C  CD  . ARG A 1 79  ? 11.889  6.235   -24.008 1.00 50.32 ? 665  ARG A CD  1 
ATOM   444  N  NE  . ARG A 1 79  ? 13.152  6.924   -24.152 1.00 54.83 ? 665  ARG A NE  1 
ATOM   445  C  CZ  . ARG A 1 79  ? 13.712  7.577   -23.146 1.00 57.67 ? 665  ARG A CZ  1 
ATOM   446  N  NH1 . ARG A 1 79  ? 13.096  7.608   -21.983 1.00 58.49 ? 665  ARG A NH1 1 
ATOM   447  N  NH2 . ARG A 1 79  ? 14.864  8.193   -23.293 1.00 58.25 ? 665  ARG A NH2 1 
ATOM   448  N  N   . ASP A 1 80  ? 9.149   1.798   -22.802 1.00 33.88 ? 666  ASP A N   1 
ATOM   449  C  CA  . ASP A 1 80  ? 7.800   1.262   -22.912 1.00 34.42 ? 666  ASP A CA  1 
ATOM   450  C  C   . ASP A 1 80  ? 7.552   0.245   -21.804 1.00 30.76 ? 666  ASP A C   1 
ATOM   451  O  O   . ASP A 1 80  ? 6.457   0.175   -21.247 1.00 30.58 ? 666  ASP A O   1 
ATOM   452  C  CB  . ASP A 1 80  ? 7.574   0.640   -24.292 1.00 37.09 ? 666  ASP A CB  1 
ATOM   453  C  CG  . ASP A 1 80  ? 7.620   1.671   -25.411 1.00 40.66 ? 666  ASP A CG  1 
ATOM   454  O  OD1 . ASP A 1 80  ? 7.509   2.877   -25.108 1.00 41.81 ? 666  ASP A OD1 1 
ATOM   455  O  OD2 . ASP A 1 80  ? 7.767   1.280   -26.591 1.00 41.75 ? 666  ASP A OD2 1 
ATOM   456  N  N   . PHE A 1 81  ? 8.585   -0.526  -21.477 1.00 26.82 ? 667  PHE A N   1 
ATOM   457  C  CA  . PHE A 1 81  ? 8.516   -1.483  -20.378 1.00 24.46 ? 667  PHE A CA  1 
ATOM   458  C  C   . PHE A 1 81  ? 8.190   -0.774  -19.066 1.00 23.00 ? 667  PHE A C   1 
ATOM   459  O  O   . PHE A 1 81  ? 7.202   -1.087  -18.399 1.00 23.30 ? 667  PHE A O   1 
ATOM   460  C  CB  . PHE A 1 81  ? 9.838   -2.238  -20.255 1.00 22.78 ? 667  PHE A CB  1 
ATOM   461  C  CG  . PHE A 1 81  ? 9.849   -3.289  -19.180 1.00 22.46 ? 667  PHE A CG  1 
ATOM   462  C  CD1 . PHE A 1 81  ? 9.023   -4.402  -19.266 1.00 23.92 ? 667  PHE A CD1 1 
ATOM   463  C  CD2 . PHE A 1 81  ? 10.706  -3.177  -18.093 1.00 22.45 ? 667  PHE A CD2 1 
ATOM   464  C  CE1 . PHE A 1 81  ? 9.049   -5.380  -18.283 1.00 24.81 ? 667  PHE A CE1 1 
ATOM   465  C  CE2 . PHE A 1 81  ? 10.736  -4.148  -17.108 1.00 23.33 ? 667  PHE A CE2 1 
ATOM   466  C  CZ  . PHE A 1 81  ? 9.907   -5.252  -17.200 1.00 23.62 ? 667  PHE A CZ  1 
ATOM   467  N  N   . LEU A 1 82  ? 9.021   0.197   -18.705 1.00 22.21 ? 668  LEU A N   1 
ATOM   468  C  CA  . LEU A 1 82  ? 8.867   0.882   -17.428 1.00 22.76 ? 668  LEU A CA  1 
ATOM   469  C  C   . LEU A 1 82  ? 7.659   1.802   -17.425 1.00 22.85 ? 668  LEU A C   1 
ATOM   470  O  O   . LEU A 1 82  ? 7.116   2.116   -16.369 1.00 23.53 ? 668  LEU A O   1 
ATOM   471  C  CB  . LEU A 1 82  ? 10.135  1.660   -17.094 1.00 22.79 ? 668  LEU A CB  1 
ATOM   472  C  CG  . LEU A 1 82  ? 11.326  0.760   -16.753 1.00 23.03 ? 668  LEU A CG  1 
ATOM   473  C  CD1 . LEU A 1 82  ? 12.577  1.600   -16.525 1.00 24.16 ? 668  LEU A CD1 1 
ATOM   474  C  CD2 . LEU A 1 82  ? 11.014  -0.105  -15.531 1.00 23.80 ? 668  LEU A CD2 1 
ATOM   475  N  N   . GLY A 1 83  ? 7.229   2.220   -18.610 1.00 23.14 ? 669  GLY A N   1 
ATOM   476  C  CA  . GLY A 1 83  ? 6.038   3.036   -18.744 1.00 24.19 ? 669  GLY A CA  1 
ATOM   477  C  C   . GLY A 1 83  ? 4.816   2.388   -18.121 1.00 23.41 ? 669  GLY A C   1 
ATOM   478  O  O   . GLY A 1 83  ? 3.963   3.076   -17.562 1.00 23.69 ? 669  GLY A O   1 
ATOM   479  N  N   . GLU A 1 84  ? 4.731   1.064   -18.206 1.00 23.25 ? 670  GLU A N   1 
ATOM   480  C  CA  . GLU A 1 84  ? 3.629   0.347   -17.575 1.00 24.84 ? 670  GLU A CA  1 
ATOM   481  C  C   . GLU A 1 84  ? 3.665   0.527   -16.068 1.00 24.23 ? 670  GLU A C   1 
ATOM   482  O  O   . GLU A 1 84  ? 2.624   0.707   -15.436 1.00 23.04 ? 670  GLU A O   1 
ATOM   483  C  CB  . GLU A 1 84  ? 3.659   -1.146  -17.899 1.00 29.08 ? 670  GLU A CB  1 
ATOM   484  C  CG  . GLU A 1 84  ? 2.663   -1.929  -17.042 1.00 33.49 ? 670  GLU A CG  1 
ATOM   485  C  CD  . GLU A 1 84  ? 2.529   -3.382  -17.426 1.00 36.63 ? 670  GLU A CD  1 
ATOM   486  O  OE1 . GLU A 1 84  ? 3.565   -4.044  -17.654 1.00 37.06 ? 670  GLU A OE1 1 
ATOM   487  O  OE2 . GLU A 1 84  ? 1.375   -3.862  -17.486 1.00 37.31 ? 670  GLU A OE2 1 
ATOM   488  N  N   . ALA A 1 85  ? 4.864   0.455   -15.493 1.00 23.77 ? 671  ALA A N   1 
ATOM   489  C  CA  . ALA A 1 85  ? 5.017   0.616   -14.053 1.00 24.06 ? 671  ALA A CA  1 
ATOM   490  C  C   . ALA A 1 85  ? 4.616   2.022   -13.630 1.00 24.31 ? 671  ALA A C   1 
ATOM   491  O  O   . ALA A 1 85  ? 3.979   2.208   -12.594 1.00 25.78 ? 671  ALA A O   1 
ATOM   492  C  CB  . ALA A 1 85  ? 6.444   0.318   -13.627 1.00 24.84 ? 671  ALA A CB  1 
ATOM   493  N  N   . SER A 1 86  ? 4.983   3.008   -14.442 1.00 22.84 ? 672  SER A N   1 
ATOM   494  C  CA  . SER A 1 86  ? 4.617   4.392   -14.166 1.00 23.45 ? 672  SER A CA  1 
ATOM   495  C  C   . SER A 1 86  ? 3.110   4.542   -14.067 1.00 22.50 ? 672  SER A C   1 
ATOM   496  O  O   . SER A 1 86  ? 2.609   5.229   -13.181 1.00 25.84 ? 672  SER A O   1 
ATOM   497  C  CB  . SER A 1 86  ? 5.160   5.327   -15.245 1.00 26.11 ? 672  SER A CB  1 
ATOM   498  O  OG  . SER A 1 86  ? 6.568   5.414   -15.172 1.00 29.53 ? 672  SER A OG  1 
ATOM   499  N  N   . ILE A 1 87  ? 2.391   3.898   -14.982 1.00 18.48 ? 673  ILE A N   1 
ATOM   500  C  CA  . ILE A 1 87  ? 0.935   3.959   -14.980 1.00 19.41 ? 673  ILE A CA  1 
ATOM   501  C  C   . ILE A 1 87  ? 0.359   3.145   -13.819 1.00 19.50 ? 673  ILE A C   1 
ATOM   502  O  O   . ILE A 1 87  ? -0.450  3.649   -13.042 1.00 21.19 ? 673  ILE A O   1 
ATOM   503  C  CB  . ILE A 1 87  ? 0.357   3.456   -16.317 1.00 21.94 ? 673  ILE A CB  1 
ATOM   504  C  CG1 . ILE A 1 87  ? 0.768   4.404   -17.450 1.00 23.19 ? 673  ILE A CG1 1 
ATOM   505  C  CG2 . ILE A 1 87  ? -1.160  3.353   -16.239 1.00 23.32 ? 673  ILE A CG2 1 
ATOM   506  C  CD1 . ILE A 1 87  ? 0.370   3.920   -18.834 1.00 26.60 ? 673  ILE A CD1 1 
ATOM   507  N  N   . MET A 1 88  ? 0.789   1.893   -13.690 1.00 19.98 ? 674  MET A N   1 
ATOM   508  C  CA  . MET A 1 88  ? 0.271   1.002   -12.646 1.00 22.60 ? 674  MET A CA  1 
ATOM   509  C  C   . MET A 1 88  ? 0.490   1.586   -11.255 1.00 20.51 ? 674  MET A C   1 
ATOM   510  O  O   . MET A 1 88  ? -0.373  1.471   -10.376 1.00 21.06 ? 674  MET A O   1 
ATOM   511  C  CB  . MET A 1 88  ? 0.927   -0.381  -12.744 1.00 24.20 ? 674  MET A CB  1 
ATOM   512  C  CG  . MET A 1 88  ? 0.487   -1.392  -11.668 1.00 25.79 ? 674  MET A CG  1 
ATOM   513  S  SD  . MET A 1 88  ? 1.301   -2.997  -11.854 1.00 28.48 ? 674  MET A SD  1 
ATOM   514  C  CE  . MET A 1 88  ? 1.841   -2.818  -13.543 1.00 27.44 ? 674  MET A CE  1 
ATOM   515  N  N   . GLY A 1 89  ? 1.636   2.234   -11.065 1.00 21.03 ? 675  GLY A N   1 
ATOM   516  C  CA  . GLY A 1 89  ? 1.992   2.792   -9.775  1.00 21.71 ? 675  GLY A CA  1 
ATOM   517  C  C   . GLY A 1 89  ? 1.084   3.920   -9.309  1.00 22.07 ? 675  GLY A C   1 
ATOM   518  O  O   . GLY A 1 89  ? 1.133   4.313   -8.149  1.00 24.27 ? 675  GLY A O   1 
ATOM   519  N  N   . GLN A 1 90  ? 0.258   4.449   -10.206 1.00 20.23 ? 676  GLN A N   1 
ATOM   520  C  CA  . GLN A 1 90  ? -0.647  5.530   -9.839  1.00 20.79 ? 676  GLN A CA  1 
ATOM   521  C  C   . GLN A 1 90  ? -1.919  5.012   -9.173  1.00 18.85 ? 676  GLN A C   1 
ATOM   522  O  O   . GLN A 1 90  ? -2.688  5.787   -8.600  1.00 19.36 ? 676  GLN A O   1 
ATOM   523  C  CB  . GLN A 1 90  ? -0.989  6.371   -11.074 1.00 24.12 ? 676  GLN A CB  1 
ATOM   524  C  CG  . GLN A 1 90  ? 0.200   7.191   -11.571 1.00 28.91 ? 676  GLN A CG  1 
ATOM   525  C  CD  . GLN A 1 90  ? -0.026  7.843   -12.924 1.00 33.67 ? 676  GLN A CD  1 
ATOM   526  O  OE1 . GLN A 1 90  ? -1.050  8.480   -13.162 1.00 36.51 ? 676  GLN A OE1 1 
ATOM   527  N  NE2 . GLN A 1 90  ? 0.944   7.688   -13.819 1.00 35.99 ? 676  GLN A NE2 1 
ATOM   528  N  N   . PHE A 1 91  ? -2.131  3.698   -9.237  1.00 18.07 ? 677  PHE A N   1 
ATOM   529  C  CA  . PHE A 1 91  ? -3.379  3.095   -8.783  1.00 20.37 ? 677  PHE A CA  1 
ATOM   530  C  C   . PHE A 1 91  ? -3.201  2.171   -7.592  1.00 21.58 ? 677  PHE A C   1 
ATOM   531  O  O   . PHE A 1 91  ? -2.592  1.111   -7.703  1.00 26.95 ? 677  PHE A O   1 
ATOM   532  C  CB  . PHE A 1 91  ? -4.027  2.302   -9.916  1.00 20.64 ? 677  PHE A CB  1 
ATOM   533  C  CG  . PHE A 1 91  ? -4.115  3.055   -11.200 1.00 21.62 ? 677  PHE A CG  1 
ATOM   534  C  CD1 . PHE A 1 91  ? -4.647  4.335   -11.237 1.00 22.98 ? 677  PHE A CD1 1 
ATOM   535  C  CD2 . PHE A 1 91  ? -3.641  2.494   -12.373 1.00 22.29 ? 677  PHE A CD2 1 
ATOM   536  C  CE1 . PHE A 1 91  ? -4.724  5.036   -12.430 1.00 24.52 ? 677  PHE A CE1 1 
ATOM   537  C  CE2 . PHE A 1 91  ? -3.712  3.186   -13.569 1.00 23.77 ? 677  PHE A CE2 1 
ATOM   538  C  CZ  . PHE A 1 91  ? -4.254  4.454   -13.600 1.00 24.23 ? 677  PHE A CZ  1 
ATOM   539  N  N   . ASP A 1 92  ? -3.786  2.557   -6.471  1.00 19.39 ? 678  ASP A N   1 
ATOM   540  C  CA  . ASP A 1 92  ? -3.773  1.762   -5.253  1.00 19.64 ? 678  ASP A CA  1 
ATOM   541  C  C   . ASP A 1 92  ? -5.204  1.344   -4.952  1.00 18.11 ? 678  ASP A C   1 
ATOM   542  O  O   . ASP A 1 92  ? -5.974  2.120   -4.401  1.00 20.12 ? 678  ASP A O   1 
ATOM   543  C  CB  . ASP A 1 92  ? -3.184  2.586   -4.111  1.00 20.82 ? 678  ASP A CB  1 
ATOM   544  C  CG  . ASP A 1 92  ? -2.972  1.787   -2.842  1.00 24.15 ? 678  ASP A CG  1 
ATOM   545  O  OD1 . ASP A 1 92  ? -3.443  0.638   -2.744  1.00 24.93 ? 678  ASP A OD1 1 
ATOM   546  O  OD2 . ASP A 1 92  ? -2.350  2.349   -1.917  1.00 28.99 ? 678  ASP A OD2 1 
ATOM   547  N  N   . HIS A 1 93  ? -5.588  0.133   -5.357  1.00 17.05 ? 679  HIS A N   1 
ATOM   548  C  CA  . HIS A 1 93  ? -6.956  -0.316  -5.225  1.00 15.70 ? 679  HIS A CA  1 
ATOM   549  C  C   . HIS A 1 93  ? -6.980  -1.855  -5.126  1.00 14.65 ? 679  HIS A C   1 
ATOM   550  O  O   . HIS A 1 93  ? -6.224  -2.455  -5.761  1.00 14.79 ? 679  HIS A O   1 
ATOM   551  C  CB  . HIS A 1 93  ? -7.748  0.160   -6.462  1.00 15.97 ? 679  HIS A CB  1 
ATOM   552  C  CG  . HIS A 1 93  ? -9.207  -0.072  -6.383  1.00 15.41 ? 679  HIS A CG  1 
ATOM   553  N  ND1 . HIS A 1 93  ? -9.770  -1.271  -6.704  1.00 15.70 ? 679  HIS A ND1 1 
ATOM   554  C  CD2 . HIS A 1 93  ? -10.227 0.744   -6.047  1.00 17.51 ? 679  HIS A CD2 1 
ATOM   555  C  CE1 . HIS A 1 93  ? -11.067 -1.197  -6.555  1.00 17.23 ? 679  HIS A CE1 1 
ATOM   556  N  NE2 . HIS A 1 93  ? -11.370 0.022   -6.160  1.00 18.13 ? 679  HIS A NE2 1 
ATOM   557  N  N   . PRO A 1 94  ? -7.901  -2.421  -4.396  1.00 15.59 ? 680  PRO A N   1 
ATOM   558  C  CA  . PRO A 1 94  ? -7.917  -3.875  -4.222  1.00 16.31 ? 680  PRO A CA  1 
ATOM   559  C  C   . PRO A 1 94  ? -8.161  -4.643  -5.510  1.00 14.72 ? 680  PRO A C   1 
ATOM   560  O  O   . PRO A 1 94  ? -7.831  -5.793  -5.574  1.00 15.88 ? 680  PRO A O   1 
ATOM   561  C  CB  . PRO A 1 94  ? -9.034  -4.116  -3.236  1.00 18.96 ? 680  PRO A CB  1 
ATOM   562  C  CG  . PRO A 1 94  ? -9.703  -2.849  -2.990  1.00 20.89 ? 680  PRO A CG  1 
ATOM   563  C  CD  . PRO A 1 94  ? -8.897  -1.760  -3.571  1.00 17.79 ? 680  PRO A CD  1 
ATOM   564  N  N   . ASN A 1 95  ? -8.739  -4.001  -6.518  1.00 13.36 ? 681  ASN A N   1 
ATOM   565  C  CA  . ASN A 1 95  ? -9.030  -4.707  -7.762  1.00 12.90 ? 681  ASN A CA  1 
ATOM   566  C  C   . ASN A 1 95  ? -8.210  -4.194  -8.931  1.00 11.59 ? 681  ASN A C   1 
ATOM   567  O  O   . ASN A 1 95  ? -8.590  -4.358  -10.086 1.00 12.32 ? 681  ASN A O   1 
ATOM   568  C  CB  . ASN A 1 95  ? -10.521 -4.640  -8.082  1.00 12.66 ? 681  ASN A CB  1 
ATOM   569  C  CG  . ASN A 1 95  ? -11.362 -5.292  -7.018  1.00 13.10 ? 681  ASN A CG  1 
ATOM   570  O  OD1 . ASN A 1 95  ? -11.999 -4.605  -6.216  1.00 15.18 ? 681  ASN A OD1 1 
ATOM   571  N  ND2 . ASN A 1 95  ? -11.362 -6.632  -6.991  1.00 13.53 ? 681  ASN A ND2 1 
ATOM   572  N  N   . ILE A 1 96  ? -7.066  -3.592  -8.616  1.00 12.08 ? 682  ILE A N   1 
ATOM   573  C  CA  . ILE A 1 96  ? -6.077  -3.232  -9.614  1.00 13.41 ? 682  ILE A CA  1 
ATOM   574  C  C   . ILE A 1 96  ? -4.764  -3.850  -9.171  1.00 12.78 ? 682  ILE A C   1 
ATOM   575  O  O   . ILE A 1 96  ? -4.405  -3.759  -7.997  1.00 12.88 ? 682  ILE A O   1 
ATOM   576  C  CB  . ILE A 1 96  ? -5.936  -1.711  -9.776  1.00 13.18 ? 682  ILE A CB  1 
ATOM   577  C  CG1 . ILE A 1 96  ? -7.263  -1.135  -10.256 1.00 15.10 ? 682  ILE A CG1 1 
ATOM   578  C  CG2 . ILE A 1 96  ? -4.822  -1.394  -10.750 1.00 14.86 ? 682  ILE A CG2 1 
ATOM   579  C  CD1 . ILE A 1 96  ? -7.309  0.359   -10.262 1.00 18.15 ? 682  ILE A CD1 1 
ATOM   580  N  N   . ILE A 1 97  ? -4.067  -4.512  -10.089 1.00 11.85 ? 683  ILE A N   1 
ATOM   581  C  CA  . ILE A 1 97  ? -2.813  -5.177  -9.731  1.00 12.72 ? 683  ILE A CA  1 
ATOM   582  C  C   . ILE A 1 97  ? -1.876  -4.189  -9.051  1.00 13.23 ? 683  ILE A C   1 
ATOM   583  O  O   . ILE A 1 97  ? -1.672  -3.068  -9.533  1.00 14.05 ? 683  ILE A O   1 
ATOM   584  C  CB  . ILE A 1 97  ? -2.133  -5.791  -10.961 1.00 14.85 ? 683  ILE A CB  1 
ATOM   585  C  CG1 . ILE A 1 97  ? -2.927  -6.999  -11.441 1.00 18.20 ? 683  ILE A CG1 1 
ATOM   586  C  CG2 . ILE A 1 97  ? -0.734  -6.269  -10.628 1.00 18.70 ? 683  ILE A CG2 1 
ATOM   587  C  CD1 . ILE A 1 97  ? -2.930  -8.161  -10.456 1.00 20.82 ? 683  ILE A CD1 1 
ATOM   588  N  N   . ARG A 1 98  ? -1.336  -4.614  -7.919  1.00 13.34 ? 684  ARG A N   1 
ATOM   589  C  CA  . ARG A 1 98  ? -0.490  -3.782  -7.088  1.00 13.48 ? 684  ARG A CA  1 
ATOM   590  C  C   . ARG A 1 98  ? 0.952   -3.847  -7.538  1.00 12.21 ? 684  ARG A C   1 
ATOM   591  O  O   . ARG A 1 98  ? 1.538   -4.923  -7.622  1.00 14.29 ? 684  ARG A O   1 
ATOM   592  C  CB  . ARG A 1 98  ? -0.603  -4.222  -5.630  1.00 15.52 ? 684  ARG A CB  1 
ATOM   593  C  CG  . ARG A 1 98  ? 0.384   -3.565  -4.688  1.00 16.67 ? 684  ARG A CG  1 
ATOM   594  C  CD  . ARG A 1 98  ? 0.092   -3.988  -3.255  1.00 19.98 ? 684  ARG A CD  1 
ATOM   595  N  NE  . ARG A 1 98  ? 1.066   -3.456  -2.311  1.00 23.57 ? 684  ARG A NE  1 
ATOM   596  C  CZ  . ARG A 1 98  ? 0.980   -2.251  -1.761  1.00 28.06 ? 684  ARG A CZ  1 
ATOM   597  N  NH1 . ARG A 1 98  ? -0.029  -1.446  -2.077  1.00 28.92 ? 684  ARG A NH1 1 
ATOM   598  N  NH2 . ARG A 1 98  ? 1.908   -1.845  -0.906  1.00 30.85 ? 684  ARG A NH2 1 
ATOM   599  N  N   . LEU A 1 99  ? 1.509   -2.681  -7.830  1.00 13.53 ? 685  LEU A N   1 
ATOM   600  C  CA  . LEU A 1 99  ? 2.927   -2.536  -8.114  1.00 13.16 ? 685  LEU A CA  1 
ATOM   601  C  C   . LEU A 1 99  ? 3.699   -2.485  -6.796  1.00 13.47 ? 685  LEU A C   1 
ATOM   602  O  O   . LEU A 1 99  ? 3.443   -1.606  -5.970  1.00 17.42 ? 685  LEU A O   1 
ATOM   603  C  CB  . LEU A 1 99  ? 3.178   -1.265  -8.925  1.00 14.34 ? 685  LEU A CB  1 
ATOM   604  C  CG  . LEU A 1 99  ? 4.642   -0.957  -9.235  1.00 16.30 ? 685  LEU A CG  1 
ATOM   605  C  CD1 . LEU A 1 99  ? 5.213   -1.989  -10.191 1.00 17.24 ? 685  LEU A CD1 1 
ATOM   606  C  CD2 . LEU A 1 99  ? 4.799   0.440   -9.781  1.00 17.57 ? 685  LEU A CD2 1 
ATOM   607  N  N   . GLU A 1 100 ? 4.605   -3.436  -6.577  1.00 13.83 ? 686  GLU A N   1 
ATOM   608  C  CA  . GLU A 1 100 ? 5.462   -3.405  -5.397  1.00 13.95 ? 686  GLU A CA  1 
ATOM   609  C  C   . GLU A 1 100 ? 6.667   -2.502  -5.640  1.00 14.53 ? 686  GLU A C   1 
ATOM   610  O  O   . GLU A 1 100 ? 7.177   -1.866  -4.715  1.00 16.43 ? 686  GLU A O   1 
ATOM   611  C  CB  . GLU A 1 100 ? 5.908   -4.820  -5.020  1.00 15.43 ? 686  GLU A CB  1 
ATOM   612  C  CG  . GLU A 1 100 ? 4.754   -5.696  -4.548  1.00 17.07 ? 686  GLU A CG  1 
ATOM   613  C  CD  . GLU A 1 100 ? 4.162   -5.224  -3.215  1.00 19.95 ? 686  GLU A CD  1 
ATOM   614  O  OE1 . GLU A 1 100 ? 4.871   -4.541  -2.443  1.00 21.87 ? 686  GLU A OE1 1 
ATOM   615  O  OE2 . GLU A 1 100 ? 2.985   -5.539  -2.933  1.00 23.39 ? 686  GLU A OE2 1 
ATOM   616  N  N   . GLY A 1 101 ? 7.119   -2.443  -6.888  1.00 15.84 ? 687  GLY A N   1 
ATOM   617  C  CA  . GLY A 1 101 ? 8.194   -1.545  -7.246  1.00 16.11 ? 687  GLY A CA  1 
ATOM   618  C  C   . GLY A 1 101 ? 8.940   -2.008  -8.475  1.00 15.98 ? 687  GLY A C   1 
ATOM   619  O  O   . GLY A 1 101 ? 8.515   -2.940  -9.164  1.00 15.52 ? 687  GLY A O   1 
ATOM   620  N  N   . VAL A 1 102 ? 10.050  -1.337  -8.759  1.00 17.27 ? 688  VAL A N   1 
ATOM   621  C  CA  . VAL A 1 102 ? 10.867  -1.658  -9.915  1.00 17.30 ? 688  VAL A CA  1 
ATOM   622  C  C   . VAL A 1 102 ? 12.317  -1.816  -9.514  1.00 17.90 ? 688  VAL A C   1 
ATOM   623  O  O   . VAL A 1 102 ? 12.749  -1.319  -8.466  1.00 18.30 ? 688  VAL A O   1 
ATOM   624  C  CB  . VAL A 1 102 ? 10.771  -0.570  -11.011 1.00 18.69 ? 688  VAL A CB  1 
ATOM   625  C  CG1 . VAL A 1 102 ? 9.346   -0.458  -11.525 1.00 18.95 ? 688  VAL A CG1 1 
ATOM   626  C  CG2 . VAL A 1 102 ? 11.247  0.773   -10.469 1.00 19.79 ? 688  VAL A CG2 1 
ATOM   627  N  N   . VAL A 1 103 ? 13.069  -2.518  -10.351 1.00 17.72 ? 689  VAL A N   1 
ATOM   628  C  CA  . VAL A 1 103 ? 14.519  -2.560  -10.225 1.00 18.48 ? 689  VAL A CA  1 
ATOM   629  C  C   . VAL A 1 103 ? 15.101  -1.986  -11.500 1.00 19.79 ? 689  VAL A C   1 
ATOM   630  O  O   . VAL A 1 103 ? 14.894  -2.542  -12.592 1.00 20.18 ? 689  VAL A O   1 
ATOM   631  C  CB  . VAL A 1 103 ? 15.043  -3.984  -9.996  1.00 19.47 ? 689  VAL A CB  1 
ATOM   632  C  CG1 . VAL A 1 103 ? 16.563  -3.968  -9.803  1.00 21.25 ? 689  VAL A CG1 1 
ATOM   633  C  CG2 . VAL A 1 103 ? 14.353  -4.598  -8.788  1.00 20.23 ? 689  VAL A CG2 1 
ATOM   634  N  N   . THR A 1 104 ? 15.786  -0.853  -11.376 1.00 22.08 ? 690  THR A N   1 
ATOM   635  C  CA  . THR A 1 104 ? 16.371  -0.194  -12.539 1.00 24.41 ? 690  THR A CA  1 
ATOM   636  C  C   . THR A 1 104 ? 17.868  0.029   -12.366 1.00 24.90 ? 690  THR A C   1 
ATOM   637  O  O   . THR A 1 104 ? 18.600  0.151   -13.352 1.00 27.44 ? 690  THR A O   1 
ATOM   638  C  CB  . THR A 1 104 ? 15.685  1.165   -12.833 1.00 25.78 ? 690  THR A CB  1 
ATOM   639  O  OG1 . THR A 1 104 ? 15.888  2.068   -11.738 1.00 26.44 ? 690  THR A OG1 1 
ATOM   640  C  CG2 . THR A 1 104 ? 14.191  0.970   -13.053 1.00 26.25 ? 690  THR A CG2 1 
ATOM   641  N  N   . LYS A 1 105 ? 18.326  0.080   -11.118 1.00 24.63 ? 691  LYS A N   1 
ATOM   642  C  CA  . LYS A 1 105 ? 19.732  0.386   -10.845 1.00 27.35 ? 691  LYS A CA  1 
ATOM   643  C  C   . LYS A 1 105 ? 20.623  -0.848  -10.954 1.00 27.93 ? 691  LYS A C   1 
ATOM   644  O  O   . LYS A 1 105 ? 21.844  -0.760  -10.832 1.00 28.96 ? 691  LYS A O   1 
ATOM   645  C  CB  . LYS A 1 105 ? 19.883  1.031   -9.464  1.00 31.00 ? 691  LYS A CB  1 
ATOM   646  C  CG  . LYS A 1 105 ? 19.148  2.362   -9.337  1.00 35.05 ? 691  LYS A CG  1 
ATOM   647  C  CD  . LYS A 1 105 ? 19.510  3.089   -8.056  1.00 38.99 ? 691  LYS A CD  1 
ATOM   648  C  CE  . LYS A 1 105 ? 18.974  4.515   -8.061  1.00 42.12 ? 691  LYS A CE  1 
ATOM   649  N  NZ  . LYS A 1 105 ? 17.529  4.570   -7.703  1.00 43.63 ? 691  LYS A NZ  1 
ATOM   650  N  N   . SER A 1 106 ? 20.004  -1.999  -11.177 1.00 26.72 ? 692  SER A N   1 
ATOM   651  C  CA  . SER A 1 106 ? 20.738  -3.211  -11.504 1.00 26.50 ? 692  SER A CA  1 
ATOM   652  C  C   . SER A 1 106 ? 19.994  -3.928  -12.619 1.00 26.11 ? 692  SER A C   1 
ATOM   653  O  O   . SER A 1 106 ? 18.876  -3.558  -12.961 1.00 25.59 ? 692  SER A O   1 
ATOM   654  C  CB  . SER A 1 106 ? 20.915  -4.115  -10.277 1.00 27.09 ? 692  SER A CB  1 
ATOM   655  O  OG  . SER A 1 106 ? 19.681  -4.624  -9.813  1.00 27.79 ? 692  SER A OG  1 
ATOM   656  N  N   . LYS A 1 107 ? 20.590  -4.951  -13.191 1.00 25.54 ? 693  LYS A N   1 
ATOM   657  C  CA  . LYS A 1 107 ? 20.040  -5.608  -14.347 1.00 26.53 ? 693  LYS A CA  1 
ATOM   658  C  C   . LYS A 1 107 ? 19.956  -7.098  -14.096 1.00 27.02 ? 693  LYS A C   1 
ATOM   659  O  O   . LYS A 1 107 ? 20.779  -7.617  -13.402 1.00 28.40 ? 693  LYS A O   1 
ATOM   660  C  CB  . LYS A 1 107 ? 20.886  -5.197  -15.569 1.00 29.20 ? 693  LYS A CB  1 
ATOM   661  C  CG  . LYS A 1 107 ? 20.579  -3.739  -15.984 1.00 33.44 ? 693  LYS A CG  1 
ATOM   662  C  CD  . LYS A 1 107 ? 21.376  -3.199  -17.127 1.00 35.95 ? 693  LYS A CD  1 
ATOM   663  C  CE  . LYS A 1 107 ? 21.337  -1.723  -17.201 1.00 36.56 ? 693  LYS A CE  1 
ATOM   664  N  NZ  . LYS A 1 107 ? 21.946  -1.240  -18.471 1.00 36.76 ? 693  LYS A NZ  1 
ATOM   665  N  N   . PRO A 1 108 ? 18.943  -7.792  -14.578 1.00 25.82 ? 694  PRO A N   1 
ATOM   666  C  CA  . PRO A 1 108 ? 17.892  -7.268  -15.448 1.00 23.89 ? 694  PRO A CA  1 
ATOM   667  C  C   . PRO A 1 108 ? 16.977  -6.280  -14.784 1.00 22.47 ? 694  PRO A C   1 
ATOM   668  O  O   . PRO A 1 108 ? 16.756  -6.360  -13.632 1.00 22.03 ? 694  PRO A O   1 
ATOM   669  C  CB  . PRO A 1 108 ? 17.071  -8.506  -15.785 1.00 26.78 ? 694  PRO A CB  1 
ATOM   670  C  CG  . PRO A 1 108 ? 17.907  -9.678  -15.434 1.00 28.70 ? 694  PRO A CG  1 
ATOM   671  C  CD  . PRO A 1 108 ? 18.824  -9.237  -14.354 1.00 28.18 ? 694  PRO A CD  1 
ATOM   672  N  N   . VAL A 1 109 ? 16.466  -5.356  -15.579 1.00 20.72 ? 695  VAL A N   1 
ATOM   673  C  CA  . VAL A 1 109 ? 15.452  -4.410  -15.146 1.00 20.39 ? 695  VAL A CA  1 
ATOM   674  C  C   . VAL A 1 109 ? 14.168  -5.181  -14.853 1.00 18.80 ? 695  VAL A C   1 
ATOM   675  O  O   . VAL A 1 109 ? 13.786  -6.071  -15.608 1.00 19.22 ? 695  VAL A O   1 
ATOM   676  C  CB  . VAL A 1 109 ? 15.215  -3.330  -16.227 1.00 21.58 ? 695  VAL A CB  1 
ATOM   677  C  CG1 . VAL A 1 109 ? 14.112  -2.364  -15.817 1.00 22.23 ? 695  VAL A CG1 1 
ATOM   678  C  CG2 . VAL A 1 109 ? 16.512  -2.590  -16.513 1.00 22.97 ? 695  VAL A CG2 1 
ATOM   679  N  N   . MET A 1 110 ? 13.509  -4.858  -13.747 1.00 18.51 ? 696  MET A N   1 
ATOM   680  C  CA  . MET A 1 110 ? 12.347  -5.628  -13.326 1.00 18.51 ? 696  MET A CA  1 
ATOM   681  C  C   . MET A 1 110 ? 11.181  -4.758  -12.909 1.00 17.49 ? 696  MET A C   1 
ATOM   682  O  O   . MET A 1 110 ? 11.364  -3.655  -12.388 1.00 17.57 ? 696  MET A O   1 
ATOM   683  C  CB  . MET A 1 110 ? 12.698  -6.551  -12.156 1.00 20.26 ? 696  MET A CB  1 
ATOM   684  C  CG  . MET A 1 110 ? 13.832  -7.518  -12.413 1.00 22.74 ? 696  MET A CG  1 
ATOM   685  S  SD  . MET A 1 110 ? 14.105  -8.563  -10.975 1.00 27.03 ? 696  MET A SD  1 
ATOM   686  C  CE  . MET A 1 110 ? 15.461  -7.727  -10.171 1.00 31.95 ? 696  MET A CE  1 
ATOM   687  N  N   . ILE A 1 111 ? 9.983   -5.287  -13.125 1.00 17.15 ? 697  ILE A N   1 
ATOM   688  C  CA  . ILE A 1 111 ? 8.759   -4.766  -12.542 1.00 15.45 ? 697  ILE A CA  1 
ATOM   689  C  C   . ILE A 1 111 ? 8.193   -5.846  -11.615 1.00 14.98 ? 697  ILE A C   1 
ATOM   690  O  O   . ILE A 1 111 ? 7.973   -6.981  -12.039 1.00 16.30 ? 697  ILE A O   1 
ATOM   691  C  CB  . ILE A 1 111 ? 7.726   -4.399  -13.613 1.00 17.33 ? 697  ILE A CB  1 
ATOM   692  C  CG1 . ILE A 1 111 ? 8.241   -3.259  -14.494 1.00 19.12 ? 697  ILE A CG1 1 
ATOM   693  C  CG2 . ILE A 1 111 ? 6.408   -4.028  -12.969 1.00 18.61 ? 697  ILE A CG2 1 
ATOM   694  C  CD1 . ILE A 1 111 ? 7.388   -3.035  -15.736 1.00 20.86 ? 697  ILE A CD1 1 
ATOM   695  N  N   . VAL A 1 112 ? 7.979   -5.496  -10.351 1.00 14.17 ? 698  VAL A N   1 
ATOM   696  C  CA  . VAL A 1 112 ? 7.533   -6.455  -9.346  1.00 12.71 ? 698  VAL A CA  1 
ATOM   697  C  C   . VAL A 1 112 ? 6.115   -6.127  -8.891  1.00 12.99 ? 698  VAL A C   1 
ATOM   698  O  O   . VAL A 1 112 ? 5.837   -4.994  -8.476  1.00 14.01 ? 698  VAL A O   1 
ATOM   699  C  CB  . VAL A 1 112 ? 8.486   -6.456  -8.135  1.00 13.81 ? 698  VAL A CB  1 
ATOM   700  C  CG1 . VAL A 1 112 ? 8.073   -7.509  -7.136  1.00 14.46 ? 698  VAL A CG1 1 
ATOM   701  C  CG2 . VAL A 1 112 ? 9.917   -6.697  -8.610  1.00 16.23 ? 698  VAL A CG2 1 
ATOM   702  N  N   . THR A 1 113 ? 5.214   -7.099  -9.016  1.00 12.76 ? 699  THR A N   1 
ATOM   703  C  CA  . THR A 1 113 ? 3.815   -6.892  -8.683  1.00 13.81 ? 699  THR A CA  1 
ATOM   704  C  C   . THR A 1 113 ? 3.330   -7.983  -7.756  1.00 12.82 ? 699  THR A C   1 
ATOM   705  O  O   . THR A 1 113 ? 4.016   -8.983  -7.544  1.00 13.39 ? 699  THR A O   1 
ATOM   706  C  CB  . THR A 1 113 ? 2.921   -6.883  -9.932  1.00 15.57 ? 699  THR A CB  1 
ATOM   707  O  OG1 . THR A 1 113 ? 2.993   -8.166  -10.572 1.00 19.18 ? 699  THR A OG1 1 
ATOM   708  C  CG2 . THR A 1 113 ? 3.358   -5.798  -10.888 1.00 17.34 ? 699  THR A CG2 1 
ATOM   709  N  N   . GLU A 1 114 ? 2.152   -7.840  -7.225  1.00 14.24 ? 700  GLU A N   1 
ATOM   710  C  CA  . GLU A 1 114 ? 1.575   -8.859  -6.401  1.00 13.44 ? 700  GLU A CA  1 
ATOM   711  C  C   . GLU A 1 114 ? 1.363   -10.133 -7.212  1.00 14.41 ? 700  GLU A C   1 
ATOM   712  O  O   . GLU A 1 114 ? 1.157   -10.068 -8.349  1.00 16.37 ? 700  GLU A O   1 
ATOM   713  C  CB  . GLU A 1 114 ? 0.256   -8.397  -5.783  1.00 15.48 ? 700  GLU A CB  1 
ATOM   714  C  CG  . GLU A 1 114 ? -0.881  -8.274  -6.767  1.00 15.92 ? 700  GLU A CG  1 
ATOM   715  C  CD  . GLU A 1 114 ? -2.155  -7.777  -6.131  1.00 16.97 ? 700  GLU A CD  1 
ATOM   716  O  OE1 . GLU A 1 114 ? -2.651  -8.369  -5.223  1.00 17.88 ? 700  GLU A OE1 1 
ATOM   717  O  OE2 . GLU A 1 114 ? -2.634  -6.756  -6.568  1.00 16.26 ? 700  GLU A OE2 1 
ATOM   718  N  N   . TYR A 1 115 ? 1.494   -11.264 -6.551  1.00 14.84 ? 701  TYR A N   1 
ATOM   719  C  CA  . TYR A 1 115 ? 1.363   -12.568 -7.168  1.00 15.30 ? 701  TYR A CA  1 
ATOM   720  C  C   . TYR A 1 115 ? -0.107  -12.955 -7.279  1.00 14.13 ? 701  TYR A C   1 
ATOM   721  O  O   . TYR A 1 115 ? -0.889  -12.747 -6.344  1.00 16.23 ? 701  TYR A O   1 
ATOM   722  C  CB  . TYR A 1 115 ? 2.129   -13.586 -6.336  1.00 18.03 ? 701  TYR A CB  1 
ATOM   723  C  CG  . TYR A 1 115 ? 2.085   -14.990 -6.863  1.00 22.56 ? 701  TYR A CG  1 
ATOM   724  C  CD1 . TYR A 1 115 ? 2.748   -15.333 -8.031  1.00 25.62 ? 701  TYR A CD1 1 
ATOM   725  C  CD2 . TYR A 1 115 ? 1.384   -15.985 -6.185  1.00 24.87 ? 701  TYR A CD2 1 
ATOM   726  C  CE1 . TYR A 1 115 ? 2.712   -16.638 -8.514  1.00 28.50 ? 701  TYR A CE1 1 
ATOM   727  C  CE2 . TYR A 1 115 ? 1.346   -17.278 -6.652  1.00 26.58 ? 701  TYR A CE2 1 
ATOM   728  C  CZ  . TYR A 1 115 ? 2.005   -17.598 -7.820  1.00 28.38 ? 701  TYR A CZ  1 
ATOM   729  O  OH  . TYR A 1 115 ? 1.964   -18.891 -8.291  1.00 32.77 ? 701  TYR A OH  1 
ATOM   730  N  N   . MET A 1 116 ? -0.499  -13.493 -8.432  1.00 13.12 ? 702  MET A N   1 
ATOM   731  C  CA  . MET A 1 116 ? -1.886  -13.881 -8.655  1.00 13.73 ? 702  MET A CA  1 
ATOM   732  C  C   . MET A 1 116 ? -1.917  -15.348 -9.037  1.00 14.75 ? 702  MET A C   1 
ATOM   733  O  O   . MET A 1 116 ? -1.688  -15.712 -10.189 1.00 15.65 ? 702  MET A O   1 
ATOM   734  C  CB  . MET A 1 116 ? -2.528  -13.005 -9.733  1.00 14.04 ? 702  MET A CB  1 
ATOM   735  C  CG  . MET A 1 116 ? -2.485  -11.514 -9.405  1.00 14.03 ? 702  MET A CG  1 
ATOM   736  S  SD  . MET A 1 116 ? -3.581  -11.053 -8.045  1.00 15.88 ? 702  MET A SD  1 
ATOM   737  C  CE  . MET A 1 116 ? -5.178  -11.094 -8.840  1.00 16.09 ? 702  MET A CE  1 
ATOM   738  N  N   . GLU A 1 117 ? -2.218  -16.184 -8.078  1.00 14.95 ? 703  GLU A N   1 
ATOM   739  C  CA  . GLU A 1 117 ? -1.951  -17.618 -8.199  1.00 17.18 ? 703  GLU A CA  1 
ATOM   740  C  C   . GLU A 1 117 ? -2.704  -18.271 -9.356  1.00 16.56 ? 703  GLU A C   1 
ATOM   741  O  O   . GLU A 1 117 ? -2.213  -19.171 -9.923  1.00 18.37 ? 703  GLU A O   1 
ATOM   742  C  CB  . GLU A 1 117 ? -2.322  -18.297 -6.910  1.00 20.59 ? 703  GLU A CB  1 
ATOM   743  C  CG  . GLU A 1 117 ? -2.070  -19.779 -6.889  1.00 27.66 ? 703  GLU A CG  1 
ATOM   744  C  CD  . GLU A 1 117 ? -2.355  -20.288 -5.516  1.00 33.97 ? 703  GLU A CD  1 
ATOM   745  O  OE1 . GLU A 1 117 ? -1.648  -19.904 -4.593  1.00 36.41 ? 703  GLU A OE1 1 
ATOM   746  O  OE2 . GLU A 1 117 ? -3.324  -20.979 -5.355  1.00 38.91 ? 703  GLU A OE2 1 
ATOM   747  N  N   . ASN A 1 118 ? -3.901  -17.819 -9.623  1.00 15.03 ? 704  ASN A N   1 
ATOM   748  C  CA  . ASN A 1 118 ? -4.707  -18.495 -10.627 1.00 14.06 ? 704  ASN A CA  1 
ATOM   749  C  C   . ASN A 1 118 ? -4.634  -17.875 -12.015 1.00 13.65 ? 704  ASN A C   1 
ATOM   750  O  O   . ASN A 1 118 ? -5.380  -18.263 -12.899 1.00 15.93 ? 704  ASN A O   1 
ATOM   751  C  CB  . ASN A 1 118 ? -6.155  -18.587 -10.144 1.00 14.26 ? 704  ASN A CB  1 
ATOM   752  C  CG  . ASN A 1 118 ? -6.328  -19.666 -9.087  1.00 14.79 ? 704  ASN A CG  1 
ATOM   753  O  OD1 . ASN A 1 118 ? -5.867  -20.795 -9.274  1.00 16.18 ? 704  ASN A OD1 1 
ATOM   754  N  ND2 . ASN A 1 118 ? -6.981  -19.338 -7.982  1.00 16.66 ? 704  ASN A ND2 1 
ATOM   755  N  N   . GLY A 1 119 ? -3.708  -16.976 -12.234 1.00 14.90 ? 705  GLY A N   1 
ATOM   756  C  CA  . GLY A 1 119 ? -3.386  -16.506 -13.552 1.00 14.87 ? 705  GLY A CA  1 
ATOM   757  C  C   . GLY A 1 119 ? -4.416  -15.623 -14.234 1.00 13.46 ? 705  GLY A C   1 
ATOM   758  O  O   . GLY A 1 119 ? -5.167  -15.015 -13.598 1.00 14.28 ? 705  GLY A O   1 
ATOM   759  N  N   A SER A 1 120 ? -4.397  -15.679 -15.557 0.54 14.49 ? 706  SER A N   1 
ATOM   760  N  N   B SER A 1 120 ? -4.403  -15.675 -15.556 0.46 13.77 ? 706  SER A N   1 
ATOM   761  C  CA  A SER A 1 120 ? -5.361  -14.911 -16.333 0.54 15.44 ? 706  SER A CA  1 
ATOM   762  C  CA  B SER A 1 120 ? -5.358  -14.878 -16.313 0.46 13.93 ? 706  SER A CA  1 
ATOM   763  C  C   A SER A 1 120 ? -6.768  -15.482 -16.181 0.54 14.03 ? 706  SER A C   1 
ATOM   764  C  C   B SER A 1 120 ? -6.760  -15.471 -16.210 0.46 13.09 ? 706  SER A C   1 
ATOM   765  O  O   A SER A 1 120 ? -6.960  -16.701 -16.133 0.54 14.93 ? 706  SER A O   1 
ATOM   766  O  O   B SER A 1 120 ? -6.940  -16.692 -16.230 0.46 13.55 ? 706  SER A O   1 
ATOM   767  C  CB  A SER A 1 120 ? -4.956  -14.880 -17.808 0.54 18.32 ? 706  SER A CB  1 
ATOM   768  C  CB  B SER A 1 120 ? -4.930  -14.773 -17.776 0.46 15.17 ? 706  SER A CB  1 
ATOM   769  O  OG  A SER A 1 120 ? -3.730  -14.193 -17.982 0.54 20.54 ? 706  SER A OG  1 
ATOM   770  O  OG  B SER A 1 120 ? -4.920  -16.045 -18.394 0.46 15.59 ? 706  SER A OG  1 
ATOM   771  N  N   . LEU A 1 121 ? -7.755  -14.599 -16.120 1.00 13.40 ? 707  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 121 ? -9.118  -15.018 -15.854 1.00 12.79 ? 707  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 121 ? -9.702  -15.894 -16.965 1.00 13.07 ? 707  LEU A C   1 
ATOM   774  O  O   . LEU A 1 121 ? -10.408 -16.865 -16.681 1.00 13.95 ? 707  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 121 ? -9.997  -13.792 -15.632 1.00 13.81 ? 707  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 121 ? -11.466 -14.050 -15.296 1.00 14.02 ? 707  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 121 ? -11.609 -14.913 -14.031 1.00 15.42 ? 707  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 121 ? -12.199 -12.726 -15.153 1.00 15.23 ? 707  LEU A CD2 1 
ATOM   779  N  N   . ASP A 1 122 ? -9.418  -15.577 -18.226 1.00 13.87 ? 708  ASP A N   1 
ATOM   780  C  CA  . ASP A 1 122 ? -9.996  -16.382 -19.302 1.00 14.75 ? 708  ASP A CA  1 
ATOM   781  C  C   . ASP A 1 122 ? -9.441  -17.811 -19.277 1.00 15.22 ? 708  ASP A C   1 
ATOM   782  O  O   . ASP A 1 122 ? -10.210 -18.770 -19.385 1.00 16.08 ? 708  ASP A O   1 
ATOM   783  C  CB  . ASP A 1 122 ? -9.796  -15.718 -20.682 1.00 17.30 ? 708  ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 122 ? -8.348  -15.667 -21.133 1.00 19.97 ? 708  ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 122 ? -7.449  -15.444 -20.298 1.00 20.23 ? 708  ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 122 ? -8.114  -15.856 -22.351 1.00 25.22 ? 708  ASP A OD2 1 
ATOM   787  N  N   . SER A 1 123 ? -8.131  -17.965 -19.111 1.00 15.11 ? 709  SER A N   1 
ATOM   788  C  CA  . SER A 1 123 ? -7.551  -19.304 -19.053 1.00 15.94 ? 709  SER A CA  1 
ATOM   789  C  C   . SER A 1 123 ? -8.016  -20.047 -17.801 1.00 15.07 ? 709  SER A C   1 
ATOM   790  O  O   . SER A 1 123 ? -8.252  -21.254 -17.842 1.00 16.43 ? 709  SER A O   1 
ATOM   791  C  CB  . SER A 1 123 ? -6.021  -19.247 -19.102 1.00 21.51 ? 709  SER A CB  1 
ATOM   792  O  OG  . SER A 1 123 ? -5.488  -18.482 -18.045 1.00 26.59 ? 709  SER A OG  1 
ATOM   793  N  N   . PHE A 1 124 ? -8.161  -19.332 -16.691 1.00 14.26 ? 710  PHE A N   1 
ATOM   794  C  CA  . PHE A 1 124 ? -8.658  -19.962 -15.471 1.00 12.73 ? 710  PHE A CA  1 
ATOM   795  C  C   . PHE A 1 124 ? -10.071 -20.519 -15.671 1.00 12.75 ? 710  PHE A C   1 
ATOM   796  O  O   . PHE A 1 124 ? -10.346 -21.685 -15.362 1.00 13.28 ? 710  PHE A O   1 
ATOM   797  C  CB  . PHE A 1 124 ? -8.642  -18.965 -14.306 1.00 13.58 ? 710  PHE A CB  1 
ATOM   798  C  CG  . PHE A 1 124 ? -9.163  -19.532 -13.011 1.00 13.22 ? 710  PHE A CG  1 
ATOM   799  C  CD1 . PHE A 1 124 ? -8.434  -20.492 -12.316 1.00 13.80 ? 710  PHE A CD1 1 
ATOM   800  C  CD2 . PHE A 1 124 ? -10.384 -19.126 -12.494 1.00 14.49 ? 710  PHE A CD2 1 
ATOM   801  C  CE1 . PHE A 1 124 ? -8.903  -20.999 -11.113 1.00 14.19 ? 710  PHE A CE1 1 
ATOM   802  C  CE2 . PHE A 1 124 ? -10.852 -19.633 -11.284 1.00 15.37 ? 710  PHE A CE2 1 
ATOM   803  C  CZ  . PHE A 1 124 ? -10.112 -20.581 -10.603 1.00 14.72 ? 710  PHE A CZ  1 
ATOM   804  N  N   . LEU A 1 125 ? -10.970 -19.690 -16.189 1.00 12.99 ? 711  LEU A N   1 
ATOM   805  C  CA  . LEU A 1 125 ? -12.349 -20.135 -16.342 1.00 13.26 ? 711  LEU A CA  1 
ATOM   806  C  C   . LEU A 1 125 ? -12.483 -21.282 -17.335 1.00 12.97 ? 711  LEU A C   1 
ATOM   807  O  O   . LEU A 1 125 ? -13.341 -22.147 -17.155 1.00 14.02 ? 711  LEU A O   1 
ATOM   808  C  CB  . LEU A 1 125 ? -13.248 -18.984 -16.760 1.00 13.86 ? 711  LEU A CB  1 
ATOM   809  C  CG  . LEU A 1 125 ? -13.406 -17.920 -15.675 1.00 16.04 ? 711  LEU A CG  1 
ATOM   810  C  CD1 . LEU A 1 125 ? -14.234 -16.786 -16.223 1.00 17.61 ? 711  LEU A CD1 1 
ATOM   811  C  CD2 . LEU A 1 125 ? -14.031 -18.487 -14.400 1.00 17.90 ? 711  LEU A CD2 1 
ATOM   812  N  N   . ARG A 1 126 ? -11.641 -21.308 -18.369 1.00 13.81 ? 712  ARG A N   1 
ATOM   813  C  CA  . ARG A 1 126 ? -11.688 -22.402 -19.338 1.00 15.44 ? 712  ARG A CA  1 
ATOM   814  C  C   . ARG A 1 126 ? -11.388 -23.753 -18.683 1.00 16.32 ? 712  ARG A C   1 
ATOM   815  O  O   . ARG A 1 126 ? -11.843 -24.799 -19.165 1.00 19.22 ? 712  ARG A O   1 
ATOM   816  C  CB  . ARG A 1 126 ? -10.703 -22.154 -20.486 1.00 17.35 ? 712  ARG A CB  1 
ATOM   817  C  CG  . ARG A 1 126 ? -11.159 -21.102 -21.464 1.00 20.01 ? 712  ARG A CG  1 
ATOM   818  C  CD  . ARG A 1 126 ? -10.138 -20.870 -22.573 1.00 24.12 ? 712  ARG A CD  1 
ATOM   819  N  NE  . ARG A 1 126 ? -10.309 -19.526 -23.111 1.00 31.57 ? 712  ARG A NE  1 
ATOM   820  C  CZ  . ARG A 1 126 ? -9.360  -18.598 -23.125 1.00 32.33 ? 712  ARG A CZ  1 
ATOM   821  N  NH1 . ARG A 1 126 ? -9.617  -17.401 -23.632 1.00 36.33 ? 712  ARG A NH1 1 
ATOM   822  N  NH2 . ARG A 1 126 ? -8.147  -18.877 -22.667 1.00 32.41 ? 712  ARG A NH2 1 
ATOM   823  N  N   . LYS A 1 127 ? -10.627 -23.756 -17.593 1.00 16.94 ? 713  LYS A N   1 
ATOM   824  C  CA  . LYS A 1 127 ? -10.309 -25.000 -16.878 1.00 17.30 ? 713  LYS A CA  1 
ATOM   825  C  C   . LYS A 1 127 ? -11.469 -25.465 -16.018 1.00 16.49 ? 713  LYS A C   1 
ATOM   826  O  O   . LYS A 1 127 ? -11.461 -26.583 -15.495 1.00 19.29 ? 713  LYS A O   1 
ATOM   827  C  CB  . LYS A 1 127 ? -9.090  -24.805 -15.982 1.00 19.08 ? 713  LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 127 ? -7.795  -24.584 -16.699 1.00 20.85 ? 713  LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 127 ? -6.676  -24.502 -15.679 1.00 25.88 ? 713  LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 127 ? -5.494  -23.720 -16.201 1.00 29.68 ? 713  LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 127 ? -4.448  -23.604 -15.160 1.00 32.85 ? 713  LYS A NZ  1 
ATOM   832  N  N   . HIS A 1 128 ? -12.450 -24.632 -15.826 1.00 17.31 ? 714  HIS A N   1 
ATOM   833  C  CA  . HIS A 1 128 ? -13.492 -24.842 -14.893 1.00 16.89 ? 714  HIS A CA  1 
ATOM   834  C  C   . HIS A 1 128 ? -14.902 -24.657 -15.426 1.00 16.69 ? 714  HIS A C   1 
ATOM   835  O  O   . HIS A 1 128 ? -15.717 -24.240 -14.758 1.00 17.16 ? 714  HIS A O   1 
ATOM   836  C  CB  . HIS A 1 128 ? -13.255 -23.992 -13.637 1.00 16.20 ? 714  HIS A CB  1 
ATOM   837  C  CG  . HIS A 1 128 ? -11.943 -24.266 -12.998 1.00 15.80 ? 714  HIS A CG  1 
ATOM   838  N  ND1 . HIS A 1 128 ? -11.664 -25.453 -12.366 1.00 15.28 ? 714  HIS A ND1 1 
ATOM   839  C  CD2 . HIS A 1 128 ? -10.824 -23.524 -12.901 1.00 16.53 ? 714  HIS A CD2 1 
ATOM   840  C  CE1 . HIS A 1 128 ? -10.430 -25.433 -11.935 1.00 15.92 ? 714  HIS A CE1 1 
ATOM   841  N  NE2 . HIS A 1 128 ? -9.893  -24.273 -12.245 1.00 16.52 ? 714  HIS A NE2 1 
ATOM   842  N  N   . ASP A 1 129 ? -15.103 -25.057 -16.666 1.00 17.08 ? 715  ASP A N   1 
ATOM   843  C  CA  . ASP A 1 129 ? -16.369 -24.824 -17.341 1.00 18.41 ? 715  ASP A CA  1 
ATOM   844  C  C   . ASP A 1 129 ? -17.539 -25.351 -16.524 1.00 18.77 ? 715  ASP A C   1 
ATOM   845  O  O   . ASP A 1 129 ? -17.565 -26.523 -16.155 1.00 19.88 ? 715  ASP A O   1 
ATOM   846  C  CB  . ASP A 1 129 ? -16.338 -25.470 -18.723 1.00 19.62 ? 715  ASP A CB  1 
ATOM   847  C  CG  . ASP A 1 129 ? -17.556 -25.138 -19.552 1.00 24.83 ? 715  ASP A CG  1 
ATOM   848  O  OD1 . ASP A 1 129 ? -18.105 -24.025 -19.417 1.00 26.52 ? 715  ASP A OD1 1 
ATOM   849  O  OD2 . ASP A 1 129 ? -17.957 -25.997 -20.350 1.00 28.39 ? 715  ASP A OD2 1 
ATOM   850  N  N   . ALA A 1 130 ? -18.475 -24.456 -16.218 1.00 18.79 ? 716  ALA A N   1 
ATOM   851  C  CA  . ALA A 1 130 ? -19.717 -24.767 -15.509 1.00 19.37 ? 716  ALA A CA  1 
ATOM   852  C  C   . ALA A 1 130 ? -19.484 -25.235 -14.069 1.00 19.63 ? 716  ALA A C   1 
ATOM   853  O  O   . ALA A 1 130 ? -20.344 -25.900 -13.495 1.00 22.67 ? 716  ALA A O   1 
ATOM   854  C  CB  . ALA A 1 130 ? -20.536 -25.821 -16.291 1.00 20.60 ? 716  ALA A CB  1 
ATOM   855  N  N   . GLN A 1 131 ? -18.352 -24.865 -13.472 1.00 17.77 ? 717  GLN A N   1 
ATOM   856  C  CA  . GLN A 1 131 ? -18.014 -25.382 -12.143 1.00 17.64 ? 717  GLN A CA  1 
ATOM   857  C  C   . GLN A 1 131 ? -18.192 -24.373 -11.014 1.00 17.37 ? 717  GLN A C   1 
ATOM   858  O  O   . GLN A 1 131 ? -18.048 -24.731 -9.844  1.00 20.12 ? 717  GLN A O   1 
ATOM   859  C  CB  . GLN A 1 131 ? -16.569 -25.900 -12.106 1.00 18.24 ? 717  GLN A CB  1 
ATOM   860  C  CG  . GLN A 1 131 ? -16.290 -27.092 -12.999 1.00 18.39 ? 717  GLN A CG  1 
ATOM   861  C  CD  . GLN A 1 131 ? -14.811 -27.448 -13.051 1.00 17.69 ? 717  GLN A CD  1 
ATOM   862  O  OE1 . GLN A 1 131 ? -14.027 -26.996 -12.221 1.00 18.46 ? 717  GLN A OE1 1 
ATOM   863  N  NE2 . GLN A 1 131 ? -14.424 -28.260 -14.028 1.00 18.42 ? 717  GLN A NE2 1 
ATOM   864  N  N   . PHE A 1 132 ? -18.471 -23.117 -11.344 1.00 16.68 ? 718  PHE A N   1 
ATOM   865  C  CA  . PHE A 1 132 ? -18.681 -22.108 -10.309 1.00 17.45 ? 718  PHE A CA  1 
ATOM   866  C  C   . PHE A 1 132 ? -20.154 -21.758 -10.187 1.00 18.70 ? 718  PHE A C   1 
ATOM   867  O  O   . PHE A 1 132 ? -20.932 -21.972 -11.124 1.00 20.47 ? 718  PHE A O   1 
ATOM   868  C  CB  . PHE A 1 132 ? -17.851 -20.844 -10.592 1.00 16.58 ? 718  PHE A CB  1 
ATOM   869  C  CG  . PHE A 1 132 ? -16.367 -21.078 -10.536 1.00 18.09 ? 718  PHE A CG  1 
ATOM   870  C  CD1 . PHE A 1 132 ? -15.762 -21.486 -9.358  1.00 21.34 ? 718  PHE A CD1 1 
ATOM   871  C  CD2 . PHE A 1 132 ? -15.581 -20.909 -11.661 1.00 18.24 ? 718  PHE A CD2 1 
ATOM   872  C  CE1 . PHE A 1 132 ? -14.405 -21.723 -9.305  1.00 21.06 ? 718  PHE A CE1 1 
ATOM   873  C  CE2 . PHE A 1 132 ? -14.215 -21.141 -11.610 1.00 18.85 ? 718  PHE A CE2 1 
ATOM   874  C  CZ  . PHE A 1 132 ? -13.629 -21.552 -10.430 1.00 19.51 ? 718  PHE A CZ  1 
ATOM   875  N  N   . THR A 1 133 ? -20.539 -21.217 -9.035  1.00 18.43 ? 719  THR A N   1 
ATOM   876  C  CA  . THR A 1 133 ? -21.908 -20.745 -8.863  1.00 18.98 ? 719  THR A CA  1 
ATOM   877  C  C   . THR A 1 133 ? -22.063 -19.375 -9.513  1.00 18.03 ? 719  THR A C   1 
ATOM   878  O  O   . THR A 1 133 ? -21.084 -18.662 -9.704  1.00 16.63 ? 719  THR A O   1 
ATOM   879  C  CB  . THR A 1 133 ? -22.306 -20.644 -7.379  1.00 20.45 ? 719  THR A CB  1 
ATOM   880  O  OG1 . THR A 1 133 ? -21.588 -19.565 -6.753  1.00 21.24 ? 719  THR A OG1 1 
ATOM   881  C  CG2 . THR A 1 133 ? -22.025 -21.964 -6.663  1.00 21.96 ? 719  THR A CG2 1 
ATOM   882  N  N   . VAL A 1 134 ? -23.282 -18.986 -9.809  1.00 19.61 ? 720  VAL A N   1 
ATOM   883  C  CA  . VAL A 1 134 ? -23.522 -17.662 -10.355 1.00 19.61 ? 720  VAL A CA  1 
ATOM   884  C  C   . VAL A 1 134 ? -23.027 -16.602 -9.378  1.00 17.19 ? 720  VAL A C   1 
ATOM   885  O  O   . VAL A 1 134 ? -22.456 -15.641 -9.803  1.00 17.11 ? 720  VAL A O   1 
ATOM   886  C  CB  . VAL A 1 134 ? -25.006 -17.433 -10.678 1.00 22.23 ? 720  VAL A CB  1 
ATOM   887  C  CG1 . VAL A 1 134 ? -25.267 -15.996 -11.058 1.00 22.50 ? 720  VAL A CG1 1 
ATOM   888  C  CG2 . VAL A 1 134 ? -25.425 -18.312 -11.818 1.00 25.87 ? 720  VAL A CG2 1 
ATOM   889  N  N   . ILE A 1 135 ? -23.237 -16.803 -8.087  1.00 18.15 ? 721  ILE A N   1 
ATOM   890  C  CA  . ILE A 1 135 ? -22.803 -15.812 -7.109  1.00 19.11 ? 721  ILE A CA  1 
ATOM   891  C  C   . ILE A 1 135 ? -21.275 -15.684 -7.113  1.00 16.24 ? 721  ILE A C   1 
ATOM   892  O  O   . ILE A 1 135 ? -20.743 -14.582 -7.009  1.00 16.63 ? 721  ILE A O   1 
ATOM   893  C  CB  . ILE A 1 135 ? -23.321 -16.152 -5.692  1.00 22.78 ? 721  ILE A CB  1 
ATOM   894  C  CG1 . ILE A 1 135 ? -24.824 -15.877 -5.612  1.00 25.21 ? 721  ILE A CG1 1 
ATOM   895  C  CG2 . ILE A 1 135 ? -22.610 -15.318 -4.640  1.00 24.74 ? 721  ILE A CG2 1 
ATOM   896  C  CD1 . ILE A 1 135 ? -25.184 -14.413 -5.774  1.00 27.57 ? 721  ILE A CD1 1 
ATOM   897  N  N   . GLN A 1 136 ? -20.558 -16.792 -7.275  1.00 16.30 ? 722  GLN A N   1 
ATOM   898  C  CA  . GLN A 1 136 ? -19.103 -16.701 -7.406  1.00 15.39 ? 722  GLN A CA  1 
ATOM   899  C  C   . GLN A 1 136 ? -18.686 -15.888 -8.636  1.00 14.66 ? 722  GLN A C   1 
ATOM   900  O  O   . GLN A 1 136 ? -17.773 -15.065 -8.573  1.00 15.03 ? 722  GLN A O   1 
ATOM   901  C  CB  . GLN A 1 136 ? -18.474 -18.088 -7.492  1.00 16.15 ? 722  GLN A CB  1 
ATOM   902  C  CG  . GLN A 1 136 ? -18.371 -18.811 -6.172  1.00 18.56 ? 722  GLN A CG  1 
ATOM   903  C  CD  . GLN A 1 136 ? -17.784 -20.198 -6.351  1.00 20.30 ? 722  GLN A CD  1 
ATOM   904  O  OE1 . GLN A 1 136 ? -18.297 -20.996 -7.135  1.00 21.32 ? 722  GLN A OE1 1 
ATOM   905  N  NE2 . GLN A 1 136 ? -16.686 -20.479 -5.658  1.00 22.54 ? 722  GLN A NE2 1 
ATOM   906  N  N   . LEU A 1 137 ? -19.340 -16.140 -9.764  1.00 13.98 ? 723  LEU A N   1 
ATOM   907  C  CA  . LEU A 1 137 ? -19.031 -15.398 -10.985 1.00 13.52 ? 723  LEU A CA  1 
ATOM   908  C  C   . LEU A 1 137 ? -19.348 -13.912 -10.808 1.00 13.35 ? 723  LEU A C   1 
ATOM   909  O  O   . LEU A 1 137 ? -18.579 -13.065 -11.251 1.00 13.32 ? 723  LEU A O   1 
ATOM   910  C  CB  . LEU A 1 137 ? -19.800 -15.969 -12.179 1.00 13.73 ? 723  LEU A CB  1 
ATOM   911  C  CG  . LEU A 1 137 ? -19.454 -17.420 -12.524 1.00 14.52 ? 723  LEU A CG  1 
ATOM   912  C  CD1 . LEU A 1 137 ? -20.355 -17.906 -13.624 1.00 16.96 ? 723  LEU A CD1 1 
ATOM   913  C  CD2 . LEU A 1 137 ? -17.981 -17.558 -12.924 1.00 16.62 ? 723  LEU A CD2 1 
ATOM   914  N  N   . VAL A 1 138 ? -20.468 -13.602 -10.151 1.00 13.96 ? 724  VAL A N   1 
ATOM   915  C  CA  . VAL A 1 138 ? -20.860 -12.208 -9.935  1.00 14.26 ? 724  VAL A CA  1 
ATOM   916  C  C   . VAL A 1 138 ? -19.833 -11.515 -9.037  1.00 13.97 ? 724  VAL A C   1 
ATOM   917  O  O   . VAL A 1 138 ? -19.500 -10.347 -9.255  1.00 15.22 ? 724  VAL A O   1 
ATOM   918  C  CB  . VAL A 1 138 ? -22.289 -12.101 -9.340  1.00 16.32 ? 724  VAL A CB  1 
ATOM   919  C  CG1 . VAL A 1 138 ? -22.583 -10.686 -8.857  1.00 18.07 ? 724  VAL A CG1 1 
ATOM   920  C  CG2 . VAL A 1 138 ? -23.328 -12.540 -10.376 1.00 17.84 ? 724  VAL A CG2 1 
ATOM   921  N  N   . GLY A 1 139 ? -19.305 -12.230 -8.045  1.00 14.09 ? 725  GLY A N   1 
ATOM   922  C  CA  . GLY A 1 139 ? -18.229 -11.697 -7.230  1.00 14.48 ? 725  GLY A CA  1 
ATOM   923  C  C   . GLY A 1 139 ? -17.000 -11.298 -8.038  1.00 13.35 ? 725  GLY A C   1 
ATOM   924  O  O   . GLY A 1 139 ? -16.412 -10.235 -7.803  1.00 14.43 ? 725  GLY A O   1 
ATOM   925  N  N   . MET A 1 140 ? -16.595 -12.154 -8.972  1.00 12.83 ? 726  MET A N   1 
ATOM   926  C  CA  . MET A 1 140 ? -15.495 -11.845 -9.872  1.00 12.65 ? 726  MET A CA  1 
ATOM   927  C  C   . MET A 1 140 ? -15.786 -10.572 -10.664 1.00 12.13 ? 726  MET A C   1 
ATOM   928  O  O   . MET A 1 140 ? -14.956 -9.661  -10.755 1.00 13.07 ? 726  MET A O   1 
ATOM   929  C  CB  . MET A 1 140 ? -15.257 -13.004 -10.839 1.00 13.45 ? 726  MET A CB  1 
ATOM   930  C  CG  . MET A 1 140 ? -14.804 -14.283 -10.167 1.00 14.05 ? 726  MET A CG  1 
ATOM   931  S  SD  . MET A 1 140 ? -14.728 -15.618 -11.381 1.00 15.08 ? 726  MET A SD  1 
ATOM   932  C  CE  . MET A 1 140 ? -14.571 -17.071 -10.333 1.00 16.13 ? 726  MET A CE  1 
ATOM   933  N  N   . LEU A 1 141 ? -16.989 -10.525 -11.223 1.00 12.50 ? 727  LEU A N   1 
ATOM   934  C  CA  . LEU A 1 141 ? -17.411 -9.417  -12.065 1.00 12.38 ? 727  LEU A CA  1 
ATOM   935  C  C   . LEU A 1 141 ? -17.485 -8.114  -11.279 1.00 12.16 ? 727  LEU A C   1 
ATOM   936  O  O   . LEU A 1 141 ? -17.152 -7.048  -11.804 1.00 11.98 ? 727  LEU A O   1 
ATOM   937  C  CB  . LEU A 1 141 ? -18.760 -9.750  -12.701 1.00 13.33 ? 727  LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 141 ? -18.602 -10.866 -13.734 1.00 14.92 ? 727  LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 141 ? -19.924 -11.547 -14.021 1.00 17.86 ? 727  LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 141 ? -17.983 -10.288 -15.008 1.00 16.14 ? 727  LEU A CD2 1 
ATOM   941  N  N   . ARG A 1 142 ? -17.937 -8.197  -10.030 1.00 12.53 ? 728  ARG A N   1 
ATOM   942  C  CA  . ARG A 1 142 ? -18.036 -7.006  -9.197  1.00 13.02 ? 728  ARG A CA  1 
ATOM   943  C  C   . ARG A 1 142 ? -16.645 -6.444  -8.910  1.00 12.60 ? 728  ARG A C   1 
ATOM   944  O  O   . ARG A 1 142 ? -16.443 -5.227  -8.934  1.00 13.20 ? 728  ARG A O   1 
ATOM   945  C  CB  . ARG A 1 142 ? -18.781 -7.332  -7.898  1.00 14.96 ? 728  ARG A CB  1 
ATOM   946  C  CG  . ARG A 1 142 ? -19.241 -6.126  -7.106  1.00 18.74 ? 728  ARG A CG  1 
ATOM   947  C  CD  . ARG A 1 142 ? -18.208 -5.642  -6.115  1.00 22.26 ? 728  ARG A CD  1 
ATOM   948  N  NE  . ARG A 1 142 ? -18.796 -4.597  -5.280  1.00 23.31 ? 728  ARG A NE  1 
ATOM   949  C  CZ  . ARG A 1 142 ? -18.114 -3.632  -4.677  1.00 25.02 ? 728  ARG A CZ  1 
ATOM   950  N  NH1 . ARG A 1 142 ? -16.794 -3.566  -4.798  1.00 25.09 ? 728  ARG A NH1 1 
ATOM   951  N  NH2 . ARG A 1 142 ? -18.764 -2.725  -3.962  1.00 24.83 ? 728  ARG A NH2 1 
ATOM   952  N  N   . GLY A 1 143 ? -15.677 -7.317  -8.654  1.00 12.90 ? 729  GLY A N   1 
ATOM   953  C  CA  . GLY A 1 143 ? -14.309 -6.864  -8.454  1.00 12.12 ? 729  GLY A CA  1 
ATOM   954  C  C   . GLY A 1 143 ? -13.751 -6.142  -9.668  1.00 11.34 ? 729  GLY A C   1 
ATOM   955  O  O   . GLY A 1 143 ? -13.184 -5.055  -9.563  1.00 12.30 ? 729  GLY A O   1 
ATOM   956  N  N   . ILE A 1 144 ? -13.943 -6.724  -10.845 1.00 11.35 ? 730  ILE A N   1 
ATOM   957  C  CA  . ILE A 1 144 ? -13.472 -6.081  -12.066 1.00 12.13 ? 730  ILE A CA  1 
ATOM   958  C  C   . ILE A 1 144 ? -14.126 -4.707  -12.231 1.00 11.27 ? 730  ILE A C   1 
ATOM   959  O  O   . ILE A 1 144 ? -13.450 -3.715  -12.527 1.00 11.44 ? 730  ILE A O   1 
ATOM   960  C  CB  . ILE A 1 144 ? -13.762 -6.945  -13.304 1.00 11.47 ? 730  ILE A CB  1 
ATOM   961  C  CG1 . ILE A 1 144 ? -13.072 -8.306  -13.165 1.00 12.17 ? 730  ILE A CG1 1 
ATOM   962  C  CG2 . ILE A 1 144 ? -13.314 -6.228  -14.589 1.00 12.95 ? 730  ILE A CG2 1 
ATOM   963  C  CD1 . ILE A 1 144 ? -13.644 -9.349  -14.108 1.00 13.34 ? 730  ILE A CD1 1 
ATOM   964  N  N   . ALA A 1 145 ? -15.438 -4.632  -12.008 1.00 11.69 ? 731  ALA A N   1 
ATOM   965  C  CA  . ALA A 1 145 ? -16.142 -3.362  -12.161 1.00 12.00 ? 731  ALA A CA  1 
ATOM   966  C  C   . ALA A 1 145 ? -15.638 -2.306  -11.173 1.00 12.13 ? 731  ALA A C   1 
ATOM   967  O  O   . ALA A 1 145 ? -15.545 -1.119  -11.515 1.00 12.97 ? 731  ALA A O   1 
ATOM   968  C  CB  . ALA A 1 145 ? -17.645 -3.564  -12.000 1.00 12.77 ? 731  ALA A CB  1 
ATOM   969  N  N   A SER A 1 146 ? -15.348 -2.727  -9.948  0.72 12.26 ? 732  SER A N   1 
ATOM   970  N  N   B SER A 1 146 ? -15.301 -2.726  -9.956  0.28 11.94 ? 732  SER A N   1 
ATOM   971  C  CA  A SER A 1 146 ? -14.839 -1.807  -8.943  0.72 13.27 ? 732  SER A CA  1 
ATOM   972  C  CA  B SER A 1 146 ? -14.834 -1.788  -8.935  0.28 12.53 ? 732  SER A CA  1 
ATOM   973  C  C   A SER A 1 146 ? -13.497 -1.235  -9.391  0.72 11.96 ? 732  SER A C   1 
ATOM   974  C  C   B SER A 1 146 ? -13.425 -1.273  -9.223  0.28 11.24 ? 732  SER A C   1 
ATOM   975  O  O   A SER A 1 146 ? -13.277 -0.024  -9.335  0.72 12.43 ? 732  SER A O   1 
ATOM   976  O  O   B SER A 1 146 ? -13.082 -0.146  -8.859  0.28 9.57  ? 732  SER A O   1 
ATOM   977  C  CB  A SER A 1 146 ? -14.709 -2.519  -7.597  0.72 14.39 ? 732  SER A CB  1 
ATOM   978  C  CB  B SER A 1 146 ? -14.878 -2.440  -7.555  0.28 13.46 ? 732  SER A CB  1 
ATOM   979  O  OG  A SER A 1 146 ? -14.367 -1.611  -6.568  0.72 15.25 ? 732  SER A OG  1 
ATOM   980  O  OG  B SER A 1 146 ? -16.208 -2.532  -7.083  0.28 15.12 ? 732  SER A OG  1 
ATOM   981  N  N   . GLY A 1 147 ? -12.605 -2.101  -9.859  1.00 10.53 ? 733  GLY A N   1 
ATOM   982  C  CA  . GLY A 1 147 ? -11.302 -1.661  -10.320 1.00 11.89 ? 733  GLY A CA  1 
ATOM   983  C  C   . GLY A 1 147 ? -11.459 -0.674  -11.464 1.00 13.71 ? 733  GLY A C   1 
ATOM   984  O  O   . GLY A 1 147 ? -10.760 0.341   -11.514 1.00 16.69 ? 733  GLY A O   1 
ATOM   985  N  N   . MET A 1 148 ? -12.349 -0.979  -12.397 1.00 12.52 ? 734  MET A N   1 
ATOM   986  C  CA  . MET A 1 148 ? -12.575 -0.079  -13.528 1.00 11.97 ? 734  MET A CA  1 
ATOM   987  C  C   . MET A 1 148 ? -13.202 1.242   -13.093 1.00 13.12 ? 734  MET A C   1 
ATOM   988  O  O   . MET A 1 148 ? -12.920 2.282   -13.690 1.00 13.51 ? 734  MET A O   1 
ATOM   989  C  CB  . MET A 1 148 ? -13.456 -0.730  -14.589 1.00 12.64 ? 734  MET A CB  1 
ATOM   990  C  CG  . MET A 1 148 ? -12.778 -1.867  -15.333 1.00 13.26 ? 734  MET A CG  1 
ATOM   991  S  SD  . MET A 1 148 ? -11.214 -1.407  -16.104 1.00 14.55 ? 734  MET A SD  1 
ATOM   992  C  CE  . MET A 1 148 ? -11.679 -0.003  -17.112 1.00 15.89 ? 734  MET A CE  1 
ATOM   993  N  N   . LYS A 1 149 ? -14.042 1.206   -12.053 1.00 12.97 ? 735  LYS A N   1 
ATOM   994  C  CA  . LYS A 1 149 ? -14.639 2.434   -11.544 1.00 13.80 ? 735  LYS A CA  1 
ATOM   995  C  C   . LYS A 1 149 ? -13.531 3.351   -11.045 1.00 13.61 ? 735  LYS A C   1 
ATOM   996  O  O   . LYS A 1 149 ? -13.561 4.567   -11.287 1.00 14.56 ? 735  LYS A O   1 
ATOM   997  C  CB  . LYS A 1 149 ? -15.656 2.119   -10.442 1.00 15.47 ? 735  LYS A CB  1 
ATOM   998  C  CG  . LYS A 1 149 ? -16.607 3.262   -10.072 1.00 17.27 ? 735  LYS A CG  1 
ATOM   999  C  CD  . LYS A 1 149 ? -15.982 4.238   -9.097  1.00 20.01 ? 735  LYS A CD  1 
ATOM   1000 C  CE  . LYS A 1 149 ? -16.975 5.305   -8.666  1.00 21.71 ? 735  LYS A CE  1 
ATOM   1001 N  NZ  . LYS A 1 149 ? -16.373 6.233   -7.676  1.00 23.51 ? 735  LYS A NZ  1 
ATOM   1002 N  N   . TYR A 1 150 ? -12.541 2.781   -10.371 1.00 13.40 ? 736  TYR A N   1 
ATOM   1003 C  CA  . TYR A 1 150 ? -11.438 3.595   -9.874  1.00 13.30 ? 736  TYR A CA  1 
ATOM   1004 C  C   . TYR A 1 150 ? -10.565 4.107   -11.015 1.00 14.79 ? 736  TYR A C   1 
ATOM   1005 O  O   . TYR A 1 150 ? -10.209 5.290   -11.031 1.00 14.84 ? 736  TYR A O   1 
ATOM   1006 C  CB  . TYR A 1 150 ? -10.589 2.822   -8.859  1.00 15.08 ? 736  TYR A CB  1 
ATOM   1007 C  CG  . TYR A 1 150 ? -9.565  3.710   -8.190  1.00 16.60 ? 736  TYR A CG  1 
ATOM   1008 C  CD1 . TYR A 1 150 ? -9.964  4.859   -7.515  1.00 18.64 ? 736  TYR A CD1 1 
ATOM   1009 C  CD2 . TYR A 1 150 ? -8.202  3.413   -8.237  1.00 17.26 ? 736  TYR A CD2 1 
ATOM   1010 C  CE1 . TYR A 1 150 ? -9.047  5.681   -6.902  1.00 17.91 ? 736  TYR A CE1 1 
ATOM   1011 C  CE2 . TYR A 1 150 ? -7.271  4.228   -7.600  1.00 16.58 ? 736  TYR A CE2 1 
ATOM   1012 C  CZ  . TYR A 1 150 ? -7.703  5.360   -6.943  1.00 17.15 ? 736  TYR A CZ  1 
ATOM   1013 O  OH  . TYR A 1 150 ? -6.799  6.195   -6.312  1.00 18.76 ? 736  TYR A OH  1 
ATOM   1014 N  N   . LEU A 1 151 ? -10.247 3.257   -11.983 1.00 15.03 ? 737  LEU A N   1 
ATOM   1015 C  CA  . LEU A 1 151 ? -9.463  3.697   -13.131 1.00 15.06 ? 737  LEU A CA  1 
ATOM   1016 C  C   . LEU A 1 151 ? -10.108 4.871   -13.845 1.00 14.62 ? 737  LEU A C   1 
ATOM   1017 O  O   . LEU A 1 151 ? -9.440  5.851   -14.181 1.00 17.59 ? 737  LEU A O   1 
ATOM   1018 C  CB  . LEU A 1 151 ? -9.284  2.560   -14.119 1.00 15.17 ? 737  LEU A CB  1 
ATOM   1019 C  CG  . LEU A 1 151 ? -8.322  1.471   -13.688 1.00 19.44 ? 737  LEU A CG  1 
ATOM   1020 C  CD1 . LEU A 1 151 ? -8.177  0.483   -14.825 1.00 21.95 ? 737  LEU A CD1 1 
ATOM   1021 C  CD2 . LEU A 1 151 ? -6.988  2.082   -13.338 1.00 20.71 ? 737  LEU A CD2 1 
ATOM   1022 N  N   . SER A 1 152 ? -11.409 4.765   -14.091 1.00 14.97 ? 738  SER A N   1 
ATOM   1023 C  CA  . SER A 1 152 ? -12.111 5.828   -14.800 1.00 15.93 ? 738  SER A CA  1 
ATOM   1024 C  C   . SER A 1 152 ? -12.212 7.082   -13.922 1.00 16.48 ? 738  SER A C   1 
ATOM   1025 O  O   . SER A 1 152 ? -12.136 8.206   -14.429 1.00 18.09 ? 738  SER A O   1 
ATOM   1026 C  CB  . SER A 1 152 ? -13.489 5.357   -15.255 1.00 19.55 ? 738  SER A CB  1 
ATOM   1027 O  OG  . SER A 1 152 ? -14.227 4.774   -14.203 1.00 20.03 ? 738  SER A OG  1 
ATOM   1028 N  N   . ASP A 1 153 ? -12.361 6.902   -12.607 1.00 15.38 ? 739  ASP A N   1 
ATOM   1029 C  CA  . ASP A 1 153 ? -12.314 8.025   -11.663 1.00 16.67 ? 739  ASP A CA  1 
ATOM   1030 C  C   . ASP A 1 153 ? -11.002 8.771   -11.791 1.00 17.44 ? 739  ASP A C   1 
ATOM   1031 O  O   . ASP A 1 153 ? -10.953 9.980   -11.574 1.00 19.10 ? 739  ASP A O   1 
ATOM   1032 C  CB  . ASP A 1 153 ? -12.448 7.544   -10.219 1.00 18.13 ? 739  ASP A CB  1 
ATOM   1033 C  CG  . ASP A 1 153 ? -13.877 7.479   -9.733  1.00 20.53 ? 739  ASP A CG  1 
ATOM   1034 O  OD1 . ASP A 1 153 ? -14.814 7.642   -10.537 1.00 22.55 ? 739  ASP A OD1 1 
ATOM   1035 O  OD2 . ASP A 1 153 ? -14.052 7.231   -8.521  1.00 23.11 ? 739  ASP A OD2 1 
ATOM   1036 N  N   . MET A 1 154 ? -9.930  8.048   -12.107 1.00 17.47 ? 740  MET A N   1 
ATOM   1037 C  CA  . MET A 1 154 ? -8.594  8.644   -12.174 1.00 19.71 ? 740  MET A CA  1 
ATOM   1038 C  C   . MET A 1 154 ? -8.274  9.210   -13.554 1.00 18.91 ? 740  MET A C   1 
ATOM   1039 O  O   . MET A 1 154 ? -7.168  9.705   -13.778 1.00 22.50 ? 740  MET A O   1 
ATOM   1040 C  CB  . MET A 1 154 ? -7.528  7.613   -11.784 1.00 20.68 ? 740  MET A CB  1 
ATOM   1041 C  CG  . MET A 1 154 ? -7.608  7.168   -10.343 1.00 22.40 ? 740  MET A CG  1 
ATOM   1042 S  SD  . MET A 1 154 ? -7.018  8.425   -9.204  1.00 25.17 ? 740  MET A SD  1 
ATOM   1043 C  CE  . MET A 1 154 ? -5.253  8.363   -9.492  1.00 24.61 ? 740  MET A CE  1 
ATOM   1044 N  N   . GLY A 1 155 ? -9.227  9.125   -14.481 1.00 17.92 ? 741  GLY A N   1 
ATOM   1045 C  CA  . GLY A 1 155 ? -9.062  9.721   -15.796 1.00 18.46 ? 741  GLY A CA  1 
ATOM   1046 C  C   . GLY A 1 155 ? -8.353  8.820   -16.782 1.00 17.50 ? 741  GLY A C   1 
ATOM   1047 O  O   . GLY A 1 155 ? -7.913  9.262   -17.835 1.00 22.34 ? 741  GLY A O   1 
ATOM   1048 N  N   A TYR A 1 156 ? -8.221  7.536   -16.479 0.67 16.27 ? 742  TYR A N   1 
ATOM   1049 N  N   B TYR A 1 156 ? -8.206  7.533   -16.475 0.33 16.78 ? 742  TYR A N   1 
ATOM   1050 C  CA  A TYR A 1 156 ? -7.557  6.575   -17.311 0.67 17.34 ? 742  TYR A CA  1 
ATOM   1051 C  CA  B TYR A 1 156 ? -7.565  6.585   -17.350 0.33 17.14 ? 742  TYR A CA  1 
ATOM   1052 C  C   A TYR A 1 156 ? -8.593  5.845   -18.161 0.67 17.25 ? 742  TYR A C   1 
ATOM   1053 C  C   B TYR A 1 156 ? -8.595  5.833   -18.165 0.33 17.33 ? 742  TYR A C   1 
ATOM   1054 O  O   A TYR A 1 156 ? -9.495  5.333   -17.645 0.67 19.93 ? 742  TYR A O   1 
ATOM   1055 O  O   B TYR A 1 156 ? -9.497  5.330   -17.643 0.33 18.21 ? 742  TYR A O   1 
ATOM   1056 C  CB  A TYR A 1 156 ? -6.831  5.590   -16.385 0.67 17.93 ? 742  TYR A CB  1 
ATOM   1057 C  CB  B TYR A 1 156 ? -6.651  5.634   -16.558 0.33 17.30 ? 742  TYR A CB  1 
ATOM   1058 C  CG  A TYR A 1 156 ? -5.917  4.680   -17.075 0.67 18.38 ? 742  TYR A CG  1 
ATOM   1059 C  CG  B TYR A 1 156 ? -5.269  6.280   -16.415 0.33 18.22 ? 742  TYR A CG  1 
ATOM   1060 C  CD1 A TYR A 1 156 ? -4.754  5.145   -17.618 0.67 19.84 ? 742  TYR A CD1 1 
ATOM   1061 C  CD1 B TYR A 1 156 ? -5.000  7.179   -15.376 0.33 19.58 ? 742  TYR A CD1 1 
ATOM   1062 C  CD2 A TYR A 1 156 ? -6.237  3.352   -17.247 0.67 18.64 ? 742  TYR A CD2 1 
ATOM   1063 C  CD2 B TYR A 1 156 ? -4.265  6.011   -17.312 0.33 18.94 ? 742  TYR A CD2 1 
ATOM   1064 C  CE1 A TYR A 1 156 ? -3.916  4.324   -18.297 0.67 20.08 ? 742  TYR A CE1 1 
ATOM   1065 C  CE1 B TYR A 1 156 ? -3.775  7.795   -15.261 0.33 19.77 ? 742  TYR A CE1 1 
ATOM   1066 C  CE2 A TYR A 1 156 ? -5.403  2.536   -17.914 0.67 19.25 ? 742  TYR A CE2 1 
ATOM   1067 C  CE2 B TYR A 1 156 ? -3.033  6.617   -17.184 0.33 20.49 ? 742  TYR A CE2 1 
ATOM   1068 C  CZ  A TYR A 1 156 ? -4.246  3.027   -18.457 0.67 19.98 ? 742  TYR A CZ  1 
ATOM   1069 C  CZ  B TYR A 1 156 ? -2.803  7.499   -16.149 0.33 20.18 ? 742  TYR A CZ  1 
ATOM   1070 O  OH  A TYR A 1 156 ? -3.403  2.236   -19.146 0.67 22.16 ? 742  TYR A OH  1 
ATOM   1071 O  OH  B TYR A 1 156 ? -1.583  8.090   -16.018 0.33 22.79 ? 742  TYR A OH  1 
ATOM   1072 N  N   . VAL A 1 157 ? -8.290  5.697   -19.416 1.00 15.93 ? 743  VAL A N   1 
ATOM   1073 C  CA  . VAL A 1 157 ? -9.035  4.793   -20.285 1.00 15.56 ? 743  VAL A CA  1 
ATOM   1074 C  C   . VAL A 1 157 ? -8.115  3.614   -20.597 1.00 15.35 ? 743  VAL A C   1 
ATOM   1075 O  O   . VAL A 1 157 ? -7.003  3.787   -21.086 1.00 17.36 ? 743  VAL A O   1 
ATOM   1076 C  CB  . VAL A 1 157 ? -9.507  5.495   -21.568 1.00 17.41 ? 743  VAL A CB  1 
ATOM   1077 C  CG1 . VAL A 1 157 ? -10.342 4.551   -22.423 1.00 18.27 ? 743  VAL A CG1 1 
ATOM   1078 C  CG2 . VAL A 1 157 ? -10.292 6.744   -21.198 1.00 21.66 ? 743  VAL A CG2 1 
ATOM   1079 N  N   . HIS A 1 158 ? -8.558  2.412   -20.253 1.00 13.48 ? 744  HIS A N   1 
ATOM   1080 C  CA  . HIS A 1 158 ? -7.704  1.238   -20.345 1.00 14.04 ? 744  HIS A CA  1 
ATOM   1081 C  C   . HIS A 1 158 ? -7.434  0.806   -21.790 1.00 13.88 ? 744  HIS A C   1 
ATOM   1082 O  O   . HIS A 1 158 ? -6.290  0.521   -22.146 1.00 15.52 ? 744  HIS A O   1 
ATOM   1083 C  CB  . HIS A 1 158 ? -8.332  0.094   -19.559 1.00 14.11 ? 744  HIS A CB  1 
ATOM   1084 C  CG  . HIS A 1 158 ? -7.430  -1.081  -19.375 1.00 14.30 ? 744  HIS A CG  1 
ATOM   1085 N  ND1 . HIS A 1 158 ? -7.171  -1.981  -20.386 1.00 15.35 ? 744  HIS A ND1 1 
ATOM   1086 C  CD2 . HIS A 1 158 ? -6.741  -1.518  -18.295 1.00 16.22 ? 744  HIS A CD2 1 
ATOM   1087 C  CE1 . HIS A 1 158 ? -6.362  -2.924  -19.934 1.00 15.43 ? 744  HIS A CE1 1 
ATOM   1088 N  NE2 . HIS A 1 158 ? -6.083  -2.662  -18.668 1.00 16.06 ? 744  HIS A NE2 1 
ATOM   1089 N  N   . ARG A 1 159 ? -8.501  0.748   -22.590 1.00 14.01 ? 745  ARG A N   1 
ATOM   1090 C  CA  . ARG A 1 159 ? -8.484  0.386   -24.017 1.00 15.32 ? 745  ARG A CA  1 
ATOM   1091 C  C   . ARG A 1 159 ? -8.214  -1.086  -24.317 1.00 15.71 ? 745  ARG A C   1 
ATOM   1092 O  O   . ARG A 1 159 ? -8.339  -1.501  -25.469 1.00 18.99 ? 745  ARG A O   1 
ATOM   1093 C  CB  . ARG A 1 159 ? -7.455  1.223   -24.784 1.00 16.32 ? 745  ARG A CB  1 
ATOM   1094 C  CG  . ARG A 1 159 ? -7.670  2.710   -24.714 1.00 17.90 ? 745  ARG A CG  1 
ATOM   1095 C  CD  . ARG A 1 159 ? -6.778  3.430   -25.726 1.00 20.99 ? 745  ARG A CD  1 
ATOM   1096 N  NE  . ARG A 1 159 ? -7.030  4.864   -25.787 1.00 28.08 ? 745  ARG A NE  1 
ATOM   1097 C  CZ  . ARG A 1 159 ? -6.562  5.637   -26.757 1.00 32.15 ? 745  ARG A CZ  1 
ATOM   1098 N  NH1 . ARG A 1 159 ? -6.823  6.939   -26.771 1.00 35.04 ? 745  ARG A NH1 1 
ATOM   1099 N  NH2 . ARG A 1 159 ? -5.832  5.096   -27.723 1.00 33.12 ? 745  ARG A NH2 1 
ATOM   1100 N  N   . ASP A 1 160 ? -7.853  -1.881  -23.313 1.00 15.32 ? 746  ASP A N   1 
ATOM   1101 C  CA  . ASP A 1 160 ? -7.560  -3.289  -23.560 1.00 18.45 ? 746  ASP A CA  1 
ATOM   1102 C  C   . ASP A 1 160 ? -8.197  -4.154  -22.472 1.00 16.77 ? 746  ASP A C   1 
ATOM   1103 O  O   . ASP A 1 160 ? -7.635  -5.157  -22.044 1.00 16.73 ? 746  ASP A O   1 
ATOM   1104 C  CB  . ASP A 1 160 ? -6.040  -3.521  -23.625 1.00 23.52 ? 746  ASP A CB  1 
ATOM   1105 C  CG  . ASP A 1 160 ? -5.664  -4.800  -24.361 1.00 30.34 ? 746  ASP A CG  1 
ATOM   1106 O  OD1 . ASP A 1 160 ? -6.527  -5.375  -25.058 1.00 32.53 ? 746  ASP A OD1 1 
ATOM   1107 O  OD2 . ASP A 1 160 ? -4.496  -5.227  -24.247 1.00 32.70 ? 746  ASP A OD2 1 
ATOM   1108 N  N   . LEU A 1 161 ? -9.387  -3.765  -22.039 1.00 14.38 ? 747  LEU A N   1 
ATOM   1109 C  CA  . LEU A 1 161 ? -10.093 -4.515  -21.012 1.00 13.33 ? 747  LEU A CA  1 
ATOM   1110 C  C   . LEU A 1 161 ? -10.666 -5.783  -21.638 1.00 13.38 ? 747  LEU A C   1 
ATOM   1111 O  O   . LEU A 1 161 ? -11.538 -5.724  -22.507 1.00 15.92 ? 747  LEU A O   1 
ATOM   1112 C  CB  . LEU A 1 161 ? -11.193 -3.669  -20.378 1.00 13.04 ? 747  LEU A CB  1 
ATOM   1113 C  CG  . LEU A 1 161 ? -12.076 -4.361  -19.348 1.00 14.96 ? 747  LEU A CG  1 
ATOM   1114 C  CD1 . LEU A 1 161 ? -11.219 -4.894  -18.216 1.00 17.23 ? 747  LEU A CD1 1 
ATOM   1115 C  CD2 . LEU A 1 161 ? -13.114 -3.392  -18.810 1.00 16.35 ? 747  LEU A CD2 1 
ATOM   1116 N  N   . ALA A 1 162 ? -10.150 -6.920  -21.192 1.00 12.84 ? 748  ALA A N   1 
ATOM   1117 C  CA  . ALA A 1 162 ? -10.466 -8.238  -21.734 1.00 12.32 ? 748  ALA A CA  1 
ATOM   1118 C  C   . ALA A 1 162 ? -10.187 -9.220  -20.622 1.00 11.81 ? 748  ALA A C   1 
ATOM   1119 O  O   . ALA A 1 162 ? -9.353  -8.941  -19.760 1.00 13.32 ? 748  ALA A O   1 
ATOM   1120 C  CB  . ALA A 1 162 ? -9.617  -8.552  -22.941 1.00 14.05 ? 748  ALA A CB  1 
ATOM   1121 N  N   . ALA A 1 163 ? -10.844 -10.374 -20.635 1.00 12.30 ? 749  ALA A N   1 
ATOM   1122 C  CA  . ALA A 1 163 ? -10.628 -11.330 -19.554 1.00 12.85 ? 749  ALA A CA  1 
ATOM   1123 C  C   . ALA A 1 163 ? -9.174  -11.786 -19.495 1.00 13.14 ? 749  ALA A C   1 
ATOM   1124 O  O   . ALA A 1 163 ? -8.671  -12.088 -18.427 1.00 13.67 ? 749  ALA A O   1 
ATOM   1125 C  CB  . ALA A 1 163 ? -11.563 -12.532 -19.693 1.00 13.34 ? 749  ALA A CB  1 
ATOM   1126 N  N   . ARG A 1 164 ? -8.490  -11.837 -20.613 1.00 13.12 ? 750  ARG A N   1 
ATOM   1127 C  CA  . ARG A 1 164 ? -7.075  -12.191 -20.640 1.00 14.52 ? 750  ARG A CA  1 
ATOM   1128 C  C   . ARG A 1 164 ? -6.194  -11.196 -19.880 1.00 16.09 ? 750  ARG A C   1 
ATOM   1129 O  O   . ARG A 1 164 ? -5.132  -11.527 -19.487 1.00 18.81 ? 750  ARG A O   1 
ATOM   1130 C  CB  . ARG A 1 164 ? -6.580  -12.388 -22.066 1.00 17.06 ? 750  ARG A CB  1 
ATOM   1131 C  CG  . ARG A 1 164 ? -6.508  -11.128 -22.869 1.00 20.78 ? 750  ARG A CG  1 
ATOM   1132 C  CD  . ARG A 1 164 ? -6.015  -11.369 -24.286 1.00 27.01 ? 750  ARG A CD  1 
ATOM   1133 N  NE  . ARG A 1 164 ? -6.016  -10.086 -24.970 1.00 34.76 ? 750  ARG A NE  1 
ATOM   1134 C  CZ  . ARG A 1 164 ? -7.077  -9.590  -25.539 1.00 41.09 ? 750  ARG A CZ  1 
ATOM   1135 N  NH1 . ARG A 1 164 ? -8.161  -10.295 -25.578 1.00 43.26 ? 750  ARG A NH1 1 
ATOM   1136 N  NH2 . ARG A 1 164 ? -7.073  -8.378  -26.064 1.00 43.15 ? 750  ARG A NH2 1 
ATOM   1137 N  N   . ASN A 1 165 ? -6.688  -9.983  -19.706 1.00 14.75 ? 751  ASN A N   1 
ATOM   1138 C  CA  . ASN A 1 165 ? -5.938  -8.949  -18.996 1.00 15.13 ? 751  ASN A CA  1 
ATOM   1139 C  C   . ASN A 1 165 ? -6.443  -8.716  -17.579 1.00 13.63 ? 751  ASN A C   1 
ATOM   1140 O  O   . ASN A 1 165 ? -6.125  -7.699  -16.948 1.00 15.83 ? 751  ASN A O   1 
ATOM   1141 C  CB  . ASN A 1 165 ? -5.972  -7.646  -19.789 1.00 16.12 ? 751  ASN A CB  1 
ATOM   1142 C  CG  . ASN A 1 165 ? -5.213  -7.752  -21.093 1.00 19.63 ? 751  ASN A CG  1 
ATOM   1143 O  OD1 . ASN A 1 165 ? -4.221  -8.474  -21.181 1.00 21.05 ? 751  ASN A OD1 1 
ATOM   1144 N  ND2 . ASN A 1 165 ? -5.685  -7.048  -22.117 1.00 22.13 ? 751  ASN A ND2 1 
ATOM   1145 N  N   A ILE A 1 166 ? -7.229  -9.622  -17.070 0.78 13.33 ? 752  ILE A N   1 
ATOM   1146 N  N   B ILE A 1 166 ? -7.219  -9.626  -17.069 0.22 13.43 ? 752  ILE A N   1 
ATOM   1147 C  CA  A ILE A 1 166 ? -7.655  -9.653  -15.701 0.78 12.58 ? 752  ILE A CA  1 
ATOM   1148 C  CA  B ILE A 1 166 ? -7.627  -9.670  -15.696 0.22 12.84 ? 752  ILE A CA  1 
ATOM   1149 C  C   A ILE A 1 166 ? -6.943  -10.841 -15.048 0.78 12.07 ? 752  ILE A C   1 
ATOM   1150 C  C   B ILE A 1 166 ? -6.941  -10.857 -15.047 0.22 12.30 ? 752  ILE A C   1 
ATOM   1151 O  O   A ILE A 1 166 ? -6.905  -11.894 -15.621 0.78 13.49 ? 752  ILE A O   1 
ATOM   1152 O  O   B ILE A 1 166 ? -6.904  -11.901 -15.624 0.22 12.44 ? 752  ILE A O   1 
ATOM   1153 C  CB  A ILE A 1 166 ? -9.171  -9.872  -15.568 0.78 13.51 ? 752  ILE A CB  1 
ATOM   1154 C  CB  B ILE A 1 166 ? -9.129  -9.854  -15.580 0.22 13.09 ? 752  ILE A CB  1 
ATOM   1155 C  CG1 A ILE A 1 166 ? -9.965  -8.746  -16.255 0.78 14.29 ? 752  ILE A CG1 1 
ATOM   1156 C  CG1 B ILE A 1 166 ? -9.756  -8.669  -16.286 0.22 13.35 ? 752  ILE A CG1 1 
ATOM   1157 C  CG2 A ILE A 1 166 ? -9.583  -9.974  -14.114 0.78 13.76 ? 752  ILE A CG2 1 
ATOM   1158 C  CG2 B ILE A 1 166 ? -9.576  -9.967  -14.130 0.22 13.07 ? 752  ILE A CG2 1 
ATOM   1159 C  CD1 A ILE A 1 166 ? -9.657  -7.387  -15.692 0.78 14.02 ? 752  ILE A CD1 1 
ATOM   1160 C  CD1 B ILE A 1 166 ? -11.193 -8.660  -16.315 0.22 12.71 ? 752  ILE A CD1 1 
ATOM   1161 N  N   . LEU A 1 167 ? -6.405  -10.661 -13.861 1.00 11.60 ? 753  LEU A N   1 
ATOM   1162 C  CA  . LEU A 1 167 ? -5.707  -11.716 -13.135 1.00 12.73 ? 753  LEU A CA  1 
ATOM   1163 C  C   . LEU A 1 167 ? -6.556  -12.074 -11.966 1.00 11.80 ? 753  LEU A C   1 
ATOM   1164 O  O   . LEU A 1 167 ? -7.298  -11.304 -11.480 1.00 11.99 ? 753  LEU A O   1 
ATOM   1165 C  CB  . LEU A 1 167 ? -4.306  -11.255 -12.712 1.00 13.10 ? 753  LEU A CB  1 
ATOM   1166 C  CG  . LEU A 1 167 ? -3.317  -11.034 -13.827 1.00 15.66 ? 753  LEU A CG  1 
ATOM   1167 C  CD1 . LEU A 1 167 ? -2.066  -10.352 -13.316 1.00 16.36 ? 753  LEU A CD1 1 
ATOM   1168 C  CD2 . LEU A 1 167 ? -2.907  -12.357 -14.464 1.00 20.43 ? 753  LEU A CD2 1 
ATOM   1169 N  N   . ILE A 1 168 ? -6.454  -13.329 -11.528 1.00 12.22 ? 754  ILE A N   1 
ATOM   1170 C  CA  . ILE A 1 168 ? -7.278  -13.843 -10.456 1.00 12.11 ? 754  ILE A CA  1 
ATOM   1171 C  C   . ILE A 1 168 ? -6.419  -14.582 -9.425  1.00 13.06 ? 754  ILE A C   1 
ATOM   1172 O  O   . ILE A 1 168 ? -5.563  -15.290 -9.792  1.00 13.65 ? 754  ILE A O   1 
ATOM   1173 C  CB  . ILE A 1 168 ? -8.471  -14.700 -11.018 1.00 13.10 ? 754  ILE A CB  1 
ATOM   1174 C  CG1 . ILE A 1 168 ? -9.369  -15.173 -9.890  1.00 13.75 ? 754  ILE A CG1 1 
ATOM   1175 C  CG2 . ILE A 1 168 ? -7.993  -15.827 -11.927 1.00 13.86 ? 754  ILE A CG2 1 
ATOM   1176 C  CD1 . ILE A 1 168 ? -10.719 -15.748 -10.321 1.00 14.17 ? 754  ILE A CD1 1 
ATOM   1177 N  N   . ASN A 1 169 ? -6.661  -14.302 -8.167  1.00 13.37 ? 755  ASN A N   1 
ATOM   1178 C  CA  . ASN A 1 169 ? -5.817  -14.814 -7.090  1.00 13.94 ? 755  ASN A CA  1 
ATOM   1179 C  C   . ASN A 1 169 ? -6.361  -16.096 -6.463  1.00 14.93 ? 755  ASN A C   1 
ATOM   1180 O  O   . ASN A 1 169 ? -7.343  -16.599 -6.893  1.00 14.23 ? 755  ASN A O   1 
ATOM   1181 C  CB  . ASN A 1 169 ? -5.436  -13.701 -6.095  1.00 15.93 ? 755  ASN A CB  1 
ATOM   1182 C  CG  . ASN A 1 169 ? -6.493  -13.374 -5.122  1.00 16.32 ? 755  ASN A CG  1 
ATOM   1183 O  OD1 . ASN A 1 169 ? -7.483  -13.955 -5.024  1.00 16.86 ? 755  ASN A OD1 1 
ATOM   1184 N  ND2 . ASN A 1 169 ? -6.222  -12.336 -4.361  1.00 18.49 ? 755  ASN A ND2 1 
ATOM   1185 N  N   . SER A 1 170 ? -5.705  -16.563 -5.423  1.00 15.98 ? 756  SER A N   1 
ATOM   1186 C  CA  . SER A 1 170 ? -6.079  -17.823 -4.786  1.00 16.35 ? 756  SER A CA  1 
ATOM   1187 C  C   . SER A 1 170 ? -7.440  -17.774 -4.189  1.00 16.94 ? 756  SER A C   1 
ATOM   1188 O  O   . SER A 1 170 ? -8.061  -18.746 -4.024  1.00 18.78 ? 756  SER A O   1 
ATOM   1189 C  CB  . SER A 1 170 ? -5.024  -18.210 -3.740  1.00 18.71 ? 756  SER A CB  1 
ATOM   1190 O  OG  . SER A 1 170 ? -4.900  -17.221 -2.787  1.00 22.19 ? 756  SER A OG  1 
ATOM   1191 N  N   . ASN A 1 171 ? -7.926  -16.584 -3.854  1.00 16.71 ? 757  ASN A N   1 
ATOM   1192 C  CA  . ASN A 1 171 ? -9.223  -16.397 -3.279  1.00 17.54 ? 757  ASN A CA  1 
ATOM   1193 C  C   . ASN A 1 171 ? -10.296 -15.947 -4.277  1.00 16.70 ? 757  ASN A C   1 
ATOM   1194 O  O   . ASN A 1 171 ? -11.315 -15.553 -3.898  1.00 18.58 ? 757  ASN A O   1 
ATOM   1195 C  CB  . ASN A 1 171 ? -9.148  -15.426 -2.102  1.00 22.01 ? 757  ASN A CB  1 
ATOM   1196 C  CG  . ASN A 1 171 ? -8.310  -15.955 -0.982  1.00 27.55 ? 757  ASN A CG  1 
ATOM   1197 O  OD1 . ASN A 1 171 ? -8.339  -17.105 -0.702  1.00 28.87 ? 757  ASN A OD1 1 
ATOM   1198 N  ND2 . ASN A 1 171 ? -7.527  -15.108 -0.408  1.00 30.23 ? 757  ASN A ND2 1 
ATOM   1199 N  N   . LEU A 1 172 ? -9.957  -16.012 -5.534  1.00 15.50 ? 758  LEU A N   1 
ATOM   1200 C  CA  . LEU A 1 172 ? -10.835 -15.652 -6.649  1.00 15.00 ? 758  LEU A CA  1 
ATOM   1201 C  C   . LEU A 1 172 ? -11.054 -14.157 -6.829  1.00 14.67 ? 758  LEU A C   1 
ATOM   1202 O  O   . LEU A 1 172 ? -11.919 -13.782 -7.500  1.00 15.23 ? 758  LEU A O   1 
ATOM   1203 C  CB  . LEU A 1 172 ? -12.182 -16.362 -6.580  1.00 16.35 ? 758  LEU A CB  1 
ATOM   1204 C  CG  . LEU A 1 172 ? -12.097 -17.895 -6.459  1.00 17.53 ? 758  LEU A CG  1 
ATOM   1205 C  CD1 . LEU A 1 172 ? -13.467 -18.476 -6.552  1.00 19.04 ? 758  LEU A CD1 1 
ATOM   1206 C  CD2 . LEU A 1 172 ? -11.202 -18.482 -7.495  1.00 17.90 ? 758  LEU A CD2 1 
ATOM   1207 N  N   . VAL A 1 173 ? -10.229 -13.365 -6.195  1.00 14.43 ? 759  VAL A N   1 
ATOM   1208 C  CA  . VAL A 1 173 ? -10.326 -11.917 -6.383  1.00 13.76 ? 759  VAL A CA  1 
ATOM   1209 C  C   . VAL A 1 173 ? -9.713  -11.565 -7.696  1.00 12.39 ? 759  VAL A C   1 
ATOM   1210 O  O   . VAL A 1 173 ? -8.646  -11.938 -7.970  1.00 13.28 ? 759  VAL A O   1 
ATOM   1211 C  CB  . VAL A 1 173 ? -9.598  -11.168 -5.251  1.00 14.26 ? 759  VAL A CB  1 
ATOM   1212 C  CG1 . VAL A 1 173 ? -9.674  -9.653  -5.456  1.00 14.33 ? 759  VAL A CG1 1 
ATOM   1213 C  CG2 . VAL A 1 173 ? -10.177 -11.530 -3.880  1.00 16.54 ? 759  VAL A CG2 1 
ATOM   1214 N  N   . CYS A 1 174 ? -10.448 -10.794 -8.474  1.00 12.23 ? 760  CYS A N   1 
ATOM   1215 C  CA  . CYS A 1 174 ? -10.048 -10.380 -9.813  1.00 12.09 ? 760  CYS A CA  1 
ATOM   1216 C  C   . CYS A 1 174 ? -9.552  -8.945  -9.853  1.00 11.99 ? 760  CYS A C   1 
ATOM   1217 O  O   . CYS A 1 174 ? -10.105 -8.119  -9.211  1.00 12.93 ? 760  CYS A O   1 
ATOM   1218 C  CB  . CYS A 1 174 ? -11.228 -10.523 -10.765 1.00 12.98 ? 760  CYS A CB  1 
ATOM   1219 S  SG  . CYS A 1 174 ? -11.663 -12.280 -11.057 1.00 14.47 ? 760  CYS A SG  1 
ATOM   1220 N  N   . LYS A 1 175 ? -8.477  -8.786  -10.580 1.00 11.67 ? 761  LYS A N   1 
ATOM   1221 C  CA  . LYS A 1 175 ? -7.804  -7.488  -10.610 1.00 11.87 ? 761  LYS A CA  1 
ATOM   1222 C  C   . LYS A 1 175 ? -7.401  -7.103  -12.022 1.00 12.20 ? 761  LYS A C   1 
ATOM   1223 O  O   . LYS A 1 175 ? -6.930  -7.942  -12.803 1.00 13.53 ? 761  LYS A O   1 
ATOM   1224 C  CB  . LYS A 1 175 ? -6.576  -7.514  -9.699  1.00 13.27 ? 761  LYS A CB  1 
ATOM   1225 C  CG  . LYS A 1 175 ? -6.897  -7.970  -8.285  1.00 14.16 ? 761  LYS A CG  1 
ATOM   1226 C  CD  . LYS A 1 175 ? -5.742  -7.749  -7.328  1.00 14.34 ? 761  LYS A CD  1 
ATOM   1227 C  CE  . LYS A 1 175 ? -6.055  -8.372  -5.962  1.00 14.73 ? 761  LYS A CE  1 
ATOM   1228 N  NZ  . LYS A 1 175 ? -5.322  -7.689  -4.858  1.00 16.74 ? 761  LYS A NZ  1 
ATOM   1229 N  N   . VAL A 1 176 ? -7.625  -5.852  -12.359 1.00 12.33 ? 762  VAL A N   1 
ATOM   1230 C  CA  . VAL A 1 176 ? -7.240  -5.349  -13.642 1.00 12.97 ? 762  VAL A CA  1 
ATOM   1231 C  C   . VAL A 1 176 ? -5.723  -5.229  -13.781 1.00 12.17 ? 762  VAL A C   1 
ATOM   1232 O  O   . VAL A 1 176 ? -5.070  -4.749  -12.923 1.00 13.12 ? 762  VAL A O   1 
ATOM   1233 C  CB  . VAL A 1 176 ? -7.888  -3.965  -13.877 1.00 13.07 ? 762  VAL A CB  1 
ATOM   1234 C  CG1 . VAL A 1 176 ? -7.560  -3.453  -15.256 1.00 15.28 ? 762  VAL A CG1 1 
ATOM   1235 C  CG2 . VAL A 1 176 ? -9.374  -4.017  -13.677 1.00 14.04 ? 762  VAL A CG2 1 
ATOM   1236 N  N   A SER A 1 177 ? -5.270  -5.677  -14.925 0.74 13.27 ? 763  SER A N   1 
ATOM   1237 N  N   B SER A 1 177 ? -5.244  -5.695  -14.911 0.26 13.16 ? 763  SER A N   1 
ATOM   1238 C  CA  A SER A 1 177 ? -3.860  -5.712  -15.283 0.74 15.52 ? 763  SER A CA  1 
ATOM   1239 C  CA  B SER A 1 177 ? -3.822  -5.646  -15.258 0.26 14.28 ? 763  SER A CA  1 
ATOM   1240 C  C   A SER A 1 177 ? -3.624  -5.141  -16.670 0.74 15.58 ? 763  SER A C   1 
ATOM   1241 C  C   B SER A 1 177 ? -3.621  -5.150  -16.673 0.26 15.53 ? 763  SER A C   1 
ATOM   1242 O  O   A SER A 1 177 ? -4.525  -4.651  -17.262 0.74 17.65 ? 763  SER A O   1 
ATOM   1243 O  O   B SER A 1 177 ? -4.524  -4.652  -17.258 0.26 16.51 ? 763  SER A O   1 
ATOM   1244 C  CB  A SER A 1 177 ? -3.324  -7.157  -15.218 0.74 18.16 ? 763  SER A CB  1 
ATOM   1245 C  CB  B SER A 1 177 ? -3.100  -6.996  -15.049 0.26 14.19 ? 763  SER A CB  1 
ATOM   1246 O  OG  A SER A 1 177 ? -1.957  -7.179  -15.373 0.74 20.17 ? 763  SER A OG  1 
ATOM   1247 O  OG  B SER A 1 177 ? -3.469  -7.814  -16.045 0.26 13.34 ? 763  SER A OG  1 
ATOM   1248 N  N   . ASP A 1 178 ? -2.389  -5.175  -17.127 1.00 16.79 ? 764  ASP A N   1 
ATOM   1249 C  CA  . ASP A 1 178 ? -2.027  -4.798  -18.499 1.00 19.73 ? 764  ASP A CA  1 
ATOM   1250 C  C   . ASP A 1 178 ? -2.264  -3.329  -18.811 1.00 21.26 ? 764  ASP A C   1 
ATOM   1251 O  O   . ASP A 1 178 ? -3.201  -2.951  -19.522 1.00 23.74 ? 764  ASP A O   1 
ATOM   1252 C  CB  . ASP A 1 178 ? -2.771  -5.668  -19.513 1.00 25.54 ? 764  ASP A CB  1 
ATOM   1253 C  CG  . ASP A 1 178 ? -2.468  -5.271  -20.944 1.00 34.08 ? 764  ASP A CG  1 
ATOM   1254 O  OD1 . ASP A 1 178 ? -1.303  -4.922  -21.237 1.00 36.11 ? 764  ASP A OD1 1 
ATOM   1255 O  OD2 . ASP A 1 178 ? -3.406  -5.277  -21.765 1.00 38.39 ? 764  ASP A OD2 1 
ATOM   1256 N  N   . PHE A 1 179 ? -1.372  -2.495  -18.309 1.00 21.35 ? 765  PHE A N   1 
ATOM   1257 C  CA  . PHE A 1 179 ? -1.505  -1.066  -18.515 1.00 25.03 ? 765  PHE A CA  1 
ATOM   1258 C  C   . PHE A 1 179 ? -0.607  -0.560  -19.646 1.00 32.51 ? 765  PHE A C   1 
ATOM   1259 O  O   . PHE A 1 179 ? -0.179  0.595   -19.644 1.00 36.47 ? 765  PHE A O   1 
ATOM   1260 C  CB  . PHE A 1 179 ? -1.235  -0.353  -17.190 1.00 23.26 ? 765  PHE A CB  1 
ATOM   1261 C  CG  . PHE A 1 179 ? -2.309  -0.606  -16.169 1.00 20.71 ? 765  PHE A CG  1 
ATOM   1262 C  CD1 . PHE A 1 179 ? -3.463  0.157   -16.185 1.00 22.40 ? 765  PHE A CD1 1 
ATOM   1263 C  CD2 . PHE A 1 179 ? -2.201  -1.634  -15.239 1.00 21.91 ? 765  PHE A CD2 1 
ATOM   1264 C  CE1 . PHE A 1 179 ? -4.479  -0.069  -15.283 1.00 21.68 ? 765  PHE A CE1 1 
ATOM   1265 C  CE2 . PHE A 1 179 ? -3.221  -1.869  -14.331 1.00 20.81 ? 765  PHE A CE2 1 
ATOM   1266 C  CZ  . PHE A 1 179 ? -4.366  -1.080  -14.358 1.00 20.52 ? 765  PHE A CZ  1 
ATOM   1267 N  N   . GLY A 1 180 ? -0.366  -1.424  -20.633 1.00 34.00 ? 766  GLY A N   1 
ATOM   1268 C  CA  . GLY A 1 180 ? 0.476   -1.083  -21.768 1.00 34.52 ? 766  GLY A CA  1 
ATOM   1269 C  C   . GLY A 1 180 ? -0.217  -0.333  -22.897 1.00 35.19 ? 766  GLY A C   1 
ATOM   1270 O  O   . GLY A 1 180 ? 0.447   0.279   -23.729 1.00 37.33 ? 766  GLY A O   1 
ATOM   1271 N  N   . LEU A 1 181 ? -1.545  -0.375  -22.942 0.71 34.86 ? 767  LEU A N   1 
ATOM   1272 C  CA  . LEU A 1 181 ? -2.277  0.232   -24.056 0.71 35.55 ? 767  LEU A CA  1 
ATOM   1273 C  C   . LEU A 1 181 ? -3.130  1.430   -23.629 0.71 35.74 ? 767  LEU A C   1 
ATOM   1274 O  O   . LEU A 1 181 ? -3.770  2.084   -24.454 0.71 34.79 ? 767  LEU A O   1 
ATOM   1275 N  N   . SER A 1 182 ? -3.052  1.726   -22.332 0.84 34.78 ? 768  SER A N   1 
ATOM   1276 C  CA  . SER A 1 182 ? -3.907  2.739   -21.723 0.84 35.18 ? 768  SER A CA  1 
ATOM   1277 C  C   . SER A 1 182 ? -3.344  4.147   -21.778 0.84 36.68 ? 768  SER A C   1 
ATOM   1278 O  O   . SER A 1 182 ? -2.145  4.300   -21.828 0.84 34.89 ? 768  SER A O   1 
ATOM   1279 N  N   . ARG A 1 183 ? -4.248  5.087   -21.688 0.82 37.94 ? 769  ARG A N   1 
ATOM   1280 C  CA  . ARG A 1 183 ? -3.918  6.463   -21.794 0.82 39.24 ? 769  ARG A CA  1 
ATOM   1281 C  C   . ARG A 1 183 ? -4.705  7.194   -20.701 0.81 35.30 ? 769  ARG A C   1 
ATOM   1282 O  O   . ARG A 1 183 ? -5.894  7.105   -20.585 1.00 30.97 ? 769  ARG A O   1 
ATOM   1283 C  CB  . ARG A 1 183 ? -4.299  6.957   -23.195 0.89 45.87 ? 769  ARG A CB  1 
ATOM   1284 C  CG  . ARG A 1 183 ? -3.544  6.336   -24.361 1.00 51.78 ? 769  ARG A CG  1 
ATOM   1285 C  CD  . ARG A 1 183 ? -3.816  7.183   -25.612 1.00 56.99 ? 769  ARG A CD  1 
ATOM   1286 N  NE  . ARG A 1 183 ? -3.118  6.758   -26.837 1.00 61.41 ? 769  ARG A NE  1 
ATOM   1287 C  CZ  . ARG A 1 183 ? -3.428  7.147   -28.075 1.00 63.76 ? 769  ARG A CZ  1 
ATOM   1288 N  NH1 . ARG A 1 183 ? -4.417  7.988   -28.304 1.00 64.30 ? 769  ARG A NH1 1 
ATOM   1289 N  NH2 . ARG A 1 183 ? -2.733  6.686   -29.104 1.00 64.70 ? 769  ARG A NH2 1 
ATOM   1290 N  N   . ILE A 1 200 ? -5.169  -2.530  -31.958 1.00 46.89 ? 786  ILE A N   1 
ATOM   1291 C  CA  . ILE A 1 200 ? -6.239  -2.529  -30.967 1.00 46.50 ? 786  ILE A CA  1 
ATOM   1292 C  C   . ILE A 1 200 ? -7.005  -3.851  -31.000 1.00 42.59 ? 786  ILE A C   1 
ATOM   1293 O  O   . ILE A 1 200 ? -7.121  -4.479  -32.049 1.00 43.95 ? 786  ILE A O   1 
ATOM   1294 C  CB  . ILE A 1 200 ? -7.212  -1.343  -31.189 1.00 49.80 ? 786  ILE A CB  1 
ATOM   1295 C  CG1 . ILE A 1 200 ? -8.058  -1.552  -32.448 1.00 51.40 ? 786  ILE A CG1 1 
ATOM   1296 C  CG2 . ILE A 1 200 ? -6.448  -0.027  -31.256 1.00 49.82 ? 786  ILE A CG2 1 
ATOM   1297 C  CD1 . ILE A 1 200 ? -9.515  -1.201  -32.259 1.00 51.70 ? 786  ILE A CD1 1 
ATOM   1298 N  N   . PRO A 1 201 ? -7.516  -4.289  -29.841 1.00 38.03 ? 787  PRO A N   1 
ATOM   1299 C  CA  . PRO A 1 201 ? -8.228  -5.571  -29.782 1.00 34.68 ? 787  PRO A CA  1 
ATOM   1300 C  C   . PRO A 1 201 ? -9.662  -5.457  -30.300 1.00 29.74 ? 787  PRO A C   1 
ATOM   1301 O  O   . PRO A 1 201 ? -10.549 -5.085  -29.523 1.00 27.90 ? 787  PRO A O   1 
ATOM   1302 C  CB  . PRO A 1 201 ? -8.204  -5.905  -28.290 1.00 34.67 ? 787  PRO A CB  1 
ATOM   1303 C  CG  . PRO A 1 201 ? -8.202  -4.565  -27.621 1.00 36.70 ? 787  PRO A CG  1 
ATOM   1304 C  CD  . PRO A 1 201 ? -7.398  -3.658  -28.513 1.00 38.38 ? 787  PRO A CD  1 
ATOM   1305 N  N   . ILE A 1 202 ? -9.883  -5.784  -31.576 1.00 26.51 ? 788  ILE A N   1 
ATOM   1306 C  CA  . ILE A 1 202 ? -11.166 -5.526  -32.222 1.00 24.99 ? 788  ILE A CA  1 
ATOM   1307 C  C   . ILE A 1 202 ? -12.363 -6.098  -31.457 1.00 21.69 ? 788  ILE A C   1 
ATOM   1308 O  O   . ILE A 1 202 ? -13.353 -5.405  -31.243 1.00 21.54 ? 788  ILE A O   1 
ATOM   1309 C  CB  . ILE A 1 202 ? -11.178 -6.081  -33.673 1.00 29.48 ? 788  ILE A CB  1 
ATOM   1310 C  CG1 . ILE A 1 202 ? -10.202 -5.294  -34.543 1.00 31.68 ? 788  ILE A CG1 1 
ATOM   1311 C  CG2 . ILE A 1 202 ? -12.576 -6.024  -34.274 1.00 30.59 ? 788  ILE A CG2 1 
ATOM   1312 C  CD1 . ILE A 1 202 ? -10.504 -3.820  -34.612 1.00 33.88 ? 788  ILE A CD1 1 
ATOM   1313 N  N   . ARG A 1 203 ? -12.260 -7.352  -31.027 1.00 19.46 ? 789  ARG A N   1 
ATOM   1314 C  CA  . ARG A 1 203 ? -13.374 -8.039  -30.380 1.00 18.63 ? 789  ARG A CA  1 
ATOM   1315 C  C   . ARG A 1 203 ? -13.858 -7.368  -29.094 1.00 17.10 ? 789  ARG A C   1 
ATOM   1316 O  O   . ARG A 1 203 ? -15.012 -7.549  -28.691 1.00 17.40 ? 789  ARG A O   1 
ATOM   1317 C  CB  . ARG A 1 203 ? -12.983 -9.485  -30.069 1.00 19.22 ? 789  ARG A CB  1 
ATOM   1318 C  CG  . ARG A 1 203 ? -13.087 -10.378 -31.268 1.00 21.09 ? 789  ARG A CG  1 
ATOM   1319 C  CD  . ARG A 1 203 ? -12.280 -11.656 -31.128 1.00 19.45 ? 789  ARG A CD  1 
ATOM   1320 N  NE  . ARG A 1 203 ? -12.819 -12.644 -32.054 1.00 20.57 ? 789  ARG A NE  1 
ATOM   1321 C  CZ  . ARG A 1 203 ? -12.670 -12.586 -33.373 1.00 21.52 ? 789  ARG A CZ  1 
ATOM   1322 N  NH1 . ARG A 1 203 ? -11.958 -11.614 -33.933 1.00 21.52 ? 789  ARG A NH1 1 
ATOM   1323 N  NH2 . ARG A 1 203 ? -13.228 -13.505 -34.136 1.00 22.62 ? 789  ARG A NH2 1 
ATOM   1324 N  N   . TRP A 1 204 ? -12.978 -6.626  -28.446 1.00 15.33 ? 790  TRP A N   1 
ATOM   1325 C  CA  . TRP A 1 204 ? -13.286 -6.009  -27.178 1.00 15.18 ? 790  TRP A CA  1 
ATOM   1326 C  C   . TRP A 1 204 ? -13.564 -4.526  -27.270 1.00 15.22 ? 790  TRP A C   1 
ATOM   1327 O  O   . TRP A 1 204 ? -13.908 -3.920  -26.327 1.00 16.43 ? 790  TRP A O   1 
ATOM   1328 C  CB  . TRP A 1 204 ? -12.117 -6.284  -26.206 1.00 15.73 ? 790  TRP A CB  1 
ATOM   1329 C  CG  . TRP A 1 204 ? -12.039 -7.713  -25.762 1.00 15.37 ? 790  TRP A CG  1 
ATOM   1330 C  CD1 . TRP A 1 204 ? -12.599 -8.228  -24.688 1.00 16.03 ? 790  TRP A CD1 1 
ATOM   1331 C  CD2 . TRP A 1 204 ? -11.396 -8.771  -26.436 1.00 15.36 ? 790  TRP A CD2 1 
ATOM   1332 N  NE1 . TRP A 1 204 ? -12.356 -9.549  -24.610 1.00 16.02 ? 790  TRP A NE1 1 
ATOM   1333 C  CE2 . TRP A 1 204 ? -11.596 -9.919  -25.658 1.00 16.97 ? 790  TRP A CE2 1 
ATOM   1334 C  CE3 . TRP A 1 204 ? -10.628 -8.859  -27.582 1.00 18.12 ? 790  TRP A CE3 1 
ATOM   1335 C  CZ2 . TRP A 1 204 ? -11.113 -11.135 -26.020 1.00 19.35 ? 790  TRP A CZ2 1 
ATOM   1336 C  CZ3 . TRP A 1 204 ? -10.147 -10.094 -27.940 1.00 19.64 ? 790  TRP A CZ3 1 
ATOM   1337 C  CH2 . TRP A 1 204 ? -10.376 -11.201 -27.138 1.00 20.54 ? 790  TRP A CH2 1 
ATOM   1338 N  N   . THR A 1 205 ? -13.406 -3.971  -28.452 1.00 14.88 ? 791  THR A N   1 
ATOM   1339 C  CA  . THR A 1 205 ? -13.444 -2.524  -28.655 1.00 15.32 ? 791  THR A CA  1 
ATOM   1340 C  C   . THR A 1 205 ? -14.823 -2.043  -29.094 1.00 15.82 ? 791  THR A C   1 
ATOM   1341 O  O   . THR A 1 205 ? -15.467 -2.670  -29.871 1.00 17.28 ? 791  THR A O   1 
ATOM   1342 C  CB  . THR A 1 205 ? -12.347 -2.142  -29.654 1.00 16.03 ? 791  THR A CB  1 
ATOM   1343 O  OG1 . THR A 1 205 ? -11.081 -2.580  -29.181 1.00 17.04 ? 791  THR A OG1 1 
ATOM   1344 C  CG2 . THR A 1 205 ? -12.288 -0.646  -29.837 1.00 17.49 ? 791  THR A CG2 1 
ATOM   1345 N  N   . SER A 1 206 ? -15.253 -0.906  -28.572 1.00 14.49 ? 792  SER A N   1 
ATOM   1346 C  CA  . SER A 1 206 ? -16.557 -0.364  -28.922 1.00 14.39 ? 792  SER A CA  1 
ATOM   1347 C  C   . SER A 1 206 ? -16.596 0.077   -30.410 1.00 15.80 ? 792  SER A C   1 
ATOM   1348 O  O   . SER A 1 206 ? -15.584 0.360   -30.951 1.00 15.55 ? 792  SER A O   1 
ATOM   1349 C  CB  . SER A 1 206 ? -16.907 0.835   -28.047 1.00 15.67 ? 792  SER A CB  1 
ATOM   1350 O  OG  . SER A 1 206 ? -16.128 1.921   -28.431 1.00 16.48 ? 792  SER A OG  1 
ATOM   1351 N  N   . PRO A 1 207 ? -17.791 0.102   -30.995 1.00 15.87 ? 793  PRO A N   1 
ATOM   1352 C  CA  . PRO A 1 207 ? -17.886 0.449   -32.416 1.00 16.37 ? 793  PRO A CA  1 
ATOM   1353 C  C   . PRO A 1 207 ? -17.307 1.827   -32.717 1.00 16.25 ? 793  PRO A C   1 
ATOM   1354 O  O   . PRO A 1 207 ? -16.660 1.991   -33.756 1.00 17.25 ? 793  PRO A O   1 
ATOM   1355 C  CB  . PRO A 1 207 ? -19.394 0.437   -32.688 1.00 19.35 ? 793  PRO A CB  1 
ATOM   1356 C  CG  . PRO A 1 207 ? -19.971 -0.420  -31.634 1.00 20.17 ? 793  PRO A CG  1 
ATOM   1357 C  CD  . PRO A 1 207 ? -19.097 -0.274  -30.430 1.00 17.51 ? 793  PRO A CD  1 
ATOM   1358 N  N   . GLU A 1 208 ? -17.518 2.801   -31.833 1.00 15.83 ? 794  GLU A N   1 
ATOM   1359 C  CA  . GLU A 1 208 ? -17.044 4.143   -32.128 1.00 16.93 ? 794  GLU A CA  1 
ATOM   1360 C  C   . GLU A 1 208 ? -15.526 4.236   -31.975 1.00 16.83 ? 794  GLU A C   1 
ATOM   1361 O  O   . GLU A 1 208 ? -14.885 5.055   -32.647 1.00 17.85 ? 794  GLU A O   1 
ATOM   1362 C  CB  . GLU A 1 208 ? -17.752 5.188   -31.260 1.00 17.60 ? 794  GLU A CB  1 
ATOM   1363 C  CG  . GLU A 1 208 ? -17.391 5.181   -29.772 1.00 17.85 ? 794  GLU A CG  1 
ATOM   1364 C  CD  . GLU A 1 208 ? -18.138 4.142   -28.949 1.00 18.14 ? 794  GLU A CD  1 
ATOM   1365 O  OE1 . GLU A 1 208 ? -18.972 3.393   -29.504 1.00 18.55 ? 794  GLU A OE1 1 
ATOM   1366 O  OE2 . GLU A 1 208 ? -17.868 4.069   -27.728 1.00 17.16 ? 794  GLU A OE2 1 
ATOM   1367 N  N   . ALA A 1 209 ? -14.943 3.410   -31.110 1.00 15.92 ? 795  ALA A N   1 
ATOM   1368 C  CA  . ALA A 1 209 ? -13.492 3.408   -30.965 1.00 15.68 ? 795  ALA A CA  1 
ATOM   1369 C  C   . ALA A 1 209 ? -12.857 2.734   -32.185 1.00 16.55 ? 795  ALA A C   1 
ATOM   1370 O  O   . ALA A 1 209 ? -11.809 3.162   -32.656 1.00 17.61 ? 795  ALA A O   1 
ATOM   1371 C  CB  . ALA A 1 209 ? -13.071 2.715   -29.658 1.00 16.65 ? 795  ALA A CB  1 
ATOM   1372 N  N   . ILE A 1 210 ? -13.505 1.700   -32.718 1.00 15.87 ? 796  ILE A N   1 
ATOM   1373 C  CA  . ILE A 1 210 ? -13.065 1.103   -33.980 1.00 17.70 ? 796  ILE A CA  1 
ATOM   1374 C  C   . ILE A 1 210 ? -13.251 2.079   -35.141 1.00 18.57 ? 796  ILE A C   1 
ATOM   1375 O  O   . ILE A 1 210 ? -12.378 2.195   -35.999 1.00 20.22 ? 796  ILE A O   1 
ATOM   1376 C  CB  . ILE A 1 210 ? -13.825 -0.207  -34.291 1.00 18.19 ? 796  ILE A CB  1 
ATOM   1377 C  CG1 . ILE A 1 210 ? -13.533 -1.263  -33.227 1.00 18.92 ? 796  ILE A CG1 1 
ATOM   1378 C  CG2 . ILE A 1 210 ? -13.455 -0.736  -35.677 1.00 21.30 ? 796  ILE A CG2 1 
ATOM   1379 C  CD1 . ILE A 1 210 ? -14.387 -2.503  -33.335 1.00 19.90 ? 796  ILE A CD1 1 
ATOM   1380 N  N   . ALA A 1 211 ? -14.374 2.793   -35.168 1.00 17.12 ? 797  ALA A N   1 
ATOM   1381 C  CA  . ALA A 1 211 ? -14.700 3.633   -36.330 1.00 17.10 ? 797  ALA A CA  1 
ATOM   1382 C  C   . ALA A 1 211 ? -13.768 4.835   -36.478 1.00 16.87 ? 797  ALA A C   1 
ATOM   1383 O  O   . ALA A 1 211 ? -13.299 5.132   -37.585 1.00 17.59 ? 797  ALA A O   1 
ATOM   1384 C  CB  . ALA A 1 211 ? -16.146 4.118   -36.249 1.00 17.18 ? 797  ALA A CB  1 
ATOM   1385 N  N   . TYR A 1 212 ? -13.508 5.532   -35.374 1.00 17.38 ? 798  TYR A N   1 
ATOM   1386 C  CA  . TYR A 1 212 ? -12.674 6.729   -35.452 1.00 16.99 ? 798  TYR A CA  1 
ATOM   1387 C  C   . TYR A 1 212 ? -11.904 7.014   -34.162 1.00 17.55 ? 798  TYR A C   1 
ATOM   1388 O  O   . TYR A 1 212 ? -11.658 8.171   -33.820 1.00 19.03 ? 798  TYR A O   1 
ATOM   1389 C  CB  . TYR A 1 212 ? -13.518 7.944   -35.856 1.00 17.35 ? 798  TYR A CB  1 
ATOM   1390 C  CG  . TYR A 1 212 ? -14.539 8.471   -34.865 1.00 17.32 ? 798  TYR A CG  1 
ATOM   1391 C  CD1 . TYR A 1 212 ? -15.698 7.759   -34.567 1.00 18.42 ? 798  TYR A CD1 1 
ATOM   1392 C  CD2 . TYR A 1 212 ? -14.382 9.732   -34.289 1.00 17.62 ? 798  TYR A CD2 1 
ATOM   1393 C  CE1 . TYR A 1 212 ? -16.652 8.272   -33.693 1.00 17.94 ? 798  TYR A CE1 1 
ATOM   1394 C  CE2 . TYR A 1 212 ? -15.326 10.249  -33.429 1.00 18.69 ? 798  TYR A CE2 1 
ATOM   1395 C  CZ  . TYR A 1 212 ? -16.460 9.523   -33.134 1.00 18.39 ? 798  TYR A CZ  1 
ATOM   1396 O  OH  . TYR A 1 212 ? -17.396 10.049  -32.269 1.00 20.93 ? 798  TYR A OH  1 
ATOM   1397 N  N   . ARG A 1 213 ? -11.514 5.949   -33.464 1.00 18.16 ? 799  ARG A N   1 
ATOM   1398 C  CA  . ARG A 1 213 ? -10.625 6.049   -32.303 1.00 19.72 ? 799  ARG A CA  1 
ATOM   1399 C  C   . ARG A 1 213 ? -11.207 6.917   -31.198 1.00 18.73 ? 799  ARG A C   1 
ATOM   1400 O  O   . ARG A 1 213 ? -10.485 7.597   -30.471 1.00 19.06 ? 799  ARG A O   1 
ATOM   1401 C  CB  . ARG A 1 213 ? -9.245  6.561   -32.729 1.00 23.49 ? 799  ARG A CB  1 
ATOM   1402 C  CG  . ARG A 1 213 ? -8.603  5.688   -33.802 1.00 30.20 ? 799  ARG A CG  1 
ATOM   1403 C  CD  . ARG A 1 213 ? -7.117  5.955   -33.945 1.00 37.52 ? 799  ARG A CD  1 
ATOM   1404 N  NE  . ARG A 1 213 ? -6.403  5.756   -32.686 1.00 43.56 ? 799  ARG A NE  1 
ATOM   1405 C  CZ  . ARG A 1 213 ? -6.013  4.575   -32.209 1.00 47.13 ? 799  ARG A CZ  1 
ATOM   1406 N  NH1 . ARG A 1 213 ? -5.367  4.515   -31.054 1.00 47.67 ? 799  ARG A NH1 1 
ATOM   1407 N  NH2 . ARG A 1 213 ? -6.271  3.457   -32.878 1.00 48.16 ? 799  ARG A NH2 1 
ATOM   1408 N  N   . LYS A 1 214 ? -12.521 6.850   -31.044 1.00 17.02 ? 800  LYS A N   1 
ATOM   1409 C  CA  . LYS A 1 214 ? -13.196 7.541   -29.956 1.00 17.76 ? 800  LYS A CA  1 
ATOM   1410 C  C   . LYS A 1 214 ? -13.139 6.669   -28.698 1.00 17.36 ? 800  LYS A C   1 
ATOM   1411 O  O   . LYS A 1 214 ? -14.048 5.875   -28.429 1.00 18.41 ? 800  LYS A O   1 
ATOM   1412 C  CB  . LYS A 1 214 ? -14.642 7.876   -30.350 1.00 19.40 ? 800  LYS A CB  1 
ATOM   1413 C  CG  . LYS A 1 214 ? -15.404 8.710   -29.331 1.00 20.20 ? 800  LYS A CG  1 
ATOM   1414 C  CD  . LYS A 1 214 ? -14.646 9.958   -28.918 1.00 22.40 ? 800  LYS A CD  1 
ATOM   1415 C  CE  . LYS A 1 214 ? -14.500 10.935  -30.072 1.00 23.27 ? 800  LYS A CE  1 
ATOM   1416 N  NZ  . LYS A 1 214 ? -13.726 12.147  -29.678 1.00 24.67 ? 800  LYS A NZ  1 
ATOM   1417 N  N   . PHE A 1 215 ? -12.048 6.816   -27.946 1.00 16.87 ? 801  PHE A N   1 
ATOM   1418 C  CA  . PHE A 1 215 ? -11.824 6.069   -26.710 1.00 17.33 ? 801  PHE A CA  1 
ATOM   1419 C  C   . PHE A 1 215 ? -12.211 6.932   -25.519 1.00 17.98 ? 801  PHE A C   1 
ATOM   1420 O  O   . PHE A 1 215 ? -11.686 8.031   -25.344 1.00 20.22 ? 801  PHE A O   1 
ATOM   1421 C  CB  . PHE A 1 215 ? -10.361 5.631   -26.591 1.00 18.62 ? 801  PHE A CB  1 
ATOM   1422 C  CG  . PHE A 1 215 ? -9.966  4.525   -27.530 1.00 20.30 ? 801  PHE A CG  1 
ATOM   1423 C  CD1 . PHE A 1 215 ? -10.207 3.198   -27.202 1.00 21.16 ? 801  PHE A CD1 1 
ATOM   1424 C  CD2 . PHE A 1 215 ? -9.327  4.810   -28.729 1.00 22.39 ? 801  PHE A CD2 1 
ATOM   1425 C  CE1 . PHE A 1 215 ? -9.836  2.177   -28.062 1.00 21.29 ? 801  PHE A CE1 1 
ATOM   1426 C  CE2 . PHE A 1 215 ? -8.950  3.786   -29.590 1.00 23.56 ? 801  PHE A CE2 1 
ATOM   1427 C  CZ  . PHE A 1 215 ? -9.205  2.472   -29.253 1.00 22.06 ? 801  PHE A CZ  1 
ATOM   1428 N  N   . THR A 1 216 ? -13.160 6.443   -24.729 1.00 16.72 ? 802  THR A N   1 
ATOM   1429 C  CA  . THR A 1 216 ? -13.660 7.127   -23.538 1.00 16.45 ? 802  THR A CA  1 
ATOM   1430 C  C   . THR A 1 216 ? -13.866 6.086   -22.449 1.00 15.55 ? 802  THR A C   1 
ATOM   1431 O  O   . THR A 1 216 ? -13.755 4.890   -22.706 1.00 14.35 ? 802  THR A O   1 
ATOM   1432 C  CB  . THR A 1 216 ? -15.008 7.840   -23.801 1.00 16.90 ? 802  THR A CB  1 
ATOM   1433 O  OG1 . THR A 1 216 ? -16.007 6.852   -24.088 1.00 18.41 ? 802  THR A OG1 1 
ATOM   1434 C  CG2 . THR A 1 216 ? -14.917 8.824   -24.975 1.00 18.33 ? 802  THR A CG2 1 
ATOM   1435 N  N   . SER A 1 217 ? -14.207 6.505   -21.240 1.00 15.28 ? 803  SER A N   1 
ATOM   1436 C  CA  . SER A 1 217 ? -14.585 5.510   -20.251 1.00 16.47 ? 803  SER A CA  1 
ATOM   1437 C  C   . SER A 1 217 ? -15.801 4.696   -20.727 1.00 14.83 ? 803  SER A C   1 
ATOM   1438 O  O   . SER A 1 217 ? -15.929 3.522   -20.379 1.00 15.17 ? 803  SER A O   1 
ATOM   1439 C  CB  . SER A 1 217 ? -14.848 6.170   -18.910 1.00 17.94 ? 803  SER A CB  1 
ATOM   1440 O  OG  . SER A 1 217 ? -13.600 6.511   -18.317 1.00 20.54 ? 803  SER A OG  1 
ATOM   1441 N  N   . ALA A 1 218 ? -16.654 5.276   -21.568 1.00 15.26 ? 804  ALA A N   1 
ATOM   1442 C  CA  . ALA A 1 218 ? -17.804 4.532   -22.084 1.00 15.66 ? 804  ALA A CA  1 
ATOM   1443 C  C   . ALA A 1 218 ? -17.390 3.443   -23.080 1.00 15.39 ? 804  ALA A C   1 
ATOM   1444 O  O   . ALA A 1 218 ? -18.109 2.449   -23.249 1.00 15.21 ? 804  ALA A O   1 
ATOM   1445 C  CB  . ALA A 1 218 ? -18.811 5.473   -22.718 1.00 15.78 ? 804  ALA A CB  1 
ATOM   1446 N  N   A SER A 1 219 ? -16.250 3.608   -23.753 0.64 13.22 ? 805  SER A N   1 
ATOM   1447 N  N   B SER A 1 219 ? -16.249 3.630   -23.737 0.36 16.27 ? 805  SER A N   1 
ATOM   1448 C  CA  A SER A 1 219 ? -15.756 2.510   -24.582 0.64 12.13 ? 805  SER A CA  1 
ATOM   1449 C  CA  B SER A 1 219 ? -15.692 2.571   -24.566 0.36 17.03 ? 805  SER A CA  1 
ATOM   1450 C  C   A SER A 1 219 ? -15.140 1.417   -23.686 0.64 12.16 ? 805  SER A C   1 
ATOM   1451 C  C   B SER A 1 219 ? -15.185 1.438   -23.672 0.36 14.82 ? 805  SER A C   1 
ATOM   1452 O  O   A SER A 1 219 ? -15.185 0.234   -24.032 0.64 12.60 ? 805  SER A O   1 
ATOM   1453 O  O   B SER A 1 219 ? -15.321 0.261   -24.015 0.36 14.81 ? 805  SER A O   1 
ATOM   1454 C  CB  A SER A 1 219 ? -14.760 2.993   -25.655 0.64 12.42 ? 805  SER A CB  1 
ATOM   1455 C  CB  B SER A 1 219 ? -14.566 3.096   -25.455 0.36 19.73 ? 805  SER A CB  1 
ATOM   1456 O  OG  A SER A 1 219 ? -13.618 3.663   -25.151 0.64 11.51 ? 805  SER A OG  1 
ATOM   1457 O  OG  B SER A 1 219 ? -14.142 2.095   -26.364 0.36 21.73 ? 805  SER A OG  1 
ATOM   1458 N  N   . ASP A 1 220 ? -14.612 1.788   -22.520 1.00 12.97 ? 806  ASP A N   1 
ATOM   1459 C  CA  . ASP A 1 220 ? -14.204 0.769   -21.542 1.00 13.09 ? 806  ASP A CA  1 
ATOM   1460 C  C   . ASP A 1 220 ? -15.427 0.017   -21.006 1.00 12.42 ? 806  ASP A C   1 
ATOM   1461 O  O   . ASP A 1 220 ? -15.337 -1.183  -20.723 1.00 12.43 ? 806  ASP A O   1 
ATOM   1462 C  CB  . ASP A 1 220 ? -13.433 1.376   -20.369 1.00 13.89 ? 806  ASP A CB  1 
ATOM   1463 C  CG  . ASP A 1 220 ? -11.958 1.586   -20.663 1.00 14.17 ? 806  ASP A CG  1 
ATOM   1464 O  OD1 . ASP A 1 220 ? -11.443 1.073   -21.682 1.00 14.95 ? 806  ASP A OD1 1 
ATOM   1465 O  OD2 . ASP A 1 220 ? -11.297 2.265   -19.847 1.00 14.83 ? 806  ASP A OD2 1 
ATOM   1466 N  N   . VAL A 1 221 ? -16.564 0.701   -20.869 1.00 12.40 ? 807  VAL A N   1 
ATOM   1467 C  CA  . VAL A 1 221 ? -17.780 0.019   -20.419 1.00 11.93 ? 807  VAL A CA  1 
ATOM   1468 C  C   . VAL A 1 221 ? -18.238 -1.008  -21.461 1.00 11.23 ? 807  VAL A C   1 
ATOM   1469 O  O   . VAL A 1 221 ? -18.644 -2.114  -21.105 1.00 12.49 ? 807  VAL A O   1 
ATOM   1470 C  CB  . VAL A 1 221 ? -18.904 1.015   -20.102 1.00 13.32 ? 807  VAL A CB  1 
ATOM   1471 C  CG1 . VAL A 1 221 ? -20.254 0.309   -19.997 1.00 14.30 ? 807  VAL A CG1 1 
ATOM   1472 C  CG2 . VAL A 1 221 ? -18.572 1.734   -18.815 1.00 13.53 ? 807  VAL A CG2 1 
ATOM   1473 N  N   . TRP A 1 222 ? -18.161 -0.655  -22.739 1.00 12.04 ? 808  TRP A N   1 
ATOM   1474 C  CA  . TRP A 1 222 ? -18.393 -1.641  -23.790 1.00 12.05 ? 808  TRP A CA  1 
ATOM   1475 C  C   . TRP A 1 222 ? -17.512 -2.884  -23.573 1.00 12.02 ? 808  TRP A C   1 
ATOM   1476 O  O   . TRP A 1 222 ? -17.991 -4.020  -23.588 1.00 11.75 ? 808  TRP A O   1 
ATOM   1477 C  CB  . TRP A 1 222 ? -18.109 -1.036  -25.179 1.00 13.23 ? 808  TRP A CB  1 
ATOM   1478 C  CG  . TRP A 1 222 ? -18.332 -2.045  -26.283 1.00 13.32 ? 808  TRP A CG  1 
ATOM   1479 C  CD1 . TRP A 1 222 ? -17.533 -3.115  -26.595 1.00 14.59 ? 808  TRP A CD1 1 
ATOM   1480 C  CD2 . TRP A 1 222 ? -19.444 -2.105  -27.175 1.00 13.95 ? 808  TRP A CD2 1 
ATOM   1481 N  NE1 . TRP A 1 222 ? -18.080 -3.831  -27.635 1.00 15.33 ? 808  TRP A NE1 1 
ATOM   1482 C  CE2 . TRP A 1 222 ? -19.252 -3.227  -28.012 1.00 14.48 ? 808  TRP A CE2 1 
ATOM   1483 C  CE3 . TRP A 1 222 ? -20.580 -1.309  -27.365 1.00 14.60 ? 808  TRP A CE3 1 
ATOM   1484 C  CZ2 . TRP A 1 222 ? -20.161 -3.577  -29.002 1.00 16.00 ? 808  TRP A CZ2 1 
ATOM   1485 C  CZ3 . TRP A 1 222 ? -21.475 -1.658  -28.352 1.00 16.15 ? 808  TRP A CZ3 1 
ATOM   1486 C  CH2 . TRP A 1 222 ? -21.261 -2.777  -29.160 1.00 16.76 ? 808  TRP A CH2 1 
ATOM   1487 N  N   . SER A 1 223 ? -16.216 -2.662  -23.395 1.00 11.62 ? 809  SER A N   1 
ATOM   1488 C  CA  . SER A 1 223 ? -15.285 -3.762  -23.174 1.00 12.49 ? 809  SER A CA  1 
ATOM   1489 C  C   . SER A 1 223 ? -15.699 -4.575  -21.956 1.00 11.36 ? 809  SER A C   1 
ATOM   1490 O  O   . SER A 1 223 ? -15.615 -5.810  -21.960 1.00 11.90 ? 809  SER A O   1 
ATOM   1491 C  CB  . SER A 1 223 ? -13.863 -3.237  -22.978 1.00 12.55 ? 809  SER A CB  1 
ATOM   1492 O  OG  . SER A 1 223 ? -13.441 -2.487  -24.099 1.00 12.81 ? 809  SER A OG  1 
ATOM   1493 N  N   . TYR A 1 224 ? -16.138 -3.885  -20.903 1.00 11.05 ? 810  TYR A N   1 
ATOM   1494 C  CA  . TYR A 1 224 ? -16.586 -4.582  -19.704 1.00 11.20 ? 810  TYR A CA  1 
ATOM   1495 C  C   . TYR A 1 224 ? -17.754 -5.514  -20.043 1.00 11.36 ? 810  TYR A C   1 
ATOM   1496 O  O   . TYR A 1 224 ? -17.824 -6.631  -19.522 1.00 12.37 ? 810  TYR A O   1 
ATOM   1497 C  CB  . TYR A 1 224 ? -16.978 -3.593  -18.581 1.00 12.19 ? 810  TYR A CB  1 
ATOM   1498 C  CG  . TYR A 1 224 ? -17.433 -4.337  -17.343 1.00 11.69 ? 810  TYR A CG  1 
ATOM   1499 C  CD1 . TYR A 1 224 ? -16.520 -4.774  -16.391 1.00 11.82 ? 810  TYR A CD1 1 
ATOM   1500 C  CD2 . TYR A 1 224 ? -18.771 -4.668  -17.165 1.00 12.68 ? 810  TYR A CD2 1 
ATOM   1501 C  CE1 . TYR A 1 224 ? -16.936 -5.496  -15.286 1.00 11.85 ? 810  TYR A CE1 1 
ATOM   1502 C  CE2 . TYR A 1 224 ? -19.192 -5.389  -16.074 1.00 11.93 ? 810  TYR A CE2 1 
ATOM   1503 C  CZ  . TYR A 1 224 ? -18.267 -5.795  -15.131 1.00 11.30 ? 810  TYR A CZ  1 
ATOM   1504 O  OH  . TYR A 1 224 ? -18.689 -6.524  -14.048 1.00 13.30 ? 810  TYR A OH  1 
ATOM   1505 N  N   . GLY A 1 225 ? -18.666 -5.078  -20.910 1.00 12.02 ? 811  GLY A N   1 
ATOM   1506 C  CA  . GLY A 1 225 ? -19.748 -5.956  -21.318 1.00 12.67 ? 811  GLY A CA  1 
ATOM   1507 C  C   . GLY A 1 225 ? -19.234 -7.209  -22.000 1.00 11.05 ? 811  GLY A C   1 
ATOM   1508 O  O   . GLY A 1 225 ? -19.763 -8.302  -21.797 1.00 11.76 ? 811  GLY A O   1 
ATOM   1509 N  N   . ILE A 1 226 ? -18.191 -7.058  -22.811 1.00 11.46 ? 812  ILE A N   1 
ATOM   1510 C  CA  . ILE A 1 226 ? -17.571 -8.231  -23.421 1.00 12.06 ? 812  ILE A CA  1 
ATOM   1511 C  C   . ILE A 1 226 ? -16.949 -9.137  -22.343 1.00 11.11 ? 812  ILE A C   1 
ATOM   1512 O  O   . ILE A 1 226 ? -17.115 -10.356 -22.402 1.00 11.84 ? 812  ILE A O   1 
ATOM   1513 C  CB  . ILE A 1 226 ? -16.503 -7.839  -24.477 1.00 12.27 ? 812  ILE A CB  1 
ATOM   1514 C  CG1 . ILE A 1 226 ? -17.127 -6.953  -25.565 1.00 13.67 ? 812  ILE A CG1 1 
ATOM   1515 C  CG2 . ILE A 1 226 ? -15.888 -9.084  -25.088 1.00 12.84 ? 812  ILE A CG2 1 
ATOM   1516 C  CD1 . ILE A 1 226 ? -18.161 -7.663  -26.431 1.00 14.64 ? 812  ILE A CD1 1 
ATOM   1517 N  N   . VAL A 1 227 ? -16.257 -8.558  -21.360 1.00 11.59 ? 813  VAL A N   1 
ATOM   1518 C  CA  . VAL A 1 227 ? -15.684 -9.353  -20.265 1.00 12.17 ? 813  VAL A CA  1 
ATOM   1519 C  C   . VAL A 1 227 ? -16.778 -10.102 -19.507 1.00 12.06 ? 813  VAL A C   1 
ATOM   1520 O  O   . VAL A 1 227 ? -16.622 -11.278 -19.142 1.00 12.01 ? 813  VAL A O   1 
ATOM   1521 C  CB  . VAL A 1 227 ? -14.895 -8.459  -19.278 1.00 12.75 ? 813  VAL A CB  1 
ATOM   1522 C  CG1 . VAL A 1 227 ? -14.528 -9.235  -18.012 1.00 15.66 ? 813  VAL A CG1 1 
ATOM   1523 C  CG2 . VAL A 1 227 ? -13.664 -7.893  -19.958 1.00 13.54 ? 813  VAL A CG2 1 
ATOM   1524 N  N   . LEU A 1 228 ? -17.896 -9.428  -19.280 1.00 12.75 ? 814  LEU A N   1 
ATOM   1525 C  CA  . LEU A 1 228 ? -19.043 -10.040 -18.624 1.00 12.50 ? 814  LEU A CA  1 
ATOM   1526 C  C   . LEU A 1 228 ? -19.515 -11.274 -19.415 1.00 12.34 ? 814  LEU A C   1 
ATOM   1527 O  O   . LEU A 1 228 ? -19.757 -12.340 -18.849 1.00 12.75 ? 814  LEU A O   1 
ATOM   1528 C  CB  . LEU A 1 228 ? -20.153 -9.005  -18.476 1.00 15.47 ? 814  LEU A CB  1 
ATOM   1529 C  CG  . LEU A 1 228 ? -21.543 -9.381  -17.990 1.00 17.40 ? 814  LEU A CG  1 
ATOM   1530 C  CD1 . LEU A 1 228 ? -21.482 -10.144 -16.703 1.00 18.18 ? 814  LEU A CD1 1 
ATOM   1531 C  CD2 . LEU A 1 228 ? -22.379 -8.120  -17.811 1.00 18.51 ? 814  LEU A CD2 1 
ATOM   1532 N  N   . TRP A 1 229 ? -19.599 -11.142 -20.736 1.00 12.10 ? 815  TRP A N   1 
ATOM   1533 C  CA  . TRP A 1 229 ? -19.917 -12.283 -21.579 1.00 12.83 ? 815  TRP A CA  1 
ATOM   1534 C  C   . TRP A 1 229 ? -18.854 -13.378 -21.488 1.00 12.06 ? 815  TRP A C   1 
ATOM   1535 O  O   . TRP A 1 229 ? -19.191 -14.558 -21.391 1.00 12.52 ? 815  TRP A O   1 
ATOM   1536 C  CB  . TRP A 1 229 ? -20.092 -11.833 -23.026 1.00 12.29 ? 815  TRP A CB  1 
ATOM   1537 C  CG  . TRP A 1 229 ? -20.596 -12.899 -23.943 1.00 12.10 ? 815  TRP A CG  1 
ATOM   1538 C  CD1 . TRP A 1 229 ? -21.905 -13.158 -24.251 1.00 13.77 ? 815  TRP A CD1 1 
ATOM   1539 C  CD2 . TRP A 1 229 ? -19.812 -13.828 -24.702 1.00 12.66 ? 815  TRP A CD2 1 
ATOM   1540 N  NE1 . TRP A 1 229 ? -21.983 -14.197 -25.151 1.00 13.44 ? 815  TRP A NE1 1 
ATOM   1541 C  CE2 . TRP A 1 229 ? -20.714 -14.626 -25.446 1.00 13.46 ? 815  TRP A CE2 1 
ATOM   1542 C  CE3 . TRP A 1 229 ? -18.435 -14.069 -24.826 1.00 12.88 ? 815  TRP A CE3 1 
ATOM   1543 C  CZ2 . TRP A 1 229 ? -20.282 -15.635 -26.310 1.00 14.38 ? 815  TRP A CZ2 1 
ATOM   1544 C  CZ3 . TRP A 1 229 ? -18.012 -15.077 -25.679 1.00 15.00 ? 815  TRP A CZ3 1 
ATOM   1545 C  CH2 . TRP A 1 229 ? -18.935 -15.847 -26.414 1.00 15.21 ? 815  TRP A CH2 1 
ATOM   1546 N  N   . GLU A 1 230 ? -17.577 -13.002 -21.480 1.00 11.38 ? 816  GLU A N   1 
ATOM   1547 C  CA  . GLU A 1 230 ? -16.499 -13.991 -21.356 1.00 11.71 ? 816  GLU A CA  1 
ATOM   1548 C  C   . GLU A 1 230 ? -16.611 -14.776 -20.051 1.00 11.52 ? 816  GLU A C   1 
ATOM   1549 O  O   . GLU A 1 230 ? -16.439 -15.994 -20.024 1.00 12.98 ? 816  GLU A O   1 
ATOM   1550 C  CB  . GLU A 1 230 ? -15.126 -13.318 -21.404 1.00 14.01 ? 816  GLU A CB  1 
ATOM   1551 C  CG  . GLU A 1 230 ? -14.766 -12.689 -22.732 1.00 15.16 ? 816  GLU A CG  1 
ATOM   1552 C  CD  . GLU A 1 230 ? -13.369 -12.097 -22.717 1.00 15.18 ? 816  GLU A CD  1 
ATOM   1553 O  OE1 . GLU A 1 230 ? -13.213 -10.958 -22.228 1.00 14.88 ? 816  GLU A OE1 1 
ATOM   1554 O  OE2 . GLU A 1 230 ? -12.419 -12.764 -23.184 1.00 18.52 ? 816  GLU A OE2 1 
ATOM   1555 N  N   . VAL A 1 231 ? -16.878 -14.074 -18.955 1.00 11.42 ? 817  VAL A N   1 
ATOM   1556 C  CA  . VAL A 1 231 ? -16.961 -14.736 -17.666 1.00 11.98 ? 817  VAL A CA  1 
ATOM   1557 C  C   . VAL A 1 231 ? -18.142 -15.688 -17.642 1.00 11.21 ? 817  VAL A C   1 
ATOM   1558 O  O   . VAL A 1 231 ? -17.984 -16.841 -17.254 1.00 12.60 ? 817  VAL A O   1 
ATOM   1559 C  CB  . VAL A 1 231 ? -17.055 -13.720 -16.524 1.00 12.99 ? 817  VAL A CB  1 
ATOM   1560 C  CG1 . VAL A 1 231 ? -17.416 -14.403 -15.209 1.00 13.47 ? 817  VAL A CG1 1 
ATOM   1561 C  CG2 . VAL A 1 231 ? -15.732 -12.991 -16.398 1.00 13.41 ? 817  VAL A CG2 1 
ATOM   1562 N  N   . MET A 1 232 ? -19.312 -15.240 -18.088 1.00 12.02 ? 818  MET A N   1 
ATOM   1563 C  CA  . MET A 1 232 ? -20.493 -16.095 -18.010 1.00 13.22 ? 818  MET A CA  1 
ATOM   1564 C  C   . MET A 1 232 ? -20.403 -17.253 -19.005 1.00 13.64 ? 818  MET A C   1 
ATOM   1565 O  O   . MET A 1 232 ? -21.130 -18.246 -18.872 1.00 15.89 ? 818  MET A O   1 
ATOM   1566 C  CB  . MET A 1 232 ? -21.771 -15.279 -18.224 1.00 13.70 ? 818  MET A CB  1 
ATOM   1567 C  CG  . MET A 1 232 ? -21.959 -14.167 -17.187 1.00 15.23 ? 818  MET A CG  1 
ATOM   1568 S  SD  . MET A 1 232 ? -21.783 -14.697 -15.461 1.00 16.28 ? 818  MET A SD  1 
ATOM   1569 C  CE  . MET A 1 232 ? -23.120 -15.880 -15.346 1.00 19.15 ? 818  MET A CE  1 
ATOM   1570 N  N   A SER A 1 233 ? -19.498 -17.126 -19.974 0.70 13.63 ? 819  SER A N   1 
ATOM   1571 N  N   B SER A 1 233 ? -19.492 -17.145 -19.967 0.30 13.54 ? 819  SER A N   1 
ATOM   1572 C  CA  A SER A 1 233 ? -19.231 -18.172 -20.964 0.70 14.10 ? 819  SER A CA  1 
ATOM   1573 C  CA  B SER A 1 233 ? -19.268 -18.213 -20.936 0.30 13.75 ? 819  SER A CA  1 
ATOM   1574 C  C   A SER A 1 233 ? -18.009 -19.020 -20.609 0.70 14.27 ? 819  SER A C   1 
ATOM   1575 C  C   B SER A 1 233 ? -18.028 -19.040 -20.598 0.30 13.99 ? 819  SER A C   1 
ATOM   1576 O  O   A SER A 1 233 ? -17.551 -19.828 -21.422 0.70 16.21 ? 819  SER A O   1 
ATOM   1577 O  O   B SER A 1 233 ? -17.579 -19.851 -21.410 0.30 15.19 ? 819  SER A O   1 
ATOM   1578 C  CB  A SER A 1 233 ? -19.019 -17.558 -22.348 0.70 14.44 ? 819  SER A CB  1 
ATOM   1579 C  CB  B SER A 1 233 ? -19.125 -17.637 -22.341 0.30 13.77 ? 819  SER A CB  1 
ATOM   1580 O  OG  A SER A 1 233 ? -20.137 -16.794 -22.755 0.70 13.70 ? 819  SER A OG  1 
ATOM   1581 O  OG  B SER A 1 233 ? -17.885 -16.969 -22.480 0.30 13.14 ? 819  SER A OG  1 
ATOM   1582 N  N   . TYR A 1 234 ? -17.472 -18.818 -19.408 1.00 13.63 ? 820  TYR A N   1 
ATOM   1583 C  CA  . TYR A 1 234 ? -16.286 -19.551 -18.940 1.00 13.16 ? 820  TYR A CA  1 
ATOM   1584 C  C   . TYR A 1 234 ? -15.116 -19.472 -19.924 1.00 13.69 ? 820  TYR A C   1 
ATOM   1585 O  O   . TYR A 1 234 ? -14.440 -20.456 -20.206 1.00 15.94 ? 820  TYR A O   1 
ATOM   1586 C  CB  . TYR A 1 234 ? -16.627 -21.007 -18.622 1.00 15.34 ? 820  TYR A CB  1 
ATOM   1587 C  CG  . TYR A 1 234 ? -17.387 -21.143 -17.329 1.00 14.01 ? 820  TYR A CG  1 
ATOM   1588 C  CD1 . TYR A 1 234 ? -18.772 -21.013 -17.298 1.00 15.17 ? 820  TYR A CD1 1 
ATOM   1589 C  CD2 . TYR A 1 234 ? -16.722 -21.385 -16.133 1.00 14.31 ? 820  TYR A CD2 1 
ATOM   1590 C  CE1 . TYR A 1 234 ? -19.477 -21.144 -16.114 1.00 15.77 ? 820  TYR A CE1 1 
ATOM   1591 C  CE2 . TYR A 1 234 ? -17.411 -21.514 -14.949 1.00 15.50 ? 820  TYR A CE2 1 
ATOM   1592 C  CZ  . TYR A 1 234 ? -18.784 -21.397 -14.937 1.00 16.60 ? 820  TYR A CZ  1 
ATOM   1593 O  OH  . TYR A 1 234 ? -19.453 -21.540 -13.743 1.00 18.31 ? 820  TYR A OH  1 
ATOM   1594 N  N   . GLY A 1 235 ? -14.868 -18.273 -20.438 1.00 13.14 ? 821  GLY A N   1 
ATOM   1595 C  CA  . GLY A 1 235 ? -13.658 -18.058 -21.208 1.00 14.90 ? 821  GLY A CA  1 
ATOM   1596 C  C   . GLY A 1 235 ? -13.753 -18.359 -22.689 1.00 16.68 ? 821  GLY A C   1 
ATOM   1597 O  O   . GLY A 1 235 ? -12.732 -18.495 -23.367 1.00 18.93 ? 821  GLY A O   1 
ATOM   1598 N  N   A GLU A 1 236 ? -14.945 -18.481 -23.195 0.51 15.70 ? 822  GLU A N   1 
ATOM   1599 N  N   B GLU A 1 236 ? -14.951 -18.480 -23.201 0.49 16.23 ? 822  GLU A N   1 
ATOM   1600 C  CA  A GLU A 1 236 ? -15.115 -18.544 -24.634 0.51 16.12 ? 822  GLU A CA  1 
ATOM   1601 C  CA  B GLU A 1 236 ? -15.146 -18.549 -24.648 0.49 17.28 ? 822  GLU A CA  1 
ATOM   1602 C  C   A GLU A 1 236 ? -14.663 -17.259 -25.307 0.51 15.89 ? 822  GLU A C   1 
ATOM   1603 C  C   B GLU A 1 236 ? -14.656 -17.267 -25.305 0.49 16.16 ? 822  GLU A C   1 
ATOM   1604 O  O   A GLU A 1 236 ? -14.660 -16.237 -24.709 0.51 16.70 ? 822  GLU A O   1 
ATOM   1605 O  O   B GLU A 1 236 ? -14.662 -16.242 -24.709 0.49 16.61 ? 822  GLU A O   1 
ATOM   1606 C  CB  A GLU A 1 236 ? -16.568 -18.774 -24.945 0.51 18.24 ? 822  GLU A CB  1 
ATOM   1607 C  CB  B GLU A 1 236 ? -16.627 -18.683 -24.962 0.49 20.65 ? 822  GLU A CB  1 
ATOM   1608 C  CG  A GLU A 1 236 ? -16.809 -18.889 -26.439 0.51 19.62 ? 822  GLU A CG  1 
ATOM   1609 C  CG  B GLU A 1 236 ? -17.268 -20.026 -24.741 0.49 23.53 ? 822  GLU A CG  1 
ATOM   1610 C  CD  A GLU A 1 236 ? -16.030 -20.032 -27.117 0.51 22.36 ? 822  GLU A CD  1 
ATOM   1611 C  CD  B GLU A 1 236 ? -18.390 -20.390 -25.739 0.49 27.89 ? 822  GLU A CD  1 
ATOM   1612 O  OE1 A GLU A 1 236 ? -16.614 -21.113 -27.118 0.51 25.81 ? 822  GLU A OE1 1 
ATOM   1613 O  OE1 B GLU A 1 236 ? -18.826 -19.594 -26.574 0.49 30.30 ? 822  GLU A OE1 1 
ATOM   1614 O  OE2 A GLU A 1 236 ? -14.894 -19.871 -27.645 0.51 22.59 ? 822  GLU A OE2 1 
ATOM   1615 O  OE2 B GLU A 1 236 ? -18.834 -21.530 -25.687 0.49 29.19 ? 822  GLU A OE2 1 
ATOM   1616 N  N   . ARG A 1 237 ? -14.127 -17.386 -26.505 1.00 16.99 ? 823  ARG A N   1 
ATOM   1617 C  CA  . ARG A 1 237 ? -13.630 -16.233 -27.210 1.00 16.81 ? 823  ARG A CA  1 
ATOM   1618 C  C   . ARG A 1 237 ? -14.794 -15.400 -27.749 1.00 16.15 ? 823  ARG A C   1 
ATOM   1619 O  O   . ARG A 1 237 ? -15.628 -15.913 -28.387 1.00 16.40 ? 823  ARG A O   1 
ATOM   1620 C  CB  . ARG A 1 237 ? -12.715 -16.662 -28.340 1.00 18.12 ? 823  ARG A CB  1 
ATOM   1621 C  CG  . ARG A 1 237 ? -12.205 -15.534 -29.185 1.00 18.81 ? 823  ARG A CG  1 
ATOM   1622 C  CD  . ARG A 1 237 ? -11.194 -16.070 -30.183 1.00 19.61 ? 823  ARG A CD  1 
ATOM   1623 N  NE  . ARG A 1 237 ? -10.800 -15.164 -31.241 1.00 21.79 ? 823  ARG A NE  1 
ATOM   1624 C  CZ  . ARG A 1 237 ? -9.863  -14.266 -31.102 1.00 22.64 ? 823  ARG A CZ  1 
ATOM   1625 N  NH1 . ARG A 1 237 ? -9.287  -14.133 -29.954 1.00 24.57 ? 823  ARG A NH1 1 
ATOM   1626 N  NH2 . ARG A 1 237 ? -9.526  -13.489 -32.079 1.00 23.85 ? 823  ARG A NH2 1 
ATOM   1627 N  N   . PRO A 1 238 ? -14.811 -14.099 -27.508 1.00 15.15 ? 824  PRO A N   1 
ATOM   1628 C  CA  . PRO A 1 238 ? -15.914 -13.302 -28.025 1.00 15.53 ? 824  PRO A CA  1 
ATOM   1629 C  C   . PRO A 1 238 ? -15.936 -13.350 -29.548 1.00 15.25 ? 824  PRO A C   1 
ATOM   1630 O  O   . PRO A 1 238 ? -14.941 -13.151 -30.135 1.00 15.54 ? 824  PRO A O   1 
ATOM   1631 C  CB  . PRO A 1 238 ? -15.564 -11.891 -27.573 1.00 16.09 ? 824  PRO A CB  1 
ATOM   1632 C  CG  . PRO A 1 238 ? -14.638 -12.036 -26.450 1.00 17.10 ? 824  PRO A CG  1 
ATOM   1633 C  CD  . PRO A 1 238 ? -13.898 -13.310 -26.676 1.00 15.61 ? 824  PRO A CD  1 
ATOM   1634 N  N   . TYR A 1 239 ? -17.094 -13.624 -30.103 1.00 15.08 ? 825  TYR A N   1 
ATOM   1635 C  CA  . TYR A 1 239 ? -17.313 -13.720 -31.557 1.00 15.94 ? 825  TYR A CA  1 
ATOM   1636 C  C   . TYR A 1 239 ? -16.527 -14.888 -32.152 1.00 17.72 ? 825  TYR A C   1 
ATOM   1637 O  O   . TYR A 1 239 ? -16.311 -14.930 -33.320 1.00 18.10 ? 825  TYR A O   1 
ATOM   1638 C  CB  . TYR A 1 239 ? -16.972 -12.396 -32.277 1.00 16.52 ? 825  TYR A CB  1 
ATOM   1639 C  CG  . TYR A 1 239 ? -17.625 -11.183 -31.673 1.00 15.54 ? 825  TYR A CG  1 
ATOM   1640 C  CD1 . TYR A 1 239 ? -18.883 -10.786 -32.034 1.00 16.22 ? 825  TYR A CD1 1 
ATOM   1641 C  CD2 . TYR A 1 239 ? -16.974 -10.445 -30.730 1.00 15.66 ? 825  TYR A CD2 1 
ATOM   1642 C  CE1 . TYR A 1 239 ? -19.478 -9.698  -31.463 1.00 15.96 ? 825  TYR A CE1 1 
ATOM   1643 C  CE2 . TYR A 1 239 ? -17.561 -9.362  -30.149 1.00 14.78 ? 825  TYR A CE2 1 
ATOM   1644 C  CZ  . TYR A 1 239 ? -18.810 -9.004  -30.508 1.00 14.91 ? 825  TYR A CZ  1 
ATOM   1645 O  OH  . TYR A 1 239 ? -19.381 -7.918  -29.944 1.00 15.49 ? 825  TYR A OH  1 
ATOM   1646 N  N   . TRP A 1 240 ? -16.092 -15.793 -31.280 1.00 17.21 ? 826  TRP A N   1 
ATOM   1647 C  CA  . TRP A 1 240 ? -15.405 -17.009 -31.713 1.00 16.82 ? 826  TRP A CA  1 
ATOM   1648 C  C   . TRP A 1 240 ? -14.304 -16.641 -32.717 1.00 17.84 ? 826  TRP A C   1 
ATOM   1649 O  O   . TRP A 1 240 ? -13.506 -15.757 -32.429 1.00 19.57 ? 826  TRP A O   1 
ATOM   1650 C  CB  . TRP A 1 240 ? -16.435 -18.010 -32.249 1.00 18.33 ? 826  TRP A CB  1 
ATOM   1651 C  CG  . TRP A 1 240 ? -17.615 -18.070 -31.290 1.00 20.26 ? 826  TRP A CG  1 
ATOM   1652 C  CD1 . TRP A 1 240 ? -17.672 -18.748 -30.100 1.00 21.29 ? 826  TRP A CD1 1 
ATOM   1653 C  CD2 . TRP A 1 240 ? -18.867 -17.371 -31.409 1.00 21.01 ? 826  TRP A CD2 1 
ATOM   1654 N  NE1 . TRP A 1 240 ? -18.888 -18.536 -29.493 1.00 21.93 ? 826  TRP A NE1 1 
ATOM   1655 C  CE2 . TRP A 1 240 ? -19.642 -17.705 -30.280 1.00 21.86 ? 826  TRP A CE2 1 
ATOM   1656 C  CE3 . TRP A 1 240 ? -19.421 -16.526 -32.382 1.00 22.14 ? 826  TRP A CE3 1 
ATOM   1657 C  CZ2 . TRP A 1 240 ? -20.934 -17.204 -30.081 1.00 22.90 ? 826  TRP A CZ2 1 
ATOM   1658 C  CZ3 . TRP A 1 240 ? -20.706 -16.030 -32.182 1.00 23.91 ? 826  TRP A CZ3 1 
ATOM   1659 C  CH2 . TRP A 1 240 ? -21.447 -16.375 -31.044 1.00 22.96 ? 826  TRP A CH2 1 
ATOM   1660 N  N   A GLU A 1 241 ? -14.270 -17.287 -33.879 0.57 18.58 ? 827  GLU A N   1 
ATOM   1661 N  N   B GLU A 1 241 ? -14.257 -17.285 -33.877 0.43 18.74 ? 827  GLU A N   1 
ATOM   1662 C  CA  A GLU A 1 241 ? -13.217 -16.997 -34.849 0.57 19.89 ? 827  GLU A CA  1 
ATOM   1663 C  CA  B GLU A 1 241 ? -13.211 -16.951 -34.840 0.43 20.07 ? 827  GLU A CA  1 
ATOM   1664 C  C   A GLU A 1 241 ? -13.729 -16.245 -36.081 0.57 19.56 ? 827  GLU A C   1 
ATOM   1665 C  C   B GLU A 1 241 ? -13.765 -16.285 -36.096 0.43 19.93 ? 827  GLU A C   1 
ATOM   1666 O  O   A GLU A 1 241 ? -13.140 -16.348 -37.161 0.57 20.33 ? 827  GLU A O   1 
ATOM   1667 O  O   B GLU A 1 241 ? -13.249 -16.481 -37.198 0.43 21.05 ? 827  GLU A O   1 
ATOM   1668 C  CB  A GLU A 1 241 ? -12.520 -18.294 -35.281 0.57 22.17 ? 827  GLU A CB  1 
ATOM   1669 C  CB  B GLU A 1 241 ? -12.403 -18.199 -35.199 0.43 21.98 ? 827  GLU A CB  1 
ATOM   1670 C  CG  A GLU A 1 241 ? -11.806 -19.023 -34.146 0.57 25.19 ? 827  GLU A CG  1 
ATOM   1671 C  CG  B GLU A 1 241 ? -11.536 -18.671 -34.046 0.43 24.61 ? 827  GLU A CG  1 
ATOM   1672 C  CD  A GLU A 1 241 ? -10.626 -18.243 -33.588 0.57 28.19 ? 827  GLU A CD  1 
ATOM   1673 C  CD  B GLU A 1 241 ? -10.708 -19.887 -34.385 0.43 27.21 ? 827  GLU A CD  1 
ATOM   1674 O  OE1 A GLU A 1 241 ? -10.050 -17.416 -34.324 0.57 30.24 ? 827  GLU A OE1 1 
ATOM   1675 O  OE1 B GLU A 1 241 ? -9.884  -19.813 -35.322 0.43 29.32 ? 827  GLU A OE1 1 
ATOM   1676 O  OE2 A GLU A 1 241 ? -10.276 -18.457 -32.408 0.57 29.21 ? 827  GLU A OE2 1 
ATOM   1677 O  OE2 B GLU A 1 241 ? -10.883 -20.917 -33.708 0.43 29.39 ? 827  GLU A OE2 1 
ATOM   1678 N  N   . MET A 1 242 ? -14.812 -15.483 -35.915 1.00 18.99 ? 828  MET A N   1 
ATOM   1679 C  CA  . MET A 1 242 ? -15.354 -14.659 -36.998 1.00 20.22 ? 828  MET A CA  1 
ATOM   1680 C  C   . MET A 1 242 ? -14.253 -13.772 -37.565 1.00 21.46 ? 828  MET A C   1 
ATOM   1681 O  O   . MET A 1 242 ? -13.389 -13.320 -36.821 1.00 22.96 ? 828  MET A O   1 
ATOM   1682 C  CB  . MET A 1 242 ? -16.511 -13.778 -36.503 1.00 20.59 ? 828  MET A CB  1 
ATOM   1683 C  CG  . MET A 1 242 ? -17.802 -14.514 -36.176 1.00 19.83 ? 828  MET A CG  1 
ATOM   1684 S  SD  . MET A 1 242 ? -19.109 -13.406 -35.576 1.00 19.30 ? 828  MET A SD  1 
ATOM   1685 C  CE  . MET A 1 242 ? -19.357 -12.342 -36.989 1.00 21.03 ? 828  MET A CE  1 
ATOM   1686 N  N   . SER A 1 243 ? -14.266 -13.524 -38.871 1.00 23.72 ? 829  SER A N   1 
ATOM   1687 C  CA  . SER A 1 243 ? -13.292 -12.597 -39.431 1.00 27.69 ? 829  SER A CA  1 
ATOM   1688 C  C   . SER A 1 243 ? -13.514 -11.232 -38.788 1.00 27.72 ? 829  SER A C   1 
ATOM   1689 O  O   . SER A 1 243 ? -14.655 -10.864 -38.497 1.00 28.12 ? 829  SER A O   1 
ATOM   1690 C  CB  . SER A 1 243 ? -13.423 -12.507 -40.946 1.00 33.14 ? 829  SER A CB  1 
ATOM   1691 O  OG  . SER A 1 243 ? -14.540 -11.715 -41.294 1.00 37.28 ? 829  SER A OG  1 
ATOM   1692 N  N   . ASN A 1 244 ? -12.432 -10.499 -38.538 1.00 28.82 ? 830  ASN A N   1 
ATOM   1693 C  CA  . ASN A 1 244 ? -12.541 -9.191  -37.892 1.00 29.10 ? 830  ASN A CA  1 
ATOM   1694 C  C   . ASN A 1 244 ? -13.469 -8.261  -38.653 1.00 26.15 ? 830  ASN A C   1 
ATOM   1695 O  O   . ASN A 1 244 ? -14.226 -7.504  -38.056 1.00 25.38 ? 830  ASN A O   1 
ATOM   1696 C  CB  . ASN A 1 244 ? -11.165 -8.545  -37.743 1.00 31.29 ? 830  ASN A CB  1 
ATOM   1697 C  CG  . ASN A 1 244 ? -10.361 -9.152  -36.614 1.00 34.57 ? 830  ASN A CG  1 
ATOM   1698 O  OD1 . ASN A 1 244 ? -10.716 -10.205 -36.085 1.00 37.21 ? 830  ASN A OD1 1 
ATOM   1699 N  ND2 . ASN A 1 244 ? -9.274  -8.491  -36.234 1.00 36.29 ? 830  ASN A ND2 1 
ATOM   1700 N  N   . GLN A 1 245 ? -13.460 -8.358  -39.961 1.00 25.37 ? 831  GLN A N   1 
ATOM   1701 C  CA  . GLN A 1 245 ? -14.292 -7.531  -40.783 1.00 27.11 ? 831  GLN A CA  1 
ATOM   1702 C  C   . GLN A 1 245 ? -15.749 -7.786  -40.490 1.00 24.20 ? 831  GLN A C   1 
ATOM   1703 O  O   . GLN A 1 245 ? -16.543 -6.914  -40.464 1.00 23.43 ? 831  GLN A O   1 
ATOM   1704 C  CB  . GLN A 1 245 ? -13.907 -7.748  -42.255 1.00 34.32 ? 831  GLN A CB  1 
ATOM   1705 C  CG  . GLN A 1 245 ? -12.400 -7.638  -42.493 1.00 41.10 ? 831  GLN A CG  1 
ATOM   1706 C  CD  . GLN A 1 245 ? -11.543 -8.927  -42.246 1.00 44.92 ? 831  GLN A CD  1 
ATOM   1707 O  OE1 . GLN A 1 245 ? -11.183 -9.241  -41.156 1.00 45.08 ? 831  GLN A OE1 1 
ATOM   1708 N  NE2 . GLN A 1 245 ? -11.144 -9.577  -43.311 1.00 46.75 ? 831  GLN A NE2 1 
ATOM   1709 N  N   . ASP A 1 246 ? -16.082 -9.047  -40.249 1.00 22.81 ? 832  ASP A N   1 
ATOM   1710 C  CA  . ASP A 1 246 ? -17.458 -9.402  -39.923 1.00 20.90 ? 832  ASP A CA  1 
ATOM   1711 C  C   . ASP A 1 246 ? -17.841 -9.039  -38.484 1.00 19.48 ? 832  ASP A C   1 
ATOM   1712 O  O   . ASP A 1 246 ? -18.991 -8.677  -38.221 1.00 20.37 ? 832  ASP A O   1 
ATOM   1713 C  CB  . ASP A 1 246 ? -17.692 -10.892 -40.175 1.00 20.61 ? 832  ASP A CB  1 
ATOM   1714 C  CG  . ASP A 1 246 ? -17.827 -11.206 -41.656 1.00 22.73 ? 832  ASP A CG  1 
ATOM   1715 O  OD1 . ASP A 1 246 ? -18.460 -10.402 -42.372 1.00 23.88 ? 832  ASP A OD1 1 
ATOM   1716 O  OD2 . ASP A 1 246 ? -17.292 -12.240 -42.103 1.00 25.57 ? 832  ASP A OD2 1 
ATOM   1717 N  N   . VAL A 1 247 ? -16.900 -9.137  -37.548 1.00 18.71 ? 833  VAL A N   1 
ATOM   1718 C  CA  . VAL A 1 247 ? -17.171 -8.661  -36.195 1.00 18.38 ? 833  VAL A CA  1 
ATOM   1719 C  C   . VAL A 1 247 ? -17.513 -7.167  -36.242 1.00 18.94 ? 833  VAL A C   1 
ATOM   1720 O  O   . VAL A 1 247 ? -18.478 -6.715  -35.630 1.00 19.38 ? 833  VAL A O   1 
ATOM   1721 C  CB  . VAL A 1 247 ? -15.975 -8.894  -35.249 1.00 18.97 ? 833  VAL A CB  1 
ATOM   1722 C  CG1 . VAL A 1 247 ? -16.230 -8.251  -33.893 1.00 20.08 ? 833  VAL A CG1 1 
ATOM   1723 C  CG2 . VAL A 1 247 ? -15.700 -10.382 -35.104 1.00 19.15 ? 833  VAL A CG2 1 
ATOM   1724 N  N   . ILE A 1 248 ? -16.735 -6.407  -37.000 1.00 18.82 ? 834  ILE A N   1 
ATOM   1725 C  CA  . ILE A 1 248 ? -16.963 -4.971  -37.109 1.00 19.80 ? 834  ILE A CA  1 
ATOM   1726 C  C   . ILE A 1 248 ? -18.307 -4.676  -37.763 1.00 19.67 ? 834  ILE A C   1 
ATOM   1727 O  O   . ILE A 1 248 ? -19.102 -3.895  -37.245 1.00 20.88 ? 834  ILE A O   1 
ATOM   1728 C  CB  . ILE A 1 248 ? -15.832 -4.286  -37.894 1.00 21.52 ? 834  ILE A CB  1 
ATOM   1729 C  CG1 . ILE A 1 248 ? -14.521 -4.367  -37.102 1.00 22.65 ? 834  ILE A CG1 1 
ATOM   1730 C  CG2 . ILE A 1 248 ? -16.189 -2.835  -38.188 1.00 22.72 ? 834  ILE A CG2 1 
ATOM   1731 C  CD1 . ILE A 1 248 ? -13.288 -3.980  -37.904 1.00 24.03 ? 834  ILE A CD1 1 
ATOM   1732 N  N   . LYS A 1 249 ? -18.574 -5.321  -38.889 1.00 19.39 ? 835  LYS A N   1 
ATOM   1733 C  CA  . LYS A 1 249 ? -19.807 -5.053  -39.616 1.00 21.20 ? 835  LYS A CA  1 
ATOM   1734 C  C   . LYS A 1 249 ? -21.047 -5.508  -38.839 1.00 21.40 ? 835  LYS A C   1 
ATOM   1735 O  O   . LYS A 1 249 ? -22.034 -4.784  -38.763 1.00 22.10 ? 835  LYS A O   1 
ATOM   1736 C  CB  . LYS A 1 249 ? -19.766 -5.727  -40.992 1.00 22.14 ? 835  LYS A CB  1 
ATOM   1737 C  CG  . LYS A 1 249 ? -20.811 -5.211  -41.963 1.00 26.69 ? 835  LYS A CG  1 
ATOM   1738 C  CD  . LYS A 1 249 ? -20.566 -5.753  -43.369 1.00 29.98 ? 835  LYS A CD  1 
ATOM   1739 C  CE  . LYS A 1 249 ? -19.268 -5.211  -43.968 1.00 32.47 ? 835  LYS A CE  1 
ATOM   1740 N  NZ  . LYS A 1 249 ? -19.305 -3.736  -44.206 1.00 34.09 ? 835  LYS A NZ  1 
ATOM   1741 N  N   . ALA A 1 250 ? -20.996 -6.705  -38.259 1.00 19.67 ? 836  ALA A N   1 
ATOM   1742 C  CA  . ALA A 1 250 ? -22.151 -7.252  -37.547 1.00 18.71 ? 836  ALA A CA  1 
ATOM   1743 C  C   . ALA A 1 250 ? -22.538 -6.380  -36.358 1.00 19.29 ? 836  ALA A C   1 
ATOM   1744 O  O   . ALA A 1 250 ? -23.710 -6.055  -36.159 1.00 19.35 ? 836  ALA A O   1 
ATOM   1745 C  CB  . ALA A 1 250 ? -21.867 -8.668  -37.088 1.00 19.25 ? 836  ALA A CB  1 
ATOM   1746 N  N   . VAL A 1 251 ? -21.546 -6.007  -35.561 1.00 17.88 ? 837  VAL A N   1 
ATOM   1747 C  CA  . VAL A 1 251 ? -21.817 -5.191  -34.387 1.00 18.74 ? 837  VAL A CA  1 
ATOM   1748 C  C   . VAL A 1 251 ? -22.377 -3.835  -34.807 1.00 20.11 ? 837  VAL A C   1 
ATOM   1749 O  O   . VAL A 1 251 ? -23.338 -3.336  -34.222 1.00 20.31 ? 837  VAL A O   1 
ATOM   1750 C  CB  . VAL A 1 251 ? -20.555 -5.020  -33.539 1.00 17.74 ? 837  VAL A CB  1 
ATOM   1751 C  CG1 . VAL A 1 251 ? -20.758 -3.936  -32.503 1.00 20.17 ? 837  VAL A CG1 1 
ATOM   1752 C  CG2 . VAL A 1 251 ? -20.207 -6.349  -32.873 1.00 18.14 ? 837  VAL A CG2 1 
ATOM   1753 N  N   . ASP A 1 252 ? -21.813 -3.262  -35.862 1.00 19.73 ? 838  ASP A N   1 
ATOM   1754 C  CA  . ASP A 1 252 ? -22.308 -1.986  -36.340 1.00 21.50 ? 838  ASP A CA  1 
ATOM   1755 C  C   . ASP A 1 252 ? -23.771 -2.094  -36.809 1.00 23.09 ? 838  ASP A C   1 
ATOM   1756 O  O   . ASP A 1 252 ? -24.558 -1.170  -36.600 1.00 24.93 ? 838  ASP A O   1 
ATOM   1757 C  CB  . ASP A 1 252 ? -21.407 -1.463  -37.459 1.00 23.02 ? 838  ASP A CB  1 
ATOM   1758 C  CG  . ASP A 1 252 ? -21.932 -0.187  -38.080 1.00 25.23 ? 838  ASP A CG  1 
ATOM   1759 O  OD1 . ASP A 1 252 ? -21.827 0.890   -37.451 1.00 27.98 ? 838  ASP A OD1 1 
ATOM   1760 O  OD2 . ASP A 1 252 ? -22.461 -0.276  -39.194 1.00 22.90 ? 838  ASP A OD2 1 
ATOM   1761 N  N   . GLU A 1 253 ? -24.137 -3.228  -37.410 1.00 21.53 ? 839  GLU A N   1 
ATOM   1762 C  CA  . GLU A 1 253 ? -25.518 -3.454  -37.847 1.00 23.35 ? 839  GLU A CA  1 
ATOM   1763 C  C   . GLU A 1 253 ? -26.488 -3.706  -36.687 1.00 25.05 ? 839  GLU A C   1 
ATOM   1764 O  O   . GLU A 1 253 ? -27.701 -3.768  -36.897 1.00 27.82 ? 839  GLU A O   1 
ATOM   1765 C  CB  . GLU A 1 253 ? -25.585 -4.629  -38.831 1.00 23.58 ? 839  GLU A CB  1 
ATOM   1766 C  CG  . GLU A 1 253 ? -25.094 -4.280  -40.237 1.00 24.78 ? 839  GLU A CG  1 
ATOM   1767 C  CD  . GLU A 1 253 ? -25.090 -5.457  -41.195 1.00 27.72 ? 839  GLU A CD  1 
ATOM   1768 O  OE1 . GLU A 1 253 ? -25.677 -6.507  -40.862 1.00 28.83 ? 839  GLU A OE1 1 
ATOM   1769 O  OE2 . GLU A 1 253 ? -24.505 -5.321  -42.292 1.00 28.48 ? 839  GLU A OE2 1 
ATOM   1770 N  N   . GLY A 1 254 ? -25.966 -3.867  -35.474 1.00 22.81 ? 840  GLY A N   1 
ATOM   1771 C  CA  . GLY A 1 254 ? -26.825 -4.046  -34.320 1.00 22.14 ? 840  GLY A CA  1 
ATOM   1772 C  C   . GLY A 1 254 ? -26.810 -5.436  -33.714 1.00 20.99 ? 840  GLY A C   1 
ATOM   1773 O  O   . GLY A 1 254 ? -27.467 -5.682  -32.706 1.00 22.71 ? 840  GLY A O   1 
ATOM   1774 N  N   . TYR A 1 255 ? -26.064 -6.351  -34.324 1.00 19.04 ? 841  TYR A N   1 
ATOM   1775 C  CA  . TYR A 1 255 ? -25.961 -7.705  -33.788 1.00 18.24 ? 841  TYR A CA  1 
ATOM   1776 C  C   . TYR A 1 255 ? -25.137 -7.732  -32.510 1.00 17.57 ? 841  TYR A C   1 
ATOM   1777 O  O   . TYR A 1 255 ? -24.194 -6.954  -32.347 1.00 18.48 ? 841  TYR A O   1 
ATOM   1778 C  CB  . TYR A 1 255 ? -25.367 -8.647  -34.830 1.00 18.00 ? 841  TYR A CB  1 
ATOM   1779 C  CG  . TYR A 1 255 ? -26.368 -8.980  -35.910 1.00 19.54 ? 841  TYR A CG  1 
ATOM   1780 C  CD1 . TYR A 1 255 ? -26.510 -8.169  -37.034 1.00 19.82 ? 841  TYR A CD1 1 
ATOM   1781 C  CD2 . TYR A 1 255 ? -27.188 -10.100 -35.798 1.00 19.84 ? 841  TYR A CD2 1 
ATOM   1782 C  CE1 . TYR A 1 255 ? -27.441 -8.470  -38.026 1.00 20.83 ? 841  TYR A CE1 1 
ATOM   1783 C  CE2 . TYR A 1 255 ? -28.125 -10.398 -36.777 1.00 21.02 ? 841  TYR A CE2 1 
ATOM   1784 C  CZ  . TYR A 1 255 ? -28.237 -9.587  -37.888 1.00 21.59 ? 841  TYR A CZ  1 
ATOM   1785 O  OH  . TYR A 1 255 ? -29.163 -9.888  -38.856 1.00 25.48 ? 841  TYR A OH  1 
ATOM   1786 N  N   . ARG A 1 256 ? -25.503 -8.639  -31.612 1.00 17.25 ? 842  ARG A N   1 
ATOM   1787 C  CA  . ARG A 1 256 ? -24.843 -8.740  -30.314 1.00 15.84 ? 842  ARG A CA  1 
ATOM   1788 C  C   . ARG A 1 256 ? -24.572 -10.200 -29.989 1.00 15.77 ? 842  ARG A C   1 
ATOM   1789 O  O   . ARG A 1 256 ? -25.242 -11.096 -30.487 1.00 16.47 ? 842  ARG A O   1 
ATOM   1790 C  CB  . ARG A 1 256 ? -25.696 -8.112  -29.206 1.00 16.92 ? 842  ARG A CB  1 
ATOM   1791 C  CG  . ARG A 1 256 ? -25.942 -6.625  -29.375 1.00 16.03 ? 842  ARG A CG  1 
ATOM   1792 C  CD  . ARG A 1 256 ? -24.662 -5.832  -29.257 1.00 15.94 ? 842  ARG A CD  1 
ATOM   1793 N  NE  . ARG A 1 256 ? -24.860 -4.389  -29.326 1.00 16.19 ? 842  ARG A NE  1 
ATOM   1794 C  CZ  . ARG A 1 256 ? -24.703 -3.660  -30.425 1.00 16.90 ? 842  ARG A CZ  1 
ATOM   1795 N  NH1 . ARG A 1 256 ? -24.373 -4.244  -31.571 1.00 18.23 ? 842  ARG A NH1 1 
ATOM   1796 N  NH2 . ARG A 1 256 ? -24.878 -2.345  -30.381 1.00 17.24 ? 842  ARG A NH2 1 
ATOM   1797 N  N   . LEU A 1 257 ? -23.573 -10.439 -29.158 1.00 14.84 ? 843  LEU A N   1 
ATOM   1798 C  CA  . LEU A 1 257 ? -23.327 -11.785 -28.680 1.00 14.84 ? 843  LEU A CA  1 
ATOM   1799 C  C   . LEU A 1 257 ? -24.571 -12.345 -27.990 1.00 16.31 ? 843  LEU A C   1 
ATOM   1800 O  O   . LEU A 1 257 ? -25.285 -11.627 -27.292 1.00 16.45 ? 843  LEU A O   1 
ATOM   1801 C  CB  . LEU A 1 257 ? -22.132 -11.795 -27.733 1.00 15.43 ? 843  LEU A CB  1 
ATOM   1802 C  CG  . LEU A 1 257 ? -20.807 -11.503 -28.431 1.00 16.64 ? 843  LEU A CG  1 
ATOM   1803 C  CD1 . LEU A 1 257 ? -19.738 -11.149 -27.410 1.00 17.11 ? 843  LEU A CD1 1 
ATOM   1804 C  CD2 . LEU A 1 257 ? -20.365 -12.698 -29.259 1.00 17.51 ? 843  LEU A CD2 1 
ATOM   1805 N  N   . PRO A 1 258 ? -24.830 -13.639 -28.181 1.00 16.51 ? 844  PRO A N   1 
ATOM   1806 C  CA  . PRO A 1 258 ? -26.014 -14.286 -27.610 1.00 16.44 ? 844  PRO A CA  1 
ATOM   1807 C  C   . PRO A 1 258 ? -25.831 -14.580 -26.125 1.00 16.39 ? 844  PRO A C   1 
ATOM   1808 O  O   . PRO A 1 258 ? -24.704 -14.570 -25.645 1.00 15.90 ? 844  PRO A O   1 
ATOM   1809 C  CB  . PRO A 1 258 ? -26.113 -15.581 -28.419 1.00 17.18 ? 844  PRO A CB  1 
ATOM   1810 C  CG  . PRO A 1 258 ? -24.684 -15.905 -28.732 1.00 17.84 ? 844  PRO A CG  1 
ATOM   1811 C  CD  . PRO A 1 258 ? -23.992 -14.588 -28.935 1.00 17.48 ? 844  PRO A CD  1 
ATOM   1812 N  N   . PRO A 1 259 ? -26.929 -14.836 -25.405 1.00 16.23 ? 845  PRO A N   1 
ATOM   1813 C  CA  . PRO A 1 259 ? -26.773 -15.179 -23.989 1.00 17.16 ? 845  PRO A CA  1 
ATOM   1814 C  C   . PRO A 1 259 ? -25.959 -16.451 -23.802 1.00 16.95 ? 845  PRO A C   1 
ATOM   1815 O  O   . PRO A 1 259 ? -26.223 -17.446 -24.472 1.00 18.33 ? 845  PRO A O   1 
ATOM   1816 C  CB  . PRO A 1 259 ? -28.217 -15.376 -23.510 1.00 18.84 ? 845  PRO A CB  1 
ATOM   1817 C  CG  . PRO A 1 259 ? -29.020 -15.583 -24.742 1.00 20.82 ? 845  PRO A CG  1 
ATOM   1818 C  CD  . PRO A 1 259 ? -28.339 -14.827 -25.833 1.00 18.30 ? 845  PRO A CD  1 
ATOM   1819 N  N   . PRO A 1 260 ? -24.963 -16.419 -22.909 1.00 16.15 ? 846  PRO A N   1 
ATOM   1820 C  CA  . PRO A 1 260 ? -24.228 -17.639 -22.574 1.00 17.38 ? 846  PRO A CA  1 
ATOM   1821 C  C   . PRO A 1 260 ? -25.175 -18.674 -21.977 1.00 18.47 ? 846  PRO A C   1 
ATOM   1822 O  O   . PRO A 1 260 ? -26.244 -18.304 -21.489 1.00 19.18 ? 846  PRO A O   1 
ATOM   1823 C  CB  . PRO A 1 260 ? -23.192 -17.159 -21.548 1.00 16.88 ? 846  PRO A CB  1 
ATOM   1824 C  CG  . PRO A 1 260 ? -23.017 -15.698 -21.872 1.00 17.26 ? 846  PRO A CG  1 
ATOM   1825 C  CD  . PRO A 1 260 ? -24.389 -15.230 -22.255 1.00 16.88 ? 846  PRO A CD  1 
ATOM   1826 N  N   . MET A 1 261 ? -24.799 -19.946 -22.033 1.00 20.80 ? 847  MET A N   1 
ATOM   1827 C  CA  . MET A 1 261 ? -25.639 -20.993 -21.477 1.00 23.52 ? 847  MET A CA  1 
ATOM   1828 C  C   . MET A 1 261 ? -25.968 -20.720 -20.009 1.00 22.95 ? 847  MET A C   1 
ATOM   1829 O  O   . MET A 1 261 ? -25.076 -20.423 -19.202 1.00 23.42 ? 847  MET A O   1 
ATOM   1830 C  CB  . MET A 1 261 ? -24.965 -22.353 -21.613 1.00 29.07 ? 847  MET A CB  1 
ATOM   1831 C  CG  . MET A 1 261 ? -25.804 -23.487 -21.063 1.00 35.78 ? 847  MET A CG  1 
ATOM   1832 S  SD  . MET A 1 261 ? -25.093 -25.096 -21.426 1.00 41.66 ? 847  MET A SD  1 
ATOM   1833 C  CE  . MET A 1 261 ? -25.897 -26.109 -20.188 1.00 41.94 ? 847  MET A CE  1 
ATOM   1834 N  N   . ASP A 1 262 ? -27.257 -20.799 -19.690 1.00 24.81 ? 848  ASP A N   1 
ATOM   1835 C  CA  . ASP A 1 262 ? -27.758 -20.664 -18.322 1.00 26.88 ? 848  ASP A CA  1 
ATOM   1836 C  C   . ASP A 1 262 ? -27.483 -19.287 -17.722 1.00 25.95 ? 848  ASP A C   1 
ATOM   1837 O  O   . ASP A 1 262 ? -27.452 -19.128 -16.505 1.00 26.67 ? 848  ASP A O   1 
ATOM   1838 C  CB  . ASP A 1 262 ? -27.159 -21.755 -17.420 1.00 29.40 ? 848  ASP A CB  1 
ATOM   1839 C  CG  . ASP A 1 262 ? -27.649 -23.146 -17.782 1.00 34.58 ? 848  ASP A CG  1 
ATOM   1840 O  OD1 . ASP A 1 262 ? -28.834 -23.281 -18.152 1.00 36.16 ? 848  ASP A OD1 1 
ATOM   1841 O  OD2 . ASP A 1 262 ? -26.854 -24.108 -17.689 1.00 36.78 ? 848  ASP A OD2 1 
ATOM   1842 N  N   . CYS A 1 263 ? -27.301 -18.288 -18.575 1.00 22.18 ? 849  CYS A N   1 
ATOM   1843 C  CA  . CYS A 1 263 ? -27.015 -16.943 -18.087 1.00 19.38 ? 849  CYS A CA  1 
ATOM   1844 C  C   . CYS A 1 263 ? -28.271 -16.294 -17.514 1.00 19.99 ? 849  CYS A C   1 
ATOM   1845 O  O   . CYS A 1 263 ? -29.293 -16.232 -18.191 1.00 21.26 ? 849  CYS A O   1 
ATOM   1846 C  CB  . CYS A 1 263 ? -26.449 -16.068 -19.208 1.00 18.81 ? 849  CYS A CB  1 
ATOM   1847 S  SG  . CYS A 1 263 ? -25.925 -14.443 -18.654 1.00 18.63 ? 849  CYS A SG  1 
ATOM   1848 N  N   . PRO A 1 264 ? -28.199 -15.801 -16.265 1.00 19.31 ? 850  PRO A N   1 
ATOM   1849 C  CA  . PRO A 1 264 ? -29.312 -15.028 -15.700 1.00 19.53 ? 850  PRO A CA  1 
ATOM   1850 C  C   . PRO A 1 264 ? -29.703 -13.846 -16.590 1.00 17.96 ? 850  PRO A C   1 
ATOM   1851 O  O   . PRO A 1 264 ? -28.834 -13.166 -17.139 1.00 17.67 ? 850  PRO A O   1 
ATOM   1852 C  CB  . PRO A 1 264 ? -28.751 -14.532 -14.365 1.00 21.15 ? 850  PRO A CB  1 
ATOM   1853 C  CG  . PRO A 1 264 ? -27.752 -15.594 -13.983 1.00 20.59 ? 850  PRO A CG  1 
ATOM   1854 C  CD  . PRO A 1 264 ? -27.108 -15.990 -15.292 1.00 20.26 ? 850  PRO A CD  1 
ATOM   1855 N  N   . ALA A 1 265 ? -30.981 -13.580 -16.700 1.00 18.30 ? 851  ALA A N   1 
ATOM   1856 C  CA  . ALA A 1 265 ? -31.487 -12.507 -17.513 1.00 18.00 ? 851  ALA A CA  1 
ATOM   1857 C  C   . ALA A 1 265 ? -30.922 -11.170 -17.069 1.00 16.90 ? 851  ALA A C   1 
ATOM   1858 O  O   . ALA A 1 265 ? -30.633 -10.349 -17.869 1.00 17.65 ? 851  ALA A O   1 
ATOM   1859 C  CB  . ALA A 1 265 ? -32.989 -12.478 -17.452 1.00 19.98 ? 851  ALA A CB  1 
ATOM   1860 N  N   . ALA A 1 266 ? -30.767 -10.982 -15.780 1.00 16.99 ? 852  ALA A N   1 
ATOM   1861 C  CA  . ALA A 1 266 ? -30.202 -9.742  -15.258 1.00 16.49 ? 852  ALA A CA  1 
ATOM   1862 C  C   . ALA A 1 266 ? -28.815 -9.475  -15.824 1.00 15.49 ? 852  ALA A C   1 
ATOM   1863 O  O   . ALA A 1 266 ? -28.477 -8.340  -16.155 1.00 16.55 ? 852  ALA A O   1 
ATOM   1864 C  CB  . ALA A 1 266 ? -30.150 -9.786  -13.747 1.00 17.64 ? 852  ALA A CB  1 
ATOM   1865 N  N   . LEU A 1 267 ? -28.010 -10.525 -15.950 1.00 14.38 ? 853  LEU A N   1 
ATOM   1866 C  CA  . LEU A 1 267 ? -26.636 -10.352 -16.401 1.00 13.58 ? 853  LEU A CA  1 
ATOM   1867 C  C   . LEU A 1 267 ? -26.583 -10.175 -17.920 1.00 13.71 ? 853  LEU A C   1 
ATOM   1868 O  O   . LEU A 1 267 ? -25.777 -9.396  -18.416 1.00 14.39 ? 853  LEU A O   1 
ATOM   1869 C  CB  . LEU A 1 267 ? -25.762 -11.528 -15.933 1.00 13.86 ? 853  LEU A CB  1 
ATOM   1870 C  CG  . LEU A 1 267 ? -25.507 -11.527 -14.420 1.00 15.08 ? 853  LEU A CG  1 
ATOM   1871 C  CD1 . LEU A 1 267 ? -24.856 -12.839 -13.987 1.00 16.97 ? 853  LEU A CD1 1 
ATOM   1872 C  CD2 . LEU A 1 267 ? -24.656 -10.322 -14.003 1.00 16.50 ? 853  LEU A CD2 1 
ATOM   1873 N  N   . TYR A 1 268 ? -27.442 -10.871 -18.657 1.00 14.22 ? 854  TYR A N   1 
ATOM   1874 C  CA  . TYR A 1 268 ? -27.465 -10.663 -20.104 1.00 14.45 ? 854  TYR A CA  1 
ATOM   1875 C  C   . TYR A 1 268 ? -27.965 -9.250  -20.422 1.00 14.93 ? 854  TYR A C   1 
ATOM   1876 O  O   . TYR A 1 268 ? -27.438 -8.588  -21.319 1.00 15.56 ? 854  TYR A O   1 
ATOM   1877 C  CB  . TYR A 1 268 ? -28.321 -11.710 -20.820 1.00 15.76 ? 854  TYR A CB  1 
ATOM   1878 C  CG  . TYR A 1 268 ? -28.185 -11.607 -22.323 1.00 14.74 ? 854  TYR A CG  1 
ATOM   1879 C  CD1 . TYR A 1 268 ? -26.936 -11.689 -22.926 1.00 16.37 ? 854  TYR A CD1 1 
ATOM   1880 C  CD2 . TYR A 1 268 ? -29.296 -11.437 -23.139 1.00 16.74 ? 854  TYR A CD2 1 
ATOM   1881 C  CE1 . TYR A 1 268 ? -26.786 -11.590 -24.308 1.00 15.65 ? 854  TYR A CE1 1 
ATOM   1882 C  CE2 . TYR A 1 268 ? -29.162 -11.339 -24.513 1.00 16.86 ? 854  TYR A CE2 1 
ATOM   1883 C  CZ  . TYR A 1 268 ? -27.906 -11.418 -25.101 1.00 16.77 ? 854  TYR A CZ  1 
ATOM   1884 O  OH  . TYR A 1 268 ? -27.786 -11.325 -26.474 1.00 18.66 ? 854  TYR A OH  1 
ATOM   1885 N  N   . GLN A 1 269 ? -28.971 -8.782  -19.689 1.00 14.73 ? 855  GLN A N   1 
ATOM   1886 C  CA  . GLN A 1 269 ? -29.424 -7.413  -19.896 1.00 15.14 ? 855  GLN A CA  1 
ATOM   1887 C  C   . GLN A 1 269 ? -28.305 -6.411  -19.592 1.00 15.31 ? 855  GLN A C   1 
ATOM   1888 O  O   . GLN A 1 269 ? -28.162 -5.411  -20.305 1.00 15.60 ? 855  GLN A O   1 
ATOM   1889 C  CB  . GLN A 1 269 ? -30.656 -7.095  -19.054 1.00 15.91 ? 855  GLN A CB  1 
ATOM   1890 C  CG  . GLN A 1 269 ? -31.187 -5.696  -19.317 1.00 18.37 ? 855  GLN A CG  1 
ATOM   1891 C  CD  . GLN A 1 269 ? -31.727 -5.530  -20.724 1.00 20.67 ? 855  GLN A CD  1 
ATOM   1892 O  OE1 . GLN A 1 269 ? -32.531 -6.335  -21.180 1.00 22.16 ? 855  GLN A OE1 1 
ATOM   1893 N  NE2 . GLN A 1 269 ? -31.305 -4.470  -21.407 1.00 20.55 ? 855  GLN A NE2 1 
ATOM   1894 N  N   . LEU A 1 270 ? -27.507 -6.676  -18.554 1.00 13.78 ? 856  LEU A N   1 
ATOM   1895 C  CA  . LEU A 1 270 ? -26.374 -5.804  -18.260 1.00 13.99 ? 856  LEU A CA  1 
ATOM   1896 C  C   . LEU A 1 270 ? -25.389 -5.762  -19.447 1.00 12.77 ? 856  LEU A C   1 
ATOM   1897 O  O   . LEU A 1 270 ? -24.885 -4.688  -19.808 1.00 14.36 ? 856  LEU A O   1 
ATOM   1898 C  CB  . LEU A 1 270 ? -25.678 -6.247  -16.971 1.00 14.88 ? 856  LEU A CB  1 
ATOM   1899 C  CG  . LEU A 1 270 ? -24.479 -5.416  -16.512 1.00 15.02 ? 856  LEU A CG  1 
ATOM   1900 C  CD1 . LEU A 1 270 ? -24.851 -3.942  -16.332 1.00 17.36 ? 856  LEU A CD1 1 
ATOM   1901 C  CD2 . LEU A 1 270 ? -23.902 -5.972  -15.224 1.00 15.93 ? 856  LEU A CD2 1 
ATOM   1902 N  N   . MET A 1 271 ? -25.138 -6.912  -20.068 1.00 12.79 ? 857  MET A N   1 
ATOM   1903 C  CA  . MET A 1 271 ? -24.314 -6.943  -21.276 1.00 12.82 ? 857  MET A CA  1 
ATOM   1904 C  C   . MET A 1 271 ? -24.896 -6.039  -22.352 1.00 13.14 ? 857  MET A C   1 
ATOM   1905 O  O   . MET A 1 271 ? -24.191 -5.197  -22.926 1.00 13.47 ? 857  MET A O   1 
ATOM   1906 C  CB  . MET A 1 271 ? -24.199 -8.366  -21.825 1.00 13.74 ? 857  MET A CB  1 
ATOM   1907 C  CG  . MET A 1 271 ? -23.510 -9.318  -20.877 1.00 14.29 ? 857  MET A CG  1 
ATOM   1908 S  SD  . MET A 1 271 ? -23.525 -11.005 -21.509 1.00 14.83 ? 857  MET A SD  1 
ATOM   1909 C  CE  . MET A 1 271 ? -23.398 -11.957 -19.996 1.00 16.17 ? 857  MET A CE  1 
ATOM   1910 N  N   . LEU A 1 272 ? -26.184 -6.221  -22.633 1.00 13.15 ? 858  LEU A N   1 
ATOM   1911 C  CA  . LEU A 1 272 ? -26.835 -5.422  -23.666 1.00 12.59 ? 858  LEU A CA  1 
ATOM   1912 C  C   . LEU A 1 272 ? -26.756 -3.926  -23.350 1.00 13.84 ? 858  LEU A C   1 
ATOM   1913 O  O   . LEU A 1 272 ? -26.605 -3.100  -24.250 1.00 15.73 ? 858  LEU A O   1 
ATOM   1914 C  CB  . LEU A 1 272 ? -28.294 -5.847  -23.828 1.00 13.66 ? 858  LEU A CB  1 
ATOM   1915 C  CG  . LEU A 1 272 ? -28.516 -7.273  -24.322 1.00 15.28 ? 858  LEU A CG  1 
ATOM   1916 C  CD1 . LEU A 1 272 ? -29.990 -7.545  -24.482 1.00 17.36 ? 858  LEU A CD1 1 
ATOM   1917 C  CD2 . LEU A 1 272 ? -27.781 -7.554  -25.630 1.00 17.60 ? 858  LEU A CD2 1 
ATOM   1918 N  N   . ASP A 1 273 ? -26.873 -3.577  -22.072 1.00 15.01 ? 859  ASP A N   1 
ATOM   1919 C  CA  . ASP A 1 273 ? -26.762 -2.184  -21.657 1.00 16.59 ? 859  ASP A CA  1 
ATOM   1920 C  C   . ASP A 1 273 ? -25.353 -1.637  -21.910 1.00 15.82 ? 859  ASP A C   1 
ATOM   1921 O  O   . ASP A 1 273 ? -25.188 -0.495  -22.343 1.00 16.05 ? 859  ASP A O   1 
ATOM   1922 C  CB  . ASP A 1 273 ? -27.121 -2.043  -20.176 1.00 18.55 ? 859  ASP A CB  1 
ATOM   1923 C  CG  . ASP A 1 273 ? -28.585 -2.343  -19.892 1.00 23.30 ? 859  ASP A CG  1 
ATOM   1924 O  OD1 . ASP A 1 273 ? -29.391 -2.359  -20.844 1.00 24.96 ? 859  ASP A OD1 1 
ATOM   1925 O  OD2 . ASP A 1 273 ? -28.925 -2.561  -18.709 1.00 26.91 ? 859  ASP A OD2 1 
ATOM   1926 N  N   . CYS A 1 274 ? -24.340 -2.444  -21.602 1.00 14.74 ? 860  CYS A N   1 
ATOM   1927 C  CA  . CYS A 1 274 ? -22.952 -2.070  -21.872 1.00 14.58 ? 860  CYS A CA  1 
ATOM   1928 C  C   . CYS A 1 274 ? -22.691 -1.930  -23.365 1.00 14.62 ? 860  CYS A C   1 
ATOM   1929 O  O   . CYS A 1 274 ? -21.778 -1.212  -23.780 1.00 15.24 ? 860  CYS A O   1 
ATOM   1930 C  CB  . CYS A 1 274 ? -21.993 -3.101  -21.287 1.00 13.62 ? 860  CYS A CB  1 
ATOM   1931 S  SG  . CYS A 1 274 ? -21.942 -3.084  -19.480 1.00 15.17 ? 860  CYS A SG  1 
ATOM   1932 N  N   . TRP A 1 275 ? -23.500 -2.614  -24.174 1.00 13.92 ? 861  TRP A N   1 
ATOM   1933 C  CA  . TRP A 1 275 ? -23.314 -2.616  -25.618 1.00 13.98 ? 861  TRP A CA  1 
ATOM   1934 C  C   . TRP A 1 275 ? -24.278 -1.686  -26.344 1.00 14.29 ? 861  TRP A C   1 
ATOM   1935 O  O   . TRP A 1 275 ? -24.517 -1.859  -27.540 1.00 16.32 ? 861  TRP A O   1 
ATOM   1936 C  CB  . TRP A 1 275 ? -23.471 -4.034  -26.174 1.00 13.81 ? 861  TRP A CB  1 
ATOM   1937 C  CG  . TRP A 1 275 ? -22.492 -5.032  -25.630 1.00 13.53 ? 861  TRP A CG  1 
ATOM   1938 C  CD1 . TRP A 1 275 ? -21.230 -4.789  -25.163 1.00 14.29 ? 861  TRP A CD1 1 
ATOM   1939 C  CD2 . TRP A 1 275 ? -22.707 -6.440  -25.492 1.00 13.05 ? 861  TRP A CD2 1 
ATOM   1940 N  NE1 . TRP A 1 275 ? -20.649 -5.967  -24.734 1.00 13.48 ? 861  TRP A NE1 1 
ATOM   1941 C  CE2 . TRP A 1 275 ? -21.536 -6.994  -24.935 1.00 12.84 ? 861  TRP A CE2 1 
ATOM   1942 C  CE3 . TRP A 1 275 ? -23.782 -7.288  -25.791 1.00 13.31 ? 861  TRP A CE3 1 
ATOM   1943 C  CZ2 . TRP A 1 275 ? -21.416 -8.358  -24.650 1.00 13.75 ? 861  TRP A CZ2 1 
ATOM   1944 C  CZ3 . TRP A 1 275 ? -23.660 -8.642  -25.527 1.00 13.62 ? 861  TRP A CZ3 1 
ATOM   1945 C  CH2 . TRP A 1 275 ? -22.485 -9.161  -24.958 1.00 13.04 ? 861  TRP A CH2 1 
ATOM   1946 N  N   . GLN A 1 276 ? -24.825 -0.685  -25.659 1.00 14.89 ? 862  GLN A N   1 
ATOM   1947 C  CA  . GLN A 1 276 ? -25.686 0.263   -26.370 1.00 16.69 ? 862  GLN A CA  1 
ATOM   1948 C  C   . GLN A 1 276 ? -24.896 0.971   -27.470 1.00 15.75 ? 862  GLN A C   1 
ATOM   1949 O  O   . GLN A 1 276 ? -23.742 1.356   -27.270 1.00 16.30 ? 862  GLN A O   1 
ATOM   1950 C  CB  . GLN A 1 276 ? -26.285 1.300   -25.413 1.00 18.28 ? 862  GLN A CB  1 
ATOM   1951 C  CG  . GLN A 1 276 ? -27.332 0.734   -24.472 1.00 22.12 ? 862  GLN A CG  1 
ATOM   1952 C  CD  . GLN A 1 276 ? -28.511 0.156   -25.210 1.00 26.12 ? 862  GLN A CD  1 
ATOM   1953 O  OE1 . GLN A 1 276 ? -29.261 0.884   -25.860 1.00 28.87 ? 862  GLN A OE1 1 
ATOM   1954 N  NE2 . GLN A 1 276 ? -28.671 -1.162  -25.134 1.00 27.78 ? 862  GLN A NE2 1 
ATOM   1955 N  N   . LYS A 1 277 ? -25.519 1.125   -28.632 1.00 19.77 ? 863  LYS A N   1 
ATOM   1956 C  CA  . LYS A 1 277 ? -24.877 1.795   -29.750 1.00 21.62 ? 863  LYS A CA  1 
ATOM   1957 C  C   . LYS A 1 277 ? -24.474 3.225   -29.370 1.00 20.42 ? 863  LYS A C   1 
ATOM   1958 O  O   . LYS A 1 277 ? -23.358 3.665   -29.643 1.00 20.98 ? 863  LYS A O   1 
ATOM   1959 C  CB  . LYS A 1 277 ? -25.811 1.805   -30.963 1.00 24.05 ? 863  LYS A CB  1 
ATOM   1960 C  CG  . LYS A 1 277 ? -25.246 2.535   -32.155 1.00 27.24 ? 863  LYS A CG  1 
ATOM   1961 C  CD  . LYS A 1 277 ? -26.316 2.736   -33.217 1.00 32.77 ? 863  LYS A CD  1 
ATOM   1962 C  CE  . LYS A 1 277 ? -26.215 1.715   -34.320 1.00 36.99 ? 863  LYS A CE  1 
ATOM   1963 N  NZ  . LYS A 1 277 ? -27.148 2.066   -35.426 1.00 38.06 ? 863  LYS A NZ  1 
ATOM   1964 N  N   . ASP A 1 278 ? -25.393 3.938   -28.728 1.00 21.61 ? 864  ASP A N   1 
ATOM   1965 C  CA  . ASP A 1 278 ? -25.126 5.281   -28.217 1.00 22.63 ? 864  ASP A CA  1 
ATOM   1966 C  C   . ASP A 1 278 ? -24.361 5.195   -26.900 1.00 21.38 ? 864  ASP A C   1 
ATOM   1967 O  O   . ASP A 1 278 ? -24.909 4.761   -25.889 1.00 21.65 ? 864  ASP A O   1 
ATOM   1968 C  CB  . ASP A 1 278 ? -26.442 6.040   -28.029 1.00 25.78 ? 864  ASP A CB  1 
ATOM   1969 C  CG  . ASP A 1 278 ? -26.246 7.482   -27.563 1.00 29.30 ? 864  ASP A CG  1 
ATOM   1970 O  OD1 . ASP A 1 278 ? -25.140 7.855   -27.127 1.00 29.97 ? 864  ASP A OD1 1 
ATOM   1971 O  OD2 . ASP A 1 278 ? -27.222 8.257   -27.636 1.00 32.95 ? 864  ASP A OD2 1 
ATOM   1972 N  N   . ARG A 1 279 ? -23.104 5.626   -26.906 1.00 20.93 ? 865  ARG A N   1 
ATOM   1973 C  CA  . ARG A 1 279 ? -22.265 5.471   -25.726 1.00 20.54 ? 865  ARG A CA  1 
ATOM   1974 C  C   . ARG A 1 279 ? -22.809 6.231   -24.517 1.00 19.86 ? 865  ARG A C   1 
ATOM   1975 O  O   . ARG A 1 279 ? -22.568 5.818   -23.391 1.00 20.50 ? 865  ARG A O   1 
ATOM   1976 C  CB  . ARG A 1 279 ? -20.823 5.903   -26.019 1.00 21.00 ? 865  ARG A CB  1 
ATOM   1977 C  CG  . ARG A 1 279 ? -20.625 7.384   -26.260 1.00 22.19 ? 865  ARG A CG  1 
ATOM   1978 C  CD  . ARG A 1 279 ? -19.146 7.690   -26.438 1.00 23.52 ? 865  ARG A CD  1 
ATOM   1979 N  NE  . ARG A 1 279 ? -18.900 9.012   -27.012 1.00 25.02 ? 865  ARG A NE  1 
ATOM   1980 C  CZ  . ARG A 1 279 ? -19.041 9.294   -28.307 1.00 24.69 ? 865  ARG A CZ  1 
ATOM   1981 N  NH1 . ARG A 1 279 ? -19.427 8.347   -29.149 1.00 24.72 ? 865  ARG A NH1 1 
ATOM   1982 N  NH2 . ARG A 1 279 ? -18.793 10.514  -28.767 1.00 28.06 ? 865  ARG A NH2 1 
ATOM   1983 N  N   . ASN A 1 280 ? -23.561 7.309   -24.740 1.00 21.19 ? 866  ASN A N   1 
ATOM   1984 C  CA  . ASN A 1 280 ? -24.172 8.042   -23.634 1.00 22.38 ? 866  ASN A CA  1 
ATOM   1985 C  C   . ASN A 1 280 ? -25.260 7.247   -22.911 1.00 23.99 ? 866  ASN A C   1 
ATOM   1986 O  O   . ASN A 1 280 ? -25.656 7.597   -21.792 1.00 26.78 ? 866  ASN A O   1 
ATOM   1987 C  CB  . ASN A 1 280 ? -24.743 9.372   -24.133 1.00 25.91 ? 866  ASN A CB  1 
ATOM   1988 C  CG  . ASN A 1 280 ? -23.658 10.364  -24.496 1.00 31.23 ? 866  ASN A CG  1 
ATOM   1989 O  OD1 . ASN A 1 280 ? -22.582 10.372  -23.892 1.00 32.58 ? 866  ASN A OD1 1 
ATOM   1990 N  ND2 . ASN A 1 280 ? -23.931 11.207  -25.485 1.00 34.30 ? 866  ASN A ND2 1 
ATOM   1991 N  N   . ASN A 1 281 ? -25.733 6.170   -23.537 1.00 22.79 ? 867  ASN A N   1 
ATOM   1992 C  CA  . ASN A 1 281 ? -26.761 5.330   -22.919 1.00 22.96 ? 867  ASN A CA  1 
ATOM   1993 C  C   . ASN A 1 281 ? -26.206 4.145   -22.136 1.00 21.54 ? 867  ASN A C   1 
ATOM   1994 O  O   . ASN A 1 281 ? -26.958 3.411   -21.497 1.00 25.17 ? 867  ASN A O   1 
ATOM   1995 C  CB  . ASN A 1 281 ? -27.741 4.824   -23.978 1.00 26.00 ? 867  ASN A CB  1 
ATOM   1996 C  CG  . ASN A 1 281 ? -28.608 5.922   -24.524 1.00 30.64 ? 867  ASN A CG  1 
ATOM   1997 O  OD1 . ASN A 1 281 ? -28.854 6.916   -23.847 1.00 31.64 ? 867  ASN A OD1 1 
ATOM   1998 N  ND2 . ASN A 1 281 ? -29.081 5.752   -25.750 1.00 31.29 ? 867  ASN A ND2 1 
ATOM   1999 N  N   . ARG A 1 282 ? -24.895 3.954   -22.191 1.00 17.91 ? 868  ARG A N   1 
ATOM   2000 C  CA  . ARG A 1 282 ? -24.263 2.885   -21.429 1.00 17.07 ? 868  ARG A CA  1 
ATOM   2001 C  C   . ARG A 1 282 ? -24.185 3.305   -19.975 1.00 16.49 ? 868  ARG A C   1 
ATOM   2002 O  O   . ARG A 1 282 ? -24.021 4.486   -19.692 1.00 18.37 ? 868  ARG A O   1 
ATOM   2003 C  CB  . ARG A 1 282 ? -22.865 2.583   -21.976 1.00 16.08 ? 868  ARG A CB  1 
ATOM   2004 C  CG  . ARG A 1 282 ? -22.890 2.083   -23.414 1.00 15.15 ? 868  ARG A CG  1 
ATOM   2005 C  CD  . ARG A 1 282 ? -21.500 1.951   -24.016 1.00 15.03 ? 868  ARG A CD  1 
ATOM   2006 N  NE  . ARG A 1 282 ? -21.617 1.926   -25.467 1.00 14.19 ? 868  ARG A NE  1 
ATOM   2007 C  CZ  . ARG A 1 282 ? -20.668 2.308   -26.322 1.00 14.54 ? 868  ARG A CZ  1 
ATOM   2008 N  NH1 . ARG A 1 282 ? -19.475 2.697   -25.881 1.00 14.99 ? 868  ARG A NH1 1 
ATOM   2009 N  NH2 . ARG A 1 282 ? -20.922 2.302   -27.631 1.00 15.60 ? 868  ARG A NH2 1 
ATOM   2010 N  N   . PRO A 1 283 ? -24.286 2.344   -19.045 1.00 16.59 ? 869  PRO A N   1 
ATOM   2011 C  CA  . PRO A 1 283 ? -24.139 2.682   -17.625 1.00 16.62 ? 869  PRO A CA  1 
ATOM   2012 C  C   . PRO A 1 283 ? -22.715 3.139   -17.324 1.00 16.54 ? 869  PRO A C   1 
ATOM   2013 O  O   . PRO A 1 283 ? -21.795 2.781   -18.063 1.00 16.84 ? 869  PRO A O   1 
ATOM   2014 C  CB  . PRO A 1 283 ? -24.463 1.366   -16.908 1.00 17.57 ? 869  PRO A CB  1 
ATOM   2015 C  CG  . PRO A 1 283 ? -24.173 0.304   -17.919 1.00 18.38 ? 869  PRO A CG  1 
ATOM   2016 C  CD  . PRO A 1 283 ? -24.474 0.900   -19.264 1.00 17.66 ? 869  PRO A CD  1 
ATOM   2017 N  N   . LYS A 1 284 ? -22.543 3.938   -16.275 1.00 17.05 ? 870  LYS A N   1 
ATOM   2018 C  CA  . LYS A 1 284 ? -21.211 4.262   -15.784 1.00 16.25 ? 870  LYS A CA  1 
ATOM   2019 C  C   . LYS A 1 284 ? -20.734 3.112   -14.915 1.00 16.58 ? 870  LYS A C   1 
ATOM   2020 O  O   . LYS A 1 284 ? -21.542 2.326   -14.425 1.00 15.91 ? 870  LYS A O   1 
ATOM   2021 C  CB  . LYS A 1 284 ? -21.209 5.564   -14.973 1.00 19.71 ? 870  LYS A CB  1 
ATOM   2022 C  CG  . LYS A 1 284 ? -21.799 6.758   -15.704 1.00 21.49 ? 870  LYS A CG  1 
ATOM   2023 C  CD  . LYS A 1 284 ? -21.078 7.015   -17.006 1.00 25.43 ? 870  LYS A CD  1 
ATOM   2024 C  CE  . LYS A 1 284 ? -21.495 8.350   -17.614 1.00 28.93 ? 870  LYS A CE  1 
ATOM   2025 N  NZ  . LYS A 1 284 ? -20.867 8.581   -18.949 1.00 31.00 ? 870  LYS A NZ  1 
ATOM   2026 N  N   . PHE A 1 285 ? -19.430 3.022   -14.690 1.00 15.12 ? 871  PHE A N   1 
ATOM   2027 C  CA  . PHE A 1 285 ? -18.931 1.928   -13.869 1.00 15.59 ? 871  PHE A CA  1 
ATOM   2028 C  C   . PHE A 1 285 ? -19.515 1.948   -12.461 1.00 14.95 ? 871  PHE A C   1 
ATOM   2029 O  O   . PHE A 1 285 ? -19.758 0.887   -11.897 1.00 15.49 ? 871  PHE A O   1 
ATOM   2030 C  CB  . PHE A 1 285 ? -17.400 1.929   -13.825 1.00 15.39 ? 871  PHE A CB  1 
ATOM   2031 C  CG  . PHE A 1 285 ? -16.781 1.273   -15.027 1.00 14.72 ? 871  PHE A CG  1 
ATOM   2032 C  CD1 . PHE A 1 285 ? -16.975 -0.082  -15.262 1.00 14.22 ? 871  PHE A CD1 1 
ATOM   2033 C  CD2 . PHE A 1 285 ? -16.027 2.006   -15.928 1.00 13.81 ? 871  PHE A CD2 1 
ATOM   2034 C  CE1 . PHE A 1 285 ? -16.425 -0.683  -16.382 1.00 14.90 ? 871  PHE A CE1 1 
ATOM   2035 C  CE2 . PHE A 1 285 ? -15.478 1.409   -17.047 1.00 13.97 ? 871  PHE A CE2 1 
ATOM   2036 C  CZ  . PHE A 1 285 ? -15.672 0.062   -17.269 1.00 14.97 ? 871  PHE A CZ  1 
ATOM   2037 N  N   . GLU A 1 286 ? -19.760 3.126   -11.891 1.00 18.10 ? 872  GLU A N   1 
ATOM   2038 C  CA  . GLU A 1 286 ? -20.377 3.170   -10.564 1.00 18.29 ? 872  GLU A CA  1 
ATOM   2039 C  C   . GLU A 1 286 ? -21.744 2.486   -10.559 1.00 17.83 ? 872  GLU A C   1 
ATOM   2040 O  O   . GLU A 1 286 ? -22.107 1.787   -9.608  1.00 18.88 ? 872  GLU A O   1 
ATOM   2041 C  CB  . GLU A 1 286 ? -20.520 4.607   -10.073 1.00 22.50 ? 872  GLU A CB  1 
ATOM   2042 C  CG  . GLU A 1 286 ? -21.225 4.706   -8.726  1.00 28.38 ? 872  GLU A CG  1 
ATOM   2043 C  CD  . GLU A 1 286 ? -21.172 6.091   -8.123  1.00 34.75 ? 872  GLU A CD  1 
ATOM   2044 O  OE1 . GLU A 1 286 ? -20.789 7.032   -8.847  1.00 37.05 ? 872  GLU A OE1 1 
ATOM   2045 O  OE2 . GLU A 1 286 ? -21.524 6.231   -6.931  1.00 38.13 ? 872  GLU A OE2 1 
ATOM   2046 N  N   . GLN A 1 287 ? -22.488 2.665   -11.645 1.00 17.50 ? 873  GLN A N   1 
ATOM   2047 C  CA  . GLN A 1 287 ? -23.802 2.042   -11.772 1.00 17.29 ? 873  GLN A CA  1 
ATOM   2048 C  C   . GLN A 1 287 ? -23.677 0.534   -11.944 1.00 16.69 ? 873  GLN A C   1 
ATOM   2049 O  O   . GLN A 1 287 ? -24.485 -0.223  -11.397 1.00 18.12 ? 873  GLN A O   1 
ATOM   2050 C  CB  . GLN A 1 287 ? -24.583 2.658   -12.940 1.00 19.92 ? 873  GLN A CB  1 
ATOM   2051 C  CG  . GLN A 1 287 ? -24.867 4.144   -12.745 1.00 23.91 ? 873  GLN A CG  1 
ATOM   2052 C  CD  . GLN A 1 287 ? -25.510 4.803   -13.953 1.00 26.55 ? 873  GLN A CD  1 
ATOM   2053 O  OE1 . GLN A 1 287 ? -24.961 4.785   -15.055 1.00 25.45 ? 873  GLN A OE1 1 
ATOM   2054 N  NE2 . GLN A 1 287 ? -26.676 5.407   -13.744 1.00 30.02 ? 873  GLN A NE2 1 
ATOM   2055 N  N   . ILE A 1 288 ? -22.661 0.098   -12.686 1.00 15.63 ? 874  ILE A N   1 
ATOM   2056 C  CA  . ILE A 1 288 ? -22.411 -1.333  -12.855 1.00 15.37 ? 874  ILE A CA  1 
ATOM   2057 C  C   . ILE A 1 288 ? -22.093 -1.972  -11.504 1.00 15.00 ? 874  ILE A C   1 
ATOM   2058 O  O   . ILE A 1 288 ? -22.624 -3.037  -11.178 1.00 15.58 ? 874  ILE A O   1 
ATOM   2059 C  CB  . ILE A 1 288 ? -21.266 -1.594  -13.855 1.00 13.81 ? 874  ILE A CB  1 
ATOM   2060 C  CG1 . ILE A 1 288 ? -21.669 -1.091  -15.246 1.00 14.74 ? 874  ILE A CG1 1 
ATOM   2061 C  CG2 . ILE A 1 288 ? -20.933 -3.075  -13.919 1.00 14.83 ? 874  ILE A CG2 1 
ATOM   2062 C  CD1 . ILE A 1 288 ? -20.571 -1.154  -16.266 1.00 15.84 ? 874  ILE A CD1 1 
ATOM   2063 N  N   . VAL A 1 289 ? -21.243 -1.324  -10.711 1.00 14.62 ? 875  VAL A N   1 
ATOM   2064 C  CA  . VAL A 1 289 ? -20.920 -1.854  -9.397  1.00 15.98 ? 875  VAL A CA  1 
ATOM   2065 C  C   . VAL A 1 289 ? -22.187 -1.971  -8.555  1.00 17.37 ? 875  VAL A C   1 
ATOM   2066 O  O   . VAL A 1 289 ? -22.407 -2.987  -7.893  1.00 18.00 ? 875  VAL A O   1 
ATOM   2067 C  CB  . VAL A 1 289 ? -19.884 -0.982  -8.664  1.00 15.85 ? 875  VAL A CB  1 
ATOM   2068 C  CG1 . VAL A 1 289 ? -19.679 -1.483  -7.225  1.00 17.97 ? 875  VAL A CG1 1 
ATOM   2069 C  CG2 . VAL A 1 289 ? -18.571 -0.994  -9.417  1.00 16.55 ? 875  VAL A CG2 1 
ATOM   2070 N  N   . SER A 1 290 ? -23.028 -0.941  -8.604  1.00 18.55 ? 876  SER A N   1 
ATOM   2071 C  CA  . SER A 1 290 ? -24.273 -0.947  -7.844  1.00 20.13 ? 876  SER A CA  1 
ATOM   2072 C  C   . SER A 1 290 ? -25.212 -2.070  -8.289  1.00 19.14 ? 876  SER A C   1 
ATOM   2073 O  O   . SER A 1 290 ? -25.827 -2.737  -7.459  1.00 19.08 ? 876  SER A O   1 
ATOM   2074 C  CB  . SER A 1 290 ? -24.973 0.406   -7.963  1.00 22.94 ? 876  SER A CB  1 
ATOM   2075 O  OG  . SER A 1 290 ? -26.274 0.356   -7.408  1.00 28.47 ? 876  SER A OG  1 
ATOM   2076 N  N   . ILE A 1 291 ? -25.314 -2.286  -9.597  1.00 17.22 ? 877  ILE A N   1 
ATOM   2077 C  CA  . ILE A 1 291 ? -26.132 -3.373  -10.119 1.00 17.09 ? 877  ILE A CA  1 
ATOM   2078 C  C   . ILE A 1 291 ? -25.658 -4.729  -9.600  1.00 16.89 ? 877  ILE A C   1 
ATOM   2079 O  O   . ILE A 1 291 ? -26.465 -5.553  -9.161  1.00 17.85 ? 877  ILE A O   1 
ATOM   2080 C  CB  . ILE A 1 291 ? -26.121 -3.372  -11.664 1.00 17.55 ? 877  ILE A CB  1 
ATOM   2081 C  CG1 . ILE A 1 291 ? -26.925 -2.181  -12.200 1.00 20.69 ? 877  ILE A CG1 1 
ATOM   2082 C  CG2 . ILE A 1 291 ? -26.664 -4.683  -12.216 1.00 18.01 ? 877  ILE A CG2 1 
ATOM   2083 C  CD1 . ILE A 1 291 ? -26.571 -1.784  -13.617 1.00 21.45 ? 877  ILE A CD1 1 
ATOM   2084 N  N   . LEU A 1 292 ? -24.348 -4.957  -9.644  1.00 15.04 ? 878  LEU A N   1 
ATOM   2085 C  CA  . LEU A 1 292 ? -23.796 -6.235  -9.207  1.00 14.90 ? 878  LEU A CA  1 
ATOM   2086 C  C   . LEU A 1 292 ? -23.927 -6.417  -7.700  1.00 17.16 ? 878  LEU A C   1 
ATOM   2087 O  O   . LEU A 1 292 ? -24.153 -7.529  -7.230  1.00 17.54 ? 878  LEU A O   1 
ATOM   2088 C  CB  . LEU A 1 292 ? -22.334 -6.354  -9.634  1.00 15.08 ? 878  LEU A CB  1 
ATOM   2089 C  CG  . LEU A 1 292 ? -22.211 -6.359  -11.163 1.00 14.39 ? 878  LEU A CG  1 
ATOM   2090 C  CD1 . LEU A 1 292 ? -20.758 -6.241  -11.566 1.00 14.70 ? 878  LEU A CD1 1 
ATOM   2091 C  CD2 . LEU A 1 292 ? -22.841 -7.620  -11.757 1.00 16.51 ? 878  LEU A CD2 1 
ATOM   2092 N  N   . ASP A 1 293 ? -23.798 -5.332  -6.944  1.00 17.94 ? 879  ASP A N   1 
ATOM   2093 C  CA  . ASP A 1 293 ? -23.954 -5.422  -5.497  1.00 19.56 ? 879  ASP A CA  1 
ATOM   2094 C  C   . ASP A 1 293 ? -25.370 -5.854  -5.142  1.00 19.23 ? 879  ASP A C   1 
ATOM   2095 O  O   . ASP A 1 293 ? -25.574 -6.601  -4.191  1.00 22.42 ? 879  ASP A O   1 
ATOM   2096 C  CB  . ASP A 1 293 ? -23.612 -4.088  -4.840  1.00 21.92 ? 879  ASP A CB  1 
ATOM   2097 C  CG  . ASP A 1 293 ? -22.122 -3.901  -4.652  1.00 25.86 ? 879  ASP A CG  1 
ATOM   2098 O  OD1 . ASP A 1 293 ? -21.374 -4.898  -4.775  1.00 27.52 ? 879  ASP A OD1 1 
ATOM   2099 O  OD2 . ASP A 1 293 ? -21.705 -2.761  -4.370  1.00 27.88 ? 879  ASP A OD2 1 
ATOM   2100 N  N   . LYS A 1 294 ? -26.358 -5.392  -5.875  1.00 18.37 ? 880  LYS A N   1 
ATOM   2101 C  CA  . LYS A 1 294 ? -27.722 -5.858  -5.710  1.00 18.88 ? 880  LYS A CA  1 
ATOM   2102 C  C   . LYS A 1 294 ? -27.891 -7.315  -6.032  1.00 20.72 ? 880  LYS A C   1 
ATOM   2103 O  O   . LYS A 1 294 ? -28.576 -7.991  -5.373  1.00 22.36 ? 880  LYS A O   1 
ATOM   2104 C  CB  . LYS A 1 294 ? -28.703 -5.055  -6.561  1.00 21.42 ? 880  LYS A CB  1 
ATOM   2105 C  CG  . LYS A 1 294 ? -28.989 -3.682  -6.043  1.00 27.98 ? 880  LYS A CG  1 
ATOM   2106 C  CD  . LYS A 1 294 ? -30.008 -2.972  -6.884  1.00 34.07 ? 880  LYS A CD  1 
ATOM   2107 C  CE  . LYS A 1 294 ? -29.814 -1.515  -6.600  1.00 37.17 ? 880  LYS A CE  1 
ATOM   2108 N  NZ  . LYS A 1 294 ? -30.957 -0.720  -7.049  1.00 39.50 ? 880  LYS A NZ  1 
ATOM   2109 N  N   . LEU A 1 295 ? -27.240 -7.762  -7.083  1.00 20.29 ? 881  LEU A N   1 
ATOM   2110 C  CA  . LEU A 1 295 ? -27.338 -9.165  -7.463  1.00 20.61 ? 881  LEU A CA  1 
ATOM   2111 C  C   . LEU A 1 295 ? -26.652 -10.077 -6.445  1.00 22.52 ? 881  LEU A C   1 
ATOM   2112 O  O   . LEU A 1 295 ? -27.076 -11.209 -6.246  1.00 23.49 ? 881  LEU A O   1 
ATOM   2113 C  CB  . LEU A 1 295 ? -26.756 -9.379  -8.865  1.00 20.77 ? 881  LEU A CB  1 
ATOM   2114 C  CG  . LEU A 1 295 ? -27.558 -8.697  -9.982  1.00 21.03 ? 881  LEU A CG  1 
ATOM   2115 C  CD1 . LEU A 1 295 ? -26.935 -8.927  -11.354 1.00 21.79 ? 881  LEU A CD1 1 
ATOM   2116 C  CD2 . LEU A 1 295 ? -29.004 -9.183  -9.956  1.00 21.45 ? 881  LEU A CD2 1 
ATOM   2117 N  N   . ILE A 1 296 ? -25.586 -9.603  -5.827  1.00 23.61 ? 882  ILE A N   1 
ATOM   2118 C  CA  . ILE A 1 296 ? -24.938 -10.333 -4.731  1.00 28.21 ? 882  ILE A CA  1 
ATOM   2119 C  C   . ILE A 1 296 ? -25.856 -10.463 -3.511  1.00 32.42 ? 882  ILE A C   1 
ATOM   2120 O  O   . ILE A 1 296 ? -25.842 -11.470 -2.838  1.00 33.92 ? 882  ILE A O   1 
ATOM   2121 C  CB  . ILE A 1 296 ? -23.595 -9.681  -4.366  1.00 29.68 ? 882  ILE A CB  1 
ATOM   2122 C  CG1 . ILE A 1 296 ? -22.613 -9.991  -5.454  1.00 29.92 ? 882  ILE A CG1 1 
ATOM   2123 C  CG2 . ILE A 1 296 ? -23.059 -10.190 -3.028  1.00 31.71 ? 882  ILE A CG2 1 
ATOM   2124 C  CD1 . ILE A 1 296 ? -21.286 -9.320  -5.340  1.00 31.21 ? 882  ILE A CD1 1 
ATOM   2125 N  N   . ARG A 1 297 ? -26.594 -9.430  -3.224  1.00 36.95 ? 883  ARG A N   1 
ATOM   2126 C  CA  . ARG A 1 297 ? -27.512 -9.300  -2.088  1.00 43.99 ? 883  ARG A CA  1 
ATOM   2127 C  C   . ARG A 1 297 ? -28.748 -10.087 -2.146  1.00 48.72 ? 883  ARG A C   1 
ATOM   2128 O  O   . ARG A 1 297 ? -29.291 -10.466 -1.143  1.00 49.88 ? 883  ARG A O   1 
ATOM   2129 C  CB  . ARG A 1 297 ? -27.848 -7.848  -1.811  1.00 46.51 ? 883  ARG A CB  1 
ATOM   2130 C  CG  . ARG A 1 297 ? -26.858 -7.186  -0.914  1.00 50.12 ? 883  ARG A CG  1 
ATOM   2131 C  CD  . ARG A 1 297 ? -27.372 -5.901  -0.331  1.00 53.10 ? 883  ARG A CD  1 
ATOM   2132 N  NE  . ARG A 1 297 ? -28.086 -5.151  -1.327  1.00 55.62 ? 883  ARG A NE  1 
ATOM   2133 C  CZ  . ARG A 1 297 ? -29.388 -4.962  -1.332  1.00 57.39 ? 883  ARG A CZ  1 
ATOM   2134 N  NH1 . ARG A 1 297 ? -30.147 -5.439  -0.351  1.00 57.80 ? 883  ARG A NH1 1 
ATOM   2135 N  NH2 . ARG A 1 297 ? -29.917 -4.259  -2.307  1.00 57.93 ? 883  ARG A NH2 1 
ATOM   2136 N  N   . ASN A 1 298 ? -29.252 -10.328 -3.328  1.00 51.83 ? 884  ASN A N   1 
ATOM   2137 C  CA  . ASN A 1 298 ? -30.430 -11.124 -3.473  1.00 54.46 ? 884  ASN A CA  1 
ATOM   2138 C  C   . ASN A 1 298 ? -30.211 -12.165 -4.557  1.00 52.70 ? 884  ASN A C   1 
ATOM   2139 O  O   . ASN A 1 298 ? -30.607 -11.966 -5.660  1.00 51.29 ? 884  ASN A O   1 
ATOM   2140 C  CB  . ASN A 1 298 ? -31.603 -10.238 -3.839  1.00 58.33 ? 884  ASN A CB  1 
ATOM   2141 C  CG  . ASN A 1 298 ? -32.819 -11.038 -4.200  1.00 61.45 ? 884  ASN A CG  1 
ATOM   2142 O  OD1 . ASN A 1 298 ? -33.047 -11.355 -5.343  1.00 62.57 ? 884  ASN A OD1 1 
ATOM   2143 N  ND2 . ASN A 1 298 ? -33.591 -11.369 -3.217  1.00 62.80 ? 884  ASN A ND2 1 
ATOM   2144 N  N   . PRO A 1 299 ? -29.584 -13.252 -4.214  1.00 52.28 ? 885  PRO A N   1 
ATOM   2145 C  CA  . PRO A 1 299 ? -29.180 -14.250 -5.180  1.00 53.00 ? 885  PRO A CA  1 
ATOM   2146 C  C   . PRO A 1 299 ? -30.353 -14.802 -5.863  1.00 53.49 ? 885  PRO A C   1 
ATOM   2147 O  O   . PRO A 1 299 ? -30.230 -15.319 -6.934  1.00 53.52 ? 885  PRO A O   1 
ATOM   2148 C  CB  . PRO A 1 299 ? -28.632 -15.341 -4.306  1.00 51.76 ? 885  PRO A CB  1 
ATOM   2149 C  CG  . PRO A 1 299 ? -28.025 -14.589 -3.226  1.00 52.16 ? 885  PRO A CG  1 
ATOM   2150 C  CD  . PRO A 1 299 ? -28.986 -13.521 -2.900  1.00 52.15 ? 885  PRO A CD  1 
ATOM   2151 N  N   . GLY A 1 300 ? -31.508 -14.701 -5.245  1.00 52.50 ? 886  GLY A N   1 
ATOM   2152 C  CA  . GLY A 1 300 ? -32.652 -15.259 -5.885  1.00 51.90 ? 886  GLY A CA  1 
ATOM   2153 C  C   . GLY A 1 300 ? -32.893 -14.582 -7.199  1.00 51.29 ? 886  GLY A C   1 
ATOM   2154 O  O   . GLY A 1 300 ? -33.304 -15.221 -8.143  1.00 52.61 ? 886  GLY A O   1 
ATOM   2155 N  N   . SER A 1 301 ? -32.575 -13.318 -7.266  1.00 47.32 ? 887  SER A N   1 
ATOM   2156 C  CA  . SER A 1 301 ? -32.955 -12.590 -8.467  1.00 49.07 ? 887  SER A CA  1 
ATOM   2157 C  C   . SER A 1 301 ? -32.409 -13.289 -9.686  1.00 47.78 ? 887  SER A C   1 
ATOM   2158 O  O   . SER A 1 301 ? -32.970 -13.218 -10.710 1.00 48.46 ? 887  SER A O   1 
ATOM   2159 C  CB  . SER A 1 301 ? -32.428 -11.174 -8.461  1.00 51.21 ? 887  SER A CB  1 
ATOM   2160 O  OG  . SER A 1 301 ? -31.041 -11.152 -8.376  1.00 53.02 ? 887  SER A OG  1 
ATOM   2161 N  N   . LEU A 1 302 ? -31.311 -13.988 -9.497  1.00 45.92 ? 888  LEU A N   1 
ATOM   2162 C  CA  . LEU A 1 302 ? -30.569 -14.616 -10.521 1.00 43.28 ? 888  LEU A CA  1 
ATOM   2163 C  C   . LEU A 1 302 ? -31.327 -15.786 -11.137 1.00 41.84 ? 888  LEU A C   1 
ATOM   2164 O  O   . LEU A 1 302 ? -30.819 -16.397 -11.992 1.00 42.58 ? 888  LEU A O   1 
ATOM   2165 C  CB  . LEU A 1 302 ? -29.192 -15.021 -10.014 1.00 42.59 ? 888  LEU A CB  1 
ATOM   2166 C  CG  . LEU A 1 302 ? -28.347 -13.785 -9.651  1.00 41.75 ? 888  LEU A CG  1 
ATOM   2167 C  CD1 . LEU A 1 302 ? -27.146 -14.136 -8.820  1.00 43.12 ? 888  LEU A CD1 1 
ATOM   2168 C  CD2 . LEU A 1 302 ? -27.921 -13.112 -10.945 1.00 40.64 ? 888  LEU A CD2 1 
ATOM   2169 N  N   . LYS A 1 303 ? -32.501 -16.097 -10.611 1.00 40.87 ? 889  LYS A N   1 
ATOM   2170 C  CA  . LYS A 1 303 ? -33.287 -17.280 -10.975 1.00 40.16 ? 889  LYS A CA  1 
ATOM   2171 C  C   . LYS A 1 303 ? -33.841 -17.261 -12.341 1.00 37.56 ? 889  LYS A C   1 
ATOM   2172 O  O   . LYS A 1 303 ? -34.086 -18.287 -12.908 1.00 37.48 ? 889  LYS A O   1 
ATOM   2173 C  CB  . LYS A 1 303 ? -34.433 -17.539 -9.975  1.00 40.36 ? 889  LYS A CB  1 
ATOM   2174 N  N   . ILE A 1 304 ? -34.188 -16.088 -12.800 1.00 34.34 ? 890  ILE A N   1 
ATOM   2175 C  CA  . ILE A 1 304 ? -34.714 -15.919 -14.150 1.00 32.06 ? 890  ILE A CA  1 
ATOM   2176 C  C   . ILE A 1 304 ? -33.561 -16.062 -15.135 1.00 30.88 ? 890  ILE A C   1 
ATOM   2177 O  O   . ILE A 1 304 ? -32.628 -15.255 -15.139 1.00 28.62 ? 890  ILE A O   1 
ATOM   2178 C  CB  . ILE A 1 304 ? -35.409 -14.549 -14.358 1.00 31.65 ? 890  ILE A CB  1 
ATOM   2179 C  CG1 . ILE A 1 304 ? -36.638 -14.408 -13.459 1.00 33.44 ? 890  ILE A CG1 1 
ATOM   2180 C  CG2 . ILE A 1 304 ? -35.825 -14.367 -15.811 1.00 31.80 ? 890  ILE A CG2 1 
ATOM   2181 C  CD1 . ILE A 1 304 ? -37.308 -13.060 -13.607 1.00 35.22 ? 890  ILE A CD1 1 
ATOM   2182 N  N   . ILE A 1 305 ? -33.624 -17.075 -15.972 1.00 31.77 ? 891  ILE A N   1 
ATOM   2183 C  CA  . ILE A 1 305 ? -32.584 -17.393 -16.930 1.00 36.17 ? 891  ILE A CA  1 
ATOM   2184 C  C   . ILE A 1 305 ? -33.029 -17.023 -18.320 1.00 38.63 ? 891  ILE A C   1 
ATOM   2185 O  O   . ILE A 1 305 ? -34.156 -17.197 -18.640 1.00 39.29 ? 891  ILE A O   1 
ATOM   2186 C  CB  . ILE A 1 305 ? -32.296 -18.891 -16.924 1.00 39.72 ? 891  ILE A CB  1 
ATOM   2187 C  CG1 . ILE A 1 305 ? -31.825 -19.334 -15.577 1.00 41.50 ? 891  ILE A CG1 1 
ATOM   2188 C  CG2 . ILE A 1 305 ? -31.312 -19.279 -18.015 1.00 39.78 ? 891  ILE A CG2 1 
ATOM   2189 C  CD1 . ILE A 1 305 ? -30.778 -18.438 -14.983 1.00 41.69 ? 891  ILE A CD1 1 
ATOM   2190 N  N   . THR A 1 306 ? -32.104 -16.593 -19.147 1.00 41.03 ? 892  THR A N   1 
ATOM   2191 C  CA  . THR A 1 306 ? -32.444 -16.198 -20.509 1.00 45.08 ? 892  THR A CA  1 
ATOM   2192 C  C   . THR A 1 306 ? -32.771 -17.345 -21.446 1.00 47.64 ? 892  THR A C   1 
ATOM   2193 O  O   . THR A 1 306 ? -31.917 -17.840 -22.173 1.00 48.82 ? 892  THR A O   1 
ATOM   2194 C  CB  . THR A 1 306 ? -31.326 -15.412 -21.146 1.00 46.11 ? 892  THR A CB  1 
ATOM   2195 O  OG1 . THR A 1 306 ? -30.091 -15.826 -20.601 1.00 47.49 ? 892  THR A OG1 1 
ATOM   2196 C  CG2 . THR A 1 306 ? -31.514 -14.044 -20.904 1.00 45.98 ? 892  THR A CG2 1 
ATOM   2197 N  N   . PRO A 1 312 ? -31.851 -18.935 -35.917 1.00 53.48 ? 898  PRO A N   1 
ATOM   2198 C  CA  . PRO A 1 312 ? -31.890 -17.649 -36.625 1.00 52.34 ? 898  PRO A CA  1 
ATOM   2199 C  C   . PRO A 1 312 ? -30.501 -17.251 -37.114 1.00 49.73 ? 898  PRO A C   1 
ATOM   2200 O  O   . PRO A 1 312 ? -30.199 -17.373 -38.304 1.00 50.56 ? 898  PRO A O   1 
ATOM   2201 C  CB  . PRO A 1 312 ? -32.397 -16.663 -35.556 1.00 53.14 ? 898  PRO A CB  1 
ATOM   2202 C  CG  . PRO A 1 312 ? -32.699 -17.504 -34.315 1.00 53.69 ? 898  PRO A CG  1 
ATOM   2203 C  CD  . PRO A 1 312 ? -31.904 -18.753 -34.457 1.00 53.62 ? 898  PRO A CD  1 
ATOM   2204 N  N   . SER A 1 313 ? -29.666 -16.778 -36.192 1.00 45.35 ? 899  SER A N   1 
ATOM   2205 C  CA  . SER A 1 313 ? -28.254 -16.513 -36.467 1.00 40.90 ? 899  SER A CA  1 
ATOM   2206 C  C   . SER A 1 313 ? -27.483 -16.645 -35.150 1.00 36.94 ? 899  SER A C   1 
ATOM   2207 O  O   . SER A 1 313 ? -28.086 -16.572 -34.079 1.00 37.80 ? 899  SER A O   1 
ATOM   2208 C  CB  . SER A 1 313 ? -28.056 -15.125 -37.088 1.00 39.92 ? 899  SER A CB  1 
ATOM   2209 O  OG  . SER A 1 313 ? -28.803 -14.129 -36.411 1.00 39.06 ? 899  SER A OG  1 
ATOM   2210 N  N   . ASN A 1 314 ? -26.170 -16.857 -35.224 1.00 32.11 ? 900  ASN A N   1 
ATOM   2211 C  CA  . ASN A 1 314 ? -25.335 -16.968 -34.018 1.00 28.45 ? 900  ASN A CA  1 
ATOM   2212 C  C   . ASN A 1 314 ? -25.411 -15.728 -33.150 1.00 23.38 ? 900  ASN A C   1 
ATOM   2213 O  O   . ASN A 1 314 ? -25.611 -15.809 -31.936 1.00 23.63 ? 900  ASN A O   1 
ATOM   2214 C  CB  . ASN A 1 314 ? -23.876 -17.209 -34.383 1.00 31.25 ? 900  ASN A CB  1 
ATOM   2215 C  CG  . ASN A 1 314 ? -23.677 -18.472 -35.168 1.00 34.47 ? 900  ASN A CG  1 
ATOM   2216 O  OD1 . ASN A 1 314 ? -24.459 -19.417 -35.052 1.00 35.11 ? 900  ASN A OD1 1 
ATOM   2217 N  ND2 . ASN A 1 314 ? -22.623 -18.503 -35.976 1.00 34.57 ? 900  ASN A ND2 1 
ATOM   2218 N  N   . LEU A 1 315 ? -25.216 -14.579 -33.786 1.00 20.09 ? 901  LEU A N   1 
ATOM   2219 C  CA  . LEU A 1 315 ? -25.407 -13.299 -33.127 1.00 20.30 ? 901  LEU A CA  1 
ATOM   2220 C  C   . LEU A 1 315 ? -26.882 -12.916 -33.175 1.00 22.31 ? 901  LEU A C   1 
ATOM   2221 O  O   . LEU A 1 315 ? -27.608 -13.328 -34.079 1.00 24.34 ? 901  LEU A O   1 
ATOM   2222 C  CB  . LEU A 1 315 ? -24.546 -12.221 -33.782 1.00 19.72 ? 901  LEU A CB  1 
ATOM   2223 C  CG  . LEU A 1 315 ? -23.041 -12.489 -33.838 1.00 18.42 ? 901  LEU A CG  1 
ATOM   2224 C  CD1 . LEU A 1 315 ? -22.327 -11.353 -34.557 1.00 18.97 ? 901  LEU A CD1 1 
ATOM   2225 C  CD2 . LEU A 1 315 ? -22.465 -12.666 -32.436 1.00 18.57 ? 901  LEU A CD2 1 
ATOM   2226 N  N   . LEU A 1 316 ? -27.328 -12.126 -32.212 1.00 22.35 ? 902  LEU A N   1 
ATOM   2227 C  CA  . LEU A 1 316 ? -28.722 -11.723 -32.119 1.00 25.06 ? 902  LEU A CA  1 
ATOM   2228 C  C   . LEU A 1 316 ? -28.905 -10.253 -32.429 1.00 27.08 ? 902  LEU A C   1 
ATOM   2229 O  O   . LEU A 1 316 ? -28.118 -9.456  -32.059 1.00 25.52 ? 902  LEU A O   1 
ATOM   2230 C  CB  . LEU A 1 316 ? -29.267 -11.959 -30.724 1.00 27.49 ? 902  LEU A CB  1 
ATOM   2231 C  CG  . LEU A 1 316 ? -29.252 -13.382 -30.236 1.00 31.20 ? 902  LEU A CG  1 
ATOM   2232 C  CD1 . LEU A 1 316 ? -30.030 -13.498 -28.941 1.00 30.75 ? 902  LEU A CD1 1 
ATOM   2233 C  CD2 . LEU A 1 316 ? -29.705 -14.347 -31.311 1.00 33.62 ? 902  LEU A CD2 1 
ATOM   2234 N  N   . LEU A 1 317 ? -29.942 -9.915  -33.144 1.00 31.93 ? 903  LEU A N   1 
ATOM   2235 C  CA  . LEU A 1 317 ? -30.052 -8.538  -33.557 1.00 38.33 ? 903  LEU A CA  1 
ATOM   2236 C  C   . LEU A 1 317 ? -30.690 -7.840  -32.388 1.00 44.50 ? 903  LEU A C   1 
ATOM   2237 O  O   . LEU A 1 317 ? -31.844 -8.000  -32.206 1.00 45.47 ? 903  LEU A O   1 
ATOM   2238 C  CB  . LEU A 1 317 ? -30.905 -8.421  -34.817 1.00 38.54 ? 903  LEU A CB  1 
ATOM   2239 C  CG  . LEU A 1 317 ? -31.010 -7.082  -35.513 1.00 38.56 ? 903  LEU A CG  1 
ATOM   2240 C  CD1 . LEU A 1 317 ? -29.698 -6.362  -35.509 1.00 38.52 ? 903  LEU A CD1 1 
ATOM   2241 C  CD2 . LEU A 1 317 ? -31.574 -7.213  -36.926 1.00 38.38 ? 903  LEU A CD2 1 
ATOM   2242 N  N   . ASP A 1 318 ? -29.928 -7.014  -31.686 1.00 49.11 ? 904  ASP A N   1 
ATOM   2243 C  CA  . ASP A 1 318 ? -29.863 -6.768  -30.234 1.00 52.50 ? 904  ASP A CA  1 
ATOM   2244 C  C   . ASP A 1 318 ? -30.210 -7.970  -29.350 1.00 53.81 ? 904  ASP A C   1 
ATOM   2245 O  O   . ASP A 1 318 ? -31.309 -8.058  -28.781 1.00 54.65 ? 904  ASP A O   1 
ATOM   2246 C  CB  . ASP A 1 318 ? -30.681 -5.558  -29.836 1.00 54.06 ? 904  ASP A CB  1 
ATOM   2247 C  CG  . ASP A 1 318 ? -30.577 -5.213  -28.357 1.00 54.89 ? 904  ASP A CG  1 
ATOM   2248 O  OD1 . ASP A 1 318 ? -29.526 -4.909  -27.790 1.00 54.99 ? 904  ASP A OD1 1 
ATOM   2249 O  OD2 . ASP A 1 318 ? -31.614 -5.140  -27.736 1.00 55.40 ? 904  ASP A OD2 1 
HETATM 2250 CL CL  . Q0B B 2 .   ? 4.537   -9.109  -13.117 0.70 46.56 ? 1001 Q0B A CL  1 
HETATM 2251 C  C15 . Q0B B 2 .   ? 3.135   -8.200  -13.766 1.00 46.88 ? 1001 Q0B A C15 1 
HETATM 2252 C  C16 . Q0B B 2 .   ? 3.244   -6.831  -13.969 1.00 46.97 ? 1001 Q0B A C16 1 
HETATM 2253 C  C17 . Q0B B 2 .   ? 2.176   -6.113  -14.472 1.00 47.56 ? 1001 Q0B A C17 1 
HETATM 2254 C  C18 . Q0B B 2 .   ? 0.997   -6.765  -14.783 1.00 46.94 ? 1001 Q0B A C18 1 
HETATM 2255 C  C19 . Q0B B 2 .   ? 0.859   -8.132  -14.602 1.00 46.56 ? 1001 Q0B A C19 1 
HETATM 2256 C  C14 . Q0B B 2 .   ? 1.881   -8.930  -14.099 1.00 46.54 ? 1001 Q0B A C14 1 
HETATM 2257 N  N11 . Q0B B 2 .   ? 1.755   -10.246 -13.923 1.00 44.73 ? 1001 Q0B A N11 1 
HETATM 2258 C  C10 . Q0B B 2 .   ? 1.451   -10.820 -12.751 1.00 41.64 ? 1001 Q0B A C10 1 
HETATM 2259 N  N21 . Q0B B 2 .   ? 1.252   -10.163 -11.576 1.00 39.13 ? 1001 Q0B A N21 1 
HETATM 2260 C  C12 . Q0B B 2 .   ? 1.900   -11.102 -14.954 1.00 44.22 ? 1001 Q0B A C12 1 
HETATM 2261 C  C8  . Q0B B 2 .   ? 1.686   -12.468 -14.394 1.00 43.38 ? 1001 Q0B A C8  1 
HETATM 2262 N  N7  . Q0B B 2 .   ? 1.765   -13.593 -15.140 1.00 44.31 ? 1001 Q0B A N7  1 
HETATM 2263 C  C5  . Q0B B 2 .   ? 2.055   -13.439 -16.454 1.00 44.91 ? 1001 Q0B A C5  1 
HETATM 2264 C  C6  . Q0B B 2 .   ? 2.150   -14.549 -17.285 1.00 45.18 ? 1001 Q0B A C6  1 
HETATM 2265 C  C1  . Q0B B 2 .   ? 2.449   -14.382 -18.635 0.68 44.93 ? 1001 Q0B A C1  1 
HETATM 2266 C  C2  . Q0B B 2 .   ? 2.653   -13.116 -19.178 1.00 45.06 ? 1001 Q0B A C2  1 
HETATM 2267 C  C3  . Q0B B 2 .   ? 2.569   -11.971 -18.390 0.56 44.78 ? 1001 Q0B A C3  1 
HETATM 2268 C  C4  . Q0B B 2 .   ? 2.275   -12.081 -17.036 0.33 44.75 ? 1001 Q0B A C4  1 
HETATM 2269 N  N13 . Q0B B 2 .   ? 2.193   -10.968 -16.270 0.98 44.61 ? 1001 Q0B A N13 1 
HETATM 2270 C  C9  . Q0B B 2 .   ? 1.392   -12.285 -12.946 0.84 41.10 ? 1001 Q0B A C9  1 
HETATM 2271 C  C22 . Q0B B 2 .   ? 1.115   -13.415 -12.008 0.88 38.95 ? 1001 Q0B A C22 1 
HETATM 2272 O  O23 . Q0B B 2 .   ? 0.915   -13.199 -10.821 1.00 34.95 ? 1001 Q0B A O23 1 
HETATM 2273 N  N24 . Q0B B 2 .   ? 1.105   -14.652 -12.485 1.00 39.30 ? 1001 Q0B A N24 1 
HETATM 2274 C  C35 . Q0B B 2 .   ? 1.459   -15.786 -11.654 0.87 40.18 ? 1001 Q0B A C35 1 
HETATM 2275 C  C36 . Q0B B 2 .   ? 1.319   -17.112 -12.400 0.41 39.63 ? 1001 Q0B A C36 1 
HETATM 2276 C  C37 . Q0B B 2 .   ? -0.070  -17.717 -12.228 0.89 39.09 ? 1001 Q0B A C37 1 
HETATM 2277 O  O38 . Q0B B 2 .   ? -0.286  -18.723 -13.219 0.64 39.23 ? 1001 Q0B A O38 1 
HETATM 2278 C  C39 . Q0B B 2 .   ? -1.443  -19.510 -12.938 0.28 39.62 ? 1001 Q0B A C39 1 
HETATM 2279 C  C40 . Q0B B 2 .   ? -1.777  -20.394 -14.120 0.98 40.14 ? 1001 Q0B A C40 1 
HETATM 2280 O  O   . HOH C 3 .   ? -35.430 -12.466 -3.355  0.70 27.25 ? 1101 HOH A O   1 
HETATM 2281 O  O   . HOH C 3 .   ? -35.217 -14.474 -8.952  0.99 39.03 ? 1102 HOH A O   1 
HETATM 2282 O  O   . HOH C 3 .   ? -4.938  -21.978 -4.227  0.78 23.80 ? 1103 HOH A O   1 
HETATM 2283 O  O   . HOH C 3 .   ? -16.543 -22.350 -29.031 0.91 32.12 ? 1104 HOH A O   1 
HETATM 2284 O  O   . HOH C 3 .   ? 8.569   -16.526 3.155   1.00 29.70 ? 1105 HOH A O   1 
HETATM 2285 O  O   . HOH C 3 .   ? -21.887 -2.300  -40.489 0.68 20.30 ? 1106 HOH A O   1 
HETATM 2286 O  O   . HOH C 3 .   ? -10.287 -14.888 -34.408 1.00 30.31 ? 1107 HOH A O   1 
HETATM 2287 O  O   . HOH C 3 .   ? -27.136 -0.416  -35.981 1.00 43.65 ? 1108 HOH A O   1 
HETATM 2288 O  O   . HOH C 3 .   ? -28.219 -0.242  -9.025  0.47 27.24 ? 1109 HOH A O   1 
HETATM 2289 O  O   . HOH C 3 .   ? -29.530 -8.384  -40.948 0.77 27.35 ? 1110 HOH A O   1 
HETATM 2290 O  O   . HOH C 3 .   ? -5.813  11.388  -12.277 1.00 38.31 ? 1111 HOH A O   1 
HETATM 2291 O  O   . HOH C 3 .   ? 3.458   -12.688 3.914   0.79 19.22 ? 1112 HOH A O   1 
HETATM 2292 O  O   . HOH C 3 .   ? -26.475 -8.701  -42.123 0.77 18.12 ? 1113 HOH A O   1 
HETATM 2293 O  O   . HOH C 3 .   ? 23.646  -2.380  -9.745  1.00 38.21 ? 1114 HOH A O   1 
HETATM 2294 O  O   . HOH C 3 .   ? 16.660  -5.032  -28.448 1.00 48.29 ? 1115 HOH A O   1 
HETATM 2295 O  O   . HOH C 3 .   ? -21.344 3.024   -31.255 0.86 23.41 ? 1116 HOH A O   1 
HETATM 2296 O  O   . HOH C 3 .   ? -4.261  5.384   -6.306  1.00 19.79 ? 1117 HOH A O   1 
HETATM 2297 O  O   . HOH C 3 .   ? -2.473  -20.200 -2.076  1.00 38.40 ? 1118 HOH A O   1 
HETATM 2298 O  O   . HOH C 3 .   ? -10.883 -14.220 -37.093 0.83 34.42 ? 1119 HOH A O   1 
HETATM 2299 O  O   . HOH C 3 .   ? -13.949 1.526   -6.953  0.79 17.27 ? 1120 HOH A O   1 
HETATM 2300 O  O   . HOH C 3 .   ? -15.814 6.354   -12.724 0.91 18.29 ? 1121 HOH A O   1 
HETATM 2301 O  O   . HOH C 3 .   ? 17.782  -1.239  -7.145  0.95 24.19 ? 1122 HOH A O   1 
HETATM 2302 O  O   . HOH C 3 .   ? -18.268 -23.648 -6.635  1.00 24.74 ? 1123 HOH A O   1 
HETATM 2303 O  O   . HOH C 3 .   ? 10.207  -15.513 0.981   1.00 37.66 ? 1124 HOH A O   1 
HETATM 2304 O  O   . HOH C 3 .   ? 17.011  -5.870  -18.350 0.87 22.55 ? 1125 HOH A O   1 
HETATM 2305 O  O   . HOH C 3 .   ? 20.718  -3.159  -23.717 1.00 35.36 ? 1126 HOH A O   1 
HETATM 2306 O  O   . HOH C 3 .   ? 4.622   -5.439  6.478   0.96 31.35 ? 1127 HOH A O   1 
HETATM 2307 O  O   . HOH C 3 .   ? 6.952   -2.805  -2.103  1.00 19.22 ? 1128 HOH A O   1 
HETATM 2308 O  O   . HOH C 3 .   ? -5.349  -22.158 -11.589 0.94 22.71 ? 1129 HOH A O   1 
HETATM 2309 O  O   . HOH C 3 .   ? 20.686  -8.131  -10.705 1.00 34.70 ? 1130 HOH A O   1 
HETATM 2310 O  O   . HOH C 3 .   ? -10.915 -19.919 -30.170 0.78 30.65 ? 1131 HOH A O   1 
HETATM 2311 O  O   . HOH C 3 .   ? -1.954  5.059   -2.154  0.74 21.11 ? 1132 HOH A O   1 
HETATM 2312 O  O   . HOH C 3 .   ? -9.344  2.154   -33.338 1.00 49.41 ? 1133 HOH A O   1 
HETATM 2313 O  O   . HOH C 3 .   ? -7.068  10.294  -20.240 0.87 33.17 ? 1134 HOH A O   1 
HETATM 2314 O  O   . HOH C 3 .   ? 20.048  -3.296  -5.336  1.00 47.49 ? 1135 HOH A O   1 
HETATM 2315 O  O   . HOH C 3 .   ? 7.096   -7.407  9.923   1.00 32.29 ? 1136 HOH A O   1 
HETATM 2316 O  O   . HOH C 3 .   ? -16.649 -14.424 -40.541 0.91 29.94 ? 1137 HOH A O   1 
HETATM 2317 O  O   . HOH C 3 .   ? -19.616 7.907   -11.189 1.00 49.52 ? 1138 HOH A O   1 
HETATM 2318 O  O   . HOH C 3 .   ? 13.386  -14.913 6.757   1.00 25.11 ? 1139 HOH A O   1 
HETATM 2319 O  O   . HOH C 3 .   ? -17.934 -27.272 -8.764  1.00 46.75 ? 1140 HOH A O   1 
HETATM 2320 O  O   . HOH C 3 .   ? -24.208 -1.067  -32.905 0.79 24.17 ? 1141 HOH A O   1 
HETATM 2321 O  O   . HOH C 3 .   ? -15.856 -4.484  -41.592 0.92 26.38 ? 1142 HOH A O   1 
HETATM 2322 O  O   . HOH C 3 .   ? 12.645  -16.879 3.895   0.89 30.79 ? 1143 HOH A O   1 
HETATM 2323 O  O   . HOH C 3 .   ? 14.548  -3.755  6.074   0.78 20.49 ? 1144 HOH A O   1 
HETATM 2324 O  O   . HOH C 3 .   ? -16.993 9.266   -9.930  1.00 38.46 ? 1145 HOH A O   1 
HETATM 2325 O  O   . HOH C 3 .   ? -13.007 8.913   -17.031 0.59 18.77 ? 1146 HOH A O   1 
HETATM 2326 O  O   . HOH C 3 .   ? -31.924 -12.872 -13.867 1.00 24.20 ? 1147 HOH A O   1 
HETATM 2327 O  O   . HOH C 3 .   ? -28.529 -3.502  -16.110 1.00 29.96 ? 1148 HOH A O   1 
HETATM 2328 O  O   . HOH C 3 .   ? -7.132  -24.074 -11.821 0.99 20.65 ? 1149 HOH A O   1 
HETATM 2329 O  O   . HOH C 3 .   ? -17.338 12.251  -27.120 1.00 47.89 ? 1150 HOH A O   1 
HETATM 2330 O  O   . HOH C 3 .   ? -11.182 10.979  -29.546 1.00 25.83 ? 1151 HOH A O   1 
HETATM 2331 O  O   . HOH C 3 .   ? -18.316 -2.312  -35.066 0.86 18.79 ? 1152 HOH A O   1 
HETATM 2332 O  O   . HOH C 3 .   ? -7.410  -21.070 -5.456  1.00 18.80 ? 1153 HOH A O   1 
HETATM 2333 O  O   . HOH C 3 .   ? 17.221  -10.295 -7.351  0.92 33.14 ? 1154 HOH A O   1 
HETATM 2334 O  O   . HOH C 3 .   ? -26.296 11.054  -27.030 0.89 44.95 ? 1155 HOH A O   1 
HETATM 2335 O  O   . HOH C 3 .   ? -19.424 1.819   -36.275 0.81 32.19 ? 1156 HOH A O   1 
HETATM 2336 O  O   . HOH C 3 .   ? -29.192 -5.403  -9.931  0.88 21.44 ? 1157 HOH A O   1 
HETATM 2337 O  O   . HOH C 3 .   ? -5.903  -0.610  -2.051  1.00 29.58 ? 1158 HOH A O   1 
HETATM 2338 O  O   . HOH C 3 .   ? -1.874  8.473   -8.077  1.00 32.73 ? 1159 HOH A O   1 
HETATM 2339 O  O   . HOH C 3 .   ? -28.926 -5.758  -15.011 1.00 26.55 ? 1160 HOH A O   1 
HETATM 2340 O  O   . HOH C 3 .   ? -15.929 -28.804 -16.722 0.91 22.82 ? 1161 HOH A O   1 
HETATM 2341 O  O   . HOH C 3 .   ? -4.037  -22.457 -7.823  1.00 33.69 ? 1162 HOH A O   1 
HETATM 2342 O  O   . HOH C 3 .   ? -16.655 -13.002 -44.792 0.81 24.92 ? 1163 HOH A O   1 
HETATM 2343 O  O   . HOH C 3 .   ? -15.236 13.476  -27.631 0.99 34.46 ? 1164 HOH A O   1 
HETATM 2344 O  O   . HOH C 3 .   ? 2.199   -12.999 -0.308  0.98 21.00 ? 1165 HOH A O   1 
HETATM 2345 O  O   . HOH C 3 .   ? 13.980  -5.921  3.889   0.99 30.14 ? 1166 HOH A O   1 
HETATM 2346 O  O   . HOH C 3 .   ? -18.011 8.270   -18.616 0.71 25.29 ? 1167 HOH A O   1 
HETATM 2347 O  O   . HOH C 3 .   ? 16.847  -8.221  6.367   1.00 47.22 ? 1168 HOH A O   1 
HETATM 2348 O  O   . HOH C 3 .   ? -17.283 0.173   -35.923 0.66 17.68 ? 1169 HOH A O   1 
HETATM 2349 O  O   . HOH C 3 .   ? -20.825 11.435  -30.619 1.00 45.11 ? 1170 HOH A O   1 
HETATM 2350 O  O   . HOH C 3 .   ? -35.997 -18.743 -15.867 1.00 35.79 ? 1171 HOH A O   1 
HETATM 2351 O  O   . HOH C 3 .   ? -30.844 -2.917  -25.923 1.00 39.22 ? 1172 HOH A O   1 
HETATM 2352 O  O   . HOH C 3 .   ? -13.783 -19.685 -30.322 0.92 21.72 ? 1173 HOH A O   1 
HETATM 2353 O  O   . HOH C 3 .   ? -23.062 -2.855  -42.835 0.88 22.85 ? 1174 HOH A O   1 
HETATM 2354 O  O   . HOH C 3 .   ? -20.502 -16.542 -35.509 0.83 25.87 ? 1175 HOH A O   1 
HETATM 2355 O  O   . HOH C 3 .   ? 7.331   -1.069  1.266   1.00 32.47 ? 1176 HOH A O   1 
HETATM 2356 O  O   . HOH C 3 .   ? -13.512 -27.032 -18.237 0.79 21.27 ? 1177 HOH A O   1 
HETATM 2357 O  O   . HOH C 3 .   ? 23.313  -5.991  -12.605 1.00 26.88 ? 1178 HOH A O   1 
HETATM 2358 O  O   . HOH C 3 .   ? -27.857 -0.536  -16.803 0.97 38.92 ? 1179 HOH A O   1 
HETATM 2359 O  O   . HOH C 3 .   ? -18.967 -28.819 -14.870 1.00 31.99 ? 1180 HOH A O   1 
HETATM 2360 O  O   . HOH C 3 .   ? -20.621 8.770   -22.302 1.00 43.37 ? 1181 HOH A O   1 
HETATM 2361 O  O   . HOH C 3 .   ? 16.659  -3.454  2.374   1.00 37.97 ? 1182 HOH A O   1 
HETATM 2362 O  O   . HOH C 3 .   ? -14.388 9.430   -20.568 1.00 22.09 ? 1183 HOH A O   1 
HETATM 2363 O  O   . HOH C 3 .   ? -27.115 1.205   -10.993 1.00 46.24 ? 1184 HOH A O   1 
HETATM 2364 O  O   . HOH C 3 .   ? 19.234  -3.313  -7.127  0.97 35.70 ? 1185 HOH A O   1 
HETATM 2365 O  O   . HOH C 3 .   ? -17.985 11.093  -25.011 1.00 40.85 ? 1186 HOH A O   1 
HETATM 2366 O  O   . HOH C 3 .   ? -36.967 -18.357 -18.667 1.00 44.22 ? 1187 HOH A O   1 
HETATM 2367 O  O   . HOH C 3 .   ? -34.065 -7.021  -18.629 0.89 35.22 ? 1188 HOH A O   1 
HETATM 2368 O  O   . HOH C 3 .   ? -10.490 -19.012 0.341   1.00 38.98 ? 1189 HOH A O   1 
HETATM 2369 O  O   . HOH C 3 .   ? -31.438 -7.053  -5.971  1.00 45.59 ? 1190 HOH A O   1 
HETATM 2370 O  O   . HOH C 3 .   ? -17.282 8.242   -21.074 0.95 35.17 ? 1191 HOH A O   1 
HETATM 2371 O  O   . HOH C 3 .   ? -5.671  -15.361 2.077   1.00 45.66 ? 1192 HOH A O   1 
HETATM 2372 O  O   . HOH C 3 .   ? -3.892  -25.742 -12.939 1.00 44.56 ? 1193 HOH A O   1 
HETATM 2373 O  O   . HOH C 3 .   ? -22.679 -27.913 -14.159 1.00 48.58 ? 1194 HOH A O   1 
HETATM 2374 O  O   . HOH C 3 .   ? -18.375 8.977   -23.187 1.00 38.38 ? 1195 HOH A O   1 
HETATM 2375 O  O   . HOH C 3 .   ? -20.365 -25.272 -7.460  1.00 39.06 ? 1196 HOH A O   1 
HETATM 2376 O  O   . HOH C 3 .   ? 22.067  -6.736  -8.647  1.00 30.97 ? 1197 HOH A O   1 
HETATM 2377 O  O   . HOH C 3 .   ? -19.237 3.985   -34.728 0.85 23.85 ? 1198 HOH A O   1 
HETATM 2378 O  O   . HOH C 3 .   ? -19.088 -0.767  -40.107 0.74 31.77 ? 1199 HOH A O   1 
HETATM 2379 O  O   . HOH C 3 .   ? -16.925 -30.617 -14.915 0.78 22.07 ? 1200 HOH A O   1 
HETATM 2380 O  O   . HOH C 3 .   ? -18.105 -1.296  -41.864 1.00 19.59 ? 1201 HOH A O   1 
HETATM 2381 O  O   . HOH C 3 .   ? 2.272   -5.406  4.613   1.00 42.97 ? 1202 HOH A O   1 
HETATM 2382 O  O   . HOH C 3 .   ? -22.062 -19.672 -32.260 1.00 45.48 ? 1203 HOH A O   1 
HETATM 2383 O  O   . HOH C 3 .   ? -8.491  -25.211 -20.687 0.96 40.63 ? 1204 HOH A O   1 
HETATM 2384 O  O   . HOH C 3 .   ? -27.221 5.798   -31.396 1.00 42.02 ? 1205 HOH A O   1 
HETATM 2385 O  O   . HOH C 3 .   ? -12.111 -0.216  -2.509  1.00 37.72 ? 1206 HOH A O   1 
HETATM 2386 O  O   . HOH C 3 .   ? 4.759   -2.432  1.638   1.00 28.49 ? 1207 HOH A O   1 
HETATM 2387 O  O   . HOH C 3 .   ? 9.181   -2.578  -0.531  1.00 20.12 ? 1208 HOH A O   1 
HETATM 2388 O  O   . HOH C 3 .   ? -22.550 1.181   -33.581 1.00 47.98 ? 1209 HOH A O   1 
HETATM 2389 O  O   . HOH C 3 .   ? 4.428   -7.180  8.834   1.00 47.99 ? 1210 HOH A O   1 
HETATM 2390 O  O   . HOH C 3 .   ? 17.878  -4.877  3.755   1.00 47.69 ? 1211 HOH A O   1 
HETATM 2391 O  O   . HOH C 3 .   ? 18.988  -0.295  -4.802  1.00 43.64 ? 1212 HOH A O   1 
HETATM 2392 O  O   . HOH C 3 .   ? -16.132 -25.957 -24.186 1.00 42.08 ? 1213 HOH A O   1 
HETATM 2393 O  O   . HOH C 3 .   ? -14.274 -26.938 -22.503 0.56 21.08 ? 1214 HOH A O   1 
HETATM 2394 O  O   . HOH C 3 .   ? 0.232   -14.037 -1.973  0.64 28.32 ? 1215 HOH A O   1 
HETATM 2395 O  O   . HOH C 3 .   ? 18.341  0.367   1.436   0.95 46.49 ? 1216 HOH A O   1 
HETATM 2396 O  O   . HOH C 3 .   ? 1.307   4.765   -0.405  1.00 49.57 ? 1217 HOH A O   1 
HETATM 2397 O  O   . HOH C 3 .   ? -11.038 -1.420  -23.053 1.00 15.14 ? 1218 HOH A O   1 
HETATM 2398 O  O   . HOH C 3 .   ? -3.320  -1.447  -6.656  1.00 15.24 ? 1219 HOH A O   1 
HETATM 2399 O  O   . HOH C 3 .   ? -16.175 5.999   -26.648 1.00 16.52 ? 1220 HOH A O   1 
HETATM 2400 O  O   . HOH C 3 .   ? -4.544  -4.963  -5.332  1.00 15.69 ? 1221 HOH A O   1 
HETATM 2401 O  O   . HOH C 3 .   ? -21.920 -8.118  -28.602 1.00 15.49 ? 1222 HOH A O   1 
HETATM 2402 O  O   . HOH C 3 .   ? -9.816  -12.297 -23.113 1.00 16.68 ? 1223 HOH A O   1 
HETATM 2403 O  O   . HOH C 3 .   ? -20.359 4.504   -19.833 1.00 17.43 ? 1224 HOH A O   1 
HETATM 2404 O  O   . HOH C 3 .   ? -13.091 -9.999  -7.420  0.89 14.82 ? 1225 HOH A O   1 
HETATM 2405 O  O   . HOH C 3 .   ? -17.385 -6.129  -29.263 1.00 15.99 ? 1226 HOH A O   1 
HETATM 2406 O  O   . HOH C 3 .   ? -11.813 1.805   -24.419 0.94 15.19 ? 1227 HOH A O   1 
HETATM 2407 O  O   . HOH C 3 .   ? -12.001 4.288   -18.116 1.00 16.79 ? 1228 HOH A O   1 
HETATM 2408 O  O   . HOH C 3 .   ? -13.203 -0.215  -26.041 1.00 16.72 ? 1229 HOH A O   1 
HETATM 2409 O  O   . HOH C 3 .   ? -17.731 4.967   -15.945 0.85 15.90 ? 1230 HOH A O   1 
HETATM 2410 O  O   . HOH C 3 .   ? -18.519 5.628   -12.560 1.00 19.59 ? 1231 HOH A O   1 
HETATM 2411 O  O   . HOH C 3 .   ? -13.199 -8.286  -5.147  1.00 21.84 ? 1232 HOH A O   1 
HETATM 2412 O  O   . HOH C 3 .   ? -2.397  -1.588  -3.943  1.00 20.72 ? 1233 HOH A O   1 
HETATM 2413 O  O   . HOH C 3 .   ? -22.223 6.380   -20.694 0.93 21.47 ? 1234 HOH A O   1 
HETATM 2414 O  O   . HOH C 3 .   ? -26.852 -3.972  -27.094 0.83 18.35 ? 1235 HOH A O   1 
HETATM 2415 O  O   . HOH C 3 .   ? 13.889  -3.282  -1.472  0.94 21.30 ? 1236 HOH A O   1 
HETATM 2416 O  O   . HOH C 3 .   ? -2.792  -15.569 -5.323  1.00 21.32 ? 1237 HOH A O   1 
HETATM 2417 O  O   . HOH C 3 .   ? -21.367 -18.407 -24.704 1.00 22.11 ? 1238 HOH A O   1 
HETATM 2418 O  O   . HOH C 3 .   ? -18.072 5.586   -18.621 1.00 21.14 ? 1239 HOH A O   1 
HETATM 2419 O  O   . HOH C 3 .   ? -14.286 -12.715 -6.546  0.84 16.96 ? 1240 HOH A O   1 
HETATM 2420 O  O   . HOH C 3 .   ? -16.078 -4.882  -31.295 0.85 18.97 ? 1241 HOH A O   1 
HETATM 2421 O  O   . HOH C 3 .   ? -12.374 -15.337 -23.327 0.99 22.03 ? 1242 HOH A O   1 
HETATM 2422 O  O   . HOH C 3 .   ? 11.490  -4.232  -0.289  0.88 21.85 ? 1243 HOH A O   1 
HETATM 2423 O  O   . HOH C 3 .   ? -0.647  -0.705  -8.678  0.97 22.46 ? 1244 HOH A O   1 
HETATM 2424 O  O   . HOH C 3 .   ? 13.049  -12.539 -0.737  1.00 28.48 ? 1245 HOH A O   1 
HETATM 2425 O  O   . HOH C 3 .   ? 3.592   -4.163  -0.078  1.00 23.56 ? 1246 HOH A O   1 
HETATM 2426 O  O   . HOH C 3 .   ? -16.272 -14.518 -6.281  1.00 22.41 ? 1247 HOH A O   1 
HETATM 2427 O  O   . HOH C 3 .   ? -17.197 -4.527  -33.765 0.70 18.06 ? 1248 HOH A O   1 
HETATM 2428 O  O   . HOH C 3 .   ? -1.521  -7.630  -2.692  0.92 25.21 ? 1249 HOH A O   1 
HETATM 2429 O  O   . HOH C 3 .   ? 1.616   -10.278 -3.282  0.93 26.99 ? 1250 HOH A O   1 
HETATM 2430 O  O   . HOH C 3 .   ? -13.235 -24.766 -21.503 0.82 20.66 ? 1251 HOH A O   1 
HETATM 2431 O  O   . HOH C 3 .   ? -16.408 0.330   -6.126  1.00 23.80 ? 1252 HOH A O   1 
HETATM 2432 O  O   . HOH C 3 .   ? -16.394 -8.836  -5.340  0.94 25.45 ? 1253 HOH A O   1 
HETATM 2433 O  O   . HOH C 3 .   ? 18.137  -6.635  -11.093 1.00 28.63 ? 1254 HOH A O   1 
HETATM 2434 O  O   . HOH C 3 .   ? -6.998  -22.829 -19.783 0.98 23.67 ? 1255 HOH A O   1 
HETATM 2435 O  O   . HOH C 3 .   ? -22.203 -20.511 -23.047 1.00 29.02 ? 1256 HOH A O   1 
HETATM 2436 O  O   . HOH C 3 .   ? 1.382   -7.619  -2.666  1.00 29.84 ? 1257 HOH A O   1 
HETATM 2437 O  O   . HOH C 3 .   ? -23.884 -18.210 -17.900 0.71 22.17 ? 1258 HOH A O   1 
HETATM 2438 O  O   . HOH C 3 .   ? -10.418 9.280   -27.567 1.00 28.46 ? 1259 HOH A O   1 
HETATM 2439 O  O   . HOH C 3 .   ? -16.066 -18.585 -3.448  1.00 29.42 ? 1260 HOH A O   1 
HETATM 2440 O  O   . HOH C 3 .   ? -21.796 -20.655 -19.789 0.94 32.06 ? 1261 HOH A O   1 
HETATM 2441 O  O   . HOH C 3 .   ? -3.815  -3.815  -3.061  0.71 19.03 ? 1262 HOH A O   1 
HETATM 2442 O  O   . HOH C 3 .   ? -10.856 -1.748  -26.557 1.00 25.13 ? 1263 HOH A O   1 
HETATM 2443 O  O   . HOH C 3 .   ? -7.432  -12.205 -1.441  1.00 35.90 ? 1264 HOH A O   1 
HETATM 2444 O  O   . HOH C 3 .   ? -15.199 -22.759 -21.539 1.00 30.66 ? 1265 HOH A O   1 
HETATM 2445 O  O   . HOH C 3 .   ? -14.890 -5.514  -5.239  1.00 33.73 ? 1266 HOH A O   1 
HETATM 2446 O  O   . HOH C 3 .   ? -2.632  -5.642  -1.377  0.90 31.73 ? 1267 HOH A O   1 
HETATM 2447 O  O   . HOH C 3 .   ? -3.376  -11.139 -4.647  0.95 25.81 ? 1268 HOH A O   1 
HETATM 2448 O  O   . HOH C 3 .   ? -21.389 1.746   -6.836  0.70 23.19 ? 1269 HOH A O   1 
HETATM 2449 O  O   . HOH C 3 .   ? -2.655  -17.574 -16.822 0.93 30.92 ? 1270 HOH A O   1 
HETATM 2450 O  O   . HOH C 3 .   ? -28.107 3.226   -27.879 1.00 30.79 ? 1271 HOH A O   1 
HETATM 2451 O  O   . HOH C 3 .   ? -4.939  -15.753 -21.174 1.00 30.34 ? 1272 HOH A O   1 
HETATM 2452 O  O   . HOH C 3 .   ? -3.508  -13.574 -20.867 1.00 32.17 ? 1273 HOH A O   1 
HETATM 2453 O  O   . HOH C 3 .   ? -27.710 -19.998 -14.024 0.97 38.02 ? 1274 HOH A O   1 
HETATM 2454 O  O   . HOH C 3 .   ? -25.469 -20.934 -9.394  1.00 31.86 ? 1275 HOH A O   1 
HETATM 2455 O  O   . HOH C 3 .   ? -18.618 2.139   -7.251  0.99 27.32 ? 1276 HOH A O   1 
HETATM 2456 O  O   . HOH C 3 .   ? -14.219 -11.773 -3.956  0.78 28.24 ? 1277 HOH A O   1 
HETATM 2457 O  O   . HOH C 3 .   ? -6.406  -15.160 -24.264 0.93 33.87 ? 1278 HOH A O   1 
HETATM 2458 O  O   . HOH C 3 .   ? 5.648   -3.469  -18.861 0.94 34.86 ? 1279 HOH A O   1 
HETATM 2459 O  O   . HOH C 3 .   ? -20.072 -13.010 -4.593  1.00 36.94 ? 1280 HOH A O   1 
HETATM 2460 O  O   . HOH C 3 .   ? -28.100 0.028   -28.894 0.91 30.34 ? 1281 HOH A O   1 
HETATM 2461 O  O   . HOH C 3 .   ? -5.312  7.529   -30.209 1.00 44.01 ? 1282 HOH A O   1 
HETATM 2462 O  O   . HOH C 3 .   ? -22.547 -0.340  -4.918  0.93 35.69 ? 1283 HOH A O   1 
HETATM 2463 O  O   . HOH C 3 .   ? 12.289  4.827   -4.602  0.99 37.86 ? 1284 HOH A O   1 
HETATM 2464 O  O   . HOH C 3 .   ? -5.018  -18.971 -15.661 0.72 26.34 ? 1285 HOH A O   1 
HETATM 2465 O  O   . HOH C 3 .   ? -23.977 -6.671  -1.845  1.00 35.40 ? 1286 HOH A O   1 
HETATM 2466 O  O   . HOH C 3 .   ? -19.026 -21.386 -22.875 1.00 38.55 ? 1287 HOH A O   1 
HETATM 2467 O  O   . HOH C 3 .   ? -0.523  -12.033 -3.506  0.97 29.74 ? 1288 HOH A O   1 
HETATM 2468 O  O   . HOH C 3 .   ? -26.456 -1.644  -4.745  1.00 35.13 ? 1289 HOH A O   1 
HETATM 2469 O  O   . HOH C 3 .   ? -31.393 -11.909 -34.692 0.94 35.23 ? 1290 HOH A O   1 
HETATM 2470 O  O   . HOH C 3 .   ? -26.982 -3.434  -2.808  0.98 37.22 ? 1291 HOH A O   1 
HETATM 2471 O  O   . HOH C 3 .   ? -21.409 -19.623 -4.130  0.68 28.90 ? 1292 HOH A O   1 
HETATM 2472 O  O   . HOH C 3 .   ? -13.483 -2.187  -4.159  1.00 34.61 ? 1293 HOH A O   1 
HETATM 2473 O  O   . HOH C 3 .   ? -5.789  -2.770  -1.591  0.79 30.23 ? 1294 HOH A O   1 
HETATM 2474 O  O   . HOH C 3 .   ? -23.330 -18.047 -26.040 0.87 34.71 ? 1295 HOH A O   1 
HETATM 2475 O  O   . HOH C 3 .   ? -29.269 -21.355 -21.687 1.00 39.45 ? 1296 HOH A O   1 
HETATM 2476 O  O   . HOH C 3 .   ? -0.801  -4.763  0.403   0.76 34.60 ? 1297 HOH A O   1 
HETATM 2477 O  O   . HOH C 3 .   ? -1.528  -16.795 -3.375  1.00 33.88 ? 1298 HOH A O   1 
HETATM 2478 O  O   . HOH C 3 .   ? 0.658   -10.551 0.438   0.75 29.35 ? 1299 HOH A O   1 
HETATM 2479 O  O   . HOH C 3 .   ? -24.700 0.415   -4.056  1.00 40.68 ? 1300 HOH A O   1 
HETATM 2480 O  O   . HOH C 3 .   ? -29.012 4.092   -30.358 0.95 43.02 ? 1301 HOH A O   1 
HETATM 2481 O  O   . HOH C 3 .   ? -25.453 -18.685 -7.150  1.00 31.17 ? 1302 HOH A O   1 
HETATM 2482 O  O   . HOH C 3 .   ? -5.506  -20.914 -14.491 1.00 36.05 ? 1303 HOH A O   1 
HETATM 2483 O  O   . HOH C 3 .   ? -7.834  -7.360  -3.221  0.86 28.31 ? 1304 HOH A O   1 
HETATM 2484 O  O   . HOH C 3 .   ? 12.378  -13.404 1.125   1.00 39.69 ? 1305 HOH A O   1 
HETATM 2485 O  O   . HOH C 3 .   ? -0.980  -15.100 -15.915 1.00 38.60 ? 1306 HOH A O   1 
HETATM 2486 O  O   . HOH C 3 .   ? -1.721  -9.508  -17.255 1.00 36.41 ? 1307 HOH A O   1 
HETATM 2487 O  O   . HOH C 3 .   ? -5.404  10.123  -22.035 1.00 36.37 ? 1308 HOH A O   1 
HETATM 2488 O  O   . HOH C 3 .   ? 1.646   -6.150  0.076   1.00 35.07 ? 1309 HOH A O   1 
HETATM 2489 O  O   . HOH C 3 .   ? -4.258  -0.217  -20.338 0.96 31.71 ? 1310 HOH A O   1 
HETATM 2490 O  O   . HOH C 3 .   ? -10.179 -4.215  -24.998 0.97 31.31 ? 1311 HOH A O   1 
HETATM 2491 O  O   . HOH C 3 .   ? -23.131 -20.529 -13.533 1.00 22.87 ? 1312 HOH A O   1 
HETATM 2492 O  O   . HOH C 3 .   ? -8.291  -13.528 -25.370 0.93 36.29 ? 1313 HOH A O   1 
HETATM 2493 O  O   . HOH C 3 .   ? 8.663   -9.223  -18.951 0.99 27.46 ? 1314 HOH A O   1 
HETATM 2494 O  O   . HOH C 3 .   ? -5.771  -9.141  -2.654  1.00 48.00 ? 1315 HOH A O   1 
HETATM 2495 O  O   . HOH C 3 .   ? -21.831 -21.908 -14.187 1.00 39.70 ? 1316 HOH A O   1 
HETATM 2496 O  O   . HOH C 3 .   ? -24.071 -21.966 -12.402 1.00 47.66 ? 1317 HOH A O   1 
HETATM 2497 O  O   . HOH C 3 .   ? -24.046 -19.470 -15.022 1.00 41.29 ? 1318 HOH A O   1 
HETATM 2498 O  O   . HOH C 3 .   ? -3.531  3.296   -26.759 0.99 42.53 ? 1319 HOH A O   1 
HETATM 2499 O  O   . HOH C 3 .   ? -9.529  -15.303 -27.084 1.00 40.58 ? 1320 HOH A O   1 
HETATM 2500 O  O   . HOH C 3 .   ? -2.682  -17.337 -19.815 1.00 43.27 ? 1321 HOH A O   1 
HETATM 2501 O  O   . HOH C 3 .   ? -11.215 -24.196 -23.791 0.99 43.02 ? 1322 HOH A O   1 
HETATM 2502 O  O   . HOH C 3 .   ? -27.916 -2.202  -29.121 0.99 40.56 ? 1323 HOH A O   1 
HETATM 2503 O  O   . HOH C 3 .   ? -8.129  -17.386 -31.866 1.00 44.75 ? 1324 HOH A O   1 
HETATM 2504 O  O   . HOH C 3 .   ? -6.804  -5.598  -1.033  1.00 45.48 ? 1325 HOH A O   1 
HETATM 2505 O  O   . HOH C 3 .   ? 9.084   -18.805 -3.830  1.00 48.01 ? 1326 HOH A O   1 
HETATM 2506 O  O   . HOH C 3 .   ? 6.963   -8.053  -20.673 1.00 37.87 ? 1327 HOH A O   1 
HETATM 2507 O  O   . HOH C 3 .   ? -24.657 -3.901  -1.106  1.00 43.85 ? 1328 HOH A O   1 
HETATM 2508 O  O   . HOH C 3 .   ? -37.205 -20.134 -15.140 1.00 45.37 ? 1329 HOH A O   1 
HETATM 2509 O  O   . HOH C 3 .   ? 18.108  0.631   -16.201 1.00 41.42 ? 1330 HOH A O   1 
HETATM 2510 O  O   . HOH C 3 .   ? -22.755 -22.647 -16.558 1.00 43.50 ? 1331 HOH A O   1 
HETATM 2511 O  O   . HOH C 3 .   ? -4.638  -14.853 -2.872  1.00 44.21 ? 1332 HOH A O   1 
HETATM 2512 O  O   . HOH C 3 .   ? -3.128  -9.273  -23.390 1.00 45.56 ? 1333 HOH A O   1 
HETATM 2513 O  O   . HOH C 3 .   ? 4.287   -19.203 -10.139 1.00 46.85 ? 1334 HOH A O   1 
HETATM 2514 O  O   . HOH C 3 .   ? -20.653 -6.551  -3.096  1.00 45.12 ? 1335 HOH A O   1 
HETATM 2515 O  O   . HOH C 3 .   ? -21.743 -24.881 -9.984  1.00 48.32 ? 1336 HOH A O   1 
HETATM 2516 O  O   . HOH C 3 .   ? -20.348 -17.723 -2.618  1.00 41.76 ? 1337 HOH A O   1 
HETATM 2517 O  O   . HOH C 3 .   ? 17.576  4.366   -12.360 1.00 49.20 ? 1338 HOH A O   1 
HETATM 2518 O  O   . HOH C 3 .   ? 9.268   -1.035  -27.496 0.95 41.90 ? 1339 HOH A O   1 
HETATM 2519 O  O   . HOH C 3 .   ? -4.385  -22.841 -18.804 1.00 49.42 ? 1340 HOH A O   1 
HETATM 2520 O  O   . HOH C 3 .   ? -12.000 -19.908 -26.017 1.00 39.10 ? 1341 HOH A O   1 
HETATM 2521 O  O   . HOH C 3 .   ? -21.422 -13.256 -2.165  1.00 41.75 ? 1342 HOH A O   1 
HETATM 2522 O  O   . HOH C 3 .   ? -22.533 3.874   -5.537  1.00 47.54 ? 1343 HOH A O   1 
HETATM 2523 O  O   . HOH C 3 .   ? -28.041 -18.442 -26.411 1.00 44.64 ? 1344 HOH A O   1 
HETATM 2524 O  O   . HOH C 3 .   ? -6.837  -11.964 -27.302 1.00 41.73 ? 1345 HOH A O   1 
HETATM 2525 O  O   . HOH C 3 .   ? -7.111  -11.768 -30.284 1.00 37.54 ? 1346 HOH A O   1 
HETATM 2526 O  O   . HOH C 3 .   ? -13.625 -14.043 -3.410  1.00 43.79 ? 1347 HOH A O   1 
HETATM 2527 O  O   . HOH C 3 .   ? -3.559  -11.248 -17.468 1.00 44.58 ? 1348 HOH A O   1 
HETATM 2528 O  O   . HOH C 3 .   ? 14.037  -11.658 -19.527 1.00 48.15 ? 1349 HOH A O   1 
HETATM 2529 O  O   . HOH C 3 .   ? -27.989 -17.578 -7.681  1.00 42.99 ? 1350 HOH A O   1 
HETATM 2530 O  O   . HOH C 3 .   ? 16.055  -7.289  3.940   1.00 45.84 ? 1351 HOH A O   1 
HETATM 2531 O  O   . HOH C 3 .   ? 16.663  0.812   -3.387  1.00 46.98 ? 1352 HOH A O   1 
HETATM 2532 O  O   . HOH C 3 .   ? 13.272  -0.436  -29.908 1.00 47.63 ? 1353 HOH A O   1 
HETATM 2533 O  O   . HOH C 3 .   ? -27.754 -0.867  -33.007 1.00 48.05 ? 1354 HOH A O   1 
HETATM 2534 O  O   . HOH C 3 .   ? -20.882 -23.235 -19.476 1.00 41.16 ? 1355 HOH A O   1 
HETATM 2535 O  O   . HOH C 3 .   ? -9.967  -8.256  -1.815  1.00 43.47 ? 1356 HOH A O   1 
HETATM 2536 O  O   . HOH C 3 .   ? -24.810 -19.417 -4.401  1.00 46.13 ? 1357 HOH A O   1 
HETATM 2537 O  O   . HOH C 3 .   ? -23.860 -8.069  0.029   1.00 48.09 ? 1358 HOH A O   1 
HETATM 2538 O  O   . HOH C 3 .   ? -29.459 -24.283 -22.700 1.00 49.90 ? 1359 HOH A O   1 
HETATM 2539 O  O   . HOH C 3 .   ? -9.687  -5.671  0.208   1.00 44.13 ? 1360 HOH A O   1 
HETATM 2540 O  O   . HOH C 3 .   ? -28.476 -22.313 -13.243 1.00 49.45 ? 1361 HOH A O   1 
HETATM 2541 O  O   . HOH C 3 .   ? -24.480 -13.756 -1.984  1.00 46.71 ? 1362 HOH A O   1 
HETATM 2542 O  O   . HOH C 3 .   ? 9.298   5.115   -19.192 1.00 48.79 ? 1363 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . VAL A 23  ? 0.8514 0.4551 0.7490 -0.0718 0.0043  0.0013  609  VAL A N   
2    C  CA  . VAL A 23  ? 0.8440 0.4238 0.7524 -0.0671 0.0124  -0.0018 609  VAL A CA  
3    C  C   . VAL A 23  ? 0.8245 0.4083 0.7723 -0.0637 0.0125  0.0036  609  VAL A C   
4    O  O   . VAL A 23  ? 0.8202 0.3861 0.7734 -0.0796 0.0174  0.0007  609  VAL A O   
5    C  CB  . VAL A 23  ? 0.8473 0.4096 0.7373 -0.0563 0.0153  -0.0139 609  VAL A CB  
6    C  CG1 . VAL A 23  ? 0.8445 0.4188 0.7338 -0.0459 0.0219  -0.0163 609  VAL A CG1 
7    C  CG2 . VAL A 23  ? 0.8519 0.3822 0.7296 -0.0402 0.0082  -0.0132 609  VAL A CG2 
8    N  N   . HIS A 24  ? 0.8063 0.3988 0.7917 -0.0478 0.0087  0.0115  610  HIS A N   
9    C  CA  . HIS A 24  ? 0.7857 0.3992 0.8138 -0.0349 0.0060  0.0105  610  HIS A CA  
10   C  C   . HIS A 24  ? 0.7626 0.4036 0.8066 -0.0403 -0.0127 -0.0060 610  HIS A C   
11   O  O   . HIS A 24  ? 0.7582 0.4021 0.8071 -0.0299 -0.0146 -0.0141 610  HIS A O   
12   C  CB  . HIS A 24  ? 0.7887 0.3974 0.8418 -0.0354 0.0213  0.0297  610  HIS A CB  
13   C  CG  . HIS A 24  ? 0.7987 0.4174 0.8652 -0.0384 0.0385  0.0484  610  HIS A CG  
14   N  ND1 . HIS A 24  ? 0.8104 0.4132 0.8784 -0.0421 0.0560  0.0564  610  HIS A ND1 
15   C  CD2 . HIS A 24  ? 0.7994 0.4003 0.8690 -0.0450 0.0399  0.0620  610  HIS A CD2 
16   C  CE1 . HIS A 24  ? 0.8109 0.4030 0.8789 -0.0227 0.0577  0.0692  610  HIS A CE1 
17   N  NE2 . HIS A 24  ? 0.8015 0.3804 0.8728 -0.0357 0.0473  0.0680  610  HIS A NE2 
18   N  N   . GLU A 25  ? 0.7432 0.3906 0.7968 -0.0389 -0.0327 -0.0151 611  GLU A N   
19   C  CA  . GLU A 25  ? 0.7278 0.3733 0.7846 0.0138  -0.0651 -0.0104 611  GLU A CA  
20   C  C   . GLU A 25  ? 0.6978 0.3514 0.7591 0.0401  -0.0844 -0.0063 611  GLU A C   
21   O  O   . GLU A 25  ? 0.7023 0.3575 0.7693 0.0273  -0.0761 -0.0166 611  GLU A O   
22   C  CB  . GLU A 25  ? 0.7495 0.4304 0.7972 0.0293  -0.0755 -0.0172 611  GLU A CB  
23   C  CG  . GLU A 25  ? 0.7739 0.4716 0.8098 0.0453  -0.0797 -0.0210 611  GLU A CG  
24   C  CD  . GLU A 25  ? 0.7908 0.5119 0.8211 0.0699  -0.0849 -0.0308 611  GLU A CD  
25   O  OE1 . GLU A 25  ? 0.7937 0.5256 0.8174 0.0810  -0.0900 -0.0305 611  GLU A OE1 
26   O  OE2 . GLU A 25  ? 0.7943 0.5340 0.8295 0.0734  -0.0895 -0.0381 611  GLU A OE2 
27   N  N   . PHE A 26  ? 0.6630 0.2770 0.7219 0.0636  -0.1076 0.0036  612  PHE A N   
28   C  CA  . PHE A 26  ? 0.6418 0.2820 0.6924 0.0610  -0.1127 0.0139  612  PHE A CA  
29   C  C   . PHE A 26  ? 0.5895 0.2762 0.6485 0.0371  -0.1229 0.0253  612  PHE A C   
30   O  O   . PHE A 26  ? 0.5941 0.3269 0.6641 0.0444  -0.0997 0.0215  612  PHE A O   
31   C  CB  . PHE A 26  ? 0.6722 0.2800 0.7083 0.0982  -0.1028 0.0191  612  PHE A CB  
32   C  CG  . PHE A 26  ? 0.7087 0.2788 0.7182 0.1097  -0.0961 0.0184  612  PHE A CG  
33   C  CD1 . PHE A 26  ? 0.7316 0.2792 0.7217 0.1059  -0.0873 0.0001  612  PHE A CD1 
34   C  CD2 . PHE A 26  ? 0.7286 0.2913 0.7251 0.1034  -0.0894 0.0086  612  PHE A CD2 
35   C  CE1 . PHE A 26  ? 0.7437 0.2719 0.7245 0.1184  -0.0852 -0.0011 612  PHE A CE1 
36   C  CE2 . PHE A 26  ? 0.7415 0.2979 0.7273 0.1126  -0.0867 0.0018  612  PHE A CE2 
37   C  CZ  . PHE A 26  ? 0.7474 0.2899 0.7267 0.1188  -0.0852 0.0000  612  PHE A CZ  
38   N  N   . ALA A 27  ? 0.5236 0.2360 0.5858 -0.0025 -0.1647 0.0192  613  ALA A N   
39   C  CA  . ALA A 27  ? 0.4807 0.2292 0.5422 -0.0403 -0.1659 0.0046  613  ALA A CA  
40   C  C   . ALA A 27  ? 0.4749 0.2461 0.5075 -0.0222 -0.1308 0.0271  613  ALA A C   
41   O  O   . ALA A 27  ? 0.4898 0.2558 0.5183 -0.0575 -0.1184 0.0414  613  ALA A O   
42   C  CB  . ALA A 27  ? 0.4651 0.1806 0.5416 -0.0492 -0.1669 -0.0029 613  ALA A CB  
43   N  N   . LYS A 28  ? 0.4391 0.2108 0.4623 0.0009  -0.1141 0.0134  614  LYS A N   
44   C  CA  . LYS A 28  ? 0.4262 0.2574 0.4182 0.0077  -0.0861 0.0074  614  LYS A CA  
45   C  C   . LYS A 28  ? 0.3594 0.1967 0.3604 -0.0268 -0.1014 -0.0268 614  LYS A C   
46   O  O   . LYS A 28  ? 0.3390 0.2133 0.3140 -0.0209 -0.0962 -0.0365 614  LYS A O   
47   C  CB  . LYS A 28  ? 0.4776 0.3475 0.4350 0.0136  -0.0415 0.0154  614  LYS A CB  
48   C  CG  . LYS A 28  ? 0.5235 0.4217 0.4374 0.0371  -0.0147 0.0215  614  LYS A CG  
49   C  CD  . LYS A 28  ? 0.5544 0.4763 0.4345 0.0639  -0.0010 0.0364  614  LYS A CD  
50   C  CE  . LYS A 28  ? 0.5776 0.5243 0.4394 0.0811  0.0013  0.0289  614  LYS A CE  
51   N  NZ  . LYS A 28  ? 0.5879 0.5680 0.4374 0.0860  0.0064  0.0047  614  LYS A NZ  
52   N  N   . GLU A 29  ? 0.3250 0.2327 0.3685 -0.0380 -0.0926 -0.0102 615  GLU A N   
53   C  CA  . GLU A 29  ? 0.3076 0.1952 0.3639 -0.0580 -0.0771 0.0006  615  GLU A CA  
54   C  C   . GLU A 29  ? 0.3366 0.2182 0.3347 -0.0288 -0.0730 0.0044  615  GLU A C   
55   O  O   . GLU A 29  ? 0.4103 0.2452 0.3431 -0.0144 -0.0707 -0.0285 615  GLU A O   
56   C  CB  . GLU A 29  ? 0.2845 0.2119 0.3766 -0.0738 -0.0817 -0.0057 615  GLU A CB  
57   C  CG  . GLU A 29  ? 0.3036 0.2370 0.3721 -0.0545 -0.0683 -0.0055 615  GLU A CG  
58   C  CD  . GLU A 29  ? 0.3008 0.2506 0.3608 -0.0640 -0.0708 0.0008  615  GLU A CD  
59   O  OE1 . GLU A 29  ? 0.3432 0.2382 0.3721 -0.0838 -0.0381 0.0108  615  GLU A OE1 
60   O  OE2 . GLU A 29  ? 0.2837 0.2497 0.3492 -0.0371 -0.0852 0.0010  615  GLU A OE2 
61   N  N   . LEU A 30  ? 0.2903 0.1560 0.2953 -0.0545 -0.0632 0.0240  616  LEU A N   
62   C  CA  . LEU A 30  ? 0.2671 0.1980 0.2811 -0.0521 -0.0643 0.0310  616  LEU A CA  
63   C  C   . LEU A 30  ? 0.2530 0.2603 0.3119 -0.0666 -0.0380 0.0624  616  LEU A C   
64   O  O   . LEU A 30  ? 0.2942 0.3332 0.3343 -0.0529 0.0009  0.0839  616  LEU A O   
65   C  CB  . LEU A 30  ? 0.2674 0.1697 0.2511 -0.0288 -0.0594 -0.0021 616  LEU A CB  
66   C  CG  . LEU A 30  ? 0.2824 0.1639 0.2185 -0.0361 -0.0540 -0.0093 616  LEU A CG  
67   C  CD1 . LEU A 30  ? 0.2893 0.1465 0.2137 -0.0660 -0.0570 0.0017  616  LEU A CD1 
68   C  CD2 . LEU A 30  ? 0.3091 0.2008 0.1983 -0.0461 -0.0433 -0.0153 616  LEU A CD2 
69   N  N   . ASP A 31  ? 0.2422 0.2923 0.3284 -0.0746 -0.0639 0.0690  617  ASP A N   
70   C  CA  . ASP A 31  ? 0.2805 0.3408 0.3624 -0.0501 -0.0615 0.0519  617  ASP A CA  
71   C  C   . ASP A 31  ? 0.2592 0.3591 0.3702 -0.0292 -0.0650 0.0577  617  ASP A C   
72   O  O   . ASP A 31  ? 0.2209 0.3593 0.3772 -0.0355 -0.0954 0.0710  617  ASP A O   
73   C  CB  . ASP A 31  ? 0.3163 0.4058 0.3835 -0.0737 -0.0694 0.0157  617  ASP A CB  
74   C  CG  . ASP A 31  ? 0.3715 0.5159 0.4094 -0.0974 -0.0535 -0.0215 617  ASP A CG  
75   O  OD1 . ASP A 31  ? 0.3791 0.5413 0.4162 -0.1093 -0.0465 -0.0294 617  ASP A OD1 
76   O  OD2 . ASP A 31  ? 0.4049 0.5684 0.4278 -0.0860 -0.0500 -0.0144 617  ASP A OD2 
77   N  N   . ALA A 32  ? 0.2490 0.3431 0.3643 -0.0112 -0.0500 0.0574  618  ALA A N   
78   C  CA  . ALA A 32  ? 0.2480 0.4020 0.3621 -0.0087 -0.0169 0.0413  618  ALA A CA  
79   C  C   . ALA A 32  ? 0.2375 0.3807 0.3458 -0.0173 -0.0279 0.0457  618  ALA A C   
80   O  O   . ALA A 32  ? 0.2572 0.3910 0.3305 -0.0076 -0.0363 0.0668  618  ALA A O   
81   C  CB  . ALA A 32  ? 0.2766 0.4313 0.3752 0.0026  0.0044  0.0229  618  ALA A CB  
82   N  N   . THR A 33  ? 0.1981 0.3785 0.3453 0.0079  -0.0470 0.0363  619  THR A N   
83   C  CA  . THR A 33  ? 0.2298 0.3867 0.3389 -0.0190 -0.0799 0.0220  619  THR A CA  
84   C  C   . THR A 33  ? 0.2593 0.3065 0.2969 -0.0009 -0.0712 0.0320  619  THR A C   
85   O  O   . THR A 33  ? 0.2942 0.2985 0.2935 0.0036  -0.0531 0.0249  619  THR A O   
86   C  CB  . THR A 33  ? 0.2881 0.4553 0.3833 -0.0633 -0.0834 -0.0034 619  THR A CB  
87   O  OG1 . THR A 33  ? 0.3574 0.5084 0.4034 -0.1031 -0.0742 -0.0106 619  THR A OG1 
88   C  CG2 . THR A 33  ? 0.3222 0.4812 0.4100 -0.0930 -0.0722 -0.0117 619  THR A CG2 
89   N  N   . ASN A 34  ? 0.2212 0.2381 0.2764 -0.0293 -0.0938 0.0069  620  ASN A N   
90   C  CA  . ASN A 34  ? 0.2506 0.1903 0.2491 -0.0213 -0.0930 -0.0063 620  ASN A CA  
91   C  C   . ASN A 34  ? 0.2510 0.1876 0.2233 0.0062  -0.0818 -0.0123 620  ASN A C   
92   O  O   . ASN A 34  ? 0.2498 0.1820 0.2227 -0.0029 -0.0581 -0.0163 620  ASN A O   
93   C  CB  . ASN A 34  ? 0.2883 0.1797 0.2206 -0.0285 -0.1034 -0.0123 620  ASN A CB  
94   C  CG  . ASN A 34  ? 0.3531 0.2360 0.2390 -0.0315 -0.1078 -0.0246 620  ASN A CG  
95   O  OD1 . ASN A 34  ? 0.4088 0.2952 0.2392 -0.0512 -0.1093 0.0060  620  ASN A OD1 
96   N  ND2 . ASN A 34  ? 0.3748 0.2016 0.2669 -0.0334 -0.0860 -0.0323 620  ASN A ND2 
97   N  N   . ILE A 35  ? 0.2467 0.2040 0.2185 -0.0088 -0.0788 -0.0199 621  ILE A N   
98   C  CA  . ILE A 35  ? 0.2454 0.2129 0.2508 0.0083  -0.0632 -0.0393 621  ILE A CA  
99   C  C   . ILE A 35  ? 0.2369 0.2516 0.3083 0.0216  -0.0439 -0.0639 621  ILE A C   
100  O  O   . ILE A 35  ? 0.2563 0.3006 0.3526 0.0335  -0.0215 -0.0568 621  ILE A O   
101  C  CB  . ILE A 35  ? 0.2607 0.2536 0.2410 0.0263  -0.0701 -0.0508 621  ILE A CB  
102  C  CG1 . ILE A 35  ? 0.2679 0.2500 0.2368 0.0226  -0.0451 -0.0216 621  ILE A CG1 
103  C  CG2 . ILE A 35  ? 0.2883 0.3114 0.2460 0.0006  -0.0652 -0.0851 621  ILE A CG2 
104  C  CD1 . ILE A 35  ? 0.2664 0.2875 0.2387 0.0353  -0.0416 0.0171  621  ILE A CD1 
105  N  N   . SER A 36  ? 0.2336 0.2312 0.3324 0.0209  -0.0509 -0.0946 622  SER A N   
106  C  CA  . SER A 36  ? 0.2395 0.2637 0.3659 0.0482  -0.0703 -0.0960 622  SER A CA  
107  C  C   . SER A 36  ? 0.2731 0.2455 0.3931 0.0510  -0.0606 -0.1344 622  SER A C   
108  O  O   . SER A 36  ? 0.2783 0.2432 0.3889 0.0408  -0.0662 -0.1150 622  SER A O   
109  C  CB  . SER A 36  ? 0.2766 0.3386 0.3916 0.0499  -0.0445 -0.0591 622  SER A CB  
110  O  OG  . SER A 36  ? 0.3309 0.3943 0.4230 0.0681  -0.0075 -0.0165 622  SER A OG  
111  N  N   . ILE A 37  ? 0.3099 0.3124 0.4317 0.0244  -0.0574 -0.1637 623  ILE A N   
112  C  CA  . ILE A 37  ? 0.3884 0.3648 0.4714 0.0400  -0.0416 -0.1673 623  ILE A CA  
113  C  C   . ILE A 37  ? 0.4295 0.3844 0.4974 0.0986  -0.0682 -0.1601 623  ILE A C   
114  O  O   . ILE A 37  ? 0.4253 0.4127 0.5082 0.1310  -0.0763 -0.1582 623  ILE A O   
115  C  CB  . ILE A 37  ? 0.4287 0.4333 0.4942 0.0213  -0.0100 -0.1625 623  ILE A CB  
116  C  CG1 . ILE A 37  ? 0.4360 0.4629 0.5155 0.0079  -0.0079 -0.1395 623  ILE A CG1 
117  C  CG2 . ILE A 37  ? 0.4404 0.4520 0.5012 0.0140  0.0058  -0.1565 623  ILE A CG2 
118  C  CD1 . ILE A 37  ? 0.4457 0.5073 0.5351 -0.0046 -0.0067 -0.1265 623  ILE A CD1 
119  N  N   . ASP A 38  ? 0.4662 0.3261 0.5136 0.1204  -0.0838 -0.1635 624  ASP A N   
120  C  CA  . ASP A 38  ? 0.5412 0.3552 0.5602 0.1264  -0.0822 -0.1370 624  ASP A CA  
121  C  C   . ASP A 38  ? 0.5743 0.3363 0.5838 0.1327  -0.0925 -0.1405 624  ASP A C   
122  O  O   . ASP A 38  ? 0.5853 0.3483 0.5981 0.1739  -0.1013 -0.1538 624  ASP A O   
123  C  CB  . ASP A 38  ? 0.5857 0.4224 0.5914 0.1331  -0.0672 -0.1119 624  ASP A CB  
124  C  CG  . ASP A 38  ? 0.6223 0.5117 0.6273 0.1480  -0.0563 -0.0714 624  ASP A CG  
125  O  OD1 . ASP A 38  ? 0.6330 0.5537 0.6457 0.1178  -0.0519 -0.0618 624  ASP A OD1 
126  O  OD2 . ASP A 38  ? 0.6493 0.4977 0.6388 0.1480  -0.0456 -0.0573 624  ASP A OD2 
127  N  N   . LYS A 39  ? 0.5871 0.3150 0.5876 0.1347  -0.0946 -0.1335 625  LYS A N   
128  C  CA  . LYS A 39  ? 0.6154 0.3503 0.5996 0.1004  -0.0942 -0.1088 625  LYS A CA  
129  C  C   . LYS A 39  ? 0.6163 0.3309 0.5716 0.0927  -0.0921 -0.1471 625  LYS A C   
130  O  O   . LYS A 39  ? 0.6067 0.2530 0.5613 0.1067  -0.0812 -0.1454 625  LYS A O   
131  C  CB  . LYS A 39  ? 0.6508 0.4500 0.6402 0.0850  -0.0813 -0.0562 625  LYS A CB  
132  C  CG  . LYS A 39  ? 0.6744 0.5230 0.6817 0.0745  -0.0621 -0.0105 625  LYS A CG  
133  C  CD  . LYS A 39  ? 0.6846 0.5643 0.7130 0.0642  -0.0470 0.0187  625  LYS A CD  
134  C  CE  . LYS A 39  ? 0.6893 0.5885 0.7301 0.0723  -0.0424 0.0362  625  LYS A CE  
135  N  NZ  . LYS A 39  ? 0.6962 0.5984 0.7383 0.0790  -0.0397 0.0396  625  LYS A NZ  
136  N  N   . VAL A 40  ? 0.6179 0.3614 0.5557 0.0915  -0.0842 -0.1531 626  VAL A N   
137  C  CA  . VAL A 40  ? 0.6269 0.3840 0.5536 0.0608  -0.0669 -0.1588 626  VAL A CA  
138  C  C   . VAL A 40  ? 0.6335 0.3735 0.5449 -0.0163 -0.0692 -0.1765 626  VAL A C   
139  O  O   . VAL A 40  ? 0.6501 0.3621 0.5610 -0.0253 -0.0596 -0.1607 626  VAL A O   
140  C  CB  . VAL A 40  ? 0.6225 0.4268 0.5592 0.0912  -0.0707 -0.1262 626  VAL A CB  
141  C  CG1 . VAL A 40  ? 0.6286 0.4615 0.5548 0.0873  -0.0735 -0.1218 626  VAL A CG1 
142  C  CG2 . VAL A 40  ? 0.6016 0.4249 0.5677 0.1140  -0.0778 -0.1178 626  VAL A CG2 
143  N  N   . VAL A 41  ? 0.6253 0.3952 0.5276 -0.0670 -0.0817 -0.1676 627  VAL A N   
144  C  CA  . VAL A 41  ? 0.6190 0.4199 0.5172 -0.1133 -0.0796 -0.1395 627  VAL A CA  
145  C  C   . VAL A 41  ? 0.6285 0.4648 0.4956 -0.1531 -0.0893 -0.1466 627  VAL A C   
146  O  O   . VAL A 41  ? 0.6244 0.4966 0.5084 -0.1581 -0.0836 -0.1251 627  VAL A O   
147  C  CB  . VAL A 41  ? 0.6022 0.4233 0.5353 -0.1385 -0.0724 -0.1199 627  VAL A CB  
148  C  CG1 . VAL A 41  ? 0.6042 0.4396 0.5444 -0.1260 -0.0658 -0.1082 627  VAL A CG1 
149  C  CG2 . VAL A 41  ? 0.5952 0.4298 0.5429 -0.1264 -0.0638 -0.0955 627  VAL A CG2 
150  N  N   . GLY A 42  ? 0.6393 0.4849 0.4646 -0.1780 -0.0981 -0.1393 628  GLY A N   
151  C  CA  . GLY A 42  ? 0.6563 0.5176 0.4622 -0.1802 -0.0866 -0.1130 628  GLY A CA  
152  C  C   . GLY A 42  ? 0.6701 0.5176 0.4448 -0.1819 -0.0875 -0.1079 628  GLY A C   
153  O  O   . GLY A 42  ? 0.6661 0.5024 0.4323 -0.1583 -0.0907 -0.1331 628  GLY A O   
154  N  N   . ALA A 43  ? 0.6805 0.5502 0.4391 -0.1904 -0.0981 -0.0845 629  ALA A N   
155  C  CA  . ALA A 43  ? 0.6764 0.5766 0.4370 -0.1958 -0.0941 -0.0674 629  ALA A CA  
156  C  C   . ALA A 43  ? 0.6608 0.6150 0.4323 -0.1905 -0.1054 -0.0500 629  ALA A C   
157  O  O   . ALA A 43  ? 0.6662 0.6382 0.4451 -0.1645 -0.0987 -0.0396 629  ALA A O   
158  C  CB  . ALA A 43  ? 0.6865 0.5694 0.4525 -0.1844 -0.0748 -0.0472 629  ALA A CB  
159  N  N   . GLY A 44  ? 0.6345 0.6385 0.4231 -0.2008 -0.1174 -0.0415 630  GLY A N   
160  C  CA  . GLY A 44  ? 0.6134 0.6739 0.4194 -0.1912 -0.1300 -0.0516 630  GLY A CA  
161  C  C   . GLY A 44  ? 0.5960 0.7056 0.4192 -0.1725 -0.1407 -0.0508 630  GLY A C   
162  O  O   . GLY A 44  ? 0.6088 0.7122 0.4166 -0.1792 -0.1307 -0.0618 630  GLY A O   
163  N  N   . GLU A 45  ? 0.5542 0.7280 0.4213 -0.1451 -0.1585 -0.0333 631  GLU A N   
164  C  CA  . GLU A 45  ? 0.5315 0.7478 0.4258 -0.1085 -0.1546 -0.0104 631  GLU A CA  
165  C  C   . GLU A 45  ? 0.4991 0.6624 0.4012 -0.0902 -0.1365 -0.0352 631  GLU A C   
166  O  O   . GLU A 45  ? 0.5166 0.6324 0.4030 -0.0741 -0.1230 -0.0475 631  GLU A O   
167  C  CB  . GLU A 45  ? 0.5461 0.8628 0.4586 -0.0973 -0.1580 0.0134  631  GLU A CB  
168  C  CG  . GLU A 45  ? 0.5661 0.9708 0.4818 -0.0717 -0.1612 0.0424  631  GLU A CG  
169  C  CD  . GLU A 45  ? 0.5917 1.0663 0.5036 -0.0538 -0.1567 0.0640  631  GLU A CD  
170  O  OE1 . GLU A 45  ? 0.6077 1.1041 0.5059 -0.0460 -0.1504 0.0621  631  GLU A OE1 
171  O  OE2 . GLU A 45  ? 0.5895 1.0993 0.5149 -0.0453 -0.1676 0.0770  631  GLU A OE2 
172  N  N   . PHE A 46  ? 0.4562 0.6278 0.3743 -0.0692 -0.1289 -0.0478 632  PHE A N   
173  C  CA  . PHE A 46  ? 0.4377 0.5999 0.3719 -0.0474 -0.0900 -0.0539 632  PHE A CA  
174  C  C   . PHE A 46  ? 0.4012 0.5851 0.3502 -0.0614 -0.0774 -0.0779 632  PHE A C   
175  O  O   . PHE A 46  ? 0.3433 0.5729 0.3418 -0.0968 -0.0706 -0.0699 632  PHE A O   
176  C  CB  . PHE A 46  ? 0.4459 0.6013 0.3879 -0.0150 -0.0892 -0.0437 632  PHE A CB  
177  C  CG  . PHE A 46  ? 0.4446 0.6117 0.3965 0.0210  -0.0960 -0.0235 632  PHE A CG  
178  C  CD1 . PHE A 46  ? 0.4444 0.6141 0.3974 0.0313  -0.0991 -0.0094 632  PHE A CD1 
179  C  CD2 . PHE A 46  ? 0.4466 0.6147 0.4103 0.0561  -0.0848 -0.0101 632  PHE A CD2 
180  C  CE1 . PHE A 46  ? 0.4596 0.6282 0.4156 0.0517  -0.0742 0.0055  632  PHE A CE1 
181  C  CE2 . PHE A 46  ? 0.4519 0.6212 0.4178 0.0634  -0.0672 0.0002  632  PHE A CE2 
182  C  CZ  . PHE A 46  ? 0.4618 0.6348 0.4191 0.0610  -0.0659 0.0092  632  PHE A CZ  
183  N  N   . GLY A 47  ? 0.4072 0.5750 0.3490 -0.0727 -0.0895 -0.1167 633  GLY A N   
184  C  CA  . GLY A 47  ? 0.4301 0.5800 0.3623 -0.0673 -0.0761 -0.1198 633  GLY A CA  
185  C  C   . GLY A 47  ? 0.4503 0.5924 0.3671 -0.0787 -0.0601 -0.1233 633  GLY A C   
186  O  O   . GLY A 47  ? 0.4476 0.6121 0.3591 -0.0885 -0.0841 -0.0900 633  GLY A O   
187  N  N   . GLU A 48  ? 0.4784 0.5922 0.3817 -0.0935 -0.0359 -0.1520 634  GLU A N   
188  C  CA  . GLU A 48  ? 0.5087 0.6128 0.3997 -0.1161 -0.0166 -0.1343 634  GLU A CA  
189  C  C   . GLU A 48  ? 0.4511 0.5226 0.3558 -0.1369 -0.0249 -0.1411 634  GLU A C   
190  O  O   . GLU A 48  ? 0.4550 0.4723 0.3308 -0.1374 -0.0097 -0.1535 634  GLU A O   
191  C  CB  . GLU A 48  ? 0.6123 0.7108 0.4699 -0.1291 0.0092  -0.0997 634  GLU A CB  
192  C  CG  . GLU A 48  ? 0.7138 0.8087 0.5341 -0.1616 0.0319  -0.0805 634  GLU A CG  
193  C  CD  . GLU A 48  ? 0.7977 0.9034 0.5921 -0.1877 0.0685  -0.0664 634  GLU A CD  
194  O  OE1 . GLU A 48  ? 0.8200 0.9338 0.6138 -0.2014 0.0581  -0.0690 634  GLU A OE1 
195  O  OE2 . GLU A 48  ? 0.8310 0.9280 0.6170 -0.1832 0.0881  -0.0502 634  GLU A OE2 
196  N  N   . VAL A 49  ? 0.4149 0.4606 0.3445 -0.1247 -0.0200 -0.1379 635  VAL A N   
197  C  CA  . VAL A 49  ? 0.3883 0.4277 0.3414 -0.1141 -0.0155 -0.1206 635  VAL A CA  
198  C  C   . VAL A 49  ? 0.3840 0.3485 0.3319 -0.0919 -0.0090 -0.1464 635  VAL A C   
199  O  O   . VAL A 49  ? 0.4059 0.3344 0.3327 -0.0961 -0.0090 -0.1474 635  VAL A O   
200  C  CB  . VAL A 49  ? 0.3932 0.5024 0.3554 -0.0759 0.0018  -0.0704 635  VAL A CB  
201  C  CG1 . VAL A 49  ? 0.3817 0.5127 0.3516 -0.0734 0.0023  -0.0553 635  VAL A CG1 
202  C  CG2 . VAL A 49  ? 0.3919 0.5303 0.3556 -0.0709 -0.0045 -0.0559 635  VAL A CG2 
203  N  N   . CYS A 50  ? 0.3835 0.3336 0.3270 -0.0283 0.0205  -0.1318 636  CYS A N   
204  C  CA  . CYS A 50  ? 0.3807 0.3299 0.3310 0.0106  0.0291  -0.1318 636  CYS A CA  
205  C  C   . CYS A 50  ? 0.3543 0.2502 0.3058 -0.0061 -0.0051 -0.1175 636  CYS A C   
206  O  O   . CYS A 50  ? 0.3539 0.2090 0.3299 0.0026  0.0348  -0.0781 636  CYS A O   
207  C  CB  . CYS A 50  ? 0.4081 0.4263 0.3501 0.0287  0.0344  -0.1374 636  CYS A CB  
208  S  SG  . CYS A 50  ? 0.4525 0.5621 0.3753 0.0310  0.0505  -0.1482 636  CYS A SG  
209  N  N   . SER A 51  ? 0.3592 0.2280 0.2870 0.0075  -0.0413 -0.1093 637  SER A N   
210  C  CA  . SER A 51  ? 0.3585 0.2137 0.2767 0.0160  -0.0726 -0.0964 637  SER A CA  
211  C  C   . SER A 51  ? 0.3005 0.1987 0.2760 0.0504  -0.0904 -0.0895 637  SER A C   
212  O  O   . SER A 51  ? 0.2931 0.2463 0.3053 0.0604  -0.0872 -0.1145 637  SER A O   
213  C  CB  . SER A 51  ? 0.4263 0.3025 0.3151 -0.0013 -0.0573 -0.0444 637  SER A CB  
214  O  OG  . SER A 51  ? 0.4842 0.2769 0.3492 -0.0512 -0.0295 -0.0322 637  SER A OG  
215  N  N   . GLY A 52  ? 0.2684 0.1542 0.2539 0.0167  -0.0857 -0.0814 638  GLY A N   
216  C  CA  . GLY A 52  ? 0.2707 0.1705 0.2572 0.0385  -0.0720 -0.0876 638  GLY A CA  
217  C  C   . GLY A 52  ? 0.2584 0.1029 0.2467 0.0124  -0.0764 -0.0507 638  GLY A C   
218  O  O   . GLY A 52  ? 0.2313 0.1292 0.2521 0.0169  -0.0563 -0.0340 638  GLY A O   
219  N  N   . ARG A 53  ? 0.2757 0.1188 0.2423 0.0052  -0.0901 -0.0461 639  ARG A N   
220  C  CA  . ARG A 53  ? 0.2669 0.1002 0.2330 -0.0103 -0.0951 -0.0296 639  ARG A CA  
221  C  C   . ARG A 53  ? 0.2334 0.1141 0.2274 0.0085  -0.0846 -0.0311 639  ARG A C   
222  O  O   . ARG A 53  ? 0.2170 0.1511 0.2696 -0.0011 -0.0384 -0.0453 639  ARG A O   
223  C  CB  . ARG A 53  ? 0.3194 0.1164 0.2673 -0.0073 -0.0897 -0.0098 639  ARG A CB  
224  C  CG  . ARG A 53  ? 0.3905 0.1858 0.3008 -0.0026 -0.0455 0.0094  639  ARG A CG  
225  C  CD  . ARG A 53  ? 0.4784 0.2612 0.2976 0.0004  -0.0135 0.0394  639  ARG A CD  
226  N  NE  . ARG A 53  ? 0.5499 0.3129 0.2969 -0.0505 -0.0131 0.0643  639  ARG A NE  
227  C  CZ  . ARG A 53  ? 0.5940 0.4121 0.3022 -0.1107 -0.0047 0.0954  639  ARG A CZ  
228  N  NH1 . ARG A 53  ? 0.6249 0.4441 0.3231 -0.0786 0.0025  0.1032  639  ARG A NH1 
229  N  NH2 . ARG A 53  ? 0.6021 0.4476 0.2935 -0.1548 -0.0132 0.1128  639  ARG A NH2 
230  N  N   . LEU A 54  ? 0.2482 0.0965 0.1785 0.0320  -0.0825 -0.0186 640  LEU A N   
231  C  CA  . LEU A 54  ? 0.2557 0.1125 0.1615 0.0194  -0.0575 -0.0268 640  LEU A CA  
232  C  C   . LEU A 54  ? 0.2342 0.1165 0.1611 0.0066  -0.0546 -0.0166 640  LEU A C   
233  O  O   . LEU A 54  ? 0.2376 0.1145 0.1922 -0.0014 -0.0623 -0.0128 640  LEU A O   
234  C  CB  . LEU A 54  ? 0.2484 0.1082 0.1807 0.0168  -0.0642 -0.0003 640  LEU A CB  
235  C  CG  . LEU A 54  ? 0.2187 0.0908 0.1904 -0.0179 -0.0491 0.0080  640  LEU A CG  
236  C  CD1 . LEU A 54  ? 0.2311 0.1324 0.2139 -0.0239 -0.0382 0.0120  640  LEU A CD1 
237  C  CD2 . LEU A 54  ? 0.2327 0.1230 0.1930 0.0043  -0.0433 0.0260  640  LEU A CD2 
238  N  N   . LYS A 55  ? 0.2341 0.1085 0.1633 0.0153  -0.0854 -0.0228 641  LYS A N   
239  C  CA  . LYS A 55  ? 0.2370 0.1265 0.1822 0.0129  -0.0943 -0.0382 641  LYS A CA  
240  C  C   . LYS A 55  ? 0.2415 0.1257 0.1963 0.0017  -0.0678 -0.0133 641  LYS A C   
241  O  O   . LYS A 55  ? 0.2482 0.1529 0.2061 0.0089  -0.0446 -0.0245 641  LYS A O   
242  C  CB  . LYS A 55  ? 0.2637 0.1893 0.1797 0.0191  -0.1235 -0.0291 641  LYS A CB  
243  C  CG  . LYS A 55  ? 0.2984 0.2870 0.1947 0.0132  -0.1211 -0.0138 641  LYS A CG  
244  C  CD  . LYS A 55  ? 0.3202 0.3100 0.1971 -0.0018 -0.1093 0.0113  641  LYS A CD  
245  C  CE  . LYS A 55  ? 0.2977 0.2517 0.2098 -0.0030 -0.0753 0.0036  641  LYS A CE  
246  N  NZ  . LYS A 55  ? 0.2629 0.1983 0.2108 0.0010  -0.0615 -0.0196 641  LYS A NZ  
247  N  N   . LEU A 56  ? 0.2581 0.1010 0.1745 0.0216  -0.0716 -0.0072 642  LEU A N   
248  C  CA  . LEU A 56  ? 0.2693 0.1019 0.1816 0.0321  -0.0605 -0.0101 642  LEU A CA  
249  C  C   . LEU A 56  ? 0.3070 0.1058 0.1674 0.0088  -0.0761 -0.0148 642  LEU A C   
250  O  O   . LEU A 56  ? 0.2981 0.1275 0.1710 0.0055  -0.0820 -0.0099 642  LEU A O   
251  C  CB  . LEU A 56  ? 0.2566 0.1287 0.1949 0.0312  -0.0516 -0.0107 642  LEU A CB  
252  C  CG  . LEU A 56  ? 0.2643 0.1694 0.1947 0.0318  -0.0709 -0.0136 642  LEU A CG  
253  C  CD1 . LEU A 56  ? 0.2791 0.2313 0.2043 0.0381  -0.0590 0.0131  642  LEU A CD1 
254  C  CD2 . LEU A 56  ? 0.2774 0.1942 0.2006 0.0145  -0.0676 -0.0133 642  LEU A CD2 
255  N  N   . PRO A 57  ? 0.3430 0.0988 0.1793 0.0114  -0.0910 -0.0146 643  PRO A N   
256  C  CA  . PRO A 57  ? 0.3509 0.1058 0.1927 -0.0128 -0.0938 -0.0110 643  PRO A CA  
257  C  C   . PRO A 57  ? 0.3481 0.1020 0.1858 -0.0176 -0.0812 -0.0126 643  PRO A C   
258  O  O   . PRO A 57  ? 0.3781 0.1378 0.2076 -0.0242 -0.1103 -0.0289 643  PRO A O   
259  C  CB  . PRO A 57  ? 0.3660 0.1020 0.2094 -0.0067 -0.0852 0.0034  643  PRO A CB  
260  C  CG  . PRO A 57  ? 0.3601 0.0992 0.2074 0.0060  -0.0684 0.0137  643  PRO A CG  
261  C  CD  . PRO A 57  ? 0.3636 0.0973 0.1906 0.0041  -0.0682 0.0048  643  PRO A CD  
262  N  N   . SER A 58  ? 0.3424 0.0915 0.1800 0.0057  -0.0644 -0.0039 644  SER A N   
263  C  CA  . SER A 58  ? 0.3238 0.1104 0.1878 0.0177  -0.0864 -0.0209 644  SER A CA  
264  C  C   . SER A 58  ? 0.3205 0.0944 0.1823 0.0224  -0.0875 -0.0004 644  SER A C   
265  O  O   . SER A 58  ? 0.3521 0.1503 0.1971 0.0132  -0.0738 0.0171  644  SER A O   
266  C  CB  . SER A 58  ? 0.3308 0.1307 0.2368 0.0282  -0.0589 -0.0037 644  SER A CB  
267  O  OG  . SER A 58  ? 0.3269 0.1391 0.2417 0.0452  -0.0502 0.0009  644  SER A OG  
268  N  N   . LYS A 59  ? 0.3025 0.0980 0.1776 0.0096  -0.0871 -0.0278 645  LYS A N   
269  C  CA  . LYS A 59  ? 0.2841 0.0893 0.1788 0.0052  -0.0933 -0.0068 645  LYS A CA  
270  C  C   . LYS A 59  ? 0.2731 0.1357 0.1803 0.0067  -0.0748 0.0042  645  LYS A C   
271  O  O   . LYS A 59  ? 0.2803 0.1083 0.2097 0.0181  -0.0666 -0.0088 645  LYS A O   
272  C  CB  . LYS A 59  ? 0.3051 0.1399 0.2019 0.0194  -0.1034 0.0070  645  LYS A CB  
273  C  CG  . LYS A 59  ? 0.3168 0.1816 0.2144 0.0242  -0.1070 -0.0152 645  LYS A CG  
274  C  CD  . LYS A 59  ? 0.3457 0.1898 0.2412 -0.0245 -0.0935 -0.0328 645  LYS A CD  
275  C  CE  . LYS A 59  ? 0.3807 0.2596 0.2684 -0.0512 -0.0779 -0.0568 645  LYS A CE  
276  N  NZ  . LYS A 59  ? 0.3874 0.3064 0.2947 -0.0568 -0.0713 -0.0333 645  LYS A NZ  
277  N  N   . LYS A 60  ? 0.2632 0.1217 0.1757 -0.0096 -0.0682 0.0050  646  LYS A N   
278  C  CA  . LYS A 60  ? 0.2557 0.1675 0.1916 -0.0007 -0.0778 0.0074  646  LYS A CA  
279  C  C   . LYS A 60  ? 0.2829 0.1028 0.1832 0.0009  -0.0811 0.0056  646  LYS A C   
280  O  O   . LYS A 60  ? 0.3052 0.1262 0.1957 0.0131  -0.0523 0.0141  646  LYS A O   
281  C  CB  . LYS A 60  ? 0.2426 0.1721 0.2440 -0.0078 -0.0460 0.0018  646  LYS A CB  
282  C  CG  . LYS A 60  ? 0.2461 0.2173 0.2994 -0.0065 -0.0327 -0.0261 646  LYS A CG  
283  C  CD  . LYS A 60  ? 0.2571 0.3509 0.3544 0.0147  -0.0440 -0.0645 646  LYS A CD  
284  C  CE  . LYS A 60  ? 0.2816 0.5005 0.3919 0.0577  -0.0419 -0.0804 646  LYS A CE  
285  N  NZ  . LYS A 60  ? 0.3243 0.5911 0.4181 0.0465  -0.0161 -0.0832 646  LYS A NZ  
286  N  N   . GLU A 61  ? 0.2771 0.0951 0.1824 0.0109  -0.0823 0.0059  647  GLU A N   
287  C  CA  . GLU A 61  ? 0.2676 0.1087 0.2049 -0.0006 -0.0808 0.0025  647  GLU A CA  
288  C  C   . GLU A 61  ? 0.2392 0.1507 0.1931 -0.0260 -0.0829 0.0110  647  GLU A C   
289  O  O   . GLU A 61  ? 0.2618 0.1795 0.2095 -0.0415 -0.0656 0.0333  647  GLU A O   
290  C  CB  . GLU A 61  ? 0.2934 0.1213 0.2226 0.0369  -0.0864 -0.0128 647  GLU A CB  
291  C  CG  . GLU A 61  ? 0.2968 0.1783 0.2531 0.0419  -0.1055 -0.0065 647  GLU A CG  
292  C  CD  . GLU A 61  ? 0.3353 0.1832 0.2890 0.0046  -0.0798 -0.0325 647  GLU A CD  
293  O  OE1 . GLU A 61  ? 0.3511 0.2178 0.3241 0.0220  -0.0690 -0.0119 647  GLU A OE1 
294  O  OE2 . GLU A 61  ? 0.3627 0.1757 0.2710 0.0068  -0.0607 -0.0321 647  GLU A OE2 
295  N  N   . ILE A 62  ? 0.2401 0.1355 0.1812 -0.0096 -0.0791 -0.0056 648  ILE A N   
296  C  CA  . ILE A 62  ? 0.2378 0.1329 0.1713 0.0095  -0.0645 -0.0099 648  ILE A CA  
297  C  C   . ILE A 62  ? 0.2419 0.1231 0.1918 -0.0026 -0.0535 -0.0110 648  ILE A C   
298  O  O   . ILE A 62  ? 0.2165 0.1419 0.2102 -0.0003 -0.0590 -0.0234 648  ILE A O   
299  C  CB  . ILE A 62  ? 0.2446 0.1550 0.1769 0.0081  -0.0281 0.0187  648  ILE A CB  
300  C  CG1 . ILE A 62  ? 0.2469 0.1310 0.1809 0.0185  -0.0701 0.0293  648  ILE A CG1 
301  C  CG2 . ILE A 62  ? 0.2692 0.1974 0.1857 0.0117  -0.0124 0.0188  648  ILE A CG2 
302  C  CD1 . ILE A 62  ? 0.2513 0.1656 0.1847 0.0176  -0.0722 0.0252  648  ILE A CD1 
303  N  N   . SER A 63  ? 0.2679 0.1210 0.1847 -0.0360 -0.0590 0.0019  649  SER A N   
304  C  CA  . SER A 63  ? 0.2819 0.1067 0.2018 -0.0487 -0.0581 0.0097  649  SER A CA  
305  C  C   . SER A 63  ? 0.2678 0.0963 0.1929 -0.0303 -0.0479 0.0195  649  SER A C   
306  O  O   . SER A 63  ? 0.3005 0.1325 0.2041 -0.0015 -0.0331 0.0053  649  SER A O   
307  C  CB  . SER A 63  ? 0.3336 0.1231 0.2614 -0.0817 -0.0433 0.0182  649  SER A CB  
308  O  OG  . SER A 63  ? 0.3972 0.1569 0.3006 -0.0610 -0.0378 0.0309  649  SER A OG  
309  N  N   . VAL A 64  ? 0.2154 0.1242 0.1762 -0.0182 -0.0408 -0.0033 650  VAL A N   
310  C  CA  . VAL A 64  ? 0.2165 0.1263 0.1682 -0.0082 -0.0508 -0.0106 650  VAL A CA  
311  C  C   . VAL A 64  ? 0.2162 0.1033 0.1799 -0.0188 -0.0466 -0.0230 650  VAL A C   
312  O  O   . VAL A 64  ? 0.2161 0.1323 0.1928 -0.0050 -0.0363 -0.0141 650  VAL A O   
313  C  CB  . VAL A 64  ? 0.1988 0.1026 0.1819 0.0101  -0.0588 -0.0214 650  VAL A CB  
314  C  CG1 . VAL A 64  ? 0.2496 0.1225 0.1616 0.0134  -0.0574 -0.0205 650  VAL A CG1 
315  C  CG2 . VAL A 64  ? 0.1981 0.1211 0.2131 0.0049  -0.0374 -0.0165 650  VAL A CG2 
316  N  N   . ALA A 65  ? 0.2257 0.1439 0.1543 -0.0373 -0.0518 -0.0016 651  ALA A N   
317  C  CA  . ALA A 65  ? 0.2341 0.1401 0.1743 -0.0302 -0.0542 -0.0326 651  ALA A CA  
318  C  C   . ALA A 65  ? 0.2232 0.1368 0.2057 -0.0212 -0.0093 -0.0399 651  ALA A C   
319  O  O   . ALA A 65  ? 0.2086 0.1412 0.2033 -0.0106 -0.0071 -0.0340 651  ALA A O   
320  C  CB  . ALA A 65  ? 0.2354 0.1873 0.1894 -0.0127 -0.0729 -0.0197 651  ALA A CB  
321  N  N   . ILE A 66  ? 0.2294 0.1842 0.2165 -0.0349 0.0179  -0.0257 652  ILE A N   
322  C  CA  . ILE A 66  ? 0.2677 0.2523 0.2475 -0.0388 0.0294  -0.0558 652  ILE A CA  
323  C  C   . ILE A 66  ? 0.2937 0.2765 0.2465 -0.0432 0.0396  -0.0529 652  ILE A C   
324  O  O   . ILE A 66  ? 0.3494 0.2894 0.2670 -0.0421 0.0616  -0.0516 652  ILE A O   
325  C  CB  . ILE A 66  ? 0.2697 0.3083 0.2843 -0.0445 0.0290  -0.0542 652  ILE A CB  
326  C  CG1 . ILE A 66  ? 0.2825 0.3047 0.2801 -0.0211 0.0225  -0.0353 652  ILE A CG1 
327  C  CG2 . ILE A 66  ? 0.2646 0.3728 0.3078 -0.0724 0.0237  -0.0623 652  ILE A CG2 
328  C  CD1 . ILE A 66  ? 0.3050 0.3351 0.2853 -0.0015 0.0309  -0.0379 652  ILE A CD1 
329  N  N   . LYS A 67  ? 0.2681 0.2716 0.2289 -0.0642 0.0211  -0.0514 653  LYS A N   
330  C  CA  . LYS A 67  ? 0.2503 0.3356 0.2464 -0.0512 -0.0095 -0.0612 653  LYS A CA  
331  C  C   . LYS A 67  ? 0.2511 0.3056 0.2179 -0.0471 -0.0112 -0.0556 653  LYS A C   
332  O  O   . LYS A 67  ? 0.2441 0.2923 0.2338 -0.0434 -0.0031 -0.0445 653  LYS A O   
333  C  CB  . LYS A 67  ? 0.2627 0.4449 0.2953 -0.0614 -0.0383 -0.0514 653  LYS A CB  
334  C  CG  . LYS A 67  ? 0.3233 0.5625 0.3619 -0.0187 -0.0242 -0.0414 653  LYS A CG  
335  C  CD  . LYS A 67  ? 0.3742 0.6490 0.3964 -0.0056 -0.0367 -0.0384 653  LYS A CD  
336  C  CE  . LYS A 67  ? 0.4067 0.6985 0.4168 0.0061  -0.0375 -0.0312 653  LYS A CE  
337  N  NZ  . LYS A 67  ? 0.4348 0.7353 0.4385 -0.0050 -0.0435 -0.0421 653  LYS A NZ  
338  N  N   . THR A 68  ? 0.2690 0.3193 0.2101 -0.0352 -0.0194 -0.0126 654  THR A N   
339  C  CA  . THR A 68  ? 0.2906 0.3418 0.2274 -0.0343 -0.0095 0.0033  654  THR A CA  
340  C  C   . THR A 68  ? 0.2747 0.3666 0.2267 -0.0430 -0.0251 0.0015  654  THR A C   
341  O  O   . THR A 68  ? 0.3123 0.3884 0.2285 -0.0627 -0.0106 -0.0165 654  THR A O   
342  C  CB  . THR A 68  ? 0.3335 0.3234 0.2562 -0.0190 -0.0118 -0.0141 654  THR A CB  
343  O  OG1 . THR A 68  ? 0.3609 0.3266 0.3072 -0.0174 0.0000  -0.0334 654  THR A OG1 
344  C  CG2 . THR A 68  ? 0.3568 0.3475 0.2553 0.0050  -0.0180 -0.0158 654  THR A CG2 
345  N  N   . LEU A 69  ? 0.2619 0.3551 0.2403 -0.0177 -0.0098 0.0288  655  LEU A N   
346  C  CA  . LEU A 69  ? 0.2724 0.3777 0.2376 -0.0172 -0.0222 0.0218  655  LEU A CA  
347  C  C   . LEU A 69  ? 0.2808 0.3929 0.2370 -0.0262 -0.0285 -0.0122 655  LEU A C   
348  O  O   . LEU A 69  ? 0.2629 0.3930 0.2315 -0.0397 -0.0371 0.0092  655  LEU A O   
349  C  CB  . LEU A 69  ? 0.2825 0.3737 0.2424 -0.0318 -0.0205 0.0465  655  LEU A CB  
350  C  CG  . LEU A 69  ? 0.2843 0.4029 0.2395 -0.0245 -0.0212 0.0576  655  LEU A CG  
351  C  CD1 . LEU A 69  ? 0.2799 0.4345 0.2420 0.0135  -0.0291 0.0657  655  LEU A CD1 
352  C  CD2 . LEU A 69  ? 0.2907 0.4129 0.2537 -0.0128 -0.0134 0.0623  655  LEU A CD2 
353  N  N   . LYS A 70  ? 0.2956 0.4182 0.2577 -0.0338 -0.0271 -0.0556 656  LYS A N   
354  C  CA  . LYS A 70  ? 0.2941 0.4787 0.2873 -0.0169 -0.0425 -0.0495 656  LYS A CA  
355  C  C   . LYS A 70  ? 0.2743 0.4447 0.2897 0.0104  -0.0254 0.0013  656  LYS A C   
356  O  O   . LYS A 70  ? 0.2317 0.4356 0.2744 0.0048  -0.0041 0.0292  656  LYS A O   
357  C  CB  . LYS A 70  ? 0.3504 0.5751 0.3143 0.0001  -0.0602 -0.0580 656  LYS A CB  
358  C  CG  . LYS A 70  ? 0.4052 0.6623 0.3422 0.0407  -0.0578 -0.0762 656  LYS A CG  
359  C  CD  . LYS A 70  ? 0.4660 0.7192 0.3806 0.0778  -0.0428 -0.0643 656  LYS A CD  
360  C  CE  . LYS A 70  ? 0.5021 0.7556 0.4074 0.1126  -0.0393 -0.0535 656  LYS A CE  
361  N  NZ  . LYS A 70  ? 0.5195 0.7748 0.4259 0.1161  -0.0360 -0.0435 656  LYS A NZ  
362  N  N   A VAL A 71  ? 0.2802 0.4440 0.2933 0.0311  -0.0240 0.0114  657  VAL A N   
363  N  N   B VAL A 71  ? 0.2903 0.4167 0.2873 0.0208  -0.0259 0.0156  657  VAL A N   
364  C  CA  A VAL A 71  ? 0.2834 0.4460 0.2984 0.0483  -0.0252 0.0214  657  VAL A CA  
365  C  CA  B VAL A 71  ? 0.3098 0.4318 0.2981 0.0337  -0.0301 0.0322  657  VAL A CA  
366  C  C   A VAL A 71  ? 0.2870 0.4486 0.2864 0.0527  -0.0209 0.0185  657  VAL A C   
367  C  C   B VAL A 71  ? 0.2962 0.4528 0.2858 0.0370  -0.0081 0.0110  657  VAL A C   
368  O  O   A VAL A 71  ? 0.2844 0.4602 0.2875 0.0482  -0.0252 0.0115  657  VAL A O   
369  O  O   B VAL A 71  ? 0.2873 0.4702 0.2864 0.0280  -0.0135 -0.0118 657  VAL A O   
370  C  CB  A VAL A 71  ? 0.2926 0.4437 0.3128 0.0625  -0.0212 0.0258  657  VAL A CB  
371  C  CB  B VAL A 71  ? 0.3764 0.4406 0.3201 0.0372  -0.0266 0.0372  657  VAL A CB  
372  C  CG1 A VAL A 71  ? 0.2772 0.4369 0.3158 0.0740  -0.0244 0.0264  657  VAL A CG1 
373  C  CG1 B VAL A 71  ? 0.4167 0.4640 0.3366 0.0376  -0.0207 0.0362  657  VAL A CG1 
374  C  CG2 A VAL A 71  ? 0.3092 0.4516 0.3197 0.0650  -0.0161 0.0281  657  VAL A CG2 
375  C  CG2 B VAL A 71  ? 0.3846 0.4354 0.3141 0.0462  -0.0342 0.0457  657  VAL A CG2 
376  N  N   . GLY A 72  ? 0.2977 0.4291 0.2769 0.0610  -0.0155 0.0248  658  GLY A N   
377  C  CA  . GLY A 72  ? 0.2996 0.4641 0.2732 0.0979  -0.0196 0.0764  658  GLY A CA  
378  C  C   . GLY A 72  ? 0.3074 0.4913 0.2822 0.1217  -0.0086 0.0643  658  GLY A C   
379  O  O   . GLY A 72  ? 0.3337 0.5218 0.2940 0.1234  0.0134  0.0678  658  GLY A O   
380  N  N   . TYR A 73  ? 0.2973 0.4814 0.2653 0.1375  -0.0085 0.0656  659  TYR A N   
381  C  CA  . TYR A 73  ? 0.2791 0.4644 0.2696 0.1119  0.0035  0.0938  659  TYR A CA  
382  C  C   . TYR A 73  ? 0.3078 0.5144 0.2828 0.1381  0.0356  0.1340  659  TYR A C   
383  O  O   . TYR A 73  ? 0.3379 0.5190 0.3046 0.1245  0.0773  0.1241  659  TYR A O   
384  C  CB  . TYR A 73  ? 0.2742 0.4189 0.2658 0.0922  -0.0127 0.0950  659  TYR A CB  
385  C  CG  . TYR A 73  ? 0.2689 0.3910 0.2787 0.0797  -0.0289 0.0945  659  TYR A CG  
386  C  CD1 . TYR A 73  ? 0.2539 0.3933 0.2915 0.0640  -0.0401 0.0775  659  TYR A CD1 
387  C  CD2 . TYR A 73  ? 0.2676 0.4144 0.2888 0.0552  -0.0462 0.0716  659  TYR A CD2 
388  C  CE1 . TYR A 73  ? 0.2730 0.4277 0.3100 0.0332  -0.0327 0.0806  659  TYR A CE1 
389  C  CE2 . TYR A 73  ? 0.2797 0.4216 0.2971 0.0280  -0.0547 0.0742  659  TYR A CE2 
390  C  CZ  . TYR A 73  ? 0.2944 0.4517 0.3130 0.0122  -0.0483 0.0715  659  TYR A CZ  
391  O  OH  . TYR A 73  ? 0.3393 0.5043 0.3572 -0.0037 -0.0291 0.0520  659  TYR A OH  
392  N  N   . THR A 74  ? 0.3309 0.5710 0.2956 0.1630  0.0308  0.1695  660  THR A N   
393  C  CA  . THR A 74  ? 0.3661 0.5920 0.3210 0.1676  0.0469  0.2034  660  THR A CA  
394  C  C   . THR A 74  ? 0.4010 0.5916 0.3586 0.1449  0.0677  0.2360  660  THR A C   
395  O  O   . THR A 74  ? 0.3954 0.5914 0.3508 0.1526  0.0672  0.2377  660  THR A O   
396  C  CB  . THR A 74  ? 0.3835 0.6441 0.3202 0.1691  0.0679  0.1925  660  THR A CB  
397  O  OG1 . THR A 74  ? 0.4073 0.6759 0.3178 0.1602  0.0595  0.2052  660  THR A OG1 
398  C  CG2 . THR A 74  ? 0.3754 0.6460 0.3275 0.1904  0.0730  0.1602  660  THR A CG2 
399  N  N   . GLU A 75  ? 0.4336 0.5951 0.4099 0.1123  0.0894  0.2465  661  GLU A N   
400  C  CA  . GLU A 75  ? 0.4608 0.6249 0.4443 0.0991  0.0947  0.2423  661  GLU A CA  
401  C  C   . GLU A 75  ? 0.4659 0.6188 0.4327 0.1090  0.1003  0.2672  661  GLU A C   
402  O  O   . GLU A 75  ? 0.4446 0.5871 0.4348 0.1147  0.1027  0.2847  661  GLU A O   
403  C  CB  . GLU A 75  ? 0.5041 0.6574 0.4856 0.0871  0.0879  0.2118  661  GLU A CB  
404  C  CG  . GLU A 75  ? 0.5662 0.6939 0.5321 0.0730  0.1123  0.1759  661  GLU A CG  
405  C  CD  . GLU A 75  ? 0.6038 0.7086 0.5653 0.0647  0.1164  0.1498  661  GLU A CD  
406  O  OE1 . GLU A 75  ? 0.6090 0.7316 0.5772 0.0575  0.1192  0.1239  661  GLU A OE1 
407  O  OE2 . GLU A 75  ? 0.6239 0.7104 0.5762 0.0589  0.1066  0.1498  661  GLU A OE2 
408  N  N   . LYS A 76  ? 0.4765 0.6192 0.4118 0.1067  0.0971  0.2619  662  LYS A N   
409  C  CA  . LYS A 76  ? 0.4815 0.6332 0.3838 0.1235  0.0617  0.2544  662  LYS A CA  
410  C  C   . LYS A 76  ? 0.4542 0.6033 0.3557 0.1523  0.0286  0.2338  662  LYS A C   
411  O  O   . LYS A 76  ? 0.4418 0.6230 0.3547 0.1506  0.0302  0.2366  662  LYS A O   
412  C  CB  . LYS A 76  ? 0.5129 0.6954 0.4042 0.1264  0.0611  0.2469  662  LYS A CB  
413  C  CG  . LYS A 76  ? 0.5610 0.7687 0.4261 0.1176  0.0650  0.2264  662  LYS A CG  
414  C  CD  . LYS A 76  ? 0.6060 0.8255 0.4589 0.1097  0.0668  0.2023  662  LYS A CD  
415  C  CE  . LYS A 76  ? 0.6421 0.8801 0.4941 0.0852  0.0707  0.1577  662  LYS A CE  
416  N  NZ  . LYS A 76  ? 0.6614 0.9091 0.5134 0.0821  0.0772  0.1415  662  LYS A NZ  
417  N  N   . GLN A 77  ? 0.4282 0.5655 0.3209 0.1619  0.0037  0.1946  663  GLN A N   
418  C  CA  . GLN A 77  ? 0.4038 0.5492 0.2836 0.1501  -0.0061 0.1706  663  GLN A CA  
419  C  C   . GLN A 77  ? 0.3783 0.5232 0.2717 0.1145  -0.0034 0.1782  663  GLN A C   
420  O  O   . GLN A 77  ? 0.3611 0.5474 0.2578 0.1005  -0.0148 0.1636  663  GLN A O   
421  C  CB  . GLN A 77  ? 0.4098 0.5928 0.2704 0.1516  -0.0272 0.1326  663  GLN A CB  
422  C  CG  . GLN A 77  ? 0.4321 0.6728 0.2852 0.1620  -0.0363 0.0739  663  GLN A CG  
423  C  CD  . GLN A 77  ? 0.4559 0.7153 0.3211 0.1688  -0.0389 0.0380  663  GLN A CD  
424  O  OE1 . GLN A 77  ? 0.4581 0.7144 0.3285 0.1925  -0.0315 0.0606  663  GLN A OE1 
425  N  NE2 . GLN A 77  ? 0.4614 0.7358 0.3573 0.1506  -0.0400 0.0054  663  GLN A NE2 
426  N  N   . ARG A 78  ? 0.3692 0.4735 0.2988 0.0988  0.0184  0.2007  664  ARG A N   
427  C  CA  . ARG A 78  ? 0.3575 0.4600 0.3332 0.0867  0.0206  0.2047  664  ARG A CA  
428  C  C   . ARG A 78  ? 0.3959 0.4326 0.3595 0.0968  0.0606  0.2200  664  ARG A C   
429  O  O   . ARG A 78  ? 0.3571 0.4186 0.3482 0.0928  0.0777  0.2147  664  ARG A O   
430  C  CB  . ARG A 78  ? 0.3327 0.4851 0.3571 0.0363  0.0109  0.1780  664  ARG A CB  
431  C  CG  . ARG A 78  ? 0.3343 0.5423 0.4001 -0.0052 0.0052  0.1257  664  ARG A CG  
432  C  CD  . ARG A 78  ? 0.3596 0.6360 0.4485 -0.0208 -0.0067 0.0667  664  ARG A CD  
433  N  NE  . ARG A 78  ? 0.3883 0.7101 0.4968 -0.0494 -0.0008 0.0282  664  ARG A NE  
434  C  CZ  . ARG A 78  ? 0.3955 0.7804 0.5153 -0.0779 -0.0228 0.0158  664  ARG A CZ  
435  N  NH1 . ARG A 78  ? 0.3887 0.7955 0.5267 -0.0946 -0.0402 0.0207  664  ARG A NH1 
436  N  NH2 . ARG A 78  ? 0.3976 0.7956 0.5190 -0.0933 -0.0255 0.0140  664  ARG A NH2 
437  N  N   . ARG A 79  ? 0.4482 0.4520 0.3940 0.1064  0.0790  0.2391  665  ARG A N   
438  C  CA  . ARG A 79  ? 0.4759 0.4656 0.4271 0.1187  0.0946  0.2513  665  ARG A CA  
439  C  C   . ARG A 79  ? 0.4510 0.4765 0.3878 0.1238  0.0811  0.2396  665  ARG A C   
440  O  O   . ARG A 79  ? 0.4503 0.4644 0.3786 0.1295  0.0965  0.2295  665  ARG A O   
441  C  CB  . ARG A 79  ? 0.5376 0.4976 0.4751 0.0994  0.1190  0.2689  665  ARG A CB  
442  C  CG  . ARG A 79  ? 0.6125 0.5772 0.5416 0.0693  0.1282  0.2411  665  ARG A CG  
443  C  CD  . ARG A 79  ? 0.6671 0.6476 0.5973 0.0343  0.1380  0.2164  665  ARG A CD  
444  N  NE  . ARG A 79  ? 0.7161 0.7264 0.6410 0.0315  0.1426  0.1943  665  ARG A NE  
445  C  CZ  . ARG A 79  ? 0.7468 0.7804 0.6641 0.0181  0.1557  0.1785  665  ARG A CZ  
446  N  NH1 . ARG A 79  ? 0.7629 0.7944 0.6650 0.0194  0.1618  0.1790  665  ARG A NH1 
447  N  NH2 . ARG A 79  ? 0.7523 0.7846 0.6762 0.0006  0.1603  0.1767  665  ARG A NH2 
448  N  N   . ASP A 80  ? 0.4277 0.5180 0.3414 0.1346  0.0598  0.2127  666  ASP A N   
449  C  CA  . ASP A 80  ? 0.4248 0.5558 0.3271 0.1656  0.0295  0.1652  666  ASP A CA  
450  C  C   . ASP A 80  ? 0.3627 0.5067 0.2994 0.1470  -0.0080 0.1400  666  ASP A C   
451  O  O   . ASP A 80  ? 0.3279 0.5256 0.3084 0.1436  -0.0104 0.1100  666  ASP A O   
452  C  CB  . ASP A 80  ? 0.4714 0.6080 0.3297 0.2150  0.0096  0.1681  666  ASP A CB  
453  C  CG  . ASP A 80  ? 0.5210 0.6713 0.3527 0.2212  -0.0047 0.1530  666  ASP A CG  
454  O  OD1 . ASP A 80  ? 0.5451 0.6698 0.3735 0.2478  -0.0042 0.1526  666  ASP A OD1 
455  O  OD2 . ASP A 80  ? 0.5230 0.7094 0.3540 0.2084  -0.0347 0.1465  666  ASP A OD2 
456  N  N   . PHE A 81  ? 0.3093 0.4431 0.2667 0.1165  -0.0296 0.1170  667  PHE A N   
457  C  CA  . PHE A 81  ? 0.2714 0.4005 0.2575 0.0800  -0.0331 0.0838  667  PHE A CA  
458  C  C   . PHE A 81  ? 0.2445 0.3710 0.2583 0.0561  -0.0197 0.0788  667  PHE A C   
459  O  O   . PHE A 81  ? 0.2628 0.3463 0.2763 0.0428  -0.0219 0.0565  667  PHE A O   
460  C  CB  . PHE A 81  ? 0.2594 0.3552 0.2507 0.0725  -0.0201 0.0701  667  PHE A CB  
461  C  CG  . PHE A 81  ? 0.2465 0.3698 0.2370 0.0183  -0.0206 0.0598  667  PHE A CG  
462  C  CD1 . PHE A 81  ? 0.2656 0.4010 0.2423 0.0061  -0.0155 0.0510  667  PHE A CD1 
463  C  CD2 . PHE A 81  ? 0.2349 0.3874 0.2308 0.0011  -0.0136 0.0606  667  PHE A CD2 
464  C  CE1 . PHE A 81  ? 0.2790 0.4208 0.2427 -0.0113 -0.0182 0.0328  667  PHE A CE1 
465  C  CE2 . PHE A 81  ? 0.2406 0.4133 0.2323 0.0054  -0.0204 0.0493  667  PHE A CE2 
466  C  CZ  . PHE A 81  ? 0.2555 0.4082 0.2337 -0.0111 -0.0213 0.0466  667  PHE A CZ  
467  N  N   . LEU A 82  ? 0.2398 0.3438 0.2604 0.0465  -0.0093 0.0981  668  LEU A N   
468  C  CA  . LEU A 82  ? 0.2687 0.3244 0.2715 0.0234  0.0091  0.1024  668  LEU A CA  
469  C  C   . LEU A 82  ? 0.2678 0.3277 0.2725 0.0090  0.0075  0.1174  668  LEU A C   
470  O  O   . LEU A 82  ? 0.2679 0.3458 0.2803 -0.0015 0.0158  0.0981  668  LEU A O   
471  C  CB  . LEU A 82  ? 0.2794 0.3062 0.2805 0.0177  0.0019  0.1036  668  LEU A CB  
472  C  CG  . LEU A 82  ? 0.2778 0.3185 0.2787 -0.0195 -0.0020 0.1054  668  LEU A CG  
473  C  CD1 . LEU A 82  ? 0.2714 0.3430 0.3036 -0.0537 0.0095  0.0864  668  LEU A CD1 
474  C  CD2 . LEU A 82  ? 0.2926 0.3337 0.2780 -0.0144 -0.0056 0.1001  668  LEU A CD2 
475  N  N   . GLY A 83  ? 0.2764 0.3179 0.2851 0.0324  0.0052  0.1369  669  GLY A N   
476  C  CA  . GLY A 83  ? 0.2828 0.3267 0.3095 0.0423  0.0124  0.1229  669  GLY A CA  
477  C  C   . GLY A 83  ? 0.2734 0.2898 0.3263 0.0387  -0.0155 0.1193  669  GLY A C   
478  O  O   . GLY A 83  ? 0.3014 0.2726 0.3262 0.0363  -0.0029 0.0835  669  GLY A O   
479  N  N   . GLU A 84  ? 0.2668 0.2599 0.3567 -0.0053 -0.0145 0.1074  670  GLU A N   
480  C  CA  . GLU A 84  ? 0.2828 0.2555 0.4056 -0.0419 -0.0128 0.0815  670  GLU A CA  
481  C  C   . GLU A 84  ? 0.2668 0.2544 0.3993 -0.0037 -0.0171 0.0849  670  GLU A C   
482  O  O   . GLU A 84  ? 0.2417 0.2204 0.4134 0.0184  -0.0172 0.0752  670  GLU A O   
483  C  CB  . GLU A 84  ? 0.3544 0.2961 0.4543 -0.0723 0.0151  0.0576  670  GLU A CB  
484  C  CG  . GLU A 84  ? 0.4239 0.3629 0.4858 -0.0944 0.0087  0.0489  670  GLU A CG  
485  C  CD  . GLU A 84  ? 0.4749 0.4150 0.5017 -0.1148 -0.0052 0.0512  670  GLU A CD  
486  O  OE1 . GLU A 84  ? 0.4830 0.4173 0.5078 -0.0988 -0.0123 0.0383  670  GLU A OE1 
487  O  OE2 . GLU A 84  ? 0.4744 0.4300 0.5133 -0.1336 -0.0385 0.0708  670  GLU A OE2 
488  N  N   . ALA A 85  ? 0.2578 0.2716 0.3738 0.0330  -0.0316 0.1146  671  ALA A N   
489  C  CA  . ALA A 85  ? 0.2594 0.3091 0.3456 0.0196  -0.0318 0.1260  671  ALA A CA  
490  C  C   . ALA A 85  ? 0.2527 0.3351 0.3359 0.0152  -0.0249 0.1399  671  ALA A C   
491  O  O   . ALA A 85  ? 0.2453 0.3938 0.3404 0.0072  -0.0056 0.1539  671  ALA A O   
492  C  CB  . ALA A 85  ? 0.2685 0.3373 0.3380 0.0286  -0.0321 0.1211  671  ALA A CB  
493  N  N   . SER A 86  ? 0.2378 0.2998 0.3303 0.0101  -0.0341 0.1148  672  SER A N   
494  C  CA  . SER A 86  ? 0.2623 0.2925 0.3361 -0.0005 -0.0234 0.0790  672  SER A CA  
495  C  C   . SER A 86  ? 0.2566 0.2794 0.3189 -0.0009 -0.0303 0.0441  672  SER A C   
496  O  O   . SER A 86  ? 0.3015 0.3416 0.3386 0.0185  -0.0270 -0.0096 672  SER A O   
497  C  CB  . SER A 86  ? 0.3024 0.3089 0.3806 -0.0381 0.0169  0.0623  672  SER A CB  
498  O  OG  . SER A 86  ? 0.3450 0.3653 0.4118 -0.0231 0.0149  0.0443  672  SER A OG  
499  N  N   . ILE A 87  ? 0.2265 0.1825 0.2932 0.0014  -0.0354 0.0669  673  ILE A N   
500  C  CA  . ILE A 87  ? 0.2562 0.1925 0.2888 -0.0082 -0.0572 0.0371  673  ILE A CA  
501  C  C   . ILE A 87  ? 0.2617 0.1743 0.3048 0.0174  -0.0389 0.0511  673  ILE A C   
502  O  O   . ILE A 87  ? 0.2723 0.2162 0.3167 0.0226  -0.0146 0.0397  673  ILE A O   
503  C  CB  . ILE A 87  ? 0.2928 0.2652 0.2756 -0.0246 -0.0762 0.0224  673  ILE A CB  
504  C  CG1 . ILE A 87  ? 0.3207 0.2922 0.2680 -0.0264 -0.0935 0.0273  673  ILE A CG1 
505  C  CG2 . ILE A 87  ? 0.3066 0.2875 0.2918 -0.0073 -0.0686 -0.0017 673  ILE A CG2 
506  C  CD1 . ILE A 87  ? 0.3581 0.3623 0.2901 -0.0422 -0.0837 0.0134  673  ILE A CD1 
507  N  N   . MET A 88  ? 0.2842 0.1527 0.3222 0.0164  -0.0198 0.0684  674  MET A N   
508  C  CA  . MET A 88  ? 0.3290 0.1857 0.3438 0.0284  0.0207  0.0764  674  MET A CA  
509  C  C   . MET A 88  ? 0.3080 0.1491 0.3222 0.0350  0.0299  0.0488  674  MET A C   
510  O  O   . MET A 88  ? 0.3193 0.1488 0.3322 0.0400  0.0602  0.0356  674  MET A O   
511  C  CB  . MET A 88  ? 0.3843 0.1573 0.3780 0.0350  0.0462  0.0932  674  MET A CB  
512  C  CG  . MET A 88  ? 0.4155 0.1702 0.3944 0.0399  0.0444  0.0572  674  MET A CG  
513  S  SD  . MET A 88  ? 0.4652 0.2219 0.3952 0.0254  0.0469  0.0472  674  MET A SD  
514  C  CE  . MET A 88  ? 0.4656 0.2085 0.3686 0.0185  0.0474  0.0523  674  MET A CE  
515  N  N   . GLY A 89  ? 0.3027 0.1839 0.3123 0.0484  0.0235  0.0426  675  GLY A N   
516  C  CA  . GLY A 89  ? 0.3181 0.1997 0.3072 0.0408  0.0103  0.0351  675  GLY A CA  
517  C  C   . GLY A 89  ? 0.3248 0.2119 0.3020 0.0485  -0.0214 0.0326  675  GLY A C   
518  O  O   . GLY A 89  ? 0.3553 0.2537 0.3130 0.0510  -0.0244 0.0139  675  GLY A O   
519  N  N   . GLN A 90  ? 0.3033 0.1614 0.3038 0.0338  -0.0302 0.0342  676  GLN A N   
520  C  CA  . GLN A 90  ? 0.3039 0.1721 0.3139 0.0430  -0.0319 0.0426  676  GLN A CA  
521  C  C   . GLN A 90  ? 0.2984 0.1292 0.2884 0.0330  -0.0413 0.0100  676  GLN A C   
522  O  O   . GLN A 90  ? 0.2935 0.1523 0.2897 -0.0013 -0.0415 0.0000  676  GLN A O   
523  C  CB  . GLN A 90  ? 0.3282 0.2153 0.3730 0.0935  0.0067  0.1013  676  GLN A CB  
524  C  CG  . GLN A 90  ? 0.3541 0.3171 0.4272 0.0917  0.0495  0.1312  676  GLN A CG  
525  C  CD  . GLN A 90  ? 0.4056 0.3900 0.4836 0.1192  0.0753  0.1311  676  GLN A CD  
526  O  OE1 . GLN A 90  ? 0.4343 0.4414 0.5115 0.1059  0.0568  0.1399  676  GLN A OE1 
527  N  NE2 . GLN A 90  ? 0.4331 0.4242 0.5099 0.0985  0.0950  0.1131  676  GLN A NE2 
528  N  N   . PHE A 91  ? 0.2972 0.1024 0.2870 0.0094  -0.0132 0.0119  677  PHE A N   
529  C  CA  . PHE A 91  ? 0.3308 0.1631 0.2800 0.0296  -0.0117 0.0121  677  PHE A CA  
530  C  C   . PHE A 91  ? 0.3693 0.1567 0.2940 0.0661  0.0082  0.0306  677  PHE A C   
531  O  O   . PHE A 91  ? 0.4500 0.2291 0.3449 0.1125  0.0668  0.0506  677  PHE A O   
532  C  CB  . PHE A 91  ? 0.3296 0.1802 0.2744 0.0153  -0.0224 -0.0352 677  PHE A CB  
533  C  CG  . PHE A 91  ? 0.3326 0.2200 0.2686 -0.0021 -0.0572 -0.0154 677  PHE A CG  
534  C  CD1 . PHE A 91  ? 0.3573 0.2513 0.2644 0.0093  -0.0532 -0.0181 677  PHE A CD1 
535  C  CD2 . PHE A 91  ? 0.3181 0.2603 0.2686 0.0014  -0.0670 -0.0233 677  PHE A CD2 
536  C  CE1 . PHE A 91  ? 0.3637 0.3124 0.2557 0.0229  -0.0640 -0.0017 677  PHE A CE1 
537  C  CE2 . PHE A 91  ? 0.3148 0.3274 0.2609 0.0073  -0.0667 -0.0082 677  PHE A CE2 
538  C  CZ  . PHE A 91  ? 0.3389 0.3302 0.2518 0.0228  -0.0695 -0.0093 677  PHE A CZ  
539  N  N   . ASP A 92  ? 0.3312 0.1632 0.2424 -0.0003 -0.0707 -0.0263 678  ASP A N   
540  C  CA  . ASP A 92  ? 0.3433 0.1675 0.2353 -0.0242 -0.0667 -0.0433 678  ASP A CA  
541  C  C   . ASP A 92  ? 0.3286 0.1361 0.2234 -0.0287 -0.0365 -0.0310 678  ASP A C   
542  O  O   . ASP A 92  ? 0.3348 0.1685 0.2611 -0.0159 -0.0246 -0.0590 678  ASP A O   
543  C  CB  . ASP A 92  ? 0.3807 0.1740 0.2362 -0.0375 -0.0937 -0.0460 678  ASP A CB  
544  C  CG  . ASP A 92  ? 0.4622 0.1979 0.2573 -0.0428 -0.0836 -0.0507 678  ASP A CG  
545  O  OD1 . ASP A 92  ? 0.4623 0.2144 0.2707 -0.0279 -0.0816 -0.0607 678  ASP A OD1 
546  O  OD2 . ASP A 92  ? 0.5368 0.2866 0.2782 -0.0316 -0.0820 -0.0339 678  ASP A OD2 
547  N  N   . HIS A 93  ? 0.3036 0.1387 0.2053 -0.0327 -0.0480 -0.0253 679  HIS A N   
548  C  CA  . HIS A 93  ? 0.2880 0.1201 0.1882 -0.0083 -0.0537 -0.0157 679  HIS A CA  
549  C  C   . HIS A 93  ? 0.2743 0.1144 0.1678 -0.0109 -0.0649 0.0037  679  HIS A C   
550  O  O   . HIS A 93  ? 0.2302 0.1460 0.1858 0.0143  -0.0505 -0.0087 679  HIS A O   
551  C  CB  . HIS A 93  ? 0.2740 0.1501 0.1827 0.0338  -0.0492 0.0123  679  HIS A CB  
552  C  CG  . HIS A 93  ? 0.2855 0.1270 0.1730 0.0417  -0.0556 0.0111  679  HIS A CG  
553  N  ND1 . HIS A 93  ? 0.2814 0.1381 0.1768 0.0390  -0.0554 0.0038  679  HIS A ND1 
554  C  CD2 . HIS A 93  ? 0.2934 0.1877 0.1840 0.0638  -0.0642 0.0001  679  HIS A CD2 
555  C  CE1 . HIS A 93  ? 0.2746 0.1977 0.1825 0.0731  -0.0404 -0.0256 679  HIS A CE1 
556  N  NE2 . HIS A 93  ? 0.2871 0.2059 0.1960 0.0641  -0.0558 -0.0050 679  HIS A NE2 
557  N  N   . PRO A 94  ? 0.2802 0.1389 0.1732 0.0043  -0.0700 0.0137  680  PRO A N   
558  C  CA  . PRO A 94  ? 0.2994 0.1436 0.1768 -0.0147 -0.0480 0.0174  680  PRO A CA  
559  C  C   . PRO A 94  ? 0.2659 0.1261 0.1673 -0.0146 -0.0540 0.0291  680  PRO A C   
560  O  O   . PRO A 94  ? 0.2705 0.1392 0.1937 -0.0061 -0.0551 0.0320  680  PRO A O   
561  C  CB  . PRO A 94  ? 0.3313 0.1809 0.2082 0.0131  -0.0148 0.0198  680  PRO A CB  
562  C  CG  . PRO A 94  ? 0.3391 0.2084 0.2463 0.0195  0.0114  0.0398  680  PRO A CG  
563  C  CD  . PRO A 94  ? 0.3024 0.1631 0.2105 -0.0234 -0.0096 0.0122  680  PRO A CD  
564  N  N   . ASN A 95  ? 0.2241 0.1202 0.1633 -0.0093 -0.0525 0.0231  681  ASN A N   
565  C  CA  . ASN A 95  ? 0.2041 0.1134 0.1725 0.0046  -0.0510 0.0091  681  ASN A CA  
566  C  C   . ASN A 95  ? 0.1857 0.0827 0.1721 0.0227  -0.0512 0.0156  681  ASN A C   
567  O  O   . ASN A 95  ? 0.1983 0.1026 0.1674 0.0178  -0.0386 0.0051  681  ASN A O   
568  C  CB  . ASN A 95  ? 0.2099 0.0965 0.1746 -0.0035 -0.0230 0.0317  681  ASN A CB  
569  C  CG  . ASN A 95  ? 0.2035 0.1121 0.1819 0.0147  -0.0136 0.0043  681  ASN A CG  
570  O  OD1 . ASN A 95  ? 0.2266 0.1572 0.1930 0.0221  -0.0135 0.0006  681  ASN A OD1 
571  N  ND2 . ASN A 95  ? 0.2007 0.1259 0.1876 0.0236  -0.0411 0.0303  681  ASN A ND2 
572  N  N   . ILE A 96  ? 0.1738 0.1032 0.1820 0.0134  -0.0309 0.0160  682  ILE A N   
573  C  CA  . ILE A 96  ? 0.1915 0.1077 0.2105 0.0254  -0.0448 -0.0076 682  ILE A CA  
574  C  C   . ILE A 96  ? 0.1816 0.1059 0.1981 0.0056  -0.0579 0.0030  682  ILE A C   
575  O  O   . ILE A 96  ? 0.2151 0.0902 0.1839 -0.0110 -0.0574 -0.0141 682  ILE A O   
576  C  CB  . ILE A 96  ? 0.2088 0.0667 0.2255 0.0303  -0.0180 0.0100  682  ILE A CB  
577  C  CG1 . ILE A 96  ? 0.2334 0.0747 0.2655 0.0301  -0.0194 0.0066  682  ILE A CG1 
578  C  CG2 . ILE A 96  ? 0.2274 0.1137 0.2234 -0.0019 -0.0150 0.0021  682  ILE A CG2 
579  C  CD1 . ILE A 96  ? 0.2733 0.1164 0.3000 0.0079  -0.0364 -0.0337 682  ILE A CD1 
580  N  N   . ILE A 97  ? 0.1721 0.0857 0.1923 0.0140  -0.0499 0.0103  683  ILE A N   
581  C  CA  . ILE A 97  ? 0.1961 0.0844 0.2029 0.0168  -0.0458 -0.0135 683  ILE A CA  
582  C  C   . ILE A 97  ? 0.2108 0.1156 0.1763 -0.0067 -0.0646 0.0030  683  ILE A C   
583  O  O   . ILE A 97  ? 0.2149 0.1258 0.1931 -0.0258 -0.0552 0.0029  683  ILE A O   
584  C  CB  . ILE A 97  ? 0.2270 0.1044 0.2328 0.0437  -0.0235 -0.0295 683  ILE A CB  
585  C  CG1 . ILE A 97  ? 0.2681 0.1643 0.2592 -0.0064 -0.0278 -0.0181 683  ILE A CG1 
586  C  CG2 . ILE A 97  ? 0.2593 0.2220 0.2291 0.0740  -0.0299 -0.0139 683  ILE A CG2 
587  C  CD1 . ILE A 97  ? 0.3228 0.1797 0.2885 -0.0382 0.0127  0.0149  683  ILE A CD1 
588  N  N   . ARG A 98  ? 0.1926 0.1378 0.1764 -0.0056 -0.0616 -0.0058 684  ARG A N   
589  C  CA  . ARG A 98  ? 0.2001 0.1406 0.1716 0.0056  -0.0560 0.0102  684  ARG A CA  
590  C  C   . ARG A 98  ? 0.1815 0.1000 0.1826 0.0131  -0.0574 0.0142  684  ARG A C   
591  O  O   . ARG A 98  ? 0.2130 0.1062 0.2237 0.0013  -0.0397 0.0065  684  ARG A O   
592  C  CB  . ARG A 98  ? 0.2441 0.1926 0.1529 0.0263  -0.0795 -0.0019 684  ARG A CB  
593  C  CG  . ARG A 98  ? 0.2932 0.1843 0.1558 0.0411  -0.1024 -0.0180 684  ARG A CG  
594  C  CD  . ARG A 98  ? 0.3370 0.2361 0.1859 0.0406  -0.1256 -0.0306 684  ARG A CD  
595  N  NE  . ARG A 98  ? 0.4155 0.2578 0.2223 0.0627  -0.1246 -0.0581 684  ARG A NE  
596  C  CZ  . ARG A 98  ? 0.4870 0.3051 0.2739 0.0641  -0.1265 -0.0622 684  ARG A CZ  
597  N  NH1 . ARG A 98  ? 0.4981 0.2920 0.3087 0.0932  -0.1231 -0.0465 684  ARG A NH1 
598  N  NH2 . ARG A 98  ? 0.5266 0.3676 0.2780 0.0412  -0.1461 -0.0704 684  ARG A NH2 
599  N  N   . LEU A 99  ? 0.1987 0.1209 0.1944 0.0020  -0.0437 0.0093  685  LEU A N   
600  C  CA  . LEU A 99  ? 0.2144 0.0970 0.1888 0.0045  -0.0620 0.0200  685  LEU A CA  
601  C  C   . LEU A 99  ? 0.2194 0.0958 0.1967 0.0325  -0.0577 0.0158  685  LEU A C   
602  O  O   . LEU A 99  ? 0.2567 0.1733 0.2319 0.0280  -0.0501 -0.0220 685  LEU A O   
603  C  CB  . LEU A 99  ? 0.2328 0.0984 0.2138 -0.0095 -0.0524 0.0259  685  LEU A CB  
604  C  CG  . LEU A 99  ? 0.2376 0.1342 0.2475 0.0029  -0.0419 0.0441  685  LEU A CG  
605  C  CD1 . LEU A 99  ? 0.2377 0.1683 0.2489 -0.0044 -0.0586 0.0166  685  LEU A CD1 
606  C  CD2 . LEU A 99  ? 0.2551 0.1374 0.2751 -0.0266 -0.0438 0.0550  685  LEU A CD2 
607  N  N   . GLU A 100 ? 0.2087 0.1190 0.1976 0.0118  -0.0635 0.0062  686  GLU A N   
608  C  CA  . GLU A 100 ? 0.2188 0.1145 0.1967 -0.0027 -0.0982 0.0032  686  GLU A CA  
609  C  C   . GLU A 100 ? 0.2402 0.1277 0.1840 -0.0124 -0.0753 0.0002  686  GLU A C   
610  O  O   . GLU A 100 ? 0.2576 0.1631 0.2036 -0.0132 -0.0618 -0.0462 686  GLU A O   
611  C  CB  . GLU A 100 ? 0.2467 0.1297 0.2101 -0.0003 -0.0850 0.0109  686  GLU A CB  
612  C  CG  . GLU A 100 ? 0.2962 0.1272 0.2252 0.0387  -0.0523 0.0011  686  GLU A CG  
613  C  CD  . GLU A 100 ? 0.3410 0.1858 0.2311 0.0349  -0.0676 -0.0079 686  GLU A CD  
614  O  OE1 . GLU A 100 ? 0.3747 0.2242 0.2322 0.0183  -0.0690 -0.0207 686  GLU A OE1 
615  O  OE2 . GLU A 100 ? 0.3708 0.2548 0.2631 0.0719  -0.0713 -0.0018 686  GLU A OE2 
616  N  N   . GLY A 101 ? 0.2322 0.1710 0.1987 -0.0298 -0.0477 0.0044  687  GLY A N   
617  C  CA  . GLY A 101 ? 0.2203 0.1734 0.2183 -0.0250 -0.0333 -0.0025 687  GLY A CA  
618  C  C   . GLY A 101 ? 0.2036 0.1769 0.2266 -0.0486 -0.0338 0.0025  687  GLY A C   
619  O  O   . GLY A 101 ? 0.2001 0.1560 0.2334 -0.0286 -0.0319 -0.0071 687  GLY A O   
620  N  N   . VAL A 102 ? 0.2131 0.1904 0.2525 -0.0358 -0.0304 0.0106  688  VAL A N   
621  C  CA  . VAL A 102 ? 0.2291 0.1781 0.2502 -0.0509 -0.0367 0.0362  688  VAL A CA  
622  C  C   . VAL A 102 ? 0.2287 0.2016 0.2499 -0.0432 -0.0334 0.0177  688  VAL A C   
623  O  O   . VAL A 102 ? 0.2500 0.2089 0.2364 -0.0253 -0.0593 0.0079  688  VAL A O   
624  C  CB  . VAL A 102 ? 0.2448 0.1935 0.2718 -0.0455 -0.0527 0.0309  688  VAL A CB  
625  C  CG1 . VAL A 102 ? 0.2113 0.2237 0.2848 -0.0257 -0.0775 0.0269  688  VAL A CG1 
626  C  CG2 . VAL A 102 ? 0.2716 0.1868 0.2934 -0.0403 -0.0459 0.0543  688  VAL A CG2 
627  N  N   . VAL A 103 ? 0.1944 0.2136 0.2650 -0.0404 -0.0354 0.0298  689  VAL A N   
628  C  CA  . VAL A 103 ? 0.1984 0.2319 0.2718 -0.0388 -0.0367 0.0372  689  VAL A CA  
629  C  C   . VAL A 103 ? 0.2267 0.2559 0.2695 -0.0583 -0.0597 0.0373  689  VAL A C   
630  O  O   . VAL A 103 ? 0.2466 0.2510 0.2692 -0.0516 -0.0446 0.0294  689  VAL A O   
631  C  CB  . VAL A 103 ? 0.2150 0.2445 0.2802 -0.0122 0.0028  0.0293  689  VAL A CB  
632  C  CG1 . VAL A 103 ? 0.2253 0.2906 0.2916 0.0233  0.0089  0.0159  689  VAL A CG1 
633  C  CG2 . VAL A 103 ? 0.2630 0.2254 0.2800 0.0236  0.0328  0.0228  689  VAL A CG2 
634  N  N   . THR A 104 ? 0.2450 0.2789 0.3149 -0.1066 -0.0561 0.0518  690  THR A N   
635  C  CA  . THR A 104 ? 0.2756 0.2941 0.3578 -0.0937 -0.0417 0.0543  690  THR A CA  
636  C  C   . THR A 104 ? 0.2610 0.3091 0.3759 -0.1058 -0.0394 0.0616  690  THR A C   
637  O  O   . THR A 104 ? 0.2729 0.3816 0.3881 -0.0903 -0.0004 0.0776  690  THR A O   
638  C  CB  . THR A 104 ? 0.3066 0.3111 0.3620 -0.0530 -0.0398 0.0621  690  THR A CB  
639  O  OG1 . THR A 104 ? 0.3326 0.2983 0.3738 -0.0337 -0.0186 0.0689  690  THR A OG1 
640  C  CG2 . THR A 104 ? 0.2971 0.3276 0.3727 -0.0185 -0.0407 0.0886  690  THR A CG2 
641  N  N   . LYS A 105 ? 0.2514 0.2956 0.3889 -0.0886 -0.0768 0.0392  691  LYS A N   
642  C  CA  . LYS A 105 ? 0.2600 0.3698 0.4093 -0.0737 -0.0680 -0.0019 691  LYS A CA  
643  C  C   . LYS A 105 ? 0.2481 0.4191 0.3941 -0.0478 -0.0504 0.0019  691  LYS A C   
644  O  O   . LYS A 105 ? 0.2590 0.4289 0.4124 -0.0620 -0.0461 0.0122  691  LYS A O   
645  C  CB  . LYS A 105 ? 0.2970 0.4298 0.4511 -0.0766 -0.0480 -0.0342 691  LYS A CB  
646  C  CG  . LYS A 105 ? 0.3510 0.4831 0.4976 -0.0489 -0.0209 -0.0536 691  LYS A CG  
647  C  CD  . LYS A 105 ? 0.4060 0.5382 0.5372 -0.0053 0.0061  -0.0533 691  LYS A CD  
648  C  CE  . LYS A 105 ? 0.4478 0.5936 0.5589 0.0005  0.0204  -0.0475 691  LYS A CE  
649  N  NZ  . LYS A 105 ? 0.4774 0.6118 0.5686 0.0000  0.0311  -0.0546 691  LYS A NZ  
650  N  N   . SER A 106 ? 0.2474 0.4069 0.3609 -0.0280 -0.0599 -0.0262 692  SER A N   
651  C  CA  . SER A 106 ? 0.2509 0.4212 0.3348 -0.0224 -0.0728 -0.0367 692  SER A CA  
652  C  C   . SER A 106 ? 0.2498 0.4267 0.3156 -0.0097 -0.0663 -0.0344 692  SER A C   
653  O  O   . SER A 106 ? 0.2663 0.3882 0.3178 -0.0243 -0.0600 -0.0134 692  SER A O   
654  C  CB  . SER A 106 ? 0.2918 0.3973 0.3400 0.0139  -0.0695 -0.0245 692  SER A CB  
655  O  OG  . SER A 106 ? 0.3427 0.3837 0.3296 0.0305  -0.0683 -0.0166 692  SER A OG  
656  N  N   . LYS A 107 ? 0.2518 0.4322 0.2864 0.0109  -0.0571 -0.0846 693  LYS A N   
657  C  CA  . LYS A 107 ? 0.2688 0.4423 0.2969 0.0104  -0.0334 -0.0651 693  LYS A CA  
658  C  C   . LYS A 107 ? 0.2591 0.4518 0.3159 0.0368  -0.0253 -0.0335 693  LYS A C   
659  O  O   . LYS A 107 ? 0.2683 0.4762 0.3346 0.0871  -0.0358 0.0049  693  LYS A O   
660  C  CB  . LYS A 107 ? 0.3141 0.4804 0.3150 0.0097  -0.0044 -0.0950 693  LYS A CB  
661  C  CG  . LYS A 107 ? 0.3663 0.5542 0.3501 -0.0258 0.0232  -0.0828 693  LYS A CG  
662  C  CD  . LYS A 107 ? 0.4035 0.5798 0.3827 -0.0161 0.0035  -0.0744 693  LYS A CD  
663  C  CE  . LYS A 107 ? 0.4027 0.5870 0.3994 0.0431  -0.0108 -0.0628 693  LYS A CE  
664  N  NZ  . LYS A 107 ? 0.3845 0.6041 0.4081 0.0680  -0.0036 -0.0849 693  LYS A NZ  
665  N  N   . PRO A 108 ? 0.2588 0.4015 0.3209 0.0258  -0.0178 0.0109  694  PRO A N   
666  C  CA  . PRO A 108 ? 0.2279 0.3638 0.3161 0.0336  -0.0350 0.0148  694  PRO A CA  
667  C  C   . PRO A 108 ? 0.2337 0.3291 0.2911 0.0197  -0.0200 0.0276  694  PRO A C   
668  O  O   . PRO A 108 ? 0.2319 0.3226 0.2823 0.0284  -0.0366 0.0375  694  PRO A O   
669  C  CB  . PRO A 108 ? 0.2578 0.4194 0.3402 0.0330  -0.0389 -0.0051 694  PRO A CB  
670  C  CG  . PRO A 108 ? 0.3024 0.4383 0.3499 0.0157  -0.0264 0.0027  694  PRO A CG  
671  C  CD  . PRO A 108 ? 0.3002 0.4328 0.3379 0.0248  -0.0197 0.0148  694  PRO A CD  
672  N  N   . VAL A 109 ? 0.2096 0.3030 0.2746 -0.0109 -0.0299 0.0358  695  VAL A N   
673  C  CA  . VAL A 109 ? 0.2157 0.2986 0.2603 -0.0124 -0.0036 0.0760  695  VAL A CA  
674  C  C   . VAL A 109 ? 0.2127 0.2656 0.2362 -0.0232 -0.0125 0.0489  695  VAL A C   
675  O  O   . VAL A 109 ? 0.2156 0.2892 0.2256 -0.0070 -0.0107 0.0156  695  VAL A O   
676  C  CB  . VAL A 109 ? 0.2350 0.3093 0.2756 -0.0019 0.0013  0.0843  695  VAL A CB  
677  C  CG1 . VAL A 109 ? 0.2380 0.3141 0.2928 -0.0107 -0.0209 0.0838  695  VAL A CG1 
678  C  CG2 . VAL A 109 ? 0.2508 0.3313 0.2907 -0.0076 0.0117  0.0785  695  VAL A CG2 
679  N  N   . MET A 110 ? 0.2063 0.2662 0.2308 -0.0448 -0.0210 0.0470  696  MET A N   
680  C  CA  . MET A 110 ? 0.2115 0.2446 0.2472 -0.0242 -0.0256 0.0451  696  MET A CA  
681  C  C   . MET A 110 ? 0.1998 0.2411 0.2237 -0.0443 -0.0266 0.0202  696  MET A C   
682  O  O   . MET A 110 ? 0.2103 0.2213 0.2360 -0.0521 -0.0327 -0.0021 696  MET A O   
683  C  CB  . MET A 110 ? 0.2351 0.2482 0.2863 -0.0352 -0.0217 0.0712  696  MET A CB  
684  C  CG  . MET A 110 ? 0.2624 0.2860 0.3153 -0.0534 -0.0523 0.0766  696  MET A CG  
685  S  SD  . MET A 110 ? 0.3166 0.3512 0.3590 -0.0655 -0.0800 0.1073  696  MET A SD  
686  C  CE  . MET A 110 ? 0.3764 0.4432 0.3943 -0.0481 -0.0356 0.0714  696  MET A CE  
687  N  N   . ILE A 111 ? 0.1687 0.2669 0.2162 -0.0436 -0.0117 0.0254  697  ILE A N   
688  C  CA  . ILE A 111 ? 0.1773 0.2250 0.1847 -0.0344 -0.0124 0.0116  697  ILE A CA  
689  C  C   . ILE A 111 ? 0.1972 0.1839 0.1882 -0.0535 -0.0262 0.0067  697  ILE A C   
690  O  O   . ILE A 111 ? 0.2317 0.1839 0.2038 -0.0661 0.0052  -0.0104 697  ILE A O   
691  C  CB  . ILE A 111 ? 0.2248 0.2255 0.2082 -0.0352 -0.0042 0.0218  697  ILE A CB  
692  C  CG1 . ILE A 111 ? 0.2702 0.2523 0.2041 -0.0519 -0.0081 0.0328  697  ILE A CG1 
693  C  CG2 . ILE A 111 ? 0.2191 0.2617 0.2262 -0.0178 0.0007  0.0190  697  ILE A CG2 
694  C  CD1 . ILE A 111 ? 0.2848 0.2855 0.2222 -0.0180 -0.0077 0.0555  697  ILE A CD1 
695  N  N   . VAL A 112 ? 0.1945 0.1597 0.1844 -0.0245 -0.0347 0.0253  698  VAL A N   
696  C  CA  . VAL A 112 ? 0.1688 0.1298 0.1843 -0.0021 -0.0436 -0.0025 698  VAL A CA  
697  C  C   . VAL A 112 ? 0.1759 0.1251 0.1925 -0.0065 -0.0485 0.0063  698  VAL A C   
698  O  O   . VAL A 112 ? 0.1968 0.1309 0.2045 -0.0174 -0.0428 0.0026  698  VAL A O   
699  C  CB  . VAL A 112 ? 0.1837 0.1433 0.1977 -0.0087 -0.0415 -0.0102 698  VAL A CB  
700  C  CG1 . VAL A 112 ? 0.2186 0.1508 0.1798 0.0068  -0.0393 0.0154  698  VAL A CG1 
701  C  CG2 . VAL A 112 ? 0.1688 0.2114 0.2367 -0.0078 -0.0357 -0.0059 698  VAL A CG2 
702  N  N   . THR A 113 ? 0.1701 0.1214 0.1933 -0.0053 -0.0347 -0.0035 699  THR A N   
703  C  CA  . THR A 113 ? 0.1976 0.1197 0.2072 -0.0154 -0.0449 0.0073  699  THR A CA  
704  C  C   . THR A 113 ? 0.1740 0.0894 0.2236 0.0107  -0.0269 0.0075  699  THR A C   
705  O  O   . THR A 113 ? 0.1901 0.1011 0.2175 0.0085  -0.0163 -0.0096 699  THR A O   
706  C  CB  . THR A 113 ? 0.2439 0.1168 0.2310 -0.0128 -0.0919 0.0012  699  THR A CB  
707  O  OG1 . THR A 113 ? 0.2928 0.1486 0.2874 -0.0071 -0.1122 -0.0076 699  THR A OG1 
708  C  CG2 . THR A 113 ? 0.2526 0.1872 0.2191 0.0047  -0.0597 0.0252  699  THR A CG2 
709  N  N   . GLU A 114 ? 0.1704 0.1268 0.2439 -0.0091 -0.0151 0.0003  700  GLU A N   
710  C  CA  . GLU A 114 ? 0.1772 0.0996 0.2339 0.0055  -0.0292 -0.0153 700  GLU A CA  
711  C  C   . GLU A 114 ? 0.2054 0.1069 0.2353 -0.0053 -0.0556 -0.0231 700  GLU A C   
712  O  O   . GLU A 114 ? 0.2423 0.1470 0.2325 0.0219  -0.0440 -0.0087 700  GLU A O   
713  C  CB  . GLU A 114 ? 0.1966 0.1520 0.2397 0.0231  -0.0334 -0.0029 700  GLU A CB  
714  C  CG  . GLU A 114 ? 0.2090 0.1504 0.2454 0.0445  -0.0506 -0.0025 700  GLU A CG  
715  C  CD  . GLU A 114 ? 0.2329 0.1618 0.2503 -0.0082 -0.0447 -0.0060 700  GLU A CD  
716  O  OE1 . GLU A 114 ? 0.2627 0.1803 0.2362 -0.0163 -0.0576 0.0153  700  GLU A OE1 
717  O  OE2 . GLU A 114 ? 0.2387 0.1353 0.2439 -0.0106 -0.0391 -0.0038 700  GLU A OE2 
718  N  N   . TYR A 115 ? 0.2129 0.0940 0.2568 -0.0214 -0.0667 0.0009  701  TYR A N   
719  C  CA  . TYR A 115 ? 0.2111 0.1118 0.2585 -0.0189 -0.0975 0.0081  701  TYR A CA  
720  C  C   . TYR A 115 ? 0.1859 0.1392 0.2118 -0.0200 -0.0993 0.0244  701  TYR A C   
721  O  O   . TYR A 115 ? 0.2300 0.1546 0.2321 -0.0310 -0.0615 0.0080  701  TYR A O   
722  C  CB  . TYR A 115 ? 0.2532 0.1223 0.3095 0.0158  -0.1273 -0.0117 701  TYR A CB  
723  C  CG  . TYR A 115 ? 0.3102 0.1575 0.3895 0.0292  -0.1533 -0.0476 701  TYR A CG  
724  C  CD1 . TYR A 115 ? 0.3423 0.2114 0.4196 0.0710  -0.1533 -0.0794 701  TYR A CD1 
725  C  CD2 . TYR A 115 ? 0.3407 0.1781 0.4262 0.0605  -0.1721 -0.0288 701  TYR A CD2 
726  C  CE1 . TYR A 115 ? 0.3719 0.2437 0.4674 0.0719  -0.1568 -0.0879 701  TYR A CE1 
727  C  CE2 . TYR A 115 ? 0.3543 0.2011 0.4544 0.0884  -0.1868 -0.0676 701  TYR A CE2 
728  C  CZ  . TYR A 115 ? 0.3828 0.2154 0.4800 0.0717  -0.1802 -0.0988 701  TYR A CZ  
729  O  OH  . TYR A 115 ? 0.4285 0.3015 0.5151 0.0454  -0.1719 -0.1021 701  TYR A OH  
730  N  N   . MET A 116 ? 0.1721 0.1141 0.2124 -0.0336 -0.1012 0.0048  702  MET A N   
731  C  CA  . MET A 116 ? 0.1984 0.0973 0.2260 -0.0139 -0.0818 0.0130  702  MET A CA  
732  C  C   . MET A 116 ? 0.2231 0.1022 0.2351 -0.0025 -0.0860 0.0161  702  MET A C   
733  O  O   . MET A 116 ? 0.2264 0.1132 0.2549 -0.0252 -0.0569 0.0070  702  MET A O   
734  C  CB  . MET A 116 ? 0.2075 0.0941 0.2319 -0.0026 -0.0565 0.0115  702  MET A CB  
735  C  CG  . MET A 116 ? 0.2115 0.0859 0.2359 -0.0030 -0.0599 0.0047  702  MET A CG  
736  S  SD  . MET A 116 ? 0.2583 0.1155 0.2296 0.0017  -0.0864 -0.0087 702  MET A SD  
737  C  CE  . MET A 116 ? 0.2455 0.1159 0.2499 -0.0211 -0.1135 0.0175  702  MET A CE  
738  N  N   . GLU A 117 ? 0.2275 0.0859 0.2545 -0.0043 -0.1006 0.0052  703  GLU A N   
739  C  CA  . GLU A 117 ? 0.2810 0.1091 0.2626 -0.0182 -0.1223 0.0016  703  GLU A CA  
740  C  C   . GLU A 117 ? 0.2784 0.0976 0.2531 0.0003  -0.1138 -0.0148 703  GLU A C   
741  O  O   . GLU A 117 ? 0.2961 0.1148 0.2873 0.0149  -0.1052 -0.0486 703  GLU A O   
742  C  CB  . GLU A 117 ? 0.3599 0.1331 0.2894 -0.0043 -0.1170 0.0444  703  GLU A CB  
743  C  CG  . GLU A 117 ? 0.4533 0.2675 0.3302 -0.0373 -0.0957 0.0146  703  GLU A CG  
744  C  CD  . GLU A 117 ? 0.5307 0.4001 0.3599 -0.0563 -0.0644 0.0221  703  GLU A CD  
745  O  OE1 . GLU A 117 ? 0.5593 0.4474 0.3767 -0.0559 -0.0541 0.0422  703  GLU A OE1 
746  O  OE2 . GLU A 117 ? 0.5773 0.5206 0.3805 -0.0671 -0.0548 0.0018  703  GLU A OE2 
747  N  N   . ASN A 118 ? 0.2591 0.0872 0.2250 -0.0092 -0.1032 0.0044  704  ASN A N   
748  C  CA  . ASN A 118 ? 0.2264 0.0854 0.2225 -0.0174 -0.0836 0.0050  704  ASN A CA  
749  C  C   . ASN A 118 ? 0.2115 0.0808 0.2264 0.0010  -0.0700 -0.0009 704  ASN A C   
750  O  O   . ASN A 118 ? 0.2272 0.1444 0.2337 -0.0169 -0.0783 -0.0313 704  ASN A O   
751  C  CB  . ASN A 118 ? 0.2304 0.0832 0.2281 -0.0166 -0.0897 0.0194  704  ASN A CB  
752  C  CG  . ASN A 118 ? 0.2562 0.0891 0.2165 -0.0297 -0.0798 -0.0067 704  ASN A CG  
753  O  OD1 . ASN A 118 ? 0.2843 0.0849 0.2456 -0.0058 -0.0711 0.0036  704  ASN A OD1 
754  N  ND2 . ASN A 118 ? 0.2843 0.1213 0.2274 -0.0298 -0.0807 -0.0020 704  ASN A ND2 
755  N  N   . GLY A 119 ? 0.2335 0.1126 0.2202 0.0048  -0.0600 0.0004  705  GLY A N   
756  C  CA  . GLY A 119 ? 0.2334 0.1162 0.2155 0.0013  -0.0455 0.0157  705  GLY A CA  
757  C  C   . GLY A 119 ? 0.2230 0.0923 0.1962 0.0227  -0.0503 0.0050  705  GLY A C   
758  O  O   . GLY A 119 ? 0.2239 0.1151 0.2036 0.0238  -0.0622 -0.0070 705  GLY A O   
759  N  N   A SER A 120 ? 0.2272 0.1198 0.2036 -0.0054 -0.0345 0.0010  706  SER A N   
760  N  N   B SER A 120 ? 0.2115 0.1169 0.1949 0.0029  -0.0372 0.0006  706  SER A N   
761  C  CA  A SER A 120 ? 0.2409 0.1213 0.2244 -0.0277 -0.0221 0.0019  706  SER A CA  
762  C  CA  B SER A 120 ? 0.2098 0.1220 0.1975 -0.0090 -0.0284 -0.0034 706  SER A CA  
763  C  C   A SER A 120 ? 0.2243 0.0941 0.2148 0.0017  -0.0286 0.0089  706  SER A C   
764  C  C   B SER A 120 ? 0.2095 0.0900 0.1980 0.0074  -0.0312 0.0043  706  SER A C   
765  O  O   A SER A 120 ? 0.2313 0.1043 0.2317 0.0149  -0.0324 -0.0092 706  SER A O   
766  O  O   B SER A 120 ? 0.2188 0.0894 0.2069 0.0157  -0.0332 -0.0161 706  SER A O   
767  C  CB  A SER A 120 ? 0.2625 0.1900 0.2438 -0.0302 -0.0097 -0.0002 706  SER A CB  
768  C  CB  B SER A 120 ? 0.1965 0.1872 0.1926 0.0118  -0.0110 -0.0132 706  SER A CB  
769  O  OG  A SER A 120 ? 0.2826 0.2477 0.2502 -0.0362 -0.0094 0.0003  706  SER A OG  
770  O  OG  B SER A 120 ? 0.1837 0.2245 0.1843 0.0084  -0.0099 -0.0326 706  SER A OG  
771  N  N   . LEU A 121 ? 0.2103 0.0984 0.2002 0.0066  -0.0479 -0.0177 707  LEU A N   
772  C  CA  . LEU A 121 ? 0.2182 0.0704 0.1975 -0.0056 -0.0716 0.0017  707  LEU A CA  
773  C  C   . LEU A 121 ? 0.2398 0.0682 0.1885 0.0096  -0.0465 0.0070  707  LEU A C   
774  O  O   . LEU A 121 ? 0.2583 0.0727 0.1988 -0.0046 -0.0542 0.0006  707  LEU A O   
775  C  CB  . LEU A 121 ? 0.2257 0.0902 0.2086 0.0189  -0.0544 -0.0092 707  LEU A CB  
776  C  CG  . LEU A 121 ? 0.2340 0.0897 0.2092 0.0028  -0.0775 -0.0045 707  LEU A CG  
777  C  CD1 . LEU A 121 ? 0.2454 0.1219 0.2187 0.0112  -0.0558 -0.0174 707  LEU A CD1 
778  C  CD2 . LEU A 121 ? 0.2498 0.0968 0.2321 0.0186  -0.0710 -0.0393 707  LEU A CD2 
779  N  N   . ASP A 122 ? 0.2541 0.0916 0.1815 0.0065  -0.0543 -0.0099 708  ASP A N   
780  C  CA  . ASP A 122 ? 0.2928 0.0928 0.1749 0.0312  -0.0592 -0.0081 708  ASP A CA  
781  C  C   . ASP A 122 ? 0.2918 0.1033 0.1834 0.0195  -0.0599 -0.0134 708  ASP A C   
782  O  O   . ASP A 122 ? 0.3134 0.1039 0.1939 0.0060  -0.0533 -0.0290 708  ASP A O   
783  C  CB  . ASP A 122 ? 0.3248 0.1511 0.1812 0.0307  -0.0571 -0.0112 708  ASP A CB  
784  C  CG  . ASP A 122 ? 0.3610 0.1956 0.2022 0.0105  -0.0426 -0.0168 708  ASP A CG  
785  O  OD1 . ASP A 122 ? 0.3483 0.1855 0.2349 -0.0274 -0.0278 -0.0013 708  ASP A OD1 
786  O  OD2 . ASP A 122 ? 0.4016 0.3317 0.2249 -0.0060 -0.0352 -0.0090 708  ASP A OD2 
787  N  N   . SER A 123 ? 0.2695 0.1028 0.2018 0.0385  -0.0565 0.0058  709  SER A N   
788  C  CA  . SER A 123 ? 0.2614 0.1115 0.2327 0.0379  -0.0425 -0.0081 709  SER A CA  
789  C  C   . SER A 123 ? 0.2573 0.1052 0.2101 0.0247  -0.0449 -0.0113 709  SER A C   
790  O  O   . SER A 123 ? 0.3072 0.0862 0.2310 0.0161  -0.0429 0.0012  709  SER A O   
791  C  CB  . SER A 123 ? 0.3131 0.2131 0.2913 0.0268  -0.0200 -0.0343 709  SER A CB  
792  O  OG  . SER A 123 ? 0.3734 0.2836 0.3534 0.0079  0.0065  -0.0076 709  SER A OG  
793  N  N   . PHE A 124 ? 0.2475 0.1282 0.1661 0.0241  -0.0432 -0.0067 710  PHE A N   
794  C  CA  . PHE A 124 ? 0.2427 0.0752 0.1660 0.0163  -0.0528 -0.0260 710  PHE A CA  
795  C  C   . PHE A 124 ? 0.2321 0.0733 0.1788 0.0183  -0.0685 -0.0158 710  PHE A C   
796  O  O   . PHE A 124 ? 0.2562 0.0751 0.1732 0.0071  -0.0733 -0.0034 710  PHE A O   
797  C  CB  . PHE A 124 ? 0.2642 0.0759 0.1758 0.0147  -0.0606 -0.0119 710  PHE A CB  
798  C  CG  . PHE A 124 ? 0.2404 0.0731 0.1889 -0.0171 -0.0593 -0.0059 710  PHE A CG  
799  C  CD1 . PHE A 124 ? 0.2668 0.0799 0.1777 -0.0275 -0.0622 0.0134  710  PHE A CD1 
800  C  CD2 . PHE A 124 ? 0.2621 0.0799 0.2086 -0.0057 -0.0608 -0.0201 710  PHE A CD2 
801  C  CE1 . PHE A 124 ? 0.2587 0.0824 0.1981 -0.0272 -0.0656 0.0229  710  PHE A CE1 
802  C  CE2 . PHE A 124 ? 0.2622 0.1003 0.2215 -0.0093 -0.0710 -0.0010 710  PHE A CE2 
803  C  CZ  . PHE A 124 ? 0.2535 0.0888 0.2171 -0.0267 -0.0778 -0.0125 710  PHE A CZ  
804  N  N   . LEU A 125 ? 0.2198 0.0818 0.1922 0.0135  -0.0836 -0.0167 711  LEU A N   
805  C  CA  . LEU A 125 ? 0.2340 0.0720 0.1977 0.0072  -0.0607 -0.0157 711  LEU A CA  
806  C  C   . LEU A 125 ? 0.2454 0.0707 0.1765 0.0145  -0.0553 -0.0083 711  LEU A C   
807  O  O   . LEU A 125 ? 0.2719 0.0787 0.1821 -0.0054 -0.0726 -0.0037 711  LEU A O   
808  C  CB  . LEU A 125 ? 0.2391 0.0713 0.2161 0.0122  -0.0484 -0.0133 711  LEU A CB  
809  C  CG  . LEU A 125 ? 0.2701 0.0889 0.2506 0.0265  -0.0641 -0.0274 711  LEU A CG  
810  C  CD1 . LEU A 125 ? 0.2762 0.1113 0.2816 0.0449  -0.1092 -0.0325 711  LEU A CD1 
811  C  CD2 . LEU A 125 ? 0.2827 0.1336 0.2638 0.0520  -0.0539 -0.0291 711  LEU A CD2 
812  N  N   . ARG A 126 ? 0.2658 0.0780 0.1811 -0.0073 -0.0599 -0.0153 712  ARG A N   
813  C  CA  . ARG A 126 ? 0.3212 0.0906 0.1750 0.0059  -0.0507 -0.0231 712  ARG A CA  
814  C  C   . ARG A 126 ? 0.3241 0.0956 0.2004 0.0226  -0.0625 -0.0276 712  ARG A C   
815  O  O   . ARG A 126 ? 0.4013 0.1146 0.2143 -0.0033 -0.0910 -0.0186 712  ARG A O   
816  C  CB  . ARG A 126 ? 0.3736 0.1072 0.1784 0.0257  -0.0377 -0.0165 712  ARG A CB  
817  C  CG  . ARG A 126 ? 0.4218 0.1546 0.1838 0.0540  -0.0311 0.0131  712  ARG A CG  
818  C  CD  . ARG A 126 ? 0.4962 0.2190 0.2013 0.1108  -0.0084 0.0463  712  ARG A CD  
819  N  NE  . ARG A 126 ? 0.5472 0.4014 0.2510 0.0501  0.0089  0.0537  712  ARG A NE  
820  C  CZ  . ARG A 126 ? 0.5801 0.3916 0.2566 -0.0020 -0.0206 -0.0009 712  ARG A CZ  
821  N  NH1 . ARG A 126 ? 0.5989 0.4749 0.3065 0.0043  -0.0237 -0.0241 712  ARG A NH1 
822  N  NH2 . ARG A 126 ? 0.5968 0.3996 0.2351 0.0105  -0.0082 -0.0024 712  ARG A NH2 
823  N  N   . LYS A 127 ? 0.3202 0.0972 0.2263 0.0150  -0.0838 -0.0240 713  LYS A N   
824  C  CA  . LYS A 127 ? 0.3171 0.0958 0.2445 -0.0091 -0.0931 -0.0003 713  LYS A CA  
825  C  C   . LYS A 127 ? 0.3084 0.0929 0.2254 -0.0012 -0.0954 -0.0028 713  LYS A C   
826  O  O   . LYS A 127 ? 0.3520 0.0976 0.2833 -0.0153 -0.0588 0.0048  713  LYS A O   
827  C  CB  . LYS A 127 ? 0.3198 0.1136 0.2915 -0.0009 -0.1039 0.0055  713  LYS A CB  
828  C  CG  . LYS A 127 ? 0.3307 0.1421 0.3195 -0.0194 -0.1018 0.0206  713  LYS A CG  
829  C  CD  . LYS A 127 ? 0.3620 0.2656 0.3558 -0.0172 -0.1050 0.0217  713  LYS A CD  
830  C  CE  . LYS A 127 ? 0.3975 0.3484 0.3817 -0.0321 -0.1038 0.0353  713  LYS A CE  
831  N  NZ  . LYS A 127 ? 0.4099 0.4348 0.4032 -0.0513 -0.1129 0.0107  713  LYS A NZ  
832  N  N   . HIS A 128 ? 0.3225 0.0993 0.2357 0.0020  -0.1084 -0.0061 714  HIS A N   
833  C  CA  . HIS A 128 ? 0.3139 0.1054 0.2224 -0.0275 -0.1197 0.0041  714  HIS A CA  
834  C  C   . HIS A 128 ? 0.3045 0.0999 0.2298 -0.0132 -0.1219 0.0040  714  HIS A C   
835  O  O   . HIS A 128 ? 0.2976 0.1166 0.2376 -0.0230 -0.1108 0.0173  714  HIS A O   
836  C  CB  . HIS A 128 ? 0.2985 0.0959 0.2211 -0.0186 -0.1057 0.0014  714  HIS A CB  
837  C  CG  . HIS A 128 ? 0.3100 0.0909 0.1996 -0.0050 -0.0931 0.0012  714  HIS A CG  
838  N  ND1 . HIS A 128 ? 0.3082 0.0902 0.1821 -0.0158 -0.0874 0.0004  714  HIS A ND1 
839  C  CD2 . HIS A 128 ? 0.3164 0.0993 0.2122 -0.0044 -0.1089 -0.0115 714  HIS A CD2 
840  C  CE1 . HIS A 128 ? 0.3079 0.1016 0.1953 -0.0068 -0.1089 -0.0156 714  HIS A CE1 
841  N  NE2 . HIS A 128 ? 0.3138 0.1019 0.2121 -0.0249 -0.1027 -0.0058 714  HIS A NE2 
842  N  N   . ASP A 129 ? 0.3030 0.1023 0.2438 0.0091  -0.1302 -0.0065 715  ASP A N   
843  C  CA  . ASP A 129 ? 0.3366 0.1120 0.2511 -0.0089 -0.1245 -0.0154 715  ASP A CA  
844  C  C   . ASP A 129 ? 0.3379 0.1173 0.2580 -0.0310 -0.1090 -0.0028 715  ASP A C   
845  O  O   . ASP A 129 ? 0.3581 0.1389 0.2585 -0.0408 -0.1106 0.0016  715  ASP A O   
846  C  CB  . ASP A 129 ? 0.3479 0.1367 0.2608 -0.0032 -0.1439 -0.0344 715  ASP A CB  
847  C  CG  . ASP A 129 ? 0.3969 0.2305 0.3161 0.0202  -0.1648 -0.0521 715  ASP A CG  
848  O  OD1 . ASP A 129 ? 0.4038 0.2563 0.3476 0.0188  -0.1763 -0.0326 715  ASP A OD1 
849  O  OD2 . ASP A 129 ? 0.4235 0.3029 0.3521 0.0069  -0.1600 -0.0641 715  ASP A OD2 
850  N  N   . ALA A 130 ? 0.3195 0.1441 0.2502 -0.0236 -0.1150 -0.0039 716  ALA A N   
851  C  CA  . ALA A 130 ? 0.3167 0.1586 0.2605 -0.0405 -0.1061 0.0106  716  ALA A CA  
852  C  C   . ALA A 130 ? 0.3198 0.1639 0.2622 -0.0586 -0.0994 0.0315  716  ALA A C   
853  O  O   . ALA A 130 ? 0.3094 0.2565 0.2954 -0.0678 -0.1011 0.0312  716  ALA A O   
854  C  CB  . ALA A 130 ? 0.3125 0.1801 0.2902 -0.0325 -0.0903 0.0094  716  ALA A CB  
855  N  N   . GLN A 131 ? 0.3065 0.1212 0.2475 -0.0217 -0.0960 0.0193  717  GLN A N   
856  C  CA  . GLN A 131 ? 0.2976 0.1372 0.2355 -0.0143 -0.0775 0.0243  717  GLN A CA  
857  C  C   . GLN A 131 ? 0.3071 0.1273 0.2257 -0.0269 -0.0425 0.0384  717  GLN A C   
858  O  O   . GLN A 131 ? 0.3700 0.1673 0.2272 -0.0105 -0.0228 0.0492  717  GLN A O   
859  C  CB  . GLN A 131 ? 0.2940 0.1604 0.2385 -0.0085 -0.0814 0.0113  717  GLN A CB  
860  C  CG  . GLN A 131 ? 0.3211 0.1389 0.2388 -0.0079 -0.0907 0.0052  717  GLN A CG  
861  C  CD  . GLN A 131 ? 0.3388 0.0966 0.2368 -0.0137 -0.0778 0.0107  717  GLN A CD  
862  O  OE1 . GLN A 131 ? 0.3416 0.1301 0.2298 -0.0316 -0.0816 0.0108  717  GLN A OE1 
863  N  NE2 . GLN A 131 ? 0.3700 0.1062 0.2238 -0.0024 -0.1037 -0.0031 717  GLN A NE2 
864  N  N   . PHE A 132 ? 0.2774 0.1326 0.2237 -0.0412 -0.0368 0.0294  718  PHE A N   
865  C  CA  . PHE A 132 ? 0.2864 0.1377 0.2387 -0.0443 -0.0179 0.0119  718  PHE A CA  
866  C  C   . PHE A 132 ? 0.2954 0.1808 0.2341 -0.0365 -0.0111 0.0057  718  PHE A C   
867  O  O   . PHE A 132 ? 0.2987 0.2480 0.2311 -0.0403 -0.0181 0.0065  718  PHE A O   
868  C  CB  . PHE A 132 ? 0.2685 0.1198 0.2416 -0.0596 -0.0460 0.0185  718  PHE A CB  
869  C  CG  . PHE A 132 ? 0.2753 0.1611 0.2511 -0.0602 -0.0573 0.0221  718  PHE A CG  
870  C  CD1 . PHE A 132 ? 0.2941 0.2454 0.2712 -0.0434 -0.0699 0.0605  718  PHE A CD1 
871  C  CD2 . PHE A 132 ? 0.2934 0.1375 0.2623 -0.0528 -0.0588 0.0033  718  PHE A CD2 
872  C  CE1 . PHE A 132 ? 0.2939 0.2389 0.2675 -0.0357 -0.0802 0.0670  718  PHE A CE1 
873  C  CE2 . PHE A 132 ? 0.3041 0.1516 0.2606 -0.0413 -0.0750 0.0104  718  PHE A CE2 
874  C  CZ  . PHE A 132 ? 0.3118 0.1642 0.2653 -0.0387 -0.0776 0.0380  718  PHE A CZ  
875  N  N   . THR A 133 ? 0.3062 0.1515 0.2424 -0.0353 -0.0078 -0.0010 719  THR A N   
876  C  CA  . THR A 133 ? 0.3223 0.1676 0.2314 -0.0414 -0.0142 0.0119  719  THR A CA  
877  C  C   . THR A 133 ? 0.2836 0.1702 0.2311 -0.0537 -0.0184 0.0301  719  THR A C   
878  O  O   . THR A 133 ? 0.2375 0.1714 0.2230 -0.0564 -0.0153 0.0136  719  THR A O   
879  C  CB  . THR A 133 ? 0.3828 0.1567 0.2373 -0.0807 -0.0074 0.0268  719  THR A CB  
880  O  OG1 . THR A 133 ? 0.3925 0.1753 0.2391 -0.0856 -0.0140 0.0135  719  THR A OG1 
881  C  CG2 . THR A 133 ? 0.3880 0.1844 0.2619 -0.0918 -0.0071 0.0865  719  THR A CG2 
882  N  N   . VAL A 134 ? 0.2976 0.2052 0.2421 -0.0130 -0.0321 0.0209  720  VAL A N   
883  C  CA  . VAL A 134 ? 0.2694 0.2297 0.2460 -0.0185 -0.0639 0.0207  720  VAL A CA  
884  C  C   . VAL A 134 ? 0.2449 0.1941 0.2140 -0.0461 -0.0575 0.0090  720  VAL A C   
885  O  O   . VAL A 134 ? 0.2346 0.1843 0.2313 -0.0628 -0.0392 0.0380  720  VAL A O   
886  C  CB  . VAL A 134 ? 0.2781 0.2899 0.2768 -0.0129 -0.0797 0.0322  720  VAL A CB  
887  C  CG1 . VAL A 134 ? 0.2781 0.2881 0.2887 -0.0169 -0.0660 0.0663  720  VAL A CG1 
888  C  CG2 . VAL A 134 ? 0.3095 0.3831 0.2903 -0.0136 -0.0640 0.0413  720  VAL A CG2 
889  N  N   . ILE A 135 ? 0.2665 0.1998 0.2232 -0.0417 -0.0337 0.0153  721  ILE A N   
890  C  CA  . ILE A 135 ? 0.2855 0.2297 0.2109 -0.0209 0.0125  0.0229  721  ILE A CA  
891  C  C   . ILE A 135 ? 0.2547 0.1655 0.1968 -0.0240 -0.0043 0.0447  721  ILE A C   
892  O  O   . ILE A 135 ? 0.2542 0.1563 0.2215 -0.0328 0.0041  0.0313  721  ILE A O   
893  C  CB  . ILE A 135 ? 0.3264 0.2837 0.2555 -0.0481 0.0444  0.0025  721  ILE A CB  
894  C  CG1 . ILE A 135 ? 0.3531 0.3102 0.2947 -0.0051 0.0429  -0.0140 721  ILE A CG1 
895  C  CG2 . ILE A 135 ? 0.3566 0.3166 0.2666 -0.0604 0.0446  -0.0015 721  ILE A CG2 
896  C  CD1 . ILE A 135 ? 0.3532 0.3735 0.3209 0.0063  0.0368  -0.0019 721  ILE A CD1 
897  N  N   . GLN A 136 ? 0.2480 0.1821 0.1890 -0.0346 -0.0206 0.0261  722  GLN A N   
898  C  CA  . GLN A 136 ? 0.2632 0.1435 0.1782 -0.0078 -0.0252 0.0494  722  GLN A CA  
899  C  C   . GLN A 136 ? 0.2493 0.1396 0.1683 -0.0179 -0.0327 0.0506  722  GLN A C   
900  O  O   . GLN A 136 ? 0.2482 0.1224 0.2005 -0.0333 -0.0349 0.0325  722  GLN A O   
901  C  CB  . GLN A 136 ? 0.3005 0.1231 0.1902 -0.0138 -0.0533 0.0292  722  GLN A CB  
902  C  CG  . GLN A 136 ? 0.3525 0.1528 0.2000 -0.0129 -0.0732 0.0654  722  GLN A CG  
903  C  CD  . GLN A 136 ? 0.3854 0.1754 0.2105 -0.0099 -0.0852 0.0761  722  GLN A CD  
904  O  OE1 . GLN A 136 ? 0.3891 0.1803 0.2407 -0.0241 -0.0829 0.0284  722  GLN A OE1 
905  N  NE2 . GLN A 136 ? 0.3962 0.2173 0.2431 -0.0086 -0.0789 0.0801  722  GLN A NE2 
906  N  N   . LEU A 137 ? 0.2337 0.1440 0.1535 -0.0161 -0.0534 0.0468  723  LEU A N   
907  C  CA  . LEU A 137 ? 0.2353 0.1104 0.1681 -0.0315 -0.0485 0.0459  723  LEU A CA  
908  C  C   . LEU A 137 ? 0.2133 0.1107 0.1830 -0.0091 -0.0300 0.0335  723  LEU A C   
909  O  O   . LEU A 137 ? 0.2120 0.1112 0.1830 -0.0235 -0.0357 0.0271  723  LEU A O   
910  C  CB  . LEU A 137 ? 0.2333 0.1035 0.1849 -0.0270 -0.0711 0.0229  723  LEU A CB  
911  C  CG  . LEU A 137 ? 0.2395 0.1232 0.1889 -0.0269 -0.0574 0.0173  723  LEU A CG  
912  C  CD1 . LEU A 137 ? 0.2514 0.1867 0.2065 -0.0104 -0.0600 -0.0003 723  LEU A CD1 
913  C  CD2 . LEU A 137 ? 0.2739 0.1576 0.2000 -0.0301 -0.0401 0.0411  723  LEU A CD2 
914  N  N   . VAL A 138 ? 0.2124 0.1184 0.1995 -0.0190 -0.0403 0.0246  724  VAL A N   
915  C  CA  . VAL A 138 ? 0.1953 0.1370 0.2095 -0.0189 -0.0264 0.0064  724  VAL A CA  
916  C  C   . VAL A 138 ? 0.2076 0.1350 0.1880 -0.0065 -0.0295 0.0317  724  VAL A C   
917  O  O   . VAL A 138 ? 0.2441 0.1213 0.2127 -0.0161 -0.0182 0.0116  724  VAL A O   
918  C  CB  . VAL A 138 ? 0.2189 0.1677 0.2335 -0.0160 -0.0231 -0.0041 724  VAL A CB  
919  C  CG1 . VAL A 138 ? 0.2239 0.2081 0.2548 0.0160  -0.0091 -0.0091 724  VAL A CG1 
920  C  CG2 . VAL A 138 ? 0.2391 0.1988 0.2400 -0.0178 -0.0613 0.0272  724  VAL A CG2 
921  N  N   . GLY A 139 ? 0.2038 0.1517 0.1800 -0.0168 -0.0165 0.0133  725  GLY A N   
922  C  CA  . GLY A 139 ? 0.2222 0.1427 0.1854 -0.0283 -0.0244 0.0309  725  GLY A CA  
923  C  C   . GLY A 139 ? 0.2061 0.1277 0.1735 0.0005  -0.0458 0.0227  725  GLY A C   
924  O  O   . GLY A 139 ? 0.2392 0.1312 0.1780 -0.0102 -0.0399 0.0099  725  GLY A O   
925  N  N   . MET A 140 ? 0.2057 0.1117 0.1702 -0.0118 -0.0457 0.0270  726  MET A N   
926  C  CA  . MET A 140 ? 0.2153 0.0803 0.1848 0.0083  -0.0432 0.0137  726  MET A CA  
927  C  C   . MET A 140 ? 0.2038 0.0854 0.1718 -0.0068 -0.0594 0.0090  726  MET A C   
928  O  O   . MET A 140 ? 0.2099 0.0904 0.1965 -0.0150 -0.0511 -0.0026 726  MET A O   
929  C  CB  . MET A 140 ? 0.2427 0.0696 0.1987 -0.0078 -0.0434 0.0037  726  MET A CB  
930  C  CG  . MET A 140 ? 0.2316 0.0985 0.2037 -0.0072 -0.0538 0.0041  726  MET A CG  
931  S  SD  . MET A 140 ? 0.2446 0.1077 0.2208 -0.0016 -0.0367 0.0028  726  MET A SD  
932  C  CE  . MET A 140 ? 0.2614 0.1185 0.2329 0.0113  -0.0414 0.0481  726  MET A CE  
933  N  N   . LEU A 141 ? 0.2114 0.1049 0.1587 0.0116  -0.0665 0.0184  727  LEU A N   
934  C  CA  . LEU A 141 ? 0.2021 0.0947 0.1735 0.0065  -0.0665 0.0016  727  LEU A CA  
935  C  C   . LEU A 141 ? 0.1952 0.0915 0.1754 0.0043  -0.0368 -0.0028 727  LEU A C   
936  O  O   . LEU A 141 ? 0.2128 0.0721 0.1703 -0.0126 -0.0423 0.0033  727  LEU A O   
937  C  CB  . LEU A 141 ? 0.2255 0.0907 0.1905 0.0054  -0.0697 0.0094  727  LEU A CB  
938  C  CG  . LEU A 141 ? 0.2767 0.0971 0.1929 -0.0106 -0.0815 -0.0125 727  LEU A CG  
939  C  CD1 . LEU A 141 ? 0.2932 0.1564 0.2292 -0.0107 -0.0978 0.0058  727  LEU A CD1 
940  C  CD2 . LEU A 141 ? 0.3064 0.1169 0.1900 0.0270  -0.0594 -0.0145 727  LEU A CD2 
941  N  N   . ARG A 142 ? 0.1992 0.1077 0.1690 0.0105  -0.0271 -0.0072 728  ARG A N   
942  C  CA  . ARG A 142 ? 0.1929 0.1372 0.1646 0.0037  -0.0219 -0.0216 728  ARG A CA  
943  C  C   . ARG A 142 ? 0.1949 0.1157 0.1680 0.0269  -0.0306 -0.0181 728  ARG A C   
944  O  O   . ARG A 142 ? 0.2139 0.1109 0.1768 0.0013  -0.0438 -0.0158 728  ARG A O   
945  C  CB  . ARG A 142 ? 0.2666 0.1401 0.1618 -0.0002 0.0102  -0.0204 728  ARG A CB  
946  C  CG  . ARG A 142 ? 0.3107 0.2070 0.1942 0.0148  -0.0117 -0.0340 728  ARG A CG  
947  C  CD  . ARG A 142 ? 0.3597 0.2653 0.2209 0.0343  -0.0225 -0.0592 728  ARG A CD  
948  N  NE  . ARG A 142 ? 0.3909 0.2731 0.2219 0.0293  -0.0308 -0.0761 728  ARG A NE  
949  C  CZ  . ARG A 142 ? 0.4106 0.3340 0.2060 -0.0020 -0.0226 -0.0473 728  ARG A CZ  
950  N  NH1 . ARG A 142 ? 0.4013 0.3499 0.2022 -0.0164 -0.0385 -0.0036 728  ARG A NH1 
951  N  NH2 . ARG A 142 ? 0.4258 0.3281 0.1894 -0.0017 0.0003  -0.0465 728  ARG A NH2 
952  N  N   . GLY A 143 ? 0.1938 0.1426 0.1535 0.0189  -0.0348 0.0148  729  GLY A N   
953  C  CA  . GLY A 143 ? 0.2136 0.1016 0.1454 0.0234  -0.0405 0.0178  729  GLY A CA  
954  C  C   . GLY A 143 ? 0.2042 0.0745 0.1520 0.0061  -0.0443 0.0162  729  GLY A C   
955  O  O   . GLY A 143 ? 0.2293 0.0772 0.1609 -0.0060 -0.0511 0.0148  729  GLY A O   
956  N  N   . ILE A 144 ? 0.2152 0.0799 0.1363 0.0142  -0.0495 -0.0061 730  ILE A N   
957  C  CA  . ILE A 144 ? 0.2471 0.0801 0.1335 0.0337  -0.0346 -0.0010 730  ILE A CA  
958  C  C   . ILE A 144 ? 0.2122 0.0608 0.1554 0.0136  -0.0446 -0.0064 730  ILE A C   
959  O  O   . ILE A 144 ? 0.2029 0.0698 0.1620 -0.0054 -0.0437 -0.0006 730  ILE A O   
960  C  CB  . ILE A 144 ? 0.2323 0.0646 0.1391 0.0244  -0.0277 -0.0081 730  ILE A CB  
961  C  CG1 . ILE A 144 ? 0.2351 0.0715 0.1558 0.0167  -0.0323 -0.0179 730  ILE A CG1 
962  C  CG2 . ILE A 144 ? 0.2603 0.0746 0.1569 -0.0043 -0.0448 0.0072  730  ILE A CG2 
963  C  CD1 . ILE A 144 ? 0.2449 0.0811 0.1809 -0.0024 -0.0237 -0.0434 730  ILE A CD1 
964  N  N   . ALA A 145 ? 0.1985 0.0971 0.1484 0.0515  -0.0543 -0.0025 731  ALA A N   
965  C  CA  . ALA A 145 ? 0.1816 0.1039 0.1705 0.0335  -0.0437 -0.0150 731  ALA A CA  
966  C  C   . ALA A 145 ? 0.1974 0.1001 0.1635 0.0256  -0.0545 0.0017  731  ALA A C   
967  O  O   . ALA A 145 ? 0.2271 0.0787 0.1869 0.0102  -0.0581 0.0177  731  ALA A O   
968  C  CB  . ALA A 145 ? 0.1682 0.1139 0.2030 0.0228  -0.0403 0.0007  731  ALA A CB  
969  N  N   A SER A 146 ? 0.2083 0.1072 0.1503 -0.0013 -0.0587 -0.0035 732  SER A N   
970  N  N   B SER A 146 ? 0.1984 0.1035 0.1518 0.0130  -0.0529 0.0002  732  SER A N   
971  C  CA  A SER A 146 ? 0.2348 0.1229 0.1463 -0.0208 -0.0446 -0.0114 732  SER A CA  
972  C  CA  B SER A 146 ? 0.1979 0.1198 0.1582 0.0013  -0.0424 -0.0016 732  SER A CA  
973  C  C   A SER A 146 ? 0.2333 0.0810 0.1402 0.0243  -0.0494 0.0125  732  SER A C   
974  C  C   B SER A 146 ? 0.1836 0.0853 0.1582 0.0202  -0.0657 -0.0086 732  SER A C   
975  O  O   A SER A 146 ? 0.2658 0.0761 0.1305 -0.0007 -0.0742 0.0066  732  SER A O   
976  O  O   B SER A 146 ? 0.1635 0.0637 0.1365 0.0162  -0.0885 -0.0140 732  SER A O   
977  C  CB  A SER A 146 ? 0.2652 0.1269 0.1546 -0.0136 -0.0439 -0.0188 732  SER A CB  
978  C  CB  B SER A 146 ? 0.2090 0.1477 0.1549 0.0047  -0.0377 0.0160  732  SER A CB  
979  O  OG  A SER A 146 ? 0.2873 0.1302 0.1619 -0.0361 -0.0573 -0.0323 732  SER A OG  
980  O  OG  B SER A 146 ? 0.2331 0.1724 0.1690 -0.0162 -0.0234 0.0242  732  SER A OG  
981  N  N   . GLY A 147 ? 0.1701 0.0780 0.1518 0.0177  -0.0410 -0.0019 733  GLY A N   
982  C  CA  . GLY A 147 ? 0.1591 0.1371 0.1555 0.0332  -0.0692 -0.0035 733  GLY A CA  
983  C  C   . GLY A 147 ? 0.1639 0.1864 0.1706 0.0282  -0.0705 0.0226  733  GLY A C   
984  O  O   . GLY A 147 ? 0.1767 0.2955 0.1620 0.0055  -0.0452 -0.0080 733  GLY A O   
985  N  N   . MET A 148 ? 0.2421 0.0785 0.1553 0.0142  -0.0660 0.0157  734  MET A N   
986  C  CA  . MET A 148 ? 0.2423 0.0700 0.1427 0.0087  -0.0664 -0.0084 734  MET A CA  
987  C  C   . MET A 148 ? 0.2617 0.0738 0.1631 0.0095  -0.0601 -0.0094 734  MET A C   
988  O  O   . MET A 148 ? 0.2617 0.0733 0.1783 0.0072  -0.0553 0.0057  734  MET A O   
989  C  CB  . MET A 148 ? 0.2459 0.0845 0.1499 0.0137  -0.0635 -0.0020 734  MET A CB  
990  C  CG  . MET A 148 ? 0.2526 0.0959 0.1553 0.0164  -0.0352 -0.0076 734  MET A CG  
991  S  SD  . MET A 148 ? 0.2582 0.1302 0.1644 0.0181  -0.0548 0.0131  734  MET A SD  
992  C  CE  . MET A 148 ? 0.2681 0.1537 0.1819 -0.0151 -0.0515 0.0130  734  MET A CE  
993  N  N   . LYS A 149 ? 0.2359 0.0720 0.1847 0.0115  -0.0647 -0.0131 735  LYS A N   
994  C  CA  . LYS A 149 ? 0.2463 0.0904 0.1875 -0.0044 -0.0746 0.0055  735  LYS A CA  
995  C  C   . LYS A 149 ? 0.2615 0.0761 0.1794 0.0086  -0.0704 0.0002  735  LYS A C   
996  O  O   . LYS A 149 ? 0.2790 0.0808 0.1935 -0.0068 -0.0602 0.0186  735  LYS A O   
997  C  CB  . LYS A 149 ? 0.2649 0.1159 0.2071 0.0226  -0.0531 -0.0052 735  LYS A CB  
998  C  CG  . LYS A 149 ? 0.2975 0.1276 0.2313 0.0256  -0.0478 -0.0387 735  LYS A CG  
999  C  CD  . LYS A 149 ? 0.3295 0.1856 0.2453 0.0281  -0.0466 -0.0278 735  LYS A CD  
1000 C  CE  . LYS A 149 ? 0.3617 0.1875 0.2757 0.0094  -0.0228 -0.0536 735  LYS A CE  
1001 N  NZ  . LYS A 149 ? 0.3778 0.2165 0.2991 -0.0317 0.0060  -0.0732 735  LYS A NZ  
1002 N  N   . TYR A 150 ? 0.2499 0.0846 0.1747 0.0008  -0.0807 -0.0162 736  TYR A N   
1003 C  CA  . TYR A 150 ? 0.2494 0.0892 0.1666 0.0050  -0.0891 0.0041  736  TYR A CA  
1004 C  C   . TYR A 150 ? 0.2798 0.1023 0.1800 0.0110  -0.0753 -0.0163 736  TYR A C   
1005 O  O   . TYR A 150 ? 0.2967 0.0825 0.1847 -0.0044 -0.0674 -0.0037 736  TYR A O   
1006 C  CB  . TYR A 150 ? 0.2560 0.1312 0.1859 -0.0105 -0.0905 -0.0027 736  TYR A CB  
1007 C  CG  . TYR A 150 ? 0.2611 0.1585 0.2110 0.0205  -0.0761 -0.0134 736  TYR A CG  
1008 C  CD1 . TYR A 150 ? 0.2800 0.1904 0.2377 0.0070  -0.0593 -0.0471 736  TYR A CD1 
1009 C  CD2 . TYR A 150 ? 0.2854 0.1525 0.2180 0.0050  -0.0793 0.0094  736  TYR A CD2 
1010 C  CE1 . TYR A 150 ? 0.2823 0.1816 0.2167 0.0182  -0.0681 -0.0451 736  TYR A CE1 
1011 C  CE2 . TYR A 150 ? 0.2940 0.1177 0.2183 0.0074  -0.0666 -0.0266 736  TYR A CE2 
1012 C  CZ  . TYR A 150 ? 0.2759 0.1636 0.2122 0.0285  -0.0836 -0.0430 736  TYR A CZ  
1013 O  OH  . TYR A 150 ? 0.2850 0.1957 0.2322 0.0280  -0.0608 -0.0713 736  TYR A OH  
1014 N  N   . LEU A 151 ? 0.2708 0.1099 0.1902 -0.0124 -0.0656 0.0036  737  LEU A N   
1015 C  CA  . LEU A 151 ? 0.2916 0.0866 0.1938 -0.0050 -0.0474 -0.0152 737  LEU A CA  
1016 C  C   . LEU A 151 ? 0.2883 0.0847 0.1826 -0.0231 -0.0475 -0.0171 737  LEU A C   
1017 O  O   . LEU A 151 ? 0.3504 0.1140 0.2039 -0.0565 -0.0511 -0.0164 737  LEU A O   
1018 C  CB  . LEU A 151 ? 0.2826 0.0780 0.2158 0.0073  -0.0408 -0.0179 737  LEU A CB  
1019 C  CG  . LEU A 151 ? 0.3358 0.1438 0.2589 -0.0096 -0.0455 -0.0214 737  LEU A CG  
1020 C  CD1 . LEU A 151 ? 0.3649 0.1745 0.2946 0.0099  -0.0235 -0.0839 737  LEU A CD1 
1021 C  CD2 . LEU A 151 ? 0.3253 0.2082 0.2533 -0.0216 -0.0618 -0.0133 737  LEU A CD2 
1022 N  N   . SER A 152 ? 0.2983 0.0989 0.1713 -0.0168 -0.0898 -0.0160 738  SER A N   
1023 C  CA  . SER A 152 ? 0.3178 0.1111 0.1765 0.0056  -0.1131 0.0002  738  SER A CA  
1024 C  C   . SER A 152 ? 0.3457 0.0996 0.1810 0.0006  -0.0994 0.0078  738  SER A C   
1025 O  O   . SER A 152 ? 0.3859 0.1080 0.1933 -0.0071 -0.0879 0.0151  738  SER A O   
1026 C  CB  . SER A 152 ? 0.3376 0.1975 0.2077 -0.0053 -0.0766 0.0291  738  SER A CB  
1027 O  OG  . SER A 152 ? 0.3520 0.1990 0.2102 0.0097  -0.0846 -0.0071 738  SER A OG  
1028 N  N   . ASP A 153 ? 0.3207 0.0895 0.1741 -0.0065 -0.0814 0.0020  739  ASP A N   
1029 C  CA  . ASP A 153 ? 0.3508 0.0959 0.1867 -0.0074 -0.0726 -0.0069 739  ASP A CA  
1030 C  C   . ASP A 153 ? 0.3662 0.1132 0.1832 -0.0155 -0.0611 -0.0308 739  ASP A C   
1031 O  O   . ASP A 153 ? 0.4149 0.1114 0.1995 -0.0145 -0.0504 -0.0162 739  ASP A O   
1032 C  CB  . ASP A 153 ? 0.3612 0.1313 0.1962 0.0028  -0.0685 0.0015  739  ASP A CB  
1033 C  CG  . ASP A 153 ? 0.3843 0.1718 0.2239 0.0172  -0.0700 -0.0173 739  ASP A CG  
1034 O  OD1 . ASP A 153 ? 0.3770 0.2206 0.2594 0.0330  -0.0695 -0.0439 739  ASP A OD1 
1035 O  OD2 . ASP A 153 ? 0.3839 0.2785 0.2155 -0.0602 -0.0918 -0.0176 739  ASP A OD2 
1036 N  N   . MET A 154 ? 0.3631 0.1107 0.1898 -0.0204 -0.0701 -0.0245 740  MET A N   
1037 C  CA  . MET A 154 ? 0.3771 0.1557 0.2159 -0.0195 -0.0521 -0.0369 740  MET A CA  
1038 C  C   . MET A 154 ? 0.3855 0.1222 0.2109 -0.0544 -0.0361 -0.0281 740  MET A C   
1039 O  O   . MET A 154 ? 0.4208 0.1948 0.2394 -0.0844 -0.0066 -0.0056 740  MET A O   
1040 C  CB  . MET A 154 ? 0.3843 0.1951 0.2065 -0.0036 -0.0633 -0.0291 740  MET A CB  
1041 C  CG  . MET A 154 ? 0.4143 0.2215 0.2153 -0.0305 -0.0649 -0.0328 740  MET A CG  
1042 S  SD  . MET A 154 ? 0.4388 0.2898 0.2278 -0.0560 -0.0582 -0.0436 740  MET A SD  
1043 C  CE  . MET A 154 ? 0.4182 0.2540 0.2628 -0.0576 -0.0805 -0.0283 740  MET A CE  
1044 N  N   . GLY A 155 ? 0.3856 0.1033 0.1918 -0.0196 -0.0332 -0.0167 741  GLY A N   
1045 C  CA  . GLY A 155 ? 0.3964 0.1008 0.2041 0.0002  -0.0226 -0.0104 741  GLY A CA  
1046 C  C   . GLY A 155 ? 0.3489 0.0897 0.2263 0.0056  -0.0330 0.0048  741  GLY A C   
1047 O  O   . GLY A 155 ? 0.4135 0.1862 0.2489 0.0470  -0.0212 0.0417  741  GLY A O   
1048 N  N   A TYR A 156 ? 0.3081 0.0954 0.2148 -0.0027 -0.0685 -0.0305 742  TYR A N   
1049 N  N   B TYR A 156 ? 0.3252 0.0909 0.2216 0.0034  -0.0645 -0.0152 742  TYR A N   
1050 C  CA  A TYR A 156 ? 0.2766 0.1314 0.2509 -0.0060 -0.0979 -0.0262 742  TYR A CA  
1051 C  CA  B TYR A 156 ? 0.2958 0.1138 0.2416 0.0041  -0.0925 -0.0170 742  TYR A CA  
1052 C  C   A TYR A 156 ? 0.2707 0.1305 0.2541 -0.0074 -0.0638 -0.0588 742  TYR A C   
1053 C  C   B TYR A 156 ? 0.2788 0.1447 0.2350 -0.0027 -0.0780 -0.0242 742  TYR A C   
1054 O  O   A TYR A 156 ? 0.2462 0.2392 0.2718 -0.0215 -0.0432 -0.1085 742  TYR A O   
1055 O  O   B TYR A 156 ? 0.2558 0.2028 0.2333 -0.0042 -0.0798 -0.0232 742  TYR A O   
1056 C  CB  A TYR A 156 ? 0.2512 0.1469 0.2833 -0.0087 -0.1086 -0.0078 742  TYR A CB  
1057 C  CB  B TYR A 156 ? 0.2870 0.1049 0.2654 0.0076  -0.1038 -0.0152 742  TYR A CB  
1058 C  CG  A TYR A 156 ? 0.2421 0.1676 0.2885 -0.0155 -0.1125 0.0119  742  TYR A CG  
1059 C  CG  B TYR A 156 ? 0.2910 0.1214 0.2800 -0.0130 -0.1060 -0.0075 742  TYR A CG  
1060 C  CD1 A TYR A 156 ? 0.2575 0.1937 0.3028 0.0022  -0.1016 0.0152  742  TYR A CD1 
1061 C  CD1 B TYR A 156 ? 0.2982 0.1609 0.2847 -0.0221 -0.1082 -0.0054 742  TYR A CD1 
1062 C  CD2 A TYR A 156 ? 0.2429 0.1748 0.2906 -0.0114 -0.1086 0.0287  742  TYR A CD2 
1063 C  CD2 B TYR A 156 ? 0.2861 0.1468 0.2867 -0.0256 -0.1147 -0.0098 742  TYR A CD2 
1064 C  CE1 A TYR A 156 ? 0.2648 0.1849 0.3132 0.0195  -0.0878 0.0299  742  TYR A CE1 
1065 C  CE1 B TYR A 156 ? 0.2849 0.1674 0.2987 -0.0477 -0.1225 -0.0090 742  TYR A CE1 
1066 C  CE2 A TYR A 156 ? 0.2526 0.1821 0.2965 0.0124  -0.1055 0.0458  742  TYR A CE2 
1067 C  CE2 B TYR A 156 ? 0.2942 0.1750 0.3092 -0.0205 -0.1059 -0.0010 742  TYR A CE2 
1068 C  CZ  A TYR A 156 ? 0.2685 0.1764 0.3143 0.0048  -0.0727 0.0250  742  TYR A CZ  
1069 C  CZ  B TYR A 156 ? 0.2873 0.1656 0.3139 -0.0380 -0.1275 -0.0129 742  TYR A CZ  
1070 O  OH  A TYR A 156 ? 0.2977 0.2094 0.3349 0.0348  -0.0165 0.0157  742  TYR A OH  
1071 O  OH  B TYR A 156 ? 0.3038 0.2137 0.3485 -0.0232 -0.1169 -0.0106 742  TYR A OH  
1072 N  N   . VAL A 157 ? 0.2775 0.1124 0.2155 -0.0101 -0.0859 -0.0076 743  VAL A N   
1073 C  CA  . VAL A 157 ? 0.2634 0.1230 0.2049 -0.0061 -0.0896 0.0087  743  VAL A CA  
1074 C  C   . VAL A 157 ? 0.2710 0.1168 0.1952 -0.0055 -0.0525 0.0121  743  VAL A C   
1075 O  O   . VAL A 157 ? 0.3024 0.1292 0.2281 -0.0305 -0.0100 0.0087  743  VAL A O   
1076 C  CB  . VAL A 157 ? 0.2793 0.1545 0.2276 0.0168  -0.0817 0.0197  743  VAL A CB  
1077 C  CG1 . VAL A 157 ? 0.2677 0.2007 0.2258 0.0206  -0.0752 -0.0004 743  VAL A CG1 
1078 C  CG2 . VAL A 157 ? 0.3220 0.2372 0.2638 0.0069  -0.0673 0.0398  743  VAL A CG2 
1079 N  N   . HIS A 158 ? 0.2413 0.0906 0.1804 -0.0025 -0.0531 -0.0154 744  HIS A N   
1080 C  CA  . HIS A 158 ? 0.2451 0.1162 0.1722 0.0198  -0.0262 0.0222  744  HIS A CA  
1081 C  C   . HIS A 158 ? 0.2323 0.1389 0.1562 -0.0125 -0.0289 0.0311  744  HIS A C   
1082 O  O   . HIS A 158 ? 0.2449 0.1723 0.1726 -0.0354 -0.0332 -0.0060 744  HIS A O   
1083 C  CB  . HIS A 158 ? 0.2299 0.1118 0.1946 0.0032  -0.0458 0.0441  744  HIS A CB  
1084 C  CG  . HIS A 158 ? 0.2443 0.1118 0.1874 0.0122  -0.0593 0.0175  744  HIS A CG  
1085 N  ND1 . HIS A 158 ? 0.2530 0.1571 0.1732 -0.0179 -0.0566 0.0049  744  HIS A ND1 
1086 C  CD2 . HIS A 158 ? 0.2470 0.1674 0.2019 0.0178  -0.0538 0.0149  744  HIS A CD2 
1087 C  CE1 . HIS A 158 ? 0.2184 0.1548 0.2129 0.0019  -0.0803 0.0269  744  HIS A CE1 
1088 N  NE2 . HIS A 158 ? 0.2347 0.1539 0.2217 0.0082  -0.0502 0.0168  744  HIS A NE2 
1089 N  N   . ARG A 159 ? 0.2555 0.1302 0.1468 -0.0153 -0.0575 0.0169  745  ARG A N   
1090 C  CA  . ARG A 159 ? 0.2797 0.1225 0.1800 -0.0577 -0.0258 0.0429  745  ARG A CA  
1091 C  C   . ARG A 159 ? 0.2738 0.1382 0.1848 -0.0468 -0.0250 0.0114  745  ARG A C   
1092 O  O   . ARG A 159 ? 0.3350 0.1984 0.1883 -0.0281 -0.0355 -0.0170 745  ARG A O   
1093 C  CB  . ARG A 159 ? 0.2971 0.1333 0.1895 -0.0479 -0.0212 0.0514  745  ARG A CB  
1094 C  CG  . ARG A 159 ? 0.3186 0.1399 0.2217 -0.0361 -0.0377 0.0750  745  ARG A CG  
1095 C  CD  . ARG A 159 ? 0.3715 0.1323 0.2937 -0.0577 0.0037  0.0674  745  ARG A CD  
1096 N  NE  . ARG A 159 ? 0.3976 0.3256 0.3437 -0.0580 -0.0178 0.0934  745  ARG A NE  
1097 C  CZ  . ARG A 159 ? 0.4250 0.4223 0.3744 -0.0413 -0.0200 0.1268  745  ARG A CZ  
1098 N  NH1 . ARG A 159 ? 0.4473 0.4673 0.4168 -0.0193 -0.0081 0.1164  745  ARG A NH1 
1099 N  NH2 . ARG A 159 ? 0.4282 0.4690 0.3611 -0.0245 -0.0297 0.1413  745  ARG A NH2 
1100 N  N   . ASP A 160 ? 0.2537 0.1168 0.2116 -0.0159 -0.0357 0.0276  746  ASP A N   
1101 C  CA  . ASP A 160 ? 0.2954 0.1688 0.2367 -0.0016 -0.0210 0.0337  746  ASP A CA  
1102 C  C   . ASP A 160 ? 0.2825 0.1593 0.1953 -0.0043 -0.0273 0.0104  746  ASP A C   
1103 O  O   . ASP A 160 ? 0.2641 0.1437 0.2279 0.0066  -0.0229 0.0047  746  ASP A O   
1104 C  CB  . ASP A 160 ? 0.3498 0.2516 0.2923 0.0411  0.0134  0.0301  746  ASP A CB  
1105 C  CG  . ASP A 160 ? 0.4333 0.3990 0.3205 0.0714  0.0078  0.0310  746  ASP A CG  
1106 O  OD1 . ASP A 160 ? 0.4873 0.4448 0.3039 0.0769  0.0011  0.0114  746  ASP A OD1 
1107 O  OD2 . ASP A 160 ? 0.4639 0.4376 0.3410 0.0976  0.0240  0.0309  746  ASP A OD2 
1108 N  N   . LEU A 161 ? 0.2534 0.1250 0.1679 -0.0224 -0.0470 0.0125  747  LEU A N   
1109 C  CA  . LEU A 161 ? 0.2470 0.0828 0.1768 -0.0117 -0.0519 0.0115  747  LEU A CA  
1110 C  C   . LEU A 161 ? 0.2498 0.0819 0.1768 -0.0020 -0.0576 -0.0019 747  LEU A C   
1111 O  O   . LEU A 161 ? 0.2627 0.1365 0.2056 0.0158  -0.0893 0.0044  747  LEU A O   
1112 C  CB  . LEU A 161 ? 0.2477 0.0793 0.1684 -0.0210 -0.0469 0.0102  747  LEU A CB  
1113 C  CG  . LEU A 161 ? 0.2718 0.1122 0.1846 -0.0083 -0.0439 0.0123  747  LEU A CG  
1114 C  CD1 . LEU A 161 ? 0.3104 0.1416 0.2025 0.0387  -0.0350 0.0263  747  LEU A CD1 
1115 C  CD2 . LEU A 161 ? 0.2804 0.1493 0.1915 0.0031  -0.0486 0.0017  747  LEU A CD2 
1116 N  N   . ALA A 162 ? 0.2320 0.0712 0.1848 0.0047  -0.0422 0.0149  748  ALA A N   
1117 C  CA  . ALA A 162 ? 0.2357 0.0836 0.1489 0.0013  -0.0321 0.0102  748  ALA A CA  
1118 C  C   . ALA A 162 ? 0.2319 0.0787 0.1382 -0.0130 -0.0189 -0.0053 748  ALA A C   
1119 O  O   . ALA A 162 ? 0.2381 0.1247 0.1434 -0.0089 -0.0499 -0.0034 748  ALA A O   
1120 C  CB  . ALA A 162 ? 0.2457 0.1308 0.1575 -0.0149 -0.0060 -0.0114 748  ALA A CB  
1121 N  N   . ALA A 163 ? 0.2208 0.0862 0.1604 -0.0051 -0.0189 0.0024  749  ALA A N   
1122 C  CA  . ALA A 163 ? 0.2369 0.0778 0.1736 -0.0148 -0.0258 0.0267  749  ALA A CA  
1123 C  C   . ALA A 163 ? 0.2281 0.1002 0.1709 0.0092  -0.0178 0.0167  749  ALA A C   
1124 O  O   . ALA A 163 ? 0.2392 0.1209 0.1593 -0.0029 -0.0432 0.0072  749  ALA A O   
1125 C  CB  . ALA A 163 ? 0.2335 0.0785 0.1947 -0.0355 -0.0266 0.0188  749  ALA A CB  
1126 N  N   . ARG A 164 ? 0.1961 0.1224 0.1799 0.0309  0.0012  0.0080  750  ARG A N   
1127 C  CA  . ARG A 164 ? 0.2453 0.0992 0.2073 0.0109  0.0087  -0.0022 750  ARG A CA  
1128 C  C   . ARG A 164 ? 0.2440 0.1230 0.2444 -0.0108 -0.0372 -0.0044 750  ARG A C   
1129 O  O   . ARG A 164 ? 0.2545 0.1665 0.2937 0.0115  -0.0642 -0.0295 750  ARG A O   
1130 C  CB  . ARG A 164 ? 0.2888 0.1428 0.2165 0.0246  0.0457  0.0151  750  ARG A CB  
1131 C  CG  . ARG A 164 ? 0.3488 0.1886 0.2522 0.0278  0.0752  0.0556  750  ARG A CG  
1132 C  CD  . ARG A 164 ? 0.4302 0.2957 0.3001 0.0570  0.1203  0.0972  750  ARG A CD  
1133 N  NE  . ARG A 164 ? 0.5112 0.4744 0.3352 0.0630  0.1413  0.1095  750  ARG A NE  
1134 C  CZ  . ARG A 164 ? 0.5712 0.6165 0.3735 0.0377  0.1496  0.1115  750  ARG A CZ  
1135 N  NH1 . ARG A 164 ? 0.5836 0.6637 0.3967 0.0455  0.1467  0.0812  750  ARG A NH1 
1136 N  NH2 . ARG A 164 ? 0.6110 0.6310 0.3975 0.0242  0.1413  0.1413  750  ARG A NH2 
1137 N  N   . ASN A 165 ? 0.2479 0.1017 0.2109 -0.0044 -0.0355 -0.0063 751  ASN A N   
1138 C  CA  . ASN A 165 ? 0.2350 0.1150 0.2249 -0.0196 -0.0295 0.0166  751  ASN A CA  
1139 C  C   . ASN A 165 ? 0.2390 0.0722 0.2066 -0.0149 -0.0570 0.0005  751  ASN A C   
1140 O  O   . ASN A 165 ? 0.2617 0.0983 0.2416 -0.0186 -0.0429 -0.0285 751  ASN A O   
1141 C  CB  . ASN A 165 ? 0.2190 0.1428 0.2507 -0.0053 0.0040  0.0343  751  ASN A CB  
1142 C  CG  . ASN A 165 ? 0.2583 0.2048 0.2827 -0.0002 0.0309  0.0504  751  ASN A CG  
1143 O  OD1 . ASN A 165 ? 0.2609 0.2437 0.2952 0.0244  0.0290  0.0709  751  ASN A OD1 
1144 N  ND2 . ASN A 165 ? 0.3041 0.2380 0.2989 0.0497  0.0591  0.0811  751  ASN A ND2 
1145 N  N   A ILE A 166 ? 0.2272 0.1007 0.1785 0.0083  -0.0719 0.0263  752  ILE A N   
1146 N  N   B ILE A 166 ? 0.2320 0.0842 0.1940 -0.0037 -0.0609 0.0083  752  ILE A N   
1147 C  CA  A ILE A 166 ? 0.2346 0.0764 0.1670 0.0037  -0.0844 0.0101  752  ILE A CA  
1148 C  CA  B ILE A 166 ? 0.2250 0.0830 0.1799 -0.0003 -0.0604 0.0115  752  ILE A CA  
1149 C  C   A ILE A 166 ? 0.2188 0.0657 0.1739 0.0050  -0.0615 -0.0016 752  ILE A C   
1150 C  C   B ILE A 166 ? 0.2157 0.0817 0.1698 0.0048  -0.0594 0.0215  752  ILE A C   
1151 O  O   A ILE A 166 ? 0.2368 0.0744 0.2013 0.0103  -0.0479 -0.0285 752  ILE A O   
1152 O  O   B ILE A 166 ? 0.2150 0.0881 0.1696 0.0255  -0.0506 0.0324  752  ILE A O   
1153 C  CB  A ILE A 166 ? 0.2484 0.0965 0.1683 0.0357  -0.0890 -0.0063 752  ILE A CB  
1154 C  CB  B ILE A 166 ? 0.2277 0.0899 0.1798 0.0050  -0.0514 0.0015  752  ILE A CB  
1155 C  CG1 A ILE A 166 ? 0.2781 0.0957 0.1690 0.0217  -0.0705 -0.0129 752  ILE A CG1 
1156 C  CG1 B ILE A 166 ? 0.2300 0.1009 0.1763 -0.0093 -0.0391 0.0006  752  ILE A CG1 
1157 C  CG2 A ILE A 166 ? 0.2537 0.0951 0.1739 0.0094  -0.0748 -0.0177 752  ILE A CG2 
1158 C  CG2 B ILE A 166 ? 0.2268 0.0879 0.1820 0.0052  -0.0508 0.0060  752  ILE A CG2 
1159 C  CD1 A ILE A 166 ? 0.2581 0.1085 0.1660 0.0120  -0.0757 0.0153  752  ILE A CD1 
1160 C  CD1 B ILE A 166 ? 0.2174 0.0968 0.1686 -0.0227 -0.0425 -0.0029 752  ILE A CD1 
1161 N  N   . LEU A 167 ? 0.2077 0.0768 0.1563 -0.0022 -0.0626 0.0313  753  LEU A N   
1162 C  CA  . LEU A 167 ? 0.2105 0.0980 0.1750 -0.0016 -0.0616 0.0165  753  LEU A CA  
1163 C  C   . LEU A 167 ? 0.2001 0.0716 0.1767 0.0231  -0.0520 0.0179  753  LEU A C   
1164 O  O   . LEU A 167 ? 0.1941 0.0732 0.1885 0.0192  -0.0382 0.0191  753  LEU A O   
1165 C  CB  . LEU A 167 ? 0.1945 0.1082 0.1950 -0.0044 -0.0544 0.0055  753  LEU A CB  
1166 C  CG  . LEU A 167 ? 0.2207 0.1393 0.2350 -0.0015 -0.0225 -0.0107 753  LEU A CG  
1167 C  CD1 . LEU A 167 ? 0.1848 0.1894 0.2474 -0.0338 -0.0653 0.0155  753  LEU A CD1 
1168 C  CD2 . LEU A 167 ? 0.2858 0.1922 0.2984 -0.0280 0.0473  -0.0620 753  LEU A CD2 
1169 N  N   . ILE A 168 ? 0.2250 0.0683 0.1711 -0.0087 -0.0531 0.0192  754  ILE A N   
1170 C  CA  . ILE A 168 ? 0.2297 0.0731 0.1572 -0.0154 -0.0793 0.0144  754  ILE A CA  
1171 C  C   . ILE A 168 ? 0.2434 0.0879 0.1650 0.0044  -0.0757 0.0033  754  ILE A C   
1172 O  O   . ILE A 168 ? 0.2335 0.0993 0.1859 0.0178  -0.0566 0.0153  754  ILE A O   
1173 C  CB  . ILE A 168 ? 0.2268 0.0827 0.1883 -0.0280 -0.0596 -0.0098 754  ILE A CB  
1174 C  CG1 . ILE A 168 ? 0.2167 0.1166 0.1891 -0.0404 -0.0624 0.0042  754  ILE A CG1 
1175 C  CG2 . ILE A 168 ? 0.2237 0.1076 0.1952 0.0122  -0.0828 -0.0383 754  ILE A CG2 
1176 C  CD1 . ILE A 168 ? 0.2174 0.1210 0.1999 -0.0339 -0.0568 0.0022  754  ILE A CD1 
1177 N  N   . ASN A 169 ? 0.2438 0.0949 0.1693 0.0050  -0.0858 0.0289  755  ASN A N   
1178 C  CA  . ASN A 169 ? 0.2604 0.0922 0.1771 -0.0125 -0.0997 0.0257  755  ASN A CA  
1179 C  C   . ASN A 169 ? 0.2828 0.0899 0.1945 -0.0060 -0.0823 0.0247  755  ASN A C   
1180 O  O   . ASN A 169 ? 0.2575 0.0791 0.2041 0.0029  -0.0773 0.0027  755  ASN A O   
1181 C  CB  . ASN A 169 ? 0.2932 0.0951 0.2169 0.0043  -0.0975 -0.0065 755  ASN A CB  
1182 C  CG  . ASN A 169 ? 0.3066 0.0988 0.2146 0.0135  -0.1213 -0.0101 755  ASN A CG  
1183 O  OD1 . ASN A 169 ? 0.3209 0.1038 0.2157 0.0205  -0.1097 0.0065  755  ASN A OD1 
1184 N  ND2 . ASN A 169 ? 0.3389 0.1241 0.2395 0.0229  -0.1222 -0.0236 755  ASN A ND2 
1185 N  N   . SER A 170 ? 0.3005 0.1099 0.1968 0.0260  -0.0827 0.0296  756  SER A N   
1186 C  CA  . SER A 170 ? 0.3120 0.1162 0.1930 0.0375  -0.0872 0.0221  756  SER A CA  
1187 C  C   . SER A 170 ? 0.3304 0.1052 0.2080 0.0130  -0.0798 0.0107  756  SER A C   
1188 O  O   . SER A 170 ? 0.3402 0.1328 0.2404 -0.0032 -0.0484 0.0242  756  SER A O   
1189 C  CB  . SER A 170 ? 0.3585 0.1604 0.1918 0.0346  -0.1102 0.0309  756  SER A CB  
1190 O  OG  . SER A 170 ? 0.3794 0.2329 0.2306 0.0131  -0.0958 0.0198  756  SER A OG  
1191 N  N   . ASN A 171 ? 0.3304 0.1186 0.1858 0.0327  -0.0824 0.0137  757  ASN A N   
1192 C  CA  . ASN A 171 ? 0.3442 0.1367 0.1855 0.0183  -0.0755 0.0121  757  ASN A CA  
1193 C  C   . ASN A 171 ? 0.3385 0.1032 0.1928 0.0038  -0.0494 0.0173  757  ASN A C   
1194 O  O   . ASN A 171 ? 0.3508 0.1756 0.1795 0.0016  -0.0244 0.0138  757  ASN A O   
1195 C  CB  . ASN A 171 ? 0.3886 0.2500 0.1977 0.0357  -0.0846 0.0137  757  ASN A CB  
1196 C  CG  . ASN A 171 ? 0.4595 0.3457 0.2416 0.0192  -0.0705 0.0094  757  ASN A CG  
1197 O  OD1 . ASN A 171 ? 0.4932 0.3665 0.2372 0.0045  -0.0706 0.0410  757  ASN A OD1 
1198 N  ND2 . ASN A 171 ? 0.4734 0.4009 0.2744 0.0118  -0.0762 -0.0183 757  ASN A ND2 
1199 N  N   . LEU A 172 ? 0.3139 0.1020 0.1732 -0.0072 -0.0714 0.0217  758  LEU A N   
1200 C  CA  . LEU A 172 ? 0.2854 0.0854 0.1990 -0.0118 -0.0659 0.0235  758  LEU A CA  
1201 C  C   . LEU A 172 ? 0.2803 0.0852 0.1920 -0.0136 -0.0598 0.0145  758  LEU A C   
1202 O  O   . LEU A 172 ? 0.2755 0.0988 0.2044 -0.0171 -0.0631 0.0240  758  LEU A O   
1203 C  CB  . LEU A 172 ? 0.2762 0.1199 0.2253 -0.0213 -0.0599 0.0473  758  LEU A CB  
1204 C  CG  . LEU A 172 ? 0.2924 0.1321 0.2414 -0.0066 -0.0416 0.0690  758  LEU A CG  
1205 C  CD1 . LEU A 172 ? 0.3210 0.1348 0.2676 -0.0138 -0.0323 0.0726  758  LEU A CD1 
1206 C  CD2 . LEU A 172 ? 0.3307 0.1276 0.2216 -0.0092 -0.0496 0.0397  758  LEU A CD2 
1207 N  N   . VAL A 173 ? 0.2745 0.0871 0.1868 -0.0148 -0.0563 0.0048  759  VAL A N   
1208 C  CA  . VAL A 173 ? 0.2721 0.0793 0.1714 -0.0053 -0.0403 0.0030  759  VAL A CA  
1209 C  C   . VAL A 173 ? 0.2315 0.0674 0.1720 0.0127  -0.0509 0.0048  759  VAL A C   
1210 O  O   . VAL A 173 ? 0.2395 0.0907 0.1742 0.0262  -0.0655 0.0011  759  VAL A O   
1211 C  CB  . VAL A 173 ? 0.2890 0.0864 0.1666 -0.0183 -0.0408 -0.0094 759  VAL A CB  
1212 C  CG1 . VAL A 173 ? 0.2731 0.0845 0.1868 -0.0116 -0.0591 -0.0088 759  VAL A CG1 
1213 C  CG2 . VAL A 173 ? 0.3492 0.1301 0.1492 -0.0220 -0.0333 0.0072  759  VAL A CG2 
1214 N  N   . CYS A 174 ? 0.2365 0.0730 0.1552 0.0006  -0.0545 0.0221  760  CYS A N   
1215 C  CA  . CYS A 174 ? 0.2196 0.0705 0.1691 0.0040  -0.0494 0.0254  760  CYS A CA  
1216 C  C   . CYS A 174 ? 0.2191 0.0647 0.1716 0.0115  -0.0452 0.0113  760  CYS A C   
1217 O  O   . CYS A 174 ? 0.2211 0.0810 0.1893 0.0150  -0.0320 0.0157  760  CYS A O   
1218 C  CB  . CYS A 174 ? 0.2333 0.0896 0.1703 0.0107  -0.0597 0.0017  760  CYS A CB  
1219 S  SG  . CYS A 174 ? 0.2293 0.1172 0.2032 -0.0083 -0.0492 -0.0036 760  CYS A SG  
1220 N  N   . LYS A 175 ? 0.2120 0.0648 0.1668 -0.0142 -0.0437 0.0210  761  LYS A N   
1221 C  CA  . LYS A 175 ? 0.2325 0.0789 0.1398 -0.0267 -0.0626 0.0283  761  LYS A CA  
1222 C  C   . LYS A 175 ? 0.2276 0.0753 0.1608 -0.0071 -0.0730 0.0218  761  LYS A C   
1223 O  O   . LYS A 175 ? 0.2469 0.0808 0.1862 0.0036  -0.0634 -0.0059 761  LYS A O   
1224 C  CB  . LYS A 175 ? 0.2506 0.0988 0.1546 -0.0150 -0.0955 0.0184  761  LYS A CB  
1225 C  CG  . LYS A 175 ? 0.2475 0.1431 0.1474 -0.0105 -0.0826 0.0278  761  LYS A CG  
1226 C  CD  . LYS A 175 ? 0.2551 0.1360 0.1536 -0.0173 -0.0717 0.0296  761  LYS A CD  
1227 C  CE  . LYS A 175 ? 0.2638 0.1384 0.1576 -0.0161 -0.0610 0.0354  761  LYS A CE  
1228 N  NZ  . LYS A 175 ? 0.2644 0.2112 0.1604 -0.0222 -0.0631 0.0160  761  LYS A NZ  
1229 N  N   . VAL A 176 ? 0.2320 0.0741 0.1624 0.0008  -0.0606 0.0227  762  VAL A N   
1230 C  CA  . VAL A 176 ? 0.2206 0.0894 0.1827 -0.0004 -0.0324 0.0412  762  VAL A CA  
1231 C  C   . VAL A 176 ? 0.2103 0.0796 0.1726 -0.0161 -0.0429 0.0104  762  VAL A C   
1232 O  O   . VAL A 176 ? 0.2221 0.0922 0.1843 -0.0129 -0.0634 0.0075  762  VAL A O   
1233 C  CB  . VAL A 176 ? 0.2228 0.0877 0.1861 0.0060  -0.0517 0.0443  762  VAL A CB  
1234 C  CG1 . VAL A 176 ? 0.2514 0.1245 0.2047 0.0106  -0.0210 0.0593  762  VAL A CG1 
1235 C  CG2 . VAL A 176 ? 0.2125 0.1276 0.1933 0.0181  -0.0458 0.0259  762  VAL A CG2 
1236 N  N   A SER A 177 ? 0.2093 0.1041 0.1906 -0.0016 -0.0243 0.0046  763  SER A N   
1237 N  N   B SER A 177 ? 0.2183 0.0968 0.1851 -0.0084 -0.0276 0.0078  763  SER A N   
1238 C  CA  A SER A 177 ? 0.2230 0.1429 0.2236 0.0362  -0.0160 -0.0057 763  SER A CA  
1239 C  CA  B SER A 177 ? 0.2226 0.1179 0.2023 0.0032  -0.0170 0.0097  763  SER A CA  
1240 C  C   A SER A 177 ? 0.2145 0.1622 0.2154 0.0178  -0.0385 0.0337  763  SER A C   
1241 C  C   B SER A 177 ? 0.2322 0.1483 0.2095 -0.0042 -0.0108 0.0222  763  SER A C   
1242 O  O   A SER A 177 ? 0.2145 0.2284 0.2276 0.0260  -0.0331 0.0718  763  SER A O   
1243 O  O   B SER A 177 ? 0.2359 0.1753 0.2161 -0.0032 0.0024  0.0447  763  SER A O   
1244 C  CB  A SER A 177 ? 0.2297 0.2071 0.2533 0.0750  -0.0022 -0.0046 763  SER A CB  
1245 C  CB  B SER A 177 ? 0.2129 0.1229 0.2034 0.0095  -0.0196 0.0137  763  SER A CB  
1246 O  OG  A SER A 177 ? 0.2522 0.2477 0.2665 0.0839  -0.0005 0.0074  763  SER A OG  
1247 O  OG  B SER A 177 ? 0.2199 0.0958 0.1912 0.0192  -0.0197 0.0035  763  SER A OG  
1248 N  N   . ASP A 178 ? 0.2449 0.1809 0.2120 -0.0081 0.0043  0.0147  764  ASP A N   
1249 C  CA  . ASP A 178 ? 0.2669 0.2549 0.2280 -0.0469 0.0137  -0.0016 764  ASP A CA  
1250 C  C   . ASP A 178 ? 0.2561 0.2901 0.2615 -0.0007 0.0030  0.0352  764  ASP A C   
1251 O  O   . ASP A 178 ? 0.2526 0.3667 0.2828 0.0094  -0.0344 0.0432  764  ASP A O   
1252 C  CB  . ASP A 178 ? 0.3460 0.3786 0.2457 -0.0660 0.0484  -0.0244 764  ASP A CB  
1253 C  CG  . ASP A 178 ? 0.4505 0.5415 0.3030 -0.0284 0.0678  -0.0201 764  ASP A CG  
1254 O  OD1 . ASP A 178 ? 0.4660 0.5774 0.3288 0.0171  0.1268  -0.0014 764  ASP A OD1 
1255 O  OD2 . ASP A 178 ? 0.5196 0.6111 0.3281 -0.0298 0.0322  -0.0441 764  ASP A OD2 
1256 N  N   . PHE A 179 ? 0.2960 0.2324 0.2828 0.0081  0.0262  0.0406  765  PHE A N   
1257 C  CA  . PHE A 179 ? 0.3593 0.2518 0.3399 0.0227  0.0639  0.0471  765  PHE A CA  
1258 C  C   . PHE A 179 ? 0.4739 0.3408 0.4205 0.0020  0.1509  0.0334  765  PHE A C   
1259 O  O   . PHE A 179 ? 0.5332 0.3815 0.4709 -0.0097 0.1764  0.0137  765  PHE A O   
1260 C  CB  . PHE A 179 ? 0.3070 0.2544 0.3225 -0.0061 0.0145  0.0128  765  PHE A CB  
1261 C  CG  . PHE A 179 ? 0.3028 0.2145 0.2695 -0.0303 -0.0210 0.0231  765  PHE A CG  
1262 C  CD1 . PHE A 179 ? 0.3116 0.2763 0.2632 0.0076  -0.0297 0.0201  765  PHE A CD1 
1263 C  CD2 . PHE A 179 ? 0.3197 0.2453 0.2676 0.0043  -0.0199 -0.0115 765  PHE A CD2 
1264 C  CE1 . PHE A 179 ? 0.2945 0.2908 0.2383 -0.0081 -0.0473 0.0289  765  PHE A CE1 
1265 C  CE2 . PHE A 179 ? 0.3368 0.2071 0.2466 0.0497  -0.0321 -0.0099 765  PHE A CE2 
1266 C  CZ  . PHE A 179 ? 0.3151 0.2308 0.2339 -0.0190 -0.0457 -0.0014 765  PHE A CZ  
1267 N  N   . GLY A 180 ? 0.4932 0.3607 0.4381 0.0056  0.1664  0.0732  766  GLY A N   
1268 C  CA  . GLY A 180 ? 0.5058 0.3609 0.4450 0.0133  0.1640  0.0825  766  GLY A CA  
1269 C  C   . GLY A 180 ? 0.5205 0.3596 0.4571 -0.0116 0.1547  0.0909  766  GLY A C   
1270 O  O   . GLY A 180 ? 0.5342 0.4006 0.4836 -0.0198 0.1369  0.0803  766  GLY A O   
1271 N  N   . LEU A 181 ? 0.5370 0.3352 0.4522 0.0014  0.1420  0.1046  767  LEU A N   
1272 C  CA  . LEU A 181 ? 0.5385 0.3518 0.4605 -0.0011 0.1301  0.0804  767  LEU A CA  
1273 C  C   . LEU A 181 ? 0.5360 0.3505 0.4713 -0.0278 0.1162  0.0738  767  LEU A C   
1274 O  O   . LEU A 181 ? 0.5147 0.3236 0.4835 -0.0090 0.0870  0.0996  767  LEU A O   
1275 N  N   . SER A 182 ? 0.5447 0.3036 0.4733 -0.0516 0.1211  0.0512  768  SER A N   
1276 C  CA  . SER A 182 ? 0.5687 0.2978 0.4704 -0.0692 0.1215  0.0187  768  SER A CA  
1277 C  C   . SER A 182 ? 0.5913 0.3455 0.4570 -0.0758 0.1115  0.0225  768  SER A C   
1278 O  O   . SER A 182 ? 0.5634 0.3092 0.4531 -0.0484 0.1013  0.0203  768  SER A O   
1279 N  N   . ARG A 183 ? 0.6185 0.3827 0.4402 -0.0766 0.1108  0.0258  769  ARG A N   
1280 C  CA  . ARG A 183 ? 0.6519 0.4174 0.4216 -0.1096 0.1029  0.0560  769  ARG A CA  
1281 C  C   . ARG A 183 ? 0.6192 0.3578 0.3641 -0.1223 0.0529  0.0883  769  ARG A C   
1282 O  O   . ARG A 183 ? 0.5860 0.2852 0.3055 -0.1622 0.0013  0.0801  769  ARG A O   
1283 C  CB  . ARG A 183 ? 0.7261 0.5583 0.4583 -0.0909 0.1453  0.0580  769  ARG A CB  
1284 C  CG  . ARG A 183 ? 0.7950 0.6764 0.4958 -0.0711 0.1747  0.0473  769  ARG A CG  
1285 C  CD  . ARG A 183 ? 0.8613 0.7736 0.5303 -0.0494 0.1972  0.0376  769  ARG A CD  
1286 N  NE  . ARG A 183 ? 0.9129 0.8572 0.5631 -0.0318 0.2190  0.0348  769  ARG A NE  
1287 C  CZ  . ARG A 183 ? 0.9435 0.8973 0.5817 -0.0134 0.2383  0.0446  769  ARG A CZ  
1288 N  NH1 . ARG A 183 ? 0.9500 0.9062 0.5869 -0.0070 0.2472  0.0531  769  ARG A NH1 
1289 N  NH2 . ARG A 183 ? 0.9561 0.9110 0.5912 -0.0082 0.2391  0.0431  769  ARG A NH2 
1290 N  N   . ILE A 200 ? 0.6752 0.5519 0.5548 -0.0446 0.0040  -0.0225 786  ILE A N   
1291 C  CA  . ILE A 200 ? 0.6837 0.5408 0.5422 -0.0445 -0.0063 -0.0253 786  ILE A CA  
1292 C  C   . ILE A 200 ? 0.6577 0.4730 0.4875 -0.0441 -0.0272 -0.0254 786  ILE A C   
1293 O  O   . ILE A 200 ? 0.6814 0.4910 0.4974 -0.0280 -0.0247 -0.0096 786  ILE A O   
1294 C  CB  . ILE A 200 ? 0.7042 0.6166 0.5714 -0.0611 -0.0078 -0.0331 786  ILE A CB  
1295 C  CG1 . ILE A 200 ? 0.7104 0.6600 0.5827 -0.0718 -0.0061 -0.0430 786  ILE A CG1 
1296 C  CG2 . ILE A 200 ? 0.7042 0.6128 0.5760 -0.0749 -0.0177 -0.0380 786  ILE A CG2 
1297 C  CD1 . ILE A 200 ? 0.7004 0.6768 0.5869 -0.0808 -0.0137 -0.0521 786  ILE A CD1 
1298 N  N   . PRO A 201 ? 0.6054 0.4130 0.4265 -0.0845 -0.0496 -0.0403 787  PRO A N   
1299 C  CA  . PRO A 201 ? 0.5695 0.3726 0.3754 -0.0944 -0.0557 -0.0421 787  PRO A CA  
1300 C  C   . PRO A 201 ? 0.5192 0.3123 0.2983 -0.0882 -0.0570 -0.0188 787  PRO A C   
1301 O  O   . PRO A 201 ? 0.4697 0.2840 0.3063 -0.1293 -0.0753 -0.0004 787  PRO A O   
1302 C  CB  . PRO A 201 ? 0.5811 0.3605 0.3757 -0.1070 -0.0768 -0.0750 787  PRO A CB  
1303 C  CG  . PRO A 201 ? 0.5958 0.4069 0.3916 -0.1079 -0.0788 -0.0743 787  PRO A CG  
1304 C  CD  . PRO A 201 ? 0.6049 0.4344 0.4189 -0.0915 -0.0570 -0.0536 787  PRO A CD  
1305 N  N   . ILE A 202 ? 0.5067 0.2542 0.2462 -0.0510 -0.0211 -0.0032 788  ILE A N   
1306 C  CA  . ILE A 202 ? 0.4834 0.2755 0.1904 -0.0460 -0.0192 0.0073  788  ILE A CA  
1307 C  C   . ILE A 202 ? 0.4483 0.2131 0.1626 -0.0057 -0.0361 -0.0069 788  ILE A C   
1308 O  O   . ILE A 202 ? 0.4600 0.2094 0.1490 0.0143  -0.0262 0.0152  788  ILE A O   
1309 C  CB  . ILE A 202 ? 0.5160 0.3910 0.2130 -0.0140 -0.0015 0.0148  788  ILE A CB  
1310 C  CG1 . ILE A 202 ? 0.5363 0.4018 0.2656 0.0341  0.0310  0.0547  788  ILE A CG1 
1311 C  CG2 . ILE A 202 ? 0.5369 0.4246 0.2010 -0.0099 -0.0091 0.0066  788  ILE A CG2 
1312 C  CD1 . ILE A 202 ? 0.5516 0.4446 0.2909 0.0310  0.0443  0.0486  788  ILE A CD1 
1313 N  N   . ARG A 203 ? 0.4113 0.1691 0.1590 0.0033  -0.0378 -0.0007 789  ARG A N   
1314 C  CA  . ARG A 203 ? 0.3682 0.1590 0.1807 0.0135  -0.0388 -0.0194 789  ARG A CA  
1315 C  C   . ARG A 203 ? 0.3233 0.1659 0.1606 0.0204  -0.0701 -0.0085 789  ARG A C   
1316 O  O   . ARG A 203 ? 0.3111 0.1594 0.1908 -0.0005 -0.0672 -0.0036 789  ARG A O   
1317 C  CB  . ARG A 203 ? 0.3800 0.1607 0.1896 0.0018  -0.0178 -0.0111 789  ARG A CB  
1318 C  CG  . ARG A 203 ? 0.3770 0.2031 0.2211 0.0143  -0.0203 -0.0304 789  ARG A CG  
1319 C  CD  . ARG A 203 ? 0.3748 0.1326 0.2315 0.0144  -0.0463 -0.0173 789  ARG A CD  
1320 N  NE  . ARG A 203 ? 0.3609 0.1737 0.2471 0.0237  -0.0345 -0.0277 789  ARG A NE  
1321 C  CZ  . ARG A 203 ? 0.3612 0.1862 0.2704 0.0201  -0.0389 -0.0246 789  ARG A CZ  
1322 N  NH1 . ARG A 203 ? 0.3603 0.1717 0.2857 -0.0010 -0.0181 -0.0099 789  ARG A NH1 
1323 N  NH2 . ARG A 203 ? 0.3777 0.1901 0.2916 -0.0200 -0.0411 -0.0364 789  ARG A NH2 
1324 N  N   . TRP A 204 ? 0.2917 0.1425 0.1482 0.0109  -0.0801 -0.0148 790  TRP A N   
1325 C  CA  . TRP A 204 ? 0.3028 0.1422 0.1318 0.0121  -0.0731 -0.0012 790  TRP A CA  
1326 C  C   . TRP A 204 ? 0.3040 0.1424 0.1319 0.0128  -0.0728 0.0155  790  TRP A C   
1327 O  O   . TRP A 204 ? 0.2970 0.1666 0.1606 -0.0027 -0.0477 0.0216  790  TRP A O   
1328 C  CB  . TRP A 204 ? 0.2860 0.1501 0.1615 0.0025  -0.0820 -0.0031 790  TRP A CB  
1329 C  CG  . TRP A 204 ? 0.2656 0.1304 0.1880 -0.0061 -0.0888 0.0069  790  TRP A CG  
1330 C  CD1 . TRP A 204 ? 0.2679 0.1554 0.1856 0.0032  -0.0822 0.0334  790  TRP A CD1 
1331 C  CD2 . TRP A 204 ? 0.2697 0.1353 0.1787 0.0013  -0.0898 0.0042  790  TRP A CD2 
1332 N  NE1 . TRP A 204 ? 0.2753 0.1389 0.1946 -0.0108 -0.0864 0.0193  790  TRP A NE1 
1333 C  CE2 . TRP A 204 ? 0.2813 0.1686 0.1948 0.0138  -0.1052 0.0037  790  TRP A CE2 
1334 C  CE3 . TRP A 204 ? 0.3113 0.1718 0.2052 -0.0024 -0.0683 -0.0142 790  TRP A CE3 
1335 C  CZ2 . TRP A 204 ? 0.3199 0.1921 0.2233 0.0325  -0.0979 -0.0099 790  TRP A CZ2 
1336 C  CZ3 . TRP A 204 ? 0.3121 0.2115 0.2225 0.0246  -0.0816 -0.0027 790  TRP A CZ3 
1337 C  CH2 . TRP A 204 ? 0.3272 0.2147 0.2387 0.0422  -0.0780 -0.0164 790  TRP A CH2 
1338 N  N   . THR A 205 ? 0.2864 0.1100 0.1688 0.0092  -0.0524 0.0099  791  THR A N   
1339 C  CA  . THR A 205 ? 0.2784 0.1321 0.1716 -0.0084 -0.0535 0.0083  791  THR A CA  
1340 C  C   . THR A 205 ? 0.2814 0.1545 0.1653 0.0224  -0.0525 0.0174  791  THR A C   
1341 O  O   . THR A 205 ? 0.2952 0.1791 0.1822 0.0056  -0.0727 0.0271  791  THR A O   
1342 C  CB  . THR A 205 ? 0.2840 0.1587 0.1664 0.0101  -0.0465 0.0221  791  THR A CB  
1343 O  OG1 . THR A 205 ? 0.2780 0.1964 0.1731 -0.0058 -0.0490 0.0062  791  THR A OG1 
1344 C  CG2 . THR A 205 ? 0.2901 0.1814 0.1931 -0.0149 -0.0345 0.0094  791  THR A CG2 
1345 N  N   . SER A 206 ? 0.2611 0.1455 0.1441 0.0248  -0.0355 0.0282  792  SER A N   
1346 C  CA  . SER A 206 ? 0.2814 0.1224 0.1431 0.0137  -0.0542 0.0094  792  SER A CA  
1347 C  C   . SER A 206 ? 0.2927 0.1563 0.1512 0.0044  -0.0345 0.0049  792  SER A C   
1348 O  O   . SER A 206 ? 0.2891 0.1598 0.1419 -0.0129 -0.0454 0.0275  792  SER A O   
1349 C  CB  . SER A 206 ? 0.2993 0.1298 0.1662 -0.0115 -0.0485 0.0060  792  SER A CB  
1350 O  OG  . SER A 206 ? 0.3091 0.1491 0.1678 0.0126  -0.0698 0.0341  792  SER A OG  
1351 N  N   . PRO A 207 ? 0.2711 0.1678 0.1640 -0.0111 -0.0467 0.0489  793  PRO A N   
1352 C  CA  . PRO A 207 ? 0.2842 0.1842 0.1537 -0.0394 -0.0717 0.0546  793  PRO A CA  
1353 C  C   . PRO A 207 ? 0.2951 0.1623 0.1599 -0.0303 -0.0692 0.0225  793  PRO A C   
1354 O  O   . PRO A 207 ? 0.3016 0.1775 0.1764 -0.0182 -0.0349 0.0057  793  PRO A O   
1355 C  CB  . PRO A 207 ? 0.2914 0.2787 0.1650 -0.0390 -0.0809 0.0586  793  PRO A CB  
1356 C  CG  . PRO A 207 ? 0.2793 0.2925 0.1943 -0.0048 -0.0656 0.0697  793  PRO A CG  
1357 C  CD  . PRO A 207 ? 0.2483 0.2339 0.1830 -0.0087 -0.0558 0.0507  793  PRO A CD  
1358 N  N   . GLU A 208 ? 0.2971 0.1566 0.1476 -0.0283 -0.0826 0.0271  794  GLU A N   
1359 C  CA  . GLU A 208 ? 0.3047 0.1750 0.1635 -0.0157 -0.0755 0.0246  794  GLU A CA  
1360 C  C   . GLU A 208 ? 0.3050 0.1715 0.1630 -0.0096 -0.0996 0.0182  794  GLU A C   
1361 O  O   . GLU A 208 ? 0.3293 0.1701 0.1788 -0.0081 -0.0675 0.0198  794  GLU A O   
1362 C  CB  . GLU A 208 ? 0.3280 0.1834 0.1571 -0.0090 -0.0534 0.0351  794  GLU A CB  
1363 C  CG  . GLU A 208 ? 0.3209 0.1861 0.1714 -0.0075 -0.0601 0.0401  794  GLU A CG  
1364 C  CD  . GLU A 208 ? 0.3079 0.2005 0.1810 0.0088  -0.0772 0.0369  794  GLU A CD  
1365 O  OE1 . GLU A 208 ? 0.3015 0.2199 0.1834 0.0019  -0.0770 0.0405  794  GLU A OE1 
1366 O  OE2 . GLU A 208 ? 0.3157 0.1603 0.1762 -0.0008 -0.0647 0.0373  794  GLU A OE2 
1367 N  N   . ALA A 209 ? 0.2844 0.1422 0.1783 0.0021  -0.0976 0.0205  795  ALA A N   
1368 C  CA  . ALA A 209 ? 0.2884 0.1414 0.1661 -0.0158 -0.0999 0.0266  795  ALA A CA  
1369 C  C   . ALA A 209 ? 0.3164 0.1500 0.1623 -0.0096 -0.0899 0.0123  795  ALA A C   
1370 O  O   . ALA A 209 ? 0.3242 0.1599 0.1851 -0.0074 -0.0416 0.0221  795  ALA A O   
1371 C  CB  . ALA A 209 ? 0.2787 0.1735 0.1806 -0.0304 -0.0972 0.0224  795  ALA A CB  
1372 N  N   . ILE A 210 ? 0.3356 0.1173 0.1502 -0.0089 -0.0781 0.0124  796  ILE A N   
1373 C  CA  . ILE A 210 ? 0.3656 0.1287 0.1782 -0.0160 -0.0622 0.0189  796  ILE A CA  
1374 C  C   . ILE A 210 ? 0.3548 0.1744 0.1764 -0.0136 -0.0724 0.0303  796  ILE A C   
1375 O  O   . ILE A 210 ? 0.3515 0.2077 0.2093 -0.0032 -0.0593 0.0366  796  ILE A O   
1376 C  CB  . ILE A 210 ? 0.3926 0.1243 0.1740 -0.0285 -0.0583 0.0154  796  ILE A CB  
1377 C  CG1 . ILE A 210 ? 0.3918 0.1462 0.1810 -0.0343 -0.0654 0.0388  796  ILE A CG1 
1378 C  CG2 . ILE A 210 ? 0.4325 0.1638 0.2128 -0.0473 -0.0327 -0.0120 796  ILE A CG2 
1379 C  CD1 . ILE A 210 ? 0.3853 0.1750 0.1958 -0.0446 -0.0684 0.0444  796  ILE A CD1 
1380 N  N   . ALA A 211 ? 0.3462 0.1363 0.1679 -0.0038 -0.0821 0.0448  797  ALA A N   
1381 C  CA  . ALA A 211 ? 0.3322 0.1355 0.1820 -0.0110 -0.0664 0.0453  797  ALA A CA  
1382 C  C   . ALA A 211 ? 0.3276 0.1362 0.1774 -0.0559 -0.0572 0.0320  797  ALA A C   
1383 O  O   . ALA A 211 ? 0.3245 0.1686 0.1754 -0.0436 -0.0478 0.0411  797  ALA A O   
1384 C  CB  . ALA A 211 ? 0.3038 0.1583 0.1905 0.0016  -0.0811 0.0563  797  ALA A CB  
1385 N  N   . TYR A 212 ? 0.3285 0.1393 0.1927 -0.0530 -0.0761 0.0221  798  TYR A N   
1386 C  CA  . TYR A 212 ? 0.3244 0.1307 0.1905 -0.0366 -0.0798 0.0328  798  TYR A CA  
1387 C  C   . TYR A 212 ? 0.3301 0.1645 0.1721 -0.0414 -0.0742 0.0466  798  TYR A C   
1388 O  O   . TYR A 212 ? 0.3281 0.2063 0.1888 -0.0512 -0.0605 0.0316  798  TYR A O   
1389 C  CB  . TYR A 212 ? 0.3377 0.1393 0.1822 -0.0059 -0.0649 0.0125  798  TYR A CB  
1390 C  CG  . TYR A 212 ? 0.3552 0.1415 0.1615 -0.0188 -0.0808 0.0132  798  TYR A CG  
1391 C  CD1 . TYR A 212 ? 0.3776 0.1714 0.1508 0.0012  -0.0753 0.0208  798  TYR A CD1 
1392 C  CD2 . TYR A 212 ? 0.3684 0.1393 0.1619 -0.0312 -0.0929 0.0061  798  TYR A CD2 
1393 C  CE1 . TYR A 212 ? 0.3966 0.1364 0.1487 0.0195  -0.0783 0.0209  798  TYR A CE1 
1394 C  CE2 . TYR A 212 ? 0.3843 0.1638 0.1622 -0.0318 -0.0909 0.0405  798  TYR A CE2 
1395 C  CZ  . TYR A 212 ? 0.3868 0.1480 0.1638 -0.0026 -0.0914 0.0172  798  TYR A CZ  
1396 O  OH  . TYR A 212 ? 0.4113 0.1905 0.1936 0.0222  -0.0852 0.0066  798  TYR A OH  
1397 N  N   . ARG A 213 ? 0.3170 0.2155 0.1573 -0.0452 -0.0706 0.0630  799  ARG A N   
1398 C  CA  . ARG A 213 ? 0.3183 0.2521 0.1789 -0.0597 -0.0926 0.0421  799  ARG A CA  
1399 C  C   . ARG A 213 ? 0.3357 0.2066 0.1692 -0.0548 -0.0940 0.0437  799  ARG A C   
1400 O  O   . ARG A 213 ? 0.3355 0.2107 0.1780 -0.0426 -0.0803 0.0209  799  ARG A O   
1401 C  CB  . ARG A 213 ? 0.3365 0.3385 0.2174 -0.0562 -0.0764 0.0382  799  ARG A CB  
1402 C  CG  . ARG A 213 ? 0.3827 0.4943 0.2705 -0.0923 -0.0716 0.0424  799  ARG A CG  
1403 C  CD  . ARG A 213 ? 0.4626 0.6201 0.3428 -0.0692 -0.0519 0.0833  799  ARG A CD  
1404 N  NE  . ARG A 213 ? 0.5367 0.7127 0.4056 -0.0519 -0.0250 0.1239  799  ARG A NE  
1405 C  CZ  . ARG A 213 ? 0.5708 0.7824 0.4375 -0.0326 -0.0262 0.1502  799  ARG A CZ  
1406 N  NH1 . ARG A 213 ? 0.5745 0.8001 0.4367 -0.0363 -0.0349 0.1766  799  ARG A NH1 
1407 N  NH2 . ARG A 213 ? 0.5792 0.7960 0.4549 -0.0218 -0.0263 0.1356  799  ARG A NH2 
1408 N  N   . LYS A 214 ? 0.3270 0.1546 0.1652 -0.0236 -0.0910 0.0281  800  LYS A N   
1409 C  CA  . LYS A 214 ? 0.3385 0.1718 0.1645 0.0012  -0.0899 0.0525  800  LYS A CA  
1410 C  C   . LYS A 214 ? 0.3242 0.1578 0.1775 -0.0049 -0.0888 0.0511  800  LYS A C   
1411 O  O   . LYS A 214 ? 0.3281 0.1757 0.1955 -0.0477 -0.0887 0.0433  800  LYS A O   
1412 C  CB  . LYS A 214 ? 0.3718 0.1948 0.1704 0.0419  -0.0683 0.0537  800  LYS A CB  
1413 C  CG  . LYS A 214 ? 0.4058 0.1699 0.1920 0.0325  -0.0682 0.0395  800  LYS A CG  
1414 C  CD  . LYS A 214 ? 0.4521 0.1852 0.2140 -0.0247 -0.0701 0.0366  800  LYS A CD  
1415 C  CE  . LYS A 214 ? 0.4895 0.1665 0.2283 -0.0275 -0.0850 0.0350  800  LYS A CE  
1416 N  NZ  . LYS A 214 ? 0.5151 0.1840 0.2380 -0.0433 -0.0901 0.0045  800  LYS A NZ  
1417 N  N   . PHE A 215 ? 0.3166 0.1569 0.1676 -0.0040 -0.0978 0.0411  801  PHE A N   
1418 C  CA  . PHE A 215 ? 0.3087 0.1799 0.1698 -0.0033 -0.0951 0.0318  801  PHE A CA  
1419 C  C   . PHE A 215 ? 0.3271 0.1825 0.1737 -0.0584 -0.0685 0.0260  801  PHE A C   
1420 O  O   . PHE A 215 ? 0.3593 0.2116 0.1971 -0.0923 -0.0375 -0.0011 801  PHE A O   
1421 C  CB  . PHE A 215 ? 0.3041 0.2257 0.1776 0.0110  -0.0896 0.0524  801  PHE A CB  
1422 C  CG  . PHE A 215 ? 0.3151 0.2565 0.1996 0.0049  -0.0905 0.0431  801  PHE A CG  
1423 C  CD1 . PHE A 215 ? 0.3155 0.2652 0.2235 0.0132  -0.0897 0.0203  801  PHE A CD1 
1424 C  CD2 . PHE A 215 ? 0.3345 0.3135 0.2026 0.0313  -0.0813 0.0363  801  PHE A CD2 
1425 C  CE1 . PHE A 215 ? 0.3100 0.2705 0.2286 0.0013  -0.0791 0.0200  801  PHE A CE1 
1426 C  CE2 . PHE A 215 ? 0.3268 0.3472 0.2210 0.0314  -0.0646 0.0345  801  PHE A CE2 
1427 C  CZ  . PHE A 215 ? 0.3081 0.3060 0.2242 0.0289  -0.0765 0.0243  801  PHE A CZ  
1428 N  N   . THR A 216 ? 0.3042 0.1519 0.1792 -0.0116 -0.0584 0.0185  802  THR A N   
1429 C  CA  . THR A 216 ? 0.2961 0.1444 0.1846 0.0023  -0.0655 0.0143  802  THR A CA  
1430 C  C   . THR A 216 ? 0.2918 0.1380 0.1608 0.0307  -0.0669 0.0026  802  THR A C   
1431 O  O   . THR A 216 ? 0.2715 0.1169 0.1570 0.0099  -0.0589 0.0126  802  THR A O   
1432 C  CB  . THR A 216 ? 0.3002 0.1467 0.1952 -0.0050 -0.1010 0.0292  802  THR A CB  
1433 O  OG1 . THR A 216 ? 0.3018 0.1841 0.2134 -0.0096 -0.0761 0.0326  802  THR A OG1 
1434 C  CG2 . THR A 216 ? 0.3256 0.1469 0.2241 0.0128  -0.0915 0.0284  802  THR A CG2 
1435 N  N   . SER A 217 ? 0.2855 0.1311 0.1641 -0.0042 -0.0786 0.0078  803  SER A N   
1436 C  CA  . SER A 217 ? 0.3038 0.1443 0.1777 -0.0148 -0.0664 -0.0190 803  SER A CA  
1437 C  C   . SER A 217 ? 0.2798 0.1205 0.1631 0.0147  -0.0722 -0.0037 803  SER A C   
1438 O  O   . SER A 217 ? 0.2953 0.1009 0.1804 0.0153  -0.0642 0.0074  803  SER A O   
1439 C  CB  . SER A 217 ? 0.3338 0.1550 0.1927 -0.0090 -0.0728 -0.0142 803  SER A CB  
1440 O  OG  . SER A 217 ? 0.3891 0.1758 0.2153 -0.0019 -0.0657 -0.0027 803  SER A OG  
1441 N  N   . ALA A 218 ? 0.2622 0.1298 0.1879 0.0346  -0.0787 0.0013  804  ALA A N   
1442 C  CA  . ALA A 218 ? 0.2596 0.1440 0.1916 0.0442  -0.0898 0.0017  804  ALA A CA  
1443 C  C   . ALA A 218 ? 0.2618 0.1437 0.1793 0.0092  -0.0733 0.0221  804  ALA A C   
1444 O  O   . ALA A 218 ? 0.2663 0.1301 0.1814 0.0061  -0.0855 0.0307  804  ALA A O   
1445 C  CB  . ALA A 218 ? 0.2863 0.1055 0.2078 0.0217  -0.0725 0.0191  804  ALA A CB  
1446 N  N   A SER A 219 ? 0.2487 0.0891 0.1646 0.0007  -0.0638 0.0120  805  SER A N   
1447 N  N   B SER A 219 ? 0.2684 0.1600 0.1899 0.0244  -0.0635 0.0343  805  SER A N   
1448 C  CA  A SER A 219 ? 0.2378 0.0938 0.1291 0.0051  -0.0566 0.0169  805  SER A CA  
1449 C  CA  B SER A 219 ? 0.2768 0.1875 0.1825 0.0244  -0.0494 0.0457  805  SER A CA  
1450 C  C   A SER A 219 ? 0.2391 0.0869 0.1358 0.0070  -0.0605 0.0234  805  SER A C   
1451 C  C   B SER A 219 ? 0.2587 0.1417 0.1626 0.0122  -0.0631 0.0371  805  SER A C   
1452 O  O   A SER A 219 ? 0.2422 0.0721 0.1645 0.0122  -0.0271 0.0091  805  SER A O   
1453 O  O   B SER A 219 ? 0.2598 0.1276 0.1755 0.0021  -0.0521 0.0208  805  SER A O   
1454 C  CB  A SER A 219 ? 0.2422 0.1081 0.1214 0.0104  -0.0256 -0.0070 805  SER A CB  
1455 C  CB  B SER A 219 ? 0.3063 0.2380 0.2055 0.0330  -0.0222 0.0513  805  SER A CB  
1456 O  OG  A SER A 219 ? 0.2177 0.0865 0.1332 -0.0159 -0.0522 0.0239  805  SER A OG  
1457 O  OG  B SER A 219 ? 0.3202 0.2722 0.2334 0.0209  -0.0078 0.0604  805  SER A OG  
1458 N  N   . ASP A 220 ? 0.2420 0.0989 0.1517 0.0063  -0.0693 0.0367  806  ASP A N   
1459 C  CA  . ASP A 220 ? 0.2226 0.1257 0.1491 -0.0100 -0.0702 0.0305  806  ASP A CA  
1460 C  C   . ASP A 220 ? 0.2110 0.1063 0.1547 0.0072  -0.0697 0.0137  806  ASP A C   
1461 O  O   . ASP A 220 ? 0.2357 0.0855 0.1513 -0.0057 -0.0717 0.0205  806  ASP A O   
1462 C  CB  . ASP A 220 ? 0.2274 0.1536 0.1466 -0.0233 -0.0708 0.0168  806  ASP A CB  
1463 C  CG  . ASP A 220 ? 0.2565 0.1254 0.1567 -0.0131 -0.0432 0.0219  806  ASP A CG  
1464 O  OD1 . ASP A 220 ? 0.2559 0.1371 0.1751 0.0063  -0.0567 -0.0087 806  ASP A OD1 
1465 O  OD2 . ASP A 220 ? 0.2446 0.1422 0.1765 -0.0078 -0.0552 0.0033  806  ASP A OD2 
1466 N  N   . VAL A 221 ? 0.2214 0.1021 0.1475 -0.0069 -0.0567 0.0131  807  VAL A N   
1467 C  CA  . VAL A 221 ? 0.2065 0.1075 0.1392 0.0172  -0.0423 -0.0085 807  VAL A CA  
1468 C  C   . VAL A 221 ? 0.2209 0.0796 0.1262 0.0215  -0.0470 0.0122  807  VAL A C   
1469 O  O   . VAL A 221 ? 0.2368 0.0823 0.1554 0.0134  -0.0527 0.0136  807  VAL A O   
1470 C  CB  . VAL A 221 ? 0.2206 0.1185 0.1671 0.0009  -0.0355 -0.0215 807  VAL A CB  
1471 C  CG1 . VAL A 221 ? 0.2202 0.1514 0.1719 0.0387  -0.0257 0.0027  807  VAL A CG1 
1472 C  CG2 . VAL A 221 ? 0.2480 0.0967 0.1693 0.0409  -0.0389 -0.0030 807  VAL A CG2 
1473 N  N   . TRP A 222 ? 0.2277 0.0974 0.1324 0.0053  -0.0611 0.0024  808  TRP A N   
1474 C  CA  . TRP A 222 ? 0.2364 0.0913 0.1302 0.0165  -0.0613 -0.0037 808  TRP A CA  
1475 C  C   . TRP A 222 ? 0.2299 0.0816 0.1452 -0.0217 -0.0361 0.0113  808  TRP A C   
1476 O  O   . TRP A 222 ? 0.2211 0.0834 0.1421 -0.0096 -0.0534 0.0024  808  TRP A O   
1477 C  CB  . TRP A 222 ? 0.2663 0.1108 0.1257 0.0010  -0.0628 -0.0052 808  TRP A CB  
1478 C  CG  . TRP A 222 ? 0.2624 0.0988 0.1448 0.0015  -0.0759 0.0164  808  TRP A CG  
1479 C  CD1 . TRP A 222 ? 0.2724 0.1197 0.1623 -0.0195 -0.0755 0.0214  808  TRP A CD1 
1480 C  CD2 . TRP A 222 ? 0.2730 0.1154 0.1416 -0.0021 -0.0610 0.0149  808  TRP A CD2 
1481 N  NE1 . TRP A 222 ? 0.2888 0.1507 0.1431 -0.0098 -0.0826 0.0222  808  TRP A NE1 
1482 C  CE2 . TRP A 222 ? 0.2794 0.1310 0.1399 -0.0225 -0.0784 0.0158  808  TRP A CE2 
1483 C  CE3 . TRP A 222 ? 0.2590 0.1544 0.1414 0.0245  -0.0695 0.0171  808  TRP A CE3 
1484 C  CZ2 . TRP A 222 ? 0.2891 0.1743 0.1443 -0.0464 -0.0714 0.0245  808  TRP A CZ2 
1485 C  CZ3 . TRP A 222 ? 0.2764 0.1836 0.1535 -0.0031 -0.0608 0.0183  808  TRP A CZ3 
1486 C  CH2 . TRP A 222 ? 0.3026 0.1759 0.1585 -0.0358 -0.0576 0.0170  808  TRP A CH2 
1487 N  N   . SER A 223 ? 0.2152 0.0995 0.1266 -0.0135 -0.0568 0.0154  809  SER A N   
1488 C  CA  . SER A 223 ? 0.2084 0.1137 0.1526 0.0106  -0.0415 0.0397  809  SER A CA  
1489 C  C   . SER A 223 ? 0.2009 0.1011 0.1294 0.0114  -0.0447 0.0282  809  SER A C   
1490 O  O   . SER A 223 ? 0.2021 0.0999 0.1500 0.0070  -0.0419 0.0201  809  SER A O   
1491 C  CB  . SER A 223 ? 0.2022 0.1249 0.1499 -0.0201 -0.0424 0.0183  809  SER A CB  
1492 O  OG  . SER A 223 ? 0.2150 0.1054 0.1662 -0.0010 -0.0352 0.0225  809  SER A OG  
1493 N  N   . TYR A 224 ? 0.2053 0.1102 0.1045 -0.0036 -0.0336 0.0132  810  TYR A N   
1494 C  CA  . TYR A 224 ? 0.2046 0.0986 0.1223 0.0015  -0.0330 -0.0140 810  TYR A CA  
1495 C  C   . TYR A 224 ? 0.2226 0.0860 0.1230 0.0154  -0.0494 -0.0140 810  TYR A C   
1496 O  O   . TYR A 224 ? 0.2550 0.0773 0.1378 0.0147  -0.0306 0.0059  810  TYR A O   
1497 C  CB  . TYR A 224 ? 0.2250 0.1059 0.1323 0.0200  -0.0130 0.0108  810  TYR A CB  
1498 C  CG  . TYR A 224 ? 0.2177 0.0932 0.1332 0.0141  -0.0252 0.0055  810  TYR A CG  
1499 C  CD1 . TYR A 224 ? 0.2194 0.0928 0.1371 0.0128  -0.0562 0.0320  810  TYR A CD1 
1500 C  CD2 . TYR A 224 ? 0.2119 0.1221 0.1480 0.0367  -0.0269 -0.0071 810  TYR A CD2 
1501 C  CE1 . TYR A 224 ? 0.2144 0.0806 0.1552 0.0143  -0.0266 0.0197  810  TYR A CE1 
1502 C  CE2 . TYR A 224 ? 0.2205 0.1069 0.1257 0.0274  -0.0441 0.0028  810  TYR A CE2 
1503 C  CZ  . TYR A 224 ? 0.2087 0.0835 0.1370 -0.0056 -0.0506 0.0139  810  TYR A CZ  
1504 O  OH  . TYR A 224 ? 0.2318 0.1289 0.1445 -0.0002 -0.0352 0.0043  810  TYR A OH  
1505 N  N   . GLY A 225 ? 0.2090 0.1100 0.1376 0.0199  -0.0561 -0.0167 811  GLY A N   
1506 C  CA  . GLY A 225 ? 0.2043 0.1083 0.1688 0.0100  -0.0484 -0.0102 811  GLY A CA  
1507 C  C   . GLY A 225 ? 0.1827 0.0811 0.1560 -0.0225 -0.0314 0.0087  811  GLY A C   
1508 O  O   . GLY A 225 ? 0.1869 0.1043 0.1557 -0.0110 -0.0455 0.0144  811  GLY A O   
1509 N  N   . ILE A 226 ? 0.1915 0.1007 0.1433 0.0145  -0.0318 -0.0029 812  ILE A N   
1510 C  CA  . ILE A 226 ? 0.2007 0.1238 0.1337 -0.0057 -0.0338 0.0049  812  ILE A CA  
1511 C  C   . ILE A 226 ? 0.2001 0.0923 0.1298 -0.0088 -0.0464 -0.0145 812  ILE A C   
1512 O  O   . ILE A 226 ? 0.2282 0.0752 0.1466 -0.0094 -0.0445 -0.0025 812  ILE A O   
1513 C  CB  . ILE A 226 ? 0.2008 0.1262 0.1391 0.0203  -0.0354 0.0136  812  ILE A CB  
1514 C  CG1 . ILE A 226 ? 0.2304 0.1553 0.1335 -0.0066 -0.0675 0.0125  812  ILE A CG1 
1515 C  CG2 . ILE A 226 ? 0.2249 0.1000 0.1630 0.0314  -0.0309 -0.0091 812  ILE A CG2 
1516 C  CD1 . ILE A 226 ? 0.2608 0.1540 0.1415 0.0111  -0.0576 -0.0017 812  ILE A CD1 
1517 N  N   . VAL A 227 ? 0.2243 0.0988 0.1174 0.0210  -0.0406 0.0107  813  VAL A N   
1518 C  CA  . VAL A 227 ? 0.2253 0.1058 0.1314 -0.0152 -0.0550 0.0005  813  VAL A CA  
1519 C  C   . VAL A 227 ? 0.2257 0.0792 0.1534 -0.0097 -0.0313 -0.0031 813  VAL A C   
1520 O  O   . VAL A 227 ? 0.2242 0.0707 0.1614 -0.0149 -0.0397 0.0054  813  VAL A O   
1521 C  CB  . VAL A 227 ? 0.2365 0.1097 0.1381 -0.0346 -0.0712 0.0119  813  VAL A CB  
1522 C  CG1 . VAL A 227 ? 0.2838 0.1552 0.1560 -0.0249 -0.0918 0.0483  813  VAL A CG1 
1523 C  CG2 . VAL A 227 ? 0.2196 0.1326 0.1623 -0.0323 -0.0477 0.0149  813  VAL A CG2 
1524 N  N   . LEU A 228 ? 0.2352 0.1003 0.1491 -0.0220 -0.0467 0.0025  814  LEU A N   
1525 C  CA  . LEU A 228 ? 0.2334 0.1022 0.1396 0.0275  -0.0489 -0.0044 814  LEU A CA  
1526 C  C   . LEU A 228 ? 0.2317 0.1009 0.1363 0.0145  -0.0553 -0.0037 814  LEU A C   
1527 O  O   . LEU A 228 ? 0.2313 0.1049 0.1483 0.0086  -0.0418 -0.0006 814  LEU A O   
1528 C  CB  . LEU A 228 ? 0.2576 0.1469 0.1833 0.0448  -0.0448 0.0080  814  LEU A CB  
1529 C  CG  . LEU A 228 ? 0.2545 0.2019 0.2045 0.0290  -0.0251 0.0109  814  LEU A CG  
1530 C  CD1 . LEU A 228 ? 0.2787 0.2057 0.2062 -0.0005 0.0031  0.0313  814  LEU A CD1 
1531 C  CD2 . LEU A 228 ? 0.2377 0.2480 0.2176 0.0752  -0.0265 -0.0132 814  LEU A CD2 
1532 N  N   . TRP A 229 ? 0.2188 0.1086 0.1324 0.0037  -0.0704 -0.0154 815  TRP A N   
1533 C  CA  . TRP A 229 ? 0.2145 0.1289 0.1442 0.0099  -0.0731 -0.0065 815  TRP A CA  
1534 C  C   . TRP A 229 ? 0.2002 0.1039 0.1540 -0.0121 -0.0632 -0.0010 815  TRP A C   
1535 O  O   . TRP A 229 ? 0.2149 0.0941 0.1668 -0.0200 -0.0635 -0.0069 815  TRP A O   
1536 C  CB  . TRP A 229 ? 0.2220 0.1191 0.1257 0.0112  -0.0627 -0.0001 815  TRP A CB  
1537 C  CG  . TRP A 229 ? 0.2031 0.1213 0.1355 0.0123  -0.0500 0.0068  815  TRP A CG  
1538 C  CD1 . TRP A 229 ? 0.2316 0.1554 0.1363 -0.0057 -0.0618 0.0024  815  TRP A CD1 
1539 C  CD2 . TRP A 229 ? 0.2129 0.1202 0.1478 0.0139  -0.0486 0.0056  815  TRP A CD2 
1540 N  NE1 . TRP A 229 ? 0.2222 0.1403 0.1483 0.0102  -0.0356 -0.0065 815  TRP A NE1 
1541 C  CE2 . TRP A 229 ? 0.2299 0.1311 0.1506 0.0113  -0.0374 -0.0131 815  TRP A CE2 
1542 C  CE3 . TRP A 229 ? 0.2305 0.0994 0.1593 0.0257  -0.0339 0.0153  815  TRP A CE3 
1543 C  CZ2 . TRP A 229 ? 0.2531 0.1336 0.1596 0.0138  -0.0474 0.0044  815  TRP A CZ2 
1544 C  CZ3 . TRP A 229 ? 0.2740 0.1226 0.1731 0.0306  -0.0434 -0.0079 815  TRP A CZ3 
1545 C  CH2 . TRP A 229 ? 0.2632 0.1497 0.1649 0.0069  -0.0437 -0.0160 815  TRP A CH2 
1546 N  N   . GLU A 230 ? 0.1989 0.0872 0.1463 0.0008  -0.0604 -0.0066 816  GLU A N   
1547 C  CA  . GLU A 230 ? 0.1930 0.0881 0.1640 -0.0103 -0.0189 0.0220  816  GLU A CA  
1548 C  C   . GLU A 230 ? 0.1887 0.1020 0.1469 0.0002  -0.0486 0.0054  816  GLU A C   
1549 O  O   . GLU A 230 ? 0.2325 0.0823 0.1784 0.0053  -0.0347 0.0021  816  GLU A O   
1550 C  CB  . GLU A 230 ? 0.2193 0.1395 0.1734 -0.0268 -0.0048 0.0070  816  GLU A CB  
1551 C  CG  . GLU A 230 ? 0.2255 0.1708 0.1799 -0.0162 -0.0105 -0.0103 816  GLU A CG  
1552 C  CD  . GLU A 230 ? 0.2350 0.1456 0.1962 -0.0121 -0.0135 -0.0318 816  GLU A CD  
1553 O  OE1 . GLU A 230 ? 0.2546 0.1145 0.1965 -0.0298 -0.0262 0.0003  816  GLU A OE1 
1554 O  OE2 . GLU A 230 ? 0.2558 0.2192 0.2287 0.0025  -0.0039 -0.0474 816  GLU A OE2 
1555 N  N   . VAL A 231 ? 0.2026 0.1132 0.1181 -0.0021 -0.0470 0.0028  817  VAL A N   
1556 C  CA  . VAL A 231 ? 0.2187 0.0975 0.1388 -0.0112 -0.0565 -0.0100 817  VAL A CA  
1557 C  C   . VAL A 231 ? 0.2044 0.0701 0.1513 0.0018  -0.0617 0.0014  817  VAL A C   
1558 O  O   . VAL A 231 ? 0.2126 0.0933 0.1729 -0.0147 -0.0548 0.0034  817  VAL A O   
1559 C  CB  . VAL A 231 ? 0.2319 0.1126 0.1492 -0.0099 -0.0559 -0.0100 817  VAL A CB  
1560 C  CG1 . VAL A 231 ? 0.2606 0.1042 0.1469 0.0181  -0.0257 0.0112  817  VAL A CG1 
1561 C  CG2 . VAL A 231 ? 0.2280 0.1030 0.1785 -0.0182 -0.0665 0.0130  817  VAL A CG2 
1562 N  N   . MET A 232 ? 0.2044 0.0979 0.1544 -0.0051 -0.0503 0.0032  818  MET A N   
1563 C  CA  . MET A 232 ? 0.2007 0.1312 0.1705 -0.0114 -0.0635 -0.0031 818  MET A CA  
1564 C  C   . MET A 232 ? 0.2218 0.1212 0.1754 -0.0236 -0.0601 0.0123  818  MET A C   
1565 O  O   . MET A 232 ? 0.2657 0.1343 0.2037 -0.0330 -0.0403 0.0071  818  MET A O   
1566 C  CB  . MET A 232 ? 0.2206 0.1327 0.1674 -0.0029 -0.0498 -0.0120 818  MET A CB  
1567 C  CG  . MET A 232 ? 0.2319 0.1563 0.1904 0.0009  -0.0391 -0.0123 818  MET A CG  
1568 S  SD  . MET A 232 ? 0.2467 0.1751 0.1967 -0.0226 -0.0414 0.0070  818  MET A SD  
1569 C  CE  . MET A 232 ? 0.2853 0.2208 0.2214 -0.0487 -0.0066 0.0068  818  MET A CE  
1570 N  N   A SER A 233 ? 0.2259 0.1207 0.1713 -0.0125 -0.0661 -0.0202 819  SER A N   
1571 N  N   B SER A 233 ? 0.2319 0.1158 0.1668 -0.0097 -0.0660 -0.0077 819  SER A N   
1572 C  CA  A SER A 233 ? 0.2265 0.1337 0.1755 -0.0077 -0.0696 -0.0289 819  SER A CA  
1573 C  CA  B SER A 233 ? 0.2369 0.1238 0.1619 0.0061  -0.0665 -0.0052 819  SER A CA  
1574 C  C   A SER A 233 ? 0.2471 0.1228 0.1722 0.0119  -0.0721 -0.0094 819  SER A C   
1575 C  C   B SER A 233 ? 0.2485 0.1170 0.1660 0.0094  -0.0661 -0.0001 819  SER A C   
1576 O  O   A SER A 233 ? 0.2901 0.1354 0.1904 0.0187  -0.0613 -0.0296 819  SER A O   
1577 O  O   B SER A 233 ? 0.2743 0.1285 0.1743 0.0184  -0.0565 -0.0035 819  SER A O   
1578 C  CB  A SER A 233 ? 0.2220 0.1518 0.1750 -0.0025 -0.0655 -0.0369 819  SER A CB  
1579 C  CB  B SER A 233 ? 0.2392 0.1408 0.1432 0.0145  -0.0726 0.0050  819  SER A CB  
1580 O  OG  A SER A 233 ? 0.1924 0.1480 0.1803 0.0079  -0.0732 0.0016  819  SER A OG  
1581 O  OG  B SER A 233 ? 0.2371 0.1353 0.1270 0.0266  -0.0822 0.0176  819  SER A OG  
1582 N  N   . TYR A 234 ? 0.2435 0.1060 0.1684 0.0029  -0.0667 0.0155  820  TYR A N   
1583 C  CA  . TYR A 234 ? 0.2393 0.0739 0.1868 -0.0093 -0.0485 0.0273  820  TYR A CA  
1584 C  C   . TYR A 234 ? 0.2560 0.0848 0.1793 0.0080  -0.0739 0.0175  820  TYR A C   
1585 O  O   . TYR A 234 ? 0.2878 0.1095 0.2083 0.0094  -0.0554 0.0090  820  TYR A O   
1586 C  CB  . TYR A 234 ? 0.2744 0.1272 0.1813 -0.0139 -0.0618 0.0100  820  TYR A CB  
1587 C  CG  . TYR A 234 ? 0.2695 0.0854 0.1773 -0.0161 -0.0592 0.0218  820  TYR A CG  
1588 C  CD1 . TYR A 234 ? 0.2707 0.1039 0.2017 -0.0287 -0.0401 0.0059  820  TYR A CD1 
1589 C  CD2 . TYR A 234 ? 0.2683 0.0920 0.1833 -0.0124 -0.0538 0.0300  820  TYR A CD2 
1590 C  CE1 . TYR A 234 ? 0.2756 0.1330 0.1905 -0.0121 -0.0487 0.0308  820  TYR A CE1 
1591 C  CE2 . TYR A 234 ? 0.2737 0.1074 0.2077 -0.0101 -0.0284 0.0375  820  TYR A CE2 
1592 C  CZ  . TYR A 234 ? 0.2864 0.1433 0.2009 -0.0061 -0.0392 0.0437  820  TYR A CZ  
1593 O  OH  . TYR A 234 ? 0.3169 0.1682 0.2107 -0.0089 -0.0245 0.0393  820  TYR A OH  
1594 N  N   . GLY A 235 ? 0.2411 0.0833 0.1747 0.0015  -0.0560 0.0106  821  GLY A N   
1595 C  CA  . GLY A 235 ? 0.2590 0.1147 0.1923 -0.0052 -0.0461 0.0187  821  GLY A CA  
1596 C  C   . GLY A 235 ? 0.2827 0.1563 0.1947 0.0414  -0.0558 0.0139  821  GLY A C   
1597 O  O   . GLY A 235 ? 0.2838 0.2272 0.2081 0.0417  -0.0245 0.0160  821  GLY A O   
1598 N  N   A GLU A 236 ? 0.2958 0.1337 0.1672 0.0279  -0.0674 -0.0180 822  GLU A N   
1599 N  N   B GLU A 236 ? 0.2988 0.1328 0.1850 0.0238  -0.0604 -0.0194 822  GLU A N   
1600 C  CA  A GLU A 236 ? 0.2990 0.1409 0.1725 0.0234  -0.0694 -0.0212 822  GLU A CA  
1601 C  CA  B GLU A 236 ? 0.3089 0.1446 0.2033 0.0196  -0.0592 -0.0222 822  GLU A CA  
1602 C  C   A GLU A 236 ? 0.2851 0.1477 0.1709 0.0176  -0.0522 -0.0214 822  GLU A C   
1603 C  C   B GLU A 236 ? 0.2858 0.1531 0.1750 0.0198  -0.0611 -0.0164 822  GLU A C   
1604 O  O   A GLU A 236 ? 0.2870 0.1727 0.1748 0.0049  -0.0484 -0.0213 822  GLU A O   
1605 O  O   B GLU A 236 ? 0.2818 0.1888 0.1604 0.0124  -0.0813 -0.0133 822  GLU A O   
1606 C  CB  A GLU A 236 ? 0.3245 0.1850 0.1837 0.0048  -0.0786 -0.0406 822  GLU A CB  
1607 C  CB  B GLU A 236 ? 0.3495 0.1812 0.2539 0.0038  -0.0467 -0.0394 822  GLU A CB  
1608 C  CG  A GLU A 236 ? 0.3671 0.1822 0.1962 -0.0046 -0.0905 -0.0494 822  GLU A CG  
1609 C  CG  B GLU A 236 ? 0.4027 0.1908 0.3005 -0.0046 -0.0416 -0.0414 822  GLU A CG  
1610 C  CD  A GLU A 236 ? 0.4218 0.1927 0.2351 -0.0107 -0.0942 -0.0102 822  GLU A CD  
1611 C  CD  B GLU A 236 ? 0.4569 0.2594 0.3435 -0.0024 -0.0323 -0.0098 822  GLU A CD  
1612 O  OE1 A GLU A 236 ? 0.4470 0.2628 0.2707 -0.0390 -0.0684 -0.0147 822  GLU A OE1 
1613 O  OE1 B GLU A 236 ? 0.4796 0.3093 0.3625 0.0101  -0.0148 -0.0015 822  GLU A OE1 
1614 O  OE2 A GLU A 236 ? 0.4523 0.1689 0.2370 -0.0424 -0.1072 -0.0201 822  GLU A OE2 
1615 O  OE2 B GLU A 236 ? 0.4746 0.2765 0.3579 -0.0065 -0.0298 -0.0126 822  GLU A OE2 
1616 N  N   . ARG A 237 ? 0.2915 0.1759 0.1781 0.0244  -0.0442 -0.0130 823  ARG A N   
1617 C  CA  . ARG A 237 ? 0.2936 0.1648 0.1804 0.0426  -0.0158 -0.0149 823  ARG A CA  
1618 C  C   . ARG A 237 ? 0.2938 0.1559 0.1639 0.0264  -0.0295 -0.0372 823  ARG A C   
1619 O  O   . ARG A 237 ? 0.2856 0.1529 0.1845 0.0004  -0.0360 -0.0176 823  ARG A O   
1620 C  CB  . ARG A 237 ? 0.2908 0.2132 0.1845 0.0462  -0.0271 -0.0094 823  ARG A CB  
1621 C  CG  . ARG A 237 ? 0.2827 0.2106 0.2212 0.0562  -0.0275 0.0182  823  ARG A CG  
1622 C  CD  . ARG A 237 ? 0.2696 0.2297 0.2458 0.0482  0.0023  0.0095  823  ARG A CD  
1623 N  NE  . ARG A 237 ? 0.3034 0.2460 0.2786 0.0409  0.0232  -0.0195 823  ARG A NE  
1624 C  CZ  . ARG A 237 ? 0.3105 0.2804 0.2695 0.0348  -0.0043 -0.0307 823  ARG A CZ  
1625 N  NH1 . ARG A 237 ? 0.3327 0.3197 0.2812 0.0527  -0.0323 -0.0411 823  ARG A NH1 
1626 N  NH2 . ARG A 237 ? 0.3219 0.2967 0.2876 0.0417  0.0346  0.0042  823  ARG A NH2 
1627 N  N   . PRO A 238 ? 0.2869 0.1357 0.1530 0.0213  -0.0572 -0.0115 824  PRO A N   
1628 C  CA  . PRO A 238 ? 0.2925 0.1520 0.1457 0.0310  -0.0678 -0.0169 824  PRO A CA  
1629 C  C   . PRO A 238 ? 0.2818 0.1460 0.1517 0.0170  -0.0516 -0.0098 824  PRO A C   
1630 O  O   . PRO A 238 ? 0.2636 0.1636 0.1631 0.0150  -0.0300 -0.0228 824  PRO A O   
1631 C  CB  . PRO A 238 ? 0.2891 0.1624 0.1599 -0.0019 -0.0675 -0.0391 824  PRO A CB  
1632 C  CG  . PRO A 238 ? 0.2720 0.1873 0.1903 0.0112  -0.0792 -0.0210 824  PRO A CG  
1633 C  CD  . PRO A 238 ? 0.2743 0.1372 0.1816 0.0249  -0.0691 -0.0250 824  PRO A CD  
1634 N  N   . TYR A 239 ? 0.2800 0.1291 0.1638 0.0155  -0.0775 -0.0158 825  TYR A N   
1635 C  CA  . TYR A 239 ? 0.3034 0.1312 0.1710 0.0259  -0.0683 -0.0165 825  TYR A CA  
1636 C  C   . TYR A 239 ? 0.3169 0.1678 0.1884 0.0171  -0.0769 -0.0308 825  TYR A C   
1637 O  O   . TYR A 239 ? 0.3318 0.1797 0.1762 0.0293  -0.0741 -0.0392 825  TYR A O   
1638 C  CB  . TYR A 239 ? 0.3103 0.1382 0.1790 0.0226  -0.0573 0.0028  825  TYR A CB  
1639 C  CG  . TYR A 239 ? 0.2917 0.1282 0.1705 0.0180  -0.0663 0.0079  825  TYR A CG  
1640 C  CD1 . TYR A 239 ? 0.3044 0.1585 0.1535 0.0195  -0.0657 0.0072  825  TYR A CD1 
1641 C  CD2 . TYR A 239 ? 0.2943 0.1271 0.1737 -0.0012 -0.0775 0.0042  825  TYR A CD2 
1642 C  CE1 . TYR A 239 ? 0.3159 0.1363 0.1542 0.0101  -0.0709 -0.0060 825  TYR A CE1 
1643 C  CE2 . TYR A 239 ? 0.3030 0.0872 0.1712 0.0210  -0.0583 0.0111  825  TYR A CE2 
1644 C  CZ  . TYR A 239 ? 0.3086 0.1179 0.1398 0.0325  -0.0768 0.0169  825  TYR A CZ  
1645 O  OH  . TYR A 239 ? 0.2861 0.1346 0.1678 0.0129  -0.0481 0.0086  825  TYR A OH  
1646 N  N   . TRP A 240 ? 0.3194 0.1391 0.1953 0.0190  -0.0609 -0.0467 826  TRP A N   
1647 C  CA  . TRP A 240 ? 0.3139 0.1326 0.1926 0.0077  -0.0710 -0.0511 826  TRP A CA  
1648 C  C   . TRP A 240 ? 0.3184 0.1699 0.1894 0.0188  -0.0721 -0.0461 826  TRP A C   
1649 O  O   . TRP A 240 ? 0.3268 0.2117 0.2052 0.0026  -0.0558 -0.0733 826  TRP A O   
1650 C  CB  . TRP A 240 ? 0.3171 0.1684 0.2110 0.0090  -0.0498 -0.0487 826  TRP A CB  
1651 C  CG  . TRP A 240 ? 0.3288 0.2226 0.2183 -0.0003 -0.0563 -0.0293 826  TRP A CG  
1652 C  CD1 . TRP A 240 ? 0.3433 0.2323 0.2334 -0.0246 -0.0493 -0.0656 826  TRP A CD1 
1653 C  CD2 . TRP A 240 ? 0.3290 0.2238 0.2454 0.0238  -0.0608 -0.0302 826  TRP A CD2 
1654 N  NE1 . TRP A 240 ? 0.3485 0.2521 0.2328 0.0032  -0.0713 -0.0829 826  TRP A NE1 
1655 C  CE2 . TRP A 240 ? 0.3385 0.2310 0.2610 0.0178  -0.0730 -0.0734 826  TRP A CE2 
1656 C  CE3 . TRP A 240 ? 0.3189 0.2484 0.2741 0.0518  -0.0512 -0.0179 826  TRP A CE3 
1657 C  CZ2 . TRP A 240 ? 0.3487 0.2441 0.2772 0.0227  -0.0804 -0.0691 826  TRP A CZ2 
1658 C  CZ3 . TRP A 240 ? 0.3461 0.2699 0.2925 0.0170  -0.0428 -0.0504 826  TRP A CZ3 
1659 C  CH2 . TRP A 240 ? 0.3545 0.2284 0.2896 0.0150  -0.0573 -0.0790 826  TRP A CH2 
1660 N  N   A GLU A 241 ? 0.3098 0.1998 0.1964 0.0182  -0.0744 -0.0527 827  GLU A N   
1661 N  N   B GLU A 241 ? 0.3209 0.1872 0.2039 0.0203  -0.0625 -0.0426 827  GLU A N   
1662 C  CA  A GLU A 241 ? 0.3203 0.2216 0.2140 0.0484  -0.0649 -0.0561 827  GLU A CA  
1663 C  CA  B GLU A 241 ? 0.3370 0.2008 0.2249 0.0461  -0.0454 -0.0423 827  GLU A CA  
1664 C  C   A GLU A 241 ? 0.3217 0.1892 0.2324 0.0260  -0.0475 -0.0417 827  GLU A C   
1665 C  C   B GLU A 241 ? 0.3345 0.1846 0.2382 0.0261  -0.0376 -0.0329 827  GLU A C   
1666 O  O   A GLU A 241 ? 0.3348 0.1910 0.2467 0.0492  -0.0264 -0.0142 827  GLU A O   
1667 O  O   B GLU A 241 ? 0.3501 0.1973 0.2525 0.0473  -0.0161 -0.0037 827  GLU A O   
1668 C  CB  A GLU A 241 ? 0.3504 0.2703 0.2215 0.0573  -0.0602 -0.0657 827  GLU A CB  
1669 C  CB  B GLU A 241 ? 0.3687 0.2279 0.2385 0.0610  -0.0277 -0.0438 827  GLU A CB  
1670 C  CG  A GLU A 241 ? 0.3633 0.3563 0.2373 0.0584  -0.0742 -0.0784 827  GLU A CG  
1671 C  CG  B GLU A 241 ? 0.3903 0.2835 0.2613 0.0777  -0.0205 -0.0495 827  GLU A CG  
1672 C  CD  A GLU A 241 ? 0.3856 0.4309 0.2545 0.0591  -0.0723 -0.0630 827  GLU A CD  
1673 C  CD  B GLU A 241 ? 0.4126 0.3389 0.2823 0.0819  -0.0121 -0.0495 827  GLU A CD  
1674 O  OE1 A GLU A 241 ? 0.3958 0.4670 0.2863 0.0595  -0.0706 -0.0355 827  GLU A OE1 
1675 O  OE1 B GLU A 241 ? 0.4292 0.3790 0.3057 0.0872  -0.0123 -0.0392 827  GLU A OE1 
1676 O  OE2 A GLU A 241 ? 0.3998 0.4572 0.2530 0.0361  -0.0767 -0.0898 827  GLU A OE2 
1677 O  OE2 B GLU A 241 ? 0.4221 0.3953 0.2992 0.0682  0.0027  -0.0519 827  GLU A OE2 
1678 N  N   . MET A 242 ? 0.3209 0.1636 0.2370 0.0158  -0.0601 -0.0379 828  MET A N   
1679 C  CA  . MET A 242 ? 0.3262 0.1865 0.2555 0.0199  -0.0365 -0.0027 828  MET A CA  
1680 C  C   . MET A 242 ? 0.3302 0.2038 0.2815 0.0516  -0.0173 0.0345  828  MET A C   
1681 O  O   . MET A 242 ? 0.3364 0.2234 0.3126 0.0260  -0.0068 0.0215  828  MET A O   
1682 C  CB  . MET A 242 ? 0.3427 0.1905 0.2493 0.0075  -0.0291 -0.0207 828  MET A CB  
1683 C  CG  . MET A 242 ? 0.3404 0.1932 0.2197 0.0217  -0.0368 -0.0526 828  MET A CG  
1684 S  SD  . MET A 242 ? 0.3253 0.2192 0.1887 0.0191  -0.0683 -0.0341 828  MET A SD  
1685 C  CE  . MET A 242 ? 0.3671 0.2087 0.2232 0.0396  -0.0424 -0.0030 828  MET A CE  
1686 N  N   . SER A 243 ? 0.3686 0.2262 0.3065 0.0593  0.0001  0.0584  829  SER A N   
1687 C  CA  . SER A 243 ? 0.3792 0.3233 0.3494 0.0556  0.0122  0.0693  829  SER A CA  
1688 C  C   . SER A 243 ? 0.3726 0.3161 0.3644 0.0394  0.0210  0.0703  829  SER A C   
1689 O  O   . SER A 243 ? 0.3846 0.3094 0.3745 0.0133  0.0565  0.1105  829  SER A O   
1690 C  CB  . SER A 243 ? 0.4233 0.4448 0.3911 0.0701  0.0211  0.0482  829  SER A CB  
1691 O  OG  . SER A 243 ? 0.4686 0.5273 0.4208 0.0671  0.0352  0.0336  829  SER A OG  
1692 N  N   . ASN A 244 ? 0.4085 0.3100 0.3765 0.0421  0.0255  0.0554  830  ASN A N   
1693 C  CA  . ASN A 244 ? 0.4169 0.3249 0.3638 0.0411  0.0023  0.0693  830  ASN A CA  
1694 C  C   . ASN A 244 ? 0.4131 0.2653 0.3153 -0.0152 -0.0021 0.0413  830  ASN A C   
1695 O  O   . ASN A 244 ? 0.4060 0.2431 0.3153 -0.0232 0.0176  0.0168  830  ASN A O   
1696 C  CB  . ASN A 244 ? 0.4173 0.3708 0.4008 0.0311  -0.0115 0.1135  830  ASN A CB  
1697 C  CG  . ASN A 244 ? 0.4338 0.4500 0.4298 0.0373  -0.0227 0.1435  830  ASN A CG  
1698 O  OD1 . ASN A 244 ? 0.4533 0.5186 0.4419 0.0378  -0.0081 0.1609  830  ASN A OD1 
1699 N  ND2 . ASN A 244 ? 0.4408 0.4888 0.4491 0.0518  -0.0275 0.1556  830  ASN A ND2 
1700 N  N   . GLN A 245 ? 0.4299 0.2500 0.2840 -0.0169 -0.0091 0.0422  831  GLN A N   
1701 C  CA  . GLN A 245 ? 0.4727 0.2843 0.2731 -0.0011 0.0059  0.0215  831  GLN A CA  
1702 C  C   . GLN A 245 ? 0.4660 0.2361 0.2173 -0.0134 -0.0054 0.0139  831  GLN A C   
1703 O  O   . GLN A 245 ? 0.4528 0.2277 0.2097 -0.0015 -0.0016 0.0046  831  GLN A O   
1704 C  CB  . GLN A 245 ? 0.5483 0.4310 0.3246 0.0286  0.0577  0.0379  831  GLN A CB  
1705 C  CG  . GLN A 245 ? 0.6358 0.5482 0.3774 0.0295  0.0818  0.0374  831  GLN A CG  
1706 C  CD  . GLN A 245 ? 0.6814 0.6202 0.4052 0.0244  0.1019  0.0242  831  GLN A CD  
1707 O  OE1 . GLN A 245 ? 0.6797 0.6210 0.4123 0.0039  0.0960  0.0405  831  GLN A OE1 
1708 N  NE2 . GLN A 245 ? 0.7017 0.6546 0.4200 0.0290  0.1095  0.0054  831  GLN A NE2 
1709 N  N   . ASP A 246 ? 0.4624 0.2168 0.1874 -0.0350 -0.0256 0.0010  832  ASP A N   
1710 C  CA  . ASP A 246 ? 0.4249 0.2019 0.1672 -0.0132 -0.0508 -0.0315 832  ASP A CA  
1711 C  C   . ASP A 246 ? 0.3951 0.1740 0.1711 0.0313  -0.0758 -0.0009 832  ASP A C   
1712 O  O   . ASP A 246 ? 0.4071 0.1566 0.2101 0.0405  -0.0744 -0.0304 832  ASP A O   
1713 C  CB  . ASP A 246 ? 0.4227 0.1901 0.1702 -0.0026 -0.0433 -0.0401 832  ASP A CB  
1714 C  CG  . ASP A 246 ? 0.4454 0.2268 0.1914 0.0285  -0.0367 -0.0159 832  ASP A CG  
1715 O  OD1 . ASP A 246 ? 0.4511 0.2441 0.2122 0.0336  -0.0119 -0.0159 832  ASP A OD1 
1716 O  OD2 . ASP A 246 ? 0.4601 0.2899 0.2218 0.0167  -0.0553 -0.0138 832  ASP A OD2 
1717 N  N   . VAL A 247 ? 0.3741 0.1744 0.1625 0.0261  -0.0709 0.0190  833  VAL A N   
1718 C  CA  . VAL A 247 ? 0.3523 0.1656 0.1802 0.0353  -0.0768 0.0187  833  VAL A CA  
1719 C  C   . VAL A 247 ? 0.3767 0.1594 0.1834 0.0033  -0.0593 0.0263  833  VAL A C   
1720 O  O   . VAL A 247 ? 0.4020 0.1623 0.1722 -0.0120 -0.0540 0.0208  833  VAL A O   
1721 C  CB  . VAL A 247 ? 0.3426 0.1741 0.2042 0.0222  -0.0908 -0.0053 833  VAL A CB  
1722 C  CG1 . VAL A 247 ? 0.3676 0.1916 0.2037 0.0157  -0.0967 -0.0064 833  VAL A CG1 
1723 C  CG2 . VAL A 247 ? 0.3355 0.1595 0.2325 0.0341  -0.0858 0.0273  833  VAL A CG2 
1724 N  N   . ILE A 248 ? 0.3744 0.1563 0.1846 0.0066  -0.0599 0.0230  834  ILE A N   
1725 C  CA  . ILE A 248 ? 0.3796 0.1663 0.2065 0.0014  -0.0654 0.0292  834  ILE A CA  
1726 C  C   . ILE A 248 ? 0.4023 0.1633 0.1819 0.0037  -0.0788 0.0142  834  ILE A C   
1727 O  O   . ILE A 248 ? 0.4165 0.1824 0.1943 0.0278  -0.0774 0.0199  834  ILE A O   
1728 C  CB  . ILE A 248 ? 0.4056 0.1726 0.2395 -0.0072 -0.0527 0.0399  834  ILE A CB  
1729 C  CG1 . ILE A 248 ? 0.4157 0.1910 0.2538 -0.0495 -0.0304 -0.0019 834  ILE A CG1 
1730 C  CG2 . ILE A 248 ? 0.4255 0.1848 0.2528 0.0116  -0.0490 0.0437  834  ILE A CG2 
1731 C  CD1 . ILE A 248 ? 0.4110 0.2172 0.2848 -0.0837 -0.0366 -0.0098 834  ILE A CD1 
1732 N  N   . LYS A 249 ? 0.4228 0.1575 0.1564 -0.0201 -0.0956 -0.0075 835  LYS A N   
1733 C  CA  . LYS A 249 ? 0.4569 0.1951 0.1532 -0.0043 -0.0922 -0.0059 835  LYS A CA  
1734 C  C   . LYS A 249 ? 0.4605 0.1967 0.1560 0.0215  -0.0959 -0.0093 835  LYS A C   
1735 O  O   . LYS A 249 ? 0.4796 0.1990 0.1611 0.0494  -0.0987 -0.0297 835  LYS A O   
1736 C  CB  . LYS A 249 ? 0.4813 0.1977 0.1621 -0.0015 -0.0804 -0.0366 835  LYS A CB  
1737 C  CG  . LYS A 249 ? 0.5226 0.2956 0.1958 -0.0104 -0.0879 -0.0507 835  LYS A CG  
1738 C  CD  . LYS A 249 ? 0.5545 0.3669 0.2177 -0.0361 -0.0649 -0.0486 835  LYS A CD  
1739 C  CE  . LYS A 249 ? 0.5746 0.4129 0.2460 -0.0709 -0.0553 -0.0605 835  LYS A CE  
1740 N  NZ  . LYS A 249 ? 0.5780 0.4368 0.2806 -0.0911 -0.0407 -0.0349 835  LYS A NZ  
1741 N  N   . ALA A 250 ? 0.4289 0.1722 0.1464 0.0334  -0.0919 0.0061  836  ALA A N   
1742 C  CA  . ALA A 250 ? 0.3990 0.1520 0.1600 0.0349  -0.0913 -0.0204 836  ALA A CA  
1743 C  C   . ALA A 250 ? 0.3877 0.1804 0.1646 0.0227  -0.0854 -0.0060 836  ALA A C   
1744 O  O   . ALA A 250 ? 0.3827 0.1757 0.1768 0.0572  -0.0846 -0.0078 836  ALA A O   
1745 C  CB  . ALA A 250 ? 0.3913 0.1458 0.1943 0.0150  -0.0721 -0.0201 836  ALA A CB  
1746 N  N   . VAL A 251 ? 0.3862 0.1497 0.1434 -0.0062 -0.0870 0.0137  837  VAL A N   
1747 C  CA  . VAL A 251 ? 0.4127 0.1542 0.1451 0.0003  -0.0733 -0.0027 837  VAL A CA  
1748 C  C   . VAL A 251 ? 0.4466 0.1760 0.1414 0.0084  -0.0526 0.0154  837  VAL A C   
1749 O  O   . VAL A 251 ? 0.4572 0.1545 0.1602 0.0343  -0.0496 0.0172  837  VAL A O   
1750 C  CB  . VAL A 251 ? 0.3805 0.1316 0.1621 -0.0111 -0.0860 -0.0143 837  VAL A CB  
1751 C  CG1 . VAL A 251 ? 0.3982 0.1908 0.1773 -0.0170 -0.0690 -0.0314 837  VAL A CG1 
1752 C  CG2 . VAL A 251 ? 0.3845 0.1125 0.1920 0.0235  -0.0852 0.0031  837  VAL A CG2 
1753 N  N   . ASP A 252 ? 0.4429 0.1549 0.1519 0.0156  -0.0470 0.0160  838  ASP A N   
1754 C  CA  . ASP A 252 ? 0.4726 0.1681 0.1761 0.0380  -0.0230 0.0366  838  ASP A CA  
1755 C  C   . ASP A 252 ? 0.4922 0.2049 0.1802 0.0652  -0.0317 0.0262  838  ASP A C   
1756 O  O   . ASP A 252 ? 0.5187 0.2307 0.1979 0.0829  -0.0254 0.0425  838  ASP A O   
1757 C  CB  . ASP A 252 ? 0.4859 0.1973 0.1914 0.0331  -0.0114 0.0691  838  ASP A CB  
1758 C  CG  . ASP A 252 ? 0.4949 0.2232 0.2406 0.0420  -0.0301 0.0580  838  ASP A CG  
1759 O  OD1 . ASP A 252 ? 0.5372 0.2641 0.2620 0.0768  -0.0725 0.0523  838  ASP A OD1 
1760 O  OD2 . ASP A 252 ? 0.4408 0.1934 0.2357 0.0174  -0.0321 0.0653  838  ASP A OD2 
1761 N  N   . GLU A 253 ? 0.4727 0.1866 0.1587 0.0495  -0.0813 -0.0013 839  GLU A N   
1762 C  CA  . GLU A 253 ? 0.4762 0.2378 0.1732 0.0751  -0.0679 -0.0264 839  GLU A CA  
1763 C  C   . GLU A 253 ? 0.4681 0.2980 0.1856 0.1031  -0.0841 -0.0229 839  GLU A C   
1764 O  O   . GLU A 253 ? 0.4545 0.3784 0.2242 0.1242  -0.0993 -0.0281 839  GLU A O   
1765 C  CB  . GLU A 253 ? 0.4689 0.2589 0.1682 0.1038  -0.0959 -0.0510 839  GLU A CB  
1766 C  CG  . GLU A 253 ? 0.4763 0.2805 0.1848 0.1305  -0.0961 -0.0671 839  GLU A CG  
1767 C  CD  . GLU A 253 ? 0.5074 0.3242 0.2217 0.1066  -0.1064 -0.0750 839  GLU A CD  
1768 O  OE1 . GLU A 253 ? 0.5337 0.3218 0.2400 0.0881  -0.0942 -0.0618 839  GLU A OE1 
1769 O  OE2 . GLU A 253 ? 0.5103 0.3279 0.2440 0.1035  -0.1151 -0.1078 839  GLU A OE2 
1770 N  N   . GLY A 254 ? 0.4657 0.2372 0.1636 0.0930  -0.0781 -0.0289 840  GLY A N   
1771 C  CA  . GLY A 254 ? 0.4404 0.2254 0.1755 0.0958  -0.0866 -0.0042 840  GLY A CA  
1772 C  C   . GLY A 254 ? 0.4147 0.2071 0.1757 0.0791  -0.0775 -0.0126 840  GLY A C   
1773 O  O   . GLY A 254 ? 0.4363 0.2284 0.1980 0.0681  -0.0569 -0.0241 840  GLY A O   
1774 N  N   . TYR A 255 ? 0.3739 0.1841 0.1655 0.0740  -0.0854 -0.0129 841  TYR A N   
1775 C  CA  . TYR A 255 ? 0.3454 0.1851 0.1624 0.0661  -0.0912 -0.0322 841  TYR A CA  
1776 C  C   . TYR A 255 ? 0.3432 0.1657 0.1584 0.0338  -0.0798 -0.0164 841  TYR A C   
1777 O  O   . TYR A 255 ? 0.3533 0.1801 0.1689 0.0382  -0.0788 -0.0176 841  TYR A O   
1778 C  CB  . TYR A 255 ? 0.3240 0.1926 0.1672 0.0840  -0.0970 -0.0640 841  TYR A CB  
1779 C  CG  . TYR A 255 ? 0.3295 0.2340 0.1787 0.0792  -0.0984 -0.0469 841  TYR A CG  
1780 C  CD1 . TYR A 255 ? 0.3485 0.2261 0.1785 0.0890  -0.0856 -0.0301 841  TYR A CD1 
1781 C  CD2 . TYR A 255 ? 0.3102 0.2408 0.2027 0.0802  -0.0775 -0.0453 841  TYR A CD2 
1782 C  CE1 . TYR A 255 ? 0.3328 0.2574 0.2012 0.0734  -0.0970 -0.0587 841  TYR A CE1 
1783 C  CE2 . TYR A 255 ? 0.3254 0.2686 0.2045 0.0617  -0.0777 -0.0479 841  TYR A CE2 
1784 C  CZ  . TYR A 255 ? 0.3340 0.2864 0.1997 0.0651  -0.1119 -0.0719 841  TYR A CZ  
1785 O  OH  . TYR A 255 ? 0.3593 0.3794 0.2294 0.0910  -0.1014 -0.0894 841  TYR A OH  
1786 N  N   . ARG A 256 ? 0.3221 0.1729 0.1604 0.0430  -0.0507 0.0057  842  ARG A N   
1787 C  CA  . ARG A 256 ? 0.2943 0.1598 0.1476 0.0459  -0.0569 -0.0057 842  ARG A CA  
1788 C  C   . ARG A 256 ? 0.2783 0.1691 0.1517 0.0201  -0.0529 -0.0184 842  ARG A C   
1789 O  O   . ARG A 256 ? 0.2744 0.1867 0.1646 0.0160  -0.0653 -0.0236 842  ARG A O   
1790 C  CB  . ARG A 256 ? 0.3094 0.1724 0.1610 0.0335  -0.0494 -0.0138 842  ARG A CB  
1791 C  CG  . ARG A 256 ? 0.3037 0.1180 0.1872 0.0165  -0.0589 -0.0064 842  ARG A CG  
1792 C  CD  . ARG A 256 ? 0.3055 0.1111 0.1889 0.0151  -0.0753 0.0052  842  ARG A CD  
1793 N  NE  . ARG A 256 ? 0.2886 0.1582 0.1682 0.0367  -0.0783 0.0268  842  ARG A NE  
1794 C  CZ  . ARG A 256 ? 0.3103 0.1569 0.1749 0.0412  -0.0650 0.0230  842  ARG A CZ  
1795 N  NH1 . ARG A 256 ? 0.3296 0.1852 0.1778 0.0270  -0.0407 0.0007  842  ARG A NH1 
1796 N  NH2 . ARG A 256 ? 0.3181 0.1388 0.1981 0.0571  -0.0627 0.0200  842  ARG A NH2 
1797 N  N   . LEU A 257 ? 0.2584 0.1511 0.1541 0.0297  -0.0637 0.0165  843  LEU A N   
1798 C  CA  . LEU A 257 ? 0.2556 0.1494 0.1587 0.0388  -0.0508 0.0118  843  LEU A CA  
1799 C  C   . LEU A 257 ? 0.2708 0.1866 0.1622 0.0128  -0.0483 -0.0222 843  LEU A C   
1800 O  O   . LEU A 257 ? 0.2798 0.1680 0.1773 0.0127  -0.0391 -0.0300 843  LEU A O   
1801 C  CB  . LEU A 257 ? 0.2539 0.1581 0.1742 0.0045  -0.0476 0.0014  843  LEU A CB  
1802 C  CG  . LEU A 257 ? 0.2724 0.1739 0.1862 0.0096  -0.0368 0.0151  843  LEU A CG  
1803 C  CD1 . LEU A 257 ? 0.2774 0.1971 0.1754 -0.0216 -0.0733 0.0347  843  LEU A CD1 
1804 C  CD2 . LEU A 257 ? 0.3029 0.1717 0.1906 0.0360  -0.0116 -0.0044 843  LEU A CD2 
1805 N  N   . PRO A 258 ? 0.2775 0.1861 0.1638 0.0072  -0.0366 0.0017  844  PRO A N   
1806 C  CA  . PRO A 258 ? 0.2604 0.2017 0.1626 -0.0195 -0.0496 -0.0363 844  PRO A CA  
1807 C  C   . PRO A 258 ? 0.2403 0.1997 0.1828 0.0053  -0.0567 -0.0172 844  PRO A C   
1808 O  O   . PRO A 258 ? 0.2426 0.1714 0.1900 -0.0008 -0.0580 0.0139  844  PRO A O   
1809 C  CB  . PRO A 258 ? 0.2867 0.1766 0.1893 0.0011  -0.0409 -0.0401 844  PRO A CB  
1810 C  CG  . PRO A 258 ? 0.3009 0.1759 0.2011 0.0013  -0.0314 0.0034  844  PRO A CG  
1811 C  CD  . PRO A 258 ? 0.3088 0.1702 0.1850 0.0225  -0.0245 0.0178  844  PRO A CD  
1812 N  N   . PRO A 259 ? 0.2159 0.2117 0.1890 -0.0254 -0.0644 -0.0077 845  PRO A N   
1813 C  CA  . PRO A 259 ? 0.2369 0.2021 0.2128 -0.0122 -0.0396 0.0095  845  PRO A CA  
1814 C  C   . PRO A 259 ? 0.2563 0.1826 0.2051 -0.0105 -0.0555 0.0027  845  PRO A C   
1815 O  O   . PRO A 259 ? 0.2962 0.1873 0.2131 -0.0188 -0.0620 -0.0111 845  PRO A O   
1816 C  CB  . PRO A 259 ? 0.2259 0.2482 0.2417 -0.0271 -0.0327 0.0106  845  PRO A CB  
1817 C  CG  . PRO A 259 ? 0.2403 0.3040 0.2468 -0.0421 -0.0333 0.0115  845  PRO A CG  
1818 C  CD  . PRO A 259 ? 0.2176 0.2561 0.2215 -0.0537 -0.0585 -0.0067 845  PRO A CD  
1819 N  N   . PRO A 260 ? 0.2633 0.1457 0.2044 -0.0215 -0.0593 -0.0057 846  PRO A N   
1820 C  CA  . PRO A 260 ? 0.2820 0.1527 0.2257 -0.0223 -0.0618 0.0035  846  PRO A CA  
1821 C  C   . PRO A 260 ? 0.2952 0.1572 0.2493 -0.0367 -0.0810 -0.0077 846  PRO A C   
1822 O  O   . PRO A 260 ? 0.3024 0.1703 0.2563 -0.0309 -0.0523 0.0048  846  PRO A O   
1823 C  CB  . PRO A 260 ? 0.2667 0.1492 0.2253 -0.0098 -0.0795 0.0208  846  PRO A CB  
1824 C  CG  . PRO A 260 ? 0.2591 0.1845 0.2120 -0.0154 -0.0720 0.0511  846  PRO A CG  
1825 C  CD  . PRO A 260 ? 0.2582 0.1812 0.2018 -0.0097 -0.0739 0.0014  846  PRO A CD  
1826 N  N   . MET A 261 ? 0.3402 0.1702 0.2798 -0.0487 -0.0652 -0.0001 847  MET A N   
1827 C  CA  . MET A 261 ? 0.3922 0.1836 0.3181 -0.0706 -0.0522 -0.0205 847  MET A CA  
1828 C  C   . MET A 261 ? 0.4110 0.1599 0.3012 -0.0805 -0.0590 -0.0190 847  MET A C   
1829 O  O   . MET A 261 ? 0.4156 0.1709 0.3035 -0.0564 -0.0634 0.0017  847  MET A O   
1830 C  CB  . MET A 261 ? 0.4583 0.2544 0.3920 -0.0425 -0.0135 -0.0375 847  MET A CB  
1831 C  CG  . MET A 261 ? 0.5415 0.3448 0.4732 0.0032  0.0288  -0.0217 847  MET A CG  
1832 S  SD  . MET A 261 ? 0.6101 0.4285 0.5445 -0.0070 0.0562  -0.0262 847  MET A SD  
1833 C  CE  . MET A 261 ? 0.5999 0.4499 0.5437 -0.0227 0.0512  -0.0329 847  MET A CE  
1834 N  N   . ASP A 262 ? 0.4425 0.1834 0.3167 -0.0812 -0.0352 -0.0141 848  ASP A N   
1835 C  CA  . ASP A 262 ? 0.4872 0.1991 0.3352 -0.0815 0.0001  -0.0056 848  ASP A CA  
1836 C  C   . ASP A 262 ? 0.4479 0.2244 0.3138 -0.0986 0.0145  0.0211  848  ASP A C   
1837 O  O   . ASP A 262 ? 0.4671 0.2373 0.3089 -0.1113 0.0251  0.0200  848  ASP A O   
1838 C  CB  . ASP A 262 ? 0.5615 0.1643 0.3912 -0.0743 0.0105  -0.0135 848  ASP A CB  
1839 C  CG  . ASP A 262 ? 0.6153 0.2513 0.4474 -0.0592 0.0087  -0.0093 848  ASP A CG  
1840 O  OD1 . ASP A 262 ? 0.6251 0.2805 0.4683 -0.0951 0.0040  -0.0302 848  ASP A OD1 
1841 O  OD2 . ASP A 262 ? 0.6425 0.2840 0.4712 -0.0417 0.0121  -0.0005 848  ASP A OD2 
1842 N  N   . CYS A 263 ? 0.3724 0.1866 0.2839 -0.0881 -0.0064 0.0151  849  CYS A N   
1843 C  CA  . CYS A 263 ? 0.3105 0.1689 0.2570 -0.0826 -0.0228 0.0140  849  CYS A CA  
1844 C  C   . CYS A 263 ? 0.3024 0.2011 0.2562 -0.0759 -0.0418 0.0121  849  CYS A C   
1845 O  O   . CYS A 263 ? 0.3140 0.2306 0.2632 -0.0952 -0.0617 0.0056  849  CYS A O   
1846 C  CB  . CYS A 263 ? 0.3000 0.1645 0.2502 -0.0529 0.0032  0.0196  849  CYS A CB  
1847 S  SG  . CYS A 263 ? 0.2736 0.1797 0.2545 -0.0426 0.0003  -0.0031 849  CYS A SG  
1848 N  N   . PRO A 264 ? 0.2854 0.1982 0.2499 -0.0266 -0.0526 0.0251  850  PRO A N   
1849 C  CA  . PRO A 264 ? 0.2559 0.2448 0.2414 -0.0288 -0.0373 0.0233  850  PRO A CA  
1850 C  C   . PRO A 264 ? 0.2122 0.2308 0.2394 -0.0329 -0.0113 0.0446  850  PRO A C   
1851 O  O   . PRO A 264 ? 0.2218 0.2315 0.2183 -0.0380 -0.0162 0.0247  850  PRO A O   
1852 C  CB  . PRO A 264 ? 0.2935 0.2609 0.2492 -0.0149 -0.0361 0.0350  850  PRO A CB  
1853 C  CG  . PRO A 264 ? 0.3003 0.2323 0.2498 0.0006  -0.0464 0.0390  850  PRO A CG  
1854 C  CD  . PRO A 264 ? 0.2950 0.2336 0.2411 -0.0292 -0.0473 0.0300  850  PRO A CD  
1855 N  N   . ALA A 265 ? 0.1998 0.2405 0.2550 -0.0174 -0.0273 0.0217  851  ALA A N   
1856 C  CA  . ALA A 265 ? 0.1741 0.2512 0.2586 -0.0204 -0.0353 0.0132  851  ALA A CA  
1857 C  C   . ALA A 265 ? 0.1603 0.2419 0.2397 -0.0215 -0.0197 0.0123  851  ALA A C   
1858 O  O   . ALA A 265 ? 0.1794 0.2522 0.2392 -0.0135 -0.0190 0.0326  851  ALA A O   
1859 C  CB  . ALA A 265 ? 0.1902 0.2700 0.2987 -0.0186 -0.0170 0.0152  851  ALA A CB  
1860 N  N   . ALA A 266 ? 0.1632 0.2589 0.2237 -0.0208 -0.0071 0.0131  852  ALA A N   
1861 C  CA  . ALA A 266 ? 0.1850 0.2358 0.2057 -0.0061 -0.0123 0.0065  852  ALA A CA  
1862 C  C   . ALA A 266 ? 0.1905 0.2041 0.1940 0.0015  -0.0184 -0.0043 852  ALA A C   
1863 O  O   . ALA A 266 ? 0.2011 0.2073 0.2203 0.0059  -0.0179 0.0063  852  ALA A O   
1864 C  CB  . ALA A 266 ? 0.2051 0.2558 0.2095 -0.0299 -0.0057 0.0098  852  ALA A CB  
1865 N  N   . LEU A 267 ? 0.1608 0.2003 0.1852 0.0071  -0.0278 -0.0022 853  LEU A N   
1866 C  CA  . LEU A 267 ? 0.1650 0.1753 0.1756 0.0054  -0.0582 -0.0105 853  LEU A CA  
1867 C  C   . LEU A 267 ? 0.1806 0.1639 0.1766 -0.0117 -0.0560 -0.0211 853  LEU A C   
1868 O  O   . LEU A 267 ? 0.2049 0.1550 0.1870 -0.0151 -0.0239 -0.0062 853  LEU A O   
1869 C  CB  . LEU A 267 ? 0.2009 0.1570 0.1688 0.0188  -0.0585 -0.0085 853  LEU A CB  
1870 C  CG  . LEU A 267 ? 0.2521 0.1446 0.1763 -0.0101 -0.0557 -0.0183 853  LEU A CG  
1871 C  CD1 . LEU A 267 ? 0.2952 0.1461 0.2035 0.0009  -0.0559 0.0145  853  LEU A CD1 
1872 C  CD2 . LEU A 267 ? 0.2675 0.1724 0.1872 -0.0152 -0.0437 -0.0152 853  LEU A CD2 
1873 N  N   . TYR A 268 ? 0.1962 0.1729 0.1711 0.0042  -0.0451 -0.0357 854  TYR A N   
1874 C  CA  . TYR A 268 ? 0.2375 0.1509 0.1606 -0.0126 -0.0663 -0.0224 854  TYR A CA  
1875 C  C   . TYR A 268 ? 0.2285 0.1815 0.1575 0.0193  -0.0434 -0.0186 854  TYR A C   
1876 O  O   . TYR A 268 ? 0.2400 0.1809 0.1702 0.0225  -0.0373 -0.0097 854  TYR A O   
1877 C  CB  . TYR A 268 ? 0.2619 0.1692 0.1676 -0.0215 -0.0623 -0.0209 854  TYR A CB  
1878 C  CG  . TYR A 268 ? 0.2476 0.1414 0.1709 -0.0145 -0.0730 -0.0356 854  TYR A CG  
1879 C  CD1 . TYR A 268 ? 0.2512 0.1731 0.1979 -0.0036 -0.0637 -0.0503 854  TYR A CD1 
1880 C  CD2 . TYR A 268 ? 0.2560 0.1948 0.1852 -0.0203 -0.0645 -0.0230 854  TYR A CD2 
1881 C  CE1 . TYR A 268 ? 0.2386 0.1657 0.1904 -0.0144 -0.0709 -0.0450 854  TYR A CE1 
1882 C  CE2 . TYR A 268 ? 0.2443 0.2102 0.1860 -0.0089 -0.0474 -0.0255 854  TYR A CE2 
1883 C  CZ  . TYR A 268 ? 0.2561 0.1935 0.1877 -0.0003 -0.0572 -0.0281 854  TYR A CZ  
1884 O  OH  . TYR A 268 ? 0.2978 0.2229 0.1881 -0.0036 -0.0687 -0.0221 854  TYR A OH  
1885 N  N   . GLN A 269 ? 0.1861 0.1923 0.1812 0.0361  -0.0412 -0.0159 855  GLN A N   
1886 C  CA  . GLN A 269 ? 0.1663 0.2076 0.2012 0.0340  -0.0326 -0.0116 855  GLN A CA  
1887 C  C   . GLN A 269 ? 0.1934 0.2119 0.1766 0.0050  -0.0397 -0.0104 855  GLN A C   
1888 O  O   . GLN A 269 ? 0.2073 0.1930 0.1922 0.0148  -0.0357 0.0002  855  GLN A O   
1889 C  CB  . GLN A 269 ? 0.1776 0.1951 0.2320 0.0572  -0.0168 0.0025  855  GLN A CB  
1890 C  CG  . GLN A 269 ? 0.2070 0.2281 0.2627 0.0316  -0.0122 0.0211  855  GLN A CG  
1891 C  CD  . GLN A 269 ? 0.2351 0.2563 0.2940 0.0367  -0.0339 0.0252  855  GLN A CD  
1892 O  OE1 . GLN A 269 ? 0.2518 0.2891 0.3012 0.0086  -0.0571 0.0334  855  GLN A OE1 
1893 N  NE2 . GLN A 269 ? 0.2530 0.2323 0.2954 0.0401  -0.0364 0.0468  855  GLN A NE2 
1894 N  N   . LEU A 270 ? 0.1803 0.1716 0.1716 0.0099  -0.0327 -0.0164 856  LEU A N   
1895 C  CA  . LEU A 270 ? 0.1918 0.1764 0.1633 0.0273  -0.0215 -0.0082 856  LEU A CA  
1896 C  C   . LEU A 270 ? 0.1849 0.1343 0.1662 0.0231  -0.0222 -0.0181 856  LEU A C   
1897 O  O   . LEU A 270 ? 0.2155 0.1469 0.1832 -0.0092 -0.0273 0.0147  856  LEU A O   
1898 C  CB  . LEU A 270 ? 0.2119 0.1886 0.1648 -0.0011 -0.0481 -0.0125 856  LEU A CB  
1899 C  CG  . LEU A 270 ? 0.2404 0.1511 0.1791 0.0000  -0.0359 -0.0149 856  LEU A CG  
1900 C  CD1 . LEU A 270 ? 0.2900 0.1595 0.2099 0.0033  -0.0380 -0.0038 856  LEU A CD1 
1901 C  CD2 . LEU A 270 ? 0.2407 0.2059 0.1586 0.0111  -0.0375 -0.0175 856  LEU A CD2 
1902 N  N   . MET A 271 ? 0.1862 0.1459 0.1537 0.0495  -0.0241 -0.0186 857  MET A N   
1903 C  CA  . MET A 271 ? 0.2022 0.1258 0.1592 0.0473  -0.0335 -0.0095 857  MET A CA  
1904 C  C   . MET A 271 ? 0.1934 0.1411 0.1646 0.0395  -0.0582 -0.0012 857  MET A C   
1905 O  O   . MET A 271 ? 0.2294 0.1084 0.1739 0.0067  -0.0480 0.0057  857  MET A O   
1906 C  CB  . MET A 271 ? 0.2131 0.1338 0.1750 0.0346  -0.0571 -0.0005 857  MET A CB  
1907 C  CG  . MET A 271 ? 0.2247 0.1326 0.1858 0.0279  -0.0665 -0.0094 857  MET A CG  
1908 S  SD  . MET A 271 ? 0.2304 0.1430 0.1899 0.0066  -0.0545 -0.0065 857  MET A SD  
1909 C  CE  . MET A 271 ? 0.2352 0.1842 0.1949 0.0056  -0.0541 0.0266  857  MET A CE  
1910 N  N   . LEU A 272 ? 0.1798 0.1532 0.1668 0.0277  -0.0625 -0.0175 858  LEU A N   
1911 C  CA  . LEU A 272 ? 0.1710 0.1346 0.1728 0.0288  -0.0667 0.0110  858  LEU A CA  
1912 C  C   . LEU A 272 ? 0.2162 0.1361 0.1735 0.0211  -0.0584 0.0072  858  LEU A C   
1913 O  O   . LEU A 272 ? 0.2720 0.1491 0.1765 0.0321  -0.0383 0.0095  858  LEU A O   
1914 C  CB  . LEU A 272 ? 0.1685 0.1520 0.1985 0.0042  -0.0555 0.0073  858  LEU A CB  
1915 C  CG  . LEU A 272 ? 0.1917 0.1747 0.2143 -0.0157 -0.0421 -0.0133 858  LEU A CG  
1916 C  CD1 . LEU A 272 ? 0.1842 0.2249 0.2504 -0.0214 -0.0244 -0.0184 858  LEU A CD1 
1917 C  CD2 . LEU A 272 ? 0.2379 0.2147 0.2160 -0.0244 -0.0270 -0.0177 858  LEU A CD2 
1918 N  N   . ASP A 273 ? 0.2404 0.1506 0.1794 0.0348  -0.0485 -0.0206 859  ASP A N   
1919 C  CA  . ASP A 273 ? 0.2409 0.1791 0.2102 0.0478  -0.0212 -0.0179 859  ASP A CA  
1920 C  C   . ASP A 273 ? 0.2506 0.1529 0.1976 0.0384  -0.0543 -0.0038 859  ASP A C   
1921 O  O   . ASP A 273 ? 0.2588 0.1412 0.2099 0.0435  -0.0609 -0.0054 859  ASP A O   
1922 C  CB  . ASP A 273 ? 0.2322 0.2264 0.2465 0.0239  0.0106  -0.0560 859  ASP A CB  
1923 C  CG  . ASP A 273 ? 0.2841 0.3111 0.2903 0.0169  0.0024  -0.0530 859  ASP A CG  
1924 O  OD1 . ASP A 273 ? 0.2805 0.3434 0.3245 0.0515  -0.0268 -0.0626 859  ASP A OD1 
1925 O  OD2 . ASP A 273 ? 0.3263 0.3703 0.3259 0.0123  0.0303  -0.0299 859  ASP A OD2 
1926 N  N   . CYS A 274 ? 0.2305 0.1560 0.1735 0.0442  -0.0521 -0.0153 860  CYS A N   
1927 C  CA  . CYS A 274 ? 0.2406 0.1423 0.1710 0.0361  -0.0591 -0.0014 860  CYS A CA  
1928 C  C   . CYS A 274 ? 0.2446 0.1361 0.1747 0.0395  -0.0567 0.0095  860  CYS A C   
1929 O  O   . CYS A 274 ? 0.2473 0.1557 0.1760 0.0114  -0.0332 -0.0030 860  CYS A O   
1930 C  CB  . CYS A 274 ? 0.2271 0.1268 0.1637 0.0272  -0.0583 0.0103  860  CYS A CB  
1931 S  SG  . CYS A 274 ? 0.2405 0.1585 0.1774 -0.0127 -0.0474 0.0061  860  CYS A SG  
1932 N  N   . TRP A 275 ? 0.2478 0.1155 0.1655 0.0249  -0.0669 -0.0129 861  TRP A N   
1933 C  CA  . TRP A 275 ? 0.2494 0.1098 0.1718 0.0293  -0.0616 -0.0138 861  TRP A CA  
1934 C  C   . TRP A 275 ? 0.2429 0.1133 0.1868 0.0396  -0.0596 -0.0070 861  TRP A C   
1935 O  O   . TRP A 275 ? 0.2755 0.1595 0.1851 0.0371  -0.0614 0.0077  861  TRP A O   
1936 C  CB  . TRP A 275 ? 0.2583 0.1108 0.1557 0.0325  -0.0544 0.0000  861  TRP A CB  
1937 C  CG  . TRP A 275 ? 0.2360 0.1313 0.1466 0.0263  -0.0522 -0.0024 861  TRP A CG  
1938 C  CD1 . TRP A 275 ? 0.2619 0.1382 0.1427 0.0023  -0.0417 -0.0086 861  TRP A CD1 
1939 C  CD2 . TRP A 275 ? 0.2437 0.1117 0.1406 0.0163  -0.0569 0.0023  861  TRP A CD2 
1940 N  NE1 . TRP A 275 ? 0.2405 0.1044 0.1673 0.0175  -0.0443 -0.0009 861  TRP A NE1 
1941 C  CE2 . TRP A 275 ? 0.2399 0.0907 0.1572 0.0197  -0.0580 0.0096  861  TRP A CE2 
1942 C  CE3 . TRP A 275 ? 0.2296 0.1260 0.1501 -0.0046 -0.0405 -0.0037 861  TRP A CE3 
1943 C  CZ2 . TRP A 275 ? 0.2296 0.1252 0.1675 0.0197  -0.0484 -0.0111 861  TRP A CZ2 
1944 C  CZ3 . TRP A 275 ? 0.2386 0.1374 0.1415 0.0029  -0.0346 0.0029  861  TRP A CZ3 
1945 C  CH2 . TRP A 275 ? 0.2193 0.1296 0.1467 0.0018  -0.0674 0.0003  861  TRP A CH2 
1946 N  N   . GLN A 276 ? 0.2483 0.1275 0.1901 0.0532  -0.0630 0.0093  862  GLN A N   
1947 C  CA  . GLN A 276 ? 0.2901 0.1346 0.2096 0.0401  -0.0776 0.0148  862  GLN A CA  
1948 C  C   . GLN A 276 ? 0.2859 0.1045 0.2079 -0.0014 -0.1124 0.0212  862  GLN A C   
1949 O  O   . GLN A 276 ? 0.2622 0.1355 0.2216 0.0049  -0.0917 0.0161  862  GLN A O   
1950 C  CB  . GLN A 276 ? 0.2902 0.1471 0.2572 0.0426  -0.0597 0.0199  862  GLN A CB  
1951 C  CG  . GLN A 276 ? 0.3122 0.2339 0.2944 0.0503  -0.0555 0.0372  862  GLN A CG  
1952 C  CD  . GLN A 276 ? 0.3570 0.2919 0.3436 0.0613  -0.0450 0.0514  862  GLN A CD  
1953 O  OE1 . GLN A 276 ? 0.3663 0.3356 0.3948 0.1024  -0.0447 0.0436  862  GLN A OE1 
1954 N  NE2 . GLN A 276 ? 0.3776 0.3137 0.3643 0.0302  -0.0387 0.0432  862  GLN A NE2 
1955 N  N   . LYS A 277 ? 0.3321 0.1940 0.2252 0.0266  -0.1280 0.0354  863  LYS A N   
1956 C  CA  . LYS A 277 ? 0.3807 0.2070 0.2337 0.0111  -0.1350 0.0367  863  LYS A CA  
1957 C  C   . LYS A 277 ? 0.3794 0.1542 0.2421 0.0080  -0.1041 0.0203  863  LYS A C   
1958 O  O   . LYS A 277 ? 0.3495 0.2137 0.2338 -0.0288 -0.0714 0.0283  863  LYS A O   
1959 C  CB  . LYS A 277 ? 0.4194 0.2653 0.2290 0.0098  -0.1620 0.0331  863  LYS A CB  
1960 C  CG  . LYS A 277 ? 0.4610 0.3391 0.2349 -0.0255 -0.1701 0.0075  863  LYS A CG  
1961 C  CD  . LYS A 277 ? 0.5046 0.4596 0.2811 -0.0313 -0.1564 0.0000  863  LYS A CD  
1962 C  CE  . LYS A 277 ? 0.5296 0.5620 0.3140 -0.0538 -0.1447 0.0085  863  LYS A CE  
1963 N  NZ  . LYS A 277 ? 0.5421 0.5898 0.3141 -0.0648 -0.1355 0.0099  863  LYS A NZ  
1964 N  N   . ASP A 278 ? 0.4047 0.1678 0.2486 0.0617  -0.1198 0.0113  864  ASP A N   
1965 C  CA  . ASP A 278 ? 0.4258 0.1624 0.2718 0.0688  -0.1249 0.0153  864  ASP A CA  
1966 C  C   . ASP A 278 ? 0.3880 0.1511 0.2730 0.0710  -0.1160 0.0096  864  ASP A C   
1967 O  O   . ASP A 278 ? 0.3807 0.1741 0.2678 0.0453  -0.1213 0.0200  864  ASP A O   
1968 C  CB  . ASP A 278 ? 0.4649 0.2053 0.3092 0.1234  -0.1209 -0.0003 864  ASP A CB  
1969 C  CG  . ASP A 278 ? 0.5083 0.2663 0.3386 0.1622  -0.1320 0.0029  864  ASP A CG  
1970 O  OD1 . ASP A 278 ? 0.5383 0.2582 0.3422 0.1640  -0.1354 -0.0097 864  ASP A OD1 
1971 O  OD2 . ASP A 278 ? 0.5254 0.3620 0.3646 0.1570  -0.1271 0.0061  864  ASP A OD2 
1972 N  N   . ARG A 279 ? 0.3798 0.1475 0.2681 0.0518  -0.1104 0.0069  865  ARG A N   
1973 C  CA  . ARG A 279 ? 0.3605 0.1493 0.2705 0.0525  -0.0825 -0.0017 865  ARG A CA  
1974 C  C   . ARG A 279 ? 0.3404 0.1331 0.2813 0.0793  -0.0783 -0.0137 865  ARG A C   
1975 O  O   . ARG A 279 ? 0.3414 0.1784 0.2591 0.0622  -0.0962 -0.0041 865  ARG A O   
1976 C  CB  . ARG A 279 ? 0.3791 0.1436 0.2753 0.0324  -0.0571 0.0369  865  ARG A CB  
1977 C  CG  . ARG A 279 ? 0.3916 0.1847 0.2667 0.0255  -0.0567 0.0160  865  ARG A CG  
1978 C  CD  . ARG A 279 ? 0.4214 0.2330 0.2395 0.0266  -0.0605 0.0067  865  ARG A CD  
1979 N  NE  . ARG A 279 ? 0.4595 0.2475 0.2435 0.0457  -0.0291 0.0379  865  ARG A NE  
1980 C  CZ  . ARG A 279 ? 0.4633 0.2371 0.2378 0.0647  -0.0268 0.0743  865  ARG A CZ  
1981 N  NH1 . ARG A 279 ? 0.4740 0.2283 0.2370 0.0843  -0.0112 0.0389  865  ARG A NH1 
1982 N  NH2 . ARG A 279 ? 0.4778 0.3119 0.2765 0.0357  -0.0119 0.0589  865  ARG A NH2 
1983 N  N   . ASN A 280 ? 0.3687 0.1398 0.2966 0.0720  -0.0701 -0.0299 866  ASN A N   
1984 C  CA  . ASN A 280 ? 0.3880 0.1446 0.3177 0.0930  -0.0581 0.0030  866  ASN A CA  
1985 C  C   . ASN A 280 ? 0.3982 0.1978 0.3154 0.1209  -0.0651 -0.0151 866  ASN A C   
1986 O  O   . ASN A 280 ? 0.4145 0.2644 0.3385 0.1307  -0.0475 -0.0164 866  ASN A O   
1987 C  CB  . ASN A 280 ? 0.4655 0.1518 0.3673 0.0802  -0.0737 0.0099  866  ASN A CB  
1988 C  CG  . ASN A 280 ? 0.5192 0.2534 0.4141 0.0366  -0.0491 0.0065  866  ASN A CG  
1989 O  OD1 . ASN A 280 ? 0.5393 0.2667 0.4321 -0.0119 -0.0425 -0.0385 866  ASN A OD1 
1990 N  ND2 . ASN A 280 ? 0.5543 0.3159 0.4331 0.0066  -0.0115 0.0200  866  ASN A ND2 
1991 N  N   . ASN A 281 ? 0.3647 0.2014 0.2999 0.1139  -0.0812 0.0127  867  ASN A N   
1992 C  CA  . ASN A 281 ? 0.3319 0.2465 0.2941 0.0998  -0.0980 0.0269  867  ASN A CA  
1993 C  C   . ASN A 281 ? 0.3077 0.2328 0.2780 0.1073  -0.0598 0.0307  867  ASN A C   
1994 O  O   . ASN A 281 ? 0.3371 0.3034 0.3160 0.1041  -0.0207 0.0419  867  ASN A O   
1995 C  CB  . ASN A 281 ? 0.3522 0.3271 0.3087 0.1205  -0.1274 0.0490  867  ASN A CB  
1996 C  CG  . ASN A 281 ? 0.3942 0.4100 0.3601 0.1462  -0.0901 0.0340  867  ASN A CG  
1997 O  OD1 . ASN A 281 ? 0.4002 0.4176 0.3846 0.2014  -0.0728 0.0277  867  ASN A OD1 
1998 N  ND2 . ASN A 281 ? 0.3894 0.4418 0.3578 0.1416  -0.1159 0.0499  867  ASN A ND2 
1999 N  N   . ARG A 282 ? 0.2754 0.1725 0.2325 0.0882  -0.0645 -0.0027 868  ARG A N   
2000 C  CA  . ARG A 282 ? 0.2691 0.1682 0.2113 0.0683  -0.0535 -0.0131 868  ARG A CA  
2001 C  C   . ARG A 282 ? 0.2489 0.1555 0.2221 0.0686  -0.0481 -0.0077 868  ARG A C   
2002 O  O   . ARG A 282 ? 0.2590 0.1858 0.2533 0.0486  -0.0252 -0.0086 868  ARG A O   
2003 C  CB  . ARG A 282 ? 0.2603 0.1567 0.1938 0.0369  -0.0508 -0.0055 868  ARG A CB  
2004 C  CG  . ARG A 282 ? 0.2522 0.1439 0.1796 0.0462  -0.0388 -0.0005 868  ARG A CG  
2005 C  CD  . ARG A 282 ? 0.2524 0.1424 0.1764 0.0358  -0.0283 0.0016  868  ARG A CD  
2006 N  NE  . ARG A 282 ? 0.2444 0.1349 0.1600 0.0288  -0.0428 -0.0003 868  ARG A NE  
2007 C  CZ  . ARG A 282 ? 0.2352 0.1515 0.1659 0.0089  -0.0480 0.0114  868  ARG A CZ  
2008 N  NH1 . ARG A 282 ? 0.2442 0.1403 0.1849 -0.0052 -0.0589 0.0053  868  ARG A NH1 
2009 N  NH2 . ARG A 282 ? 0.2580 0.1724 0.1623 0.0108  -0.0636 0.0201  868  ARG A NH2 
2010 N  N   . PRO A 283 ? 0.2578 0.1510 0.2213 0.0504  -0.0572 -0.0211 869  PRO A N   
2011 C  CA  . PRO A 283 ? 0.2794 0.1552 0.1967 0.0087  -0.0742 -0.0105 869  PRO A CA  
2012 C  C   . PRO A 283 ? 0.2643 0.1523 0.2120 0.0284  -0.0793 -0.0165 869  PRO A C   
2013 O  O   . PRO A 283 ? 0.2643 0.1437 0.2318 0.0007  -0.0677 -0.0126 869  PRO A O   
2014 C  CB  . PRO A 283 ? 0.3015 0.1736 0.1925 -0.0056 -0.0555 -0.0283 869  PRO A CB  
2015 C  CG  . PRO A 283 ? 0.3087 0.1785 0.2112 0.0311  -0.0581 -0.0095 869  PRO A CG  
2016 C  CD  . PRO A 283 ? 0.2907 0.1483 0.2318 0.0437  -0.0489 -0.0106 869  PRO A CD  
2017 N  N   . LYS A 284 ? 0.2901 0.1458 0.2119 0.0134  -0.0656 -0.0244 870  LYS A N   
2018 C  CA  . LYS A 284 ? 0.2903 0.1238 0.2032 0.0253  -0.0815 -0.0231 870  LYS A CA  
2019 C  C   . LYS A 284 ? 0.2772 0.1611 0.1919 0.0182  -0.0625 -0.0272 870  LYS A C   
2020 O  O   . LYS A 284 ? 0.2549 0.1626 0.1870 0.0238  -0.0545 -0.0379 870  LYS A O   
2021 C  CB  . LYS A 284 ? 0.3597 0.1455 0.2437 0.0386  -0.0839 -0.0418 870  LYS A CB  
2022 C  CG  . LYS A 284 ? 0.4023 0.1448 0.2693 0.0368  -0.0644 0.0032  870  LYS A CG  
2023 C  CD  . LYS A 284 ? 0.4573 0.2187 0.2904 0.0315  -0.0378 0.0445  870  LYS A CD  
2024 C  CE  . LYS A 284 ? 0.5122 0.2702 0.3167 0.0418  -0.0107 0.0860  870  LYS A CE  
2025 N  NZ  . LYS A 284 ? 0.5429 0.2895 0.3454 0.0451  0.0097  0.1067  870  LYS A NZ  
2026 N  N   . PHE A 285 ? 0.2627 0.1348 0.1772 0.0251  -0.0594 -0.0294 871  PHE A N   
2027 C  CA  . PHE A 285 ? 0.2512 0.1538 0.1874 0.0495  -0.0540 -0.0171 871  PHE A CA  
2028 C  C   . PHE A 285 ? 0.2509 0.1411 0.1763 0.0309  -0.0482 -0.0515 871  PHE A C   
2029 O  O   . PHE A 285 ? 0.2639 0.1516 0.1732 0.0176  -0.0246 -0.0149 871  PHE A O   
2030 C  CB  . PHE A 285 ? 0.2403 0.1650 0.1796 0.0289  -0.0504 -0.0217 871  PHE A CB  
2031 C  CG  . PHE A 285 ? 0.2416 0.1447 0.1731 0.0208  -0.0611 -0.0365 871  PHE A CG  
2032 C  CD1 . PHE A 285 ? 0.2376 0.1164 0.1861 0.0334  -0.0614 -0.0346 871  PHE A CD1 
2033 C  CD2 . PHE A 285 ? 0.2432 0.1030 0.1786 0.0464  -0.0556 -0.0293 871  PHE A CD2 
2034 C  CE1 . PHE A 285 ? 0.2322 0.1352 0.1986 0.0325  -0.0699 -0.0332 871  PHE A CE1 
2035 C  CE2 . PHE A 285 ? 0.2120 0.1156 0.2032 0.0337  -0.0558 -0.0288 871  PHE A CE2 
2036 C  CZ  . PHE A 285 ? 0.2239 0.1314 0.2135 0.0154  -0.0737 -0.0201 871  PHE A CZ  
2037 N  N   . GLU A 286 ? 0.2837 0.2107 0.1933 0.0289  -0.0263 -0.0685 872  GLU A N   
2038 C  CA  . GLU A 286 ? 0.3116 0.1845 0.1988 0.0136  -0.0313 -0.0797 872  GLU A CA  
2039 C  C   . GLU A 286 ? 0.2998 0.1757 0.2019 0.0423  -0.0192 -0.0606 872  GLU A C   
2040 O  O   . GLU A 286 ? 0.2838 0.2209 0.2127 0.0459  -0.0214 -0.0468 872  GLU A O   
2041 C  CB  . GLU A 286 ? 0.3938 0.2277 0.2336 0.0081  0.0075  -0.1001 872  GLU A CB  
2042 C  CG  . GLU A 286 ? 0.4953 0.2972 0.2860 -0.0049 0.0473  -0.1157 872  GLU A CG  
2043 C  CD  . GLU A 286 ? 0.5885 0.3951 0.3368 -0.0274 0.0902  -0.1186 872  GLU A CD  
2044 O  OE1 . GLU A 286 ? 0.6187 0.4290 0.3601 -0.0324 0.1056  -0.1072 872  GLU A OE1 
2045 O  OE2 . GLU A 286 ? 0.6312 0.4547 0.3629 -0.0212 0.1012  -0.1166 872  GLU A OE2 
2046 N  N   . GLN A 287 ? 0.2798 0.1542 0.2310 0.0300  -0.0363 -0.0552 873  GLN A N   
2047 C  CA  . GLN A 287 ? 0.2585 0.1479 0.2504 0.0521  -0.0501 -0.0281 873  GLN A CA  
2048 C  C   . GLN A 287 ? 0.2372 0.1595 0.2373 0.0511  -0.0296 -0.0162 873  GLN A C   
2049 O  O   . GLN A 287 ? 0.2458 0.1876 0.2552 0.0523  0.0045  0.0010  873  GLN A O   
2050 C  CB  . GLN A 287 ? 0.3021 0.1780 0.2766 0.1010  -0.0425 -0.0062 873  GLN A CB  
2051 C  CG  . GLN A 287 ? 0.3313 0.2716 0.3056 0.1031  -0.0249 0.0001  873  GLN A CG  
2052 C  CD  . GLN A 287 ? 0.3511 0.3449 0.3128 0.1095  -0.0041 -0.0066 873  GLN A CD  
2053 O  OE1 . GLN A 287 ? 0.3315 0.3418 0.2936 0.1070  0.0217  -0.0224 873  GLN A OE1 
2054 N  NE2 . GLN A 287 ? 0.3963 0.4107 0.3336 0.1174  -0.0013 0.0011  873  GLN A NE2 
2055 N  N   . ILE A 288 ? 0.2386 0.1362 0.2191 0.0488  -0.0504 -0.0354 874  ILE A N   
2056 C  CA  . ILE A 288 ? 0.2169 0.1513 0.2157 0.0433  -0.0292 -0.0128 874  ILE A CA  
2057 C  C   . ILE A 288 ? 0.2328 0.1410 0.1962 0.0218  -0.0250 -0.0362 874  ILE A C   
2058 O  O   . ILE A 288 ? 0.2399 0.1452 0.2070 0.0171  -0.0322 -0.0253 874  ILE A O   
2059 C  CB  . ILE A 288 ? 0.2179 0.1170 0.1899 0.0329  -0.0343 -0.0089 874  ILE A CB  
2060 C  CG1 . ILE A 288 ? 0.2144 0.1600 0.1858 0.0066  -0.0281 0.0142  874  ILE A CG1 
2061 C  CG2 . ILE A 288 ? 0.2435 0.1300 0.1899 0.0269  -0.0261 0.0047  874  ILE A CG2 
2062 C  CD1 . ILE A 288 ? 0.2346 0.1797 0.1876 0.0103  -0.0262 -0.0054 874  ILE A CD1 
2063 N  N   . VAL A 289 ? 0.2346 0.1412 0.1796 0.0203  -0.0228 -0.0276 875  VAL A N   
2064 C  CA  . VAL A 289 ? 0.2425 0.1916 0.1730 0.0259  -0.0332 -0.0224 875  VAL A CA  
2065 C  C   . VAL A 289 ? 0.2549 0.2074 0.1976 0.0368  -0.0293 -0.0193 875  VAL A C   
2066 O  O   . VAL A 289 ? 0.2813 0.2052 0.1973 0.0026  -0.0224 -0.0097 875  VAL A O   
2067 C  CB  . VAL A 289 ? 0.2560 0.1846 0.1617 -0.0079 -0.0377 -0.0302 875  VAL A CB  
2068 C  CG1 . VAL A 289 ? 0.2713 0.2392 0.1724 0.0082  -0.0500 -0.0185 875  VAL A CG1 
2069 C  CG2 . VAL A 289 ? 0.2680 0.1810 0.1797 0.0200  -0.0264 -0.0239 875  VAL A CG2 
2070 N  N   . SER A 290 ? 0.2654 0.2253 0.2141 0.0380  0.0016  -0.0419 876  SER A N   
2071 C  CA  . SER A 290 ? 0.2588 0.2484 0.2576 0.0435  0.0003  -0.0395 876  SER A CA  
2072 C  C   . SER A 290 ? 0.2530 0.2445 0.2297 0.0451  -0.0169 -0.0280 876  SER A C   
2073 O  O   . SER A 290 ? 0.2316 0.2525 0.2409 0.0297  0.0008  -0.0057 876  SER A O   
2074 C  CB  . SER A 290 ? 0.2628 0.2765 0.3324 0.0668  0.0529  -0.0326 876  SER A CB  
2075 O  OG  . SER A 290 ? 0.3320 0.3621 0.3877 0.0752  0.0701  -0.0403 876  SER A OG  
2076 N  N   . ILE A 291 ? 0.2362 0.2063 0.2116 0.0448  -0.0315 -0.0230 877  ILE A N   
2077 C  CA  . ILE A 291 ? 0.2366 0.2115 0.2014 0.0570  -0.0313 -0.0068 877  ILE A CA  
2078 C  C   . ILE A 291 ? 0.2141 0.2235 0.2043 0.0485  -0.0181 -0.0064 877  ILE A C   
2079 O  O   . ILE A 291 ? 0.2245 0.2387 0.2151 0.0348  -0.0078 0.0049  877  ILE A O   
2080 C  CB  . ILE A 291 ? 0.2618 0.2075 0.1976 0.0642  -0.0438 -0.0046 877  ILE A CB  
2081 C  CG1 . ILE A 291 ? 0.2850 0.2760 0.2253 0.0658  -0.0292 0.0064  877  ILE A CG1 
2082 C  CG2 . ILE A 291 ? 0.2684 0.2076 0.2083 0.0281  -0.0433 -0.0219 877  ILE A CG2 
2083 C  CD1 . ILE A 291 ? 0.2923 0.2814 0.2412 0.0784  -0.0215 0.0168  877  ILE A CD1 
2084 N  N   . LEU A 292 ? 0.1854 0.1912 0.1950 0.0499  -0.0083 -0.0169 878  LEU A N   
2085 C  CA  . LEU A 292 ? 0.2007 0.1845 0.1811 0.0566  0.0014  -0.0193 878  LEU A CA  
2086 C  C   . LEU A 292 ? 0.2434 0.2104 0.1983 0.0520  0.0185  -0.0258 878  LEU A C   
2087 O  O   . LEU A 292 ? 0.2542 0.2006 0.2117 0.0329  0.0139  0.0182  878  LEU A O   
2088 C  CB  . LEU A 292 ? 0.2032 0.1961 0.1738 0.0513  0.0004  -0.0156 878  LEU A CB  
2089 C  CG  . LEU A 292 ? 0.2143 0.1503 0.1820 0.0240  -0.0085 -0.0319 878  LEU A CG  
2090 C  CD1 . LEU A 292 ? 0.1822 0.1709 0.2055 0.0356  -0.0025 -0.0008 878  LEU A CD1 
2091 C  CD2 . LEU A 292 ? 0.2642 0.1511 0.2121 -0.0056 -0.0022 -0.0090 878  LEU A CD2 
2092 N  N   . ASP A 293 ? 0.2604 0.2551 0.1661 0.0498  0.0027  -0.0218 879  ASP A N   
2093 C  CA  . ASP A 293 ? 0.2945 0.2729 0.1758 0.0435  0.0140  -0.0177 879  ASP A CA  
2094 C  C   . ASP A 293 ? 0.2851 0.2597 0.1859 0.0394  0.0181  0.0174  879  ASP A C   
2095 O  O   . ASP A 293 ? 0.3051 0.3256 0.2213 0.0174  0.0144  0.0524  879  ASP A O   
2096 C  CB  . ASP A 293 ? 0.3322 0.3087 0.1918 0.0098  0.0216  -0.0480 879  ASP A CB  
2097 C  CG  . ASP A 293 ? 0.4057 0.3586 0.2183 0.0053  0.0261  -0.0542 879  ASP A CG  
2098 O  OD1 . ASP A 293 ? 0.4338 0.3999 0.2120 0.0033  0.0340  -0.0396 879  ASP A OD1 
2099 O  OD2 . ASP A 293 ? 0.4382 0.3808 0.2403 -0.0298 0.0165  -0.0543 879  ASP A OD2 
2100 N  N   . LYS A 294 ? 0.2762 0.2218 0.1999 0.0493  0.0226  -0.0153 880  LYS A N   
2101 C  CA  . LYS A 294 ? 0.2692 0.2266 0.2217 0.0430  0.0268  -0.0013 880  LYS A CA  
2102 C  C   . LYS A 294 ? 0.2831 0.2712 0.2331 0.0274  0.0155  0.0006  880  LYS A C   
2103 O  O   . LYS A 294 ? 0.2970 0.3117 0.2408 0.0048  0.0352  0.0019  880  LYS A O   
2104 C  CB  . LYS A 294 ? 0.3075 0.2439 0.2626 0.0645  0.0340  0.0187  880  LYS A CB  
2105 C  CG  . LYS A 294 ? 0.3952 0.3508 0.3169 0.0973  0.0304  0.0486  880  LYS A CG  
2106 C  CD  . LYS A 294 ? 0.4775 0.4488 0.3681 0.1194  0.0387  0.0421  880  LYS A CD  
2107 C  CE  . LYS A 294 ? 0.5085 0.5058 0.3980 0.1534  0.0305  0.0828  880  LYS A CE  
2108 N  NZ  . LYS A 294 ? 0.5143 0.5761 0.4105 0.1534  0.0123  0.1121  880  LYS A NZ  
2109 N  N   . LEU A 295 ? 0.2840 0.2495 0.2375 0.0207  -0.0099 -0.0178 881  LEU A N   
2110 C  CA  . LEU A 295 ? 0.2716 0.2498 0.2618 0.0192  -0.0155 -0.0221 881  LEU A CA  
2111 C  C   . LEU A 295 ? 0.3079 0.2292 0.3184 0.0279  -0.0585 -0.0016 881  LEU A C   
2112 O  O   . LEU A 295 ? 0.3134 0.2123 0.3668 0.0115  -0.0609 0.0137  881  LEU A O   
2113 C  CB  . LEU A 295 ? 0.2442 0.2927 0.2522 0.0253  0.0257  -0.0375 881  LEU A CB  
2114 C  CG  . LEU A 295 ? 0.1980 0.3417 0.2593 -0.0075 0.0585  -0.0237 881  LEU A CG  
2115 C  CD1 . LEU A 295 ? 0.2121 0.3601 0.2556 -0.0264 0.0639  -0.0201 881  LEU A CD1 
2116 C  CD2 . LEU A 295 ? 0.2025 0.3458 0.2669 -0.0196 0.0793  -0.0339 881  LEU A CD2 
2117 N  N   . ILE A 296 ? 0.3396 0.2409 0.3166 -0.0021 -0.0836 0.0313  882  ILE A N   
2118 C  CA  . ILE A 296 ? 0.3941 0.3504 0.3275 -0.0073 -0.1070 0.0706  882  ILE A CA  
2119 C  C   . ILE A 296 ? 0.4815 0.4173 0.3329 -0.0400 -0.0869 0.1075  882  ILE A C   
2120 O  O   . ILE A 296 ? 0.5052 0.4316 0.3519 -0.0309 -0.1026 0.1259  882  ILE A O   
2121 C  CB  . ILE A 296 ? 0.3763 0.4199 0.3315 0.0090  -0.1037 0.1008  882  ILE A CB  
2122 C  CG1 . ILE A 296 ? 0.3761 0.4375 0.3231 -0.0355 -0.0978 0.0700  882  ILE A CG1 
2123 C  CG2 . ILE A 296 ? 0.3897 0.4690 0.3461 0.0054  -0.0871 0.0977  882  ILE A CG2 
2124 C  CD1 . ILE A 296 ? 0.3859 0.4653 0.3347 -0.0659 -0.0814 0.0413  882  ILE A CD1 
2125 N  N   . ARG A 297 ? 0.5281 0.5348 0.3410 0.0051  -0.0641 0.1204  883  ARG A N   
2126 C  CA  . ARG A 297 ? 0.6271 0.6597 0.3847 0.0303  -0.0121 0.0952  883  ARG A CA  
2127 C  C   . ARG A 297 ? 0.6797 0.7505 0.4210 0.0563  0.0101  0.0976  883  ARG A C   
2128 O  O   . ARG A 297 ? 0.6958 0.7633 0.4359 0.0571  0.0167  0.1000  883  ARG A O   
2129 C  CB  . ARG A 297 ? 0.6725 0.6864 0.4083 0.0443  -0.0036 0.0662  883  ARG A CB  
2130 C  CG  . ARG A 297 ? 0.7280 0.7232 0.4532 0.0540  -0.0050 0.0256  883  ARG A CG  
2131 C  CD  . ARG A 297 ? 0.7764 0.7545 0.4865 0.0554  -0.0167 -0.0194 883  ARG A CD  
2132 N  NE  . ARG A 297 ? 0.8122 0.7886 0.5124 0.0500  -0.0201 -0.0577 883  ARG A NE  
2133 C  CZ  . ARG A 297 ? 0.8424 0.8134 0.5248 0.0412  -0.0188 -0.0832 883  ARG A CZ  
2134 N  NH1 . ARG A 297 ? 0.8496 0.8208 0.5258 0.0293  -0.0137 -0.0894 883  ARG A NH1 
2135 N  NH2 . ARG A 297 ? 0.8563 0.8173 0.5276 0.0405  -0.0154 -0.0974 883  ARG A NH2 
2136 N  N   . ASN A 298 ? 0.7029 0.8153 0.4512 0.0748  0.0157  0.0820  884  ASN A N   
2137 C  CA  . ASN A 298 ? 0.7248 0.8747 0.4696 0.0939  0.0265  0.0712  884  ASN A CA  
2138 C  C   . ASN A 298 ? 0.7128 0.8410 0.4485 0.0954  0.0281  0.0833  884  ASN A C   
2139 O  O   . ASN A 298 ? 0.6820 0.8354 0.4314 0.1037  -0.0205 0.0660  884  ASN A O   
2140 C  CB  . ASN A 298 ? 0.7584 0.9583 0.4995 0.1031  0.0352  0.0493  884  ASN A CB  
2141 C  CG  . ASN A 298 ? 0.7883 1.0278 0.5186 0.1058  0.0395  0.0377  884  ASN A CG  
2142 O  OD1 . ASN A 298 ? 0.7994 1.0569 0.5210 0.1110  0.0324  0.0307  884  ASN A OD1 
2143 N  ND2 . ASN A 298 ? 0.8030 1.0517 0.5314 0.1025  0.0514  0.0326  884  ASN A ND2 
2144 N  N   . PRO A 299 ? 0.7227 0.8201 0.4436 0.0852  0.0511  0.1344  885  PRO A N   
2145 C  CA  . PRO A 299 ? 0.7206 0.8279 0.4651 0.0443  0.0816  0.1561  885  PRO A CA  
2146 C  C   . PRO A 299 ? 0.7196 0.8142 0.4984 -0.0214 0.1317  0.1496  885  PRO A C   
2147 O  O   . PRO A 299 ? 0.7119 0.8145 0.5071 -0.0126 0.1429  0.1354  885  PRO A O   
2148 C  CB  . PRO A 299 ? 0.7041 0.8082 0.4544 0.0805  0.0672  0.1764  885  PRO A CB  
2149 C  CG  . PRO A 299 ? 0.7069 0.8175 0.4574 0.0872  0.0657  0.1617  885  PRO A CG  
2150 C  CD  . PRO A 299 ? 0.7163 0.8211 0.4441 0.0850  0.0544  0.1611  885  PRO A CD  
2151 N  N   . GLY A 300 ? 0.6952 0.7858 0.5137 -0.0820 0.1443  0.1608  886  GLY A N   
2152 C  CA  . GLY A 300 ? 0.6738 0.7755 0.5227 -0.1283 0.1575  0.1409  886  GLY A CA  
2153 C  C   . GLY A 300 ? 0.6477 0.7701 0.5309 -0.1630 0.1684  0.1054  886  GLY A C   
2154 O  O   . GLY A 300 ? 0.6576 0.8078 0.5336 -0.1483 0.1889  0.0874  886  GLY A O   
2155 N  N   . SER A 301 ? 0.6072 0.6623 0.5286 -0.2398 0.1629  0.0998  887  SER A N   
2156 C  CA  . SER A 301 ? 0.6574 0.6595 0.5475 -0.2165 0.1525  0.0628  887  SER A CA  
2157 C  C   . SER A 301 ? 0.6856 0.5913 0.5386 -0.2076 0.1527  0.0564  887  SER A C   
2158 O  O   . SER A 301 ? 0.7000 0.5823 0.5590 -0.1970 0.1540  0.0301  887  SER A O   
2159 C  CB  . SER A 301 ? 0.6791 0.7009 0.5656 -0.2273 0.1527  0.0413  887  SER A CB  
2160 O  OG  . SER A 301 ? 0.7092 0.7295 0.5757 -0.2207 0.1557  0.0288  887  SER A OG  
2161 N  N   . LEU A 302 ? 0.6989 0.5337 0.5120 -0.2200 0.1504  0.0537  888  LEU A N   
2162 C  CA  . LEU A 302 ? 0.6920 0.4690 0.4835 -0.2206 0.1348  0.0388  888  LEU A CA  
2163 C  C   . LEU A 302 ? 0.6774 0.4514 0.4609 -0.2264 0.1271  0.0171  888  LEU A C   
2164 O  O   . LEU A 302 ? 0.6901 0.4721 0.4557 -0.2277 0.1158  0.0166  888  LEU A O   
2165 C  CB  . LEU A 302 ? 0.7068 0.4372 0.4745 -0.2132 0.1227  0.0462  888  LEU A CB  
2166 C  CG  . LEU A 302 ? 0.7201 0.3992 0.4670 -0.2107 0.1129  0.0575  888  LEU A CG  
2167 C  CD1 . LEU A 302 ? 0.7376 0.4413 0.4593 -0.1934 0.1031  0.0326  888  LEU A CD1 
2168 C  CD2 . LEU A 302 ? 0.7025 0.3751 0.4665 -0.2197 0.1181  0.0754  888  LEU A CD2 
2169 N  N   . LYS A 303 ? 0.6563 0.4474 0.4493 -0.2170 0.1432  0.0114  889  LYS A N   
2170 C  CA  . LYS A 303 ? 0.6335 0.4445 0.4480 -0.2180 0.1471  -0.0195 889  LYS A CA  
2171 C  C   . LYS A 303 ? 0.5982 0.3930 0.4360 -0.1938 0.1446  -0.0521 889  LYS A C   
2172 O  O   . LYS A 303 ? 0.6089 0.3689 0.4464 -0.2109 0.1342  -0.0705 889  LYS A O   
2173 C  CB  . LYS A 303 ? 0.6355 0.4381 0.4600 -0.2590 0.1454  -0.0267 889  LYS A CB  
2174 N  N   . ILE A 304 ? 0.5342 0.3551 0.4153 -0.1861 0.1477  -0.0440 890  ILE A N   
2175 C  CA  . ILE A 304 ? 0.4680 0.3446 0.4057 -0.1507 0.1301  -0.0002 890  ILE A CA  
2176 C  C   . ILE A 304 ? 0.4507 0.3275 0.3950 -0.1069 0.1087  0.0311  890  ILE A C   
2177 O  O   . ILE A 304 ? 0.4207 0.2833 0.3833 -0.1130 0.0795  0.0366  890  ILE A O   
2178 C  CB  . ILE A 304 ? 0.4343 0.3660 0.4024 -0.1071 0.1176  0.0159  890  ILE A CB  
2179 C  CG1 . ILE A 304 ? 0.4594 0.3848 0.4264 -0.0636 0.1129  0.0188  890  ILE A CG1 
2180 C  CG2 . ILE A 304 ? 0.4278 0.3819 0.3987 -0.1078 0.1018  0.0144  890  ILE A CG2 
2181 C  CD1 . ILE A 304 ? 0.4676 0.4321 0.4384 -0.0446 0.1093  0.0213  890  ILE A CD1 
2182 N  N   . ILE A 305 ? 0.4592 0.3397 0.4082 -0.0860 0.1087  0.0162  891  ILE A N   
2183 C  CA  . ILE A 305 ? 0.5015 0.4403 0.4327 -0.0899 0.1107  -0.0054 891  ILE A CA  
2184 C  C   . ILE A 305 ? 0.5246 0.5150 0.4282 -0.1015 0.1103  -0.0184 891  ILE A C   
2185 O  O   . ILE A 305 ? 0.5168 0.5468 0.4293 -0.1111 0.1004  -0.0220 891  ILE A O   
2186 C  CB  . ILE A 305 ? 0.5387 0.5164 0.4540 -0.0488 0.1101  -0.0097 891  ILE A CB  
2187 C  CG1 . ILE A 305 ? 0.5605 0.5569 0.4595 -0.0459 0.1211  -0.0086 891  ILE A CG1 
2188 C  CG2 . ILE A 305 ? 0.5423 0.5103 0.4589 -0.0529 0.1082  -0.0201 891  ILE A CG2 
2189 C  CD1 . ILE A 305 ? 0.5628 0.5609 0.4603 -0.0705 0.1114  -0.0114 891  ILE A CD1 
2190 N  N   . THR A 306 ? 0.5472 0.5809 0.4309 -0.0891 0.1184  -0.0220 892  THR A N   
2191 C  CA  . THR A 306 ? 0.5991 0.6577 0.4560 -0.0708 0.1250  -0.0207 892  THR A CA  
2192 C  C   . THR A 306 ? 0.6227 0.7177 0.4696 -0.0501 0.1418  -0.0257 892  THR A C   
2193 O  O   . THR A 306 ? 0.6349 0.7463 0.4737 -0.0336 0.1469  -0.0349 892  THR A O   
2194 C  CB  . THR A 306 ? 0.6219 0.6548 0.4751 -0.0744 0.1264  -0.0056 892  THR A CB  
2195 O  OG1 . THR A 306 ? 0.6354 0.6803 0.4886 -0.0852 0.1176  0.0251  892  THR A OG1 
2196 C  CG2 . THR A 306 ? 0.6321 0.6361 0.4787 -0.0624 0.1374  -0.0235 892  THR A CG2 
2197 N  N   . PRO A 312 ? 0.6914 0.7764 0.5641 -0.2232 0.0662  -0.0531 898  PRO A N   
2198 C  CA  . PRO A 312 ? 0.6850 0.7575 0.5460 -0.2213 0.0568  -0.0645 898  PRO A CA  
2199 C  C   . PRO A 312 ? 0.6711 0.7215 0.4969 -0.2115 0.0276  -0.0665 898  PRO A C   
2200 O  O   . PRO A 312 ? 0.6751 0.7536 0.4922 -0.2186 0.0066  -0.0747 898  PRO A O   
2201 C  CB  . PRO A 312 ? 0.6876 0.7666 0.5649 -0.2254 0.0677  -0.0647 898  PRO A CB  
2202 C  CG  . PRO A 312 ? 0.6958 0.7710 0.5734 -0.2238 0.0670  -0.0599 898  PRO A CG  
2203 C  CD  . PRO A 312 ? 0.6951 0.7720 0.5704 -0.2255 0.0650  -0.0514 898  PRO A CD  
2204 N  N   . SER A 313 ? 0.6473 0.6313 0.4445 -0.1924 -0.0028 -0.0685 899  SER A N   
2205 C  CA  . SER A 313 ? 0.6209 0.5498 0.3832 -0.1546 -0.0280 -0.0650 899  SER A CA  
2206 C  C   . SER A 313 ? 0.5880 0.4801 0.3353 -0.1395 -0.0395 -0.1028 899  SER A C   
2207 O  O   . SER A 313 ? 0.5837 0.5145 0.3379 -0.1337 -0.0213 -0.1102 899  SER A O   
2208 C  CB  . SER A 313 ? 0.6323 0.5246 0.3599 -0.1064 -0.0499 -0.0221 899  SER A CB  
2209 O  OG  . SER A 313 ? 0.6356 0.4967 0.3518 -0.0977 -0.0911 -0.0137 899  SER A OG  
2210 N  N   . ASN A 314 ? 0.5437 0.3845 0.2920 -0.1124 -0.0413 -0.1081 900  ASN A N   
2211 C  CA  . ASN A 314 ? 0.5177 0.2980 0.2652 -0.0307 -0.0304 -0.0810 900  ASN A CA  
2212 C  C   . ASN A 314 ? 0.4571 0.2014 0.2299 0.0228  -0.0390 -0.0507 900  ASN A C   
2213 O  O   . ASN A 314 ? 0.4824 0.1884 0.2271 0.0178  -0.0161 -0.0171 900  ASN A O   
2214 C  CB  . ASN A 314 ? 0.5501 0.3444 0.2928 -0.0104 -0.0243 -0.0862 900  ASN A CB  
2215 C  CG  . ASN A 314 ? 0.5869 0.3894 0.3334 -0.0090 -0.0057 -0.1051 900  ASN A CG  
2216 O  OD1 . ASN A 314 ? 0.5965 0.3936 0.3437 -0.0382 -0.0155 -0.0906 900  ASN A OD1 
2217 N  ND2 . ASN A 314 ? 0.5855 0.3877 0.3404 0.0147  0.0136  -0.1004 900  ASN A ND2 
2218 N  N   . LEU A 315 ? 0.3798 0.1612 0.2222 0.0346  -0.0758 -0.0568 901  LEU A N   
2219 C  CA  . LEU A 315 ? 0.3428 0.2145 0.2139 0.0576  -0.0840 -0.0631 901  LEU A CA  
2220 C  C   . LEU A 315 ? 0.3358 0.2904 0.2215 0.0478  -0.0984 -0.0628 901  LEU A C   
2221 O  O   . LEU A 315 ? 0.3551 0.3434 0.2264 0.0431  -0.1042 -0.0961 901  LEU A O   
2222 C  CB  . LEU A 315 ? 0.3342 0.2197 0.1954 0.0565  -0.0783 -0.0446 901  LEU A CB  
2223 C  CG  . LEU A 315 ? 0.3229 0.1993 0.1778 0.0349  -0.0687 -0.0093 901  LEU A CG  
2224 C  CD1 . LEU A 315 ? 0.3409 0.1828 0.1972 0.0156  -0.0555 0.0192  901  LEU A CD1 
2225 C  CD2 . LEU A 315 ? 0.3105 0.2206 0.1743 0.0300  -0.0646 -0.0119 901  LEU A CD2 
2226 N  N   . LEU A 316 ? 0.2976 0.3075 0.2441 0.0442  -0.0945 -0.0491 902  LEU A N   
2227 C  CA  . LEU A 316 ? 0.3147 0.3677 0.2699 0.0525  -0.0818 -0.0104 902  LEU A CA  
2228 C  C   . LEU A 316 ? 0.3614 0.3766 0.2909 0.0672  -0.0632 -0.0241 902  LEU A C   
2229 O  O   . LEU A 316 ? 0.3588 0.3320 0.2788 0.0547  -0.0636 -0.0166 902  LEU A O   
2230 C  CB  . LEU A 316 ? 0.3483 0.4092 0.2870 -0.0037 -0.0528 0.0152  902  LEU A CB  
2231 C  CG  . LEU A 316 ? 0.3884 0.4911 0.3059 -0.0537 -0.0523 0.0172  902  LEU A CG  
2232 C  CD1 . LEU A 316 ? 0.3743 0.5036 0.2904 -0.0539 -0.0894 0.0250  902  LEU A CD1 
2233 C  CD2 . LEU A 316 ? 0.4256 0.5209 0.3308 -0.0551 -0.0223 0.0234  902  LEU A CD2 
2234 N  N   . LEU A 317 ? 0.4017 0.4632 0.3482 0.0962  -0.0594 -0.0441 903  LEU A N   
2235 C  CA  . LEU A 317 ? 0.4743 0.5887 0.3933 0.0993  -0.0312 -0.0509 903  LEU A CA  
2236 C  C   . LEU A 317 ? 0.5539 0.6913 0.4457 0.0980  0.0336  -0.0440 903  LEU A C   
2237 O  O   . LEU A 317 ? 0.5555 0.7097 0.4622 0.1142  0.0352  -0.0357 903  LEU A O   
2238 C  CB  . LEU A 317 ? 0.4667 0.6120 0.3857 0.0884  -0.0494 -0.0571 903  LEU A CB  
2239 C  CG  . LEU A 317 ? 0.4544 0.6308 0.3800 0.0875  -0.0578 -0.0666 903  LEU A CG  
2240 C  CD1 . LEU A 317 ? 0.4540 0.6289 0.3808 0.0879  -0.0589 -0.0669 903  LEU A CD1 
2241 C  CD2 . LEU A 317 ? 0.4421 0.6414 0.3747 0.0792  -0.0633 -0.0795 903  LEU A CD2 
2242 N  N   . ASP A 318 ? 0.6291 0.7585 0.4782 0.0677  0.0766  -0.0496 904  ASP A N   
2243 C  CA  . ASP A 318 ? 0.6910 0.8042 0.4994 0.0460  0.0943  -0.0491 904  ASP A CA  
2244 C  C   . ASP A 318 ? 0.7219 0.8191 0.5037 0.0463  0.1067  -0.0517 904  ASP A C   
2245 O  O   . ASP A 318 ? 0.7388 0.8367 0.5010 0.0366  0.1177  -0.0544 904  ASP A O   
2246 C  CB  . ASP A 318 ? 0.7197 0.8210 0.5132 0.0289  0.0873  -0.0316 904  ASP A CB  
2247 C  CG  . ASP A 318 ? 0.7306 0.8320 0.5228 0.0137  0.0806  -0.0069 904  ASP A CG  
2248 O  OD1 . ASP A 318 ? 0.7277 0.8247 0.5371 0.0192  0.0634  0.0024  904  ASP A OD1 
2249 O  OD2 . ASP A 318 ? 0.7441 0.8405 0.5204 -0.0089 0.0967  0.0072  904  ASP A OD2 
2250 CL CL  . Q0B B .   ? 0.6108 0.6356 0.5227 0.0379  -0.0974 0.1816  1001 Q0B A CL  
2251 C  C15 . Q0B B .   ? 0.6327 0.6231 0.5253 0.0244  -0.1198 0.1520  1001 Q0B A C15 
2252 C  C16 . Q0B B .   ? 0.6524 0.6049 0.5275 0.0381  -0.1283 0.1502  1001 Q0B A C16 
2253 C  C17 . Q0B B .   ? 0.6563 0.6119 0.5388 0.0508  -0.1227 0.1564  1001 Q0B A C17 
2254 C  C18 . Q0B B .   ? 0.6409 0.6034 0.5391 0.0438  -0.1352 0.1559  1001 Q0B A C18 
2255 C  C19 . Q0B B .   ? 0.6335 0.6011 0.5343 0.0269  -0.1372 0.1487  1001 Q0B A C19 
2256 C  C14 . Q0B B .   ? 0.6267 0.6169 0.5249 -0.0188 -0.1261 0.1103  1001 Q0B A C14 
2257 N  N11 . Q0B B .   ? 0.5918 0.6081 0.4997 -0.0930 -0.1364 0.0401  1001 Q0B A N11 
2258 C  C10 . Q0B B .   ? 0.5305 0.5887 0.4630 -0.1188 -0.1802 0.0169  1001 Q0B A C10 
2259 N  N21 . Q0B B .   ? 0.4716 0.5701 0.4449 -0.1074 -0.2553 -0.0028 1001 Q0B A N21 
2260 C  C12 . Q0B B .   ? 0.5900 0.5978 0.4926 -0.1552 -0.1203 -0.0142 1001 Q0B A C12 
2261 C  C8  . Q0B B .   ? 0.5717 0.5889 0.4878 -0.1775 -0.1210 -0.0315 1001 Q0B A C8  
2262 N  N7  . Q0B B .   ? 0.5897 0.6106 0.4832 -0.2072 -0.1188 -0.0705 1001 Q0B A N7  
2263 C  C5  . Q0B B .   ? 0.6002 0.6182 0.4882 -0.2262 -0.1070 -0.0818 1001 Q0B A C5  
2264 C  C6  . Q0B B .   ? 0.6130 0.6126 0.4910 -0.2330 -0.0951 -0.0950 1001 Q0B A C6  
2265 C  C1  . Q0B B .   ? 0.6118 0.6117 0.4836 -0.2435 -0.0964 -0.1084 1001 Q0B A C1  
2266 C  C2  . Q0B B .   ? 0.6080 0.6245 0.4794 -0.2430 -0.0970 -0.1035 1001 Q0B A C2  
2267 C  C3  . Q0B B .   ? 0.6025 0.6169 0.4822 -0.2383 -0.0980 -0.0913 1001 Q0B A C3  
2268 C  C4  . Q0B B .   ? 0.6001 0.6147 0.4854 -0.2205 -0.1022 -0.0711 1001 Q0B A C4  
2269 N  N13 . Q0B B .   ? 0.5989 0.6043 0.4917 -0.1935 -0.1016 -0.0395 1001 Q0B A N13 
2270 C  C9  . Q0B B .   ? 0.5299 0.5686 0.4632 -0.1659 -0.1386 -0.0119 1001 Q0B A C9  
2271 C  C22 . Q0B B .   ? 0.4975 0.5265 0.4559 -0.1688 -0.0957 -0.0418 1001 Q0B A C22 
2272 O  O23 . Q0B B .   ? 0.4596 0.4596 0.4087 -0.1870 -0.0878 -0.0650 1001 Q0B A O23 
2273 N  N24 . Q0B B .   ? 0.5116 0.4912 0.4906 -0.1173 -0.0309 -0.0130 1001 Q0B A N24 
2274 C  C35 . Q0B B .   ? 0.5127 0.5069 0.5070 -0.0909 -0.0125 -0.0088 1001 Q0B A C35 
2275 C  C36 . Q0B B .   ? 0.5084 0.4809 0.5165 -0.0790 -0.0049 -0.0122 1001 Q0B A C36 
2276 C  C37 . Q0B B .   ? 0.5051 0.4551 0.5251 -0.0592 0.0068  -0.0045 1001 Q0B A C37 
2277 O  O38 . Q0B B .   ? 0.4978 0.4656 0.5273 -0.0368 0.0131  0.0054  1001 Q0B A O38 
2278 C  C39 . Q0B B .   ? 0.5001 0.4749 0.5306 -0.0188 0.0197  0.0083  1001 Q0B A C39 
2279 C  C40 . Q0B B .   ? 0.5033 0.4849 0.5370 -0.0138 0.0236  0.0118  1001 Q0B A C40 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   587 ?   ?   ?   A . n 
A 1 2   GLY 2   588 ?   ?   ?   A . n 
A 1 3   SER 3   589 ?   ?   ?   A . n 
A 1 4   SER 4   590 ?   ?   ?   A . n 
A 1 5   HIS 5   591 ?   ?   ?   A . n 
A 1 6   HIS 6   592 ?   ?   ?   A . n 
A 1 7   HIS 7   593 ?   ?   ?   A . n 
A 1 8   HIS 8   594 ?   ?   ?   A . n 
A 1 9   HIS 9   595 ?   ?   ?   A . n 
A 1 10  HIS 10  596 ?   ?   ?   A . n 
A 1 11  SER 11  597 ?   ?   ?   A . n 
A 1 12  SER 12  598 ?   ?   ?   A . n 
A 1 13  GLY 13  599 ?   ?   ?   A . n 
A 1 14  LEU 14  600 ?   ?   ?   A . n 
A 1 15  VAL 15  601 ?   ?   ?   A . n 
A 1 16  PRO 16  602 ?   ?   ?   A . n 
A 1 17  ARG 17  603 ?   ?   ?   A . n 
A 1 18  GLY 18  604 ?   ?   ?   A . n 
A 1 19  SER 19  605 ?   ?   ?   A . n 
A 1 20  THR 20  606 ?   ?   ?   A . n 
A 1 21  GLN 21  607 ?   ?   ?   A . n 
A 1 22  THR 22  608 ?   ?   ?   A . n 
A 1 23  VAL 23  609 609 VAL VAL A . n 
A 1 24  HIS 24  610 610 HIS HIS A . n 
A 1 25  GLU 25  611 611 GLU GLU A . n 
A 1 26  PHE 26  612 612 PHE PHE A . n 
A 1 27  ALA 27  613 613 ALA ALA A . n 
A 1 28  LYS 28  614 614 LYS LYS A . n 
A 1 29  GLU 29  615 615 GLU GLU A . n 
A 1 30  LEU 30  616 616 LEU LEU A . n 
A 1 31  ASP 31  617 617 ASP ASP A . n 
A 1 32  ALA 32  618 618 ALA ALA A . n 
A 1 33  THR 33  619 619 THR THR A . n 
A 1 34  ASN 34  620 620 ASN ASN A . n 
A 1 35  ILE 35  621 621 ILE ILE A . n 
A 1 36  SER 36  622 622 SER SER A . n 
A 1 37  ILE 37  623 623 ILE ILE A . n 
A 1 38  ASP 38  624 624 ASP ASP A . n 
A 1 39  LYS 39  625 625 LYS LYS A . n 
A 1 40  VAL 40  626 626 VAL VAL A . n 
A 1 41  VAL 41  627 627 VAL VAL A . n 
A 1 42  GLY 42  628 628 GLY GLY A . n 
A 1 43  ALA 43  629 629 ALA ALA A . n 
A 1 44  GLY 44  630 630 GLY GLY A . n 
A 1 45  GLU 45  631 631 GLU GLU A . n 
A 1 46  PHE 46  632 632 PHE PHE A . n 
A 1 47  GLY 47  633 633 GLY GLY A . n 
A 1 48  GLU 48  634 634 GLU GLU A . n 
A 1 49  VAL 49  635 635 VAL VAL A . n 
A 1 50  CYS 50  636 636 CYS CYS A . n 
A 1 51  SER 51  637 637 SER SER A . n 
A 1 52  GLY 52  638 638 GLY GLY A . n 
A 1 53  ARG 53  639 639 ARG ARG A . n 
A 1 54  LEU 54  640 640 LEU LEU A . n 
A 1 55  LYS 55  641 641 LYS LYS A . n 
A 1 56  LEU 56  642 642 LEU LEU A . n 
A 1 57  PRO 57  643 643 PRO PRO A . n 
A 1 58  SER 58  644 644 SER SER A . n 
A 1 59  LYS 59  645 645 LYS LYS A . n 
A 1 60  LYS 60  646 646 LYS LYS A . n 
A 1 61  GLU 61  647 647 GLU GLU A . n 
A 1 62  ILE 62  648 648 ILE ILE A . n 
A 1 63  SER 63  649 649 SER SER A . n 
A 1 64  VAL 64  650 650 VAL VAL A . n 
A 1 65  ALA 65  651 651 ALA ALA A . n 
A 1 66  ILE 66  652 652 ILE ILE A . n 
A 1 67  LYS 67  653 653 LYS LYS A . n 
A 1 68  THR 68  654 654 THR THR A . n 
A 1 69  LEU 69  655 655 LEU LEU A . n 
A 1 70  LYS 70  656 656 LYS LYS A . n 
A 1 71  VAL 71  657 657 VAL VAL A . n 
A 1 72  GLY 72  658 658 GLY GLY A . n 
A 1 73  TYR 73  659 659 TYR TYR A . n 
A 1 74  THR 74  660 660 THR THR A . n 
A 1 75  GLU 75  661 661 GLU GLU A . n 
A 1 76  LYS 76  662 662 LYS LYS A . n 
A 1 77  GLN 77  663 663 GLN GLN A . n 
A 1 78  ARG 78  664 664 ARG ARG A . n 
A 1 79  ARG 79  665 665 ARG ARG A . n 
A 1 80  ASP 80  666 666 ASP ASP A . n 
A 1 81  PHE 81  667 667 PHE PHE A . n 
A 1 82  LEU 82  668 668 LEU LEU A . n 
A 1 83  GLY 83  669 669 GLY GLY A . n 
A 1 84  GLU 84  670 670 GLU GLU A . n 
A 1 85  ALA 85  671 671 ALA ALA A . n 
A 1 86  SER 86  672 672 SER SER A . n 
A 1 87  ILE 87  673 673 ILE ILE A . n 
A 1 88  MET 88  674 674 MET MET A . n 
A 1 89  GLY 89  675 675 GLY GLY A . n 
A 1 90  GLN 90  676 676 GLN GLN A . n 
A 1 91  PHE 91  677 677 PHE PHE A . n 
A 1 92  ASP 92  678 678 ASP ASP A . n 
A 1 93  HIS 93  679 679 HIS HIS A . n 
A 1 94  PRO 94  680 680 PRO PRO A . n 
A 1 95  ASN 95  681 681 ASN ASN A . n 
A 1 96  ILE 96  682 682 ILE ILE A . n 
A 1 97  ILE 97  683 683 ILE ILE A . n 
A 1 98  ARG 98  684 684 ARG ARG A . n 
A 1 99  LEU 99  685 685 LEU LEU A . n 
A 1 100 GLU 100 686 686 GLU GLU A . n 
A 1 101 GLY 101 687 687 GLY GLY A . n 
A 1 102 VAL 102 688 688 VAL VAL A . n 
A 1 103 VAL 103 689 689 VAL VAL A . n 
A 1 104 THR 104 690 690 THR THR A . n 
A 1 105 LYS 105 691 691 LYS LYS A . n 
A 1 106 SER 106 692 692 SER SER A . n 
A 1 107 LYS 107 693 693 LYS LYS A . n 
A 1 108 PRO 108 694 694 PRO PRO A . n 
A 1 109 VAL 109 695 695 VAL VAL A . n 
A 1 110 MET 110 696 696 MET MET A . n 
A 1 111 ILE 111 697 697 ILE ILE A . n 
A 1 112 VAL 112 698 698 VAL VAL A . n 
A 1 113 THR 113 699 699 THR THR A . n 
A 1 114 GLU 114 700 700 GLU GLU A . n 
A 1 115 TYR 115 701 701 TYR TYR A . n 
A 1 116 MET 116 702 702 MET MET A . n 
A 1 117 GLU 117 703 703 GLU GLU A . n 
A 1 118 ASN 118 704 704 ASN ASN A . n 
A 1 119 GLY 119 705 705 GLY GLY A . n 
A 1 120 SER 120 706 706 SER SER A . n 
A 1 121 LEU 121 707 707 LEU LEU A . n 
A 1 122 ASP 122 708 708 ASP ASP A . n 
A 1 123 SER 123 709 709 SER SER A . n 
A 1 124 PHE 124 710 710 PHE PHE A . n 
A 1 125 LEU 125 711 711 LEU LEU A . n 
A 1 126 ARG 126 712 712 ARG ARG A . n 
A 1 127 LYS 127 713 713 LYS LYS A . n 
A 1 128 HIS 128 714 714 HIS HIS A . n 
A 1 129 ASP 129 715 715 ASP ASP A . n 
A 1 130 ALA 130 716 716 ALA ALA A . n 
A 1 131 GLN 131 717 717 GLN GLN A . n 
A 1 132 PHE 132 718 718 PHE PHE A . n 
A 1 133 THR 133 719 719 THR THR A . n 
A 1 134 VAL 134 720 720 VAL VAL A . n 
A 1 135 ILE 135 721 721 ILE ILE A . n 
A 1 136 GLN 136 722 722 GLN GLN A . n 
A 1 137 LEU 137 723 723 LEU LEU A . n 
A 1 138 VAL 138 724 724 VAL VAL A . n 
A 1 139 GLY 139 725 725 GLY GLY A . n 
A 1 140 MET 140 726 726 MET MET A . n 
A 1 141 LEU 141 727 727 LEU LEU A . n 
A 1 142 ARG 142 728 728 ARG ARG A . n 
A 1 143 GLY 143 729 729 GLY GLY A . n 
A 1 144 ILE 144 730 730 ILE ILE A . n 
A 1 145 ALA 145 731 731 ALA ALA A . n 
A 1 146 SER 146 732 732 SER SER A . n 
A 1 147 GLY 147 733 733 GLY GLY A . n 
A 1 148 MET 148 734 734 MET MET A . n 
A 1 149 LYS 149 735 735 LYS LYS A . n 
A 1 150 TYR 150 736 736 TYR TYR A . n 
A 1 151 LEU 151 737 737 LEU LEU A . n 
A 1 152 SER 152 738 738 SER SER A . n 
A 1 153 ASP 153 739 739 ASP ASP A . n 
A 1 154 MET 154 740 740 MET MET A . n 
A 1 155 GLY 155 741 741 GLY GLY A . n 
A 1 156 TYR 156 742 742 TYR TYR A . n 
A 1 157 VAL 157 743 743 VAL VAL A . n 
A 1 158 HIS 158 744 744 HIS HIS A . n 
A 1 159 ARG 159 745 745 ARG ARG A . n 
A 1 160 ASP 160 746 746 ASP ASP A . n 
A 1 161 LEU 161 747 747 LEU LEU A . n 
A 1 162 ALA 162 748 748 ALA ALA A . n 
A 1 163 ALA 163 749 749 ALA ALA A . n 
A 1 164 ARG 164 750 750 ARG ARG A . n 
A 1 165 ASN 165 751 751 ASN ASN A . n 
A 1 166 ILE 166 752 752 ILE ILE A . n 
A 1 167 LEU 167 753 753 LEU LEU A . n 
A 1 168 ILE 168 754 754 ILE ILE A . n 
A 1 169 ASN 169 755 755 ASN ASN A . n 
A 1 170 SER 170 756 756 SER SER A . n 
A 1 171 ASN 171 757 757 ASN ASN A . n 
A 1 172 LEU 172 758 758 LEU LEU A . n 
A 1 173 VAL 173 759 759 VAL VAL A . n 
A 1 174 CYS 174 760 760 CYS CYS A . n 
A 1 175 LYS 175 761 761 LYS LYS A . n 
A 1 176 VAL 176 762 762 VAL VAL A . n 
A 1 177 SER 177 763 763 SER SER A . n 
A 1 178 ASP 178 764 764 ASP ASP A . n 
A 1 179 PHE 179 765 765 PHE PHE A . n 
A 1 180 GLY 180 766 766 GLY GLY A . n 
A 1 181 LEU 181 767 767 LEU LEU A . n 
A 1 182 SER 182 768 768 SER SER A . n 
A 1 183 ARG 183 769 769 ARG ARG A . n 
A 1 184 VAL 184 770 ?   ?   ?   A . n 
A 1 185 LEU 185 771 ?   ?   ?   A . n 
A 1 186 GLU 186 772 ?   ?   ?   A . n 
A 1 187 ASP 187 773 ?   ?   ?   A . n 
A 1 188 ASP 188 774 ?   ?   ?   A . n 
A 1 189 PRO 189 775 ?   ?   ?   A . n 
A 1 190 GLU 190 776 ?   ?   ?   A . n 
A 1 191 ALA 191 777 ?   ?   ?   A . n 
A 1 192 ALA 192 778 ?   ?   ?   A . n 
A 1 193 TYR 193 779 ?   ?   ?   A . n 
A 1 194 THR 194 780 ?   ?   ?   A . n 
A 1 195 THR 195 781 ?   ?   ?   A . n 
A 1 196 ARG 196 782 ?   ?   ?   A . n 
A 1 197 GLY 197 783 ?   ?   ?   A . n 
A 1 198 GLY 198 784 ?   ?   ?   A . n 
A 1 199 LYS 199 785 ?   ?   ?   A . n 
A 1 200 ILE 200 786 786 ILE ILE A . n 
A 1 201 PRO 201 787 787 PRO PRO A . n 
A 1 202 ILE 202 788 788 ILE ILE A . n 
A 1 203 ARG 203 789 789 ARG ARG A . n 
A 1 204 TRP 204 790 790 TRP TRP A . n 
A 1 205 THR 205 791 791 THR THR A . n 
A 1 206 SER 206 792 792 SER SER A . n 
A 1 207 PRO 207 793 793 PRO PRO A . n 
A 1 208 GLU 208 794 794 GLU GLU A . n 
A 1 209 ALA 209 795 795 ALA ALA A . n 
A 1 210 ILE 210 796 796 ILE ILE A . n 
A 1 211 ALA 211 797 797 ALA ALA A . n 
A 1 212 TYR 212 798 798 TYR TYR A . n 
A 1 213 ARG 213 799 799 ARG ARG A . n 
A 1 214 LYS 214 800 800 LYS LYS A . n 
A 1 215 PHE 215 801 801 PHE PHE A . n 
A 1 216 THR 216 802 802 THR THR A . n 
A 1 217 SER 217 803 803 SER SER A . n 
A 1 218 ALA 218 804 804 ALA ALA A . n 
A 1 219 SER 219 805 805 SER SER A . n 
A 1 220 ASP 220 806 806 ASP ASP A . n 
A 1 221 VAL 221 807 807 VAL VAL A . n 
A 1 222 TRP 222 808 808 TRP TRP A . n 
A 1 223 SER 223 809 809 SER SER A . n 
A 1 224 TYR 224 810 810 TYR TYR A . n 
A 1 225 GLY 225 811 811 GLY GLY A . n 
A 1 226 ILE 226 812 812 ILE ILE A . n 
A 1 227 VAL 227 813 813 VAL VAL A . n 
A 1 228 LEU 228 814 814 LEU LEU A . n 
A 1 229 TRP 229 815 815 TRP TRP A . n 
A 1 230 GLU 230 816 816 GLU GLU A . n 
A 1 231 VAL 231 817 817 VAL VAL A . n 
A 1 232 MET 232 818 818 MET MET A . n 
A 1 233 SER 233 819 819 SER SER A . n 
A 1 234 TYR 234 820 820 TYR TYR A . n 
A 1 235 GLY 235 821 821 GLY GLY A . n 
A 1 236 GLU 236 822 822 GLU GLU A . n 
A 1 237 ARG 237 823 823 ARG ARG A . n 
A 1 238 PRO 238 824 824 PRO PRO A . n 
A 1 239 TYR 239 825 825 TYR TYR A . n 
A 1 240 TRP 240 826 826 TRP TRP A . n 
A 1 241 GLU 241 827 827 GLU GLU A . n 
A 1 242 MET 242 828 828 MET MET A . n 
A 1 243 SER 243 829 829 SER SER A . n 
A 1 244 ASN 244 830 830 ASN ASN A . n 
A 1 245 GLN 245 831 831 GLN GLN A . n 
A 1 246 ASP 246 832 832 ASP ASP A . n 
A 1 247 VAL 247 833 833 VAL VAL A . n 
A 1 248 ILE 248 834 834 ILE ILE A . n 
A 1 249 LYS 249 835 835 LYS LYS A . n 
A 1 250 ALA 250 836 836 ALA ALA A . n 
A 1 251 VAL 251 837 837 VAL VAL A . n 
A 1 252 ASP 252 838 838 ASP ASP A . n 
A 1 253 GLU 253 839 839 GLU GLU A . n 
A 1 254 GLY 254 840 840 GLY GLY A . n 
A 1 255 TYR 255 841 841 TYR TYR A . n 
A 1 256 ARG 256 842 842 ARG ARG A . n 
A 1 257 LEU 257 843 843 LEU LEU A . n 
A 1 258 PRO 258 844 844 PRO PRO A . n 
A 1 259 PRO 259 845 845 PRO PRO A . n 
A 1 260 PRO 260 846 846 PRO PRO A . n 
A 1 261 MET 261 847 847 MET MET A . n 
A 1 262 ASP 262 848 848 ASP ASP A . n 
A 1 263 CYS 263 849 849 CYS CYS A . n 
A 1 264 PRO 264 850 850 PRO PRO A . n 
A 1 265 ALA 265 851 851 ALA ALA A . n 
A 1 266 ALA 266 852 852 ALA ALA A . n 
A 1 267 LEU 267 853 853 LEU LEU A . n 
A 1 268 TYR 268 854 854 TYR TYR A . n 
A 1 269 GLN 269 855 855 GLN GLN A . n 
A 1 270 LEU 270 856 856 LEU LEU A . n 
A 1 271 MET 271 857 857 MET MET A . n 
A 1 272 LEU 272 858 858 LEU LEU A . n 
A 1 273 ASP 273 859 859 ASP ASP A . n 
A 1 274 CYS 274 860 860 CYS CYS A . n 
A 1 275 TRP 275 861 861 TRP TRP A . n 
A 1 276 GLN 276 862 862 GLN GLN A . n 
A 1 277 LYS 277 863 863 LYS LYS A . n 
A 1 278 ASP 278 864 864 ASP ASP A . n 
A 1 279 ARG 279 865 865 ARG ARG A . n 
A 1 280 ASN 280 866 866 ASN ASN A . n 
A 1 281 ASN 281 867 867 ASN ASN A . n 
A 1 282 ARG 282 868 868 ARG ARG A . n 
A 1 283 PRO 283 869 869 PRO PRO A . n 
A 1 284 LYS 284 870 870 LYS LYS A . n 
A 1 285 PHE 285 871 871 PHE PHE A . n 
A 1 286 GLU 286 872 872 GLU GLU A . n 
A 1 287 GLN 287 873 873 GLN GLN A . n 
A 1 288 ILE 288 874 874 ILE ILE A . n 
A 1 289 VAL 289 875 875 VAL VAL A . n 
A 1 290 SER 290 876 876 SER SER A . n 
A 1 291 ILE 291 877 877 ILE ILE A . n 
A 1 292 LEU 292 878 878 LEU LEU A . n 
A 1 293 ASP 293 879 879 ASP ASP A . n 
A 1 294 LYS 294 880 880 LYS LYS A . n 
A 1 295 LEU 295 881 881 LEU LEU A . n 
A 1 296 ILE 296 882 882 ILE ILE A . n 
A 1 297 ARG 297 883 883 ARG ARG A . n 
A 1 298 ASN 298 884 884 ASN ASN A . n 
A 1 299 PRO 299 885 885 PRO PRO A . n 
A 1 300 GLY 300 886 886 GLY GLY A . n 
A 1 301 SER 301 887 887 SER SER A . n 
A 1 302 LEU 302 888 888 LEU LEU A . n 
A 1 303 LYS 303 889 889 LYS LYS A . n 
A 1 304 ILE 304 890 890 ILE ILE A . n 
A 1 305 ILE 305 891 891 ILE ILE A . n 
A 1 306 THR 306 892 892 THR THR A . n 
A 1 307 SER 307 893 ?   ?   ?   A . n 
A 1 308 ALA 308 894 ?   ?   ?   A . n 
A 1 309 ALA 309 895 ?   ?   ?   A . n 
A 1 310 ALA 310 896 ?   ?   ?   A . n 
A 1 311 ARG 311 897 ?   ?   ?   A . n 
A 1 312 PRO 312 898 898 PRO PRO A . n 
A 1 313 SER 313 899 899 SER SER A . n 
A 1 314 ASN 314 900 900 ASN ASN A . n 
A 1 315 LEU 315 901 901 LEU LEU A . n 
A 1 316 LEU 316 902 902 LEU LEU A . n 
A 1 317 LEU 317 903 903 LEU LEU A . n 
A 1 318 ASP 318 904 904 ASP ASP A . n 
A 1 319 GLN 319 905 ?   ?   ?   A . n 
A 1 320 SER 320 906 ?   ?   ?   A . n 
A 1 321 ASN 321 907 ?   ?   ?   A . n 
A 1 322 VAL 322 908 ?   ?   ?   A . n 
A 1 323 ASP 323 909 ?   ?   ?   A . n 
A 1 324 ILE 324 910 ?   ?   ?   A . n 
A 1 325 THR 325 911 ?   ?   ?   A . n 
A 1 326 THR 326 912 ?   ?   ?   A . n 
A 1 327 PHE 327 913 ?   ?   ?   A . n 
A 1 328 ARG 328 914 ?   ?   ?   A . n 
A 1 329 THR 329 915 ?   ?   ?   A . n 
A 1 330 THR 330 916 ?   ?   ?   A . n 
A 1 331 GLY 331 917 ?   ?   ?   A . n 
A 1 332 ASP 332 918 ?   ?   ?   A . n 
A 1 333 TRP 333 919 ?   ?   ?   A . n 
A 1 334 LEU 334 920 ?   ?   ?   A . n 
A 1 335 ASN 335 921 ?   ?   ?   A . n 
A 1 336 GLY 336 922 ?   ?   ?   A . n 
A 1 337 VAL 337 923 ?   ?   ?   A . n 
A 1 338 TRP 338 924 ?   ?   ?   A . n 
A 1 339 THR 339 925 ?   ?   ?   A . n 
A 1 340 ALA 340 926 ?   ?   ?   A . n 
A 1 341 HIS 341 927 ?   ?   ?   A . n 
A 1 342 CYS 342 928 ?   ?   ?   A . n 
A 1 343 LYS 343 929 ?   ?   ?   A . n 
A 1 344 GLU 344 930 ?   ?   ?   A . n 
A 1 345 ILE 345 931 ?   ?   ?   A . n 
A 1 346 PHE 346 932 ?   ?   ?   A . n 
A 1 347 THR 347 933 ?   ?   ?   A . n 
A 1 348 GLY 348 934 ?   ?   ?   A . n 
A 1 349 VAL 349 935 ?   ?   ?   A . n 
A 1 350 GLU 350 936 ?   ?   ?   A . n 
A 1 351 TYR 351 937 ?   ?   ?   A . n 
A 1 352 SER 352 938 ?   ?   ?   A . n 
A 1 353 SER 353 939 ?   ?   ?   A . n 
A 1 354 CYS 354 940 ?   ?   ?   A . n 
A 1 355 ASP 355 941 ?   ?   ?   A . n 
A 1 356 THR 356 942 ?   ?   ?   A . n 
A 1 357 ILE 357 943 ?   ?   ?   A . n 
A 1 358 ALA 358 944 ?   ?   ?   A . n 
A 1 359 LYS 359 945 ?   ?   ?   A . n 
A 1 360 ILE 360 946 ?   ?   ?   A . n 
A 1 361 SER 361 947 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 Q0B 1   1001 1   Q0B Q0B A . 
C 3 HOH 1   1101 163 HOH HOH A . 
C 3 HOH 2   1102 174 HOH HOH A . 
C 3 HOH 3   1103 74  HOH HOH A . 
C 3 HOH 4   1104 122 HOH HOH A . 
C 3 HOH 5   1105 160 HOH HOH A . 
C 3 HOH 6   1106 110 HOH HOH A . 
C 3 HOH 7   1107 153 HOH HOH A . 
C 3 HOH 8   1108 225 HOH HOH A . 
C 3 HOH 9   1109 125 HOH HOH A . 
C 3 HOH 10  1110 138 HOH HOH A . 
C 3 HOH 11  1111 185 HOH HOH A . 
C 3 HOH 12  1112 36  HOH HOH A . 
C 3 HOH 13  1113 47  HOH HOH A . 
C 3 HOH 14  1114 221 HOH HOH A . 
C 3 HOH 15  1115 184 HOH HOH A . 
C 3 HOH 16  1116 84  HOH HOH A . 
C 3 HOH 17  1117 25  HOH HOH A . 
C 3 HOH 18  1118 119 HOH HOH A . 
C 3 HOH 19  1119 131 HOH HOH A . 
C 3 HOH 20  1120 20  HOH HOH A . 
C 3 HOH 21  1121 13  HOH HOH A . 
C 3 HOH 22  1122 51  HOH HOH A . 
C 3 HOH 23  1123 62  HOH HOH A . 
C 3 HOH 24  1124 166 HOH HOH A . 
C 3 HOH 25  1125 53  HOH HOH A . 
C 3 HOH 26  1126 94  HOH HOH A . 
C 3 HOH 27  1127 85  HOH HOH A . 
C 3 HOH 28  1128 16  HOH HOH A . 
C 3 HOH 29  1129 39  HOH HOH A . 
C 3 HOH 30  1130 56  HOH HOH A . 
C 3 HOH 31  1131 123 HOH HOH A . 
C 3 HOH 32  1132 86  HOH HOH A . 
C 3 HOH 33  1133 255 HOH HOH A . 
C 3 HOH 34  1134 170 HOH HOH A . 
C 3 HOH 35  1135 232 HOH HOH A . 
C 3 HOH 36  1136 76  HOH HOH A . 
C 3 HOH 37  1137 126 HOH HOH A . 
C 3 HOH 38  1138 262 HOH HOH A . 
C 3 HOH 39  1139 178 HOH HOH A . 
C 3 HOH 40  1140 246 HOH HOH A . 
C 3 HOH 41  1141 90  HOH HOH A . 
C 3 HOH 42  1142 75  HOH HOH A . 
C 3 HOH 43  1143 140 HOH HOH A . 
C 3 HOH 44  1144 57  HOH HOH A . 
C 3 HOH 45  1145 124 HOH HOH A . 
C 3 HOH 46  1146 108 HOH HOH A . 
C 3 HOH 47  1147 37  HOH HOH A . 
C 3 HOH 48  1148 102 HOH HOH A . 
C 3 HOH 49  1149 17  HOH HOH A . 
C 3 HOH 50  1150 224 HOH HOH A . 
C 3 HOH 51  1151 58  HOH HOH A . 
C 3 HOH 52  1152 14  HOH HOH A . 
C 3 HOH 53  1153 28  HOH HOH A . 
C 3 HOH 54  1154 132 HOH HOH A . 
C 3 HOH 55  1155 106 HOH HOH A . 
C 3 HOH 56  1156 133 HOH HOH A . 
C 3 HOH 57  1157 40  HOH HOH A . 
C 3 HOH 58  1158 95  HOH HOH A . 
C 3 HOH 59  1159 98  HOH HOH A . 
C 3 HOH 60  1160 45  HOH HOH A . 
C 3 HOH 61  1161 65  HOH HOH A . 
C 3 HOH 62  1162 78  HOH HOH A . 
C 3 HOH 63  1163 87  HOH HOH A . 
C 3 HOH 64  1164 176 HOH HOH A . 
C 3 HOH 65  1165 23  HOH HOH A . 
C 3 HOH 66  1166 60  HOH HOH A . 
C 3 HOH 67  1167 141 HOH HOH A . 
C 3 HOH 68  1168 202 HOH HOH A . 
C 3 HOH 69  1169 54  HOH HOH A . 
C 3 HOH 70  1170 242 HOH HOH A . 
C 3 HOH 71  1171 158 HOH HOH A . 
C 3 HOH 72  1172 230 HOH HOH A . 
C 3 HOH 73  1173 44  HOH HOH A . 
C 3 HOH 74  1174 61  HOH HOH A . 
C 3 HOH 75  1175 120 HOH HOH A . 
C 3 HOH 76  1176 104 HOH HOH A . 
C 3 HOH 77  1177 165 HOH HOH A . 
C 3 HOH 78  1178 59  HOH HOH A . 
C 3 HOH 79  1179 168 HOH HOH A . 
C 3 HOH 80  1180 103 HOH HOH A . 
C 3 HOH 81  1181 193 HOH HOH A . 
C 3 HOH 82  1182 243 HOH HOH A . 
C 3 HOH 83  1183 32  HOH HOH A . 
C 3 HOH 84  1184 216 HOH HOH A . 
C 3 HOH 85  1185 159 HOH HOH A . 
C 3 HOH 86  1186 229 HOH HOH A . 
C 3 HOH 87  1187 200 HOH HOH A . 
C 3 HOH 88  1188 137 HOH HOH A . 
C 3 HOH 89  1189 180 HOH HOH A . 
C 3 HOH 90  1190 250 HOH HOH A . 
C 3 HOH 91  1191 162 HOH HOH A . 
C 3 HOH 92  1192 240 HOH HOH A . 
C 3 HOH 93  1193 204 HOH HOH A . 
C 3 HOH 94  1194 241 HOH HOH A . 
C 3 HOH 95  1195 233 HOH HOH A . 
C 3 HOH 96  1196 145 HOH HOH A . 
C 3 HOH 97  1197 115 HOH HOH A . 
C 3 HOH 98  1198 81  HOH HOH A . 
C 3 HOH 99  1199 151 HOH HOH A . 
C 3 HOH 100 1200 99  HOH HOH A . 
C 3 HOH 101 1201 197 HOH HOH A . 
C 3 HOH 102 1202 207 HOH HOH A . 
C 3 HOH 103 1203 213 HOH HOH A . 
C 3 HOH 104 1204 191 HOH HOH A . 
C 3 HOH 105 1205 219 HOH HOH A . 
C 3 HOH 106 1206 116 HOH HOH A . 
C 3 HOH 107 1207 70  HOH HOH A . 
C 3 HOH 108 1208 19  HOH HOH A . 
C 3 HOH 109 1209 244 HOH HOH A . 
C 3 HOH 110 1210 256 HOH HOH A . 
C 3 HOH 111 1211 254 HOH HOH A . 
C 3 HOH 112 1212 222 HOH HOH A . 
C 3 HOH 113 1213 226 HOH HOH A . 
C 3 HOH 114 1214 155 HOH HOH A . 
C 3 HOH 115 1215 167 HOH HOH A . 
C 3 HOH 116 1216 217 HOH HOH A . 
C 3 HOH 117 1217 259 HOH HOH A . 
C 3 HOH 118 1218 1   HOH HOH A . 
C 3 HOH 119 1219 2   HOH HOH A . 
C 3 HOH 120 1220 3   HOH HOH A . 
C 3 HOH 121 1221 4   HOH HOH A . 
C 3 HOH 122 1222 5   HOH HOH A . 
C 3 HOH 123 1223 6   HOH HOH A . 
C 3 HOH 124 1224 7   HOH HOH A . 
C 3 HOH 125 1225 8   HOH HOH A . 
C 3 HOH 126 1226 9   HOH HOH A . 
C 3 HOH 127 1227 10  HOH HOH A . 
C 3 HOH 128 1228 11  HOH HOH A . 
C 3 HOH 129 1229 12  HOH HOH A . 
C 3 HOH 130 1230 15  HOH HOH A . 
C 3 HOH 131 1231 18  HOH HOH A . 
C 3 HOH 132 1232 21  HOH HOH A . 
C 3 HOH 133 1233 22  HOH HOH A . 
C 3 HOH 134 1234 24  HOH HOH A . 
C 3 HOH 135 1235 26  HOH HOH A . 
C 3 HOH 136 1236 27  HOH HOH A . 
C 3 HOH 137 1237 29  HOH HOH A . 
C 3 HOH 138 1238 30  HOH HOH A . 
C 3 HOH 139 1239 31  HOH HOH A . 
C 3 HOH 140 1240 33  HOH HOH A . 
C 3 HOH 141 1241 34  HOH HOH A . 
C 3 HOH 142 1242 35  HOH HOH A . 
C 3 HOH 143 1243 38  HOH HOH A . 
C 3 HOH 144 1244 41  HOH HOH A . 
C 3 HOH 145 1245 42  HOH HOH A . 
C 3 HOH 146 1246 43  HOH HOH A . 
C 3 HOH 147 1247 46  HOH HOH A . 
C 3 HOH 148 1248 48  HOH HOH A . 
C 3 HOH 149 1249 49  HOH HOH A . 
C 3 HOH 150 1250 50  HOH HOH A . 
C 3 HOH 151 1251 52  HOH HOH A . 
C 3 HOH 152 1252 55  HOH HOH A . 
C 3 HOH 153 1253 63  HOH HOH A . 
C 3 HOH 154 1254 64  HOH HOH A . 
C 3 HOH 155 1255 66  HOH HOH A . 
C 3 HOH 156 1256 67  HOH HOH A . 
C 3 HOH 157 1257 68  HOH HOH A . 
C 3 HOH 158 1258 69  HOH HOH A . 
C 3 HOH 159 1259 71  HOH HOH A . 
C 3 HOH 160 1260 72  HOH HOH A . 
C 3 HOH 161 1261 73  HOH HOH A . 
C 3 HOH 162 1262 77  HOH HOH A . 
C 3 HOH 163 1263 79  HOH HOH A . 
C 3 HOH 164 1264 80  HOH HOH A . 
C 3 HOH 165 1265 82  HOH HOH A . 
C 3 HOH 166 1266 83  HOH HOH A . 
C 3 HOH 167 1267 88  HOH HOH A . 
C 3 HOH 168 1268 89  HOH HOH A . 
C 3 HOH 169 1269 91  HOH HOH A . 
C 3 HOH 170 1270 92  HOH HOH A . 
C 3 HOH 171 1271 93  HOH HOH A . 
C 3 HOH 172 1272 96  HOH HOH A . 
C 3 HOH 173 1273 97  HOH HOH A . 
C 3 HOH 174 1274 100 HOH HOH A . 
C 3 HOH 175 1275 101 HOH HOH A . 
C 3 HOH 176 1276 105 HOH HOH A . 
C 3 HOH 177 1277 107 HOH HOH A . 
C 3 HOH 178 1278 109 HOH HOH A . 
C 3 HOH 179 1279 111 HOH HOH A . 
C 3 HOH 180 1280 112 HOH HOH A . 
C 3 HOH 181 1281 113 HOH HOH A . 
C 3 HOH 182 1282 114 HOH HOH A . 
C 3 HOH 183 1283 117 HOH HOH A . 
C 3 HOH 184 1284 118 HOH HOH A . 
C 3 HOH 185 1285 121 HOH HOH A . 
C 3 HOH 186 1286 127 HOH HOH A . 
C 3 HOH 187 1287 128 HOH HOH A . 
C 3 HOH 188 1288 129 HOH HOH A . 
C 3 HOH 189 1289 130 HOH HOH A . 
C 3 HOH 190 1290 134 HOH HOH A . 
C 3 HOH 191 1291 135 HOH HOH A . 
C 3 HOH 192 1292 136 HOH HOH A . 
C 3 HOH 193 1293 139 HOH HOH A . 
C 3 HOH 194 1294 142 HOH HOH A . 
C 3 HOH 195 1295 143 HOH HOH A . 
C 3 HOH 196 1296 144 HOH HOH A . 
C 3 HOH 197 1297 146 HOH HOH A . 
C 3 HOH 198 1298 147 HOH HOH A . 
C 3 HOH 199 1299 148 HOH HOH A . 
C 3 HOH 200 1300 149 HOH HOH A . 
C 3 HOH 201 1301 150 HOH HOH A . 
C 3 HOH 202 1302 152 HOH HOH A . 
C 3 HOH 203 1303 154 HOH HOH A . 
C 3 HOH 204 1304 156 HOH HOH A . 
C 3 HOH 205 1305 157 HOH HOH A . 
C 3 HOH 206 1306 161 HOH HOH A . 
C 3 HOH 207 1307 164 HOH HOH A . 
C 3 HOH 208 1308 169 HOH HOH A . 
C 3 HOH 209 1309 171 HOH HOH A . 
C 3 HOH 210 1310 172 HOH HOH A . 
C 3 HOH 211 1311 173 HOH HOH A . 
C 3 HOH 212 1312 175 HOH HOH A . 
C 3 HOH 213 1313 177 HOH HOH A . 
C 3 HOH 214 1314 179 HOH HOH A . 
C 3 HOH 215 1315 181 HOH HOH A . 
C 3 HOH 216 1316 182 HOH HOH A . 
C 3 HOH 217 1317 183 HOH HOH A . 
C 3 HOH 218 1318 186 HOH HOH A . 
C 3 HOH 219 1319 187 HOH HOH A . 
C 3 HOH 220 1320 188 HOH HOH A . 
C 3 HOH 221 1321 189 HOH HOH A . 
C 3 HOH 222 1322 190 HOH HOH A . 
C 3 HOH 223 1323 192 HOH HOH A . 
C 3 HOH 224 1324 194 HOH HOH A . 
C 3 HOH 225 1325 195 HOH HOH A . 
C 3 HOH 226 1326 196 HOH HOH A . 
C 3 HOH 227 1327 198 HOH HOH A . 
C 3 HOH 228 1328 199 HOH HOH A . 
C 3 HOH 229 1329 201 HOH HOH A . 
C 3 HOH 230 1330 203 HOH HOH A . 
C 3 HOH 231 1331 205 HOH HOH A . 
C 3 HOH 232 1332 206 HOH HOH A . 
C 3 HOH 233 1333 208 HOH HOH A . 
C 3 HOH 234 1334 209 HOH HOH A . 
C 3 HOH 235 1335 210 HOH HOH A . 
C 3 HOH 236 1336 211 HOH HOH A . 
C 3 HOH 237 1337 212 HOH HOH A . 
C 3 HOH 238 1338 214 HOH HOH A . 
C 3 HOH 239 1339 215 HOH HOH A . 
C 3 HOH 240 1340 218 HOH HOH A . 
C 3 HOH 241 1341 220 HOH HOH A . 
C 3 HOH 242 1342 223 HOH HOH A . 
C 3 HOH 243 1343 227 HOH HOH A . 
C 3 HOH 244 1344 228 HOH HOH A . 
C 3 HOH 245 1345 231 HOH HOH A . 
C 3 HOH 246 1346 234 HOH HOH A . 
C 3 HOH 247 1347 235 HOH HOH A . 
C 3 HOH 248 1348 236 HOH HOH A . 
C 3 HOH 249 1349 237 HOH HOH A . 
C 3 HOH 250 1350 238 HOH HOH A . 
C 3 HOH 251 1351 239 HOH HOH A . 
C 3 HOH 252 1352 245 HOH HOH A . 
C 3 HOH 253 1353 247 HOH HOH A . 
C 3 HOH 254 1354 248 HOH HOH A . 
C 3 HOH 255 1355 249 HOH HOH A . 
C 3 HOH 256 1356 251 HOH HOH A . 
C 3 HOH 257 1357 252 HOH HOH A . 
C 3 HOH 258 1358 253 HOH HOH A . 
C 3 HOH 259 1359 257 HOH HOH A . 
C 3 HOH 260 1360 258 HOH HOH A . 
C 3 HOH 261 1361 260 HOH HOH A . 
C 3 HOH 262 1362 261 HOH HOH A . 
C 3 HOH 263 1363 263 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   Monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0     ? 
1 MORE         0     ? 
1 'SSA (A^2)'  13170 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-08-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       . . . . . . . . . . . PHENIX  . . . '(phenix.refine: 1.8.4_1496)'             1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? 'VERSION January 10, 2014 BUILT=20140115' 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 'VESION: 0.2.17'                          3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? 2.5.6                                     4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 1171 ? ? O A HOH 1329 ? ? 1.98 
2 1 O   A HOH 1312 ? ? O A HOH 1316 ? ? 2.00 
3 1 O   A HOH 1312 ? ? O A HOH 1318 ? ? 2.04 
4 1 O   A HOH 1312 ? ? O A HOH 1317 ? ? 2.06 
5 1 NH1 A ARG 769  ? ? O A HOH 1282 ? ? 2.15 
6 1 O   A HOH 1245 ? ? O A HOH 1305 ? ? 2.16 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     1201 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     1203 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_454 
_pdbx_validate_symm_contact.dist              2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 624 ? ? CG A ASP 624 ? ? OD2 A ASP 624 ? ? 123.89 118.30 5.59 0.90 N 
2 1 CB A ASP 904 ? ? CG A ASP 904 ? ? OD1 A ASP 904 ? ? 124.14 118.30 5.84 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 645 ? ? 82.11   -8.51   
2 1 ARG A 745 ? ? 71.58   -8.33   
3 1 ASP A 764 ? ? 65.28   76.17   
4 1 ASP A 764 ? ? 65.75   76.17   
5 1 PHE A 765 ? ? -99.61  30.73   
6 1 TYR A 798 ? ? -151.29 33.19   
7 1 TRP A 826 ? ? 48.54   -128.54 
8 1 TRP A 826 ? ? 48.54   -128.90 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    903 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    904 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -141.31 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       1360 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.91 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
_pdbx_distant_solvent_atoms.label_comp_id                     ? 
_pdbx_distant_solvent_atoms.label_asym_id                     ? 
_pdbx_distant_solvent_atoms.label_seq_id                      ? 
_pdbx_distant_solvent_atoms.label_atom_id                     ? 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 767 ? CB  ? A LEU 181 CB  
2  1 Y 1 A LEU 767 ? CG  ? A LEU 181 CG  
3  1 Y 1 A LEU 767 ? CD1 ? A LEU 181 CD1 
4  1 Y 1 A LEU 767 ? CD2 ? A LEU 181 CD2 
5  1 Y 1 A SER 768 ? CB  ? A SER 182 CB  
6  1 Y 1 A SER 768 ? OG  ? A SER 182 OG  
7  1 Y 1 A LYS 889 ? CG  ? A LYS 303 CG  
8  1 Y 1 A LYS 889 ? CD  ? A LYS 303 CD  
9  1 Y 1 A LYS 889 ? CE  ? A LYS 303 CE  
10 1 Y 1 A LYS 889 ? NZ  ? A LYS 303 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 587 ? A MET 1   
2  1 Y 1 A GLY 588 ? A GLY 2   
3  1 Y 1 A SER 589 ? A SER 3   
4  1 Y 1 A SER 590 ? A SER 4   
5  1 Y 1 A HIS 591 ? A HIS 5   
6  1 Y 1 A HIS 592 ? A HIS 6   
7  1 Y 1 A HIS 593 ? A HIS 7   
8  1 Y 1 A HIS 594 ? A HIS 8   
9  1 Y 1 A HIS 595 ? A HIS 9   
10 1 Y 1 A HIS 596 ? A HIS 10  
11 1 Y 1 A SER 597 ? A SER 11  
12 1 Y 1 A SER 598 ? A SER 12  
13 1 Y 1 A GLY 599 ? A GLY 13  
14 1 Y 1 A LEU 600 ? A LEU 14  
15 1 Y 1 A VAL 601 ? A VAL 15  
16 1 Y 1 A PRO 602 ? A PRO 16  
17 1 Y 1 A ARG 603 ? A ARG 17  
18 1 Y 1 A GLY 604 ? A GLY 18  
19 1 Y 1 A SER 605 ? A SER 19  
20 1 Y 1 A THR 606 ? A THR 20  
21 1 Y 1 A GLN 607 ? A GLN 21  
22 1 Y 1 A THR 608 ? A THR 22  
23 1 Y 1 A VAL 770 ? A VAL 184 
24 1 Y 1 A LEU 771 ? A LEU 185 
25 1 Y 1 A GLU 772 ? A GLU 186 
26 1 Y 1 A ASP 773 ? A ASP 187 
27 1 Y 1 A ASP 774 ? A ASP 188 
28 1 Y 1 A PRO 775 ? A PRO 189 
29 1 Y 1 A GLU 776 ? A GLU 190 
30 1 Y 1 A ALA 777 ? A ALA 191 
31 1 Y 1 A ALA 778 ? A ALA 192 
32 1 Y 1 A TYR 779 ? A TYR 193 
33 1 Y 1 A THR 780 ? A THR 194 
34 1 Y 1 A THR 781 ? A THR 195 
35 1 Y 1 A ARG 782 ? A ARG 196 
36 1 Y 1 A GLY 783 ? A GLY 197 
37 1 Y 1 A GLY 784 ? A GLY 198 
38 1 Y 1 A LYS 785 ? A LYS 199 
39 1 Y 1 A SER 893 ? A SER 307 
40 1 Y 1 A ALA 894 ? A ALA 308 
41 1 Y 1 A ALA 895 ? A ALA 309 
42 1 Y 1 A ALA 896 ? A ALA 310 
43 1 Y 1 A ARG 897 ? A ARG 311 
44 1 Y 1 A GLN 905 ? A GLN 319 
45 1 Y 1 A SER 906 ? A SER 320 
46 1 Y 1 A ASN 907 ? A ASN 321 
47 1 Y 1 A VAL 908 ? A VAL 322 
48 1 Y 1 A ASP 909 ? A ASP 323 
49 1 Y 1 A ILE 910 ? A ILE 324 
50 1 Y 1 A THR 911 ? A THR 325 
51 1 Y 1 A THR 912 ? A THR 326 
52 1 Y 1 A PHE 913 ? A PHE 327 
53 1 Y 1 A ARG 914 ? A ARG 328 
54 1 Y 1 A THR 915 ? A THR 329 
55 1 Y 1 A THR 916 ? A THR 330 
56 1 Y 1 A GLY 917 ? A GLY 331 
57 1 Y 1 A ASP 918 ? A ASP 332 
58 1 Y 1 A TRP 919 ? A TRP 333 
59 1 Y 1 A LEU 920 ? A LEU 334 
60 1 Y 1 A ASN 921 ? A ASN 335 
61 1 Y 1 A GLY 922 ? A GLY 336 
62 1 Y 1 A VAL 923 ? A VAL 337 
63 1 Y 1 A TRP 924 ? A TRP 338 
64 1 Y 1 A THR 925 ? A THR 339 
65 1 Y 1 A ALA 926 ? A ALA 340 
66 1 Y 1 A HIS 927 ? A HIS 341 
67 1 Y 1 A CYS 928 ? A CYS 342 
68 1 Y 1 A LYS 929 ? A LYS 343 
69 1 Y 1 A GLU 930 ? A GLU 344 
70 1 Y 1 A ILE 931 ? A ILE 345 
71 1 Y 1 A PHE 932 ? A PHE 346 
72 1 Y 1 A THR 933 ? A THR 347 
73 1 Y 1 A GLY 934 ? A GLY 348 
74 1 Y 1 A VAL 935 ? A VAL 349 
75 1 Y 1 A GLU 936 ? A GLU 350 
76 1 Y 1 A TYR 937 ? A TYR 351 
77 1 Y 1 A SER 938 ? A SER 352 
78 1 Y 1 A SER 939 ? A SER 353 
79 1 Y 1 A CYS 940 ? A CYS 354 
80 1 Y 1 A ASP 941 ? A ASP 355 
81 1 Y 1 A THR 942 ? A THR 356 
82 1 Y 1 A ILE 943 ? A ILE 357 
83 1 Y 1 A ALA 944 ? A ALA 358 
84 1 Y 1 A LYS 945 ? A LYS 359 
85 1 Y 1 A ILE 946 ? A ILE 360 
86 1 Y 1 A SER 947 ? A SER 361 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-amino-1-(2-chlorophenyl)-N-(3-ethoxypropyl)-1H-pyrrolo[2,3-b]quinoxaline-3-carboxamide' Q0B 
3 water                                                                                      HOH 
#