data_4P9O
# 
_entry.id   4P9O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4P9O         
WWPDB D_1000200991 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'wild-type native co-ordinates'                     4CBC unspecified 
PDB 'complex with drub PI1 in absence of Thallium ions' 4CBD unspecified 
PDB 'PI1 complex in T207A/F214A mutant'                 4P30 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4P9O 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Naylor, C.E.'  1 
'Bagneris, C.'  2 
'Wallace, B.A.' 3 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 111 ? 8428 8433 
'Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.' 2014 ? 
10.1073/pnas.1406855111 24850863 ? 
? ? ? ? ? ? ? UK ? ? 1       'Nat Commun'           ?      ?    2041-1723 ? ? 4   ? 2465 2465 
'Role of the C-terminal domain in the structure and function of tetrameric sodium channels.'               2013 ? 
10.1038/ncomms3465      24051986 ? 
? ? ? ? ? ? ? UK ? ? 2       'Nat Commun'           ?      ?    2041-1723 ? ? 3   ? 1102 1102 
'Structure of a bacterial voltage-gated sodium channel pore reveals mechanisms of opening and closing.'    2012 ? 
10.1038/ncomms2077      23033078 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bagneris, C.'   1  ? 
primary 'DeCaen, P.G.'   2  ? 
primary 'Naylor, C.E.'   3  ? 
primary 'Pryde, D.C.'    4  ? 
primary 'Nobeli, I.'     5  ? 
primary 'Clapham, D.E.'  6  ? 
primary 'Wallace, B.A.'  7  ? 
1       'Bagneris, C.'   8  ? 
1       'Decaen, P.G.'   9  ? 
1       'Hall, B.A.'     10 ? 
1       'Naylor, C.E.'   11 ? 
1       'Clapham, D.E.'  12 ? 
1       'Kay, C.W.'      13 ? 
1       'Wallace, B.A.'  14 ? 
2       'McCusker, E.C.' 15 ? 
2       'Bagneris, C.'   16 ? 
2       'Naylor, C.E.'   17 ? 
2       'Cole, A.R.'     18 ? 
2       
;D'Avanzo, N.
;
19 ? 
2       'Nichols, C.G.'  20 ? 
2       'Wallace, B.A.'  21 ? 
# 
_cell.entry_id           4P9O 
_cell.length_a           80.420 
_cell.length_b           328.370 
_cell.length_c           80.390 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4P9O 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ion transport protein' 16836.502 4   ? ? ? ? 
2 non-polymer syn HEGA-10                 379.489   6   ? ? ? ? 
3 non-polymer syn 'BROMIDE ION'           79.904    4   ? ? ? ? 
4 water       nat water                   18.015    253 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMGVGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIML
TTFTVLNLFIGIIVDAMAITKEQEEEAKTGHHQEPISQTLLHLGDRLDRIEKQLAQNNELLQRQQPQKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMGVGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIML
TTFTVLNLFIGIIVDAMAITKEQEEEAKTGHHQEPISQTLLHLGDRLDRIEKQLAQNNELLQRQQPQKK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   GLY n 
1 6   VAL n 
1 7   GLY n 
1 8   SER n 
1 9   VAL n 
1 10  ALA n 
1 11  ALA n 
1 12  LEU n 
1 13  LEU n 
1 14  THR n 
1 15  VAL n 
1 16  VAL n 
1 17  PHE n 
1 18  TYR n 
1 19  ILE n 
1 20  ALA n 
1 21  ALA n 
1 22  VAL n 
1 23  MET n 
1 24  ALA n 
1 25  THR n 
1 26  ASN n 
1 27  LEU n 
1 28  TYR n 
1 29  GLY n 
1 30  ALA n 
1 31  THR n 
1 32  PHE n 
1 33  PRO n 
1 34  GLU n 
1 35  TRP n 
1 36  PHE n 
1 37  GLY n 
1 38  ASP n 
1 39  LEU n 
1 40  SER n 
1 41  LYS n 
1 42  SER n 
1 43  LEU n 
1 44  TYR n 
1 45  THR n 
1 46  LEU n 
1 47  PHE n 
1 48  GLN n 
1 49  VAL n 
1 50  MET n 
1 51  THR n 
1 52  LEU n 
1 53  GLU n 
1 54  SER n 
1 55  TRP n 
1 56  SER n 
1 57  MET n 
1 58  GLY n 
1 59  ILE n 
1 60  VAL n 
1 61  ARG n 
1 62  PRO n 
1 63  VAL n 
1 64  MET n 
1 65  ASN n 
1 66  VAL n 
1 67  HIS n 
1 68  PRO n 
1 69  ASN n 
1 70  ALA n 
1 71  TRP n 
1 72  VAL n 
1 73  PHE n 
1 74  PHE n 
1 75  ILE n 
1 76  PRO n 
1 77  PHE n 
1 78  ILE n 
1 79  MET n 
1 80  LEU n 
1 81  THR n 
1 82  THR n 
1 83  PHE n 
1 84  THR n 
1 85  VAL n 
1 86  LEU n 
1 87  ASN n 
1 88  LEU n 
1 89  PHE n 
1 90  ILE n 
1 91  GLY n 
1 92  ILE n 
1 93  ILE n 
1 94  VAL n 
1 95  ASP n 
1 96  ALA n 
1 97  MET n 
1 98  ALA n 
1 99  ILE n 
1 100 THR n 
1 101 LYS n 
1 102 GLU n 
1 103 GLN n 
1 104 GLU n 
1 105 GLU n 
1 106 GLU n 
1 107 ALA n 
1 108 LYS n 
1 109 THR n 
1 110 GLY n 
1 111 HIS n 
1 112 HIS n 
1 113 GLN n 
1 114 GLU n 
1 115 PRO n 
1 116 ILE n 
1 117 SER n 
1 118 GLN n 
1 119 THR n 
1 120 LEU n 
1 121 LEU n 
1 122 HIS n 
1 123 LEU n 
1 124 GLY n 
1 125 ASP n 
1 126 ARG n 
1 127 LEU n 
1 128 ASP n 
1 129 ARG n 
1 130 ILE n 
1 131 GLU n 
1 132 LYS n 
1 133 GLN n 
1 134 LEU n 
1 135 ALA n 
1 136 GLN n 
1 137 ASN n 
1 138 ASN n 
1 139 GLU n 
1 140 LEU n 
1 141 LEU n 
1 142 GLN n 
1 143 ARG n 
1 144 GLN n 
1 145 GLN n 
1 146 PRO n 
1 147 GLN n 
1 148 LYS n 
1 149 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   149 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Mmc1_0798 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    MC-1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Magnetococcus sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     156889 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               C-41 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       Pet15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0L5S6_MAGSM 
_struct_ref.pdbx_db_accession          A0L5S6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GVGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFT
VLNLFIGIIVDAMAITKEQEEEAKTGHHQEPISQTLLHLGDRLDRIEKQLAQNNELLQRQQPQKK
;
_struct_ref.pdbx_align_begin           130 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4P9O A 5 ? 149 ? A0L5S6 130 ? 274 ? 130 274 
2 1 4P9O B 5 ? 149 ? A0L5S6 130 ? 274 ? 130 274 
3 1 4P9O C 5 ? 149 ? A0L5S6 130 ? 274 ? 130 274 
4 1 4P9O D 5 ? 149 ? A0L5S6 130 ? 274 ? 130 274 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4P9O GLY A 1 ? UNP A0L5S6 ? ? 'expression tag' 126 1  
1 4P9O SER A 2 ? UNP A0L5S6 ? ? 'expression tag' 127 2  
1 4P9O HIS A 3 ? UNP A0L5S6 ? ? 'expression tag' 128 3  
1 4P9O MET A 4 ? UNP A0L5S6 ? ? 'expression tag' 129 4  
2 4P9O GLY B 1 ? UNP A0L5S6 ? ? 'expression tag' 126 5  
2 4P9O SER B 2 ? UNP A0L5S6 ? ? 'expression tag' 127 6  
2 4P9O HIS B 3 ? UNP A0L5S6 ? ? 'expression tag' 128 7  
2 4P9O MET B 4 ? UNP A0L5S6 ? ? 'expression tag' 129 8  
3 4P9O GLY C 1 ? UNP A0L5S6 ? ? 'expression tag' 126 9  
3 4P9O SER C 2 ? UNP A0L5S6 ? ? 'expression tag' 127 10 
3 4P9O HIS C 3 ? UNP A0L5S6 ? ? 'expression tag' 128 11 
3 4P9O MET C 4 ? UNP A0L5S6 ? ? 'expression tag' 129 12 
4 4P9O GLY D 1 ? UNP A0L5S6 ? ? 'expression tag' 126 13 
4 4P9O SER D 2 ? UNP A0L5S6 ? ? 'expression tag' 127 14 
4 4P9O HIS D 3 ? UNP A0L5S6 ? ? 'expression tag' 128 15 
4 4P9O MET D 4 ? UNP A0L5S6 ? ? 'expression tag' 129 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2CV non-polymer         . HEGA-10         ? 'C18 H37 N O7'   379.489 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BR  non-polymer         . 'BROMIDE ION'   ? 'Br -1'          79.904  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4P9O 
_exptl.crystals_number            . 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            3.94 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         68.78 
_exptl_crystal.description                 'Flat rectangular plates' 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    '0.1 M sodium citrate, 0.1 M Tris, 34% PEG' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2013-04-27 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    crystal 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        0.92 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4P9O 
_reflns.data_reduction_details           . 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.89 
_reflns.d_resolution_low                 45.24 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      . 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24368 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         . 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_sigma_F       0 
_reflns.observed_criterion_sigma_I       0 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 . 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.5 
_reflns.pdbx_Rmerge_I_obs                0.191 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.pdbx_chi_squared                 . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_Rpim_I_all                  . 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
# 
_reflns_shell.d_res_high                  2.89 
_reflns_shell.d_res_low                   3.07 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           . 
_reflns_shell.percent_possible_all        99 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.714 
_reflns_shell.meanI_over_sigI_gt          . 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          . 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 . 
_reflns_shell.pdbx_redundancy             13.9 
_reflns_shell.pdbx_Rsym_value             . 
_reflns_shell.pdbx_chi_squared            . 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   3.6 
_reflns_shell.pdbx_Rrim_I_all             . 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4P9O 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     24118 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.91 
_refine.ls_d_res_high                            2.89 
_refine.ls_percent_reflns_obs                    98.82 
_refine.ls_R_factor_obs                          0.2158 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2139 
_refine.ls_R_factor_R_free                       0.2507 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.19 
_refine.ls_number_reflns_R_free                  1251 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8963 
_refine.correlation_coeff_Fo_to_Fc_free          0.8584 
_refine.B_iso_mean                               61.82 
_refine.aniso_B[1][1]                            12.2370 
_refine.aniso_B[2][2]                            -22.6386 
_refine.aniso_B[3][3]                            10.4016 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.344 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.265 
_refine.pdbx_overall_SU_R_Blow_DPI               0.353 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.270 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4P9O 
_refine_analyze.Luzzati_coordinate_error_obs    0.393 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        2856 
_refine_hist.pdbx_number_atoms_nucleic_acid   ? 
_refine_hist.pdbx_number_atoms_ligand         ? 
_refine_hist.number_atoms_solvent             ? 
_refine_hist.number_atoms_total               ? 
_refine_hist.d_res_high                       2.89 
_refine_hist.d_res_low                        32.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  3234 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.08  ? 2.00  4566 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  1001 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  35   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  444  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 3234 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           2.43  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           19.47 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  412  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  4027 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   12 
_refine_ls_shell.d_res_high                       2.89 
_refine_ls_shell.d_res_low                        3.02 
_refine_ls_shell.number_reflns_R_work             2743 
_refine_ls_shell.R_factor_R_work                  0.2075 
_refine_ls_shell.percent_reflns_obs               98.82 
_refine_ls_shell.R_factor_R_free                  0.2372 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.12 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_all                2891 
_refine_ls_shell.R_factor_all                     0.2090 
# 
_struct.entry_id                     4P9O 
_struct.title                        'Complex of Voltage-gated ion channel in a the presence of channel blocking compound' 
_struct.pdbx_descriptor              'Voltage-gated sodium ion channel (pore and C-terminal domain)' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4P9O 
_struct_keywords.text            'ion channel, membrane protein, channel blocker, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 2 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 6  ? GLY A 29 ? VAL A 131 GLY A 154 1 ? 24 
HELX_P HELX_P2  AA2 PHE A 32 ? GLY A 37 ? PHE A 157 GLY A 162 1 ? 6  
HELX_P HELX_P3  AA3 ASP A 38 ? THR A 51 ? ASP A 163 THR A 176 1 ? 14 
HELX_P HELX_P4  AA4 ILE A 59 ? ASN A 65 ? ILE A 184 ASN A 190 1 ? 7  
HELX_P HELX_P5  AA5 ALA A 70 ? ASP A 95 ? ALA A 195 ASP A 220 1 ? 26 
HELX_P HELX_P6  AA6 GLY B 7  ? GLY B 29 ? GLY B 132 GLY B 154 1 ? 23 
HELX_P HELX_P7  AA7 PHE B 32 ? GLY B 37 ? PHE B 157 GLY B 162 1 ? 6  
HELX_P HELX_P8  AA8 ASP B 38 ? THR B 51 ? ASP B 163 THR B 176 1 ? 14 
HELX_P HELX_P9  AA9 ILE B 59 ? ASN B 65 ? ILE B 184 ASN B 190 1 ? 7  
HELX_P HELX_P10 AB1 ALA B 70 ? ASP B 95 ? ALA B 195 ASP B 220 1 ? 26 
HELX_P HELX_P11 AB2 VAL C 6  ? GLY C 29 ? VAL C 131 GLY C 154 1 ? 24 
HELX_P HELX_P12 AB3 PHE C 32 ? GLY C 37 ? PHE C 157 GLY C 162 1 ? 6  
HELX_P HELX_P13 AB4 ASP C 38 ? THR C 51 ? ASP C 163 THR C 176 1 ? 14 
HELX_P HELX_P14 AB5 SER C 54 ? ILE C 59 ? SER C 179 ILE C 184 1 ? 6  
HELX_P HELX_P15 AB6 ILE C 59 ? ASN C 65 ? ILE C 184 ASN C 190 1 ? 7  
HELX_P HELX_P16 AB7 HIS C 67 ? ASN C 69 ? HIS C 192 ASN C 194 5 ? 3  
HELX_P HELX_P17 AB8 ALA C 70 ? ASP C 95 ? ALA C 195 ASP C 220 1 ? 26 
HELX_P HELX_P18 AB9 VAL D 6  ? GLY D 29 ? VAL D 131 GLY D 154 1 ? 24 
HELX_P HELX_P19 AC1 PHE D 32 ? GLY D 37 ? PHE D 157 GLY D 162 1 ? 6  
HELX_P HELX_P20 AC2 ASP D 38 ? THR D 51 ? ASP D 163 THR D 176 1 ? 14 
HELX_P HELX_P21 AC3 SER D 54 ? ILE D 59 ? SER D 179 ILE D 184 1 ? 6  
HELX_P HELX_P22 AC4 ILE D 59 ? ASN D 65 ? ILE D 184 ASN D 190 1 ? 7  
HELX_P HELX_P23 AC5 HIS D 67 ? ASN D 69 ? HIS D 192 ASN D 194 5 ? 3  
HELX_P HELX_P24 AC6 ALA D 70 ? ASP D 95 ? ALA D 195 ASP D 220 1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 2CV 300 ? 4 'binding site for residue 2CV A 300' 
AC2 Software A 2CV 301 ? 2 'binding site for residue 2CV A 301' 
AC3 Software B 2CV 302 ? 5 'binding site for residue 2CV B 302' 
AC4 Software B 2CV 303 ? 3 'binding site for residue 2CV B 303' 
AC5 Software C 2CV 300 ? 5 'binding site for residue 2CV C 300' 
AC6 Software D 2CV 302 ? 5 'binding site for residue 2CV D 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PRO A 68 ? PRO A 193 . ? 1_555 ? 
2  AC1 4 ASN A 69 ? ASN A 194 . ? 1_555 ? 
3  AC1 4 TRP A 71 ? TRP A 196 . ? 1_555 ? 
4  AC1 4 SER B 40 ? SER B 165 . ? 1_555 ? 
5  AC2 2 TYR A 28 ? TYR A 153 . ? 1_555 ? 
6  AC2 2 VAL A 72 ? VAL A 197 . ? 1_555 ? 
7  AC3 5 SER A 40 ? SER A 165 . ? 3_455 ? 
8  AC3 5 PHE A 47 ? PHE A 172 . ? 3_455 ? 
9  AC3 5 PRO B 68 ? PRO B 193 . ? 1_555 ? 
10 AC3 5 ASN B 69 ? ASN B 194 . ? 1_555 ? 
11 AC3 5 TRP B 71 ? TRP B 196 . ? 1_555 ? 
12 AC4 3 TYR B 28 ? TYR B 153 . ? 1_555 ? 
13 AC4 3 ALA B 70 ? ALA B 195 . ? 1_555 ? 
14 AC4 3 VAL B 72 ? VAL B 197 . ? 1_555 ? 
15 AC5 5 PRO C 68 ? PRO C 193 . ? 1_555 ? 
16 AC5 5 ASN C 69 ? ASN C 194 . ? 1_555 ? 
17 AC5 5 TRP C 71 ? TRP C 196 . ? 1_555 ? 
18 AC5 5 HOH Q .  ? HOH C 462 . ? 1_555 ? 
19 AC5 5 SER D 40 ? SER D 165 . ? 1_555 ? 
20 AC6 5 SER C 40 ? SER C 165 . ? 3_455 ? 
21 AC6 5 PRO D 68 ? PRO D 193 . ? 1_555 ? 
22 AC6 5 ASN D 69 ? ASN D 194 . ? 1_555 ? 
23 AC6 5 TRP D 71 ? TRP D 196 . ? 1_555 ? 
24 AC6 5 HOH R .  ? HOH D 402 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4P9O 
_atom_sites.fract_transf_matrix[1][1]   0.012435 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003045 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012439 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 6  ? -31.718 -41.533  5.599   1.00 137.68 ? 131 VAL A N   1 
ATOM   2    C  CA  . VAL A 1 6  ? -32.580 -42.711  5.736   1.00 134.21 ? 131 VAL A CA  1 
ATOM   3    C  C   . VAL A 1 6  ? -32.251 -43.752  4.651   1.00 135.01 ? 131 VAL A C   1 
ATOM   4    O  O   . VAL A 1 6  ? -32.193 -44.945  4.949   1.00 131.30 ? 131 VAL A O   1 
ATOM   5    C  CB  . VAL A 1 6  ? -34.099 -42.372  5.800   1.00 139.68 ? 131 VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 6  ? -34.908 -43.557  6.326   1.00 136.32 ? 131 VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 6  ? -34.361 -41.135  6.658   1.00 143.27 ? 131 VAL A CG2 1 
ATOM   8    N  N   . GLY A 1 7  ? -32.027 -43.288  3.420   1.00 132.89 ? 132 GLY A N   1 
ATOM   9    C  CA  . GLY A 1 7  ? -31.663 -44.134  2.285   1.00 130.59 ? 132 GLY A CA  1 
ATOM   10   C  C   . GLY A 1 7  ? -30.296 -44.770  2.456   1.00 131.48 ? 132 GLY A C   1 
ATOM   11   O  O   . GLY A 1 7  ? -30.100 -45.933  2.089   1.00 128.29 ? 132 GLY A O   1 
ATOM   12   N  N   . SER A 1 8  ? -29.352 -44.004  3.049   1.00 128.64 ? 133 SER A N   1 
ATOM   13   C  CA  . SER A 1 8  ? -27.980 -44.419  3.363   1.00 126.53 ? 133 SER A CA  1 
ATOM   14   C  C   . SER A 1 8  ? -27.974 -45.499  4.450   1.00 125.52 ? 133 SER A C   1 
ATOM   15   O  O   . SER A 1 8  ? -27.068 -46.332  4.478   1.00 122.99 ? 133 SER A O   1 
ATOM   16   C  CB  . SER A 1 8  ? -27.160 -43.218  3.824   1.00 133.32 ? 133 SER A CB  1 
ATOM   17   O  OG  . SER A 1 8  ? -27.755 -42.589  4.948   1.00 143.81 ? 133 SER A OG  1 
ATOM   18   N  N   . VAL A 1 9  ? -28.985 -45.471  5.344   1.00 120.61 ? 134 VAL A N   1 
ATOM   19   C  CA  . VAL A 1 9  ? -29.176 -46.439  6.433   1.00 117.04 ? 134 VAL A CA  1 
ATOM   20   C  C   . VAL A 1 9  ? -29.581 -47.791  5.818   1.00 115.27 ? 134 VAL A C   1 
ATOM   21   O  O   . VAL A 1 9  ? -29.040 -48.826  6.216   1.00 112.41 ? 134 VAL A O   1 
ATOM   22   C  CB  . VAL A 1 9  ? -30.207 -45.943  7.490   1.00 122.53 ? 134 VAL A CB  1 
ATOM   23   C  CG1 . VAL A 1 9  ? -30.235 -46.855  8.715   1.00 119.88 ? 134 VAL A CG1 1 
ATOM   24   C  CG2 . VAL A 1 9  ? -29.929 -44.499  7.906   1.00 126.26 ? 134 VAL A CG2 1 
ATOM   25   N  N   . ALA A 1 10 ? -30.507 -47.766  4.829   1.00 110.16 ? 135 ALA A N   1 
ATOM   26   C  CA  . ALA A 1 10 ? -30.983 -48.945  4.097   1.00 106.69 ? 135 ALA A CA  1 
ATOM   27   C  C   . ALA A 1 10 ? -29.848 -49.544  3.276   1.00 106.74 ? 135 ALA A C   1 
ATOM   28   O  O   . ALA A 1 10 ? -29.755 -50.766  3.166   1.00 103.76 ? 135 ALA A O   1 
ATOM   29   C  CB  . ALA A 1 10 ? -32.136 -48.564  3.180   1.00 109.14 ? 135 ALA A CB  1 
ATOM   30   N  N   . ALA A 1 11 ? -28.980 -48.678  2.716   1.00 103.39 ? 136 ALA A N   1 
ATOM   31   C  CA  . ALA A 1 11 ? -27.815 -49.077  1.931   1.00 101.92 ? 136 ALA A CA  1 
ATOM   32   C  C   . ALA A 1 11 ? -26.780 -49.750  2.834   1.00 101.63 ? 136 ALA A C   1 
ATOM   33   O  O   . ALA A 1 11 ? -26.159 -50.724  2.412   1.00 99.85  ? 136 ALA A O   1 
ATOM   34   C  CB  . ALA A 1 11 ? -27.208 -47.866  1.241   1.00 105.87 ? 136 ALA A CB  1 
ATOM   35   N  N   . LEU A 1 12 ? -26.623 -49.250  4.083   1.00 96.44  ? 137 LEU A N   1 
ATOM   36   C  CA  . LEU A 1 12 ? -25.704 -49.793  5.086   1.00 93.69  ? 137 LEU A CA  1 
ATOM   37   C  C   . LEU A 1 12 ? -26.161 -51.184  5.526   1.00 91.19  ? 137 LEU A C   1 
ATOM   38   O  O   . LEU A 1 12 ? -25.337 -52.095  5.595   1.00 88.91  ? 137 LEU A O   1 
ATOM   39   C  CB  . LEU A 1 12 ? -25.612 -48.849  6.299   1.00 95.52  ? 137 LEU A CB  1 
ATOM   40   C  CG  . LEU A 1 12 ? -24.568 -49.207  7.360   1.00 99.41  ? 137 LEU A CG  1 
ATOM   41   C  CD1 . LEU A 1 12 ? -23.653 -48.031  7.640   1.00 102.69 ? 137 LEU A CD1 1 
ATOM   42   C  CD2 . LEU A 1 12 ? -25.228 -49.687  8.637   1.00 99.76  ? 137 LEU A CD2 1 
ATOM   43   N  N   . LEU A 1 13 ? -27.470 -51.338  5.816   1.00 85.02  ? 138 LEU A N   1 
ATOM   44   C  CA  . LEU A 1 13 ? -28.065 -52.600  6.248   1.00 81.26  ? 138 LEU A CA  1 
ATOM   45   C  C   . LEU A 1 13 ? -27.944 -53.688  5.187   1.00 82.57  ? 138 LEU A C   1 
ATOM   46   O  O   . LEU A 1 13 ? -27.583 -54.807  5.536   1.00 80.80  ? 138 LEU A O   1 
ATOM   47   C  CB  . LEU A 1 13 ? -29.526 -52.419  6.695   1.00 81.46  ? 138 LEU A CB  1 
ATOM   48   C  CG  . LEU A 1 13 ? -30.165 -53.611  7.421   1.00 83.35  ? 138 LEU A CG  1 
ATOM   49   C  CD1 . LEU A 1 13 ? -29.903 -53.557  8.921   1.00 82.94  ? 138 LEU A CD1 1 
ATOM   50   C  CD2 . LEU A 1 13 ? -31.648 -53.685  7.141   1.00 85.95  ? 138 LEU A CD2 1 
ATOM   51   N  N   . THR A 1 14 ? -28.212 -53.364  3.905   1.00 78.72  ? 139 THR A N   1 
ATOM   52   C  CA  . THR A 1 14 ? -28.108 -54.312  2.789   1.00 76.96  ? 139 THR A CA  1 
ATOM   53   C  C   . THR A 1 14 ? -26.675 -54.855  2.679   1.00 78.45  ? 139 THR A C   1 
ATOM   54   O  O   . THR A 1 14 ? -26.493 -56.066  2.556   1.00 76.39  ? 139 THR A O   1 
ATOM   55   C  CB  . THR A 1 14 ? -28.601 -53.665  1.488   1.00 87.72  ? 139 THR A CB  1 
ATOM   56   O  OG1 . THR A 1 14 ? -29.886 -53.083  1.709   1.00 89.95  ? 139 THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 14 ? -28.686 -54.656  0.337   1.00 86.09  ? 139 THR A CG2 1 
ATOM   58   N  N   . VAL A 1 15 ? -25.671 -53.958  2.770   1.00 75.02  ? 140 VAL A N   1 
ATOM   59   C  CA  . VAL A 1 15 ? -24.238 -54.272  2.712   1.00 73.86  ? 140 VAL A CA  1 
ATOM   60   C  C   . VAL A 1 15 ? -23.849 -55.188  3.887   1.00 74.06  ? 140 VAL A C   1 
ATOM   61   O  O   . VAL A 1 15 ? -23.193 -56.210  3.677   1.00 72.45  ? 140 VAL A O   1 
ATOM   62   C  CB  . VAL A 1 15 ? -23.379 -52.972  2.622   1.00 80.00  ? 140 VAL A CB  1 
ATOM   63   C  CG1 . VAL A 1 15 ? -21.916 -53.218  2.986   1.00 79.59  ? 140 VAL A CG1 1 
ATOM   64   C  CG2 . VAL A 1 15 ? -23.484 -52.339  1.238   1.00 81.94  ? 140 VAL A CG2 1 
ATOM   65   N  N   . VAL A 1 16 ? -24.294 -54.835  5.103   1.00 69.18  ? 141 VAL A N   1 
ATOM   66   C  CA  . VAL A 1 16 ? -24.044 -55.594  6.328   1.00 66.71  ? 141 VAL A CA  1 
ATOM   67   C  C   . VAL A 1 16 ? -24.737 -56.966  6.268   1.00 66.93  ? 141 VAL A C   1 
ATOM   68   O  O   . VAL A 1 16 ? -24.126 -57.972  6.622   1.00 65.53  ? 141 VAL A O   1 
ATOM   69   C  CB  . VAL A 1 16 ? -24.389 -54.748  7.589   1.00 71.41  ? 141 VAL A CB  1 
ATOM   70   C  CG1 . VAL A 1 16 ? -24.924 -55.595  8.745   1.00 69.42  ? 141 VAL A CG1 1 
ATOM   71   C  CG2 . VAL A 1 16 ? -23.188 -53.914  8.027   1.00 72.71  ? 141 VAL A CG2 1 
ATOM   72   N  N   . PHE A 1 17 ? -25.977 -57.003  5.764   1.00 61.95  ? 142 PHE A N   1 
ATOM   73   C  CA  . PHE A 1 17 ? -26.753 -58.228  5.615   1.00 59.50  ? 142 PHE A CA  1 
ATOM   74   C  C   . PHE A 1 17 ? -26.148 -59.166  4.572   1.00 63.04  ? 142 PHE A C   1 
ATOM   75   O  O   . PHE A 1 17 ? -26.077 -60.369  4.809   1.00 60.70  ? 142 PHE A O   1 
ATOM   76   C  CB  . PHE A 1 17 ? -28.214 -57.905  5.270   1.00 61.61  ? 142 PHE A CB  1 
ATOM   77   C  CG  . PHE A 1 17 ? -29.171 -58.975  5.724   1.00 61.06  ? 142 PHE A CG  1 
ATOM   78   C  CD1 . PHE A 1 17 ? -29.639 -59.002  7.034   1.00 62.82  ? 142 PHE A CD1 1 
ATOM   79   C  CD2 . PHE A 1 17 ? -29.581 -59.975  4.853   1.00 62.33  ? 142 PHE A CD2 1 
ATOM   80   C  CE1 . PHE A 1 17 ? -30.486 -60.020  7.467   1.00 62.39  ? 142 PHE A CE1 1 
ATOM   81   C  CE2 . PHE A 1 17 ? -30.440 -60.983  5.281   1.00 64.02  ? 142 PHE A CE2 1 
ATOM   82   C  CZ  . PHE A 1 17 ? -30.888 -60.997  6.585   1.00 61.25  ? 142 PHE A CZ  1 
ATOM   83   N  N   . TYR A 1 18 ? -25.691 -58.624  3.439   1.00 62.10  ? 143 TYR A N   1 
ATOM   84   C  CA  . TYR A 1 18 ? -25.088 -59.445  2.401   1.00 62.85  ? 143 TYR A CA  1 
ATOM   85   C  C   . TYR A 1 18 ? -23.738 -60.021  2.795   1.00 63.87  ? 143 TYR A C   1 
ATOM   86   O  O   . TYR A 1 18 ? -23.523 -61.220  2.593   1.00 63.17  ? 143 TYR A O   1 
ATOM   87   C  CB  . TYR A 1 18 ? -25.109 -58.756  1.032   1.00 68.12  ? 143 TYR A CB  1 
ATOM   88   C  CG  . TYR A 1 18 ? -26.426 -59.004  0.328   1.00 74.22  ? 143 TYR A CG  1 
ATOM   89   C  CD1 . TYR A 1 18 ? -26.526 -59.938  -0.699  1.00 77.51  ? 143 TYR A CD1 1 
ATOM   90   C  CD2 . TYR A 1 18 ? -27.603 -58.392  0.768   1.00 76.08  ? 143 TYR A CD2 1 
ATOM   91   C  CE1 . TYR A 1 18 ? -27.752 -60.217  -1.311  1.00 80.57  ? 143 TYR A CE1 1 
ATOM   92   C  CE2 . TYR A 1 18 ? -28.834 -58.672  0.174   1.00 77.81  ? 143 TYR A CE2 1 
ATOM   93   C  CZ  . TYR A 1 18 ? -28.904 -59.581  -0.870  1.00 89.80  ? 143 TYR A CZ  1 
ATOM   94   O  OH  . TYR A 1 18 ? -30.119 -59.846  -1.459  1.00 96.65  ? 143 TYR A OH  1 
ATOM   95   N  N   . ILE A 1 19 ? -22.872 -59.197  3.437   1.00 57.80  ? 144 ILE A N   1 
ATOM   96   C  CA  . ILE A 1 19 ? -21.556 -59.613  3.925   1.00 55.54  ? 144 ILE A CA  1 
ATOM   97   C  C   . ILE A 1 19 ? -21.672 -60.641  5.052   1.00 52.73  ? 144 ILE A C   1 
ATOM   98   O  O   . ILE A 1 19 ? -20.937 -61.628  5.026   1.00 52.24  ? 144 ILE A O   1 
ATOM   99   C  CB  . ILE A 1 19 ? -20.596 -58.419  4.205   1.00 60.50  ? 144 ILE A CB  1 
ATOM   100  C  CG1 . ILE A 1 19 ? -19.932 -57.967  2.887   1.00 63.25  ? 144 ILE A CG1 1 
ATOM   101  C  CG2 . ILE A 1 19 ? -19.516 -58.749  5.254   1.00 60.43  ? 144 ILE A CG2 1 
ATOM   102  C  CD1 . ILE A 1 19 ? -19.901 -56.475  2.662   1.00 74.75  ? 144 ILE A CD1 1 
ATOM   103  N  N   . ALA A 1 20 ? -22.624 -60.446  5.999   1.00 43.85  ? 145 ALA A N   1 
ATOM   104  C  CA  . ALA A 1 20 ? -22.862 -61.386  7.096   1.00 39.98  ? 145 ALA A CA  1 
ATOM   105  C  C   . ALA A 1 20 ? -23.332 -62.735  6.562   1.00 42.63  ? 145 ALA A C   1 
ATOM   106  O  O   . ALA A 1 20 ? -22.877 -63.768  7.061   1.00 40.72  ? 145 ALA A O   1 
ATOM   107  C  CB  . ALA A 1 20 ? -23.887 -60.821  8.060   1.00 39.99  ? 145 ALA A CB  1 
ATOM   108  N  N   . ALA A 1 21 ? -24.217 -62.721  5.521   1.00 40.29  ? 146 ALA A N   1 
ATOM   109  C  CA  . ALA A 1 21 ? -24.757 -63.912  4.858   1.00 39.30  ? 146 ALA A CA  1 
ATOM   110  C  C   . ALA A 1 21 ? -23.682 -64.654  4.080   1.00 45.18  ? 146 ALA A C   1 
ATOM   111  O  O   . ALA A 1 21 ? -23.745 -65.876  3.979   1.00 44.75  ? 146 ALA A O   1 
ATOM   112  C  CB  . ALA A 1 21 ? -25.886 -63.530  3.949   1.00 40.71  ? 146 ALA A CB  1 
ATOM   113  N  N   . VAL A 1 22 ? -22.691 -63.917  3.546   1.00 43.49  ? 147 VAL A N   1 
ATOM   114  C  CA  . VAL A 1 22 ? -21.518 -64.469  2.879   1.00 44.56  ? 147 VAL A CA  1 
ATOM   115  C  C   . VAL A 1 22 ? -20.678 -65.226  3.957   1.00 49.01  ? 147 VAL A C   1 
ATOM   116  O  O   . VAL A 1 22 ? -20.372 -66.408  3.769   1.00 49.52  ? 147 VAL A O   1 
ATOM   117  C  CB  . VAL A 1 22 ? -20.682 -63.360  2.160   1.00 49.73  ? 147 VAL A CB  1 
ATOM   118  C  CG1 . VAL A 1 22 ? -19.297 -63.868  1.761   1.00 49.90  ? 147 VAL A CG1 1 
ATOM   119  C  CG2 . VAL A 1 22 ? -21.414 -62.811  0.943   1.00 50.92  ? 147 VAL A CG2 1 
ATOM   120  N  N   . MET A 1 23 ? -20.338 -64.540  5.085   1.00 43.65  ? 148 MET A N   1 
ATOM   121  C  CA  . MET A 1 23 ? -19.540 -65.078  6.196   1.00 41.37  ? 148 MET A CA  1 
ATOM   122  C  C   . MET A 1 23 ? -20.112 -66.356  6.743   1.00 39.32  ? 148 MET A C   1 
ATOM   123  O  O   . MET A 1 23 ? -19.364 -67.314  6.901   1.00 37.82  ? 148 MET A O   1 
ATOM   124  C  CB  . MET A 1 23 ? -19.376 -64.060  7.331   1.00 44.27  ? 148 MET A CB  1 
ATOM   125  C  CG  . MET A 1 23 ? -18.552 -62.876  6.951   1.00 50.92  ? 148 MET A CG  1 
ATOM   126  S  SD  . MET A 1 23 ? -18.084 -61.902  8.383   1.00 57.04  ? 148 MET A SD  1 
ATOM   127  C  CE  . MET A 1 23 ? -16.616 -61.068  7.729   1.00 55.96  ? 148 MET A CE  1 
ATOM   128  N  N   . ALA A 1 24 ? -21.442 -66.371  7.032   1.00 33.26  ? 149 ALA A N   1 
ATOM   129  C  CA  . ALA A 1 24 ? -22.157 -67.519  7.588   1.00 30.65  ? 149 ALA A CA  1 
ATOM   130  C  C   . ALA A 1 24 ? -22.124 -68.732  6.637   1.00 35.15  ? 149 ALA A C   1 
ATOM   131  O  O   . ALA A 1 24 ? -21.828 -69.839  7.098   1.00 34.08  ? 149 ALA A O   1 
ATOM   132  C  CB  . ALA A 1 24 ? -23.574 -67.131  7.943   1.00 30.30  ? 149 ALA A CB  1 
ATOM   133  N  N   . THR A 1 25 ? -22.350 -68.512  5.311   1.00 33.17  ? 150 THR A N   1 
ATOM   134  C  CA  . THR A 1 25 ? -22.285 -69.546  4.262   1.00 34.53  ? 150 THR A CA  1 
ATOM   135  C  C   . THR A 1 25 ? -20.913 -70.241  4.335   1.00 41.22  ? 150 THR A C   1 
ATOM   136  O  O   . THR A 1 25 ? -20.831 -71.472  4.310   1.00 41.66  ? 150 THR A O   1 
ATOM   137  C  CB  . THR A 1 25 ? -22.487 -68.920  2.862   1.00 42.90  ? 150 THR A CB  1 
ATOM   138  O  OG1 . THR A 1 25 ? -23.771 -68.318  2.785   1.00 51.06  ? 150 THR A OG1 1 
ATOM   139  C  CG2 . THR A 1 25 ? -22.375 -69.930  1.750   1.00 38.71  ? 150 THR A CG2 1 
ATOM   140  N  N   . ASN A 1 26 ? -19.844 -69.435  4.453   1.00 38.55  ? 151 ASN A N   1 
ATOM   141  C  CA  . ASN A 1 26 ? -18.467 -69.909  4.557   1.00 38.67  ? 151 ASN A CA  1 
ATOM   142  C  C   . ASN A 1 26 ? -18.221 -70.655  5.871   1.00 39.58  ? 151 ASN A C   1 
ATOM   143  O  O   . ASN A 1 26 ? -17.691 -71.762  5.862   1.00 39.44  ? 151 ASN A O   1 
ATOM   144  C  CB  . ASN A 1 26 ? -17.487 -68.737  4.412   1.00 39.38  ? 151 ASN A CB  1 
ATOM   145  C  CG  . ASN A 1 26 ? -16.047 -69.150  4.472   1.00 54.41  ? 151 ASN A CG  1 
ATOM   146  O  OD1 . ASN A 1 26 ? -15.317 -68.771  5.401   1.00 52.06  ? 151 ASN A OD1 1 
ATOM   147  N  ND2 . ASN A 1 26 ? -15.626 -69.972  3.503   1.00 38.00  ? 151 ASN A ND2 1 
ATOM   148  N  N   . LEU A 1 27 ? -18.629 -70.057  6.982   1.00 33.90  ? 152 LEU A N   1 
ATOM   149  C  CA  . LEU A 1 27 ? -18.419 -70.602  8.307   1.00 32.66  ? 152 LEU A CA  1 
ATOM   150  C  C   . LEU A 1 27 ? -19.178 -71.894  8.634   1.00 37.90  ? 152 LEU A C   1 
ATOM   151  O  O   . LEU A 1 27 ? -18.545 -72.889  9.013   1.00 38.08  ? 152 LEU A O   1 
ATOM   152  C  CB  . LEU A 1 27 ? -18.687 -69.517  9.370   1.00 31.58  ? 152 LEU A CB  1 
ATOM   153  C  CG  . LEU A 1 27 ? -17.627 -68.434  9.513   1.00 36.22  ? 152 LEU A CG  1 
ATOM   154  C  CD1 . LEU A 1 27 ? -18.229 -67.145  9.999   1.00 35.96  ? 152 LEU A CD1 1 
ATOM   155  C  CD2 . LEU A 1 27 ? -16.547 -68.872  10.441  1.00 39.02  ? 152 LEU A CD2 1 
ATOM   156  N  N   . TYR A 1 28 ? -20.526 -71.876  8.495   1.00 33.79  ? 153 TYR A N   1 
ATOM   157  C  CA  . TYR A 1 28 ? -21.415 -72.957  8.921   1.00 31.86  ? 153 TYR A CA  1 
ATOM   158  C  C   . TYR A 1 28 ? -22.181 -73.691  7.818   1.00 35.57  ? 153 TYR A C   1 
ATOM   159  O  O   . TYR A 1 28 ? -23.060 -74.502  8.118   1.00 35.11  ? 153 TYR A O   1 
ATOM   160  C  CB  . TYR A 1 28 ? -22.393 -72.386  9.940   1.00 31.95  ? 153 TYR A CB  1 
ATOM   161  C  CG  . TYR A 1 28 ? -21.852 -71.241  10.773  1.00 34.34  ? 153 TYR A CG  1 
ATOM   162  C  CD1 . TYR A 1 28 ? -20.898 -71.463  11.770  1.00 35.55  ? 153 TYR A CD1 1 
ATOM   163  C  CD2 . TYR A 1 28 ? -22.345 -69.946  10.619  1.00 35.86  ? 153 TYR A CD2 1 
ATOM   164  C  CE1 . TYR A 1 28 ? -20.450 -70.423  12.587  1.00 35.26  ? 153 TYR A CE1 1 
ATOM   165  C  CE2 . TYR A 1 28 ? -21.901 -68.898  11.432  1.00 36.95  ? 153 TYR A CE2 1 
ATOM   166  C  CZ  . TYR A 1 28 ? -20.951 -69.141  12.410  1.00 42.55  ? 153 TYR A CZ  1 
ATOM   167  O  OH  . TYR A 1 28 ? -20.509 -68.104  13.192  1.00 44.71  ? 153 TYR A OH  1 
ATOM   168  N  N   . GLY A 1 29 ? -21.829 -73.423  6.564   1.00 31.80  ? 154 GLY A N   1 
ATOM   169  C  CA  . GLY A 1 29 ? -22.485 -74.015  5.412   1.00 31.66  ? 154 GLY A CA  1 
ATOM   170  C  C   . GLY A 1 29 ? -22.329 -75.508  5.286   1.00 36.86  ? 154 GLY A C   1 
ATOM   171  O  O   . GLY A 1 29 ? -23.248 -76.173  4.820   1.00 38.57  ? 154 GLY A O   1 
ATOM   172  N  N   . ALA A 1 30 ? -21.170 -76.042  5.657   1.00 33.64  ? 155 ALA A N   1 
ATOM   173  C  CA  . ALA A 1 30 ? -20.908 -77.474  5.524   1.00 34.79  ? 155 ALA A CA  1 
ATOM   174  C  C   . ALA A 1 30 ? -21.430 -78.277  6.708   1.00 39.77  ? 155 ALA A C   1 
ATOM   175  O  O   . ALA A 1 30 ? -21.886 -79.405  6.539   1.00 39.65  ? 155 ALA A O   1 
ATOM   176  C  CB  . ALA A 1 30 ? -19.421 -77.717  5.338   1.00 36.53  ? 155 ALA A CB  1 
ATOM   177  N  N   . THR A 1 31 ? -21.342 -77.703  7.904   1.00 37.05  ? 156 THR A N   1 
ATOM   178  C  CA  . THR A 1 31 ? -21.754 -78.345  9.143   1.00 37.04  ? 156 THR A CA  1 
ATOM   179  C  C   . THR A 1 31 ? -23.268 -78.236  9.372   1.00 45.03  ? 156 THR A C   1 
ATOM   180  O  O   . THR A 1 31 ? -23.857 -79.145  9.971   1.00 45.24  ? 156 THR A O   1 
ATOM   181  C  CB  . THR A 1 31 ? -20.880 -77.858  10.312  1.00 34.40  ? 156 THR A CB  1 
ATOM   182  O  OG1 . THR A 1 31 ? -20.755 -76.442  10.243  1.00 37.83  ? 156 THR A OG1 1 
ATOM   183  C  CG2 . THR A 1 31 ? -19.509 -78.456  10.291  1.00 26.19  ? 156 THR A CG2 1 
ATOM   184  N  N   . PHE A 1 32 ? -23.892 -77.121  8.889   1.00 42.56  ? 157 PHE A N   1 
ATOM   185  C  CA  . PHE A 1 32 ? -25.332 -76.819  8.990   1.00 41.52  ? 157 PHE A CA  1 
ATOM   186  C  C   . PHE A 1 32 ? -25.885 -76.411  7.580   1.00 46.18  ? 157 PHE A C   1 
ATOM   187  O  O   . PHE A 1 32 ? -26.239 -75.244  7.368   1.00 45.32  ? 157 PHE A O   1 
ATOM   188  C  CB  . PHE A 1 32 ? -25.572 -75.749  10.083  1.00 42.05  ? 157 PHE A CB  1 
ATOM   189  C  CG  . PHE A 1 32 ? -25.139 -76.195  11.471  1.00 43.05  ? 157 PHE A CG  1 
ATOM   190  C  CD1 . PHE A 1 32 ? -23.831 -76.002  11.908  1.00 45.79  ? 157 PHE A CD1 1 
ATOM   191  C  CD2 . PHE A 1 32 ? -26.036 -76.818  12.333  1.00 44.48  ? 157 PHE A CD2 1 
ATOM   192  C  CE1 . PHE A 1 32 ? -23.420 -76.465  13.159  1.00 46.52  ? 157 PHE A CE1 1 
ATOM   193  C  CE2 . PHE A 1 32 ? -25.625 -77.267  13.591  1.00 46.81  ? 157 PHE A CE2 1 
ATOM   194  C  CZ  . PHE A 1 32 ? -24.318 -77.103  13.988  1.00 45.05  ? 157 PHE A CZ  1 
ATOM   195  N  N   . PRO A 1 33 ? -25.950 -77.371  6.600   1.00 43.63  ? 158 PRO A N   1 
ATOM   196  C  CA  . PRO A 1 33 ? -26.382 -77.018  5.234   1.00 44.28  ? 158 PRO A CA  1 
ATOM   197  C  C   . PRO A 1 33 ? -27.832 -76.601  4.993   1.00 48.51  ? 158 PRO A C   1 
ATOM   198  O  O   . PRO A 1 33 ? -28.095 -75.981  3.959   1.00 49.42  ? 158 PRO A O   1 
ATOM   199  C  CB  . PRO A 1 33 ? -25.994 -78.254  4.417   1.00 47.52  ? 158 PRO A CB  1 
ATOM   200  C  CG  . PRO A 1 33 ? -26.053 -79.360  5.376   1.00 51.15  ? 158 PRO A CG  1 
ATOM   201  C  CD  . PRO A 1 33 ? -25.530 -78.789  6.656   1.00 45.25  ? 158 PRO A CD  1 
ATOM   202  N  N   . GLU A 1 34 ? -28.770 -76.964  5.895   1.00 43.15  ? 159 GLU A N   1 
ATOM   203  C  CA  . GLU A 1 34 ? -30.186 -76.599  5.751   1.00 42.36  ? 159 GLU A CA  1 
ATOM   204  C  C   . GLU A 1 34 ? -30.369 -75.119  6.068   1.00 42.67  ? 159 GLU A C   1 
ATOM   205  O  O   . GLU A 1 34 ? -31.186 -74.456  5.448   1.00 40.40  ? 159 GLU A O   1 
ATOM   206  C  CB  . GLU A 1 34 ? -31.057 -77.448  6.693   1.00 44.15  ? 159 GLU A CB  1 
ATOM   207  C  CG  . GLU A 1 34 ? -32.481 -77.698  6.208   1.00 60.15  ? 159 GLU A CG  1 
ATOM   208  C  CD  . GLU A 1 34 ? -32.642 -78.518  4.936   1.00 81.27  ? 159 GLU A CD  1 
ATOM   209  O  OE1 . GLU A 1 34 ? -32.053 -79.622  4.854   1.00 77.49  ? 159 GLU A OE1 1 
ATOM   210  O  OE2 . GLU A 1 34 ? -33.382 -78.065  4.030   1.00 61.62  ? 159 GLU A OE2 1 
ATOM   211  N  N   . TRP A 1 35 ? -29.569 -74.593  7.008   1.00 39.90  ? 160 TRP A N   1 
ATOM   212  C  CA  . TRP A 1 35 ? -29.652 -73.198  7.425   1.00 38.58  ? 160 TRP A CA  1 
ATOM   213  C  C   . TRP A 1 35 ? -28.702 -72.266  6.720   1.00 38.13  ? 160 TRP A C   1 
ATOM   214  O  O   . TRP A 1 35 ? -29.084 -71.119  6.501   1.00 36.59  ? 160 TRP A O   1 
ATOM   215  C  CB  . TRP A 1 35 ? -29.507 -73.057  8.942   1.00 36.83  ? 160 TRP A CB  1 
ATOM   216  C  CG  . TRP A 1 35 ? -30.460 -73.888  9.757   1.00 38.27  ? 160 TRP A CG  1 
ATOM   217  C  CD1 . TRP A 1 35 ? -31.701 -74.326  9.389   1.00 42.08  ? 160 TRP A CD1 1 
ATOM   218  C  CD2 . TRP A 1 35 ? -30.274 -74.308  11.120  1.00 37.54  ? 160 TRP A CD2 1 
ATOM   219  N  NE1 . TRP A 1 35 ? -32.288 -75.017  10.430  1.00 41.66  ? 160 TRP A NE1 1 
ATOM   220  C  CE2 . TRP A 1 35 ? -31.429 -75.028  11.500  1.00 41.89  ? 160 TRP A CE2 1 
ATOM   221  C  CE3 . TRP A 1 35 ? -29.240 -74.147  12.057  1.00 37.91  ? 160 TRP A CE3 1 
ATOM   222  C  CZ2 . TRP A 1 35 ? -31.550 -75.632  12.751  1.00 40.56  ? 160 TRP A CZ2 1 
ATOM   223  C  CZ3 . TRP A 1 35 ? -29.377 -74.725  13.306  1.00 38.88  ? 160 TRP A CZ3 1 
ATOM   224  C  CH2 . TRP A 1 35 ? -30.509 -75.475  13.633  1.00 39.75  ? 160 TRP A CH2 1 
ATOM   225  N  N   . PHE A 1 36 ? -27.475 -72.727  6.370   1.00 33.78  ? 161 PHE A N   1 
ATOM   226  C  CA  . PHE A 1 36 ? -26.443 -71.869  5.737   1.00 33.53  ? 161 PHE A CA  1 
ATOM   227  C  C   . PHE A 1 36 ? -25.690 -72.483  4.516   1.00 39.64  ? 161 PHE A C   1 
ATOM   228  O  O   . PHE A 1 36 ? -24.606 -72.000  4.154   1.00 38.00  ? 161 PHE A O   1 
ATOM   229  C  CB  . PHE A 1 36 ? -25.421 -71.395  6.798   1.00 33.56  ? 161 PHE A CB  1 
ATOM   230  C  CG  . PHE A 1 36 ? -25.949 -70.826  8.097   1.00 33.40  ? 161 PHE A CG  1 
ATOM   231  C  CD1 . PHE A 1 36 ? -26.262 -69.476  8.209   1.00 36.36  ? 161 PHE A CD1 1 
ATOM   232  C  CD2 . PHE A 1 36 ? -26.069 -71.628  9.230   1.00 34.24  ? 161 PHE A CD2 1 
ATOM   233  C  CE1 . PHE A 1 36 ? -26.713 -68.938  9.431   1.00 36.83  ? 161 PHE A CE1 1 
ATOM   234  C  CE2 . PHE A 1 36 ? -26.500 -71.089  10.454  1.00 36.00  ? 161 PHE A CE2 1 
ATOM   235  C  CZ  . PHE A 1 36 ? -26.822 -69.748  10.547  1.00 34.32  ? 161 PHE A CZ  1 
ATOM   236  N  N   . GLY A 1 37 ? -26.296 -73.493  3.876   1.00 39.03  ? 162 GLY A N   1 
ATOM   237  C  CA  . GLY A 1 37 ? -25.723 -74.236  2.746   1.00 40.73  ? 162 GLY A CA  1 
ATOM   238  C  C   . GLY A 1 37 ? -25.495 -73.520  1.425   1.00 45.55  ? 162 GLY A C   1 
ATOM   239  O  O   . GLY A 1 37 ? -24.895 -74.102  0.521   1.00 46.50  ? 162 GLY A O   1 
ATOM   240  N  N   . ASP A 1 38 ? -26.031 -72.294  1.280   1.00 41.71  ? 163 ASP A N   1 
ATOM   241  C  CA  . ASP A 1 38 ? -25.898 -71.382  0.132   1.00 42.70  ? 163 ASP A CA  1 
ATOM   242  C  C   . ASP A 1 38 ? -26.185 -69.946  0.592   1.00 46.37  ? 163 ASP A C   1 
ATOM   243  O  O   . ASP A 1 38 ? -26.579 -69.769  1.748   1.00 45.73  ? 163 ASP A O   1 
ATOM   244  C  CB  . ASP A 1 38 ? -26.729 -71.805  -1.110  1.00 46.04  ? 163 ASP A CB  1 
ATOM   245  C  CG  . ASP A 1 38 ? -28.170 -72.238  -0.894  1.00 53.25  ? 163 ASP A CG  1 
ATOM   246  O  OD1 . ASP A 1 38 ? -29.031 -71.354  -0.707  1.00 54.74  ? 163 ASP A OD1 1 
ATOM   247  O  OD2 . ASP A 1 38 ? -28.460 -73.450  -1.063  1.00 54.58  ? 163 ASP A OD2 1 
ATOM   248  N  N   . LEU A 1 39 ? -25.955 -68.921  -0.262  1.00 42.96  ? 164 LEU A N   1 
ATOM   249  C  CA  . LEU A 1 39 ? -26.205 -67.531  0.153   1.00 41.81  ? 164 LEU A CA  1 
ATOM   250  C  C   . LEU A 1 39 ? -27.680 -67.298  0.513   1.00 46.48  ? 164 LEU A C   1 
ATOM   251  O  O   . LEU A 1 39 ? -27.951 -66.680  1.544   1.00 45.06  ? 164 LEU A O   1 
ATOM   252  C  CB  . LEU A 1 39 ? -25.703 -66.503  -0.885  1.00 42.82  ? 164 LEU A CB  1 
ATOM   253  C  CG  . LEU A 1 39 ? -25.683 -65.016  -0.460  1.00 46.13  ? 164 LEU A CG  1 
ATOM   254  C  CD1 . LEU A 1 39 ? -24.649 -64.748  0.611   1.00 44.85  ? 164 LEU A CD1 1 
ATOM   255  C  CD2 . LEU A 1 39 ? -25.388 -64.119  -1.637  1.00 50.23  ? 164 LEU A CD2 1 
ATOM   256  N  N   . SER A 1 40 ? -28.617 -67.844  -0.312  1.00 44.17  ? 165 SER A N   1 
ATOM   257  C  CA  . SER A 1 40 ? -30.077 -67.756  -0.152  1.00 43.39  ? 165 SER A CA  1 
ATOM   258  C  C   . SER A 1 40 ? -30.564 -68.242  1.216   1.00 45.28  ? 165 SER A C   1 
ATOM   259  O  O   . SER A 1 40 ? -31.266 -67.499  1.915   1.00 46.15  ? 165 SER A O   1 
ATOM   260  C  CB  . SER A 1 40 ? -30.783 -68.529  -1.257  1.00 47.60  ? 165 SER A CB  1 
ATOM   261  O  OG  . SER A 1 40 ? -30.878 -67.739  -2.428  1.00 62.55  ? 165 SER A OG  1 
ATOM   262  N  N   . LYS A 1 41 ? -30.179 -69.479  1.601   1.00 37.73  ? 166 LYS A N   1 
ATOM   263  C  CA  . LYS A 1 41 ? -30.546 -70.085  2.873   1.00 34.43  ? 166 LYS A CA  1 
ATOM   264  C  C   . LYS A 1 41 ? -30.029 -69.228  4.004   1.00 37.87  ? 166 LYS A C   1 
ATOM   265  O  O   . LYS A 1 41 ? -30.758 -69.038  4.975   1.00 37.09  ? 166 LYS A O   1 
ATOM   266  C  CB  . LYS A 1 41 ? -29.974 -71.497  2.977   1.00 35.10  ? 166 LYS A CB  1 
ATOM   267  C  CG  . LYS A 1 41 ? -30.653 -72.535  2.099   1.00 29.24  ? 166 LYS A CG  1 
ATOM   268  C  CD  . LYS A 1 41 ? -29.855 -73.816  2.167   1.00 36.14  ? 166 LYS A CD  1 
ATOM   269  C  CE  . LYS A 1 41 ? -30.513 -75.028  1.564   1.00 46.19  ? 166 LYS A CE  1 
ATOM   270  N  NZ  . LYS A 1 41 ? -29.649 -76.237  1.726   1.00 57.68  ? 166 LYS A NZ  1 
ATOM   271  N  N   . SER A 1 42 ? -28.789 -68.667  3.849   1.00 35.11  ? 167 SER A N   1 
ATOM   272  C  CA  . SER A 1 42 ? -28.082 -67.790  4.808   1.00 34.03  ? 167 SER A CA  1 
ATOM   273  C  C   . SER A 1 42 ? -28.775 -66.434  5.016   1.00 37.33  ? 167 SER A C   1 
ATOM   274  O  O   . SER A 1 42 ? -28.917 -66.018  6.167   1.00 37.20  ? 167 SER A O   1 
ATOM   275  C  CB  . SER A 1 42 ? -26.623 -67.585  4.400   1.00 38.57  ? 167 SER A CB  1 
ATOM   276  O  OG  . SER A 1 42 ? -25.809 -68.700  4.724   1.00 47.27  ? 167 SER A OG  1 
ATOM   277  N  N   . LEU A 1 43 ? -29.208 -65.751  3.923   1.00 33.60  ? 168 LEU A N   1 
ATOM   278  C  CA  . LEU A 1 43 ? -29.954 -64.477  3.991   1.00 33.98  ? 168 LEU A CA  1 
ATOM   279  C  C   . LEU A 1 43 ? -31.325 -64.711  4.685   1.00 37.51  ? 168 LEU A C   1 
ATOM   280  O  O   . LEU A 1 43 ? -31.767 -63.874  5.481   1.00 37.23  ? 168 LEU A O   1 
ATOM   281  C  CB  . LEU A 1 43 ? -30.184 -63.875  2.592   1.00 35.48  ? 168 LEU A CB  1 
ATOM   282  C  CG  . LEU A 1 43 ? -28.957 -63.435  1.798   1.00 40.66  ? 168 LEU A CG  1 
ATOM   283  C  CD1 . LEU A 1 43 ? -29.242 -63.495  0.318   1.00 42.16  ? 168 LEU A CD1 1 
ATOM   284  C  CD2 . LEU A 1 43 ? -28.496 -62.041  2.204   1.00 41.75  ? 168 LEU A CD2 1 
ATOM   285  N  N   . TYR A 1 44 ? -31.971 -65.869  4.399   1.00 32.91  ? 169 TYR A N   1 
ATOM   286  C  CA  . TYR A 1 44 ? -33.229 -66.250  5.017   1.00 32.31  ? 169 TYR A CA  1 
ATOM   287  C  C   . TYR A 1 44 ? -33.050 -66.445  6.541   1.00 36.25  ? 169 TYR A C   1 
ATOM   288  O  O   . TYR A 1 44 ? -33.840 -65.906  7.337   1.00 35.28  ? 169 TYR A O   1 
ATOM   289  C  CB  . TYR A 1 44 ? -33.828 -67.522  4.377   1.00 33.40  ? 169 TYR A CB  1 
ATOM   290  C  CG  . TYR A 1 44 ? -35.106 -67.947  5.077   1.00 35.71  ? 169 TYR A CG  1 
ATOM   291  C  CD1 . TYR A 1 44 ? -36.331 -67.371  4.744   1.00 39.13  ? 169 TYR A CD1 1 
ATOM   292  C  CD2 . TYR A 1 44 ? -35.074 -68.828  6.158   1.00 34.79  ? 169 TYR A CD2 1 
ATOM   293  C  CE1 . TYR A 1 44 ? -37.495 -67.691  5.441   1.00 40.42  ? 169 TYR A CE1 1 
ATOM   294  C  CE2 . TYR A 1 44 ? -36.229 -69.150  6.864   1.00 35.39  ? 169 TYR A CE2 1 
ATOM   295  C  CZ  . TYR A 1 44 ? -37.438 -68.578  6.505   1.00 46.32  ? 169 TYR A CZ  1 
ATOM   296  O  OH  . TYR A 1 44 ? -38.589 -68.929  7.175   1.00 50.19  ? 169 TYR A OH  1 
ATOM   297  N  N   . THR A 1 45 ? -32.041 -67.261  6.927   1.00 32.07  ? 170 THR A N   1 
ATOM   298  C  CA  . THR A 1 45 ? -31.749 -67.581  8.317   1.00 31.10  ? 170 THR A CA  1 
ATOM   299  C  C   . THR A 1 45 ? -31.412 -66.323  9.093   1.00 36.81  ? 170 THR A C   1 
ATOM   300  O  O   . THR A 1 45 ? -31.975 -66.117  10.164  1.00 36.83  ? 170 THR A O   1 
ATOM   301  C  CB  . THR A 1 45 ? -30.697 -68.683  8.413   1.00 37.19  ? 170 THR A CB  1 
ATOM   302  O  OG1 . THR A 1 45 ? -31.150 -69.781  7.632   1.00 43.04  ? 170 THR A OG1 1 
ATOM   303  C  CG2 . THR A 1 45 ? -30.473 -69.166  9.840   1.00 32.03  ? 170 THR A CG2 1 
ATOM   304  N  N   . LEU A 1 46 ? -30.554 -65.455  8.531   1.00 34.36  ? 171 LEU A N   1 
ATOM   305  C  CA  . LEU A 1 46 ? -30.159 -64.212  9.193   1.00 34.43  ? 171 LEU A CA  1 
ATOM   306  C  C   . LEU A 1 46 ? -31.290 -63.183  9.320   1.00 41.46  ? 171 LEU A C   1 
ATOM   307  O  O   . LEU A 1 46 ? -31.254 -62.353  10.234  1.00 42.73  ? 171 LEU A O   1 
ATOM   308  C  CB  . LEU A 1 46 ? -28.859 -63.633  8.622   1.00 34.33  ? 171 LEU A CB  1 
ATOM   309  C  CG  . LEU A 1 46 ? -27.605 -64.479  8.874   1.00 37.20  ? 171 LEU A CG  1 
ATOM   310  C  CD1 . LEU A 1 46 ? -26.493 -64.035  8.003   1.00 37.51  ? 171 LEU A CD1 1 
ATOM   311  C  CD2 . LEU A 1 46 ? -27.157 -64.419  10.329  1.00 39.72  ? 171 LEU A CD2 1 
ATOM   312  N  N   . PHE A 1 47 ? -32.331 -63.275  8.462   1.00 38.24  ? 172 PHE A N   1 
ATOM   313  C  CA  . PHE A 1 47 ? -33.502 -62.402  8.589   1.00 38.27  ? 172 PHE A CA  1 
ATOM   314  C  C   . PHE A 1 47 ? -34.283 -62.877  9.826   1.00 42.98  ? 172 PHE A C   1 
ATOM   315  O  O   . PHE A 1 47 ? -34.732 -62.053  10.625  1.00 43.88  ? 172 PHE A O   1 
ATOM   316  C  CB  . PHE A 1 47 ? -34.383 -62.436  7.320   1.00 39.60  ? 172 PHE A CB  1 
ATOM   317  C  CG  . PHE A 1 47 ? -35.649 -61.611  7.441   1.00 41.28  ? 172 PHE A CG  1 
ATOM   318  C  CD1 . PHE A 1 47 ? -35.631 -60.239  7.214   1.00 44.67  ? 172 PHE A CD1 1 
ATOM   319  C  CD2 . PHE A 1 47 ? -36.855 -62.203  7.794   1.00 42.29  ? 172 PHE A CD2 1 
ATOM   320  C  CE1 . PHE A 1 47 ? -36.792 -59.476  7.345   1.00 46.22  ? 172 PHE A CE1 1 
ATOM   321  C  CE2 . PHE A 1 47 ? -38.015 -61.439  7.926   1.00 45.92  ? 172 PHE A CE2 1 
ATOM   322  C  CZ  . PHE A 1 47 ? -37.974 -60.081  7.699   1.00 45.33  ? 172 PHE A CZ  1 
ATOM   323  N  N   . GLN A 1 48 ? -34.418 -64.217  9.970   1.00 37.69  ? 173 GLN A N   1 
ATOM   324  C  CA  . GLN A 1 48 ? -35.089 -64.882  11.076  1.00 36.31  ? 173 GLN A CA  1 
ATOM   325  C  C   . GLN A 1 48 ? -34.325 -64.613  12.385  1.00 41.18  ? 173 GLN A C   1 
ATOM   326  O  O   . GLN A 1 48 ? -34.948 -64.284  13.396  1.00 41.99  ? 173 GLN A O   1 
ATOM   327  C  CB  . GLN A 1 48 ? -35.210 -66.385  10.786  1.00 35.84  ? 173 GLN A CB  1 
ATOM   328  C  CG  . GLN A 1 48 ? -35.609 -67.191  12.005  1.00 36.46  ? 173 GLN A CG  1 
ATOM   329  C  CD  . GLN A 1 48 ? -35.257 -68.641  11.910  1.00 46.06  ? 173 GLN A CD  1 
ATOM   330  O  OE1 . GLN A 1 48 ? -35.242 -69.237  10.821  1.00 37.62  ? 173 GLN A OE1 1 
ATOM   331  N  NE2 . GLN A 1 48 ? -35.040 -69.258  13.076  1.00 30.74  ? 173 GLN A NE2 1 
ATOM   332  N  N   . VAL A 1 49 ? -32.983 -64.739  12.360  1.00 37.71  ? 174 VAL A N   1 
ATOM   333  C  CA  . VAL A 1 49 ? -32.118 -64.462  13.519  1.00 37.72  ? 174 VAL A CA  1 
ATOM   334  C  C   . VAL A 1 49 ? -32.354 -62.996  13.938  1.00 46.47  ? 174 VAL A C   1 
ATOM   335  O  O   . VAL A 1 49 ? -32.554 -62.731  15.128  1.00 47.98  ? 174 VAL A O   1 
ATOM   336  C  CB  . VAL A 1 49 ? -30.604 -64.772  13.272  1.00 39.24  ? 174 VAL A CB  1 
ATOM   337  C  CG1 . VAL A 1 49 ? -29.741 -64.284  14.434  1.00 38.83  ? 174 VAL A CG1 1 
ATOM   338  C  CG2 . VAL A 1 49 ? -30.366 -66.264  13.032  1.00 37.42  ? 174 VAL A CG2 1 
ATOM   339  N  N   . MET A 1 50 ? -32.413 -62.070  12.953  1.00 43.88  ? 175 MET A N   1 
ATOM   340  C  CA  . MET A 1 50 ? -32.680 -60.654  13.203  1.00 45.44  ? 175 MET A CA  1 
ATOM   341  C  C   . MET A 1 50 ? -34.021 -60.462  13.928  1.00 49.68  ? 175 MET A C   1 
ATOM   342  O  O   . MET A 1 50 ? -34.057 -59.755  14.938  1.00 51.01  ? 175 MET A O   1 
ATOM   343  C  CB  . MET A 1 50 ? -32.652 -59.856  11.894  1.00 48.95  ? 175 MET A CB  1 
ATOM   344  C  CG  . MET A 1 50 ? -32.715 -58.360  12.099  1.00 54.71  ? 175 MET A CG  1 
ATOM   345  S  SD  . MET A 1 50 ? -32.826 -57.492  10.528  1.00 60.24  ? 175 MET A SD  1 
ATOM   346  C  CE  . MET A 1 50 ? -34.552 -57.691  10.182  1.00 57.89  ? 175 MET A CE  1 
ATOM   347  N  N   . THR A 1 51 ? -35.099 -61.138  13.454  1.00 44.49  ? 176 THR A N   1 
ATOM   348  C  CA  . THR A 1 51 ? -36.438 -61.058  14.064  1.00 44.51  ? 176 THR A CA  1 
ATOM   349  C  C   . THR A 1 51 ? -36.488 -61.734  15.448  1.00 46.05  ? 176 THR A C   1 
ATOM   350  O  O   . THR A 1 51 ? -37.504 -61.649  16.141  1.00 45.14  ? 176 THR A O   1 
ATOM   351  C  CB  . THR A 1 51 ? -37.530 -61.537  13.092  1.00 51.54  ? 176 THR A CB  1 
ATOM   352  O  OG1 . THR A 1 51 ? -37.317 -62.916  12.793  1.00 53.02  ? 176 THR A OG1 1 
ATOM   353  C  CG2 . THR A 1 51 ? -37.604 -60.696  11.808  1.00 47.14  ? 176 THR A CG2 1 
ATOM   354  N  N   . LEU A 1 52 ? -35.351 -62.377  15.852  1.00 41.33  ? 177 LEU A N   1 
ATOM   355  C  CA  . LEU A 1 52 ? -35.101 -63.053  17.141  1.00 39.56  ? 177 LEU A CA  1 
ATOM   356  C  C   . LEU A 1 52 ? -35.851 -64.372  17.300  1.00 40.94  ? 177 LEU A C   1 
ATOM   357  O  O   . LEU A 1 52 ? -35.879 -64.929  18.391  1.00 40.85  ? 177 LEU A O   1 
ATOM   358  C  CB  . LEU A 1 52 ? -35.361 -62.100  18.333  1.00 40.78  ? 177 LEU A CB  1 
ATOM   359  C  CG  . LEU A 1 52 ? -34.543 -60.811  18.341  1.00 46.07  ? 177 LEU A CG  1 
ATOM   360  C  CD1 . LEU A 1 52 ? -35.200 -59.747  19.187  1.00 48.13  ? 177 LEU A CD1 1 
ATOM   361  C  CD2 . LEU A 1 52 ? -33.113 -61.069  18.771  1.00 47.17  ? 177 LEU A CD2 1 
ATOM   362  N  N   . GLU A 1 53 ? -36.445 -64.877  16.205  1.00 35.03  ? 178 GLU A N   1 
ATOM   363  C  CA  . GLU A 1 53 ? -37.229 -66.107  16.193  1.00 33.38  ? 178 GLU A CA  1 
ATOM   364  C  C   . GLU A 1 53 ? -36.314 -67.300  16.288  1.00 34.36  ? 178 GLU A C   1 
ATOM   365  O  O   . GLU A 1 53 ? -35.430 -67.439  15.465  1.00 34.60  ? 178 GLU A O   1 
ATOM   366  C  CB  . GLU A 1 53 ? -38.127 -66.161  14.937  1.00 34.91  ? 178 GLU A CB  1 
ATOM   367  C  CG  . GLU A 1 53 ? -39.367 -67.010  15.125  1.00 41.11  ? 178 GLU A CG  1 
ATOM   368  C  CD  . GLU A 1 53 ? -39.161 -68.481  14.842  1.00 57.58  ? 178 GLU A CD  1 
ATOM   369  O  OE1 . GLU A 1 53 ? -38.896 -69.243  15.796  1.00 38.51  ? 178 GLU A OE1 1 
ATOM   370  O  OE2 . GLU A 1 53 ? -39.258 -68.875  13.661  1.00 59.49  ? 178 GLU A OE2 1 
ATOM   371  N  N   . SER A 1 54 ? -36.500 -68.139  17.302  1.00 31.33  ? 179 SER A N   1 
ATOM   372  C  CA  . SER A 1 54 ? -35.689 -69.337  17.610  1.00 30.97  ? 179 SER A CA  1 
ATOM   373  C  C   . SER A 1 54 ? -34.177 -69.135  17.410  1.00 34.52  ? 179 SER A C   1 
ATOM   374  O  O   . SER A 1 54 ? -33.476 -70.068  17.011  1.00 32.72  ? 179 SER A O   1 
ATOM   375  C  CB  . SER A 1 54 ? -36.189 -70.559  16.836  1.00 33.70  ? 179 SER A CB  1 
ATOM   376  O  OG  . SER A 1 54 ? -37.477 -70.997  17.244  1.00 39.20  ? 179 SER A OG  1 
ATOM   377  N  N   . TRP A 1 55 ? -33.687 -67.908  17.654  1.00 33.75  ? 180 TRP A N   1 
ATOM   378  C  CA  . TRP A 1 55 ? -32.294 -67.555  17.407  1.00 34.99  ? 180 TRP A CA  1 
ATOM   379  C  C   . TRP A 1 55 ? -31.300 -68.391  18.195  1.00 37.50  ? 180 TRP A C   1 
ATOM   380  O  O   . TRP A 1 55 ? -30.382 -68.942  17.607  1.00 35.61  ? 180 TRP A O   1 
ATOM   381  C  CB  . TRP A 1 55 ? -32.055 -66.037  17.532  1.00 36.16  ? 180 TRP A CB  1 
ATOM   382  C  CG  . TRP A 1 55 ? -31.762 -65.516  18.915  1.00 38.67  ? 180 TRP A CG  1 
ATOM   383  C  CD1 . TRP A 1 55 ? -32.625 -64.863  19.738  1.00 43.03  ? 180 TRP A CD1 1 
ATOM   384  C  CD2 . TRP A 1 55 ? -30.488 -65.513  19.585  1.00 38.65  ? 180 TRP A CD2 1 
ATOM   385  N  NE1 . TRP A 1 55 ? -31.985 -64.498  20.904  1.00 43.26  ? 180 TRP A NE1 1 
ATOM   386  C  CE2 . TRP A 1 55 ? -30.673 -64.880  20.835  1.00 43.80  ? 180 TRP A CE2 1 
ATOM   387  C  CE3 . TRP A 1 55 ? -29.207 -65.987  19.252  1.00 39.30  ? 180 TRP A CE3 1 
ATOM   388  C  CZ2 . TRP A 1 55 ? -29.630 -64.716  21.757  1.00 43.85  ? 180 TRP A CZ2 1 
ATOM   389  C  CZ3 . TRP A 1 55 ? -28.169 -65.813  20.165  1.00 41.44  ? 180 TRP A CZ3 1 
ATOM   390  C  CH2 . TRP A 1 55 ? -28.382 -65.178  21.397  1.00 43.24  ? 180 TRP A CH2 1 
ATOM   391  N  N   . SER A 1 56 ? -31.525 -68.536  19.506  1.00 34.51  ? 181 SER A N   1 
ATOM   392  C  CA  . SER A 1 56 ? -30.662 -69.321  20.373  1.00 33.98  ? 181 SER A CA  1 
ATOM   393  C  C   . SER A 1 56 ? -31.053 -70.824  20.397  1.00 35.88  ? 181 SER A C   1 
ATOM   394  O  O   . SER A 1 56 ? -30.259 -71.659  19.983  1.00 35.83  ? 181 SER A O   1 
ATOM   395  C  CB  . SER A 1 56 ? -30.633 -68.713  21.771  1.00 38.77  ? 181 SER A CB  1 
ATOM   396  O  OG  . SER A 1 56 ? -29.873 -69.466  22.701  1.00 48.51  ? 181 SER A OG  1 
ATOM   397  N  N   . MET A 1 57 ? -32.262 -71.164  20.829  1.00 30.96  ? 182 MET A N   1 
ATOM   398  C  CA  . MET A 1 57 ? -32.674 -72.566  20.932  1.00 30.32  ? 182 MET A CA  1 
ATOM   399  C  C   . MET A 1 57 ? -32.709 -73.317  19.602  1.00 35.35  ? 182 MET A C   1 
ATOM   400  O  O   . MET A 1 57 ? -32.183 -74.429  19.513  1.00 34.19  ? 182 MET A O   1 
ATOM   401  C  CB  . MET A 1 57 ? -34.009 -72.717  21.689  1.00 33.09  ? 182 MET A CB  1 
ATOM   402  C  CG  . MET A 1 57 ? -34.068 -71.952  23.011  1.00 37.53  ? 182 MET A CG  1 
ATOM   403  S  SD  . MET A 1 57 ? -32.865 -72.376  24.300  1.00 41.68  ? 182 MET A SD  1 
ATOM   404  C  CE  . MET A 1 57 ? -33.621 -73.819  24.990  1.00 39.10  ? 182 MET A CE  1 
ATOM   405  N  N   . GLY A 1 58 ? -33.331 -72.691  18.598  1.00 33.10  ? 183 GLY A N   1 
ATOM   406  C  CA  . GLY A 1 58 ? -33.538 -73.233  17.263  1.00 31.79  ? 183 GLY A CA  1 
ATOM   407  C  C   . GLY A 1 58 ? -32.340 -73.168  16.348  1.00 34.59  ? 183 GLY A C   1 
ATOM   408  O  O   . GLY A 1 58 ? -32.186 -74.079  15.539  1.00 33.28  ? 183 GLY A O   1 
ATOM   409  N  N   . ILE A 1 59 ? -31.480 -72.108  16.454  1.00 32.07  ? 184 ILE A N   1 
ATOM   410  C  CA  . ILE A 1 59 ? -30.303 -71.938  15.567  1.00 32.53  ? 184 ILE A CA  1 
ATOM   411  C  C   . ILE A 1 59 ? -28.892 -71.933  16.219  1.00 37.12  ? 184 ILE A C   1 
ATOM   412  O  O   . ILE A 1 59 ? -28.072 -72.811  15.929  1.00 36.76  ? 184 ILE A O   1 
ATOM   413  C  CB  . ILE A 1 59 ? -30.464 -70.741  14.555  1.00 35.97  ? 184 ILE A CB  1 
ATOM   414  C  CG1 . ILE A 1 59 ? -31.846 -70.706  13.805  1.00 36.95  ? 184 ILE A CG1 1 
ATOM   415  C  CG2 . ILE A 1 59 ? -29.253 -70.581  13.605  1.00 34.90  ? 184 ILE A CG2 1 
ATOM   416  C  CD1 . ILE A 1 59 ? -32.177 -71.827  12.773  1.00 40.04  ? 184 ILE A CD1 1 
ATOM   417  N  N   . VAL A 1 60 ? -28.603 -70.897  17.018  1.00 34.00  ? 185 VAL A N   1 
ATOM   418  C  CA  . VAL A 1 60 ? -27.305 -70.625  17.626  1.00 34.24  ? 185 VAL A CA  1 
ATOM   419  C  C   . VAL A 1 60 ? -26.776 -71.683  18.626  1.00 37.64  ? 185 VAL A C   1 
ATOM   420  O  O   . VAL A 1 60 ? -25.599 -72.025  18.542  1.00 37.49  ? 185 VAL A O   1 
ATOM   421  C  CB  . VAL A 1 60 ? -27.177 -69.137  18.070  1.00 39.08  ? 185 VAL A CB  1 
ATOM   422  C  CG1 . VAL A 1 60 ? -25.785 -68.819  18.584  1.00 39.04  ? 185 VAL A CG1 1 
ATOM   423  C  CG2 . VAL A 1 60 ? -27.518 -68.197  16.915  1.00 38.92  ? 185 VAL A CG2 1 
ATOM   424  N  N   . ARG A 1 61 ? -27.618 -72.206  19.543  1.00 33.35  ? 186 ARG A N   1 
ATOM   425  C  CA  . ARG A 1 61 ? -27.206 -73.289  20.451  1.00 32.78  ? 186 ARG A CA  1 
ATOM   426  C  C   . ARG A 1 61 ? -26.814 -74.533  19.608  1.00 37.77  ? 186 ARG A C   1 
ATOM   427  O  O   . ARG A 1 61 ? -25.653 -74.935  19.729  1.00 37.43  ? 186 ARG A O   1 
ATOM   428  C  CB  . ARG A 1 61 ? -28.280 -73.634  21.499  1.00 31.43  ? 186 ARG A CB  1 
ATOM   429  C  CG  . ARG A 1 61 ? -28.453 -72.578  22.579  1.00 40.84  ? 186 ARG A CG  1 
ATOM   430  C  CD  . ARG A 1 61 ? -29.258 -73.109  23.757  1.00 40.64  ? 186 ARG A CD  1 
ATOM   431  N  NE  . ARG A 1 61 ? -29.390 -72.124  24.831  1.00 37.82  ? 186 ARG A NE  1 
ATOM   432  C  CZ  . ARG A 1 61 ? -28.458 -71.901  25.755  1.00 49.52  ? 186 ARG A CZ  1 
ATOM   433  N  NH1 . ARG A 1 61 ? -27.312 -72.576  25.728  1.00 31.77  ? 186 ARG A NH1 1 
ATOM   434  N  NH2 . ARG A 1 61 ? -28.656 -70.988  26.702  1.00 30.79  ? 186 ARG A NH2 1 
ATOM   435  N  N   . PRO A 1 62 ? -27.664 -75.078  18.668  1.00 35.16  ? 187 PRO A N   1 
ATOM   436  C  CA  . PRO A 1 62 ? -27.201 -76.205  17.829  1.00 35.00  ? 187 PRO A CA  1 
ATOM   437  C  C   . PRO A 1 62 ? -25.910 -75.911  17.070  1.00 38.74  ? 187 PRO A C   1 
ATOM   438  O  O   . PRO A 1 62 ? -25.072 -76.813  16.958  1.00 39.52  ? 187 PRO A O   1 
ATOM   439  C  CB  . PRO A 1 62 ? -28.363 -76.429  16.866  1.00 36.80  ? 187 PRO A CB  1 
ATOM   440  C  CG  . PRO A 1 62 ? -29.559 -75.945  17.624  1.00 40.98  ? 187 PRO A CG  1 
ATOM   441  C  CD  . PRO A 1 62 ? -29.068 -74.736  18.338  1.00 36.31  ? 187 PRO A CD  1 
ATOM   442  N  N   . VAL A 1 63 ? -25.722 -74.657  16.583  1.00 34.08  ? 188 VAL A N   1 
ATOM   443  C  CA  . VAL A 1 63 ? -24.480 -74.281  15.886  1.00 33.87  ? 188 VAL A CA  1 
ATOM   444  C  C   . VAL A 1 63 ? -23.268 -74.352  16.834  1.00 37.89  ? 188 VAL A C   1 
ATOM   445  O  O   . VAL A 1 63 ? -22.311 -75.073  16.536  1.00 39.01  ? 188 VAL A O   1 
ATOM   446  C  CB  . VAL A 1 63 ? -24.562 -72.972  15.045  1.00 37.62  ? 188 VAL A CB  1 
ATOM   447  C  CG1 . VAL A 1 63 ? -23.179 -72.485  14.610  1.00 37.53  ? 188 VAL A CG1 1 
ATOM   448  C  CG2 . VAL A 1 63 ? -25.454 -73.168  13.826  1.00 37.59  ? 188 VAL A CG2 1 
ATOM   449  N  N   . MET A 1 64 ? -23.357 -73.678  18.007  1.00 32.29  ? 189 MET A N   1 
ATOM   450  C  CA  . MET A 1 64 ? -22.328 -73.638  19.037  1.00 31.47  ? 189 MET A CA  1 
ATOM   451  C  C   . MET A 1 64 ? -21.879 -75.005  19.502  1.00 38.04  ? 189 MET A C   1 
ATOM   452  O  O   . MET A 1 64 ? -20.784 -75.126  20.049  1.00 39.97  ? 189 MET A O   1 
ATOM   453  C  CB  . MET A 1 64 ? -22.791 -72.837  20.228  1.00 33.76  ? 189 MET A CB  1 
ATOM   454  C  CG  . MET A 1 64 ? -22.570 -71.364  20.103  1.00 37.67  ? 189 MET A CG  1 
ATOM   455  S  SD  . MET A 1 64 ? -22.764 -70.561  21.730  1.00 43.48  ? 189 MET A SD  1 
ATOM   456  C  CE  . MET A 1 64 ? -24.421 -71.221  22.295  1.00 39.51  ? 189 MET A CE  1 
ATOM   457  N  N   . ASN A 1 65 ? -22.704 -76.039  19.288  1.00 35.40  ? 190 ASN A N   1 
ATOM   458  C  CA  . ASN A 1 65 ? -22.358 -77.419  19.645  1.00 36.09  ? 190 ASN A CA  1 
ATOM   459  C  C   . ASN A 1 65 ? -21.188 -77.941  18.782  1.00 39.78  ? 190 ASN A C   1 
ATOM   460  O  O   . ASN A 1 65 ? -20.420 -78.787  19.247  1.00 40.68  ? 190 ASN A O   1 
ATOM   461  C  CB  . ASN A 1 65 ? -23.579 -78.338  19.557  1.00 37.13  ? 190 ASN A CB  1 
ATOM   462  C  CG  . ASN A 1 65 ? -23.648 -79.315  20.690  1.00 67.76  ? 190 ASN A CG  1 
ATOM   463  O  OD1 . ASN A 1 65 ? -22.710 -80.092  20.943  1.00 67.99  ? 190 ASN A OD1 1 
ATOM   464  N  ND2 . ASN A 1 65 ? -24.745 -79.260  21.426  1.00 59.08  ? 190 ASN A ND2 1 
ATOM   465  N  N   . VAL A 1 66 ? -21.037 -77.394  17.553  1.00 34.64  ? 191 VAL A N   1 
ATOM   466  C  CA  . VAL A 1 66 ? -19.947 -77.699  16.617  1.00 34.43  ? 191 VAL A CA  1 
ATOM   467  C  C   . VAL A 1 66 ? -18.878 -76.567  16.630  1.00 38.67  ? 191 VAL A C   1 
ATOM   468  O  O   . VAL A 1 66 ? -17.683 -76.864  16.707  1.00 38.24  ? 191 VAL A O   1 
ATOM   469  C  CB  . VAL A 1 66 ? -20.464 -78.080  15.198  1.00 37.06  ? 191 VAL A CB  1 
ATOM   470  C  CG1 . VAL A 1 66 ? -19.314 -78.339  14.224  1.00 37.12  ? 191 VAL A CG1 1 
ATOM   471  C  CG2 . VAL A 1 66 ? -21.379 -79.302  15.269  1.00 36.84  ? 191 VAL A CG2 1 
ATOM   472  N  N   . HIS A 1 67 ? -19.313 -75.292  16.611  1.00 35.76  ? 192 HIS A N   1 
ATOM   473  C  CA  . HIS A 1 67 ? -18.429 -74.123  16.641  1.00 37.55  ? 192 HIS A CA  1 
ATOM   474  C  C   . HIS A 1 67 ? -18.660 -73.369  17.944  1.00 43.83  ? 192 HIS A C   1 
ATOM   475  O  O   . HIS A 1 67 ? -19.516 -72.487  17.987  1.00 43.49  ? 192 HIS A O   1 
ATOM   476  C  CB  . HIS A 1 67 ? -18.674 -73.223  15.416  1.00 39.25  ? 192 HIS A CB  1 
ATOM   477  C  CG  . HIS A 1 67 ? -18.899 -74.004  14.153  1.00 43.13  ? 192 HIS A CG  1 
ATOM   478  N  ND1 . HIS A 1 67 ? -20.130 -74.570  13.873  1.00 44.43  ? 192 HIS A ND1 1 
ATOM   479  C  CD2 . HIS A 1 67 ? -18.024 -74.364  13.187  1.00 45.09  ? 192 HIS A CD2 1 
ATOM   480  C  CE1 . HIS A 1 67 ? -19.978 -75.209  12.727  1.00 43.96  ? 192 HIS A CE1 1 
ATOM   481  N  NE2 . HIS A 1 67 ? -18.731 -75.119  12.278  1.00 44.90  ? 192 HIS A NE2 1 
ATOM   482  N  N   . PRO A 1 68 ? -17.904 -73.694  19.025  1.00 42.73  ? 193 PRO A N   1 
ATOM   483  C  CA  . PRO A 1 68 ? -18.141 -73.047  20.336  1.00 42.87  ? 193 PRO A CA  1 
ATOM   484  C  C   . PRO A 1 68 ? -18.104 -71.521  20.443  1.00 47.18  ? 193 PRO A C   1 
ATOM   485  O  O   . PRO A 1 68 ? -18.630 -70.961  21.416  1.00 48.23  ? 193 PRO A O   1 
ATOM   486  C  CB  . PRO A 1 68 ? -17.115 -73.718  21.254  1.00 45.56  ? 193 PRO A CB  1 
ATOM   487  C  CG  . PRO A 1 68 ? -16.103 -74.298  20.351  1.00 50.38  ? 193 PRO A CG  1 
ATOM   488  C  CD  . PRO A 1 68 ? -16.851 -74.722  19.135  1.00 45.17  ? 193 PRO A CD  1 
ATOM   489  N  N   . ASN A 1 69 ? -17.502 -70.858  19.455  1.00 42.97  ? 194 ASN A N   1 
ATOM   490  C  CA  . ASN A 1 69 ? -17.374 -69.409  19.409  1.00 43.52  ? 194 ASN A CA  1 
ATOM   491  C  C   . ASN A 1 69 ? -18.385 -68.723  18.515  1.00 45.73  ? 194 ASN A C   1 
ATOM   492  O  O   . ASN A 1 69 ? -18.266 -67.513  18.338  1.00 47.68  ? 194 ASN A O   1 
ATOM   493  C  CB  . ASN A 1 69 ? -15.959 -69.026  18.971  1.00 49.42  ? 194 ASN A CB  1 
ATOM   494  C  CG  . ASN A 1 69 ? -14.942 -68.965  20.093  1.00 91.95  ? 194 ASN A CG  1 
ATOM   495  O  OD1 . ASN A 1 69 ? -15.271 -68.811  21.285  1.00 84.59  ? 194 ASN A OD1 1 
ATOM   496  N  ND2 . ASN A 1 69 ? -13.663 -69.034  19.721  1.00 89.81  ? 194 ASN A ND2 1 
ATOM   497  N  N   . ALA A 1 70 ? -19.378 -69.461  17.951  1.00 38.47  ? 195 ALA A N   1 
ATOM   498  C  CA  . ALA A 1 70 ? -20.393 -68.907  17.044  1.00 36.71  ? 195 ALA A CA  1 
ATOM   499  C  C   . ALA A 1 70 ? -21.103 -67.672  17.599  1.00 40.40  ? 195 ALA A C   1 
ATOM   500  O  O   . ALA A 1 70 ? -21.565 -66.847  16.811  1.00 40.36  ? 195 ALA A O   1 
ATOM   501  C  CB  . ALA A 1 70 ? -21.402 -69.969  16.645  1.00 36.26  ? 195 ALA A CB  1 
ATOM   502  N  N   . TRP A 1 71 ? -21.129 -67.507  18.948  1.00 36.57  ? 196 TRP A N   1 
ATOM   503  C  CA  . TRP A 1 71 ? -21.725 -66.345  19.634  1.00 36.66  ? 196 TRP A CA  1 
ATOM   504  C  C   . TRP A 1 71 ? -21.022 -65.008  19.300  1.00 41.76  ? 196 TRP A C   1 
ATOM   505  O  O   . TRP A 1 71 ? -21.628 -63.939  19.446  1.00 42.93  ? 196 TRP A O   1 
ATOM   506  C  CB  . TRP A 1 71 ? -21.751 -66.559  21.153  1.00 35.29  ? 196 TRP A CB  1 
ATOM   507  C  CG  . TRP A 1 71 ? -20.408 -66.772  21.771  1.00 36.34  ? 196 TRP A CG  1 
ATOM   508  C  CD1 . TRP A 1 71 ? -19.777 -67.963  21.976  1.00 38.71  ? 196 TRP A CD1 1 
ATOM   509  C  CD2 . TRP A 1 71 ? -19.531 -65.757  22.270  1.00 37.25  ? 196 TRP A CD2 1 
ATOM   510  N  NE1 . TRP A 1 71 ? -18.559 -67.754  22.574  1.00 39.35  ? 196 TRP A NE1 1 
ATOM   511  C  CE2 . TRP A 1 71 ? -18.381 -66.407  22.768  1.00 41.44  ? 196 TRP A CE2 1 
ATOM   512  C  CE3 . TRP A 1 71 ? -19.610 -64.356  22.357  1.00 39.20  ? 196 TRP A CE3 1 
ATOM   513  C  CZ2 . TRP A 1 71 ? -17.327 -65.708  23.362  1.00 41.71  ? 196 TRP A CZ2 1 
ATOM   514  C  CZ3 . TRP A 1 71 ? -18.553 -63.662  22.914  1.00 41.94  ? 196 TRP A CZ3 1 
ATOM   515  C  CH2 . TRP A 1 71 ? -17.433 -64.337  23.422  1.00 42.85  ? 196 TRP A CH2 1 
ATOM   516  N  N   . VAL A 1 72 ? -19.740 -65.079  18.879  1.00 36.67  ? 197 VAL A N   1 
ATOM   517  C  CA  . VAL A 1 72 ? -18.918 -63.924  18.498  1.00 37.12  ? 197 VAL A CA  1 
ATOM   518  C  C   . VAL A 1 72 ? -19.440 -63.376  17.179  1.00 40.82  ? 197 VAL A C   1 
ATOM   519  O  O   . VAL A 1 72 ? -19.237 -62.205  16.867  1.00 42.33  ? 197 VAL A O   1 
ATOM   520  C  CB  . VAL A 1 72 ? -17.414 -64.290  18.435  1.00 41.06  ? 197 VAL A CB  1 
ATOM   521  C  CG1 . VAL A 1 72 ? -16.566 -63.110  17.974  1.00 42.58  ? 197 VAL A CG1 1 
ATOM   522  C  CG2 . VAL A 1 72 ? -16.926 -64.794  19.790  1.00 41.10  ? 197 VAL A CG2 1 
ATOM   523  N  N   . PHE A 1 73 ? -20.135 -64.222  16.413  1.00 35.03  ? 198 PHE A N   1 
ATOM   524  C  CA  . PHE A 1 73 ? -20.723 -63.813  15.156  1.00 33.07  ? 198 PHE A CA  1 
ATOM   525  C  C   . PHE A 1 73 ? -22.147 -63.321  15.405  1.00 34.01  ? 198 PHE A C   1 
ATOM   526  O  O   . PHE A 1 73 ? -22.436 -62.151  15.166  1.00 34.67  ? 198 PHE A O   1 
ATOM   527  C  CB  . PHE A 1 73 ? -20.668 -64.961  14.129  1.00 33.43  ? 198 PHE A CB  1 
ATOM   528  C  CG  . PHE A 1 73 ? -21.391 -64.664  12.836  1.00 35.35  ? 198 PHE A CG  1 
ATOM   529  C  CD1 . PHE A 1 73 ? -20.754 -63.978  11.804  1.00 39.65  ? 198 PHE A CD1 1 
ATOM   530  C  CD2 . PHE A 1 73 ? -22.703 -65.078  12.643  1.00 37.08  ? 198 PHE A CD2 1 
ATOM   531  C  CE1 . PHE A 1 73 ? -21.421 -63.687  10.615  1.00 40.55  ? 198 PHE A CE1 1 
ATOM   532  C  CE2 . PHE A 1 73 ? -23.375 -64.781  11.455  1.00 40.70  ? 198 PHE A CE2 1 
ATOM   533  C  CZ  . PHE A 1 73 ? -22.724 -64.093  10.443  1.00 39.65  ? 198 PHE A CZ  1 
ATOM   534  N  N   . PHE A 1 74 ? -23.020 -64.207  15.917  1.00 27.42  ? 199 PHE A N   1 
ATOM   535  C  CA  . PHE A 1 74 ? -24.437 -63.914  16.101  1.00 26.26  ? 199 PHE A CA  1 
ATOM   536  C  C   . PHE A 1 74 ? -24.793 -62.815  17.071  1.00 33.38  ? 199 PHE A C   1 
ATOM   537  O  O   . PHE A 1 74 ? -25.546 -61.930  16.681  1.00 34.19  ? 199 PHE A O   1 
ATOM   538  C  CB  . PHE A 1 74 ? -25.285 -65.167  16.292  1.00 25.62  ? 199 PHE A CB  1 
ATOM   539  C  CG  . PHE A 1 74 ? -25.161 -66.221  15.210  1.00 24.96  ? 199 PHE A CG  1 
ATOM   540  C  CD1 . PHE A 1 74 ? -25.984 -66.194  14.094  1.00 27.33  ? 199 PHE A CD1 1 
ATOM   541  C  CD2 . PHE A 1 74 ? -24.284 -67.291  15.355  1.00 25.35  ? 199 PHE A CD2 1 
ATOM   542  C  CE1 . PHE A 1 74 ? -25.938 -67.223  13.146  1.00 27.19  ? 199 PHE A CE1 1 
ATOM   543  C  CE2 . PHE A 1 74 ? -24.223 -68.302  14.399  1.00 26.77  ? 199 PHE A CE2 1 
ATOM   544  C  CZ  . PHE A 1 74 ? -25.062 -68.271  13.310  1.00 25.51  ? 199 PHE A CZ  1 
ATOM   545  N  N   . ILE A 1 75 ? -24.273 -62.843  18.314  1.00 31.65  ? 200 ILE A N   1 
ATOM   546  C  CA  . ILE A 1 75 ? -24.570 -61.784  19.289  1.00 33.21  ? 200 ILE A CA  1 
ATOM   547  C  C   . ILE A 1 75 ? -24.295 -60.362  18.738  1.00 40.75  ? 200 ILE A C   1 
ATOM   548  O  O   . ILE A 1 75 ? -25.262 -59.599  18.655  1.00 41.61  ? 200 ILE A O   1 
ATOM   549  C  CB  . ILE A 1 75 ? -24.063 -62.082  20.701  1.00 36.41  ? 200 ILE A CB  1 
ATOM   550  C  CG1 . ILE A 1 75 ? -24.777 -63.344  21.220  1.00 35.78  ? 200 ILE A CG1 1 
ATOM   551  C  CG2 . ILE A 1 75 ? -24.273 -60.868  21.622  1.00 39.12  ? 200 ILE A CG2 1 
ATOM   552  C  CD1 . ILE A 1 75 ? -24.178 -64.022  22.420  1.00 46.45  ? 200 ILE A CD1 1 
ATOM   553  N  N   . PRO A 1 76 ? -23.079 -60.030  18.214  1.00 38.76  ? 201 PRO A N   1 
ATOM   554  C  CA  . PRO A 1 76 ? -22.883 -58.706  17.586  1.00 40.79  ? 201 PRO A CA  1 
ATOM   555  C  C   . PRO A 1 76 ? -23.791 -58.481  16.369  1.00 47.07  ? 201 PRO A C   1 
ATOM   556  O  O   . PRO A 1 76 ? -24.308 -57.371  16.211  1.00 48.99  ? 201 PRO A O   1 
ATOM   557  C  CB  . PRO A 1 76 ? -21.408 -58.725  17.175  1.00 42.50  ? 201 PRO A CB  1 
ATOM   558  C  CG  . PRO A 1 76 ? -20.788 -59.722  18.082  1.00 46.12  ? 201 PRO A CG  1 
ATOM   559  C  CD  . PRO A 1 76 ? -21.818 -60.796  18.200  1.00 39.73  ? 201 PRO A CD  1 
ATOM   560  N  N   . PHE A 1 77 ? -24.020 -59.533  15.531  1.00 42.20  ? 202 PHE A N   1 
ATOM   561  C  CA  . PHE A 1 77 ? -24.916 -59.442  14.378  1.00 41.90  ? 202 PHE A CA  1 
ATOM   562  C  C   . PHE A 1 77 ? -26.319 -58.992  14.836  1.00 48.65  ? 202 PHE A C   1 
ATOM   563  O  O   . PHE A 1 77 ? -26.923 -58.126  14.203  1.00 49.53  ? 202 PHE A O   1 
ATOM   564  C  CB  . PHE A 1 77 ? -24.991 -60.777  13.616  1.00 41.70  ? 202 PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 77 ? -26.144 -60.832  12.642  1.00 43.34  ? 202 PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 77 ? -26.045 -60.240  11.387  1.00 47.54  ? 202 PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 77 ? -27.355 -61.409  13.007  1.00 45.12  ? 202 PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 77 ? -27.120 -60.263  10.497  1.00 48.66  ? 202 PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 77 ? -28.441 -61.399  12.131  1.00 48.53  ? 202 PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 77 ? -28.316 -60.830  10.880  1.00 47.52  ? 202 PHE A CZ  1 
ATOM   571  N  N   . ILE A 1 78 ? -26.828 -59.594  15.927  1.00 46.15  ? 203 ILE A N   1 
ATOM   572  C  CA  . ILE A 1 78 ? -28.126 -59.261  16.504  1.00 47.55  ? 203 ILE A CA  1 
ATOM   573  C  C   . ILE A 1 78 ? -28.091 -57.808  16.983  1.00 57.64  ? 203 ILE A C   1 
ATOM   574  O  O   . ILE A 1 78 ? -28.909 -57.011  16.537  1.00 58.87  ? 203 ILE A O   1 
ATOM   575  C  CB  . ILE A 1 78 ? -28.536 -60.286  17.606  1.00 49.16  ? 203 ILE A CB  1 
ATOM   576  C  CG1 . ILE A 1 78 ? -29.127 -61.559  16.963  1.00 46.72  ? 203 ILE A CG1 1 
ATOM   577  C  CG2 . ILE A 1 78 ? -29.516 -59.678  18.634  1.00 51.48  ? 203 ILE A CG2 1 
ATOM   578  C  CD1 . ILE A 1 78 ? -29.206 -62.748  17.859  1.00 42.43  ? 203 ILE A CD1 1 
ATOM   579  N  N   . MET A 1 79 ? -27.093 -57.451  17.812  1.00 57.64  ? 204 MET A N   1 
ATOM   580  C  CA  . MET A 1 79 ? -26.922 -56.101  18.360  1.00 61.09  ? 204 MET A CA  1 
ATOM   581  C  C   . MET A 1 79 ? -26.848 -55.012  17.283  1.00 66.98  ? 204 MET A C   1 
ATOM   582  O  O   . MET A 1 79 ? -27.427 -53.944  17.465  1.00 68.03  ? 204 MET A O   1 
ATOM   583  C  CB  . MET A 1 79 ? -25.717 -56.037  19.305  1.00 64.58  ? 204 MET A CB  1 
ATOM   584  C  CG  . MET A 1 79 ? -25.880 -56.903  20.543  1.00 68.57  ? 204 MET A CG  1 
ATOM   585  S  SD  . MET A 1 79 ? -24.692 -56.538  21.862  1.00 76.01  ? 204 MET A SD  1 
ATOM   586  C  CE  . MET A 1 79 ? -23.177 -57.230  21.157  1.00 71.48  ? 204 MET A CE  1 
ATOM   587  N  N   . LEU A 1 80 ? -26.181 -55.304  16.152  1.00 64.06  ? 205 LEU A N   1 
ATOM   588  C  CA  . LEU A 1 80 ? -26.018 -54.368  15.044  1.00 66.07  ? 205 LEU A CA  1 
ATOM   589  C  C   . LEU A 1 80 ? -27.292 -54.195  14.228  1.00 71.20  ? 205 LEU A C   1 
ATOM   590  O  O   . LEU A 1 80 ? -27.743 -53.063  14.065  1.00 72.99  ? 205 LEU A O   1 
ATOM   591  C  CB  . LEU A 1 80 ? -24.836 -54.774  14.145  1.00 65.50  ? 205 LEU A CB  1 
ATOM   592  C  CG  . LEU A 1 80 ? -24.428 -53.779  13.052  1.00 72.49  ? 205 LEU A CG  1 
ATOM   593  C  CD1 . LEU A 1 80 ? -23.660 -52.594  13.634  1.00 75.51  ? 205 LEU A CD1 1 
ATOM   594  C  CD2 . LEU A 1 80 ? -23.581 -54.457  12.004  1.00 74.14  ? 205 LEU A CD2 1 
ATOM   595  N  N   . THR A 1 81 ? -27.858 -55.306  13.708  1.00 66.65  ? 206 THR A N   1 
ATOM   596  C  CA  . THR A 1 81 ? -29.076 -55.312  12.884  1.00 66.61  ? 206 THR A CA  1 
ATOM   597  C  C   . THR A 1 81 ? -30.317 -54.894  13.676  1.00 74.38  ? 206 THR A C   1 
ATOM   598  O  O   . THR A 1 81 ? -31.030 -53.989  13.244  1.00 75.61  ? 206 THR A O   1 
ATOM   599  C  CB  . THR A 1 81 ? -29.235 -56.627  12.112  1.00 63.42  ? 206 THR A CB  1 
ATOM   600  O  OG1 . THR A 1 81 ? -29.280 -57.721  13.026  1.00 56.38  ? 206 THR A OG1 1 
ATOM   601  C  CG2 . THR A 1 81 ? -28.132 -56.837  11.092  1.00 59.94  ? 206 THR A CG2 1 
ATOM   602  N  N   . THR A 1 82 ? -30.534 -55.494  14.863  1.00 72.70  ? 207 THR A N   1 
ATOM   603  C  CA  . THR A 1 82 ? -31.658 -55.168  15.749  1.00 75.19  ? 207 THR A CA  1 
ATOM   604  C  C   . THR A 1 82 ? -31.359 -53.839  16.496  1.00 85.36  ? 207 THR A C   1 
ATOM   605  O  O   . THR A 1 82 ? -31.450 -53.757  17.723  1.00 85.88  ? 207 THR A O   1 
ATOM   606  C  CB  . THR A 1 82 ? -32.012 -56.393  16.643  1.00 82.29  ? 207 THR A CB  1 
ATOM   607  O  OG1 . THR A 1 82 ? -31.877 -57.605  15.890  1.00 79.03  ? 207 THR A OG1 1 
ATOM   608  C  CG2 . THR A 1 82 ? -33.409 -56.316  17.226  1.00 82.81  ? 207 THR A CG2 1 
ATOM   609  N  N   . PHE A 1 83 ? -30.984 -52.811  15.718  1.00 86.56  ? 208 PHE A N   1 
ATOM   610  C  CA  . PHE A 1 83 ? -30.638 -51.440  16.107  1.00 90.98  ? 208 PHE A CA  1 
ATOM   611  C  C   . PHE A 1 83 ? -30.721 -50.600  14.836  1.00 98.33  ? 208 PHE A C   1 
ATOM   612  O  O   . PHE A 1 83 ? -31.406 -49.578  14.820  1.00 100.75 ? 208 PHE A O   1 
ATOM   613  C  CB  . PHE A 1 83 ? -29.214 -51.357  16.710  1.00 93.35  ? 208 PHE A CB  1 
ATOM   614  C  CG  . PHE A 1 83 ? -28.533 -50.012  16.562  1.00 98.37  ? 208 PHE A CG  1 
ATOM   615  C  CD1 . PHE A 1 83 ? -28.830 -48.964  17.427  1.00 105.32 ? 208 PHE A CD1 1 
ATOM   616  C  CD2 . PHE A 1 83 ? -27.604 -49.790  15.551  1.00 100.80 ? 208 PHE A CD2 1 
ATOM   617  C  CE1 . PHE A 1 83 ? -28.212 -47.715  17.281  1.00 109.37 ? 208 PHE A CE1 1 
ATOM   618  C  CE2 . PHE A 1 83 ? -26.998 -48.538  15.396  1.00 106.89 ? 208 PHE A CE2 1 
ATOM   619  C  CZ  . PHE A 1 83 ? -27.302 -47.511  16.267  1.00 108.20 ? 208 PHE A CZ  1 
ATOM   620  N  N   . THR A 1 84 ? -30.001 -51.037  13.776  1.00 94.53  ? 209 THR A N   1 
ATOM   621  C  CA  . THR A 1 84 ? -29.959 -50.399  12.465  1.00 96.02  ? 209 THR A CA  1 
ATOM   622  C  C   . THR A 1 84 ? -31.348 -50.480  11.832  1.00 102.05 ? 209 THR A C   1 
ATOM   623  O  O   . THR A 1 84 ? -31.752 -49.524  11.180  1.00 104.22 ? 209 THR A O   1 
ATOM   624  C  CB  . THR A 1 84 ? -28.830 -50.991  11.612  1.00 101.61 ? 209 THR A CB  1 
ATOM   625  O  OG1 . THR A 1 84 ? -27.632 -51.007  12.389  1.00 100.96 ? 209 THR A OG1 1 
ATOM   626  C  CG2 . THR A 1 84 ? -28.583 -50.205  10.330  1.00 101.56 ? 209 THR A CG2 1 
ATOM   627  N  N   . VAL A 1 85 ? -32.094 -51.592  12.070  1.00 97.79  ? 210 VAL A N   1 
ATOM   628  C  CA  . VAL A 1 85 ? -33.471 -51.781  11.591  1.00 98.26  ? 210 VAL A CA  1 
ATOM   629  C  C   . VAL A 1 85 ? -34.389 -50.794  12.322  1.00 106.08 ? 210 VAL A C   1 
ATOM   630  O  O   . VAL A 1 85 ? -35.180 -50.110  11.670  1.00 107.44 ? 210 VAL A O   1 
ATOM   631  C  CB  . VAL A 1 85 ? -33.946 -53.254  11.672  1.00 99.22  ? 210 VAL A CB  1 
ATOM   632  C  CG1 . VAL A 1 85 ? -35.453 -53.380  11.447  1.00 99.59  ? 210 VAL A CG1 1 
ATOM   633  C  CG2 . VAL A 1 85 ? -33.190 -54.103  10.663  1.00 96.92  ? 210 VAL A CG2 1 
ATOM   634  N  N   . LEU A 1 86 ? -34.220 -50.672  13.657  1.00 104.24 ? 211 LEU A N   1 
ATOM   635  C  CA  . LEU A 1 86 ? -34.953 -49.729  14.512  1.00 107.73 ? 211 LEU A CA  1 
ATOM   636  C  C   . LEU A 1 86 ? -34.643 -48.272  14.107  1.00 116.02 ? 211 LEU A C   1 
ATOM   637  O  O   . LEU A 1 86 ? -35.538 -47.425  14.129  1.00 118.23 ? 211 LEU A O   1 
ATOM   638  C  CB  . LEU A 1 86 ? -34.581 -49.988  15.993  1.00 107.80 ? 211 LEU A CB  1 
ATOM   639  C  CG  . LEU A 1 86 ? -35.018 -48.976  17.074  1.00 116.16 ? 211 LEU A CG  1 
ATOM   640  C  CD1 . LEU A 1 86 ? -36.510 -49.067  17.357  1.00 117.75 ? 211 LEU A CD1 1 
ATOM   641  C  CD2 . LEU A 1 86 ? -34.265 -49.213  18.368  1.00 118.37 ? 211 LEU A CD2 1 
ATOM   642  N  N   . ASN A 1 87 ? -33.387 -48.007  13.708  1.00 113.50 ? 212 ASN A N   1 
ATOM   643  C  CA  . ASN A 1 87 ? -32.921 -46.697  13.257  1.00 116.97 ? 212 ASN A CA  1 
ATOM   644  C  C   . ASN A 1 87 ? -33.506 -46.348  11.884  1.00 123.14 ? 212 ASN A C   1 
ATOM   645  O  O   . ASN A 1 87 ? -33.957 -45.221  11.690  1.00 126.10 ? 212 ASN A O   1 
ATOM   646  C  CB  . ASN A 1 87 ? -31.394 -46.658  13.206  1.00 118.02 ? 212 ASN A CB  1 
ATOM   647  C  CG  . ASN A 1 87 ? -30.783 -45.684  14.173  1.00 145.54 ? 212 ASN A CG  1 
ATOM   648  O  OD1 . ASN A 1 87 ? -30.536 -44.520  13.843  1.00 143.37 ? 212 ASN A OD1 1 
ATOM   649  N  ND2 . ASN A 1 87 ? -30.516 -46.141  15.387  1.00 136.99 ? 212 ASN A ND2 1 
ATOM   650  N  N   . LEU A 1 88 ? -33.494 -47.320  10.938  1.00 118.01 ? 213 LEU A N   1 
ATOM   651  C  CA  . LEU A 1 88 ? -34.014 -47.196  9.569   1.00 118.62 ? 213 LEU A CA  1 
ATOM   652  C  C   . LEU A 1 88 ? -35.522 -46.952  9.565   1.00 125.10 ? 213 LEU A C   1 
ATOM   653  O  O   . LEU A 1 88 ? -35.994 -46.099  8.812   1.00 127.32 ? 213 LEU A O   1 
ATOM   654  C  CB  . LEU A 1 88 ? -33.667 -48.462  8.750   1.00 115.37 ? 213 LEU A CB  1 
ATOM   655  C  CG  . LEU A 1 88 ? -34.324 -48.647  7.373   1.00 120.06 ? 213 LEU A CG  1 
ATOM   656  C  CD1 . LEU A 1 88 ? -33.838 -47.609  6.375   1.00 122.60 ? 213 LEU A CD1 1 
ATOM   657  C  CD2 . LEU A 1 88 ? -34.079 -50.043  6.843   1.00 119.32 ? 213 LEU A CD2 1 
ATOM   658  N  N   . PHE A 1 89 ? -36.268 -47.700  10.401  1.00 120.88 ? 214 PHE A N   1 
ATOM   659  C  CA  . PHE A 1 89 ? -37.722 -47.593  10.519  1.00 122.18 ? 214 PHE A CA  1 
ATOM   660  C  C   . PHE A 1 89 ? -38.155 -46.262  11.146  1.00 131.07 ? 214 PHE A C   1 
ATOM   661  O  O   . PHE A 1 89 ? -39.095 -45.642  10.638  1.00 132.92 ? 214 PHE A O   1 
ATOM   662  C  CB  . PHE A 1 89 ? -38.312 -48.826  11.234  1.00 121.30 ? 214 PHE A CB  1 
ATOM   663  C  CG  . PHE A 1 89 ? -38.538 -50.046  10.358  1.00 119.92 ? 214 PHE A CG  1 
ATOM   664  C  CD1 . PHE A 1 89 ? -37.628 -50.392  9.361   1.00 121.40 ? 214 PHE A CD1 1 
ATOM   665  C  CD2 . PHE A 1 89 ? -39.632 -50.876  10.564  1.00 121.09 ? 214 PHE A CD2 1 
ATOM   666  C  CE1 . PHE A 1 89 ? -37.836 -51.518  8.558   1.00 120.09 ? 214 PHE A CE1 1 
ATOM   667  C  CE2 . PHE A 1 89 ? -39.836 -52.006  9.763   1.00 121.63 ? 214 PHE A CE2 1 
ATOM   668  C  CZ  . PHE A 1 89 ? -38.935 -52.321  8.769   1.00 118.30 ? 214 PHE A CZ  1 
ATOM   669  N  N   . ILE A 1 90 ? -37.432 -45.795  12.200  1.00 129.48 ? 215 ILE A N   1 
ATOM   670  C  CA  . ILE A 1 90 ? -37.675 -44.502  12.869  1.00 133.76 ? 215 ILE A CA  1 
ATOM   671  C  C   . ILE A 1 90 ? -37.373 -43.325  11.910  1.00 141.72 ? 215 ILE A C   1 
ATOM   672  O  O   . ILE A 1 90 ? -38.084 -42.315  11.934  1.00 144.95 ? 215 ILE A O   1 
ATOM   673  C  CB  . ILE A 1 90 ? -36.925 -44.415  14.243  1.00 137.09 ? 215 ILE A CB  1 
ATOM   674  C  CG1 . ILE A 1 90 ? -37.744 -45.110  15.357  1.00 136.71 ? 215 ILE A CG1 1 
ATOM   675  C  CG2 . ILE A 1 90 ? -36.547 -42.970  14.643  1.00 141.95 ? 215 ILE A CG2 1 
ATOM   676  C  CD1 . ILE A 1 90 ? -37.018 -45.324  16.702  1.00 143.08 ? 215 ILE A CD1 1 
ATOM   677  N  N   . GLY A 1 91 ? -36.352 -43.501  11.066  1.00 137.50 ? 216 GLY A N   1 
ATOM   678  C  CA  . GLY A 1 91 ? -35.902 -42.533  10.068  1.00 140.02 ? 216 GLY A CA  1 
ATOM   679  C  C   . GLY A 1 91 ? -36.974 -42.069  9.101   1.00 146.73 ? 216 GLY A C   1 
ATOM   680  O  O   . GLY A 1 91 ? -37.041 -40.876  8.798   1.00 150.09 ? 216 GLY A O   1 
ATOM   681  N  N   . ILE A 1 92 ? -37.833 -42.999  8.624   1.00 141.68 ? 217 ILE A N   1 
ATOM   682  C  CA  . ILE A 1 92 ? -38.942 -42.693  7.702   1.00 143.42 ? 217 ILE A CA  1 
ATOM   683  C  C   . ILE A 1 92 ? -40.077 -41.969  8.447   1.00 150.84 ? 217 ILE A C   1 
ATOM   684  O  O   . ILE A 1 92 ? -40.719 -41.089  7.868   1.00 153.53 ? 217 ILE A O   1 
ATOM   685  C  CB  . ILE A 1 92 ? -39.479 -43.935  6.924   1.00 143.41 ? 217 ILE A CB  1 
ATOM   686  C  CG1 . ILE A 1 92 ? -38.413 -45.035  6.737   1.00 139.83 ? 217 ILE A CG1 1 
ATOM   687  C  CG2 . ILE A 1 92 ? -40.092 -43.517  5.580   1.00 145.91 ? 217 ILE A CG2 1 
ATOM   688  C  CD1 . ILE A 1 92 ? -38.910 -46.427  7.036   1.00 142.96 ? 217 ILE A CD1 1 
ATOM   689  N  N   . ILE A 1 93 ? -40.318 -42.352  9.726   1.00 147.13 ? 218 ILE A N   1 
ATOM   690  C  CA  . ILE A 1 93 ? -41.343 -41.782  10.616  1.00 150.21 ? 218 ILE A CA  1 
ATOM   691  C  C   . ILE A 1 93 ? -41.079 -40.277  10.857  1.00 160.00 ? 218 ILE A C   1 
ATOM   692  O  O   . ILE A 1 93 ? -42.014 -39.471  10.798  1.00 163.05 ? 218 ILE A O   1 
ATOM   693  C  CB  . ILE A 1 93 ? -41.474 -42.624  11.928  1.00 151.17 ? 218 ILE A CB  1 
ATOM   694  C  CG1 . ILE A 1 93 ? -41.972 -44.060  11.612  1.00 147.61 ? 218 ILE A CG1 1 
ATOM   695  C  CG2 . ILE A 1 93 ? -42.384 -41.944  12.970  1.00 155.35 ? 218 ILE A CG2 1 
ATOM   696  C  CD1 . ILE A 1 93 ? -41.695 -45.124  12.682  1.00 151.73 ? 218 ILE A CD1 1 
ATOM   697  N  N   . VAL A 1 94 ? -39.800 -39.910  11.077  1.00 157.79 ? 219 VAL A N   1 
ATOM   698  C  CA  . VAL A 1 94 ? -39.343 -38.527  11.282  1.00 162.43 ? 219 VAL A CA  1 
ATOM   699  C  C   . VAL A 1 94 ? -39.488 -37.728  9.960   1.00 169.67 ? 219 VAL A C   1 
ATOM   700  O  O   . VAL A 1 94 ? -39.877 -36.557  9.994   1.00 173.93 ? 219 VAL A O   1 
ATOM   701  C  CB  . VAL A 1 94 ? -37.899 -38.489  11.872  1.00 165.56 ? 219 VAL A CB  1 
ATOM   702  C  CG1 . VAL A 1 94 ? -37.358 -37.062  11.978  1.00 170.04 ? 219 VAL A CG1 1 
ATOM   703  C  CG2 . VAL A 1 94 ? -37.842 -39.176  13.235  1.00 163.70 ? 219 VAL A CG2 1 
ATOM   704  N  N   . ASP A 1 95 ? -39.242 -38.393  8.803   1.00 163.80 ? 220 ASP A N   1 
ATOM   705  C  CA  . ASP A 1 95 ? -39.351 -37.825  7.452   1.00 165.58 ? 220 ASP A CA  1 
ATOM   706  C  C   . ASP A 1 95 ? -40.795 -37.438  7.071   1.00 172.70 ? 220 ASP A C   1 
ATOM   707  O  O   . ASP A 1 95 ? -41.040 -37.027  5.934   1.00 173.94 ? 220 ASP A O   1 
ATOM   708  C  CB  . ASP A 1 95 ? -38.733 -38.779  6.414   1.00 163.56 ? 220 ASP A CB  1 
ATOM   709  N  N   . ALA A 1 96 ? -41.733 -37.533  8.033   1.00 170.53 ? 221 ALA A N   1 
ATOM   710  C  CA  . ALA A 1 96 ? -43.139 -37.153  7.895   1.00 173.35 ? 221 ALA A CA  1 
ATOM   711  C  C   . ALA A 1 96 ? -43.437 -35.949  8.805   1.00 182.21 ? 221 ALA A C   1 
ATOM   712  O  O   . ALA A 1 96 ? -44.176 -35.047  8.402   1.00 185.32 ? 221 ALA A O   1 
ATOM   713  C  CB  . ALA A 1 96 ? -44.039 -38.325  8.257   1.00 171.17 ? 221 ALA A CB  1 
ATOM   714  N  N   . MET A 1 97 ? -42.841 -35.933  10.019  1.00 178.70 ? 222 MET A N   1 
ATOM   715  C  CA  . MET A 1 97 ? -42.994 -34.870  11.013  1.00 211.23 ? 222 MET A CA  1 
ATOM   716  C  C   . MET A 1 97 ? -41.837 -33.878  10.932  1.00 235.48 ? 222 MET A C   1 
ATOM   717  O  O   . MET A 1 97 ? -41.686 -33.186  9.928   1.00 198.54 ? 222 MET A O   1 
ATOM   718  C  CB  . MET A 1 97 ? -43.084 -35.466  12.426  1.00 212.14 ? 222 MET A CB  1 
ATOM   719  N  N   . VAL B 1 6  ? -25.962 -41.535  28.639  1.00 137.09 ? 131 VAL B N   1 
ATOM   720  C  CA  . VAL B 1 6  ? -26.100 -42.707  27.769  1.00 132.63 ? 131 VAL B CA  1 
ATOM   721  C  C   . VAL B 1 6  ? -25.004 -43.741  28.083  1.00 132.89 ? 131 VAL B C   1 
ATOM   722  O  O   . VAL B 1 6  ? -25.298 -44.935  28.153  1.00 128.70 ? 131 VAL B O   1 
ATOM   723  C  CB  . VAL B 1 6  ? -26.170 -42.340  26.256  1.00 137.91 ? 131 VAL B CB  1 
ATOM   724  C  CG1 . VAL B 1 6  ? -26.585 -43.544  25.409  1.00 133.65 ? 131 VAL B CG1 1 
ATOM   725  C  CG2 . VAL B 1 6  ? -27.125 -41.173  26.012  1.00 142.17 ? 131 VAL B CG2 1 
ATOM   726  N  N   . GLY B 1 7  ? -23.770 -43.270  28.277  1.00 130.78 ? 132 GLY B N   1 
ATOM   727  C  CA  . GLY B 1 7  ? -22.623 -44.108  28.617  1.00 127.84 ? 132 GLY B CA  1 
ATOM   728  C  C   . GLY B 1 7  ? -22.757 -44.743  29.988  1.00 128.79 ? 132 GLY B C   1 
ATOM   729  O  O   . GLY B 1 7  ? -22.380 -45.904  30.177  1.00 125.04 ? 132 GLY B O   1 
ATOM   730  N  N   . SER B 1 8  ? -23.330 -43.979  30.945  1.00 126.77 ? 133 SER B N   1 
ATOM   731  C  CA  . SER B 1 8  ? -23.601 -44.401  32.323  1.00 124.84 ? 133 SER B CA  1 
ATOM   732  C  C   . SER B 1 8  ? -24.689 -45.483  32.362  1.00 122.78 ? 133 SER B C   1 
ATOM   733  O  O   . SER B 1 8  ? -24.691 -46.319  33.268  1.00 119.86 ? 133 SER B O   1 
ATOM   734  C  CB  . SER B 1 8  ? -24.014 -43.205  33.176  1.00 132.88 ? 133 SER B CB  1 
ATOM   735  O  OG  . SER B 1 8  ? -25.147 -42.543  32.634  1.00 144.14 ? 133 SER B OG  1 
ATOM   736  N  N   . VAL B 1 9  ? -25.606 -45.460  31.372  1.00 117.62 ? 134 VAL B N   1 
ATOM   737  C  CA  . VAL B 1 9  ? -26.695 -46.430  31.208  1.00 113.69 ? 134 VAL B CA  1 
ATOM   738  C  C   . VAL B 1 9  ? -26.085 -47.779  30.789  1.00 111.13 ? 134 VAL B C   1 
ATOM   739  O  O   . VAL B 1 9  ? -26.465 -48.817  31.339  1.00 108.01 ? 134 VAL B O   1 
ATOM   740  C  CB  . VAL B 1 9  ? -27.778 -45.938  30.200  1.00 119.37 ? 134 VAL B CB  1 
ATOM   741  C  CG1 . VAL B 1 9  ? -29.002 -46.854  30.200  1.00 116.44 ? 134 VAL B CG1 1 
ATOM   742  C  CG2 . VAL B 1 9  ? -28.192 -44.495  30.487  1.00 124.01 ? 134 VAL B CG2 1 
ATOM   743  N  N   . ALA B 1 10 ? -25.119 -47.749  29.838  1.00 105.51 ? 135 ALA B N   1 
ATOM   744  C  CA  . ALA B 1 10 ? -24.400 -48.927  29.345  1.00 101.25 ? 135 ALA B CA  1 
ATOM   745  C  C   . ALA B 1 10 ? -23.537 -49.520  30.456  1.00 101.26 ? 135 ALA B C   1 
ATOM   746  O  O   . ALA B 1 10 ? -23.415 -50.740  30.547  1.00 97.91  ? 135 ALA B O   1 
ATOM   747  C  CB  . ALA B 1 10 ? -23.539 -48.557  28.149  1.00 103.39 ? 135 ALA B CB  1 
ATOM   748  N  N   . ALA B 1 11 ? -22.968 -48.653  31.313  1.00 98.65  ? 136 ALA B N   1 
ATOM   749  C  CA  . ALA B 1 11 ? -22.154 -49.052  32.459  1.00 97.54  ? 136 ALA B CA  1 
ATOM   750  C  C   . ALA B 1 11 ? -23.029 -49.734  33.514  1.00 97.65  ? 136 ALA B C   1 
ATOM   751  O  O   . ALA B 1 11 ? -22.589 -50.711  34.122  1.00 95.36  ? 136 ALA B O   1 
ATOM   752  C  CB  . ALA B 1 11 ? -21.457 -47.840  33.054  1.00 102.18 ? 136 ALA B CB  1 
ATOM   753  N  N   . LEU B 1 12 ? -24.276 -49.239  33.702  1.00 93.43  ? 137 LEU B N   1 
ATOM   754  C  CA  . LEU B 1 12 ? -25.260 -49.791  34.640  1.00 90.84  ? 137 LEU B CA  1 
ATOM   755  C  C   . LEU B 1 12 ? -25.698 -51.183  34.186  1.00 88.22  ? 137 LEU B C   1 
ATOM   756  O  O   . LEU B 1 12 ? -25.745 -52.095  35.008  1.00 85.57  ? 137 LEU B O   1 
ATOM   757  C  CB  . LEU B 1 12 ? -26.484 -48.861  34.768  1.00 93.14  ? 137 LEU B CB  1 
ATOM   758  C  CG  . LEU B 1 12 ? -27.563 -49.290  35.774  1.00 97.03  ? 137 LEU B CG  1 
ATOM   759  C  CD1 . LEU B 1 12 ? -27.845 -48.191  36.775  1.00 100.96 ? 137 LEU B CD1 1 
ATOM   760  C  CD2 . LEU B 1 12 ? -28.841 -49.716  35.069  1.00 97.59  ? 137 LEU B CD2 1 
ATOM   761  N  N   . LEU B 1 13 ? -26.016 -51.334  32.884  1.00 82.61  ? 138 LEU B N   1 
ATOM   762  C  CA  . LEU B 1 13 ? -26.454 -52.595  32.287  1.00 78.84  ? 138 LEU B CA  1 
ATOM   763  C  C   . LEU B 1 13 ? -25.385 -53.679  32.386  1.00 79.51  ? 138 LEU B C   1 
ATOM   764  O  O   . LEU B 1 13 ? -25.723 -54.801  32.746  1.00 77.40  ? 138 LEU B O   1 
ATOM   765  C  CB  . LEU B 1 13 ? -26.906 -52.393  30.829  1.00 79.17  ? 138 LEU B CB  1 
ATOM   766  C  CG  . LEU B 1 13 ? -27.563 -53.594  30.139  1.00 81.06  ? 138 LEU B CG  1 
ATOM   767  C  CD1 . LEU B 1 13 ? -29.065 -53.636  30.404  1.00 80.71  ? 138 LEU B CD1 1 
ATOM   768  C  CD2 . LEU B 1 13 ? -27.281 -53.578  28.653  1.00 84.00  ? 138 LEU B CD2 1 
ATOM   769  N  N   . THR B 1 14 ? -24.109 -53.350  32.097  1.00 75.75  ? 139 THR B N   1 
ATOM   770  C  CA  . THR B 1 14 ? -22.992 -54.299  32.178  1.00 74.00  ? 139 THR B CA  1 
ATOM   771  C  C   . THR B 1 14 ? -22.858 -54.849  33.607  1.00 76.83  ? 139 THR B C   1 
ATOM   772  O  O   . THR B 1 14 ? -22.727 -56.061  33.785  1.00 74.84  ? 139 THR B O   1 
ATOM   773  C  CB  . THR B 1 14 ? -21.683 -53.658  31.682  1.00 83.66  ? 139 THR B CB  1 
ATOM   774  O  OG1 . THR B 1 14 ? -21.914 -52.961  30.456  1.00 85.15  ? 139 THR B OG1 1 
ATOM   775  C  CG2 . THR B 1 14 ? -20.572 -54.681  31.484  1.00 81.12  ? 139 THR B CG2 1 
ATOM   776  N  N   . VAL B 1 15 ? -22.931 -53.953  34.613  1.00 74.31  ? 140 VAL B N   1 
ATOM   777  C  CA  . VAL B 1 15 ? -22.847 -54.269  36.041  1.00 73.46  ? 140 VAL B CA  1 
ATOM   778  C  C   . VAL B 1 15 ? -24.017 -55.185  36.454  1.00 72.96  ? 140 VAL B C   1 
ATOM   779  O  O   . VAL B 1 15 ? -23.799 -56.205  37.108  1.00 71.45  ? 140 VAL B O   1 
ATOM   780  C  CB  . VAL B 1 15 ? -22.738 -52.960  36.876  1.00 80.60  ? 140 VAL B CB  1 
ATOM   781  C  CG1 . VAL B 1 15 ? -23.109 -53.171  38.342  1.00 80.75  ? 140 VAL B CG1 1 
ATOM   782  C  CG2 . VAL B 1 15 ? -21.341 -52.353  36.759  1.00 82.69  ? 140 VAL B CG2 1 
ATOM   783  N  N   . VAL B 1 16 ? -25.238 -54.837  36.028  1.00 67.51  ? 141 VAL B N   1 
ATOM   784  C  CA  . VAL B 1 16 ? -26.466 -55.592  36.290  1.00 64.33  ? 141 VAL B CA  1 
ATOM   785  C  C   . VAL B 1 16 ? -26.415 -56.968  35.591  1.00 63.19  ? 141 VAL B C   1 
ATOM   786  O  O   . VAL B 1 16 ? -26.763 -57.975  36.201  1.00 61.00  ? 141 VAL B O   1 
ATOM   787  C  CB  . VAL B 1 16 ? -27.700 -54.723  35.916  1.00 68.92  ? 141 VAL B CB  1 
ATOM   788  C  CG1 . VAL B 1 16 ? -28.869 -55.546  35.370  1.00 66.73  ? 141 VAL B CG1 1 
ATOM   789  C  CG2 . VAL B 1 16 ? -28.128 -53.856  37.094  1.00 70.60  ? 141 VAL B CG2 1 
ATOM   790  N  N   . PHE B 1 17 ? -25.923 -57.005  34.349  1.00 58.23  ? 142 PHE B N   1 
ATOM   791  C  CA  . PHE B 1 17 ? -25.785 -58.231  33.569  1.00 55.91  ? 142 PHE B CA  1 
ATOM   792  C  C   . PHE B 1 17 ? -24.729 -59.166  34.164  1.00 60.14  ? 142 PHE B C   1 
ATOM   793  O  O   . PHE B 1 17 ? -24.959 -60.369  34.234  1.00 58.04  ? 142 PHE B O   1 
ATOM   794  C  CB  . PHE B 1 17 ? -25.458 -57.903  32.104  1.00 57.93  ? 142 PHE B CB  1 
ATOM   795  C  CG  . PHE B 1 17 ? -25.899 -58.950  31.113  1.00 57.55  ? 142 PHE B CG  1 
ATOM   796  C  CD1 . PHE B 1 17 ? -27.220 -59.008  30.678  1.00 59.41  ? 142 PHE B CD1 1 
ATOM   797  C  CD2 . PHE B 1 17 ? -24.991 -59.863  30.595  1.00 59.15  ? 142 PHE B CD2 1 
ATOM   798  C  CE1 . PHE B 1 17 ? -27.630 -59.988  29.775  1.00 59.00  ? 142 PHE B CE1 1 
ATOM   799  C  CE2 . PHE B 1 17 ? -25.399 -60.832  29.681  1.00 60.74  ? 142 PHE B CE2 1 
ATOM   800  C  CZ  . PHE B 1 17 ? -26.714 -60.887  29.277  1.00 57.98  ? 142 PHE B CZ  1 
ATOM   801  N  N   . TYR B 1 18 ? -23.595 -58.621  34.615  1.00 59.56  ? 143 TYR B N   1 
ATOM   802  C  CA  . TYR B 1 18 ? -22.539 -59.431  35.208  1.00 60.67  ? 143 TYR B CA  1 
ATOM   803  C  C   . TYR B 1 18 ? -22.936 -60.015  36.562  1.00 62.16  ? 143 TYR B C   1 
ATOM   804  O  O   . TYR B 1 18 ? -22.728 -61.211  36.780  1.00 61.51  ? 143 TYR B O   1 
ATOM   805  C  CB  . TYR B 1 18 ? -21.208 -58.663  35.252  1.00 66.22  ? 143 TYR B CB  1 
ATOM   806  C  CG  . TYR B 1 18 ? -20.339 -58.909  34.032  1.00 72.22  ? 143 TYR B CG  1 
ATOM   807  C  CD1 . TYR B 1 18 ? -19.034 -59.378  34.166  1.00 76.62  ? 143 TYR B CD1 1 
ATOM   808  C  CD2 . TYR B 1 18 ? -20.825 -58.689  32.742  1.00 73.11  ? 143 TYR B CD2 1 
ATOM   809  C  CE1 . TYR B 1 18 ? -18.227 -59.603  33.046  1.00 80.17  ? 143 TYR B CE1 1 
ATOM   810  C  CE2 . TYR B 1 18 ? -20.039 -58.942  31.615  1.00 74.74  ? 143 TYR B CE2 1 
ATOM   811  C  CZ  . TYR B 1 18 ? -18.737 -59.395  31.773  1.00 87.80  ? 143 TYR B CZ  1 
ATOM   812  O  OH  . TYR B 1 18 ? -17.944 -59.629  30.672  1.00 93.82  ? 143 TYR B OH  1 
ATOM   813  N  N   . ILE B 1 19 ? -23.567 -59.195  37.435  1.00 56.68  ? 144 ILE B N   1 
ATOM   814  C  CA  . ILE B 1 19 ? -24.061 -59.602  38.757  1.00 55.09  ? 144 ILE B CA  1 
ATOM   815  C  C   . ILE B 1 19 ? -25.180 -60.640  38.635  1.00 53.95  ? 144 ILE B C   1 
ATOM   816  O  O   . ILE B 1 19 ? -25.154 -61.625  39.371  1.00 53.77  ? 144 ILE B O   1 
ATOM   817  C  CB  . ILE B 1 19 ? -24.435 -58.376  39.647  1.00 60.08  ? 144 ILE B CB  1 
ATOM   818  C  CG1 . ILE B 1 19 ? -23.151 -57.687  40.172  1.00 63.38  ? 144 ILE B CG1 1 
ATOM   819  C  CG2 . ILE B 1 19 ? -25.371 -58.759  40.817  1.00 59.67  ? 144 ILE B CG2 1 
ATOM   820  C  CD1 . ILE B 1 19 ? -23.292 -56.225  40.571  1.00 75.12  ? 144 ILE B CD1 1 
ATOM   821  N  N   . ALA B 1 20 ? -26.134 -60.446  37.692  1.00 46.25  ? 145 ALA B N   1 
ATOM   822  C  CA  . ALA B 1 20 ? -27.222 -61.404  37.479  1.00 43.01  ? 145 ALA B CA  1 
ATOM   823  C  C   . ALA B 1 20 ? -26.684 -62.746  36.975  1.00 45.16  ? 145 ALA B C   1 
ATOM   824  O  O   . ALA B 1 20 ? -27.178 -63.786  37.414  1.00 43.16  ? 145 ALA B O   1 
ATOM   825  C  CB  . ALA B 1 20 ? -28.270 -60.849  36.533  1.00 43.03  ? 145 ALA B CB  1 
ATOM   826  N  N   . ALA B 1 21 ? -25.633 -62.723  36.102  1.00 42.36  ? 146 ALA B N   1 
ATOM   827  C  CA  . ALA B 1 21 ? -24.967 -63.915  35.562  1.00 41.46  ? 146 ALA B CA  1 
ATOM   828  C  C   . ALA B 1 21 ? -24.185 -64.651  36.634  1.00 47.73  ? 146 ALA B C   1 
ATOM   829  O  O   . ALA B 1 21 ? -24.075 -65.873  36.574  1.00 47.95  ? 146 ALA B O   1 
ATOM   830  C  CB  . ALA B 1 21 ? -24.063 -63.536  34.435  1.00 42.77  ? 146 ALA B CB  1 
ATOM   831  N  N   . VAL B 1 22 ? -23.662 -63.911  37.625  1.00 45.67  ? 147 VAL B N   1 
ATOM   832  C  CA  . VAL B 1 22 ? -22.994 -64.462  38.800  1.00 46.53  ? 147 VAL B CA  1 
ATOM   833  C  C   . VAL B 1 22 ? -24.066 -65.218  39.645  1.00 51.00  ? 147 VAL B C   1 
ATOM   834  O  O   . VAL B 1 22 ? -23.877 -66.400  39.954  1.00 51.85  ? 147 VAL B O   1 
ATOM   835  C  CB  . VAL B 1 22 ? -22.273 -63.350  39.621  1.00 51.42  ? 147 VAL B CB  1 
ATOM   836  C  CG1 . VAL B 1 22 ? -21.901 -63.832  41.023  1.00 51.82  ? 147 VAL B CG1 1 
ATOM   837  C  CG2 . VAL B 1 22 ? -21.041 -62.836  38.888  1.00 52.52  ? 147 VAL B CG2 1 
ATOM   838  N  N   . MET B 1 23 ? -25.191 -64.535  39.983  1.00 45.89  ? 148 MET B N   1 
ATOM   839  C  CA  . MET B 1 23 ? -26.294 -65.077  40.784  1.00 44.58  ? 148 MET B CA  1 
ATOM   840  C  C   . MET B 1 23 ? -26.847 -66.359  40.203  1.00 43.78  ? 148 MET B C   1 
ATOM   841  O  O   . MET B 1 23 ? -27.011 -67.319  40.949  1.00 43.72  ? 148 MET B O   1 
ATOM   842  C  CB  . MET B 1 23 ? -27.439 -64.068  40.940  1.00 47.56  ? 148 MET B CB  1 
ATOM   843  C  CG  . MET B 1 23 ? -27.053 -62.796  41.621  1.00 54.68  ? 148 MET B CG  1 
ATOM   844  S  SD  . MET B 1 23 ? -28.529 -61.865  42.072  1.00 61.32  ? 148 MET B SD  1 
ATOM   845  C  CE  . MET B 1 23 ? -28.782 -62.466  43.756  1.00 58.85  ? 148 MET B CE  1 
ATOM   846  N  N   . ALA B 1 24 ? -27.134 -66.374  38.873  1.00 36.23  ? 149 ALA B N   1 
ATOM   847  C  CA  . ALA B 1 24 ? -27.689 -67.520  38.162  1.00 33.06  ? 149 ALA B CA  1 
ATOM   848  C  C   . ALA B 1 24 ? -26.735 -68.732  38.189  1.00 35.85  ? 149 ALA B C   1 
ATOM   849  O  O   . ALA B 1 24 ? -27.196 -69.842  38.483  1.00 34.72  ? 149 ALA B O   1 
ATOM   850  C  CB  . ALA B 1 24 ? -28.070 -67.132  36.749  1.00 32.56  ? 149 ALA B CB  1 
ATOM   851  N  N   . THR B 1 25 ? -25.405 -68.509  37.970  1.00 32.48  ? 150 THR B N   1 
ATOM   852  C  CA  . THR B 1 25 ? -24.356 -69.542  38.038  1.00 33.47  ? 150 THR B CA  1 
ATOM   853  C  C   . THR B 1 25 ? -24.433 -70.239  39.411  1.00 39.00  ? 150 THR B C   1 
ATOM   854  O  O   . THR B 1 25 ? -24.410 -71.471  39.490  1.00 39.63  ? 150 THR B O   1 
ATOM   855  C  CB  . THR B 1 25 ? -22.962 -68.915  37.832  1.00 40.45  ? 150 THR B CB  1 
ATOM   856  O  OG1 . THR B 1 25 ? -22.903 -68.309  36.548  1.00 47.03  ? 150 THR B OG1 1 
ATOM   857  C  CG2 . THR B 1 25 ? -21.846 -69.929  37.924  1.00 38.15  ? 150 THR B CG2 1 
ATOM   858  N  N   . ASN B 1 26 ? -24.560 -69.435  40.484  1.00 34.81  ? 151 ASN B N   1 
ATOM   859  C  CA  . ASN B 1 26 ? -24.670 -69.911  41.856  1.00 34.79  ? 151 ASN B CA  1 
ATOM   860  C  C   . ASN B 1 26 ? -25.988 -70.660  42.091  1.00 36.67  ? 151 ASN B C   1 
ATOM   861  O  O   . ASN B 1 26 ? -25.986 -71.771  42.611  1.00 36.69  ? 151 ASN B O   1 
ATOM   862  C  CB  . ASN B 1 26 ? -24.519 -68.736  42.835  1.00 35.32  ? 151 ASN B CB  1 
ATOM   863  C  CG  . ASN B 1 26 ? -24.620 -69.121  44.293  1.00 57.98  ? 151 ASN B CG  1 
ATOM   864  O  OD1 . ASN B 1 26 ? -25.486 -68.611  45.037  1.00 49.27  ? 151 ASN B OD1 1 
ATOM   865  N  ND2 . ASN B 1 26 ? -23.755 -70.050  44.722  1.00 45.64  ? 151 ASN B ND2 1 
ATOM   866  N  N   . LEU B 1 27 ? -27.095 -70.065  41.677  1.00 32.15  ? 152 LEU B N   1 
ATOM   867  C  CA  . LEU B 1 27 ? -28.419 -70.616  41.881  1.00 31.47  ? 152 LEU B CA  1 
ATOM   868  C  C   . LEU B 1 27 ? -28.756 -71.890  41.102  1.00 37.54  ? 152 LEU B C   1 
ATOM   869  O  O   . LEU B 1 27 ? -29.167 -72.876  41.720  1.00 38.52  ? 152 LEU B O   1 
ATOM   870  C  CB  . LEU B 1 27 ? -29.477 -69.529  41.658  1.00 30.19  ? 152 LEU B CB  1 
ATOM   871  C  CG  . LEU B 1 27 ? -29.564 -68.468  42.737  1.00 35.40  ? 152 LEU B CG  1 
ATOM   872  C  CD1 . LEU B 1 27 ? -30.052 -67.162  42.170  1.00 35.51  ? 152 LEU B CD1 1 
ATOM   873  C  CD2 . LEU B 1 27 ? -30.442 -68.923  43.867  1.00 37.69  ? 152 LEU B CD2 1 
ATOM   874  N  N   . TYR B 1 28 ? -28.598 -71.875  39.755  1.00 33.41  ? 153 TYR B N   1 
ATOM   875  C  CA  . TYR B 1 28 ? -29.018 -72.976  38.874  1.00 31.87  ? 153 TYR B CA  1 
ATOM   876  C  C   . TYR B 1 28 ? -27.905 -73.707  38.121  1.00 37.04  ? 153 TYR B C   1 
ATOM   877  O  O   . TYR B 1 28 ? -28.193 -74.525  37.244  1.00 36.94  ? 153 TYR B O   1 
ATOM   878  C  CB  . TYR B 1 28 ? -30.073 -72.457  37.892  1.00 30.86  ? 153 TYR B CB  1 
ATOM   879  C  CG  . TYR B 1 28 ? -30.904 -71.301  38.415  1.00 32.39  ? 153 TYR B CG  1 
ATOM   880  C  CD1 . TYR B 1 28 ? -31.849 -71.488  39.429  1.00 34.22  ? 153 TYR B CD1 1 
ATOM   881  C  CD2 . TYR B 1 28 ? -30.764 -70.020  37.884  1.00 32.95  ? 153 TYR B CD2 1 
ATOM   882  C  CE1 . TYR B 1 28 ? -32.620 -70.427  39.908  1.00 34.11  ? 153 TYR B CE1 1 
ATOM   883  C  CE2 . TYR B 1 28 ? -31.542 -68.954  38.344  1.00 33.59  ? 153 TYR B CE2 1 
ATOM   884  C  CZ  . TYR B 1 28 ? -32.467 -69.160  39.357  1.00 40.48  ? 153 TYR B CZ  1 
ATOM   885  O  OH  . TYR B 1 28 ? -33.232 -68.102  39.795  1.00 40.62  ? 153 TYR B OH  1 
ATOM   886  N  N   . GLY B 1 29 ? -26.656 -73.430  38.483  1.00 33.67  ? 154 GLY B N   1 
ATOM   887  C  CA  . GLY B 1 29 ? -25.497 -74.018  37.836  1.00 34.28  ? 154 GLY B CA  1 
ATOM   888  C  C   . GLY B 1 29 ? -25.362 -75.510  37.993  1.00 39.62  ? 154 GLY B C   1 
ATOM   889  O  O   . GLY B 1 29 ? -24.879 -76.176  37.076  1.00 41.60  ? 154 GLY B O   1 
ATOM   890  N  N   . ALA B 1 30 ? -25.756 -76.043  39.155  1.00 35.36  ? 155 ALA B N   1 
ATOM   891  C  CA  . ALA B 1 30 ? -25.622 -77.469  39.448  1.00 36.82  ? 155 ALA B CA  1 
ATOM   892  C  C   . ALA B 1 30 ? -26.766 -78.285  38.894  1.00 40.79  ? 155 ALA B C   1 
ATOM   893  O  O   . ALA B 1 30 ? -26.563 -79.407  38.438  1.00 41.85  ? 155 ALA B O   1 
ATOM   894  C  CB  . ALA B 1 30 ? -25.521 -77.680  40.948  1.00 38.42  ? 155 ALA B CB  1 
ATOM   895  N  N   . THR B 1 31 ? -27.971 -77.731  38.974  1.00 36.21  ? 156 THR B N   1 
ATOM   896  C  CA  . THR B 1 31 ? -29.211 -78.368  38.558  1.00 35.73  ? 156 THR B CA  1 
ATOM   897  C  C   . THR B 1 31 ? -29.412 -78.279  37.033  1.00 42.52  ? 156 THR B C   1 
ATOM   898  O  O   . THR B 1 31 ? -29.964 -79.212  36.435  1.00 43.60  ? 156 THR B O   1 
ATOM   899  C  CB  . THR B 1 31 ? -30.388 -77.789  39.377  1.00 34.04  ? 156 THR B CB  1 
ATOM   900  O  OG1 . THR B 1 31 ? -30.339 -76.363  39.342  1.00 37.07  ? 156 THR B OG1 1 
ATOM   901  C  CG2 . THR B 1 31 ? -30.367 -78.221  40.807  1.00 24.14  ? 156 THR B CG2 1 
ATOM   902  N  N   . PHE B 1 32 ? -28.954 -77.150  36.415  1.00 38.72  ? 157 PHE B N   1 
ATOM   903  C  CA  . PHE B 1 32 ? -29.049 -76.847  34.977  1.00 37.75  ? 157 PHE B CA  1 
ATOM   904  C  C   . PHE B 1 32 ? -27.636 -76.432  34.433  1.00 43.26  ? 157 PHE B C   1 
ATOM   905  O  O   . PHE B 1 32 ? -27.429 -75.260  34.088  1.00 42.15  ? 157 PHE B O   1 
ATOM   906  C  CB  . PHE B 1 32 ? -30.114 -75.745  34.737  1.00 37.43  ? 157 PHE B CB  1 
ATOM   907  C  CG  . PHE B 1 32 ? -31.511 -76.122  35.193  1.00 38.54  ? 157 PHE B CG  1 
ATOM   908  C  CD1 . PHE B 1 32 ? -31.913 -75.917  36.511  1.00 41.17  ? 157 PHE B CD1 1 
ATOM   909  C  CD2 . PHE B 1 32 ? -32.423 -76.686  34.306  1.00 40.09  ? 157 PHE B CD2 1 
ATOM   910  C  CE1 . PHE B 1 32 ? -33.177 -76.319  36.943  1.00 41.84  ? 157 PHE B CE1 1 
ATOM   911  C  CE2 . PHE B 1 32 ? -33.699 -77.063  34.734  1.00 42.42  ? 157 PHE B CE2 1 
ATOM   912  C  CZ  . PHE B 1 32 ? -34.057 -76.898  36.052  1.00 40.60  ? 157 PHE B CZ  1 
ATOM   913  N  N   . PRO B 1 33 ? -26.651 -77.383  34.355  1.00 41.24  ? 158 PRO B N   1 
ATOM   914  C  CA  . PRO B 1 33 ? -25.292 -77.009  33.926  1.00 41.58  ? 158 PRO B CA  1 
ATOM   915  C  C   . PRO B 1 33 ? -25.062 -76.580  32.470  1.00 45.53  ? 158 PRO B C   1 
ATOM   916  O  O   . PRO B 1 33 ? -24.043 -75.938  32.203  1.00 45.02  ? 158 PRO B O   1 
ATOM   917  C  CB  . PRO B 1 33 ? -24.449 -78.220  34.341  1.00 45.58  ? 158 PRO B CB  1 
ATOM   918  C  CG  . PRO B 1 33 ? -25.373 -79.347  34.281  1.00 50.19  ? 158 PRO B CG  1 
ATOM   919  C  CD  . PRO B 1 33 ? -26.703 -78.817  34.720  1.00 43.88  ? 158 PRO B CD  1 
ATOM   920  N  N   . GLU B 1 34 ? -25.976 -76.938  31.531  1.00 41.28  ? 159 GLU B N   1 
ATOM   921  C  CA  . GLU B 1 34 ? -25.865 -76.559  30.115  1.00 39.92  ? 159 GLU B CA  1 
ATOM   922  C  C   . GLU B 1 34 ? -26.195 -75.085  29.955  1.00 39.82  ? 159 GLU B C   1 
ATOM   923  O  O   . GLU B 1 34 ? -25.604 -74.416  29.130  1.00 37.70  ? 159 GLU B O   1 
ATOM   924  C  CB  . GLU B 1 34 ? -26.833 -77.389  29.259  1.00 41.96  ? 159 GLU B CB  1 
ATOM   925  C  CG  . GLU B 1 34 ? -26.361 -77.649  27.836  1.00 56.01  ? 159 GLU B CG  1 
ATOM   926  C  CD  . GLU B 1 34 ? -25.198 -78.616  27.707  1.00 76.92  ? 159 GLU B CD  1 
ATOM   927  O  OE1 . GLU B 1 34 ? -25.382 -79.813  28.029  1.00 76.99  ? 159 GLU B OE1 1 
ATOM   928  O  OE2 . GLU B 1 34 ? -24.106 -78.180  27.271  1.00 61.87  ? 159 GLU B OE2 1 
ATOM   929  N  N   . TRP B 1 35 ? -27.122 -74.572  30.771  1.00 37.32  ? 160 TRP B N   1 
ATOM   930  C  CA  . TRP B 1 35 ? -27.558 -73.179  30.709  1.00 36.02  ? 160 TRP B CA  1 
ATOM   931  C  C   . TRP B 1 35 ? -26.844 -72.248  31.644  1.00 37.95  ? 160 TRP B C   1 
ATOM   932  O  O   . TRP B 1 35 ? -26.645 -71.098  31.262  1.00 37.01  ? 160 TRP B O   1 
ATOM   933  C  CB  . TRP B 1 35 ? -29.074 -73.051  30.921  1.00 33.96  ? 160 TRP B CB  1 
ATOM   934  C  CG  . TRP B 1 35 ? -29.930 -73.810  29.936  1.00 35.43  ? 160 TRP B CG  1 
ATOM   935  C  CD1 . TRP B 1 35 ? -29.601 -74.180  28.661  1.00 39.32  ? 160 TRP B CD1 1 
ATOM   936  C  CD2 . TRP B 1 35 ? -31.283 -74.245  30.143  1.00 34.77  ? 160 TRP B CD2 1 
ATOM   937  N  NE1 . TRP B 1 35 ? -30.660 -74.833  28.069  1.00 39.12  ? 160 TRP B NE1 1 
ATOM   938  C  CE2 . TRP B 1 35 ? -31.701 -74.898  28.961  1.00 39.56  ? 160 TRP B CE2 1 
ATOM   939  C  CE3 . TRP B 1 35 ? -32.193 -74.125  31.207  1.00 34.84  ? 160 TRP B CE3 1 
ATOM   940  C  CZ2 . TRP B 1 35 ? -32.976 -75.455  28.828  1.00 38.63  ? 160 TRP B CZ2 1 
ATOM   941  C  CZ3 . TRP B 1 35 ? -33.455 -74.679  31.070  1.00 36.11  ? 160 TRP B CZ3 1 
ATOM   942  C  CH2 . TRP B 1 35 ? -33.832 -75.341  29.897  1.00 37.43  ? 160 TRP B CH2 1 
ATOM   943  N  N   . PHE B 1 36 ? -26.472 -72.713  32.863  1.00 34.32  ? 161 PHE B N   1 
ATOM   944  C  CA  . PHE B 1 36 ? -25.832 -71.856  33.882  1.00 33.68  ? 161 PHE B CA  1 
ATOM   945  C  C   . PHE B 1 36 ? -24.607 -72.473  34.631  1.00 38.70  ? 161 PHE B C   1 
ATOM   946  O  O   . PHE B 1 36 ? -24.240 -71.993  35.719  1.00 36.55  ? 161 PHE B O   1 
ATOM   947  C  CB  . PHE B 1 36 ? -26.893 -71.344  34.898  1.00 34.00  ? 161 PHE B CB  1 
ATOM   948  C  CG  . PHE B 1 36 ? -28.186 -70.756  34.363  1.00 34.09  ? 161 PHE B CG  1 
ATOM   949  C  CD1 . PHE B 1 36 ? -28.273 -69.406  34.035  1.00 36.79  ? 161 PHE B CD1 1 
ATOM   950  C  CD2 . PHE B 1 36 ? -29.332 -71.541  34.241  1.00 35.85  ? 161 PHE B CD2 1 
ATOM   951  C  CE1 . PHE B 1 36 ? -29.483 -68.853  33.569  1.00 37.34  ? 161 PHE B CE1 1 
ATOM   952  C  CE2 . PHE B 1 36 ? -30.545 -70.986  33.795  1.00 37.53  ? 161 PHE B CE2 1 
ATOM   953  C  CZ  . PHE B 1 36 ? -30.614 -69.644  33.463  1.00 35.34  ? 161 PHE B CZ  1 
ATOM   954  N  N   . GLY B 1 37 ? -23.965 -73.479  34.015  1.00 37.65  ? 162 GLY B N   1 
ATOM   955  C  CA  . GLY B 1 37 ? -22.831 -74.217  34.589  1.00 39.57  ? 162 GLY B CA  1 
ATOM   956  C  C   . GLY B 1 37 ? -21.516 -73.496  34.828  1.00 43.82  ? 162 GLY B C   1 
ATOM   957  O  O   . GLY B 1 37 ? -20.611 -74.073  35.426  1.00 44.83  ? 162 GLY B O   1 
ATOM   958  N  N   . ASP B 1 38 ? -21.378 -72.272  34.301  1.00 40.37  ? 163 ASP B N   1 
ATOM   959  C  CA  . ASP B 1 38 ? -20.238 -71.360  34.432  1.00 41.94  ? 163 ASP B CA  1 
ATOM   960  C  C   . ASP B 1 38 ? -20.691 -69.930  34.124  1.00 45.40  ? 163 ASP B C   1 
ATOM   961  O  O   . ASP B 1 38 ? -21.848 -69.753  33.734  1.00 43.69  ? 163 ASP B O   1 
ATOM   962  C  CB  . ASP B 1 38 ? -18.994 -71.793  33.616  1.00 46.29  ? 163 ASP B CB  1 
ATOM   963  C  CG  . ASP B 1 38 ? -19.203 -72.237  32.182  1.00 55.40  ? 163 ASP B CG  1 
ATOM   964  O  OD1 . ASP B 1 38 ? -19.518 -71.376  31.337  1.00 57.55  ? 163 ASP B OD1 1 
ATOM   965  O  OD2 . ASP B 1 38 ? -18.913 -73.422  31.877  1.00 57.19  ? 163 ASP B OD2 1 
ATOM   966  N  N   . LEU B 1 39 ? -19.831 -68.906  34.345  1.00 42.66  ? 164 LEU B N   1 
ATOM   967  C  CA  . LEU B 1 39 ? -20.241 -67.518  34.096  1.00 41.07  ? 164 LEU B CA  1 
ATOM   968  C  C   . LEU B 1 39 ? -20.612 -67.290  32.624  1.00 45.11  ? 164 LEU B C   1 
ATOM   969  O  O   . LEU B 1 39 ? -21.648 -66.675  32.361  1.00 42.99  ? 164 LEU B O   1 
ATOM   970  C  CB  . LEU B 1 39 ? -19.192 -66.500  34.595  1.00 41.99  ? 164 LEU B CB  1 
ATOM   971  C  CG  . LEU B 1 39 ? -19.602 -65.012  34.617  1.00 45.24  ? 164 LEU B CG  1 
ATOM   972  C  CD1 . LEU B 1 39 ? -20.729 -64.748  35.596  1.00 44.29  ? 164 LEU B CD1 1 
ATOM   973  C  CD2 . LEU B 1 39 ? -18.422 -64.123  34.956  1.00 48.40  ? 164 LEU B CD2 1 
ATOM   974  N  N   . SER B 1 40 ? -19.792 -67.844  31.684  1.00 43.44  ? 165 SER B N   1 
ATOM   975  C  CA  . SER B 1 40 ? -19.945 -67.773  30.218  1.00 42.97  ? 165 SER B CA  1 
ATOM   976  C  C   . SER B 1 40 ? -21.319 -68.240  29.738  1.00 45.61  ? 165 SER B C   1 
ATOM   977  O  O   . SER B 1 40 ? -22.014 -67.485  29.041  1.00 44.98  ? 165 SER B O   1 
ATOM   978  C  CB  . SER B 1 40 ? -18.860 -68.591  29.529  1.00 47.75  ? 165 SER B CB  1 
ATOM   979  O  OG  . SER B 1 40 ? -17.621 -67.902  29.517  1.00 63.04  ? 165 SER B OG  1 
ATOM   980  N  N   . LYS B 1 41 ? -21.712 -69.483  30.124  1.00 39.82  ? 166 LYS B N   1 
ATOM   981  C  CA  . LYS B 1 41 ? -22.993 -70.082  29.768  1.00 36.60  ? 166 LYS B CA  1 
ATOM   982  C  C   . LYS B 1 41 ? -24.113 -69.224  30.295  1.00 38.17  ? 166 LYS B C   1 
ATOM   983  O  O   . LYS B 1 41 ? -25.081 -69.029  29.571  1.00 36.89  ? 166 LYS B O   1 
ATOM   984  C  CB  . LYS B 1 41 ? -23.109 -71.508  30.308  1.00 38.39  ? 166 LYS B CB  1 
ATOM   985  C  CG  . LYS B 1 41 ? -22.188 -72.528  29.644  1.00 35.60  ? 166 LYS B CG  1 
ATOM   986  C  CD  . LYS B 1 41 ? -22.058 -73.746  30.554  1.00 43.62  ? 166 LYS B CD  1 
ATOM   987  C  CE  . LYS B 1 41 ? -21.695 -75.048  29.881  1.00 47.09  ? 166 LYS B CE  1 
ATOM   988  N  NZ  . LYS B 1 41 ? -21.749 -76.191  30.847  1.00 53.14  ? 166 LYS B NZ  1 
ATOM   989  N  N   . SER B 1 42 ? -23.952 -68.661  31.530  1.00 35.62  ? 167 SER B N   1 
ATOM   990  C  CA  . SER B 1 42 ? -24.912 -67.783  32.234  1.00 34.79  ? 167 SER B CA  1 
ATOM   991  C  C   . SER B 1 42 ? -25.123 -66.427  31.543  1.00 39.51  ? 167 SER B C   1 
ATOM   992  O  O   . SER B 1 42 ? -26.277 -66.014  31.390  1.00 38.15  ? 167 SER B O   1 
ATOM   993  C  CB  . SER B 1 42 ? -24.514 -67.576  33.694  1.00 38.84  ? 167 SER B CB  1 
ATOM   994  O  OG  . SER B 1 42 ? -24.730 -68.737  34.477  1.00 46.50  ? 167 SER B OG  1 
ATOM   995  N  N   . LEU B 1 43 ? -24.024 -65.740  31.117  1.00 37.52  ? 168 LEU B N   1 
ATOM   996  C  CA  . LEU B 1 43 ? -24.089 -64.465  30.369  1.00 37.47  ? 168 LEU B CA  1 
ATOM   997  C  C   . LEU B 1 43 ? -24.779 -64.695  28.997  1.00 39.47  ? 168 LEU B C   1 
ATOM   998  O  O   . LEU B 1 43 ? -25.571 -63.859  28.554  1.00 38.57  ? 168 LEU B O   1 
ATOM   999  C  CB  . LEU B 1 43 ? -22.683 -63.858  30.157  1.00 39.04  ? 168 LEU B CB  1 
ATOM   1000 C  CG  . LEU B 1 43 ? -21.915 -63.375  31.404  1.00 44.46  ? 168 LEU B CG  1 
ATOM   1001 C  CD1 . LEU B 1 43 ? -20.419 -63.308  31.119  1.00 46.84  ? 168 LEU B CD1 1 
ATOM   1002 C  CD2 . LEU B 1 43 ? -22.411 -62.015  31.891  1.00 43.91  ? 168 LEU B CD2 1 
ATOM   1003 N  N   . TYR B 1 44 ? -24.494 -65.851  28.354  1.00 35.20  ? 169 TYR B N   1 
ATOM   1004 C  CA  . TYR B 1 44 ? -25.102 -66.243  27.095  1.00 34.90  ? 169 TYR B CA  1 
ATOM   1005 C  C   . TYR B 1 44 ? -26.623 -66.436  27.263  1.00 38.57  ? 169 TYR B C   1 
ATOM   1006 O  O   . TYR B 1 44 ? -27.411 -65.898  26.465  1.00 37.61  ? 169 TYR B O   1 
ATOM   1007 C  CB  . TYR B 1 44 ? -24.465 -67.540  26.551  1.00 36.65  ? 169 TYR B CB  1 
ATOM   1008 C  CG  . TYR B 1 44 ? -25.164 -67.998  25.294  1.00 38.78  ? 169 TYR B CG  1 
ATOM   1009 C  CD1 . TYR B 1 44 ? -24.885 -67.407  24.067  1.00 42.32  ? 169 TYR B CD1 1 
ATOM   1010 C  CD2 . TYR B 1 44 ? -26.215 -68.911  25.353  1.00 38.72  ? 169 TYR B CD2 1 
ATOM   1011 C  CE1 . TYR B 1 44 ? -25.611 -67.730  22.925  1.00 44.81  ? 169 TYR B CE1 1 
ATOM   1012 C  CE2 . TYR B 1 44 ? -26.948 -69.244  24.216  1.00 40.12  ? 169 TYR B CE2 1 
ATOM   1013 C  CZ  . TYR B 1 44 ? -26.633 -68.660  23.000  1.00 52.63  ? 169 TYR B CZ  1 
ATOM   1014 O  OH  . TYR B 1 44 ? -27.303 -69.024  21.858  1.00 59.14  ? 169 TYR B OH  1 
ATOM   1015 N  N   . THR B 1 45 ? -27.014 -67.253  28.268  1.00 34.50  ? 170 THR B N   1 
ATOM   1016 C  CA  . THR B 1 45 ? -28.403 -67.579  28.549  1.00 33.75  ? 170 THR B CA  1 
ATOM   1017 C  C   . THR B 1 45 ? -29.185 -66.326  28.889  1.00 38.13  ? 170 THR B C   1 
ATOM   1018 O  O   . THR B 1 45 ? -30.256 -66.129  28.329  1.00 38.38  ? 170 THR B O   1 
ATOM   1019 C  CB  . THR B 1 45 ? -28.502 -68.709  29.576  1.00 43.98  ? 170 THR B CB  1 
ATOM   1020 O  OG1 . THR B 1 45 ? -27.821 -69.840  29.048  1.00 47.56  ? 170 THR B OG1 1 
ATOM   1021 C  CG2 . THR B 1 45 ? -29.936 -69.109  29.880  1.00 42.94  ? 170 THR B CG2 1 
ATOM   1022 N  N   . LEU B 1 46 ? -28.629 -65.450  29.747  1.00 34.75  ? 171 LEU B N   1 
ATOM   1023 C  CA  . LEU B 1 46 ? -29.298 -64.205  30.132  1.00 34.07  ? 171 LEU B CA  1 
ATOM   1024 C  C   . LEU B 1 46 ? -29.416 -63.182  28.995  1.00 41.34  ? 171 LEU B C   1 
ATOM   1025 O  O   . LEU B 1 46 ? -30.330 -62.359  29.022  1.00 43.11  ? 171 LEU B O   1 
ATOM   1026 C  CB  . LEU B 1 46 ? -28.749 -63.605  31.428  1.00 33.48  ? 171 LEU B CB  1 
ATOM   1027 C  CG  . LEU B 1 46 ? -28.917 -64.458  32.687  1.00 35.71  ? 171 LEU B CG  1 
ATOM   1028 C  CD1 . LEU B 1 46 ? -28.130 -63.891  33.800  1.00 35.27  ? 171 LEU B CD1 1 
ATOM   1029 C  CD2 . LEU B 1 46 ? -30.372 -64.562  33.115  1.00 38.66  ? 171 LEU B CD2 1 
ATOM   1030 N  N   . PHE B 1 47 ? -28.556 -63.278  27.962  1.00 37.85  ? 172 PHE B N   1 
ATOM   1031 C  CA  . PHE B 1 47 ? -28.682 -62.413  26.788  1.00 38.23  ? 172 PHE B CA  1 
ATOM   1032 C  C   . PHE B 1 47 ? -29.910 -62.907  25.992  1.00 43.31  ? 172 PHE B C   1 
ATOM   1033 O  O   . PHE B 1 47 ? -30.712 -62.094  25.527  1.00 45.05  ? 172 PHE B O   1 
ATOM   1034 C  CB  . PHE B 1 47 ? -27.403 -62.435  25.920  1.00 39.82  ? 172 PHE B CB  1 
ATOM   1035 C  CG  . PHE B 1 47 ? -27.546 -61.632  24.643  1.00 41.03  ? 172 PHE B CG  1 
ATOM   1036 C  CD1 . PHE B 1 47 ? -27.390 -60.251  24.648  1.00 44.19  ? 172 PHE B CD1 1 
ATOM   1037 C  CD2 . PHE B 1 47 ? -27.867 -62.252  23.445  1.00 41.38  ? 172 PHE B CD2 1 
ATOM   1038 C  CE1 . PHE B 1 47 ? -27.553 -59.510  23.480  1.00 45.51  ? 172 PHE B CE1 1 
ATOM   1039 C  CE2 . PHE B 1 47 ? -28.037 -61.508  22.282  1.00 45.07  ? 172 PHE B CE2 1 
ATOM   1040 C  CZ  . PHE B 1 47 ? -27.883 -60.142  22.308  1.00 44.34  ? 172 PHE B CZ  1 
ATOM   1041 N  N   . GLN B 1 48 ? -30.050 -64.247  25.863  1.00 37.03  ? 173 GLN B N   1 
ATOM   1042 C  CA  . GLN B 1 48 ? -31.159 -64.901  25.185  1.00 35.33  ? 173 GLN B CA  1 
ATOM   1043 C  C   . GLN B 1 48 ? -32.475 -64.643  25.946  1.00 41.33  ? 173 GLN B C   1 
ATOM   1044 O  O   . GLN B 1 48 ? -33.488 -64.318  25.324  1.00 43.20  ? 173 GLN B O   1 
ATOM   1045 C  CB  . GLN B 1 48 ? -30.868 -66.391  25.041  1.00 34.89  ? 173 GLN B CB  1 
ATOM   1046 C  CG  . GLN B 1 48 ? -32.089 -67.194  24.676  1.00 34.84  ? 173 GLN B CG  1 
ATOM   1047 C  CD  . GLN B 1 48 ? -31.961 -68.620  25.097  1.00 49.88  ? 173 GLN B CD  1 
ATOM   1048 O  OE1 . GLN B 1 48 ? -30.854 -69.186  25.161  1.00 43.57  ? 173 GLN B OE1 1 
ATOM   1049 N  NE2 . GLN B 1 48 ? -33.106 -69.236  25.373  1.00 37.56  ? 173 GLN B NE2 1 
ATOM   1050 N  N   . VAL B 1 49 ? -32.450 -64.761  27.285  1.00 37.27  ? 174 VAL B N   1 
ATOM   1051 C  CA  . VAL B 1 49 ? -33.612 -64.496  28.137  1.00 37.06  ? 174 VAL B CA  1 
ATOM   1052 C  C   . VAL B 1 49 ? -34.025 -63.018  27.920  1.00 44.79  ? 174 VAL B C   1 
ATOM   1053 O  O   . VAL B 1 49 ? -35.214 -62.742  27.740  1.00 46.09  ? 174 VAL B O   1 
ATOM   1054 C  CB  . VAL B 1 49 ? -33.364 -64.867  29.637  1.00 38.80  ? 174 VAL B CB  1 
ATOM   1055 C  CG1 . VAL B 1 49 ? -34.461 -64.311  30.545  1.00 38.17  ? 174 VAL B CG1 1 
ATOM   1056 C  CG2 . VAL B 1 49 ? -33.233 -66.380  29.818  1.00 37.36  ? 174 VAL B CG2 1 
ATOM   1057 N  N   . MET B 1 50 ? -33.036 -62.096  27.844  1.00 41.60  ? 175 MET B N   1 
ATOM   1058 C  CA  . MET B 1 50 ? -33.291 -60.680  27.587  1.00 43.16  ? 175 MET B CA  1 
ATOM   1059 C  C   . MET B 1 50 ? -33.996 -60.484  26.239  1.00 48.68  ? 175 MET B C   1 
ATOM   1060 O  O   . MET B 1 50 ? -34.995 -59.773  26.193  1.00 50.52  ? 175 MET B O   1 
ATOM   1061 C  CB  . MET B 1 50 ? -31.992 -59.882  27.655  1.00 46.35  ? 175 MET B CB  1 
ATOM   1062 C  CG  . MET B 1 50 ? -32.182 -58.390  27.596  1.00 51.91  ? 175 MET B CG  1 
ATOM   1063 S  SD  . MET B 1 50 ? -30.576 -57.582  27.502  1.00 57.28  ? 175 MET B SD  1 
ATOM   1064 C  CE  . MET B 1 50 ? -30.227 -57.747  25.760  1.00 54.66  ? 175 MET B CE  1 
ATOM   1065 N  N   . THR B 1 51 ? -33.531 -61.169  25.167  1.00 44.39  ? 176 THR B N   1 
ATOM   1066 C  CA  . THR B 1 51 ? -34.153 -61.083  23.831  1.00 45.09  ? 176 THR B CA  1 
ATOM   1067 C  C   . THR B 1 51 ? -35.542 -61.748  23.791  1.00 47.47  ? 176 THR B C   1 
ATOM   1068 O  O   . THR B 1 51 ? -36.244 -61.654  22.775  1.00 49.17  ? 176 THR B O   1 
ATOM   1069 C  CB  . THR B 1 51 ? -33.210 -61.577  22.722  1.00 53.75  ? 176 THR B CB  1 
ATOM   1070 O  OG1 . THR B 1 51 ? -32.924 -62.962  22.928  1.00 53.56  ? 176 THR B OG1 1 
ATOM   1071 C  CG2 . THR B 1 51 ? -31.927 -60.744  22.613  1.00 51.89  ? 176 THR B CG2 1 
ATOM   1072 N  N   . LEU B 1 52 ? -35.940 -62.392  24.922  1.00 40.18  ? 177 LEU B N   1 
ATOM   1073 C  CA  . LEU B 1 52 ? -37.226 -63.061  25.180  1.00 38.37  ? 177 LEU B CA  1 
ATOM   1074 C  C   . LEU B 1 52 ? -37.403 -64.368  24.438  1.00 41.21  ? 177 LEU B C   1 
ATOM   1075 O  O   . LEU B 1 52 ? -38.498 -64.917  24.433  1.00 42.70  ? 177 LEU B O   1 
ATOM   1076 C  CB  . LEU B 1 52 ? -38.420 -62.104  24.969  1.00 39.65  ? 177 LEU B CB  1 
ATOM   1077 C  CG  . LEU B 1 52 ? -38.370 -60.801  25.773  1.00 44.91  ? 177 LEU B CG  1 
ATOM   1078 C  CD1 . LEU B 1 52 ? -39.251 -59.738  25.152  1.00 47.12  ? 177 LEU B CD1 1 
ATOM   1079 C  CD2 . LEU B 1 52 ? -38.684 -61.037  27.253  1.00 45.06  ? 177 LEU B CD2 1 
ATOM   1080 N  N   . GLU B 1 53 ? -36.322 -64.879  23.837  1.00 35.80  ? 178 GLU B N   1 
ATOM   1081 C  CA  . GLU B 1 53 ? -36.329 -66.105  23.043  1.00 34.90  ? 178 GLU B CA  1 
ATOM   1082 C  C   . GLU B 1 53 ? -36.421 -67.304  23.951  1.00 36.32  ? 178 GLU B C   1 
ATOM   1083 O  O   . GLU B 1 53 ? -35.588 -67.447  24.829  1.00 36.26  ? 178 GLU B O   1 
ATOM   1084 C  CB  . GLU B 1 53 ? -35.081 -66.163  22.132  1.00 36.37  ? 178 GLU B CB  1 
ATOM   1085 C  CG  . GLU B 1 53 ? -35.273 -67.042  20.916  1.00 42.28  ? 178 GLU B CG  1 
ATOM   1086 C  CD  . GLU B 1 53 ? -34.972 -68.505  21.144  1.00 56.13  ? 178 GLU B CD  1 
ATOM   1087 O  OE1 . GLU B 1 53 ? -35.923 -69.290  21.347  1.00 38.32  ? 178 GLU B OE1 1 
ATOM   1088 O  OE2 . GLU B 1 53 ? -33.779 -68.869  21.113  1.00 56.70  ? 178 GLU B OE2 1 
ATOM   1089 N  N   . SER B 1 54 ? -37.443 -68.141  23.765  1.00 33.87  ? 179 SER B N   1 
ATOM   1090 C  CA  . SER B 1 54 ? -37.761 -69.341  24.575  1.00 34.04  ? 179 SER B CA  1 
ATOM   1091 C  C   . SER B 1 54 ? -37.542 -69.142  26.090  1.00 38.02  ? 179 SER B C   1 
ATOM   1092 O  O   . SER B 1 54 ? -37.145 -70.081  26.785  1.00 37.60  ? 179 SER B O   1 
ATOM   1093 C  CB  . SER B 1 54 ? -37.016 -70.576  24.060  1.00 36.73  ? 179 SER B CB  1 
ATOM   1094 O  OG  . SER B 1 54 ? -37.533 -71.078  22.837  1.00 41.38  ? 179 SER B OG  1 
ATOM   1095 N  N   . TRP B 1 55 ? -37.770 -67.910  26.585  1.00 35.62  ? 180 TRP B N   1 
ATOM   1096 C  CA  . TRP B 1 55 ? -37.505 -67.562  27.976  1.00 36.35  ? 180 TRP B CA  1 
ATOM   1097 C  C   . TRP B 1 55 ? -38.297 -68.386  28.979  1.00 38.54  ? 180 TRP B C   1 
ATOM   1098 O  O   . TRP B 1 55 ? -37.707 -68.940  29.900  1.00 36.75  ? 180 TRP B O   1 
ATOM   1099 C  CB  . TRP B 1 55 ? -37.580 -66.039  28.218  1.00 37.01  ? 180 TRP B CB  1 
ATOM   1100 C  CG  . TRP B 1 55 ? -38.948 -65.474  28.493  1.00 39.44  ? 180 TRP B CG  1 
ATOM   1101 C  CD1 . TRP B 1 55 ? -39.745 -64.804  27.618  1.00 43.76  ? 180 TRP B CD1 1 
ATOM   1102 C  CD2 . TRP B 1 55 ? -39.621 -65.430  29.764  1.00 39.34  ? 180 TRP B CD2 1 
ATOM   1103 N  NE1 . TRP B 1 55 ? -40.904 -64.398  28.247  1.00 43.84  ? 180 TRP B NE1 1 
ATOM   1104 C  CE2 . TRP B 1 55 ? -40.851 -64.767  29.564  1.00 44.33  ? 180 TRP B CE2 1 
ATOM   1105 C  CE3 . TRP B 1 55 ? -39.314 -65.913  31.050  1.00 40.06  ? 180 TRP B CE3 1 
ATOM   1106 C  CZ2 . TRP B 1 55 ? -41.779 -64.576  30.598  1.00 44.48  ? 180 TRP B CZ2 1 
ATOM   1107 C  CZ3 . TRP B 1 55 ? -40.234 -65.721  32.076  1.00 42.16  ? 180 TRP B CZ3 1 
ATOM   1108 C  CH2 . TRP B 1 55 ? -41.448 -65.056  31.848  1.00 44.06  ? 180 TRP B CH2 1 
ATOM   1109 N  N   . SER B 1 56 ? -39.612 -68.521  28.759  1.00 34.32  ? 181 SER B N   1 
ATOM   1110 C  CA  . SER B 1 56 ? -40.475 -69.294  29.632  1.00 33.97  ? 181 SER B CA  1 
ATOM   1111 C  C   . SER B 1 56 ? -40.514 -70.800  29.246  1.00 36.14  ? 181 SER B C   1 
ATOM   1112 O  O   . SER B 1 56 ? -40.093 -71.639  30.039  1.00 36.24  ? 181 SER B O   1 
ATOM   1113 C  CB  . SER B 1 56 ? -41.864 -68.663  29.668  1.00 39.33  ? 181 SER B CB  1 
ATOM   1114 O  OG  . SER B 1 56 ? -42.833 -69.425  30.367  1.00 48.31  ? 181 SER B OG  1 
ATOM   1115 N  N   . MET B 1 57 ? -40.967 -71.139  28.042  1.00 30.34  ? 182 MET B N   1 
ATOM   1116 C  CA  . MET B 1 57 ? -41.080 -72.540  27.629  1.00 29.68  ? 182 MET B CA  1 
ATOM   1117 C  C   . MET B 1 57 ? -39.747 -73.306  27.585  1.00 33.51  ? 182 MET B C   1 
ATOM   1118 O  O   . MET B 1 57 ? -39.660 -74.419  28.108  1.00 31.58  ? 182 MET B O   1 
ATOM   1119 C  CB  . MET B 1 57 ? -41.847 -72.667  26.297  1.00 32.67  ? 182 MET B CB  1 
ATOM   1120 C  CG  . MET B 1 57 ? -43.168 -71.899  26.272  1.00 36.91  ? 182 MET B CG  1 
ATOM   1121 S  SD  . MET B 1 57 ? -44.479 -72.348  27.461  1.00 40.86  ? 182 MET B SD  1 
ATOM   1122 C  CE  . MET B 1 57 ? -45.109 -73.816  26.696  1.00 39.21  ? 182 MET B CE  1 
ATOM   1123 N  N   . GLY B 1 58 ? -38.740 -72.687  26.960  1.00 31.36  ? 183 GLY B N   1 
ATOM   1124 C  CA  . GLY B 1 58 ? -37.411 -73.238  26.747  1.00 30.79  ? 183 GLY B CA  1 
ATOM   1125 C  C   . GLY B 1 58 ? -36.486 -73.182  27.938  1.00 34.53  ? 183 GLY B C   1 
ATOM   1126 O  O   . GLY B 1 58 ? -35.692 -74.113  28.094  1.00 35.14  ? 183 GLY B O   1 
ATOM   1127 N  N   . ILE B 1 59 ? -36.581 -72.117  28.799  1.00 29.35  ? 184 ILE B N   1 
ATOM   1128 C  CA  . ILE B 1 59 ? -35.683 -71.941  29.964  1.00 28.89  ? 184 ILE B CA  1 
ATOM   1129 C  C   . ILE B 1 59 ? -36.335 -71.933  31.383  1.00 33.56  ? 184 ILE B C   1 
ATOM   1130 O  O   . ILE B 1 59 ? -36.037 -72.804  32.206  1.00 32.62  ? 184 ILE B O   1 
ATOM   1131 C  CB  . ILE B 1 59 ? -34.696 -70.712  29.781  1.00 31.42  ? 184 ILE B CB  1 
ATOM   1132 C  CG1 . ILE B 1 59 ? -33.915 -70.685  28.418  1.00 32.06  ? 184 ILE B CG1 1 
ATOM   1133 C  CG2 . ILE B 1 59 ? -33.785 -70.440  31.009  1.00 29.73  ? 184 ILE B CG2 1 
ATOM   1134 C  CD1 . ILE B 1 59 ? -32.816 -71.696  28.160  1.00 31.98  ? 184 ILE B CD1 1 
ATOM   1135 N  N   . VAL B 1 60 ? -37.135 -70.892  31.679  1.00 31.05  ? 185 VAL B N   1 
ATOM   1136 C  CA  . VAL B 1 60 ? -37.734 -70.623  32.986  1.00 30.87  ? 185 VAL B CA  1 
ATOM   1137 C  C   . VAL B 1 60 ? -38.730 -71.678  33.510  1.00 35.29  ? 185 VAL B C   1 
ATOM   1138 O  O   . VAL B 1 60 ? -38.649 -72.015  34.686  1.00 35.01  ? 185 VAL B O   1 
ATOM   1139 C  CB  . VAL B 1 60 ? -38.194 -69.148  33.150  1.00 34.94  ? 185 VAL B CB  1 
ATOM   1140 C  CG1 . VAL B 1 60 ? -38.733 -68.867  34.560  1.00 34.81  ? 185 VAL B CG1 1 
ATOM   1141 C  CG2 . VAL B 1 60 ? -37.057 -68.189  32.811  1.00 34.42  ? 185 VAL B CG2 1 
ATOM   1142 N  N   . ARG B 1 61 ? -39.653 -72.195  32.671  1.00 31.82  ? 186 ARG B N   1 
ATOM   1143 C  CA  . ARG B 1 61 ? -40.564 -73.269  33.093  1.00 31.85  ? 186 ARG B CA  1 
ATOM   1144 C  C   . ARG B 1 61 ? -39.718 -74.521  33.470  1.00 35.01  ? 186 ARG B C   1 
ATOM   1145 O  O   . ARG B 1 61 ? -39.825 -74.927  34.626  1.00 35.27  ? 186 ARG B O   1 
ATOM   1146 C  CB  . ARG B 1 61 ? -41.655 -73.593  32.043  1.00 34.04  ? 186 ARG B CB  1 
ATOM   1147 C  CG  . ARG B 1 61 ? -42.697 -72.493  31.844  1.00 43.98  ? 186 ARG B CG  1 
ATOM   1148 C  CD  . ARG B 1 61 ? -43.872 -72.989  31.013  1.00 47.77  ? 186 ARG B CD  1 
ATOM   1149 N  NE  . ARG B 1 61 ? -44.929 -71.987  30.834  1.00 47.37  ? 186 ARG B NE  1 
ATOM   1150 C  CZ  . ARG B 1 61 ? -45.888 -71.741  31.723  1.00 55.04  ? 186 ARG B CZ  1 
ATOM   1151 N  NH1 . ARG B 1 61 ? -45.910 -72.389  32.882  1.00 37.12  ? 186 ARG B NH1 1 
ATOM   1152 N  NH2 . ARG B 1 61 ? -46.819 -70.825  31.471  1.00 36.51  ? 186 ARG B NH2 1 
ATOM   1153 N  N   . PRO B 1 62 ? -38.785 -75.068  32.620  1.00 31.27  ? 187 PRO B N   1 
ATOM   1154 C  CA  . PRO B 1 62 ? -37.943 -76.187  33.079  1.00 31.46  ? 187 PRO B CA  1 
ATOM   1155 C  C   . PRO B 1 62 ? -37.182 -75.899  34.369  1.00 35.81  ? 187 PRO B C   1 
ATOM   1156 O  O   . PRO B 1 62 ? -37.071 -76.800  35.209  1.00 36.69  ? 187 PRO B O   1 
ATOM   1157 C  CB  . PRO B 1 62 ? -36.984 -76.396  31.911  1.00 33.40  ? 187 PRO B CB  1 
ATOM   1158 C  CG  . PRO B 1 62 ? -37.776 -75.986  30.729  1.00 37.56  ? 187 PRO B CG  1 
ATOM   1159 C  CD  . PRO B 1 62 ? -38.472 -74.751  31.207  1.00 32.47  ? 187 PRO B CD  1 
ATOM   1160 N  N   . VAL B 1 63 ? -36.691 -74.647  34.556  1.00 31.58  ? 188 VAL B N   1 
ATOM   1161 C  CA  . VAL B 1 63 ? -35.997 -74.273  35.798  1.00 31.53  ? 188 VAL B CA  1 
ATOM   1162 C  C   . VAL B 1 63 ? -36.940 -74.343  37.015  1.00 36.57  ? 188 VAL B C   1 
ATOM   1163 O  O   . VAL B 1 63 ? -36.645 -75.076  37.967  1.00 38.02  ? 188 VAL B O   1 
ATOM   1164 C  CB  . VAL B 1 63 ? -35.130 -72.983  35.716  1.00 34.93  ? 188 VAL B CB  1 
ATOM   1165 C  CG1 . VAL B 1 63 ? -34.685 -72.503  37.102  1.00 34.95  ? 188 VAL B CG1 1 
ATOM   1166 C  CG2 . VAL B 1 63 ? -33.910 -73.213  34.838  1.00 35.14  ? 188 VAL B CG2 1 
ATOM   1167 N  N   . MET B 1 64 ? -38.110 -73.661  36.929  1.00 31.16  ? 189 MET B N   1 
ATOM   1168 C  CA  . MET B 1 64 ? -39.134 -73.617  37.961  1.00 30.62  ? 189 MET B CA  1 
ATOM   1169 C  C   . MET B 1 64 ? -39.610 -74.978  38.405  1.00 38.91  ? 189 MET B C   1 
ATOM   1170 O  O   . MET B 1 64 ? -40.157 -75.096  39.504  1.00 40.76  ? 189 MET B O   1 
ATOM   1171 C  CB  . MET B 1 64 ? -40.320 -72.790  37.525  1.00 32.56  ? 189 MET B CB  1 
ATOM   1172 C  CG  . MET B 1 64 ? -40.194 -71.320  37.811  1.00 35.98  ? 189 MET B CG  1 
ATOM   1173 S  SD  . MET B 1 64 ? -41.821 -70.529  37.599  1.00 41.51  ? 189 MET B SD  1 
ATOM   1174 C  CE  . MET B 1 64 ? -42.247 -71.050  35.868  1.00 37.83  ? 189 MET B CE  1 
ATOM   1175 N  N   . ASN B 1 65 ? -39.406 -76.012  37.574  1.00 37.32  ? 190 ASN B N   1 
ATOM   1176 C  CA  . ASN B 1 65 ? -39.782 -77.389  37.910  1.00 38.89  ? 190 ASN B CA  1 
ATOM   1177 C  C   . ASN B 1 65 ? -38.926 -77.925  39.076  1.00 44.12  ? 190 ASN B C   1 
ATOM   1178 O  O   . ASN B 1 65 ? -39.404 -78.774  39.842  1.00 45.83  ? 190 ASN B O   1 
ATOM   1179 C  CB  . ASN B 1 65 ? -39.702 -78.290  36.682  1.00 40.32  ? 190 ASN B CB  1 
ATOM   1180 C  CG  . ASN B 1 65 ? -40.705 -79.397  36.719  1.00 76.78  ? 190 ASN B CG  1 
ATOM   1181 O  OD1 . ASN B 1 65 ? -41.671 -79.406  35.948  1.00 77.91  ? 190 ASN B OD1 1 
ATOM   1182 N  ND2 . ASN B 1 65 ? -40.523 -80.335  37.645  1.00 70.78  ? 190 ASN B ND2 1 
ATOM   1183 N  N   . VAL B 1 66 ? -37.684 -77.391  39.226  1.00 38.99  ? 191 VAL B N   1 
ATOM   1184 C  CA  . VAL B 1 66 ? -36.747 -77.707  40.319  1.00 39.33  ? 191 VAL B CA  1 
ATOM   1185 C  C   . VAL B 1 66 ? -36.761 -76.588  41.398  1.00 41.77  ? 191 VAL B C   1 
ATOM   1186 O  O   . VAL B 1 66 ? -36.869 -76.896  42.587  1.00 41.65  ? 191 VAL B O   1 
ATOM   1187 C  CB  . VAL B 1 66 ? -35.326 -78.038  39.790  1.00 43.02  ? 191 VAL B CB  1 
ATOM   1188 C  CG1 . VAL B 1 66 ? -34.294 -78.086  40.916  1.00 42.97  ? 191 VAL B CG1 1 
ATOM   1189 C  CG2 . VAL B 1 66 ? -35.337 -79.348  39.002  1.00 44.03  ? 191 VAL B CG2 1 
ATOM   1190 N  N   . HIS B 1 67 ? -36.710 -75.308  40.969  1.00 37.47  ? 192 HIS B N   1 
ATOM   1191 C  CA  . HIS B 1 67 ? -36.715 -74.131  41.838  1.00 38.15  ? 192 HIS B CA  1 
ATOM   1192 C  C   . HIS B 1 67 ? -38.025 -73.377  41.631  1.00 45.13  ? 192 HIS B C   1 
ATOM   1193 O  O   . HIS B 1 67 ? -38.067 -72.490  40.786  1.00 45.23  ? 192 HIS B O   1 
ATOM   1194 C  CB  . HIS B 1 67 ? -35.507 -73.217  41.532  1.00 39.19  ? 192 HIS B CB  1 
ATOM   1195 C  CG  . HIS B 1 67 ? -34.226 -73.969  41.280  1.00 43.57  ? 192 HIS B CG  1 
ATOM   1196 N  ND1 . HIS B 1 67 ? -33.383 -74.327  42.315  1.00 46.08  ? 192 HIS B ND1 1 
ATOM   1197 C  CD2 . HIS B 1 67 ? -33.717 -74.449  40.120  1.00 45.18  ? 192 HIS B CD2 1 
ATOM   1198 C  CE1 . HIS B 1 67 ? -32.390 -74.997  41.752  1.00 45.96  ? 192 HIS B CE1 1 
ATOM   1199 N  NE2 . HIS B 1 67 ? -32.552 -75.103  40.439  1.00 45.76  ? 192 HIS B NE2 1 
ATOM   1200 N  N   . PRO B 1 68 ? -39.110 -73.699  42.388  1.00 44.05  ? 193 PRO B N   1 
ATOM   1201 C  CA  . PRO B 1 68 ? -40.416 -73.032  42.162  1.00 44.03  ? 193 PRO B CA  1 
ATOM   1202 C  C   . PRO B 1 68 ? -40.498 -71.505  42.203  1.00 49.01  ? 193 PRO B C   1 
ATOM   1203 O  O   . PRO B 1 68 ? -41.463 -70.928  41.683  1.00 50.23  ? 193 PRO B O   1 
ATOM   1204 C  CB  . PRO B 1 68 ? -41.336 -73.679  43.205  1.00 46.38  ? 193 PRO B CB  1 
ATOM   1205 C  CG  . PRO B 1 68 ? -40.452 -74.334  44.170  1.00 51.21  ? 193 PRO B CG  1 
ATOM   1206 C  CD  . PRO B 1 68 ? -39.229 -74.745  43.423  1.00 46.45  ? 193 PRO B CD  1 
ATOM   1207 N  N   . ASN B 1 69 ? -39.508 -70.855  42.806  1.00 44.99  ? 194 ASN B N   1 
ATOM   1208 C  CA  . ASN B 1 69 ? -39.475 -69.407  42.917  1.00 45.00  ? 194 ASN B CA  1 
ATOM   1209 C  C   . ASN B 1 69 ? -38.538 -68.726  41.926  1.00 45.79  ? 194 ASN B C   1 
ATOM   1210 O  O   . ASN B 1 69 ? -38.340 -67.516  42.050  1.00 46.57  ? 194 ASN B O   1 
ATOM   1211 C  CB  . ASN B 1 69 ? -39.177 -68.979  44.362  1.00 50.48  ? 194 ASN B CB  1 
ATOM   1212 C  CG  . ASN B 1 69 ? -40.354 -69.120  45.319  1.00 86.10  ? 194 ASN B CG  1 
ATOM   1213 O  OD1 . ASN B 1 69 ? -41.536 -69.210  44.924  1.00 78.58  ? 194 ASN B OD1 1 
ATOM   1214 N  ND2 . ASN B 1 69 ? -40.052 -69.110  46.615  1.00 81.13  ? 194 ASN B ND2 1 
ATOM   1215 N  N   . ALA B 1 70 ? -37.999 -69.469  40.916  1.00 38.30  ? 195 ALA B N   1 
ATOM   1216 C  CA  . ALA B 1 70 ? -37.095 -68.916  39.891  1.00 36.28  ? 195 ALA B CA  1 
ATOM   1217 C  C   . ALA B 1 70 ? -37.672 -67.686  39.182  1.00 38.93  ? 195 ALA B C   1 
ATOM   1218 O  O   . ALA B 1 70 ? -36.904 -66.849  38.726  1.00 39.16  ? 195 ALA B O   1 
ATOM   1219 C  CB  . ALA B 1 70 ? -36.705 -69.979  38.875  1.00 36.09  ? 195 ALA B CB  1 
ATOM   1220 N  N   . TRP B 1 71 ? -39.010 -67.537  39.157  1.00 34.86  ? 196 TRP B N   1 
ATOM   1221 C  CA  . TRP B 1 71 ? -39.700 -66.392  38.545  1.00 35.85  ? 196 TRP B CA  1 
ATOM   1222 C  C   . TRP B 1 71 ? -39.399 -65.045  39.251  1.00 42.43  ? 196 TRP B C   1 
ATOM   1223 O  O   . TRP B 1 71 ? -39.557 -63.977  38.645  1.00 43.42  ? 196 TRP B O   1 
ATOM   1224 C  CB  . TRP B 1 71 ? -41.211 -66.644  38.462  1.00 34.93  ? 196 TRP B CB  1 
ATOM   1225 C  CG  . TRP B 1 71 ? -41.857 -66.872  39.795  1.00 36.50  ? 196 TRP B CG  1 
ATOM   1226 C  CD1 . TRP B 1 71 ? -42.049 -68.070  40.417  1.00 39.06  ? 196 TRP B CD1 1 
ATOM   1227 C  CD2 . TRP B 1 71 ? -42.352 -65.867  40.693  1.00 37.65  ? 196 TRP B CD2 1 
ATOM   1228 N  NE1 . TRP B 1 71 ? -42.657 -67.878  41.635  1.00 39.72  ? 196 TRP B NE1 1 
ATOM   1229 C  CE2 . TRP B 1 71 ? -42.857 -66.535  41.830  1.00 41.79  ? 196 TRP B CE2 1 
ATOM   1230 C  CE3 . TRP B 1 71 ? -42.442 -64.461  40.635  1.00 39.85  ? 196 TRP B CE3 1 
ATOM   1231 C  CZ2 . TRP B 1 71 ? -43.449 -65.851  42.897  1.00 41.93  ? 196 TRP B CZ2 1 
ATOM   1232 C  CZ3 . TRP B 1 71 ? -43.018 -63.784  41.697  1.00 42.54  ? 196 TRP B CZ3 1 
ATOM   1233 C  CH2 . TRP B 1 71 ? -43.521 -64.477  42.807  1.00 43.26  ? 196 TRP B CH2 1 
ATOM   1234 N  N   . VAL B 1 72 ? -38.975 -65.106  40.534  1.00 39.08  ? 197 VAL B N   1 
ATOM   1235 C  CA  . VAL B 1 72 ? -38.609 -63.943  41.358  1.00 39.64  ? 197 VAL B CA  1 
ATOM   1236 C  C   . VAL B 1 72 ? -37.299 -63.378  40.831  1.00 41.91  ? 197 VAL B C   1 
ATOM   1237 O  O   . VAL B 1 72 ? -37.003 -62.202  41.039  1.00 43.46  ? 197 VAL B O   1 
ATOM   1238 C  CB  . VAL B 1 72 ? -38.536 -64.295  42.868  1.00 43.69  ? 197 VAL B CB  1 
ATOM   1239 C  CG1 . VAL B 1 72 ? -38.123 -63.088  43.706  1.00 45.14  ? 197 VAL B CG1 1 
ATOM   1240 C  CG2 . VAL B 1 72 ? -39.873 -64.852  43.359  1.00 43.76  ? 197 VAL B CG2 1 
ATOM   1241 N  N   . PHE B 1 73 ? -36.521 -64.219  40.134  1.00 34.85  ? 198 PHE B N   1 
ATOM   1242 C  CA  . PHE B 1 73 ? -35.268 -63.807  39.546  1.00 32.85  ? 198 PHE B CA  1 
ATOM   1243 C  C   . PHE B 1 73 ? -35.519 -63.312  38.131  1.00 33.62  ? 198 PHE B C   1 
ATOM   1244 O  O   . PHE B 1 73 ? -35.298 -62.138  37.850  1.00 34.29  ? 198 PHE B O   1 
ATOM   1245 C  CB  . PHE B 1 73 ? -34.229 -64.945  39.608  1.00 33.66  ? 198 PHE B CB  1 
ATOM   1246 C  CG  . PHE B 1 73 ? -32.953 -64.652  38.842  1.00 36.01  ? 198 PHE B CG  1 
ATOM   1247 C  CD1 . PHE B 1 73 ? -31.907 -63.949  39.439  1.00 40.25  ? 198 PHE B CD1 1 
ATOM   1248 C  CD2 . PHE B 1 73 ? -32.800 -65.073  37.520  1.00 36.77  ? 198 PHE B CD2 1 
ATOM   1249 C  CE1 . PHE B 1 73 ? -30.739 -63.662  38.729  1.00 40.83  ? 198 PHE B CE1 1 
ATOM   1250 C  CE2 . PHE B 1 73 ? -31.636 -64.774  36.809  1.00 39.81  ? 198 PHE B CE2 1 
ATOM   1251 C  CZ  . PHE B 1 73 ? -30.609 -64.082  37.423  1.00 39.06  ? 198 PHE B CZ  1 
ATOM   1252 N  N   . PHE B 1 74 ? -36.017 -64.198  37.257  1.00 27.01  ? 199 PHE B N   1 
ATOM   1253 C  CA  . PHE B 1 74 ? -36.215 -63.923  35.839  1.00 25.57  ? 199 PHE B CA  1 
ATOM   1254 C  C   . PHE B 1 74 ? -37.179 -62.818  35.489  1.00 33.10  ? 199 PHE B C   1 
ATOM   1255 O  O   . PHE B 1 74 ? -36.783 -61.929  34.743  1.00 34.28  ? 199 PHE B O   1 
ATOM   1256 C  CB  . PHE B 1 74 ? -36.461 -65.206  35.042  1.00 24.75  ? 199 PHE B CB  1 
ATOM   1257 C  CG  . PHE B 1 74 ? -35.357 -66.243  35.139  1.00 24.08  ? 199 PHE B CG  1 
ATOM   1258 C  CD1 . PHE B 1 74 ? -34.268 -66.206  34.277  1.00 26.37  ? 199 PHE B CD1 1 
ATOM   1259 C  CD2 . PHE B 1 74 ? -35.447 -67.296  36.037  1.00 23.80  ? 199 PHE B CD2 1 
ATOM   1260 C  CE1 . PHE B 1 74 ? -33.290 -67.206  34.318  1.00 26.20  ? 199 PHE B CE1 1 
ATOM   1261 C  CE2 . PHE B 1 74 ? -34.467 -68.280  36.088  1.00 25.07  ? 199 PHE B CE2 1 
ATOM   1262 C  CZ  . PHE B 1 74 ? -33.406 -68.242  35.215  1.00 24.19  ? 199 PHE B CZ  1 
ATOM   1263 N  N   . ILE B 1 75 ? -38.430 -62.851  36.007  1.00 31.27  ? 200 ILE B N   1 
ATOM   1264 C  CA  . ILE B 1 75 ? -39.418 -61.796  35.723  1.00 33.00  ? 200 ILE B CA  1 
ATOM   1265 C  C   . ILE B 1 75 ? -38.856 -60.376  35.980  1.00 40.49  ? 200 ILE B C   1 
ATOM   1266 O  O   . ILE B 1 75 ? -38.768 -59.621  35.005  1.00 41.00  ? 200 ILE B O   1 
ATOM   1267 C  CB  . ILE B 1 75 ? -40.818 -62.070  36.317  1.00 36.13  ? 200 ILE B CB  1 
ATOM   1268 C  CG1 . ILE B 1 75 ? -41.382 -63.381  35.734  1.00 35.33  ? 200 ILE B CG1 1 
ATOM   1269 C  CG2 . ILE B 1 75 ? -41.764 -60.865  36.106  1.00 38.52  ? 200 ILE B CG2 1 
ATOM   1270 C  CD1 . ILE B 1 75 ? -42.724 -63.875  36.316  1.00 45.36  ? 200 ILE B CD1 1 
ATOM   1271 N  N   . PRO B 1 76 ? -38.344 -60.035  37.201  1.00 38.95  ? 201 PRO B N   1 
ATOM   1272 C  CA  . PRO B 1 76 ? -37.721 -58.707  37.391  1.00 41.26  ? 201 PRO B CA  1 
ATOM   1273 C  C   . PRO B 1 76 ? -36.505 -58.477  36.487  1.00 46.21  ? 201 PRO B C   1 
ATOM   1274 O  O   . PRO B 1 76 ? -36.362 -57.368  35.964  1.00 47.61  ? 201 PRO B O   1 
ATOM   1275 C  CB  . PRO B 1 76 ? -37.321 -58.708  38.874  1.00 43.16  ? 201 PRO B CB  1 
ATOM   1276 C  CG  . PRO B 1 76 ? -38.216 -59.710  39.502  1.00 46.12  ? 201 PRO B CG  1 
ATOM   1277 C  CD  . PRO B 1 76 ? -38.338 -60.791  38.471  1.00 39.64  ? 201 PRO B CD  1 
ATOM   1278 N  N   . PHE B 1 77 ? -35.657 -59.523  36.268  1.00 41.27  ? 202 PHE B N   1 
ATOM   1279 C  CA  . PHE B 1 77 ? -34.497 -59.425  35.375  1.00 41.20  ? 202 PHE B CA  1 
ATOM   1280 C  C   . PHE B 1 77 ? -34.953 -58.978  33.966  1.00 48.72  ? 202 PHE B C   1 
ATOM   1281 O  O   . PHE B 1 77 ? -34.328 -58.107  33.359  1.00 49.44  ? 202 PHE B O   1 
ATOM   1282 C  CB  . PHE B 1 77 ? -33.705 -60.753  35.306  1.00 40.84  ? 202 PHE B CB  1 
ATOM   1283 C  CG  . PHE B 1 77 ? -32.762 -60.823  34.122  1.00 42.55  ? 202 PHE B CG  1 
ATOM   1284 C  CD1 . PHE B 1 77 ? -31.494 -60.259  34.189  1.00 46.36  ? 202 PHE B CD1 1 
ATOM   1285 C  CD2 . PHE B 1 77 ? -33.183 -61.359  32.905  1.00 44.67  ? 202 PHE B CD2 1 
ATOM   1286 C  CE1 . PHE B 1 77 ? -30.642 -60.274  33.077  1.00 47.62  ? 202 PHE B CE1 1 
ATOM   1287 C  CE2 . PHE B 1 77 ? -32.340 -61.350  31.786  1.00 47.62  ? 202 PHE B CE2 1 
ATOM   1288 C  CZ  . PHE B 1 77 ? -31.074 -60.814  31.880  1.00 46.33  ? 202 PHE B CZ  1 
ATOM   1289 N  N   . ILE B 1 78 ? -36.032 -59.596  33.455  1.00 46.84  ? 203 ILE B N   1 
ATOM   1290 C  CA  . ILE B 1 78 ? -36.603 -59.278  32.151  1.00 48.29  ? 203 ILE B CA  1 
ATOM   1291 C  C   . ILE B 1 78 ? -37.097 -57.828  32.175  1.00 58.65  ? 203 ILE B C   1 
ATOM   1292 O  O   . ILE B 1 78 ? -36.652 -57.026  31.358  1.00 59.43  ? 203 ILE B O   1 
ATOM   1293 C  CB  . ILE B 1 78 ? -37.697 -60.321  31.745  1.00 49.46  ? 203 ILE B CB  1 
ATOM   1294 C  CG1 . ILE B 1 78 ? -37.040 -61.601  31.203  1.00 47.04  ? 203 ILE B CG1 1 
ATOM   1295 C  CG2 . ILE B 1 78 ? -38.703 -59.755  30.727  1.00 50.91  ? 203 ILE B CG2 1 
ATOM   1296 C  CD1 . ILE B 1 78 ? -37.789 -62.819  31.456  1.00 46.26  ? 203 ILE B CD1 1 
ATOM   1297 N  N   . MET B 1 79 ? -37.943 -57.483  33.164  1.00 58.84  ? 204 MET B N   1 
ATOM   1298 C  CA  . MET B 1 79 ? -38.513 -56.145  33.322  1.00 62.58  ? 204 MET B CA  1 
ATOM   1299 C  C   . MET B 1 79 ? -37.457 -55.037  33.402  1.00 68.02  ? 204 MET B C   1 
ATOM   1300 O  O   . MET B 1 79 ? -37.655 -53.977  32.807  1.00 69.33  ? 204 MET B O   1 
ATOM   1301 C  CB  . MET B 1 79 ? -39.478 -56.098  34.515  1.00 66.22  ? 204 MET B CB  1 
ATOM   1302 C  CG  . MET B 1 79 ? -40.723 -56.946  34.309  1.00 70.19  ? 204 MET B CG  1 
ATOM   1303 S  SD  . MET B 1 79 ? -42.117 -56.501  35.383  1.00 78.02  ? 204 MET B SD  1 
ATOM   1304 C  CE  . MET B 1 79 ? -41.557 -57.158  36.945  1.00 73.35  ? 204 MET B CE  1 
ATOM   1305 N  N   . LEU B 1 80 ? -36.327 -55.305  34.086  1.00 64.01  ? 205 LEU B N   1 
ATOM   1306 C  CA  . LEU B 1 80 ? -35.231 -54.354  34.261  1.00 65.81  ? 205 LEU B CA  1 
ATOM   1307 C  C   . LEU B 1 80 ? -34.408 -54.164  32.990  1.00 71.13  ? 205 LEU B C   1 
ATOM   1308 O  O   . LEU B 1 80 ? -34.262 -53.030  32.532  1.00 73.14  ? 205 LEU B O   1 
ATOM   1309 C  CB  . LEU B 1 80 ? -34.343 -54.766  35.453  1.00 64.88  ? 205 LEU B CB  1 
ATOM   1310 C  CG  . LEU B 1 80 ? -33.067 -53.960  35.722  1.00 71.19  ? 205 LEU B CG  1 
ATOM   1311 C  CD1 . LEU B 1 80 ? -33.385 -52.563  36.244  1.00 75.01  ? 205 LEU B CD1 1 
ATOM   1312 C  CD2 . LEU B 1 80 ? -32.200 -54.670  36.726  1.00 72.45  ? 205 LEU B CD2 1 
ATOM   1313 N  N   . THR B 1 81 ? -33.863 -55.266  32.435  1.00 66.37  ? 206 THR B N   1 
ATOM   1314 C  CA  . THR B 1 81 ? -33.021 -55.258  31.231  1.00 66.09  ? 206 THR B CA  1 
ATOM   1315 C  C   . THR B 1 81 ? -33.804 -54.866  29.980  1.00 73.40  ? 206 THR B C   1 
ATOM   1316 O  O   . THR B 1 81 ? -33.380 -53.955  29.270  1.00 74.50  ? 206 THR B O   1 
ATOM   1317 C  CB  . THR B 1 81 ? -32.234 -56.565  31.092  1.00 64.54  ? 206 THR B CB  1 
ATOM   1318 O  OG1 . THR B 1 81 ? -33.142 -57.658  30.974  1.00 58.93  ? 206 THR B OG1 1 
ATOM   1319 C  CG2 . THR B 1 81 ? -31.291 -56.799  32.258  1.00 62.06  ? 206 THR B CG2 1 
ATOM   1320 N  N   . THR B 1 82 ? -34.976 -55.498  29.749  1.00 71.45  ? 207 THR B N   1 
ATOM   1321 C  CA  . THR B 1 82 ? -35.847 -55.186  28.607  1.00 73.57  ? 207 THR B CA  1 
ATOM   1322 C  C   . THR B 1 82 ? -36.632 -53.886  28.887  1.00 83.65  ? 207 THR B C   1 
ATOM   1323 O  O   . THR B 1 82 ? -37.858 -53.836  28.770  1.00 84.30  ? 207 THR B O   1 
ATOM   1324 C  CB  . THR B 1 82 ? -36.684 -56.405  28.147  1.00 77.66  ? 207 THR B CB  1 
ATOM   1325 O  OG1 . THR B 1 82 ? -37.856 -56.519  28.954  1.00 79.26  ? 207 THR B OG1 1 
ATOM   1326 C  CG2 . THR B 1 82 ? -35.904 -57.705  28.179  1.00 71.07  ? 207 THR B CG2 1 
ATOM   1327 N  N   . PHE B 1 83 ? -35.887 -52.841  29.275  1.00 84.71  ? 208 PHE B N   1 
ATOM   1328 C  CA  . PHE B 1 83 ? -36.321 -51.485  29.613  1.00 89.60  ? 208 PHE B CA  1 
ATOM   1329 C  C   . PHE B 1 83 ? -35.075 -50.613  29.527  1.00 97.21  ? 208 PHE B C   1 
ATOM   1330 O  O   . PHE B 1 83 ? -35.088 -49.611  28.816  1.00 99.98  ? 208 PHE B O   1 
ATOM   1331 C  CB  . PHE B 1 83 ? -36.927 -51.430  31.038  1.00 92.05  ? 208 PHE B CB  1 
ATOM   1332 C  CG  . PHE B 1 83 ? -37.049 -50.054  31.659  1.00 97.87  ? 208 PHE B CG  1 
ATOM   1333 C  CD1 . PHE B 1 83 ? -38.182 -49.275  31.449  1.00 104.63 ? 208 PHE B CD1 1 
ATOM   1334 C  CD2 . PHE B 1 83 ? -36.041 -49.547  32.472  1.00 101.10 ? 208 PHE B CD2 1 
ATOM   1335 C  CE1 . PHE B 1 83 ? -38.295 -48.002  32.025  1.00 109.67 ? 208 PHE B CE1 1 
ATOM   1336 C  CE2 . PHE B 1 83 ? -36.150 -48.271  33.039  1.00 108.10 ? 208 PHE B CE2 1 
ATOM   1337 C  CZ  . PHE B 1 83 ? -37.280 -47.510  32.817  1.00 109.44 ? 208 PHE B CZ  1 
ATOM   1338 N  N   . THR B 1 84 ? -34.006 -51.006  30.265  1.00 93.16  ? 209 THR B N   1 
ATOM   1339 C  CA  . THR B 1 84 ? -32.713 -50.323  30.304  1.00 94.62  ? 209 THR B CA  1 
ATOM   1340 C  C   . THR B 1 84 ? -32.073 -50.384  28.924  1.00 100.29 ? 209 THR B C   1 
ATOM   1341 O  O   . THR B 1 84 ? -31.474 -49.396  28.502  1.00 102.84 ? 209 THR B O   1 
ATOM   1342 C  CB  . THR B 1 84 ? -31.816 -50.912  31.406  1.00 97.99  ? 209 THR B CB  1 
ATOM   1343 O  OG1 . THR B 1 84 ? -32.578 -51.060  32.602  1.00 96.81  ? 209 THR B OG1 1 
ATOM   1344 C  CG2 . THR B 1 84 ? -30.602 -50.048  31.698  1.00 97.99  ? 209 THR B CG2 1 
ATOM   1345 N  N   . VAL B 1 85 ? -32.239 -51.525  28.209  1.00 95.55  ? 210 VAL B N   1 
ATOM   1346 C  CA  . VAL B 1 85 ? -31.741 -51.739  26.841  1.00 95.79  ? 210 VAL B CA  1 
ATOM   1347 C  C   . VAL B 1 85 ? -32.486 -50.806  25.896  1.00 104.54 ? 210 VAL B C   1 
ATOM   1348 O  O   . VAL B 1 85 ? -31.852 -50.110  25.102  1.00 106.19 ? 210 VAL B O   1 
ATOM   1349 C  CB  . VAL B 1 85 ? -31.837 -53.234  26.416  1.00 96.18  ? 210 VAL B CB  1 
ATOM   1350 C  CG1 . VAL B 1 85 ? -31.810 -53.411  24.899  1.00 96.26  ? 210 VAL B CG1 1 
ATOM   1351 C  CG2 . VAL B 1 85 ? -30.731 -54.050  27.064  1.00 93.77  ? 210 VAL B CG2 1 
ATOM   1352 N  N   . LEU B 1 86 ? -33.824 -50.760  26.030  1.00 103.34 ? 211 LEU B N   1 
ATOM   1353 C  CA  . LEU B 1 86 ? -34.707 -49.904  25.248  1.00 107.34 ? 211 LEU B CA  1 
ATOM   1354 C  C   . LEU B 1 86 ? -34.430 -48.422  25.530  1.00 116.76 ? 211 LEU B C   1 
ATOM   1355 O  O   . LEU B 1 86 ? -34.498 -47.615  24.610  1.00 119.23 ? 211 LEU B O   1 
ATOM   1356 C  CB  . LEU B 1 86 ? -36.178 -50.269  25.492  1.00 107.51 ? 211 LEU B CB  1 
ATOM   1357 C  CG  . LEU B 1 86 ? -36.783 -51.308  24.530  1.00 110.88 ? 211 LEU B CG  1 
ATOM   1358 C  CD1 . LEU B 1 86 ? -36.297 -52.734  24.835  1.00 106.99 ? 211 LEU B CD1 1 
ATOM   1359 C  CD2 . LEU B 1 86 ? -38.299 -51.262  24.570  1.00 115.34 ? 211 LEU B CD2 1 
ATOM   1360 N  N   . ASN B 1 87 ? -34.054 -48.087  26.778  1.00 114.88 ? 212 ASN B N   1 
ATOM   1361 C  CA  . ASN B 1 87 ? -33.704 -46.736  27.216  1.00 119.18 ? 212 ASN B CA  1 
ATOM   1362 C  C   . ASN B 1 87 ? -32.353 -46.313  26.630  1.00 125.20 ? 212 ASN B C   1 
ATOM   1363 O  O   . ASN B 1 87 ? -32.233 -45.193  26.128  1.00 128.53 ? 212 ASN B O   1 
ATOM   1364 C  CB  . ASN B 1 87 ? -33.663 -46.681  28.746  1.00 120.98 ? 212 ASN B CB  1 
ATOM   1365 C  CG  . ASN B 1 87 ? -33.747 -45.296  29.324  1.00 155.78 ? 212 ASN B CG  1 
ATOM   1366 O  OD1 . ASN B 1 87 ? -32.751 -44.729  29.787  1.00 153.18 ? 212 ASN B OD1 1 
ATOM   1367 N  ND2 . ASN B 1 87 ? -34.948 -44.735  29.350  1.00 152.28 ? 212 ASN B ND2 1 
ATOM   1368 N  N   . LEU B 1 88 ? -31.346 -47.213  26.694  1.00 119.89 ? 213 LEU B N   1 
ATOM   1369 C  CA  . LEU B 1 88 ? -29.985 -47.005  26.187  1.00 120.75 ? 213 LEU B CA  1 
ATOM   1370 C  C   . LEU B 1 88 ? -29.971 -46.812  24.666  1.00 127.32 ? 213 LEU B C   1 
ATOM   1371 O  O   . LEU B 1 88 ? -29.287 -45.911  24.169  1.00 129.88 ? 213 LEU B O   1 
ATOM   1372 C  CB  . LEU B 1 88 ? -29.074 -48.182  26.611  1.00 117.10 ? 213 LEU B CB  1 
ATOM   1373 C  CG  . LEU B 1 88 ? -27.724 -48.368  25.902  1.00 121.61 ? 213 LEU B CG  1 
ATOM   1374 C  CD1 . LEU B 1 88 ? -26.712 -47.328  26.343  1.00 124.58 ? 213 LEU B CD1 1 
ATOM   1375 C  CD2 . LEU B 1 88 ? -27.172 -49.753  26.153  1.00 120.64 ? 213 LEU B CD2 1 
ATOM   1376 N  N   . PHE B 1 89 ? -30.729 -47.658  23.941  1.00 122.74 ? 214 PHE B N   1 
ATOM   1377 C  CA  . PHE B 1 89 ? -30.836 -47.629  22.483  1.00 123.79 ? 214 PHE B CA  1 
ATOM   1378 C  C   . PHE B 1 89 ? -31.557 -46.377  21.985  1.00 133.08 ? 214 PHE B C   1 
ATOM   1379 O  O   . PHE B 1 89 ? -31.087 -45.768  21.023  1.00 135.45 ? 214 PHE B O   1 
ATOM   1380 C  CB  . PHE B 1 89 ? -31.475 -48.928  21.950  1.00 122.39 ? 214 PHE B CB  1 
ATOM   1381 C  CG  . PHE B 1 89 ? -30.516 -50.079  21.697  1.00 120.69 ? 214 PHE B CG  1 
ATOM   1382 C  CD1 . PHE B 1 89 ? -29.605 -50.480  22.671  1.00 121.84 ? 214 PHE B CD1 1 
ATOM   1383 C  CD2 . PHE B 1 89 ? -30.563 -50.795  20.507  1.00 121.88 ? 214 PHE B CD2 1 
ATOM   1384 C  CE1 . PHE B 1 89 ? -28.728 -51.544  22.437  1.00 120.21 ? 214 PHE B CE1 1 
ATOM   1385 C  CE2 . PHE B 1 89 ? -29.694 -51.868  20.281  1.00 122.10 ? 214 PHE B CE2 1 
ATOM   1386 C  CZ  . PHE B 1 89 ? -28.781 -52.232  21.245  1.00 118.50 ? 214 PHE B CZ  1 
ATOM   1387 N  N   . ILE B 1 90 ? -32.657 -45.964  22.668  1.00 131.16 ? 215 ILE B N   1 
ATOM   1388 C  CA  . ILE B 1 90 ? -33.428 -44.750  22.351  1.00 135.72 ? 215 ILE B CA  1 
ATOM   1389 C  C   . ILE B 1 90 ? -32.583 -43.482  22.613  1.00 143.98 ? 215 ILE B C   1 
ATOM   1390 O  O   . ILE B 1 90 ? -32.681 -42.520  21.847  1.00 147.54 ? 215 ILE B O   1 
ATOM   1391 C  CB  . ILE B 1 90 ? -34.842 -44.753  23.026  1.00 139.25 ? 215 ILE B CB  1 
ATOM   1392 C  CG1 . ILE B 1 90 ? -35.821 -45.630  22.211  1.00 138.10 ? 215 ILE B CG1 1 
ATOM   1393 C  CG2 . ILE B 1 90 ? -35.422 -43.339  23.246  1.00 144.95 ? 215 ILE B CG2 1 
ATOM   1394 C  CD1 . ILE B 1 90 ? -37.050 -46.158  22.974  1.00 144.22 ? 215 ILE B CD1 1 
ATOM   1395 N  N   . GLY B 1 91 ? -31.736 -43.536  23.648  1.00 139.77 ? 216 GLY B N   1 
ATOM   1396 C  CA  . GLY B 1 91 ? -30.834 -42.461  24.053  1.00 143.06 ? 216 GLY B CA  1 
ATOM   1397 C  C   . GLY B 1 91 ? -29.906 -41.959  22.962  1.00 149.59 ? 216 GLY B C   1 
ATOM   1398 O  O   . GLY B 1 91 ? -29.723 -40.745  22.817  1.00 153.82 ? 216 GLY B O   1 
ATOM   1399 N  N   . ILE B 1 92 ? -29.326 -42.891  22.176  1.00 143.46 ? 217 ILE B N   1 
ATOM   1400 C  CA  . ILE B 1 92 ? -28.418 -42.558  21.068  1.00 145.04 ? 217 ILE B CA  1 
ATOM   1401 C  C   . ILE B 1 92 ? -29.199 -41.993  19.870  1.00 152.21 ? 217 ILE B C   1 
ATOM   1402 O  O   . ILE B 1 92 ? -28.692 -41.106  19.180  1.00 155.24 ? 217 ILE B O   1 
ATOM   1403 C  CB  . ILE B 1 92 ? -27.465 -43.719  20.647  1.00 144.20 ? 217 ILE B CB  1 
ATOM   1404 C  CG1 . ILE B 1 92 ? -27.243 -44.755  21.768  1.00 140.50 ? 217 ILE B CG1 1 
ATOM   1405 C  CG2 . ILE B 1 92 ? -26.131 -43.170  20.131  1.00 146.92 ? 217 ILE B CG2 1 
ATOM   1406 C  CD1 . ILE B 1 92 ? -27.406 -46.188  21.311  1.00 143.08 ? 217 ILE B CD1 1 
ATOM   1407 N  N   . ILE B 1 93 ? -30.430 -42.511  19.633  1.00 147.83 ? 218 ILE B N   1 
ATOM   1408 C  CA  . ILE B 1 93 ? -31.347 -42.102  18.556  1.00 150.64 ? 218 ILE B CA  1 
ATOM   1409 C  C   . ILE B 1 93 ? -31.746 -40.620  18.717  1.00 160.84 ? 218 ILE B C   1 
ATOM   1410 O  O   . ILE B 1 93 ? -31.756 -39.882  17.727  1.00 164.32 ? 218 ILE B O   1 
ATOM   1411 C  CB  . ILE B 1 93 ? -32.558 -43.086  18.436  1.00 150.99 ? 218 ILE B CB  1 
ATOM   1412 C  CG1 . ILE B 1 93 ? -32.074 -44.494  18.003  1.00 146.55 ? 218 ILE B CG1 1 
ATOM   1413 C  CG2 . ILE B 1 93 ? -33.653 -42.562  17.480  1.00 155.27 ? 218 ILE B CG2 1 
ATOM   1414 C  CD1 . ILE B 1 93 ? -33.048 -45.648  18.245  1.00 150.14 ? 218 ILE B CD1 1 
ATOM   1415 N  N   . VAL B 1 94 ? -32.019 -40.186  19.969  1.00 158.51 ? 219 VAL B N   1 
ATOM   1416 C  CA  . VAL B 1 94 ? -32.367 -38.799  20.313  1.00 164.02 ? 219 VAL B CA  1 
ATOM   1417 C  C   . VAL B 1 94 ? -31.122 -37.890  20.121  1.00 171.01 ? 219 VAL B C   1 
ATOM   1418 O  O   . VAL B 1 94 ? -31.262 -36.758  19.644  1.00 176.04 ? 219 VAL B O   1 
ATOM   1419 C  CB  . VAL B 1 94 ? -33.018 -38.682  21.729  1.00 167.95 ? 219 VAL B CB  1 
ATOM   1420 C  CG1 . VAL B 1 94 ? -33.354 -37.233  22.086  1.00 174.14 ? 219 VAL B CG1 1 
ATOM   1421 C  CG2 . VAL B 1 94 ? -34.273 -39.548  21.835  1.00 165.11 ? 219 VAL B CG2 1 
ATOM   1422 N  N   . ASP B 1 95 ? -29.912 -38.419  20.431  1.00 164.12 ? 220 ASP B N   1 
ATOM   1423 C  CA  . ASP B 1 95 ? -28.633 -37.713  20.287  1.00 192.28 ? 220 ASP B CA  1 
ATOM   1424 C  C   . ASP B 1 95 ? -28.254 -37.452  18.819  1.00 223.19 ? 220 ASP B C   1 
ATOM   1425 O  O   . ASP B 1 95 ? -27.196 -36.892  18.526  1.00 182.92 ? 220 ASP B O   1 
ATOM   1426 C  CB  . ASP B 1 95 ? -27.506 -38.464  21.019  1.00 189.95 ? 220 ASP B CB  1 
ATOM   1427 C  CG  . ASP B 1 95 ? -27.506 -38.292  22.525  1.00 199.00 ? 220 ASP B CG  1 
ATOM   1428 O  OD1 . ASP B 1 95 ? -27.783 -37.166  22.997  1.00 204.08 ? 220 ASP B OD1 1 
ATOM   1429 O  OD2 . ASP B 1 95 ? -27.169 -39.262  23.229  1.00 200.11 ? 220 ASP B OD2 1 
ATOM   1430 N  N   . GLY C 1 5  ? -31.156 -121.362 37.871  1.00 133.49 ? 130 GLY C N   1 
ATOM   1431 C  CA  . GLY C 1 5  ? -32.055 -121.302 36.727  1.00 132.16 ? 130 GLY C CA  1 
ATOM   1432 C  C   . GLY C 1 5  ? -32.494 -119.890 36.405  1.00 131.01 ? 130 GLY C C   1 
ATOM   1433 O  O   . GLY C 1 5  ? -31.681 -119.080 35.952  1.00 127.83 ? 130 GLY C O   1 
ATOM   1434 N  N   . VAL C 1 6  ? -33.786 -119.590 36.647  1.00 126.57 ? 131 VAL C N   1 
ATOM   1435 C  CA  . VAL C 1 6  ? -34.405 -118.273 36.417  1.00 121.93 ? 131 VAL C CA  1 
ATOM   1436 C  C   . VAL C 1 6  ? -33.956 -117.267 37.504  1.00 122.36 ? 131 VAL C C   1 
ATOM   1437 O  O   . VAL C 1 6  ? -33.659 -116.112 37.183  1.00 118.30 ? 131 VAL C O   1 
ATOM   1438 C  CB  . VAL C 1 6  ? -35.959 -118.376 36.279  1.00 126.35 ? 131 VAL C CB  1 
ATOM   1439 C  CG1 . VAL C 1 6  ? -36.613 -117.003 36.122  1.00 122.02 ? 131 VAL C CG1 1 
ATOM   1440 C  CG2 . VAL C 1 6  ? -36.351 -119.285 35.115  1.00 128.49 ? 131 VAL C CG2 1 
ATOM   1441 N  N   . GLY C 1 7  ? -33.901 -117.734 38.757  1.00 120.36 ? 132 GLY C N   1 
ATOM   1442 C  CA  . GLY C 1 7  ? -33.489 -116.956 39.924  1.00 118.37 ? 132 GLY C CA  1 
ATOM   1443 C  C   . GLY C 1 7  ? -32.098 -116.364 39.808  1.00 119.25 ? 132 GLY C C   1 
ATOM   1444 O  O   . GLY C 1 7  ? -31.894 -115.194 40.146  1.00 115.98 ? 132 GLY C O   1 
ATOM   1445 N  N   . SER C 1 8  ? -31.135 -117.166 39.299  1.00 116.57 ? 133 SER C N   1 
ATOM   1446 C  CA  . SER C 1 8  ? -29.739 -116.771 39.070  1.00 114.50 ? 133 SER C CA  1 
ATOM   1447 C  C   . SER C 1 8  ? -29.640 -115.670 37.999  1.00 112.21 ? 133 SER C C   1 
ATOM   1448 O  O   . SER C 1 8  ? -28.770 -114.804 38.083  1.00 109.34 ? 133 SER C O   1 
ATOM   1449 C  CB  . SER C 1 8  ? -28.908 -117.984 38.659  1.00 121.50 ? 133 SER C CB  1 
ATOM   1450 O  OG  . SER C 1 8  ? -29.434 -118.620 37.505  1.00 130.77 ? 133 SER C OG  1 
ATOM   1451 N  N   . VAL C 1 9  ? -30.547 -115.716 37.007  1.00 106.73 ? 134 VAL C N   1 
ATOM   1452 C  CA  . VAL C 1 9  ? -30.651 -114.762 35.901  1.00 102.66 ? 134 VAL C CA  1 
ATOM   1453 C  C   . VAL C 1 9  ? -31.332 -113.463 36.384  1.00 102.05 ? 134 VAL C C   1 
ATOM   1454 O  O   . VAL C 1 9  ? -30.881 -112.371 36.026  1.00 98.74  ? 134 VAL C O   1 
ATOM   1455 C  CB  . VAL C 1 9  ? -31.345 -115.408 34.665  1.00 107.59 ? 134 VAL C CB  1 
ATOM   1456 C  CG1 . VAL C 1 9  ? -31.629 -114.383 33.566  1.00 104.14 ? 134 VAL C CG1 1 
ATOM   1457 C  CG2 . VAL C 1 9  ? -30.508 -116.560 34.112  1.00 110.65 ? 134 VAL C CG2 1 
ATOM   1458 N  N   . ALA C 1 10 ? -32.396 -113.585 37.209  1.00 98.31  ? 135 ALA C N   1 
ATOM   1459 C  CA  . ALA C 1 10 ? -33.130 -112.444 37.771  1.00 95.03  ? 135 ALA C CA  1 
ATOM   1460 C  C   . ALA C 1 10 ? -32.218 -111.580 38.652  1.00 95.86  ? 135 ALA C C   1 
ATOM   1461 O  O   . ALA C 1 10 ? -32.298 -110.350 38.599  1.00 92.85  ? 135 ALA C O   1 
ATOM   1462 C  CB  . ALA C 1 10 ? -34.332 -112.929 38.568  1.00 97.60  ? 135 ALA C CB  1 
ATOM   1463 N  N   . ALA C 1 11 ? -31.331 -112.230 39.431  1.00 92.81  ? 136 ALA C N   1 
ATOM   1464 C  CA  . ALA C 1 11 ? -30.365 -111.567 40.298  1.00 91.17  ? 136 ALA C CA  1 
ATOM   1465 C  C   . ALA C 1 11 ? -29.287 -110.892 39.451  1.00 90.87  ? 136 ALA C C   1 
ATOM   1466 O  O   . ALA C 1 11 ? -28.913 -109.759 39.742  1.00 88.16  ? 136 ALA C O   1 
ATOM   1467 C  CB  . ALA C 1 11 ? -29.737 -112.576 41.244  1.00 95.47  ? 136 ALA C CB  1 
ATOM   1468 N  N   . LEU C 1 12 ? -28.829 -111.576 38.378  1.00 86.94  ? 137 LEU C N   1 
ATOM   1469 C  CA  . LEU C 1 12 ? -27.816 -111.103 37.430  1.00 84.64  ? 137 LEU C CA  1 
ATOM   1470 C  C   . LEU C 1 12 ? -28.211 -109.769 36.804  1.00 82.72  ? 137 LEU C C   1 
ATOM   1471 O  O   . LEU C 1 12 ? -27.354 -108.905 36.655  1.00 80.24  ? 137 LEU C O   1 
ATOM   1472 C  CB  . LEU C 1 12 ? -27.582 -112.158 36.341  1.00 86.87  ? 137 LEU C CB  1 
ATOM   1473 C  CG  . LEU C 1 12 ? -26.327 -112.002 35.495  1.00 91.61  ? 137 LEU C CG  1 
ATOM   1474 C  CD1 . LEU C 1 12 ? -25.463 -113.250 35.574  1.00 95.38  ? 137 LEU C CD1 1 
ATOM   1475 C  CD2 . LEU C 1 12 ? -26.685 -111.672 34.058  1.00 93.00  ? 137 LEU C CD2 1 
ATOM   1476 N  N   . LEU C 1 13 ? -29.504 -109.596 36.463  1.00 77.59  ? 138 LEU C N   1 
ATOM   1477 C  CA  . LEU C 1 13 ? -30.031 -108.354 35.890  1.00 73.87  ? 138 LEU C CA  1 
ATOM   1478 C  C   . LEU C 1 13 ? -30.081 -107.215 36.929  1.00 73.94  ? 138 LEU C C   1 
ATOM   1479 O  O   . LEU C 1 13 ? -29.889 -106.057 36.557  1.00 71.30  ? 138 LEU C O   1 
ATOM   1480 C  CB  . LEU C 1 13 ? -31.405 -108.571 35.221  1.00 73.89  ? 138 LEU C CB  1 
ATOM   1481 C  CG  . LEU C 1 13 ? -31.977 -107.383 34.430  1.00 75.88  ? 138 LEU C CG  1 
ATOM   1482 C  CD1 . LEU C 1 13 ? -31.302 -107.234 33.064  1.00 75.26  ? 138 LEU C CD1 1 
ATOM   1483 C  CD2 . LEU C 1 13 ? -33.478 -107.491 34.297  1.00 78.41  ? 138 LEU C CD2 1 
ATOM   1484 N  N   . THR C 1 14 ? -30.317 -107.543 38.219  1.00 69.95  ? 139 THR C N   1 
ATOM   1485 C  CA  . THR C 1 14 ? -30.353 -106.567 39.320  1.00 67.76  ? 139 THR C CA  1 
ATOM   1486 C  C   . THR C 1 14 ? -28.928 -106.094 39.653  1.00 68.05  ? 139 THR C C   1 
ATOM   1487 O  O   . THR C 1 14 ? -28.735 -104.932 40.014  1.00 66.50  ? 139 THR C O   1 
ATOM   1488 C  CB  . THR C 1 14 ? -31.081 -107.135 40.555  1.00 77.41  ? 139 THR C CB  1 
ATOM   1489 O  OG1 . THR C 1 14 ? -32.222 -107.890 40.136  1.00 78.22  ? 139 THR C OG1 1 
ATOM   1490 C  CG2 . THR C 1 14 ? -31.516 -106.043 41.532  1.00 73.98  ? 139 THR C CG2 1 
ATOM   1491 N  N   . VAL C 1 15 ? -27.939 -106.999 39.523  1.00 63.12  ? 140 VAL C N   1 
ATOM   1492 C  CA  . VAL C 1 15 ? -26.526 -106.708 39.759  1.00 61.55  ? 140 VAL C CA  1 
ATOM   1493 C  C   . VAL C 1 15 ? -26.029 -105.808 38.621  1.00 60.76  ? 140 VAL C C   1 
ATOM   1494 O  O   . VAL C 1 15 ? -25.433 -104.770 38.894  1.00 59.65  ? 140 VAL C O   1 
ATOM   1495 C  CB  . VAL C 1 15 ? -25.685 -108.007 39.924  1.00 68.12  ? 140 VAL C CB  1 
ATOM   1496 C  CG1 . VAL C 1 15 ? -24.195 -107.709 39.953  1.00 68.01  ? 140 VAL C CG1 1 
ATOM   1497 C  CG2 . VAL C 1 15 ? -26.086 -108.771 41.182  1.00 70.65  ? 140 VAL C CG2 1 
ATOM   1498 N  N   . VAL C 1 16 ? -26.324 -106.187 37.357  1.00 54.67  ? 141 VAL C N   1 
ATOM   1499 C  CA  . VAL C 1 16 ? -25.971 -105.464 36.130  1.00 51.69  ? 141 VAL C CA  1 
ATOM   1500 C  C   . VAL C 1 16 ? -26.553 -104.046 36.136  1.00 52.51  ? 141 VAL C C   1 
ATOM   1501 O  O   . VAL C 1 16 ? -25.843 -103.088 35.820  1.00 50.82  ? 141 VAL C O   1 
ATOM   1502 C  CB  . VAL C 1 16 ? -26.361 -106.296 34.867  1.00 55.74  ? 141 VAL C CB  1 
ATOM   1503 C  CG1 . VAL C 1 16 ? -26.702 -105.418 33.667  1.00 53.34  ? 141 VAL C CG1 1 
ATOM   1504 C  CG2 . VAL C 1 16 ? -25.264 -107.300 34.507  1.00 57.42  ? 141 VAL C CG2 1 
ATOM   1505 N  N   . PHE C 1 17 ? -27.829 -103.921 36.531  1.00 48.60  ? 142 PHE C N   1 
ATOM   1506 C  CA  . PHE C 1 17 ? -28.550 -102.650 36.605  1.00 46.53  ? 142 PHE C CA  1 
ATOM   1507 C  C   . PHE C 1 17 ? -28.030 -101.749 37.717  1.00 50.31  ? 142 PHE C C   1 
ATOM   1508 O  O   . PHE C 1 17 ? -28.039 -100.534 37.539  1.00 49.12  ? 142 PHE C O   1 
ATOM   1509 C  CB  . PHE C 1 17 ? -30.066 -102.871 36.754  1.00 48.38  ? 142 PHE C CB  1 
ATOM   1510 C  CG  . PHE C 1 17 ? -30.911 -102.111 35.760  1.00 48.05  ? 142 PHE C CG  1 
ATOM   1511 C  CD1 . PHE C 1 17 ? -31.325 -102.710 34.573  1.00 51.59  ? 142 PHE C CD1 1 
ATOM   1512 C  CD2 . PHE C 1 17 ? -31.293 -100.797 36.008  1.00 48.03  ? 142 PHE C CD2 1 
ATOM   1513 C  CE1 . PHE C 1 17 ? -32.117 -102.012 33.659  1.00 51.05  ? 142 PHE C CE1 1 
ATOM   1514 C  CE2 . PHE C 1 17 ? -32.085 -100.101 35.095  1.00 49.79  ? 142 PHE C CE2 1 
ATOM   1515 C  CZ  . PHE C 1 17 ? -32.489 -100.714 33.927  1.00 48.45  ? 142 PHE C CZ  1 
ATOM   1516 N  N   . TYR C 1 18 ? -27.589 -102.325 38.858  1.00 47.91  ? 143 TYR C N   1 
ATOM   1517 C  CA  . TYR C 1 18 ? -27.032 -101.534 39.959  1.00 47.75  ? 143 TYR C CA  1 
ATOM   1518 C  C   . TYR C 1 18 ? -25.657 -100.965 39.570  1.00 49.89  ? 143 TYR C C   1 
ATOM   1519 O  O   . TYR C 1 18 ? -25.371 -99.811  39.890  1.00 49.41  ? 143 TYR C O   1 
ATOM   1520 C  CB  . TYR C 1 18 ? -26.946 -102.349 41.267  1.00 51.62  ? 143 TYR C CB  1 
ATOM   1521 C  CG  . TYR C 1 18 ? -26.158 -101.660 42.370  1.00 54.50  ? 143 TYR C CG  1 
ATOM   1522 C  CD1 . TYR C 1 18 ? -26.731 -100.647 43.136  1.00 56.23  ? 143 TYR C CD1 1 
ATOM   1523 C  CD2 . TYR C 1 18 ? -24.840 -102.024 42.649  1.00 55.91  ? 143 TYR C CD2 1 
ATOM   1524 C  CE1 . TYR C 1 18 ? -26.009 -100.001 44.139  1.00 57.09  ? 143 TYR C CE1 1 
ATOM   1525 C  CE2 . TYR C 1 18 ? -24.111 -101.388 43.654  1.00 57.07  ? 143 TYR C CE2 1 
ATOM   1526 C  CZ  . TYR C 1 18 ? -24.698 -100.372 44.391  1.00 62.43  ? 143 TYR C CZ  1 
ATOM   1527 O  OH  . TYR C 1 18 ? -23.994 -99.733  45.381  1.00 61.29  ? 143 TYR C OH  1 
ATOM   1528 N  N   . ILE C 1 19 ? -24.817 -101.779 38.893  1.00 45.30  ? 144 ILE C N   1 
ATOM   1529 C  CA  . ILE C 1 19 ? -23.469 -101.398 38.459  1.00 44.15  ? 144 ILE C CA  1 
ATOM   1530 C  C   . ILE C 1 19 ? -23.516 -100.331 37.372  1.00 46.05  ? 144 ILE C C   1 
ATOM   1531 O  O   . ILE C 1 19 ? -22.726 -99.389  37.409  1.00 45.49  ? 144 ILE C O   1 
ATOM   1532 C  CB  . ILE C 1 19 ? -22.611 -102.640 38.089  1.00 48.44  ? 144 ILE C CB  1 
ATOM   1533 C  CG1 . ILE C 1 19 ? -22.281 -103.446 39.366  1.00 51.48  ? 144 ILE C CG1 1 
ATOM   1534 C  CG2 . ILE C 1 19 ? -21.322 -102.243 37.343  1.00 47.56  ? 144 ILE C CG2 1 
ATOM   1535 C  CD1 . ILE C 1 19 ? -22.070 -104.887 39.167  1.00 62.18  ? 144 ILE C CD1 1 
ATOM   1536 N  N   . ALA C 1 20 ? -24.445 -100.473 36.421  1.00 41.12  ? 145 ALA C N   1 
ATOM   1537 C  CA  . ALA C 1 20 ? -24.599 -99.524  35.342  1.00 39.67  ? 145 ALA C CA  1 
ATOM   1538 C  C   . ALA C 1 20 ? -25.094 -98.184  35.876  1.00 45.65  ? 145 ALA C C   1 
ATOM   1539 O  O   . ALA C 1 20 ? -24.572 -97.153  35.451  1.00 44.55  ? 145 ALA C O   1 
ATOM   1540 C  CB  . ALA C 1 20 ? -25.568 -100.070 34.319  1.00 40.39  ? 145 ALA C CB  1 
ATOM   1541 N  N   . ALA C 1 21 ? -26.080 -98.198  36.829  1.00 44.58  ? 146 ALA C N   1 
ATOM   1542 C  CA  . ALA C 1 21 ? -26.671 -96.994  37.450  1.00 44.33  ? 146 ALA C CA  1 
ATOM   1543 C  C   . ALA C 1 21 ? -25.672 -96.198  38.305  1.00 50.51  ? 146 ALA C C   1 
ATOM   1544 O  O   . ALA C 1 21 ? -25.767 -94.968  38.361  1.00 50.37  ? 146 ALA C O   1 
ATOM   1545 C  CB  . ALA C 1 21 ? -27.888 -97.358  38.268  1.00 45.61  ? 146 ALA C CB  1 
ATOM   1546 N  N   . VAL C 1 22 ? -24.713 -96.895  38.956  1.00 47.22  ? 147 VAL C N   1 
ATOM   1547 C  CA  . VAL C 1 22 ? -23.654 -96.254  39.727  1.00 46.98  ? 147 VAL C CA  1 
ATOM   1548 C  C   . VAL C 1 22 ? -22.729 -95.585  38.698  1.00 49.75  ? 147 VAL C C   1 
ATOM   1549 O  O   . VAL C 1 22 ? -22.420 -94.398  38.824  1.00 48.85  ? 147 VAL C O   1 
ATOM   1550 C  CB  . VAL C 1 22 ? -22.894 -97.261  40.643  1.00 51.80  ? 147 VAL C CB  1 
ATOM   1551 C  CG1 . VAL C 1 22 ? -21.616 -96.649  41.216  1.00 51.56  ? 147 VAL C CG1 1 
ATOM   1552 C  CG2 . VAL C 1 22 ? -23.795 -97.766  41.767  1.00 52.91  ? 147 VAL C CG2 1 
ATOM   1553 N  N   . MET C 1 23 ? -22.352 -96.344  37.649  1.00 45.99  ? 148 MET C N   1 
ATOM   1554 C  CA  . MET C 1 23 ? -21.452 -95.920  36.579  1.00 45.02  ? 148 MET C CA  1 
ATOM   1555 C  C   . MET C 1 23 ? -21.996 -94.672  35.902  1.00 43.62  ? 148 MET C C   1 
ATOM   1556 O  O   . MET C 1 23 ? -21.263 -93.690  35.771  1.00 41.70  ? 148 MET C O   1 
ATOM   1557 C  CB  . MET C 1 23 ? -21.277 -97.077  35.583  1.00 48.63  ? 148 MET C CB  1 
ATOM   1558 C  CG  . MET C 1 23 ? -19.868 -97.274  35.064  1.00 54.58  ? 148 MET C CG  1 
ATOM   1559 S  SD  . MET C 1 23 ? -19.833 -98.382  33.599  1.00 60.38  ? 148 MET C SD  1 
ATOM   1560 C  CE  . MET C 1 23 ? -18.522 -97.608  32.618  1.00 56.75  ? 148 MET C CE  1 
ATOM   1561 N  N   . ALA C 1 24 ? -23.302 -94.688  35.556  1.00 38.57  ? 149 ALA C N   1 
ATOM   1562 C  CA  . ALA C 1 24 ? -24.013 -93.589  34.896  1.00 36.80  ? 149 ALA C CA  1 
ATOM   1563 C  C   . ALA C 1 24 ? -24.059 -92.309  35.733  1.00 40.13  ? 149 ALA C C   1 
ATOM   1564 O  O   . ALA C 1 24 ? -23.825 -91.229  35.188  1.00 38.63  ? 149 ALA C O   1 
ATOM   1565 C  CB  . ALA C 1 24 ? -25.410 -94.023  34.502  1.00 37.00  ? 149 ALA C CB  1 
ATOM   1566 N  N   . THR C 1 25 ? -24.317 -92.427  37.056  1.00 38.10  ? 150 THR C N   1 
ATOM   1567 C  CA  . THR C 1 25 ? -24.353 -91.290  37.989  1.00 38.34  ? 150 THR C CA  1 
ATOM   1568 C  C   . THR C 1 25 ? -22.936 -90.701  38.106  1.00 46.07  ? 150 THR C C   1 
ATOM   1569 O  O   . THR C 1 25 ? -22.779 -89.481  38.161  1.00 47.67  ? 150 THR C O   1 
ATOM   1570 C  CB  . THR C 1 25 ? -24.821 -91.732  39.386  1.00 40.57  ? 150 THR C CB  1 
ATOM   1571 O  OG1 . THR C 1 25 ? -25.919 -92.630  39.305  1.00 36.16  ? 150 THR C OG1 1 
ATOM   1572 C  CG2 . THR C 1 25 ? -25.166 -90.567  40.282  1.00 40.85  ? 150 THR C CG2 1 
ATOM   1573 N  N   . ASN C 1 26 ? -21.912 -91.572  38.172  1.00 42.59  ? 151 ASN C N   1 
ATOM   1574 C  CA  . ASN C 1 26 ? -20.522 -91.161  38.321  1.00 43.08  ? 151 ASN C CA  1 
ATOM   1575 C  C   . ASN C 1 26 ? -19.984 -90.426  37.089  1.00 47.20  ? 151 ASN C C   1 
ATOM   1576 O  O   . ASN C 1 26 ? -19.287 -89.419  37.247  1.00 48.06  ? 151 ASN C O   1 
ATOM   1577 C  CB  . ASN C 1 26 ? -19.649 -92.372  38.689  1.00 43.36  ? 151 ASN C CB  1 
ATOM   1578 C  CG  . ASN C 1 26 ? -18.232 -92.039  39.047  1.00 55.50  ? 151 ASN C CG  1 
ATOM   1579 O  OD1 . ASN C 1 26 ? -17.302 -92.359  38.305  1.00 48.51  ? 151 ASN C OD1 1 
ATOM   1580 N  ND2 . ASN C 1 26 ? -18.038 -91.386  40.194  1.00 47.59  ? 151 ASN C ND2 1 
ATOM   1581 N  N   . LEU C 1 27 ? -20.307 -90.918  35.876  1.00 42.16  ? 152 LEU C N   1 
ATOM   1582 C  CA  . LEU C 1 27 ? -19.836 -90.307  34.629  1.00 40.98  ? 152 LEU C CA  1 
ATOM   1583 C  C   . LEU C 1 27 ? -20.710 -89.118  34.168  1.00 43.68  ? 152 LEU C C   1 
ATOM   1584 O  O   . LEU C 1 27 ? -20.197 -88.029  33.870  1.00 43.11  ? 152 LEU C O   1 
ATOM   1585 C  CB  . LEU C 1 27 ? -19.739 -91.366  33.493  1.00 40.42  ? 152 LEU C CB  1 
ATOM   1586 C  CG  . LEU C 1 27 ? -18.871 -92.635  33.716  1.00 45.10  ? 152 LEU C CG  1 
ATOM   1587 C  CD1 . LEU C 1 27 ? -18.875 -93.529  32.483  1.00 43.81  ? 152 LEU C CD1 1 
ATOM   1588 C  CD2 . LEU C 1 27 ? -17.443 -92.293  34.102  1.00 48.44  ? 152 LEU C CD2 1 
ATOM   1589 N  N   . TYR C 1 28 ? -22.033 -89.334  34.132  1.00 38.50  ? 153 TYR C N   1 
ATOM   1590 C  CA  . TYR C 1 28 ? -22.972 -88.375  33.579  1.00 37.35  ? 153 TYR C CA  1 
ATOM   1591 C  C   . TYR C 1 28 ? -23.807 -87.587  34.578  1.00 41.38  ? 153 TYR C C   1 
ATOM   1592 O  O   . TYR C 1 28 ? -24.597 -86.721  34.178  1.00 42.10  ? 153 TYR C O   1 
ATOM   1593 C  CB  . TYR C 1 28 ? -23.873 -89.096  32.554  1.00 37.51  ? 153 TYR C CB  1 
ATOM   1594 C  CG  . TYR C 1 28 ? -23.137 -90.073  31.658  1.00 39.10  ? 153 TYR C CG  1 
ATOM   1595 C  CD1 . TYR C 1 28 ? -22.152 -89.636  30.780  1.00 41.57  ? 153 TYR C CD1 1 
ATOM   1596 C  CD2 . TYR C 1 28 ? -23.450 -91.429  31.662  1.00 39.86  ? 153 TYR C CD2 1 
ATOM   1597 C  CE1 . TYR C 1 28 ? -21.476 -90.525  29.948  1.00 44.04  ? 153 TYR C CE1 1 
ATOM   1598 C  CE2 . TYR C 1 28 ? -22.784 -92.330  30.830  1.00 41.07  ? 153 TYR C CE2 1 
ATOM   1599 C  CZ  . TYR C 1 28 ? -21.800 -91.872  29.967  1.00 50.18  ? 153 TYR C CZ  1 
ATOM   1600 O  OH  . TYR C 1 28 ? -21.127 -92.737  29.127  1.00 50.10  ? 153 TYR C OH  1 
ATOM   1601 N  N   . GLY C 1 29 ? -23.645 -87.885  35.854  1.00 36.84  ? 154 GLY C N   1 
ATOM   1602 C  CA  . GLY C 1 29 ? -24.429 -87.249  36.905  1.00 37.11  ? 154 GLY C CA  1 
ATOM   1603 C  C   . GLY C 1 29 ? -24.322 -85.749  37.034  1.00 41.66  ? 154 GLY C C   1 
ATOM   1604 O  O   . GLY C 1 29 ? -25.341 -85.076  37.164  1.00 43.04  ? 154 GLY C O   1 
ATOM   1605 N  N   . ALA C 1 30 ? -23.089 -85.231  37.038  1.00 37.83  ? 155 ALA C N   1 
ATOM   1606 C  CA  . ALA C 1 30 ? -22.759 -83.815  37.211  1.00 38.84  ? 155 ALA C CA  1 
ATOM   1607 C  C   . ALA C 1 30 ? -23.189 -82.948  36.053  1.00 42.69  ? 155 ALA C C   1 
ATOM   1608 O  O   . ALA C 1 30 ? -23.671 -81.828  36.263  1.00 42.79  ? 155 ALA C O   1 
ATOM   1609 C  CB  . ALA C 1 30 ? -21.261 -83.663  37.434  1.00 40.33  ? 155 ALA C CB  1 
ATOM   1610 N  N   . THR C 1 31 ? -22.979 -83.479  34.832  1.00 39.34  ? 156 THR C N   1 
ATOM   1611 C  CA  . THR C 1 31 ? -23.234 -82.885  33.516  1.00 38.88  ? 156 THR C CA  1 
ATOM   1612 C  C   . THR C 1 31 ? -24.683 -82.946  33.118  1.00 41.09  ? 156 THR C C   1 
ATOM   1613 O  O   . THR C 1 31 ? -25.150 -82.035  32.426  1.00 40.62  ? 156 THR C O   1 
ATOM   1614 C  CB  . THR C 1 31 ? -22.334 -83.545  32.459  1.00 47.21  ? 156 THR C CB  1 
ATOM   1615 O  OG1 . THR C 1 31 ? -22.157 -84.938  32.764  1.00 48.26  ? 156 THR C OG1 1 
ATOM   1616 C  CG2 . THR C 1 31 ? -20.978 -82.882  32.377  1.00 45.68  ? 156 THR C CG2 1 
ATOM   1617 N  N   . PHE C 1 32 ? -25.384 -84.044  33.521  1.00 36.88  ? 157 PHE C N   1 
ATOM   1618 C  CA  . PHE C 1 32 ? -26.810 -84.306  33.243  1.00 35.76  ? 157 PHE C CA  1 
ATOM   1619 C  C   . PHE C 1 32 ? -27.551 -84.713  34.537  1.00 38.83  ? 157 PHE C C   1 
ATOM   1620 O  O   . PHE C 1 32 ? -27.813 -85.907  34.764  1.00 38.14  ? 157 PHE C O   1 
ATOM   1621 C  CB  . PHE C 1 32 ? -26.989 -85.332  32.109  1.00 36.48  ? 157 PHE C CB  1 
ATOM   1622 C  CG  . PHE C 1 32 ? -26.461 -84.846  30.779  1.00 38.79  ? 157 PHE C CG  1 
ATOM   1623 C  CD1 . PHE C 1 32 ? -25.136 -85.081  30.406  1.00 42.93  ? 157 PHE C CD1 1 
ATOM   1624 C  CD2 . PHE C 1 32 ? -27.271 -84.121  29.915  1.00 41.01  ? 157 PHE C CD2 1 
ATOM   1625 C  CE1 . PHE C 1 32 ? -24.634 -84.578  29.204  1.00 44.10  ? 157 PHE C CE1 1 
ATOM   1626 C  CE2 . PHE C 1 32 ? -26.775 -83.645  28.699  1.00 44.23  ? 157 PHE C CE2 1 
ATOM   1627 C  CZ  . PHE C 1 32 ? -25.464 -83.875  28.354  1.00 42.84  ? 157 PHE C CZ  1 
ATOM   1628 N  N   . PRO C 1 33 ? -27.854 -83.712  35.411  1.00 34.63  ? 158 PRO C N   1 
ATOM   1629 C  CA  . PRO C 1 33 ? -28.542 -84.015  36.675  1.00 35.01  ? 158 PRO C CA  1 
ATOM   1630 C  C   . PRO C 1 33 ? -29.970 -84.566  36.557  1.00 41.84  ? 158 PRO C C   1 
ATOM   1631 O  O   . PRO C 1 33 ? -30.356 -85.385  37.387  1.00 42.15  ? 158 PRO C O   1 
ATOM   1632 C  CB  . PRO C 1 33 ? -28.526 -82.681  37.431  1.00 38.17  ? 158 PRO C CB  1 
ATOM   1633 C  CG  . PRO C 1 33 ? -27.679 -81.782  36.665  1.00 42.65  ? 158 PRO C CG  1 
ATOM   1634 C  CD  . PRO C 1 33 ? -27.592 -82.266  35.280  1.00 36.71  ? 158 PRO C CD  1 
ATOM   1635 N  N   . GLU C 1 34 ? -30.762 -84.119  35.563  1.00 39.76  ? 159 GLU C N   1 
ATOM   1636 C  CA  . GLU C 1 34 ? -32.153 -84.576  35.404  1.00 40.21  ? 159 GLU C CA  1 
ATOM   1637 C  C   . GLU C 1 34 ? -32.287 -86.060  35.129  1.00 41.90  ? 159 GLU C C   1 
ATOM   1638 O  O   . GLU C 1 34 ? -33.223 -86.691  35.613  1.00 41.23  ? 159 GLU C O   1 
ATOM   1639 C  CB  . GLU C 1 34 ? -32.906 -83.774  34.331  1.00 42.62  ? 159 GLU C CB  1 
ATOM   1640 C  CG  . GLU C 1 34 ? -33.086 -82.303  34.683  1.00 63.01  ? 159 GLU C CG  1 
ATOM   1641 C  CD  . GLU C 1 34 ? -34.508 -81.773  34.717  1.00 95.87  ? 159 GLU C CD  1 
ATOM   1642 O  OE1 . GLU C 1 34 ? -34.729 -80.739  35.390  1.00 89.59  ? 159 GLU C OE1 1 
ATOM   1643 O  OE2 . GLU C 1 34 ? -35.393 -82.372  34.060  1.00 93.81  ? 159 GLU C OE2 1 
ATOM   1644 N  N   . TRP C 1 35 ? -31.341 -86.614  34.370  1.00 37.89  ? 160 TRP C N   1 
ATOM   1645 C  CA  . TRP C 1 35 ? -31.344 -88.015  33.988  1.00 36.50  ? 160 TRP C CA  1 
ATOM   1646 C  C   . TRP C 1 35 ? -30.418 -88.881  34.798  1.00 37.80  ? 160 TRP C C   1 
ATOM   1647 O  O   . TRP C 1 35 ? -30.700 -90.075  34.898  1.00 36.48  ? 160 TRP C O   1 
ATOM   1648 C  CB  . TRP C 1 35 ? -30.965 -88.156  32.519  1.00 35.24  ? 160 TRP C CB  1 
ATOM   1649 C  CG  . TRP C 1 35 ? -31.790 -87.334  31.572  1.00 37.13  ? 160 TRP C CG  1 
ATOM   1650 C  CD1 . TRP C 1 35 ? -33.125 -87.055  31.663  1.00 40.32  ? 160 TRP C CD1 1 
ATOM   1651 C  CD2 . TRP C 1 35 ? -31.345 -86.775  30.329  1.00 37.39  ? 160 TRP C CD2 1 
ATOM   1652 N  NE1 . TRP C 1 35 ? -33.522 -86.302  30.585  1.00 40.32  ? 160 TRP C NE1 1 
ATOM   1653 C  CE2 . TRP C 1 35 ? -32.449 -86.118  29.747  1.00 41.76  ? 160 TRP C CE2 1 
ATOM   1654 C  CE3 . TRP C 1 35 ? -30.105 -86.744  29.661  1.00 38.40  ? 160 TRP C CE3 1 
ATOM   1655 C  CZ2 . TRP C 1 35 ? -32.357 -85.454  28.518  1.00 41.57  ? 160 TRP C CZ2 1 
ATOM   1656 C  CZ3 . TRP C 1 35 ? -30.017 -86.078  28.452  1.00 40.22  ? 160 TRP C CZ3 1 
ATOM   1657 C  CH2 . TRP C 1 35 ? -31.134 -85.448  27.890  1.00 41.47  ? 160 TRP C CH2 1 
ATOM   1658 N  N   . PHE C 1 36 ? -29.283 -88.321  35.319  1.00 33.25  ? 161 PHE C N   1 
ATOM   1659 C  CA  . PHE C 1 36 ? -28.270 -89.107  36.035  1.00 32.49  ? 161 PHE C CA  1 
ATOM   1660 C  C   . PHE C 1 36 ? -27.728 -88.526  37.322  1.00 41.63  ? 161 PHE C C   1 
ATOM   1661 O  O   . PHE C 1 36 ? -26.709 -89.018  37.814  1.00 42.93  ? 161 PHE C O   1 
ATOM   1662 C  CB  . PHE C 1 36 ? -27.104 -89.473  35.093  1.00 32.58  ? 161 PHE C CB  1 
ATOM   1663 C  CG  . PHE C 1 36 ? -27.533 -90.274  33.888  1.00 32.47  ? 161 PHE C CG  1 
ATOM   1664 C  CD1 . PHE C 1 36 ? -27.957 -91.592  34.024  1.00 33.65  ? 161 PHE C CD1 1 
ATOM   1665 C  CD2 . PHE C 1 36 ? -27.587 -89.687  32.630  1.00 33.68  ? 161 PHE C CD2 1 
ATOM   1666 C  CE1 . PHE C 1 36 ? -28.427 -92.305  32.930  1.00 33.90  ? 161 PHE C CE1 1 
ATOM   1667 C  CE2 . PHE C 1 36 ? -28.054 -90.404  31.532  1.00 35.73  ? 161 PHE C CE2 1 
ATOM   1668 C  CZ  . PHE C 1 36 ? -28.459 -91.712  31.686  1.00 33.48  ? 161 PHE C CZ  1 
ATOM   1669 N  N   . GLY C 1 37 ? -28.410 -87.528  37.879  1.00 39.85  ? 162 GLY C N   1 
ATOM   1670 C  CA  . GLY C 1 37 ? -27.994 -86.830  39.095  1.00 41.19  ? 162 GLY C CA  1 
ATOM   1671 C  C   . GLY C 1 37 ? -27.835 -87.641  40.369  1.00 46.47  ? 162 GLY C C   1 
ATOM   1672 O  O   . GLY C 1 37 ? -27.159 -87.192  41.304  1.00 47.94  ? 162 GLY C O   1 
ATOM   1673 N  N   . ASP C 1 38 ? -28.497 -88.814  40.430  1.00 41.82  ? 163 ASP C N   1 
ATOM   1674 C  CA  . ASP C 1 38 ? -28.450 -89.761  41.550  1.00 42.06  ? 163 ASP C CA  1 
ATOM   1675 C  C   . ASP C 1 38 ? -28.854 -91.157  41.093  1.00 43.31  ? 163 ASP C C   1 
ATOM   1676 O  O   . ASP C 1 38 ? -29.442 -91.297  40.019  1.00 42.62  ? 163 ASP C O   1 
ATOM   1677 C  CB  . ASP C 1 38 ? -29.274 -89.288  42.767  1.00 45.39  ? 163 ASP C CB  1 
ATOM   1678 C  CG  . ASP C 1 38 ? -30.738 -89.020  42.517  1.00 54.11  ? 163 ASP C CG  1 
ATOM   1679 O  OD1 . ASP C 1 38 ? -31.469 -89.980  42.203  1.00 55.36  ? 163 ASP C OD1 1 
ATOM   1680 O  OD2 . ASP C 1 38 ? -31.175 -87.869  42.739  1.00 58.39  ? 163 ASP C OD2 1 
ATOM   1681 N  N   . LEU C 1 39 ? -28.552 -92.181  41.907  1.00 38.40  ? 164 LEU C N   1 
ATOM   1682 C  CA  . LEU C 1 39 ? -28.867 -93.581  41.635  1.00 37.33  ? 164 LEU C CA  1 
ATOM   1683 C  C   . LEU C 1 39 ? -30.324 -93.824  41.185  1.00 41.88  ? 164 LEU C C   1 
ATOM   1684 O  O   . LEU C 1 39 ? -30.520 -94.522  40.189  1.00 42.01  ? 164 LEU C O   1 
ATOM   1685 C  CB  . LEU C 1 39 ? -28.511 -94.471  42.838  1.00 38.57  ? 164 LEU C CB  1 
ATOM   1686 C  CG  . LEU C 1 39 ? -28.423 -95.967  42.555  1.00 42.77  ? 164 LEU C CG  1 
ATOM   1687 C  CD1 . LEU C 1 39 ? -27.176 -96.310  41.747  1.00 42.61  ? 164 LEU C CD1 1 
ATOM   1688 C  CD2 . LEU C 1 39 ? -28.452 -96.759  43.821  1.00 45.12  ? 164 LEU C CD2 1 
ATOM   1689 N  N   . SER C 1 40 ? -31.320 -93.233  41.892  1.00 37.70  ? 165 SER C N   1 
ATOM   1690 C  CA  . SER C 1 40 ? -32.759 -93.358  41.610  1.00 36.89  ? 165 SER C CA  1 
ATOM   1691 C  C   . SER C 1 40 ? -33.098 -92.904  40.200  1.00 39.84  ? 165 SER C C   1 
ATOM   1692 O  O   . SER C 1 40 ? -33.736 -93.646  39.445  1.00 38.77  ? 165 SER C O   1 
ATOM   1693 C  CB  . SER C 1 40 ? -33.571 -92.556  42.618  1.00 41.33  ? 165 SER C CB  1 
ATOM   1694 O  OG  . SER C 1 40 ? -33.713 -93.251  43.845  1.00 54.73  ? 165 SER C OG  1 
ATOM   1695 N  N   . LYS C 1 41 ? -32.633 -91.696  39.838  1.00 36.61  ? 166 LYS C N   1 
ATOM   1696 C  CA  . LYS C 1 41 ? -32.800 -91.098  38.512  1.00 35.36  ? 166 LYS C CA  1 
ATOM   1697 C  C   . LYS C 1 41 ? -32.113 -91.966  37.446  1.00 40.28  ? 166 LYS C C   1 
ATOM   1698 O  O   . LYS C 1 41 ? -32.738 -92.251  36.420  1.00 41.22  ? 166 LYS C O   1 
ATOM   1699 C  CB  . LYS C 1 41 ? -32.233 -89.668  38.474  1.00 36.78  ? 166 LYS C CB  1 
ATOM   1700 C  CG  . LYS C 1 41 ? -32.946 -88.661  39.370  1.00 35.43  ? 166 LYS C CG  1 
ATOM   1701 C  CD  . LYS C 1 41 ? -32.231 -87.329  39.274  1.00 36.74  ? 166 LYS C CD  1 
ATOM   1702 C  CE  . LYS C 1 41 ? -32.941 -86.190  39.955  1.00 46.53  ? 166 LYS C CE  1 
ATOM   1703 N  NZ  . LYS C 1 41 ? -32.205 -84.908  39.758  1.00 57.07  ? 166 LYS C NZ  1 
ATOM   1704 N  N   . SER C 1 42 ? -30.853 -92.423  37.706  1.00 35.56  ? 167 SER C N   1 
ATOM   1705 C  CA  . SER C 1 42 ? -30.091 -93.283  36.790  1.00 34.37  ? 167 SER C CA  1 
ATOM   1706 C  C   . SER C 1 42 ? -30.767 -94.631  36.507  1.00 38.29  ? 167 SER C C   1 
ATOM   1707 O  O   . SER C 1 42 ? -30.838 -95.024  35.346  1.00 37.02  ? 167 SER C O   1 
ATOM   1708 C  CB  . SER C 1 42 ? -28.658 -93.465  37.273  1.00 38.26  ? 167 SER C CB  1 
ATOM   1709 O  OG  . SER C 1 42 ? -27.945 -92.239  37.195  1.00 45.06  ? 167 SER C OG  1 
ATOM   1710 N  N   . LEU C 1 43 ? -31.326 -95.299  37.545  1.00 35.99  ? 168 LEU C N   1 
ATOM   1711 C  CA  . LEU C 1 43 ? -32.056 -96.570  37.403  1.00 35.94  ? 168 LEU C CA  1 
ATOM   1712 C  C   . LEU C 1 43 ? -33.313 -96.420  36.484  1.00 40.59  ? 168 LEU C C   1 
ATOM   1713 O  O   . LEU C 1 43 ? -33.590 -97.306  35.658  1.00 39.15  ? 168 LEU C O   1 
ATOM   1714 C  CB  . LEU C 1 43 ? -32.471 -97.110  38.778  1.00 36.77  ? 168 LEU C CB  1 
ATOM   1715 C  CG  . LEU C 1 43 ? -31.379 -97.666  39.681  1.00 41.50  ? 168 LEU C CG  1 
ATOM   1716 C  CD1 . LEU C 1 43 ? -31.791 -97.561  41.142  1.00 42.71  ? 168 LEU C CD1 1 
ATOM   1717 C  CD2 . LEU C 1 43 ? -31.047 -99.103  39.331  1.00 43.99  ? 168 LEU C CD2 1 
ATOM   1718 N  N   . TYR C 1 44 ? -34.051 -95.288  36.635  1.00 37.93  ? 169 TYR C N   1 
ATOM   1719 C  CA  . TYR C 1 44 ? -35.245 -94.967  35.847  1.00 37.91  ? 169 TYR C CA  1 
ATOM   1720 C  C   . TYR C 1 44 ? -34.877 -94.689  34.401  1.00 39.21  ? 169 TYR C C   1 
ATOM   1721 O  O   . TYR C 1 44 ? -35.584 -95.155  33.507  1.00 37.33  ? 169 TYR C O   1 
ATOM   1722 C  CB  . TYR C 1 44 ? -36.050 -93.786  36.458  1.00 40.74  ? 169 TYR C CB  1 
ATOM   1723 C  CG  . TYR C 1 44 ? -37.209 -93.324  35.590  1.00 43.94  ? 169 TYR C CG  1 
ATOM   1724 C  CD1 . TYR C 1 44 ? -37.023 -92.363  34.599  1.00 45.54  ? 169 TYR C CD1 1 
ATOM   1725 C  CD2 . TYR C 1 44 ? -38.484 -93.865  35.743  1.00 45.89  ? 169 TYR C CD2 1 
ATOM   1726 C  CE1 . TYR C 1 44 ? -38.063 -91.986  33.748  1.00 46.71  ? 169 TYR C CE1 1 
ATOM   1727 C  CE2 . TYR C 1 44 ? -39.537 -93.487  34.902  1.00 47.25  ? 169 TYR C CE2 1 
ATOM   1728 C  CZ  . TYR C 1 44 ? -39.317 -92.551  33.898  1.00 53.09  ? 169 TYR C CZ  1 
ATOM   1729 O  OH  . TYR C 1 44 ? -40.331 -92.121  33.072  1.00 50.28  ? 169 TYR C OH  1 
ATOM   1730 N  N   . THR C 1 45 ? -33.797 -93.902  34.174  1.00 36.81  ? 170 THR C N   1 
ATOM   1731 C  CA  . THR C 1 45 ? -33.298 -93.539  32.833  1.00 36.23  ? 170 THR C CA  1 
ATOM   1732 C  C   . THR C 1 45 ? -32.756 -94.772  32.103  1.00 39.52  ? 170 THR C C   1 
ATOM   1733 O  O   . THR C 1 45 ? -33.043 -94.928  30.917  1.00 39.83  ? 170 THR C O   1 
ATOM   1734 C  CB  . THR C 1 45 ? -32.274 -92.388  32.885  1.00 41.69  ? 170 THR C CB  1 
ATOM   1735 O  OG1 . THR C 1 45 ? -32.689 -91.423  33.848  1.00 38.88  ? 170 THR C OG1 1 
ATOM   1736 C  CG2 . THR C 1 45 ? -32.101 -91.700  31.526  1.00 39.96  ? 170 THR C CG2 1 
ATOM   1737 N  N   . LEU C 1 46 ? -32.010 -95.655  32.811  1.00 34.68  ? 171 LEU C N   1 
ATOM   1738 C  CA  . LEU C 1 46 ? -31.494 -96.889  32.228  1.00 34.66  ? 171 LEU C CA  1 
ATOM   1739 C  C   . LEU C 1 46 ? -32.611 -97.867  31.916  1.00 39.60  ? 171 LEU C C   1 
ATOM   1740 O  O   . LEU C 1 46 ? -32.479 -98.623  30.953  1.00 40.61  ? 171 LEU C O   1 
ATOM   1741 C  CB  . LEU C 1 46 ? -30.404 -97.538  33.074  1.00 35.41  ? 171 LEU C CB  1 
ATOM   1742 C  CG  . LEU C 1 46 ? -29.071 -96.787  33.185  1.00 40.14  ? 171 LEU C CG  1 
ATOM   1743 C  CD1 . LEU C 1 46 ? -28.243 -97.355  34.300  1.00 40.68  ? 171 LEU C CD1 1 
ATOM   1744 C  CD2 . LEU C 1 46 ? -28.280 -96.794  31.861  1.00 43.46  ? 171 LEU C CD2 1 
ATOM   1745 N  N   . PHE C 1 47 ? -33.730 -97.833  32.686  1.00 36.11  ? 172 PHE C N   1 
ATOM   1746 C  CA  . PHE C 1 47 ? -34.900 -98.665  32.381  1.00 36.99  ? 172 PHE C CA  1 
ATOM   1747 C  C   . PHE C 1 47 ? -35.506 -98.153  31.082  1.00 41.56  ? 172 PHE C C   1 
ATOM   1748 O  O   . PHE C 1 47 ? -35.715 -98.953  30.168  1.00 43.68  ? 172 PHE C O   1 
ATOM   1749 C  CB  . PHE C 1 47 ? -35.944 -98.686  33.517  1.00 39.57  ? 172 PHE C CB  1 
ATOM   1750 C  CG  . PHE C 1 47 ? -37.153 -99.543  33.201  1.00 42.09  ? 172 PHE C CG  1 
ATOM   1751 C  CD1 . PHE C 1 47 ? -37.090 -100.930 33.303  1.00 46.04  ? 172 PHE C CD1 1 
ATOM   1752 C  CD2 . PHE C 1 47 ? -38.340 -98.965  32.755  1.00 44.40  ? 172 PHE C CD2 1 
ATOM   1753 C  CE1 . PHE C 1 47 ? -38.197 -101.723 32.972  1.00 48.37  ? 172 PHE C CE1 1 
ATOM   1754 C  CE2 . PHE C 1 47 ? -39.444 -99.759  32.415  1.00 48.14  ? 172 PHE C CE2 1 
ATOM   1755 C  CZ  . PHE C 1 47 ? -39.367 -101.134 32.530  1.00 47.33  ? 172 PHE C CZ  1 
ATOM   1756 N  N   . GLN C 1 48 ? -35.727 -96.810  30.975  1.00 35.85  ? 173 GLN C N   1 
ATOM   1757 C  CA  . GLN C 1 48 ? -36.226 -96.132  29.772  1.00 34.31  ? 173 GLN C CA  1 
ATOM   1758 C  C   . GLN C 1 48 ? -35.357 -96.503  28.557  1.00 40.78  ? 173 GLN C C   1 
ATOM   1759 O  O   . GLN C 1 48 ? -35.894 -96.705  27.469  1.00 42.52  ? 173 GLN C O   1 
ATOM   1760 C  CB  . GLN C 1 48 ? -36.245 -94.608  29.964  1.00 33.92  ? 173 GLN C CB  1 
ATOM   1761 C  CG  . GLN C 1 48 ? -36.525 -93.864  28.662  1.00 37.36  ? 173 GLN C CG  1 
ATOM   1762 C  CD  . GLN C 1 48 ? -36.380 -92.375  28.726  1.00 41.60  ? 173 GLN C CD  1 
ATOM   1763 O  OE1 . GLN C 1 48 ? -36.548 -91.750  29.794  1.00 39.35  ? 173 GLN C OE1 1 
ATOM   1764 N  NE2 . GLN C 1 48 ? -36.094 -91.778  27.558  1.00 18.03  ? 173 GLN C NE2 1 
ATOM   1765 N  N   . VAL C 1 49 ? -34.027 -96.597  28.748  1.00 37.60  ? 174 VAL C N   1 
ATOM   1766 C  CA  . VAL C 1 49 ? -33.079 -96.960  27.694  1.00 38.54  ? 174 VAL C CA  1 
ATOM   1767 C  C   . VAL C 1 49 ? -33.301 -98.417  27.246  1.00 43.59  ? 174 VAL C C   1 
ATOM   1768 O  O   . VAL C 1 49 ? -33.316 -98.699  26.045  1.00 43.71  ? 174 VAL C O   1 
ATOM   1769 C  CB  . VAL C 1 49 ? -31.615 -96.632  28.113  1.00 42.19  ? 174 VAL C CB  1 
ATOM   1770 C  CG1 . VAL C 1 49 ? -30.594 -97.466  27.337  1.00 42.54  ? 174 VAL C CG1 1 
ATOM   1771 C  CG2 . VAL C 1 49 ? -31.329 -95.140  27.944  1.00 41.34  ? 174 VAL C CG2 1 
ATOM   1772 N  N   . MET C 1 50 ? -33.525 -99.309  28.207  1.00 40.39  ? 175 MET C N   1 
ATOM   1773 C  CA  . MET C 1 50 ? -33.758 -100.714 27.945  1.00 42.59  ? 175 MET C CA  1 
ATOM   1774 C  C   . MET C 1 50 ? -35.035 -100.943 27.111  1.00 47.87  ? 175 MET C C   1 
ATOM   1775 O  O   . MET C 1 50 ? -35.001 -101.760 26.184  1.00 50.62  ? 175 MET C O   1 
ATOM   1776 C  CB  . MET C 1 50 ? -33.794 -101.487 29.263  1.00 46.12  ? 175 MET C CB  1 
ATOM   1777 C  CG  . MET C 1 50 ? -34.091 -102.935 29.082  1.00 52.79  ? 175 MET C CG  1 
ATOM   1778 S  SD  . MET C 1 50 ? -33.935 -103.802 30.623  1.00 59.64  ? 175 MET C SD  1 
ATOM   1779 C  CE  . MET C 1 50 ? -35.541 -103.490 31.344  1.00 56.79  ? 175 MET C CE  1 
ATOM   1780 N  N   . THR C 1 51 ? -36.142 -100.215 27.416  1.00 41.55  ? 176 THR C N   1 
ATOM   1781 C  CA  . THR C 1 51 ? -37.422 -100.317 26.680  1.00 41.17  ? 176 THR C CA  1 
ATOM   1782 C  C   . THR C 1 51 ? -37.296 -99.669  25.276  1.00 43.09  ? 176 THR C C   1 
ATOM   1783 O  O   . THR C 1 51 ? -38.195 -99.798  24.436  1.00 44.31  ? 176 THR C O   1 
ATOM   1784 C  CB  . THR C 1 51 ? -38.600 -99.711  27.484  1.00 49.13  ? 176 THR C CB  1 
ATOM   1785 O  OG1 . THR C 1 51 ? -38.433 -98.298  27.590  1.00 51.21  ? 176 THR C OG1 1 
ATOM   1786 C  CG2 . THR C 1 51 ? -38.772 -100.326 28.869  1.00 46.71  ? 176 THR C CG2 1 
ATOM   1787 N  N   . LEU C 1 52 ? -36.159 -98.975  25.047  1.00 35.75  ? 177 LEU C N   1 
ATOM   1788 C  CA  . LEU C 1 52 ? -35.739 -98.288  23.830  1.00 34.08  ? 177 LEU C CA  1 
ATOM   1789 C  C   . LEU C 1 52 ? -36.379 -96.930  23.616  1.00 36.49  ? 177 LEU C C   1 
ATOM   1790 O  O   . LEU C 1 52 ? -36.010 -96.232  22.677  1.00 36.76  ? 177 LEU C O   1 
ATOM   1791 C  CB  . LEU C 1 52 ? -35.778 -99.192  22.569  1.00 35.04  ? 177 LEU C CB  1 
ATOM   1792 C  CG  . LEU C 1 52 ? -35.090 -100.556 22.681  1.00 39.56  ? 177 LEU C CG  1 
ATOM   1793 C  CD1 . LEU C 1 52 ? -35.255 -101.342 21.429  1.00 41.20  ? 177 LEU C CD1 1 
ATOM   1794 C  CD2 . LEU C 1 52 ? -33.615 -100.415 22.987  1.00 41.46  ? 177 LEU C CD2 1 
ATOM   1795 N  N   . GLU C 1 53 ? -37.287 -96.525  24.516  1.00 32.22  ? 178 GLU C N   1 
ATOM   1796 C  CA  . GLU C 1 53 ? -38.023 -95.251  24.445  1.00 31.71  ? 178 GLU C CA  1 
ATOM   1797 C  C   . GLU C 1 53 ? -37.086 -94.030  24.371  1.00 36.35  ? 178 GLU C C   1 
ATOM   1798 O  O   . GLU C 1 53 ? -36.355 -93.769  25.337  1.00 37.99  ? 178 GLU C O   1 
ATOM   1799 C  CB  . GLU C 1 53 ? -39.021 -95.154  25.617  1.00 32.11  ? 178 GLU C CB  1 
ATOM   1800 C  CG  . GLU C 1 53 ? -40.170 -94.201  25.369  1.00 38.30  ? 178 GLU C CG  1 
ATOM   1801 C  CD  . GLU C 1 53 ? -39.810 -92.730  25.415  1.00 58.14  ? 178 GLU C CD  1 
ATOM   1802 O  OE1 . GLU C 1 53 ? -39.748 -92.100  24.335  1.00 54.13  ? 178 GLU C OE1 1 
ATOM   1803 O  OE2 . GLU C 1 53 ? -39.560 -92.212  26.526  1.00 50.27  ? 178 GLU C OE2 1 
ATOM   1804 N  N   . SER C 1 54 ? -37.086 -93.313  23.218  1.00 31.55  ? 179 SER C N   1 
ATOM   1805 C  CA  . SER C 1 54 ? -36.241 -92.136  22.928  1.00 31.80  ? 179 SER C CA  1 
ATOM   1806 C  C   . SER C 1 54 ? -34.739 -92.285  23.331  1.00 36.77  ? 179 SER C C   1 
ATOM   1807 O  O   . SER C 1 54 ? -34.065 -91.284  23.608  1.00 35.88  ? 179 SER C O   1 
ATOM   1808 C  CB  . SER C 1 54 ? -36.839 -90.869  23.531  1.00 35.45  ? 179 SER C CB  1 
ATOM   1809 O  OG  . SER C 1 54 ? -38.075 -90.522  22.932  1.00 49.36  ? 179 SER C OG  1 
ATOM   1810 N  N   . TRP C 1 55 ? -34.216 -93.526  23.351  1.00 34.62  ? 180 TRP C N   1 
ATOM   1811 C  CA  . TRP C 1 55 ? -32.856 -93.766  23.814  1.00 35.19  ? 180 TRP C CA  1 
ATOM   1812 C  C   . TRP C 1 55 ? -31.784 -92.900  23.179  1.00 40.08  ? 180 TRP C C   1 
ATOM   1813 O  O   . TRP C 1 55 ? -30.957 -92.341  23.900  1.00 38.22  ? 180 TRP C O   1 
ATOM   1814 C  CB  . TRP C 1 55 ? -32.497 -95.265  23.833  1.00 34.65  ? 180 TRP C CB  1 
ATOM   1815 C  CG  . TRP C 1 55 ? -32.116 -95.842  22.514  1.00 36.44  ? 180 TRP C CG  1 
ATOM   1816 C  CD1 . TRP C 1 55 ? -32.921 -96.517  21.656  1.00 40.54  ? 180 TRP C CD1 1 
ATOM   1817 C  CD2 . TRP C 1 55 ? -30.815 -95.819  21.914  1.00 36.72  ? 180 TRP C CD2 1 
ATOM   1818 N  NE1 . TRP C 1 55 ? -32.221 -96.857  20.518  1.00 41.43  ? 180 TRP C NE1 1 
ATOM   1819 C  CE2 . TRP C 1 55 ? -30.925 -96.436  20.650  1.00 42.17  ? 180 TRP C CE2 1 
ATOM   1820 C  CE3 . TRP C 1 55 ? -29.571 -95.293  22.303  1.00 37.47  ? 180 TRP C CE3 1 
ATOM   1821 C  CZ2 . TRP C 1 55 ? -29.829 -96.600  19.797  1.00 42.39  ? 180 TRP C CZ2 1 
ATOM   1822 C  CZ3 . TRP C 1 55 ? -28.484 -95.445  21.452  1.00 39.84  ? 180 TRP C CZ3 1 
ATOM   1823 C  CH2 . TRP C 1 55 ? -28.617 -96.101  20.219  1.00 41.90  ? 180 TRP C CH2 1 
ATOM   1824 N  N   . SER C 1 56 ? -31.838 -92.760  21.832  1.00 38.09  ? 181 SER C N   1 
ATOM   1825 C  CA  . SER C 1 56 ? -30.865 -92.014  21.051  1.00 37.40  ? 181 SER C CA  1 
ATOM   1826 C  C   . SER C 1 56 ? -31.198 -90.533  20.891  1.00 40.57  ? 181 SER C C   1 
ATOM   1827 O  O   . SER C 1 56 ? -30.371 -89.699  21.266  1.00 40.71  ? 181 SER C O   1 
ATOM   1828 C  CB  . SER C 1 56 ? -30.588 -92.698  19.719  1.00 40.59  ? 181 SER C CB  1 
ATOM   1829 O  OG  . SER C 1 56 ? -29.547 -92.032  19.022  1.00 50.25  ? 181 SER C OG  1 
ATOM   1830 N  N   . MET C 1 57 ? -32.386 -90.188  20.385  1.00 35.74  ? 182 MET C N   1 
ATOM   1831 C  CA  . MET C 1 57 ? -32.725 -88.773  20.210  1.00 36.00  ? 182 MET C CA  1 
ATOM   1832 C  C   . MET C 1 57 ? -32.957 -88.049  21.547  1.00 38.94  ? 182 MET C C   1 
ATOM   1833 O  O   . MET C 1 57 ? -32.591 -86.875  21.676  1.00 38.89  ? 182 MET C O   1 
ATOM   1834 C  CB  . MET C 1 57 ? -33.919 -88.571  19.246  1.00 40.00  ? 182 MET C CB  1 
ATOM   1835 C  CG  . MET C 1 57 ? -33.748 -89.216  17.866  1.00 44.99  ? 182 MET C CG  1 
ATOM   1836 S  SD  . MET C 1 57 ? -32.480 -88.509  16.792  1.00 50.36  ? 182 MET C SD  1 
ATOM   1837 C  CE  . MET C 1 57 ? -33.427 -87.324  15.923  1.00 49.16  ? 182 MET C CE  1 
ATOM   1838 N  N   . GLY C 1 58 ? -33.512 -88.773  22.528  1.00 34.69  ? 183 GLY C N   1 
ATOM   1839 C  CA  . GLY C 1 58 ? -33.867 -88.259  23.849  1.00 33.26  ? 183 GLY C CA  1 
ATOM   1840 C  C   . GLY C 1 58 ? -32.753 -88.134  24.859  1.00 36.43  ? 183 GLY C C   1 
ATOM   1841 O  O   . GLY C 1 58 ? -32.612 -87.067  25.462  1.00 36.45  ? 183 GLY C O   1 
ATOM   1842 N  N   . ILE C 1 59 ? -31.965 -89.222  25.072  1.00 32.23  ? 184 ILE C N   1 
ATOM   1843 C  CA  . ILE C 1 59 ? -30.860 -89.231  26.049  1.00 31.15  ? 184 ILE C CA  1 
ATOM   1844 C  C   . ILE C 1 59 ? -29.433 -89.286  25.439  1.00 39.84  ? 184 ILE C C   1 
ATOM   1845 O  O   . ILE C 1 59 ? -28.662 -88.338  25.626  1.00 41.40  ? 184 ILE C O   1 
ATOM   1846 C  CB  . ILE C 1 59 ? -31.035 -90.342  27.112  1.00 32.48  ? 184 ILE C CB  1 
ATOM   1847 C  CG1 . ILE C 1 59 ? -32.496 -90.494  27.614  1.00 32.72  ? 184 ILE C CG1 1 
ATOM   1848 C  CG2 . ILE C 1 59 ? -30.001 -90.210  28.239  1.00 31.70  ? 184 ILE C CG2 1 
ATOM   1849 C  CD1 . ILE C 1 59 ? -33.072 -89.374  28.479  1.00 38.99  ? 184 ILE C CD1 1 
ATOM   1850 N  N   . VAL C 1 60 ? -29.067 -90.423  24.783  1.00 36.34  ? 185 VAL C N   1 
ATOM   1851 C  CA  . VAL C 1 60 ? -27.730 -90.699  24.245  1.00 35.92  ? 185 VAL C CA  1 
ATOM   1852 C  C   . VAL C 1 60 ? -27.087 -89.575  23.409  1.00 39.82  ? 185 VAL C C   1 
ATOM   1853 O  O   . VAL C 1 60 ? -25.969 -89.161  23.734  1.00 38.64  ? 185 VAL C O   1 
ATOM   1854 C  CB  . VAL C 1 60 ? -27.584 -92.133  23.661  1.00 40.13  ? 185 VAL C CB  1 
ATOM   1855 C  CG1 . VAL C 1 60 ? -26.150 -92.422  23.235  1.00 40.24  ? 185 VAL C CG1 1 
ATOM   1856 C  CG2 . VAL C 1 60 ? -28.022 -93.166  24.691  1.00 39.66  ? 185 VAL C CG2 1 
ATOM   1857 N  N   . ARG C 1 61 ? -27.788 -89.060  22.369  1.00 37.16  ? 186 ARG C N   1 
ATOM   1858 C  CA  . ARG C 1 61 ? -27.237 -87.975  21.544  1.00 37.48  ? 186 ARG C CA  1 
ATOM   1859 C  C   . ARG C 1 61 ? -26.945 -86.716  22.388  1.00 41.70  ? 186 ARG C C   1 
ATOM   1860 O  O   . ARG C 1 61 ? -25.769 -86.343  22.406  1.00 42.52  ? 186 ARG C O   1 
ATOM   1861 C  CB  . ARG C 1 61 ? -28.057 -87.684  20.274  1.00 37.55  ? 186 ARG C CB  1 
ATOM   1862 C  CG  . ARG C 1 61 ? -28.030 -88.805  19.225  1.00 42.64  ? 186 ARG C CG  1 
ATOM   1863 C  CD  . ARG C 1 61 ? -28.563 -88.313  17.886  1.00 44.73  ? 186 ARG C CD  1 
ATOM   1864 N  NE  . ARG C 1 61 ? -28.739 -89.397  16.915  1.00 46.99  ? 186 ARG C NE  1 
ATOM   1865 C  CZ  . ARG C 1 61 ? -27.934 -89.617  15.878  1.00 54.01  ? 186 ARG C CZ  1 
ATOM   1866 N  NH1 . ARG C 1 61 ? -26.879 -88.838  15.670  1.00 37.94  ? 186 ARG C NH1 1 
ATOM   1867 N  NH2 . ARG C 1 61 ? -28.173 -90.623  15.046  1.00 33.86  ? 186 ARG C NH2 1 
ATOM   1868 N  N   . PRO C 1 62 ? -27.898 -86.155  23.219  1.00 36.60  ? 187 PRO C N   1 
ATOM   1869 C  CA  . PRO C 1 62 ? -27.542 -84.997  24.076  1.00 35.41  ? 187 PRO C CA  1 
ATOM   1870 C  C   . PRO C 1 62 ? -26.313 -85.205  24.980  1.00 35.87  ? 187 PRO C C   1 
ATOM   1871 O  O   . PRO C 1 62 ? -25.503 -84.274  25.131  1.00 34.93  ? 187 PRO C O   1 
ATOM   1872 C  CB  . PRO C 1 62 ? -28.814 -84.753  24.894  1.00 36.68  ? 187 PRO C CB  1 
ATOM   1873 C  CG  . PRO C 1 62 ? -29.901 -85.287  24.071  1.00 41.27  ? 187 PRO C CG  1 
ATOM   1874 C  CD  . PRO C 1 62 ? -29.339 -86.476  23.353  1.00 36.99  ? 187 PRO C CD  1 
ATOM   1875 N  N   . VAL C 1 63 ? -26.153 -86.436  25.538  1.00 30.40  ? 188 VAL C N   1 
ATOM   1876 C  CA  . VAL C 1 63 ? -25.019 -86.827  26.402  1.00 29.35  ? 188 VAL C CA  1 
ATOM   1877 C  C   . VAL C 1 63 ? -23.709 -86.873  25.590  1.00 35.96  ? 188 VAL C C   1 
ATOM   1878 O  O   . VAL C 1 63 ? -22.673 -86.408  26.081  1.00 36.31  ? 188 VAL C O   1 
ATOM   1879 C  CB  . VAL C 1 63 ? -25.286 -88.144  27.178  1.00 31.19  ? 188 VAL C CB  1 
ATOM   1880 C  CG1 . VAL C 1 63 ? -24.064 -88.600  27.956  1.00 30.68  ? 188 VAL C CG1 1 
ATOM   1881 C  CG2 . VAL C 1 63 ? -26.474 -88.007  28.106  1.00 30.46  ? 188 VAL C CG2 1 
ATOM   1882 N  N   . MET C 1 64 ? -23.768 -87.390  24.333  1.00 33.26  ? 189 MET C N   1 
ATOM   1883 C  CA  . MET C 1 64 ? -22.598 -87.462  23.447  1.00 33.65  ? 189 MET C CA  1 
ATOM   1884 C  C   . MET C 1 64 ? -22.041 -86.091  23.049  1.00 38.84  ? 189 MET C C   1 
ATOM   1885 O  O   . MET C 1 64 ? -20.833 -85.977  22.819  1.00 38.14  ? 189 MET C O   1 
ATOM   1886 C  CB  . MET C 1 64 ? -22.852 -88.332  22.223  1.00 36.10  ? 189 MET C CB  1 
ATOM   1887 C  CG  . MET C 1 64 ? -22.758 -89.803  22.508  1.00 38.40  ? 189 MET C CG  1 
ATOM   1888 S  SD  . MET C 1 64 ? -22.615 -90.751  20.985  1.00 43.94  ? 189 MET C SD  1 
ATOM   1889 C  CE  . MET C 1 64 ? -24.086 -90.173  20.085  1.00 40.90  ? 189 MET C CE  1 
ATOM   1890 N  N   . ASN C 1 65 ? -22.916 -85.048  23.008  1.00 35.90  ? 190 ASN C N   1 
ATOM   1891 C  CA  . ASN C 1 65 ? -22.538 -83.656  22.707  1.00 36.64  ? 190 ASN C CA  1 
ATOM   1892 C  C   . ASN C 1 65 ? -21.579 -83.085  23.765  1.00 39.92  ? 190 ASN C C   1 
ATOM   1893 O  O   . ASN C 1 65 ? -20.849 -82.135  23.486  1.00 42.32  ? 190 ASN C O   1 
ATOM   1894 C  CB  . ASN C 1 65 ? -23.777 -82.772  22.540  1.00 35.02  ? 190 ASN C CB  1 
ATOM   1895 C  CG  . ASN C 1 65 ? -24.650 -83.174  21.364  1.00 72.87  ? 190 ASN C CG  1 
ATOM   1896 O  OD1 . ASN C 1 65 ? -24.166 -83.544  20.287  1.00 73.63  ? 190 ASN C OD1 1 
ATOM   1897 N  ND2 . ASN C 1 65 ? -25.964 -83.100  21.531  1.00 68.47  ? 190 ASN C ND2 1 
ATOM   1898 N  N   . VAL C 1 66 ? -21.560 -83.700  24.958  1.00 32.48  ? 191 VAL C N   1 
ATOM   1899 C  CA  . VAL C 1 66 ? -20.700 -83.345  26.078  1.00 31.37  ? 191 VAL C CA  1 
ATOM   1900 C  C   . VAL C 1 66 ? -19.626 -84.450  26.211  1.00 34.13  ? 191 VAL C C   1 
ATOM   1901 O  O   . VAL C 1 66 ? -18.431 -84.137  26.257  1.00 33.07  ? 191 VAL C O   1 
ATOM   1902 C  CB  . VAL C 1 66 ? -21.527 -83.153  27.387  1.00 33.95  ? 191 VAL C CB  1 
ATOM   1903 C  CG1 . VAL C 1 66 ? -20.629 -82.797  28.574  1.00 33.39  ? 191 VAL C CG1 1 
ATOM   1904 C  CG2 . VAL C 1 66 ? -22.614 -82.092  27.197  1.00 34.56  ? 191 VAL C CG2 1 
ATOM   1905 N  N   . HIS C 1 67 ? -20.069 -85.735  26.260  1.00 30.42  ? 192 HIS C N   1 
ATOM   1906 C  CA  . HIS C 1 67 ? -19.219 -86.924  26.383  1.00 30.57  ? 192 HIS C CA  1 
ATOM   1907 C  C   . HIS C 1 67 ? -19.205 -87.657  25.039  1.00 39.49  ? 192 HIS C C   1 
ATOM   1908 O  O   . HIS C 1 67 ? -20.090 -88.464  24.789  1.00 41.15  ? 192 HIS C O   1 
ATOM   1909 C  CB  . HIS C 1 67 ? -19.722 -87.854  27.505  1.00 29.93  ? 192 HIS C CB  1 
ATOM   1910 C  CG  . HIS C 1 67 ? -19.989 -87.147  28.803  1.00 32.88  ? 192 HIS C CG  1 
ATOM   1911 N  ND1 . HIS C 1 67 ? -18.962 -86.738  29.625  1.00 34.65  ? 192 HIS C ND1 1 
ATOM   1912 C  CD2 . HIS C 1 67 ? -21.164 -86.777  29.362  1.00 34.01  ? 192 HIS C CD2 1 
ATOM   1913 C  CE1 . HIS C 1 67 ? -19.538 -86.137  30.651  1.00 33.75  ? 192 HIS C CE1 1 
ATOM   1914 N  NE2 . HIS C 1 67 ? -20.859 -86.155  30.547  1.00 33.80  ? 192 HIS C NE2 1 
ATOM   1915 N  N   . PRO C 1 68 ? -18.232 -87.383  24.144  1.00 37.22  ? 193 PRO C N   1 
ATOM   1916 C  CA  . PRO C 1 68 ? -18.242 -88.022  22.818  1.00 37.55  ? 193 PRO C CA  1 
ATOM   1917 C  C   . PRO C 1 68 ? -18.269 -89.546  22.780  1.00 42.98  ? 193 PRO C C   1 
ATOM   1918 O  O   . PRO C 1 68 ? -18.954 -90.134  21.947  1.00 43.18  ? 193 PRO C O   1 
ATOM   1919 C  CB  . PRO C 1 68 ? -16.978 -87.457  22.163  1.00 40.64  ? 193 PRO C CB  1 
ATOM   1920 C  CG  . PRO C 1 68 ? -16.754 -86.137  22.841  1.00 44.82  ? 193 PRO C CG  1 
ATOM   1921 C  CD  . PRO C 1 68 ? -17.105 -86.432  24.262  1.00 39.58  ? 193 PRO C CD  1 
ATOM   1922 N  N   . ASN C 1 69 ? -17.531 -90.180  23.679  1.00 42.13  ? 194 ASN C N   1 
ATOM   1923 C  CA  . ASN C 1 69 ? -17.432 -91.633  23.742  1.00 43.34  ? 194 ASN C CA  1 
ATOM   1924 C  C   . ASN C 1 69 ? -18.587 -92.299  24.486  1.00 48.10  ? 194 ASN C C   1 
ATOM   1925 O  O   . ASN C 1 69 ? -18.562 -93.524  24.603  1.00 49.54  ? 194 ASN C O   1 
ATOM   1926 C  CB  . ASN C 1 69 ? -16.072 -92.062  24.324  1.00 46.61  ? 194 ASN C CB  1 
ATOM   1927 C  CG  . ASN C 1 69 ? -14.871 -91.652  23.485  1.00 85.39  ? 194 ASN C CG  1 
ATOM   1928 O  OD1 . ASN C 1 69 ? -14.726 -92.027  22.312  1.00 79.68  ? 194 ASN C OD1 1 
ATOM   1929 N  ND2 . ASN C 1 69 ? -13.953 -90.903  24.086  1.00 84.11  ? 194 ASN C ND2 1 
ATOM   1930 N  N   . ALA C 1 70 ? -19.611 -91.526  24.954  1.00 42.95  ? 195 ALA C N   1 
ATOM   1931 C  CA  . ALA C 1 70 ? -20.760 -92.052  25.717  1.00 41.64  ? 195 ALA C CA  1 
ATOM   1932 C  C   . ALA C 1 70 ? -21.437 -93.298  25.122  1.00 45.69  ? 195 ALA C C   1 
ATOM   1933 O  O   . ALA C 1 70 ? -22.018 -94.085  25.874  1.00 46.63  ? 195 ALA C O   1 
ATOM   1934 C  CB  . ALA C 1 70 ? -21.786 -90.959  25.988  1.00 41.54  ? 195 ALA C CB  1 
ATOM   1935 N  N   . TRP C 1 71 ? -21.310 -93.499  23.797  1.00 41.03  ? 196 TRP C N   1 
ATOM   1936 C  CA  . TRP C 1 71 ? -21.884 -94.625  23.063  1.00 41.61  ? 196 TRP C CA  1 
ATOM   1937 C  C   . TRP C 1 71 ? -21.275 -95.982  23.442  1.00 44.84  ? 196 TRP C C   1 
ATOM   1938 O  O   . TRP C 1 71 ? -21.913 -97.019  23.256  1.00 44.88  ? 196 TRP C O   1 
ATOM   1939 C  CB  . TRP C 1 71 ? -21.778 -94.379  21.549  1.00 42.13  ? 196 TRP C CB  1 
ATOM   1940 C  CG  . TRP C 1 71 ? -20.372 -94.372  21.041  1.00 44.28  ? 196 TRP C CG  1 
ATOM   1941 C  CD1 . TRP C 1 71 ? -19.533 -93.299  20.942  1.00 47.07  ? 196 TRP C CD1 1 
ATOM   1942 C  CD2 . TRP C 1 71 ? -19.619 -95.512  20.630  1.00 45.88  ? 196 TRP C CD2 1 
ATOM   1943 N  NE1 . TRP C 1 71 ? -18.309 -93.699  20.463  1.00 47.68  ? 196 TRP C NE1 1 
ATOM   1944 C  CE2 . TRP C 1 71 ? -18.326 -95.057  20.280  1.00 50.51  ? 196 TRP C CE2 1 
ATOM   1945 C  CE3 . TRP C 1 71 ? -19.913 -96.887  20.523  1.00 48.38  ? 196 TRP C CE3 1 
ATOM   1946 C  CZ2 . TRP C 1 71 ? -17.333 -95.923  19.806  1.00 51.82  ? 196 TRP C CZ2 1 
ATOM   1947 C  CZ3 . TRP C 1 71 ? -18.921 -97.747  20.071  1.00 51.85  ? 196 TRP C CZ3 1 
ATOM   1948 C  CH2 . TRP C 1 71 ? -17.656 -97.264  19.700  1.00 53.26  ? 196 TRP C CH2 1 
ATOM   1949 N  N   . VAL C 1 72 ? -20.029 -95.976  23.939  1.00 41.42  ? 197 VAL C N   1 
ATOM   1950 C  CA  . VAL C 1 72 ? -19.324 -97.191  24.363  1.00 42.12  ? 197 VAL C CA  1 
ATOM   1951 C  C   . VAL C 1 72 ? -19.965 -97.757  25.645  1.00 44.98  ? 197 VAL C C   1 
ATOM   1952 O  O   . VAL C 1 72 ? -19.824 -98.944  25.928  1.00 45.36  ? 197 VAL C O   1 
ATOM   1953 C  CB  . VAL C 1 72 ? -17.768 -97.019  24.432  1.00 46.32  ? 197 VAL C CB  1 
ATOM   1954 C  CG1 . VAL C 1 72 ? -17.315 -96.352  25.728  1.00 45.34  ? 197 VAL C CG1 1 
ATOM   1955 C  CG2 . VAL C 1 72 ? -17.056 -98.346  24.248  1.00 47.69  ? 197 VAL C CG2 1 
ATOM   1956 N  N   . PHE C 1 73 ? -20.669 -96.899  26.406  1.00 40.29  ? 198 PHE C N   1 
ATOM   1957 C  CA  . PHE C 1 73 ? -21.367 -97.294  27.621  1.00 39.77  ? 198 PHE C CA  1 
ATOM   1958 C  C   . PHE C 1 73 ? -22.743 -97.814  27.228  1.00 41.31  ? 198 PHE C C   1 
ATOM   1959 O  O   . PHE C 1 73 ? -23.061 -98.983  27.473  1.00 41.77  ? 198 PHE C O   1 
ATOM   1960 C  CB  . PHE C 1 73 ? -21.488 -96.092  28.594  1.00 41.27  ? 198 PHE C CB  1 
ATOM   1961 C  CG  . PHE C 1 73 ? -22.343 -96.301  29.835  1.00 43.73  ? 198 PHE C CG  1 
ATOM   1962 C  CD1 . PHE C 1 73 ? -23.704 -96.033  29.817  1.00 46.57  ? 198 PHE C CD1 1 
ATOM   1963 C  CD2 . PHE C 1 73 ? -21.771 -96.697  31.038  1.00 48.33  ? 198 PHE C CD2 1 
ATOM   1964 C  CE1 . PHE C 1 73 ? -24.487 -96.228  30.956  1.00 47.92  ? 198 PHE C CE1 1 
ATOM   1965 C  CE2 . PHE C 1 73 ? -22.552 -96.858  32.188  1.00 50.96  ? 198 PHE C CE2 1 
ATOM   1966 C  CZ  . PHE C 1 73 ? -23.904 -96.636  32.134  1.00 48.45  ? 198 PHE C CZ  1 
ATOM   1967 N  N   . PHE C 1 74 ? -23.552 -96.926  26.620  1.00 35.33  ? 199 PHE C N   1 
ATOM   1968 C  CA  . PHE C 1 74 ? -24.937 -97.169  26.268  1.00 34.87  ? 199 PHE C CA  1 
ATOM   1969 C  C   . PHE C 1 74 ? -25.245 -98.238  25.218  1.00 39.61  ? 199 PHE C C   1 
ATOM   1970 O  O   . PHE C 1 74 ? -26.194 -98.992  25.432  1.00 39.84  ? 199 PHE C O   1 
ATOM   1971 C  CB  . PHE C 1 74 ? -25.659 -95.859  25.983  1.00 35.97  ? 199 PHE C CB  1 
ATOM   1972 C  CG  . PHE C 1 74 ? -25.796 -94.939  27.173  1.00 36.41  ? 199 PHE C CG  1 
ATOM   1973 C  CD1 . PHE C 1 74 ? -26.776 -95.162  28.139  1.00 39.18  ? 199 PHE C CD1 1 
ATOM   1974 C  CD2 . PHE C 1 74 ? -24.996 -93.809  27.294  1.00 37.45  ? 199 PHE C CD2 1 
ATOM   1975 C  CE1 . PHE C 1 74 ? -26.923 -94.292  29.232  1.00 39.10  ? 199 PHE C CE1 1 
ATOM   1976 C  CE2 . PHE C 1 74 ? -25.157 -92.931  28.373  1.00 39.88  ? 199 PHE C CE2 1 
ATOM   1977 C  CZ  . PHE C 1 74 ? -26.117 -93.181  29.339  1.00 37.55  ? 199 PHE C CZ  1 
ATOM   1978 N  N   . ILE C 1 75 ? -24.499 -98.302  24.089  1.00 35.68  ? 200 ILE C N   1 
ATOM   1979 C  CA  . ILE C 1 75 ? -24.761 -99.331  23.067  1.00 37.09  ? 200 ILE C CA  1 
ATOM   1980 C  C   . ILE C 1 75 ? -24.596 -100.756 23.640  1.00 42.69  ? 200 ILE C C   1 
ATOM   1981 O  O   . ILE C 1 75 ? -25.568 -101.516 23.548  1.00 43.58  ? 200 ILE C O   1 
ATOM   1982 C  CB  . ILE C 1 75 ? -24.124 -99.078  21.663  1.00 41.07  ? 200 ILE C CB  1 
ATOM   1983 C  CG1 . ILE C 1 75 ? -24.818 -97.881  20.970  1.00 40.44  ? 200 ILE C CG1 1 
ATOM   1984 C  CG2 . ILE C 1 75 ? -24.176 -100.340 20.763  1.00 43.16  ? 200 ILE C CG2 1 
ATOM   1985 C  CD1 . ILE C 1 75 ? -24.002 -97.165  19.951  1.00 47.73  ? 200 ILE C CD1 1 
ATOM   1986 N  N   . PRO C 1 76 ? -23.488 -101.086 24.365  1.00 38.62  ? 201 PRO C N   1 
ATOM   1987 C  CA  . PRO C 1 76 ? -23.386 -102.415 24.997  1.00 39.64  ? 201 PRO C CA  1 
ATOM   1988 C  C   . PRO C 1 76 ? -24.498 -102.708 26.009  1.00 43.22  ? 201 PRO C C   1 
ATOM   1989 O  O   . PRO C 1 76 ? -25.008 -103.832 26.002  1.00 43.90  ? 201 PRO C O   1 
ATOM   1990 C  CB  . PRO C 1 76 ? -22.002 -102.384 25.659  1.00 41.46  ? 201 PRO C CB  1 
ATOM   1991 C  CG  . PRO C 1 76 ? -21.239 -101.412 24.863  1.00 45.43  ? 201 PRO C CG  1 
ATOM   1992 C  CD  . PRO C 1 76 ? -22.242 -100.328 24.581  1.00 39.63  ? 201 PRO C CD  1 
ATOM   1993 N  N   . PHE C 1 77 ? -24.907 -101.696 26.838  1.00 38.27  ? 202 PHE C N   1 
ATOM   1994 C  CA  . PHE C 1 77 ? -26.000 -101.816 27.824  1.00 37.69  ? 202 PHE C CA  1 
ATOM   1995 C  C   . PHE C 1 77 ? -27.278 -102.287 27.139  1.00 45.18  ? 202 PHE C C   1 
ATOM   1996 O  O   . PHE C 1 77 ? -27.938 -103.180 27.664  1.00 46.83  ? 202 PHE C O   1 
ATOM   1997 C  CB  . PHE C 1 77 ? -26.256 -100.484 28.574  1.00 37.09  ? 202 PHE C CB  1 
ATOM   1998 C  CG  . PHE C 1 77 ? -27.386 -100.526 29.588  1.00 38.04  ? 202 PHE C CG  1 
ATOM   1999 C  CD1 . PHE C 1 77 ? -28.658 -100.065 29.261  1.00 40.07  ? 202 PHE C CD1 1 
ATOM   2000 C  CD2 . PHE C 1 77 ? -27.174 -101.011 30.875  1.00 40.66  ? 202 PHE C CD2 1 
ATOM   2001 C  CE1 . PHE C 1 77 ? -29.708 -100.125 30.190  1.00 40.54  ? 202 PHE C CE1 1 
ATOM   2002 C  CE2 . PHE C 1 77 ? -28.223 -101.064 31.804  1.00 43.35  ? 202 PHE C CE2 1 
ATOM   2003 C  CZ  . PHE C 1 77 ? -29.486 -100.624 31.453  1.00 40.31  ? 202 PHE C CZ  1 
ATOM   2004 N  N   . ILE C 1 78 ? -27.619 -101.681 25.973  1.00 42.33  ? 203 ILE C N   1 
ATOM   2005 C  CA  . ILE C 1 78 ? -28.787 -102.025 25.158  1.00 43.92  ? 203 ILE C CA  1 
ATOM   2006 C  C   . ILE C 1 78 ? -28.620 -103.458 24.650  1.00 55.47  ? 203 ILE C C   1 
ATOM   2007 O  O   . ILE C 1 78 ? -29.499 -104.280 24.886  1.00 57.24  ? 203 ILE C O   1 
ATOM   2008 C  CB  . ILE C 1 78 ? -29.056 -100.997 23.996  1.00 45.49  ? 203 ILE C CB  1 
ATOM   2009 C  CG1 . ILE C 1 78 ? -29.639 -99.683  24.539  1.00 43.02  ? 203 ILE C CG1 1 
ATOM   2010 C  CG2 . ILE C 1 78 ? -29.956 -101.577 22.882  1.00 46.05  ? 203 ILE C CG2 1 
ATOM   2011 C  CD1 . ILE C 1 78 ? -29.314 -98.496  23.733  1.00 40.33  ? 203 ILE C CD1 1 
ATOM   2012 N  N   . MET C 1 79 ? -27.482 -103.760 23.996  1.00 55.88  ? 204 MET C N   1 
ATOM   2013 C  CA  . MET C 1 79 ? -27.178 -105.079 23.446  1.00 59.69  ? 204 MET C CA  1 
ATOM   2014 C  C   . MET C 1 79 ? -27.274 -106.162 24.518  1.00 65.29  ? 204 MET C C   1 
ATOM   2015 O  O   . MET C 1 79 ? -27.866 -107.213 24.264  1.00 66.56  ? 204 MET C O   1 
ATOM   2016 C  CB  . MET C 1 79 ? -25.803 -105.068 22.754  1.00 63.68  ? 204 MET C CB  1 
ATOM   2017 C  CG  . MET C 1 79 ? -25.691 -103.986 21.678  1.00 67.80  ? 204 MET C CG  1 
ATOM   2018 S  SD  . MET C 1 79 ? -24.270 -104.028 20.540  1.00 75.01  ? 204 MET C SD  1 
ATOM   2019 C  CE  . MET C 1 79 ? -22.873 -103.855 21.686  1.00 70.73  ? 204 MET C CE  1 
ATOM   2020 N  N   . LEU C 1 80 ? -26.773 -105.857 25.737  1.00 61.80  ? 205 LEU C N   1 
ATOM   2021 C  CA  . LEU C 1 80 ? -26.773 -106.743 26.899  1.00 63.37  ? 205 LEU C CA  1 
ATOM   2022 C  C   . LEU C 1 80 ? -28.158 -106.975 27.482  1.00 69.04  ? 205 LEU C C   1 
ATOM   2023 O  O   . LEU C 1 80 ? -28.552 -108.131 27.623  1.00 70.96  ? 205 LEU C O   1 
ATOM   2024 C  CB  . LEU C 1 80 ? -25.821 -106.216 27.987  1.00 62.57  ? 205 LEU C CB  1 
ATOM   2025 C  CG  . LEU C 1 80 ? -25.795 -106.974 29.324  1.00 69.35  ? 205 LEU C CG  1 
ATOM   2026 C  CD1 . LEU C 1 80 ? -25.066 -108.314 29.205  1.00 72.71  ? 205 LEU C CD1 1 
ATOM   2027 C  CD2 . LEU C 1 80 ? -25.131 -106.145 30.393  1.00 71.61  ? 205 LEU C CD2 1 
ATOM   2028 N  N   . THR C 1 81 ? -28.871 -105.892 27.869  1.00 64.65  ? 206 THR C N   1 
ATOM   2029 C  CA  . THR C 1 81 ? -30.199 -105.972 28.492  1.00 64.57  ? 206 THR C CA  1 
ATOM   2030 C  C   . THR C 1 81 ? -31.242 -106.586 27.580  1.00 70.57  ? 206 THR C C   1 
ATOM   2031 O  O   . THR C 1 81 ? -31.925 -107.519 28.002  1.00 72.21  ? 206 THR C O   1 
ATOM   2032 C  CB  . THR C 1 81 ? -30.650 -104.635 29.081  1.00 71.19  ? 206 THR C CB  1 
ATOM   2033 O  OG1 . THR C 1 81 ? -30.729 -103.667 28.037  1.00 71.42  ? 206 THR C OG1 1 
ATOM   2034 C  CG2 . THR C 1 81 ? -29.755 -104.152 30.227  1.00 68.77  ? 206 THR C CG2 1 
ATOM   2035 N  N   . THR C 1 82 ? -31.334 -106.121 26.317  1.00 67.38  ? 207 THR C N   1 
ATOM   2036 C  CA  . THR C 1 82 ? -32.293 -106.668 25.344  1.00 69.06  ? 207 THR C CA  1 
ATOM   2037 C  C   . THR C 1 82 ? -31.869 -108.072 24.853  1.00 77.96  ? 207 THR C C   1 
ATOM   2038 O  O   . THR C 1 82 ? -32.021 -108.415 23.680  1.00 78.84  ? 207 THR C O   1 
ATOM   2039 C  CB  . THR C 1 82 ? -32.710 -105.633 24.270  1.00 74.80  ? 207 THR C CB  1 
ATOM   2040 O  OG1 . THR C 1 82 ? -31.677 -105.477 23.300  1.00 73.66  ? 207 THR C OG1 1 
ATOM   2041 C  CG2 . THR C 1 82 ? -33.113 -104.275 24.866  1.00 71.55  ? 207 THR C CG2 1 
ATOM   2042 N  N   . PHE C 1 83 ? -31.334 -108.870 25.794  1.00 77.46  ? 208 PHE C N   1 
ATOM   2043 C  CA  . PHE C 1 83 ? -30.867 -110.241 25.655  1.00 81.19  ? 208 PHE C CA  1 
ATOM   2044 C  C   . PHE C 1 83 ? -31.021 -110.905 27.019  1.00 88.48  ? 208 PHE C C   1 
ATOM   2045 O  O   . PHE C 1 83 ? -31.530 -112.022 27.090  1.00 90.93  ? 208 PHE C O   1 
ATOM   2046 C  CB  . PHE C 1 83 ? -29.394 -110.290 25.197  1.00 83.56  ? 208 PHE C CB  1 
ATOM   2047 C  CG  . PHE C 1 83 ? -28.848 -111.691 25.022  1.00 88.58  ? 208 PHE C CG  1 
ATOM   2048 C  CD1 . PHE C 1 83 ? -28.293 -112.381 26.095  1.00 92.43  ? 208 PHE C CD1 1 
ATOM   2049 C  CD2 . PHE C 1 83 ? -28.898 -112.325 23.787  1.00 93.11  ? 208 PHE C CD2 1 
ATOM   2050 C  CE1 . PHE C 1 83 ? -27.810 -113.682 25.935  1.00 96.69  ? 208 PHE C CE1 1 
ATOM   2051 C  CE2 . PHE C 1 83 ? -28.404 -113.623 23.627  1.00 99.21  ? 208 PHE C CE2 1 
ATOM   2052 C  CZ  . PHE C 1 83 ? -27.868 -114.294 24.704  1.00 98.26  ? 208 PHE C CZ  1 
ATOM   2053 N  N   . THR C 1 84 ? -30.551 -110.229 28.095  1.00 85.27  ? 209 THR C N   1 
ATOM   2054 C  CA  . THR C 1 84 ? -30.616 -110.713 29.480  1.00 87.21  ? 209 THR C CA  1 
ATOM   2055 C  C   . THR C 1 84 ? -32.078 -110.857 29.911  1.00 94.60  ? 209 THR C C   1 
ATOM   2056 O  O   . THR C 1 84 ? -32.416 -111.840 30.569  1.00 96.81  ? 209 THR C O   1 
ATOM   2057 C  CB  . THR C 1 84 ? -29.791 -109.818 30.439  1.00 94.32  ? 209 THR C CB  1 
ATOM   2058 O  OG1 . THR C 1 84 ? -28.531 -109.499 29.846  1.00 94.38  ? 209 THR C OG1 1 
ATOM   2059 C  CG2 . THR C 1 84 ? -29.553 -110.472 31.809  1.00 93.88  ? 209 THR C CG2 1 
ATOM   2060 N  N   . VAL C 1 85 ? -32.940 -109.896 29.516  1.00 91.27  ? 210 VAL C N   1 
ATOM   2061 C  CA  . VAL C 1 85 ? -34.379 -109.922 29.819  1.00 92.21  ? 210 VAL C CA  1 
ATOM   2062 C  C   . VAL C 1 85 ? -35.084 -110.866 28.827  1.00 100.16 ? 210 VAL C C   1 
ATOM   2063 O  O   . VAL C 1 85 ? -36.065 -111.520 29.197  1.00 101.52 ? 210 VAL C O   1 
ATOM   2064 C  CB  . VAL C 1 85 ? -35.039 -108.508 29.855  1.00 93.42  ? 210 VAL C CB  1 
ATOM   2065 C  CG1 . VAL C 1 85 ? -36.385 -108.547 30.575  1.00 93.55  ? 210 VAL C CG1 1 
ATOM   2066 C  CG2 . VAL C 1 85 ? -34.127 -107.478 30.516  1.00 91.08  ? 210 VAL C CG2 1 
ATOM   2067 N  N   . LEU C 1 86 ? -34.555 -110.960 27.584  1.00 98.16  ? 211 LEU C N   1 
ATOM   2068 C  CA  . LEU C 1 86 ? -35.094 -111.829 26.531  1.00 101.12 ? 211 LEU C CA  1 
ATOM   2069 C  C   . LEU C 1 86 ? -34.912 -113.317 26.850  1.00 110.30 ? 211 LEU C C   1 
ATOM   2070 O  O   . LEU C 1 86 ? -35.658 -114.156 26.346  1.00 112.00 ? 211 LEU C O   1 
ATOM   2071 C  CB  . LEU C 1 86 ? -34.471 -111.488 25.178  1.00 100.94 ? 211 LEU C CB  1 
ATOM   2072 C  CG  . LEU C 1 86 ? -35.433 -111.493 24.009  1.00 106.43 ? 211 LEU C CG  1 
ATOM   2073 C  CD1 . LEU C 1 86 ? -36.139 -110.153 23.880  1.00 103.86 ? 211 LEU C CD1 1 
ATOM   2074 C  CD2 . LEU C 1 86 ? -34.709 -111.821 22.721  1.00 110.78 ? 211 LEU C CD2 1 
ATOM   2075 N  N   . ASN C 1 87 ? -33.923 -113.633 27.692  1.00 109.38 ? 212 ASN C N   1 
ATOM   2076 C  CA  . ASN C 1 87 ? -33.645 -114.987 28.150  1.00 113.77 ? 212 ASN C CA  1 
ATOM   2077 C  C   . ASN C 1 87 ? -34.421 -115.267 29.436  1.00 120.23 ? 212 ASN C C   1 
ATOM   2078 O  O   . ASN C 1 87 ? -34.958 -116.365 29.593  1.00 123.04 ? 212 ASN C O   1 
ATOM   2079 C  CB  . ASN C 1 87 ? -32.142 -115.186 28.364  1.00 116.21 ? 212 ASN C CB  1 
ATOM   2080 C  CG  . ASN C 1 87 ? -31.384 -115.620 27.131  1.00 145.99 ? 212 ASN C CG  1 
ATOM   2081 O  OD1 . ASN C 1 87 ? -31.954 -115.932 26.075  1.00 141.57 ? 212 ASN C OD1 1 
ATOM   2082 N  ND2 . ASN C 1 87 ? -30.070 -115.688 27.256  1.00 140.52 ? 212 ASN C ND2 1 
ATOM   2083 N  N   . LEU C 1 88 ? -34.486 -114.262 30.347  1.00 115.42 ? 213 LEU C N   1 
ATOM   2084 C  CA  . LEU C 1 88 ? -35.191 -114.315 31.632  1.00 116.14 ? 213 LEU C CA  1 
ATOM   2085 C  C   . LEU C 1 88 ? -36.685 -114.568 31.434  1.00 122.54 ? 213 LEU C C   1 
ATOM   2086 O  O   . LEU C 1 88 ? -37.220 -115.501 32.036  1.00 125.32 ? 213 LEU C O   1 
ATOM   2087 C  CB  . LEU C 1 88 ? -34.964 -113.013 32.438  1.00 112.97 ? 213 LEU C CB  1 
ATOM   2088 C  CG  . LEU C 1 88 ? -35.816 -112.797 33.705  1.00 117.59 ? 213 LEU C CG  1 
ATOM   2089 C  CD1 . LEU C 1 88 ? -35.275 -113.591 34.885  1.00 120.09 ? 213 LEU C CD1 1 
ATOM   2090 C  CD2 . LEU C 1 88 ? -35.900 -111.328 34.062  1.00 116.64 ? 213 LEU C CD2 1 
ATOM   2091 N  N   . PHE C 1 89 ? -37.347 -113.743 30.595  1.00 117.51 ? 214 PHE C N   1 
ATOM   2092 C  CA  . PHE C 1 89 ? -38.774 -113.859 30.310  1.00 118.29 ? 214 PHE C CA  1 
ATOM   2093 C  C   . PHE C 1 89 ? -39.139 -115.162 29.602  1.00 126.63 ? 214 PHE C C   1 
ATOM   2094 O  O   . PHE C 1 89 ? -40.134 -115.786 29.978  1.00 128.33 ? 214 PHE C O   1 
ATOM   2095 C  CB  . PHE C 1 89 ? -39.299 -112.625 29.559  1.00 117.32 ? 214 PHE C CB  1 
ATOM   2096 C  CG  . PHE C 1 89 ? -39.591 -111.405 30.412  1.00 116.15 ? 214 PHE C CG  1 
ATOM   2097 C  CD1 . PHE C 1 89 ? -39.731 -111.514 31.793  1.00 119.60 ? 214 PHE C CD1 1 
ATOM   2098 C  CD2 . PHE C 1 89 ? -39.775 -110.157 29.828  1.00 115.77 ? 214 PHE C CD2 1 
ATOM   2099 C  CE1 . PHE C 1 89 ? -40.017 -110.390 32.575  1.00 118.32 ? 214 PHE C CE1 1 
ATOM   2100 C  CE2 . PHE C 1 89 ? -40.066 -109.035 30.612  1.00 116.39 ? 214 PHE C CE2 1 
ATOM   2101 C  CZ  . PHE C 1 89 ? -40.184 -109.159 31.980  1.00 114.86 ? 214 PHE C CZ  1 
ATOM   2102 N  N   . ILE C 1 90 ? -38.316 -115.595 28.619  1.00 124.99 ? 215 ILE C N   1 
ATOM   2103 C  CA  . ILE C 1 90 ? -38.521 -116.851 27.886  1.00 129.00 ? 215 ILE C CA  1 
ATOM   2104 C  C   . ILE C 1 90 ? -38.310 -118.087 28.796  1.00 136.90 ? 215 ILE C C   1 
ATOM   2105 O  O   . ILE C 1 90 ? -39.010 -119.091 28.637  1.00 139.87 ? 215 ILE C O   1 
ATOM   2106 C  CB  . ILE C 1 90 ? -37.785 -116.868 26.507  1.00 132.57 ? 215 ILE C CB  1 
ATOM   2107 C  CG1 . ILE C 1 90 ? -38.612 -116.074 25.465  1.00 131.39 ? 215 ILE C CG1 1 
ATOM   2108 C  CG2 . ILE C 1 90 ? -37.487 -118.294 25.997  1.00 137.90 ? 215 ILE C CG2 1 
ATOM   2109 C  CD1 . ILE C 1 90 ? -37.864 -115.601 24.215  1.00 138.30 ? 215 ILE C CD1 1 
ATOM   2110 N  N   . GLY C 1 91 ? -37.410 -117.955 29.775  1.00 133.05 ? 216 GLY C N   1 
ATOM   2111 C  CA  . GLY C 1 91 ? -37.116 -118.983 30.771  1.00 136.10 ? 216 GLY C CA  1 
ATOM   2112 C  C   . GLY C 1 91 ? -38.296 -119.287 31.678  1.00 141.37 ? 216 GLY C C   1 
ATOM   2113 O  O   . GLY C 1 91 ? -38.504 -120.446 32.047  1.00 144.54 ? 216 GLY C O   1 
ATOM   2114 N  N   . ILE C 1 92 ? -39.088 -118.241 32.025  1.00 135.33 ? 217 ILE C N   1 
ATOM   2115 C  CA  . ILE C 1 92 ? -40.303 -118.324 32.856  1.00 136.03 ? 217 ILE C CA  1 
ATOM   2116 C  C   . ILE C 1 92 ? -41.380 -119.143 32.115  1.00 143.32 ? 217 ILE C C   1 
ATOM   2117 O  O   . ILE C 1 92 ? -42.062 -119.959 32.739  1.00 145.85 ? 217 ILE C O   1 
ATOM   2118 C  CB  . ILE C 1 92 ? -40.813 -116.900 33.275  1.00 135.01 ? 217 ILE C CB  1 
ATOM   2119 C  CG1 . ILE C 1 92 ? -39.749 -116.137 34.100  1.00 133.06 ? 217 ILE C CG1 1 
ATOM   2120 C  CG2 . ILE C 1 92 ? -42.145 -116.966 34.049  1.00 136.49 ? 217 ILE C CG2 1 
ATOM   2121 C  CD1 . ILE C 1 92 ? -39.863 -114.603 34.063  1.00 135.65 ? 217 ILE C CD1 1 
ATOM   2122 N  N   . ILE C 1 93 ? -41.502 -118.934 30.784  1.00 139.56 ? 218 ILE C N   1 
ATOM   2123 C  CA  . ILE C 1 93 ? -42.451 -119.613 29.889  1.00 142.06 ? 218 ILE C CA  1 
ATOM   2124 C  C   . ILE C 1 93 ? -42.201 -121.141 29.852  1.00 151.62 ? 218 ILE C C   1 
ATOM   2125 O  O   . ILE C 1 93 ? -43.159 -121.918 29.926  1.00 154.25 ? 218 ILE C O   1 
ATOM   2126 C  CB  . ILE C 1 93 ? -42.457 -118.945 28.475  1.00 143.10 ? 218 ILE C CB  1 
ATOM   2127 C  CG1 . ILE C 1 93 ? -42.876 -117.455 28.569  1.00 138.89 ? 218 ILE C CG1 1 
ATOM   2128 C  CG2 . ILE C 1 93 ? -43.355 -119.704 27.476  1.00 147.03 ? 218 ILE C CG2 1 
ATOM   2129 C  CD1 . ILE C 1 93 ? -42.351 -116.550 27.459  1.00 142.23 ? 218 ILE C CD1 1 
ATOM   2130 N  N   . VAL C 1 94 ? -40.920 -121.557 29.773  1.00 149.60 ? 219 VAL C N   1 
ATOM   2131 C  CA  . VAL C 1 94 ? -40.509 -122.968 29.735  1.00 154.46 ? 219 VAL C CA  1 
ATOM   2132 C  C   . VAL C 1 94 ? -40.683 -123.635 31.116  1.00 161.06 ? 219 VAL C C   1 
ATOM   2133 O  O   . VAL C 1 94 ? -41.269 -124.719 31.195  1.00 164.86 ? 219 VAL C O   1 
ATOM   2134 C  CB  . VAL C 1 94 ? -39.070 -123.155 29.163  1.00 158.79 ? 219 VAL C CB  1 
ATOM   2135 C  CG1 . VAL C 1 94 ? -38.727 -124.633 28.982  1.00 164.06 ? 219 VAL C CG1 1 
ATOM   2136 C  CG2 . VAL C 1 94 ? -38.894 -122.408 27.843  1.00 156.27 ? 219 VAL C CG2 1 
ATOM   2137 N  N   . ASP C 1 95 ? -40.180 -122.986 32.190  1.00 155.35 ? 220 ASP C N   1 
ATOM   2138 C  CA  . ASP C 1 95 ? -40.246 -123.494 33.565  1.00 190.66 ? 220 ASP C CA  1 
ATOM   2139 C  C   . ASP C 1 95 ? -41.662 -123.497 34.147  1.00 212.83 ? 220 ASP C C   1 
ATOM   2140 O  O   . ASP C 1 95 ? -42.302 -122.453 34.255  1.00 166.42 ? 220 ASP C O   1 
ATOM   2141 C  CB  . ASP C 1 95 ? -39.268 -122.736 34.481  1.00 189.92 ? 220 ASP C CB  1 
ATOM   2142 C  CG  . ASP C 1 95 ? -37.818 -123.141 34.303  1.00 201.17 ? 220 ASP C CG  1 
ATOM   2143 O  OD1 . ASP C 1 95 ? -37.451 -124.248 34.753  1.00 206.21 ? 220 ASP C OD1 1 
ATOM   2144 O  OD2 . ASP C 1 95 ? -37.042 -122.337 33.745  1.00 203.22 ? 220 ASP C OD2 1 
ATOM   2145 N  N   . GLY D 1 5  ? -22.613 -121.406 11.030  1.00 139.84 ? 130 GLY D N   1 
ATOM   2146 C  CA  . GLY D 1 5  ? -23.747 -121.321 11.940  1.00 139.12 ? 130 GLY D CA  1 
ATOM   2147 C  C   . GLY D 1 5  ? -24.041 -119.903 12.380  1.00 137.98 ? 130 GLY D C   1 
ATOM   2148 O  O   . GLY D 1 5  ? -24.497 -119.089 11.574  1.00 134.69 ? 130 GLY D O   1 
ATOM   2149 N  N   . VAL D 1 6  ? -23.773 -119.601 13.666  1.00 133.76 ? 131 VAL D N   1 
ATOM   2150 C  CA  . VAL D 1 6  ? -23.973 -118.278 14.281  1.00 129.38 ? 131 VAL D CA  1 
ATOM   2151 C  C   . VAL D 1 6  ? -22.877 -117.295 13.810  1.00 129.63 ? 131 VAL D C   1 
ATOM   2152 O  O   . VAL D 1 6  ? -23.185 -116.137 13.513  1.00 125.69 ? 131 VAL D O   1 
ATOM   2153 C  CB  . VAL D 1 6  ? -24.089 -118.359 15.837  1.00 134.06 ? 131 VAL D CB  1 
ATOM   2154 C  CG1 . VAL D 1 6  ? -24.295 -116.980 16.465  1.00 129.86 ? 131 VAL D CG1 1 
ATOM   2155 C  CG2 . VAL D 1 6  ? -25.212 -119.304 16.260  1.00 137.00 ? 131 VAL D CG2 1 
ATOM   2156 N  N   . GLY D 1 7  ? -21.632 -117.780 13.737  1.00 127.26 ? 132 GLY D N   1 
ATOM   2157 C  CA  . GLY D 1 7  ? -20.462 -117.018 13.303  1.00 124.80 ? 132 GLY D CA  1 
ATOM   2158 C  C   . GLY D 1 7  ? -20.591 -116.429 11.911  1.00 125.06 ? 132 GLY D C   1 
ATOM   2159 O  O   . GLY D 1 7  ? -20.243 -115.262 11.700  1.00 121.73 ? 132 GLY D O   1 
ATOM   2160 N  N   . SER D 1 8  ? -21.124 -117.230 10.959  1.00 122.10 ? 133 SER D N   1 
ATOM   2161 C  CA  . SER D 1 8  ? -21.363 -116.832 9.567   1.00 120.02 ? 133 SER D CA  1 
ATOM   2162 C  C   . SER D 1 8  ? -22.419 -115.720 9.476   1.00 118.23 ? 133 SER D C   1 
ATOM   2163 O  O   . SER D 1 8  ? -22.333 -114.855 8.602   1.00 115.47 ? 133 SER D O   1 
ATOM   2164 C  CB  . SER D 1 8  ? -21.790 -118.035 8.730   1.00 127.12 ? 133 SER D CB  1 
ATOM   2165 O  OG  . SER D 1 8  ? -23.048 -118.550 9.136   1.00 137.13 ? 133 SER D OG  1 
ATOM   2166 N  N   . VAL D 1 9  ? -23.403 -115.755 10.394  1.00 112.95 ? 134 VAL D N   1 
ATOM   2167 C  CA  . VAL D 1 9  ? -24.503 -114.796 10.516  1.00 108.99 ? 134 VAL D CA  1 
ATOM   2168 C  C   . VAL D 1 9  ? -23.997 -113.501 11.183  1.00 107.29 ? 134 VAL D C   1 
ATOM   2169 O  O   . VAL D 1 9  ? -24.352 -112.411 10.731  1.00 104.36 ? 134 VAL D O   1 
ATOM   2170 C  CB  . VAL D 1 9  ? -25.714 -115.448 11.252  1.00 114.55 ? 134 VAL D CB  1 
ATOM   2171 C  CG1 . VAL D 1 9  ? -26.783 -114.423 11.631  1.00 111.55 ? 134 VAL D CG1 1 
ATOM   2172 C  CG2 . VAL D 1 9  ? -26.326 -116.570 10.413  1.00 117.53 ? 134 VAL D CG2 1 
ATOM   2173 N  N   . ALA D 1 10 ? -23.160 -113.624 12.238  1.00 102.42 ? 135 ALA D N   1 
ATOM   2174 C  CA  . ALA D 1 10 ? -22.575 -112.490 12.967  1.00 98.84  ? 135 ALA D CA  1 
ATOM   2175 C  C   . ALA D 1 10 ? -21.705 -111.632 12.043  1.00 98.59  ? 135 ALA D C   1 
ATOM   2176 O  O   . ALA D 1 10 ? -21.749 -110.402 12.125  1.00 95.56  ? 135 ALA D O   1 
ATOM   2177 C  CB  . ALA D 1 10 ? -21.755 -112.991 14.146  1.00 101.40 ? 135 ALA D CB  1 
ATOM   2178 N  N   . ALA D 1 11 ? -20.943 -112.289 11.147  1.00 94.69  ? 136 ALA D N   1 
ATOM   2179 C  CA  . ALA D 1 11 ? -20.085 -111.631 10.168  1.00 92.42  ? 136 ALA D CA  1 
ATOM   2180 C  C   . ALA D 1 11 ? -20.940 -110.949 9.105   1.00 91.14  ? 136 ALA D C   1 
ATOM   2181 O  O   . ALA D 1 11 ? -20.649 -109.814 8.736   1.00 88.34  ? 136 ALA D O   1 
ATOM   2182 C  CB  . ALA D 1 11 ? -19.156 -112.648 9.524   1.00 96.35  ? 136 ALA D CB  1 
ATOM   2183 N  N   . LEU D 1 12 ? -22.018 -111.628 8.655   1.00 86.58  ? 137 LEU D N   1 
ATOM   2184 C  CA  . LEU D 1 12 ? -22.973 -111.151 7.652   1.00 84.12  ? 137 LEU D CA  1 
ATOM   2185 C  C   . LEU D 1 12 ? -23.590 -109.812 8.050   1.00 81.46  ? 137 LEU D C   1 
ATOM   2186 O  O   . LEU D 1 12 ? -23.741 -108.945 7.194   1.00 78.94  ? 137 LEU D O   1 
ATOM   2187 C  CB  . LEU D 1 12 ? -24.067 -112.208 7.432   1.00 86.43  ? 137 LEU D CB  1 
ATOM   2188 C  CG  . LEU D 1 12 ? -24.936 -112.057 6.190   1.00 91.08  ? 137 LEU D CG  1 
ATOM   2189 C  CD1 . LEU D 1 12 ? -24.928 -113.333 5.370   1.00 94.75  ? 137 LEU D CD1 1 
ATOM   2190 C  CD2 . LEU D 1 12 ? -26.350 -111.667 6.567   1.00 91.92  ? 137 LEU D CD2 1 
ATOM   2191 N  N   . LEU D 1 13 ? -23.921 -109.641 9.345   1.00 75.86  ? 138 LEU D N   1 
ATOM   2192 C  CA  . LEU D 1 13 ? -24.490 -108.403 9.888   1.00 72.04  ? 138 LEU D CA  1 
ATOM   2193 C  C   . LEU D 1 13 ? -23.451 -107.262 9.928   1.00 72.19  ? 138 LEU D C   1 
ATOM   2194 O  O   . LEU D 1 13 ? -23.822 -106.103 9.733   1.00 69.72  ? 138 LEU D O   1 
ATOM   2195 C  CB  . LEU D 1 13 ? -25.128 -108.646 11.280  1.00 72.06  ? 138 LEU D CB  1 
ATOM   2196 C  CG  . LEU D 1 13 ? -25.878 -107.467 11.942  1.00 73.80  ? 138 LEU D CG  1 
ATOM   2197 C  CD1 . LEU D 1 13 ? -27.215 -107.165 11.245  1.00 72.85  ? 138 LEU D CD1 1 
ATOM   2198 C  CD2 . LEU D 1 13 ? -26.085 -107.717 13.416  1.00 76.28  ? 138 LEU D CD2 1 
ATOM   2199 N  N   . THR D 1 14 ? -22.164 -107.594 10.160  1.00 67.97  ? 139 THR D N   1 
ATOM   2200 C  CA  . THR D 1 14 ? -21.056 -106.630 10.198  1.00 66.04  ? 139 THR D CA  1 
ATOM   2201 C  C   . THR D 1 14 ? -20.722 -106.154 8.776   1.00 66.88  ? 139 THR D C   1 
ATOM   2202 O  O   . THR D 1 14 ? -20.358 -104.995 8.587   1.00 64.93  ? 139 THR D O   1 
ATOM   2203 C  CB  . THR D 1 14 ? -19.854 -107.246 10.935  1.00 78.76  ? 139 THR D CB  1 
ATOM   2204 O  OG1 . THR D 1 14 ? -20.310 -107.832 12.161  1.00 79.99  ? 139 THR D OG1 1 
ATOM   2205 C  CG2 . THR D 1 14 ? -18.755 -106.228 11.231  1.00 76.93  ? 139 THR D CG2 1 
ATOM   2206 N  N   . VAL D 1 15 ? -20.863 -107.051 7.784   1.00 63.43  ? 140 VAL D N   1 
ATOM   2207 C  CA  . VAL D 1 15 ? -20.634 -106.764 6.368   1.00 62.68  ? 140 VAL D CA  1 
ATOM   2208 C  C   . VAL D 1 15 ? -21.760 -105.852 5.883   1.00 62.37  ? 140 VAL D C   1 
ATOM   2209 O  O   . VAL D 1 15 ? -21.479 -104.813 5.294   1.00 62.17  ? 140 VAL D O   1 
ATOM   2210 C  CB  . VAL D 1 15 ? -20.524 -108.073 5.532   1.00 69.60  ? 140 VAL D CB  1 
ATOM   2211 C  CG1 . VAL D 1 15 ? -20.542 -107.790 4.035   1.00 69.64  ? 140 VAL D CG1 1 
ATOM   2212 C  CG2 . VAL D 1 15 ? -19.269 -108.862 5.899   1.00 71.95  ? 140 VAL D CG2 1 
ATOM   2213 N  N   . VAL D 1 16 ? -23.022 -106.229 6.169   1.00 56.02  ? 141 VAL D N   1 
ATOM   2214 C  CA  . VAL D 1 16 ? -24.239 -105.492 5.813   1.00 53.21  ? 141 VAL D CA  1 
ATOM   2215 C  C   . VAL D 1 16 ? -24.231 -104.077 6.401   1.00 53.50  ? 141 VAL D C   1 
ATOM   2216 O  O   . VAL D 1 16 ? -24.534 -103.114 5.694   1.00 51.73  ? 141 VAL D O   1 
ATOM   2217 C  CB  . VAL D 1 16 ? -25.512 -106.315 6.168   1.00 57.64  ? 141 VAL D CB  1 
ATOM   2218 C  CG1 . VAL D 1 16 ? -26.694 -105.430 6.539   1.00 55.50  ? 141 VAL D CG1 1 
ATOM   2219 C  CG2 . VAL D 1 16 ? -25.884 -107.263 5.029   1.00 59.35  ? 141 VAL D CG2 1 
ATOM   2220 N  N   . PHE D 1 17 ? -23.844 -103.961 7.679   1.00 49.38  ? 142 PHE D N   1 
ATOM   2221 C  CA  . PHE D 1 17 ? -23.764 -102.692 8.404   1.00 47.10  ? 142 PHE D CA  1 
ATOM   2222 C  C   . PHE D 1 17 ? -22.643 -101.793 7.895   1.00 50.45  ? 142 PHE D C   1 
ATOM   2223 O  O   . PHE D 1 17 ? -22.812 -100.574 7.912   1.00 48.84  ? 142 PHE D O   1 
ATOM   2224 C  CB  . PHE D 1 17 ? -23.627 -102.923 9.915   1.00 48.70  ? 142 PHE D CB  1 
ATOM   2225 C  CG  . PHE D 1 17 ? -24.629 -102.180 10.763  1.00 48.56  ? 142 PHE D CG  1 
ATOM   2226 C  CD1 . PHE D 1 17 ? -25.786 -102.809 11.213  1.00 52.13  ? 142 PHE D CD1 1 
ATOM   2227 C  CD2 . PHE D 1 17 ? -24.411 -100.853 11.126  1.00 48.93  ? 142 PHE D CD2 1 
ATOM   2228 C  CE1 . PHE D 1 17 ? -26.702 -102.130 12.022  1.00 51.73  ? 142 PHE D CE1 1 
ATOM   2229 C  CE2 . PHE D 1 17 ? -25.323 -100.178 11.939  1.00 50.80  ? 142 PHE D CE2 1 
ATOM   2230 C  CZ  . PHE D 1 17 ? -26.463 -100.822 12.380  1.00 49.35  ? 142 PHE D CZ  1 
ATOM   2231 N  N   . TYR D 1 18 ? -21.504 -102.374 7.459   1.00 48.41  ? 143 TYR D N   1 
ATOM   2232 C  CA  . TYR D 1 18 ? -20.400 -101.580 6.920   1.00 48.83  ? 143 TYR D CA  1 
ATOM   2233 C  C   . TYR D 1 18 ? -20.772 -101.014 5.532   1.00 51.01  ? 143 TYR D C   1 
ATOM   2234 O  O   . TYR D 1 18 ? -20.452 -99.858  5.247   1.00 50.75  ? 143 TYR D O   1 
ATOM   2235 C  CB  . TYR D 1 18 ? -19.068 -102.362 6.890   1.00 53.17  ? 143 TYR D CB  1 
ATOM   2236 C  CG  . TYR D 1 18 ? -17.976 -101.686 6.075   1.00 57.85  ? 143 TYR D CG  1 
ATOM   2237 C  CD1 . TYR D 1 18 ? -17.243 -100.622 6.597   1.00 60.18  ? 143 TYR D CD1 1 
ATOM   2238 C  CD2 . TYR D 1 18 ? -17.680 -102.109 4.776   1.00 59.83  ? 143 TYR D CD2 1 
ATOM   2239 C  CE1 . TYR D 1 18 ? -16.250 -99.989  5.846   1.00 62.23  ? 143 TYR D CE1 1 
ATOM   2240 C  CE2 . TYR D 1 18 ? -16.688 -101.484 4.018   1.00 61.44  ? 143 TYR D CE2 1 
ATOM   2241 C  CZ  . TYR D 1 18 ? -15.981 -100.420 4.556   1.00 67.13  ? 143 TYR D CZ  1 
ATOM   2242 O  OH  . TYR D 1 18 ? -15.004 -99.794  3.822   1.00 66.46  ? 143 TYR D OH  1 
ATOM   2243 N  N   . ILE D 1 19 ? -21.448 -101.823 4.687   1.00 45.72  ? 144 ILE D N   1 
ATOM   2244 C  CA  . ILE D 1 19 ? -21.863 -101.438 3.337   1.00 44.58  ? 144 ILE D CA  1 
ATOM   2245 C  C   . ILE D 1 19 ? -22.934 -100.359 3.375   1.00 46.61  ? 144 ILE D C   1 
ATOM   2246 O  O   . ILE D 1 19 ? -22.881 -99.412  2.581   1.00 45.55  ? 144 ILE D O   1 
ATOM   2247 C  CB  . ILE D 1 19 ? -22.256 -102.680 2.492   1.00 48.64  ? 144 ILE D CB  1 
ATOM   2248 C  CG1 . ILE D 1 19 ? -21.006 -103.511 2.176   1.00 51.35  ? 144 ILE D CG1 1 
ATOM   2249 C  CG2 . ILE D 1 19 ? -22.991 -102.291 1.191   1.00 48.52  ? 144 ILE D CG2 1 
ATOM   2250 C  CD1 . ILE D 1 19 ? -21.251 -104.935 1.967   1.00 61.10  ? 144 ILE D CD1 1 
ATOM   2251 N  N   . ALA D 1 20 ? -23.899 -100.501 4.297   1.00 42.30  ? 145 ALA D N   1 
ATOM   2252 C  CA  . ALA D 1 20 ? -24.979 -99.547  4.441   1.00 40.69  ? 145 ALA D CA  1 
ATOM   2253 C  C   . ALA D 1 20 ? -24.448 -98.213  4.949   1.00 45.95  ? 145 ALA D C   1 
ATOM   2254 O  O   . ALA D 1 20 ? -24.861 -97.182  4.422   1.00 44.25  ? 145 ALA D O   1 
ATOM   2255 C  CB  . ALA D 1 20 ? -26.030 -100.093 5.374   1.00 41.09  ? 145 ALA D CB  1 
ATOM   2256 N  N   . ALA D 1 21 ? -23.500 -98.234  5.940   1.00 45.06  ? 146 ALA D N   1 
ATOM   2257 C  CA  . ALA D 1 21 ? -22.880 -97.034  6.540   1.00 44.69  ? 146 ALA D CA  1 
ATOM   2258 C  C   . ALA D 1 21 ? -22.003 -96.241  5.549   1.00 50.14  ? 146 ALA D C   1 
ATOM   2259 O  O   . ALA D 1 21 ? -21.944 -95.011  5.641   1.00 49.96  ? 146 ALA D O   1 
ATOM   2260 C  CB  . ALA D 1 21 ? -22.098 -97.396  7.789   1.00 45.72  ? 146 ALA D CB  1 
ATOM   2261 N  N   . VAL D 1 22 ? -21.349 -96.939  4.597   1.00 46.37  ? 147 VAL D N   1 
ATOM   2262 C  CA  . VAL D 1 22 ? -20.572 -96.290  3.544   1.00 46.69  ? 147 VAL D CA  1 
ATOM   2263 C  C   . VAL D 1 22 ? -21.603 -95.617  2.605   1.00 49.42  ? 147 VAL D C   1 
ATOM   2264 O  O   . VAL D 1 22 ? -21.483 -94.427  2.294   1.00 48.13  ? 147 VAL D O   1 
ATOM   2265 C  CB  . VAL D 1 22 ? -19.629 -97.286  2.789   1.00 51.86  ? 147 VAL D CB  1 
ATOM   2266 C  CG1 . VAL D 1 22 ? -19.020 -96.655  1.540   1.00 52.25  ? 147 VAL D CG1 1 
ATOM   2267 C  CG2 . VAL D 1 22 ? -18.523 -97.805  3.704   1.00 52.89  ? 147 VAL D CG2 1 
ATOM   2268 N  N   . MET D 1 23 ? -22.644 -96.380  2.221   1.00 45.76  ? 148 MET D N   1 
ATOM   2269 C  CA  . MET D 1 23 ? -23.675 -95.915  1.321   1.00 45.51  ? 148 MET D CA  1 
ATOM   2270 C  C   . MET D 1 23 ? -24.392 -94.693  1.868   1.00 44.18  ? 148 MET D C   1 
ATOM   2271 O  O   . MET D 1 23 ? -24.531 -93.706  1.147   1.00 42.33  ? 148 MET D O   1 
ATOM   2272 C  CB  . MET D 1 23 ? -24.613 -97.047  0.888   1.00 49.34  ? 148 MET D CB  1 
ATOM   2273 C  CG  . MET D 1 23 ? -24.609 -97.278  -0.613  1.00 56.56  ? 148 MET D CG  1 
ATOM   2274 S  SD  . MET D 1 23 ? -23.187 -98.189  -1.319  1.00 65.61  ? 148 MET D SD  1 
ATOM   2275 C  CE  . MET D 1 23 ? -22.231 -96.828  -2.095  1.00 62.85  ? 148 MET D CE  1 
ATOM   2276 N  N   . ALA D 1 24 ? -24.735 -94.719  3.170   1.00 39.13  ? 149 ALA D N   1 
ATOM   2277 C  CA  . ALA D 1 24 ? -25.412 -93.625  3.882   1.00 37.12  ? 149 ALA D CA  1 
ATOM   2278 C  C   . ALA D 1 24 ? -24.573 -92.345  3.950   1.00 40.24  ? 149 ALA D C   1 
ATOM   2279 O  O   . ALA D 1 24 ? -25.115 -91.264  3.718   1.00 39.91  ? 149 ALA D O   1 
ATOM   2280 C  CB  . ALA D 1 24 ? -25.852 -94.069  5.274   1.00 36.84  ? 149 ALA D CB  1 
ATOM   2281 N  N   . THR D 1 25 ? -23.258 -92.466  4.214   1.00 36.81  ? 150 THR D N   1 
ATOM   2282 C  CA  . THR D 1 25 ? -22.331 -91.332  4.256   1.00 37.34  ? 150 THR D CA  1 
ATOM   2283 C  C   . THR D 1 25 ? -22.198 -90.735  2.840   1.00 45.45  ? 150 THR D C   1 
ATOM   2284 O  O   . THR D 1 25 ? -22.153 -89.512  2.692   1.00 47.41  ? 150 THR D O   1 
ATOM   2285 C  CB  . THR D 1 25 ? -20.958 -91.793  4.773   1.00 39.19  ? 150 THR D CB  1 
ATOM   2286 O  OG1 . THR D 1 25 ? -21.110 -92.567  5.957   1.00 38.57  ? 150 THR D OG1 1 
ATOM   2287 C  CG2 . THR D 1 25 ? -20.000 -90.647  5.019   1.00 35.20  ? 150 THR D CG2 1 
ATOM   2288 N  N   . ASN D 1 26 ? -22.121 -91.602  1.805   1.00 41.47  ? 151 ASN D N   1 
ATOM   2289 C  CA  . ASN D 1 26 ? -21.973 -91.156  0.424   1.00 42.09  ? 151 ASN D CA  1 
ATOM   2290 C  C   . ASN D 1 26 ? -23.199 -90.434  -0.111  1.00 45.56  ? 151 ASN D C   1 
ATOM   2291 O  O   . ASN D 1 26 ? -23.041 -89.426  -0.803  1.00 46.81  ? 151 ASN D O   1 
ATOM   2292 C  CB  . ASN D 1 26 ? -21.567 -92.300  -0.509  1.00 43.13  ? 151 ASN D CB  1 
ATOM   2293 C  CG  . ASN D 1 26 ? -21.172 -91.819  -1.879  1.00 58.28  ? 151 ASN D CG  1 
ATOM   2294 O  OD1 . ASN D 1 26 ? -21.959 -91.895  -2.836  1.00 52.45  ? 151 ASN D OD1 1 
ATOM   2295 N  ND2 . ASN D 1 26 ? -19.976 -91.228  -1.978  1.00 46.98  ? 151 ASN D ND2 1 
ATOM   2296 N  N   . LEU D 1 27 ? -24.412 -90.934  0.204   1.00 40.05  ? 152 LEU D N   1 
ATOM   2297 C  CA  . LEU D 1 27 ? -25.645 -90.319  -0.282  1.00 39.25  ? 152 LEU D CA  1 
ATOM   2298 C  C   . LEU D 1 27 ? -26.129 -89.152  0.594   1.00 41.93  ? 152 LEU D C   1 
ATOM   2299 O  O   . LEU D 1 27 ? -26.432 -88.065  0.079   1.00 41.32  ? 152 LEU D O   1 
ATOM   2300 C  CB  . LEU D 1 27 ? -26.775 -91.370  -0.446  1.00 38.57  ? 152 LEU D CB  1 
ATOM   2301 C  CG  . LEU D 1 27 ? -26.517 -92.647  -1.288  1.00 43.37  ? 152 LEU D CG  1 
ATOM   2302 C  CD1 . LEU D 1 27 ? -27.790 -93.501  -1.390  1.00 42.21  ? 152 LEU D CD1 1 
ATOM   2303 C  CD2 . LEU D 1 27 ? -26.001 -92.322  -2.675  1.00 46.20  ? 152 LEU D CD2 1 
ATOM   2304 N  N   . TYR D 1 28 ? -26.178 -89.374  1.916   1.00 37.07  ? 153 TYR D N   1 
ATOM   2305 C  CA  . TYR D 1 28 ? -26.739 -88.417  2.853   1.00 36.44  ? 153 TYR D CA  1 
ATOM   2306 C  C   . TYR D 1 28 ? -25.738 -87.625  3.705   1.00 41.99  ? 153 TYR D C   1 
ATOM   2307 O  O   . TYR D 1 28 ? -26.137 -86.752  4.489   1.00 42.87  ? 153 TYR D O   1 
ATOM   2308 C  CB  . TYR D 1 28 ? -27.768 -89.148  3.724   1.00 36.55  ? 153 TYR D CB  1 
ATOM   2309 C  CG  . TYR D 1 28 ? -28.653 -90.131  2.972   1.00 38.84  ? 153 TYR D CG  1 
ATOM   2310 C  CD1 . TYR D 1 28 ? -29.548 -89.694  2.003   1.00 41.08  ? 153 TYR D CD1 1 
ATOM   2311 C  CD2 . TYR D 1 28 ? -28.661 -91.485  3.300   1.00 39.64  ? 153 TYR D CD2 1 
ATOM   2312 C  CE1 . TYR D 1 28 ? -30.408 -90.579  1.357   1.00 42.84  ? 153 TYR D CE1 1 
ATOM   2313 C  CE2 . TYR D 1 28 ? -29.507 -92.384  2.648   1.00 40.67  ? 153 TYR D CE2 1 
ATOM   2314 C  CZ  . TYR D 1 28 ? -30.386 -91.925  1.683   1.00 49.56  ? 153 TYR D CZ  1 
ATOM   2315 O  OH  . TYR D 1 28 ? -31.240 -92.796  1.041   1.00 51.96  ? 153 TYR D OH  1 
ATOM   2316 N  N   . GLY D 1 29 ? -24.459 -87.923  3.544   1.00 37.89  ? 154 GLY D N   1 
ATOM   2317 C  CA  . GLY D 1 29 ? -23.410 -87.287  4.326   1.00 38.45  ? 154 GLY D CA  1 
ATOM   2318 C  C   . GLY D 1 29 ? -23.275 -85.788  4.209   1.00 43.31  ? 154 GLY D C   1 
ATOM   2319 O  O   . GLY D 1 29 ? -23.142 -85.106  5.226   1.00 43.33  ? 154 GLY D O   1 
ATOM   2320 N  N   . ALA D 1 30 ? -23.265 -85.277  2.966   1.00 40.18  ? 155 ALA D N   1 
ATOM   2321 C  CA  . ALA D 1 30 ? -23.077 -83.867  2.641   1.00 41.05  ? 155 ALA D CA  1 
ATOM   2322 C  C   . ALA D 1 30 ? -24.247 -82.995  3.038   1.00 43.23  ? 155 ALA D C   1 
ATOM   2323 O  O   . ALA D 1 30 ? -24.035 -81.871  3.509   1.00 42.56  ? 155 ALA D O   1 
ATOM   2324 C  CB  . ALA D 1 30 ? -22.790 -83.717  1.158   1.00 43.30  ? 155 ALA D CB  1 
ATOM   2325 N  N   . THR D 1 31 ? -25.474 -83.527  2.839   1.00 39.80  ? 156 THR D N   1 
ATOM   2326 C  CA  . THR D 1 31 ? -26.779 -82.906  3.111   1.00 39.57  ? 156 THR D CA  1 
ATOM   2327 C  C   . THR D 1 31 ? -27.166 -82.959  4.566   1.00 42.64  ? 156 THR D C   1 
ATOM   2328 O  O   . THR D 1 31 ? -27.843 -82.035  5.034   1.00 42.80  ? 156 THR D O   1 
ATOM   2329 C  CB  . THR D 1 31 ? -27.884 -83.530  2.248   1.00 46.65  ? 156 THR D CB  1 
ATOM   2330 O  OG1 . THR D 1 31 ? -27.531 -84.873  1.883   1.00 48.44  ? 156 THR D OG1 1 
ATOM   2331 C  CG2 . THR D 1 31 ? -28.154 -82.724  1.014   1.00 45.22  ? 156 THR D CG2 1 
ATOM   2332 N  N   . PHE D 1 32 ? -26.771 -84.065  5.267   1.00 37.41  ? 157 PHE D N   1 
ATOM   2333 C  CA  . PHE D 1 32 ? -27.049 -84.333  6.690   1.00 35.84  ? 157 PHE D CA  1 
ATOM   2334 C  C   . PHE D 1 32 ? -25.751 -84.726  7.436   1.00 38.75  ? 157 PHE D C   1 
ATOM   2335 O  O   . PHE D 1 32 ? -25.527 -85.920  7.712   1.00 38.52  ? 157 PHE D O   1 
ATOM   2336 C  CB  . PHE D 1 32 ? -28.144 -85.403  6.841   1.00 36.04  ? 157 PHE D CB  1 
ATOM   2337 C  CG  . PHE D 1 32 ? -29.471 -84.959  6.272   1.00 37.81  ? 157 PHE D CG  1 
ATOM   2338 C  CD1 . PHE D 1 32 ? -29.786 -85.188  4.933   1.00 41.67  ? 157 PHE D CD1 1 
ATOM   2339 C  CD2 . PHE D 1 32 ? -30.397 -84.292  7.065   1.00 38.84  ? 157 PHE D CD2 1 
ATOM   2340 C  CE1 . PHE D 1 32 ? -30.984 -84.720  4.396   1.00 42.17  ? 157 PHE D CE1 1 
ATOM   2341 C  CE2 . PHE D 1 32 ? -31.602 -83.852  6.533   1.00 41.41  ? 157 PHE D CE2 1 
ATOM   2342 C  CZ  . PHE D 1 32 ? -31.885 -84.064  5.205   1.00 40.20  ? 157 PHE D CZ  1 
ATOM   2343 N  N   . PRO D 1 33 ? -24.875 -83.720  7.728   1.00 32.80  ? 158 PRO D N   1 
ATOM   2344 C  CA  . PRO D 1 33 ? -23.608 -84.018  8.420   1.00 33.26  ? 158 PRO D CA  1 
ATOM   2345 C  C   . PRO D 1 33 ? -23.717 -84.578  9.847   1.00 39.57  ? 158 PRO D C   1 
ATOM   2346 O  O   . PRO D 1 33 ? -22.890 -85.401  10.229  1.00 39.81  ? 158 PRO D O   1 
ATOM   2347 C  CB  . PRO D 1 33 ? -22.862 -82.679  8.411   1.00 36.58  ? 158 PRO D CB  1 
ATOM   2348 C  CG  . PRO D 1 33 ? -23.653 -81.766  7.602   1.00 40.44  ? 158 PRO D CG  1 
ATOM   2349 C  CD  . PRO D 1 33 ? -25.013 -82.277  7.450   1.00 33.79  ? 158 PRO D CD  1 
ATOM   2350 N  N   . GLU D 1 34 ? -24.698 -84.123  10.645  1.00 37.42  ? 159 GLU D N   1 
ATOM   2351 C  CA  . GLU D 1 34 ? -24.861 -84.570  12.031  1.00 37.55  ? 159 GLU D CA  1 
ATOM   2352 C  C   . GLU D 1 34 ? -25.144 -86.057  12.180  1.00 40.72  ? 159 GLU D C   1 
ATOM   2353 O  O   . GLU D 1 34 ? -24.673 -86.686  13.128  1.00 40.62  ? 159 GLU D O   1 
ATOM   2354 C  CB  . GLU D 1 34 ? -25.941 -83.760  12.736  1.00 39.39  ? 159 GLU D CB  1 
ATOM   2355 C  CG  . GLU D 1 34 ? -25.390 -82.586  13.521  1.00 56.67  ? 159 GLU D CG  1 
ATOM   2356 C  CD  . GLU D 1 34 ? -26.027 -82.366  14.880  1.00 87.36  ? 159 GLU D CD  1 
ATOM   2357 O  OE1 . GLU D 1 34 ? -26.928 -83.151  15.269  1.00 62.55  ? 159 GLU D OE1 1 
ATOM   2358 O  OE2 . GLU D 1 34 ? -25.614 -81.397  15.560  1.00 95.66  ? 159 GLU D OE2 1 
ATOM   2359 N  N   . TRP D 1 35 ? -25.900 -86.615  11.242  1.00 37.24  ? 160 TRP D N   1 
ATOM   2360 C  CA  . TRP D 1 35 ? -26.277 -88.019  11.266  1.00 36.03  ? 160 TRP D CA  1 
ATOM   2361 C  C   . TRP D 1 35 ? -25.482 -88.889  10.332  1.00 37.06  ? 160 TRP D C   1 
ATOM   2362 O  O   . TRP D 1 35 ? -25.391 -90.085  10.610  1.00 35.59  ? 160 TRP D O   1 
ATOM   2363 C  CB  . TRP D 1 35 ? -27.753 -88.179  10.905  1.00 34.64  ? 160 TRP D CB  1 
ATOM   2364 C  CG  . TRP D 1 35 ? -28.714 -87.353  11.706  1.00 36.20  ? 160 TRP D CG  1 
ATOM   2365 C  CD1 . TRP D 1 35 ? -28.649 -87.059  13.039  1.00 39.56  ? 160 TRP D CD1 1 
ATOM   2366 C  CD2 . TRP D 1 35 ? -29.962 -86.834  11.239  1.00 36.13  ? 160 TRP D CD2 1 
ATOM   2367 N  NE1 . TRP D 1 35 ? -29.759 -86.339  13.416  1.00 39.20  ? 160 TRP D NE1 1 
ATOM   2368 C  CE2 . TRP D 1 35 ? -30.581 -86.186  12.328  1.00 40.17  ? 160 TRP D CE2 1 
ATOM   2369 C  CE3 . TRP D 1 35 ? -30.603 -86.820  9.986   1.00 37.25  ? 160 TRP D CE3 1 
ATOM   2370 C  CZ2 . TRP D 1 35 ? -31.809 -85.534  12.204  1.00 39.53  ? 160 TRP D CZ2 1 
ATOM   2371 C  CZ3 . TRP D 1 35 ? -31.819 -86.178  9.868   1.00 38.69  ? 160 TRP D CZ3 1 
ATOM   2372 C  CH2 . TRP D 1 35 ? -32.412 -85.548  10.970  1.00 39.62  ? 160 TRP D CH2 1 
ATOM   2373 N  N   . PHE D 1 36 ? -24.978 -88.331  9.188   1.00 32.96  ? 161 PHE D N   1 
ATOM   2374 C  CA  . PHE D 1 36 ? -24.278 -89.122  8.168   1.00 32.57  ? 161 PHE D CA  1 
ATOM   2375 C  C   . PHE D 1 36 ? -22.989 -88.548  7.616   1.00 39.50  ? 161 PHE D C   1 
ATOM   2376 O  O   . PHE D 1 36 ? -22.507 -89.046  6.601   1.00 40.53  ? 161 PHE D O   1 
ATOM   2377 C  CB  . PHE D 1 36 ? -25.233 -89.481  7.013   1.00 33.14  ? 161 PHE D CB  1 
ATOM   2378 C  CG  . PHE D 1 36 ? -26.446 -90.275  7.444   1.00 33.35  ? 161 PHE D CG  1 
ATOM   2379 C  CD1 . PHE D 1 36 ? -26.324 -91.608  7.833   1.00 35.08  ? 161 PHE D CD1 1 
ATOM   2380 C  CD2 . PHE D 1 36 ? -27.702 -89.674  7.512   1.00 34.18  ? 161 PHE D CD2 1 
ATOM   2381 C  CE1 . PHE D 1 36 ? -27.434 -92.324  8.276   1.00 35.01  ? 161 PHE D CE1 1 
ATOM   2382 C  CE2 . PHE D 1 36 ? -28.810 -90.391  7.953   1.00 35.50  ? 161 PHE D CE2 1 
ATOM   2383 C  CZ  . PHE D 1 36 ? -28.672 -91.713  8.322   1.00 33.62  ? 161 PHE D CZ  1 
ATOM   2384 N  N   . GLY D 1 37 ? -22.421 -87.552  8.290   1.00 37.23  ? 162 GLY D N   1 
ATOM   2385 C  CA  . GLY D 1 37 ? -21.203 -86.862  7.863   1.00 38.84  ? 162 GLY D CA  1 
ATOM   2386 C  C   . GLY D 1 37 ? -19.932 -87.676  7.710   1.00 43.70  ? 162 GLY D C   1 
ATOM   2387 O  O   . GLY D 1 37 ? -18.992 -87.219  7.053   1.00 45.86  ? 162 GLY D O   1 
ATOM   2388 N  N   . ASP D 1 38 ? -19.875 -88.854  8.355   1.00 38.57  ? 163 ASP D N   1 
ATOM   2389 C  CA  . ASP D 1 38 ? -18.755 -89.798  8.304   1.00 39.26  ? 163 ASP D CA  1 
ATOM   2390 C  C   . ASP D 1 38 ? -19.217 -91.195  8.710   1.00 41.07  ? 163 ASP D C   1 
ATOM   2391 O  O   . ASP D 1 38 ? -20.285 -91.333  9.311   1.00 39.68  ? 163 ASP D O   1 
ATOM   2392 C  CB  . ASP D 1 38 ? -17.554 -89.328  9.159   1.00 42.90  ? 163 ASP D CB  1 
ATOM   2393 C  CG  . ASP D 1 38 ? -17.848 -89.085  10.625  1.00 49.95  ? 163 ASP D CG  1 
ATOM   2394 O  OD1 . ASP D 1 38 ? -18.361 -90.017  11.295  1.00 49.25  ? 163 ASP D OD1 1 
ATOM   2395 O  OD2 . ASP D 1 38 ? -17.508 -87.988  11.122  1.00 54.08  ? 163 ASP D OD2 1 
ATOM   2396 N  N   . LEU D 1 39 ? -18.400 -92.217  8.403   1.00 37.13  ? 164 LEU D N   1 
ATOM   2397 C  CA  . LEU D 1 39 ? -18.660 -93.618  8.720   1.00 36.14  ? 164 LEU D CA  1 
ATOM   2398 C  C   . LEU D 1 39 ? -19.121 -93.864  10.175  1.00 40.17  ? 164 LEU D C   1 
ATOM   2399 O  O   . LEU D 1 39 ? -20.117 -94.560  10.367  1.00 38.99  ? 164 LEU D O   1 
ATOM   2400 C  CB  . LEU D 1 39 ? -17.421 -94.470  8.386   1.00 37.72  ? 164 LEU D CB  1 
ATOM   2401 C  CG  . LEU D 1 39 ? -17.636 -95.979  8.288   1.00 42.16  ? 164 LEU D CG  1 
ATOM   2402 C  CD1 . LEU D 1 39 ? -18.563 -96.340  7.124   1.00 42.11  ? 164 LEU D CD1 1 
ATOM   2403 C  CD2 . LEU D 1 39 ? -16.326 -96.706  8.162   1.00 44.14  ? 164 LEU D CD2 1 
ATOM   2404 N  N   . SER D 1 40 ? -18.416 -93.273  11.176  1.00 37.20  ? 165 SER D N   1 
ATOM   2405 C  CA  . SER D 1 40 ? -18.689 -93.411  12.616  1.00 36.50  ? 165 SER D CA  1 
ATOM   2406 C  C   . SER D 1 40 ? -20.092 -92.965  12.960  1.00 40.01  ? 165 SER D C   1 
ATOM   2407 O  O   . SER D 1 40 ? -20.840 -93.713  13.599  1.00 38.58  ? 165 SER D O   1 
ATOM   2408 C  CB  . SER D 1 40 ? -17.681 -92.607  13.428  1.00 41.47  ? 165 SER D CB  1 
ATOM   2409 O  OG  . SER D 1 40 ? -16.432 -93.265  13.563  1.00 53.40  ? 165 SER D OG  1 
ATOM   2410 N  N   . LYS D 1 41 ? -20.454 -91.751  12.502  1.00 37.69  ? 166 LYS D N   1 
ATOM   2411 C  CA  . LYS D 1 41 ? -21.776 -91.144  12.673  1.00 36.38  ? 166 LYS D CA  1 
ATOM   2412 C  C   . LYS D 1 41 ? -22.853 -92.006  11.984  1.00 40.19  ? 166 LYS D C   1 
ATOM   2413 O  O   . LYS D 1 41 ? -23.879 -92.296  12.611  1.00 40.77  ? 166 LYS D O   1 
ATOM   2414 C  CB  . LYS D 1 41 ? -21.786 -89.716  12.104  1.00 38.58  ? 166 LYS D CB  1 
ATOM   2415 C  CG  . LYS D 1 41 ? -20.995 -88.699  12.925  1.00 41.32  ? 166 LYS D CG  1 
ATOM   2416 C  CD  . LYS D 1 41 ? -20.931 -87.392  12.159  1.00 46.86  ? 166 LYS D CD  1 
ATOM   2417 C  CE  . LYS D 1 41 ? -20.498 -86.217  12.990  1.00 53.39  ? 166 LYS D CE  1 
ATOM   2418 N  NZ  . LYS D 1 41 ? -20.611 -84.950  12.221  1.00 58.97  ? 166 LYS D NZ  1 
ATOM   2419 N  N   . SER D 1 42 ? -22.599 -92.454  10.720  1.00 35.12  ? 167 SER D N   1 
ATOM   2420 C  CA  . SER D 1 42 ? -23.522 -93.308  9.957   1.00 33.63  ? 167 SER D CA  1 
ATOM   2421 C  C   . SER D 1 42 ? -23.802 -94.656  10.625  1.00 36.37  ? 167 SER D C   1 
ATOM   2422 O  O   . SER D 1 42 ? -24.960 -95.043  10.694  1.00 34.58  ? 167 SER D O   1 
ATOM   2423 C  CB  . SER D 1 42 ? -23.050 -93.499  8.521   1.00 37.99  ? 167 SER D CB  1 
ATOM   2424 O  OG  . SER D 1 42 ? -23.135 -92.285  7.789   1.00 46.06  ? 167 SER D OG  1 
ATOM   2425 N  N   . LEU D 1 43 ? -22.764 -95.334  11.174  1.00 34.15  ? 168 LEU D N   1 
ATOM   2426 C  CA  . LEU D 1 43 ? -22.895 -96.612  11.902  1.00 33.97  ? 168 LEU D CA  1 
ATOM   2427 C  C   . LEU D 1 43 ? -23.817 -96.476  13.141  1.00 39.37  ? 168 LEU D C   1 
ATOM   2428 O  O   . LEU D 1 43 ? -24.647 -97.363  13.395  1.00 38.73  ? 168 LEU D O   1 
ATOM   2429 C  CB  . LEU D 1 43 ? -21.511 -97.113  12.346  1.00 34.80  ? 168 LEU D CB  1 
ATOM   2430 C  CG  . LEU D 1 43 ? -20.596 -97.673  11.273  1.00 39.57  ? 168 LEU D CG  1 
ATOM   2431 C  CD1 . LEU D 1 43 ? -19.153 -97.453  11.645  1.00 41.57  ? 168 LEU D CD1 1 
ATOM   2432 C  CD2 . LEU D 1 43 ? -20.842 -99.146  11.050  1.00 41.01  ? 168 LEU D CD2 1 
ATOM   2433 N  N   . TYR D 1 44 ? -23.657 -95.356  13.899  1.00 36.68  ? 169 TYR D N   1 
ATOM   2434 C  CA  . TYR D 1 44 ? -24.440 -95.045  15.093  1.00 36.58  ? 169 TYR D CA  1 
ATOM   2435 C  C   . TYR D 1 44 ? -25.890 -94.757  14.735  1.00 38.30  ? 169 TYR D C   1 
ATOM   2436 O  O   . TYR D 1 44 ? -26.783 -95.228  15.441  1.00 37.01  ? 169 TYR D O   1 
ATOM   2437 C  CB  . TYR D 1 44 ? -23.820 -93.874  15.897  1.00 39.23  ? 169 TYR D CB  1 
ATOM   2438 C  CG  . TYR D 1 44 ? -24.675 -93.424  17.066  1.00 41.73  ? 169 TYR D CG  1 
ATOM   2439 C  CD1 . TYR D 1 44 ? -24.477 -93.943  18.344  1.00 44.50  ? 169 TYR D CD1 1 
ATOM   2440 C  CD2 . TYR D 1 44 ? -25.694 -92.493  16.892  1.00 42.11  ? 169 TYR D CD2 1 
ATOM   2441 C  CE1 . TYR D 1 44 ? -25.297 -93.567  19.413  1.00 46.21  ? 169 TYR D CE1 1 
ATOM   2442 C  CE2 . TYR D 1 44 ? -26.530 -92.124  17.944  1.00 43.50  ? 169 TYR D CE2 1 
ATOM   2443 C  CZ  . TYR D 1 44 ? -26.334 -92.664  19.204  1.00 50.42  ? 169 TYR D CZ  1 
ATOM   2444 O  OH  . TYR D 1 44 ? -27.159 -92.239  20.223  1.00 46.07  ? 169 TYR D OH  1 
ATOM   2445 N  N   . THR D 1 45 ? -26.121 -93.954  13.664  1.00 35.11  ? 170 THR D N   1 
ATOM   2446 C  CA  . THR D 1 45 ? -27.464 -93.584  13.175  1.00 33.75  ? 170 THR D CA  1 
ATOM   2447 C  C   . THR D 1 45 ? -28.194 -94.808  12.622  1.00 36.71  ? 170 THR D C   1 
ATOM   2448 O  O   . THR D 1 45 ? -29.377 -94.961  12.909  1.00 37.56  ? 170 THR D O   1 
ATOM   2449 C  CB  . THR D 1 45 ? -27.414 -92.418  12.179  1.00 38.72  ? 170 THR D CB  1 
ATOM   2450 O  OG1 . THR D 1 45 ? -26.522 -91.421  12.676  1.00 39.34  ? 170 THR D OG1 1 
ATOM   2451 C  CG2 . THR D 1 45 ? -28.789 -91.792  11.941  1.00 35.34  ? 170 THR D CG2 1 
ATOM   2452 N  N   . LEU D 1 46 ? -27.493 -95.694  11.873  1.00 31.45  ? 171 LEU D N   1 
ATOM   2453 C  CA  . LEU D 1 46 ? -28.080 -96.926  11.345  1.00 30.92  ? 171 LEU D CA  1 
ATOM   2454 C  C   . LEU D 1 46 ? -28.403 -97.898  12.454  1.00 35.56  ? 171 LEU D C   1 
ATOM   2455 O  O   . LEU D 1 46 ? -29.370 -98.652  12.314  1.00 36.18  ? 171 LEU D O   1 
ATOM   2456 C  CB  . LEU D 1 46 ? -27.201 -97.610  10.305  1.00 31.41  ? 171 LEU D CB  1 
ATOM   2457 C  CG  . LEU D 1 46 ? -26.988 -96.910  8.986   1.00 34.95  ? 171 LEU D CG  1 
ATOM   2458 C  CD1 . LEU D 1 46 ? -25.910 -97.591  8.237   1.00 35.04  ? 171 LEU D CD1 1 
ATOM   2459 C  CD2 . LEU D 1 46 ? -28.278 -96.827  8.163   1.00 38.62  ? 171 LEU D CD2 1 
ATOM   2460 N  N   . PHE D 1 47 ? -27.623 -97.882  13.564  1.00 32.48  ? 172 PHE D N   1 
ATOM   2461 C  CA  . PHE D 1 47 ? -27.928 -98.712  14.742  1.00 33.78  ? 172 PHE D CA  1 
ATOM   2462 C  C   . PHE D 1 47 ? -29.238 -98.194  15.347  1.00 38.87  ? 172 PHE D C   1 
ATOM   2463 O  O   . PHE D 1 47 ? -30.159 -98.987  15.549  1.00 40.40  ? 172 PHE D O   1 
ATOM   2464 C  CB  . PHE D 1 47 ? -26.797 -98.689  15.789  1.00 36.18  ? 172 PHE D CB  1 
ATOM   2465 C  CG  . PHE D 1 47 ? -27.095 -99.521  17.020  1.00 39.17  ? 172 PHE D CG  1 
ATOM   2466 C  CD1 . PHE D 1 47 ? -26.924 -100.903 17.008  1.00 43.59  ? 172 PHE D CD1 1 
ATOM   2467 C  CD2 . PHE D 1 47 ? -27.568 -98.925  18.186  1.00 41.70  ? 172 PHE D CD2 1 
ATOM   2468 C  CE1 . PHE D 1 47 ? -27.224 -101.672 18.138  1.00 45.93  ? 172 PHE D CE1 1 
ATOM   2469 C  CE2 . PHE D 1 47 ? -27.879 -99.698  19.312  1.00 45.76  ? 172 PHE D CE2 1 
ATOM   2470 C  CZ  . PHE D 1 47 ? -27.703 -101.067 19.280  1.00 45.12  ? 172 PHE D CZ  1 
ATOM   2471 N  N   . GLN D 1 48 ? -29.338 -96.850  15.572  1.00 33.58  ? 173 GLN D N   1 
ATOM   2472 C  CA  . GLN D 1 48 ? -30.535 -96.168  16.071  1.00 32.51  ? 173 GLN D CA  1 
ATOM   2473 C  C   . GLN D 1 48 ? -31.751 -96.535  15.210  1.00 39.04  ? 173 GLN D C   1 
ATOM   2474 O  O   . GLN D 1 48 ? -32.839 -96.735  15.752  1.00 40.86  ? 173 GLN D O   1 
ATOM   2475 C  CB  . GLN D 1 48 ? -30.345 -94.641  16.076  1.00 32.19  ? 173 GLN D CB  1 
ATOM   2476 C  CG  . GLN D 1 48 ? -31.615 -93.912  16.514  1.00 36.87  ? 173 GLN D CG  1 
ATOM   2477 C  CD  . GLN D 1 48 ? -31.636 -92.429  16.282  1.00 38.40  ? 173 GLN D CD  1 
ATOM   2478 O  OE1 . GLN D 1 48 ? -30.618 -91.725  16.448  1.00 33.61  ? 173 GLN D OE1 1 
ATOM   2479 N  NE2 . GLN D 1 48 ? -32.835 -91.921  15.968  1.00 17.56  ? 173 GLN D NE2 1 
ATOM   2480 N  N   . VAL D 1 49 ? -31.562 -96.621  13.878  1.00 35.61  ? 174 VAL D N   1 
ATOM   2481 C  CA  . VAL D 1 49 ? -32.624 -96.976  12.929  1.00 35.84  ? 174 VAL D CA  1 
ATOM   2482 C  C   . VAL D 1 49 ? -33.076 -98.432  13.142  1.00 41.87  ? 174 VAL D C   1 
ATOM   2483 O  O   . VAL D 1 49 ? -34.275 -98.712  13.152  1.00 41.80  ? 174 VAL D O   1 
ATOM   2484 C  CB  . VAL D 1 49 ? -32.253 -96.633  11.456  1.00 38.01  ? 174 VAL D CB  1 
ATOM   2485 C  CG1 . VAL D 1 49 ? -33.165 -97.350  10.455  1.00 37.97  ? 174 VAL D CG1 1 
ATOM   2486 C  CG2 . VAL D 1 49 ? -32.290 -95.123  11.233  1.00 36.63  ? 174 VAL D CG2 1 
ATOM   2487 N  N   . MET D 1 50 ? -32.118 -99.325  13.363  1.00 39.54  ? 175 MET D N   1 
ATOM   2488 C  CA  . MET D 1 50 ? -32.374 -100.734 13.590  1.00 41.81  ? 175 MET D CA  1 
ATOM   2489 C  C   . MET D 1 50 ? -33.209 -100.970 14.855  1.00 46.21  ? 175 MET D C   1 
ATOM   2490 O  O   . MET D 1 50 ? -34.134 -101.788 14.808  1.00 48.85  ? 175 MET D O   1 
ATOM   2491 C  CB  . MET D 1 50 ? -31.044 -101.486 13.647  1.00 45.28  ? 175 MET D CB  1 
ATOM   2492 C  CG  . MET D 1 50 ? -31.198 -102.945 13.887  1.00 51.55  ? 175 MET D CG  1 
ATOM   2493 S  SD  . MET D 1 50 ? -29.594 -103.674 14.098  1.00 57.29  ? 175 MET D SD  1 
ATOM   2494 C  CE  . MET D 1 50 ? -29.344 -103.422 15.829  1.00 54.54  ? 175 MET D CE  1 
ATOM   2495 N  N   . THR D 1 51 ? -32.903 -100.250 15.971  1.00 39.94  ? 176 THR D N   1 
ATOM   2496 C  CA  . THR D 1 51 ? -33.638 -100.351 17.255  1.00 39.77  ? 176 THR D CA  1 
ATOM   2497 C  C   . THR D 1 51 ? -35.039 -99.710  17.131  1.00 41.72  ? 176 THR D C   1 
ATOM   2498 O  O   . THR D 1 51 ? -35.878 -99.850  18.024  1.00 43.82  ? 176 THR D O   1 
ATOM   2499 C  CB  . THR D 1 51 ? -32.850 -99.715  18.422  1.00 47.19  ? 176 THR D CB  1 
ATOM   2500 O  OG1 . THR D 1 51 ? -32.697 -98.315  18.191  1.00 50.22  ? 176 THR D OG1 1 
ATOM   2501 C  CG2 . THR D 1 51 ? -31.504 -100.370 18.671  1.00 44.39  ? 176 THR D CG2 1 
ATOM   2502 N  N   . LEU D 1 52 ? -35.266 -99.004  16.010  1.00 34.29  ? 177 LEU D N   1 
ATOM   2503 C  CA  . LEU D 1 52 ? -36.484 -98.313  15.597  1.00 32.32  ? 177 LEU D CA  1 
ATOM   2504 C  C   . LEU D 1 52 ? -36.692 -96.956  16.240  1.00 35.88  ? 177 LEU D C   1 
ATOM   2505 O  O   . LEU D 1 52 ? -37.609 -96.243  15.859  1.00 36.30  ? 177 LEU D O   1 
ATOM   2506 C  CB  . LEU D 1 52 ? -37.744 -99.218  15.620  1.00 33.26  ? 177 LEU D CB  1 
ATOM   2507 C  CG  . LEU D 1 52 ? -37.651 -100.536 14.841  1.00 37.74  ? 177 LEU D CG  1 
ATOM   2508 C  CD1 . LEU D 1 52 ? -38.830 -101.428 15.131  1.00 40.27  ? 177 LEU D CD1 1 
ATOM   2509 C  CD2 . LEU D 1 52 ? -37.564 -100.298 13.348  1.00 38.04  ? 177 LEU D CD2 1 
ATOM   2510 N  N   . GLU D 1 53 ? -35.804 -96.566  17.152  1.00 32.81  ? 178 GLU D N   1 
ATOM   2511 C  CA  . GLU D 1 53 ? -35.876 -95.298  17.884  1.00 32.82  ? 178 GLU D CA  1 
ATOM   2512 C  C   . GLU D 1 53 ? -35.920 -94.065  16.954  1.00 38.82  ? 178 GLU D C   1 
ATOM   2513 O  O   . GLU D 1 53 ? -34.945 -93.800  16.239  1.00 40.13  ? 178 GLU D O   1 
ATOM   2514 C  CB  . GLU D 1 53 ? -34.709 -95.208  18.879  1.00 33.49  ? 178 GLU D CB  1 
ATOM   2515 C  CG  . GLU D 1 53 ? -34.977 -94.266  20.032  1.00 42.31  ? 178 GLU D CG  1 
ATOM   2516 C  CD  . GLU D 1 53 ? -34.867 -92.790  19.717  1.00 60.27  ? 178 GLU D CD  1 
ATOM   2517 O  OE1 . GLU D 1 53 ? -35.924 -92.132  19.582  1.00 56.60  ? 178 GLU D OE1 1 
ATOM   2518 O  OE2 . GLU D 1 53 ? -33.726 -92.289  19.612  1.00 49.15  ? 178 GLU D OE2 1 
ATOM   2519 N  N   . SER D 1 54 ? -37.051 -93.328  16.956  1.00 35.51  ? 179 SER D N   1 
ATOM   2520 C  CA  . SER D 1 54 ? -37.303 -92.132  16.117  1.00 35.76  ? 179 SER D CA  1 
ATOM   2521 C  C   . SER D 1 54 ? -36.925 -92.286  14.616  1.00 40.01  ? 179 SER D C   1 
ATOM   2522 O  O   . SER D 1 54 ? -36.664 -91.285  13.944  1.00 38.79  ? 179 SER D O   1 
ATOM   2523 C  CB  . SER D 1 54 ? -36.632 -90.887  16.698  1.00 39.85  ? 179 SER D CB  1 
ATOM   2524 O  OG  . SER D 1 54 ? -37.209 -90.428  17.911  1.00 52.97  ? 179 SER D OG  1 
ATOM   2525 N  N   . TRP D 1 55 ? -36.910 -93.526  14.091  1.00 37.58  ? 180 TRP D N   1 
ATOM   2526 C  CA  . TRP D 1 55 ? -36.471 -93.768  12.728  1.00 38.00  ? 180 TRP D CA  1 
ATOM   2527 C  C   . TRP D 1 55 ? -37.112 -92.902  11.659  1.00 41.93  ? 180 TRP D C   1 
ATOM   2528 O  O   . TRP D 1 55 ? -36.399 -92.350  10.821  1.00 40.24  ? 180 TRP D O   1 
ATOM   2529 C  CB  . TRP D 1 55 ? -36.447 -95.266  12.372  1.00 38.14  ? 180 TRP D CB  1 
ATOM   2530 C  CG  . TRP D 1 55 ? -37.767 -95.884  12.039  1.00 40.42  ? 180 TRP D CG  1 
ATOM   2531 C  CD1 . TRP D 1 55 ? -38.545 -96.634  12.859  1.00 44.83  ? 180 TRP D CD1 1 
ATOM   2532 C  CD2 . TRP D 1 55 ? -38.421 -95.872  10.764  1.00 40.78  ? 180 TRP D CD2 1 
ATOM   2533 N  NE1 . TRP D 1 55 ? -39.679 -97.039  12.196  1.00 45.78  ? 180 TRP D NE1 1 
ATOM   2534 C  CE2 . TRP D 1 55 ? -39.632 -96.578  10.908  1.00 46.50  ? 180 TRP D CE2 1 
ATOM   2535 C  CE3 . TRP D 1 55 ? -38.117 -95.300  9.517   1.00 41.62  ? 180 TRP D CE3 1 
ATOM   2536 C  CZ2 . TRP D 1 55 ? -40.524 -96.763  9.845   1.00 46.99  ? 180 TRP D CZ2 1 
ATOM   2537 C  CZ3 . TRP D 1 55 ? -39.012 -95.465  8.469   1.00 44.15  ? 180 TRP D CZ3 1 
ATOM   2538 C  CH2 . TRP D 1 55 ? -40.194 -96.198  8.635   1.00 46.40  ? 180 TRP D CH2 1 
ATOM   2539 N  N   . SER D 1 56 ? -38.449 -92.754  11.725  1.00 39.54  ? 181 SER D N   1 
ATOM   2540 C  CA  . SER D 1 56 ? -39.243 -92.013  10.761  1.00 38.65  ? 181 SER D CA  1 
ATOM   2541 C  C   . SER D 1 56 ? -39.401 -90.529  11.095  1.00 41.92  ? 181 SER D C   1 
ATOM   2542 O  O   . SER D 1 56 ? -39.029 -89.697  10.262  1.00 42.19  ? 181 SER D O   1 
ATOM   2543 C  CB  . SER D 1 56 ? -40.578 -92.703  10.515  1.00 41.54  ? 181 SER D CB  1 
ATOM   2544 O  OG  . SER D 1 56 ? -41.329 -91.995  9.544   1.00 50.73  ? 181 SER D OG  1 
ATOM   2545 N  N   . MET D 1 57 ? -39.896 -90.182  12.292  1.00 37.10  ? 182 MET D N   1 
ATOM   2546 C  CA  . MET D 1 57 ? -40.067 -88.763  12.621  1.00 37.26  ? 182 MET D CA  1 
ATOM   2547 C  C   . MET D 1 57 ? -38.723 -88.046  12.844  1.00 40.44  ? 182 MET D C   1 
ATOM   2548 O  O   . MET D 1 57 ? -38.594 -86.870  12.480  1.00 40.39  ? 182 MET D O   1 
ATOM   2549 C  CB  . MET D 1 57 ? -41.024 -88.523  13.819  1.00 41.20  ? 182 MET D CB  1 
ATOM   2550 C  CG  . MET D 1 57 ? -42.431 -89.139  13.679  1.00 46.53  ? 182 MET D CG  1 
ATOM   2551 S  SD  . MET D 1 57 ? -43.528 -88.527  12.362  1.00 51.70  ? 182 MET D SD  1 
ATOM   2552 C  CE  . MET D 1 57 ? -44.469 -87.299  13.246  1.00 49.84  ? 182 MET D CE  1 
ATOM   2553 N  N   . GLY D 1 58 ? -37.741 -88.774  13.388  1.00 35.85  ? 183 GLY D N   1 
ATOM   2554 C  CA  . GLY D 1 58 ? -36.419 -88.258  13.729  1.00 34.70  ? 183 GLY D CA  1 
ATOM   2555 C  C   . GLY D 1 58 ? -35.411 -88.141  12.609  1.00 37.84  ? 183 GLY D C   1 
ATOM   2556 O  O   . GLY D 1 58 ? -34.800 -87.079  12.466  1.00 38.55  ? 183 GLY D O   1 
ATOM   2557 N  N   . ILE D 1 59 ? -35.208 -89.225  11.825  1.00 32.85  ? 184 ILE D N   1 
ATOM   2558 C  CA  . ILE D 1 59 ? -34.241 -89.243  10.719  1.00 32.28  ? 184 ILE D CA  1 
ATOM   2559 C  C   . ILE D 1 59 ? -34.865 -89.300  9.293   1.00 38.81  ? 184 ILE D C   1 
ATOM   2560 O  O   . ILE D 1 59 ? -34.687 -88.352  8.523   1.00 39.57  ? 184 ILE D O   1 
ATOM   2561 C  CB  . ILE D 1 59 ? -33.173 -90.363  10.890  1.00 34.71  ? 184 ILE D CB  1 
ATOM   2562 C  CG1 . ILE D 1 59 ? -32.703 -90.573  12.359  1.00 35.54  ? 184 ILE D CG1 1 
ATOM   2563 C  CG2 . ILE D 1 59 ? -32.018 -90.231  9.865   1.00 33.51  ? 184 ILE D CG2 1 
ATOM   2564 C  CD1 . ILE D 1 59 ? -31.935 -89.408  13.052  1.00 44.41  ? 184 ILE D CD1 1 
ATOM   2565 N  N   . VAL D 1 60 ? -35.525 -90.436  8.929   1.00 34.55  ? 185 VAL D N   1 
ATOM   2566 C  CA  . VAL D 1 60 ? -36.072 -90.711  7.596   1.00 34.07  ? 185 VAL D CA  1 
ATOM   2567 C  C   . VAL D 1 60 ? -36.904 -89.576  6.963   1.00 38.12  ? 185 VAL D C   1 
ATOM   2568 O  O   . VAL D 1 60 ? -36.582 -89.169  5.837   1.00 36.99  ? 185 VAL D O   1 
ATOM   2569 C  CB  . VAL D 1 60 ? -36.672 -92.142  7.433   1.00 38.16  ? 185 VAL D CB  1 
ATOM   2570 C  CG1 . VAL D 1 60 ? -37.081 -92.419  5.993   1.00 38.48  ? 185 VAL D CG1 1 
ATOM   2571 C  CG2 . VAL D 1 60 ? -35.681 -93.201  7.884   1.00 37.78  ? 185 VAL D CG2 1 
ATOM   2572 N  N   . ARG D 1 61 ? -37.940 -89.051  7.677   1.00 34.42  ? 186 ARG D N   1 
ATOM   2573 C  CA  . ARG D 1 61 ? -38.764 -87.956  7.133   1.00 33.86  ? 186 ARG D CA  1 
ATOM   2574 C  C   . ARG D 1 61 ? -37.909 -86.704  6.820   1.00 37.26  ? 186 ARG D C   1 
ATOM   2575 O  O   . ARG D 1 61 ? -37.894 -86.338  5.637   1.00 37.10  ? 186 ARG D O   1 
ATOM   2576 C  CB  . ARG D 1 61 ? -40.018 -87.657  7.975   1.00 32.20  ? 186 ARG D CB  1 
ATOM   2577 C  CG  . ARG D 1 61 ? -41.066 -88.783  7.960   1.00 36.69  ? 186 ARG D CG  1 
ATOM   2578 C  CD  . ARG D 1 61 ? -42.368 -88.331  8.597   1.00 39.73  ? 186 ARG D CD  1 
ATOM   2579 N  NE  . ARG D 1 61 ? -43.366 -89.403  8.689   1.00 47.35  ? 186 ARG D NE  1 
ATOM   2580 C  CZ  . ARG D 1 61 ? -44.388 -89.561  7.848   1.00 55.85  ? 186 ARG D CZ  1 
ATOM   2581 N  NH1 . ARG D 1 61 ? -44.540 -88.739  6.812   1.00 39.82  ? 186 ARG D NH1 1 
ATOM   2582 N  NH2 . ARG D 1 61 ? -45.246 -90.561  8.017   1.00 32.17  ? 186 ARG D NH2 1 
ATOM   2583 N  N   . PRO D 1 62 ? -37.067 -86.149  7.771   1.00 32.41  ? 187 PRO D N   1 
ATOM   2584 C  CA  . PRO D 1 62 ? -36.197 -85.004  7.419   1.00 31.05  ? 187 PRO D CA  1 
ATOM   2585 C  C   . PRO D 1 62 ? -35.313 -85.214  6.178   1.00 32.54  ? 187 PRO D C   1 
ATOM   2586 O  O   . PRO D 1 62 ? -35.148 -84.277  5.373   1.00 31.10  ? 187 PRO D O   1 
ATOM   2587 C  CB  . PRO D 1 62 ? -35.336 -84.815  8.677   1.00 32.21  ? 187 PRO D CB  1 
ATOM   2588 C  CG  . PRO D 1 62 ? -36.127 -85.331  9.764   1.00 36.84  ? 187 PRO D CG  1 
ATOM   2589 C  CD  . PRO D 1 62 ? -36.940 -86.465  9.216   1.00 33.10  ? 187 PRO D CD  1 
ATOM   2590 N  N   . VAL D 1 63 ? -34.768 -86.452  6.015   1.00 28.07  ? 188 VAL D N   1 
ATOM   2591 C  CA  . VAL D 1 63 ? -33.905 -86.848  4.887   1.00 27.11  ? 188 VAL D CA  1 
ATOM   2592 C  C   . VAL D 1 63 ? -34.713 -86.912  3.586   1.00 34.56  ? 188 VAL D C   1 
ATOM   2593 O  O   . VAL D 1 63 ? -34.221 -86.452  2.550   1.00 35.79  ? 188 VAL D O   1 
ATOM   2594 C  CB  . VAL D 1 63 ? -33.052 -88.115  5.191   1.00 29.07  ? 188 VAL D CB  1 
ATOM   2595 C  CG1 . VAL D 1 63 ? -32.310 -88.618  3.969   1.00 29.11  ? 188 VAL D CG1 1 
ATOM   2596 C  CG2 . VAL D 1 63 ? -32.064 -87.843  6.306   1.00 28.52  ? 188 VAL D CG2 1 
ATOM   2597 N  N   . MET D 1 64 ? -35.978 -87.408  3.647   1.00 32.66  ? 189 MET D N   1 
ATOM   2598 C  CA  . MET D 1 64 ? -36.869 -87.478  2.472   1.00 33.42  ? 189 MET D CA  1 
ATOM   2599 C  C   . MET D 1 64 ? -37.244 -86.107  1.907   1.00 38.39  ? 189 MET D C   1 
ATOM   2600 O  O   . MET D 1 64 ? -37.465 -85.994  0.696   1.00 37.60  ? 189 MET D O   1 
ATOM   2601 C  CB  . MET D 1 64 ? -38.123 -88.317  2.720   1.00 35.67  ? 189 MET D CB  1 
ATOM   2602 C  CG  . MET D 1 64 ? -37.876 -89.800  2.698   1.00 38.58  ? 189 MET D CG  1 
ATOM   2603 S  SD  . MET D 1 64 ? -39.421 -90.720  2.543   1.00 43.99  ? 189 MET D SD  1 
ATOM   2604 C  CE  . MET D 1 64 ? -40.326 -90.103  3.999   1.00 40.95  ? 189 MET D CE  1 
ATOM   2605 N  N   . ASN D 1 65 ? -37.279 -85.059  2.786   1.00 35.02  ? 190 ASN D N   1 
ATOM   2606 C  CA  . ASN D 1 65 ? -37.566 -83.670  2.394   1.00 35.41  ? 190 ASN D CA  1 
ATOM   2607 C  C   . ASN D 1 65 ? -36.508 -83.108  1.446   1.00 40.29  ? 190 ASN D C   1 
ATOM   2608 O  O   . ASN D 1 65 ? -36.783 -82.161  0.710   1.00 43.17  ? 190 ASN D O   1 
ATOM   2609 C  CB  . ASN D 1 65 ? -37.776 -82.777  3.606   1.00 31.44  ? 190 ASN D CB  1 
ATOM   2610 C  CG  . ASN D 1 65 ? -39.071 -83.092  4.320   1.00 68.97  ? 190 ASN D CG  1 
ATOM   2611 O  OD1 . ASN D 1 65 ? -40.178 -83.029  3.744   1.00 72.90  ? 190 ASN D OD1 1 
ATOM   2612 N  ND2 . ASN D 1 65 ? -38.964 -83.469  5.587   1.00 60.88  ? 190 ASN D ND2 1 
ATOM   2613 N  N   . VAL D 1 66 ? -35.320 -83.730  1.435   1.00 33.53  ? 191 VAL D N   1 
ATOM   2614 C  CA  . VAL D 1 66 ? -34.198 -83.380  0.580   1.00 32.86  ? 191 VAL D CA  1 
ATOM   2615 C  C   . VAL D 1 66 ? -34.056 -84.490  -0.489  1.00 35.07  ? 191 VAL D C   1 
ATOM   2616 O  O   . VAL D 1 66 ? -34.003 -84.181  -1.686  1.00 33.66  ? 191 VAL D O   1 
ATOM   2617 C  CB  . VAL D 1 66 ? -32.913 -83.188  1.428   1.00 35.83  ? 191 VAL D CB  1 
ATOM   2618 C  CG1 . VAL D 1 66 ? -31.715 -82.846  0.547   1.00 36.27  ? 191 VAL D CG1 1 
ATOM   2619 C  CG2 . VAL D 1 66 ? -33.121 -82.113  2.495   1.00 36.00  ? 191 VAL D CG2 1 
ATOM   2620 N  N   . HIS D 1 67 ? -34.019 -85.773  -0.038  1.00 30.83  ? 192 HIS D N   1 
ATOM   2621 C  CA  . HIS D 1 67 ? -33.891 -86.962  -0.888  1.00 31.04  ? 192 HIS D CA  1 
ATOM   2622 C  C   . HIS D 1 67 ? -35.240 -87.700  -0.908  1.00 38.77  ? 192 HIS D C   1 
ATOM   2623 O  O   . HIS D 1 67 ? -35.496 -88.506  -0.024  1.00 40.33  ? 192 HIS D O   1 
ATOM   2624 C  CB  . HIS D 1 67 ? -32.742 -87.883  -0.404  1.00 30.12  ? 192 HIS D CB  1 
ATOM   2625 C  CG  . HIS D 1 67 ? -31.469 -87.155  -0.092  1.00 32.85  ? 192 HIS D CG  1 
ATOM   2626 N  ND1 . HIS D 1 67 ? -30.652 -86.669  -1.090  1.00 34.89  ? 192 HIS D ND1 1 
ATOM   2627 C  CD2 . HIS D 1 67 ? -30.934 -86.827  1.107   1.00 33.67  ? 192 HIS D CD2 1 
ATOM   2628 C  CE1 . HIS D 1 67 ? -29.649 -86.069  -0.475  1.00 34.40  ? 192 HIS D CE1 1 
ATOM   2629 N  NE2 . HIS D 1 67 ? -29.766 -86.155  0.847   1.00 34.06  ? 192 HIS D NE2 1 
ATOM   2630 N  N   . PRO D 1 68 ? -36.132 -87.428  -1.880  1.00 35.28  ? 193 PRO D N   1 
ATOM   2631 C  CA  . PRO D 1 68 ? -37.452 -88.067  -1.871  1.00 35.36  ? 193 PRO D CA  1 
ATOM   2632 C  C   . PRO D 1 68 ? -37.485 -89.591  -1.851  1.00 42.02  ? 193 PRO D C   1 
ATOM   2633 O  O   . PRO D 1 68 ? -38.321 -90.175  -1.179  1.00 41.87  ? 193 PRO D O   1 
ATOM   2634 C  CB  . PRO D 1 68 ? -38.108 -87.490  -3.123  1.00 38.41  ? 193 PRO D CB  1 
ATOM   2635 C  CG  . PRO D 1 68 ? -37.456 -86.159  -3.305  1.00 42.66  ? 193 PRO D CG  1 
ATOM   2636 C  CD  . PRO D 1 68 ? -36.031 -86.462  -2.992  1.00 37.80  ? 193 PRO D CD  1 
ATOM   2637 N  N   . ASN D 1 69 ? -36.581 -90.232  -2.578  1.00 42.37  ? 194 ASN D N   1 
ATOM   2638 C  CA  . ASN D 1 69 ? -36.533 -91.690  -2.662  1.00 43.62  ? 194 ASN D CA  1 
ATOM   2639 C  C   . ASN D 1 69 ? -35.797 -92.349  -1.497  1.00 47.60  ? 194 ASN D C   1 
ATOM   2640 O  O   . ASN D 1 69 ? -35.651 -93.573  -1.526  1.00 48.51  ? 194 ASN D O   1 
ATOM   2641 C  CB  . ASN D 1 69 ? -35.910 -92.139  -3.991  1.00 47.92  ? 194 ASN D CB  1 
ATOM   2642 C  CG  . ASN D 1 69 ? -36.721 -91.847  -5.235  1.00 84.05  ? 194 ASN D CG  1 
ATOM   2643 O  OD1 . ASN D 1 69 ? -37.950 -91.666  -5.204  1.00 75.89  ? 194 ASN D OD1 1 
ATOM   2644 N  ND2 . ASN D 1 69 ? -36.042 -91.852  -6.380  1.00 83.35  ? 194 ASN D ND2 1 
ATOM   2645 N  N   . ALA D 1 70 ? -35.347 -91.571  -0.470  1.00 42.34  ? 195 ALA D N   1 
ATOM   2646 C  CA  . ALA D 1 70 ? -34.591 -92.089  0.689   1.00 40.95  ? 195 ALA D CA  1 
ATOM   2647 C  C   . ALA D 1 70 ? -35.196 -93.333  1.359   1.00 44.84  ? 195 ALA D C   1 
ATOM   2648 O  O   . ALA D 1 70 ? -34.453 -94.111  1.963   1.00 45.62  ? 195 ALA D O   1 
ATOM   2649 C  CB  . ALA D 1 70 ? -34.349 -90.991  1.720   1.00 40.67  ? 195 ALA D CB  1 
ATOM   2650 N  N   . TRP D 1 71 ? -36.521 -93.543  1.206   1.00 40.23  ? 196 TRP D N   1 
ATOM   2651 C  CA  . TRP D 1 71 ? -37.262 -94.671  1.776   1.00 40.30  ? 196 TRP D CA  1 
ATOM   2652 C  C   . TRP D 1 71 ? -36.867 -96.028  1.180   1.00 42.58  ? 196 TRP D C   1 
ATOM   2653 O  O   . TRP D 1 71 ? -37.054 -97.061  1.825   1.00 42.49  ? 196 TRP D O   1 
ATOM   2654 C  CB  . TRP D 1 71 ? -38.781 -94.430  1.671   1.00 40.29  ? 196 TRP D CB  1 
ATOM   2655 C  CG  . TRP D 1 71 ? -39.276 -94.327  0.265   1.00 42.26  ? 196 TRP D CG  1 
ATOM   2656 C  CD1 . TRP D 1 71 ? -39.372 -93.198  -0.497  1.00 45.08  ? 196 TRP D CD1 1 
ATOM   2657 C  CD2 . TRP D 1 71 ? -39.706 -95.408  -0.560  1.00 44.13  ? 196 TRP D CD2 1 
ATOM   2658 N  NE1 . TRP D 1 71 ? -39.862 -93.508  -1.742  1.00 45.65  ? 196 TRP D NE1 1 
ATOM   2659 C  CE2 . TRP D 1 71 ? -40.057 -94.862  -1.817  1.00 48.60  ? 196 TRP D CE2 1 
ATOM   2660 C  CE3 . TRP D 1 71 ? -39.846 -96.793  -0.354  1.00 46.85  ? 196 TRP D CE3 1 
ATOM   2661 C  CZ2 . TRP D 1 71 ? -40.527 -95.654  -2.871  1.00 50.25  ? 196 TRP D CZ2 1 
ATOM   2662 C  CZ3 . TRP D 1 71 ? -40.295 -97.580  -1.404  1.00 50.64  ? 196 TRP D CZ3 1 
ATOM   2663 C  CH2 . TRP D 1 71 ? -40.650 -97.010  -2.638  1.00 52.07  ? 196 TRP D CH2 1 
ATOM   2664 N  N   . VAL D 1 72 ? -36.334 -96.025  -0.050  1.00 38.23  ? 197 VAL D N   1 
ATOM   2665 C  CA  . VAL D 1 72 ? -35.890 -97.234  -0.763  1.00 38.91  ? 197 VAL D CA  1 
ATOM   2666 C  C   . VAL D 1 72 ? -34.630 -97.790  -0.091  1.00 42.31  ? 197 VAL D C   1 
ATOM   2667 O  O   . VAL D 1 72 ? -34.338 -98.978  -0.222  1.00 42.75  ? 197 VAL D O   1 
ATOM   2668 C  CB  . VAL D 1 72 ? -35.700 -96.973  -2.291  1.00 43.11  ? 197 VAL D CB  1 
ATOM   2669 C  CG1 . VAL D 1 72 ? -35.356 -98.253  -3.052  1.00 44.17  ? 197 VAL D CG1 1 
ATOM   2670 C  CG2 . VAL D 1 72 ? -36.945 -96.334  -2.888  1.00 43.63  ? 197 VAL D CG2 1 
ATOM   2671 N  N   . PHE D 1 73 ? -33.882 -96.924  0.617   1.00 38.01  ? 198 PHE D N   1 
ATOM   2672 C  CA  . PHE D 1 73 ? -32.683 -97.322  1.335   1.00 37.90  ? 198 PHE D CA  1 
ATOM   2673 C  C   . PHE D 1 73 ? -33.095 -97.828  2.706   1.00 40.84  ? 198 PHE D C   1 
ATOM   2674 O  O   . PHE D 1 73 ? -32.847 -98.993  3.032   1.00 42.28  ? 198 PHE D O   1 
ATOM   2675 C  CB  . PHE D 1 73 ? -31.685 -96.144  1.468   1.00 39.26  ? 198 PHE D CB  1 
ATOM   2676 C  CG  . PHE D 1 73 ? -30.458 -96.429  2.321   1.00 41.52  ? 198 PHE D CG  1 
ATOM   2677 C  CD1 . PHE D 1 73 ? -30.460 -96.164  3.685   1.00 44.41  ? 198 PHE D CD1 1 
ATOM   2678 C  CD2 . PHE D 1 73 ? -29.297 -96.937  1.751   1.00 46.21  ? 198 PHE D CD2 1 
ATOM   2679 C  CE1 . PHE D 1 73 ? -29.340 -96.443  4.470   1.00 45.91  ? 198 PHE D CE1 1 
ATOM   2680 C  CE2 . PHE D 1 73 ? -28.157 -97.173  2.529   1.00 49.21  ? 198 PHE D CE2 1 
ATOM   2681 C  CZ  . PHE D 1 73 ? -28.194 -96.942  3.884   1.00 46.78  ? 198 PHE D CZ  1 
ATOM   2682 N  N   . PHE D 1 74 ? -33.716 -96.941  3.503   1.00 34.28  ? 199 PHE D N   1 
ATOM   2683 C  CA  . PHE D 1 74 ? -34.076 -97.184  4.884   1.00 33.67  ? 199 PHE D CA  1 
ATOM   2684 C  C   . PHE D 1 74 ? -35.121 -98.255  5.183   1.00 37.80  ? 199 PHE D C   1 
ATOM   2685 O  O   . PHE D 1 74 ? -34.908 -99.007  6.135   1.00 37.79  ? 199 PHE D O   1 
ATOM   2686 C  CB  . PHE D 1 74 ? -34.376 -95.872  5.599   1.00 34.70  ? 199 PHE D CB  1 
ATOM   2687 C  CG  . PHE D 1 74 ? -33.216 -94.905  5.691   1.00 35.07  ? 199 PHE D CG  1 
ATOM   2688 C  CD1 . PHE D 1 74 ? -32.195 -95.102  6.621   1.00 37.64  ? 199 PHE D CD1 1 
ATOM   2689 C  CD2 . PHE D 1 74 ? -33.190 -93.750  4.914   1.00 36.12  ? 199 PHE D CD2 1 
ATOM   2690 C  CE1 . PHE D 1 74 ? -31.133 -94.193  6.725   1.00 37.69  ? 199 PHE D CE1 1 
ATOM   2691 C  CE2 . PHE D 1 74 ? -32.143 -92.829  5.036   1.00 38.47  ? 199 PHE D CE2 1 
ATOM   2692 C  CZ  . PHE D 1 74 ? -31.113 -93.065  5.933   1.00 36.35  ? 199 PHE D CZ  1 
ATOM   2693 N  N   . ILE D 1 75 ? -36.246 -98.326  4.426   1.00 34.07  ? 200 ILE D N   1 
ATOM   2694 C  CA  . ILE D 1 75 ? -37.269 -99.362  4.679   1.00 35.38  ? 200 ILE D CA  1 
ATOM   2695 C  C   . ILE D 1 75 ? -36.695 -100.786 4.516   1.00 41.33  ? 200 ILE D C   1 
ATOM   2696 O  O   . ILE D 1 75 ? -36.791 -101.553 5.478   1.00 41.34  ? 200 ILE D O   1 
ATOM   2697 C  CB  . ILE D 1 75 ? -38.675 -99.092  4.056   1.00 39.30  ? 200 ILE D CB  1 
ATOM   2698 C  CG1 . ILE D 1 75 ? -39.332 -97.871  4.751   1.00 38.07  ? 200 ILE D CG1 1 
ATOM   2699 C  CG2 . ILE D 1 75 ? -39.609 -100.342 4.100   1.00 42.27  ? 200 ILE D CG2 1 
ATOM   2700 C  CD1 . ILE D 1 75 ? -40.463 -97.217  4.002   1.00 44.68  ? 200 ILE D CD1 1 
ATOM   2701 N  N   . PRO D 1 76 ? -35.952 -101.106 3.418   1.00 39.20  ? 201 PRO D N   1 
ATOM   2702 C  CA  . PRO D 1 76 ? -35.316 -102.431 3.317   1.00 40.57  ? 201 PRO D CA  1 
ATOM   2703 C  C   . PRO D 1 76 ? -34.303 -102.719 4.431   1.00 43.84  ? 201 PRO D C   1 
ATOM   2704 O  O   . PRO D 1 76 ? -34.290 -103.842 4.933   1.00 44.68  ? 201 PRO D O   1 
ATOM   2705 C  CB  . PRO D 1 76 ? -34.661 -102.392 1.933   1.00 42.62  ? 201 PRO D CB  1 
ATOM   2706 C  CG  . PRO D 1 76 ? -35.489 -101.421 1.168   1.00 46.73  ? 201 PRO D CG  1 
ATOM   2707 C  CD  . PRO D 1 76 ? -35.719 -100.339 2.181   1.00 40.60  ? 201 PRO D CD  1 
ATOM   2708 N  N   . PHE D 1 77 ? -33.496 -101.704 4.852   1.00 38.92  ? 202 PHE D N   1 
ATOM   2709 C  CA  . PHE D 1 77 ? -32.513 -101.830 5.943   1.00 38.41  ? 202 PHE D CA  1 
ATOM   2710 C  C   . PHE D 1 77 ? -33.205 -102.297 7.222   1.00 44.62  ? 202 PHE D C   1 
ATOM   2711 O  O   . PHE D 1 77 ? -32.676 -103.177 7.892   1.00 45.77  ? 202 PHE D O   1 
ATOM   2712 C  CB  . PHE D 1 77 ? -31.749 -100.508 6.194   1.00 37.89  ? 202 PHE D CB  1 
ATOM   2713 C  CG  . PHE D 1 77 ? -30.696 -100.583 7.287   1.00 38.54  ? 202 PHE D CG  1 
ATOM   2714 C  CD1 . PHE D 1 77 ? -31.017 -100.291 8.607   1.00 40.78  ? 202 PHE D CD1 1 
ATOM   2715 C  CD2 . PHE D 1 77 ? -29.383 -100.921 6.988   1.00 41.14  ? 202 PHE D CD2 1 
ATOM   2716 C  CE1 . PHE D 1 77 ? -30.053 -100.376 9.618   1.00 41.92  ? 202 PHE D CE1 1 
ATOM   2717 C  CE2 . PHE D 1 77 ? -28.417 -100.998 7.997   1.00 44.42  ? 202 PHE D CE2 1 
ATOM   2718 C  CZ  . PHE D 1 77 ? -28.758 -100.719 9.307   1.00 42.09  ? 202 PHE D CZ  1 
ATOM   2719 N  N   . ILE D 1 78 ? -34.381 -101.706 7.550   1.00 41.26  ? 203 ILE D N   1 
ATOM   2720 C  CA  . ILE D 1 78 ? -35.213 -102.054 8.704   1.00 42.50  ? 203 ILE D CA  1 
ATOM   2721 C  C   . ILE D 1 78 ? -35.696 -103.497 8.534   1.00 54.30  ? 203 ILE D C   1 
ATOM   2722 O  O   . ILE D 1 78 ? -35.456 -104.321 9.413   1.00 56.32  ? 203 ILE D O   1 
ATOM   2723 C  CB  . ILE D 1 78 ? -36.398 -101.045 8.869   1.00 43.68  ? 203 ILE D CB  1 
ATOM   2724 C  CG1 . ILE D 1 78 ? -35.901 -99.694  9.406   1.00 41.05  ? 203 ILE D CG1 1 
ATOM   2725 C  CG2 . ILE D 1 78 ? -37.521 -101.610 9.750   1.00 44.98  ? 203 ILE D CG2 1 
ATOM   2726 C  CD1 . ILE D 1 78 ? -36.743 -98.548  9.065   1.00 39.77  ? 203 ILE D CD1 1 
ATOM   2727 N  N   . MET D 1 79 ? -36.332 -103.804 7.390   1.00 54.77  ? 204 MET D N   1 
ATOM   2728 C  CA  . MET D 1 79 ? -36.862 -105.128 7.089   1.00 59.21  ? 204 MET D CA  1 
ATOM   2729 C  C   . MET D 1 79 ? -35.773 -106.198 7.171   1.00 65.50  ? 204 MET D C   1 
ATOM   2730 O  O   . MET D 1 79 ? -36.012 -107.258 7.751   1.00 67.94  ? 204 MET D O   1 
ATOM   2731 C  CB  . MET D 1 79 ? -37.592 -105.130 5.734   1.00 63.38  ? 204 MET D CB  1 
ATOM   2732 C  CG  . MET D 1 79 ? -38.724 -104.087 5.659   1.00 67.49  ? 204 MET D CG  1 
ATOM   2733 S  SD  . MET D 1 79 ? -39.851 -104.113 4.223   1.00 74.55  ? 204 MET D SD  1 
ATOM   2734 C  CE  . MET D 1 79 ? -38.695 -103.856 2.853   1.00 70.27  ? 204 MET D CE  1 
ATOM   2735 N  N   . LEU D 1 80 ? -34.558 -105.874 6.685   1.00 61.26  ? 205 LEU D N   1 
ATOM   2736 C  CA  . LEU D 1 80 ? -33.391 -106.753 6.685   1.00 62.87  ? 205 LEU D CA  1 
ATOM   2737 C  C   . LEU D 1 80 ? -32.798 -106.974 8.070   1.00 67.66  ? 205 LEU D C   1 
ATOM   2738 O  O   . LEU D 1 80 ? -32.636 -108.127 8.460   1.00 69.44  ? 205 LEU D O   1 
ATOM   2739 C  CB  . LEU D 1 80 ? -32.314 -106.237 5.705   1.00 62.11  ? 205 LEU D CB  1 
ATOM   2740 C  CG  . LEU D 1 80 ? -30.983 -107.016 5.605   1.00 68.50  ? 205 LEU D CG  1 
ATOM   2741 C  CD1 . LEU D 1 80 ? -31.156 -108.358 4.883   1.00 71.68  ? 205 LEU D CD1 1 
ATOM   2742 C  CD2 . LEU D 1 80 ? -29.940 -106.195 4.880   1.00 69.81  ? 205 LEU D CD2 1 
ATOM   2743 N  N   . THR D 1 81 ? -32.436 -105.886 8.789   1.00 63.04  ? 206 THR D N   1 
ATOM   2744 C  CA  . THR D 1 81 ? -31.823 -105.954 10.124  1.00 63.03  ? 206 THR D CA  1 
ATOM   2745 C  C   . THR D 1 81 ? -32.735 -106.591 11.159  1.00 69.26  ? 206 THR D C   1 
ATOM   2746 O  O   . THR D 1 81 ? -32.301 -107.516 11.839  1.00 70.55  ? 206 THR D O   1 
ATOM   2747 C  CB  . THR D 1 81 ? -31.248 -104.606 10.583  1.00 68.12  ? 206 THR D CB  1 
ATOM   2748 O  OG1 . THR D 1 81 ? -32.294 -103.643 10.674  1.00 66.97  ? 206 THR D OG1 1 
ATOM   2749 C  CG2 . THR D 1 81 ? -30.110 -104.107 9.694   1.00 65.22  ? 206 THR D CG2 1 
ATOM   2750 N  N   . THR D 1 82 ? -34.008 -106.157 11.240  1.00 66.79  ? 207 THR D N   1 
ATOM   2751 C  CA  . THR D 1 82 ? -34.985 -106.724 12.182  1.00 69.12  ? 207 THR D CA  1 
ATOM   2752 C  C   . THR D 1 82 ? -35.435 -108.136 11.746  1.00 77.84  ? 207 THR D C   1 
ATOM   2753 O  O   . THR D 1 82 ? -36.602 -108.509 11.880  1.00 79.12  ? 207 THR D O   1 
ATOM   2754 C  CB  . THR D 1 82 ? -36.109 -105.720 12.531  1.00 75.70  ? 207 THR D CB  1 
ATOM   2755 O  OG1 . THR D 1 82 ? -36.933 -105.502 11.389  1.00 74.50  ? 207 THR D OG1 1 
ATOM   2756 C  CG2 . THR D 1 82 ? -35.576 -104.386 13.077  1.00 72.38  ? 207 THR D CG2 1 
ATOM   2757 N  N   . PHE D 1 83 ? -34.469 -108.909 11.225  1.00 76.81  ? 208 PHE D N   1 
ATOM   2758 C  CA  . PHE D 1 83 ? -34.574 -110.281 10.756  1.00 80.75  ? 208 PHE D CA  1 
ATOM   2759 C  C   . PHE D 1 83 ? -33.198 -110.920 10.922  1.00 87.28  ? 208 PHE D C   1 
ATOM   2760 O  O   . PHE D 1 83 ? -33.106 -112.034 11.439  1.00 89.62  ? 208 PHE D O   1 
ATOM   2761 C  CB  . PHE D 1 83 ? -35.025 -110.337 9.282   1.00 83.12  ? 208 PHE D CB  1 
ATOM   2762 C  CG  . PHE D 1 83 ? -35.257 -111.743 8.775   1.00 88.63  ? 208 PHE D CG  1 
ATOM   2763 C  CD1 . PHE D 1 83 ? -36.530 -112.303 8.786   1.00 94.56  ? 208 PHE D CD1 1 
ATOM   2764 C  CD2 . PHE D 1 83 ? -34.198 -112.517 8.305   1.00 91.83  ? 208 PHE D CD2 1 
ATOM   2765 C  CE1 . PHE D 1 83 ? -36.741 -113.612 8.339   1.00 99.20  ? 208 PHE D CE1 1 
ATOM   2766 C  CE2 . PHE D 1 83 ? -34.408 -113.827 7.868   1.00 98.45  ? 208 PHE D CE2 1 
ATOM   2767 C  CZ  . PHE D 1 83 ? -35.678 -114.365 7.884   1.00 99.28  ? 208 PHE D CZ  1 
ATOM   2768 N  N   . THR D 1 84 ? -32.134 -110.221 10.460  1.00 83.50  ? 209 THR D N   1 
ATOM   2769 C  CA  . THR D 1 84 ? -30.740 -110.675 10.539  1.00 84.97  ? 209 THR D CA  1 
ATOM   2770 C  C   . THR D 1 84 ? -30.316 -110.807 12.006  1.00 92.20  ? 209 THR D C   1 
ATOM   2771 O  O   . THR D 1 84 ? -29.641 -111.777 12.356  1.00 94.52  ? 209 THR D O   1 
ATOM   2772 C  CB  . THR D 1 84 ? -29.796 -109.767 9.713   1.00 90.47  ? 209 THR D CB  1 
ATOM   2773 O  OG1 . THR D 1 84 ? -30.386 -109.477 8.444   1.00 91.09  ? 209 THR D OG1 1 
ATOM   2774 C  CG2 . THR D 1 84 ? -28.414 -110.392 9.492   1.00 88.77  ? 209 THR D CG2 1 
ATOM   2775 N  N   . VAL D 1 85 ? -30.733 -109.850 12.860  1.00 88.57  ? 210 VAL D N   1 
ATOM   2776 C  CA  . VAL D 1 85 ? -30.434 -109.879 14.296  1.00 89.54  ? 210 VAL D CA  1 
ATOM   2777 C  C   . VAL D 1 85 ? -31.424 -110.827 15.005  1.00 98.00  ? 210 VAL D C   1 
ATOM   2778 O  O   . VAL D 1 85 ? -31.051 -111.468 15.990  1.00 99.44  ? 210 VAL D O   1 
ATOM   2779 C  CB  . VAL D 1 85 ? -30.336 -108.481 14.982  1.00 90.48  ? 210 VAL D CB  1 
ATOM   2780 C  CG1 . VAL D 1 85 ? -29.424 -108.540 16.207  1.00 90.60  ? 210 VAL D CG1 1 
ATOM   2781 C  CG2 . VAL D 1 85 ? -29.845 -107.406 14.015  1.00 87.56  ? 210 VAL D CG2 1 
ATOM   2782 N  N   . LEU D 1 86 ? -32.659 -110.952 14.466  1.00 96.52  ? 211 LEU D N   1 
ATOM   2783 C  CA  . LEU D 1 86 ? -33.707 -111.837 14.991  1.00 100.25 ? 211 LEU D CA  1 
ATOM   2784 C  C   . LEU D 1 86 ? -33.350 -113.319 14.820  1.00 109.85 ? 211 LEU D C   1 
ATOM   2785 O  O   . LEU D 1 86 ? -33.846 -114.164 15.565  1.00 112.00 ? 211 LEU D O   1 
ATOM   2786 C  CB  . LEU D 1 86 ? -35.050 -111.527 14.305  1.00 100.23 ? 211 LEU D CB  1 
ATOM   2787 C  CG  . LEU D 1 86 ? -36.306 -111.398 15.180  1.00 105.89 ? 211 LEU D CG  1 
ATOM   2788 C  CD1 . LEU D 1 86 ? -36.858 -112.751 15.595  1.00 110.19 ? 211 LEU D CD1 1 
ATOM   2789 C  CD2 . LEU D 1 86 ? -36.107 -110.434 16.352  1.00 106.55 ? 211 LEU D CD2 1 
ATOM   2790 N  N   . ASN D 1 87 ? -32.494 -113.624 13.840  1.00 108.71 ? 212 ASN D N   1 
ATOM   2791 C  CA  . ASN D 1 87 ? -32.004 -114.970 13.572  1.00 113.09 ? 212 ASN D CA  1 
ATOM   2792 C  C   . ASN D 1 87 ? -30.719 -115.219 14.365  1.00 119.88 ? 212 ASN D C   1 
ATOM   2793 O  O   . ASN D 1 87 ? -30.546 -116.311 14.911  1.00 122.94 ? 212 ASN D O   1 
ATOM   2794 C  CB  . ASN D 1 87 ? -31.769 -115.170 12.073  1.00 114.14 ? 212 ASN D CB  1 
ATOM   2795 C  CG  . ASN D 1 87 ? -33.011 -115.485 11.275  1.00 139.24 ? 212 ASN D CG  1 
ATOM   2796 O  OD1 . ASN D 1 87 ? -34.148 -115.440 11.766  1.00 132.84 ? 212 ASN D OD1 1 
ATOM   2797 N  ND2 . ASN D 1 87 ? -32.812 -115.829 10.014  1.00 133.91 ? 212 ASN D ND2 1 
ATOM   2798 N  N   . LEU D 1 88 ? -29.830 -114.195 14.434  1.00 114.88 ? 213 LEU D N   1 
ATOM   2799 C  CA  . LEU D 1 88 ? -28.552 -114.224 15.153  1.00 115.33 ? 213 LEU D CA  1 
ATOM   2800 C  C   . LEU D 1 88 ? -28.757 -114.466 16.649  1.00 122.61 ? 213 LEU D C   1 
ATOM   2801 O  O   . LEU D 1 88 ? -28.147 -115.386 17.198  1.00 125.38 ? 213 LEU D O   1 
ATOM   2802 C  CB  . LEU D 1 88 ? -27.766 -112.922 14.930  1.00 111.67 ? 213 LEU D CB  1 
ATOM   2803 N  N   . PHE D 1 89 ? -29.627 -113.656 17.297  1.00 118.34 ? 214 PHE D N   1 
ATOM   2804 C  CA  . PHE D 1 89 ? -29.932 -113.763 18.724  1.00 119.75 ? 214 PHE D CA  1 
ATOM   2805 C  C   . PHE D 1 89 ? -30.615 -115.081 19.085  1.00 127.44 ? 214 PHE D C   1 
ATOM   2806 O  O   . PHE D 1 89 ? -30.245 -115.688 20.091  1.00 129.34 ? 214 PHE D O   1 
ATOM   2807 C  CB  . PHE D 1 89 ? -30.745 -112.553 19.222  1.00 119.43 ? 214 PHE D CB  1 
ATOM   2808 C  CG  . PHE D 1 89 ? -29.951 -111.346 19.685  1.00 118.47 ? 214 PHE D CG  1 
ATOM   2809 C  CD1 . PHE D 1 89 ? -28.782 -111.499 20.424  1.00 122.52 ? 214 PHE D CD1 1 
ATOM   2810 C  CD2 . PHE D 1 89 ? -30.416 -110.057 19.453  1.00 118.08 ? 214 PHE D CD2 1 
ATOM   2811 C  CE1 . PHE D 1 89 ? -28.070 -110.384 20.883  1.00 121.24 ? 214 PHE D CE1 1 
ATOM   2812 C  CE2 . PHE D 1 89 ? -29.701 -108.942 19.909  1.00 118.73 ? 214 PHE D CE2 1 
ATOM   2813 C  CZ  . PHE D 1 89 ? -28.535 -109.114 20.624  1.00 117.50 ? 214 PHE D CZ  1 
ATOM   2814 N  N   . ILE D 1 90 ? -31.579 -115.539 18.252  1.00 125.00 ? 215 ILE D N   1 
ATOM   2815 C  CA  . ILE D 1 90 ? -32.291 -116.809 18.446  1.00 129.14 ? 215 ILE D CA  1 
ATOM   2816 C  C   . ILE D 1 90 ? -31.354 -118.023 18.266  1.00 135.58 ? 215 ILE D C   1 
ATOM   2817 O  O   . ILE D 1 90 ? -31.508 -119.024 18.970  1.00 138.90 ? 215 ILE D O   1 
ATOM   2818 C  CB  . ILE D 1 90 ? -33.618 -116.855 17.629  1.00 133.02 ? 215 ILE D CB  1 
ATOM   2819 C  CG1 . ILE D 1 90 ? -34.789 -116.334 18.494  1.00 133.36 ? 215 ILE D CG1 1 
ATOM   2820 C  CG2 . ILE D 1 90 ? -33.928 -118.247 17.044  1.00 138.32 ? 215 ILE D CG2 1 
ATOM   2821 C  CD1 . ILE D 1 90 ? -36.013 -115.826 17.729  1.00 140.56 ? 215 ILE D CD1 1 
ATOM   2822 N  N   . GLY D 1 91 ? -30.366 -117.881 17.378  1.00 130.31 ? 216 GLY D N   1 
ATOM   2823 C  CA  . GLY D 1 91 ? -29.346 -118.891 17.107  1.00 132.61 ? 216 GLY D CA  1 
ATOM   2824 C  C   . GLY D 1 91 ? -28.453 -119.170 18.302  1.00 137.21 ? 216 GLY D C   1 
ATOM   2825 O  O   . GLY D 1 91 ? -28.066 -120.321 18.526  1.00 140.55 ? 216 GLY D O   1 
ATOM   2826 N  N   . ILE D 1 92 ? -28.136 -118.111 19.090  1.00 130.40 ? 217 ILE D N   1 
ATOM   2827 C  CA  . ILE D 1 92 ? -27.319 -118.177 20.313  1.00 130.81 ? 217 ILE D CA  1 
ATOM   2828 C  C   . ILE D 1 92 ? -28.064 -118.992 21.395  1.00 138.71 ? 217 ILE D C   1 
ATOM   2829 O  O   . ILE D 1 92 ? -27.437 -119.792 22.092  1.00 141.19 ? 217 ILE D O   1 
ATOM   2830 C  CB  . ILE D 1 92 ? -26.879 -116.755 20.800  1.00 129.49 ? 217 ILE D CB  1 
ATOM   2831 C  CG1 . ILE D 1 92 ? -26.014 -116.042 19.733  1.00 126.64 ? 217 ILE D CG1 1 
ATOM   2832 C  CG2 . ILE D 1 92 ? -26.131 -116.811 22.145  1.00 131.10 ? 217 ILE D CG2 1 
ATOM   2833 C  CD1 . ILE D 1 92 ? -26.037 -114.512 19.777  1.00 128.15 ? 217 ILE D CD1 1 
ATOM   2834 N  N   . ILE D 1 93 ? -29.403 -118.808 21.493  1.00 135.61 ? 218 ILE D N   1 
ATOM   2835 C  CA  . ILE D 1 93 ? -30.305 -119.495 22.434  1.00 139.06 ? 218 ILE D CA  1 
ATOM   2836 C  C   . ILE D 1 93 ? -30.302 -121.025 22.199  1.00 148.67 ? 218 ILE D C   1 
ATOM   2837 O  O   . ILE D 1 93 ? -30.227 -121.792 23.164  1.00 151.87 ? 218 ILE D O   1 
ATOM   2838 C  CB  . ILE D 1 93 ? -31.743 -118.870 22.393  1.00 140.84 ? 218 ILE D CB  1 
ATOM   2839 C  CG1 . ILE D 1 93 ? -31.714 -117.362 22.751  1.00 136.43 ? 218 ILE D CG1 1 
ATOM   2840 C  CG2 . ILE D 1 93 ? -32.734 -119.630 23.299  1.00 145.86 ? 218 ILE D CG2 1 
ATOM   2841 C  CD1 . ILE D 1 93 ? -32.917 -116.536 22.270  1.00 140.52 ? 218 ILE D CD1 1 
ATOM   2842 N  N   . VAL D 1 94 ? -30.356 -121.453 20.920  1.00 146.10 ? 219 VAL D N   1 
ATOM   2843 C  CA  . VAL D 1 94 ? -30.363 -122.867 20.525  1.00 150.95 ? 219 VAL D CA  1 
ATOM   2844 C  C   . VAL D 1 94 ? -28.971 -123.509 20.716  1.00 156.95 ? 219 VAL D C   1 
ATOM   2845 O  O   . VAL D 1 94 ? -28.880 -124.585 21.313  1.00 161.21 ? 219 VAL D O   1 
ATOM   2846 C  CB  . VAL D 1 94 ? -30.949 -123.090 19.097  1.00 155.05 ? 219 VAL D CB  1 
ATOM   2847 C  CG1 . VAL D 1 94 ? -31.033 -124.576 18.747  1.00 160.51 ? 219 VAL D CG1 1 
ATOM   2848 C  CG2 . VAL D 1 94 ? -32.324 -122.439 18.955  1.00 153.32 ? 219 VAL D CG2 1 
ATOM   2849 N  N   . ASP D 1 95 ? -27.902 -122.842 20.227  1.00 150.19 ? 220 ASP D N   1 
ATOM   2850 C  CA  . ASP D 1 95 ? -26.520 -123.329 20.319  1.00 184.41 ? 220 ASP D CA  1 
ATOM   2851 C  C   . ASP D 1 95 ? -25.956 -123.306 21.743  1.00 207.10 ? 220 ASP D C   1 
ATOM   2852 O  O   . ASP D 1 95 ? -25.879 -122.255 22.375  1.00 161.56 ? 220 ASP D O   1 
ATOM   2853 C  CB  . ASP D 1 95 ? -25.601 -122.580 19.339  1.00 182.73 ? 220 ASP D CB  1 
ATOM   2854 C  CG  . ASP D 1 95 ? -25.730 -123.052 17.905  1.00 193.93 ? 220 ASP D CG  1 
ATOM   2855 O  OD1 . ASP D 1 95 ? -25.122 -124.090 17.565  1.00 198.18 ? 220 ASP D OD1 1 
ATOM   2856 O  OD2 . ASP D 1 95 ? -26.429 -122.378 17.119  1.00 196.95 ? 220 ASP D OD2 1 
HETATM 2857 C  C9  . 2CV E 2 .  ? -23.532 -60.759  26.250  1.00 64.01  ? 300 2CV A C9  1 
HETATM 2858 C  C12 . 2CV E 2 .  ? -22.251 -61.558  26.369  1.00 60.92  ? 300 2CV A C12 1 
HETATM 2859 C  C15 . 2CV E 2 .  ? -22.382 -62.993  25.910  1.00 56.08  ? 300 2CV A C15 1 
HETATM 2860 C  C18 . 2CV E 2 .  ? -21.126 -63.829  26.083  1.00 56.64  ? 300 2CV A C18 1 
HETATM 2861 C  C21 . 2CV E 2 .  ? -21.407 -65.291  25.935  1.00 58.45  ? 300 2CV A C21 1 
HETATM 2862 C  C24 . 2CV E 2 .  ? -20.221 -66.213  26.063  1.00 64.21  ? 300 2CV A C24 1 
HETATM 2863 C  C27 . 2CV E 2 .  ? -20.618 -67.645  25.707  1.00 69.17  ? 300 2CV A C27 1 
HETATM 2864 C  C30 . 2CV E 2 .  ? -19.523 -68.656  25.974  1.00 73.86  ? 300 2CV A C30 1 
HETATM 2865 N  N33 . 2CV E 2 .  ? -19.880 -69.946  26.192  1.00 77.72  ? 300 2CV A N33 1 
HETATM 2866 O  O34 . 2CV E 2 .  ? -18.353 -68.306  25.963  1.00 73.93  ? 300 2CV A O34 1 
HETATM 2867 C  C35 . 2CV E 2 .  ? -21.288 -70.403  26.115  1.00 73.22  ? 300 2CV A C35 1 
HETATM 2868 C  C36 . 2CV E 2 .  ? -18.814 -70.880  26.585  1.00 85.14  ? 300 2CV A C36 1 
HETATM 2869 C  C37 . 2CV E 2 .  ? -18.047 -71.483  25.411  1.00 91.20  ? 300 2CV A C37 1 
HETATM 2870 C  C40 . 2CV E 2 .  ? -16.579 -71.050  25.417  1.00 96.99  ? 300 2CV A C40 1 
HETATM 2871 C  C41 . 2CV E 2 .  ? -15.802 -71.589  24.213  1.00 101.07 ? 300 2CV A C41 1 
HETATM 2872 C  C42 . 2CV E 2 .  ? -14.477 -72.267  24.566  1.00 105.71 ? 300 2CV A C42 1 
HETATM 2873 C  C43 . 2CV E 2 .  ? -14.659 -73.730  24.984  1.00 106.43 ? 300 2CV A C43 1 
HETATM 2874 O  O44 . 2CV E 2 .  ? -15.049 -74.532  23.874  1.00 105.17 ? 300 2CV A O44 1 
HETATM 2875 O  O47 . 2CV E 2 .  ? -18.658 -71.138  24.162  1.00 91.16  ? 300 2CV A O47 1 
HETATM 2876 O  O49 . 2CV E 2 .  ? -15.983 -71.442  26.651  1.00 98.97  ? 300 2CV A O49 1 
HETATM 2877 O  O51 . 2CV E 2 .  ? -15.565 -70.528  23.293  1.00 101.55 ? 300 2CV A O51 1 
HETATM 2878 O  O53 . 2CV E 2 .  ? -13.773 -71.547  25.582  1.00 108.17 ? 300 2CV A O53 1 
HETATM 2879 C  C60 . 2CV E 2 .  ? -21.484 -71.903  26.017  1.00 71.91  ? 300 2CV A C60 1 
HETATM 2880 O  O63 . 2CV E 2 .  ? -22.862 -72.213  25.944  1.00 71.03  ? 300 2CV A O63 1 
HETATM 2881 C  C1  . 2CV E 2 .  ? -23.455 -59.378  26.863  1.00 69.94  ? 300 2CV A C1  1 
HETATM 2882 C  C0  . 2CV E 2 .  ? -24.755 -58.603  26.759  1.00 73.03  ? 300 2CV A C0  1 
HETATM 2883 C  C9  . 2CV F 2 .  ? -19.877 -59.775  12.823  1.00 69.47  ? 301 2CV A C9  1 
HETATM 2884 C  C12 . 2CV F 2 .  ? -18.873 -60.920  12.881  1.00 70.07  ? 301 2CV A C12 1 
HETATM 2885 C  C15 . 2CV F 2 .  ? -17.758 -60.725  13.899  1.00 72.57  ? 301 2CV A C15 1 
HETATM 2886 C  C18 . 2CV F 2 .  ? -16.549 -61.640  13.716  1.00 73.84  ? 301 2CV A C18 1 
HETATM 2887 C  C21 . 2CV F 2 .  ? -16.863 -63.131  13.596  1.00 73.65  ? 301 2CV A C21 1 
HETATM 2888 C  C24 . 2CV F 2 .  ? -15.609 -64.011  13.515  1.00 75.80  ? 301 2CV A C24 1 
HETATM 2889 C  C27 . 2CV F 2 .  ? -15.906 -65.479  13.193  1.00 75.76  ? 301 2CV A C27 1 
HETATM 2890 C  C30 . 2CV F 2 .  ? -15.776 -66.391  14.393  1.00 76.42  ? 301 2CV A C30 1 
HETATM 2891 N  N33 . 2CV F 2 .  ? -16.885 -67.039  14.799  1.00 74.28  ? 301 2CV A N33 1 
HETATM 2892 O  O34 . 2CV F 2 .  ? -14.702 -66.545  14.952  1.00 79.05  ? 301 2CV A O34 1 
HETATM 2893 C  C36 . 2CV F 2 .  ? -17.157 -68.396  14.330  1.00 72.54  ? 301 2CV A C36 1 
HETATM 2894 C  C1  . 2CV F 2 .  ? -21.012 -59.982  11.841  1.00 67.14  ? 301 2CV A C1  1 
HETATM 2895 C  C0  . 2CV F 2 .  ? -21.781 -58.716  11.570  1.00 68.18  ? 301 2CV A C0  1 
HETATM 2896 BR BR  . BR  G 3 .  ? -30.522 -56.309  22.118  0.25 39.90  ? 301 BR  B BR  1 
HETATM 2897 C  C9  . 2CV H 2 .  ? -46.300 -60.452  36.567  1.00 61.14  ? 302 2CV B C9  1 
HETATM 2898 C  C12 . 2CV H 2 .  ? -46.692 -61.363  37.708  1.00 59.76  ? 302 2CV B C12 1 
HETATM 2899 C  C15 . 2CV H 2 .  ? -45.922 -62.660  37.769  1.00 56.71  ? 302 2CV B C15 1 
HETATM 2900 C  C18 . 2CV H 2 .  ? -46.272 -63.534  38.967  1.00 58.08  ? 302 2CV B C18 1 
HETATM 2901 C  C21 . 2CV H 2 .  ? -45.762 -64.943  38.837  1.00 60.59  ? 302 2CV B C21 1 
HETATM 2902 C  C24 . 2CV H 2 .  ? -46.100 -65.864  39.992  1.00 65.93  ? 302 2CV B C24 1 
HETATM 2903 C  C27 . 2CV H 2 .  ? -45.840 -67.337  39.654  1.00 70.28  ? 302 2CV B C27 1 
HETATM 2904 C  C30 . 2CV H 2 .  ? -46.091 -68.271  40.818  1.00 75.85  ? 302 2CV B C30 1 
HETATM 2905 N  N33 . 2CV H 2 .  ? -46.079 -69.611  40.592  1.00 79.26  ? 302 2CV B N33 1 
HETATM 2906 O  O34 . 2CV H 2 .  ? -46.335 -67.810  41.923  1.00 77.63  ? 302 2CV B O34 1 
HETATM 2907 C  C35 . 2CV H 2 .  ? -45.883 -70.160  39.226  1.00 75.31  ? 302 2CV B C35 1 
HETATM 2908 C  C36 . 2CV H 2 .  ? -46.308 -70.502  41.744  1.00 86.34  ? 302 2CV B C36 1 
HETATM 2909 C  C37 . 2CV H 2 .  ? -45.324 -70.363  42.904  1.00 92.61  ? 302 2CV B C37 1 
HETATM 2910 C  C40 . 2CV H 2 .  ? -44.432 -71.581  43.149  1.00 95.70  ? 302 2CV B C40 1 
HETATM 2911 C  C41 . 2CV H 2 .  ? -45.201 -72.807  43.653  1.00 98.86  ? 302 2CV B C41 1 
HETATM 2912 C  C42 . 2CV H 2 .  ? -45.185 -72.982  45.174  1.00 100.25 ? 302 2CV B C42 1 
HETATM 2913 C  C43 . 2CV H 2 .  ? -43.946 -73.690  45.764  1.00 100.06 ? 302 2CV B C43 1 
HETATM 2914 O  O44 . 2CV H 2 .  ? -43.743 -74.980  45.200  1.00 99.74  ? 302 2CV B O44 1 
HETATM 2915 O  O47 . 2CV H 2 .  ? -46.024 -70.054  44.111  1.00 96.00  ? 302 2CV B O47 1 
HETATM 2916 O  O49 . 2CV H 2 .  ? -43.422 -71.179  44.071  1.00 96.71  ? 302 2CV B O49 1 
HETATM 2917 O  O51 . 2CV H 2 .  ? -44.718 -73.977  43.000  1.00 99.62  ? 302 2CV B O51 1 
HETATM 2918 O  O53 . 2CV H 2 .  ? -46.356 -73.702  45.565  1.00 101.67 ? 302 2CV B O53 1 
HETATM 2919 C  C60 . 2CV H 2 .  ? -46.086 -71.656  39.073  1.00 73.11  ? 302 2CV B C60 1 
HETATM 2920 O  O63 . 2CV H 2 .  ? -45.996 -72.043  37.716  1.00 70.36  ? 302 2CV B O63 1 
HETATM 2921 C  C1  . 2CV H 2 .  ? -47.103 -59.158  36.531  1.00 66.44  ? 302 2CV B C1  1 
HETATM 2922 C  C0  . 2CV H 2 .  ? -46.964 -58.361  35.241  1.00 68.65  ? 302 2CV B C0  1 
HETATM 2923 C  C9  . 2CV I 2 .  ? -32.166 -59.680  39.046  1.00 71.71  ? 303 2CV B C9  1 
HETATM 2924 C  C12 . 2CV I 2 .  ? -32.419 -59.612  40.544  1.00 74.77  ? 303 2CV B C12 1 
HETATM 2925 C  C15 . 2CV I 2 .  ? -33.418 -60.639  41.034  1.00 75.80  ? 303 2CV B C15 1 
HETATM 2926 C  C18 . 2CV I 2 .  ? -33.271 -61.040  42.501  1.00 77.64  ? 303 2CV B C18 1 
HETATM 2927 C  C21 . 2CV I 2 .  ? -34.139 -62.222  42.882  1.00 78.65  ? 303 2CV B C21 1 
HETATM 2928 C  C24 . 2CV I 2 .  ? -33.651 -63.069  44.050  1.00 82.57  ? 303 2CV B C24 1 
HETATM 2929 C  C27 . 2CV I 2 .  ? -33.885 -64.564  43.809  1.00 85.23  ? 303 2CV B C27 1 
HETATM 2930 C  C30 . 2CV I 2 .  ? -33.855 -65.388  45.077  1.00 90.38  ? 303 2CV B C30 1 
HETATM 2931 N  N33 . 2CV I 2 .  ? -34.350 -66.647  45.028  1.00 91.29  ? 303 2CV B N33 1 
HETATM 2932 O  O34 . 2CV I 2 .  ? -33.370 -64.930  46.104  1.00 93.21  ? 303 2CV B O34 1 
HETATM 2933 C  C35 . 2CV I 2 .  ? -34.832 -67.336  43.811  1.00 89.37  ? 303 2CV B C35 1 
HETATM 2934 C  C36 . 2CV I 2 .  ? -34.494 -67.350  46.306  1.00 92.48  ? 303 2CV B C36 1 
HETATM 2935 C  C60 . 2CV I 2 .  ? -34.576 -68.831  43.811  1.00 89.38  ? 303 2CV B C60 1 
HETATM 2936 O  O63 . 2CV I 2 .  ? -34.738 -69.379  42.510  1.00 88.59  ? 303 2CV B O63 1 
HETATM 2937 C  C1  . 2CV I 2 .  ? -31.228 -58.610  38.510  1.00 73.88  ? 303 2CV B C1  1 
HETATM 2938 C  C0  . 2CV I 2 .  ? -29.852 -58.578  39.177  1.00 75.65  ? 303 2CV B C0  1 
HETATM 2939 BR BR  . BR  J 3 .  ? -42.254 -56.764  29.545  0.25 38.11  ? 304 BR  B BR  1 
HETATM 2940 C  C9  . 2CV K 2 .  ? -23.287 -100.789 15.540  1.00 69.38  ? 300 2CV C C9  1 
HETATM 2941 C  C12 . 2CV K 2 .  ? -22.056 -99.910  15.399  1.00 70.92  ? 300 2CV C C12 1 
HETATM 2942 C  C15 . 2CV K 2 .  ? -22.051 -98.674  16.299  1.00 69.56  ? 300 2CV C C15 1 
HETATM 2943 C  C18 . 2CV K 2 .  ? -20.762 -97.843  16.221  1.00 70.93  ? 300 2CV C C18 1 
HETATM 2944 C  C21 . 2CV K 2 .  ? -20.876 -96.464  16.848  1.00 69.89  ? 300 2CV C C21 1 
HETATM 2945 C  C24 . 2CV K 2 .  ? -19.663 -95.561  16.652  1.00 71.85  ? 300 2CV C C24 1 
HETATM 2946 C  C27 . 2CV K 2 .  ? -19.933 -94.111  17.063  1.00 72.00  ? 300 2CV C C27 1 
HETATM 2947 C  C30 . 2CV K 2 .  ? -18.741 -93.196  16.878  1.00 74.32  ? 300 2CV C C30 1 
HETATM 2948 N  N33 . 2CV K 2 .  ? -18.924 -91.866  17.067  1.00 72.82  ? 300 2CV C N33 1 
HETATM 2949 O  O34 . 2CV K 2 .  ? -17.644 -93.656  16.586  1.00 77.29  ? 300 2CV C O34 1 
HETATM 2950 C  C35 . 2CV K 2 .  ? -20.188 -91.220  17.474  1.00 65.92  ? 300 2CV C C35 1 
HETATM 2951 C  C36 . 2CV K 2 .  ? -17.816 -90.925  16.849  1.00 76.83  ? 300 2CV C C36 1 
HETATM 2952 C  C37 . 2CV K 2 .  ? -16.764 -90.929  17.954  1.00 78.63  ? 300 2CV C C37 1 
HETATM 2953 C  C40 . 2CV K 2 .  ? -17.350 -90.547  19.315  1.00 77.20  ? 300 2CV C C40 1 
HETATM 2954 O  O47 . 2CV K 2 .  ? -15.707 -90.022  17.633  1.00 80.31  ? 300 2CV C O47 1 
HETATM 2955 O  O49 . 2CV K 2 .  ? -16.409 -90.896  20.323  1.00 77.46  ? 300 2CV C O49 1 
HETATM 2956 C  C60 . 2CV K 2 .  ? -20.972 -90.658  16.311  1.00 59.77  ? 300 2CV C C60 1 
HETATM 2957 O  O63 . 2CV K 2 .  ? -21.868 -89.652  16.760  1.00 53.59  ? 300 2CV C O63 1 
HETATM 2958 BR BR  . BR  L 3 .  ? -30.860 -104.185 19.141  0.25 34.24  ? 301 BR  D BR  1 
HETATM 2959 C  C9  . 2CV M 2 .  ? -44.157 -100.561 2.902   1.00 56.41  ? 302 2CV D C9  1 
HETATM 2960 C  C12 . 2CV M 2 .  ? -44.065 -99.087  2.501   1.00 56.61  ? 302 2CV D C12 1 
HETATM 2961 C  C15 . 2CV M 2 .  ? -44.302 -98.830  1.018   1.00 59.88  ? 302 2CV D C15 1 
HETATM 2962 C  C18 . 2CV M 2 .  ? -43.401 -97.771  0.386   1.00 58.56  ? 302 2CV D C18 1 
HETATM 2963 C  C21 . 2CV M 2 .  ? -43.759 -96.330  0.718   1.00 58.63  ? 302 2CV D C21 1 
HETATM 2964 C  C24 . 2CV M 2 .  ? -43.719 -95.399  -0.489  1.00 59.99  ? 302 2CV D C24 1 
HETATM 2965 C  C27 . 2CV M 2 .  ? -43.379 -93.948  -0.147  1.00 58.84  ? 302 2CV D C27 1 
HETATM 2966 C  C30 . 2CV M 2 .  ? -43.439 -93.035  -1.352  1.00 60.66  ? 302 2CV D C30 1 
HETATM 2967 N  N33 . 2CV M 2 .  ? -43.218 -91.713  -1.160  1.00 60.57  ? 302 2CV D N33 1 
HETATM 2968 O  O34 . 2CV M 2 .  ? -43.659 -93.494  -2.469  1.00 61.07  ? 302 2CV D O34 1 
HETATM 2969 C  C35 . 2CV M 2 .  ? -42.822 -91.068  0.109   1.00 52.97  ? 302 2CV D C35 1 
HETATM 2970 C  C36 . 2CV M 2 .  ? -43.445 -90.781  -2.271  1.00 65.98  ? 302 2CV D C36 1 
HETATM 2971 C  C37 . 2CV M 2 .  ? -42.339 -90.805  -3.321  1.00 70.67  ? 302 2CV D C37 1 
HETATM 2972 C  C40 . 2CV M 2 .  ? -40.998 -90.373  -2.728  1.00 69.62  ? 302 2CV D C40 1 
HETATM 2973 O  O47 . 2CV M 2 .  ? -42.679 -89.940  -4.408  1.00 74.89  ? 302 2CV D O47 1 
HETATM 2974 O  O49 . 2CV M 2 .  ? -39.975 -90.659  -3.672  1.00 70.91  ? 302 2CV D O49 1 
HETATM 2975 C  C60 . 2CV M 2 .  ? -43.991 -90.490  0.872   1.00 47.43  ? 302 2CV D C60 1 
HETATM 2976 O  O63 . 2CV M 2 .  ? -43.559 -89.482  1.779   1.00 42.39  ? 302 2CV D O63 1 
HETATM 2977 C  C1  . 2CV M 2 .  ? -45.491 -101.215 2.607   1.00 59.54  ? 302 2CV D C1  1 
HETATM 2978 C  C0  . 2CV M 2 .  ? -45.682 -102.567 3.283   1.00 61.72  ? 302 2CV D C0  1 
HETATM 2979 BR BR  . BR  N 3 .  ? -40.925 -104.401 10.355  0.25 37.38  ? 303 BR  D BR  1 
HETATM 2980 O  O   . HOH O 4 .  ? -14.824 -66.399  6.500   1.00 48.64  ? 401 HOH A O   1 
HETATM 2981 O  O   . HOH O 4 .  ? -34.354 -76.824  9.785   1.00 39.96  ? 402 HOH A O   1 
HETATM 2982 O  O   . HOH O 4 .  ? -19.631 -72.931  2.104   1.00 9.24   ? 403 HOH A O   1 
HETATM 2983 O  O   . HOH O 4 .  ? -39.446 -61.316  18.452  1.00 43.40  ? 404 HOH A O   1 
HETATM 2984 O  O   . HOH O 4 .  ? -30.841 -74.831  -2.451  1.00 41.74  ? 405 HOH A O   1 
HETATM 2985 O  O   . HOH O 4 .  ? -21.762 -76.754  1.724   1.00 32.36  ? 406 HOH A O   1 
HETATM 2986 O  O   . HOH O 4 .  ? -32.148 -64.082  -3.019  1.00 35.89  ? 407 HOH A O   1 
HETATM 2987 O  O   . HOH O 4 .  ? -38.865 -63.592  20.551  1.00 67.08  ? 408 HOH A O   1 
HETATM 2988 O  O   . HOH O 4 .  ? -26.376 -72.778  -4.398  1.00 46.22  ? 409 HOH A O   1 
HETATM 2989 O  O   . HOH O 4 .  ? -18.924 -75.390  2.206   1.00 36.38  ? 410 HOH A O   1 
HETATM 2990 O  O   . HOH O 4 .  ? -25.808 -69.212  -5.315  1.00 27.83  ? 411 HOH A O   1 
HETATM 2991 O  O   . HOH O 4 .  ? -37.313 -73.985  17.249  1.00 31.12  ? 412 HOH A O   1 
HETATM 2992 O  O   . HOH O 4 .  ? -33.096 -61.243  -2.028  1.00 39.52  ? 413 HOH A O   1 
HETATM 2993 O  O   . HOH O 4 .  ? -29.332 -77.242  -2.307  1.00 33.20  ? 414 HOH A O   1 
HETATM 2994 O  O   . HOH O 4 .  ? -32.872 -76.691  15.558  1.00 12.94  ? 416 HOH A O   1 
HETATM 2995 O  O   . HOH O 4 .  ? -25.788 -71.336  27.601  1.00 21.52  ? 417 HOH A O   1 
HETATM 2996 O  O   . HOH O 4 .  ? -22.135 -81.514  12.324  1.00 40.74  ? 418 HOH A O   1 
HETATM 2997 O  O   . HOH O 4 .  ? -27.328 -75.712  24.552  1.00 26.20  ? 419 HOH A O   1 
HETATM 2998 O  O   . HOH O 4 .  ? -26.181 -80.117  10.680  1.00 19.56  ? 420 HOH A O   1 
HETATM 2999 O  O   . HOH O 4 .  ? -28.225 -68.185  -3.417  1.00 29.62  ? 421 HOH A O   1 
HETATM 3000 O  O   . HOH O 4 .  ? -15.759 -71.788  16.430  1.00 39.88  ? 422 HOH A O   1 
HETATM 3001 O  O   . HOH O 4 .  ? -23.046 -59.698  -1.452  1.00 34.48  ? 423 HOH A O   1 
HETATM 3002 O  O   . HOH O 4 .  ? -8.771  -61.410  18.965  1.00 60.50  ? 424 HOH A O   1 
HETATM 3003 O  O   . HOH O 4 .  ? -36.569 -56.833  16.499  1.00 39.72  ? 425 HOH A O   1 
HETATM 3004 O  O   . HOH O 4 .  ? -0.608  -61.517  21.642  1.00 44.51  ? 426 HOH A O   1 
HETATM 3005 O  O   . HOH O 4 .  ? -20.318 -82.065  20.360  1.00 28.16  ? 427 HOH A O   1 
HETATM 3006 O  O   . HOH O 4 .  ? -35.203 -80.535  16.037  1.00 40.51  ? 428 HOH A O   1 
HETATM 3007 O  O   . HOH O 4 .  ? -21.729 -74.365  23.544  1.00 44.75  ? 429 HOH A O   1 
HETATM 3008 O  O   . HOH O 4 .  ? -30.288 -50.232  -11.535 1.00 67.89  ? 430 HOH A O   1 
HETATM 3009 O  O   . HOH O 4 .  ? -25.321 -55.566  -1.785  1.00 54.35  ? 431 HOH A O   1 
HETATM 3010 O  O   . HOH O 4 .  ? -13.127 -69.453  14.856  1.00 46.81  ? 432 HOH A O   1 
HETATM 3011 O  O   . HOH O 4 .  ? -19.228 -73.789  5.144   1.00 33.09  ? 433 HOH A O   1 
HETATM 3012 O  O   . HOH O 4 .  ? -27.436 -76.333  0.050   1.00 37.73  ? 434 HOH A O   1 
HETATM 3013 O  O   . HOH O 4 .  ? -33.102 -77.147  18.780  1.00 26.39  ? 435 HOH A O   1 
HETATM 3014 O  O   . HOH O 4 .  ? -29.687 -77.428  10.448  1.00 37.87  ? 436 HOH A O   1 
HETATM 3015 O  O   . HOH O 4 .  ? -30.883 -57.213  2.213   1.00 55.36  ? 437 HOH A O   1 
HETATM 3016 O  O   . HOH O 4 .  ? -13.553 -71.159  7.231   1.00 59.63  ? 438 HOH A O   1 
HETATM 3017 O  O   . HOH O 4 .  ? -17.533 -79.655  21.351  1.00 48.76  ? 439 HOH A O   1 
HETATM 3018 O  O   . HOH O 4 .  ? -15.937 -72.606  10.296  1.00 27.97  ? 440 HOH A O   1 
HETATM 3019 O  O   . HOH O 4 .  ? -19.716 -59.296  22.027  1.00 48.79  ? 441 HOH A O   1 
HETATM 3020 O  O   . HOH O 4 .  ? -21.668 -24.630  -1.959  1.00 93.40  ? 442 HOH A O   1 
HETATM 3021 O  O   . HOH O 4 .  ? -8.022  -74.844  28.214  1.00 55.15  ? 443 HOH A O   1 
HETATM 3022 O  O   . HOH O 4 .  ? -27.196 -66.088  -5.075  1.00 33.12  ? 444 HOH A O   1 
HETATM 3023 O  O   . HOH O 4 .  ? -7.870  -64.200  17.439  1.00 52.24  ? 445 HOH A O   1 
HETATM 3024 O  O   . HOH O 4 .  ? -13.070 -66.798  22.168  1.00 54.29  ? 446 HOH A O   1 
HETATM 3025 O  O   . HOH O 4 .  ? -55.743 -24.994  1.808   1.00 95.31  ? 447 HOH A O   1 
HETATM 3026 O  O   . HOH O 4 .  ? -15.271 -76.101  14.672  1.00 46.88  ? 448 HOH A O   1 
HETATM 3027 O  O   . HOH O 4 .  ? -27.639 -75.953  -4.664  1.00 46.99  ? 449 HOH A O   1 
HETATM 3028 O  O   . HOH O 4 .  ? -12.497 -67.717  8.800   1.00 61.15  ? 450 HOH A O   1 
HETATM 3029 O  O   . HOH O 4 .  ? -15.649 -66.112  27.014  1.00 47.93  ? 451 HOH A O   1 
HETATM 3030 O  O   . HOH O 4 .  ? -11.382 -77.743  27.589  1.00 46.24  ? 452 HOH A O   1 
HETATM 3031 O  O   . HOH O 4 .  ? -13.367 -70.974  10.107  1.00 85.41  ? 453 HOH A O   1 
HETATM 3032 O  O   . HOH O 4 .  ? -15.797 -78.309  12.126  1.00 27.20  ? 454 HOH A O   1 
HETATM 3033 O  O   . HOH O 4 .  ? -11.202 -64.860  17.356  1.00 66.80  ? 455 HOH A O   1 
HETATM 3034 O  O   . HOH O 4 .  ? -12.989 -64.657  19.427  1.00 62.08  ? 456 HOH A O   1 
HETATM 3035 O  O   . HOH O 4 .  ? -15.783 -57.782  17.857  1.00 66.27  ? 457 HOH A O   1 
HETATM 3036 O  O   . HOH O 4 .  ? -42.532 -18.528  17.539  1.00 87.99  ? 458 HOH A O   1 
HETATM 3037 O  O   . HOH O 4 .  ? -13.067 -68.479  11.980  1.00 65.21  ? 459 HOH A O   1 
HETATM 3038 O  O   . HOH O 4 .  ? -13.580 -79.239  13.402  1.00 64.40  ? 460 HOH A O   1 
HETATM 3039 O  O   . HOH O 4 .  ? -27.664 -41.730  11.538  1.00 63.21  ? 461 HOH A O   1 
HETATM 3040 O  O   . HOH O 4 .  ? -29.635 -79.445  3.669   1.00 42.48  ? 462 HOH A O   1 
HETATM 3041 O  O   . HOH O 4 .  ? -29.014 -80.022  20.037  1.00 42.30  ? 463 HOH A O   1 
HETATM 3042 O  O   . HOH P 4 .  ? -47.613 -71.311  34.633  1.00 19.73  ? 401 HOH B O   1 
HETATM 3043 O  O   . HOH P 4 .  ? -37.036 -79.176  33.847  1.00 30.87  ? 402 HOH B O   1 
HETATM 3044 O  O   . HOH P 4 .  ? -22.429 -73.164  40.361  1.00 18.63  ? 403 HOH B O   1 
HETATM 3045 O  O   . HOH P 4 .  ? -40.647 -82.317  39.917  1.00 44.00  ? 404 HOH B O   1 
HETATM 3046 O  O   . HOH P 4 .  ? -44.652 -75.452  32.943  1.00 24.69  ? 405 HOH B O   1 
HETATM 3047 O  O   . HOH P 4 .  ? -43.688 -74.393  38.429  1.00 30.81  ? 406 HOH B O   1 
HETATM 3048 O  O   . HOH P 4 .  ? -27.120 -70.746  47.210  1.00 50.19  ? 407 HOH B O   1 
HETATM 3049 O  O   . HOH P 4 .  ? -38.740 -60.137  20.856  1.00 40.15  ? 408 HOH B O   1 
HETATM 3050 O  O   . HOH P 4 .  ? -21.732 -76.504  38.662  1.00 32.88  ? 409 HOH B O   1 
HETATM 3051 O  O   . HOH P 4 .  ? -15.715 -72.469  34.018  1.00 48.61  ? 410 HOH B O   1 
HETATM 3052 O  O   . HOH P 4 .  ? -28.541 -65.550  47.882  1.00 44.56  ? 411 HOH B O   1 
HETATM 3053 O  O   . HOH P 4 .  ? -14.653 -69.018  34.582  1.00 32.68  ? 412 HOH B O   1 
HETATM 3054 O  O   . HOH P 4 .  ? -30.692 -80.143  33.960  1.00 20.08  ? 413 HOH B O   1 
HETATM 3055 O  O   . HOH P 4 .  ? -23.909 -79.708  30.561  1.00 33.12  ? 414 HOH B O   1 
HETATM 3056 O  O   . HOH P 4 .  ? -36.721 -71.982  44.562  1.00 28.39  ? 415 HOH B O   1 
HETATM 3057 O  O   . HOH P 4 .  ? -39.762 -79.023  43.600  1.00 53.46  ? 416 HOH B O   1 
HETATM 3058 O  O   . HOH P 4 .  ? -16.769 -68.992  32.364  1.00 35.90  ? 417 HOH B O   1 
HETATM 3059 O  O   . HOH P 4 .  ? -32.300 -79.340  44.088  1.00 22.16  ? 418 HOH B O   1 
HETATM 3060 O  O   . HOH P 4 .  ? -38.984 -61.842  51.802  1.00 72.30  ? 419 HOH B O   1 
HETATM 3061 O  O   . HOH P 4 .  ? -36.161 -56.100  24.153  1.00 62.49  ? 420 HOH B O   1 
HETATM 3062 O  O   . HOH P 4 .  ? -18.166 -60.312  37.084  1.00 41.83  ? 421 HOH B O   1 
HETATM 3063 O  O   . HOH P 4 .  ? -8.134  -48.030  30.083  1.00 69.73  ? 422 HOH B O   1 
HETATM 3064 O  O   . HOH P 4 .  ? -37.288 -74.228  23.166  1.00 30.19  ? 423 HOH B O   1 
HETATM 3065 O  O   . HOH P 4 .  ? -19.899 -76.012  32.898  1.00 30.76  ? 424 HOH B O   1 
HETATM 3066 O  O   . HOH P 4 .  ? -31.007 -78.112  28.971  1.00 39.61  ? 425 HOH B O   1 
HETATM 3067 O  O   . HOH P 4 .  ? -39.163 -77.061  27.386  1.00 23.61  ? 426 HOH B O   1 
HETATM 3068 O  O   . HOH P 4 .  ? -14.466 -61.262  36.534  1.00 63.53  ? 427 HOH B O   1 
HETATM 3069 O  O   . HOH P 4 .  ? -15.544 -63.592  36.932  1.00 38.99  ? 428 HOH B O   1 
HETATM 3070 O  O   . HOH P 4 .  ? -29.783 -68.745  47.858  1.00 74.40  ? 429 HOH B O   1 
HETATM 3071 O  O   . HOH P 4 .  ? -13.463 -66.264  29.882  1.00 57.24  ? 430 HOH B O   1 
HETATM 3072 O  O   . HOH P 4 .  ? -38.416 -65.429  49.921  1.00 71.67  ? 431 HOH B O   1 
HETATM 3073 O  O   . HOH P 4 .  ? -17.884 -61.208  27.146  1.00 57.87  ? 432 HOH B O   1 
HETATM 3074 O  O   . HOH P 4 .  ? -41.818 -66.208  47.230  1.00 51.34  ? 433 HOH B O   1 
HETATM 3075 O  O   . HOH P 4 .  ? -37.891 -58.389  44.577  1.00 63.35  ? 434 HOH B O   1 
HETATM 3076 O  O   . HOH P 4 .  ? -18.103 -55.358  35.361  1.00 44.87  ? 435 HOH B O   1 
HETATM 3077 O  O   . HOH P 4 .  ? -14.402 -41.509  20.362  1.00 73.67  ? 436 HOH B O   1 
HETATM 3078 O  O   . HOH P 4 .  ? -38.874 -64.585  47.280  1.00 68.49  ? 437 HOH B O   1 
HETATM 3079 O  O   . HOH P 4 .  ? -30.466 -72.706  44.707  1.00 37.26  ? 438 HOH B O   1 
HETATM 3080 O  O   . HOH P 4 .  ? -44.373 -69.902  47.587  1.00 68.94  ? 439 HOH B O   1 
HETATM 3081 O  O   . HOH P 4 .  ? -17.044 -63.754  28.079  1.00 41.85  ? 440 HOH B O   1 
HETATM 3082 O  O   . HOH P 4 .  ? -36.912 -79.739  43.487  1.00 52.63  ? 441 HOH B O   1 
HETATM 3083 O  O   . HOH P 4 .  ? -15.442 -66.387  32.773  1.00 42.79  ? 442 HOH B O   1 
HETATM 3084 O  O   . HOH P 4 .  ? -25.381 -74.113  41.142  1.00 36.90  ? 443 HOH B O   1 
HETATM 3085 O  O   . HOH P 4 .  ? -36.630 -58.521  23.278  1.00 57.55  ? 444 HOH B O   1 
HETATM 3086 O  O   . HOH P 4 .  ? -18.112 -77.256  31.071  1.00 41.79  ? 445 HOH B O   1 
HETATM 3087 O  O   . HOH P 4 .  ? -21.881 -57.335  29.528  1.00 69.22  ? 446 HOH B O   1 
HETATM 3088 O  O   . HOH P 4 .  ? -27.414 -82.107  41.157  1.00 55.12  ? 447 HOH B O   1 
HETATM 3089 O  O   . HOH P 4 .  ? -34.945 -70.241  47.511  1.00 60.39  ? 448 HOH B O   1 
HETATM 3090 O  O   . HOH P 4 .  ? -37.240 -81.969  46.069  1.00 69.81  ? 449 HOH B O   1 
HETATM 3091 O  O   . HOH P 4 .  ? -33.629 -56.886  21.843  1.00 84.76  ? 450 HOH B O   1 
HETATM 3092 O  O   . HOH Q 4 .  ? -15.898 -94.225  37.026  1.00 14.98  ? 401 HOH C O   1 
HETATM 3093 O  O   . HOH Q 4 .  ? -22.137 -93.177  41.235  1.00 34.80  ? 402 HOH C O   1 
HETATM 3094 O  O   . HOH Q 4 .  ? -34.144 -90.847  45.550  1.00 69.88  ? 403 HOH C O   1 
HETATM 3095 O  O   . HOH Q 4 .  ? -26.369 -91.379  44.274  1.00 38.78  ? 404 HOH C O   1 
HETATM 3096 O  O   . HOH Q 4 .  ? -34.979 -82.684  38.177  1.00 79.96  ? 405 HOH C O   1 
HETATM 3097 O  O   . HOH Q 4 .  ? -32.809 -96.345  45.029  1.00 45.69  ? 406 HOH C O   1 
HETATM 3098 O  O   . HOH Q 4 .  ? -36.031 -83.894  30.622  1.00 41.95  ? 407 HOH C O   1 
HETATM 3099 O  O   . HOH Q 4 .  ? -18.383 -96.905  38.387  1.00 25.06  ? 408 HOH C O   1 
HETATM 3100 O  O   . HOH Q 4 .  ? -35.582 -94.527  47.747  1.00 78.97  ? 409 HOH C O   1 
HETATM 3101 O  O   . HOH Q 4 .  ? -24.082 -87.391  42.782  1.00 38.65  ? 410 HOH C O   1 
HETATM 3102 O  O   . HOH Q 4 .  ? -23.061 -81.920  18.301  1.00 38.15  ? 411 HOH C O   1 
HETATM 3103 O  O   . HOH Q 4 .  ? -30.058 -82.767  33.207  1.00 29.49  ? 412 HOH C O   1 
HETATM 3104 O  O   . HOH Q 4 .  ? -17.361 -95.906  29.889  1.00 21.34  ? 413 HOH C O   1 
HETATM 3105 O  O   . HOH Q 4 .  ? -32.555 -81.298  38.642  1.00 42.41  ? 414 HOH C O   1 
HETATM 3106 O  O   . HOH Q 4 .  ? -32.584 -81.435  22.301  1.00 51.71  ? 415 HOH C O   1 
HETATM 3107 O  O   . HOH Q 4 .  ? -29.228 -84.013  20.139  1.00 33.86  ? 416 HOH C O   1 
HETATM 3108 O  O   . HOH Q 4 .  ? -25.809 -86.430  16.741  1.00 22.83  ? 417 HOH C O   1 
HETATM 3109 O  O   . HOH Q 4 .  ? -16.809 -100.683 34.980  1.00 27.58  ? 418 HOH C O   1 
HETATM 3110 O  O   . HOH Q 4 .  ? -27.951 -80.506  31.451  1.00 40.37  ? 419 HOH C O   1 
HETATM 3111 O  O   . HOH Q 4 .  ? -14.601 -94.812  16.531  1.00 41.11  ? 420 HOH C O   1 
HETATM 3112 O  O   . HOH Q 4 .  ? -35.813 -79.402  31.155  1.00 23.97  ? 421 HOH C O   1 
HETATM 3113 O  O   . HOH Q 4 .  ? -17.134 -90.048  26.926  1.00 44.81  ? 422 HOH C O   1 
HETATM 3114 O  O   . HOH Q 4 .  ? -17.820 -82.307  22.051  1.00 45.00  ? 423 HOH C O   1 
HETATM 3115 O  O   . HOH Q 4 .  ? -33.680 -84.645  25.576  1.00 42.69  ? 424 HOH C O   1 
HETATM 3116 O  O   . HOH Q 4 .  ? -37.055 -103.857 24.293  1.00 38.88  ? 425 HOH C O   1 
HETATM 3117 O  O   . HOH Q 4 .  ? -33.023 -111.061 48.772  1.00 71.99  ? 426 HOH C O   1 
HETATM 3118 O  O   . HOH Q 4 .  ? -21.550 -103.969 34.444  1.00 25.56  ? 427 HOH C O   1 
HETATM 3119 O  O   . HOH Q 4 .  ? -20.102 -100.853 20.963  1.00 47.28  ? 428 HOH C O   1 
HETATM 3120 O  O   . HOH Q 4 .  ? -17.144 -102.755 26.646  1.00 50.20  ? 429 HOH C O   1 
HETATM 3121 O  O   . HOH Q 4 .  ? -25.218 -104.565 44.793  1.00 38.13  ? 430 HOH C O   1 
HETATM 3122 O  O   . HOH Q 4 .  ? -29.617 -85.161  41.345  1.00 27.68  ? 431 HOH C O   1 
HETATM 3123 O  O   . HOH Q 4 .  ? -13.973 -91.962  15.884  1.00 46.50  ? 432 HOH C O   1 
HETATM 3124 O  O   . HOH Q 4 .  ? -17.595 -100.885 22.015  1.00 42.23  ? 433 HOH C O   1 
HETATM 3125 O  O   . HOH Q 4 .  ? -30.421 -107.918 45.536  1.00 61.00  ? 434 HOH C O   1 
HETATM 3126 O  O   . HOH Q 4 .  ? -25.650 -109.724 24.411  1.00 65.92  ? 435 HOH C O   1 
HETATM 3127 O  O   . HOH Q 4 .  ? -18.291 -92.120  28.702  1.00 55.46  ? 436 HOH C O   1 
HETATM 3128 O  O   . HOH Q 4 .  ? -17.435 -100.706 16.366  1.00 43.01  ? 437 HOH C O   1 
HETATM 3129 O  O   . HOH Q 4 .  ? -35.364 -104.627 22.117  1.00 65.52  ? 438 HOH C O   1 
HETATM 3130 O  O   . HOH Q 4 .  ? -28.029 -113.726 29.096  1.00 50.06  ? 439 HOH C O   1 
HETATM 3131 O  O   . HOH Q 4 .  ? -22.668 -86.488  16.031  1.00 34.61  ? 440 HOH C O   1 
HETATM 3132 O  O   . HOH Q 4 .  ? -13.064 -95.346  21.957  1.00 43.93  ? 441 HOH C O   1 
HETATM 3133 O  O   . HOH Q 4 .  ? -31.189 -93.279  45.105  1.00 46.15  ? 442 HOH C O   1 
HETATM 3134 O  O   . HOH Q 4 .  ? -21.784 -84.657  19.272  1.00 50.73  ? 443 HOH C O   1 
HETATM 3135 O  O   . HOH Q 4 .  ? -17.373 -88.275  32.791  1.00 39.80  ? 444 HOH C O   1 
HETATM 3136 O  O   . HOH Q 4 .  ? -31.297 -96.971  49.537  1.00 75.84  ? 445 HOH C O   1 
HETATM 3137 O  O   . HOH Q 4 .  ? -27.397 -99.688  49.300  1.00 46.95  ? 446 HOH C O   1 
HETATM 3138 O  O   . HOH Q 4 .  ? -36.757 -106.950 24.865  1.00 45.38  ? 447 HOH C O   1 
HETATM 3139 O  O   . HOH Q 4 .  ? -24.599 -86.255  19.260  1.00 20.59  ? 448 HOH C O   1 
HETATM 3140 O  O   . HOH Q 4 .  ? -16.262 -97.473  14.985  1.00 50.02  ? 449 HOH C O   1 
HETATM 3141 O  O   . HOH Q 4 .  ? -40.649 -123.445 25.111  1.00 73.51  ? 450 HOH C O   1 
HETATM 3142 O  O   . HOH Q 4 .  ? -19.398 -101.340 32.711  1.00 57.64  ? 451 HOH C O   1 
HETATM 3143 O  O   . HOH Q 4 .  ? -17.514 -98.669  29.581  1.00 56.94  ? 452 HOH C O   1 
HETATM 3144 O  O   . HOH Q 4 .  ? -18.516 -83.695  34.771  1.00 58.48  ? 453 HOH C O   1 
HETATM 3145 O  O   . HOH Q 4 .  ? -36.606 -118.314 22.635  1.00 72.64  ? 454 HOH C O   1 
HETATM 3146 O  O   . HOH Q 4 .  ? -31.111 -101.811 42.418  1.00 56.13  ? 455 HOH C O   1 
HETATM 3147 O  O   . HOH Q 4 .  ? -13.345 -94.753  25.250  1.00 58.73  ? 456 HOH C O   1 
HETATM 3148 O  O   . HOH Q 4 .  ? -14.791 -91.879  29.838  1.00 58.64  ? 457 HOH C O   1 
HETATM 3149 O  O   . HOH Q 4 .  ? -15.375 -103.323 34.611  1.00 59.28  ? 458 HOH C O   1 
HETATM 3150 O  O   . HOH Q 4 .  ? -15.337 -97.534  33.778  1.00 48.76  ? 459 HOH C O   1 
HETATM 3151 O  O   . HOH Q 4 .  ? -26.171 -81.736  25.474  1.00 41.60  ? 460 HOH C O   1 
HETATM 3152 O  O   . HOH Q 4 .  ? -20.878 -87.631  19.647  1.00 79.22  ? 461 HOH C O   1 
HETATM 3153 O  O   . HOH Q 4 .  ? -13.535 -91.699  18.624  1.00 63.68  ? 462 HOH C O   1 
HETATM 3154 O  O   . HOH Q 4 .  ? -19.846 -104.089 28.336  1.00 48.20  ? 463 HOH C O   1 
HETATM 3155 O  O   . HOH Q 4 .  ? -21.101 -101.318 29.585  1.00 48.31  ? 464 HOH C O   1 
HETATM 3156 O  O   . HOH Q 4 .  ? -1.675  -181.900 53.355  1.00 87.00  ? 465 HOH C O   1 
HETATM 3157 O  O   . HOH Q 4 .  ? -20.640 -78.740  35.094  1.00 35.58  ? 466 HOH C O   1 
HETATM 3158 O  O   . HOH Q 4 .  ? -23.466 -102.507 33.238  1.00 52.97  ? 467 HOH C O   1 
HETATM 3159 O  O   . HOH Q 4 .  ? -18.040 -103.747 33.047  1.00 72.52  ? 468 HOH C O   1 
HETATM 3160 O  O   . HOH Q 4 .  ? -13.321 -94.945  18.877  1.00 88.84  ? 469 HOH C O   1 
HETATM 3161 O  O   . HOH Q 4 .  ? -33.793 -97.450  48.440  1.00 77.96  ? 470 HOH C O   1 
HETATM 3162 O  O   . HOH Q 4 .  ? -21.032 -87.299  37.776  1.00 43.33  ? 471 HOH C O   1 
HETATM 3163 O  O   . HOH Q 4 .  ? -15.743 -85.468  28.268  1.00 54.21  ? 472 HOH C O   1 
HETATM 3164 O  O   . HOH Q 4 .  ? -33.301 -80.999  42.237  1.00 59.00  ? 473 HOH C O   1 
HETATM 3165 O  O   . HOH Q 4 .  ? -37.717 -87.514  23.263  1.00 51.58  ? 474 HOH C O   1 
HETATM 3166 O  O   . HOH Q 4 .  ? -37.421 -120.366 40.112  1.00 82.86  ? 475 HOH C O   1 
HETATM 3167 O  O   . HOH Q 4 .  ? -10.385 -94.620  19.836  1.00 101.55 ? 476 HOH C O   1 
HETATM 3168 O  O   . HOH R 4 .  ? -40.061 -97.299  16.992  1.00 95.89  ? 401 HOH D O   1 
HETATM 3169 O  O   . HOH R 4 .  ? -43.960 -94.862  -5.067  1.00 34.17  ? 402 HOH D O   1 
HETATM 3170 O  O   . HOH R 4 .  ? -19.029 -92.827  1.716   1.00 43.33  ? 403 HOH D O   1 
HETATM 3171 O  O   . HOH R 4 .  ? -15.868 -91.553  6.718   1.00 42.58  ? 404 HOH D O   1 
HETATM 3172 O  O   . HOH R 4 .  ? -23.271 -94.352  -4.237  1.00 15.82  ? 405 HOH D O   1 
HETATM 3173 O  O   . HOH R 4 .  ? -44.138 -92.199  -6.363  1.00 48.15  ? 406 HOH D O   1 
HETATM 3174 O  O   . HOH R 4 .  ? -38.623 -80.603  -2.523  1.00 55.88  ? 407 HOH D O   1 
HETATM 3175 O  O   . HOH R 4 .  ? -18.449 -88.692  1.210   1.00 41.08  ? 408 HOH D O   1 
HETATM 3176 O  O   . HOH R 4 .  ? -44.884 -97.690  -3.495  1.00 45.05  ? 409 HOH D O   1 
HETATM 3177 O  O   . HOH R 4 .  ? -29.576 -84.447  15.897  1.00 44.43  ? 410 HOH D O   1 
HETATM 3178 O  O   . HOH R 4 .  ? -30.679 -95.685  -2.685  1.00 18.35  ? 411 HOH D O   1 
HETATM 3179 O  O   . HOH R 4 .  ? -22.497 -87.309  0.928   1.00 32.94  ? 412 HOH D O   1 
HETATM 3180 O  O   . HOH R 4 .  ? -40.744 -86.131  4.355   1.00 25.51  ? 413 HOH D O   1 
HETATM 3181 O  O   . HOH R 4 .  ? -39.582 -100.900 0.051   1.00 46.15  ? 414 HOH D O   1 
HETATM 3182 O  O   . HOH R 4 .  ? -40.254 -84.351  9.155   1.00 50.53  ? 415 HOH D O   1 
HETATM 3183 O  O   . HOH R 4 .  ? -26.172 -103.366 1.947   1.00 36.01  ? 416 HOH D O   1 
HETATM 3184 O  O   . HOH R 4 .  ? -31.084 -113.753 8.039   1.00 64.16  ? 417 HOH D O   1 
HETATM 3185 O  O   . HOH R 4 .  ? -43.898 -100.592 -2.591  1.00 43.11  ? 418 HOH D O   1 
HETATM 3186 O  O   . HOH R 4 .  ? -31.874 -92.724  -2.281  1.00 41.12  ? 419 HOH D O   1 
HETATM 3187 O  O   . HOH R 4 .  ? -33.862 -102.046 -3.062  1.00 51.17  ? 420 HOH D O   1 
HETATM 3188 O  O   . HOH R 4 .  ? -35.204 -109.825 5.040   1.00 67.63  ? 421 HOH D O   1 
HETATM 3189 O  O   . HOH R 4 .  ? -32.290 -85.109  -4.130  1.00 43.23  ? 422 HOH D O   1 
HETATM 3190 O  O   . HOH R 4 .  ? -33.320 -89.787  -2.995  1.00 59.18  ? 423 HOH D O   1 
HETATM 3191 O  O   . HOH R 4 .  ? -19.863 -85.028  4.833   1.00 30.09  ? 424 HOH D O   1 
HETATM 3192 O  O   . HOH R 4 .  ? -38.323 -100.639 -2.626  1.00 37.00  ? 425 HOH D O   1 
HETATM 3193 O  O   . HOH R 4 .  ? -35.666 -104.069 16.472  1.00 49.01  ? 426 HOH D O   1 
HETATM 3194 O  O   . HOH R 4 .  ? -38.685 -95.506  -6.959  1.00 47.09  ? 427 HOH D O   1 
HETATM 3195 O  O   . HOH R 4 .  ? -16.954 -80.739  12.348  1.00 38.26  ? 428 HOH D O   1 
HETATM 3196 O  O   . HOH R 4 .  ? -27.488 -88.188  -2.657  1.00 38.78  ? 429 HOH D O   1 
HETATM 3197 O  O   . HOH R 4 .  ? -30.758 -91.977  -5.142  1.00 39.00  ? 430 HOH D O   1 
HETATM 3198 O  O   . HOH R 4 .  ? -32.225 -104.167 -0.496  1.00 47.20  ? 431 HOH D O   1 
HETATM 3199 O  O   . HOH R 4 .  ? -34.996 -107.218 16.848  1.00 49.55  ? 432 HOH D O   1 
HETATM 3200 O  O   . HOH R 4 .  ? -30.491 -101.194 1.650   1.00 66.60  ? 433 HOH D O   1 
HETATM 3201 O  O   . HOH R 4 .  ? -15.538 -104.765 5.088   1.00 41.94  ? 434 HOH D O   1 
HETATM 3202 O  O   . HOH R 4 .  ? -34.132 -94.924  -6.801  1.00 53.53  ? 435 HOH D O   1 
HETATM 3203 O  O   . HOH R 4 .  ? -30.990 -93.971  -7.738  1.00 59.91  ? 436 HOH D O   1 
HETATM 3204 O  O   . HOH R 4 .  ? -38.023 -105.265 15.980  1.00 63.80  ? 437 HOH D O   1 
HETATM 3205 O  O   . HOH R 4 .  ? -27.186 -98.753  -0.613  1.00 30.78  ? 438 HOH D O   1 
HETATM 3206 O  O   . HOH R 4 .  ? -25.115 -79.158  0.596   1.00 34.53  ? 439 HOH D O   1 
HETATM 3207 O  O   . HOH R 4 .  ? -29.026 -102.867 3.330   1.00 29.21  ? 440 HOH D O   1 
HETATM 3208 O  O   . HOH R 4 .  ? -28.379 -117.968 13.942  1.00 66.04  ? 441 HOH D O   1 
HETATM 3209 O  O   . HOH R 4 .  ? -16.752 -100.994 10.740  1.00 48.97  ? 442 HOH D O   1 
HETATM 3210 O  O   . HOH R 4 .  ? -28.194 -92.175  -6.293  1.00 52.43  ? 443 HOH D O   1 
HETATM 3211 O  O   . HOH R 4 .  ? -38.127 -104.058 18.395  1.00 56.68  ? 444 HOH D O   1 
HETATM 3212 O  O   . HOH R 4 .  ? -30.030 -98.427  -2.308  1.00 46.00  ? 445 HOH D O   1 
HETATM 3213 O  O   . HOH R 4 .  ? -37.002 -87.487  17.377  1.00 44.84  ? 446 HOH D O   1 
HETATM 3214 O  O   . HOH R 4 .  ? -13.999 -95.248  10.719  1.00 52.32  ? 447 HOH D O   1 
HETATM 3215 O  O   . HOH R 4 .  ? -17.612 -88.074  14.240  1.00 45.40  ? 448 HOH D O   1 
HETATM 3216 O  O   . HOH R 4 .  ? -18.821 -85.517  9.750   1.00 38.80  ? 449 HOH D O   1 
HETATM 3217 O  O   . HOH R 4 .  ? -44.479 -90.501  -10.985 1.00 51.45  ? 450 HOH D O   1 
HETATM 3218 O  O   . HOH R 4 .  ? -15.052 -89.610  13.745  1.00 63.80  ? 451 HOH D O   1 
HETATM 3219 O  O   . HOH R 4 .  ? -15.155 -92.309  11.126  1.00 63.70  ? 452 HOH D O   1 
HETATM 3220 O  O   . HOH R 4 .  ? -27.214 -82.617  9.883   1.00 43.19  ? 453 HOH D O   1 
HETATM 3221 O  O   . HOH R 4 .  ? -13.766 -98.975  10.024  1.00 45.10  ? 454 HOH D O   1 
HETATM 3222 O  O   . HOH R 4 .  ? -24.700 -116.607 6.413   1.00 73.00  ? 455 HOH D O   1 
HETATM 3223 O  O   . HOH R 4 .  ? -41.632 -95.117  -7.223  1.00 86.25  ? 456 HOH D O   1 
HETATM 3224 O  O   . HOH R 4 .  ? -12.958 -92.106  12.774  1.00 98.01  ? 457 HOH D O   1 
HETATM 3225 O  O   . HOH R 4 .  ? -35.327 -125.416 17.847  1.00 82.08  ? 458 HOH D O   1 
HETATM 3226 O  O   . HOH R 4 .  ? -27.042 -101.562 -0.579  1.00 46.47  ? 459 HOH D O   1 
HETATM 3227 O  O   . HOH R 4 .  ? -40.204 -98.894  -6.362  1.00 67.98  ? 460 HOH D O   1 
HETATM 3228 O  O   . HOH R 4 .  ? -28.049 -94.165  -8.441  1.00 73.41  ? 461 HOH D O   1 
HETATM 3229 O  O   . HOH R 4 .  ? -10.292 -97.204  17.085  1.00 76.81  ? 462 HOH D O   1 
HETATM 3230 O  O   . HOH R 4 .  ? -14.978 -97.009  12.517  1.00 67.09  ? 463 HOH D O   1 
HETATM 3231 O  O   . HOH R 4 .  ? -12.849 -94.946  14.449  1.00 90.65  ? 464 HOH D O   1 
HETATM 3232 O  O   . HOH R 4 .  ? -40.545 -92.314  -8.591  1.00 87.37  ? 465 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . VAL A 6  ? 1.6122 1.7099 1.9092 0.0397  0.0197  0.3805  131 VAL A N   
2    C  CA  . VAL A 6  ? 1.5563 1.7083 1.8346 0.0569  0.0280  0.3666  131 VAL A CA  
3    C  C   . VAL A 6  ? 1.5402 1.7779 1.8118 0.0391  0.0224  0.3858  131 VAL A C   
4    O  O   . VAL A 6  ? 1.4891 1.7650 1.7347 0.0361  0.0237  0.3612  131 VAL A O   
5    C  CB  . VAL A 6  ? 1.6214 1.7681 1.9176 0.0935  0.0398  0.3786  131 VAL A CB  
6    C  CG1 . VAL A 6  ? 1.5722 1.7608 1.8467 0.1099  0.0483  0.3548  131 VAL A CG1 
7    C  CG2 . VAL A 6  ? 1.6927 1.7503 2.0005 0.1121  0.0459  0.3659  131 VAL A CG2 
8    N  N   . GLY A 7  ? 1.4964 1.7622 1.7908 0.0279  0.0164  0.4290  132 GLY A N   
9    C  CA  . GLY A 7  ? 1.4432 1.7884 1.7304 0.0112  0.0114  0.4492  132 GLY A CA  
10   C  C   . GLY A 7  ? 1.4574 1.8157 1.7224 -0.0163 0.0057  0.4277  132 GLY A C   
11   O  O   . GLY A 7  ? 1.4046 1.8212 1.6488 -0.0233 0.0054  0.4189  132 GLY A O   
12   N  N   . SER A 8  ? 1.4386 1.7403 1.7089 -0.0316 0.0009  0.4183  133 SER A N   
13   C  CA  . SER A 8  ? 1.4157 1.7215 1.6704 -0.0583 -0.0054 0.3990  133 SER A CA  
14   C  C   . SER A 8  ? 1.4134 1.7199 1.6358 -0.0533 -0.0019 0.3518  133 SER A C   
15   O  O   . SER A 8  ? 1.3757 1.7154 1.5818 -0.0704 -0.0050 0.3382  133 SER A O   
16   C  CB  . SER A 8  ? 1.5185 1.7568 1.7901 -0.0745 -0.0130 0.4010  133 SER A CB  
17   O  OG  . SER A 8  ? 1.6769 1.8408 1.9465 -0.0572 -0.0099 0.3746  133 SER A OG  
18   N  N   . VAL A 9  ? 1.3653 1.6369 1.5804 -0.0289 0.0052  0.3289  134 VAL A N   
19   C  CA  . VAL A 9  ? 1.3297 1.6012 1.5160 -0.0204 0.0098  0.2873  134 VAL A CA  
20   C  C   . VAL A 9  ? 1.2865 1.6326 1.4608 -0.0168 0.0128  0.2899  134 VAL A C   
21   O  O   . VAL A 9  ? 1.2495 1.6192 1.4024 -0.0260 0.0117  0.2659  134 VAL A O   
22   C  CB  . VAL A 9  ? 1.4182 1.6355 1.6018 0.0067  0.0183  0.2667  134 VAL A CB  
23   C  CG1 . VAL A 9  ? 1.3959 1.6103 1.5486 0.0120  0.0223  0.2242  134 VAL A CG1 
24   C  CG2 . VAL A 9  ? 1.4864 1.6262 1.6846 0.0052  0.0153  0.2675  134 VAL A CG2 
25   N  N   . ALA A 10 ? 1.2048 1.5870 1.3938 -0.0045 0.0154  0.3199  135 ALA A N   
26   C  CA  . ALA A 10 ? 1.1410 1.5925 1.3202 -0.0022 0.0162  0.3253  135 ALA A CA  
27   C  C   . ALA A 10 ? 1.1297 1.6262 1.2996 -0.0264 0.0103  0.3315  135 ALA A C   
28   O  O   . ALA A 10 ? 1.0849 1.6221 1.2354 -0.0298 0.0106  0.3149  135 ALA A O   
29   C  CB  . ALA A 10 ? 1.1566 1.6341 1.3562 0.0130  0.0177  0.3603  135 ALA A CB  
30   N  N   . ALA A 11 ? 1.0851 1.5731 1.2702 -0.0425 0.0056  0.3558  136 ALA A N   
31   C  CA  . ALA A 11 ? 1.0541 1.5846 1.2339 -0.0649 0.0016  0.3658  136 ALA A CA  
32   C  C   . ALA A 11 ? 1.0597 1.5802 1.2217 -0.0775 0.0004  0.3311  136 ALA A C   
33   O  O   . ALA A 11 ? 1.0261 1.5939 1.1740 -0.0867 0.0007  0.3249  136 ALA A O   
34   C  CB  . ALA A 11 ? 1.0996 1.6183 1.3045 -0.0787 -0.0029 0.4023  136 ALA A CB  
35   N  N   . LEU A 12 ? 1.0144 1.4739 1.1759 -0.0767 -0.0008 0.3081  137 LEU A N   
36   C  CA  . LEU A 12 ? 0.9894 1.4356 1.1347 -0.0880 -0.0033 0.2756  137 LEU A CA  
37   C  C   . LEU A 12 ? 0.9556 1.4313 1.0779 -0.0764 0.0016  0.2484  137 LEU A C   
38   O  O   . LEU A 12 ? 0.9207 1.4264 1.0311 -0.0871 0.0005  0.2352  137 LEU A O   
39   C  CB  . LEU A 12 ? 1.0366 1.4092 1.1837 -0.0879 -0.0065 0.2569  137 LEU A CB  
40   C  CG  . LEU A 12 ? 1.0965 1.4524 1.2281 -0.1030 -0.0119 0.2265  137 LEU A CG  
41   C  CD1 . LEU A 12 ? 1.1492 1.4575 1.2950 -0.1233 -0.0217 0.2320  137 LEU A CD1 
42   C  CD2 . LEU A 12 ? 1.1169 1.4473 1.2263 -0.0862 -0.0075 0.1905  137 LEU A CD2 
43   N  N   . LEU A 13 ? 0.8810 1.3491 1.0001 -0.0544 0.0072  0.2423  138 LEU A N   
44   C  CA  . LEU A 13 ? 0.8309 1.3243 0.9324 -0.0429 0.0114  0.2200  138 LEU A CA  
45   C  C   . LEU A 13 ? 0.8284 1.3853 0.9234 -0.0483 0.0109  0.2281  138 LEU A C   
46   O  O   . LEU A 13 ? 0.8046 1.3812 0.8844 -0.0514 0.0113  0.2066  138 LEU A O   
47   C  CB  . LEU A 13 ? 0.8382 1.3139 0.9430 -0.0187 0.0176  0.2180  138 LEU A CB  
48   C  CG  . LEU A 13 ? 0.8617 1.3544 0.9509 -0.0071 0.0220  0.1939  138 LEU A CG  
49   C  CD1 . LEU A 13 ? 0.8753 1.3256 0.9504 -0.0043 0.0241  0.1632  138 LEU A CD1 
50   C  CD2 . LEU A 13 ? 0.8862 1.3943 0.9852 0.0133  0.0269  0.2069  138 LEU A CD2 
51   N  N   . THR A 14 ? 0.7658 1.3539 0.8714 -0.0495 0.0098  0.2586  139 THR A N   
52   C  CA  . THR A 14 ? 0.7267 1.3750 0.8226 -0.0546 0.0091  0.2659  139 THR A CA  
53   C  C   . THR A 14 ? 0.7422 1.4099 0.8288 -0.0716 0.0083  0.2562  139 THR A C   
54   O  O   . THR A 14 ? 0.7107 1.4101 0.7816 -0.0721 0.0095  0.2393  139 THR A O   
55   C  CB  . THR A 14 ? 0.8495 1.5256 0.9577 -0.0538 0.0074  0.3029  139 THR A CB  
56   O  OG1 . THR A 14 ? 0.8805 1.5350 1.0022 -0.0367 0.0084  0.3135  139 THR A OG1 
57   C  CG2 . THR A 14 ? 0.8132 1.5516 0.9062 -0.0569 0.0061  0.3076  139 THR A CG2 
58   N  N   . VAL A 15 ? 0.7017 1.3486 0.8001 -0.0852 0.0061  0.2670  140 VAL A N   
59   C  CA  . VAL A 15 ? 0.6818 1.3467 0.7780 -0.1022 0.0052  0.2628  140 VAL A CA  
60   C  C   . VAL A 15 ? 0.6930 1.3454 0.7757 -0.1014 0.0056  0.2276  140 VAL A C   
61   O  O   . VAL A 15 ? 0.6640 1.3517 0.7370 -0.1053 0.0077  0.2171  140 VAL A O   
62   C  CB  . VAL A 15 ? 0.7606 1.4013 0.8776 -0.1180 0.0009  0.2853  140 VAL A CB  
63   C  CG1 . VAL A 15 ? 0.7532 1.3997 0.8713 -0.1355 -0.0014 0.2760  140 VAL A CG1 
64   C  CG2 . VAL A 15 ? 0.7703 1.4431 0.8999 -0.1221 0.0013  0.3245  140 VAL A CG2 
65   N  N   . VAL A 16 ? 0.6478 1.2512 0.7295 -0.0948 0.0041  0.2101  141 VAL A N   
66   C  CA  . VAL A 16 ? 0.6258 1.2142 0.6946 -0.0931 0.0038  0.1788  141 VAL A CA  
67   C  C   . VAL A 16 ? 0.6230 1.2421 0.6779 -0.0807 0.0081  0.1639  141 VAL A C   
68   O  O   . VAL A 16 ? 0.6024 1.2385 0.6488 -0.0839 0.0084  0.1469  141 VAL A O   
69   C  CB  . VAL A 16 ? 0.7053 1.2341 0.7739 -0.0883 0.0018  0.1654  141 VAL A CB  
70   C  CG1 . VAL A 16 ? 0.6890 1.2076 0.7409 -0.0764 0.0044  0.1364  141 VAL A CG1 
71   C  CG2 . VAL A 16 ? 0.7288 1.2284 0.8055 -0.1072 -0.0055 0.1669  141 VAL A CG2 
72   N  N   . PHE A 17 ? 0.5569 1.1846 0.6122 -0.0675 0.0104  0.1725  142 PHE A N   
73   C  CA  . PHE A 17 ? 0.5201 1.1758 0.5650 -0.0576 0.0125  0.1614  142 PHE A CA  
74   C  C   . PHE A 17 ? 0.5515 1.2547 0.5889 -0.0649 0.0126  0.1631  142 PHE A C   
75   O  O   . PHE A 17 ? 0.5202 1.2387 0.5475 -0.0628 0.0134  0.1442  142 PHE A O   
76   C  CB  . PHE A 17 ? 0.5447 1.2008 0.5955 -0.0437 0.0135  0.1744  142 PHE A CB  
77   C  CG  . PHE A 17 ? 0.5367 1.2030 0.5804 -0.0327 0.0147  0.1586  142 PHE A CG  
78   C  CD1 . PHE A 17 ? 0.5695 1.2054 0.6119 -0.0231 0.0177  0.1422  142 PHE A CD1 
79   C  CD2 . PHE A 17 ? 0.5412 1.2482 0.5790 -0.0331 0.0124  0.1598  142 PHE A CD2 
80   C  CE1 . PHE A 17 ? 0.5611 1.2099 0.5997 -0.0144 0.0188  0.1306  142 PHE A CE1 
81   C  CE2 . PHE A 17 ? 0.5609 1.2763 0.5952 -0.0256 0.0121  0.1464  142 PHE A CE2 
82   C  CZ  . PHE A 17 ? 0.5345 1.2219 0.5710 -0.0164 0.0155  0.1337  142 PHE A CZ  
83   N  N   . TYR A 18 ? 0.5305 1.2562 0.5728 -0.0730 0.0123  0.1857  143 TYR A N   
84   C  CA  . TYR A 18 ? 0.5278 1.3002 0.5602 -0.0784 0.0142  0.1870  143 TYR A CA  
85   C  C   . TYR A 18 ? 0.5391 1.3182 0.5694 -0.0864 0.0165  0.1725  143 TYR A C   
86   O  O   . TYR A 18 ? 0.5260 1.3296 0.5446 -0.0835 0.0191  0.1563  143 TYR A O   
87   C  CB  . TYR A 18 ? 0.5834 1.3855 0.6193 -0.0830 0.0141  0.2172  143 TYR A CB  
88   C  CG  . TYR A 18 ? 0.6563 1.4785 0.6853 -0.0740 0.0117  0.2243  143 TYR A CG  
89   C  CD1 . TYR A 18 ? 0.6890 1.5561 0.7001 -0.0743 0.0118  0.2205  143 TYR A CD1 
90   C  CD2 . TYR A 18 ? 0.6849 1.4812 0.7246 -0.0644 0.0091  0.2319  143 TYR A CD2 
91   C  CE1 . TYR A 18 ? 0.7234 1.6104 0.7275 -0.0684 0.0071  0.2259  143 TYR A CE1 
92   C  CE2 . TYR A 18 ? 0.7004 1.5193 0.7366 -0.0568 0.0057  0.2396  143 TYR A CE2 
93   C  CZ  . TYR A 18 ? 0.8430 1.7076 0.8614 -0.0602 0.0036  0.2369  143 TYR A CZ  
94   O  OH  . TYR A 18 ? 0.9230 1.8114 0.9379 -0.0552 -0.0021 0.2447  143 TYR A OH  
95   N  N   . ILE A 19 ? 0.4664 1.2208 0.5089 -0.0961 0.0148  0.1770  144 ILE A N   
96   C  CA  . ILE A 19 ? 0.4348 1.1956 0.4799 -0.1049 0.0155  0.1664  144 ILE A CA  
97   C  C   . ILE A 19 ? 0.4066 1.1537 0.4433 -0.0978 0.0152  0.1379  144 ILE A C   
98   O  O   . ILE A 19 ? 0.3932 1.1648 0.4268 -0.0979 0.0182  0.1269  144 ILE A O   
99   C  CB  . ILE A 19 ? 0.4983 1.2402 0.5603 -0.1205 0.0114  0.1819  144 ILE A CB  
100  C  CG1 . ILE A 19 ? 0.5173 1.2978 0.5882 -0.1301 0.0143  0.2102  144 ILE A CG1 
101  C  CG2 . ILE A 19 ? 0.4994 1.2317 0.5650 -0.1287 0.0084  0.1660  144 ILE A CG2 
102  C  CD1 . ILE A 19 ? 0.6647 1.4225 0.7531 -0.1408 0.0095  0.2370  144 ILE A CD1 
103  N  N   . ALA A 20 ? 0.3070 1.0180 0.3410 -0.0900 0.0126  0.1274  145 ALA A N   
104  C  CA  . ALA A 20 ? 0.2643 0.9639 0.2908 -0.0828 0.0124  0.1037  145 ALA A CA  
105  C  C   . ALA A 20 ? 0.2911 1.0197 0.3091 -0.0743 0.0155  0.0941  145 ALA A C   
106  O  O   . ALA A 20 ? 0.2653 1.0010 0.2807 -0.0727 0.0163  0.0784  145 ALA A O   
107  C  CB  . ALA A 20 ? 0.2781 0.9387 0.3026 -0.0747 0.0109  0.0979  145 ALA A CB  
108  N  N   . ALA A 21 ? 0.2571 1.0024 0.2713 -0.0695 0.0162  0.1043  146 ALA A N   
109  C  CA  . ALA A 21 ? 0.2391 1.0105 0.2436 -0.0635 0.0170  0.0953  146 ALA A CA  
110  C  C   . ALA A 21 ? 0.3048 1.1083 0.3037 -0.0673 0.0208  0.0906  146 ALA A C   
111  O  O   . ALA A 21 ? 0.2980 1.1127 0.2896 -0.0625 0.0217  0.0740  146 ALA A O   
112  C  CB  . ALA A 21 ? 0.2540 1.0366 0.2561 -0.0600 0.0149  0.1098  146 ALA A CB  
113  N  N   . VAL A 22 ? 0.2770 1.0947 0.2809 -0.0754 0.0235  0.1057  147 VAL A N   
114  C  CA  . VAL A 22 ? 0.2802 1.1313 0.2816 -0.0781 0.0294  0.1041  147 VAL A CA  
115  C  C   . VAL A 22 ? 0.3375 1.1791 0.3457 -0.0772 0.0305  0.0869  147 VAL A C   
116  O  O   . VAL A 22 ? 0.3403 1.1984 0.3430 -0.0708 0.0346  0.0717  147 VAL A O   
117  C  CB  . VAL A 22 ? 0.3366 1.2064 0.3464 -0.0884 0.0318  0.1296  147 VAL A CB  
118  C  CG1 . VAL A 22 ? 0.3264 1.2313 0.3384 -0.0906 0.0394  0.1289  147 VAL A CG1 
119  C  CG2 . VAL A 22 ? 0.3481 1.2364 0.3504 -0.0883 0.0314  0.1485  147 VAL A CG2 
120  N  N   . MET A 23 ? 0.2749 1.0890 0.2946 -0.0835 0.0262  0.0893  148 MET A N   
121  C  CA  . MET A 23 ? 0.2461 1.0524 0.2732 -0.0847 0.0251  0.0770  148 MET A CA  
122  C  C   . MET A 23 ? 0.2246 1.0241 0.2454 -0.0738 0.0252  0.0569  148 MET A C   
123  O  O   . MET A 23 ? 0.1993 1.0135 0.2242 -0.0704 0.0283  0.0475  148 MET A O   
124  C  CB  . MET A 23 ? 0.2914 1.0647 0.3258 -0.0935 0.0182  0.0807  148 MET A CB  
125  C  CG  . MET A 23 ? 0.3704 1.1482 0.4161 -0.1075 0.0163  0.1001  148 MET A CG  
126  S  SD  . MET A 23 ? 0.4594 1.1963 0.5117 -0.1199 0.0062  0.0981  148 MET A SD  
127  C  CE  . MET A 23 ? 0.4306 1.1929 0.5028 -0.1391 0.0044  0.1204  148 MET A CE  
128  N  N   . ALA A 24 ? 0.1572 0.9356 0.1710 -0.0681 0.0220  0.0521  149 ALA A N   
129  C  CA  . ALA A 24 ? 0.1279 0.8985 0.1383 -0.0594 0.0209  0.0363  149 ALA A CA  
130  C  C   . ALA A 24 ? 0.1789 0.9731 0.1836 -0.0537 0.0244  0.0266  149 ALA A C   
131  O  O   . ALA A 24 ? 0.1642 0.9581 0.1724 -0.0488 0.0252  0.0136  149 ALA A O   
132  C  CB  . ALA A 24 ? 0.1316 0.8811 0.1385 -0.0553 0.0176  0.0380  149 ALA A CB  
133  N  N   . THR A 25 ? 0.1501 0.9646 0.1456 -0.0544 0.0263  0.0331  150 THR A N   
134  C  CA  . THR A 25 ? 0.1633 1.0005 0.1480 -0.0496 0.0297  0.0219  150 THR A CA  
135  C  C   . THR A 25 ? 0.2414 1.0928 0.2321 -0.0464 0.0367  0.0139  150 THR A C   
136  O  O   . THR A 25 ? 0.2473 1.0994 0.2361 -0.0389 0.0387  -0.0032 150 THR A O   
137  C  CB  . THR A 25 ? 0.2653 1.1273 0.2374 -0.0526 0.0311  0.0340  150 THR A CB  
138  O  OG1 . THR A 25 ? 0.3730 1.2241 0.3428 -0.0542 0.0244  0.0434  150 THR A OG1 
139  C  CG2 . THR A 25 ? 0.2099 1.0957 0.1653 -0.0476 0.0346  0.0199  150 THR A CG2 
140  N  N   . ASN A 26 ? 0.2007 1.0627 0.2014 -0.0522 0.0401  0.0275  151 ASN A N   
141  C  CA  . ASN A 26 ? 0.1922 1.0733 0.2036 -0.0498 0.0469  0.0254  151 ASN A CA  
142  C  C   . ASN A 26 ? 0.2057 1.0684 0.2298 -0.0461 0.0439  0.0149  151 ASN A C   
143  O  O   . ASN A 26 ? 0.1994 1.0712 0.2280 -0.0369 0.0490  0.0032  151 ASN A O   
144  C  CB  . ASN A 26 ? 0.1921 1.0900 0.2143 -0.0603 0.0487  0.0464  151 ASN A CB  
145  C  CG  . ASN A 26 ? 0.3686 1.2932 0.4055 -0.0583 0.0559  0.0482  151 ASN A CG  
146  O  OD1 . ASN A 26 ? 0.3346 1.2548 0.3885 -0.0657 0.0519  0.0556  151 ASN A OD1 
147  N  ND2 . ASN A 26 ? 0.1534 1.1067 0.1836 -0.0476 0.0664  0.0406  151 ASN A ND2 
148  N  N   . LEU A 27 ? 0.1406 0.9777 0.1696 -0.0522 0.0362  0.0191  152 LEU A N   
149  C  CA  . LEU A 27 ? 0.1264 0.9487 0.1657 -0.0503 0.0324  0.0126  152 LEU A CA  
150  C  C   . LEU A 27 ? 0.1977 1.0072 0.2351 -0.0405 0.0313  -0.0024 152 LEU A C   
151  O  O   . LEU A 27 ? 0.1946 1.0095 0.2427 -0.0339 0.0337  -0.0091 152 LEU A O   
152  C  CB  . LEU A 27 ? 0.1203 0.9192 0.1603 -0.0597 0.0248  0.0200  152 LEU A CB  
153  C  CG  . LEU A 27 ? 0.1737 0.9803 0.2221 -0.0718 0.0229  0.0334  152 LEU A CG  
154  C  CD1 . LEU A 27 ? 0.1818 0.9604 0.2241 -0.0803 0.0165  0.0393  152 LEU A CD1 
155  C  CD2 . LEU A 27 ? 0.2015 1.0173 0.2637 -0.0741 0.0206  0.0330  152 LEU A CD2 
156  N  N   . TYR A 28 ? 0.1545 0.9478 0.1815 -0.0398 0.0275  -0.0056 153 TYR A N   
157  C  CA  . TYR A 28 ? 0.1345 0.9134 0.1625 -0.0339 0.0242  -0.0163 153 TYR A CA  
158  C  C   . TYR A 28 ? 0.1835 0.9662 0.2017 -0.0302 0.0242  -0.0263 153 TYR A C   
159  O  O   . TYR A 28 ? 0.1814 0.9510 0.2017 -0.0279 0.0197  -0.0334 153 TYR A O   
160  C  CB  . TYR A 28 ? 0.1427 0.9012 0.1700 -0.0366 0.0187  -0.0108 153 TYR A CB  
161  C  CG  . TYR A 28 ? 0.1748 0.9266 0.2033 -0.0428 0.0174  -0.0017 153 TYR A CG  
162  C  CD1 . TYR A 28 ? 0.1869 0.9398 0.2242 -0.0442 0.0162  -0.0017 153 TYR A CD1 
163  C  CD2 . TYR A 28 ? 0.1997 0.9421 0.2209 -0.0474 0.0162  0.0068  153 TYR A CD2 
164  C  CE1 . TYR A 28 ? 0.1865 0.9309 0.2224 -0.0519 0.0127  0.0042  153 TYR A CE1 
165  C  CE2 . TYR A 28 ? 0.2179 0.9473 0.2389 -0.0537 0.0138  0.0121  153 TYR A CE2 
166  C  CZ  . TYR A 28 ? 0.2865 1.0168 0.3134 -0.0569 0.0115  0.0097  153 TYR A CZ  
167  O  OH  . TYR A 28 ? 0.3192 1.0359 0.3435 -0.0652 0.0072  0.0130  153 TYR A OH  
168  N  N   . GLY A 29 ? 0.1329 0.9348 0.1404 -0.0306 0.0286  -0.0263 154 GLY A N   
169  C  CA  . GLY A 29 ? 0.1337 0.9424 0.1267 -0.0285 0.0278  -0.0369 154 GLY A CA  
170  C  C   . GLY A 29 ? 0.2010 1.0039 0.1957 -0.0210 0.0289  -0.0564 154 GLY A C   
171  O  O   . GLY A 29 ? 0.2280 1.0230 0.2144 -0.0216 0.0231  -0.0673 154 GLY A O   
172  N  N   . ALA A 30 ? 0.1551 0.9616 0.1616 -0.0140 0.0356  -0.0605 155 ALA A N   
173  C  CA  . ALA A 30 ? 0.1711 0.9691 0.1815 -0.0044 0.0379  -0.0791 155 ALA A CA  
174  C  C   . ALA A 30 ? 0.2370 1.0091 0.2648 -0.0038 0.0309  -0.0806 155 ALA A C   
175  O  O   . ALA A 30 ? 0.2405 0.9964 0.2697 -0.0003 0.0276  -0.0953 155 ALA A O   
176  C  CB  . ALA A 30 ? 0.1843 1.0012 0.2023 0.0054  0.0497  -0.0810 155 ALA A CB  
177  N  N   . THR A 31 ? 0.1995 0.9679 0.2402 -0.0077 0.0283  -0.0655 156 THR A N   
178  C  CA  . THR A 31 ? 0.2000 0.9500 0.2572 -0.0074 0.0226  -0.0623 156 THR A CA  
179  C  C   . THR A 31 ? 0.3072 1.0436 0.3603 -0.0144 0.0139  -0.0591 156 THR A C   
180  O  O   . THR A 31 ? 0.3105 1.0323 0.3760 -0.0139 0.0088  -0.0600 156 THR A O   
181  C  CB  . THR A 31 ? 0.1602 0.9168 0.2302 -0.0078 0.0241  -0.0486 156 THR A CB  
182  O  OG1 . THR A 31 ? 0.2037 0.9705 0.2632 -0.0153 0.0247  -0.0387 156 THR A OG1 
183  C  CG2 . THR A 31 ? 0.0835 0.7950 0.1167 -0.0005 0.0114  -0.0502 156 THR A CG2 
184  N  N   . PHE A 32 ? 0.2783 1.0219 0.3169 -0.0206 0.0125  -0.0528 157 PHE A N   
185  C  CA  . PHE A 32 ? 0.2683 1.0055 0.3038 -0.0261 0.0055  -0.0467 157 PHE A CA  
186  C  C   . PHE A 32 ? 0.3294 1.0780 0.3474 -0.0300 0.0035  -0.0500 157 PHE A C   
187  O  O   . PHE A 32 ? 0.3182 1.0746 0.3291 -0.0332 0.0037  -0.0383 157 PHE A O   
188  C  CB  . PHE A 32 ? 0.2750 1.0095 0.3132 -0.0278 0.0060  -0.0316 157 PHE A CB  
189  C  CG  . PHE A 32 ? 0.2857 1.0125 0.3374 -0.0250 0.0063  -0.0283 157 PHE A CG  
190  C  CD1 . PHE A 32 ? 0.3176 1.0495 0.3729 -0.0235 0.0102  -0.0270 157 PHE A CD1 
191  C  CD2 . PHE A 32 ? 0.3032 1.0216 0.3653 -0.0247 0.0021  -0.0242 157 PHE A CD2 
192  C  CE1 . PHE A 32 ? 0.3238 1.0525 0.3911 -0.0214 0.0092  -0.0226 157 PHE A CE1 
193  C  CE2 . PHE A 32 ? 0.3298 1.0450 0.4036 -0.0222 0.0022  -0.0190 157 PHE A CE2 
194  C  CZ  . PHE A 32 ? 0.3053 1.0256 0.3808 -0.0204 0.0054  -0.0186 157 PHE A CZ  
195  N  N   . PRO A 33 ? 0.2993 1.0486 0.3097 -0.0295 0.0013  -0.0661 158 PRO A N   
196  C  CA  . PRO A 33 ? 0.3092 1.0738 0.2993 -0.0336 -0.0010 -0.0697 158 PRO A CA  
197  C  C   . PRO A 33 ? 0.3625 1.1311 0.3497 -0.0414 -0.0106 -0.0602 158 PRO A C   
198  O  O   . PRO A 33 ? 0.3733 1.1598 0.3446 -0.0447 -0.0119 -0.0564 158 PRO A O   
199  C  CB  . PRO A 33 ? 0.3545 1.1153 0.3357 -0.0301 -0.0007 -0.0929 158 PRO A CB  
200  C  CG  . PRO A 33 ? 0.4017 1.1387 0.4030 -0.0276 -0.0038 -0.0990 158 PRO A CG  
201  C  CD  . PRO A 33 ? 0.3218 1.0575 0.3401 -0.0246 0.0012  -0.0825 158 PRO A CD  
202  N  N   . GLU A 34 ? 0.2934 1.0493 0.2968 -0.0439 -0.0171 -0.0544 159 GLU A N   
203  C  CA  . GLU A 34 ? 0.2801 1.0434 0.2860 -0.0502 -0.0257 -0.0426 159 GLU A CA  
204  C  C   . GLU A 34 ? 0.2810 1.0526 0.2875 -0.0476 -0.0207 -0.0227 159 GLU A C   
205  O  O   . GLU A 34 ? 0.2491 1.0349 0.2512 -0.0506 -0.0248 -0.0118 159 GLU A O   
206  C  CB  . GLU A 34 ? 0.3001 1.0506 0.3267 -0.0529 -0.0323 -0.0399 159 GLU A CB  
207  C  CG  . GLU A 34 ? 0.4983 1.2582 0.5290 -0.0622 -0.0448 -0.0348 159 GLU A CG  
208  C  CD  . GLU A 34 ? 0.7699 1.5320 0.7860 -0.0706 -0.0548 -0.0530 159 GLU A CD  
209  O  OE1 . GLU A 34 ? 0.7282 1.4719 0.7442 -0.0708 -0.0561 -0.0721 159 GLU A OE1 
210  O  OE2 . GLU A 34 ? 0.5183 1.3000 0.5230 -0.0769 -0.0618 -0.0481 159 GLU A OE2 
211  N  N   . TRP A 35 ? 0.2473 1.0096 0.2593 -0.0420 -0.0123 -0.0182 160 TRP A N   
212  C  CA  . TRP A 35 ? 0.2304 0.9928 0.2427 -0.0393 -0.0076 -0.0024 160 TRP A CA  
213  C  C   . TRP A 35 ? 0.2258 0.9963 0.2268 -0.0397 -0.0022 0.0009  160 TRP A C   
214  O  O   . TRP A 35 ? 0.2056 0.9794 0.2051 -0.0397 -0.0014 0.0152  160 TRP A O   
215  C  CB  . TRP A 35 ? 0.2098 0.9565 0.2330 -0.0347 -0.0035 0.0012  160 TRP A CB  
216  C  CG  . TRP A 35 ? 0.2250 0.9673 0.2616 -0.0339 -0.0074 0.0026  160 TRP A CG  
217  C  CD1 . TRP A 35 ? 0.2683 1.0189 0.3117 -0.0373 -0.0146 0.0067  160 TRP A CD1 
218  C  CD2 . TRP A 35 ? 0.2160 0.9480 0.2622 -0.0304 -0.0049 0.0030  160 TRP A CD2 
219  N  NE1 . TRP A 35 ? 0.2594 1.0054 0.3180 -0.0363 -0.0160 0.0105  160 TRP A NE1 
220  C  CE2 . TRP A 35 ? 0.2657 1.0007 0.3253 -0.0315 -0.0097 0.0084  160 TRP A CE2 
221  C  CE3 . TRP A 35 ? 0.2239 0.9474 0.2691 -0.0275 0.0002  0.0009  160 TRP A CE3 
222  C  CZ2 . TRP A 35 ? 0.2464 0.9767 0.3179 -0.0291 -0.0085 0.0123  160 TRP A CZ2 
223  C  CZ3 . TRP A 35 ? 0.2346 0.9535 0.2893 -0.0249 0.0006  0.0037  160 TRP A CZ3 
224  C  CH2 . TRP A 35 ? 0.2401 0.9627 0.3077 -0.0253 -0.0032 0.0098  160 TRP A CH2 
225  N  N   . PHE A 36 ? 0.1711 0.9455 0.1667 -0.0396 0.0020  -0.0101 161 PHE A N   
226  C  CA  . PHE A 36 ? 0.1666 0.9530 0.1544 -0.0408 0.0080  -0.0045 161 PHE A CA  
227  C  C   . PHE A 36 ? 0.2417 1.0477 0.2166 -0.0406 0.0111  -0.0156 161 PHE A C   
228  O  O   . PHE A 36 ? 0.2176 1.0365 0.1897 -0.0407 0.0179  -0.0115 161 PHE A O   
229  C  CB  . PHE A 36 ? 0.1676 0.9429 0.1645 -0.0400 0.0130  -0.0012 161 PHE A CB  
230  C  CG  . PHE A 36 ? 0.1696 0.9246 0.1747 -0.0389 0.0114  0.0054  161 PHE A CG  
231  C  CD1 . PHE A 36 ? 0.2100 0.9574 0.2143 -0.0402 0.0119  0.0185  161 PHE A CD1 
232  C  CD2 . PHE A 36 ? 0.1815 0.9247 0.1948 -0.0358 0.0101  -0.0015 161 PHE A CD2 
233  C  CE1 . PHE A 36 ? 0.2212 0.9483 0.2297 -0.0372 0.0119  0.0214  161 PHE A CE1 
234  C  CE2 . PHE A 36 ? 0.2076 0.9354 0.2247 -0.0338 0.0100  0.0038  161 PHE A CE2 
235  C  CZ  . PHE A 36 ? 0.1906 0.9097 0.2037 -0.0340 0.0113  0.0136  161 PHE A CZ  
236  N  N   . GLY A 37 ? 0.2357 1.0448 0.2024 -0.0408 0.0060  -0.0291 162 GLY A N   
237  C  CA  . GLY A 37 ? 0.2577 1.0817 0.2080 -0.0389 0.0088  -0.0449 162 GLY A CA  
238  C  C   . GLY A 37 ? 0.3155 1.1683 0.2468 -0.0412 0.0119  -0.0379 162 GLY A C   
239  O  O   . GLY A 37 ? 0.3280 1.1957 0.2432 -0.0379 0.0165  -0.0519 162 GLY A O   
240  N  N   . ASP A 38 ? 0.2638 1.1248 0.1963 -0.0460 0.0094  -0.0159 163 ASP A N   
241  C  CA  . ASP A 38 ? 0.2714 1.1609 0.1901 -0.0493 0.0116  -0.0009 163 ASP A CA  
242  C  C   . ASP A 38 ? 0.3151 1.1989 0.2479 -0.0523 0.0109  0.0254  163 ASP A C   
243  O  O   . ASP A 38 ? 0.3101 1.1684 0.2589 -0.0510 0.0085  0.0278  163 ASP A O   
244  C  CB  . ASP A 38 ? 0.3143 1.2245 0.2105 -0.0528 0.0040  -0.0071 163 ASP A CB  
245  C  CG  . ASP A 38 ? 0.4079 1.3072 0.3080 -0.0570 -0.0091 -0.0095 163 ASP A CG  
246  O  OD1 . ASP A 38 ? 0.4229 1.3240 0.3331 -0.0596 -0.0141 0.0118  163 ASP A OD1 
247  O  OD2 . ASP A 38 ? 0.4299 1.3217 0.3221 -0.0580 -0.0148 -0.0318 163 ASP A OD2 
248  N  N   . LEU A 39 ? 0.2663 1.1723 0.1936 -0.0557 0.0135  0.0453  164 LEU A N   
249  C  CA  . LEU A 39 ? 0.2502 1.1457 0.1926 -0.0581 0.0127  0.0703  164 LEU A CA  
250  C  C   . LEU A 39 ? 0.3113 1.1936 0.2611 -0.0566 0.0043  0.0775  164 LEU A C   
251  O  O   . LEU A 39 ? 0.2967 1.1527 0.2625 -0.0541 0.0046  0.0842  164 LEU A O   
252  C  CB  . LEU A 39 ? 0.2554 1.1782 0.1932 -0.0627 0.0164  0.0935  164 LEU A CB  
253  C  CG  . LEU A 39 ? 0.2965 1.2033 0.2529 -0.0658 0.0166  0.1193  164 LEU A CG  
254  C  CD1 . LEU A 39 ? 0.2837 1.1659 0.2544 -0.0675 0.0211  0.1148  164 LEU A CD1 
255  C  CD2 . LEU A 39 ? 0.3395 1.2769 0.2922 -0.0711 0.0187  0.1452  164 LEU A CD2 
256  N  N   . SER A 40 ? 0.2796 1.1812 0.2174 -0.0581 -0.0032 0.0746  165 SER A N   
257  C  CA  . SER A 40 ? 0.2679 1.1669 0.2138 -0.0574 -0.0122 0.0830  165 SER A CA  
258  C  C   . SER A 40 ? 0.2965 1.1659 0.2582 -0.0530 -0.0130 0.0724  165 SER A C   
259  O  O   . SER A 40 ? 0.3067 1.1624 0.2843 -0.0484 -0.0131 0.0863  165 SER A O   
260  C  CB  . SER A 40 ? 0.3179 1.2445 0.2462 -0.0625 -0.0218 0.0762  165 SER A CB  
261  O  OG  . SER A 40 ? 0.5007 1.4593 0.4165 -0.0660 -0.0230 0.0948  165 SER A OG  
262  N  N   . LYS A 41 ? 0.2052 1.0652 0.1630 -0.0533 -0.0129 0.0485  166 LYS A N   
263  C  CA  . LYS A 41 ? 0.1667 1.0026 0.1389 -0.0499 -0.0136 0.0394  166 LYS A CA  
264  C  C   . LYS A 41 ? 0.2137 1.0271 0.1979 -0.0449 -0.0059 0.0465  166 LYS A C   
265  O  O   . LYS A 41 ? 0.2047 1.0031 0.2013 -0.0404 -0.0062 0.0511  166 LYS A O   
266  C  CB  . LYS A 41 ? 0.1790 1.0088 0.1458 -0.0510 -0.0140 0.0149  166 LYS A CB  
267  C  CG  . LYS A 41 ? 0.1027 0.9433 0.0651 -0.0565 -0.0203 0.0029  166 LYS A CG  
268  C  CD  . LYS A 41 ? 0.1971 1.0284 0.1475 -0.0557 -0.0221 -0.0224 166 LYS A CD  
269  C  CE  . LYS A 41 ? 0.3269 1.1590 0.2691 -0.0618 -0.0330 -0.0398 166 LYS A CE  
270  N  NZ  . LYS A 41 ? 0.4789 1.2937 0.4188 -0.0581 -0.0293 -0.0642 166 LYS A NZ  
271  N  N   . SER A 42 ? 0.1804 0.9934 0.1602 -0.0462 0.0007  0.0481  167 SER A N   
272  C  CA  . SER A 42 ? 0.1709 0.9628 0.1594 -0.0447 0.0063  0.0536  167 SER A CA  
273  C  C   . SER A 42 ? 0.2139 0.9942 0.2104 -0.0420 0.0063  0.0729  167 SER A C   
274  O  O   . SER A 42 ? 0.2180 0.9733 0.2221 -0.0377 0.0084  0.0721  167 SER A O   
275  C  CB  . SER A 42 ? 0.2268 1.0279 0.2108 -0.0492 0.0115  0.0530  167 SER A CB  
276  O  OG  . SER A 42 ? 0.3371 1.1393 0.3198 -0.0483 0.0139  0.0349  167 SER A OG  
277  N  N   . LEU A 43 ? 0.1613 0.9596 0.1557 -0.0437 0.0043  0.0903  168 LEU A N   
278  C  CA  . LEU A 43 ? 0.1661 0.9538 0.1711 -0.0392 0.0043  0.1112  168 LEU A CA  
279  C  C   . LEU A 43 ? 0.2103 0.9902 0.2246 -0.0305 0.0023  0.1111  168 LEU A C   
280  O  O   . LEU A 43 ? 0.2110 0.9680 0.2355 -0.0225 0.0059  0.1183  168 LEU A O   
281  C  CB  . LEU A 43 ? 0.1770 0.9922 0.1790 -0.0426 0.0014  0.1322  168 LEU A CB  
282  C  CG  . LEU A 43 ? 0.2402 1.0690 0.2357 -0.0506 0.0045  0.1400  168 LEU A CG  
283  C  CD1 . LEU A 43 ? 0.2496 1.1180 0.2343 -0.0544 0.0007  0.1536  168 LEU A CD1 
284  C  CD2 . LEU A 43 ? 0.2580 1.0614 0.2670 -0.0514 0.0078  0.1562  168 LEU A CD2 
285  N  N   . TYR A 44 ? 0.1468 0.9457 0.1579 -0.0321 -0.0033 0.1025  169 TYR A N   
286  C  CA  . TYR A 44 ? 0.1356 0.9339 0.1580 -0.0259 -0.0059 0.1038  169 TYR A CA  
287  C  C   . TYR A 44 ? 0.1929 0.9638 0.2206 -0.0199 0.0001  0.0918  169 TYR A C   
288  O  O   . TYR A 44 ? 0.1808 0.9404 0.2192 -0.0100 0.0040  0.0995  169 TYR A O   
289  C  CB  . TYR A 44 ? 0.1427 0.9654 0.1610 -0.0327 -0.0151 0.0959  169 TYR A CB  
290  C  CG  . TYR A 44 ? 0.1659 0.9908 0.2002 -0.0282 -0.0182 0.1000  169 TYR A CG  
291  C  CD1 . TYR A 44 ? 0.1990 1.0413 0.2463 -0.0237 -0.0215 0.1213  169 TYR A CD1 
292  C  CD2 . TYR A 44 ? 0.1572 0.9681 0.1966 -0.0270 -0.0165 0.0861  169 TYR A CD2 
293  C  CE1 . TYR A 44 ? 0.2074 1.0553 0.2729 -0.0183 -0.0227 0.1281  169 TYR A CE1 
294  C  CE2 . TYR A 44 ? 0.1576 0.9733 0.2139 -0.0225 -0.0177 0.0933  169 TYR A CE2 
295  C  CZ  . TYR A 44 ? 0.2852 1.1202 0.3547 -0.0180 -0.0204 0.1141  169 TYR A CZ  
296  O  OH  . TYR A 44 ? 0.3243 1.1696 0.4131 -0.0135 -0.0211 0.1233  169 TYR A OH  
297  N  N   . THR A 45 ? 0.1449 0.9085 0.1650 -0.0248 0.0011  0.0735  170 THR A N   
298  C  CA  . THR A 45 ? 0.1386 0.8815 0.1614 -0.0209 0.0053  0.0625  170 THR A CA  
299  C  C   . THR A 45 ? 0.2193 0.9373 0.2420 -0.0156 0.0116  0.0668  170 THR A C   
300  O  O   . THR A 45 ? 0.2230 0.9268 0.2495 -0.0072 0.0156  0.0661  170 THR A O   
301  C  CB  . THR A 45 ? 0.2173 0.9612 0.2344 -0.0270 0.0042  0.0454  170 THR A CB  
302  O  OG1 . THR A 45 ? 0.2856 1.0474 0.3024 -0.0313 -0.0022 0.0403  170 THR A OG1 
303  C  CG2 . THR A 45 ? 0.1561 0.8840 0.1770 -0.0236 0.0071  0.0366  170 THR A CG2 
304  N  N   . LEU A 46 ? 0.1915 0.9044 0.2097 -0.0205 0.0125  0.0718  171 LEU A N   
305  C  CA  . LEU A 46 ? 0.2018 0.8864 0.2200 -0.0181 0.0165  0.0749  171 LEU A CA  
306  C  C   . LEU A 46 ? 0.2924 0.9643 0.3185 -0.0067 0.0197  0.0884  171 LEU A C   
307  O  O   . LEU A 46 ? 0.3188 0.9609 0.3437 -0.0008 0.0240  0.0852  171 LEU A O   
308  C  CB  . LEU A 46 ? 0.2022 0.8852 0.2171 -0.0286 0.0156  0.0782  171 LEU A CB  
309  C  CG  . LEU A 46 ? 0.2379 0.9279 0.2476 -0.0369 0.0148  0.0642  171 LEU A CG  
310  C  CD1 . LEU A 46 ? 0.2383 0.9391 0.2479 -0.0469 0.0145  0.0721  171 LEU A CD1 
311  C  CD2 . LEU A 46 ? 0.2787 0.9444 0.2860 -0.0363 0.0157  0.0520  171 LEU A CD2 
312  N  N   . PHE A 47 ? 0.2414 0.9360 0.2754 -0.0028 0.0174  0.1026  172 PHE A N   
313  C  CA  . PHE A 47 ? 0.2401 0.9279 0.2860 0.0106  0.0211  0.1177  172 PHE A CA  
314  C  C   . PHE A 47 ? 0.3009 0.9828 0.3495 0.0216  0.0261  0.1089  172 PHE A C   
315  O  O   . PHE A 47 ? 0.3187 0.9781 0.3705 0.0347  0.0335  0.1103  172 PHE A O   
316  C  CB  . PHE A 47 ? 0.2430 0.9635 0.2981 0.0104  0.0158  0.1377  172 PHE A CB  
317  C  CG  . PHE A 47 ? 0.2593 0.9781 0.3311 0.0259  0.0198  0.1563  172 PHE A CG  
318  C  CD1 . PHE A 47 ? 0.3062 1.0053 0.3857 0.0325  0.0233  0.1718  172 PHE A CD1 
319  C  CD2 . PHE A 47 ? 0.2622 0.9997 0.3451 0.0344  0.0202  0.1600  172 PHE A CD2 
320  C  CE1 . PHE A 47 ? 0.3208 1.0173 0.4181 0.0497  0.0283  0.1894  172 PHE A CE1 
321  C  CE2 . PHE A 47 ? 0.3014 1.0410 0.4025 0.0508  0.0254  0.1786  172 PHE A CE2 
322  C  CZ  . PHE A 47 ? 0.2986 1.0170 0.4066 0.0595  0.0298  0.1928  172 PHE A CZ  
323  N  N   . GLN A 48 ? 0.2274 0.9297 0.2749 0.0164  0.0223  0.1000  173 GLN A N   
324  C  CA  . GLN A 48 ? 0.2080 0.9121 0.2596 0.0240  0.0261  0.0941  173 GLN A CA  
325  C  C   . GLN A 48 ? 0.2835 0.9582 0.3228 0.0272  0.0323  0.0785  173 GLN A C   
326  O  O   . GLN A 48 ? 0.2972 0.9614 0.3370 0.0402  0.0401  0.0779  173 GLN A O   
327  C  CB  . GLN A 48 ? 0.1928 0.9219 0.2472 0.0142  0.0185  0.0889  173 GLN A CB  
328  C  CG  . GLN A 48 ? 0.1991 0.9287 0.2574 0.0187  0.0218  0.0827  173 GLN A CG  
329  C  CD  . GLN A 48 ? 0.3166 1.0580 0.3756 0.0072  0.0145  0.0733  173 GLN A CD  
330  O  OE1 . GLN A 48 ? 0.2043 0.9607 0.2644 -0.0026 0.0060  0.0729  173 GLN A OE1 
331  N  NE2 . GLN A 48 ? 0.1245 0.8600 0.1833 0.0090  0.0177  0.0659  173 GLN A NE2 
332  N  N   . VAL A 49 ? 0.2468 0.9112 0.2748 0.0156  0.0289  0.0666  174 VAL A N   
333  C  CA  . VAL A 49 ? 0.2596 0.8988 0.2748 0.0150  0.0318  0.0523  174 VAL A CA  
334  C  C   . VAL A 49 ? 0.3818 0.9906 0.3933 0.0248  0.0378  0.0542  174 VAL A C   
335  O  O   . VAL A 49 ? 0.4097 1.0010 0.4123 0.0338  0.0436  0.0449  174 VAL A O   
336  C  CB  . VAL A 49 ? 0.2816 0.9197 0.2897 0.0002  0.0262  0.0432  174 VAL A CB  
337  C  CG1 . VAL A 49 ? 0.2889 0.9016 0.2847 -0.0019 0.0272  0.0309  174 VAL A CG1 
338  C  CG2 . VAL A 49 ? 0.2493 0.9117 0.2609 -0.0061 0.0220  0.0383  174 VAL A CG2 
339  N  N   . MET A 50 ? 0.3486 0.9517 0.3668 0.0241  0.0366  0.0668  175 MET A N   
340  C  CA  . MET A 50 ? 0.3792 0.9498 0.3977 0.0339  0.0418  0.0706  175 MET A CA  
341  C  C   . MET A 50 ? 0.4320 1.0004 0.4554 0.0547  0.0514  0.0734  175 MET A C   
342  O  O   . MET A 50 ? 0.4625 0.9997 0.4758 0.0650  0.0582  0.0625  175 MET A O   
343  C  CB  . MET A 50 ? 0.4193 0.9914 0.4492 0.0298  0.0385  0.0893  175 MET A CB  
344  C  CG  . MET A 50 ? 0.5047 1.0368 0.5371 0.0376  0.0425  0.0936  175 MET A CG  
345  S  SD  . MET A 50 ? 0.5658 1.1064 0.6165 0.0346  0.0388  0.1226  175 MET A SD  
346  C  CE  . MET A 50 ? 0.5214 1.0893 0.5887 0.0542  0.0439  0.1400  175 MET A CE  
347  N  N   . THR A 51 ? 0.3498 0.9530 0.3878 0.0604  0.0518  0.0870  176 THR A N   
348  C  CA  . THR A 51 ? 0.3442 0.9553 0.3918 0.0803  0.0614  0.0939  176 THR A CA  
349  C  C   . THR A 51 ? 0.3675 0.9788 0.4033 0.0854  0.0672  0.0786  176 THR A C   
350  O  O   . THR A 51 ? 0.3517 0.9705 0.3931 0.1028  0.0772  0.0829  176 THR A O   
351  C  CB  . THR A 51 ? 0.4125 1.0636 0.4821 0.0821  0.0579  0.1159  176 THR A CB  
352  O  OG1 . THR A 51 ? 0.4216 1.1017 0.4911 0.0671  0.0490  0.1124  176 THR A OG1 
353  C  CG2 . THR A 51 ? 0.3529 1.0050 0.4333 0.0802  0.0533  0.1341  176 THR A CG2 
354  N  N   . LEU A 52 ? 0.3148 0.9204 0.3350 0.0707  0.0614  0.0624  177 LEU A N   
355  C  CA  . LEU A 52 ? 0.2969 0.9030 0.3032 0.0715  0.0644  0.0483  177 LEU A CA  
356  C  C   . LEU A 52 ? 0.2975 0.9412 0.3167 0.0718  0.0641  0.0567  177 LEU A C   
357  O  O   . LEU A 52 ? 0.2971 0.9465 0.3087 0.0754  0.0683  0.0505  177 LEU A O   
358  C  CB  . LEU A 52 ? 0.3273 0.9046 0.3175 0.0881  0.0757  0.0371  177 LEU A CB  
359  C  CG  . LEU A 52 ? 0.4137 0.9467 0.3900 0.0854  0.0742  0.0256  177 LEU A CG  
360  C  CD1 . LEU A 52 ? 0.4535 0.9567 0.4187 0.1064  0.0867  0.0173  177 LEU A CD1 
361  C  CD2 . LEU A 52 ? 0.4374 0.9586 0.3963 0.0665  0.0648  0.0096  177 LEU A CD2 
362  N  N   . GLU A 53 ? 0.2076 0.8773 0.2462 0.0667  0.0581  0.0715  178 GLU A N   
363  C  CA  . GLU A 53 ? 0.1699 0.8739 0.2245 0.0642  0.0552  0.0813  178 GLU A CA  
364  C  C   . GLU A 53 ? 0.1824 0.8910 0.2321 0.0483  0.0467  0.0711  178 GLU A C   
365  O  O   . GLU A 53 ? 0.1888 0.8918 0.2342 0.0359  0.0389  0.0652  178 GLU A O   
366  C  CB  . GLU A 53 ? 0.1744 0.9025 0.2494 0.0624  0.0495  0.0993  178 GLU A CB  
367  C  CG  . GLU A 53 ? 0.2345 0.9969 0.3307 0.0657  0.0496  0.1142  178 GLU A CG  
368  C  CD  . GLU A 53 ? 0.4350 1.2152 0.5377 0.0483  0.0380  0.1118  178 GLU A CD  
369  O  OE1 . GLU A 53 ? 0.1944 0.9744 0.2944 0.0466  0.0399  0.1057  178 GLU A OE1 
370  O  OE2 . GLU A 53 ? 0.4524 1.2458 0.5622 0.0365  0.0267  0.1161  178 GLU A OE2 
371  N  N   . SER A 54 ? 0.1400 0.8595 0.1910 0.0498  0.0492  0.0701  179 SER A N   
372  C  CA  . SER A 54 ? 0.1346 0.8581 0.1841 0.0374  0.0425  0.0627  179 SER A CA  
373  C  C   . SER A 54 ? 0.1918 0.8943 0.2254 0.0277  0.0376  0.0475  179 SER A C   
374  O  O   . SER A 54 ? 0.1660 0.8735 0.2037 0.0164  0.0301  0.0433  179 SER A O   
375  C  CB  . SER A 54 ? 0.1546 0.9011 0.2247 0.0273  0.0332  0.0713  179 SER A CB  
376  O  OG  . SER A 54 ? 0.2102 0.9806 0.2985 0.0332  0.0362  0.0871  179 SER A OG  
377  N  N   . TRP A 55 ? 0.1953 0.8742 0.2128 0.0321  0.0420  0.0400  180 TRP A N   
378  C  CA  . TRP A 55 ? 0.2208 0.8821 0.2264 0.0217  0.0370  0.0288  180 TRP A CA  
379  C  C   . TRP A 55 ? 0.2537 0.9175 0.2536 0.0144  0.0333  0.0204  180 TRP A C   
380  O  O   . TRP A 55 ? 0.2270 0.8952 0.2308 0.0040  0.0269  0.0173  180 TRP A O   
381  C  CB  . TRP A 55 ? 0.2495 0.8826 0.2418 0.0263  0.0409  0.0239  180 TRP A CB  
382  C  CG  . TRP A 55 ? 0.2942 0.9079 0.2673 0.0319  0.0456  0.0122  180 TRP A CG  
383  C  CD1 . TRP A 55 ? 0.3555 0.9590 0.3203 0.0477  0.0553  0.0107  180 TRP A CD1 
384  C  CD2 . TRP A 55 ? 0.3029 0.9049 0.2607 0.0218  0.0404  -0.0005 180 TRP A CD2 
385  N  NE1 . TRP A 55 ? 0.3722 0.9574 0.3139 0.0477  0.0564  -0.0044 180 TRP A NE1 
386  C  CE2 . TRP A 55 ? 0.3806 0.9652 0.3183 0.0308  0.0462  -0.0107 180 TRP A CE2 
387  C  CE3 . TRP A 55 ? 0.3089 0.9159 0.2686 0.0065  0.0315  -0.0038 180 TRP A CE3 
388  C  CZ2 . TRP A 55 ? 0.3920 0.9642 0.3100 0.0228  0.0413  -0.0243 180 TRP A CZ2 
389  C  CZ3 . TRP A 55 ? 0.3445 0.9413 0.2888 -0.0008 0.0272  -0.0147 180 TRP A CZ3 
390  C  CH2 . TRP A 55 ? 0.3802 0.9597 0.3032 0.0061  0.0310  -0.0249 180 TRP A CH2 
391  N  N   . SER A 56 ? 0.2184 0.8831 0.2099 0.0210  0.0379  0.0183  181 SER A N   
392  C  CA  . SER A 56 ? 0.2113 0.8819 0.1980 0.0150  0.0342  0.0136  181 SER A CA  
393  C  C   . SER A 56 ? 0.2209 0.9153 0.2269 0.0130  0.0315  0.0234  181 SER A C   
394  O  O   . SER A 56 ? 0.2157 0.9148 0.2309 0.0041  0.0249  0.0221  181 SER A O   
395  C  CB  . SER A 56 ? 0.2823 0.9436 0.2472 0.0219  0.0394  0.0066  181 SER A CB  
396  O  OG  . SER A 56 ? 0.4039 1.0758 0.3636 0.0166  0.0354  0.0050  181 SER A OG  
397  N  N   . MET A 57 ? 0.1509 0.8600 0.1653 0.0212  0.0368  0.0340  182 MET A N   
398  C  CA  . MET A 57 ? 0.1291 0.8587 0.1642 0.0176  0.0333  0.0452  182 MET A CA  
399  C  C   . MET A 57 ? 0.1857 0.9182 0.2394 0.0086  0.0252  0.0465  182 MET A C   
400  O  O   . MET A 57 ? 0.1660 0.9019 0.2312 0.0013  0.0189  0.0464  182 MET A O   
401  C  CB  . MET A 57 ? 0.1553 0.9040 0.1978 0.0275  0.0409  0.0592  182 MET A CB  
402  C  CG  . MET A 57 ? 0.2198 0.9668 0.2394 0.0390  0.0509  0.0558  182 MET A CG  
403  S  SD  . MET A 57 ? 0.2782 1.0257 0.2798 0.0346  0.0482  0.0497  182 MET A SD  
404  C  CE  . MET A 57 ? 0.2267 1.0071 0.2518 0.0345  0.0486  0.0719  182 MET A CE  
405  N  N   . GLY A 58 ? 0.1570 0.8880 0.2126 0.0099  0.0254  0.0477  183 GLY A N   
406  C  CA  . GLY A 58 ? 0.1347 0.8705 0.2028 0.0018  0.0176  0.0482  183 GLY A CA  
407  C  C   . GLY A 58 ? 0.1766 0.9011 0.2364 -0.0055 0.0131  0.0358  183 GLY A C   
408  O  O   . GLY A 58 ? 0.1560 0.8842 0.2243 -0.0128 0.0064  0.0323  183 GLY A O   
409  N  N   . ILE A 59 ? 0.1549 0.8656 0.1982 -0.0039 0.0166  0.0289  184 ILE A N   
410  C  CA  . ILE A 59 ? 0.1647 0.8694 0.2018 -0.0109 0.0135  0.0201  184 ILE A CA  
411  C  C   . ILE A 59 ? 0.2276 0.9252 0.2575 -0.0141 0.0134  0.0125  184 ILE A C   
412  O  O   . ILE A 59 ? 0.2193 0.9219 0.2556 -0.0185 0.0102  0.0080  184 ILE A O   
413  C  CB  . ILE A 59 ? 0.2119 0.9125 0.2422 -0.0109 0.0145  0.0224  184 ILE A CB  
414  C  CG1 . ILE A 59 ? 0.2175 0.9301 0.2564 -0.0082 0.0132  0.0325  184 ILE A CG1 
415  C  CG2 . ILE A 59 ? 0.2002 0.9006 0.2252 -0.0184 0.0122  0.0163  184 ILE A CG2 
416  C  CD1 . ILE A 59 ? 0.2485 0.9764 0.2964 -0.0154 0.0055  0.0315  184 ILE A CD1 
417  N  N   . VAL A 60 ? 0.1964 0.8822 0.2133 -0.0120 0.0165  0.0108  185 VAL A N   
418  C  CA  . VAL A 60 ? 0.2041 0.8839 0.2128 -0.0171 0.0146  0.0047  185 VAL A CA  
419  C  C   . VAL A 60 ? 0.2422 0.9319 0.2561 -0.0179 0.0122  0.0049  185 VAL A C   
420  O  O   . VAL A 60 ? 0.2371 0.9319 0.2553 -0.0235 0.0087  0.0024  185 VAL A O   
421  C  CB  . VAL A 60 ? 0.2776 0.9378 0.2696 -0.0167 0.0166  0.0010  185 VAL A CB  
422  C  CG1 . VAL A 60 ? 0.2811 0.9366 0.2658 -0.0258 0.0118  -0.0049 185 VAL A CG1 
423  C  CG2 . VAL A 60 ? 0.2783 0.9299 0.2706 -0.0167 0.0181  0.0043  185 VAL A CG2 
424  N  N   . ARG A 61 ? 0.1852 0.8809 0.2009 -0.0119 0.0143  0.0103  186 ARG A N   
425  C  CA  . ARG A 61 ? 0.1714 0.8790 0.1950 -0.0125 0.0117  0.0147  186 ARG A CA  
426  C  C   . ARG A 61 ? 0.2254 0.9399 0.2699 -0.0157 0.0079  0.0158  186 ARG A C   
427  O  O   . ARG A 61 ? 0.2181 0.9366 0.2674 -0.0188 0.0049  0.0142  186 ARG A O   
428  C  CB  . ARG A 61 ? 0.1512 0.8679 0.1750 -0.0056 0.0156  0.0237  186 ARG A CB  
429  C  CG  . ARG A 61 ? 0.2803 0.9912 0.2801 -0.0005 0.0203  0.0200  186 ARG A CG  
430  C  CD  . ARG A 61 ? 0.2725 0.9998 0.2719 0.0066  0.0248  0.0304  186 ARG A CD  
431  N  NE  . ARG A 61 ? 0.2477 0.9700 0.2194 0.0129  0.0303  0.0239  186 ARG A NE  
432  C  CZ  . ARG A 61 ? 0.4023 1.1241 0.3552 0.0088  0.0264  0.0175  186 ARG A CZ  
433  N  NH1 . ARG A 61 ? 0.1720 0.9008 0.1344 -0.0009 0.0175  0.0195  186 ARG A NH1 
434  N  NH2 . ARG A 61 ? 0.1770 0.8917 0.1010 0.0148  0.0313  0.0085  186 ARG A NH2 
435  N  N   . PRO A 62 ? 0.1883 0.9034 0.2444 -0.0152 0.0075  0.0171  187 PRO A N   
436  C  CA  . PRO A 62 ? 0.1805 0.8969 0.2523 -0.0178 0.0037  0.0135  187 PRO A CA  
437  C  C   . PRO A 62 ? 0.2297 0.9451 0.2971 -0.0204 0.0039  0.0045  187 PRO A C   
438  O  O   . PRO A 62 ? 0.2346 0.9530 0.3138 -0.0198 0.0026  0.0022  187 PRO A O   
439  C  CB  . PRO A 62 ? 0.2018 0.9176 0.2790 -0.0188 0.0021  0.0136  187 PRO A CB  
440  C  CG  . PRO A 62 ? 0.2540 0.9742 0.3288 -0.0153 0.0050  0.0238  187 PRO A CG  
441  C  CD  . PRO A 62 ? 0.2026 0.9183 0.2588 -0.0122 0.0097  0.0217  187 PRO A CD  
442  N  N   . VAL A 63 ? 0.1767 0.8887 0.2293 -0.0225 0.0060  0.0013  188 VAL A N   
443  C  CA  . VAL A 63 ? 0.1739 0.8892 0.2238 -0.0260 0.0066  -0.0037 188 VAL A CA  
444  C  C   . VAL A 63 ? 0.2219 0.9430 0.2749 -0.0279 0.0051  -0.0018 188 VAL A C   
445  O  O   . VAL A 63 ? 0.2290 0.9596 0.2937 -0.0272 0.0052  -0.0031 188 VAL A O   
446  C  CB  . VAL A 63 ? 0.2268 0.9383 0.2642 -0.0293 0.0084  -0.0042 188 VAL A CB  
447  C  CG1 . VAL A 63 ? 0.2237 0.9421 0.2603 -0.0344 0.0091  -0.0053 188 VAL A CG1 
448  C  CG2 . VAL A 63 ? 0.2257 0.9395 0.2631 -0.0281 0.0086  -0.0054 188 VAL A CG2 
449  N  N   . MET A 64 ? 0.1558 0.8724 0.1985 -0.0295 0.0036  0.0013  189 MET A N   
450  C  CA  . MET A 64 ? 0.1432 0.8670 0.1854 -0.0332 -0.0002 0.0038  189 MET A CA  
451  C  C   . MET A 64 ? 0.2159 0.9529 0.2765 -0.0295 -0.0019 0.0095  189 MET A C   
452  O  O   . MET A 64 ? 0.2346 0.9835 0.3006 -0.0325 -0.0055 0.0135  189 MET A O   
453  C  CB  . MET A 64 ? 0.1812 0.8966 0.2050 -0.0342 -0.0014 0.0037  189 MET A CB  
454  C  CG  . MET A 64 ? 0.2410 0.9420 0.2481 -0.0404 -0.0023 -0.0021 189 MET A CG  
455  S  SD  . MET A 64 ? 0.3265 1.0170 0.3087 -0.0414 -0.0049 -0.0066 189 MET A SD  
456  C  CE  . MET A 64 ? 0.2757 0.9688 0.2567 -0.0276 0.0026  -0.0019 189 MET A CE  
457  N  N   . ASN A 65 ? 0.1792 0.9142 0.2516 -0.0237 -0.0004 0.0114  190 ASN A N   
458  C  CA  . ASN A 65 ? 0.1784 0.9209 0.2721 -0.0194 -0.0020 0.0177  190 ASN A CA  
459  C  C   . ASN A 65 ? 0.2181 0.9670 0.3263 -0.0172 -0.0007 0.0136  190 ASN A C   
460  O  O   . ASN A 65 ? 0.2204 0.9788 0.3464 -0.0135 -0.0021 0.0204  190 ASN A O   
461  C  CB  . ASN A 65 ? 0.1906 0.9256 0.2945 -0.0160 -0.0018 0.0204  190 ASN A CB  
462  C  CG  . ASN A 65 ? 0.5712 1.3131 0.6901 -0.0135 -0.0045 0.0337  190 ASN A CG  
463  O  OD1 . ASN A 65 ? 0.5664 1.3150 0.7021 -0.0109 -0.0064 0.0391  190 ASN A OD1 
464  N  ND2 . ASN A 65 ? 0.4626 1.2059 0.5764 -0.0136 -0.0042 0.0416  190 ASN A ND2 
465  N  N   . VAL A 66 ? 0.1563 0.9025 0.2573 -0.0185 0.0028  0.0041  191 VAL A N   
466  C  CA  . VAL A 66 ? 0.1471 0.9031 0.2579 -0.0153 0.0066  -0.0007 191 VAL A CA  
467  C  C   . VAL A 66 ? 0.1983 0.9681 0.3028 -0.0222 0.0064  0.0026  191 VAL A C   
468  O  O   . VAL A 66 ? 0.1824 0.9694 0.3013 -0.0204 0.0072  0.0071  191 VAL A O   
469  C  CB  . VAL A 66 ? 0.1840 0.9322 0.2918 -0.0116 0.0107  -0.0126 191 VAL A CB  
470  C  CG1 . VAL A 66 ? 0.1782 0.9395 0.2927 -0.0063 0.0169  -0.0184 191 VAL A CG1 
471  C  CG2 . VAL A 66 ? 0.1828 0.9165 0.3005 -0.0074 0.0083  -0.0154 191 VAL A CG2 
472  N  N   . HIS A 67 ? 0.1704 0.9324 0.2560 -0.0301 0.0049  0.0017  192 HIS A N   
473  C  CA  . HIS A 67 ? 0.1926 0.9621 0.2722 -0.0395 0.0029  0.0050  192 HIS A CA  
474  C  C   . HIS A 67 ? 0.2795 1.0398 0.3459 -0.0464 -0.0037 0.0076  192 HIS A C   
475  O  O   . HIS A 67 ? 0.2867 1.0293 0.3363 -0.0489 -0.0038 0.0039  192 HIS A O   
476  C  CB  . HIS A 67 ? 0.2190 0.9842 0.2882 -0.0430 0.0067  0.0018  192 HIS A CB  
477  C  CG  . HIS A 67 ? 0.2650 1.0354 0.3385 -0.0350 0.0131  -0.0042 192 HIS A CG  
478  N  ND1 . HIS A 67 ? 0.2873 1.0445 0.3563 -0.0297 0.0135  -0.0103 192 HIS A ND1 
479  C  CD2 . HIS A 67 ? 0.2811 1.0695 0.3625 -0.0316 0.0189  -0.0055 192 HIS A CD2 
480  C  CE1 . HIS A 67 ? 0.2782 1.0427 0.3495 -0.0245 0.0183  -0.0171 192 HIS A CE1 
481  N  NE2 . HIS A 67 ? 0.2817 1.0650 0.3593 -0.0242 0.0227  -0.0151 192 HIS A NE2 
482  N  N   . PRO A 68 ? 0.2592 1.0320 0.3322 -0.0490 -0.0093 0.0137  193 PRO A N   
483  C  CA  . PRO A 68 ? 0.2693 1.0344 0.3250 -0.0552 -0.0160 0.0139  193 PRO A CA  
484  C  C   . PRO A 68 ? 0.3359 1.0853 0.3715 -0.0662 -0.0198 0.0083  193 PRO A C   
485  O  O   . PRO A 68 ? 0.3605 1.0960 0.3761 -0.0682 -0.0231 0.0037  193 PRO A O   
486  C  CB  . PRO A 68 ? 0.2913 1.0795 0.3603 -0.0571 -0.0223 0.0233  193 PRO A CB  
487  C  CG  . PRO A 68 ? 0.3378 1.1451 0.4313 -0.0541 -0.0190 0.0282  193 PRO A CG  
488  C  CD  . PRO A 68 ? 0.2747 1.0705 0.3712 -0.0448 -0.0097 0.0211  193 PRO A CD  
489  N  N   . ASN A 69 ? 0.2804 1.0313 0.3210 -0.0728 -0.0190 0.0089  194 ASN A N   
490  C  CA  . ASN A 69 ? 0.2978 1.0314 0.3245 -0.0845 -0.0233 0.0056  194 ASN A CA  
491  C  C   . ASN A 69 ? 0.3358 1.0480 0.3536 -0.0806 -0.0169 0.0019  194 ASN A C   
492  O  O   . ASN A 69 ? 0.3687 1.0643 0.3785 -0.0897 -0.0199 0.0010  194 ASN A O   
493  C  CB  . ASN A 69 ? 0.3611 1.1139 0.4027 -0.0970 -0.0279 0.0135  194 ASN A CB  
494  C  CG  . ASN A 69 ? 0.8943 1.6613 0.9381 -0.1081 -0.0393 0.0172  194 ASN A CG  
495  O  OD1 . ASN A 69 ? 0.8110 1.5664 0.8368 -0.1104 -0.0457 0.0111  194 ASN A OD1 
496  N  ND2 . ASN A 69 ? 0.8506 1.6459 0.9159 -0.1159 -0.0423 0.0280  194 ASN A ND2 
497  N  N   . ALA A 70 ? 0.2431 0.9551 0.2636 -0.0681 -0.0093 0.0008  195 ALA A N   
498  C  CA  . ALA A 70 ? 0.2277 0.9252 0.2420 -0.0639 -0.0040 -0.0002 195 ALA A CA  
499  C  C   . ALA A 70 ? 0.2897 0.9589 0.2864 -0.0653 -0.0053 -0.0043 195 ALA A C   
500  O  O   . ALA A 70 ? 0.2941 0.9509 0.2884 -0.0654 -0.0027 -0.0019 195 ALA A O   
501  C  CB  . ALA A 70 ? 0.2188 0.9212 0.2378 -0.0522 0.0014  -0.0013 195 ALA A CB  
502  N  N   . TRP A 71 ? 0.2488 0.9082 0.2326 -0.0661 -0.0092 -0.0102 196 TRP A N   
503  C  CA  . TRP A 71 ? 0.2665 0.8963 0.2302 -0.0658 -0.0098 -0.0178 196 TRP A CA  
504  C  C   . TRP A 71 ? 0.3385 0.9490 0.2993 -0.0789 -0.0153 -0.0184 196 TRP A C   
505  O  O   . TRP A 71 ? 0.3675 0.9479 0.3159 -0.0769 -0.0140 -0.0237 196 TRP A O   
506  C  CB  . TRP A 71 ? 0.2549 0.8833 0.2026 -0.0647 -0.0132 -0.0251 196 TRP A CB  
507  C  CG  . TRP A 71 ? 0.2627 0.9058 0.2121 -0.0777 -0.0233 -0.0246 196 TRP A CG  
508  C  CD1 . TRP A 71 ? 0.2778 0.9509 0.2420 -0.0779 -0.0256 -0.0171 196 TRP A CD1 
509  C  CD2 . TRP A 71 ? 0.2829 0.9120 0.2206 -0.0929 -0.0334 -0.0309 196 TRP A CD2 
510  N  NE1 . TRP A 71 ? 0.2829 0.9658 0.2464 -0.0916 -0.0363 -0.0166 196 TRP A NE1 
511  C  CE2 . TRP A 71 ? 0.3238 0.9803 0.2704 -0.1024 -0.0421 -0.0254 196 TRP A CE2 
512  C  CE3 . TRP A 71 ? 0.3245 0.9188 0.2462 -0.0997 -0.0368 -0.0404 196 TRP A CE3 
513  C  CZ2 . TRP A 71 ? 0.3305 0.9843 0.2699 -0.1202 -0.0553 -0.0288 196 TRP A CZ2 
514  C  CZ3 . TRP A 71 ? 0.3643 0.9509 0.2785 -0.1180 -0.0498 -0.0454 196 TRP A CZ3 
515  C  CH2 . TRP A 71 ? 0.3627 0.9804 0.2850 -0.1289 -0.0595 -0.0397 196 TRP A CH2 
516  N  N   . VAL A 72 ? 0.2636 0.8917 0.2380 -0.0920 -0.0212 -0.0120 197 VAL A N   
517  C  CA  . VAL A 72 ? 0.2723 0.8882 0.2499 -0.1077 -0.0278 -0.0084 197 VAL A CA  
518  C  C   . VAL A 72 ? 0.3186 0.9281 0.3043 -0.1043 -0.0212 0.0004  197 VAL A C   
519  O  O   . VAL A 72 ? 0.3445 0.9331 0.3307 -0.1138 -0.0248 0.0041  197 VAL A O   
520  C  CB  . VAL A 72 ? 0.3068 0.9524 0.3008 -0.1217 -0.0351 -0.0005 197 VAL A CB  
521  C  CG1 . VAL A 72 ? 0.3268 0.9630 0.3281 -0.1401 -0.0425 0.0065  197 VAL A CG1 
522  C  CG2 . VAL A 72 ? 0.3070 0.9614 0.2932 -0.1252 -0.0429 -0.0069 197 VAL A CG2 
523  N  N   . PHE A 73 ? 0.2374 0.8643 0.2294 -0.0915 -0.0127 0.0044  198 PHE A N   
524  C  CA  . PHE A 73 ? 0.2109 0.8371 0.2086 -0.0876 -0.0071 0.0136  198 PHE A CA  
525  C  C   . PHE A 73 ? 0.2353 0.8352 0.2218 -0.0754 -0.0027 0.0096  198 PHE A C   
526  O  O   . PHE A 73 ? 0.2524 0.8278 0.2370 -0.0771 -0.0030 0.0134  198 PHE A O   
527  C  CB  . PHE A 73 ? 0.2004 0.8606 0.2090 -0.0818 -0.0015 0.0189  198 PHE A CB  
528  C  CG  . PHE A 73 ? 0.2227 0.8872 0.2334 -0.0772 0.0035  0.0279  198 PHE A CG  
529  C  CD1 . PHE A 73 ? 0.2708 0.9465 0.2893 -0.0860 0.0037  0.0407  198 PHE A CD1 
530  C  CD2 . PHE A 73 ? 0.2469 0.9087 0.2531 -0.0649 0.0075  0.0258  198 PHE A CD2 
531  C  CE1 . PHE A 73 ? 0.2795 0.9629 0.2985 -0.0821 0.0077  0.0509  198 PHE A CE1 
532  C  CE2 . PHE A 73 ? 0.2897 0.9590 0.2976 -0.0618 0.0104  0.0355  198 PHE A CE2 
533  C  CZ  . PHE A 73 ? 0.2710 0.9513 0.2841 -0.0702 0.0105  0.0479  198 PHE A CZ  
534  N  N   . PHE A 74 ? 0.1514 0.7572 0.1331 -0.0629 0.0014  0.0034  199 PHE A N   
535  C  CA  . PHE A 74 ? 0.1442 0.7344 0.1193 -0.0493 0.0072  0.0023  199 PHE A CA  
536  C  C   . PHE A 74 ? 0.2509 0.8060 0.2112 -0.0461 0.0073  -0.0061 199 PHE A C   
537  O  O   . PHE A 74 ? 0.2675 0.8035 0.2282 -0.0393 0.0112  -0.0016 199 PHE A O   
538  C  CB  . PHE A 74 ? 0.1287 0.7383 0.1065 -0.0384 0.0113  0.0013  199 PHE A CB  
539  C  CG  . PHE A 74 ? 0.1067 0.7440 0.0977 -0.0394 0.0110  0.0070  199 PHE A CG  
540  C  CD1 . PHE A 74 ? 0.1323 0.7776 0.1285 -0.0351 0.0141  0.0150  199 PHE A CD1 
541  C  CD2 . PHE A 74 ? 0.1049 0.7562 0.1019 -0.0432 0.0038  0.0034  199 PHE A CD2 
542  C  CE1 . PHE A 74 ? 0.1201 0.7894 0.1236 -0.0359 0.0137  0.0166  199 PHE A CE1 
543  C  CE2 . PHE A 74 ? 0.1110 0.7888 0.1174 -0.0426 0.0102  0.0056  199 PHE A CE2 
544  C  CZ  . PHE A 74 ? 0.0994 0.7695 0.1002 -0.0383 0.0032  0.0098  199 PHE A CZ  
545  N  N   . ILE A 75 ? 0.2366 0.7829 0.1832 -0.0502 0.0032  -0.0181 200 ILE A N   
546  C  CA  . ILE A 75 ? 0.2748 0.7849 0.2021 -0.0471 0.0032  -0.0304 200 ILE A CA  
547  C  C   . ILE A 75 ? 0.3805 0.8579 0.3100 -0.0546 0.0000  -0.0282 200 ILE A C   
548  O  O   . ILE A 75 ? 0.4004 0.8535 0.3271 -0.0421 0.0066  -0.0282 200 ILE A O   
549  C  CB  . ILE A 75 ? 0.3216 0.8315 0.2303 -0.0512 -0.0018 -0.0442 200 ILE A CB  
550  C  CG1 . ILE A 75 ? 0.3046 0.8420 0.2129 -0.0385 0.0045  -0.0426 200 ILE A CG1 
551  C  CG2 . ILE A 75 ? 0.3780 0.8461 0.2624 -0.0497 -0.0028 -0.0606 200 ILE A CG2 
552  C  CD1 . ILE A 75 ? 0.4388 0.9910 0.3352 -0.0433 -0.0009 -0.0491 200 ILE A CD1 
553  N  N   . PRO A 76 ? 0.3511 0.8312 0.2905 -0.0735 -0.0090 -0.0222 201 PRO A N   
554  C  CA  . PRO A 76 ? 0.3844 0.8348 0.3305 -0.0815 -0.0121 -0.0155 201 PRO A CA  
555  C  C   . PRO A 76 ? 0.4575 0.9126 0.4184 -0.0705 -0.0041 0.0012  201 PRO A C   
556  O  O   . PRO A 76 ? 0.4927 0.9141 0.4545 -0.0661 -0.0023 0.0040  201 PRO A O   
557  C  CB  . PRO A 76 ? 0.3959 0.8641 0.3548 -0.1037 -0.0222 -0.0073 201 PRO A CB  
558  C  CG  . PRO A 76 ? 0.4368 0.9278 0.3877 -0.1076 -0.0266 -0.0173 201 PRO A CG  
559  C  CD  . PRO A 76 ? 0.3506 0.8611 0.2979 -0.0883 -0.0165 -0.0193 201 PRO A CD  
560  N  N   . PHE A 77 ? 0.3787 0.8742 0.3506 -0.0656 0.0004  0.0118  202 PHE A N   
561  C  CA  . PHE A 77 ? 0.3674 0.8736 0.3509 -0.0561 0.0065  0.0276  202 PHE A CA  
562  C  C   . PHE A 77 ? 0.4624 0.9458 0.4402 -0.0369 0.0139  0.0242  202 PHE A C   
563  O  O   . PHE A 77 ? 0.4752 0.9450 0.4618 -0.0307 0.0168  0.0366  202 PHE A O   
564  C  CB  . PHE A 77 ? 0.3476 0.8985 0.3382 -0.0541 0.0088  0.0334  202 PHE A CB  
565  C  CG  . PHE A 77 ? 0.3616 0.9255 0.3596 -0.0427 0.0140  0.0460  202 PHE A CG  
566  C  CD1 . PHE A 77 ? 0.4086 0.9810 0.4167 -0.0474 0.0133  0.0639  202 PHE A CD1 
567  C  CD2 . PHE A 77 ? 0.3832 0.9523 0.3788 -0.0280 0.0189  0.0423  202 PHE A CD2 
568  C  CE1 . PHE A 77 ? 0.4158 1.0031 0.4300 -0.0378 0.0165  0.0769  202 PHE A CE1 
569  C  CE2 . PHE A 77 ? 0.4190 1.0020 0.4231 -0.0189 0.0220  0.0556  202 PHE A CE2 
570  C  CZ  . PHE A 77 ? 0.4002 0.9923 0.4129 -0.0239 0.0203  0.0724  202 PHE A CZ  
571  N  N   . ILE A 78 ? 0.4354 0.9179 0.4001 -0.0268 0.0176  0.0097  203 ILE A N   
572  C  CA  . ILE A 78 ? 0.4605 0.9267 0.4193 -0.0069 0.0265  0.0059  203 ILE A CA  
573  C  C   . ILE A 78 ? 0.6076 1.0244 0.5580 -0.0046 0.0268  -0.0017 203 ILE A C   
574  O  O   . ILE A 78 ? 0.6258 1.0259 0.5852 0.0074  0.0324  0.0079  203 ILE A O   
575  C  CB  . ILE A 78 ? 0.4794 0.9619 0.4264 0.0016  0.0305  -0.0059 203 ILE A CB  
576  C  CG1 . ILE A 78 ? 0.4299 0.9541 0.3911 0.0055  0.0300  0.0056  203 ILE A CG1 
577  C  CG2 . ILE A 78 ? 0.5220 0.9792 0.4548 0.0202  0.0398  -0.0162 203 ILE A CG2 
578  C  CD1 . ILE A 78 ? 0.3705 0.9157 0.3259 0.0074  0.0334  -0.0014 203 ILE A CD1 
579  N  N   . MET A 79 ? 0.6206 1.0138 0.5556 -0.0174 0.0194  -0.0177 204 MET A N   
580  C  CA  . MET A 79 ? 0.6857 1.0261 0.6095 -0.0186 0.0172  -0.0297 204 MET A CA  
581  C  C   . MET A 79 ? 0.7612 1.0792 0.7045 -0.0232 0.0150  -0.0126 204 MET A C   
582  O  O   . MET A 79 ? 0.7891 1.0652 0.7307 -0.0117 0.0195  -0.0159 204 MET A O   
583  C  CB  . MET A 79 ? 0.7404 1.0673 0.6462 -0.0376 0.0056  -0.0477 204 MET A CB  
584  C  CG  . MET A 79 ? 0.7929 1.1362 0.6764 -0.0312 0.0079  -0.0645 204 MET A CG  
585  S  SD  . MET A 79 ? 0.9045 1.2236 0.7601 -0.0502 -0.0059 -0.0889 204 MET A SD  
586  C  CE  . MET A 79 ? 0.8268 1.1850 0.7043 -0.0775 -0.0197 -0.0731 204 MET A CE  
587  N  N   . LEU A 80 ? 0.7081 1.0556 0.6703 -0.0381 0.0093  0.0067  205 LEU A N   
588  C  CA  . LEU A 80 ? 0.7308 1.0665 0.7132 -0.0449 0.0067  0.0279  205 LEU A CA  
589  C  C   . LEU A 80 ? 0.7879 1.1326 0.7846 -0.0256 0.0161  0.0463  205 LEU A C   
590  O  O   . LEU A 80 ? 0.8198 1.1284 0.8249 -0.0183 0.0183  0.0537  205 LEU A O   
591  C  CB  . LEU A 80 ? 0.7075 1.0781 0.7031 -0.0669 -0.0014 0.0427  205 LEU A CB  
592  C  CG  . LEU A 80 ? 0.7920 1.1538 0.8083 -0.0785 -0.0056 0.0666  205 LEU A CG  
593  C  CD1 . LEU A 80 ? 0.8470 1.1594 0.8626 -0.0947 -0.0154 0.0594  205 LEU A CD1 
594  C  CD2 . LEU A 80 ? 0.7916 1.2048 0.8204 -0.0919 -0.0080 0.0844  205 LEU A CD2 
595  N  N   . THR A 81 ? 0.7130 1.1053 0.7142 -0.0183 0.0207  0.0545  206 THR A N   
596  C  CA  . THR A 81 ? 0.7015 1.1125 0.7169 -0.0022 0.0275  0.0735  206 THR A CA  
597  C  C   . THR A 81 ? 0.8093 1.1957 0.8210 0.0220  0.0375  0.0661  206 THR A C   
598  O  O   . THR A 81 ? 0.8260 1.1951 0.8516 0.0342  0.0419  0.0808  206 THR A O   
599  C  CB  . THR A 81 ? 0.6412 1.1078 0.6607 -0.0047 0.0270  0.0819  206 THR A CB  
600  O  OG1 . THR A 81 ? 0.5519 1.0321 0.5581 -0.0015 0.0288  0.0633  206 THR A OG1 
601  C  CG2 . THR A 81 ? 0.5870 1.0783 0.6122 -0.0245 0.0199  0.0928  206 THR A CG2 
602  N  N   . THR A 82 ? 0.7947 1.1794 0.7883 0.0295  0.0417  0.0445  207 THR A N   
603  C  CA  . THR A 82 ? 0.8349 1.2002 0.8219 0.0537  0.0532  0.0353  207 THR A CA  
604  C  C   . THR A 82 ? 0.9882 1.2916 0.9634 0.0569  0.0540  0.0195  207 THR A C   
605  O  O   . THR A 82 ? 1.0100 1.2905 0.9626 0.0651  0.0586  -0.0042 207 THR A O   
606  C  CB  . THR A 82 ? 0.9196 1.3141 0.8929 0.0597  0.0576  0.0220  207 THR A CB  
607  O  OG1 . THR A 82 ? 0.8591 1.3016 0.8420 0.0487  0.0523  0.0330  207 THR A OG1 
608  C  CG2 . THR A 82 ? 0.9249 1.3219 0.8996 0.0865  0.0715  0.0225  207 THR A CG2 
609  N  N   . PHE A 83 ? 1.0074 1.2841 0.9975 0.0493  0.0489  0.0331  208 PHE A N   
610  C  CA  . PHE A 83 ? 1.0858 1.2993 1.0717 0.0484  0.0468  0.0232  208 PHE A CA  
611  C  C   . PHE A 83 ? 1.1717 1.3778 1.1867 0.0458  0.0441  0.0530  208 PHE A C   
612  O  O   . PHE A 83 ? 1.2117 1.3793 1.2369 0.0627  0.0505  0.0583  208 PHE A O   
613  C  CB  . PHE A 83 ? 1.1290 1.3212 1.0968 0.0225  0.0338  0.0034  208 PHE A CB  
614  C  CG  . PHE A 83 ? 1.2087 1.3460 1.1831 0.0091  0.0250  0.0042  208 PHE A CG  
615  C  CD1 . PHE A 83 ? 1.3223 1.3957 1.2835 0.0207  0.0283  -0.0163 208 PHE A CD1 
616  C  CD2 . PHE A 83 ? 1.2287 1.3780 1.2232 -0.0149 0.0138  0.0259  208 PHE A CD2 
617  C  CE1 . PHE A 83 ? 1.3894 1.4073 1.3590 0.0068  0.0188  -0.0154 208 PHE A CE1 
618  C  CE2 . PHE A 83 ? 1.3192 1.4183 1.3240 -0.0289 0.0050  0.0303  208 PHE A CE2 
619  C  CZ  . PHE A 83 ? 1.3622 1.3937 1.3551 -0.0188 0.0066  0.0093  208 PHE A CZ  
620  N  N   . THR A 84 ? 1.1065 1.3505 1.1346 0.0251  0.0351  0.0730  209 THR A N   
621  C  CA  . THR A 84 ? 1.1146 1.3646 1.1691 0.0190  0.0315  0.1051  209 THR A CA  
622  C  C   . THR A 84 ? 1.1767 1.4527 1.2481 0.0423  0.0409  0.1266  209 THR A C   
623  O  O   . THR A 84 ? 1.2029 1.4613 1.2955 0.0493  0.0421  0.1494  209 THR A O   
624  C  CB  . THR A 84 ? 1.1706 1.4609 1.2294 -0.0074 0.0214  0.1174  209 THR A CB  
625  O  OG1 . THR A 84 ? 1.1743 1.4437 1.2181 -0.0267 0.0131  0.0961  209 THR A OG1 
626  C  CG2 . THR A 84 ? 1.1602 1.4549 1.2439 -0.0171 0.0168  0.1509  209 THR A CG2 
627  N  N   . VAL A 85 ? 1.1115 1.4284 1.1755 0.0540  0.0470  0.1206  210 VAL A N   
628  C  CA  . VAL A 85 ? 1.1021 1.4488 1.1825 0.0753  0.0550  0.1401  210 VAL A CA  
629  C  C   . VAL A 85 ? 1.2143 1.5165 1.2996 0.1021  0.0665  0.1354  210 VAL A C   
630  O  O   . VAL A 85 ? 1.2242 1.5247 1.3333 0.1165  0.0704  0.1603  210 VAL A O   
631  C  CB  . VAL A 85 ? 1.0983 1.4999 1.1718 0.0769  0.0565  0.1357  210 VAL A CB  
632  C  CG1 . VAL A 85 ? 1.0879 1.5167 1.1792 0.0994  0.0644  0.1540  210 VAL A CG1 
633  C  CG2 . VAL A 85 ? 1.0552 1.4994 1.1280 0.0541  0.0462  0.1445  210 VAL A CG2 
634  N  N   . LEU A 86 ? 1.2111 1.4762 1.2734 0.1087  0.0717  0.1038  211 LEU A N   
635  C  CA  . LEU A 86 ? 1.2725 1.4887 1.3322 0.1349  0.0840  0.0914  211 LEU A CA  
636  C  C   . LEU A 86 ? 1.3913 1.5507 1.4663 0.1344  0.0809  0.1014  211 LEU A C   
637  O  O   . LEU A 86 ? 1.4228 1.5557 1.5136 0.1597  0.0913  0.1103  211 LEU A O   
638  C  CB  . LEU A 86 ? 1.2933 1.4847 1.3180 0.1354  0.0870  0.0400  211 LEU A CB  
639  C  CG  . LEU A 86 ? 1.4255 1.5532 1.4350 0.1567  0.0975  0.0282  211 LEU A CG  
640  C  CD1 . LEU A 86 ? 1.4381 1.5793 1.4567 0.1928  0.1164  0.0337  211 LEU A CD1 
641  C  CD2 . LEU A 86 ? 1.4733 1.5800 1.4442 0.1463  0.0943  -0.0092 211 LEU A CD2 
642  N  N   . ASN A 87 ? 1.3652 1.5086 1.4386 0.1056  0.0668  0.1023  212 ASN A N   
643  C  CA  . ASN A 87 ? 1.4208 1.5127 1.5110 0.0981  0.0607  0.1147  212 ASN A CA  
644  C  C   . ASN A 87 ? 1.4779 1.5971 1.6037 0.1037  0.0609  0.1582  212 ASN A C   
645  O  O   . ASN A 87 ? 1.5223 1.6002 1.6687 0.1185  0.0650  0.1723  212 ASN A O   
646  C  CB  . ASN A 87 ? 1.4412 1.5212 1.5220 0.0632  0.0449  0.1070  212 ASN A CB  
647  C  CG  . ASN A 87 ? 1.8196 1.8239 1.8864 0.0572  0.0403  0.0803  212 ASN A CG  
648  O  OD1 . ASN A 87 ? 1.8020 1.7581 1.8872 0.0529  0.0357  0.0925  212 ASN A OD1 
649  N  ND2 . ASN A 87 ? 1.7264 1.7184 1.7601 0.0554  0.0404  0.0437  212 ASN A ND2 
650  N  N   . LEU A 88 ? 1.3877 1.5760 1.5200 0.0922  0.0562  0.1791  213 LEU A N   
651  C  CA  . LEU A 88 ? 1.3727 1.6008 1.5336 0.0943  0.0545  0.2205  213 LEU A CA  
652  C  C   . LEU A 88 ? 1.4465 1.6814 1.6254 0.1270  0.0666  0.2347  213 LEU A C   
653  O  O   . LEU A 88 ? 1.4675 1.6954 1.6747 0.1367  0.0674  0.2660  213 LEU A O   
654  C  CB  . LEU A 88 ? 1.3096 1.6099 1.4640 0.0758  0.0474  0.2298  213 LEU A CB  
655  C  CG  . LEU A 88 ? 1.3433 1.6993 1.5190 0.0785  0.0454  0.2680  213 LEU A CG  
656  C  CD1 . LEU A 88 ? 1.3718 1.7167 1.5697 0.0677  0.0388  0.3011  213 LEU A CD1 
657  C  CD2 . LEU A 88 ? 1.3173 1.7377 1.4785 0.0639  0.0400  0.2653  213 LEU A CD2 
658  N  N   . PHE A 89 ? 1.3922 1.6437 1.5570 0.1440  0.0761  0.2142  214 PHE A N   
659  C  CA  . PHE A 89 ? 1.3983 1.6636 1.5805 0.1760  0.0890  0.2264  214 PHE A CA  
660  C  C   . PHE A 89 ? 1.5303 1.7275 1.7224 0.2016  0.1002  0.2210  214 PHE A C   
661  O  O   . PHE A 89 ? 1.5426 1.7429 1.7649 0.2235  0.1067  0.2493  214 PHE A O   
662  C  CB  . PHE A 89 ? 1.3786 1.6859 1.5443 0.1838  0.0954  0.2084  214 PHE A CB  
663  C  CG  . PHE A 89 ? 1.3347 1.7164 1.5054 0.1701  0.0872  0.2263  214 PHE A CG  
664  C  CD1 . PHE A 89 ? 1.3467 1.7519 1.5142 0.1419  0.0733  0.2365  214 PHE A CD1 
665  C  CD2 . PHE A 89 ? 1.3319 1.7598 1.5091 0.1848  0.0935  0.2311  214 PHE A CD2 
666  C  CE1 . PHE A 89 ? 1.3082 1.7779 1.4766 0.1302  0.0659  0.2490  214 PHE A CE1 
667  C  CE2 . PHE A 89 ? 1.3164 1.8080 1.4970 0.1704  0.0842  0.2452  214 PHE A CE2 
668  C  CZ  . PHE A 89 ? 1.2701 1.7801 1.4445 0.1437  0.0705  0.2522  214 PHE A CZ  
669  N  N   . ILE A 90 ? 1.5392 1.6738 1.7066 0.1980  0.1013  0.1856  215 ILE A N   
670  C  CA  . ILE A 90 ? 1.6176 1.6762 1.7885 0.2199  0.1106  0.1731  215 ILE A CA  
671  C  C   . ILE A 90 ? 1.7197 1.7431 1.9218 0.2137  0.1031  0.2037  215 ILE A C   
672  O  O   . ILE A 90 ? 1.7667 1.7499 1.9909 0.2402  0.1128  0.2144  215 ILE A O   
673  C  CB  . ILE A 90 ? 1.6910 1.6957 1.8222 0.2140  0.1112  0.1244  215 ILE A CB  
674  C  CG1 . ILE A 90 ? 1.6874 1.7106 1.7965 0.2391  0.1273  0.0994  215 ILE A CG1 
675  C  CG2 . ILE A 90 ? 1.7826 1.6966 1.9144 0.2178  0.1106  0.1106  215 ILE A CG2 
676  C  CD1 . ILE A 90 ? 1.7947 1.7823 1.8594 0.2319  0.1272  0.0523  215 ILE A CD1 
677  N  N   . GLY A 91 ? 1.6588 1.7016 1.8641 0.1802  0.0868  0.2194  216 GLY A N   
678  C  CA  . GLY A 91 ? 1.6883 1.7093 1.9227 0.1678  0.0775  0.2526  216 GLY A CA  
679  C  C   . GLY A 91 ? 1.7520 1.7977 2.0254 0.1895  0.0829  0.2970  216 GLY A C   
680  O  O   . GLY A 91 ? 1.8018 1.7993 2.1018 0.1974  0.0830  0.3170  216 GLY A O   
681  N  N   . ILE A 92 ? 1.6614 1.7817 1.9401 0.1991  0.0867  0.3138  217 ILE A N   
682  C  CA  . ILE A 92 ? 1.6591 1.8155 1.9747 0.2195  0.0907  0.3578  217 ILE A CA  
683  C  C   . ILE A 92 ? 1.7611 1.8775 2.0927 0.2606  0.1084  0.3532  217 ILE A C   
684  O  O   . ILE A 92 ? 1.7862 1.8929 2.1544 0.2794  0.1119  0.3879  217 ILE A O   
685  C  CB  . ILE A 92 ? 1.6277 1.8778 1.9433 0.2135  0.0865  0.3767  217 ILE A CB  
686  C  CG1 . ILE A 92 ? 1.5807 1.8667 1.8655 0.1791  0.0746  0.3591  217 ILE A CG1 
687  C  CG2 . ILE A 92 ? 1.6333 1.9247 1.9858 0.2181  0.0816  0.4299  217 ILE A CG2 
688  C  CD1 . ILE A 92 ? 1.6075 1.9504 1.8739 0.1804  0.0767  0.3430  217 ILE A CD1 
689  N  N   . ILE A 93 ? 1.7299 1.8262 2.0343 0.2755  0.1201  0.3117  218 ILE A N   
690  C  CA  . ILE A 93 ? 1.7785 1.8384 2.0904 0.3163  0.1398  0.2994  218 ILE A CA  
691  C  C   . ILE A 93 ? 1.9291 1.8964 2.2539 0.3281  0.1431  0.2957  218 ILE A C   
692  O  O   . ILE A 93 ? 1.9646 1.9106 2.3201 0.3619  0.1558  0.3142  218 ILE A O   
693  C  CB  . ILE A 93 ? 1.8018 1.8665 2.0755 0.3243  0.1503  0.2546  218 ILE A CB  
694  C  CG1 . ILE A 93 ? 1.7272 1.8836 1.9976 0.3168  0.1479  0.2652  218 ILE A CG1 
695  C  CG2 . ILE A 93 ? 1.8692 1.8891 2.1444 0.3670  0.1726  0.2361  218 ILE A CG2 
696  C  CD1 . ILE A 93 ? 1.7881 1.9583 2.0187 0.3097  0.1511  0.2253  218 ILE A CD1 
697  N  N   . VAL A 94 ? 1.9256 1.8397 2.2301 0.2993  0.1307  0.2739  219 VAL A N   
698  C  CA  . VAL A 94 ? 2.0120 1.8331 2.3265 0.3016  0.1292  0.2680  219 VAL A CA  
699  C  C   . VAL A 94 ? 2.0859 1.9117 2.4491 0.3004  0.1222  0.3231  219 VAL A C   
700  O  O   . VAL A 94 ? 2.1515 1.9155 2.5415 0.3233  0.1292  0.3337  219 VAL A O   
701  C  CB  . VAL A 94 ? 2.0789 1.8530 2.3586 0.2657  0.1148  0.2315  219 VAL A CB  
702  C  CG1 . VAL A 94 ? 2.1628 1.8416 2.4562 0.2616  0.1090  0.2288  219 VAL A CG1 
703  C  CG2 . VAL A 94 ? 2.0736 1.8401 2.3062 0.2708  0.1224  0.1787  219 VAL A CG2 
704  N  N   . ASP A 95 ? 1.9826 1.8841 2.3568 0.2760  0.1096  0.3588  220 ASP A N   
705  C  CA  . ASP A 95 ? 1.9833 1.9081 2.3999 0.2711  0.1016  0.4150  220 ASP A CA  
706  C  C   . ASP A 95 ? 2.0533 2.0001 2.5086 0.3107  0.1146  0.4500  220 ASP A C   
707  O  O   . ASP A 95 ? 2.0460 2.0257 2.5372 0.3094  0.1083  0.5008  220 ASP A O   
708  C  CB  . ASP A 95 ? 1.9332 1.9392 2.3423 0.2360  0.0862  0.4372  220 ASP A CB  
709  N  N   . ALA A 96 ? 2.0335 1.9631 2.4827 0.3465  0.1331  0.4244  221 ALA A N   
710  C  CA  . ALA A 96 ? 2.0516 1.9975 2.5376 0.3889  0.1487  0.4521  221 ALA A CA  
711  C  C   . ALA A 96 ? 2.1935 2.0417 2.6880 0.4227  0.1646  0.4302  221 ALA A C   
712  O  O   . ALA A 96 ? 2.2249 2.0535 2.7629 0.4513  0.1723  0.4640  221 ALA A O   
713  C  CB  . ALA A 96 ? 2.0037 2.0235 2.4766 0.4034  0.1584  0.4424  221 ALA A CB  
714  N  N   . MET A 97 ? 2.1836 1.9702 2.6360 0.4194  0.1690  0.3735  222 MET A N   
715  C  CA  . MET A 97 ? 2.6297 2.3175 3.0785 0.4485  0.1834  0.3413  222 MET A CA  
716  C  C   . MET A 97 ? 2.9960 2.6012 3.3500 0.3859  0.0966  0.2658  222 MET A C   
717  O  O   . MET A 97 ? 2.4881 2.0793 2.9762 0.4141  0.1587  0.3773  222 MET A O   
718  C  CB  . MET A 97 ? 2.6615 2.3379 3.0610 0.4607  0.1970  0.2833  222 MET A CB  
719  N  N   . VAL B 6  ? 1.9204 1.6506 1.6378 -0.4023 0.0640  0.0358  131 VAL B N   
720  C  CA  . VAL B 6  ? 1.8215 1.6498 1.5680 -0.3815 0.0427  0.0587  131 VAL B CA  
721  C  C   . VAL B 6  ? 1.7943 1.7264 1.5287 -0.4061 0.0359  0.0348  131 VAL B C   
722  O  O   . VAL B 6  ? 1.7075 1.7138 1.4686 -0.3776 0.0288  0.0312  131 VAL B O   
723  C  CB  . VAL B 6  ? 1.8888 1.7119 1.6391 -0.3878 0.0255  0.1064  131 VAL B CB  
724  C  CG1 . VAL B 6  ? 1.7931 1.7089 1.5762 -0.3605 0.0071  0.1276  131 VAL B CG1 
725  C  CG2 . VAL B 6  ? 1.9763 1.6898 1.7357 -0.3667 0.0333  0.1327  131 VAL B CG2 
726  N  N   . GLY B 7  ? 1.7794 1.7153 1.4742 -0.4584 0.0386  0.0199  132 GLY B N   
727  C  CA  . GLY B 7  ? 1.7135 1.7480 1.3959 -0.4842 0.0334  -0.0010 132 GLY B CA  
728  C  C   . GLY B 7  ? 1.7135 1.7757 1.4043 -0.4671 0.0445  -0.0360 132 GLY B C   
729  O  O   . GLY B 7  ? 1.6304 1.7850 1.3354 -0.4571 0.0371  -0.0439 132 GLY B O   
730  N  N   . SER B 8  ? 1.7181 1.6978 1.4006 -0.4624 0.0634  -0.0565 133 SER B N   
731  C  CA  . SER B 8  ? 1.6874 1.6806 1.3754 -0.4481 0.0766  -0.0904 133 SER B CA  
732  C  C   . SER B 8  ? 1.6336 1.6649 1.3667 -0.3911 0.0709  -0.0831 133 SER B C   
733  O  O   . SER B 8  ? 1.5755 1.6611 1.3176 -0.3799 0.0733  -0.1039 133 SER B O   
734  C  CB  . SER B 8  ? 1.8318 1.7181 1.4991 -0.4571 0.1000  -0.1130 133 SER B CB  
735  O  OG  . SER B 8  ? 1.9960 1.7966 1.6840 -0.4216 0.1045  -0.0916 133 SER B OG  
736  N  N   . VAL B 9  ? 1.5682 1.5728 1.3280 -0.3580 0.0630  -0.0517 134 VAL B N   
737  C  CA  . VAL B 9  ? 1.4932 1.5324 1.2940 -0.3075 0.0562  -0.0397 134 VAL B CA  
738  C  C   . VAL B 9  ? 1.4228 1.5671 1.2326 -0.3080 0.0396  -0.0349 134 VAL B C   
739  O  O   . VAL B 9  ? 1.3606 1.5530 1.1901 -0.2823 0.0387  -0.0456 134 VAL B O   
740  C  CB  . VAL B 9  ? 1.5745 1.5621 1.3988 -0.2779 0.0515  -0.0041 134 VAL B CB  
741  C  CG1 . VAL B 9  ? 1.5126 1.5343 1.3772 -0.2284 0.0470  0.0051  134 VAL B CG1 
742  C  CG2 . VAL B 9  ? 1.6740 1.5505 1.4872 -0.2796 0.0687  -0.0057 134 VAL B CG2 
743  N  N   . ALA B 10 ? 1.3456 1.5235 1.1397 -0.3382 0.0279  -0.0199 135 ALA B N   
744  C  CA  . ALA B 10 ? 1.2576 1.5317 1.0578 -0.3410 0.0148  -0.0166 135 ALA B CA  
745  C  C   . ALA B 10 ? 1.2424 1.5722 1.0328 -0.3538 0.0199  -0.0458 135 ALA B C   
746  O  O   . ALA B 10 ? 1.1713 1.5695 0.9794 -0.3340 0.0141  -0.0491 135 ALA B O   
747  C  CB  . ALA B 10 ? 1.2844 1.5772 1.0666 -0.3748 0.0044  0.0030  135 ALA B CB  
748  N  N   . ALA B 11 ? 1.2294 1.5279 0.9911 -0.3871 0.0312  -0.0661 136 ALA B N   
749  C  CA  . ALA B 11 ? 1.2020 1.5530 0.9512 -0.4049 0.0366  -0.0925 136 ALA B CA  
750  C  C   . ALA B 11 ? 1.1948 1.5499 0.9657 -0.3694 0.0432  -0.1076 136 ALA B C   
751  O  O   . ALA B 11 ? 1.1390 1.5667 0.9176 -0.3638 0.0399  -0.1167 136 ALA B O   
752  C  CB  . ALA B 11 ? 1.2884 1.5958 0.9980 -0.4533 0.0484  -0.1103 136 ALA B CB  
753  N  N   . LEU B 12 ? 1.1625 1.4426 0.9447 -0.3440 0.0522  -0.1081 137 LEU B N   
754  C  CA  . LEU B 12 ? 1.1230 1.4024 0.9262 -0.3100 0.0592  -0.1213 137 LEU B CA  
755  C  C   . LEU B 12 ? 1.0588 1.3997 0.8935 -0.2741 0.0456  -0.1053 137 LEU B C   
756  O  O   . LEU B 12 ? 1.0061 1.3950 0.8503 -0.2616 0.0454  -0.1167 137 LEU B O   
757  C  CB  . LEU B 12 ? 1.1803 1.3675 0.9911 -0.2893 0.0722  -0.1219 137 LEU B CB  
758  C  CG  . LEU B 12 ? 1.2240 1.4073 1.0555 -0.2560 0.0820  -0.1373 137 LEU B CG  
759  C  CD1 . LEU B 12 ? 1.3037 1.4147 1.1175 -0.2675 0.1045  -0.1646 137 LEU B CD1 
760  C  CD2 . LEU B 12 ? 1.2215 1.3974 1.0889 -0.2105 0.0751  -0.1131 137 LEU B CD2 
761  N  N   . LEU B 13 ? 0.9840 1.3226 0.8323 -0.2606 0.0345  -0.0786 138 LEU B N   
762  C  CA  . LEU B 13 ? 0.9110 1.2999 0.7847 -0.2310 0.0227  -0.0636 138 LEU B CA  
763  C  C   . LEU B 13 ? 0.8931 1.3634 0.7645 -0.2392 0.0156  -0.0691 138 LEU B C   
764  O  O   . LEU B 13 ? 0.8482 1.3559 0.7367 -0.2148 0.0129  -0.0715 138 LEU B O   
765  C  CB  . LEU B 13 ? 0.9180 1.2888 0.8012 -0.2233 0.0132  -0.0346 138 LEU B CB  
766  C  CG  . LEU B 13 ? 0.9202 1.3327 0.8272 -0.1947 0.0029  -0.0197 138 LEU B CG  
767  C  CD1 . LEU B 13 ? 0.9186 1.2994 0.8486 -0.1607 0.0063  -0.0141 138 LEU B CD1 
768  C  CD2 . LEU B 13 ? 0.9528 1.3810 0.8577 -0.2058 -0.0082 0.0040  138 LEU B CD2 
769  N  N   . THR B 14 ? 0.8429 1.3414 0.6939 -0.2729 0.0133  -0.0705 139 THR B N   
770  C  CA  . THR B 14 ? 0.7932 1.3742 0.6442 -0.2795 0.0078  -0.0746 139 THR B CA  
771  C  C   . THR B 14 ? 0.8177 1.4301 0.6713 -0.2736 0.0131  -0.0927 139 THR B C   
772  O  O   . THR B 14 ? 0.7692 1.4353 0.6390 -0.2526 0.0085  -0.0910 139 THR B O   
773  C  CB  . THR B 14 ? 0.9152 1.5211 0.7425 -0.3203 0.0058  -0.0733 139 THR B CB  
774  O  OG1 . THR B 14 ? 0.9493 1.5152 0.7708 -0.3298 0.0015  -0.0553 139 THR B OG1 
775  C  CG2 . THR B 14 ? 0.8505 1.5479 0.6837 -0.3213 -0.0002 -0.0727 139 THR B CG2 
776  N  N   . VAL B 15 ? 0.8038 1.3793 0.6403 -0.2926 0.0235  -0.1096 140 VAL B N   
777  C  CA  . VAL B 15 ? 0.7850 1.3870 0.6191 -0.2943 0.0297  -0.1279 140 VAL B CA  
778  C  C   . VAL B 15 ? 0.7712 1.3701 0.6309 -0.2536 0.0291  -0.1262 140 VAL B C   
779  O  O   . VAL B 15 ? 0.7303 1.3844 0.5999 -0.2422 0.0257  -0.1276 140 VAL B O   
780  C  CB  . VAL B 15 ? 0.9018 1.4533 0.7075 -0.3280 0.0434  -0.1486 140 VAL B CB  
781  C  CG1 . VAL B 15 ? 0.9014 1.4601 0.7067 -0.3245 0.0400  -0.1689 140 VAL B CG1 
782  C  CG2 . VAL B 15 ? 0.9277 1.5095 0.7048 -0.3749 0.0430  -0.1529 140 VAL B CG2 
783  N  N   . VAL B 16 ? 0.7188 1.2565 0.5897 -0.2323 0.0318  -0.1204 141 VAL B N   
784  C  CA  . VAL B 16 ? 0.6729 1.2042 0.5670 -0.1961 0.0313  -0.1171 141 VAL B CA  
785  C  C   . VAL B 16 ? 0.6362 1.2164 0.5483 -0.1738 0.0190  -0.1008 141 VAL B C   
786  O  O   . VAL B 16 ? 0.5950 1.2038 0.5190 -0.1550 0.0172  -0.1021 141 VAL B O   
787  C  CB  . VAL B 16 ? 0.7530 1.2112 0.6546 -0.1813 0.0378  -0.1127 141 VAL B CB  
788  C  CG1 . VAL B 16 ? 0.7155 1.1765 0.6435 -0.1453 0.0311  -0.0965 141 VAL B CG1 
789  C  CG2 . VAL B 16 ? 0.7917 1.2075 0.6833 -0.1888 0.0540  -0.1358 141 VAL B CG2 
790  N  N   . PHE B 17 ? 0.5705 1.1601 0.4819 -0.1788 0.0117  -0.0866 142 PHE B N   
791  C  CA  . PHE B 17 ? 0.5228 1.1542 0.4474 -0.1614 0.0028  -0.0744 142 PHE B CA  
792  C  C   . PHE B 17 ? 0.5546 1.2507 0.4796 -0.1627 0.0011  -0.0801 142 PHE B C   
793  O  O   . PHE B 17 ? 0.5151 1.2365 0.4538 -0.1395 -0.0022 -0.0759 142 PHE B O   
794  C  CB  . PHE B 17 ? 0.5509 1.1789 0.4714 -0.1720 -0.0027 -0.0604 142 PHE B CB  
795  C  CG  . PHE B 17 ? 0.5354 1.1816 0.4696 -0.1515 -0.0092 -0.0482 142 PHE B CG  
796  C  CD1 . PHE B 17 ? 0.5662 1.1792 0.5118 -0.1334 -0.0112 -0.0377 142 PHE B CD1 
797  C  CD2 . PHE B 17 ? 0.5380 1.2363 0.4732 -0.1511 -0.0122 -0.0479 142 PHE B CD2 
798  C  CE1 . PHE B 17 ? 0.5522 1.1835 0.5062 -0.1198 -0.0164 -0.0284 142 PHE B CE1 
799  C  CE2 . PHE B 17 ? 0.5511 1.2613 0.4954 -0.1348 -0.0156 -0.0406 142 PHE B CE2 
800  C  CZ  . PHE B 17 ? 0.5250 1.2011 0.4767 -0.1217 -0.0179 -0.0314 142 PHE B CZ  
801  N  N   . TYR B 18 ? 0.5436 1.2662 0.4532 -0.1901 0.0035  -0.0883 143 TYR B N   
802  C  CA  . TYR B 18 ? 0.5336 1.3259 0.4458 -0.1914 0.0015  -0.0902 143 TYR B CA  
803  C  C   . TYR B 18 ? 0.5458 1.3512 0.4648 -0.1787 0.0034  -0.0962 143 TYR B C   
804  O  O   . TYR B 18 ? 0.5190 1.3658 0.4523 -0.1577 -0.0006 -0.0890 143 TYR B O   
805  C  CB  . TYR B 18 ? 0.5985 1.4255 0.4920 -0.2278 0.0026  -0.0950 143 TYR B CB  
806  C  CG  . TYR B 18 ? 0.6611 1.5262 0.5567 -0.2315 -0.0023 -0.0851 143 TYR B CG  
807  C  CD1 . TYR B 18 ? 0.6895 1.6336 0.5881 -0.2376 -0.0042 -0.0833 143 TYR B CD1 
808  C  CD2 . TYR B 18 ? 0.6842 1.5130 0.5805 -0.2282 -0.0047 -0.0766 143 TYR B CD2 
809  C  CE1 . TYR B 18 ? 0.7200 1.7043 0.6217 -0.2401 -0.0068 -0.0763 143 TYR B CE1 
810  C  CE2 . TYR B 18 ? 0.6913 1.5598 0.5886 -0.2333 -0.0082 -0.0693 143 TYR B CE2 
811  C  CZ  . TYR B 18 ? 0.8302 1.7757 0.7301 -0.2389 -0.0084 -0.0706 143 TYR B CZ  
812  O  OH  . TYR B 18 ? 0.8912 1.8808 0.7928 -0.2436 -0.0099 -0.0656 143 TYR B OH  
813  N  N   . ILE B 19 ? 0.4928 1.2593 0.4016 -0.1900 0.0105  -0.1090 144 ILE B N   
814  C  CA  . ILE B 19 ? 0.4681 1.2447 0.3803 -0.1825 0.0134  -0.1166 144 ILE B CA  
815  C  C   . ILE B 19 ? 0.4515 1.2146 0.3837 -0.1471 0.0097  -0.1072 144 ILE B C   
816  O  O   . ILE B 19 ? 0.4342 1.2339 0.3748 -0.1348 0.0064  -0.1031 144 ILE B O   
817  C  CB  . ILE B 19 ? 0.5505 1.2879 0.4444 -0.2064 0.0249  -0.1368 144 ILE B CB  
818  C  CG1 . ILE B 19 ? 0.5885 1.3607 0.4590 -0.2467 0.0281  -0.1473 144 ILE B CG1 
819  C  CG2 . ILE B 19 ? 0.5436 1.2800 0.4434 -0.1941 0.0293  -0.1453 144 ILE B CG2 
820  C  CD1 . ILE B 19 ? 0.7639 1.4814 0.6090 -0.2779 0.0413  -0.1685 144 ILE B CD1 
821  N  N   . ALA B 20 ? 0.3679 1.0822 0.3071 -0.1327 0.0094  -0.1016 145 ALA B N   
822  C  CA  . ALA B 20 ? 0.3252 1.0286 0.2803 -0.1040 0.0058  -0.0925 145 ALA B CA  
823  C  C   . ALA B 20 ? 0.3366 1.0786 0.3008 -0.0885 -0.0015 -0.0805 145 ALA B C   
824  O  O   . ALA B 20 ? 0.3052 1.0564 0.2781 -0.0705 -0.0039 -0.0758 145 ALA B O   
825  C  CB  . ALA B 20 ? 0.3405 0.9936 0.3007 -0.0955 0.0065  -0.0868 145 ALA B CB  
826  N  N   . ALA B 21 ? 0.2943 1.0593 0.2557 -0.0964 -0.0039 -0.0763 146 ALA B N   
827  C  CA  . ALA B 21 ? 0.2677 1.0697 0.2378 -0.0812 -0.0076 -0.0678 146 ALA B CA  
828  C  C   . ALA B 21 ? 0.3287 1.1807 0.3040 -0.0758 -0.0086 -0.0659 146 ALA B C   
829  O  O   . ALA B 21 ? 0.3223 1.1909 0.3086 -0.0536 -0.0104 -0.0577 146 ALA B O   
830  C  CB  . ALA B 21 ? 0.2805 1.0986 0.2461 -0.0935 -0.0081 -0.0661 146 ALA B CB  
831  N  N   . VAL B 22 ? 0.2981 1.1728 0.2645 -0.0971 -0.0069 -0.0728 147 VAL B N   
832  C  CA  . VAL B 22 ? 0.2899 1.2182 0.2600 -0.0968 -0.0087 -0.0689 147 VAL B CA  
833  C  C   . VAL B 22 ? 0.3501 1.2609 0.3266 -0.0794 -0.0099 -0.0656 147 VAL B C   
834  O  O   . VAL B 22 ? 0.3482 1.2857 0.3362 -0.0594 -0.0138 -0.0528 147 VAL B O   
835  C  CB  . VAL B 22 ? 0.3480 1.3038 0.3018 -0.1317 -0.0058 -0.0795 147 VAL B CB  
836  C  CG1 . VAL B 22 ? 0.3346 1.3441 0.2904 -0.1349 -0.0080 -0.0753 147 VAL B CG1 
837  C  CG2 . VAL B 22 ? 0.3529 1.3420 0.3007 -0.1500 -0.0061 -0.0791 147 VAL B CG2 
838  N  N   . MET B 23 ? 0.3030 1.1684 0.2723 -0.0864 -0.0060 -0.0764 148 MET B N   
839  C  CA  . MET B 23 ? 0.2901 1.1404 0.2632 -0.0748 -0.0062 -0.0756 148 MET B CA  
840  C  C   . MET B 23 ? 0.2806 1.1176 0.2654 -0.0475 -0.0108 -0.0620 148 MET B C   
841  O  O   . MET B 23 ? 0.2724 1.1268 0.2619 -0.0366 -0.0143 -0.0528 148 MET B O   
842  C  CB  . MET B 23 ? 0.3461 1.1481 0.3130 -0.0826 0.0007  -0.0898 148 MET B CB  
843  C  CG  . MET B 23 ? 0.4412 1.2433 0.3932 -0.1106 0.0085  -0.1071 148 MET B CG  
844  S  SD  . MET B 23 ? 0.5440 1.2924 0.4935 -0.1107 0.0192  -0.1238 148 MET B SD  
845  C  CE  . MET B 23 ? 0.4994 1.2920 0.4448 -0.1187 0.0207  -0.1302 148 MET B CE  
846  N  N   . ALA B 24 ? 0.1946 1.0003 0.1817 -0.0392 -0.0107 -0.0604 149 ALA B N   
847  C  CA  . ALA B 24 ? 0.1585 0.9458 0.1518 -0.0184 -0.0133 -0.0511 149 ALA B CA  
848  C  C   . ALA B 24 ? 0.1807 1.0001 0.1812 -0.0028 -0.0153 -0.0403 149 ALA B C   
849  O  O   . ALA B 24 ? 0.1684 0.9788 0.1721 0.0128  -0.0171 -0.0318 149 ALA B O   
850  C  CB  . ALA B 24 ? 0.1632 0.9191 0.1550 -0.0191 -0.0123 -0.0527 149 ALA B CB  
851  N  N   . THR B 25 ? 0.1243 0.9823 0.1274 -0.0070 -0.0147 -0.0399 150 THR B N   
852  C  CA  . THR B 25 ? 0.1202 1.0173 0.1343 0.0108  -0.0152 -0.0286 150 THR B CA  
853  C  C   . THR B 25 ? 0.1813 1.1002 0.2003 0.0182  -0.0193 -0.0168 150 THR B C   
854  O  O   . THR B 25 ? 0.1872 1.1040 0.2146 0.0410  -0.0201 -0.0039 150 THR B O   
855  C  CB  . THR B 25 ? 0.1908 1.1390 0.2070 -0.0007 -0.0142 -0.0302 150 THR B CB  
856  O  OG1 . THR B 25 ? 0.2824 1.2116 0.2928 -0.0097 -0.0112 -0.0392 150 THR B OG1 
857  C  CG2 . THR B 25 ? 0.1402 1.1370 0.1723 0.0212  -0.0139 -0.0170 150 THR B CG2 
858  N  N   . ASN B 26 ? 0.1247 1.0612 0.1366 -0.0028 -0.0210 -0.0215 151 ASN B N   
859  C  CA  . ASN B 26 ? 0.1148 1.0786 0.1283 -0.0029 -0.0253 -0.0112 151 ASN B CA  
860  C  C   . ASN B 26 ? 0.1535 1.0747 0.1651 0.0083  -0.0269 -0.0069 151 ASN B C   
861  O  O   . ASN B 26 ? 0.1486 1.0790 0.1663 0.0237  -0.0309 0.0103  151 ASN B O   
862  C  CB  . ASN B 26 ? 0.1162 1.1076 0.1183 -0.0336 -0.0243 -0.0229 151 ASN B CB  
863  C  CG  . ASN B 26 ? 0.3915 1.4189 0.3925 -0.0401 -0.0285 -0.0138 151 ASN B CG  
864  O  OD1 . ASN B 26 ? 0.2894 1.3032 0.2795 -0.0566 -0.0259 -0.0259 151 ASN B OD1 
865  N  ND2 . ASN B 26 ? 0.2149 1.2913 0.2280 -0.0264 -0.0346 0.0087  151 ASN B ND2 
866  N  N   . LEU B 27 ? 0.1138 0.9902 0.1176 0.0008  -0.0237 -0.0204 152 LEU B N   
867  C  CA  . LEU B 27 ? 0.1176 0.9598 0.1182 0.0065  -0.0249 -0.0180 152 LEU B CA  
868  C  C   . LEU B 27 ? 0.2043 1.0147 0.2072 0.0270  -0.0259 -0.0074 152 LEU B C   
869  O  O   . LEU B 27 ? 0.2184 1.0248 0.2205 0.0348  -0.0294 0.0053  152 LEU B O   
870  C  CB  . LEU B 27 ? 0.1137 0.9252 0.1083 -0.0062 -0.0205 -0.0344 152 LEU B CB  
871  C  CG  . LEU B 27 ? 0.1752 1.0058 0.1642 -0.0262 -0.0169 -0.0472 152 LEU B CG  
872  C  CD1 . LEU B 27 ? 0.1881 0.9871 0.1739 -0.0356 -0.0100 -0.0639 152 LEU B CD1 
873  C  CD2 . LEU B 27 ? 0.2023 1.0409 0.1889 -0.0284 -0.0183 -0.0447 152 LEU B CD2 
874  N  N   . TYR B 28 ? 0.1598 0.9464 0.1631 0.0329  -0.0224 -0.0130 153 TYR B N   
875  C  CA  . TYR B 28 ? 0.1534 0.9035 0.1540 0.0471  -0.0207 -0.0087 153 TYR B CA  
876  C  C   . TYR B 28 ? 0.2148 0.9710 0.2217 0.0643  -0.0167 -0.0048 153 TYR B C   
877  O  O   . TYR B 28 ? 0.2265 0.9487 0.2285 0.0737  -0.0125 -0.0060 153 TYR B O   
878  C  CB  . TYR B 28 ? 0.1542 0.8707 0.1476 0.0376  -0.0189 -0.0189 153 TYR B CB  
879  C  CG  . TYR B 28 ? 0.1734 0.8913 0.1659 0.0228  -0.0200 -0.0260 153 TYR B CG  
880  C  CD1 . TYR B 28 ? 0.1974 0.9152 0.1876 0.0194  -0.0222 -0.0232 153 TYR B CD1 
881  C  CD2 . TYR B 28 ? 0.1802 0.8977 0.1739 0.0126  -0.0177 -0.0354 153 TYR B CD2 
882  C  CE1 . TYR B 28 ? 0.1952 0.9146 0.1863 0.0087  -0.0204 -0.0321 153 TYR B CE1 
883  C  CE2 . TYR B 28 ? 0.1903 0.9018 0.1843 0.0026  -0.0162 -0.0426 153 TYR B CE2 
884  C  CZ  . TYR B 28 ? 0.2770 0.9904 0.2707 0.0020  -0.0167 -0.0422 153 TYR B CZ  
885  O  OH  . TYR B 28 ? 0.2799 0.9878 0.2756 -0.0050 -0.0126 -0.0515 153 TYR B OH  
886  N  N   . GLY B 29 ? 0.1535 0.9553 0.1706 0.0675  -0.0170 -0.0011 154 GLY B N   
887  C  CA  . GLY B 29 ? 0.1519 0.9715 0.1791 0.0859  -0.0121 0.0025  154 GLY B CA  
888  C  C   . GLY B 29 ? 0.2233 1.0259 0.2560 0.1120  -0.0096 0.0163  154 GLY B C   
889  O  O   . GLY B 29 ? 0.2517 1.0408 0.2882 0.1292  -0.0014 0.0131  154 GLY B O   
890  N  N   . ALA B 30 ? 0.1693 0.9720 0.2022 0.1149  -0.0156 0.0315  155 ALA B N   
891  C  CA  . ALA B 30 ? 0.1928 0.9757 0.2306 0.1395  -0.0140 0.0492  155 ALA B CA  
892  C  C   . ALA B 30 ? 0.2719 0.9852 0.2929 0.1398  -0.0100 0.0441  155 ALA B C   
893  O  O   . ALA B 30 ? 0.2968 0.9753 0.3179 0.1606  -0.0025 0.0486  155 ALA B O   
894  C  CB  . ALA B 30 ? 0.2000 1.0167 0.2432 0.1386  -0.0235 0.0708  155 ALA B CB  
895  N  N   . THR B 31 ? 0.2251 0.9192 0.2314 0.1163  -0.0141 0.0351  156 THR B N   
896  C  CA  . THR B 31 ? 0.2438 0.8820 0.2317 0.1087  -0.0123 0.0310  156 THR B CA  
897  C  C   . THR B 31 ? 0.3429 0.9512 0.3216 0.1041  -0.0039 0.0121  156 THR B C   
898  O  O   . THR B 31 ? 0.3777 0.9378 0.3411 0.1040  0.0017  0.0088  156 THR B O   
899  C  CB  . THR B 31 ? 0.2230 0.8675 0.2028 0.0865  -0.0206 0.0318  156 THR B CB  
900  O  OG1 . THR B 31 ? 0.2485 0.9259 0.2341 0.0729  -0.0223 0.0197  156 THR B OG1 
901  C  CG2 . THR B 31 ? 0.0900 0.7540 0.0731 0.0881  -0.0267 0.0509  156 THR B CG2 
902  N  N   . PHE B 32 ? 0.2827 0.9204 0.2682 0.0970  -0.0030 0.0002  157 PHE B N   
903  C  CA  . PHE B 32 ? 0.2776 0.9008 0.2558 0.0891  0.0033  -0.0159 157 PHE B CA  
904  C  C   . PHE B 32 ? 0.3308 0.9904 0.3225 0.0991  0.0084  -0.0214 157 PHE B C   
905  O  O   . PHE B 32 ? 0.3072 0.9929 0.3015 0.0850  0.0058  -0.0280 157 PHE B O   
906  C  CB  . PHE B 32 ? 0.2755 0.8995 0.2471 0.0654  -0.0026 -0.0220 157 PHE B CB  
907  C  CG  . PHE B 32 ? 0.3023 0.9000 0.2620 0.0551  -0.0068 -0.0173 157 PHE B CG  
908  C  CD1 . PHE B 32 ? 0.3296 0.9415 0.2932 0.0400  -0.0136 -0.0082 157 PHE B CD1 
909  C  CD2 . PHE B 32 ? 0.3387 0.9029 0.2818 0.0448  -0.0036 -0.0225 157 PHE B CD2 
910  C  CE1 . PHE B 32 ? 0.3479 0.9415 0.3005 0.0424  -0.0170 -0.0036 157 PHE B CE1 
911  C  CE2 . PHE B 32 ? 0.3780 0.9245 0.3093 0.0329  -0.0076 -0.0172 157 PHE B CE2 
912  C  CZ  . PHE B 32 ? 0.3481 0.9097 0.2849 0.0328  -0.0143 -0.0075 157 PHE B CZ  
913  N  N   . PRO B 33 ? 0.3013 0.9637 0.3021 0.1238  0.0163  -0.0176 158 PRO B N   
914  C  CA  . PRO B 33 ? 0.2853 0.9932 0.3012 0.1338  0.0212  -0.0215 158 PRO B CA  
915  C  C   . PRO B 33 ? 0.3368 1.0468 0.3464 0.1235  0.0286  -0.0396 158 PRO B C   
916  O  O   . PRO B 33 ? 0.3112 1.0681 0.3314 0.1231  0.0297  -0.0424 158 PRO B O   
917  C  CB  . PRO B 33 ? 0.3305 1.0406 0.3606 0.1669  0.0280  -0.0097 158 PRO B CB  
918  C  CG  . PRO B 33 ? 0.4158 1.0605 0.4308 0.1720  0.0322  -0.0086 158 PRO B CG  
919  C  CD  . PRO B 33 ? 0.3470 0.9737 0.3464 0.1449  0.0213  -0.0076 158 PRO B CD  
920  N  N   . GLU B 34 ? 0.3042 0.9690 0.2952 0.1124  0.0336  -0.0512 159 GLU B N   
921  C  CA  . GLU B 34 ? 0.2887 0.9573 0.2707 0.0982  0.0400  -0.0673 159 GLU B CA  
922  C  C   . GLU B 34 ? 0.2800 0.9726 0.2604 0.0723  0.0292  -0.0661 159 GLU B C   
923  O  O   . GLU B 34 ? 0.2438 0.9639 0.2248 0.0620  0.0311  -0.0729 159 GLU B O   
924  C  CB  . GLU B 34 ? 0.3392 0.9558 0.2991 0.0891  0.0474  -0.0783 159 GLU B CB  
925  C  CG  . GLU B 34 ? 0.5198 1.1372 0.4710 0.0856  0.0611  -0.0972 159 GLU B CG  
926  C  CD  . GLU B 34 ? 0.7809 1.3990 0.7426 0.1161  0.0771  -0.1046 159 GLU B CD  
927  O  OE1 . GLU B 34 ? 0.7997 1.3703 0.7553 0.1325  0.0859  -0.1055 159 GLU B OE1 
928  O  OE2 . GLU B 34 ? 0.5694 1.2357 0.5457 0.1238  0.0813  -0.1088 159 GLU B OE2 
929  N  N   . TRP B 35 ? 0.2526 0.9344 0.2311 0.0622  0.0187  -0.0570 160 TRP B N   
930  C  CA  . TRP B 35 ? 0.2321 0.9266 0.2098 0.0410  0.0101  -0.0551 160 TRP B CA  
931  C  C   . TRP B 35 ? 0.2411 0.9703 0.2305 0.0395  0.0047  -0.0499 160 TRP B C   
932  O  O   . TRP B 35 ? 0.2246 0.9687 0.2131 0.0230  0.0018  -0.0518 160 TRP B O   
933  C  CB  . TRP B 35 ? 0.2190 0.8833 0.1882 0.0298  0.0041  -0.0507 160 TRP B CB  
934  C  CG  . TRP B 35 ? 0.2526 0.8872 0.2063 0.0226  0.0081  -0.0556 160 TRP B CG  
935  C  CD1 . TRP B 35 ? 0.3056 0.9385 0.2499 0.0173  0.0159  -0.0658 160 TRP B CD1 
936  C  CD2 . TRP B 35 ? 0.2566 0.8642 0.2002 0.0155  0.0048  -0.0513 160 TRP B CD2 
937  N  NE1 . TRP B 35 ? 0.3181 0.9228 0.2453 0.0057  0.0179  -0.0688 160 TRP B NE1 
938  C  CE2 . TRP B 35 ? 0.3289 0.9185 0.2556 0.0044  0.0107  -0.0591 160 TRP B CE2 
939  C  CE3 . TRP B 35 ? 0.2587 0.8602 0.2050 0.0151  -0.0020 -0.0425 160 TRP B CE3 
940  C  CZ2 . TRP B 35 ? 0.3299 0.8963 0.2416 -0.0083 0.0093  -0.0570 160 TRP B CZ2 
941  C  CZ3 . TRP B 35 ? 0.2860 0.8664 0.2195 0.0048  -0.0035 -0.0399 160 TRP B CZ3 
942  C  CH2 . TRP B 35 ? 0.3142 0.8776 0.2303 -0.0074 0.0017  -0.0465 160 TRP B CH2 
943  N  N   . PHE B 36 ? 0.1880 0.9297 0.1862 0.0537  0.0033  -0.0424 161 PHE B N   
944  C  CA  . PHE B 36 ? 0.1648 0.9438 0.1710 0.0479  -0.0018 -0.0380 161 PHE B CA  
945  C  C   . PHE B 36 ? 0.2098 1.0307 0.2298 0.0657  -0.0003 -0.0297 161 PHE B C   
946  O  O   . PHE B 36 ? 0.1703 1.0234 0.1950 0.0599  -0.0053 -0.0237 161 PHE B O   
947  C  CB  . PHE B 36 ? 0.1755 0.9382 0.1780 0.0380  -0.0080 -0.0349 161 PHE B CB  
948  C  CG  . PHE B 36 ? 0.1912 0.9189 0.1852 0.0252  -0.0097 -0.0389 161 PHE B CG  
949  C  CD1 . PHE B 36 ? 0.2258 0.9541 0.2179 0.0084  -0.0111 -0.0433 161 PHE B CD1 
950  C  CD2 . PHE B 36 ? 0.2262 0.9218 0.2142 0.0295  -0.0101 -0.0364 161 PHE B CD2 
951  C  CE1 . PHE B 36 ? 0.2435 0.9433 0.2318 0.0005  -0.0129 -0.0429 161 PHE B CE1 
952  C  CE2 . PHE B 36 ? 0.2563 0.9303 0.2393 0.0183  -0.0123 -0.0372 161 PHE B CE2 
953  C  CZ  . PHE B 36 ? 0.2267 0.9043 0.2119 0.0061  -0.0138 -0.0394 161 PHE B CZ  
954  N  N   . GLY B 37 ? 0.1937 1.0170 0.2200 0.0865  0.0074  -0.0297 162 GLY B N   
955  C  CA  . GLY B 37 ? 0.1992 1.0617 0.2426 0.1104  0.0101  -0.0188 162 GLY B CA  
956  C  C   . GLY B 37 ? 0.2259 1.1579 0.2812 0.1056  0.0086  -0.0157 162 GLY B C   
957  O  O   . GLY B 37 ? 0.2192 1.1928 0.2915 0.1259  0.0096  -0.0028 162 GLY B O   
958  N  N   . ASP B 38 ? 0.1804 1.1267 0.2269 0.0788  0.0067  -0.0261 163 ASP B N   
959  C  CA  . ASP B 38 ? 0.1780 1.1867 0.2287 0.0632  0.0048  -0.0259 163 ASP B CA  
960  C  C   . ASP B 38 ? 0.2334 1.2250 0.2665 0.0283  0.0008  -0.0363 163 ASP B C   
961  O  O   . ASP B 38 ? 0.2338 1.1704 0.2560 0.0220  0.0000  -0.0418 163 ASP B O   
962  C  CB  . ASP B 38 ? 0.2131 1.2687 0.2771 0.0786  0.0130  -0.0272 163 ASP B CB  
963  C  CG  . ASP B 38 ? 0.3406 1.3647 0.3996 0.0853  0.0223  -0.0404 163 ASP B CG  
964  O  OD1 . ASP B 38 ? 0.3779 1.3871 0.4218 0.0595  0.0210  -0.0506 163 ASP B OD1 
965  O  OD2 . ASP B 38 ? 0.3608 1.3809 0.4313 0.1157  0.0320  -0.0403 163 ASP B OD2 
966  N  N   . LEU B 39 ? 0.1846 1.2218 0.2143 0.0048  -0.0017 -0.0375 164 LEU B N   
967  C  CA  . LEU B 39 ? 0.1786 1.1914 0.1903 -0.0283 -0.0044 -0.0462 164 LEU B CA  
968  C  C   . LEU B 39 ? 0.2431 1.2238 0.2472 -0.0340 -0.0018 -0.0527 164 LEU B C   
969  O  O   . LEU B 39 ? 0.2365 1.1669 0.2300 -0.0457 -0.0041 -0.0555 164 LEU B O   
970  C  CB  . LEU B 39 ? 0.1748 1.2405 0.1803 -0.0562 -0.0063 -0.0472 164 LEU B CB  
971  C  CG  . LEU B 39 ? 0.2339 1.2666 0.2183 -0.0920 -0.0079 -0.0561 164 LEU B CG  
972  C  CD1 . LEU B 39 ? 0.2393 1.2256 0.2179 -0.0939 -0.0091 -0.0593 164 LEU B CD1 
973  C  CD2 . LEU B 39 ? 0.2591 1.3460 0.2338 -0.1227 -0.0084 -0.0581 164 LEU B CD2 
974  N  N   . SER B 40 ? 0.2087 1.2221 0.2197 -0.0240 0.0035  -0.0543 165 SER B N   
975  C  CA  . SER B 40 ? 0.2103 1.2082 0.2141 -0.0305 0.0070  -0.0606 165 SER B CA  
976  C  C   . SER B 40 ? 0.2663 1.2021 0.2647 -0.0220 0.0073  -0.0623 165 SER B C   
977  O  O   . SER B 40 ? 0.2722 1.1781 0.2587 -0.0411 0.0040  -0.0628 165 SER B O   
978  C  CB  . SER B 40 ? 0.2504 1.2981 0.2656 -0.0144 0.0155  -0.0642 165 SER B CB  
979  O  OG  . SER B 40 ? 0.4238 1.5328 0.4387 -0.0340 0.0148  -0.0638 165 SER B OG  
980  N  N   . LYS B 41 ? 0.1962 1.1140 0.2028 0.0054  0.0109  -0.0612 166 LYS B N   
981  C  CA  . LYS B 41 ? 0.1758 1.0391 0.1756 0.0119  0.0115  -0.0627 166 LYS B CA  
982  C  C   . LYS B 41 ? 0.2097 1.0384 0.2023 -0.0031 0.0033  -0.0581 166 LYS B C   
983  O  O   . LYS B 41 ? 0.2071 1.0036 0.1911 -0.0120 0.0017  -0.0584 166 LYS B O   
984  C  CB  . LYS B 41 ? 0.2004 1.0500 0.2083 0.0411  0.0165  -0.0607 166 LYS B CB  
985  C  CG  . LYS B 41 ? 0.1562 1.0249 0.1715 0.0617  0.0284  -0.0673 166 LYS B CG  
986  C  CD  . LYS B 41 ? 0.2564 1.1172 0.2838 0.0928  0.0322  -0.0597 166 LYS B CD  
987  C  CE  . LYS B 41 ? 0.3039 1.1506 0.3348 0.1180  0.0468  -0.0678 166 LYS B CE  
988  N  NZ  . LYS B 41 ? 0.3842 1.2096 0.4251 0.1474  0.0491  -0.0563 166 LYS B NZ  
989  N  N   . SER B 42 ? 0.1724 1.0125 0.1685 -0.0070 -0.0011 -0.0541 167 SER B N   
990  C  CA  . SER B 42 ? 0.1733 0.9842 0.1644 -0.0193 -0.0063 -0.0525 167 SER B CA  
991  C  C   . SER B 42 ? 0.2411 1.0370 0.2231 -0.0429 -0.0085 -0.0535 167 SER B C   
992  O  O   . SER B 42 ? 0.2373 0.9957 0.2165 -0.0460 -0.0108 -0.0508 167 SER B O   
993  C  CB  . SER B 42 ? 0.2157 1.0493 0.2106 -0.0201 -0.0080 -0.0511 167 SER B CB  
994  O  OG  . SER B 42 ? 0.3097 1.1450 0.3122 0.0008  -0.0081 -0.0456 167 SER B OG  
995  N  N   . LEU B 43 ? 0.2071 1.0335 0.1850 -0.0595 -0.0079 -0.0554 168 LEU B N   
996  C  CA  . LEU B 43 ? 0.2152 1.0261 0.1825 -0.0841 -0.0102 -0.0537 168 LEU B CA  
997  C  C   . LEU B 43 ? 0.2479 1.0391 0.2126 -0.0837 -0.0113 -0.0490 168 LEU B C   
998  O  O   . LEU B 43 ? 0.2487 1.0080 0.2088 -0.0948 -0.0149 -0.0420 168 LEU B O   
999  C  CB  . LEU B 43 ? 0.2227 1.0768 0.1839 -0.1043 -0.0094 -0.0561 168 LEU B CB  
1000 C  CG  . LEU B 43 ? 0.2834 1.1635 0.2422 -0.1155 -0.0089 -0.0602 168 LEU B CG  
1001 C  CD1 . LEU B 43 ? 0.2931 1.2362 0.2504 -0.1285 -0.0077 -0.0613 168 LEU B CD1 
1002 C  CD2 . LEU B 43 ? 0.2948 1.1330 0.2406 -0.1380 -0.0095 -0.0625 168 LEU B CD2 
1003 N  N   . TYR B 44 ? 0.1863 0.9969 0.1542 -0.0707 -0.0074 -0.0526 169 TYR B N   
1004 C  CA  . TYR B 44 ? 0.1883 0.9869 0.1510 -0.0728 -0.0070 -0.0511 169 TYR B CA  
1005 C  C   . TYR B 44 ? 0.2484 1.0055 0.2117 -0.0657 -0.0104 -0.0451 169 TYR B C   
1006 O  O   . TYR B 44 ? 0.2431 0.9841 0.2017 -0.0777 -0.0147 -0.0364 169 TYR B O   
1007 C  CB  . TYR B 44 ? 0.2015 1.0250 0.1660 -0.0588 0.0014  -0.0609 169 TYR B CB  
1008 C  CG  . TYR B 44 ? 0.2361 1.0462 0.1912 -0.0651 0.0033  -0.0624 169 TYR B CG  
1009 C  CD1 . TYR B 44 ? 0.2777 1.1067 0.2236 -0.0878 0.0021  -0.0606 169 TYR B CD1 
1010 C  CD2 . TYR B 44 ? 0.2465 1.0253 0.1993 -0.0537 0.0050  -0.0637 169 TYR B CD2 
1011 C  CE1 . TYR B 44 ? 0.3152 1.1366 0.2506 -0.0986 0.0027  -0.0602 169 TYR B CE1 
1012 C  CE2 . TYR B 44 ? 0.2713 1.0406 0.2124 -0.0655 0.0061  -0.0646 169 TYR B CE2 
1013 C  CZ  . TYR B 44 ? 0.4248 1.2175 0.3575 -0.0878 0.0050  -0.0630 169 TYR B CZ  
1014 O  OH  . TYR B 44 ? 0.5122 1.3034 0.4316 -0.1028 0.0063  -0.0640 169 TYR B OH  
1015 N  N   . THR B 45 ? 0.1987 0.9442 0.1681 -0.0467 -0.0087 -0.0479 170 THR B N   
1016 C  CA  . THR B 45 ? 0.1995 0.9134 0.1694 -0.0399 -0.0113 -0.0431 170 THR B CA  
1017 C  C   . THR B 45 ? 0.2606 0.9547 0.2335 -0.0482 -0.0165 -0.0349 170 THR B C   
1018 O  O   . THR B 45 ? 0.2693 0.9470 0.2419 -0.0515 -0.0199 -0.0262 170 THR B O   
1019 C  CB  . THR B 45 ? 0.3292 1.0386 0.3033 -0.0207 -0.0083 -0.0469 170 THR B CB  
1020 O  OG1 . THR B 45 ? 0.3716 1.0920 0.3433 -0.0113 -0.0016 -0.0538 170 THR B OG1 
1021 C  CG2 . THR B 45 ? 0.3257 1.0074 0.2984 -0.0165 -0.0109 -0.0422 170 THR B CG2 
1022 N  N   . LEU B 46 ? 0.2160 0.9129 0.1913 -0.0526 -0.0163 -0.0374 171 LEU B N   
1023 C  CA  . LEU B 46 ? 0.2154 0.8864 0.1928 -0.0590 -0.0180 -0.0327 171 LEU B CA  
1024 C  C   . LEU B 46 ? 0.3126 0.9716 0.2864 -0.0742 -0.0213 -0.0219 171 LEU B C   
1025 O  O   . LEU B 46 ? 0.3427 0.9739 0.3215 -0.0734 -0.0227 -0.0133 171 LEU B O   
1026 C  CB  . LEU B 46 ? 0.2074 0.8802 0.1845 -0.0625 -0.0147 -0.0416 171 LEU B CB  
1027 C  CG  . LEU B 46 ? 0.2307 0.9136 0.2125 -0.0485 -0.0129 -0.0477 171 LEU B CG  
1028 C  CD1 . LEU B 46 ? 0.2213 0.9192 0.1996 -0.0580 -0.0100 -0.0564 171 LEU B CD1 
1029 C  CD2 . LEU B 46 ? 0.2743 0.9324 0.2623 -0.0377 -0.0132 -0.0449 171 LEU B CD2 
1030 N  N   . PHE B 47 ? 0.2635 0.9450 0.2298 -0.0867 -0.0223 -0.0208 172 PHE B N   
1031 C  CA  . PHE B 47 ? 0.2721 0.9471 0.2335 -0.1036 -0.0269 -0.0073 172 PHE B CA  
1032 C  C   . PHE B 47 ? 0.3368 1.0067 0.3019 -0.0979 -0.0308 0.0044  172 PHE B C   
1033 O  O   . PHE B 47 ? 0.3634 1.0159 0.3324 -0.1021 -0.0357 0.0213  172 PHE B O   
1034 C  CB  . PHE B 47 ? 0.2842 0.9933 0.2353 -0.1212 -0.0264 -0.0105 172 PHE B CB  
1035 C  CG  . PHE B 47 ? 0.3024 1.0099 0.2467 -0.1415 -0.0322 0.0057  172 PHE B CG  
1036 C  CD1 . PHE B 47 ? 0.3517 1.0360 0.2914 -0.1577 -0.0352 0.0163  172 PHE B CD1 
1037 C  CD2 . PHE B 47 ? 0.3015 1.0285 0.2422 -0.1463 -0.0344 0.0111  172 PHE B CD2 
1038 C  CE1 . PHE B 47 ? 0.3714 1.0528 0.3050 -0.1764 -0.0417 0.0358  172 PHE B CE1 
1039 C  CE2 . PHE B 47 ? 0.3491 1.0800 0.2834 -0.1669 -0.0410 0.0293  172 PHE B CE2 
1040 C  CZ  . PHE B 47 ? 0.3482 1.0565 0.2800 -0.1809 -0.0454 0.0434  172 PHE B CZ  
1041 N  N   . GLN B 48 ? 0.2528 0.9380 0.2162 -0.0889 -0.0283 -0.0040 173 GLN B N   
1042 C  CA  . GLN B 48 ? 0.2316 0.9166 0.1942 -0.0877 -0.0308 0.0035  173 GLN B CA  
1043 C  C   . GLN B 48 ? 0.3112 0.9740 0.2853 -0.0748 -0.0335 0.0123  173 GLN B C   
1044 O  O   . GLN B 48 ? 0.3337 0.9957 0.3121 -0.0783 -0.0389 0.0290  173 GLN B O   
1045 C  CB  . GLN B 48 ? 0.2244 0.9222 0.1791 -0.0823 -0.0247 -0.0115 173 GLN B CB  
1046 C  CG  . GLN B 48 ? 0.2270 0.9194 0.1775 -0.0823 -0.0259 -0.0075 173 GLN B CG  
1047 C  CD  . GLN B 48 ? 0.4217 1.1076 0.3660 -0.0709 -0.0185 -0.0229 173 GLN B CD  
1048 O  OE1 . GLN B 48 ? 0.3403 1.0335 0.2815 -0.0650 -0.0113 -0.0366 173 GLN B OE1 
1049 N  NE2 . GLN B 48 ? 0.2705 0.9433 0.2132 -0.0676 -0.0200 -0.0195 173 GLN B NE2 
1050 N  N   . VAL B 49 ? 0.2616 0.9126 0.2418 -0.0606 -0.0297 0.0023  174 VAL B N   
1051 C  CA  . VAL B 49 ? 0.2607 0.8952 0.2522 -0.0480 -0.0302 0.0070  174 VAL B CA  
1052 C  C   . VAL B 49 ? 0.3615 0.9782 0.3622 -0.0502 -0.0324 0.0213  174 VAL B C   
1053 O  O   . VAL B 49 ? 0.3756 0.9885 0.3872 -0.0433 -0.0353 0.0355  174 VAL B O   
1054 C  CB  . VAL B 49 ? 0.2834 0.9134 0.2774 -0.0364 -0.0252 -0.0075 174 VAL B CB  
1055 C  CG1 . VAL B 49 ? 0.2764 0.8917 0.2823 -0.0258 -0.0239 -0.0047 174 VAL B CG1 
1056 C  CG2 . VAL B 49 ? 0.2637 0.9050 0.2507 -0.0309 -0.0236 -0.0155 174 VAL B CG2 
1057 N  N   . MET B 50 ? 0.3257 0.9331 0.3217 -0.0607 -0.0311 0.0192  175 MET B N   
1058 C  CA  . MET B 50 ? 0.3523 0.9336 0.3538 -0.0644 -0.0322 0.0331  175 MET B CA  
1059 C  C   . MET B 50 ? 0.4180 1.0084 0.4233 -0.0700 -0.0403 0.0578  175 MET B C   
1060 O  O   . MET B 50 ? 0.4419 1.0161 0.4615 -0.0599 -0.0420 0.0751  175 MET B O   
1061 C  CB  . MET B 50 ? 0.3998 0.9716 0.3895 -0.0811 -0.0295 0.0256  175 MET B CB  
1062 C  CG  . MET B 50 ? 0.4827 1.0150 0.4748 -0.0859 -0.0284 0.0375  175 MET B CG  
1063 S  SD  . MET B 50 ? 0.5593 1.0864 0.5308 -0.1146 -0.0265 0.0294  175 MET B SD  
1064 C  CE  . MET B 50 ? 0.5178 1.0769 0.4820 -0.1327 -0.0366 0.0485  175 MET B CE  
1065 N  N   . THR B 51 ? 0.3575 0.9779 0.3511 -0.0849 -0.0446 0.0596  176 THR B N   
1066 C  CA  . THR B 51 ? 0.3601 0.9991 0.3540 -0.0956 -0.0528 0.0828  176 THR B CA  
1067 C  C   . THR B 51 ? 0.3824 1.0353 0.3861 -0.0846 -0.0556 0.0921  176 THR B C   
1068 O  O   . THR B 51 ? 0.3961 1.0704 0.4019 -0.0932 -0.0631 0.1141  176 THR B O   
1069 C  CB  . THR B 51 ? 0.4655 1.1352 0.4417 -0.1181 -0.0544 0.0783  176 THR B CB  
1070 O  OG1 . THR B 51 ? 0.4602 1.1466 0.4281 -0.1143 -0.0487 0.0564  176 THR B OG1 
1071 C  CG2 . THR B 51 ? 0.4468 1.1110 0.4138 -0.1330 -0.0533 0.0746  176 THR B CG2 
1072 N  N   . LEU B 52 ? 0.2908 0.9361 0.2996 -0.0679 -0.0502 0.0768  177 LEU B N   
1073 C  CA  . LEU B 52 ? 0.2608 0.9192 0.2777 -0.0577 -0.0515 0.0818  177 LEU B CA  
1074 C  C   . LEU B 52 ? 0.2929 0.9789 0.2939 -0.0720 -0.0533 0.0775  177 LEU B C   
1075 O  O   . LEU B 52 ? 0.3055 1.0077 0.3093 -0.0708 -0.0558 0.0847  177 LEU B O   
1076 C  CB  . LEU B 52 ? 0.2697 0.9294 0.3076 -0.0475 -0.0564 0.1091  177 LEU B CB  
1077 C  CG  . LEU B 52 ? 0.3434 0.9660 0.3971 -0.0307 -0.0513 0.1111  177 LEU B CG  
1078 C  CD1 . LEU B 52 ? 0.3647 0.9867 0.4389 -0.0212 -0.0562 0.1429  177 LEU B CD1 
1079 C  CD2 . LEU B 52 ? 0.3478 0.9564 0.4079 -0.0131 -0.0424 0.0905  177 LEU B CD2 
1080 N  N   . GLU B 53 ? 0.2283 0.9202 0.2117 -0.0863 -0.0508 0.0642  178 GLU B N   
1081 C  CA  . GLU B 53 ? 0.2165 0.9282 0.1812 -0.1017 -0.0492 0.0554  178 GLU B CA  
1082 C  C   . GLU B 53 ? 0.2409 0.9396 0.1994 -0.0914 -0.0425 0.0361  178 GLU B C   
1083 O  O   . GLU B 53 ? 0.2451 0.9274 0.2051 -0.0791 -0.0370 0.0211  178 GLU B O   
1084 C  CB  . GLU B 53 ? 0.2363 0.9592 0.1864 -0.1180 -0.0464 0.0463  178 GLU B CB  
1085 C  CG  . GLU B 53 ? 0.3091 1.0574 0.2399 -0.1403 -0.0454 0.0432  178 GLU B CG  
1086 C  CD  . GLU B 53 ? 0.4931 1.2316 0.4080 -0.1384 -0.0347 0.0171  178 GLU B CD  
1087 O  OE1 . GLU B 53 ? 0.2709 1.0052 0.1799 -0.1396 -0.0342 0.0163  178 GLU B OE1 
1088 O  OE2 . GLU B 53 ? 0.5036 1.2389 0.4119 -0.1356 -0.0263 -0.0017 178 GLU B OE2 
1089 N  N   . SER B 54 ? 0.2093 0.9173 0.1602 -0.0981 -0.0435 0.0384  179 SER B N   
1090 C  CA  . SER B 54 ? 0.2192 0.9127 0.1614 -0.0921 -0.0382 0.0242  179 SER B CA  
1091 C  C   . SER B 54 ? 0.2718 0.9451 0.2276 -0.0695 -0.0358 0.0178  179 SER B C   
1092 O  O   . SER B 54 ? 0.2745 0.9319 0.2221 -0.0630 -0.0303 0.0034  179 SER B O   
1093 C  CB  . SER B 54 ? 0.2641 0.9486 0.1830 -0.1023 -0.0295 0.0039  179 SER B CB  
1094 O  OG  . SER B 54 ? 0.3233 1.0253 0.2235 -0.1274 -0.0296 0.0055  179 SER B OG  
1095 N  N   . TRP B 55 ? 0.2349 0.9079 0.2106 -0.0583 -0.0393 0.0286  180 TRP B N   
1096 C  CA  . TRP B 55 ? 0.2457 0.9030 0.2325 -0.0410 -0.0360 0.0206  180 TRP B CA  
1097 C  C   . TRP B 55 ? 0.2742 0.9300 0.2602 -0.0343 -0.0347 0.0165  180 TRP B C   
1098 O  O   . TRP B 55 ? 0.2565 0.9014 0.2383 -0.0275 -0.0307 0.0042  180 TRP B O   
1099 C  CB  . TRP B 55 ? 0.2502 0.9011 0.2550 -0.0328 -0.0371 0.0299  180 TRP B CB  
1100 C  CG  . TRP B 55 ? 0.2729 0.9305 0.2951 -0.0233 -0.0394 0.0445  180 TRP B CG  
1101 C  CD1 . TRP B 55 ? 0.3194 0.9908 0.3524 -0.0249 -0.0449 0.0664  180 TRP B CD1 
1102 C  CD2 . TRP B 55 ? 0.2689 0.9239 0.3021 -0.0089 -0.0356 0.0392  180 TRP B CD2 
1103 N  NE1 . TRP B 55 ? 0.3117 0.9904 0.3638 -0.0097 -0.0442 0.0753  180 TRP B NE1 
1104 C  CE2 . TRP B 55 ? 0.3213 0.9899 0.3730 -0.0004 -0.0379 0.0572  180 TRP B CE2 
1105 C  CE3 . TRP B 55 ? 0.2817 0.9292 0.3112 -0.0029 -0.0305 0.0223  180 TRP B CE3 
1106 C  CZ2 . TRP B 55 ? 0.3161 0.9911 0.3829 0.0146  -0.0337 0.0558  180 TRP B CZ2 
1107 C  CZ3 . TRP B 55 ? 0.3022 0.9557 0.3440 0.0084  -0.0273 0.0211  180 TRP B CZ3 
1108 C  CH2 . TRP B 55 ? 0.3156 0.9825 0.3760 0.0175  -0.0281 0.0361  180 TRP B CH2 
1109 N  N   . SER B 56 ? 0.2143 0.8861 0.2035 -0.0383 -0.0385 0.0286  181 SER B N   
1110 C  CA  . SER B 56 ? 0.2093 0.8853 0.1961 -0.0363 -0.0381 0.0267  181 SER B CA  
1111 C  C   . SER B 56 ? 0.2474 0.9171 0.2087 -0.0520 -0.0368 0.0197  181 SER B C   
1112 O  O   . SER B 56 ? 0.2580 0.9091 0.2099 -0.0481 -0.0331 0.0088  181 SER B O   
1113 C  CB  . SER B 56 ? 0.2628 0.9646 0.2668 -0.0326 -0.0419 0.0432  181 SER B CB  
1114 O  OG  . SER B 56 ? 0.3732 1.0885 0.3737 -0.0351 -0.0422 0.0433  181 SER B OG  
1115 N  N   . MET B 57 ? 0.1735 0.8567 0.1226 -0.0706 -0.0393 0.0260  182 MET B N   
1116 C  CA  . MET B 57 ? 0.1783 0.8500 0.0995 -0.0890 -0.0358 0.0169  182 MET B CA  
1117 C  C   . MET B 57 ? 0.2426 0.8813 0.1493 -0.0853 -0.0276 -0.0015 182 MET B C   
1118 O  O   . MET B 57 ? 0.2317 0.8451 0.1231 -0.0858 -0.0227 -0.0107 182 MET B O   
1119 C  CB  . MET B 57 ? 0.2114 0.9098 0.1202 -0.1143 -0.0394 0.0264  182 MET B CB  
1120 C  CG  . MET B 57 ? 0.2450 0.9850 0.1724 -0.1151 -0.0480 0.0488  182 MET B CG  
1121 S  SD  . MET B 57 ? 0.2888 1.0438 0.2199 -0.1133 -0.0500 0.0542  182 MET B SD  
1122 C  CE  . MET B 57 ? 0.2802 1.0375 0.1722 -0.1511 -0.0487 0.0489  182 MET B CE  
1123 N  N   . GLY B 58 ? 0.2127 0.8538 0.1252 -0.0814 -0.0260 -0.0048 183 GLY B N   
1124 C  CA  . GLY B 58 ? 0.2149 0.8367 0.1184 -0.0763 -0.0177 -0.0208 183 GLY B CA  
1125 C  C   . GLY B 58 ? 0.2622 0.8713 0.1783 -0.0536 -0.0153 -0.0261 183 GLY B C   
1126 O  O   . GLY B 58 ? 0.2793 0.8691 0.1867 -0.0462 -0.0078 -0.0375 183 GLY B O   
1127 N  N   . ILE B 59 ? 0.1863 0.8064 0.1224 -0.0426 -0.0207 -0.0181 184 ILE B N   
1128 C  CA  . ILE B 59 ? 0.1783 0.7944 0.1251 -0.0256 -0.0189 -0.0229 184 ILE B CA  
1129 C  C   . ILE B 59 ? 0.2351 0.8507 0.1895 -0.0175 -0.0215 -0.0190 184 ILE B C   
1130 O  O   . ILE B 59 ? 0.2280 0.8338 0.1778 -0.0104 -0.0195 -0.0219 184 ILE B O   
1131 C  CB  . ILE B 59 ? 0.2020 0.8310 0.1608 -0.0227 -0.0193 -0.0237 184 ILE B CB  
1132 C  CG1 . ILE B 59 ? 0.2102 0.8467 0.1613 -0.0324 -0.0166 -0.0277 184 ILE B CG1 
1133 C  CG2 . ILE B 59 ? 0.1763 0.8091 0.1443 -0.0101 -0.0177 -0.0285 184 ILE B CG2 
1134 C  CD1 . ILE B 59 ? 0.2133 0.8464 0.1554 -0.0271 -0.0085 -0.0403 184 ILE B CD1 
1135 N  N   . VAL B 60 ? 0.1949 0.8226 0.1624 -0.0174 -0.0253 -0.0120 185 VAL B N   
1136 C  CA  . VAL B 60 ? 0.1876 0.8212 0.1643 -0.0105 -0.0261 -0.0109 185 VAL B CA  
1137 C  C   . VAL B 60 ? 0.2468 0.8801 0.2140 -0.0152 -0.0275 -0.0075 185 VAL B C   
1138 O  O   . VAL B 60 ? 0.2432 0.8768 0.2104 -0.0103 -0.0270 -0.0097 185 VAL B O   
1139 C  CB  . VAL B 60 ? 0.2301 0.8728 0.2248 -0.0060 -0.0264 -0.0072 185 VAL B CB  
1140 C  CG1 . VAL B 60 ? 0.2230 0.8733 0.2264 0.0009  -0.0242 -0.0108 185 VAL B CG1 
1141 C  CG2 . VAL B 60 ? 0.2239 0.8608 0.2231 -0.0050 -0.0245 -0.0114 185 VAL B CG2 
1142 N  N   . ARG B 61 ? 0.2054 0.8411 0.1627 -0.0276 -0.0297 -0.0014 186 ARG B N   
1143 C  CA  . ARG B 61 ? 0.2109 0.8450 0.1543 -0.0373 -0.0310 0.0016  186 ARG B CA  
1144 C  C   . ARG B 61 ? 0.2665 0.8709 0.1929 -0.0359 -0.0275 -0.0047 186 ARG B C   
1145 O  O   . ARG B 61 ? 0.2704 0.8737 0.1961 -0.0323 -0.0285 -0.0027 186 ARG B O   
1146 C  CB  . ARG B 61 ? 0.2383 0.8842 0.1707 -0.0560 -0.0337 0.0090  186 ARG B CB  
1147 C  CG  . ARG B 61 ? 0.3456 1.0271 0.2982 -0.0543 -0.0379 0.0208  186 ARG B CG  
1148 C  CD  . ARG B 61 ? 0.3897 1.0943 0.3309 -0.0753 -0.0418 0.0311  186 ARG B CD  
1149 N  NE  . ARG B 61 ? 0.3631 1.1090 0.3277 -0.0701 -0.0460 0.0466  186 ARG B NE  
1150 C  CZ  . ARG B 61 ? 0.4466 1.2189 0.4256 -0.0629 -0.0466 0.0521  186 ARG B CZ  
1151 N  NH1 . ARG B 61 ? 0.2258 0.9883 0.1964 -0.0631 -0.0444 0.0436  186 ARG B NH1 
1152 N  NH2 . ARG B 61 ? 0.1910 1.0017 0.1944 -0.0543 -0.0491 0.0673  186 ARG B NH2 
1153 N  N   . PRO B 62 ? 0.2301 0.8123 0.1456 -0.0357 -0.0228 -0.0117 187 PRO B N   
1154 C  CA  . PRO B 62 ? 0.2457 0.7993 0.1505 -0.0277 -0.0181 -0.0156 187 PRO B CA  
1155 C  C   . PRO B 62 ? 0.2923 0.8560 0.2125 -0.0104 -0.0196 -0.0131 187 PRO B C   
1156 O  O   . PRO B 62 ? 0.3103 0.8598 0.2240 -0.0060 -0.0196 -0.0083 187 PRO B O   
1157 C  CB  . PRO B 62 ? 0.2770 0.8165 0.1755 -0.0261 -0.0112 -0.0254 187 PRO B CB  
1158 C  CG  . PRO B 62 ? 0.3276 0.8799 0.2197 -0.0449 -0.0128 -0.0254 187 PRO B CG  
1159 C  CD  . PRO B 62 ? 0.2458 0.8298 0.1580 -0.0427 -0.0206 -0.0157 187 PRO B CD  
1160 N  N   . VAL B 63 ? 0.2242 0.8127 0.1630 -0.0034 -0.0211 -0.0150 188 VAL B N   
1161 C  CA  . VAL B 63 ? 0.2141 0.8188 0.1650 0.0074  -0.0223 -0.0140 188 VAL B CA  
1162 C  C   . VAL B 63 ? 0.2738 0.8903 0.2254 0.0031  -0.0261 -0.0086 188 VAL B C   
1163 O  O   . VAL B 63 ? 0.2933 0.9098 0.2416 0.0068  -0.0275 -0.0029 188 VAL B O   
1164 C  CB  . VAL B 63 ? 0.2460 0.8698 0.2112 0.0116  -0.0213 -0.0198 188 VAL B CB  
1165 C  CG1 . VAL B 63 ? 0.2360 0.8817 0.2104 0.0153  -0.0224 -0.0202 188 VAL B CG1 
1166 C  CG2 . VAL B 63 ? 0.2506 0.8702 0.2144 0.0176  -0.0174 -0.0239 188 VAL B CG2 
1167 N  N   . MET B 64 ? 0.1998 0.8285 0.1556 -0.0048 -0.0276 -0.0085 189 MET B N   
1168 C  CA  . MET B 64 ? 0.1864 0.8330 0.1442 -0.0097 -0.0297 -0.0053 189 MET B CA  
1169 C  C   . MET B 64 ? 0.3009 0.9362 0.2414 -0.0181 -0.0324 0.0027  189 MET B C   
1170 O  O   . MET B 64 ? 0.3184 0.9716 0.2587 -0.0229 -0.0346 0.0063  189 MET B O   
1171 C  CB  . MET B 64 ? 0.2025 0.8652 0.1695 -0.0136 -0.0297 -0.0050 189 MET B CB  
1172 C  CG  . MET B 64 ? 0.2348 0.9113 0.2211 -0.0048 -0.0260 -0.0119 189 MET B CG  
1173 S  SD  . MET B 64 ? 0.2921 0.9918 0.2933 -0.0040 -0.0250 -0.0074 189 MET B SD  
1174 C  CE  . MET B 64 ? 0.2508 0.9438 0.2428 -0.0136 -0.0301 0.0043  189 MET B CE  
1175 N  N   . ASN B 65 ? 0.2965 0.9006 0.2207 -0.0216 -0.0315 0.0049  190 ASN B N   
1176 C  CA  . ASN B 65 ? 0.3311 0.9117 0.2347 -0.0310 -0.0328 0.0128  190 ASN B CA  
1177 C  C   . ASN B 65 ? 0.3981 0.9754 0.3030 -0.0206 -0.0343 0.0203  190 ASN B C   
1178 O  O   . ASN B 65 ? 0.4264 0.9963 0.3186 -0.0292 -0.0375 0.0306  190 ASN B O   
1179 C  CB  . ASN B 65 ? 0.3687 0.9105 0.2529 -0.0377 -0.0283 0.0096  190 ASN B CB  
1180 C  CG  . ASN B 65 ? 0.8450 1.3680 0.7044 -0.0590 -0.0295 0.0150  190 ASN B CG  
1181 O  OD1 . ASN B 65 ? 0.8609 1.3893 0.7101 -0.0768 -0.0295 0.0125  190 ASN B OD1 
1182 N  ND2 . ASN B 65 ? 0.7786 1.2835 0.6272 -0.0602 -0.0313 0.0244  190 ASN B ND2 
1183 N  N   . VAL B 66 ? 0.3244 0.9123 0.2446 -0.0041 -0.0326 0.0173  191 VAL B N   
1184 C  CA  . VAL B 66 ? 0.3232 0.9220 0.2492 0.0065  -0.0349 0.0267  191 VAL B CA  
1185 C  C   . VAL B 66 ? 0.3339 0.9790 0.2740 0.0035  -0.0375 0.0234  191 VAL B C   
1186 O  O   . VAL B 66 ? 0.3267 0.9909 0.2651 -0.0010 -0.0417 0.0301  191 VAL B O   
1187 C  CB  . VAL B 66 ? 0.3724 0.9577 0.3044 0.0253  -0.0307 0.0270  191 VAL B CB  
1188 C  CG1 . VAL B 66 ? 0.3590 0.9715 0.3023 0.0369  -0.0341 0.0391  191 VAL B CG1 
1189 C  CG2 . VAL B 66 ? 0.4076 0.9423 0.3231 0.0283  -0.0255 0.0290  191 VAL B CG2 
1190 N  N   . HIS B 67 ? 0.2705 0.9309 0.2223 0.0039  -0.0343 0.0099  192 HIS B N   
1191 C  CA  . HIS B 67 ? 0.2639 0.9587 0.2269 0.0003  -0.0332 0.0016  192 HIS B CA  
1192 C  C   . HIS B 67 ? 0.3494 1.0492 0.3160 -0.0067 -0.0308 -0.0065 192 HIS B C   
1193 O  O   . HIS B 67 ? 0.3502 1.0435 0.3247 -0.0034 -0.0274 -0.0143 192 HIS B O   
1194 C  CB  . HIS B 67 ? 0.2709 0.9743 0.2440 0.0069  -0.0300 -0.0068 192 HIS B CB  
1195 C  CG  . HIS B 67 ? 0.3278 1.0268 0.3007 0.0179  -0.0312 0.0016  192 HIS B CG  
1196 N  ND1 . HIS B 67 ? 0.3495 1.0758 0.3255 0.0208  -0.0341 0.0107  192 HIS B ND1 
1197 C  CD2 . HIS B 67 ? 0.3571 1.0313 0.3281 0.0272  -0.0290 0.0025  192 HIS B CD2 
1198 C  CE1 . HIS B 67 ? 0.3501 1.0674 0.3287 0.0351  -0.0335 0.0183  192 HIS B CE1 
1199 N  NE2 . HIS B 67 ? 0.3597 1.0440 0.3348 0.0394  -0.0295 0.0118  192 HIS B NE2 
1200 N  N   . PRO B 68 ? 0.3323 1.0471 0.2944 -0.0160 -0.0325 -0.0030 193 PRO B N   
1201 C  CA  . PRO B 68 ? 0.3260 1.0524 0.2947 -0.0197 -0.0296 -0.0087 193 PRO B CA  
1202 C  C   . PRO B 68 ? 0.3792 1.1180 0.3651 -0.0131 -0.0223 -0.0229 193 PRO B C   
1203 O  O   . PRO B 68 ? 0.3901 1.1328 0.3856 -0.0102 -0.0195 -0.0245 193 PRO B O   
1204 C  CB  . PRO B 68 ? 0.3508 1.1000 0.3115 -0.0317 -0.0323 -0.0027 193 PRO B CB  
1205 C  CG  . PRO B 68 ? 0.4130 1.1670 0.3658 -0.0343 -0.0360 0.0041  193 PRO B CG  
1206 C  CD  . PRO B 68 ? 0.3634 1.0874 0.3142 -0.0238 -0.0375 0.0089  193 PRO B CD  
1207 N  N   . ASN B 69 ? 0.3250 1.0699 0.3145 -0.0115 -0.0187 -0.0321 194 ASN B N   
1208 C  CA  . ASN B 69 ? 0.3202 1.0677 0.3219 -0.0078 -0.0099 -0.0476 194 ASN B CA  
1209 C  C   . ASN B 69 ? 0.3369 1.0606 0.3422 -0.0024 -0.0086 -0.0504 194 ASN B C   
1210 O  O   . ASN B 69 ? 0.3462 1.0651 0.3583 -0.0015 -0.0009 -0.0630 194 ASN B O   
1211 C  CB  . ASN B 69 ? 0.3817 1.1552 0.3812 -0.0164 -0.0046 -0.0599 194 ASN B CB  
1212 C  CG  . ASN B 69 ? 0.8231 1.6253 0.8230 -0.0224 -0.0017 -0.0631 194 ASN B CG  
1213 O  OD1 . ASN B 69 ? 0.7247 1.5298 0.7311 -0.0179 -0.0011 -0.0595 194 ASN B OD1 
1214 N  ND2 . ASN B 69 ? 0.7530 1.5838 0.7459 -0.0345 0.0004  -0.0700 194 ASN B ND2 
1215 N  N   . ALA B 70 ? 0.2495 0.9567 0.2491 0.0001  -0.0148 -0.0399 195 ALA B N   
1216 C  CA  . ALA B 70 ? 0.2289 0.9191 0.2306 0.0030  -0.0142 -0.0415 195 ALA B CA  
1217 C  C   . ALA B 70 ? 0.2631 0.9403 0.2756 0.0065  -0.0097 -0.0451 195 ALA B C   
1218 O  O   . ALA B 70 ? 0.2694 0.9350 0.2835 0.0054  -0.0072 -0.0496 195 ALA B O   
1219 C  CB  . ALA B 70 ? 0.2335 0.9103 0.2274 0.0052  -0.0194 -0.0315 195 ALA B CB  
1220 N  N   . TRP B 71 ? 0.2074 0.8891 0.2279 0.0105  -0.0085 -0.0418 196 TRP B N   
1221 C  CA  . TRP B 71 ? 0.2182 0.8906 0.2533 0.0182  -0.0042 -0.0408 196 TRP B CA  
1222 C  C   . TRP B 71 ? 0.3027 0.9646 0.3447 0.0206  0.0064  -0.0562 196 TRP B C   
1223 O  O   . TRP B 71 ? 0.3187 0.9604 0.3706 0.0271  0.0107  -0.0550 196 TRP B O   
1224 C  CB  . TRP B 71 ? 0.1974 0.8878 0.2418 0.0233  -0.0051 -0.0320 196 TRP B CB  
1225 C  CG  . TRP B 71 ? 0.2092 0.9229 0.2547 0.0225  -0.0007 -0.0403 196 TRP B CG  
1226 C  CD1 . TRP B 71 ? 0.2401 0.9712 0.2729 0.0129  -0.0057 -0.0373 196 TRP B CD1 
1227 C  CD2 . TRP B 71 ? 0.2169 0.9382 0.2754 0.0301  0.0108  -0.0537 196 TRP B CD2 
1228 N  NE1 . TRP B 71 ? 0.2389 0.9943 0.2760 0.0123  0.0005  -0.0467 196 TRP B NE1 
1229 C  CE2 . TRP B 71 ? 0.2613 1.0121 0.3144 0.0232  0.0117  -0.0587 196 TRP B CE2 
1230 C  CE3 . TRP B 71 ? 0.2458 0.9489 0.3194 0.0420  0.0216  -0.0623 196 TRP B CE3 
1231 C  CZ2 . TRP B 71 ? 0.2541 1.0226 0.3166 0.0273  0.0236  -0.0743 196 TRP B CZ2 
1232 C  CZ3 . TRP B 71 ? 0.2733 0.9866 0.3563 0.0481  0.0347  -0.0787 196 TRP B CZ3 
1233 C  CH2 . TRP B 71 ? 0.2725 1.0211 0.3502 0.0406  0.0360  -0.0856 196 TRP B CH2 
1234 N  N   . VAL B 72 ? 0.2584 0.9330 0.2934 0.0136  0.0111  -0.0701 197 VAL B N   
1235 C  CA  . VAL B 72 ? 0.2684 0.9340 0.3036 0.0098  0.0229  -0.0892 197 VAL B CA  
1236 C  C   . VAL B 72 ? 0.3067 0.9522 0.3335 0.0011  0.0224  -0.0920 197 VAL B C   
1237 O  O   . VAL B 72 ? 0.3338 0.9579 0.3596 -0.0032 0.0323  -0.1054 197 VAL B O   
1238 C  CB  . VAL B 72 ? 0.3129 1.0073 0.3398 -0.0006 0.0269  -0.1023 197 VAL B CB  
1239 C  CG1 . VAL B 72 ? 0.3359 1.0209 0.3584 -0.0096 0.0408  -0.1257 197 VAL B CG1 
1240 C  CG2 . VAL B 72 ? 0.3034 1.0215 0.3377 0.0056  0.0274  -0.0992 197 VAL B CG2 
1241 N  N   . PHE B 73 ? 0.2175 0.8692 0.2373 -0.0022 0.0120  -0.0800 198 PHE B N   
1242 C  CA  . PHE B 73 ? 0.1979 0.8398 0.2104 -0.0109 0.0106  -0.0807 198 PHE B CA  
1243 C  C   . PHE B 73 ? 0.2138 0.8310 0.2326 -0.0053 0.0082  -0.0696 198 PHE B C   
1244 O  O   . PHE B 73 ? 0.2302 0.8229 0.2496 -0.0092 0.0136  -0.0739 198 PHE B O   
1245 C  CB  . PHE B 73 ? 0.2026 0.8698 0.2064 -0.0154 0.0028  -0.0748 198 PHE B CB  
1246 C  CG  . PHE B 73 ? 0.2345 0.9009 0.2327 -0.0230 0.0009  -0.0737 198 PHE B CG  
1247 C  CD1 . PHE B 73 ? 0.2871 0.9650 0.2771 -0.0382 0.0049  -0.0846 198 PHE B CD1 
1248 C  CD2 . PHE B 73 ? 0.2462 0.9052 0.2456 -0.0182 -0.0046 -0.0625 198 PHE B CD2 
1249 C  CE1 . PHE B 73 ? 0.2944 0.9781 0.2789 -0.0476 0.0030  -0.0830 198 PHE B CE1 
1250 C  CE2 . PHE B 73 ? 0.2847 0.9487 0.2791 -0.0264 -0.0057 -0.0623 198 PHE B CE2 
1251 C  CZ  . PHE B 73 ? 0.2730 0.9506 0.2606 -0.0406 -0.0022 -0.0718 198 PHE B CZ  
1252 N  N   . PHE B 74 ? 0.1271 0.7501 0.1490 0.0015  0.0003  -0.0549 199 PHE B N   
1253 C  CA  . PHE B 74 ? 0.1119 0.7218 0.1377 0.0032  -0.0040 -0.0417 199 PHE B CA  
1254 C  C   . PHE B 74 ? 0.2089 0.7999 0.2487 0.0115  -0.0002 -0.0355 199 PHE B C   
1255 O  O   . PHE B 74 ? 0.2304 0.8015 0.2706 0.0078  0.0001  -0.0303 199 PHE B O   
1256 C  CB  . PHE B 74 ? 0.0986 0.7217 0.1200 0.0039  -0.0119 -0.0305 199 PHE B CB  
1257 C  CG  . PHE B 74 ? 0.0929 0.7218 0.1001 -0.0003 -0.0102 -0.0342 199 PHE B CG  
1258 C  CD1 . PHE B 74 ? 0.1212 0.7560 0.1248 -0.0065 -0.0158 -0.0339 199 PHE B CD1 
1259 C  CD2 . PHE B 74 ? 0.0887 0.7239 0.0918 0.0030  -0.0052 -0.0360 199 PHE B CD2 
1260 C  CE1 . PHE B 74 ? 0.1170 0.7650 0.1133 -0.0058 -0.0165 -0.0366 199 PHE B CE1 
1261 C  CE2 . PHE B 74 ? 0.1004 0.7542 0.0980 0.0030  -0.0160 -0.0365 199 PHE B CE2 
1262 C  CZ  . PHE B 74 ? 0.0906 0.7398 0.0886 0.0010  -0.0088 -0.0365 199 PHE B CZ  
1263 N  N   . ILE B 75 ? 0.1792 0.7779 0.2311 0.0232  0.0030  -0.0342 200 ILE B N   
1264 C  CA  . ILE B 75 ? 0.1996 0.7841 0.2700 0.0369  0.0080  -0.0263 200 ILE B CA  
1265 C  C   . ILE B 75 ? 0.3068 0.8539 0.3777 0.0362  0.0182  -0.0368 200 ILE B C   
1266 O  O   . ILE B 75 ? 0.3192 0.8443 0.3945 0.0372  0.0163  -0.0233 200 ILE B O   
1267 C  CB  . ILE B 75 ? 0.2269 0.8341 0.3119 0.0504  0.0112  -0.0247 200 ILE B CB  
1268 C  CG1 . ILE B 75 ? 0.2077 0.8460 0.2885 0.0459  0.0000  -0.0105 200 ILE B CG1 
1269 C  CG2 . ILE B 75 ? 0.2539 0.8472 0.3623 0.0696  0.0189  -0.0169 200 ILE B CG2 
1270 C  CD1 . ILE B 75 ? 0.3208 0.9908 0.4118 0.0533  0.0011  -0.0075 200 ILE B CD1 
1271 N  N   . PRO B 76 ? 0.2928 0.8319 0.3551 0.0297  0.0284  -0.0600 201 PRO B N   
1272 C  CA  . PRO B 76 ? 0.3375 0.8361 0.3941 0.0229  0.0391  -0.0721 201 PRO B CA  
1273 C  C   . PRO B 76 ? 0.4093 0.8949 0.4515 0.0055  0.0321  -0.0654 201 PRO B C   
1274 O  O   . PRO B 76 ? 0.4399 0.8869 0.4823 0.0037  0.0364  -0.0612 201 PRO B O   
1275 C  CB  . PRO B 76 ? 0.3628 0.8695 0.4076 0.0123  0.0493  -0.0990 201 PRO B CB  
1276 C  CG  . PRO B 76 ? 0.3848 0.9295 0.4380 0.0224  0.0469  -0.0983 201 PRO B CG  
1277 C  CD  . PRO B 76 ? 0.2948 0.8614 0.3501 0.0251  0.0311  -0.0756 201 PRO B CD  
1278 N  N   . PHE B 77 ? 0.3402 0.8574 0.3705 -0.0061 0.0218  -0.0630 202 PHE B N   
1279 C  CA  . PHE B 77 ? 0.3439 0.8596 0.3620 -0.0221 0.0154  -0.0569 202 PHE B CA  
1280 C  C   . PHE B 77 ? 0.4418 0.9408 0.4686 -0.0170 0.0095  -0.0345 202 PHE B C   
1281 O  O   . PHE B 77 ? 0.4609 0.9374 0.4803 -0.0293 0.0094  -0.0298 202 PHE B O   
1282 C  CB  . PHE B 77 ? 0.3289 0.8845 0.3385 -0.0282 0.0069  -0.0565 202 PHE B CB  
1283 C  CG  . PHE B 77 ? 0.3510 0.9130 0.3528 -0.0395 0.0001  -0.0470 202 PHE B CG  
1284 C  CD1 . PHE B 77 ? 0.4032 0.9665 0.3917 -0.0584 0.0021  -0.0549 202 PHE B CD1 
1285 C  CD2 . PHE B 77 ? 0.3740 0.9429 0.3804 -0.0345 -0.0076 -0.0306 202 PHE B CD2 
1286 C  CE1 . PHE B 77 ? 0.4179 0.9921 0.3995 -0.0701 -0.0036 -0.0465 202 PHE B CE1 
1287 C  CE2 . PHE B 77 ? 0.4112 0.9884 0.4097 -0.0469 -0.0125 -0.0235 202 PHE B CE2 
1288 C  CZ  . PHE B 77 ? 0.3976 0.9781 0.3846 -0.0637 -0.0105 -0.0313 202 PHE B CZ  
1289 N  N   . ILE B 78 ? 0.4082 0.9225 0.4489 -0.0020 0.0039  -0.0193 203 ILE B N   
1290 C  CA  . ILE B 78 ? 0.4249 0.9348 0.4752 0.0022  -0.0030 0.0051  203 ILE B CA  
1291 C  C   . ILE B 78 ? 0.5659 1.0344 0.6283 0.0119  0.0046  0.0116  203 ILE B C   
1292 O  O   . ILE B 78 ? 0.5847 1.0301 0.6431 0.0029  0.0022  0.0239  203 ILE B O   
1293 C  CB  . ILE B 78 ? 0.4253 0.9685 0.4855 0.0123  -0.0103 0.0184  203 ILE B CB  
1294 C  CG1 . ILE B 78 ? 0.3907 0.9615 0.4352 -0.0008 -0.0179 0.0163  203 ILE B CG1 
1295 C  CG2 . ILE B 78 ? 0.4381 0.9814 0.5148 0.0210  -0.0154 0.0454  203 ILE B CG2 
1296 C  CD1 . ILE B 78 ? 0.3721 0.9682 0.4173 0.0041  -0.0208 0.0166  203 ILE B CD1 
1297 N  N   . MET B 79 ? 0.5676 1.0247 0.6433 0.0294  0.0152  0.0019  204 MET B N   
1298 C  CA  . MET B 79 ? 0.6249 1.0381 0.7148 0.0444  0.0264  0.0051  204 MET B CA  
1299 C  C   . MET B 79 ? 0.7161 1.0794 0.7888 0.0272  0.0337  -0.0050 204 MET B C   
1300 O  O   . MET B 79 ? 0.7438 1.0667 0.8238 0.0331  0.0363  0.0109  204 MET B O   
1301 C  CB  . MET B 79 ? 0.6657 1.0809 0.7694 0.0636  0.0395  -0.0118 204 MET B CB  
1302 C  CG  . MET B 79 ? 0.6940 1.1551 0.8179 0.0817  0.0332  0.0032  204 MET B CG  
1303 S  SD  . MET B 79 ? 0.7844 1.2470 0.9329 0.1102  0.0503  -0.0092 204 MET B SD  
1304 C  CE  . MET B 79 ? 0.7273 1.2064 0.8531 0.0920  0.0570  -0.0457 204 MET B CE  
1305 N  N   . LEU B 80 ? 0.6713 1.0401 0.7207 0.0047  0.0362  -0.0286 205 LEU B N   
1306 C  CA  . LEU B 80 ? 0.7141 1.0442 0.7421 -0.0187 0.0432  -0.0415 205 LEU B CA  
1307 C  C   . LEU B 80 ? 0.7858 1.1144 0.8025 -0.0374 0.0315  -0.0222 205 LEU B C   
1308 O  O   . LEU B 80 ? 0.8287 1.1093 0.8410 -0.0439 0.0352  -0.0133 205 LEU B O   
1309 C  CB  . LEU B 80 ? 0.7020 1.0530 0.7103 -0.0377 0.0489  -0.0711 205 LEU B CB  
1310 C  CG  . LEU B 80 ? 0.7988 1.1260 0.7800 -0.0693 0.0548  -0.0869 205 LEU B CG  
1311 C  CD1 . LEU B 80 ? 0.8714 1.1310 0.8476 -0.0705 0.0731  -0.1010 205 LEU B CD1 
1312 C  CD2 . LEU B 80 ? 0.8049 1.1772 0.7707 -0.0871 0.0550  -0.1077 205 LEU B CD2 
1313 N  N   . THR B 81 ? 0.7104 1.0896 0.7216 -0.0466 0.0186  -0.0164 206 THR B N   
1314 C  CA  . THR B 81 ? 0.7069 1.0975 0.7066 -0.0660 0.0080  -0.0010 206 THR B CA  
1315 C  C   . THR B 81 ? 0.7985 1.1781 0.8124 -0.0564 0.0001  0.0304  206 THR B C   
1316 O  O   . THR B 81 ? 0.8244 1.1762 0.8302 -0.0708 -0.0020 0.0441  206 THR B O   
1317 C  CB  . THR B 81 ? 0.6713 1.1182 0.6626 -0.0752 0.0000  -0.0076 206 THR B CB  
1318 O  OG1 . THR B 81 ? 0.5857 1.0618 0.5915 -0.0557 -0.0050 -0.0012 206 THR B OG1 
1319 C  CG2 . THR B 81 ? 0.6396 1.1013 0.6170 -0.0875 0.0064  -0.0331 206 THR B CG2 
1320 N  N   . THR B 82 ? 0.7595 1.1616 0.7938 -0.0338 -0.0043 0.0434  207 THR B N   
1321 C  CA  . THR B 82 ? 0.7807 1.1835 0.8311 -0.0238 -0.0126 0.0763  207 THR B CA  
1322 C  C   . THR B 82 ? 0.9204 1.2702 0.9878 -0.0043 -0.0032 0.0867  207 THR B C   
1323 O  O   . THR B 82 ? 0.9180 1.2746 1.0103 0.0211  -0.0035 0.1038  207 THR B O   
1324 C  CB  . THR B 82 ? 0.8113 1.2666 0.8729 -0.0138 -0.0216 0.0867  207 THR B CB  
1325 O  OG1 . THR B 82 ? 0.8247 1.2809 0.9061 0.0116  -0.0151 0.0833  207 THR B OG1 
1326 C  CG2 . THR B 82 ? 0.7205 1.2148 0.7650 -0.0284 -0.0254 0.0691  207 THR B CG2 
1327 N  N   . PHE B 83 ? 0.9562 1.2533 1.0092 -0.0168 0.0061  0.0755  208 PHE B N   
1328 C  CA  . PHE B 83 ? 1.0377 1.2673 1.0993 -0.0031 0.0191  0.0790  208 PHE B CA  
1329 C  C   . PHE B 83 ? 1.1586 1.3433 1.1915 -0.0346 0.0226  0.0712  208 PHE B C   
1330 O  O   . PHE B 83 ? 1.2087 1.3483 1.2418 -0.0374 0.0217  0.0945  208 PHE B O   
1331 C  CB  . PHE B 83 ? 1.0708 1.2850 1.1418 0.0172  0.0363  0.0502  208 PHE B CB  
1332 C  CG  . PHE B 83 ? 1.1705 1.3072 1.2411 0.0250  0.0556  0.0391  208 PHE B CG  
1333 C  CD1 . PHE B 83 ? 1.2577 1.3604 1.3574 0.0589  0.0630  0.0590  208 PHE B CD1 
1334 C  CD2 . PHE B 83 ? 1.2338 1.3328 1.2749 -0.0017 0.0677  0.0080  208 PHE B CD2 
1335 C  CE1 . PHE B 83 ? 1.3483 1.3712 1.4474 0.0684  0.0838  0.0466  208 PHE B CE1 
1336 C  CE2 . PHE B 83 ? 1.3501 1.3705 1.3866 0.0022  0.0879  -0.0056 208 PHE B CE2 
1337 C  CZ  . PHE B 83 ? 1.3713 1.3499 1.4369 0.0386  0.0968  0.0127  208 PHE B CZ  
1338 N  N   . THR B 84 ? 1.1105 1.3104 1.1188 -0.0592 0.0263  0.0403  209 THR B N   
1339 C  CA  . THR B 84 ? 1.1488 1.3205 1.1260 -0.0951 0.0296  0.0286  209 THR B CA  
1340 C  C   . THR B 84 ? 1.2158 1.4111 1.1836 -0.1166 0.0135  0.0547  209 THR B C   
1341 O  O   . THR B 84 ? 1.2680 1.4212 1.2181 -0.1397 0.0144  0.0633  209 THR B O   
1342 C  CB  . THR B 84 ? 1.1877 1.3895 1.1458 -0.1135 0.0356  -0.0071 209 THR B CB  
1343 O  OG1 . THR B 84 ? 1.1717 1.3649 1.1416 -0.0917 0.0484  -0.0281 209 THR B OG1 
1344 C  CG2 . THR B 84 ? 1.2092 1.3792 1.1346 -0.1515 0.0425  -0.0229 209 THR B CG2 
1345 N  N   . VAL B 85 ? 1.1305 1.3911 1.1087 -0.1107 -0.0002 0.0670  210 VAL B N   
1346 C  CA  . VAL B 85 ? 1.1249 1.4190 1.0956 -0.1302 -0.0150 0.0904  210 VAL B CA  
1347 C  C   . VAL B 85 ? 1.2438 1.5017 1.2267 -0.1226 -0.0203 0.1276  210 VAL B C   
1348 O  O   . VAL B 85 ? 1.2755 1.5165 1.2427 -0.1477 -0.0258 0.1445  210 VAL B O   
1349 C  CB  . VAL B 85 ? 1.1031 1.4705 1.0809 -0.1242 -0.0245 0.0893  210 VAL B CB  
1350 C  CG1 . VAL B 85 ? 1.0936 1.4938 1.0700 -0.1374 -0.0384 0.1173  210 VAL B CG1 
1351 C  CG2 . VAL B 85 ? 1.0655 1.4696 1.0276 -0.1380 -0.0214 0.0594  210 VAL B CG2 
1352 N  N   . LEU B 86 ? 1.2224 1.4702 1.2337 -0.0881 -0.0184 0.1415  211 LEU B N   
1353 C  CA  . LEU B 86 ? 1.2767 1.4947 1.3071 -0.0725 -0.0229 0.1804  211 LEU B CA  
1354 C  C   . LEU B 86 ? 1.4279 1.5593 1.4490 -0.0777 -0.0119 0.1837  211 LEU B C   
1355 O  O   . LEU B 86 ? 1.4679 1.5725 1.4898 -0.0839 -0.0190 0.2182  211 LEU B O   
1356 C  CB  . LEU B 86 ? 1.2615 1.4972 1.3262 -0.0326 -0.0215 0.1910  211 LEU B CB  
1357 C  CG  . LEU B 86 ? 1.2749 1.5858 1.3521 -0.0298 -0.0375 0.2134  211 LEU B CG  
1358 C  CD1 . LEU B 86 ? 1.2117 1.5782 1.2752 -0.0416 -0.0394 0.1834  211 LEU B CD1 
1359 C  CD2 . LEU B 86 ? 1.3161 1.6377 1.4287 0.0071  -0.0372 0.2358  211 LEU B CD2 
1360 N  N   . ASN B 87 ? 1.4226 1.5111 1.4313 -0.0795 0.0054  0.1475  212 ASN B N   
1361 C  CA  . ASN B 87 ? 1.5119 1.5117 1.5048 -0.0894 0.0198  0.1408  212 ASN B CA  
1362 C  C   . ASN B 87 ? 1.6032 1.5938 1.5601 -0.1367 0.0133  0.1432  212 ASN B C   
1363 O  O   . ASN B 87 ? 1.6692 1.5972 1.6170 -0.1478 0.0142  0.1654  212 ASN B O   
1364 C  CB  . ASN B 87 ? 1.5462 1.5182 1.5324 -0.0835 0.0403  0.0964  212 ASN B CB  
1365 C  CG  . ASN B 87 ? 2.0232 1.8952 2.0007 -0.0818 0.0604  0.0871  212 ASN B CG  
1366 O  OD1 . ASN B 87 ? 2.0149 1.8472 1.9579 -0.1167 0.0697  0.0637  212 ASN B OD1 
1367 N  ND2 . ASN B 87 ? 1.9824 1.8127 1.9907 -0.0409 0.0692  0.1035  212 ASN B ND2 
1368 N  N   . LEU B 88 ? 1.5212 1.5753 1.4586 -0.1639 0.0070  0.1219  213 LEU B N   
1369 C  CA  . LEU B 88 ? 1.5390 1.6058 1.4432 -0.2099 0.0006  0.1204  213 LEU B CA  
1370 C  C   . LEU B 88 ? 1.6162 1.6999 1.5216 -0.2219 -0.0166 0.1622  213 LEU B C   
1371 O  O   . LEU B 88 ? 1.6685 1.7160 1.5505 -0.2537 -0.0187 0.1756  213 LEU B O   
1372 C  CB  . LEU B 88 ? 1.4705 1.6153 1.3635 -0.2252 -0.0022 0.0910  213 LEU B CB  
1373 C  CG  . LEU B 88 ? 1.5203 1.7130 1.3874 -0.2666 -0.0119 0.0919  213 LEU B CG  
1374 C  CD1 . LEU B 88 ? 1.5843 1.7319 1.4174 -0.3056 -0.0031 0.0774  213 LEU B CD1 
1375 C  CD2 . LEU B 88 ? 1.4787 1.7563 1.3488 -0.2648 -0.0156 0.0710  213 LEU B CD2 
1376 N  N   . PHE B 89 ? 1.5309 1.6711 1.4614 -0.1998 -0.0287 0.1828  214 PHE B N   
1377 C  CA  . PHE B 89 ? 1.5331 1.7037 1.4666 -0.2108 -0.0457 0.2227  214 PHE B CA  
1378 C  C   . PHE B 89 ? 1.6701 1.7718 1.6146 -0.1998 -0.0468 0.2623  214 PHE B C   
1379 O  O   . PHE B 89 ? 1.7080 1.8012 1.6373 -0.2277 -0.0568 0.2906  214 PHE B O   
1380 C  CB  . PHE B 89 ? 1.4818 1.7325 1.4359 -0.1930 -0.0561 0.2291  214 PHE B CB  
1381 C  CG  . PHE B 89 ? 1.4409 1.7664 1.3785 -0.2161 -0.0610 0.2071  214 PHE B CG  
1382 C  CD1 . PHE B 89 ? 1.4573 1.7918 1.3801 -0.2250 -0.0514 0.1680  214 PHE B CD1 
1383 C  CD2 . PHE B 89 ? 1.4343 1.8241 1.3726 -0.2273 -0.0742 0.2252  214 PHE B CD2 
1384 C  CE1 . PHE B 89 ? 1.4173 1.8209 1.3291 -0.2409 -0.0548 0.1498  214 PHE B CE1 
1385 C  CE2 . PHE B 89 ? 1.4200 1.8747 1.3446 -0.2448 -0.0757 0.2025  214 PHE B CE2 
1386 C  CZ  . PHE B 89 ? 1.3765 1.8366 1.2895 -0.2492 -0.0659 0.1660  214 PHE B CZ  
1387 N  N   . ILE B 90 ? 1.6536 1.7056 1.6242 -0.1595 -0.0358 0.2644  215 ILE B N   
1388 C  CA  . ILE B 90 ? 1.7304 1.7094 1.7170 -0.1398 -0.0334 0.3012  215 ILE B CA  
1389 C  C   . ILE B 90 ? 1.8758 1.7636 1.8311 -0.1683 -0.0230 0.2958  215 ILE B C   
1390 O  O   . ILE B 90 ? 1.9374 1.7770 1.8913 -0.1744 -0.0285 0.3350  215 ILE B O   
1391 C  CB  . ILE B 90 ? 1.7680 1.7288 1.7942 -0.0857 -0.0227 0.3026  215 ILE B CB  
1392 C  CG1 . ILE B 90 ? 1.7156 1.7585 1.7730 -0.0637 -0.0390 0.3337  215 ILE B CG1 
1393 C  CG2 . ILE B 90 ? 1.8703 1.7285 1.9086 -0.0619 -0.0091 0.3216  215 ILE B CG2 
1394 C  CD1 . ILE B 90 ? 1.7747 1.8381 1.8669 -0.0181 -0.0305 0.3234  215 ILE B CD1 
1395 N  N   . GLY B 91 ? 1.8373 1.7075 1.7660 -0.1888 -0.0092 0.2493  216 GLY B N   
1396 C  CA  . GLY B 91 ? 1.9175 1.7083 1.8099 -0.2233 0.0026  0.2347  216 GLY B CA  
1397 C  C   . GLY B 91 ? 2.0097 1.8009 1.8731 -0.2696 -0.0115 0.2619  216 GLY B C   
1398 O  O   . GLY B 91 ? 2.0984 1.8023 1.9438 -0.2860 -0.0059 0.2778  216 GLY B O   
1399 N  N   . ILE B 92 ? 1.9016 1.7897 1.7597 -0.2915 -0.0290 0.2673  217 ILE B N   
1400 C  CA  . ILE B 92 ? 1.9240 1.8318 1.7550 -0.3378 -0.0436 0.2923  217 ILE B CA  
1401 C  C   . ILE B 92 ? 2.0148 1.9045 1.8638 -0.3267 -0.0576 0.3502  217 ILE B C   
1402 O  O   . ILE B 92 ? 2.0735 1.9257 1.8992 -0.3604 -0.0639 0.3776  217 ILE B O   
1403 C  CB  . ILE B 92 ? 1.8807 1.8993 1.6991 -0.3657 -0.0547 0.2750  217 ILE B CB  
1404 C  CG1 . ILE B 92 ? 1.8179 1.8801 1.6403 -0.3522 -0.0441 0.2265  217 ILE B CG1 
1405 C  CG2 . ILE B 92 ? 1.9271 1.9503 1.7049 -0.4235 -0.0601 0.2789  217 ILE B CG2 
1406 C  CD1 . ILE B 92 ? 1.8108 1.9742 1.6514 -0.3383 -0.0542 0.2219  217 ILE B CD1 
1407 N  N   . ILE B 93 ? 1.9358 1.8556 1.8253 -0.2815 -0.0627 0.3704  218 ILE B N   
1408 C  CA  . ILE B 93 ? 1.9639 1.8817 1.8779 -0.2641 -0.0768 0.4281  218 ILE B CA  
1409 C  C   . ILE B 93 ? 2.1321 1.9306 2.0483 -0.2512 -0.0672 0.4547  218 ILE B C   
1410 O  O   . ILE B 93 ? 2.1853 1.9608 2.0975 -0.2660 -0.0795 0.5031  218 ILE B O   
1411 C  CB  . ILE B 93 ? 1.9315 1.9181 1.8872 -0.2202 -0.0826 0.4372  218 ILE B CB  
1412 C  CG1 . ILE B 93 ? 1.8407 1.9391 1.7884 -0.2404 -0.0934 0.4172  218 ILE B CG1 
1413 C  CG2 . ILE B 93 ? 1.9768 1.9598 1.9631 -0.1963 -0.0954 0.4991  218 ILE B CG2 
1414 C  CD1 . ILE B 93 ? 1.8551 2.0160 1.8337 -0.2040 -0.0938 0.4065  218 ILE B CD1 
1415 N  N   . VAL B 94 ? 2.1270 1.8483 2.0472 -0.2259 -0.0443 0.4222  219 VAL B N   
1416 C  CA  . VAL B 94 ? 2.2387 1.8343 2.1590 -0.2110 -0.0290 0.4369  219 VAL B CA  
1417 C  C   . VAL B 94 ? 2.3653 1.8975 2.2348 -0.2686 -0.0276 0.4353  219 VAL B C   
1418 O  O   . VAL B 94 ? 2.4589 1.9065 2.3233 -0.2720 -0.0275 0.4735  219 VAL B O   
1419 C  CB  . VAL B 94 ? 2.3016 1.8403 2.2395 -0.1689 -0.0026 0.3968  219 VAL B CB  
1420 C  CG1 . VAL B 94 ? 2.4261 1.8276 2.3628 -0.1525 0.0167  0.4085  219 VAL B CG1 
1421 C  CG2 . VAL B 94 ? 2.2264 1.8333 2.2137 -0.1153 -0.0058 0.4033  219 VAL B CG2 
1422 N  N   . ASP B 95 ? 2.2745 1.8539 2.1074 -0.3147 -0.0278 0.3948  220 ASP B N   
1423 C  CA  . ASP B 95 ? 2.6609 2.2019 2.4428 -0.3759 -0.0274 0.3885  220 ASP B CA  
1424 C  C   . ASP B 95 ? 3.0458 2.6184 2.8159 -0.4100 -0.0509 0.4403  220 ASP B C   
1425 O  O   . ASP B 95 ? 2.5552 2.1124 2.2827 -0.4653 -0.0543 0.4407  220 ASP B O   
1426 C  CB  . ASP B 95 ? 2.6204 2.2235 2.3733 -0.4107 -0.0222 0.3336  220 ASP B CB  
1427 C  CG  . ASP B 95 ? 2.7572 2.3027 2.5012 -0.4010 0.0033  0.2822  220 ASP B CG  
1428 O  OD1 . ASP B 95 ? 2.8644 2.2928 2.5969 -0.3984 0.0205  0.2816  220 ASP B OD1 
1429 O  OD2 . ASP B 95 ? 2.7472 2.3634 2.4927 -0.3995 0.0067  0.2423  220 ASP B OD2 
1430 N  N   . GLY C 5  ? 1.4597 1.5463 2.0659 -0.0060 -0.1174 0.3935  130 GLY C N   
1431 C  CA  . GLY C 5  ? 1.4524 1.5181 2.0511 -0.0258 -0.1118 0.3444  130 GLY C CA  
1432 C  C   . GLY C 5  ? 1.4431 1.5613 1.9732 -0.0332 -0.1071 0.3162  130 GLY C C   
1433 O  O   . GLY C 5  ? 1.4056 1.5457 1.9055 -0.0165 -0.1042 0.2868  130 GLY C O   
1434 N  N   . VAL C 6  ? 1.3870 1.5263 1.8956 -0.0583 -0.1060 0.3266  131 VAL C N   
1435 C  CA  . VAL C 6  ? 1.3314 1.5203 1.7810 -0.0672 -0.1018 0.3049  131 VAL C CA  
1436 C  C   . VAL C 6  ? 1.3313 1.5782 1.7398 -0.0555 -0.1022 0.3343  131 VAL C C   
1437 O  O   . VAL C 6  ? 1.2830 1.5630 1.6490 -0.0475 -0.0989 0.3074  131 VAL C O   
1438 C  CB  . VAL C 6  ? 1.3869 1.5791 1.8346 -0.0973 -0.1006 0.3055  131 VAL C CB  
1439 C  CG1 . VAL C 6  ? 1.3330 1.5786 1.7246 -0.1043 -0.0966 0.2878  131 VAL C CG1 
1440 C  CG2 . VAL C 6  ? 1.4192 1.5585 1.9045 -0.1099 -0.1004 0.2682  131 VAL C CG2 
1441 N  N   . GLY C 7  ? 1.2968 1.5561 1.7204 -0.0554 -0.1065 0.3887  132 GLY C N   
1442 C  CA  . GLY C 7  ? 1.2635 1.5808 1.6533 -0.0463 -0.1078 0.4205  132 GLY C CA  
1443 C  C   . GLY C 7  ? 1.2753 1.6060 1.6497 -0.0204 -0.1087 0.4031  132 GLY C C   
1444 O  O   . GLY C 7  ? 1.2322 1.6125 1.5621 -0.0156 -0.1065 0.3958  132 GLY C O   
1445 N  N   . SER C 8  ? 1.2429 1.5291 1.6572 -0.0037 -0.1114 0.3939  133 SER C N   
1446 C  CA  . SER C 8  ? 1.2157 1.5096 1.6251 0.0217  -0.1121 0.3755  133 SER C CA  
1447 C  C   . SER C 8  ? 1.1957 1.5016 1.5663 0.0231  -0.1053 0.3196  133 SER C C   
1448 O  O   . SER C 8  ? 1.1574 1.4956 1.5016 0.0374  -0.1046 0.3084  133 SER C O   
1449 C  CB  . SER C 8  ? 1.3027 1.5427 1.7712 0.0377  -0.1153 0.3754  133 SER C CB  
1450 O  OG  . SER C 8  ? 1.4286 1.6157 1.9243 0.0277  -0.1113 0.3392  133 SER C OG  
1451 N  N   . VAL C 9  ? 1.1349 1.4169 1.5036 0.0069  -0.1008 0.2867  134 VAL C N   
1452 C  CA  . VAL C 9  ? 1.0910 1.3839 1.4256 0.0045  -0.0949 0.2373  134 VAL C CA  
1453 C  C   . VAL C 9  ? 1.0825 1.4277 1.3673 -0.0053 -0.0927 0.2428  134 VAL C C   
1454 O  O   . VAL C 9  ? 1.0424 1.4144 1.2947 0.0021  -0.0895 0.2187  134 VAL C O   
1455 C  CB  . VAL C 9  ? 1.1607 1.4118 1.5156 -0.0094 -0.0922 0.2017  134 VAL C CB  
1456 C  CG1 . VAL C 9  ? 1.1231 1.3942 1.4395 -0.0151 -0.0871 0.1572  134 VAL C CG1 
1457 C  CG2 . VAL C 9  ? 1.1994 1.4006 1.6041 0.0036  -0.0928 0.1869  134 VAL C CG2 
1458 N  N   . ALA C 10 ? 1.0309 1.3914 1.3130 -0.0218 -0.0938 0.2746  135 ALA C N   
1459 C  CA  . ALA C 10 ? 0.9862 1.3972 1.2273 -0.0311 -0.0909 0.2809  135 ALA C CA  
1460 C  C   . ALA C 10 ? 0.9908 1.4455 1.2061 -0.0159 -0.0914 0.2929  135 ALA C C   
1461 O  O   . ALA C 10 ? 0.9531 1.4416 1.1333 -0.0153 -0.0875 0.2740  135 ALA C O   
1462 C  CB  . ALA C 10 ? 1.0126 1.4329 1.2628 -0.0505 -0.0916 0.3159  135 ALA C CB  
1463 N  N   . ALA C 11 ? 0.9456 1.3993 1.1813 -0.0035 -0.0968 0.3235  136 ALA C N   
1464 C  CA  . ALA C 11 ? 0.9172 1.4139 1.1330 0.0107  -0.0990 0.3363  136 ALA C CA  
1465 C  C   . ALA C 11 ? 0.9180 1.4111 1.1236 0.0266  -0.0971 0.2978  136 ALA C C   
1466 O  O   . ALA C 11 ? 0.8809 1.4137 1.0551 0.0310  -0.0952 0.2872  136 ALA C O   
1467 C  CB  . ALA C 11 ? 0.9620 1.4577 1.2078 0.0192  -0.1066 0.3818  136 ALA C CB  
1468 N  N   . LEU C 12 ? 0.8744 1.3212 1.1078 0.0339  -0.0967 0.2750  137 LEU C N   
1469 C  CA  . LEU C 12 ? 0.8487 1.2898 1.0774 0.0480  -0.0939 0.2378  137 LEU C CA  
1470 C  C   . LEU C 12 ? 0.8300 1.2940 1.0190 0.0404  -0.0879 0.2053  137 LEU C C   
1471 O  O   . LEU C 12 ? 0.7969 1.2835 0.9683 0.0504  -0.0862 0.1890  137 LEU C O   
1472 C  CB  . LEU C 12 ? 0.8821 1.2703 1.1482 0.0400  -0.0928 0.2161  137 LEU C CB  
1473 C  CG  . LEU C 12 ? 0.9420 1.3247 1.2142 0.0703  -0.0900 0.1838  137 LEU C CG  
1474 C  CD1 . LEU C 12 ? 0.9837 1.3346 1.3058 0.0873  -0.0935 0.1954  137 LEU C CD1 
1475 C  CD2 . LEU C 12 ? 0.9685 1.3362 1.2287 0.0622  -0.0832 0.1379  137 LEU C CD2 
1476 N  N   . LEU C 13 ? 0.7702 1.2299 0.9479 0.0226  -0.0850 0.1982  138 LEU C N   
1477 C  CA  . LEU C 13 ? 0.7270 1.2082 0.8717 0.0150  -0.0801 0.1724  138 LEU C CA  
1478 C  C   . LEU C 13 ? 0.7214 1.2505 0.8373 0.0152  -0.0792 0.1852  138 LEU C C   
1479 O  O   . LEU C 13 ? 0.6891 1.2376 0.7823 0.0170  -0.0757 0.1634  138 LEU C O   
1480 C  CB  . LEU C 13 ? 0.7322 1.1976 0.8778 -0.0034 -0.0784 0.1627  138 LEU C CB  
1481 C  CG  . LEU C 13 ? 0.7604 1.2448 0.8780 -0.0106 -0.0743 0.1367  138 LEU C CG  
1482 C  CD1 . LEU C 13 ? 0.7580 1.2279 0.8738 -0.0048 -0.0723 0.1018  138 LEU C CD1 
1483 C  CD2 . LEU C 13 ? 0.7923 1.2772 0.9098 -0.0292 -0.0741 0.1404  138 LEU C CD2 
1484 N  N   . THR C 14 ? 0.6632 1.2127 0.7817 0.0130  -0.0822 0.2199  139 THR C N   
1485 C  CA  . THR C 14 ? 0.6273 1.2271 0.7201 0.0125  -0.0811 0.2309  139 THR C CA  
1486 C  C   . THR C 14 ? 0.6262 1.2464 0.7131 0.0283  -0.0834 0.2267  139 THR C C   
1487 O  O   . THR C 14 ? 0.6027 1.2582 0.6659 0.0291  -0.0809 0.2150  139 THR C O   
1488 C  CB  . THR C 14 ? 0.7411 1.3621 0.8379 0.0034  -0.0832 0.2697  139 THR C CB  
1489 O  OG1 . THR C 14 ? 0.7554 1.3481 0.8684 -0.0106 -0.0824 0.2763  139 THR C OG1 
1490 C  CG2 . THR C 14 ? 0.6891 1.3650 0.7567 -0.0018 -0.0794 0.2726  139 THR C CG2 
1491 N  N   . VAL C 15 ? 0.5627 1.1610 0.6744 0.0406  -0.0883 0.2354  140 VAL C N   
1492 C  CA  . VAL C 15 ? 0.5366 1.1532 0.6490 0.0564  -0.0913 0.2325  140 VAL C CA  
1493 C  C   . VAL C 15 ? 0.5326 1.1428 0.6332 0.0600  -0.0860 0.1924  140 VAL C C   
1494 O  O   . VAL C 15 ? 0.5139 1.1564 0.5960 0.0632  -0.0850 0.1814  140 VAL C O   
1495 C  CB  . VAL C 15 ? 0.6153 1.2087 0.7643 0.0697  -0.0979 0.2546  140 VAL C CB  
1496 C  CG1 . VAL C 15 ? 0.6065 1.2175 0.7602 0.0871  -0.1006 0.2468  140 VAL C CG1 
1497 C  CG2 . VAL C 15 ? 0.6389 1.2466 0.7990 0.0659  -0.1041 0.3011  140 VAL C CG2 
1498 N  N   . VAL C 16 ? 0.4649 1.0362 0.5761 0.0577  -0.0826 0.1707  141 VAL C N   
1499 C  CA  . VAL C 16 ? 0.4327 0.9974 0.5338 0.0590  -0.0773 0.1352  141 VAL C CA  
1500 C  C   . VAL C 16 ? 0.4442 1.0356 0.5153 0.0495  -0.0732 0.1229  141 VAL C C   
1501 O  O   . VAL C 16 ? 0.4212 1.0291 0.4808 0.0537  -0.0706 0.1055  141 VAL C O   
1502 C  CB  . VAL C 16 ? 0.4924 1.0153 0.6102 0.0554  -0.0750 0.1169  141 VAL C CB  
1503 C  CG1 . VAL C 16 ? 0.4681 0.9924 0.5661 0.0477  -0.0694 0.0862  141 VAL C CG1 
1504 C  CG2 . VAL C 16 ? 0.5112 1.0110 0.6596 0.0704  -0.0763 0.1124  141 VAL C CG2 
1505 N  N   . PHE C 17 ? 0.3960 0.9924 0.4580 0.0370  -0.0724 0.1330  142 PHE C N   
1506 C  CA  . PHE C 17 ? 0.3694 0.9894 0.4091 0.0286  -0.0682 0.1230  142 PHE C CA  
1507 C  C   . PHE C 17 ? 0.4085 1.0683 0.4347 0.0324  -0.0682 0.1276  142 PHE C C   
1508 O  O   . PHE C 17 ? 0.3927 1.0680 0.4058 0.0307  -0.0643 0.1099  142 PHE C O   
1509 C  CB  . PHE C 17 ? 0.3942 1.0115 0.4327 0.0151  -0.0671 0.1328  142 PHE C CB  
1510 C  CG  . PHE C 17 ? 0.3945 1.0072 0.4241 0.0070  -0.0633 0.1126  142 PHE C CG  
1511 C  CD1 . PHE C 17 ? 0.4461 1.0298 0.4842 0.0018  -0.0638 0.1008  142 PHE C CD1 
1512 C  CD2 . PHE C 17 ? 0.3903 1.0296 0.4052 0.0047  -0.0594 0.1049  142 PHE C CD2 
1513 C  CE1 . PHE C 17 ? 0.4414 1.0270 0.4711 -0.0059 -0.0616 0.0855  142 PHE C CE1 
1514 C  CE2 . PHE C 17 ? 0.4149 1.0512 0.4257 -0.0015 -0.0569 0.0905  142 PHE C CE2 
1515 C  CZ  . PHE C 17 ? 0.4041 1.0155 0.4211 -0.0069 -0.0585 0.0827  142 PHE C CZ  
1516 N  N   . TYR C 18 ? 0.3704 1.0486 0.4013 0.0369  -0.0728 0.1514  143 TYR C N   
1517 C  CA  . TYR C 18 ? 0.3582 1.0807 0.3755 0.0396  -0.0737 0.1542  143 TYR C CA  
1518 C  C   . TYR C 18 ? 0.3831 1.1109 0.4015 0.0495  -0.0744 0.1361  143 TYR C C   
1519 O  O   . TYR C 18 ? 0.3721 1.1276 0.3775 0.0479  -0.0721 0.1212  143 TYR C O   
1520 C  CB  . TYR C 18 ? 0.3977 1.1451 0.4186 0.0406  -0.0794 0.1879  143 TYR C CB  
1521 C  CG  . TYR C 18 ? 0.4217 1.2200 0.4292 0.0438  -0.0819 0.1896  143 TYR C CG  
1522 C  CD1 . TYR C 18 ? 0.4374 1.2746 0.4246 0.0354  -0.0773 0.1799  143 TYR C CD1 
1523 C  CD2 . TYR C 18 ? 0.4322 1.2425 0.4495 0.0553  -0.0887 0.1988  143 TYR C CD2 
1524 C  CE1 . TYR C 18 ? 0.4358 1.3225 0.4107 0.0367  -0.0795 0.1767  143 TYR C CE1 
1525 C  CE2 . TYR C 18 ? 0.4340 1.2956 0.4388 0.0567  -0.0920 0.1989  143 TYR C CE2 
1526 C  CZ  . TYR C 18 ? 0.4965 1.3963 0.4792 0.0466  -0.0873 0.1864  143 TYR C CZ  
1527 O  OH  . TYR C 18 ? 0.4684 1.4217 0.4387 0.0463  -0.0904 0.1821  143 TYR C OH  
1528 N  N   . ILE C 19 ? 0.3275 1.0297 0.3640 0.0591  -0.0771 0.1363  144 ILE C N   
1529 C  CA  . ILE C 19 ? 0.3093 1.0174 0.3507 0.0690  -0.0775 0.1207  144 ILE C CA  
1530 C  C   . ILE C 19 ? 0.3393 1.0395 0.3709 0.0641  -0.0708 0.0916  144 ILE C C   
1531 O  O   . ILE C 19 ? 0.3267 1.0487 0.3529 0.0654  -0.0696 0.0783  144 ILE C O   
1532 C  CB  . ILE C 19 ? 0.3625 1.0479 0.4302 0.0820  -0.0813 0.1291  144 ILE C CB  
1533 C  CG1 . ILE C 19 ? 0.3909 1.0946 0.4705 0.0885  -0.0895 0.1629  144 ILE C CG1 
1534 C  CG2 . ILE C 19 ? 0.3475 1.0377 0.4218 0.0914  -0.0794 0.1082  144 ILE C CG2 
1535 C  CD1 . ILE C 19 ? 0.5267 1.1982 0.6375 0.0985  -0.0933 0.1791  144 ILE C CD1 
1536 N  N   . ALA C 20 ? 0.2868 0.9583 0.3174 0.0574  -0.0671 0.0833  145 ALA C N   
1537 C  CA  . ALA C 20 ? 0.2733 0.9387 0.2954 0.0521  -0.0616 0.0610  145 ALA C CA  
1538 C  C   . ALA C 20 ? 0.3460 1.0346 0.3540 0.0447  -0.0590 0.0558  145 ALA C C   
1539 O  O   . ALA C 20 ? 0.3303 1.0271 0.3353 0.0439  -0.0559 0.0405  145 ALA C O   
1540 C  CB  . ALA C 20 ? 0.2916 0.9275 0.3157 0.0457  -0.0599 0.0564  145 ALA C CB  
1541 N  N   . ALA C 21 ? 0.3305 1.0310 0.3325 0.0393  -0.0596 0.0682  146 ALA C N   
1542 C  CA  . ALA C 21 ? 0.3227 1.0469 0.3147 0.0331  -0.0560 0.0610  146 ALA C CA  
1543 C  C   . ALA C 21 ? 0.3913 1.1477 0.3800 0.0361  -0.0566 0.0535  146 ALA C C   
1544 O  O   . ALA C 21 ? 0.3865 1.1550 0.3725 0.0321  -0.0526 0.0373  146 ALA C O   
1545 C  CB  . ALA C 21 ? 0.3371 1.0707 0.3250 0.0271  -0.0556 0.0755  146 ALA C CB  
1546 N  N   . VAL C 22 ? 0.3438 1.1146 0.3356 0.0429  -0.0621 0.0650  147 VAL C N   
1547 C  CA  . VAL C 22 ? 0.3300 1.1353 0.3197 0.0452  -0.0642 0.0577  147 VAL C CA  
1548 C  C   . VAL C 22 ? 0.3666 1.1601 0.3636 0.0471  -0.0618 0.0388  147 VAL C C   
1549 O  O   . VAL C 22 ? 0.3504 1.1594 0.3463 0.0425  -0.0590 0.0213  147 VAL C O   
1550 C  CB  . VAL C 22 ? 0.3825 1.2100 0.3758 0.0400  -0.0721 0.0796  147 VAL C CB  
1551 C  CG1 . VAL C 22 ? 0.3671 1.2310 0.3609 0.0553  -0.0755 0.0702  147 VAL C CG1 
1552 C  CG2 . VAL C 22 ? 0.3925 1.2409 0.3770 0.0481  -0.0739 0.1005  147 VAL C CG2 
1553 N  N   . MET C 23 ? 0.3251 1.0911 0.3311 0.0529  -0.0622 0.0412  148 MET C N   
1554 C  CA  . MET C 23 ? 0.3133 1.0710 0.3263 0.0548  -0.0593 0.0263  148 MET C CA  
1555 C  C   . MET C 23 ? 0.2995 1.0497 0.3081 0.0455  -0.0533 0.0112  148 MET C C   
1556 O  O   . MET C 23 ? 0.2696 1.0327 0.2820 0.0427  -0.0513 -0.0013 148 MET C O   
1557 C  CB  . MET C 23 ? 0.3651 1.0952 0.3873 0.0617  -0.0593 0.0300  148 MET C CB  
1558 C  CG  . MET C 23 ? 0.4339 1.1710 0.4689 0.0706  -0.0595 0.0234  148 MET C CG  
1559 S  SD  . MET C 23 ? 0.5148 1.2190 0.5602 0.0761  -0.0557 0.0162  148 MET C SD  
1560 C  CE  . MET C 23 ? 0.4613 1.1835 0.5115 0.0771  -0.0502 -0.0026 148 MET C CE  
1561 N  N   . ALA C 24 ? 0.2436 0.9751 0.2469 0.0403  -0.0511 0.0140  149 ALA C N   
1562 C  CA  . ALA C 24 ? 0.2242 0.9473 0.2266 0.0300  -0.0463 0.0046  149 ALA C CA  
1563 C  C   . ALA C 24 ? 0.2590 1.0023 0.2633 0.0282  -0.0442 -0.0055 149 ALA C C   
1564 O  O   . ALA C 24 ? 0.2384 0.9792 0.2500 0.0240  -0.0408 -0.0159 149 ALA C O   
1565 C  CB  . ALA C 24 ? 0.2342 0.9391 0.2327 0.0290  -0.0458 0.0121  149 ALA C CB  
1566 N  N   . THR C 25 ? 0.2277 0.9928 0.2270 0.0286  -0.0459 -0.0029 150 THR C N   
1567 C  CA  . THR C 25 ? 0.2221 1.0113 0.2235 0.0243  -0.0433 -0.0174 150 THR C CA  
1568 C  C   . THR C 25 ? 0.3122 1.1178 0.3203 0.0238  -0.0446 -0.0296 150 THR C C   
1569 O  O   . THR C 25 ? 0.3276 1.1386 0.3452 0.0182  -0.0411 -0.0467 150 THR C O   
1570 C  CB  . THR C 25 ? 0.2442 1.0617 0.2355 0.0243  -0.0451 -0.0111 150 THR C CB  
1571 O  OG1 . THR C 25 ? 0.1946 0.9991 0.1804 0.0247  -0.0452 0.0056  150 THR C OG1 
1572 C  CG2 . THR C 25 ? 0.2388 1.0812 0.2321 0.0191  -0.0406 -0.0305 150 THR C CG2 
1573 N  N   . ASN C 26 ? 0.2659 1.0800 0.2725 0.0297  -0.0497 -0.0208 151 ASN C N   
1574 C  CA  . ASN C 26 ? 0.2625 1.0975 0.2767 0.0296  -0.0518 -0.0305 151 ASN C CA  
1575 C  C   . ASN C 26 ? 0.3168 1.1341 0.3426 0.0258  -0.0474 -0.0399 151 ASN C C   
1576 O  O   . ASN C 26 ? 0.3196 1.1511 0.3554 0.0194  -0.0461 -0.0546 151 ASN C O   
1577 C  CB  . ASN C 26 ? 0.2614 1.1114 0.2747 0.0389  -0.0586 -0.0158 151 ASN C CB  
1578 C  CG  . ASN C 26 ? 0.4019 1.2833 0.4234 0.0393  -0.0622 -0.0239 151 ASN C CG  
1579 O  OD1 . ASN C 26 ? 0.3114 1.1890 0.3429 0.0444  -0.0626 -0.0227 151 ASN C OD1 
1580 N  ND2 . ASN C 26 ? 0.2910 1.2079 0.3093 0.0334  -0.0645 -0.0342 151 ASN C ND2 
1581 N  N   . LEU C 27 ? 0.2624 1.0519 0.2876 0.0283  -0.0452 -0.0317 152 LEU C N   
1582 C  CA  . LEU C 27 ? 0.2485 1.0260 0.2824 0.0240  -0.0409 -0.0367 152 LEU C CA  
1583 C  C   . LEU C 27 ? 0.2859 1.0480 0.3257 0.0154  -0.0363 -0.0412 152 LEU C C   
1584 O  O   . LEU C 27 ? 0.2735 1.0380 0.3266 0.0083  -0.0334 -0.0492 152 LEU C O   
1585 C  CB  . LEU C 27 ? 0.2482 1.0094 0.2783 0.0298  -0.0404 -0.0282 152 LEU C CB  
1586 C  CG  . LEU C 27 ? 0.3042 1.0740 0.3355 0.0408  -0.0442 -0.0230 152 LEU C CG  
1587 C  CD1 . LEU C 27 ? 0.2942 1.0455 0.3250 0.0453  -0.0417 -0.0212 152 LEU C CD1 
1588 C  CD2 . LEU C 27 ? 0.3334 1.1318 0.3753 0.0425  -0.0457 -0.0293 152 LEU C CD2 
1589 N  N   . TYR C 28 ? 0.2278 0.9743 0.2607 0.0161  -0.0359 -0.0346 153 TYR C N   
1590 C  CA  . TYR C 28 ? 0.2157 0.9467 0.2566 0.0106  -0.0324 -0.0347 153 TYR C CA  
1591 C  C   . TYR C 28 ? 0.2629 0.9987 0.3107 0.0088  -0.0306 -0.0435 153 TYR C C   
1592 O  O   . TYR C 28 ? 0.2722 0.9952 0.3323 0.0058  -0.0276 -0.0438 153 TYR C O   
1593 C  CB  . TYR C 28 ? 0.2269 0.9396 0.2588 0.0119  -0.0329 -0.0218 153 TYR C CB  
1594 C  CG  . TYR C 28 ? 0.2503 0.9608 0.2744 0.0148  -0.0339 -0.0176 153 TYR C CG  
1595 C  CD1 . TYR C 28 ? 0.2781 0.9936 0.3078 0.0116  -0.0314 -0.0199 153 TYR C CD1 
1596 C  CD2 . TYR C 28 ? 0.2657 0.9694 0.2795 0.0201  -0.0367 -0.0121 153 TYR C CD2 
1597 C  CE1 . TYR C 28 ? 0.3106 1.0282 0.3345 0.0148  -0.0308 -0.0196 153 TYR C CE1 
1598 C  CE2 . TYR C 28 ? 0.2831 0.9837 0.2937 0.0236  -0.0367 -0.0125 153 TYR C CE2 
1599 C  CZ  . TYR C 28 ? 0.3941 1.1033 0.4091 0.0214  -0.0333 -0.0176 153 TYR C CZ  
1600 O  OH  . TYR C 28 ? 0.3932 1.1038 0.4064 0.0254  -0.0318 -0.0214 153 TYR C OH  
1601 N  N   . GLY C 29 ? 0.2004 0.9576 0.2418 0.0109  -0.0324 -0.0504 154 GLY C N   
1602 C  CA  . GLY C 29 ? 0.1983 0.9676 0.2440 0.0093  -0.0297 -0.0622 154 GLY C CA  
1603 C  C   . GLY C 29 ? 0.2488 1.0171 0.3170 0.0036  -0.0252 -0.0811 154 GLY C C   
1604 O  O   . GLY C 29 ? 0.2649 1.0255 0.3451 0.0034  -0.0210 -0.0869 154 GLY C O   
1605 N  N   . ALA C 30 ? 0.1944 0.9712 0.2718 -0.0011 -0.0259 -0.0913 155 ALA C N   
1606 C  CA  . ALA C 30 ? 0.1991 0.9746 0.3021 -0.0086 -0.0220 -0.1111 155 ALA C CA  
1607 C  C   . ALA C 30 ? 0.2510 0.9951 0.3760 -0.0112 -0.0184 -0.1034 155 ALA C C   
1608 O  O   . ALA C 30 ? 0.2470 0.9816 0.3972 -0.0141 -0.0141 -0.1166 155 ALA C O   
1609 C  CB  . ALA C 30 ? 0.2104 1.0050 0.3170 -0.0142 -0.0247 -0.1205 155 ALA C CB  
1610 N  N   . THR C 31 ? 0.2158 0.9462 0.3327 -0.0102 -0.0203 -0.0820 156 THR C N   
1611 C  CA  . THR C 31 ? 0.2127 0.9200 0.3444 -0.0133 -0.0186 -0.0666 156 THR C CA  
1612 C  C   . THR C 31 ? 0.2456 0.9379 0.3776 -0.0084 -0.0181 -0.0549 156 THR C C   
1613 O  O   . THR C 31 ? 0.2376 0.9136 0.3923 -0.0107 -0.0163 -0.0468 156 THR C O   
1614 C  CB  . THR C 31 ? 0.3217 1.0315 0.4404 -0.0150 -0.0204 -0.0518 156 THR C CB  
1615 O  OG1 . THR C 31 ? 0.3398 1.0619 0.4321 -0.0080 -0.0239 -0.0499 156 THR C OG1 
1616 C  CG2 . THR C 31 ? 0.2943 1.0130 0.4283 -0.0233 -0.0190 -0.0588 156 THR C CG2 
1617 N  N   . PHE C 32 ? 0.1977 0.8968 0.3068 -0.0021 -0.0203 -0.0512 157 PHE C N   
1618 C  CA  . PHE C 32 ? 0.1870 0.8774 0.2942 0.0022  -0.0205 -0.0404 157 PHE C CA  
1619 C  C   . PHE C 32 ? 0.2237 0.9290 0.3228 0.0066  -0.0193 -0.0513 157 PHE C C   
1620 O  O   . PHE C 32 ? 0.2199 0.9325 0.2967 0.0092  -0.0221 -0.0434 157 PHE C O   
1621 C  CB  . PHE C 32 ? 0.2046 0.8888 0.2928 0.0026  -0.0243 -0.0208 157 PHE C CB  
1622 C  CG  . PHE C 32 ? 0.2340 0.9104 0.3295 -0.0026 -0.0246 -0.0089 157 PHE C CG  
1623 C  CD1 . PHE C 32 ? 0.2866 0.9698 0.3748 -0.0058 -0.0246 -0.0104 157 PHE C CD1 
1624 C  CD2 . PHE C 32 ? 0.2601 0.9268 0.3712 -0.0043 -0.0248 0.0053  157 PHE C CD2 
1625 C  CE1 . PHE C 32 ? 0.2996 0.9814 0.3946 -0.0120 -0.0237 0.0012  157 PHE C CE1 
1626 C  CE2 . PHE C 32 ? 0.2995 0.9645 0.4165 -0.0104 -0.0251 0.0198  157 PHE C CE2 
1627 C  CZ  . PHE C 32 ? 0.2821 0.9554 0.3901 -0.0148 -0.0241 0.0173  157 PHE C CZ  
1628 N  N   . PRO C 33 ? 0.1617 0.8733 0.2807 0.0067  -0.0146 -0.0703 158 PRO C N   
1629 C  CA  . PRO C 33 ? 0.1620 0.8954 0.2730 0.0098  -0.0121 -0.0824 158 PRO C CA  
1630 C  C   . PRO C 33 ? 0.2503 0.9830 0.3563 0.0141  -0.0117 -0.0695 158 PRO C C   
1631 O  O   . PRO C 33 ? 0.2537 1.0061 0.3416 0.0152  -0.0118 -0.0687 158 PRO C O   
1632 C  CB  . PRO C 33 ? 0.1910 0.9301 0.3293 0.0084  -0.0061 -0.1093 158 PRO C CB  
1633 C  CG  . PRO C 33 ? 0.2471 0.9662 0.4071 0.0036  -0.0064 -0.1102 158 PRO C CG  
1634 C  CD  . PRO C 33 ? 0.1810 0.8809 0.3331 0.0034  -0.0108 -0.0823 158 PRO C CD  
1635 N  N   . GLU C 34 ? 0.2246 0.9381 0.3480 0.0158  -0.0116 -0.0577 159 GLU C N   
1636 C  CA  . GLU C 34 ? 0.2299 0.9456 0.3522 0.0191  -0.0117 -0.0456 159 GLU C CA  
1637 C  C   . GLU C 34 ? 0.2602 0.9786 0.3533 0.0171  -0.0170 -0.0287 159 GLU C C   
1638 O  O   . GLU C 34 ? 0.2498 0.9807 0.3361 0.0179  -0.0162 -0.0245 159 GLU C O   
1639 C  CB  . GLU C 34 ? 0.2577 0.9557 0.4059 0.0212  -0.0123 -0.0335 159 GLU C CB  
1640 C  CG  . GLU C 34 ? 0.5051 1.1976 0.6913 0.0250  -0.0064 -0.0494 159 GLU C CG  
1641 C  CD  . GLU C 34 ? 0.9114 1.6058 1.1254 0.0323  -0.0032 -0.0473 159 GLU C CD  
1642 O  OE1 . GLU C 34 ? 0.8213 1.5166 1.0662 0.0371  0.0036  -0.0679 159 GLU C OE1 
1643 O  OE2 . GLU C 34 ? 0.8871 1.5831 1.0943 0.0332  -0.0076 -0.0267 159 GLU C OE2 
1644 N  N   . TRP C 35 ? 0.2179 0.9253 0.2966 0.0142  -0.0217 -0.0200 160 TRP C N   
1645 C  CA  . TRP C 35 ? 0.2086 0.9136 0.2647 0.0126  -0.0265 -0.0066 160 TRP C CA  
1646 C  C   . TRP C 35 ? 0.2276 0.9424 0.2663 0.0130  -0.0280 -0.0097 160 TRP C C   
1647 O  O   . TRP C 35 ? 0.2154 0.9302 0.2404 0.0126  -0.0310 0.0007  160 TRP C O   
1648 C  CB  . TRP C 35 ? 0.1989 0.8880 0.2522 0.0098  -0.0303 0.0041  160 TRP C CB  
1649 C  CG  . TRP C 35 ? 0.2194 0.9020 0.2894 0.0088  -0.0307 0.0129  160 TRP C CG  
1650 C  CD1 . TRP C 35 ? 0.2543 0.9411 0.3367 0.0105  -0.0302 0.0177  160 TRP C CD1 
1651 C  CD2 . TRP C 35 ? 0.2234 0.8981 0.2991 0.0057  -0.0325 0.0215  160 TRP C CD2 
1652 N  NE1 . TRP C 35 ? 0.2510 0.9323 0.3487 0.0097  -0.0324 0.0295  160 TRP C NE1 
1653 C  CE2 . TRP C 35 ? 0.2731 0.9475 0.3659 0.0061  -0.0339 0.0331  160 TRP C CE2 
1654 C  CE3 . TRP C 35 ? 0.2394 0.9111 0.3087 0.0025  -0.0329 0.0218  160 TRP C CE3 
1655 C  CZ2 . TRP C 35 ? 0.2686 0.9402 0.3707 0.0028  -0.0364 0.0477  160 TRP C CZ2 
1656 C  CZ3 . TRP C 35 ? 0.2603 0.9301 0.3379 -0.0015 -0.0342 0.0344  160 TRP C CZ3 
1657 C  CH2 . TRP C 35 ? 0.2709 0.9408 0.3640 -0.0016 -0.0363 0.0485  160 TRP C CH2 
1658 N  N   . PHE C 36 ? 0.1663 0.8894 0.2077 0.0135  -0.0267 -0.0224 161 PHE C N   
1659 C  CA  . PHE C 36 ? 0.1571 0.8934 0.1841 0.0147  -0.0295 -0.0230 161 PHE C CA  
1660 C  C   . PHE C 36 ? 0.2636 1.0257 0.2925 0.0144  -0.0275 -0.0392 161 PHE C C   
1661 O  O   . PHE C 36 ? 0.2784 1.0545 0.2983 0.0154  -0.0309 -0.0392 161 PHE C O   
1662 C  CB  . PHE C 36 ? 0.1634 0.8874 0.1871 0.0151  -0.0326 -0.0188 161 PHE C CB  
1663 C  CG  . PHE C 36 ? 0.1704 0.8751 0.1881 0.0147  -0.0349 -0.0060 161 PHE C CG  
1664 C  CD1 . PHE C 36 ? 0.1902 0.8914 0.1971 0.0163  -0.0381 0.0042  161 PHE C CD1 
1665 C  CD2 . PHE C 36 ? 0.1876 0.8798 0.2121 0.0116  -0.0341 -0.0039 161 PHE C CD2 
1666 C  CE1 . PHE C 36 ? 0.2001 0.8846 0.2034 0.0143  -0.0400 0.0115  161 PHE C CE1 
1667 C  CE2 . PHE C 36 ? 0.2198 0.9006 0.2371 0.0099  -0.0364 0.0052  161 PHE C CE2 
1668 C  CZ  . PHE C 36 ? 0.1962 0.8728 0.2031 0.0110  -0.0392 0.0104  161 PHE C CZ  
1669 N  N   . GLY C 37 ? 0.2338 1.0050 0.2755 0.0134  -0.0222 -0.0536 162 GLY C N   
1670 C  CA  . GLY C 37 ? 0.2401 1.0390 0.2858 0.0116  -0.0192 -0.0753 162 GLY C CA  
1671 C  C   . GLY C 37 ? 0.3019 1.1361 0.3276 0.0115  -0.0214 -0.0736 162 GLY C C   
1672 O  O   . GLY C 37 ? 0.3114 1.1739 0.3361 0.0089  -0.0210 -0.0909 162 GLY C O   
1673 N  N   . ASP C 38 ? 0.2475 1.0828 0.2587 0.0132  -0.0237 -0.0523 163 ASP C N   
1674 C  CA  . ASP C 38 ? 0.2458 1.1134 0.2387 0.0129  -0.0266 -0.0413 163 ASP C CA  
1675 C  C   . ASP C 38 ? 0.2706 1.1204 0.2545 0.0145  -0.0312 -0.0128 163 ASP C C   
1676 O  O   . ASP C 38 ? 0.2703 1.0881 0.2608 0.0150  -0.0309 -0.0062 163 ASP C O   
1677 C  CB  . ASP C 38 ? 0.2762 1.1816 0.2668 0.0100  -0.0202 -0.0547 163 ASP C CB  
1678 C  CG  . ASP C 38 ? 0.3864 1.2825 0.3872 0.0102  -0.0136 -0.0556 163 ASP C CG  
1679 O  OD1 . ASP C 38 ? 0.4075 1.2938 0.4023 0.0100  -0.0154 -0.0329 163 ASP C OD1 
1680 O  OD2 . ASP C 38 ? 0.4330 1.3358 0.4499 0.0105  -0.0064 -0.0799 163 ASP C OD2 
1681 N  N   . LEU C 39 ? 0.2053 1.0773 0.1763 0.0148  -0.0358 0.0045  164 LEU C N   
1682 C  CA  . LEU C 39 ? 0.1987 1.0539 0.1656 0.0158  -0.0404 0.0321  164 LEU C CA  
1683 C  C   . LEU C 39 ? 0.2608 1.0990 0.2316 0.0121  -0.0367 0.0397  164 LEU C C   
1684 O  O   . LEU C 39 ? 0.2720 1.0767 0.2474 0.0124  -0.0396 0.0501  164 LEU C O   
1685 C  CB  . LEU C 39 ? 0.2067 1.0961 0.1626 0.0158  -0.0451 0.0517  164 LEU C CB  
1686 C  CG  . LEU C 39 ? 0.2662 1.1344 0.2244 0.0183  -0.0516 0.0813  164 LEU C CG  
1687 C  CD1 . LEU C 39 ? 0.2703 1.1116 0.2369 0.0260  -0.0568 0.0806  164 LEU C CD1 
1688 C  CD2 . LEU C 39 ? 0.2863 1.1916 0.2363 0.0168  -0.0555 0.1055  164 LEU C CD2 
1689 N  N   . SER C 40 ? 0.1993 1.0634 0.1698 0.0083  -0.0303 0.0321  165 SER C N   
1690 C  CA  . SER C 40 ? 0.1892 1.0469 0.1656 0.0045  -0.0262 0.0381  165 SER C CA  
1691 C  C   . SER C 40 ? 0.2347 1.0552 0.2240 0.0059  -0.0260 0.0311  165 SER C C   
1692 O  O   . SER C 40 ? 0.2275 1.0263 0.2193 0.0030  -0.0287 0.0449  165 SER C O   
1693 C  CB  . SER C 40 ? 0.2320 1.1292 0.2093 0.0023  -0.0177 0.0240  165 SER C CB  
1694 O  OG  . SER C 40 ? 0.3928 1.3303 0.3563 -0.0019 -0.0174 0.0378  165 SER C OG  
1695 N  N   . LYS C 41 ? 0.1927 1.0075 0.1909 0.0093  -0.0235 0.0105  166 LYS C N   
1696 C  CA  . LYS C 41 ? 0.1827 0.9672 0.1938 0.0106  -0.0238 0.0057  166 LYS C CA  
1697 C  C   . LYS C 41 ? 0.2565 1.0125 0.2615 0.0105  -0.0304 0.0175  166 LYS C C   
1698 O  O   . LYS C 41 ? 0.2736 1.0105 0.2821 0.0082  -0.0323 0.0250  166 LYS C O   
1699 C  CB  . LYS C 41 ? 0.1961 0.9810 0.2202 0.0133  -0.0201 -0.0158 166 LYS C CB  
1700 C  CG  . LYS C 41 ? 0.1668 0.9759 0.2033 0.0144  -0.0124 -0.0340 166 LYS C CG  
1701 C  CD  . LYS C 41 ? 0.1800 0.9816 0.2343 0.0162  -0.0096 -0.0552 166 LYS C CD  
1702 C  CE  . LYS C 41 ? 0.2913 1.1113 0.3653 0.0183  -0.0011 -0.0786 166 LYS C CE  
1703 N  NZ  . LYS C 41 ? 0.4219 1.2287 0.5179 0.0188  0.0010  -0.0987 166 LYS C NZ  
1704 N  N   . SER C 42 ? 0.1990 0.9560 0.1961 0.0130  -0.0338 0.0181  167 SER C N   
1705 C  CA  . SER C 42 ? 0.1928 0.9263 0.1868 0.0146  -0.0389 0.0258  167 SER C CA  
1706 C  C   . SER C 42 ? 0.2480 0.9674 0.2394 0.0119  -0.0422 0.0425  167 SER C C   
1707 O  O   . SER C 42 ? 0.2389 0.9353 0.2325 0.0104  -0.0441 0.0432  167 SER C O   
1708 C  CB  . SER C 42 ? 0.2400 0.9834 0.2302 0.0192  -0.0416 0.0236  167 SER C CB  
1709 O  OG  . SER C 42 ? 0.3219 1.0724 0.3176 0.0196  -0.0390 0.0066  167 SER C OG  
1710 N  N   . LEU C 43 ? 0.2148 0.9501 0.2026 0.0097  -0.0425 0.0555  168 LEU C N   
1711 C  CA  . LEU C 43 ? 0.2179 0.9402 0.2075 0.0049  -0.0453 0.0729  168 LEU C CA  
1712 C  C   . LEU C 43 ? 0.2790 0.9890 0.2744 -0.0015 -0.0440 0.0708  168 LEU C C   
1713 O  O   . LEU C 43 ? 0.2671 0.9544 0.2661 -0.0056 -0.0474 0.0760  168 LEU C O   
1714 C  CB  . LEU C 43 ? 0.2207 0.9699 0.2064 0.0021  -0.0448 0.0894  168 LEU C CB  
1715 C  CG  . LEU C 43 ? 0.2775 1.0407 0.2587 0.0070  -0.0488 0.1009  168 LEU C CG  
1716 C  CD1 . LEU C 43 ? 0.2813 1.0873 0.2543 0.0035  -0.0464 0.1112  168 LEU C CD1 
1717 C  CD2 . LEU C 43 ? 0.3154 1.0508 0.3053 0.0083  -0.0547 0.1191  168 LEU C CD2 
1718 N  N   . TYR C 44 ? 0.2386 0.9653 0.2372 -0.0022 -0.0392 0.0619  169 TYR C N   
1719 C  CA  . TYR C 44 ? 0.2371 0.9594 0.2440 -0.0068 -0.0384 0.0610  169 TYR C CA  
1720 C  C   . TYR C 44 ? 0.2603 0.9605 0.2690 -0.0062 -0.0414 0.0540  169 TYR C C   
1721 O  O   . TYR C 44 ? 0.2389 0.9291 0.2504 -0.0121 -0.0445 0.0580  169 TYR C O   
1722 C  CB  . TYR C 44 ? 0.2617 1.0093 0.2769 -0.0051 -0.0320 0.0530  169 TYR C CB  
1723 C  CG  . TYR C 44 ? 0.2988 1.0440 0.3269 -0.0075 -0.0319 0.0532  169 TYR C CG  
1724 C  CD1 . TYR C 44 ? 0.3198 1.0540 0.3564 -0.0039 -0.0328 0.0456  169 TYR C CD1 
1725 C  CD2 . TYR C 44 ? 0.3180 1.0744 0.3513 -0.0143 -0.0317 0.0637  169 TYR C CD2 
1726 C  CE1 . TYR C 44 ? 0.3301 1.0651 0.3795 -0.0059 -0.0345 0.0498  169 TYR C CE1 
1727 C  CE2 . TYR C 44 ? 0.3303 1.0880 0.3768 -0.0167 -0.0331 0.0652  169 TYR C CE2 
1728 C  CZ  . TYR C 44 ? 0.4052 1.1527 0.4594 -0.0119 -0.0350 0.0589  169 TYR C CZ  
1729 O  OH  . TYR C 44 ? 0.3629 1.1161 0.4316 -0.0134 -0.0374 0.0634  169 TYR C OH  
1730 N  N   . THR C 45 ? 0.2314 0.9283 0.2388 -0.0005 -0.0405 0.0435  170 THR C N   
1731 C  CA  . THR C 45 ? 0.2289 0.9108 0.2370 -0.0004 -0.0425 0.0383  170 THR C CA  
1732 C  C   . THR C 45 ? 0.2787 0.9432 0.2795 -0.0024 -0.0466 0.0400  170 THR C C   
1733 O  O   . THR C 45 ? 0.2855 0.9421 0.2856 -0.0068 -0.0489 0.0386  170 THR C O   
1734 C  CB  . THR C 45 ? 0.2958 0.9811 0.3073 0.0047  -0.0397 0.0281  170 THR C CB  
1735 O  OG1 . THR C 45 ? 0.2518 0.9533 0.2721 0.0071  -0.0353 0.0224  170 THR C OG1 
1736 C  CG2 . THR C 45 ? 0.2750 0.9522 0.2912 0.0030  -0.0406 0.0270  170 THR C CG2 
1737 N  N   . LEU C 46 ? 0.2199 0.8807 0.2172 0.0010  -0.0475 0.0429  171 LEU C N   
1738 C  CA  . LEU C 46 ? 0.2261 0.8682 0.2227 0.0009  -0.0507 0.0430  171 LEU C CA  
1739 C  C   . LEU C 46 ? 0.2910 0.9222 0.2913 -0.0075 -0.0534 0.0492  171 LEU C C   
1740 O  O   . LEU C 46 ? 0.3088 0.9239 0.3104 -0.0104 -0.0556 0.0426  171 LEU C O   
1741 C  CB  . LEU C 46 ? 0.2355 0.8768 0.2331 0.0084  -0.0517 0.0471  171 LEU C CB  
1742 C  CG  . LEU C 46 ? 0.2928 0.9438 0.2884 0.0159  -0.0501 0.0384  171 LEU C CG  
1743 C  CD1 . LEU C 46 ? 0.2959 0.9566 0.2932 0.0226  -0.0521 0.0467  171 LEU C CD1 
1744 C  CD2 . LEU C 46 ? 0.3385 0.9782 0.3345 0.0176  -0.0496 0.0266  171 LEU C CD2 
1745 N  N   . PHE C 47 ? 0.2421 0.8847 0.2453 -0.0124 -0.0528 0.0598  172 PHE C N   
1746 C  CA  . PHE C 47 ? 0.2535 0.8894 0.2626 -0.0228 -0.0554 0.0662  172 PHE C CA  
1747 C  C   . PHE C 47 ? 0.3111 0.9485 0.3195 -0.0283 -0.0570 0.0573  172 PHE C C   
1748 O  O   . PHE C 47 ? 0.3417 0.9662 0.3517 -0.0354 -0.0605 0.0519  172 PHE C O   
1749 C  CB  . PHE C 47 ? 0.2786 0.9329 0.2918 -0.0272 -0.0534 0.0804  172 PHE C CB  
1750 C  CG  . PHE C 47 ? 0.3093 0.9586 0.3313 -0.0397 -0.0561 0.0879  172 PHE C CG  
1751 C  CD1 . PHE C 47 ? 0.3635 0.9927 0.3932 -0.0453 -0.0591 0.0965  172 PHE C CD1 
1752 C  CD2 . PHE C 47 ? 0.3322 0.9965 0.3582 -0.0460 -0.0560 0.0864  172 PHE C CD2 
1753 C  CE1 . PHE C 47 ? 0.3912 1.0147 0.4320 -0.0590 -0.0617 0.1017  172 PHE C CE1 
1754 C  CE2 . PHE C 47 ? 0.3771 1.0397 0.4124 -0.0591 -0.0591 0.0921  172 PHE C CE2 
1755 C  CZ  . PHE C 47 ? 0.3713 1.0132 0.4137 -0.0664 -0.0618 0.0989  172 PHE C CZ  
1756 N  N   . GLN C 48 ? 0.2335 0.8874 0.2413 -0.0250 -0.0547 0.0551  173 GLN C N   
1757 C  CA  . GLN C 48 ? 0.2116 0.8720 0.2202 -0.0287 -0.0569 0.0514  173 GLN C CA  
1758 C  C   . GLN C 48 ? 0.3000 0.9491 0.3003 -0.0299 -0.0592 0.0411  173 GLN C C   
1759 O  O   . GLN C 48 ? 0.3214 0.9745 0.3198 -0.0379 -0.0631 0.0381  173 GLN C O   
1760 C  CB  . GLN C 48 ? 0.2000 0.8746 0.2142 -0.0219 -0.0536 0.0520  173 GLN C CB  
1761 C  CG  . GLN C 48 ? 0.2406 0.9218 0.2570 -0.0245 -0.0567 0.0528  173 GLN C CG  
1762 C  CD  . GLN C 48 ? 0.2881 0.9772 0.3152 -0.0176 -0.0537 0.0548  173 GLN C CD  
1763 O  OE1 . GLN C 48 ? 0.2545 0.9487 0.2918 -0.0116 -0.0491 0.0536  173 GLN C OE1 
1764 N  NE2 . GLN C 48 ? 0.0512 0.5790 0.0547 -0.0182 -0.0016 0.0470  173 GLN C NE2 
1765 N  N   . VAL C 49 ? 0.2644 0.9043 0.2601 -0.0225 -0.0568 0.0350  174 VAL C N   
1766 C  CA  . VAL C 49 ? 0.2808 0.9137 0.2699 -0.0222 -0.0571 0.0232  174 VAL C CA  
1767 C  C   . VAL C 49 ? 0.3492 0.9669 0.3400 -0.0285 -0.0599 0.0157  174 VAL C C   
1768 O  O   . VAL C 49 ? 0.3515 0.9718 0.3374 -0.0346 -0.0615 0.0043  174 VAL C O   
1769 C  CB  . VAL C 49 ? 0.3281 0.9592 0.3156 -0.0121 -0.0533 0.0189  174 VAL C CB  
1770 C  CG1 . VAL C 49 ? 0.3365 0.9588 0.3212 -0.0101 -0.0526 0.0057  174 VAL C CG1 
1771 C  CG2 . VAL C 49 ? 0.3126 0.9580 0.3000 -0.0098 -0.0509 0.0209  174 VAL C CG2 
1772 N  N   . MET C 50 ? 0.3105 0.9146 0.3097 -0.0281 -0.0605 0.0225  175 MET C N   
1773 C  CA  . MET C 50 ? 0.3421 0.9266 0.3497 -0.0342 -0.0630 0.0169  175 MET C CA  
1774 C  C   . MET C 50 ? 0.4066 0.9973 0.4150 -0.0487 -0.0669 0.0132  175 MET C C   
1775 O  O   . MET C 50 ? 0.4439 1.0251 0.4543 -0.0554 -0.0688 -0.0028 175 MET C O   
1776 C  CB  . MET C 50 ? 0.3872 0.9588 0.4063 -0.0315 -0.0632 0.0320  175 MET C CB  
1777 C  CG  . MET C 50 ? 0.4749 1.0218 0.5091 -0.0383 -0.0658 0.0292  175 MET C CG  
1778 S  SD  . MET C 50 ? 0.5609 1.0949 0.6104 -0.0341 -0.0664 0.0534  175 MET C SD  
1779 C  CE  . MET C 50 ? 0.5183 1.0723 0.5670 -0.0469 -0.0669 0.0718  175 MET C CE  
1780 N  N   . THR C 51 ? 0.3205 0.9297 0.3287 -0.0533 -0.0681 0.0257  176 THR C N   
1781 C  CA  . THR C 51 ? 0.3105 0.9325 0.3211 -0.0669 -0.0728 0.0248  176 THR C CA  
1782 C  C   . THR C 51 ? 0.3329 0.9727 0.3318 -0.0697 -0.0751 0.0137  176 THR C C   
1783 O  O   . THR C 51 ? 0.3436 0.9978 0.3421 -0.0817 -0.0803 0.0096  176 THR C O   
1784 C  CB  . THR C 51 ? 0.4029 1.0434 0.4203 -0.0688 -0.0728 0.0421  176 THR C CB  
1785 O  OG1 . THR C 51 ? 0.4250 1.0827 0.4381 -0.0595 -0.0702 0.0470  176 THR C OG1 
1786 C  CG2 . THR C 51 ? 0.3722 1.0038 0.3986 -0.0677 -0.0699 0.0550  176 THR C CG2 
1787 N  N   . LEU C 52 ? 0.2423 0.8842 0.2320 -0.0597 -0.0716 0.0102  177 LEU C N   
1788 C  CA  . LEU C 52 ? 0.2187 0.8794 0.1967 -0.0609 -0.0722 0.0036  177 LEU C CA  
1789 C  C   . LEU C 52 ? 0.2411 0.9260 0.2195 -0.0604 -0.0741 0.0195  177 LEU C C   
1790 O  O   . LEU C 52 ? 0.2415 0.9434 0.2119 -0.0607 -0.0746 0.0203  177 LEU C O   
1791 C  CB  . LEU C 52 ? 0.2315 0.8974 0.2025 -0.0721 -0.0753 -0.0161 177 LEU C CB  
1792 C  CG  . LEU C 52 ? 0.2958 0.9345 0.2727 -0.0713 -0.0727 -0.0352 177 LEU C CG  
1793 C  CD1 . LEU C 52 ? 0.3153 0.9624 0.2877 -0.0837 -0.0754 -0.0587 177 LEU C CD1 
1794 C  CD2 . LEU C 52 ? 0.3240 0.9521 0.2991 -0.0575 -0.0664 -0.0399 177 LEU C CD2 
1795 N  N   . GLU C 53 ? 0.1822 0.8697 0.1724 -0.0590 -0.0747 0.0333  178 GLU C N   
1796 C  CA  . GLU C 53 ? 0.1661 0.8743 0.1646 -0.0565 -0.0762 0.0486  178 GLU C CA  
1797 C  C   . GLU C 53 ? 0.2244 0.9340 0.2226 -0.0469 -0.0723 0.0531  178 GLU C C   
1798 O  O   . GLU C 53 ? 0.2491 0.9445 0.2500 -0.0381 -0.0667 0.0509  178 GLU C O   
1799 C  CB  . GLU C 53 ? 0.1659 0.8749 0.1793 -0.0543 -0.0747 0.0580  178 GLU C CB  
1800 C  CG  . GLU C 53 ? 0.2314 0.9648 0.2590 -0.0544 -0.0780 0.0714  178 GLU C CG  
1801 C  CD  . GLU C 53 ? 0.4778 1.2162 0.5149 -0.0434 -0.0752 0.0797  178 GLU C CD  
1802 O  OE1 . GLU C 53 ? 0.4230 1.1745 0.4591 -0.0450 -0.0794 0.0868  178 GLU C OE1 
1803 O  OE2 . GLU C 53 ? 0.3778 1.1082 0.4241 -0.0341 -0.0687 0.0789  178 GLU C OE2 
1804 N  N   . SER C 54 ? 0.1581 0.8871 0.1537 -0.0499 -0.0757 0.0603  179 SER C N   
1805 C  CA  . SER C 54 ? 0.1593 0.8916 0.1574 -0.0438 -0.0728 0.0679  179 SER C CA  
1806 C  C   . SER C 54 ? 0.2306 0.9456 0.2208 -0.0381 -0.0661 0.0558  179 SER C C   
1807 O  O   . SER C 54 ? 0.2177 0.9297 0.2158 -0.0320 -0.0622 0.0609  179 SER C O   
1808 C  CB  . SER C 54 ? 0.1972 0.9313 0.2183 -0.0359 -0.0717 0.0827  179 SER C CB  
1809 O  OG  . SER C 54 ? 0.3623 1.1186 0.3944 -0.0392 -0.0782 0.0989  179 SER C OG  
1810 N  N   . TRP C 55 ? 0.2110 0.9151 0.1892 -0.0401 -0.0649 0.0397  180 TRP C N   
1811 C  CA  . TRP C 55 ? 0.2243 0.9142 0.1985 -0.0333 -0.0593 0.0290  180 TRP C CA  
1812 C  C   . TRP C 55 ? 0.2837 0.9842 0.2550 -0.0319 -0.0560 0.0309  180 TRP C C   
1813 O  O   . TRP C 55 ? 0.2605 0.9533 0.2383 -0.0250 -0.0517 0.0308  180 TRP C O   
1814 C  CB  . TRP C 55 ? 0.2243 0.9006 0.1917 -0.0346 -0.0590 0.0126  180 TRP C CB  
1815 C  CG  . TRP C 55 ? 0.2472 0.9348 0.2026 -0.0414 -0.0595 -0.0010 180 TRP C CG  
1816 C  CD1 . TRP C 55 ? 0.2978 0.9949 0.2475 -0.0521 -0.0640 -0.0084 180 TRP C CD1 
1817 C  CD2 . TRP C 55 ? 0.2508 0.9455 0.1990 -0.0386 -0.0546 -0.0118 180 TRP C CD2 
1818 N  NE1 . TRP C 55 ? 0.3081 1.0201 0.2458 -0.0564 -0.0621 -0.0241 180 TRP C NE1 
1819 C  CE2 . TRP C 55 ? 0.3181 1.0294 0.2549 -0.0478 -0.0559 -0.0259 180 TRP C CE2 
1820 C  CE3 . TRP C 55 ? 0.2600 0.9530 0.2108 -0.0301 -0.0491 -0.0116 180 TRP C CE3 
1821 C  CZ2 . TRP C 55 ? 0.3189 1.0452 0.2465 -0.0478 -0.0507 -0.0407 180 TRP C CZ2 
1822 C  CZ3 . TRP C 55 ? 0.2878 0.9947 0.2311 -0.0303 -0.0445 -0.0240 180 TRP C CZ3 
1823 C  CH2 . TRP C 55 ? 0.3122 1.0359 0.2438 -0.0386 -0.0448 -0.0387 180 TRP C CH2 
1824 N  N   . SER C 56 ? 0.2543 0.9766 0.2162 -0.0399 -0.0583 0.0337  181 SER C N   
1825 C  CA  . SER C 56 ? 0.2415 0.9801 0.1994 -0.0414 -0.0551 0.0380  181 SER C CA  
1826 C  C   . SER C 56 ? 0.2738 1.0221 0.2455 -0.0419 -0.0566 0.0615  181 SER C C   
1827 O  O   . SER C 56 ? 0.2742 1.0165 0.2562 -0.0378 -0.0522 0.0658  181 SER C O   
1828 C  CB  . SER C 56 ? 0.2804 1.0421 0.2198 -0.0501 -0.0554 0.0272  181 SER C CB  
1829 O  OG  . SER C 56 ? 0.3979 1.1783 0.3329 -0.0518 -0.0508 0.0311  181 SER C OG  
1830 N  N   . MET C 57 ? 0.2065 0.9691 0.1825 -0.0466 -0.0631 0.0769  182 MET C N   
1831 C  CA  . MET C 57 ? 0.2007 0.9708 0.1962 -0.0455 -0.0650 0.1017  182 MET C CA  
1832 C  C   . MET C 57 ? 0.2382 0.9832 0.2582 -0.0353 -0.0621 0.1032  182 MET C C   
1833 O  O   . MET C 57 ? 0.2327 0.9729 0.2721 -0.0324 -0.0596 0.1147  182 MET C O   
1834 C  CB  . MET C 57 ? 0.2422 1.0392 0.2386 -0.0522 -0.0737 0.1204  182 MET C CB  
1835 C  CG  . MET C 57 ? 0.3028 1.1332 0.2736 -0.0642 -0.0771 0.1178  182 MET C CG  
1836 S  SD  . MET C 57 ? 0.3655 1.2208 0.3272 -0.0702 -0.0729 0.1295  182 MET C SD  
1837 C  CE  . MET C 57 ? 0.3350 1.2225 0.3102 -0.0755 -0.0822 0.1690  182 MET C CE  
1838 N  N   . GLY C 58 ? 0.1892 0.9201 0.2089 -0.0311 -0.0617 0.0903  183 GLY C N   
1839 C  CA  . GLY C 58 ? 0.1701 0.8844 0.2094 -0.0224 -0.0585 0.0877  183 GLY C CA  
1840 C  C   . GLY C 58 ? 0.2150 0.9132 0.2558 -0.0168 -0.0519 0.0738  183 GLY C C   
1841 O  O   . GLY C 58 ? 0.2108 0.9020 0.2722 -0.0120 -0.0486 0.0754  183 GLY C O   
1842 N  N   . ILE C 59 ? 0.1700 0.8629 0.1917 -0.0173 -0.0501 0.0592  184 ILE C N   
1843 C  CA  . ILE C 59 ? 0.1596 0.8423 0.1817 -0.0120 -0.0451 0.0468  184 ILE C CA  
1844 C  C   . ILE C 59 ? 0.2711 0.9579 0.2848 -0.0139 -0.0425 0.0418  184 ILE C C   
1845 O  O   . ILE C 59 ? 0.2871 0.9738 0.3123 -0.0131 -0.0392 0.0424  184 ILE C O   
1846 C  CB  . ILE C 59 ? 0.1816 0.8564 0.1960 -0.0083 -0.0450 0.0368  184 ILE C CB  
1847 C  CG1 . ILE C 59 ? 0.1824 0.8585 0.2025 -0.0087 -0.0472 0.0421  184 ILE C CG1 
1848 C  CG2 . ILE C 59 ? 0.1720 0.8431 0.1892 -0.0025 -0.0411 0.0271  184 ILE C CG2 
1849 C  CD1 . ILE C 59 ? 0.2542 0.9331 0.2941 -0.0040 -0.0445 0.0443  184 ILE C CD1 
1850 N  N   . VAL C 60 ? 0.2312 0.9222 0.2273 -0.0163 -0.0432 0.0344  185 VAL C N   
1851 C  CA  . VAL C 60 ? 0.2261 0.9244 0.2144 -0.0167 -0.0396 0.0261  185 VAL C CA  
1852 C  C   . VAL C 60 ? 0.2686 0.9819 0.2623 -0.0221 -0.0371 0.0362  185 VAL C C   
1853 O  O   . VAL C 60 ? 0.2511 0.9657 0.2513 -0.0203 -0.0329 0.0320  185 VAL C O   
1854 C  CB  . VAL C 60 ? 0.2840 0.9836 0.2571 -0.0174 -0.0400 0.0129  185 VAL C CB  
1855 C  CG1 . VAL C 60 ? 0.2836 0.9924 0.2528 -0.0153 -0.0349 0.0017  185 VAL C CG1 
1856 C  CG2 . VAL C 60 ? 0.2839 0.9649 0.2580 -0.0120 -0.0421 0.0064  185 VAL C CG2 
1857 N  N   . ARG C 61 ? 0.2307 0.9577 0.2236 -0.0293 -0.0400 0.0516  186 ARG C N   
1858 C  CA  . ARG C 61 ? 0.2269 0.9699 0.2271 -0.0357 -0.0380 0.0670  186 ARG C CA  
1859 C  C   . ARG C 61 ? 0.2766 1.0052 0.3027 -0.0330 -0.0358 0.0739  186 ARG C C   
1860 O  O   . ARG C 61 ? 0.2838 1.0168 0.3149 -0.0350 -0.0312 0.0712  186 ARG C O   
1861 C  CB  . ARG C 61 ? 0.2223 0.9875 0.2171 -0.0440 -0.0428 0.0861  186 ARG C CB  
1862 C  CG  . ARG C 61 ? 0.2879 1.0759 0.2563 -0.0500 -0.0436 0.0754  186 ARG C CG  
1863 C  CD  . ARG C 61 ? 0.3056 1.1263 0.2676 -0.0604 -0.0481 0.0966  186 ARG C CD  
1864 N  NE  . ARG C 61 ? 0.3343 1.1803 0.2707 -0.0673 -0.0496 0.0823  186 ARG C NE  
1865 C  CZ  . ARG C 61 ? 0.4182 1.2961 0.3377 -0.0746 -0.0452 0.0766  186 ARG C CZ  
1866 N  NH1 . ARG C 61 ? 0.2092 1.0978 0.1346 -0.0764 -0.0392 0.0870  186 ARG C NH1 
1867 N  NH2 . ARG C 61 ? 0.1625 1.0637 0.0602 -0.0810 -0.0463 0.0586  186 ARG C NH2 
1868 N  N   . PRO C 62 ? 0.2116 0.9236 0.2555 -0.0281 -0.0381 0.0777  187 PRO C N   
1869 C  CA  . PRO C 62 ? 0.1922 0.8903 0.2630 -0.0257 -0.0349 0.0773  187 PRO C CA  
1870 C  C   . PRO C 62 ? 0.2000 0.8939 0.2691 -0.0232 -0.0305 0.0577  187 PRO C C   
1871 O  O   . PRO C 62 ? 0.1826 0.8747 0.2697 -0.0266 -0.0272 0.0581  187 PRO C O   
1872 C  CB  . PRO C 62 ? 0.2077 0.8932 0.2927 -0.0192 -0.0371 0.0768  187 PRO C CB  
1873 C  CG  . PRO C 62 ? 0.2662 0.9622 0.3395 -0.0209 -0.0426 0.0887  187 PRO C CG  
1874 C  CD  . PRO C 62 ? 0.2179 0.9264 0.2613 -0.0253 -0.0431 0.0814  187 PRO C CD  
1875 N  N   . VAL C 63 ? 0.1373 0.8308 0.1868 -0.0180 -0.0308 0.0422  188 VAL C N   
1876 C  CA  . VAL C 63 ? 0.1248 0.8192 0.1713 -0.0143 -0.0282 0.0258  188 VAL C CA  
1877 C  C   . VAL C 63 ? 0.2049 0.9143 0.2472 -0.0188 -0.0249 0.0253  188 VAL C C   
1878 O  O   . VAL C 63 ? 0.2044 0.9181 0.2571 -0.0195 -0.0222 0.0182  188 VAL C O   
1879 C  CB  . VAL C 63 ? 0.1546 0.8447 0.1856 -0.0070 -0.0304 0.0152  188 VAL C CB  
1880 C  CG1 . VAL C 63 ? 0.1469 0.8427 0.1761 -0.0025 -0.0289 0.0026  188 VAL C CG1 
1881 C  CG2 . VAL C 63 ? 0.1465 0.8276 0.1831 -0.0038 -0.0322 0.0155  188 VAL C CG2 
1882 N  N   . MET C 64 ? 0.1714 0.8931 0.1993 -0.0227 -0.0249 0.0318  189 MET C N   
1883 C  CA  . MET C 64 ? 0.1712 0.9135 0.1940 -0.0275 -0.0204 0.0309  189 MET C CA  
1884 C  C   . MET C 64 ? 0.2279 0.9786 0.2693 -0.0367 -0.0175 0.0451  189 MET C C   
1885 O  O   . MET C 64 ? 0.2127 0.9793 0.2571 -0.0401 -0.0128 0.0413  189 MET C O   
1886 C  CB  . MET C 64 ? 0.2037 0.9620 0.2059 -0.0303 -0.0204 0.0309  189 MET C CB  
1887 C  CG  . MET C 64 ? 0.2391 0.9919 0.2280 -0.0220 -0.0207 0.0117  189 MET C CG  
1888 S  SD  . MET C 64 ? 0.3078 1.0852 0.2765 -0.0266 -0.0180 0.0030  189 MET C SD  
1889 C  CE  . MET C 64 ? 0.2689 1.0545 0.2306 -0.0373 -0.0238 0.0235  189 MET C CE  
1890 N  N   . ASN C 65 ? 0.1889 0.9287 0.2466 -0.0405 -0.0201 0.0619  190 ASN C N   
1891 C  CA  . ASN C 65 ? 0.1894 0.9302 0.2725 -0.0494 -0.0180 0.0785  190 ASN C CA  
1892 C  C   . ASN C 65 ? 0.2272 0.9595 0.3301 -0.0494 -0.0148 0.0641  190 ASN C C   
1893 O  O   . ASN C 65 ? 0.2492 0.9866 0.3720 -0.0587 -0.0116 0.0728  190 ASN C O   
1894 C  CB  . ASN C 65 ? 0.1674 0.8943 0.2690 -0.0501 -0.0221 0.0981  190 ASN C CB  
1895 C  CG  . ASN C 65 ? 0.6471 1.3898 0.7317 -0.0525 -0.0263 0.1158  190 ASN C CG  
1896 O  OD1 . ASN C 65 ? 0.6547 1.4238 0.7191 -0.0587 -0.0250 0.1208  190 ASN C OD1 
1897 N  ND2 . ASN C 65 ? 0.5925 1.3236 0.6855 -0.0480 -0.0314 0.1246  190 ASN C ND2 
1898 N  N   . VAL C 66 ? 0.1380 0.8609 0.2351 -0.0404 -0.0160 0.0428  191 VAL C N   
1899 C  CA  . VAL C 66 ? 0.1198 0.8411 0.2309 -0.0400 -0.0143 0.0257  191 VAL C CA  
1900 C  C   . VAL C 66 ? 0.1546 0.8946 0.2477 -0.0356 -0.0132 0.0123  191 VAL C C   
1901 O  O   . VAL C 66 ? 0.1328 0.8877 0.2360 -0.0406 -0.0102 0.0075  191 VAL C O   
1902 C  CB  . VAL C 66 ? 0.1555 0.8594 0.2749 -0.0334 -0.0168 0.0130  191 VAL C CB  
1903 C  CG1 . VAL C 66 ? 0.1426 0.8516 0.2745 -0.0345 -0.0157 -0.0070 191 VAL C CG1 
1904 C  CG2 . VAL C 66 ? 0.1618 0.8477 0.3036 -0.0355 -0.0173 0.0253  191 VAL C CG2 
1905 N  N   . HIS C 67 ? 0.1154 0.8546 0.1858 -0.0262 -0.0156 0.0071  192 HIS C N   
1906 C  CA  . HIS C 67 ? 0.1173 0.8698 0.1745 -0.0189 -0.0150 -0.0046 192 HIS C CA  
1907 C  C   . HIS C 67 ? 0.2318 0.9956 0.2731 -0.0197 -0.0126 -0.0002 192 HIS C C   
1908 O  O   . HIS C 67 ? 0.2607 1.0153 0.2876 -0.0154 -0.0151 -0.0004 192 HIS C O   
1909 C  CB  . HIS C 67 ? 0.1157 0.8574 0.1641 -0.0081 -0.0195 -0.0137 192 HIS C CB  
1910 C  CG  . HIS C 67 ? 0.1513 0.8868 0.2113 -0.0082 -0.0217 -0.0192 192 HIS C CG  
1911 N  ND1 . HIS C 67 ? 0.1653 0.9147 0.2365 -0.0091 -0.0216 -0.0297 192 HIS C ND1 
1912 C  CD2 . HIS C 67 ? 0.1695 0.8904 0.2322 -0.0078 -0.0235 -0.0177 192 HIS C CD2 
1913 C  CE1 . HIS C 67 ? 0.1534 0.8966 0.2322 -0.0100 -0.0232 -0.0360 192 HIS C CE1 
1914 N  NE2 . HIS C 67 ? 0.1612 0.8873 0.2357 -0.0084 -0.0238 -0.0294 192 HIS C NE2 
1915 N  N   . PRO C 68 ? 0.1946 0.9811 0.2386 -0.0264 -0.0072 0.0026  193 PRO C N   
1916 C  CA  . PRO C 68 ? 0.1985 1.0022 0.2260 -0.0284 -0.0039 0.0042  193 PRO C CA  
1917 C  C   . PRO C 68 ? 0.2725 1.0751 0.2856 -0.0173 -0.0042 -0.0123 193 PRO C C   
1918 O  O   . PRO C 68 ? 0.2794 1.0840 0.2774 -0.0185 -0.0044 -0.0133 193 PRO C O   
1919 C  CB  . PRO C 68 ? 0.2249 1.0582 0.2611 -0.0369 0.0029  0.0075  193 PRO C CB  
1920 C  CG  . PRO C 68 ? 0.2730 1.0974 0.3324 -0.0444 0.0019  0.0167  193 PRO C CG  
1921 C  CD  . PRO C 68 ? 0.2132 1.0145 0.2763 -0.0343 -0.0035 0.0043  193 PRO C CD  
1922 N  N   . ASN C 69 ? 0.2601 1.0605 0.2801 -0.0069 -0.0047 -0.0250 194 ASN C N   
1923 C  CA  . ASN C 69 ? 0.2788 1.0749 0.2930 0.0052  -0.0050 -0.0394 194 ASN C CA  
1924 C  C   . ASN C 69 ? 0.3506 1.1176 0.3593 0.0112  -0.0117 -0.0385 194 ASN C C   
1925 O  O   . ASN C 69 ? 0.3718 1.1306 0.3800 0.0209  -0.0126 -0.0483 194 ASN C O   
1926 C  CB  . ASN C 69 ? 0.3108 1.1212 0.3389 0.0149  -0.0030 -0.0497 194 ASN C CB  
1927 C  CG  . ASN C 69 ? 0.7888 1.6329 0.8229 0.0101  0.0051  -0.0537 194 ASN C CG  
1928 O  OD1 . ASN C 69 ? 0.7137 1.5744 0.7394 0.0083  0.0112  -0.0605 194 ASN C OD1 
1929 N  ND2 . ASN C 69 ? 0.7624 1.6215 0.8118 0.0074  0.0057  -0.0512 194 ASN C ND2 
1930 N  N   . ALA C 70 ? 0.2908 1.0428 0.2984 0.0055  -0.0160 -0.0267 195 ALA C N   
1931 C  CA  . ALA C 70 ? 0.2832 1.0122 0.2866 0.0097  -0.0216 -0.0243 195 ALA C CA  
1932 C  C   . ALA C 70 ? 0.3413 1.0603 0.3343 0.0120  -0.0228 -0.0301 195 ALA C C   
1933 O  O   . ALA C 70 ? 0.3589 1.0605 0.3524 0.0175  -0.0269 -0.0301 195 ALA C O   
1934 C  CB  . ALA C 70 ? 0.2841 1.0045 0.2898 0.0026  -0.0241 -0.0124 195 ALA C CB  
1935 N  N   . TRP C 71 ? 0.2804 1.0131 0.2653 0.0070  -0.0191 -0.0359 196 TRP C N   
1936 C  CA  . TRP C 71 ? 0.2925 1.0200 0.2685 0.0068  -0.0195 -0.0466 196 TRP C CA  
1937 C  C   . TRP C 71 ? 0.3342 1.0505 0.3190 0.0188  -0.0186 -0.0618 196 TRP C C   
1938 O  O   . TRP C 71 ? 0.3402 1.0411 0.3239 0.0198  -0.0205 -0.0702 196 TRP C O   
1939 C  CB  . TRP C 71 ? 0.2942 1.0483 0.2583 -0.0028 -0.0150 -0.0506 196 TRP C CB  
1940 C  CG  . TRP C 71 ? 0.3119 1.0908 0.2796 -0.0002 -0.0073 -0.0613 196 TRP C CG  
1941 C  CD1 . TRP C 71 ? 0.3388 1.1384 0.3114 -0.0044 -0.0033 -0.0520 196 TRP C CD1 
1942 C  CD2 . TRP C 71 ? 0.3289 1.1147 0.2998 0.0077  -0.0020 -0.0842 196 TRP C CD2 
1943 N  NE1 . TRP C 71 ? 0.3373 1.1605 0.3138 -0.0003 0.0043  -0.0668 196 TRP C NE1 
1944 C  CE2 . TRP C 71 ? 0.3759 1.1910 0.3521 0.0084  0.0054  -0.0877 196 TRP C CE2 
1945 C  CE3 . TRP C 71 ? 0.3652 1.1346 0.3385 0.0142  -0.0026 -0.1030 196 TRP C CE3 
1946 C  CZ2 . TRP C 71 ? 0.3847 1.2163 0.3680 0.0167  0.0129  -0.1103 196 TRP C CZ2 
1947 C  CZ3 . TRP C 71 ? 0.4022 1.1833 0.3846 0.0228  0.0046  -0.1263 196 TRP C CZ3 
1948 C  CH2 . TRP C 71 ? 0.4077 1.2213 0.3945 0.0246  0.0125  -0.1303 196 TRP C CH2 
1949 N  N   . VAL C 72 ? 0.2840 1.0089 0.2808 0.0277  -0.0159 -0.0650 197 VAL C N   
1950 C  CA  . VAL C 72 ? 0.2909 1.0072 0.3023 0.0416  -0.0155 -0.0760 197 VAL C CA  
1951 C  C   . VAL C 72 ? 0.3337 1.0237 0.3516 0.0475  -0.0229 -0.0648 197 VAL C C   
1952 O  O   . VAL C 72 ? 0.3394 1.0139 0.3701 0.0572  -0.0243 -0.0698 197 VAL C O   
1953 C  CB  . VAL C 72 ? 0.3318 1.0720 0.3563 0.0496  -0.0106 -0.0818 197 VAL C CB  
1954 C  CG1 . VAL C 72 ? 0.3156 1.0587 0.3483 0.0531  -0.0152 -0.0682 197 VAL C CG1 
1955 C  CG2 . VAL C 72 ? 0.3444 1.0824 0.3852 0.0635  -0.0074 -0.0989 197 VAL C CG2 
1956 N  N   . PHE C 73 ? 0.2777 0.9644 0.2888 0.0413  -0.0271 -0.0494 198 PHE C N   
1957 C  CA  . PHE C 73 ? 0.2759 0.9453 0.2900 0.0444  -0.0332 -0.0374 198 PHE C CA  
1958 C  C   . PHE C 73 ? 0.3040 0.9545 0.3112 0.0373  -0.0355 -0.0363 198 PHE C C   
1959 O  O   . PHE C 73 ? 0.3134 0.9451 0.3286 0.0415  -0.0380 -0.0366 198 PHE C O   
1960 C  CB  . PHE C 73 ? 0.2924 0.9720 0.3036 0.0407  -0.0353 -0.0261 198 PHE C CB  
1961 C  CG  . PHE C 73 ? 0.3269 0.9971 0.3375 0.0414  -0.0404 -0.0139 198 PHE C CG  
1962 C  CD1 . PHE C 73 ? 0.3686 1.0293 0.3716 0.0334  -0.0417 -0.0081 198 PHE C CD1 
1963 C  CD2 . PHE C 73 ? 0.3805 1.0575 0.3985 0.0497  -0.0440 -0.0070 198 PHE C CD2 
1964 C  CE1 . PHE C 73 ? 0.3870 1.0443 0.3896 0.0334  -0.0451 0.0029  198 PHE C CE1 
1965 C  CE2 . PHE C 73 ? 0.4151 1.0906 0.4307 0.0490  -0.0481 0.0057  198 PHE C CE2 
1966 C  CZ  . PHE C 73 ? 0.3891 1.0547 0.3969 0.0407  -0.0480 0.0099  198 PHE C CZ  
1967 N  N   . PHE C 74 ? 0.2303 0.8866 0.2254 0.0263  -0.0350 -0.0335 199 PHE C N   
1968 C  CA  . PHE C 74 ? 0.2304 0.8757 0.2189 0.0178  -0.0379 -0.0305 199 PHE C CA  
1969 C  C   . PHE C 74 ? 0.2934 0.9312 0.2804 0.0144  -0.0375 -0.0449 199 PHE C C   
1970 O  O   . PHE C 74 ? 0.3010 0.9217 0.2909 0.0112  -0.0412 -0.0430 199 PHE C O   
1971 C  CB  . PHE C 74 ? 0.2431 0.8998 0.2238 0.0088  -0.0384 -0.0211 199 PHE C CB  
1972 C  CG  . PHE C 74 ? 0.2464 0.9050 0.2319 0.0109  -0.0393 -0.0100 199 PHE C CG  
1973 C  CD1 . PHE C 74 ? 0.2837 0.9336 0.2713 0.0109  -0.0425 -0.0016 199 PHE C CD1 
1974 C  CD2 . PHE C 74 ? 0.2540 0.9257 0.2432 0.0113  -0.0364 -0.0094 199 PHE C CD2 
1975 C  CE1 . PHE C 74 ? 0.2791 0.9356 0.2708 0.0125  -0.0422 0.0043  199 PHE C CE1 
1976 C  CE2 . PHE C 74 ? 0.2818 0.9561 0.2774 0.0121  -0.0368 -0.0040 199 PHE C CE2 
1977 C  CZ  . PHE C 74 ? 0.2543 0.9221 0.2504 0.0131  -0.0395 0.0014  199 PHE C CZ  
1978 N  N   . ILE C 75 ? 0.2399 0.8928 0.2230 0.0136  -0.0326 -0.0604 200 ILE C N   
1979 C  CA  . ILE C 75 ? 0.2592 0.9088 0.2411 0.0097  -0.0313 -0.0799 200 ILE C CA  
1980 C  C   . ILE C 75 ? 0.3331 0.9547 0.3341 0.0189  -0.0324 -0.0881 200 ILE C C   
1981 O  O   . ILE C 75 ? 0.3493 0.9533 0.3534 0.0126  -0.0360 -0.0913 200 ILE C O   
1982 C  CB  . ILE C 75 ? 0.3033 0.9823 0.2749 0.0054  -0.0250 -0.0966 200 ILE C CB  
1983 C  CG1 . ILE C 75 ? 0.2933 0.9963 0.2471 -0.0077 -0.0267 -0.0835 200 ILE C CG1 
1984 C  CG2 . ILE C 75 ? 0.3299 1.0056 0.3045 0.0040  -0.0224 -0.1244 200 ILE C CG2 
1985 C  CD1 . ILE C 75 ? 0.3773 1.1155 0.3208 -0.0122 -0.0206 -0.0878 200 ILE C CD1 
1986 N  N   . PRO C 76 ? 0.2781 0.8946 0.2948 0.0331  -0.0307 -0.0869 201 PRO C N   
1987 C  CA  . PRO C 76 ? 0.2928 0.8810 0.3324 0.0426  -0.0329 -0.0882 201 PRO C CA  
1988 C  C   . PRO C 76 ? 0.3442 0.9111 0.3868 0.0383  -0.0399 -0.0674 201 PRO C C   
1989 O  O   . PRO C 76 ? 0.3562 0.8982 0.4135 0.0370  -0.0420 -0.0715 201 PRO C O   
1990 C  CB  . PRO C 76 ? 0.3084 0.9049 0.3620 0.0583  -0.0311 -0.0843 201 PRO C CB  
1991 C  CG  . PRO C 76 ? 0.3524 0.9805 0.3932 0.0559  -0.0250 -0.0941 201 PRO C CG  
1992 C  CD  . PRO C 76 ? 0.2835 0.9212 0.3011 0.0407  -0.0270 -0.0842 201 PRO C CD  
1993 N  N   . PHE C 77 ? 0.2818 0.8600 0.3124 0.0350  -0.0427 -0.0468 202 PHE C N   
1994 C  CA  . PHE C 77 ? 0.2780 0.8449 0.3090 0.0299  -0.0480 -0.0270 202 PHE C CA  
1995 C  C   . PHE C 77 ? 0.3778 0.9327 0.4061 0.0168  -0.0498 -0.0328 202 PHE C C   
1996 O  O   . PHE C 77 ? 0.4013 0.9363 0.4419 0.0142  -0.0532 -0.0243 202 PHE C O   
1997 C  CB  . PHE C 77 ? 0.2684 0.8552 0.2858 0.0274  -0.0487 -0.0120 202 PHE C CB  
1998 C  CG  . PHE C 77 ? 0.2819 0.8646 0.2990 0.0222  -0.0524 0.0064  202 PHE C CG  
1999 C  CD1 . PHE C 77 ? 0.3093 0.8951 0.3179 0.0108  -0.0532 0.0088  202 PHE C CD1 
2000 C  CD2 . PHE C 77 ? 0.3127 0.8936 0.3386 0.0287  -0.0551 0.0227  202 PHE C CD2 
2001 C  CE1 . PHE C 77 ? 0.3147 0.9010 0.3246 0.0060  -0.0555 0.0247  202 PHE C CE1 
2002 C  CE2 . PHE C 77 ? 0.3464 0.9295 0.3711 0.0228  -0.0575 0.0401  202 PHE C CE2 
2003 C  CZ  . PHE C 77 ? 0.3097 0.8952 0.3267 0.0115  -0.0571 0.0398  202 PHE C CZ  
2004 N  N   . ILE C 78 ? 0.3416 0.9119 0.3550 0.0078  -0.0480 -0.0456 203 ILE C N   
2005 C  CA  . ILE C 78 ? 0.3639 0.9318 0.3729 -0.0060 -0.0504 -0.0536 203 ILE C CA  
2006 C  C   . ILE C 78 ? 0.5122 1.0580 0.5375 -0.0060 -0.0498 -0.0737 203 ILE C C   
2007 O  O   . ILE C 78 ? 0.5373 1.0635 0.5740 -0.0133 -0.0535 -0.0711 203 ILE C O   
2008 C  CB  . ILE C 78 ? 0.3810 0.9775 0.3701 -0.0148 -0.0494 -0.0600 203 ILE C CB  
2009 C  CG1 . ILE C 78 ? 0.3476 0.9586 0.3284 -0.0170 -0.0513 -0.0385 203 ILE C CG1 
2010 C  CG2 . ILE C 78 ? 0.3881 0.9888 0.3728 -0.0286 -0.0518 -0.0758 203 ILE C CG2 
2011 C  CD1 . ILE C 78 ? 0.3092 0.9459 0.2774 -0.0194 -0.0492 -0.0377 203 ILE C CD1 
2012 N  N   . MET C 79 ? 0.5148 1.0639 0.5445 0.0021  -0.0446 -0.0943 204 MET C N   
2013 C  CA  . MET C 79 ? 0.5631 1.0921 0.6126 0.0043  -0.0423 -0.1192 204 MET C CA  
2014 C  C   . MET C 79 ? 0.6367 1.1292 0.7147 0.0110  -0.0457 -0.1063 204 MET C C   
2015 O  O   . MET C 79 ? 0.6550 1.1232 0.7507 0.0044  -0.0472 -0.1181 204 MET C O   
2016 C  CB  . MET C 79 ? 0.6080 1.1522 0.6593 0.0152  -0.0347 -0.1411 204 MET C CB  
2017 C  CG  . MET C 79 ? 0.6562 1.2404 0.6795 0.0070  -0.0312 -0.1497 204 MET C CG  
2018 S  SD  . MET C 79 ? 0.7385 1.3507 0.7608 0.0141  -0.0207 -0.1809 204 MET C SD  
2019 C  CE  . MET C 79 ? 0.6800 1.2873 0.7203 0.0351  -0.0182 -0.1653 204 MET C CE  
2020 N  N   . LEU C 80 ? 0.5913 1.0829 0.6738 0.0221  -0.0474 -0.0803 205 LEU C N   
2021 C  CA  . LEU C 80 ? 0.6117 1.0765 0.7195 0.0292  -0.0513 -0.0597 205 LEU C CA  
2022 C  C   . LEU C 80 ? 0.6874 1.1403 0.7955 0.0156  -0.0566 -0.0404 205 LEU C C   
2023 O  O   . LEU C 80 ? 0.7133 1.1364 0.8464 0.0125  -0.0589 -0.0391 205 LEU C O   
2024 C  CB  . LEU C 80 ? 0.5969 1.0755 0.7049 0.0437  -0.0521 -0.0380 205 LEU C CB  
2025 C  CG  . LEU C 80 ? 0.6811 1.1418 0.8121 0.0513  -0.0573 -0.0097 205 LEU C CG  
2026 C  CD1 . LEU C 80 ? 0.7209 1.1525 0.8893 0.0638  -0.0568 -0.0183 205 LEU C CD1 
2027 C  CD2 . LEU C 80 ? 0.7042 1.1913 0.8253 0.0603  -0.0592 0.0119  205 LEU C CD2 
2028 N  N   . THR C 81 ? 0.6320 1.1081 0.7162 0.0078  -0.0582 -0.0247 206 THR C N   
2029 C  CA  . THR C 81 ? 0.6323 1.1053 0.7159 -0.0047 -0.0623 -0.0052 206 THR C CA  
2030 C  C   . THR C 81 ? 0.7106 1.1716 0.7993 -0.0207 -0.0638 -0.0210 206 THR C C   
2031 O  O   . THR C 81 ? 0.7322 1.1712 0.8404 -0.0282 -0.0668 -0.0110 206 THR C O   
2032 C  CB  . THR C 81 ? 0.7139 1.2165 0.7746 -0.0070 -0.0623 0.0107  206 THR C CB  
2033 O  OG1 . THR C 81 ? 0.7165 1.2390 0.7580 -0.0110 -0.0601 -0.0058 206 THR C OG1 
2034 C  CG2 . THR C 81 ? 0.6797 1.1949 0.7385 0.0061  -0.0618 0.0280  206 THR C CG2 
2035 N  N   . THR C 82 ? 0.6701 1.1469 0.7430 -0.0270 -0.0621 -0.0453 207 THR C N   
2036 C  CA  . THR C 82 ? 0.6919 1.1646 0.7676 -0.0437 -0.0644 -0.0640 207 THR C CA  
2037 C  C   . THR C 82 ? 0.8061 1.2470 0.9089 -0.0430 -0.0631 -0.0881 207 THR C C   
2038 O  O   . THR C 82 ? 0.8166 1.2609 0.9182 -0.0522 -0.0623 -0.1185 207 THR C O   
2039 C  CB  . THR C 82 ? 0.7619 1.2695 0.8105 -0.0524 -0.0646 -0.0757 207 THR C CB  
2040 O  OG1 . THR C 82 ? 0.7465 1.2659 0.7864 -0.0459 -0.0599 -0.0992 207 THR C OG1 
2041 C  CG2 . THR C 82 ? 0.7183 1.2510 0.7493 -0.0511 -0.0656 -0.0507 207 THR C CG2 
2042 N  N   . PHE C 83 ? 0.8008 1.2126 0.9298 -0.0319 -0.0631 -0.0738 208 PHE C N   
2043 C  CA  . PHE C 83 ? 0.8486 1.2229 1.0135 -0.0273 -0.0620 -0.0889 208 PHE C CA  
2044 C  C   . PHE C 83 ? 0.9410 1.2896 1.1314 -0.0238 -0.0659 -0.0533 208 PHE C C   
2045 O  O   . PHE C 83 ? 0.9727 1.2893 1.1931 -0.0326 -0.0683 -0.0532 208 PHE C O   
2046 C  CB  . PHE C 83 ? 0.8762 1.2519 1.0468 -0.0085 -0.0561 -0.1094 208 PHE C CB  
2047 C  CG  . PHE C 83 ? 0.9386 1.2753 1.1518 -0.0008 -0.0541 -0.1282 208 PHE C CG  
2048 C  CD1 . PHE C 83 ? 0.9859 1.2938 1.2322 0.0128  -0.0564 -0.1023 208 PHE C CD1 
2049 C  CD2 . PHE C 83 ? 0.9950 1.3256 1.2173 -0.0069 -0.0500 -0.1720 208 PHE C CD2 
2050 C  CE1 . PHE C 83 ? 1.0377 1.3062 1.3300 0.0211  -0.0547 -0.1181 208 PHE C CE1 
2051 C  CE2 . PHE C 83 ? 1.0701 1.3622 1.3372 0.0011  -0.0473 -0.1930 208 PHE C CE2 
2052 C  CZ  . PHE C 83 ? 1.0570 1.3156 1.3609 0.0157  -0.0497 -0.1650 208 PHE C CZ  
2053 N  N   . THR C 84 ? 0.8985 1.2633 1.0782 -0.0118 -0.0666 -0.0231 209 THR C N   
2054 C  CA  . THR C 84 ? 0.9210 1.2734 1.1191 -0.0078 -0.0704 0.0154  209 THR C CA  
2055 C  C   . THR C 84 ? 1.0150 1.3672 1.2123 -0.0275 -0.0739 0.0344  209 THR C C   
2056 O  O   . THR C 84 ? 1.0416 1.3688 1.2678 -0.0318 -0.0769 0.0560  209 THR C O   
2057 C  CB  . THR C 84 ? 1.0076 1.3887 1.1875 0.0070  -0.0703 0.0381  209 THR C CB  
2058 O  OG1 . THR C 84 ? 1.0069 1.3963 1.1828 0.0221  -0.0665 0.0163  209 THR C OG1 
2059 C  CG2 . THR C 84 ? 0.9976 1.3697 1.1996 0.0144  -0.0746 0.0765  209 THR C CG2 
2060 N  N   . VAL C 85 ? 0.9730 1.3540 1.1407 -0.0394 -0.0734 0.0276  210 VAL C N   
2061 C  CA  . VAL C 85 ? 0.9831 1.3710 1.1495 -0.0583 -0.0761 0.0425  210 VAL C CA  
2062 C  C   . VAL C 85 ? 1.0853 1.4485 1.2720 -0.0748 -0.0779 0.0185  210 VAL C C   
2063 O  O   . VAL C 85 ? 1.1003 1.4509 1.3060 -0.0899 -0.0807 0.0334  210 VAL C O   
2064 C  CB  . VAL C 85 ? 0.9957 1.4256 1.1282 -0.0629 -0.0752 0.0465  210 VAL C CB  
2065 C  CG1 . VAL C 85 ? 0.9924 1.4340 1.1280 -0.0780 -0.0770 0.0704  210 VAL C CG1 
2066 C  CG2 . VAL C 85 ? 0.9650 1.4181 1.0776 -0.0462 -0.0725 0.0569  210 VAL C CG2 
2067 N  N   . LEU C 86 ? 1.0624 1.4210 1.2463 -0.0728 -0.0759 -0.0194 211 LEU C N   
2068 C  CA  . LEU C 86 ? 1.1003 1.4400 1.3018 -0.0883 -0.0771 -0.0507 211 LEU C CA  
2069 C  C   . LEU C 86 ? 1.2174 1.5081 1.4655 -0.0887 -0.0779 -0.0494 211 LEU C C   
2070 O  O   . LEU C 86 ? 1.2381 1.5087 1.5085 -0.1063 -0.0801 -0.0658 211 LEU C O   
2071 C  CB  . LEU C 86 ? 1.0987 1.4534 1.2832 -0.0847 -0.0737 -0.0914 211 LEU C CB  
2072 C  CG  . LEU C 86 ? 1.1658 1.5375 1.3405 -0.1056 -0.0763 -0.1195 211 LEU C CG  
2073 C  CD1 . LEU C 86 ? 1.1301 1.5484 1.2676 -0.1111 -0.0785 -0.1073 211 LEU C CD1 
2074 C  CD2 . LEU C 86 ? 1.2207 1.5917 1.3967 -0.1039 -0.0724 -0.1650 211 LEU C CD2 
2075 N  N   . ASN C 87 ? 1.2061 1.4784 1.4715 -0.0697 -0.0767 -0.0292 212 ASN C N   
2076 C  CA  . ASN C 87 ? 1.2612 1.4863 1.5754 -0.0664 -0.0780 -0.0195 212 ASN C CA  
2077 C  C   . ASN C 87 ? 1.3403 1.5609 1.6671 -0.0757 -0.0823 0.0285  212 ASN C C   
2078 O  O   . ASN C 87 ? 1.3747 1.5605 1.7397 -0.0883 -0.0848 0.0355  212 ASN C O   
2079 C  CB  . ASN C 87 ? 1.2913 1.5040 1.6203 -0.0399 -0.0751 -0.0196 212 ASN C CB  
2080 C  CG  . ASN C 87 ? 1.6687 1.8604 2.0180 -0.0327 -0.0704 -0.0673 212 ASN C CG  
2081 O  OD1 . ASN C 87 ? 1.6138 1.7941 1.9713 -0.0482 -0.0694 -0.1029 212 ASN C OD1 
2082 N  ND2 . ASN C 87 ? 1.5969 1.7854 1.9570 -0.0089 -0.0672 -0.0701 212 ASN C ND2 
2083 N  N   . LEU C 88 ? 1.2773 1.5351 1.5729 -0.0705 -0.0827 0.0603  213 LEU C N   
2084 C  CA  . LEU C 88 ? 1.2820 1.5501 1.5808 -0.0785 -0.0855 0.1065  213 LEU C CA  
2085 C  C   . LEU C 88 ? 1.3609 1.6303 1.6648 -0.1049 -0.0872 0.1074  213 LEU C C   
2086 O  O   . LEU C 88 ? 1.3928 1.6395 1.7293 -0.1165 -0.0897 0.1328  213 LEU C O   
2087 C  CB  . LEU C 88 ? 1.2392 1.5551 1.4980 -0.0685 -0.0840 0.1272  213 LEU C CB  
2088 C  CG  . LEU C 88 ? 1.2912 1.6334 1.5432 -0.0785 -0.0851 0.1689  213 LEU C CG  
2089 C  CD1 . LEU C 88 ? 1.3184 1.6489 1.5955 -0.0703 -0.0879 0.2096  213 LEU C CD1 
2090 C  CD2 . LEU C 88 ? 1.2768 1.6688 1.4861 -0.0742 -0.0822 0.1702  213 LEU C CD2 
2091 N  N   . PHE C 89 ? 1.2976 1.5957 1.5717 -0.1148 -0.0863 0.0820  214 PHE C N   
2092 C  CA  . PHE C 89 ? 1.3033 1.6110 1.5801 -0.1397 -0.0885 0.0802  214 PHE C CA  
2093 C  C   . PHE C 89 ? 1.4097 1.6752 1.7264 -0.1558 -0.0910 0.0589  214 PHE C C   
2094 O  O   . PHE C 89 ? 1.4265 1.6830 1.7666 -0.1753 -0.0934 0.0773  214 PHE C O   
2095 C  CB  . PHE C 89 ? 1.2896 1.6403 1.5277 -0.1436 -0.0879 0.0595  214 PHE C CB  
2096 C  CG  . PHE C 89 ? 1.2703 1.6648 1.4780 -0.1374 -0.0859 0.0850  214 PHE C CG  
2097 C  CD1 . PHE C 89 ? 1.3097 1.7114 1.5231 -0.1352 -0.0847 0.1243  214 PHE C CD1 
2098 C  CD2 . PHE C 89 ? 1.2641 1.6947 1.4398 -0.1349 -0.0850 0.0696  214 PHE C CD2 
2099 C  CE1 . PHE C 89 ? 1.2881 1.7329 1.4748 -0.1300 -0.0818 0.1423  214 PHE C CE1 
2100 C  CE2 . PHE C 89 ? 1.2669 1.7350 1.4203 -0.1288 -0.0824 0.0897  214 PHE C CE2 
2101 C  CZ  . PHE C 89 ? 1.2434 1.7186 1.4020 -0.1264 -0.0804 0.1233  214 PHE C CZ  
2102 N  N   . ILE C 90 ? 1.3939 1.6340 1.7210 -0.1480 -0.0898 0.0199  215 ILE C N   
2103 C  CA  . ILE C 90 ? 1.4452 1.6427 1.8134 -0.1616 -0.0912 -0.0085 215 ILE C CA  
2104 C  C   . ILE C 90 ? 1.5443 1.6931 1.9640 -0.1607 -0.0925 0.0217  215 ILE C C   
2105 O  O   . ILE C 90 ? 1.5797 1.6972 2.0377 -0.1806 -0.0949 0.0172  215 ILE C O   
2106 C  CB  . ILE C 90 ? 1.4940 1.6871 1.8561 -0.1546 -0.0883 -0.0634 215 ILE C CB  
2107 C  CG1 . ILE C 90 ? 1.4766 1.7138 1.8020 -0.1706 -0.0900 -0.0913 215 ILE C CG1 
2108 C  CG2 . ILE C 90 ? 1.5621 1.7012 1.9762 -0.1591 -0.0877 -0.0929 215 ILE C CG2 
2109 C  CD1 . ILE C 90 ? 1.5659 1.8227 1.8663 -0.1616 -0.0867 -0.1360 215 ILE C CD1 
2110 N  N   . GLY C 91 ? 1.4961 1.6428 1.9164 -0.1391 -0.0915 0.0553  216 GLY C N   
2111 C  CA  . GLY C 91 ? 1.5322 1.6410 1.9979 -0.1349 -0.0936 0.0941  216 GLY C CA  
2112 C  C   . GLY C 91 ? 1.5929 1.7083 2.0704 -0.1567 -0.0966 0.1371  216 GLY C C   
2113 O  O   . GLY C 91 ? 1.6302 1.7045 2.1573 -0.1660 -0.0990 0.1578  216 GLY C O   
2114 N  N   . ILE C 92 ? 1.5133 1.6811 1.9477 -0.1653 -0.0960 0.1507  217 ILE C N   
2115 C  CA  . ILE C 92 ? 1.5141 1.7023 1.9522 -0.1867 -0.0973 0.1888  217 ILE C CA  
2116 C  C   . ILE C 92 ? 1.6039 1.7683 2.0733 -0.2155 -0.0996 0.1682  217 ILE C C   
2117 O  O   . ILE C 92 ? 1.6297 1.7786 2.1334 -0.2336 -0.1015 0.2000  217 ILE C O   
2118 C  CB  . ILE C 92 ? 1.4972 1.7502 1.8823 -0.1853 -0.0947 0.1997  217 ILE C CB  
2119 C  CG1 . ILE C 92 ? 1.4737 1.7498 1.8320 -0.1592 -0.0927 0.2201  217 ILE C CG1 
2120 C  CG2 . ILE C 92 ? 1.5055 1.7858 1.8948 -0.2082 -0.0946 0.2341  217 ILE C CG2 
2121 C  CD1 . ILE C 92 ? 1.5060 1.8352 1.8127 -0.1510 -0.0894 0.2085  217 ILE C CD1 
2122 N  N   . ILE C 93 ? 1.5601 1.7240 2.0186 -0.2205 -0.0998 0.1153  218 ILE C N   
2123 C  CA  . ILE C 93 ? 1.5888 1.7363 2.0724 -0.2478 -0.1027 0.0850  218 ILE C CA  
2124 C  C   . ILE C 93 ? 1.7109 1.7914 2.2585 -0.2551 -0.1042 0.0822  218 ILE C C   
2125 O  O   . ILE C 93 ? 1.7382 1.8017 2.3209 -0.2816 -0.1069 0.0903  218 ILE C O   
2126 C  CB  . ILE C 93 ? 1.6049 1.7763 2.0559 -0.2482 -0.1027 0.0294  218 ILE C CB  
2127 C  CG1 . ILE C 93 ? 1.5486 1.7840 1.9444 -0.2432 -0.1019 0.0384  218 ILE C CG1 
2128 C  CG2 . ILE C 93 ? 1.6506 1.8083 2.1277 -0.2771 -0.1065 -0.0076 218 ILE C CG2 
2129 C  CD1 . ILE C 93 ? 1.5953 1.8564 1.9525 -0.2310 -0.1009 -0.0019 218 ILE C CD1 
2130 N  N   . VAL C 94 ? 1.6915 1.7349 2.2577 -0.2314 -0.1023 0.0720  219 VAL C N   
2131 C  CA  . VAL C 94 ? 1.7535 1.7296 2.3855 -0.2324 -0.1031 0.0678  219 VAL C CA  
2132 C  C   . VAL C 94 ? 1.8318 1.7873 2.5005 -0.2360 -0.1055 0.1336  219 VAL C C   
2133 O  O   . VAL C 94 ? 1.8758 1.7907 2.5974 -0.2570 -0.1079 0.1424  219 VAL C O   
2134 C  CB  . VAL C 94 ? 1.8145 1.7623 2.4565 -0.2037 -0.0996 0.0341  219 VAL C CB  
2135 C  CG1 . VAL C 94 ? 1.8804 1.7562 2.5968 -0.2050 -0.1000 0.0224  219 VAL C CG1 
2136 C  CG2 . VAL C 94 ? 1.7863 1.7640 2.3871 -0.2012 -0.0967 -0.0264 219 VAL C CG2 
2137 N  N   . ASP C 95 ? 1.7585 1.7446 2.3996 -0.2168 -0.1049 0.1796  220 ASP C N   
2138 C  CA  . ASP C 95 ? 2.1990 2.1785 2.8667 -0.2180 -0.1072 0.2464  220 ASP C CA  
2139 C  C   . ASP C 95 ? 2.4712 2.4790 3.1364 -0.2484 -0.1082 0.2795  220 ASP C C   
2140 O  O   . ASP C 95 ? 1.8808 1.9467 2.4957 -0.2537 -0.1062 0.2807  220 ASP C O   
2141 C  CB  . ASP C 95 ? 2.1895 2.2027 2.8239 -0.1894 -0.1066 0.2800  220 ASP C CB  
2142 C  CG  . ASP C 95 ? 2.3360 2.3126 2.9948 -0.1600 -0.1069 0.2684  220 ASP C CG  
2143 O  OD1 . ASP C 95 ? 2.3964 2.3247 3.1138 -0.1565 -0.1099 0.2949  220 ASP C OD1 
2144 O  OD2 . ASP C 95 ? 2.3672 2.3653 2.9888 -0.1399 -0.1040 0.2358  220 ASP C OD2 
2145 N  N   . GLY D 5  ? 2.1197 1.6334 1.5603 0.3660  -0.0925 -0.0513 130 GLY D N   
2146 C  CA  . GLY D 5  ? 2.1129 1.6041 1.5688 0.3173  -0.0841 -0.0195 130 GLY D CA  
2147 C  C   . GLY D 5  ? 2.0433 1.6443 1.5552 0.2912  -0.0681 -0.0064 130 GLY D C   
2148 O  O   . GLY D 5  ? 1.9689 1.6299 1.5189 0.2651  -0.0656 -0.0197 130 GLY D O   
2149 N  N   . VAL D 6  ? 1.9814 1.6061 1.4948 0.3006  -0.0581 0.0191  131 VAL D N   
2150 C  CA  . VAL D 6  ? 1.8784 1.5999 1.4376 0.2815  -0.0441 0.0300  131 VAL D CA  
2151 C  C   . VAL D 6  ? 1.8405 1.6598 1.4252 0.3106  -0.0431 0.0111  131 VAL D C   
2152 O  O   . VAL D 6  ? 1.7506 1.6467 1.3783 0.2859  -0.0360 0.0073  131 VAL D O   
2153 C  CB  . VAL D 6  ? 1.9464 1.6547 1.4924 0.2841  -0.0352 0.0662  131 VAL D CB  
2154 C  CG1 . VAL D 6  ? 1.8466 1.6517 1.4357 0.2674  -0.0225 0.0771  131 VAL D CG1 
2155 C  CG2 . VAL D 6  ? 2.0221 1.6375 1.5456 0.2506  -0.0340 0.0906  131 VAL D CG2 
2156 N  N   . GLY D 7  ? 1.8212 1.6356 1.3786 0.3623  -0.0503 -0.0019 132 GLY D N   
2157 C  CA  . GLY D 7  ? 1.7527 1.6577 1.3314 0.3934  -0.0498 -0.0213 132 GLY D CA  
2158 C  C   . GLY D 7  ? 1.7315 1.6822 1.3380 0.3773  -0.0497 -0.0450 132 GLY D C   
2159 O  O   . GLY D 7  ? 1.6455 1.6884 1.2911 0.3713  -0.0428 -0.0503 132 GLY D O   
2160 N  N   . SER D 8  ? 1.7239 1.6069 1.3084 0.3688  -0.0580 -0.0588 133 SER D N   
2161 C  CA  . SER D 8  ? 1.6815 1.5946 1.2840 0.3543  -0.0596 -0.0818 133 SER D CA  
2162 C  C   . SER D 8  ? 1.6273 1.5900 1.2750 0.3021  -0.0507 -0.0723 133 SER D C   
2163 O  O   . SER D 8  ? 1.5613 1.5896 1.2365 0.2941  -0.0470 -0.0858 133 SER D O   
2164 C  CB  . SER D 8  ? 1.8164 1.6341 1.3794 0.3564  -0.0734 -0.0981 133 SER D CB  
2165 O  OG  . SER D 8  ? 1.9704 1.7134 1.5264 0.3149  -0.0762 -0.0815 133 SER D OG  
2166 N  N   . VAL D 9  ? 1.5688 1.5005 1.2221 0.2689  -0.0466 -0.0480 134 VAL D N   
2167 C  CA  . VAL D 9  ? 1.4918 1.4649 1.1843 0.2221  -0.0380 -0.0356 134 VAL D CA  
2168 C  C   . VAL D 9  ? 1.4299 1.4927 1.1541 0.2266  -0.0271 -0.0266 134 VAL D C   
2169 O  O   . VAL D 9  ? 1.3610 1.4851 1.1190 0.2045  -0.0217 -0.0302 134 VAL D O   
2170 C  CB  . VAL D 9  ? 1.5875 1.4935 1.2714 0.1878  -0.0373 -0.0126 134 VAL D CB  
2171 C  CG1 . VAL D 9  ? 1.5186 1.4770 1.2427 0.1460  -0.0265 0.0035  134 VAL D CG1 
2172 C  CG2 . VAL D 9  ? 1.6614 1.4836 1.3207 0.1740  -0.0501 -0.0249 134 VAL D CG2 
2173 N  N   . ALA D 10 ? 1.3710 1.4387 1.0818 0.2562  -0.0256 -0.0158 135 ALA D N   
2174 C  CA  . ALA D 10 ? 1.2909 1.4374 1.0273 0.2633  -0.0186 -0.0089 135 ALA D CA  
2175 C  C   . ALA D 10 ? 1.2541 1.4766 1.0151 0.2749  -0.0181 -0.0296 135 ALA D C   
2176 O  O   . ALA D 10 ? 1.1829 1.4712 0.9769 0.2575  -0.0120 -0.0273 135 ALA D O   
2177 C  CB  . ALA D 10 ? 1.3368 1.4680 1.0480 0.2985  -0.0206 0.0025  135 ALA D CB  
2178 N  N   . ALA D 11 ? 1.2144 1.4257 0.9576 0.3040  -0.0244 -0.0492 136 ALA D N   
2179 C  CA  . ALA D 11 ? 1.1556 1.4375 0.9186 0.3172  -0.0226 -0.0680 136 ALA D CA  
2180 C  C   . ALA D 11 ? 1.1259 1.4263 0.9106 0.2822  -0.0191 -0.0750 136 ALA D C   
2181 O  O   . ALA D 11 ? 1.0565 1.4286 0.8714 0.2727  -0.0127 -0.0780 136 ALA D O   
2182 C  CB  . ALA D 11 ? 1.2229 1.4825 0.9553 0.3611  -0.0298 -0.0863 136 ALA D CB  
2183 N  N   . LEU D 12 ? 1.0953 1.3300 0.8642 0.2617  -0.0238 -0.0767 137 LEU D N   
2184 C  CA  . LEU D 12 ? 1.0559 1.2994 0.8407 0.2294  -0.0231 -0.0839 137 LEU D CA  
2185 C  C   . LEU D 12 ? 0.9918 1.2901 0.8133 0.1970  -0.0140 -0.0697 137 LEU D C   
2186 O  O   . LEU D 12 ? 0.9381 1.2821 0.7793 0.1839  -0.0106 -0.0772 137 LEU D O   
2187 C  CB  . LEU D 12 ? 1.1206 1.2802 0.8833 0.2104  -0.0318 -0.0847 137 LEU D CB  
2188 C  CG  . LEU D 12 ? 1.1774 1.3358 0.9475 0.1853  -0.0361 -0.0987 137 LEU D CG  
2189 C  CD1 . LEU D 12 ? 1.2598 1.3474 0.9928 0.2002  -0.0498 -0.1190 137 LEU D CD1 
2190 C  CD2 . LEU D 12 ? 1.1823 1.3358 0.9746 0.1405  -0.0336 -0.0828 137 LEU D CD2 
2191 N  N   . LEU D 13 ? 0.9210 1.2133 0.7480 0.1870  -0.0103 -0.0493 138 LEU D N   
2192 C  CA  . LEU D 13 ? 0.8473 1.1863 0.7037 0.1614  -0.0025 -0.0359 138 LEU D CA  
2193 C  C   . LEU D 13 ? 0.8178 1.2301 0.6949 0.1734  0.0017  -0.0398 138 LEU D C   
2194 O  O   . LEU D 13 ? 0.7646 1.2190 0.6654 0.1526  0.0065  -0.0373 138 LEU D O   
2195 C  CB  . LEU D 13 ? 0.8590 1.1691 0.7100 0.1516  0.0003  -0.0135 138 LEU D CB  
2196 C  CG  . LEU D 13 ? 0.8591 1.2100 0.7350 0.1273  0.0078  0.0006  138 LEU D CG  
2197 C  CD1 . LEU D 13 ? 0.8422 1.1922 0.7334 0.0937  0.0094  0.0008  138 LEU D CD1 
2198 C  CD2 . LEU D 13 ? 0.9001 1.2328 0.7655 0.1306  0.0113  0.0214  138 LEU D CD2 
2199 N  N   . THR D 14 ? 0.7624 1.1896 0.6306 0.2064  -0.0007 -0.0458 139 THR D N   
2200 C  CA  . THR D 14 ? 0.7067 1.2061 0.5965 0.2174  0.0021  -0.0500 139 THR D CA  
2201 C  C   . THR D 14 ? 0.7001 1.2388 0.6022 0.2150  0.0052  -0.0647 139 THR D C   
2202 O  O   . THR D 14 ? 0.6476 1.2446 0.5749 0.2040  0.0100  -0.0641 139 THR D O   
2203 C  CB  . THR D 14 ? 0.8702 1.3753 0.7469 0.2544  -0.0023 -0.0512 139 THR D CB  
2204 O  OG1 . THR D 14 ? 0.9084 1.3650 0.7659 0.2572  -0.0048 -0.0361 139 THR D OG1 
2205 C  CG2 . THR D 14 ? 0.8121 1.3954 0.7156 0.2611  -0.0010 -0.0531 139 THR D CG2 
2206 N  N   . VAL D 15 ? 0.6749 1.1786 0.5566 0.2250  0.0020  -0.0774 140 VAL D N   
2207 C  CA  . VAL D 15 ? 0.6538 1.1880 0.5397 0.2261  0.0048  -0.0917 140 VAL D CA  
2208 C  C   . VAL D 15 ? 0.6418 1.1839 0.5440 0.1895  0.0084  -0.0867 140 VAL D C   
2209 O  O   . VAL D 15 ? 0.6151 1.2106 0.5365 0.1804  0.0148  -0.0871 140 VAL D O   
2210 C  CB  . VAL D 15 ? 0.7683 1.2549 0.6212 0.2508  -0.0020 -0.1088 140 VAL D CB  
2211 C  CG1 . VAL D 15 ? 0.7601 1.2729 0.6130 0.2497  0.0007  -0.1233 140 VAL D CG1 
2212 C  CG2 . VAL D 15 ? 0.8030 1.2916 0.6391 0.2936  -0.0050 -0.1150 140 VAL D CG2 
2213 N  N   . VAL D 16 ? 0.5809 1.0717 0.4760 0.1686  0.0045  -0.0806 141 VAL D N   
2214 C  CA  . VAL D 16 ? 0.5393 1.0341 0.4483 0.1359  0.0064  -0.0754 141 VAL D CA  
2215 C  C   . VAL D 16 ? 0.5183 1.0618 0.4528 0.1208  0.0133  -0.0626 141 VAL D C   
2216 O  O   . VAL D 16 ? 0.4813 1.0559 0.4283 0.1061  0.0170  -0.0633 141 VAL D O   
2217 C  CB  . VAL D 16 ? 0.6188 1.0536 0.5177 0.1178  0.0006  -0.0699 141 VAL D CB  
2218 C  CG1 . VAL D 16 ? 0.5798 1.0297 0.4991 0.0869  0.0044  -0.0565 141 VAL D CG1 
2219 C  CG2 . VAL D 16 ? 0.6605 1.0550 0.5395 0.1196  -0.0080 -0.0869 141 VAL D CG2 
2220 N  N   . PHE D 17 ? 0.4635 1.0106 0.4020 0.1265  0.0140  -0.0518 142 PHE D N   
2221 C  CA  . PHE D 17 ? 0.4152 1.0009 0.3733 0.1149  0.0179  -0.0414 142 PHE D CA  
2222 C  C   . PHE D 17 ? 0.4338 1.0757 0.4074 0.1200  0.0212  -0.0469 142 PHE D C   
2223 O  O   . PHE D 17 ? 0.3990 1.0687 0.3881 0.1025  0.0241  -0.0415 142 PHE D O   
2224 C  CB  . PHE D 17 ? 0.4415 1.0137 0.3950 0.1230  0.0160  -0.0302 142 PHE D CB  
2225 C  CG  . PHE D 17 ? 0.4381 1.0081 0.3987 0.1032  0.0182  -0.0168 142 PHE D CG  
2226 C  CD1 . PHE D 17 ? 0.4999 1.0297 0.4512 0.0923  0.0189  -0.0071 142 PHE D CD1 
2227 C  CD2 . PHE D 17 ? 0.4251 1.0333 0.4008 0.0954  0.0193  -0.0138 142 PHE D CD2 
2228 C  CE1 . PHE D 17 ? 0.4911 1.0258 0.4485 0.0775  0.0222  0.0056  142 PHE D CE1 
2229 C  CE2 . PHE D 17 ? 0.4492 1.0541 0.4270 0.0822  0.0207  -0.0030 142 PHE D CE2 
2230 C  CZ  . PHE D 17 ? 0.4449 1.0165 0.4138 0.0749  0.0229  0.0068  142 PHE D CZ  
2231 N  N   . TYR D 18 ? 0.4036 1.0629 0.3728 0.1440  0.0209  -0.0569 143 TYR D N   
2232 C  CA  . TYR D 18 ? 0.3827 1.1029 0.3698 0.1473  0.0256  -0.0607 143 TYR D CA  
2233 C  C   . TYR D 18 ? 0.4044 1.1397 0.3940 0.1333  0.0314  -0.0644 143 TYR D C   
2234 O  O   . TYR D 18 ? 0.3815 1.1581 0.3887 0.1188  0.0366  -0.0595 143 TYR D O   
2235 C  CB  . TYR D 18 ? 0.4312 1.1746 0.4143 0.1799  0.0244  -0.0697 143 TYR D CB  
2236 C  CG  . TYR D 18 ? 0.4612 1.2731 0.4636 0.1829  0.0313  -0.0739 143 TYR D CG  
2237 C  CD1 . TYR D 18 ? 0.4641 1.3287 0.4938 0.1706  0.0301  -0.0672 143 TYR D CD1 
2238 C  CD2 . TYR D 18 ? 0.4852 1.3102 0.4780 0.1971  0.0362  -0.0843 143 TYR D CD2 
2239 C  CE1 . TYR D 18 ? 0.4612 1.3915 0.5116 0.1687  0.0401  -0.0684 143 TYR D CE1 
2240 C  CE2 . TYR D 18 ? 0.4768 1.3701 0.4877 0.1991  0.0450  -0.0855 143 TYR D CE2 
2241 C  CZ  . TYR D 18 ? 0.5208 1.4675 0.5623 0.1830  0.0475  -0.0763 143 TYR D CZ  
2242 O  OH  . TYR D 18 ? 0.4821 1.4986 0.5444 0.1807  0.0570  -0.0750 143 TYR D OH  
2243 N  N   . ILE D 19 ? 0.3557 1.0552 0.3261 0.1372  0.0295  -0.0727 144 ILE D N   
2244 C  CA  . ILE D 19 ? 0.3392 1.0488 0.3060 0.1282  0.0333  -0.0778 144 ILE D CA  
2245 C  C   . ILE D 19 ? 0.3622 1.0698 0.3388 0.0993  0.0346  -0.0673 144 ILE D C   
2246 O  O   . ILE D 19 ? 0.3365 1.0747 0.3194 0.0892  0.0405  -0.0645 144 ILE D O   
2247 C  CB  . ILE D 19 ? 0.4127 1.0817 0.3536 0.1426  0.0276  -0.0927 144 ILE D CB  
2248 C  CG1 . ILE D 19 ? 0.4465 1.1291 0.3753 0.1766  0.0281  -0.1048 144 ILE D CG1 
2249 C  CG2 . ILE D 19 ? 0.4122 1.0845 0.3467 0.1306  0.0288  -0.0978 144 ILE D CG2 
2250 C  CD1 . ILE D 19 ? 0.5989 1.2247 0.4981 0.1957  0.0188  -0.1189 144 ILE D CD1 
2251 N  N   . ALA D 20 ? 0.3195 0.9919 0.2957 0.0877  0.0297  -0.0606 145 ALA D N   
2252 C  CA  . ALA D 20 ? 0.2973 0.9677 0.2810 0.0648  0.0303  -0.0512 145 ALA D CA  
2253 C  C   . ALA D 20 ? 0.3476 1.0514 0.3469 0.0560  0.0343  -0.0416 145 ALA D C   
2254 O  O   . ALA D 20 ? 0.3210 1.0369 0.3235 0.0420  0.0370  -0.0370 145 ALA D O   
2255 C  CB  . ALA D 20 ? 0.3162 0.9484 0.2966 0.0572  0.0255  -0.0454 145 ALA D CB  
2256 N  N   . ALA D 21 ? 0.3292 1.0464 0.3363 0.0649  0.0334  -0.0393 146 ALA D N   
2257 C  CA  . ALA D 21 ? 0.3095 1.0566 0.3318 0.0557  0.0341  -0.0324 146 ALA D CA  
2258 C  C   . ALA D 21 ? 0.3611 1.1502 0.3939 0.0502  0.0403  -0.0329 146 ALA D C   
2259 O  O   . ALA D 21 ? 0.3509 1.1542 0.3930 0.0333  0.0412  -0.0258 146 ALA D O   
2260 C  CB  . ALA D 21 ? 0.3194 1.0717 0.3462 0.0683  0.0295  -0.0320 146 ALA D CB  
2261 N  N   . VAL D 22 ? 0.3085 1.1156 0.3378 0.0645  0.0447  -0.0408 147 VAL D N   
2262 C  CA  . VAL D 22 ? 0.2953 1.1459 0.3329 0.0600  0.0532  -0.0394 147 VAL D CA  
2263 C  C   . VAL D 22 ? 0.3389 1.1733 0.3655 0.0448  0.0563  -0.0349 147 VAL D C   
2264 O  O   . VAL D 22 ? 0.3148 1.1662 0.3479 0.0275  0.0608  -0.0253 147 VAL D O   
2265 C  CB  . VAL D 22 ? 0.3531 1.2307 0.3867 0.0848  0.0577  -0.0499 147 VAL D CB  
2266 C  CG1 . VAL D 22 ? 0.3414 1.2642 0.3797 0.0801  0.0690  -0.0466 147 VAL D CG1 
2267 C  CG2 . VAL D 22 ? 0.3541 1.2557 0.3999 0.1019  0.0544  -0.0534 147 VAL D CG2 
2268 N  N   . MET D 23 ? 0.3101 1.1092 0.3192 0.0508  0.0400  -0.0416 148 MET D N   
2269 C  CA  . MET D 23 ? 0.3153 1.1011 0.3126 0.0407  0.0533  -0.0397 148 MET D CA  
2270 C  C   . MET D 23 ? 0.3005 1.0758 0.3025 0.0213  0.0517  -0.0278 148 MET D C   
2271 O  O   . MET D 23 ? 0.2751 1.0602 0.2731 0.0114  0.0561  -0.0206 148 MET D O   
2272 C  CB  . MET D 23 ? 0.3803 1.1331 0.3613 0.0493  0.0469  -0.0510 148 MET D CB  
2273 C  CG  . MET D 23 ? 0.4736 1.2370 0.4385 0.0582  0.0498  -0.0596 148 MET D CG  
2274 S  SD  . MET D 23 ? 0.5809 1.3730 0.5389 0.0850  0.0554  -0.0715 148 MET D SD  
2275 C  CE  . MET D 23 ? 0.5243 1.3732 0.4904 0.0773  0.0702  -0.0584 148 MET D CE  
2276 N  N   . ALA D 24 ? 0.2409 0.9969 0.2490 0.0182  0.0458  -0.0250 149 ALA D N   
2277 C  CA  . ALA D 24 ? 0.2191 0.9626 0.2287 0.0048  0.0430  -0.0156 149 ALA D CA  
2278 C  C   . ALA D 24 ? 0.2494 1.0126 0.2669 -0.0070 0.0457  -0.0078 149 ALA D C   
2279 O  O   . ALA D 24 ? 0.2510 1.0040 0.2613 -0.0179 0.0457  -0.0005 149 ALA D O   
2280 C  CB  . ALA D 24 ? 0.2216 0.9444 0.2336 0.0080  0.0372  -0.0150 149 ALA D CB  
2281 N  N   . THR D 25 ? 0.1919 0.9833 0.2235 -0.0050 0.0475  -0.0093 150 THR D N   
2282 C  CA  . THR D 25 ? 0.1867 1.0016 0.2303 -0.0202 0.0495  -0.0022 150 THR D CA  
2283 C  C   . THR D 25 ? 0.2862 1.1165 0.3242 -0.0288 0.0590  0.0046  150 THR D C   
2284 O  O   . THR D 25 ? 0.3126 1.1393 0.3495 -0.0466 0.0601  0.0148  150 THR D O   
2285 C  CB  . THR D 25 ? 0.1914 1.0429 0.2547 -0.0142 0.0490  -0.0066 150 THR D CB  
2286 O  OG1 . THR D 25 ? 0.1889 1.0246 0.2518 -0.0009 0.0410  -0.0127 150 THR D OG1 
2287 C  CG2 . THR D 25 ? 0.1265 1.0040 0.2071 -0.0341 0.0483  0.0000  150 THR D CG2 
2288 N  N   . ASN D 26 ? 0.2332 1.0779 0.2645 -0.0152 0.0654  -0.0010 151 ASN D N   
2289 C  CA  . ASN D 26 ? 0.2381 1.1009 0.2604 -0.0192 0.0755  0.0055  151 ASN D CA  
2290 C  C   . ASN D 26 ? 0.2995 1.1303 0.3012 -0.0261 0.0741  0.0120  151 ASN D C   
2291 O  O   . ASN D 26 ? 0.3156 1.1519 0.3110 -0.0387 0.0804  0.0244  151 ASN D O   
2292 C  CB  . ASN D 26 ? 0.2452 1.1319 0.2617 0.0014  0.0815  -0.0046 151 ASN D CB  
2293 C  CG  . ASN D 26 ? 0.4304 1.3459 0.4381 -0.0008 0.0938  0.0033  151 ASN D CG  
2294 O  OD1 . ASN D 26 ? 0.3688 1.2700 0.3542 0.0054  0.0949  0.0018  151 ASN D OD1 
2295 N  ND2 . ASN D 26 ? 0.2671 1.2255 0.2926 -0.0116 0.1031  0.0133  151 ASN D ND2 
2296 N  N   . LEU D 27 ? 0.2438 1.0429 0.2351 -0.0182 0.0660  0.0049  152 LEU D N   
2297 C  CA  . LEU D 27 ? 0.2479 1.0225 0.2208 -0.0211 0.0634  0.0096  152 LEU D CA  
2298 C  C   . LEU D 27 ? 0.2909 1.0401 0.2623 -0.0327 0.0579  0.0186  152 LEU D C   
2299 O  O   . LEU D 27 ? 0.2918 1.0292 0.2489 -0.0400 0.0595  0.0290  152 LEU D O   
2300 C  CB  . LEU D 27 ? 0.2472 1.0063 0.2119 -0.0089 0.0568  -0.0022 152 LEU D CB  
2301 C  CG  . LEU D 27 ? 0.3053 1.0769 0.2656 0.0054  0.0581  -0.0154 152 LEU D CG  
2302 C  CD1 . LEU D 27 ? 0.3004 1.0498 0.2537 0.0108  0.0486  -0.0262 152 LEU D CD1 
2303 C  CD2 . LEU D 27 ? 0.3378 1.1331 0.2846 0.0095  0.0669  -0.0127 152 LEU D CD2 
2304 N  N   . TYR D 28 ? 0.2291 0.9676 0.2117 -0.0323 0.0511  0.0145  153 TYR D N   
2305 C  CA  . TYR D 28 ? 0.2315 0.9441 0.2091 -0.0379 0.0444  0.0195  153 TYR D CA  
2306 C  C   . TYR D 28 ? 0.2983 1.0114 0.2858 -0.0500 0.0417  0.0234  153 TYR D C   
2307 O  O   . TYR D 28 ? 0.3206 1.0082 0.3001 -0.0536 0.0347  0.0260  153 TYR D O   
2308 C  CB  . TYR D 28 ? 0.2370 0.9361 0.2156 -0.0275 0.0382  0.0131  153 TYR D CB  
2309 C  CG  . TYR D 28 ? 0.2665 0.9681 0.2412 -0.0191 0.0388  0.0070  153 TYR D CG  
2310 C  CD1 . TYR D 28 ? 0.3008 0.9991 0.2611 -0.0178 0.0388  0.0093  153 TYR D CD1 
2311 C  CD2 . TYR D 28 ? 0.2729 0.9767 0.2567 -0.0126 0.0374  -0.0012 153 TYR D CD2 
2312 C  CE1 . TYR D 28 ? 0.3225 1.0247 0.2805 -0.0117 0.0365  0.0018  153 TYR D CE1 
2313 C  CE2 . TYR D 28 ? 0.2879 0.9893 0.2681 -0.0082 0.0356  -0.0080 153 TYR D CE2 
2314 C  CZ  . TYR D 28 ? 0.4039 1.1066 0.3727 -0.0086 0.0345  -0.0073 153 TYR D CZ  
2315 O  OH  . TYR D 28 ? 0.4350 1.1376 0.4017 -0.0059 0.0302  -0.0157 153 TYR D OH  
2316 N  N   . GLY D 29 ? 0.2306 0.9744 0.2347 -0.0554 0.0464  0.0227  154 GLY D N   
2317 C  CA  . GLY D 29 ? 0.2298 0.9828 0.2485 -0.0688 0.0426  0.0246  154 GLY D CA  
2318 C  C   . GLY D 29 ? 0.3010 1.0336 0.3111 -0.0886 0.0404  0.0351  154 GLY D C   
2319 O  O   . GLY D 29 ? 0.3078 1.0207 0.3179 -0.0960 0.0304  0.0336  154 GLY D O   
2320 N  N   . ALA D 30 ? 0.2639 0.9988 0.2641 -0.0968 0.0494  0.0459  155 ALA D N   
2321 C  CA  . ALA D 30 ? 0.2865 0.9983 0.2751 -0.1174 0.0494  0.0592  155 ALA D CA  
2322 C  C   . ALA D 30 ? 0.3414 0.9987 0.3023 -0.1128 0.0399  0.0608  155 ALA D C   
2323 O  O   . ALA D 30 ? 0.3462 0.9721 0.2989 -0.1279 0.0324  0.0657  155 ALA D O   
2324 C  CB  . ALA D 30 ? 0.3109 1.0416 0.2928 -0.1232 0.0634  0.0718  155 ALA D CB  
2325 N  N   . THR D 31 ? 0.3062 0.9535 0.2527 -0.0916 0.0395  0.0559  156 THR D N   
2326 C  CA  . THR D 31 ? 0.3253 0.9320 0.2460 -0.0795 0.0320  0.0562  156 THR D CA  
2327 C  C   . THR D 31 ? 0.3687 0.9600 0.2915 -0.0710 0.0211  0.0463  156 THR D C   
2328 O  O   . THR D 31 ? 0.3906 0.9441 0.2916 -0.0661 0.0130  0.0475  156 THR D O   
2329 C  CB  . THR D 31 ? 0.4158 1.0308 0.3259 -0.0619 0.0363  0.0548  156 THR D CB  
2330 O  OG1 . THR D 31 ? 0.4191 1.0728 0.3486 -0.0579 0.0429  0.0477  156 THR D OG1 
2331 C  CG2 . THR D 31 ? 0.4111 1.0108 0.2964 -0.0633 0.0408  0.0673  156 THR D CG2 
2332 N  N   . PHE D 32 ? 0.2855 0.9049 0.2310 -0.0662 0.0210  0.0368  157 PHE D N   
2333 C  CA  . PHE D 32 ? 0.2673 0.8791 0.2154 -0.0562 0.0125  0.0282  157 PHE D CA  
2334 C  C   . PHE D 32 ? 0.2889 0.9237 0.2597 -0.0645 0.0097  0.0226  157 PHE D C   
2335 O  O   . PHE D 32 ? 0.2724 0.9328 0.2585 -0.0555 0.0126  0.0170  157 PHE D O   
2336 C  CB  . PHE D 32 ? 0.2665 0.8875 0.2152 -0.0379 0.0150  0.0238  157 PHE D CB  
2337 C  CG  . PHE D 32 ? 0.3010 0.9057 0.2299 -0.0283 0.0152  0.0279  157 PHE D CG  
2338 C  CD1 . PHE D 32 ? 0.3472 0.9628 0.2732 -0.0283 0.0216  0.0313  157 PHE D CD1 
2339 C  CD2 . PHE D 32 ? 0.3276 0.9090 0.2392 -0.0165 0.0084  0.0275  157 PHE D CD2 
2340 C  CE1 . PHE D 32 ? 0.3635 0.9677 0.2709 -0.0179 0.0202  0.0346  157 PHE D CE1 
2341 C  CE2 . PHE D 32 ? 0.3692 0.9411 0.2632 -0.0048 0.0081  0.0309  157 PHE D CE2 
2342 C  CZ  . PHE D 32 ? 0.3503 0.9342 0.2431 -0.0061 0.0136  0.0346  157 PHE D CZ  
2343 N  N   . PRO D 33 ? 0.2163 0.8413 0.1886 -0.0822 0.0031  0.0241  158 PRO D N   
2344 C  CA  . PRO D 33 ? 0.2047 0.8580 0.2009 -0.0909 -0.0014 0.0181  158 PRO D CA  
2345 C  C   . PRO D 33 ? 0.2840 0.9378 0.2815 -0.0748 -0.0104 0.0075  158 PRO D C   
2346 O  O   . PRO D 33 ? 0.2694 0.9564 0.2868 -0.0715 -0.0104 0.0023  158 PRO D O   
2347 C  CB  . PRO D 33 ? 0.2530 0.8891 0.2479 -0.1161 -0.0087 0.0222  158 PRO D CB  
2348 C  CG  . PRO D 33 ? 0.3231 0.9211 0.2922 -0.1200 -0.0056 0.0324  158 PRO D CG  
2349 C  CD  . PRO D 33 ? 0.2488 0.8347 0.2004 -0.0953 -0.0017 0.0313  158 PRO D CD  
2350 N  N   . GLU D 34 ? 0.2762 0.8950 0.2507 -0.0627 -0.0179 0.0047  159 GLU D N   
2351 C  CA  . GLU D 34 ? 0.2793 0.8975 0.2501 -0.0460 -0.0256 -0.0036 159 GLU D CA  
2352 C  C   . GLU D 34 ? 0.3078 0.9506 0.2886 -0.0295 -0.0172 -0.0037 159 GLU D C   
2353 O  O   . GLU D 34 ? 0.2999 0.9565 0.2868 -0.0201 -0.0216 -0.0089 159 GLU D O   
2354 C  CB  . GLU D 34 ? 0.3256 0.9044 0.2667 -0.0334 -0.0331 -0.0054 159 GLU D CB  
2355 C  CG  . GLU D 34 ? 0.5578 1.1090 0.4863 -0.0421 -0.0492 -0.0128 159 GLU D CG  
2356 C  CD  . GLU D 34 ? 0.9603 1.4925 0.8663 -0.0205 -0.0596 -0.0216 159 GLU D CD  
2357 O  OE1 . GLU D 34 ? 0.6444 1.1872 0.5452 0.0010  -0.0523 -0.0194 159 GLU D OE1 
2358 O  OE2 . GLU D 34 ? 1.0784 1.5851 0.9710 -0.0257 -0.0753 -0.0305 159 GLU D OE2 
2359 N  N   . TRP D 35 ? 0.2626 0.9088 0.2435 -0.0261 -0.0064 0.0019  160 TRP D N   
2360 C  CA  . TRP D 35 ? 0.2401 0.9010 0.2280 -0.0134 0.0008  0.0022  160 TRP D CA  
2361 C  C   . TRP D 35 ? 0.2386 0.9257 0.2440 -0.0175 0.0079  0.0015  160 TRP D C   
2362 O  O   . TRP D 35 ? 0.2149 0.9112 0.2260 -0.0065 0.0105  -0.0006 160 TRP D O   
2363 C  CB  . TRP D 35 ? 0.2306 0.8785 0.2069 -0.0061 0.0060  0.0068  160 TRP D CB  
2364 C  CG  . TRP D 35 ? 0.2639 0.8905 0.2210 0.0027  0.0009  0.0079  160 TRP D CG  
2365 C  CD1 . TRP D 35 ? 0.3127 0.9306 0.2599 0.0123  -0.0064 0.0046  160 TRP D CD1 
2366 C  CD2 . TRP D 35 ? 0.2712 0.8866 0.2151 0.0075  0.0030  0.0120  160 TRP D CD2 
2367 N  NE1 . TRP D 35 ? 0.3205 0.9212 0.2477 0.0232  -0.0084 0.0061  160 TRP D NE1 
2368 C  CE2 . TRP D 35 ? 0.3334 0.9335 0.2593 0.0207  -0.0027 0.0109  160 TRP D CE2 
2369 C  CE3 . TRP D 35 ? 0.2845 0.9029 0.2281 0.0039  0.0083  0.0156  160 TRP D CE3 
2370 C  CZ2 . TRP D 35 ? 0.3341 0.9243 0.2434 0.0316  -0.0027 0.0138  160 TRP D CZ2 
2371 C  CZ3 . TRP D 35 ? 0.3110 0.9199 0.2392 0.0134  0.0074  0.0186  160 TRP D CZ3 
2372 C  CH2 . TRP D 35 ? 0.3325 0.9284 0.2444 0.0276  0.0023  0.0178  160 TRP D CH2 
2373 N  N   . PHE D 36 ? 0.1816 0.8783 0.1923 -0.0314 0.0118  0.0041  161 PHE D N   
2374 C  CA  . PHE D 36 ? 0.1629 0.8878 0.1870 -0.0320 0.0200  0.0032  161 PHE D CA  
2375 C  C   . PHE D 36 ? 0.2367 0.9887 0.2753 -0.0471 0.0221  0.0052  161 PHE D C   
2376 O  O   . PHE D 36 ? 0.2390 1.0160 0.2850 -0.0466 0.0307  0.0059  161 PHE D O   
2377 C  CB  . PHE D 36 ? 0.1759 0.8931 0.1901 -0.0289 0.0272  0.0056  161 PHE D CB  
2378 C  CG  . PHE D 36 ? 0.1871 0.8868 0.1933 -0.0171 0.0262  0.0040  161 PHE D CG  
2379 C  CD1 . PHE D 36 ? 0.2057 0.9094 0.2176 -0.0062 0.0269  -0.0006 161 PHE D CD1 
2380 C  CD2 . PHE D 36 ? 0.2086 0.8885 0.2016 -0.0167 0.0245  0.0079  161 PHE D CD2 
2381 C  CE1 . PHE D 36 ? 0.2122 0.8995 0.2184 0.0002  0.0265  0.0003  161 PHE D CE1 
2382 C  CE2 . PHE D 36 ? 0.2290 0.9009 0.2191 -0.0084 0.0244  0.0078  161 PHE D CE2 
2383 C  CZ  . PHE D 36 ? 0.2014 0.8768 0.1991 -0.0023 0.0257  0.0048  161 PHE D CZ  
2384 N  N   . GLY D 37 ? 0.2076 0.9567 0.2502 -0.0602 0.0140  0.0057  162 GLY D N   
2385 C  CA  . GLY D 37 ? 0.2134 0.9893 0.2730 -0.0806 0.0150  0.0093  162 GLY D CA  
2386 C  C   . GLY D 37 ? 0.2486 1.0776 0.3342 -0.0777 0.0193  0.0056  162 GLY D C   
2387 O  O   . GLY D 37 ? 0.2597 1.1210 0.3616 -0.0946 0.0246  0.0111  162 GLY D O   
2388 N  N   . ASP D 38 ? 0.1793 1.0182 0.2678 -0.0558 0.0170  -0.0027 163 ASP D N   
2389 C  CA  . ASP D 38 ? 0.1657 1.0520 0.2741 -0.0441 0.0199  -0.0080 163 ASP D CA  
2390 C  C   . ASP D 38 ? 0.1968 1.0698 0.2940 -0.0162 0.0199  -0.0144 163 ASP D C   
2391 O  O   . ASP D 38 ? 0.1986 1.0311 0.2778 -0.0099 0.0163  -0.0140 163 ASP D O   
2392 C  CB  . ASP D 38 ? 0.1927 1.1133 0.3239 -0.0537 0.0098  -0.0120 163 ASP D CB  
2393 C  CG  . ASP D 38 ? 0.2937 1.1881 0.4160 -0.0488 -0.0053 -0.0180 163 ASP D CG  
2394 O  OD1 . ASP D 38 ? 0.2950 1.1723 0.4039 -0.0251 -0.0072 -0.0220 163 ASP D OD1 
2395 O  OD2 . ASP D 38 ? 0.3449 1.2368 0.4730 -0.0684 -0.0157 -0.0189 163 ASP D OD2 
2396 N  N   . LEU D 39 ? 0.1321 1.0391 0.2394 0.0006  0.0239  -0.0195 164 LEU D N   
2397 C  CA  . LEU D 39 ? 0.1291 1.0202 0.2240 0.0274  0.0234  -0.0253 164 LEU D CA  
2398 C  C   . LEU D 39 ? 0.1938 1.0546 0.2777 0.0369  0.0134  -0.0261 164 LEU D C   
2399 O  O   . LEU D 39 ? 0.1980 1.0201 0.2635 0.0463  0.0145  -0.0246 164 LEU D O   
2400 C  CB  . LEU D 39 ? 0.1295 1.0663 0.2372 0.0462  0.0264  -0.0316 164 LEU D CB  
2401 C  CG  . LEU D 39 ? 0.1989 1.1142 0.2889 0.0748  0.0279  -0.0378 164 LEU D CG  
2402 C  CD1 . LEU D 39 ? 0.2139 1.0994 0.2868 0.0730  0.0355  -0.0378 164 LEU D CD1 
2403 C  CD2 . LEU D 39 ? 0.2048 1.1666 0.3057 0.0977  0.0289  -0.0450 164 LEU D CD2 
2404 N  N   . SER D 40 ? 0.1463 1.0261 0.2411 0.0332  0.0036  -0.0281 165 SER D N   
2405 C  CA  . SER D 40 ? 0.1484 1.0069 0.2315 0.0443  -0.0066 -0.0292 165 SER D CA  
2406 C  C   . SER D 40 ? 0.2153 1.0267 0.2781 0.0375  -0.0064 -0.0236 165 SER D C   
2407 O  O   . SER D 40 ? 0.2124 0.9954 0.2581 0.0521  -0.0059 -0.0207 165 SER D O   
2408 C  CB  . SER D 40 ? 0.1953 1.0859 0.2944 0.0369  -0.0187 -0.0343 165 SER D CB  
2409 O  OG  . SER D 40 ? 0.3253 1.2626 0.4412 0.0521  -0.0217 -0.0402 165 SER D OG  
2410 N  N   . LYS D 41 ? 0.1879 0.9919 0.2522 0.0158  -0.0062 -0.0210 166 LYS D N   
2411 C  CA  . LYS D 41 ? 0.1905 0.9554 0.2363 0.0101  -0.0059 -0.0161 166 LYS D CA  
2412 C  C   . LYS D 41 ? 0.2490 0.9936 0.2846 0.0169  0.0041  -0.0116 166 LYS D C   
2413 O  O   . LYS D 41 ? 0.2693 0.9890 0.2907 0.0250  0.0043  -0.0080 166 LYS D O   
2414 C  CB  . LYS D 41 ? 0.2190 0.9798 0.2670 -0.0126 -0.0074 -0.0141 166 LYS D CB  
2415 C  CG  . LYS D 41 ? 0.2491 1.0177 0.3033 -0.0237 -0.0205 -0.0191 166 LYS D CG  
2416 C  CD  . LYS D 41 ? 0.3235 1.0796 0.3772 -0.0481 -0.0210 -0.0151 166 LYS D CD  
2417 C  CE  . LYS D 41 ? 0.4089 1.1569 0.4626 -0.0624 -0.0362 -0.0206 166 LYS D CE  
2418 N  NZ  . LYS D 41 ? 0.4888 1.2144 0.5374 -0.0867 -0.0362 -0.0145 166 LYS D NZ  
2419 N  N   . SER D 42 ? 0.1778 0.9358 0.2208 0.0140  0.0121  -0.0122 167 SER D N   
2420 C  CA  . SER D 42 ? 0.1679 0.9079 0.2019 0.0191  0.0191  -0.0109 167 SER D CA  
2421 C  C   . SER D 42 ? 0.2108 0.9340 0.2370 0.0360  0.0185  -0.0114 167 SER D C   
2422 O  O   . SER D 42 ? 0.2000 0.8977 0.2162 0.0357  0.0205  -0.0073 167 SER D O   
2423 C  CB  . SER D 42 ? 0.2144 0.9744 0.2547 0.0163  0.0260  -0.0137 167 SER D CB  
2424 O  OG  . SER D 42 ? 0.3142 1.0801 0.3559 -0.0007 0.0285  -0.0094 167 SER D OG  
2425 N  N   . LEU D 43 ? 0.1766 0.9142 0.2068 0.0506  0.0154  -0.0153 168 LEU D N   
2426 C  CA  . LEU D 43 ? 0.1852 0.9018 0.2038 0.0688  0.0142  -0.0141 168 LEU D CA  
2427 C  C   . LEU D 43 ? 0.2656 0.9580 0.2721 0.0693  0.0120  -0.0058 168 LEU D C   
2428 O  O   . LEU D 43 ? 0.2710 0.9349 0.2658 0.0737  0.0151  0.0003  168 LEU D O   
2429 C  CB  . LEU D 43 ? 0.1854 0.9272 0.2096 0.0869  0.0097  -0.0196 168 LEU D CB  
2430 C  CG  . LEU D 43 ? 0.2355 1.0009 0.2671 0.0961  0.0131  -0.0275 168 LEU D CG  
2431 C  CD1 . LEU D 43 ? 0.2402 1.0519 0.2873 0.1064  0.0082  -0.0327 168 LEU D CD1 
2432 C  CD2 . LEU D 43 ? 0.2708 1.0027 0.2846 0.1140  0.0148  -0.0293 168 LEU D CD2 
2433 N  N   . TYR D 44 ? 0.2271 0.9311 0.2356 0.0645  0.0065  -0.0055 169 TYR D N   
2434 C  CA  . TYR D 44 ? 0.2359 0.9232 0.2308 0.0681  0.0042  0.0010  169 TYR D CA  
2435 C  C   . TYR D 44 ? 0.2657 0.9346 0.2550 0.0573  0.0103  0.0075  169 TYR D C   
2436 O  O   . TYR D 44 ? 0.2584 0.9112 0.2366 0.0627  0.0137  0.0160  169 TYR D O   
2437 C  CB  . TYR D 44 ? 0.2639 0.9667 0.2598 0.0670  -0.0059 -0.0041 169 TYR D CB  
2438 C  CG  . TYR D 44 ? 0.3074 0.9934 0.2849 0.0735  -0.0084 0.0009  169 TYR D CG  
2439 C  CD1 . TYR D 44 ? 0.3479 1.0314 0.3116 0.0922  -0.0122 0.0036  169 TYR D CD1 
2440 C  CD2 . TYR D 44 ? 0.3185 0.9921 0.2895 0.0642  -0.0066 0.0032  169 TYR D CD2 
2441 C  CE1 . TYR D 44 ? 0.3802 1.0512 0.3242 0.1009  -0.0129 0.0090  169 TYR D CE1 
2442 C  CE2 . TYR D 44 ? 0.3462 1.0080 0.2985 0.0741  -0.0075 0.0077  169 TYR D CE2 
2443 C  CZ  . TYR D 44 ? 0.4384 1.1000 0.3774 0.0921  -0.0101 0.0108  169 TYR D CZ  
2444 O  OH  . TYR D 44 ? 0.3929 1.0464 0.3113 0.1036  -0.0100 0.0153  169 TYR D OH  
2445 N  N   . THR D 45 ? 0.2209 0.8955 0.2177 0.0427  0.0120  0.0045  170 THR D N   
2446 C  CA  . THR D 45 ? 0.2088 0.8720 0.2015 0.0340  0.0165  0.0093  170 THR D CA  
2447 C  C   . THR D 45 ? 0.2497 0.9018 0.2435 0.0329  0.0226  0.0125  170 THR D C   
2448 O  O   . THR D 45 ? 0.2644 0.9082 0.2544 0.0307  0.0259  0.0196  170 THR D O   
2449 C  CB  . THR D 45 ? 0.2684 0.9380 0.2646 0.0215  0.0156  0.0060  170 THR D CB  
2450 O  OG1 . THR D 45 ? 0.2740 0.9501 0.2705 0.0193  0.0084  0.0023  170 THR D OG1 
2451 C  CG2 . THR D 45 ? 0.2316 0.8913 0.2198 0.0178  0.0177  0.0107  170 THR D CG2 
2452 N  N   . LEU D 46 ? 0.1812 0.8338 0.1798 0.0350  0.0235  0.0070  171 LEU D N   
2453 C  CA  . LEU D 46 ? 0.1812 0.8159 0.1779 0.0340  0.0264  0.0075  171 LEU D CA  
2454 C  C   . LEU D 46 ? 0.2496 0.8635 0.2379 0.0412  0.0276  0.0162  171 LEU D C   
2455 O  O   . LEU D 46 ? 0.2639 0.8600 0.2508 0.0337  0.0303  0.0213  171 LEU D O   
2456 C  CB  . LEU D 46 ? 0.1860 0.8230 0.1845 0.0388  0.0260  -0.0025 171 LEU D CB  
2457 C  CG  . LEU D 46 ? 0.2226 0.8787 0.2268 0.0314  0.0272  -0.0093 171 LEU D CG  
2458 C  CD1 . LEU D 46 ? 0.2205 0.8858 0.2249 0.0420  0.0276  -0.0185 171 LEU D CD1 
2459 C  CD2 . LEU D 46 ? 0.2723 0.9200 0.2750 0.0197  0.0283  -0.0090 171 LEU D CD2 
2460 N  N   . PHE D 47 ? 0.2118 0.8283 0.1940 0.0548  0.0251  0.0187  172 PHE D N   
2461 C  CA  . PHE D 47 ? 0.2392 0.8356 0.2088 0.0639  0.0270  0.0300  172 PHE D CA  
2462 C  C   . PHE D 47 ? 0.3036 0.9018 0.2715 0.0557  0.0318  0.0411  172 PHE D C   
2463 O  O   . PHE D 47 ? 0.3293 0.9113 0.2946 0.0495  0.0373  0.0518  172 PHE D O   
2464 C  CB  . PHE D 47 ? 0.2697 0.8737 0.2312 0.0830  0.0219  0.0292  172 PHE D CB  
2465 C  CG  . PHE D 47 ? 0.3207 0.9030 0.2645 0.0950  0.0245  0.0427  172 PHE D CG  
2466 C  CD1 . PHE D 47 ? 0.3904 0.9424 0.3233 0.1030  0.0258  0.0473  172 PHE D CD1 
2467 C  CD2 . PHE D 47 ? 0.3537 0.9427 0.2881 0.0995  0.0257  0.0515  172 PHE D CD2 
2468 C  CE1 . PHE D 47 ? 0.4346 0.9623 0.3481 0.1130  0.0293  0.0630  172 PHE D CE1 
2469 C  CE2 . PHE D 47 ? 0.4175 0.9881 0.3332 0.1110  0.0300  0.0667  172 PHE D CE2 
2470 C  CZ  . PHE D 47 ? 0.4230 0.9625 0.3287 0.1165  0.0322  0.0735  172 PHE D CZ  
2471 N  N   . GLN D 48 ? 0.2294 0.8476 0.1990 0.0549  0.0296  0.0382  173 GLN D N   
2472 C  CA  . GLN D 48 ? 0.2144 0.8398 0.1809 0.0519  0.0334  0.0461  173 GLN D CA  
2473 C  C   . GLN D 48 ? 0.2938 0.9188 0.2707 0.0364  0.0389  0.0502  173 GLN D C   
2474 O  O   . GLN D 48 ? 0.3156 0.9447 0.2921 0.0336  0.0452  0.0618  173 GLN D O   
2475 C  CB  . GLN D 48 ? 0.2065 0.8456 0.1711 0.0534  0.0277  0.0382  173 GLN D CB  
2476 C  CG  . GLN D 48 ? 0.2654 0.9118 0.2238 0.0548  0.0312  0.0446  173 GLN D CG  
2477 C  CD  . GLN D 48 ? 0.2854 0.9356 0.2381 0.0561  0.0249  0.0367  173 GLN D CD  
2478 O  OE1 . GLN D 48 ? 0.2275 0.8740 0.1755 0.0587  0.0164  0.0280  173 GLN D OE1 
2479 N  NE2 . GLN D 48 ? 0.0440 0.5812 0.0420 0.0460  0.0027  0.0323  173 GLN D NE2 
2480 N  N   . VAL D 49 ? 0.2474 0.8716 0.2339 0.0267  0.0365  0.0405  174 VAL D N   
2481 C  CA  . VAL D 49 ? 0.2466 0.8720 0.2431 0.0120  0.0386  0.0408  174 VAL D CA  
2482 C  C   . VAL D 49 ? 0.3294 0.9343 0.3270 0.0051  0.0418  0.0487  174 VAL D C   
2483 O  O   . VAL D 49 ? 0.3239 0.9346 0.3296 -0.0072 0.0455  0.0568  174 VAL D O   
2484 C  CB  . VAL D 49 ? 0.2708 0.9009 0.2726 0.0064  0.0344  0.0279  174 VAL D CB  
2485 C  CG1 . VAL D 49 ? 0.2688 0.8954 0.2785 -0.0070 0.0339  0.0253  174 VAL D CG1 
2486 C  CG2 . VAL D 49 ? 0.2482 0.8952 0.2483 0.0081  0.0300  0.0252  174 VAL D CG2 
2487 N  N   . MET D 50 ? 0.3105 0.8921 0.2996 0.0131  0.0400  0.0470  175 MET D N   
2488 C  CA  . MET D 50 ? 0.3512 0.9018 0.3355 0.0080  0.0418  0.0547  175 MET D CA  
2489 C  C   . MET D 50 ? 0.4083 0.9585 0.3890 0.0057  0.0497  0.0744  175 MET D C   
2490 O  O   . MET D 50 ? 0.4443 0.9816 0.4303 -0.0108 0.0532  0.0841  175 MET D O   
2491 C  CB  . MET D 50 ? 0.4079 0.9340 0.3787 0.0242  0.0376  0.0485  175 MET D CB  
2492 C  CG  . MET D 50 ? 0.5052 0.9889 0.4647 0.0221  0.0381  0.0562  175 MET D CG  
2493 S  SD  . MET D 50 ? 0.5923 1.0519 0.5325 0.0491  0.0325  0.0486  175 MET D SD  
2494 C  CE  . MET D 50 ? 0.5593 1.0261 0.4870 0.0658  0.0367  0.0648  175 MET D CE  
2495 N  N   . THR D 51 ? 0.3268 0.8925 0.2983 0.0214  0.0522  0.0804  176 THR D N   
2496 C  CA  . THR D 51 ? 0.3252 0.8964 0.2893 0.0241  0.0610  0.0996  176 THR D CA  
2497 C  C   . THR D 51 ? 0.3343 0.9373 0.3134 0.0109  0.0669  0.1058  176 THR D C   
2498 O  O   . THR D 51 ? 0.3575 0.9723 0.3353 0.0091  0.0764  0.1232  176 THR D O   
2499 C  CB  . THR D 51 ? 0.4222 1.0019 0.3689 0.0478  0.0596  0.1004  176 THR D CB  
2500 O  OG1 . THR D 51 ? 0.4505 1.0560 0.4016 0.0523  0.0544  0.0878  176 THR D OG1 
2501 C  CG2 . THR D 51 ? 0.3990 0.9555 0.3322 0.0633  0.0533  0.0952  176 THR D CG2 
2502 N  N   . LEU D 52 ? 0.2302 0.8499 0.2227 0.0035  0.0617  0.0921  177 LEU D N   
2503 C  CA  . LEU D 52 ? 0.1895 0.8417 0.1967 -0.0058 0.0641  0.0931  177 LEU D CA  
2504 C  C   . LEU D 52 ? 0.2286 0.9070 0.2275 0.0111  0.0653  0.0930  177 LEU D C   
2505 O  O   . LEU D 52 ? 0.2222 0.9272 0.2298 0.0090  0.0657  0.0913  177 LEU D O   
2506 C  CB  . LEU D 52 ? 0.1933 0.8540 0.2164 -0.0266 0.0712  0.1073  177 LEU D CB  
2507 C  CG  . LEU D 52 ? 0.2590 0.8864 0.2887 -0.0460 0.0668  0.1043  177 LEU D CG  
2508 C  CD1 . LEU D 52 ? 0.2854 0.9160 0.3288 -0.0686 0.0740  0.1219  177 LEU D CD1 
2509 C  CD2 . LEU D 52 ? 0.2588 0.8883 0.2982 -0.0536 0.0567  0.0849  177 LEU D CD2 
2510 N  N   . GLU D 53 ? 0.1991 0.8684 0.1793 0.0295  0.0639  0.0926  178 GLU D N   
2511 C  CA  . GLU D 53 ? 0.1985 0.8838 0.1647 0.0480  0.0625  0.0903  178 GLU D CA  
2512 C  C   . GLU D 53 ? 0.2711 0.9639 0.2399 0.0481  0.0549  0.0761  178 GLU D C   
2513 O  O   . GLU D 53 ? 0.2925 0.9702 0.2619 0.0448  0.0471  0.0640  178 GLU D O   
2514 C  CB  . GLU D 53 ? 0.2190 0.8882 0.1654 0.0652  0.0579  0.0877  178 GLU D CB  
2515 C  CG  . GLU D 53 ? 0.3329 1.0153 0.2594 0.0859  0.0582  0.0896  178 GLU D CG  
2516 C  CD  . GLU D 53 ? 0.5617 1.2469 0.4812 0.0933  0.0488  0.0749  178 GLU D CD  
2517 O  OE1 . GLU D 53 ? 0.5094 1.2125 0.4288 0.0970  0.0522  0.0769  178 GLU D OE1 
2518 O  OE2 . GLU D 53 ? 0.4279 1.0976 0.3419 0.0953  0.0378  0.0618  178 GLU D OE2 
2519 N  N   . SER D 54 ? 0.2208 0.9379 0.1904 0.0529  0.0578  0.0789  179 SER D N   
2520 C  CA  . SER D 54 ? 0.2231 0.9452 0.1906 0.0561  0.0512  0.0683  179 SER D CA  
2521 C  C   . SER D 54 ? 0.2760 0.9881 0.2561 0.0398  0.0458  0.0589  179 SER D C   
2522 O  O   . SER D 54 ? 0.2653 0.9706 0.2380 0.0429  0.0393  0.0500  179 SER D O   
2523 C  CB  . SER D 54 ? 0.2879 0.9948 0.2315 0.0741  0.0434  0.0597  179 SER D CB  
2524 O  OG  . SER D 54 ? 0.4555 1.1746 0.3824 0.0942  0.0469  0.0653  179 SER D OG  
2525 N  N   . TRP D 55 ? 0.2409 0.9498 0.2370 0.0234  0.0483  0.0611  180 TRP D N   
2526 C  CA  . TRP D 55 ? 0.2469 0.9460 0.2509 0.0114  0.0431  0.0511  180 TRP D CA  
2527 C  C   . TRP D 55 ? 0.2914 1.0046 0.2971 0.0106  0.0393  0.0453  180 TRP D C   
2528 O  O   . TRP D 55 ? 0.2759 0.9777 0.2754 0.0104  0.0343  0.0367  180 TRP D O   
2529 C  CB  . TRP D 55 ? 0.2481 0.9366 0.2645 -0.0037 0.0448  0.0527  180 TRP D CB  
2530 C  CG  . TRP D 55 ? 0.2651 0.9722 0.2984 -0.0181 0.0474  0.0584  180 TRP D CG  
2531 C  CD1 . TRP D 55 ? 0.3152 1.0312 0.3571 -0.0255 0.0546  0.0723  180 TRP D CD1 
2532 C  CD2 . TRP D 55 ? 0.2614 0.9818 0.3062 -0.0289 0.0423  0.0505  180 TRP D CD2 
2533 N  NE1 . TRP D 55 ? 0.3136 1.0510 0.3750 -0.0425 0.0539  0.0735  180 TRP D NE1 
2534 C  CE2 . TRP D 55 ? 0.3209 1.0617 0.3840 -0.0437 0.0454  0.0590  180 TRP D CE2 
2535 C  CE3 . TRP D 55 ? 0.2736 0.9933 0.3143 -0.0273 0.0354  0.0379  180 TRP D CE3 
2536 C  CZ2 . TRP D 55 ? 0.3151 1.0762 0.3940 -0.0572 0.0397  0.0528  180 TRP D CZ2 
2537 C  CZ3 . TRP D 55 ? 0.2959 1.0335 0.3480 -0.0375 0.0305  0.0324  180 TRP D CZ3 
2538 C  CH2 . TRP D 55 ? 0.3109 1.0694 0.3827 -0.0523 0.0316  0.0386  180 TRP D CH2 
2539 N  N   . SER D 56 ? 0.2494 0.9903 0.2627 0.0115  0.0421  0.0512  181 SER D N   
2540 C  CA  . SER D 56 ? 0.2315 0.9908 0.2461 0.0138  0.0381  0.0468  181 SER D CA  
2541 C  C   . SER D 56 ? 0.2797 1.0391 0.2739 0.0344  0.0358  0.0461  181 SER D C   
2542 O  O   . SER D 56 ? 0.2921 1.0370 0.2740 0.0378  0.0299  0.0395  181 SER D O   
2543 C  CB  . SER D 56 ? 0.2493 1.0433 0.2859 0.0030  0.0404  0.0518  181 SER D CB  
2544 O  OG  . SER D 56 ? 0.3583 1.1737 0.3955 0.0080  0.0350  0.0466  181 SER D OG  
2545 N  N   . MET D 57 ? 0.2170 0.9886 0.2041 0.0489  0.0401  0.0529  182 MET D N   
2546 C  CA  . MET D 57 ? 0.2293 0.9946 0.1920 0.0715  0.0360  0.0502  182 MET D CA  
2547 C  C   . MET D 57 ? 0.2907 1.0138 0.2321 0.0751  0.0295  0.0431  182 MET D C   
2548 O  O   . MET D 57 ? 0.3034 1.0065 0.2248 0.0846  0.0226  0.0379  182 MET D O   
2549 C  CB  . MET D 57 ? 0.2717 1.0649 0.2290 0.0908  0.0421  0.0579  182 MET D CB  
2550 C  CG  . MET D 57 ? 0.3134 1.1588 0.2957 0.0864  0.0492  0.0665  182 MET D CG  
2551 S  SD  . MET D 57 ? 0.3671 1.2421 0.3550 0.0929  0.0432  0.0617  182 MET D SD  
2552 C  CE  . MET D 57 ? 0.3428 1.2423 0.3086 0.1302  0.0453  0.0645  182 MET D CE  
2553 N  N   . GLY D 58 ? 0.2353 0.9452 0.1816 0.0662  0.0310  0.0433  183 GLY D N   
2554 C  CA  . GLY D 58 ? 0.2358 0.9148 0.1680 0.0671  0.0246  0.0368  183 GLY D CA  
2555 C  C   . GLY D 58 ? 0.2798 0.9417 0.2163 0.0522  0.0202  0.0306  183 GLY D C   
2556 O  O   . GLY D 58 ? 0.3013 0.9409 0.2225 0.0538  0.0133  0.0257  183 GLY D O   
2557 N  N   . ILE D 59 ? 0.2072 0.8781 0.1627 0.0376  0.0240  0.0309  184 ILE D N   
2558 C  CA  . ILE D 59 ? 0.2018 0.8632 0.1615 0.0256  0.0218  0.0255  184 ILE D CA  
2559 C  C   . ILE D 59 ? 0.2799 0.9507 0.2441 0.0194  0.0225  0.0244  184 ILE D C   
2560 O  O   . ILE D 59 ? 0.2964 0.9577 0.2492 0.0193  0.0196  0.0231  184 ILE D O   
2561 C  CB  . ILE D 59 ? 0.2291 0.8890 0.2006 0.0184  0.0236  0.0233  184 ILE D CB  
2562 C  CG1 . ILE D 59 ? 0.2425 0.8980 0.2098 0.0269  0.0228  0.0252  184 ILE D CG1 
2563 C  CG2 . ILE D 59 ? 0.2143 0.8703 0.1887 0.0094  0.0220  0.0177  184 ILE D CG2 
2564 C  CD1 . ILE D 59 ? 0.3637 1.0066 0.3172 0.0300  0.0153  0.0209  184 ILE D CD1 
2565 N  N   . VAL D 60 ? 0.2154 0.9026 0.1949 0.0132  0.0256  0.0249  185 VAL D N   
2566 C  CA  . VAL D 60 ? 0.2038 0.9021 0.1886 0.0069  0.0242  0.0212  185 VAL D CA  
2567 C  C   . VAL D 60 ? 0.2569 0.9620 0.2294 0.0155  0.0209  0.0223  185 VAL D C   
2568 O  O   . VAL D 60 ? 0.2474 0.9469 0.2112 0.0139  0.0189  0.0193  185 VAL D O   
2569 C  CB  . VAL D 60 ? 0.2454 0.9560 0.2485 -0.0035 0.0254  0.0201  185 VAL D CB  
2570 C  CG1 . VAL D 60 ? 0.2454 0.9653 0.2513 -0.0095 0.0211  0.0129  185 VAL D CG1 
2571 C  CG2 . VAL D 60 ? 0.2444 0.9386 0.2525 -0.0088 0.0275  0.0187  185 VAL D CG2 
2572 N  N   . ARG D 61 ? 0.2069 0.9247 0.1762 0.0272  0.0209  0.0270  186 ARG D N   
2573 C  CA  . ARG D 61 ? 0.2029 0.9264 0.1571 0.0406  0.0169  0.0279  186 ARG D CA  
2574 C  C   . ARG D 61 ? 0.2661 0.9551 0.1946 0.0460  0.0135  0.0278  186 ARG D C   
2575 O  O   . ARG D 61 ? 0.2685 0.9535 0.1875 0.0455  0.0113  0.0272  186 ARG D O   
2576 C  CB  . ARG D 61 ? 0.1732 0.9215 0.1286 0.0557  0.0180  0.0325  186 ARG D CB  
2577 C  CG  . ARG D 61 ? 0.2070 0.9969 0.1902 0.0468  0.0208  0.0345  186 ARG D CG  
2578 C  CD  . ARG D 61 ? 0.2336 1.0579 0.2181 0.0640  0.0227  0.0400  186 ARG D CD  
2579 N  NE  . ARG D 61 ? 0.3047 1.1740 0.3203 0.0513  0.0264  0.0440  186 ARG D NE  
2580 C  CZ  . ARG D 61 ? 0.3950 1.3014 0.4258 0.0484  0.0219  0.0416  186 ARG D CZ  
2581 N  NH1 . ARG D 61 ? 0.1986 1.1012 0.2133 0.0603  0.0140  0.0355  186 ARG D NH1 
2582 N  NH2 . ARG D 61 ? 0.0711 1.0183 0.1331 0.0323  0.0248  0.0458  186 ARG D NH2 
2583 N  N   . PRO D 62 ? 0.2170 0.8801 0.1345 0.0480  0.0128  0.0283  187 PRO D N   
2584 C  CA  . PRO D 62 ? 0.2186 0.8469 0.1143 0.0469  0.0087  0.0287  187 PRO D CA  
2585 C  C   . PRO D 62 ? 0.2372 0.8621 0.1371 0.0311  0.0110  0.0288  187 PRO D C   
2586 O  O   . PRO D 62 ? 0.2319 0.8373 0.1126 0.0314  0.0091  0.0300  187 PRO D O   
2587 C  CB  . PRO D 62 ? 0.2404 0.8504 0.1331 0.0462  0.0065  0.0267  187 PRO D CB  
2588 C  CG  . PRO D 62 ? 0.2902 0.9201 0.1895 0.0579  0.0087  0.0270  187 PRO D CG  
2589 C  CD  . PRO D 62 ? 0.2237 0.8879 0.1461 0.0517  0.0146  0.0288  187 PRO D CD  
2590 N  N   . VAL D 63 ? 0.1672 0.8101 0.0892 0.0194  0.0154  0.0253  188 VAL D N   
2591 C  CA  . VAL D 63 ? 0.1521 0.7990 0.0790 0.0078  0.0188  0.0239  188 VAL D CA  
2592 C  C   . VAL D 63 ? 0.2443 0.9036 0.1651 0.0114  0.0184  0.0236  188 VAL D C   
2593 O  O   . VAL D 63 ? 0.2657 0.9193 0.1747 0.0082  0.0202  0.0263  188 VAL D O   
2594 C  CB  . VAL D 63 ? 0.1662 0.8245 0.1137 -0.0006 0.0222  0.0188  188 VAL D CB  
2595 C  CG1 . VAL D 63 ? 0.1625 0.8302 0.1132 -0.0074 0.0260  0.0158  188 VAL D CG1 
2596 C  CG2 . VAL D 63 ? 0.1621 0.8094 0.1120 -0.0032 0.0212  0.0192  188 VAL D CG2 
2597 N  N   . MET D 64 ? 0.2113 0.8901 0.1394 0.0183  0.0158  0.0211  189 MET D N   
2598 C  CA  . MET D 64 ? 0.2169 0.9126 0.1403 0.0232  0.0127  0.0190  189 MET D CA  
2599 C  C   . MET D 64 ? 0.2936 0.9756 0.1896 0.0359  0.0098  0.0254  189 MET D C   
2600 O  O   . MET D 64 ? 0.2853 0.9735 0.1699 0.0392  0.0082  0.0251  189 MET D O   
2601 C  CB  . MET D 64 ? 0.2294 0.9544 0.1715 0.0242  0.0096  0.0148  189 MET D CB  
2602 C  CG  . MET D 64 ? 0.2561 0.9902 0.2194 0.0103  0.0105  0.0076  189 MET D CG  
2603 S  SD  . MET D 64 ? 0.3057 1.0749 0.2907 0.0057  0.0048  0.0029  189 MET D SD  
2604 C  CE  . MET D 64 ? 0.2608 1.0437 0.2515 0.0153  0.0081  0.0132  189 MET D CE  
2605 N  N   . ASN D 65 ? 0.2633 0.9225 0.1447 0.0447  0.0083  0.0309  190 ASN D N   
2606 C  CA  . ASN D 65 ? 0.2874 0.9210 0.1370 0.0584  0.0045  0.0378  190 ASN D CA  
2607 C  C   . ASN D 65 ? 0.3633 0.9718 0.1959 0.0481  0.0077  0.0442  190 ASN D C   
2608 O  O   . ASN D 65 ? 0.4153 1.0048 0.2200 0.0578  0.0056  0.0514  190 ASN D O   
2609 C  CB  . ASN D 65 ? 0.2498 0.8591 0.0856 0.0701  0.0010  0.0397  190 ASN D CB  
2610 C  CG  . ASN D 65 ? 0.7120 1.3515 0.5570 0.0870  -0.0012 0.0365  190 ASN D CG  
2611 O  OD1 . ASN D 65 ? 0.7550 1.4183 0.5965 0.1012  -0.0042 0.0365  190 ASN D OD1 
2612 N  ND2 . ASN D 65 ? 0.6040 1.2479 0.4613 0.0863  0.0006  0.0343  190 ASN D ND2 
2613 N  N   . VAL D 66 ? 0.2710 0.8827 0.1202 0.0298  0.0135  0.0426  191 VAL D N   
2614 C  CA  . VAL D 66 ? 0.2696 0.8693 0.1097 0.0173  0.0191  0.0494  191 VAL D CA  
2615 C  C   . VAL D 66 ? 0.2830 0.9149 0.1347 0.0141  0.0236  0.0439  191 VAL D C   
2616 O  O   . VAL D 66 ? 0.2709 0.9034 0.1045 0.0167  0.0263  0.0493  191 VAL D O   
2617 C  CB  . VAL D 66 ? 0.3085 0.8937 0.1593 0.0010  0.0214  0.0508  191 VAL D CB  
2618 C  CG1 . VAL D 66 ? 0.3167 0.8983 0.1630 -0.0146 0.0287  0.0595  191 VAL D CG1 
2619 C  CG2 . VAL D 66 ? 0.3273 0.8774 0.1630 0.0061  0.0141  0.0529  191 VAL D CG2 
2620 N  N   . HIS D 67 ? 0.2128 0.8677 0.0909 0.0101  0.0238  0.0331  192 HIS D N   
2621 C  CA  . HIS D 67 ? 0.2039 0.8833 0.0921 0.0083  0.0257  0.0242  192 HIS D CA  
2622 C  C   . HIS D 67 ? 0.2927 0.9902 0.1900 0.0154  0.0183  0.0152  192 HIS D C   
2623 O  O   . HIS D 67 ? 0.3035 1.0075 0.2212 0.0113  0.0167  0.0097  192 HIS D O   
2624 C  CB  . HIS D 67 ? 0.1833 0.8694 0.0918 -0.0016 0.0306  0.0188  192 HIS D CB  
2625 C  CG  . HIS D 67 ? 0.2216 0.8972 0.1293 -0.0111 0.0363  0.0272  192 HIS D CG  
2626 N  ND1 . HIS D 67 ? 0.2498 0.9294 0.1465 -0.0160 0.0434  0.0345  192 HIS D ND1 
2627 C  CD2 . HIS D 67 ? 0.2330 0.8966 0.1497 -0.0173 0.0352  0.0294  192 HIS D CD2 
2628 C  CE1 . HIS D 67 ? 0.2443 0.9157 0.1471 -0.0278 0.0463  0.0412  192 HIS D CE1 
2629 N  NE2 . HIS D 67 ? 0.2394 0.9006 0.1540 -0.0284 0.0404  0.0370  192 HIS D NE2 
2630 N  N   . PRO D 68 ? 0.2501 0.9577 0.1327 0.0255  0.0134  0.0146  193 PRO D N   
2631 C  CA  . PRO D 68 ? 0.2390 0.9703 0.1342 0.0299  0.0050  0.0060  193 PRO D CA  
2632 C  C   . PRO D 68 ? 0.3107 1.0567 0.2290 0.0194  0.0024  -0.0069 193 PRO D C   
2633 O  O   . PRO D 68 ? 0.2978 1.0571 0.2360 0.0151  -0.0019 -0.0105 193 PRO D O   
2634 C  CB  . PRO D 68 ? 0.2823 1.0227 0.1543 0.0431  -0.0002 0.0069  193 PRO D CB  
2635 C  CG  . PRO D 68 ? 0.3548 1.0668 0.1992 0.0485  0.0057  0.0213  193 PRO D CG  
2636 C  CD  . PRO D 68 ? 0.2948 0.9937 0.1478 0.0336  0.0148  0.0230  193 PRO D CD  
2637 N  N   . ASN D 69 ? 0.3177 1.0601 0.2320 0.0156  0.0051  -0.0132 194 ASN D N   
2638 C  CA  . ASN D 69 ? 0.3270 1.0738 0.2565 0.0080  0.0013  -0.0270 194 ASN D CA  
2639 C  C   . ASN D 69 ? 0.3764 1.1091 0.3229 -0.0006 0.0064  -0.0262 194 ASN D C   
2640 O  O   . ASN D 69 ? 0.3867 1.1149 0.3416 -0.0056 0.0034  -0.0367 194 ASN D O   
2641 C  CB  . ASN D 69 ? 0.3863 1.1353 0.2990 0.0131  0.0011  -0.0363 194 ASN D CB  
2642 C  CG  . ASN D 69 ? 0.8442 1.6094 0.7399 0.0224  -0.0072 -0.0421 194 ASN D CG  
2643 O  OD1 . ASN D 69 ? 0.7340 1.5138 0.6358 0.0233  -0.0162 -0.0436 194 ASN D OD1 
2644 N  ND2 . ASN D 69 ? 0.8419 1.6093 0.7157 0.0309  -0.0046 -0.0460 194 ASN D ND2 
2645 N  N   . ALA D 70 ? 0.3123 1.0353 0.2613 -0.0011 0.0126  -0.0147 195 ALA D N   
2646 C  CA  . ALA D 70 ? 0.2941 1.0055 0.2563 -0.0064 0.0169  -0.0132 195 ALA D CA  
2647 C  C   . ALA D 70 ? 0.3379 1.0482 0.3177 -0.0131 0.0131  -0.0185 195 ALA D C   
2648 O  O   . ALA D 70 ? 0.3497 1.0477 0.3359 -0.0155 0.0156  -0.0201 195 ALA D O   
2649 C  CB  . ALA D 70 ? 0.2940 0.9968 0.2544 -0.0049 0.0206  -0.0020 195 ALA D CB  
2650 N  N   . TRP D 71 ? 0.2724 0.9966 0.2596 -0.0166 0.0068  -0.0205 196 TRP D N   
2651 C  CA  . TRP D 71 ? 0.2668 0.9920 0.2724 -0.0276 0.0032  -0.0230 196 TRP D CA  
2652 C  C   . TRP D 71 ? 0.3011 1.0100 0.3069 -0.0340 -0.0017 -0.0360 196 TRP D C   
2653 O  O   . TRP D 71 ? 0.3004 0.9961 0.3178 -0.0440 -0.0031 -0.0363 196 TRP D O   
2654 C  CB  . TRP D 71 ? 0.2538 1.0070 0.2702 -0.0308 -0.0023 -0.0213 196 TRP D CB  
2655 C  CG  . TRP D 71 ? 0.2763 1.0446 0.2849 -0.0281 -0.0112 -0.0316 196 TRP D CG  
2656 C  CD1 . TRP D 71 ? 0.3144 1.0931 0.3052 -0.0146 -0.0120 -0.0299 196 TRP D CD1 
2657 C  CD2 . TRP D 71 ? 0.2972 1.0680 0.3116 -0.0382 -0.0215 -0.0458 196 TRP D CD2 
2658 N  NE1 . TRP D 71 ? 0.3190 1.1113 0.3043 -0.0139 -0.0219 -0.0417 196 TRP D NE1 
2659 C  CE2 . TRP D 71 ? 0.3529 1.1408 0.3528 -0.0286 -0.0286 -0.0531 196 TRP D CE2 
2660 C  CE3 . TRP D 71 ? 0.3317 1.0882 0.3600 -0.0545 -0.0266 -0.0533 196 TRP D CE3 
2661 C  CZ2 . TRP D 71 ? 0.3718 1.1665 0.3711 -0.0340 -0.0415 -0.0696 196 TRP D CZ2 
2662 C  CZ3 . TRP D 71 ? 0.3795 1.1373 0.4071 -0.0618 -0.0398 -0.0699 196 TRP D CZ3 
2663 C  CH2 . TRP D 71 ? 0.3950 1.1742 0.4091 -0.0515 -0.0477 -0.0788 196 TRP D CH2 
2664 N  N   . VAL D 72 ? 0.2516 0.9593 0.2417 -0.0269 -0.0044 -0.0462 197 VAL D N   
2665 C  CA  . VAL D 72 ? 0.2682 0.9586 0.2515 -0.0273 -0.0101 -0.0615 197 VAL D CA  
2666 C  C   . VAL D 72 ? 0.3195 0.9873 0.3006 -0.0224 -0.0034 -0.0601 197 VAL D C   
2667 O  O   . VAL D 72 ? 0.3340 0.9789 0.3113 -0.0225 -0.0082 -0.0707 197 VAL D O   
2668 C  CB  . VAL D 72 ? 0.3246 1.0256 0.2879 -0.0169 -0.0141 -0.0725 197 VAL D CB  
2669 C  CG1 . VAL D 72 ? 0.3479 1.0299 0.3005 -0.0144 -0.0222 -0.0913 197 VAL D CG1 
2670 C  CG2 . VAL D 72 ? 0.3226 1.0484 0.2867 -0.0186 -0.0214 -0.0726 197 VAL D CG2 
2671 N  N   . PHE D 73 ? 0.2629 0.9363 0.2450 -0.0170 0.0061  -0.0481 198 PHE D N   
2672 C  CA  . PHE D 73 ? 0.2659 0.9260 0.2482 -0.0110 0.0117  -0.0462 198 PHE D CA  
2673 C  C   . PHE D 73 ? 0.3040 0.9494 0.2984 -0.0181 0.0119  -0.0382 198 PHE D C   
2674 O  O   . PHE D 73 ? 0.3305 0.9521 0.3239 -0.0180 0.0095  -0.0425 198 PHE D O   
2675 C  CB  . PHE D 73 ? 0.2790 0.9544 0.2584 -0.0046 0.0201  -0.0378 198 PHE D CB  
2676 C  CG  . PHE D 73 ? 0.3079 0.9786 0.2912 0.0015  0.0246  -0.0355 198 PHE D CG  
2677 C  CD1 . PHE D 73 ? 0.3430 1.0094 0.3349 -0.0010 0.0263  -0.0257 198 PHE D CD1 
2678 C  CD2 . PHE D 73 ? 0.3678 1.0427 0.3452 0.0123  0.0270  -0.0436 198 PHE D CD2 
2679 C  CE1 . PHE D 73 ? 0.3615 1.0266 0.3564 0.0062  0.0287  -0.0246 198 PHE D CE1 
2680 C  CE2 . PHE D 73 ? 0.4032 1.0807 0.3857 0.0200  0.0303  -0.0418 198 PHE D CE2 
2681 C  CZ  . PHE D 73 ? 0.3713 1.0433 0.3628 0.0165  0.0304  -0.0326 198 PHE D CZ  
2682 N  N   . PHE D 74 ? 0.2141 0.8719 0.2165 -0.0223 0.0150  -0.0260 199 PHE D N   
2683 C  CA  . PHE D 74 ? 0.2057 0.8563 0.2172 -0.0263 0.0176  -0.0155 199 PHE D CA  
2684 C  C   . PHE D 74 ? 0.2580 0.8988 0.2794 -0.0394 0.0141  -0.0142 199 PHE D C   
2685 O  O   . PHE D 74 ? 0.2640 0.8853 0.2865 -0.0406 0.0165  -0.0081 199 PHE D O   
2686 C  CB  . PHE D 74 ? 0.2129 0.8799 0.2256 -0.0229 0.0217  -0.0047 199 PHE D CB  
2687 C  CG  . PHE D 74 ? 0.2198 0.8886 0.2242 -0.0142 0.0247  -0.0037 199 PHE D CG  
2688 C  CD1 . PHE D 74 ? 0.2552 0.9155 0.2594 -0.0088 0.0271  -0.0014 199 PHE D CD1 
2689 C  CD2 . PHE D 74 ? 0.2321 0.9115 0.2289 -0.0124 0.0246  -0.0037 199 PHE D CD2 
2690 C  CE1 . PHE D 74 ? 0.2551 0.9213 0.2556 -0.0045 0.0284  -0.0009 199 PHE D CE1 
2691 C  CE2 . PHE D 74 ? 0.2638 0.9432 0.2546 -0.0092 0.0271  -0.0011 199 PHE D CE2 
2692 C  CZ  . PHE D 74 ? 0.2372 0.9120 0.2319 -0.0067 0.0286  -0.0004 199 PHE D CZ  
2693 N  N   . ILE D 75 ? 0.2035 0.8586 0.2324 -0.0498 0.0082  -0.0186 200 ILE D N   
2694 C  CA  . ILE D 75 ? 0.2176 0.8666 0.2600 -0.0676 0.0039  -0.0170 200 ILE D CA  
2695 C  C   . ILE D 75 ? 0.3094 0.9170 0.3439 -0.0715 -0.0009 -0.0255 200 ILE D C   
2696 O  O   . ILE D 75 ? 0.3154 0.9018 0.3536 -0.0790 0.0020  -0.0158 200 ILE D O   
2697 C  CB  . ILE D 75 ? 0.2518 0.9329 0.3084 -0.0793 -0.0026 -0.0198 200 ILE D CB  
2698 C  CG1 . ILE D 75 ? 0.2218 0.9387 0.2859 -0.0730 0.0042  -0.0066 200 ILE D CG1 
2699 C  CG2 . ILE D 75 ? 0.2867 0.9597 0.3596 -0.1031 -0.0093 -0.0209 200 ILE D CG2 
2700 C  CD1 . ILE D 75 ? 0.2907 1.0451 0.3620 -0.0734 -0.0019 -0.0105 200 ILE D CD1 
2701 N  N   . PRO D 76 ? 0.2925 0.8855 0.3116 -0.0623 -0.0069 -0.0421 201 PRO D N   
2702 C  CA  . PRO D 76 ? 0.3287 0.8778 0.3348 -0.0600 -0.0120 -0.0514 201 PRO D CA  
2703 C  C   . PRO D 76 ? 0.3796 0.9075 0.3785 -0.0479 -0.0042 -0.0416 201 PRO D C   
2704 O  O   . PRO D 76 ? 0.4049 0.8944 0.3985 -0.0525 -0.0067 -0.0394 201 PRO D O   
2705 C  CB  . PRO D 76 ? 0.3599 0.9104 0.3490 -0.0459 -0.0175 -0.0701 201 PRO D CB  
2706 C  CG  . PRO D 76 ? 0.3970 0.9854 0.3933 -0.0509 -0.0197 -0.0717 201 PRO D CG  
2707 C  CD  . PRO D 76 ? 0.3062 0.9205 0.3160 -0.0522 -0.0096 -0.0530 201 PRO D CD  
2708 N  N   . PHE D 77 ? 0.3098 0.8611 0.3079 -0.0333 0.0043  -0.0351 202 PHE D N   
2709 C  CA  . PHE D 77 ? 0.3090 0.8488 0.3016 -0.0203 0.0103  -0.0266 202 PHE D CA  
2710 C  C   . PHE D 77 ? 0.3906 0.9154 0.3893 -0.0307 0.0135  -0.0105 202 PHE D C   
2711 O  O   . PHE D 77 ? 0.4191 0.9125 0.4075 -0.0239 0.0140  -0.0066 202 PHE D O   
2712 C  CB  . PHE D 77 ? 0.2908 0.8631 0.2858 -0.0090 0.0167  -0.0224 202 PHE D CB  
2713 C  CG  . PHE D 77 ? 0.3023 0.8690 0.2930 0.0049  0.0205  -0.0161 202 PHE D CG  
2714 C  CD1 . PHE D 77 ? 0.3286 0.8975 0.3232 0.0034  0.0245  -0.0019 202 PHE D CD1 
2715 C  CD2 . PHE D 77 ? 0.3390 0.9030 0.3211 0.0217  0.0198  -0.0250 202 PHE D CD2 
2716 C  CE1 . PHE D 77 ? 0.3464 0.9115 0.3350 0.0178  0.0262  0.0027  202 PHE D CE1 
2717 C  CE2 . PHE D 77 ? 0.3815 0.9456 0.3608 0.0359  0.0217  -0.0200 202 PHE D CE2 
2718 C  CZ  . PHE D 77 ? 0.3513 0.9148 0.3333 0.0335  0.0242  -0.0065 202 PHE D CZ  
2719 N  N   . ILE D 78 ? 0.3349 0.8840 0.3487 -0.0453 0.0163  -0.0005 203 ILE D N   
2720 C  CA  . ILE D 78 ? 0.3491 0.8947 0.3710 -0.0569 0.0215  0.0169  203 ILE D CA  
2721 C  C   . ILE D 78 ? 0.5116 1.0189 0.5328 -0.0737 0.0161  0.0164  203 ILE D C   
2722 O  O   . ILE D 78 ? 0.5509 1.0259 0.5631 -0.0731 0.0192  0.0272  203 ILE D O   
2723 C  CB  . ILE D 78 ? 0.3439 0.9330 0.3828 -0.0659 0.0254  0.0252  203 ILE D CB  
2724 C  CG1 . ILE D 78 ? 0.3040 0.9176 0.3381 -0.0485 0.0307  0.0288  203 ILE D CG1 
2725 C  CG2 . ILE D 78 ? 0.3550 0.9476 0.4066 -0.0829 0.0307  0.0423  203 ILE D CG2 
2726 C  CD1 . ILE D 78 ? 0.2730 0.9227 0.3153 -0.0493 0.0307  0.0286  203 ILE D CD1 
2727 N  N   . MET D 79 ? 0.5154 1.0226 0.5430 -0.0879 0.0068  0.0032  204 MET D N   
2728 C  CA  . MET D 79 ? 0.5848 1.0529 0.6120 -0.1077 -0.0017 -0.0005 204 MET D CA  
2729 C  C   . MET D 79 ? 0.6924 1.1025 0.6938 -0.0938 -0.0055 -0.0067 204 MET D C   
2730 O  O   . MET D 79 ? 0.7397 1.1066 0.7353 -0.1060 -0.0068 0.0023  204 MET D O   
2731 C  CB  . MET D 79 ? 0.6299 1.1122 0.6660 -0.1214 -0.0139 -0.0182 204 MET D CB  
2732 C  CG  . MET D 79 ? 0.6538 1.1959 0.7145 -0.1318 -0.0110 -0.0120 204 MET D CG  
2733 S  SD  . MET D 79 ? 0.7298 1.2976 0.8051 -0.1503 -0.0266 -0.0300 204 MET D SD  
2734 C  CE  . MET D 79 ? 0.6900 1.2430 0.7370 -0.1245 -0.0345 -0.0547 204 MET D CE  
2735 N  N   . LEU D 80 ? 0.6436 1.0549 0.6291 -0.0673 -0.0061 -0.0194 205 LEU D N   
2736 C  CA  . LEU D 80 ? 0.6875 1.0539 0.6475 -0.0464 -0.0096 -0.0274 205 LEU D CA  
2737 C  C   . LEU D 80 ? 0.7564 1.1066 0.7079 -0.0342 -0.0012 -0.0097 205 LEU D C   
2738 O  O   . LEU D 80 ? 0.8025 1.0993 0.7366 -0.0328 -0.0046 -0.0061 205 LEU D O   
2739 C  CB  . LEU D 80 ? 0.6740 1.0616 0.6242 -0.0221 -0.0112 -0.0455 205 LEU D CB  
2740 C  CG  . LEU D 80 ? 0.7743 1.1295 0.6990 0.0063  -0.0140 -0.0560 205 LEU D CG  
2741 C  CD1 . LEU D 80 ? 0.8411 1.1377 0.7447 0.0048  -0.0271 -0.0716 205 LEU D CD1 
2742 C  CD2 . LEU D 80 ? 0.7774 1.1744 0.7008 0.0278  -0.0107 -0.0674 205 LEU D CD2 
2743 N  N   . THR D 81 ? 0.6810 1.0731 0.6413 -0.0239 0.0082  0.0005  206 THR D N   
2744 C  CA  . THR D 81 ? 0.6865 1.0708 0.6377 -0.0091 0.0150  0.0158  206 THR D CA  
2745 C  C   . THR D 81 ? 0.7735 1.1332 0.7249 -0.0261 0.0198  0.0370  206 THR D C   
2746 O  O   . THR D 81 ? 0.8108 1.1273 0.7426 -0.0168 0.0200  0.0453  206 THR D O   
2747 C  CB  . THR D 81 ? 0.7317 1.1653 0.6912 0.0044  0.0212  0.0185  206 THR D CB  
2748 O  OG1 . THR D 81 ? 0.6990 1.1684 0.6771 -0.0124 0.0257  0.0261  206 THR D OG1 
2749 C  CG2 . THR D 81 ? 0.6884 1.1435 0.6461 0.0216  0.0179  0.0010  206 THR D CG2 
2750 N  N   . THR D 82 ? 0.7260 1.1131 0.6986 -0.0505 0.0239  0.0465  207 THR D N   
2751 C  CA  . THR D 82 ? 0.7585 1.1320 0.7356 -0.0704 0.0307  0.0690  207 THR D CA  
2752 C  C   . THR D 82 ? 0.8902 1.2066 0.8606 -0.0912 0.0229  0.0680  207 THR D C   
2753 O  O   . THR D 82 ? 0.9013 1.2176 0.8873 -0.1210 0.0249  0.0803  207 THR D O   
2754 C  CB  . THR D 82 ? 0.8146 1.2452 0.8166 -0.0846 0.0390  0.0805  207 THR D CB  
2755 O  OG1 . THR D 82 ? 0.7851 1.2387 0.8068 -0.1031 0.0322  0.0676  207 THR D OG1 
2756 C  CG2 . THR D 82 ? 0.7591 1.2312 0.7598 -0.0616 0.0451  0.0817  207 THR D CG2 
2757 N  N   . PHE D 83 ? 0.9011 1.1696 0.8476 -0.0746 0.0135  0.0527  208 PHE D N   
2758 C  CA  . PHE D 83 ? 0.9794 1.1797 0.9091 -0.0857 0.0028  0.0464  208 PHE D CA  
2759 C  C   . PHE D 83 ? 1.0891 1.2428 0.9843 -0.0512 -0.0008 0.0400  208 PHE D C   
2760 O  O   . PHE D 83 ? 1.1474 1.2383 1.0195 -0.0511 -0.0024 0.0510  208 PHE D O   
2761 C  CB  . PHE D 83 ? 1.0052 1.2088 0.9442 -0.0996 -0.0104 0.0217  208 PHE D CB  
2762 C  CG  . PHE D 83 ? 1.1057 1.2352 1.0266 -0.1142 -0.0242 0.0126  208 PHE D CG  
2763 C  CD1 . PHE D 83 ? 1.1805 1.2944 1.1181 -0.1548 -0.0281 0.0216  208 PHE D CD1 
2764 C  CD2 . PHE D 83 ? 1.1759 1.2509 1.0625 -0.0870 -0.0340 -0.0050 208 PHE D CD2 
2765 C  CE1 . PHE D 83 ? 1.2707 1.3087 1.1899 -0.1711 -0.0429 0.0126  208 PHE D CE1 
2766 C  CE2 . PHE D 83 ? 1.2930 1.2902 1.1575 -0.0986 -0.0485 -0.0145 208 PHE D CE2 
2767 C  CZ  . PHE D 83 ? 1.3053 1.2812 1.1858 -0.1420 -0.0535 -0.0060 208 PHE D CZ  
2768 N  N   . THR D 84 ? 1.0318 1.2174 0.9234 -0.0218 -0.0022 0.0230  209 THR D N   
2769 C  CA  . THR D 84 ? 1.0684 1.2280 0.9321 0.0152  -0.0055 0.0143  209 THR D CA  
2770 C  C   . THR D 84 ? 1.1673 1.3174 1.0184 0.0303  0.0028  0.0366  209 THR D C   
2771 O  O   . THR D 84 ? 1.2244 1.3214 1.0454 0.0512  -0.0012 0.0384  209 THR D O   
2772 C  CB  . THR D 84 ? 1.1183 1.3301 0.9889 0.0377  -0.0065 -0.0059 209 THR D CB  
2773 O  OG1 . THR D 84 ? 1.1168 1.3444 0.9998 0.0214  -0.0124 -0.0226 209 THR D OG1 
2774 C  CG2 . THR D 84 ? 1.1134 1.3023 0.9571 0.0755  -0.0118 -0.0192 209 THR D CG2 
2775 N  N   . VAL D 85 ? 1.0986 1.2976 0.9692 0.0218  0.0136  0.0532  210 VAL D N   
2776 C  CA  . VAL D 85 ? 1.1160 1.3122 0.9741 0.0359  0.0217  0.0748  210 VAL D CA  
2777 C  C   . VAL D 85 ? 1.2428 1.3894 1.0913 0.0129  0.0263  0.0988  210 VAL D C   
2778 O  O   . VAL D 85 ? 1.2824 1.3910 1.1047 0.0282  0.0292  0.1152  210 VAL D O   
2779 C  CB  . VAL D 85 ? 1.0985 1.3638 0.9755 0.0409  0.0299  0.0806  210 VAL D CB  
2780 C  CG1 . VAL D 85 ? 1.1073 1.3709 0.9641 0.0691  0.0331  0.0927  210 VAL D CG1 
2781 C  CG2 . VAL D 85 ? 1.0390 1.3542 0.9338 0.0476  0.0259  0.0585  210 VAL D CG2 
2782 N  N   . LEU D 86 ? 1.2170 1.3641 1.0862 -0.0241 0.0265  0.1012  211 LEU D N   
2783 C  CA  . LEU D 86 ? 1.2784 1.3849 1.1458 -0.0544 0.0310  0.1242  211 LEU D CA  
2784 C  C   . LEU D 86 ? 1.4417 1.4568 1.2754 -0.0517 0.0213  0.1233  211 LEU D C   
2785 O  O   . LEU D 86 ? 1.4892 1.4568 1.3093 -0.0674 0.0263  0.1476  211 LEU D O   
2786 C  CB  . LEU D 86 ? 1.2555 1.3947 1.1580 -0.0940 0.0305  0.1216  211 LEU D CB  
2787 C  CG  . LEU D 86 ? 1.3108 1.4781 1.2345 -0.1241 0.0442  0.1502  211 LEU D CG  
2788 C  CD1 . LEU D 86 ? 1.3920 1.4920 1.3029 -0.1507 0.0449  0.1709  211 LEU D CD1 
2789 C  CD2 . LEU D 86 ? 1.3017 1.5207 1.2260 -0.1035 0.0587  0.1668  211 LEU D CD2 
2790 N  N   . ASN D 87 ? 1.4408 1.4304 1.2592 -0.0309 0.0079  0.0959  212 ASN D N   
2791 C  CA  . ASN D 87 ? 1.5386 1.4391 1.3193 -0.0196 -0.0038 0.0892  212 ASN D CA  
2792 C  C   . ASN D 87 ? 1.6428 1.5224 1.3898 0.0256  -0.0021 0.0947  212 ASN D C   
2793 O  O   . ASN D 87 ? 1.7180 1.5228 1.4304 0.0301  -0.0041 0.1087  212 ASN D O   
2794 C  CB  . ASN D 87 ? 1.5564 1.4452 1.3353 -0.0154 -0.0194 0.0551  212 ASN D CB  
2795 C  CG  . ASN D 87 ? 1.8786 1.7405 1.6712 -0.0580 -0.0285 0.0486  212 ASN D CG  
2796 O  OD1 . ASN D 87 ? 1.7900 1.6546 1.6026 -0.0966 -0.0223 0.0698  212 ASN D OD1 
2797 N  ND2 . ASN D 87 ? 1.8226 1.6610 1.6044 -0.0514 -0.0440 0.0186  212 ASN D ND2 
2798 N  N   . LEU D 88 ? 1.5540 1.5002 1.3109 0.0553  0.0011  0.0841  213 LEU D N   
2799 C  CA  . LEU D 88 ? 1.5674 1.5148 1.2999 0.0996  0.0016  0.0859  213 LEU D CA  
2800 C  C   . LEU D 88 ? 1.6709 1.6003 1.3873 0.1017  0.0116  0.1180  213 LEU D C   
2801 O  O   . LEU D 88 ? 1.7385 1.6088 1.4166 0.1269  0.0083  0.1267  213 LEU D O   
2802 C  CB  . LEU D 88 ? 1.4842 1.5179 1.2407 0.1190  0.0035  0.0703  213 LEU D CB  
2803 N  N   . PHE D 89 ? 1.5914 1.5709 1.3339 0.0777  0.0240  0.1359  214 PHE D N   
2804 C  CA  . PHE D 89 ? 1.6161 1.5891 1.3446 0.0789  0.0357  0.1676  214 PHE D CA  
2805 C  C   . PHE D 89 ? 1.7500 1.6391 1.4532 0.0586  0.0379  0.1913  214 PHE D C   
2806 O  O   . PHE D 89 ? 1.7996 1.6470 1.4676 0.0794  0.0414  0.2118  214 PHE D O   
2807 C  CB  . PHE D 89 ? 1.5759 1.6246 1.3374 0.0596  0.0481  0.1784  214 PHE D CB  
2808 C  CG  . PHE D 89 ? 1.5384 1.6550 1.3078 0.0879  0.0490  0.1692  214 PHE D CG  
2809 C  CD1 . PHE D 89 ? 1.6014 1.7105 1.3432 0.1277  0.0450  0.1694  214 PHE D CD1 
2810 C  CD2 . PHE D 89 ? 1.4990 1.6854 1.3020 0.0743  0.0530  0.1617  214 PHE D CD2 
2811 C  CE1 . PHE D 89 ? 1.5611 1.7334 1.3121 0.1501  0.0439  0.1603  214 PHE D CE1 
2812 C  CE2 . PHE D 89 ? 1.4870 1.7287 1.2954 0.0974  0.0522  0.1532  214 PHE D CE2 
2813 C  CZ  . PHE D 89 ? 1.4819 1.7171 1.2656 0.1334  0.0472  0.1522  214 PHE D CZ  
2814 N  N   . ILE D 90 ? 1.7228 1.5847 1.4420 0.0185  0.0346  0.1882  215 ILE D N   
2815 C  CA  . ILE D 90 ? 1.8100 1.5880 1.5089 -0.0089 0.0346  0.2090  215 ILE D CA  
2816 C  C   . ILE D 90 ? 1.9396 1.6228 1.5890 0.0207  0.0213  0.2014  215 ILE D C   
2817 O  O   . ILE D 90 ? 2.0177 1.6262 1.6335 0.0171  0.0240  0.2268  215 ILE D O   
2818 C  CB  . ILE D 90 ? 1.8448 1.6298 1.5794 -0.0621 0.0329  0.2057  215 ILE D CB  
2819 C  CG1 . ILE D 90 ? 1.8201 1.6618 1.5851 -0.0942 0.0515  0.2356  215 ILE D CG1 
2820 C  CG2 . ILE D 90 ? 1.9533 1.6371 1.6651 -0.0853 0.0204  0.2048  215 ILE D CG2 
2821 C  CD1 . ILE D 90 ? 1.8787 1.7703 1.6915 -0.1388 0.0513  0.2284  215 ILE D CD1 
2822 N  N   . GLY D 91 ? 1.8726 1.5627 1.5160 0.0523  0.0082  0.1683  216 GLY D N   
2823 C  CA  . GLY D 91 ? 1.9427 1.5561 1.5396 0.0899  -0.0054 0.1554  216 GLY D CA  
2824 C  C   . GLY D 91 ? 2.0194 1.6146 1.5792 0.1325  -0.0009 0.1739  216 GLY D C   
2825 O  O   . GLY D 91 ? 2.1075 1.6127 1.6199 0.1527  -0.0081 0.1806  216 GLY D O   
2826 N  N   . ILE D 92 ? 1.8993 1.5775 1.4779 0.1473  0.0098  0.1819  217 ILE D N   
2827 C  CA  . ILE D 92 ? 1.9146 1.5932 1.4625 0.1878  0.0140  0.1991  217 ILE D CA  
2828 C  C   . ILE D 92 ? 2.0462 1.6593 1.5648 0.1707  0.0244  0.2393  217 ILE D C   
2829 O  O   . ILE D 92 ? 2.1128 1.6674 1.5842 0.2039  0.0220  0.2535  217 ILE D O   
2830 C  CB  . ILE D 92 ? 1.8518 1.6381 1.4303 0.2027  0.0204  0.1938  217 ILE D CB  
2831 C  CG1 . ILE D 92 ? 1.7874 1.6326 1.3916 0.2196  0.0105  0.1567  217 ILE D CG1 
2832 C  CG2 . ILE D 92 ? 1.8818 1.6712 1.4283 0.2431  0.0233  0.2116  217 ILE D CG2 
2833 C  CD1 . ILE D 92 ? 1.7581 1.7055 1.4055 0.2113  0.0165  0.1487  217 ILE D CD1 
2834 N  N   . ILE D 93 ? 1.9940 1.6180 1.5405 0.1193  0.0360  0.2581  218 ILE D N   
2835 C  CA  . ILE D 93 ? 2.0607 1.6341 1.5887 0.0924  0.0490  0.2990  218 ILE D CA  
2836 C  C   . ILE D 93 ? 2.2392 1.6872 1.7223 0.0881  0.0394  0.3072  218 ILE D C   
2837 O  O   . ILE D 93 ? 2.3149 1.7002 1.7552 0.0993  0.0454  0.3382  218 ILE D O   
2838 C  CB  . ILE D 93 ? 2.0485 1.6776 1.6253 0.0372  0.0629  0.3125  218 ILE D CB  
2839 C  CG1 . ILE D 93 ? 1.9424 1.6862 1.5551 0.0471  0.0718  0.3056  218 ILE D CG1 
2840 C  CG2 . ILE D 93 ? 2.1331 1.7146 1.6945 0.0048  0.0782  0.3571  218 ILE D CG2 
2841 C  CD1 . ILE D 93 ? 1.9540 1.7652 1.6198 0.0017  0.0799  0.3042  218 ILE D CD1 
2842 N  N   . VAL D 94 ? 2.2174 1.6267 1.7069 0.0739  0.0237  0.2788  219 VAL D N   
2843 C  CA  . VAL D 94 ? 2.3345 1.6198 1.7813 0.0686  0.0107  0.2798  219 VAL D CA  
2844 C  C   . VAL D 94 ? 2.4489 1.6759 1.8387 0.1324  -0.0010 0.2703  219 VAL D C   
2845 O  O   . VAL D 94 ? 2.5527 1.6815 1.8912 0.1421  -0.0022 0.2940  219 VAL D O   
2846 C  CB  . VAL D 94 ? 2.3853 1.6497 1.8563 0.0320  -0.0038 0.2507  219 VAL D CB  
2847 C  CG1 . VAL D 94 ? 2.5158 1.6432 1.9397 0.0226  -0.0187 0.2525  219 VAL D CG1 
2848 C  CG2 . VAL D 94 ? 2.3219 1.6529 1.8507 -0.0278 0.0073  0.2604  219 VAL D CG2 
2849 N  N   . ASP D 95 ? 2.3394 1.6288 1.7382 0.1760  -0.0091 0.2374  220 ASP D N   
2850 C  CA  . ASP D 95 ? 2.7998 2.0550 2.1521 0.2404  -0.0207 0.2241  220 ASP D CA  
2851 C  C   . ASP D 95 ? 3.0938 2.3581 2.4168 0.2766  -0.0113 0.2524  220 ASP D C   
2852 O  O   . ASP D 95 ? 2.4753 1.8353 1.8281 0.2810  -0.0006 0.2578  220 ASP D O   
2853 C  CB  . ASP D 95 ? 2.7448 2.0761 2.1221 0.2710  -0.0303 0.1821  220 ASP D CB  
2854 C  CG  . ASP D 95 ? 2.9007 2.1894 2.2782 0.2596  -0.0454 0.1504  220 ASP D CG  
2855 O  OD1 . ASP D 95 ? 3.0005 2.2008 2.3286 0.2914  -0.0596 0.1393  220 ASP D OD1 
2856 O  OD2 . ASP D 95 ? 2.9051 2.2487 2.3293 0.2219  -0.0437 0.1358  220 ASP D OD2 
2857 C  C9  . 2CV E .  ? 0.7311 1.1794 0.5214 -0.0543 -0.0161 -0.1150 300 2CV A C9  
2858 C  C12 . 2CV E .  ? 0.6775 1.1588 0.4784 -0.0736 -0.0297 -0.1068 300 2CV A C12 
2859 C  C15 . 2CV E .  ? 0.5927 1.1189 0.4191 -0.0674 -0.0245 -0.0874 300 2CV A C15 
2860 C  C18 . 2CV E .  ? 0.5844 1.1441 0.4234 -0.0830 -0.0365 -0.0783 300 2CV A C18 
2861 C  C21 . 2CV E .  ? 0.5880 1.1859 0.4470 -0.0734 -0.0304 -0.0627 300 2CV A C21 
2862 C  C24 . 2CV E .  ? 0.6437 1.2761 0.5198 -0.0847 -0.0401 -0.0514 300 2CV A C24 
2863 C  C27 . 2CV E .  ? 0.6888 1.3506 0.5889 -0.0730 -0.0325 -0.0362 300 2CV A C27 
2864 C  C30 . 2CV E .  ? 0.7308 1.4266 0.6489 -0.0801 -0.0405 -0.0240 300 2CV A C30 
2865 N  N33 . 2CV E .  ? 0.7672 1.4863 0.6995 -0.0698 -0.0360 -0.0123 300 2CV A N33 
2866 O  O34 . 2CV E .  ? 0.7281 1.4303 0.6507 -0.0947 -0.0510 -0.0233 300 2CV A O34 
2867 C  C35 . 2CV E .  ? 0.7119 1.4263 0.6439 -0.0544 -0.0243 -0.0104 300 2CV A C35 
2868 C  C36 . 2CV E .  ? 0.8447 1.5954 0.7950 -0.0751 -0.0438 0.0006  300 2CV A C36 
2869 C  C37 . 2CV E .  ? 0.9059 1.6696 0.8898 -0.0760 -0.0429 0.0097  300 2CV A C37 
2870 C  C40 . 2CV E .  ? 0.9722 1.7494 0.9634 -0.0913 -0.0539 0.0124  300 2CV A C40 
2871 C  C41 . 2CV E .  ? 1.0074 1.8011 1.0316 -0.0899 -0.0505 0.0216  300 2CV A C41 
2872 C  C42 . 2CV E .  ? 1.0467 1.8759 1.0939 -0.0945 -0.0582 0.0360  300 2CV A C42 
2873 C  C43 . 2CV E .  ? 1.0441 1.8912 1.1085 -0.0809 -0.0548 0.0478  300 2CV A C43 
2874 O  O44 . 2CV E .  ? 1.0230 1.8652 1.1078 -0.0674 -0.0432 0.0483  300 2CV A O44 
2875 O  O47 . 2CV E .  ? 0.9099 1.6547 0.8992 -0.0709 -0.0341 0.0044  300 2CV A O47 
2876 O  O49 . 2CV E .  ? 0.9915 1.7914 0.9776 -0.0969 -0.0641 0.0191  300 2CV A O49 
2877 O  O51 . 2CV E .  ? 1.0190 1.7982 1.0414 -0.0984 -0.0500 0.0157  300 2CV A O51 
2878 O  O53 . 2CV E .  ? 1.0803 1.9172 1.1124 -0.1105 -0.0723 0.0356  300 2CV A O53 
2879 C  C60 . 2CV E .  ? 0.6788 1.4170 0.6365 -0.0468 -0.0212 0.0049  300 2CV A C60 
2880 O  O63 . 2CV E .  ? 0.6692 1.4026 0.6270 -0.0349 -0.0116 0.0072  300 2CV A O63 
2881 C  C1  . 2CV E .  ? 0.8324 1.2307 0.5944 -0.0579 -0.0204 -0.1378 300 2CV A C1  
2882 C  C0  . 2CV E .  ? 0.8850 1.2505 0.6392 -0.0352 -0.0050 -0.1450 300 2CV A C0  
2883 C  C9  . 2CV F .  ? 0.6792 1.2610 0.6992 -0.1195 -0.0144 0.0540  301 2CV A C9  
2884 C  C12 . 2CV F .  ? 0.6720 1.2926 0.6979 -0.1238 -0.0149 0.0518  301 2CV A C12 
2885 C  C15 . 2CV F .  ? 0.7052 1.3203 0.7320 -0.1389 -0.0250 0.0459  301 2CV A C15 
2886 C  C18 . 2CV F .  ? 0.7018 1.3607 0.7429 -0.1451 -0.0255 0.0515  301 2CV A C18 
2887 C  C21 . 2CV F .  ? 0.6907 1.3772 0.7306 -0.1289 -0.0174 0.0451  301 2CV A C21 
2888 C  C24 . 2CV F .  ? 0.6991 1.4260 0.7551 -0.1327 -0.0173 0.0503  301 2CV A C24 
2889 C  C27 . 2CV F .  ? 0.6902 1.4408 0.7476 -0.1157 -0.0083 0.0445  301 2CV A C27 
2890 C  C30 . 2CV F .  ? 0.6983 1.4507 0.7545 -0.1112 -0.0120 0.0347  301 2CV A C30 
2891 N  N33 . 2CV F .  ? 0.6797 1.4181 0.7246 -0.0981 -0.0090 0.0242  301 2CV A N33 
2892 O  O34 . 2CV F .  ? 0.7224 1.4916 0.7896 -0.1197 -0.0178 0.0388  301 2CV A O34 
2893 C  C36 . 2CV F .  ? 0.6497 1.4059 0.7005 -0.0841 -0.0013 0.0209  301 2CV A C36 
2894 C  C1  . 2CV F .  ? 0.6462 1.2383 0.6667 -0.1051 -0.0059 0.0623  301 2CV A C1  
2895 C  C0  . 2CV F .  ? 0.6697 1.2289 0.6918 -0.1024 -0.0056 0.0713  301 2CV A C0  
2896 BR BR  . BR  G .  ? 0.4454 0.7661 0.3047 0.0598  0.0591  -0.0777 301 BR  B BR  
2897 C  C9  . 2CV H .  ? 0.4832 1.1700 0.6698 0.1319  0.0312  0.0144  302 2CV B C9  
2898 C  C12 . 2CV H .  ? 0.4567 1.1791 0.6347 0.1237  0.0333  -0.0016 302 2CV B C12 
2899 C  C15 . 2CV H .  ? 0.4265 1.1543 0.5741 0.0967  0.0218  -0.0062 302 2CV B C15 
2900 C  C18 . 2CV H .  ? 0.4368 1.1954 0.5744 0.0872  0.0238  -0.0200 302 2CV B C18 
2901 C  C21 . 2CV H .  ? 0.4754 1.2404 0.5863 0.0640  0.0111  -0.0165 302 2CV B C21 
2902 C  C24 . 2CV H .  ? 0.5374 1.3310 0.6367 0.0525  0.0112  -0.0254 302 2CV B C24 
2903 C  C27 . 2CV H .  ? 0.5996 1.3962 0.6744 0.0321  -0.0017 -0.0154 302 2CV B C27 
2904 C  C30 . 2CV H .  ? 0.6670 1.4871 0.7280 0.0188  -0.0027 -0.0209 302 2CV B C30 
2905 N  N33 . 2CV H .  ? 0.7171 1.5376 0.7567 0.0013  -0.0127 -0.0105 302 2CV B N33 
2906 O  O34 . 2CV H .  ? 0.6813 1.5187 0.7496 0.0227  0.0061  -0.0342 302 2CV B O34 
2907 C  C35 . 2CV H .  ? 0.6771 1.4779 0.7064 -0.0052 -0.0207 0.0022  302 2CV B C35 
2908 C  C36 . 2CV H .  ? 0.8052 1.6453 0.8302 -0.0130 -0.0145 -0.0126 302 2CV B C36 
2909 C  C37 . 2CV H .  ? 0.8887 1.7219 0.9080 -0.0142 -0.0106 -0.0258 302 2CV B C37 
2910 C  C40 . 2CV H .  ? 0.9421 1.7561 0.9381 -0.0271 -0.0190 -0.0186 302 2CV B C40 
2911 C  C41 . 2CV H .  ? 0.9820 1.8134 0.9608 -0.0450 -0.0255 -0.0072 302 2CV B C41 
2912 C  C42 . 2CV H .  ? 0.9917 1.8521 0.9653 -0.0546 -0.0244 -0.0112 302 2CV B C42 
2913 C  C43 . 2CV H .  ? 1.0000 1.8429 0.9590 -0.0597 -0.0298 -0.0054 302 2CV B C43 
2914 O  O44 . 2CV H .  ? 1.0128 1.8236 0.9533 -0.0665 -0.0384 0.0115  302 2CV B O44 
2915 O  O47 . 2CV H .  ? 0.9170 1.7879 0.9427 -0.0162 -0.0036 -0.0354 302 2CV B O47 
2916 O  O49 . 2CV H .  ? 0.9551 1.7687 0.9508 -0.0258 -0.0153 -0.0294 302 2CV B O49 
2917 O  O51 . 2CV H .  ? 1.0099 1.8065 0.9688 -0.0529 -0.0333 0.0050  302 2CV B O51 
2918 O  O53 . 2CV H .  ? 1.0031 1.8925 0.9673 -0.0708 -0.0279 -0.0025 302 2CV B O53 
2919 C  C60 . 2CV H .  ? 0.6587 1.4569 0.6622 -0.0261 -0.0286 0.0109  302 2CV B C60 
2920 O  O63 . 2CV H .  ? 0.6324 1.4144 0.6264 -0.0333 -0.0333 0.0194  302 2CV B O63 
2921 C  C1  . 2CV H .  ? 0.5431 1.2189 0.7623 0.1628  0.0437  0.0218  302 2CV B C1  
2922 C  C0  . 2CV H .  ? 0.5760 1.2257 0.8065 0.1713  0.0379  0.0483  302 2CV B C0  
2923 C  C9  . 2CV I .  ? 0.7242 1.2961 0.7042 -0.0644 0.0308  -0.1131 303 2CV B C9  
2924 C  C12 . 2CV I .  ? 0.7602 1.3450 0.7357 -0.0698 0.0398  -0.1318 303 2CV B C12 
2925 C  C15 . 2CV I .  ? 0.7616 1.3693 0.7491 -0.0522 0.0364  -0.1265 303 2CV B C15 
2926 C  C18 . 2CV I .  ? 0.7758 1.4187 0.7555 -0.0628 0.0401  -0.1398 303 2CV B C18 
2927 C  C21 . 2CV I .  ? 0.7767 1.4458 0.7659 -0.0485 0.0339  -0.1300 303 2CV B C21 
2928 C  C24 . 2CV I .  ? 0.8135 1.5294 0.7943 -0.0596 0.0301  -0.1311 303 2CV B C24 
2929 C  C27 . 2CV I .  ? 0.8384 1.5748 0.8251 -0.0465 0.0173  -0.1098 303 2CV B C27 
2930 C  C30 . 2CV I .  ? 0.8916 1.6695 0.8730 -0.0540 0.0140  -0.1075 303 2CV B C30 
2931 N  N33 . 2CV I .  ? 0.8988 1.6861 0.8838 -0.0432 0.0049  -0.0900 303 2CV B N33 
2932 O  O34 . 2CV I .  ? 0.9224 1.7247 0.8944 -0.0718 0.0194  -0.1203 303 2CV B O34 
2933 C  C35 . 2CV I .  ? 0.8808 1.6424 0.8723 -0.0269 -0.0015 -0.0752 303 2CV B C35 
2934 C  C36 . 2CV I .  ? 0.9031 1.7281 0.8826 -0.0518 0.0019  -0.0860 303 2CV B C36 
2935 C  C60 . 2CV I .  ? 0.8781 1.6511 0.8667 -0.0210 -0.0116 -0.0559 303 2CV B C60 
2936 O  O63 . 2CV I .  ? 0.8766 1.6221 0.8674 -0.0094 -0.0154 -0.0463 303 2CV B O63 
2937 C  C1  . 2CV I .  ? 0.7643 1.3120 0.7309 -0.0844 0.0339  -0.1167 303 2CV B C1  
2938 C  C0  . 2CV I .  ? 0.7821 1.3619 0.7303 -0.1107 0.0347  -0.1284 303 2CV B C0  
2939 BR BR  . BR  J .  ? 0.2555 0.7748 0.4178 0.0899  -0.0104 0.1223  304 BR  B BR  
2940 C  C9  . 2CV K .  ? 0.6351 1.4435 0.5576 -0.0272 -0.0011 -0.2080 300 2CV C C9  
2941 C  C12 . 2CV K .  ? 0.6457 1.4835 0.5655 -0.0224 0.0066  -0.1988 300 2CV C C12 
2942 C  C15 . 2CV K .  ? 0.6312 1.4590 0.5526 -0.0206 0.0019  -0.1611 300 2CV C C15 
2943 C  C18 . 2CV K .  ? 0.6389 1.4937 0.5626 -0.0168 0.0096  -0.1533 300 2CV C C18 
2944 C  C21 . 2CV K .  ? 0.6267 1.4783 0.5504 -0.0202 0.0051  -0.1183 300 2CV C C21 
2945 C  C24 . 2CV K .  ? 0.6405 1.5220 0.5673 -0.0208 0.0125  -0.1094 300 2CV C C24 
2946 C  C27 . 2CV K .  ? 0.6428 1.5218 0.5710 -0.0279 0.0078  -0.0758 300 2CV C C27 
2947 C  C30 . 2CV K .  ? 0.6607 1.5675 0.5956 -0.0310 0.0147  -0.0658 300 2CV C C30 
2948 N  N33 . 2CV K .  ? 0.6402 1.5470 0.5797 -0.0393 0.0116  -0.0374 300 2CV C N33 
2949 O  O34 . 2CV K .  ? 0.6897 1.6177 0.6291 -0.0259 0.0232  -0.0836 300 2CV C O34 
2950 C  C35 . 2CV K .  ? 0.5609 1.4429 0.5009 -0.0434 0.0022  -0.0162 300 2CV C C35 
2951 C  C36 . 2CV K .  ? 0.6790 1.6123 0.6277 -0.0454 0.0181  -0.0256 300 2CV C C36 
2952 C  C37 . 2CV K .  ? 0.6994 1.6192 0.6689 -0.0350 0.0201  -0.0331 300 2CV C C37 
2953 C  C40 . 2CV K .  ? 0.6911 1.5693 0.6728 -0.0295 0.0116  -0.0241 300 2CV C C40 
2954 O  O47 . 2CV K .  ? 0.7076 1.6568 0.6872 -0.0436 0.0266  -0.0221 300 2CV C O47 
2955 O  O49 . 2CV K .  ? 0.6919 1.5625 0.6889 -0.0182 0.0125  -0.0364 300 2CV C O49 
2956 C  C60 . 2CV K .  ? 0.4791 1.3874 0.4046 -0.0572 -0.0002 0.0018  300 2CV C C60 
2957 O  O63 . 2CV K .  ? 0.4041 1.2924 0.3397 -0.0603 -0.0077 0.0278  300 2CV C O63 
2958 BR BR  . BR  L .  ? 0.2336 0.8517 0.2158 -0.0626 -0.0518 -0.1681 301 BR  D BR  
2959 C  C9  . 2CV M .  ? 0.3970 1.1992 0.5473 -0.1592 -0.0339 -0.0250 302 2CV D C9  
2960 C  C12 . 2CV M .  ? 0.3940 1.2262 0.5308 -0.1313 -0.0311 -0.0259 302 2CV D C12 
2961 C  C15 . 2CV M .  ? 0.4334 1.2801 0.5617 -0.1254 -0.0457 -0.0446 302 2CV D C15 
2962 C  C18 . 2CV M .  ? 0.4305 1.2669 0.5278 -0.0972 -0.0428 -0.0487 302 2CV D C18 
2963 C  C21 . 2CV M .  ? 0.4219 1.2905 0.5152 -0.0772 -0.0356 -0.0369 302 2CV D C21 
2964 C  C24 . 2CV M .  ? 0.4432 1.3222 0.5139 -0.0576 -0.0419 -0.0450 302 2CV D C24 
2965 C  C27 . 2CV M .  ? 0.4356 1.3136 0.4864 -0.0340 -0.0324 -0.0330 302 2CV D C27 
2966 C  C30 . 2CV M .  ? 0.4640 1.3503 0.4904 -0.0153 -0.0384 -0.0380 302 2CV D C30 
2967 N  N33 . 2CV M .  ? 0.4718 1.3521 0.4774 0.0047  -0.0320 -0.0273 302 2CV D N33 
2968 O  O34 . 2CV M .  ? 0.4679 1.3621 0.4904 -0.0179 -0.0494 -0.0514 302 2CV D O34 
2969 C  C35 . 2CV M .  ? 0.3817 1.2458 0.3851 0.0104  -0.0208 -0.0139 302 2CV D C35 
2970 C  C36 . 2CV M .  ? 0.5461 1.4344 0.5263 0.0238  -0.0378 -0.0288 302 2CV D C36 
2971 C  C37 . 2CV M .  ? 0.6239 1.4833 0.5780 0.0265  -0.0368 -0.0340 302 2CV D C37 
2972 C  C40 . 2CV M .  ? 0.6275 1.4484 0.5693 0.0262  -0.0238 -0.0242 302 2CV D C40 
2973 O  O47 . 2CV M .  ? 0.6830 1.5519 0.6106 0.0454  -0.0423 -0.0335 302 2CV D O47 
2974 O  O49 . 2CV M .  ? 0.6550 1.4587 0.5804 0.0252  -0.0218 -0.0298 302 2CV D O49 
2975 C  C60 . 2CV M .  ? 0.2964 1.1947 0.3109 0.0204  -0.0205 -0.0061 302 2CV D C60 
2976 O  O63 . 2CV M .  ? 0.2453 1.1218 0.2434 0.0347  -0.0123 0.0044  302 2CV D O63 
2977 C  C1  . 2CV M .  ? 0.4153 1.2503 0.5966 -0.1879 -0.0450 -0.0283 302 2CV D C1  
2978 C  C0  . 2CV M .  ? 0.4481 1.2524 0.6446 -0.2192 -0.0447 -0.0207 302 2CV D C0  
2979 BR BR  . BR  N .  ? 0.2432 0.8292 0.3479 -0.1701 0.0311  0.0747  303 BR  D BR  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   126 ?   ?   ?   A . n 
A 1 2   SER 2   127 ?   ?   ?   A . n 
A 1 3   HIS 3   128 ?   ?   ?   A . n 
A 1 4   MET 4   129 ?   ?   ?   A . n 
A 1 5   GLY 5   130 ?   ?   ?   A . n 
A 1 6   VAL 6   131 131 VAL VAL A . n 
A 1 7   GLY 7   132 132 GLY GLY A . n 
A 1 8   SER 8   133 133 SER SER A . n 
A 1 9   VAL 9   134 134 VAL VAL A . n 
A 1 10  ALA 10  135 135 ALA ALA A . n 
A 1 11  ALA 11  136 136 ALA ALA A . n 
A 1 12  LEU 12  137 137 LEU LEU A . n 
A 1 13  LEU 13  138 138 LEU LEU A . n 
A 1 14  THR 14  139 139 THR THR A . n 
A 1 15  VAL 15  140 140 VAL VAL A . n 
A 1 16  VAL 16  141 141 VAL VAL A . n 
A 1 17  PHE 17  142 142 PHE PHE A . n 
A 1 18  TYR 18  143 143 TYR TYR A . n 
A 1 19  ILE 19  144 144 ILE ILE A . n 
A 1 20  ALA 20  145 145 ALA ALA A . n 
A 1 21  ALA 21  146 146 ALA ALA A . n 
A 1 22  VAL 22  147 147 VAL VAL A . n 
A 1 23  MET 23  148 148 MET MET A . n 
A 1 24  ALA 24  149 149 ALA ALA A . n 
A 1 25  THR 25  150 150 THR THR A . n 
A 1 26  ASN 26  151 151 ASN ASN A . n 
A 1 27  LEU 27  152 152 LEU LEU A . n 
A 1 28  TYR 28  153 153 TYR TYR A . n 
A 1 29  GLY 29  154 154 GLY GLY A . n 
A 1 30  ALA 30  155 155 ALA ALA A . n 
A 1 31  THR 31  156 156 THR THR A . n 
A 1 32  PHE 32  157 157 PHE PHE A . n 
A 1 33  PRO 33  158 158 PRO PRO A . n 
A 1 34  GLU 34  159 159 GLU GLU A . n 
A 1 35  TRP 35  160 160 TRP TRP A . n 
A 1 36  PHE 36  161 161 PHE PHE A . n 
A 1 37  GLY 37  162 162 GLY GLY A . n 
A 1 38  ASP 38  163 163 ASP ASP A . n 
A 1 39  LEU 39  164 164 LEU LEU A . n 
A 1 40  SER 40  165 165 SER SER A . n 
A 1 41  LYS 41  166 166 LYS LYS A . n 
A 1 42  SER 42  167 167 SER SER A . n 
A 1 43  LEU 43  168 168 LEU LEU A . n 
A 1 44  TYR 44  169 169 TYR TYR A . n 
A 1 45  THR 45  170 170 THR THR A . n 
A 1 46  LEU 46  171 171 LEU LEU A . n 
A 1 47  PHE 47  172 172 PHE PHE A . n 
A 1 48  GLN 48  173 173 GLN GLN A . n 
A 1 49  VAL 49  174 174 VAL VAL A . n 
A 1 50  MET 50  175 175 MET MET A . n 
A 1 51  THR 51  176 176 THR THR A . n 
A 1 52  LEU 52  177 177 LEU LEU A . n 
A 1 53  GLU 53  178 178 GLU GLU A . n 
A 1 54  SER 54  179 179 SER SER A . n 
A 1 55  TRP 55  180 180 TRP TRP A . n 
A 1 56  SER 56  181 181 SER SER A . n 
A 1 57  MET 57  182 182 MET MET A . n 
A 1 58  GLY 58  183 183 GLY GLY A . n 
A 1 59  ILE 59  184 184 ILE ILE A . n 
A 1 60  VAL 60  185 185 VAL VAL A . n 
A 1 61  ARG 61  186 186 ARG ARG A . n 
A 1 62  PRO 62  187 187 PRO PRO A . n 
A 1 63  VAL 63  188 188 VAL VAL A . n 
A 1 64  MET 64  189 189 MET MET A . n 
A 1 65  ASN 65  190 190 ASN ASN A . n 
A 1 66  VAL 66  191 191 VAL VAL A . n 
A 1 67  HIS 67  192 192 HIS HIS A . n 
A 1 68  PRO 68  193 193 PRO PRO A . n 
A 1 69  ASN 69  194 194 ASN ASN A . n 
A 1 70  ALA 70  195 195 ALA ALA A . n 
A 1 71  TRP 71  196 196 TRP TRP A . n 
A 1 72  VAL 72  197 197 VAL VAL A . n 
A 1 73  PHE 73  198 198 PHE PHE A . n 
A 1 74  PHE 74  199 199 PHE PHE A . n 
A 1 75  ILE 75  200 200 ILE ILE A . n 
A 1 76  PRO 76  201 201 PRO PRO A . n 
A 1 77  PHE 77  202 202 PHE PHE A . n 
A 1 78  ILE 78  203 203 ILE ILE A . n 
A 1 79  MET 79  204 204 MET MET A . n 
A 1 80  LEU 80  205 205 LEU LEU A . n 
A 1 81  THR 81  206 206 THR THR A . n 
A 1 82  THR 82  207 207 THR THR A . n 
A 1 83  PHE 83  208 208 PHE PHE A . n 
A 1 84  THR 84  209 209 THR THR A . n 
A 1 85  VAL 85  210 210 VAL VAL A . n 
A 1 86  LEU 86  211 211 LEU LEU A . n 
A 1 87  ASN 87  212 212 ASN ASN A . n 
A 1 88  LEU 88  213 213 LEU LEU A . n 
A 1 89  PHE 89  214 214 PHE PHE A . n 
A 1 90  ILE 90  215 215 ILE ILE A . n 
A 1 91  GLY 91  216 216 GLY GLY A . n 
A 1 92  ILE 92  217 217 ILE ILE A . n 
A 1 93  ILE 93  218 218 ILE ILE A . n 
A 1 94  VAL 94  219 219 VAL VAL A . n 
A 1 95  ASP 95  220 220 ASP ASP A . n 
A 1 96  ALA 96  221 221 ALA ALA A . n 
A 1 97  MET 97  222 222 MET MET A . n 
A 1 98  ALA 98  223 ?   ?   ?   A . n 
A 1 99  ILE 99  224 ?   ?   ?   A . n 
A 1 100 THR 100 225 ?   ?   ?   A . n 
A 1 101 LYS 101 226 ?   ?   ?   A . n 
A 1 102 GLU 102 227 ?   ?   ?   A . n 
A 1 103 GLN 103 228 ?   ?   ?   A . n 
A 1 104 GLU 104 229 ?   ?   ?   A . n 
A 1 105 GLU 105 230 ?   ?   ?   A . n 
A 1 106 GLU 106 231 ?   ?   ?   A . n 
A 1 107 ALA 107 232 ?   ?   ?   A . n 
A 1 108 LYS 108 233 ?   ?   ?   A . n 
A 1 109 THR 109 234 ?   ?   ?   A . n 
A 1 110 GLY 110 235 ?   ?   ?   A . n 
A 1 111 HIS 111 236 ?   ?   ?   A . n 
A 1 112 HIS 112 237 ?   ?   ?   A . n 
A 1 113 GLN 113 238 ?   ?   ?   A . n 
A 1 114 GLU 114 239 ?   ?   ?   A . n 
A 1 115 PRO 115 240 ?   ?   ?   A . n 
A 1 116 ILE 116 241 ?   ?   ?   A . n 
A 1 117 SER 117 242 ?   ?   ?   A . n 
A 1 118 GLN 118 243 ?   ?   ?   A . n 
A 1 119 THR 119 244 ?   ?   ?   A . n 
A 1 120 LEU 120 245 ?   ?   ?   A . n 
A 1 121 LEU 121 246 ?   ?   ?   A . n 
A 1 122 HIS 122 247 ?   ?   ?   A . n 
A 1 123 LEU 123 248 ?   ?   ?   A . n 
A 1 124 GLY 124 249 ?   ?   ?   A . n 
A 1 125 ASP 125 250 ?   ?   ?   A . n 
A 1 126 ARG 126 251 ?   ?   ?   A . n 
A 1 127 LEU 127 252 ?   ?   ?   A . n 
A 1 128 ASP 128 253 ?   ?   ?   A . n 
A 1 129 ARG 129 254 ?   ?   ?   A . n 
A 1 130 ILE 130 255 ?   ?   ?   A . n 
A 1 131 GLU 131 256 ?   ?   ?   A . n 
A 1 132 LYS 132 257 ?   ?   ?   A . n 
A 1 133 GLN 133 258 ?   ?   ?   A . n 
A 1 134 LEU 134 259 ?   ?   ?   A . n 
A 1 135 ALA 135 260 ?   ?   ?   A . n 
A 1 136 GLN 136 261 ?   ?   ?   A . n 
A 1 137 ASN 137 262 ?   ?   ?   A . n 
A 1 138 ASN 138 263 ?   ?   ?   A . n 
A 1 139 GLU 139 264 ?   ?   ?   A . n 
A 1 140 LEU 140 265 ?   ?   ?   A . n 
A 1 141 LEU 141 266 ?   ?   ?   A . n 
A 1 142 GLN 142 267 ?   ?   ?   A . n 
A 1 143 ARG 143 268 ?   ?   ?   A . n 
A 1 144 GLN 144 269 ?   ?   ?   A . n 
A 1 145 GLN 145 270 ?   ?   ?   A . n 
A 1 146 PRO 146 271 ?   ?   ?   A . n 
A 1 147 GLN 147 272 ?   ?   ?   A . n 
A 1 148 LYS 148 273 ?   ?   ?   A . n 
A 1 149 LYS 149 274 ?   ?   ?   A . n 
B 1 1   GLY 1   126 ?   ?   ?   B . n 
B 1 2   SER 2   127 ?   ?   ?   B . n 
B 1 3   HIS 3   128 ?   ?   ?   B . n 
B 1 4   MET 4   129 ?   ?   ?   B . n 
B 1 5   GLY 5   130 ?   ?   ?   B . n 
B 1 6   VAL 6   131 131 VAL VAL B . n 
B 1 7   GLY 7   132 132 GLY GLY B . n 
B 1 8   SER 8   133 133 SER SER B . n 
B 1 9   VAL 9   134 134 VAL VAL B . n 
B 1 10  ALA 10  135 135 ALA ALA B . n 
B 1 11  ALA 11  136 136 ALA ALA B . n 
B 1 12  LEU 12  137 137 LEU LEU B . n 
B 1 13  LEU 13  138 138 LEU LEU B . n 
B 1 14  THR 14  139 139 THR THR B . n 
B 1 15  VAL 15  140 140 VAL VAL B . n 
B 1 16  VAL 16  141 141 VAL VAL B . n 
B 1 17  PHE 17  142 142 PHE PHE B . n 
B 1 18  TYR 18  143 143 TYR TYR B . n 
B 1 19  ILE 19  144 144 ILE ILE B . n 
B 1 20  ALA 20  145 145 ALA ALA B . n 
B 1 21  ALA 21  146 146 ALA ALA B . n 
B 1 22  VAL 22  147 147 VAL VAL B . n 
B 1 23  MET 23  148 148 MET MET B . n 
B 1 24  ALA 24  149 149 ALA ALA B . n 
B 1 25  THR 25  150 150 THR THR B . n 
B 1 26  ASN 26  151 151 ASN ASN B . n 
B 1 27  LEU 27  152 152 LEU LEU B . n 
B 1 28  TYR 28  153 153 TYR TYR B . n 
B 1 29  GLY 29  154 154 GLY GLY B . n 
B 1 30  ALA 30  155 155 ALA ALA B . n 
B 1 31  THR 31  156 156 THR THR B . n 
B 1 32  PHE 32  157 157 PHE PHE B . n 
B 1 33  PRO 33  158 158 PRO PRO B . n 
B 1 34  GLU 34  159 159 GLU GLU B . n 
B 1 35  TRP 35  160 160 TRP TRP B . n 
B 1 36  PHE 36  161 161 PHE PHE B . n 
B 1 37  GLY 37  162 162 GLY GLY B . n 
B 1 38  ASP 38  163 163 ASP ASP B . n 
B 1 39  LEU 39  164 164 LEU LEU B . n 
B 1 40  SER 40  165 165 SER SER B . n 
B 1 41  LYS 41  166 166 LYS LYS B . n 
B 1 42  SER 42  167 167 SER SER B . n 
B 1 43  LEU 43  168 168 LEU LEU B . n 
B 1 44  TYR 44  169 169 TYR TYR B . n 
B 1 45  THR 45  170 170 THR THR B . n 
B 1 46  LEU 46  171 171 LEU LEU B . n 
B 1 47  PHE 47  172 172 PHE PHE B . n 
B 1 48  GLN 48  173 173 GLN GLN B . n 
B 1 49  VAL 49  174 174 VAL VAL B . n 
B 1 50  MET 50  175 175 MET MET B . n 
B 1 51  THR 51  176 176 THR THR B . n 
B 1 52  LEU 52  177 177 LEU LEU B . n 
B 1 53  GLU 53  178 178 GLU GLU B . n 
B 1 54  SER 54  179 179 SER SER B . n 
B 1 55  TRP 55  180 180 TRP TRP B . n 
B 1 56  SER 56  181 181 SER SER B . n 
B 1 57  MET 57  182 182 MET MET B . n 
B 1 58  GLY 58  183 183 GLY GLY B . n 
B 1 59  ILE 59  184 184 ILE ILE B . n 
B 1 60  VAL 60  185 185 VAL VAL B . n 
B 1 61  ARG 61  186 186 ARG ARG B . n 
B 1 62  PRO 62  187 187 PRO PRO B . n 
B 1 63  VAL 63  188 188 VAL VAL B . n 
B 1 64  MET 64  189 189 MET MET B . n 
B 1 65  ASN 65  190 190 ASN ASN B . n 
B 1 66  VAL 66  191 191 VAL VAL B . n 
B 1 67  HIS 67  192 192 HIS HIS B . n 
B 1 68  PRO 68  193 193 PRO PRO B . n 
B 1 69  ASN 69  194 194 ASN ASN B . n 
B 1 70  ALA 70  195 195 ALA ALA B . n 
B 1 71  TRP 71  196 196 TRP TRP B . n 
B 1 72  VAL 72  197 197 VAL VAL B . n 
B 1 73  PHE 73  198 198 PHE PHE B . n 
B 1 74  PHE 74  199 199 PHE PHE B . n 
B 1 75  ILE 75  200 200 ILE ILE B . n 
B 1 76  PRO 76  201 201 PRO PRO B . n 
B 1 77  PHE 77  202 202 PHE PHE B . n 
B 1 78  ILE 78  203 203 ILE ILE B . n 
B 1 79  MET 79  204 204 MET MET B . n 
B 1 80  LEU 80  205 205 LEU LEU B . n 
B 1 81  THR 81  206 206 THR THR B . n 
B 1 82  THR 82  207 207 THR THR B . n 
B 1 83  PHE 83  208 208 PHE PHE B . n 
B 1 84  THR 84  209 209 THR THR B . n 
B 1 85  VAL 85  210 210 VAL VAL B . n 
B 1 86  LEU 86  211 211 LEU LEU B . n 
B 1 87  ASN 87  212 212 ASN ASN B . n 
B 1 88  LEU 88  213 213 LEU LEU B . n 
B 1 89  PHE 89  214 214 PHE PHE B . n 
B 1 90  ILE 90  215 215 ILE ILE B . n 
B 1 91  GLY 91  216 216 GLY GLY B . n 
B 1 92  ILE 92  217 217 ILE ILE B . n 
B 1 93  ILE 93  218 218 ILE ILE B . n 
B 1 94  VAL 94  219 219 VAL VAL B . n 
B 1 95  ASP 95  220 220 ASP ASP B . n 
B 1 96  ALA 96  221 ?   ?   ?   B . n 
B 1 97  MET 97  222 ?   ?   ?   B . n 
B 1 98  ALA 98  223 ?   ?   ?   B . n 
B 1 99  ILE 99  224 ?   ?   ?   B . n 
B 1 100 THR 100 225 ?   ?   ?   B . n 
B 1 101 LYS 101 226 ?   ?   ?   B . n 
B 1 102 GLU 102 227 ?   ?   ?   B . n 
B 1 103 GLN 103 228 ?   ?   ?   B . n 
B 1 104 GLU 104 229 ?   ?   ?   B . n 
B 1 105 GLU 105 230 ?   ?   ?   B . n 
B 1 106 GLU 106 231 ?   ?   ?   B . n 
B 1 107 ALA 107 232 ?   ?   ?   B . n 
B 1 108 LYS 108 233 ?   ?   ?   B . n 
B 1 109 THR 109 234 ?   ?   ?   B . n 
B 1 110 GLY 110 235 ?   ?   ?   B . n 
B 1 111 HIS 111 236 ?   ?   ?   B . n 
B 1 112 HIS 112 237 ?   ?   ?   B . n 
B 1 113 GLN 113 238 ?   ?   ?   B . n 
B 1 114 GLU 114 239 ?   ?   ?   B . n 
B 1 115 PRO 115 240 ?   ?   ?   B . n 
B 1 116 ILE 116 241 ?   ?   ?   B . n 
B 1 117 SER 117 242 ?   ?   ?   B . n 
B 1 118 GLN 118 243 ?   ?   ?   B . n 
B 1 119 THR 119 244 ?   ?   ?   B . n 
B 1 120 LEU 120 245 ?   ?   ?   B . n 
B 1 121 LEU 121 246 ?   ?   ?   B . n 
B 1 122 HIS 122 247 ?   ?   ?   B . n 
B 1 123 LEU 123 248 ?   ?   ?   B . n 
B 1 124 GLY 124 249 ?   ?   ?   B . n 
B 1 125 ASP 125 250 ?   ?   ?   B . n 
B 1 126 ARG 126 251 ?   ?   ?   B . n 
B 1 127 LEU 127 252 ?   ?   ?   B . n 
B 1 128 ASP 128 253 ?   ?   ?   B . n 
B 1 129 ARG 129 254 ?   ?   ?   B . n 
B 1 130 ILE 130 255 ?   ?   ?   B . n 
B 1 131 GLU 131 256 ?   ?   ?   B . n 
B 1 132 LYS 132 257 ?   ?   ?   B . n 
B 1 133 GLN 133 258 ?   ?   ?   B . n 
B 1 134 LEU 134 259 ?   ?   ?   B . n 
B 1 135 ALA 135 260 ?   ?   ?   B . n 
B 1 136 GLN 136 261 ?   ?   ?   B . n 
B 1 137 ASN 137 262 ?   ?   ?   B . n 
B 1 138 ASN 138 263 ?   ?   ?   B . n 
B 1 139 GLU 139 264 ?   ?   ?   B . n 
B 1 140 LEU 140 265 ?   ?   ?   B . n 
B 1 141 LEU 141 266 ?   ?   ?   B . n 
B 1 142 GLN 142 267 ?   ?   ?   B . n 
B 1 143 ARG 143 268 ?   ?   ?   B . n 
B 1 144 GLN 144 269 ?   ?   ?   B . n 
B 1 145 GLN 145 270 ?   ?   ?   B . n 
B 1 146 PRO 146 271 ?   ?   ?   B . n 
B 1 147 GLN 147 272 ?   ?   ?   B . n 
B 1 148 LYS 148 273 ?   ?   ?   B . n 
B 1 149 LYS 149 274 ?   ?   ?   B . n 
C 1 1   GLY 1   126 ?   ?   ?   C . n 
C 1 2   SER 2   127 ?   ?   ?   C . n 
C 1 3   HIS 3   128 ?   ?   ?   C . n 
C 1 4   MET 4   129 ?   ?   ?   C . n 
C 1 5   GLY 5   130 130 GLY GLY C . n 
C 1 6   VAL 6   131 131 VAL VAL C . n 
C 1 7   GLY 7   132 132 GLY GLY C . n 
C 1 8   SER 8   133 133 SER SER C . n 
C 1 9   VAL 9   134 134 VAL VAL C . n 
C 1 10  ALA 10  135 135 ALA ALA C . n 
C 1 11  ALA 11  136 136 ALA ALA C . n 
C 1 12  LEU 12  137 137 LEU LEU C . n 
C 1 13  LEU 13  138 138 LEU LEU C . n 
C 1 14  THR 14  139 139 THR THR C . n 
C 1 15  VAL 15  140 140 VAL VAL C . n 
C 1 16  VAL 16  141 141 VAL VAL C . n 
C 1 17  PHE 17  142 142 PHE PHE C . n 
C 1 18  TYR 18  143 143 TYR TYR C . n 
C 1 19  ILE 19  144 144 ILE ILE C . n 
C 1 20  ALA 20  145 145 ALA ALA C . n 
C 1 21  ALA 21  146 146 ALA ALA C . n 
C 1 22  VAL 22  147 147 VAL VAL C . n 
C 1 23  MET 23  148 148 MET MET C . n 
C 1 24  ALA 24  149 149 ALA ALA C . n 
C 1 25  THR 25  150 150 THR THR C . n 
C 1 26  ASN 26  151 151 ASN ASN C . n 
C 1 27  LEU 27  152 152 LEU LEU C . n 
C 1 28  TYR 28  153 153 TYR TYR C . n 
C 1 29  GLY 29  154 154 GLY GLY C . n 
C 1 30  ALA 30  155 155 ALA ALA C . n 
C 1 31  THR 31  156 156 THR THR C . n 
C 1 32  PHE 32  157 157 PHE PHE C . n 
C 1 33  PRO 33  158 158 PRO PRO C . n 
C 1 34  GLU 34  159 159 GLU GLU C . n 
C 1 35  TRP 35  160 160 TRP TRP C . n 
C 1 36  PHE 36  161 161 PHE PHE C . n 
C 1 37  GLY 37  162 162 GLY GLY C . n 
C 1 38  ASP 38  163 163 ASP ASP C . n 
C 1 39  LEU 39  164 164 LEU LEU C . n 
C 1 40  SER 40  165 165 SER SER C . n 
C 1 41  LYS 41  166 166 LYS LYS C . n 
C 1 42  SER 42  167 167 SER SER C . n 
C 1 43  LEU 43  168 168 LEU LEU C . n 
C 1 44  TYR 44  169 169 TYR TYR C . n 
C 1 45  THR 45  170 170 THR THR C . n 
C 1 46  LEU 46  171 171 LEU LEU C . n 
C 1 47  PHE 47  172 172 PHE PHE C . n 
C 1 48  GLN 48  173 173 GLN GLN C . n 
C 1 49  VAL 49  174 174 VAL VAL C . n 
C 1 50  MET 50  175 175 MET MET C . n 
C 1 51  THR 51  176 176 THR THR C . n 
C 1 52  LEU 52  177 177 LEU LEU C . n 
C 1 53  GLU 53  178 178 GLU GLU C . n 
C 1 54  SER 54  179 179 SER SER C . n 
C 1 55  TRP 55  180 180 TRP TRP C . n 
C 1 56  SER 56  181 181 SER SER C . n 
C 1 57  MET 57  182 182 MET MET C . n 
C 1 58  GLY 58  183 183 GLY GLY C . n 
C 1 59  ILE 59  184 184 ILE ILE C . n 
C 1 60  VAL 60  185 185 VAL VAL C . n 
C 1 61  ARG 61  186 186 ARG ARG C . n 
C 1 62  PRO 62  187 187 PRO PRO C . n 
C 1 63  VAL 63  188 188 VAL VAL C . n 
C 1 64  MET 64  189 189 MET MET C . n 
C 1 65  ASN 65  190 190 ASN ASN C . n 
C 1 66  VAL 66  191 191 VAL VAL C . n 
C 1 67  HIS 67  192 192 HIS HIS C . n 
C 1 68  PRO 68  193 193 PRO PRO C . n 
C 1 69  ASN 69  194 194 ASN ASN C . n 
C 1 70  ALA 70  195 195 ALA ALA C . n 
C 1 71  TRP 71  196 196 TRP TRP C . n 
C 1 72  VAL 72  197 197 VAL VAL C . n 
C 1 73  PHE 73  198 198 PHE PHE C . n 
C 1 74  PHE 74  199 199 PHE PHE C . n 
C 1 75  ILE 75  200 200 ILE ILE C . n 
C 1 76  PRO 76  201 201 PRO PRO C . n 
C 1 77  PHE 77  202 202 PHE PHE C . n 
C 1 78  ILE 78  203 203 ILE ILE C . n 
C 1 79  MET 79  204 204 MET MET C . n 
C 1 80  LEU 80  205 205 LEU LEU C . n 
C 1 81  THR 81  206 206 THR THR C . n 
C 1 82  THR 82  207 207 THR THR C . n 
C 1 83  PHE 83  208 208 PHE PHE C . n 
C 1 84  THR 84  209 209 THR THR C . n 
C 1 85  VAL 85  210 210 VAL VAL C . n 
C 1 86  LEU 86  211 211 LEU LEU C . n 
C 1 87  ASN 87  212 212 ASN ASN C . n 
C 1 88  LEU 88  213 213 LEU LEU C . n 
C 1 89  PHE 89  214 214 PHE PHE C . n 
C 1 90  ILE 90  215 215 ILE ILE C . n 
C 1 91  GLY 91  216 216 GLY GLY C . n 
C 1 92  ILE 92  217 217 ILE ILE C . n 
C 1 93  ILE 93  218 218 ILE ILE C . n 
C 1 94  VAL 94  219 219 VAL VAL C . n 
C 1 95  ASP 95  220 220 ASP ASP C . n 
C 1 96  ALA 96  221 ?   ?   ?   C . n 
C 1 97  MET 97  222 ?   ?   ?   C . n 
C 1 98  ALA 98  223 ?   ?   ?   C . n 
C 1 99  ILE 99  224 ?   ?   ?   C . n 
C 1 100 THR 100 225 ?   ?   ?   C . n 
C 1 101 LYS 101 226 ?   ?   ?   C . n 
C 1 102 GLU 102 227 ?   ?   ?   C . n 
C 1 103 GLN 103 228 ?   ?   ?   C . n 
C 1 104 GLU 104 229 ?   ?   ?   C . n 
C 1 105 GLU 105 230 ?   ?   ?   C . n 
C 1 106 GLU 106 231 ?   ?   ?   C . n 
C 1 107 ALA 107 232 ?   ?   ?   C . n 
C 1 108 LYS 108 233 ?   ?   ?   C . n 
C 1 109 THR 109 234 ?   ?   ?   C . n 
C 1 110 GLY 110 235 ?   ?   ?   C . n 
C 1 111 HIS 111 236 ?   ?   ?   C . n 
C 1 112 HIS 112 237 ?   ?   ?   C . n 
C 1 113 GLN 113 238 ?   ?   ?   C . n 
C 1 114 GLU 114 239 ?   ?   ?   C . n 
C 1 115 PRO 115 240 ?   ?   ?   C . n 
C 1 116 ILE 116 241 ?   ?   ?   C . n 
C 1 117 SER 117 242 ?   ?   ?   C . n 
C 1 118 GLN 118 243 ?   ?   ?   C . n 
C 1 119 THR 119 244 ?   ?   ?   C . n 
C 1 120 LEU 120 245 ?   ?   ?   C . n 
C 1 121 LEU 121 246 ?   ?   ?   C . n 
C 1 122 HIS 122 247 ?   ?   ?   C . n 
C 1 123 LEU 123 248 ?   ?   ?   C . n 
C 1 124 GLY 124 249 ?   ?   ?   C . n 
C 1 125 ASP 125 250 ?   ?   ?   C . n 
C 1 126 ARG 126 251 ?   ?   ?   C . n 
C 1 127 LEU 127 252 ?   ?   ?   C . n 
C 1 128 ASP 128 253 ?   ?   ?   C . n 
C 1 129 ARG 129 254 ?   ?   ?   C . n 
C 1 130 ILE 130 255 ?   ?   ?   C . n 
C 1 131 GLU 131 256 ?   ?   ?   C . n 
C 1 132 LYS 132 257 ?   ?   ?   C . n 
C 1 133 GLN 133 258 ?   ?   ?   C . n 
C 1 134 LEU 134 259 ?   ?   ?   C . n 
C 1 135 ALA 135 260 ?   ?   ?   C . n 
C 1 136 GLN 136 261 ?   ?   ?   C . n 
C 1 137 ASN 137 262 ?   ?   ?   C . n 
C 1 138 ASN 138 263 ?   ?   ?   C . n 
C 1 139 GLU 139 264 ?   ?   ?   C . n 
C 1 140 LEU 140 265 ?   ?   ?   C . n 
C 1 141 LEU 141 266 ?   ?   ?   C . n 
C 1 142 GLN 142 267 ?   ?   ?   C . n 
C 1 143 ARG 143 268 ?   ?   ?   C . n 
C 1 144 GLN 144 269 ?   ?   ?   C . n 
C 1 145 GLN 145 270 ?   ?   ?   C . n 
C 1 146 PRO 146 271 ?   ?   ?   C . n 
C 1 147 GLN 147 272 ?   ?   ?   C . n 
C 1 148 LYS 148 273 ?   ?   ?   C . n 
C 1 149 LYS 149 274 ?   ?   ?   C . n 
D 1 1   GLY 1   126 ?   ?   ?   D . n 
D 1 2   SER 2   127 ?   ?   ?   D . n 
D 1 3   HIS 3   128 ?   ?   ?   D . n 
D 1 4   MET 4   129 ?   ?   ?   D . n 
D 1 5   GLY 5   130 130 GLY GLY D . n 
D 1 6   VAL 6   131 131 VAL VAL D . n 
D 1 7   GLY 7   132 132 GLY GLY D . n 
D 1 8   SER 8   133 133 SER SER D . n 
D 1 9   VAL 9   134 134 VAL VAL D . n 
D 1 10  ALA 10  135 135 ALA ALA D . n 
D 1 11  ALA 11  136 136 ALA ALA D . n 
D 1 12  LEU 12  137 137 LEU LEU D . n 
D 1 13  LEU 13  138 138 LEU LEU D . n 
D 1 14  THR 14  139 139 THR THR D . n 
D 1 15  VAL 15  140 140 VAL VAL D . n 
D 1 16  VAL 16  141 141 VAL VAL D . n 
D 1 17  PHE 17  142 142 PHE PHE D . n 
D 1 18  TYR 18  143 143 TYR TYR D . n 
D 1 19  ILE 19  144 144 ILE ILE D . n 
D 1 20  ALA 20  145 145 ALA ALA D . n 
D 1 21  ALA 21  146 146 ALA ALA D . n 
D 1 22  VAL 22  147 147 VAL VAL D . n 
D 1 23  MET 23  148 148 MET MET D . n 
D 1 24  ALA 24  149 149 ALA ALA D . n 
D 1 25  THR 25  150 150 THR THR D . n 
D 1 26  ASN 26  151 151 ASN ASN D . n 
D 1 27  LEU 27  152 152 LEU LEU D . n 
D 1 28  TYR 28  153 153 TYR TYR D . n 
D 1 29  GLY 29  154 154 GLY GLY D . n 
D 1 30  ALA 30  155 155 ALA ALA D . n 
D 1 31  THR 31  156 156 THR THR D . n 
D 1 32  PHE 32  157 157 PHE PHE D . n 
D 1 33  PRO 33  158 158 PRO PRO D . n 
D 1 34  GLU 34  159 159 GLU GLU D . n 
D 1 35  TRP 35  160 160 TRP TRP D . n 
D 1 36  PHE 36  161 161 PHE PHE D . n 
D 1 37  GLY 37  162 162 GLY GLY D . n 
D 1 38  ASP 38  163 163 ASP ASP D . n 
D 1 39  LEU 39  164 164 LEU LEU D . n 
D 1 40  SER 40  165 165 SER SER D . n 
D 1 41  LYS 41  166 166 LYS LYS D . n 
D 1 42  SER 42  167 167 SER SER D . n 
D 1 43  LEU 43  168 168 LEU LEU D . n 
D 1 44  TYR 44  169 169 TYR TYR D . n 
D 1 45  THR 45  170 170 THR THR D . n 
D 1 46  LEU 46  171 171 LEU LEU D . n 
D 1 47  PHE 47  172 172 PHE PHE D . n 
D 1 48  GLN 48  173 173 GLN GLN D . n 
D 1 49  VAL 49  174 174 VAL VAL D . n 
D 1 50  MET 50  175 175 MET MET D . n 
D 1 51  THR 51  176 176 THR THR D . n 
D 1 52  LEU 52  177 177 LEU LEU D . n 
D 1 53  GLU 53  178 178 GLU GLU D . n 
D 1 54  SER 54  179 179 SER SER D . n 
D 1 55  TRP 55  180 180 TRP TRP D . n 
D 1 56  SER 56  181 181 SER SER D . n 
D 1 57  MET 57  182 182 MET MET D . n 
D 1 58  GLY 58  183 183 GLY GLY D . n 
D 1 59  ILE 59  184 184 ILE ILE D . n 
D 1 60  VAL 60  185 185 VAL VAL D . n 
D 1 61  ARG 61  186 186 ARG ARG D . n 
D 1 62  PRO 62  187 187 PRO PRO D . n 
D 1 63  VAL 63  188 188 VAL VAL D . n 
D 1 64  MET 64  189 189 MET MET D . n 
D 1 65  ASN 65  190 190 ASN ASN D . n 
D 1 66  VAL 66  191 191 VAL VAL D . n 
D 1 67  HIS 67  192 192 HIS HIS D . n 
D 1 68  PRO 68  193 193 PRO PRO D . n 
D 1 69  ASN 69  194 194 ASN ASN D . n 
D 1 70  ALA 70  195 195 ALA ALA D . n 
D 1 71  TRP 71  196 196 TRP TRP D . n 
D 1 72  VAL 72  197 197 VAL VAL D . n 
D 1 73  PHE 73  198 198 PHE PHE D . n 
D 1 74  PHE 74  199 199 PHE PHE D . n 
D 1 75  ILE 75  200 200 ILE ILE D . n 
D 1 76  PRO 76  201 201 PRO PRO D . n 
D 1 77  PHE 77  202 202 PHE PHE D . n 
D 1 78  ILE 78  203 203 ILE ILE D . n 
D 1 79  MET 79  204 204 MET MET D . n 
D 1 80  LEU 80  205 205 LEU LEU D . n 
D 1 81  THR 81  206 206 THR THR D . n 
D 1 82  THR 82  207 207 THR THR D . n 
D 1 83  PHE 83  208 208 PHE PHE D . n 
D 1 84  THR 84  209 209 THR THR D . n 
D 1 85  VAL 85  210 210 VAL VAL D . n 
D 1 86  LEU 86  211 211 LEU LEU D . n 
D 1 87  ASN 87  212 212 ASN ASN D . n 
D 1 88  LEU 88  213 213 LEU LEU D . n 
D 1 89  PHE 89  214 214 PHE PHE D . n 
D 1 90  ILE 90  215 215 ILE ILE D . n 
D 1 91  GLY 91  216 216 GLY GLY D . n 
D 1 92  ILE 92  217 217 ILE ILE D . n 
D 1 93  ILE 93  218 218 ILE ILE D . n 
D 1 94  VAL 94  219 219 VAL VAL D . n 
D 1 95  ASP 95  220 220 ASP ASP D . n 
D 1 96  ALA 96  221 ?   ?   ?   D . n 
D 1 97  MET 97  222 ?   ?   ?   D . n 
D 1 98  ALA 98  223 ?   ?   ?   D . n 
D 1 99  ILE 99  224 ?   ?   ?   D . n 
D 1 100 THR 100 225 ?   ?   ?   D . n 
D 1 101 LYS 101 226 ?   ?   ?   D . n 
D 1 102 GLU 102 227 ?   ?   ?   D . n 
D 1 103 GLN 103 228 ?   ?   ?   D . n 
D 1 104 GLU 104 229 ?   ?   ?   D . n 
D 1 105 GLU 105 230 ?   ?   ?   D . n 
D 1 106 GLU 106 231 ?   ?   ?   D . n 
D 1 107 ALA 107 232 ?   ?   ?   D . n 
D 1 108 LYS 108 233 ?   ?   ?   D . n 
D 1 109 THR 109 234 ?   ?   ?   D . n 
D 1 110 GLY 110 235 ?   ?   ?   D . n 
D 1 111 HIS 111 236 ?   ?   ?   D . n 
D 1 112 HIS 112 237 ?   ?   ?   D . n 
D 1 113 GLN 113 238 ?   ?   ?   D . n 
D 1 114 GLU 114 239 ?   ?   ?   D . n 
D 1 115 PRO 115 240 ?   ?   ?   D . n 
D 1 116 ILE 116 241 ?   ?   ?   D . n 
D 1 117 SER 117 242 ?   ?   ?   D . n 
D 1 118 GLN 118 243 ?   ?   ?   D . n 
D 1 119 THR 119 244 ?   ?   ?   D . n 
D 1 120 LEU 120 245 ?   ?   ?   D . n 
D 1 121 LEU 121 246 ?   ?   ?   D . n 
D 1 122 HIS 122 247 ?   ?   ?   D . n 
D 1 123 LEU 123 248 ?   ?   ?   D . n 
D 1 124 GLY 124 249 ?   ?   ?   D . n 
D 1 125 ASP 125 250 ?   ?   ?   D . n 
D 1 126 ARG 126 251 ?   ?   ?   D . n 
D 1 127 LEU 127 252 ?   ?   ?   D . n 
D 1 128 ASP 128 253 ?   ?   ?   D . n 
D 1 129 ARG 129 254 ?   ?   ?   D . n 
D 1 130 ILE 130 255 ?   ?   ?   D . n 
D 1 131 GLU 131 256 ?   ?   ?   D . n 
D 1 132 LYS 132 257 ?   ?   ?   D . n 
D 1 133 GLN 133 258 ?   ?   ?   D . n 
D 1 134 LEU 134 259 ?   ?   ?   D . n 
D 1 135 ALA 135 260 ?   ?   ?   D . n 
D 1 136 GLN 136 261 ?   ?   ?   D . n 
D 1 137 ASN 137 262 ?   ?   ?   D . n 
D 1 138 ASN 138 263 ?   ?   ?   D . n 
D 1 139 GLU 139 264 ?   ?   ?   D . n 
D 1 140 LEU 140 265 ?   ?   ?   D . n 
D 1 141 LEU 141 266 ?   ?   ?   D . n 
D 1 142 GLN 142 267 ?   ?   ?   D . n 
D 1 143 ARG 143 268 ?   ?   ?   D . n 
D 1 144 GLN 144 269 ?   ?   ?   D . n 
D 1 145 GLN 145 270 ?   ?   ?   D . n 
D 1 146 PRO 146 271 ?   ?   ?   D . n 
D 1 147 GLN 147 272 ?   ?   ?   D . n 
D 1 148 LYS 148 273 ?   ?   ?   D . n 
D 1 149 LYS 149 274 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 2CV 1  300 300 2CV 2CV A . 
F 2 2CV 1  301 301 2CV 2CV A . 
G 3 BR  1  301 400 BR  BR  B . 
H 2 2CV 1  302 300 2CV 2CV B . 
I 2 2CV 1  303 301 2CV 2CV B . 
J 3 BR  1  304 400 BR  BR  B . 
K 2 2CV 1  300 300 2CV 2CV C . 
L 3 BR  1  301 400 BR  BR  D . 
M 2 2CV 1  302 300 2CV 2CV D . 
N 3 BR  1  303 400 BR  BR  D . 
O 4 HOH 1  401 348 HOH HOH A . 
O 4 HOH 2  402 141 HOH HOH A . 
O 4 HOH 3  403 127 HOH HOH A . 
O 4 HOH 4  404 233 HOH HOH A . 
O 4 HOH 5  405 170 HOH HOH A . 
O 4 HOH 6  406 128 HOH HOH A . 
O 4 HOH 7  407 241 HOH HOH A . 
O 4 HOH 8  408 280 HOH HOH A . 
O 4 HOH 9  409 263 HOH HOH A . 
O 4 HOH 10 410 237 HOH HOH A . 
O 4 HOH 11 411 222 HOH HOH A . 
O 4 HOH 12 412 206 HOH HOH A . 
O 4 HOH 13 413 160 HOH HOH A . 
O 4 HOH 14 414 290 HOH HOH A . 
O 4 HOH 15 416 131 HOH HOH A . 
O 4 HOH 16 417 135 HOH HOH A . 
O 4 HOH 17 418 142 HOH HOH A . 
O 4 HOH 18 419 144 HOH HOH A . 
O 4 HOH 19 420 147 HOH HOH A . 
O 4 HOH 20 421 157 HOH HOH A . 
O 4 HOH 21 422 162 HOH HOH A . 
O 4 HOH 22 423 163 HOH HOH A . 
O 4 HOH 23 424 164 HOH HOH A . 
O 4 HOH 24 425 172 HOH HOH A . 
O 4 HOH 25 426 175 HOH HOH A . 
O 4 HOH 26 427 180 HOH HOH A . 
O 4 HOH 27 428 192 HOH HOH A . 
O 4 HOH 28 429 194 HOH HOH A . 
O 4 HOH 29 430 204 HOH HOH A . 
O 4 HOH 30 431 210 HOH HOH A . 
O 4 HOH 31 432 211 HOH HOH A . 
O 4 HOH 32 433 213 HOH HOH A . 
O 4 HOH 33 434 215 HOH HOH A . 
O 4 HOH 34 435 218 HOH HOH A . 
O 4 HOH 35 436 220 HOH HOH A . 
O 4 HOH 36 437 230 HOH HOH A . 
O 4 HOH 37 438 234 HOH HOH A . 
O 4 HOH 38 439 242 HOH HOH A . 
O 4 HOH 39 440 246 HOH HOH A . 
O 4 HOH 40 441 259 HOH HOH A . 
O 4 HOH 41 442 265 HOH HOH A . 
O 4 HOH 42 443 270 HOH HOH A . 
O 4 HOH 43 444 277 HOH HOH A . 
O 4 HOH 44 445 289 HOH HOH A . 
O 4 HOH 45 446 291 HOH HOH A . 
O 4 HOH 46 447 297 HOH HOH A . 
O 4 HOH 47 448 302 HOH HOH A . 
O 4 HOH 48 449 304 HOH HOH A . 
O 4 HOH 49 450 313 HOH HOH A . 
O 4 HOH 50 451 319 HOH HOH A . 
O 4 HOH 51 452 324 HOH HOH A . 
O 4 HOH 52 453 326 HOH HOH A . 
O 4 HOH 53 454 330 HOH HOH A . 
O 4 HOH 54 455 338 HOH HOH A . 
O 4 HOH 55 456 339 HOH HOH A . 
O 4 HOH 56 457 340 HOH HOH A . 
O 4 HOH 57 458 341 HOH HOH A . 
O 4 HOH 58 459 343 HOH HOH A . 
O 4 HOH 59 460 349 HOH HOH A . 
O 4 HOH 60 461 356 HOH HOH A . 
O 4 HOH 61 462 359 HOH HOH A . 
O 4 HOH 62 463 372 HOH HOH A . 
P 4 HOH 1  401 151 HOH HOH B . 
P 4 HOH 2  402 276 HOH HOH B . 
P 4 HOH 3  403 133 HOH HOH B . 
P 4 HOH 4  404 272 HOH HOH B . 
P 4 HOH 5  405 137 HOH HOH B . 
P 4 HOH 6  406 193 HOH HOH B . 
P 4 HOH 7  407 227 HOH HOH B . 
P 4 HOH 8  408 344 HOH HOH B . 
P 4 HOH 9  409 136 HOH HOH B . 
P 4 HOH 10 410 231 HOH HOH B . 
P 4 HOH 11 411 225 HOH HOH B . 
P 4 HOH 12 412 328 HOH HOH B . 
P 4 HOH 13 413 126 HOH HOH B . 
P 4 HOH 14 414 130 HOH HOH B . 
P 4 HOH 15 415 138 HOH HOH B . 
P 4 HOH 16 416 174 HOH HOH B . 
P 4 HOH 17 417 188 HOH HOH B . 
P 4 HOH 18 418 190 HOH HOH B . 
P 4 HOH 19 419 198 HOH HOH B . 
P 4 HOH 20 420 199 HOH HOH B . 
P 4 HOH 21 421 200 HOH HOH B . 
P 4 HOH 22 422 201 HOH HOH B . 
P 4 HOH 23 423 208 HOH HOH B . 
P 4 HOH 24 424 212 HOH HOH B . 
P 4 HOH 25 425 219 HOH HOH B . 
P 4 HOH 26 426 229 HOH HOH B . 
P 4 HOH 27 427 236 HOH HOH B . 
P 4 HOH 28 428 239 HOH HOH B . 
P 4 HOH 29 429 245 HOH HOH B . 
P 4 HOH 30 430 252 HOH HOH B . 
P 4 HOH 31 431 254 HOH HOH B . 
P 4 HOH 32 432 255 HOH HOH B . 
P 4 HOH 33 433 258 HOH HOH B . 
P 4 HOH 34 434 261 HOH HOH B . 
P 4 HOH 35 435 262 HOH HOH B . 
P 4 HOH 36 436 266 HOH HOH B . 
P 4 HOH 37 437 268 HOH HOH B . 
P 4 HOH 38 438 269 HOH HOH B . 
P 4 HOH 39 439 284 HOH HOH B . 
P 4 HOH 40 440 285 HOH HOH B . 
P 4 HOH 41 441 287 HOH HOH B . 
P 4 HOH 42 442 301 HOH HOH B . 
P 4 HOH 43 443 309 HOH HOH B . 
P 4 HOH 44 444 315 HOH HOH B . 
P 4 HOH 45 445 332 HOH HOH B . 
P 4 HOH 46 446 334 HOH HOH B . 
P 4 HOH 47 447 358 HOH HOH B . 
P 4 HOH 48 448 361 HOH HOH B . 
P 4 HOH 49 449 371 HOH HOH B . 
P 4 HOH 50 450 378 HOH HOH B . 
Q 4 HOH 1  401 152 HOH HOH C . 
Q 4 HOH 2  402 214 HOH HOH C . 
Q 4 HOH 3  403 253 HOH HOH C . 
Q 4 HOH 4  404 299 HOH HOH C . 
Q 4 HOH 5  405 370 HOH HOH C . 
Q 4 HOH 6  406 275 HOH HOH C . 
Q 4 HOH 7  407 149 HOH HOH C . 
Q 4 HOH 8  408 189 HOH HOH C . 
Q 4 HOH 9  409 335 HOH HOH C . 
Q 4 HOH 10 410 300 HOH HOH C . 
Q 4 HOH 11 411 134 HOH HOH C . 
Q 4 HOH 12 412 139 HOH HOH C . 
Q 4 HOH 13 413 140 HOH HOH C . 
Q 4 HOH 14 414 146 HOH HOH C . 
Q 4 HOH 15 415 153 HOH HOH C . 
Q 4 HOH 16 416 154 HOH HOH C . 
Q 4 HOH 17 417 156 HOH HOH C . 
Q 4 HOH 18 418 158 HOH HOH C . 
Q 4 HOH 19 419 159 HOH HOH C . 
Q 4 HOH 20 420 161 HOH HOH C . 
Q 4 HOH 21 421 165 HOH HOH C . 
Q 4 HOH 22 422 166 HOH HOH C . 
Q 4 HOH 23 423 167 HOH HOH C . 
Q 4 HOH 24 424 169 HOH HOH C . 
Q 4 HOH 25 425 171 HOH HOH C . 
Q 4 HOH 26 426 177 HOH HOH C . 
Q 4 HOH 27 427 178 HOH HOH C . 
Q 4 HOH 28 428 179 HOH HOH C . 
Q 4 HOH 29 429 181 HOH HOH C . 
Q 4 HOH 30 430 182 HOH HOH C . 
Q 4 HOH 31 431 187 HOH HOH C . 
Q 4 HOH 32 432 191 HOH HOH C . 
Q 4 HOH 33 433 196 HOH HOH C . 
Q 4 HOH 34 434 203 HOH HOH C . 
Q 4 HOH 35 435 207 HOH HOH C . 
Q 4 HOH 36 436 221 HOH HOH C . 
Q 4 HOH 37 437 223 HOH HOH C . 
Q 4 HOH 38 438 226 HOH HOH C . 
Q 4 HOH 39 439 232 HOH HOH C . 
Q 4 HOH 40 440 238 HOH HOH C . 
Q 4 HOH 41 441 244 HOH HOH C . 
Q 4 HOH 42 442 248 HOH HOH C . 
Q 4 HOH 43 443 251 HOH HOH C . 
Q 4 HOH 44 444 260 HOH HOH C . 
Q 4 HOH 45 445 264 HOH HOH C . 
Q 4 HOH 46 446 271 HOH HOH C . 
Q 4 HOH 47 447 279 HOH HOH C . 
Q 4 HOH 48 448 282 HOH HOH C . 
Q 4 HOH 49 449 283 HOH HOH C . 
Q 4 HOH 50 450 288 HOH HOH C . 
Q 4 HOH 51 451 292 HOH HOH C . 
Q 4 HOH 52 452 293 HOH HOH C . 
Q 4 HOH 53 453 295 HOH HOH C . 
Q 4 HOH 54 454 296 HOH HOH C . 
Q 4 HOH 55 455 298 HOH HOH C . 
Q 4 HOH 56 456 303 HOH HOH C . 
Q 4 HOH 57 457 306 HOH HOH C . 
Q 4 HOH 58 458 307 HOH HOH C . 
Q 4 HOH 59 459 311 HOH HOH C . 
Q 4 HOH 60 460 318 HOH HOH C . 
Q 4 HOH 61 461 320 HOH HOH C . 
Q 4 HOH 62 462 321 HOH HOH C . 
Q 4 HOH 63 463 322 HOH HOH C . 
Q 4 HOH 64 464 327 HOH HOH C . 
Q 4 HOH 65 465 336 HOH HOH C . 
Q 4 HOH 66 466 337 HOH HOH C . 
Q 4 HOH 67 467 345 HOH HOH C . 
Q 4 HOH 68 468 347 HOH HOH C . 
Q 4 HOH 69 469 353 HOH HOH C . 
Q 4 HOH 70 470 354 HOH HOH C . 
Q 4 HOH 71 471 362 HOH HOH C . 
Q 4 HOH 72 472 363 HOH HOH C . 
Q 4 HOH 73 473 367 HOH HOH C . 
Q 4 HOH 74 474 373 HOH HOH C . 
Q 4 HOH 75 475 376 HOH HOH C . 
Q 4 HOH 76 476 377 HOH HOH C . 
R 4 HOH 1  401 374 HOH HOH D . 
R 4 HOH 2  402 185 HOH HOH D . 
R 4 HOH 3  403 346 HOH HOH D . 
R 4 HOH 4  404 195 HOH HOH D . 
R 4 HOH 5  405 150 HOH HOH D . 
R 4 HOH 6  406 247 HOH HOH D . 
R 4 HOH 7  407 331 HOH HOH D . 
R 4 HOH 8  408 217 HOH HOH D . 
R 4 HOH 9  409 286 HOH HOH D . 
R 4 HOH 10 410 129 HOH HOH D . 
R 4 HOH 11 411 132 HOH HOH D . 
R 4 HOH 12 412 143 HOH HOH D . 
R 4 HOH 13 413 145 HOH HOH D . 
R 4 HOH 14 414 148 HOH HOH D . 
R 4 HOH 15 415 155 HOH HOH D . 
R 4 HOH 16 416 168 HOH HOH D . 
R 4 HOH 17 417 173 HOH HOH D . 
R 4 HOH 18 418 176 HOH HOH D . 
R 4 HOH 19 419 183 HOH HOH D . 
R 4 HOH 20 420 184 HOH HOH D . 
R 4 HOH 21 421 186 HOH HOH D . 
R 4 HOH 22 422 197 HOH HOH D . 
R 4 HOH 23 423 202 HOH HOH D . 
R 4 HOH 24 424 205 HOH HOH D . 
R 4 HOH 25 425 209 HOH HOH D . 
R 4 HOH 26 426 216 HOH HOH D . 
R 4 HOH 27 427 224 HOH HOH D . 
R 4 HOH 28 428 228 HOH HOH D . 
R 4 HOH 29 429 235 HOH HOH D . 
R 4 HOH 30 430 240 HOH HOH D . 
R 4 HOH 31 431 243 HOH HOH D . 
R 4 HOH 32 432 249 HOH HOH D . 
R 4 HOH 33 433 250 HOH HOH D . 
R 4 HOH 34 434 256 HOH HOH D . 
R 4 HOH 35 435 257 HOH HOH D . 
R 4 HOH 36 436 267 HOH HOH D . 
R 4 HOH 37 437 273 HOH HOH D . 
R 4 HOH 38 438 274 HOH HOH D . 
R 4 HOH 39 439 278 HOH HOH D . 
R 4 HOH 40 440 281 HOH HOH D . 
R 4 HOH 41 441 294 HOH HOH D . 
R 4 HOH 42 442 305 HOH HOH D . 
R 4 HOH 43 443 308 HOH HOH D . 
R 4 HOH 44 444 310 HOH HOH D . 
R 4 HOH 45 445 312 HOH HOH D . 
R 4 HOH 46 446 314 HOH HOH D . 
R 4 HOH 47 447 316 HOH HOH D . 
R 4 HOH 48 448 317 HOH HOH D . 
R 4 HOH 49 449 323 HOH HOH D . 
R 4 HOH 50 450 325 HOH HOH D . 
R 4 HOH 51 451 329 HOH HOH D . 
R 4 HOH 52 452 333 HOH HOH D . 
R 4 HOH 53 453 342 HOH HOH D . 
R 4 HOH 54 454 350 HOH HOH D . 
R 4 HOH 55 455 351 HOH HOH D . 
R 4 HOH 56 456 352 HOH HOH D . 
R 4 HOH 57 457 355 HOH HOH D . 
R 4 HOH 58 458 357 HOH HOH D . 
R 4 HOH 59 459 360 HOH HOH D . 
R 4 HOH 60 460 364 HOH HOH D . 
R 4 HOH 61 461 365 HOH HOH D . 
R 4 HOH 62 462 366 HOH HOH D . 
R 4 HOH 63 463 368 HOH HOH D . 
R 4 HOH 64 464 369 HOH HOH D . 
R 4 HOH 65 465 375 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,E,F,G,H,I,J,O,P 
2 1,2 C,D,K,L,M,N,Q,R     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7320  ? 
1 MORE         -54   ? 
1 'SSA (A^2)'  16700 ? 
2 'ABSA (A^2)' 7030  ? 
2 MORE         -49   ? 
2 'SSA (A^2)'  17060 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_455 -x-1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 -80.4200000000 0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 40.1950000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-06-04 
2 'Structure model' 1 1 2014-08-06 
3 'Structure model' 2 0 2017-09-20 
4 'Structure model' 2 1 2020-01-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'        
2  3 'Structure model' 'Atomic model'               
3  3 'Structure model' 'Author supporting evidence' 
4  3 'Structure model' 'Data collection'            
5  3 'Structure model' 'Database references'        
6  3 'Structure model' 'Derived calculations'       
7  3 'Structure model' Other                        
8  3 'Structure model' 'Source and taxonomy'        
9  3 'Structure model' 'Structure summary'          
10 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' atom_site                 
2  3 'Structure model' citation                  
3  3 'Structure model' diffrn_source             
4  3 'Structure model' entity                    
5  3 'Structure model' entity_src_gen            
6  3 'Structure model' pdbx_audit_support        
7  3 'Structure model' pdbx_database_related     
8  3 'Structure model' pdbx_database_status      
9  3 'Structure model' pdbx_struct_assembly      
10 3 'Structure model' pdbx_struct_assembly_gen  
11 3 'Structure model' pdbx_struct_assembly_prop 
12 3 'Structure model' pdbx_struct_oper_list     
13 3 'Structure model' struct_keywords           
14 4 'Structure model' pdbx_audit_support        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_atom_site.id'                               
2  3 'Structure model' '_citation.journal_id_CSD'                    
3  3 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
4  3 'Structure model' '_entity.pdbx_number_of_molecules'            
5  3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
6  3 'Structure model' '_pdbx_audit_support.funding_organization'    
7  3 'Structure model' '_pdbx_database_related.content_type'         
8  3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
9  3 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
10 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
11 3 'Structure model' '_pdbx_struct_assembly_prop.type'             
12 3 'Structure model' '_pdbx_struct_assembly_prop.value'            
13 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
14 3 'Structure model' '_struct_keywords.text'                       
15 4 'Structure model' '_pdbx_audit_support.funding_organization'    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -27.1291 -62.7953 12.3211 -0.3040 0.3040 -0.3040 -0.0320 0.0175  0.0435  3.6828 1.8824 2.6325 
-0.0083 0.2599  -1.3960 -0.0465 0.2606  0.5442  0.1641  0.1060 0.0349  -0.5442 0.0220 -0.0595 
'X-RAY DIFFRACTION' 2 ? refined -32.5063 -63.0507 33.3795 -0.3040 0.3040 -0.3040 -0.0319 -0.0105 -0.0386 3.9484 0.9379 4.9182 
1.8585  -0.8059 -0.7137 0.0063  -0.0388 0.4930  -0.0124 0.1358 0.2017  -0.4762 0.2983 -0.1421 
'X-RAY DIFFRACTION' 3 ? refined -28.6832 -98.6214 30.0092 -0.3040 0.3040 -0.3040 0.0117  -0.0517 0.0166  5.2431 1.2747 2.1114 
0.6320  -0.0481 -0.0880 -0.0285 -0.0230 -0.5442 -0.0685 0.1474 -0.0438 0.3768  0.0472 -0.1189 
'X-RAY DIFFRACTION' 4 ? refined -30.4638 -98.4827 8.5121  -0.3040 0.3040 -0.3040 0.0073  0.0271  -0.0020 2.6129 1.9690 4.7957 
-1.3507 0.6874  -0.0707 -0.0281 0.0973  -0.4363 0.0089  0.1264 0.0867  0.5280  0.0635 -0.0983 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{ A|* }' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{ B|* }' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '{ C|* }' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '{ D|* }' 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          . 
_software.compiler_version       . 
_software.contact_author         . 
_software.contact_author_email   . 
_software.date                   . 
_software.description            . 
_software.dependencies           . 
_software.hardware               . 
_software.language               . 
_software.location               . 
_software.mods                   . 
_software.name                   BUSTER 
_software.os                     . 
_software.os_version             . 
_software.type                   . 
_software.version                2.10.0 
_software.pdbx_ordinal           1 
# 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.entry_id             4P9O 
_pdbx_entry_details.nonpolymer_details   
;THE BROMINE ION IS PART OF THE MOLECULE 2-(4-BROMOPHENYL)-1-(5-(4-CHLOROPHENYL)-1H-IMIDAZOL-2-YL)ETHANAMINE, THE REST OF WHICH CAN NOT BE SEEN IN THE DENSITY DUE TO LOW OCCUPANCY.
;
_pdbx_entry_details.sequence_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 198 ? ? -90.95  -61.40 
2  1 PHE A 208 ? ? -162.58 -53.66 
3  1 ASP A 220 ? ? -65.48  6.43   
4  1 SER B 179 ? ? 39.70   32.80  
5  1 PHE B 198 ? ? -90.55  -62.07 
6  1 PHE B 208 ? ? -161.62 -54.48 
7  1 LEU C 177 ? ? 79.23   -2.55  
8  1 SER C 179 ? ? 45.06   27.48  
9  1 THR C 207 ? ? -72.83  38.51  
10 1 PHE C 208 ? ? -152.06 -48.01 
11 1 LEU D 177 ? ? 80.10   -3.50  
12 1 SER D 179 ? ? 46.53   25.05  
13 1 THR D 207 ? ? -72.60  38.38  
14 1 PHE D 208 ? ? -152.26 -48.12 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 424 ? .     8.81 
2  1 O ? A HOH 426 ? 15.19 .    
3  1 O ? A HOH 428 ? 7.14  .    
4  1 O ? A HOH 430 ? 13.55 .    
5  1 O ? A HOH 442 ? 20.18 .    
6  1 O ? A HOH 443 ? .     7.13 
7  1 O ? A HOH 445 ? .     7.64 
8  1 O ? A HOH 447 ? 16.68 .    
9  1 O ? A HOH 452 ? .     6.13 
10 1 O ? A HOH 458 ? 16.54 .    
11 1 O ? B HOH 419 ? .     8.57 
12 1 O ? B HOH 422 ? 14.40 .    
13 1 O ? B HOH 427 ? 7.01  .    
14 1 O ? B HOH 428 ? 7.30  .    
15 1 O ? B HOH 436 ? 12.39 .    
16 1 O ? B HOH 449 ? 6.16  .    
17 1 O ? C HOH 418 ? 6.53  .    
18 1 O ? C HOH 426 ? 9.23  .    
19 1 O ? C HOH 437 ? .     7.06 
20 1 O ? C HOH 445 ? 7.22  .    
21 1 O ? C HOH 451 ? 6.08  .    
22 1 O ? C HOH 457 ? 5.89  .    
23 1 O ? C HOH 458 ? 8.79  .    
24 1 O ? C HOH 459 ? 7.15  .    
25 1 O ? C HOH 465 ? 69.09 .    
26 1 O ? C HOH 468 ? 7.74  .    
27 1 O ? C HOH 470 ? 6.23  .    
28 1 O ? D HOH 418 ? .     7.10 
29 1 O ? D HOH 443 ? 7.13  .    
30 1 O ? D HOH 450 ? .     6.84 
31 1 O ? D HOH 454 ? 6.38  .    
32 1 O ? D HOH 458 ? 7.06  .    
33 1 O ? D HOH 460 ? 7.10  .    
34 1 O ? D HOH 461 ? 8.57  .    
35 1 O ? D HOH 462 ? 8.10  .    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 220 ? CG  ? A ASP 95 CG  
2  1 Y 1 A ASP 220 ? OD1 ? A ASP 95 OD1 
3  1 Y 1 A ASP 220 ? OD2 ? A ASP 95 OD2 
4  1 Y 1 A MET 222 ? CG  ? A MET 97 CG  
5  1 Y 1 A MET 222 ? SD  ? A MET 97 SD  
6  1 Y 1 A MET 222 ? CE  ? A MET 97 CE  
7  1 Y 1 D LEU 213 ? CG  ? D LEU 88 CG  
8  1 Y 1 D LEU 213 ? CD1 ? D LEU 88 CD1 
9  1 Y 1 D LEU 213 ? CD2 ? D LEU 88 CD2 
10 1 N 1 A 2CV 301 ? C35 ? F 2CV 1  C35 
11 1 N 1 A 2CV 301 ? C37 ? F 2CV 1  C37 
12 1 N 1 A 2CV 301 ? C40 ? F 2CV 1  C40 
13 1 N 1 A 2CV 301 ? C41 ? F 2CV 1  C41 
14 1 N 1 A 2CV 301 ? C42 ? F 2CV 1  C42 
15 1 N 1 A 2CV 301 ? C43 ? F 2CV 1  C43 
16 1 N 1 A 2CV 301 ? O44 ? F 2CV 1  O44 
17 1 N 1 A 2CV 301 ? O47 ? F 2CV 1  O47 
18 1 N 1 A 2CV 301 ? O49 ? F 2CV 1  O49 
19 1 N 1 A 2CV 301 ? O51 ? F 2CV 1  O51 
20 1 N 1 A 2CV 301 ? O53 ? F 2CV 1  O53 
21 1 N 1 A 2CV 301 ? C60 ? F 2CV 1  C60 
22 1 N 1 A 2CV 301 ? O63 ? F 2CV 1  O63 
23 1 N 1 B 2CV 303 ? C37 ? I 2CV 1  C37 
24 1 N 1 B 2CV 303 ? C40 ? I 2CV 1  C40 
25 1 N 1 B 2CV 303 ? C41 ? I 2CV 1  C41 
26 1 N 1 B 2CV 303 ? C42 ? I 2CV 1  C42 
27 1 N 1 B 2CV 303 ? C43 ? I 2CV 1  C43 
28 1 N 1 B 2CV 303 ? O44 ? I 2CV 1  O44 
29 1 N 1 B 2CV 303 ? O47 ? I 2CV 1  O47 
30 1 N 1 B 2CV 303 ? O49 ? I 2CV 1  O49 
31 1 N 1 B 2CV 303 ? O51 ? I 2CV 1  O51 
32 1 N 1 B 2CV 303 ? O53 ? I 2CV 1  O53 
33 1 N 1 C 2CV 300 ? C41 ? K 2CV 1  C41 
34 1 N 1 C 2CV 300 ? C42 ? K 2CV 1  C42 
35 1 N 1 C 2CV 300 ? C43 ? K 2CV 1  C43 
36 1 N 1 C 2CV 300 ? O44 ? K 2CV 1  O44 
37 1 N 1 C 2CV 300 ? O51 ? K 2CV 1  O51 
38 1 N 1 C 2CV 300 ? O53 ? K 2CV 1  O53 
39 1 N 1 C 2CV 300 ? C1  ? K 2CV 1  C1  
40 1 N 1 C 2CV 300 ? C0  ? K 2CV 1  C0  
41 1 N 1 D 2CV 302 ? C41 ? M 2CV 1  C41 
42 1 N 1 D 2CV 302 ? C42 ? M 2CV 1  C42 
43 1 N 1 D 2CV 302 ? C43 ? M 2CV 1  C43 
44 1 N 1 D 2CV 302 ? O44 ? M 2CV 1  O44 
45 1 N 1 D 2CV 302 ? O51 ? M 2CV 1  O51 
46 1 N 1 D 2CV 302 ? O53 ? M 2CV 1  O53 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 126 ? A GLY 1   
2   1 Y 1 A SER 127 ? A SER 2   
3   1 Y 1 A HIS 128 ? A HIS 3   
4   1 Y 1 A MET 129 ? A MET 4   
5   1 Y 1 A GLY 130 ? A GLY 5   
6   1 Y 1 A ALA 223 ? A ALA 98  
7   1 Y 1 A ILE 224 ? A ILE 99  
8   1 Y 1 A THR 225 ? A THR 100 
9   1 Y 1 A LYS 226 ? A LYS 101 
10  1 Y 1 A GLU 227 ? A GLU 102 
11  1 Y 1 A GLN 228 ? A GLN 103 
12  1 Y 1 A GLU 229 ? A GLU 104 
13  1 Y 1 A GLU 230 ? A GLU 105 
14  1 Y 1 A GLU 231 ? A GLU 106 
15  1 Y 1 A ALA 232 ? A ALA 107 
16  1 Y 1 A LYS 233 ? A LYS 108 
17  1 Y 1 A THR 234 ? A THR 109 
18  1 Y 1 A GLY 235 ? A GLY 110 
19  1 Y 1 A HIS 236 ? A HIS 111 
20  1 Y 1 A HIS 237 ? A HIS 112 
21  1 Y 1 A GLN 238 ? A GLN 113 
22  1 Y 1 A GLU 239 ? A GLU 114 
23  1 Y 1 A PRO 240 ? A PRO 115 
24  1 Y 1 A ILE 241 ? A ILE 116 
25  1 Y 1 A SER 242 ? A SER 117 
26  1 Y 1 A GLN 243 ? A GLN 118 
27  1 Y 1 A THR 244 ? A THR 119 
28  1 Y 1 A LEU 245 ? A LEU 120 
29  1 Y 1 A LEU 246 ? A LEU 121 
30  1 Y 1 A HIS 247 ? A HIS 122 
31  1 Y 1 A LEU 248 ? A LEU 123 
32  1 Y 1 A GLY 249 ? A GLY 124 
33  1 Y 1 A ASP 250 ? A ASP 125 
34  1 Y 1 A ARG 251 ? A ARG 126 
35  1 Y 1 A LEU 252 ? A LEU 127 
36  1 Y 1 A ASP 253 ? A ASP 128 
37  1 Y 1 A ARG 254 ? A ARG 129 
38  1 Y 1 A ILE 255 ? A ILE 130 
39  1 Y 1 A GLU 256 ? A GLU 131 
40  1 Y 1 A LYS 257 ? A LYS 132 
41  1 Y 1 A GLN 258 ? A GLN 133 
42  1 Y 1 A LEU 259 ? A LEU 134 
43  1 Y 1 A ALA 260 ? A ALA 135 
44  1 Y 1 A GLN 261 ? A GLN 136 
45  1 Y 1 A ASN 262 ? A ASN 137 
46  1 Y 1 A ASN 263 ? A ASN 138 
47  1 Y 1 A GLU 264 ? A GLU 139 
48  1 Y 1 A LEU 265 ? A LEU 140 
49  1 Y 1 A LEU 266 ? A LEU 141 
50  1 Y 1 A GLN 267 ? A GLN 142 
51  1 Y 1 A ARG 268 ? A ARG 143 
52  1 Y 1 A GLN 269 ? A GLN 144 
53  1 Y 1 A GLN 270 ? A GLN 145 
54  1 Y 1 A PRO 271 ? A PRO 146 
55  1 Y 1 A GLN 272 ? A GLN 147 
56  1 Y 1 A LYS 273 ? A LYS 148 
57  1 Y 1 A LYS 274 ? A LYS 149 
58  1 Y 1 B GLY 126 ? B GLY 1   
59  1 Y 1 B SER 127 ? B SER 2   
60  1 Y 1 B HIS 128 ? B HIS 3   
61  1 Y 1 B MET 129 ? B MET 4   
62  1 Y 1 B GLY 130 ? B GLY 5   
63  1 Y 1 B ALA 221 ? B ALA 96  
64  1 Y 1 B MET 222 ? B MET 97  
65  1 Y 1 B ALA 223 ? B ALA 98  
66  1 Y 1 B ILE 224 ? B ILE 99  
67  1 Y 1 B THR 225 ? B THR 100 
68  1 Y 1 B LYS 226 ? B LYS 101 
69  1 Y 1 B GLU 227 ? B GLU 102 
70  1 Y 1 B GLN 228 ? B GLN 103 
71  1 Y 1 B GLU 229 ? B GLU 104 
72  1 Y 1 B GLU 230 ? B GLU 105 
73  1 Y 1 B GLU 231 ? B GLU 106 
74  1 Y 1 B ALA 232 ? B ALA 107 
75  1 Y 1 B LYS 233 ? B LYS 108 
76  1 Y 1 B THR 234 ? B THR 109 
77  1 Y 1 B GLY 235 ? B GLY 110 
78  1 Y 1 B HIS 236 ? B HIS 111 
79  1 Y 1 B HIS 237 ? B HIS 112 
80  1 Y 1 B GLN 238 ? B GLN 113 
81  1 Y 1 B GLU 239 ? B GLU 114 
82  1 Y 1 B PRO 240 ? B PRO 115 
83  1 Y 1 B ILE 241 ? B ILE 116 
84  1 Y 1 B SER 242 ? B SER 117 
85  1 Y 1 B GLN 243 ? B GLN 118 
86  1 Y 1 B THR 244 ? B THR 119 
87  1 Y 1 B LEU 245 ? B LEU 120 
88  1 Y 1 B LEU 246 ? B LEU 121 
89  1 Y 1 B HIS 247 ? B HIS 122 
90  1 Y 1 B LEU 248 ? B LEU 123 
91  1 Y 1 B GLY 249 ? B GLY 124 
92  1 Y 1 B ASP 250 ? B ASP 125 
93  1 Y 1 B ARG 251 ? B ARG 126 
94  1 Y 1 B LEU 252 ? B LEU 127 
95  1 Y 1 B ASP 253 ? B ASP 128 
96  1 Y 1 B ARG 254 ? B ARG 129 
97  1 Y 1 B ILE 255 ? B ILE 130 
98  1 Y 1 B GLU 256 ? B GLU 131 
99  1 Y 1 B LYS 257 ? B LYS 132 
100 1 Y 1 B GLN 258 ? B GLN 133 
101 1 Y 1 B LEU 259 ? B LEU 134 
102 1 Y 1 B ALA 260 ? B ALA 135 
103 1 Y 1 B GLN 261 ? B GLN 136 
104 1 Y 1 B ASN 262 ? B ASN 137 
105 1 Y 1 B ASN 263 ? B ASN 138 
106 1 Y 1 B GLU 264 ? B GLU 139 
107 1 Y 1 B LEU 265 ? B LEU 140 
108 1 Y 1 B LEU 266 ? B LEU 141 
109 1 Y 1 B GLN 267 ? B GLN 142 
110 1 Y 1 B ARG 268 ? B ARG 143 
111 1 Y 1 B GLN 269 ? B GLN 144 
112 1 Y 1 B GLN 270 ? B GLN 145 
113 1 Y 1 B PRO 271 ? B PRO 146 
114 1 Y 1 B GLN 272 ? B GLN 147 
115 1 Y 1 B LYS 273 ? B LYS 148 
116 1 Y 1 B LYS 274 ? B LYS 149 
117 1 Y 1 C GLY 126 ? C GLY 1   
118 1 Y 1 C SER 127 ? C SER 2   
119 1 Y 1 C HIS 128 ? C HIS 3   
120 1 Y 1 C MET 129 ? C MET 4   
121 1 Y 1 C ALA 221 ? C ALA 96  
122 1 Y 1 C MET 222 ? C MET 97  
123 1 Y 1 C ALA 223 ? C ALA 98  
124 1 Y 1 C ILE 224 ? C ILE 99  
125 1 Y 1 C THR 225 ? C THR 100 
126 1 Y 1 C LYS 226 ? C LYS 101 
127 1 Y 1 C GLU 227 ? C GLU 102 
128 1 Y 1 C GLN 228 ? C GLN 103 
129 1 Y 1 C GLU 229 ? C GLU 104 
130 1 Y 1 C GLU 230 ? C GLU 105 
131 1 Y 1 C GLU 231 ? C GLU 106 
132 1 Y 1 C ALA 232 ? C ALA 107 
133 1 Y 1 C LYS 233 ? C LYS 108 
134 1 Y 1 C THR 234 ? C THR 109 
135 1 Y 1 C GLY 235 ? C GLY 110 
136 1 Y 1 C HIS 236 ? C HIS 111 
137 1 Y 1 C HIS 237 ? C HIS 112 
138 1 Y 1 C GLN 238 ? C GLN 113 
139 1 Y 1 C GLU 239 ? C GLU 114 
140 1 Y 1 C PRO 240 ? C PRO 115 
141 1 Y 1 C ILE 241 ? C ILE 116 
142 1 Y 1 C SER 242 ? C SER 117 
143 1 Y 1 C GLN 243 ? C GLN 118 
144 1 Y 1 C THR 244 ? C THR 119 
145 1 Y 1 C LEU 245 ? C LEU 120 
146 1 Y 1 C LEU 246 ? C LEU 121 
147 1 Y 1 C HIS 247 ? C HIS 122 
148 1 Y 1 C LEU 248 ? C LEU 123 
149 1 Y 1 C GLY 249 ? C GLY 124 
150 1 Y 1 C ASP 250 ? C ASP 125 
151 1 Y 1 C ARG 251 ? C ARG 126 
152 1 Y 1 C LEU 252 ? C LEU 127 
153 1 Y 1 C ASP 253 ? C ASP 128 
154 1 Y 1 C ARG 254 ? C ARG 129 
155 1 Y 1 C ILE 255 ? C ILE 130 
156 1 Y 1 C GLU 256 ? C GLU 131 
157 1 Y 1 C LYS 257 ? C LYS 132 
158 1 Y 1 C GLN 258 ? C GLN 133 
159 1 Y 1 C LEU 259 ? C LEU 134 
160 1 Y 1 C ALA 260 ? C ALA 135 
161 1 Y 1 C GLN 261 ? C GLN 136 
162 1 Y 1 C ASN 262 ? C ASN 137 
163 1 Y 1 C ASN 263 ? C ASN 138 
164 1 Y 1 C GLU 264 ? C GLU 139 
165 1 Y 1 C LEU 265 ? C LEU 140 
166 1 Y 1 C LEU 266 ? C LEU 141 
167 1 Y 1 C GLN 267 ? C GLN 142 
168 1 Y 1 C ARG 268 ? C ARG 143 
169 1 Y 1 C GLN 269 ? C GLN 144 
170 1 Y 1 C GLN 270 ? C GLN 145 
171 1 Y 1 C PRO 271 ? C PRO 146 
172 1 Y 1 C GLN 272 ? C GLN 147 
173 1 Y 1 C LYS 273 ? C LYS 148 
174 1 Y 1 C LYS 274 ? C LYS 149 
175 1 Y 1 D GLY 126 ? D GLY 1   
176 1 Y 1 D SER 127 ? D SER 2   
177 1 Y 1 D HIS 128 ? D HIS 3   
178 1 Y 1 D MET 129 ? D MET 4   
179 1 Y 1 D ALA 221 ? D ALA 96  
180 1 Y 1 D MET 222 ? D MET 97  
181 1 Y 1 D ALA 223 ? D ALA 98  
182 1 Y 1 D ILE 224 ? D ILE 99  
183 1 Y 1 D THR 225 ? D THR 100 
184 1 Y 1 D LYS 226 ? D LYS 101 
185 1 Y 1 D GLU 227 ? D GLU 102 
186 1 Y 1 D GLN 228 ? D GLN 103 
187 1 Y 1 D GLU 229 ? D GLU 104 
188 1 Y 1 D GLU 230 ? D GLU 105 
189 1 Y 1 D GLU 231 ? D GLU 106 
190 1 Y 1 D ALA 232 ? D ALA 107 
191 1 Y 1 D LYS 233 ? D LYS 108 
192 1 Y 1 D THR 234 ? D THR 109 
193 1 Y 1 D GLY 235 ? D GLY 110 
194 1 Y 1 D HIS 236 ? D HIS 111 
195 1 Y 1 D HIS 237 ? D HIS 112 
196 1 Y 1 D GLN 238 ? D GLN 113 
197 1 Y 1 D GLU 239 ? D GLU 114 
198 1 Y 1 D PRO 240 ? D PRO 115 
199 1 Y 1 D ILE 241 ? D ILE 116 
200 1 Y 1 D SER 242 ? D SER 117 
201 1 Y 1 D GLN 243 ? D GLN 118 
202 1 Y 1 D THR 244 ? D THR 119 
203 1 Y 1 D LEU 245 ? D LEU 120 
204 1 Y 1 D LEU 246 ? D LEU 121 
205 1 Y 1 D HIS 247 ? D HIS 122 
206 1 Y 1 D LEU 248 ? D LEU 123 
207 1 Y 1 D GLY 249 ? D GLY 124 
208 1 Y 1 D ASP 250 ? D ASP 125 
209 1 Y 1 D ARG 251 ? D ARG 126 
210 1 Y 1 D LEU 252 ? D LEU 127 
211 1 Y 1 D ASP 253 ? D ASP 128 
212 1 Y 1 D ARG 254 ? D ARG 129 
213 1 Y 1 D ILE 255 ? D ILE 130 
214 1 Y 1 D GLU 256 ? D GLU 131 
215 1 Y 1 D LYS 257 ? D LYS 132 
216 1 Y 1 D GLN 258 ? D GLN 133 
217 1 Y 1 D LEU 259 ? D LEU 134 
218 1 Y 1 D ALA 260 ? D ALA 135 
219 1 Y 1 D GLN 261 ? D GLN 136 
220 1 Y 1 D ASN 262 ? D ASN 137 
221 1 Y 1 D ASN 263 ? D ASN 138 
222 1 Y 1 D GLU 264 ? D GLU 139 
223 1 Y 1 D LEU 265 ? D LEU 140 
224 1 Y 1 D LEU 266 ? D LEU 141 
225 1 Y 1 D GLN 267 ? D GLN 142 
226 1 Y 1 D ARG 268 ? D ARG 143 
227 1 Y 1 D GLN 269 ? D GLN 144 
228 1 Y 1 D GLN 270 ? D GLN 145 
229 1 Y 1 D PRO 271 ? D PRO 146 
230 1 Y 1 D GLN 272 ? D GLN 147 
231 1 Y 1 D LYS 273 ? D LYS 148 
232 1 Y 1 D LYS 274 ? D LYS 149 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/H02070X 1 
'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/J020702 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 HEGA-10       2CV 
3 'BROMIDE ION' BR  
4 water         HOH 
#