data_4PCW
# 
_entry.id   4PCW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4PCW         
WWPDB D_1000201171 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4PCW 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bunick, C.G.' 1 
'Steitz, T.A.' 2 
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.book_id_ISBN              . 
_citation.book_publisher            ? 
_citation.book_publisher_city       . 
_citation.book_title                . 
_citation.coordinate_linkage        . 
_citation.country                   ? 
_citation.database_id_Medline       . 
_citation.details                   . 
_citation.id                        primary 
_citation.journal_abbrev            'J. Invest. Dermatol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1523-1747 
_citation.journal_full              . 
_citation.journal_issue             . 
_citation.journal_volume            135 
_citation.language                  . 
_citation.page_first                1801 
_citation.page_last                 1809 
_citation.title                     
'Crystal Structure of Human Profilaggrin S100 Domain and Identification of Target Proteins Annexin II, Stratifin, and HSP27.' 
_citation.year                      2015 
_citation.database_id_CSD           . 
_citation.pdbx_database_id_DOI      10.1038/jid.2015.102 
_citation.pdbx_database_id_PubMed   25760235 
_citation.unpublished_flag          . 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bunick, C.G.'   1 
primary 'Presland, R.B.' 2 
primary 'Lawrence, O.T.' 3 
primary 'Pearton, D.J.'  4 
primary 'Milstone, L.M.' 5 
primary 'Steitz, T.A.'   6 
# 
_cell.entry_id           4PCW 
_cell.length_a           40.492 
_cell.length_b           85.285 
_cell.length_c           96.901 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4PCW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Filaggrin             11210.898 4   ? ? 'N-terminal domain (UNP residues 1-92)' ? 
2 non-polymer syn 'CALCIUM ION'         40.078    8   ? ? ?                                       ? 
3 non-polymer syn 'NONAETHYLENE GLYCOL' 414.488   2   ? ? ?                                       ? 
4 water       nat water                 18.015    120 ? ? ?                                       ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSMSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMV
FKLAQAYYESTRKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSMSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMV
FKLAQAYYESTRKE
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  MET n 
1 4  SER n 
1 5  THR n 
1 6  LEU n 
1 7  LEU n 
1 8  GLU n 
1 9  ASN n 
1 10 ILE n 
1 11 PHE n 
1 12 ALA n 
1 13 ILE n 
1 14 ILE n 
1 15 ASN n 
1 16 LEU n 
1 17 PHE n 
1 18 LYS n 
1 19 GLN n 
1 20 TYR n 
1 21 SER n 
1 22 LYS n 
1 23 LYS n 
1 24 ASP n 
1 25 LYS n 
1 26 ASN n 
1 27 THR n 
1 28 ASP n 
1 29 THR n 
1 30 LEU n 
1 31 SER n 
1 32 LYS n 
1 33 LYS n 
1 34 GLU n 
1 35 LEU n 
1 36 LYS n 
1 37 GLU n 
1 38 LEU n 
1 39 LEU n 
1 40 GLU n 
1 41 LYS n 
1 42 GLU n 
1 43 PHE n 
1 44 ARG n 
1 45 GLN n 
1 46 ILE n 
1 47 LEU n 
1 48 LYS n 
1 49 ASN n 
1 50 PRO n 
1 51 ASP n 
1 52 ASP n 
1 53 PRO n 
1 54 ASP n 
1 55 MET n 
1 56 VAL n 
1 57 ASP n 
1 58 VAL n 
1 59 PHE n 
1 60 MET n 
1 61 ASP n 
1 62 HIS n 
1 63 LEU n 
1 64 ASP n 
1 65 ILE n 
1 66 ASP n 
1 67 HIS n 
1 68 ASN n 
1 69 LYS n 
1 70 LYS n 
1 71 ILE n 
1 72 ASP n 
1 73 PHE n 
1 74 THR n 
1 75 GLU n 
1 76 PHE n 
1 77 LEU n 
1 78 LEU n 
1 79 MET n 
1 80 VAL n 
1 81 PHE n 
1 82 LYS n 
1 83 LEU n 
1 84 ALA n 
1 85 GLN n 
1 86 ALA n 
1 87 TYR n 
1 88 TYR n 
1 89 GLU n 
1 90 SER n 
1 91 THR n 
1 92 ARG n 
1 93 LYS n 
1 94 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   94 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 FLG 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGS-21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FILA_HUMAN 
_struct_ref.pdbx_db_accession          P20930 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMVFK
LAQAYYESTRKE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4PCW A 3 ? 94 ? P20930 1 ? 92 ? 0 91 
2 1 4PCW B 3 ? 94 ? P20930 1 ? 92 ? 0 91 
3 1 4PCW C 3 ? 94 ? P20930 1 ? 92 ? 0 91 
4 1 4PCW D 3 ? 94 ? P20930 1 ? 92 ? 0 91 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4PCW GLY A 1 ? UNP P20930 ? ? 'expression tag' -2 1 
1 4PCW SER A 2 ? UNP P20930 ? ? 'expression tag' -1 2 
2 4PCW GLY B 1 ? UNP P20930 ? ? 'expression tag' -2 3 
2 4PCW SER B 2 ? UNP P20930 ? ? 'expression tag' -1 4 
3 4PCW GLY C 1 ? UNP P20930 ? ? 'expression tag' -2 5 
3 4PCW SER C 2 ? UNP P20930 ? ? 'expression tag' -1 6 
4 4PCW GLY D 1 ? UNP P20930 ? ? 'expression tag' -2 7 
4 4PCW SER D 2 ? UNP P20930 ? ? 'expression tag' -1 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2PE non-polymer         . 'NONAETHYLENE GLYCOL' ? 'C18 H38 O10'    414.488 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'         ? 'Ca 2'           40.078  
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4PCW 
_exptl.crystals_number            1 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            1.87 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         34.21 
_exptl_crystal.description                 'small rods' 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    'PEG 4000, calcium chloride' 
_exptl_crystal_grow.pdbx_pH_range   '7.8 - 8.5' 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   'cryoprotectant PEG 400' 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2013-04-25 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            40.2 
_reflns.entry_id                         4PCW 
_reflns.data_reduction_details           . 
_reflns.data_reduction_method            . 
_reflns.d_resolution_high                1.943 
_reflns.d_resolution_low                 64.03 
_reflns.details                          . 
_reflns.limit_h_max                      . 
_reflns.limit_h_min                      . 
_reflns.limit_k_max                      . 
_reflns.limit_k_min                      . 
_reflns.limit_l_max                      . 
_reflns.limit_l_min                      . 
_reflns.number_all                       23548 
_reflns.number_obs                       16452 
_reflns.observed_criterion               . 
_reflns.observed_criterion_F_max         . 
_reflns.observed_criterion_F_min         . 
_reflns.observed_criterion_I_max         . 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_sigma_F       . 
_reflns.observed_criterion_sigma_I       . 
_reflns.percent_possible_obs             92.9 
_reflns.R_free_details                   . 
_reflns.Rmerge_F_all                     . 
_reflns.Rmerge_F_obs                     . 
_reflns.Friedel_coverage                 . 
_reflns.number_gt                        . 
_reflns.threshold_expression             . 
_reflns.pdbx_redundancy                  4.0 
_reflns.pdbx_Rmerge_I_obs                0.125 
_reflns.pdbx_Rmerge_I_all                . 
_reflns.pdbx_Rsym_value                  . 
_reflns.pdbx_netI_over_av_sigmaI         . 
_reflns.pdbx_netI_over_sigmaI            8.79 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.pdbx_chi_squared                 . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_res_high_opt              . 
_reflns.pdbx_d_res_low_opt               . 
_reflns.pdbx_d_res_opt_method            . 
_reflns.phase_calculation_details        . 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_Rpim_I_all                  . 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_number_measured_all         . 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
# 
_reflns_shell.d_res_high                  1.94 
_reflns_shell.d_res_low                   1.97 
_reflns_shell.meanI_over_sigI_all         . 
_reflns_shell.meanI_over_sigI_obs         0.37 
_reflns_shell.number_measured_all         . 
_reflns_shell.number_measured_obs         . 
_reflns_shell.number_possible             . 
_reflns_shell.number_unique_all           . 
_reflns_shell.number_unique_obs           . 
_reflns_shell.percent_possible_all        80.4 
_reflns_shell.percent_possible_obs        . 
_reflns_shell.Rmerge_F_all                . 
_reflns_shell.Rmerge_F_obs                . 
_reflns_shell.Rmerge_I_all                . 
_reflns_shell.Rmerge_I_obs                . 
_reflns_shell.meanI_over_sigI_gt          . 
_reflns_shell.meanI_over_uI_all           . 
_reflns_shell.meanI_over_uI_gt            . 
_reflns_shell.number_measured_gt          . 
_reflns_shell.number_unique_gt            . 
_reflns_shell.percent_possible_gt         . 
_reflns_shell.Rmerge_F_gt                 . 
_reflns_shell.Rmerge_I_gt                 . 
_reflns_shell.pdbx_redundancy             3.2 
_reflns_shell.pdbx_Rsym_value             . 
_reflns_shell.pdbx_chi_squared            . 
_reflns_shell.pdbx_netI_over_sigmaI_all   . 
_reflns_shell.pdbx_netI_over_sigmaI_obs   . 
_reflns_shell.pdbx_Rrim_I_all             . 
_reflns_shell.pdbx_Rpim_I_all             . 
_reflns_shell.pdbx_rejects                . 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4PCW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     16442 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.642 
_refine.ls_d_res_high                            2.200 
_refine.ls_percent_reflns_obs                    92.90 
_refine.ls_R_factor_obs                          0.1984 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1961 
_refine.ls_R_factor_R_free                       0.2421 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.13 
_refine.ls_number_reflns_R_free                  844 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1E8A 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.29 
_refine.pdbx_overall_phase_error                 24.98 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4PCW 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   . 
_refine_analyze.Luzzati_coordinate_error_obs    0.292 
_refine_analyze.Luzzati_d_res_low_free          . 
_refine_analyze.Luzzati_d_res_low_obs           . 
_refine_analyze.Luzzati_sigma_a_free            . 
_refine_analyze.Luzzati_sigma_a_free_details    . 
_refine_analyze.Luzzati_sigma_a_obs             . 
_refine_analyze.Luzzati_sigma_a_obs_details     . 
_refine_analyze.number_disordered_residues      . 
_refine_analyze.occupancy_sum_hydrogen          . 
_refine_analyze.occupancy_sum_non_hydrogen      . 
_refine_analyze.RG_d_res_high                   . 
_refine_analyze.RG_d_res_low                    . 
_refine_analyze.RG_free                         . 
_refine_analyze.RG_work                         . 
_refine_analyze.RG_free_work_ratio              . 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 3084 'X-RAY DIFFRACTION' ? 
f_angle_d          0.719  ? ? 4115 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.610 ? ? 1223 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.027  ? ? 457  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 512  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.2000 2.3378  2596 0.2526 95.00 0.3223 . . 144 . . 
'X-RAY DIFFRACTION' . 2.3378 2.5183  2577 0.2622 94.00 0.3427 . . 154 . . 
'X-RAY DIFFRACTION' . 2.5183 2.7717  2614 0.2328 94.00 0.2778 . . 141 . . 
'X-RAY DIFFRACTION' . 2.7717 3.1727  2605 0.2247 93.00 0.3049 . . 121 . . 
'X-RAY DIFFRACTION' . 3.1727 3.9968  2559 0.1676 92.00 0.2247 . . 152 . . 
'X-RAY DIFFRACTION' . 3.9968 42.6505 2647 0.1683 89.00 0.1826 . . 132 . . 
# 
_struct.entry_id                     4PCW 
_struct.title                        'Crystal Structure of the N-terminal Domain of Human Profilaggrin at 2.2 A Resolution' 
_struct.pdbx_descriptor              'N-terminal S100 fused-type calcium binding domain of human profilaggrin' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4PCW 
_struct_keywords.text            
'S100 protein, EF-Hand Calcium Binding Protein, Epidermal Skin Protein, Signaling Protein, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 3 ? 
M N N 2 ? 
N N N 2 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 5  ? LYS A 22 ? THR A 2  LYS A 19 1 ? 18 
HELX_P HELX_P2  AA2 SER A 31 ? GLU A 42 ? SER A 28 GLU A 39 1 ? 12 
HELX_P HELX_P3  AA3 MET A 55 ? ASP A 64 ? MET A 52 ASP A 61 1 ? 10 
HELX_P HELX_P4  AA4 PHE A 73 ? TYR A 88 ? PHE A 70 TYR A 85 1 ? 16 
HELX_P HELX_P5  AA5 THR B 5  ? LYS B 22 ? THR B 2  LYS B 19 1 ? 18 
HELX_P HELX_P6  AA6 SER B 31 ? PHE B 43 ? SER B 28 PHE B 40 1 ? 13 
HELX_P HELX_P7  AA7 ASP B 54 ? ASP B 64 ? ASP B 51 ASP B 61 1 ? 11 
HELX_P HELX_P8  AA8 ASP B 72 ? THR B 91 ? ASP B 69 THR B 88 1 ? 20 
HELX_P HELX_P9  AA9 THR C 5  ? SER C 21 ? THR C 2  SER C 18 1 ? 17 
HELX_P HELX_P10 AB1 SER C 31 ? PHE C 43 ? SER C 28 PHE C 40 1 ? 13 
HELX_P HELX_P11 AB2 ASP C 52 ? ASP C 64 ? ASP C 49 ASP C 61 1 ? 13 
HELX_P HELX_P12 AB3 PHE C 73 ? SER C 90 ? PHE C 70 SER C 87 1 ? 18 
HELX_P HELX_P13 AB4 THR D 5  ? LYS D 22 ? THR D 2  LYS D 19 1 ? 18 
HELX_P HELX_P14 AB5 SER D 31 ? PHE D 43 ? SER D 28 PHE D 40 1 ? 13 
HELX_P HELX_P15 AB6 ASP D 54 ? ASP D 64 ? ASP D 51 ASP D 61 1 ? 11 
HELX_P HELX_P16 AB7 ASP D 72 ? THR D 91 ? ASP D 69 THR D 88 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 21 O   ? ? ? 1_555 F CA  . CA ? ? A SER 18  A CA  102 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc2  metalc ? ? A ASP 24 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASP 21  A CA  102 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc3  metalc ? ? A ASP 24 OD2 ? ? ? 1_555 F CA  . CA ? ? A ASP 21  A CA  102 1_555 ? ? ? ? ? ? ? 3.039 ? 
metalc4  metalc ? ? A ASN 26 O   ? ? ? 1_555 F CA  . CA ? ? A ASN 23  A CA  102 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc5  metalc ? ? A THR 29 O   ? ? ? 1_555 F CA  . CA ? ? A THR 26  A CA  102 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc6  metalc ? ? A GLU 34 OE1 ? ? ? 1_555 F CA  . CA ? ? A GLU 31  A CA  102 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc7  metalc ? ? A GLU 34 OE2 ? ? ? 1_555 F CA  . CA ? ? A GLU 31  A CA  102 1_555 ? ? ? ? ? ? ? 3.011 ? 
metalc8  metalc ? ? A ASP 64 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 61  A CA  101 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc9  metalc ? ? A ASP 66 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 63  A CA  101 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc10 metalc ? ? A ASN 68 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASN 65  A CA  101 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc11 metalc ? ? A LYS 70 O   ? ? ? 1_555 E CA  . CA ? ? A LYS 67  A CA  101 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc12 metalc ? ? A GLU 75 OE1 ? ? ? 1_555 E CA  . CA ? ? A GLU 72  A CA  101 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc13 metalc ? ? A GLU 75 OE2 ? ? ? 1_555 E CA  . CA ? ? A GLU 72  A CA  101 1_555 ? ? ? ? ? ? ? 2.776 ? 
metalc14 metalc ? ? B SER 21 O   ? ? ? 1_555 H CA  . CA ? ? B SER 18  B CA  101 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc15 metalc ? ? B ASP 24 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 21  B CA  101 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc16 metalc ? ? B ASN 26 O   ? ? ? 1_555 H CA  . CA ? ? B ASN 23  B CA  101 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc17 metalc ? ? B THR 29 O   ? ? ? 1_555 H CA  . CA ? ? B THR 26  B CA  101 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc18 metalc ? ? B GLU 34 OE1 ? ? ? 1_555 H CA  . CA ? ? B GLU 31  B CA  101 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc19 metalc ? ? B GLU 34 OE2 ? ? ? 1_555 H CA  . CA ? ? B GLU 31  B CA  101 1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc20 metalc ? ? B ASP 64 OD1 ? ? ? 1_555 I CA  . CA ? ? B ASP 61  B CA  102 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc21 metalc ? ? B ASP 66 OD1 ? ? ? 1_555 I CA  . CA ? ? B ASP 63  B CA  102 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc22 metalc ? ? B ASN 68 OD1 ? ? ? 1_555 I CA  . CA ? ? B ASN 65  B CA  102 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc23 metalc ? ? B LYS 70 O   ? ? ? 1_555 I CA  . CA ? ? B LYS 67  B CA  102 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc24 metalc ? ? B GLU 75 OE1 ? ? ? 1_555 I CA  . CA ? ? B GLU 72  B CA  102 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc25 metalc ? ? B GLU 75 OE2 ? ? ? 1_555 I CA  . CA ? ? B GLU 72  B CA  102 1_555 ? ? ? ? ? ? ? 2.525 ? 
metalc26 metalc ? ? C SER 21 O   ? ? ? 1_555 K CA  . CA ? ? C SER 18  C CA  102 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc27 metalc ? ? C ASP 24 OD1 ? ? ? 1_555 K CA  . CA ? ? C ASP 21  C CA  102 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc28 metalc ? ? C ASP 24 OD2 ? ? ? 1_555 K CA  . CA ? ? C ASP 21  C CA  102 1_555 ? ? ? ? ? ? ? 3.150 ? 
metalc29 metalc ? ? C ASN 26 O   ? ? ? 1_555 K CA  . CA ? ? C ASN 23  C CA  102 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc30 metalc ? ? C THR 29 O   ? ? ? 1_555 K CA  . CA ? ? C THR 26  C CA  102 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc31 metalc ? ? C GLU 34 OE1 ? ? ? 1_555 K CA  . CA ? ? C GLU 31  C CA  102 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc32 metalc ? ? C GLU 34 OE2 ? ? ? 1_555 K CA  . CA ? ? C GLU 31  C CA  102 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc33 metalc ? ? C ASP 64 OD1 ? ? ? 1_555 J CA  . CA ? ? C ASP 61  C CA  101 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc34 metalc ? ? C ASP 66 OD1 ? ? ? 1_555 J CA  . CA ? ? C ASP 63  C CA  101 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc35 metalc ? ? C ASN 68 OD1 ? ? ? 1_555 J CA  . CA ? ? C ASN 65  C CA  101 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc36 metalc ? ? C LYS 70 O   ? ? ? 1_555 J CA  . CA ? ? C LYS 67  C CA  101 1_555 ? ? ? ? ? ? ? 2.273 ? 
metalc37 metalc ? ? C GLU 75 OE1 ? ? ? 1_555 J CA  . CA ? ? C GLU 72  C CA  101 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc38 metalc ? ? C GLU 75 OE2 ? ? ? 1_555 J CA  . CA ? ? C GLU 72  C CA  101 1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc39 metalc ? ? D SER 21 O   ? ? ? 1_555 M CA  . CA ? ? D SER 18  D CA  101 1_555 ? ? ? ? ? ? ? 2.591 ? 
metalc40 metalc ? ? D ASN 26 O   ? ? ? 1_555 M CA  . CA ? ? D ASN 23  D CA  101 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc41 metalc ? ? D THR 29 O   ? ? ? 1_555 M CA  . CA ? ? D THR 26  D CA  101 1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc42 metalc ? ? D GLU 34 OE1 ? ? ? 1_555 M CA  . CA ? ? D GLU 31  D CA  101 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc43 metalc ? ? D GLU 34 OE2 ? ? ? 1_555 M CA  . CA ? ? D GLU 31  D CA  101 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc44 metalc ? ? D ASP 64 OD1 ? ? ? 1_555 N CA  . CA ? ? D ASP 61  D CA  102 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc45 metalc ? ? D ASP 66 OD1 ? ? ? 1_555 N CA  . CA ? ? D ASP 63  D CA  102 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc46 metalc ? ? D ASN 68 OD1 ? ? ? 1_555 N CA  . CA ? ? D ASN 65  D CA  102 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc47 metalc ? ? D LYS 70 O   ? ? ? 1_555 N CA  . CA ? ? D LYS 67  D CA  102 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc48 metalc ? ? D GLU 75 OE1 ? ? ? 1_555 N CA  . CA ? ? D GLU 72  D CA  102 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc49 metalc ? ? D GLU 75 OE2 ? ? ? 1_555 N CA  . CA ? ? D GLU 72  D CA  102 1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc50 metalc ? ? E CA  .  CA  ? ? ? 1_555 O HOH . O  ? ? A CA  101 A HOH 209 1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc51 metalc ? ? F CA  .  CA  ? ? ? 1_555 O HOH . O  ? ? A CA  102 A HOH 220 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc52 metalc ? ? H CA  .  CA  ? ? ? 1_555 P HOH . O  ? ? B CA  101 B HOH 216 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc53 metalc ? ? I CA  .  CA  ? ? ? 1_555 P HOH . O  ? ? B CA  102 B HOH 217 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc54 metalc ? ? J CA  .  CA  ? ? ? 1_555 Q HOH . O  ? ? C CA  101 C HOH 202 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc55 metalc ? ? K CA  .  CA  ? ? ? 1_555 Q HOH . O  ? ? C CA  102 C HOH 219 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc56 metalc ? ? M CA  .  CA  ? ? ? 1_555 R HOH . O  ? ? D CA  101 D HOH 216 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc57 metalc ? ? N CA  .  CA  ? ? ? 1_555 R HOH . O  ? ? D CA  102 D HOH 217 1_555 ? ? ? ? ? ? ? 2.720 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 29 ? LEU A 30 ? THR A 26 LEU A 27 
AA1 2 ILE A 71 ? ASP A 72 ? ILE A 68 ASP A 69 
AA2 1 THR C 29 ? LEU C 30 ? THR C 26 LEU C 27 
AA2 2 ILE C 71 ? ASP C 72 ? ILE C 68 ASP C 69 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 30 ? N LEU A 27 O ILE A 71 ? O ILE A 68 
AA2 1 2 N LEU C 30 ? N LEU C 27 O ILE C 71 ? O ILE C 68 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  101 ? 6  'binding site for residue CA A 101'  
AC2 Software A CA  102 ? 6  'binding site for residue CA A 102'  
AC3 Software A 2PE 103 ? 10 'binding site for residue 2PE A 103' 
AC4 Software B CA  101 ? 6  'binding site for residue CA B 101'  
AC5 Software B CA  102 ? 6  'binding site for residue CA B 102'  
AC6 Software C CA  101 ? 6  'binding site for residue CA C 101'  
AC7 Software C CA  102 ? 6  'binding site for residue CA C 102'  
AC8 Software C 2PE 103 ? 10 'binding site for residue 2PE C 103' 
AC9 Software D CA  101 ? 6  'binding site for residue CA D 101'  
AD1 Software D CA  102 ? 7  'binding site for residue CA D 102'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP A 64 ? ASP A 61  . ? 1_555 ? 
2  AC1 6  ASP A 66 ? ASP A 63  . ? 1_555 ? 
3  AC1 6  ASN A 68 ? ASN A 65  . ? 1_555 ? 
4  AC1 6  LYS A 70 ? LYS A 67  . ? 1_555 ? 
5  AC1 6  GLU A 75 ? GLU A 72  . ? 1_555 ? 
6  AC1 6  HOH O .  ? HOH A 209 . ? 1_555 ? 
7  AC2 6  SER A 21 ? SER A 18  . ? 1_555 ? 
8  AC2 6  ASP A 24 ? ASP A 21  . ? 1_555 ? 
9  AC2 6  ASN A 26 ? ASN A 23  . ? 1_555 ? 
10 AC2 6  THR A 29 ? THR A 26  . ? 1_555 ? 
11 AC2 6  GLU A 34 ? GLU A 31  . ? 1_555 ? 
12 AC2 6  HOH O .  ? HOH A 220 . ? 1_555 ? 
13 AC3 10 ILE A 46 ? ILE A 43  . ? 1_555 ? 
14 AC3 10 HIS A 62 ? HIS A 59  . ? 1_555 ? 
15 AC3 10 LYS A 82 ? LYS A 79  . ? 1_555 ? 
16 AC3 10 LEU A 83 ? LEU A 80  . ? 1_555 ? 
17 AC3 10 TYR A 87 ? TYR A 84  . ? 1_555 ? 
18 AC3 10 HOH O .  ? HOH A 212 . ? 1_555 ? 
19 AC3 10 HOH O .  ? HOH A 222 . ? 1_555 ? 
20 AC3 10 ILE D 65 ? ILE D 62  . ? 1_555 ? 
21 AC3 10 ASP D 66 ? ASP D 63  . ? 1_555 ? 
22 AC3 10 PHE D 81 ? PHE D 78  . ? 1_555 ? 
23 AC4 6  SER B 21 ? SER B 18  . ? 1_555 ? 
24 AC4 6  ASP B 24 ? ASP B 21  . ? 1_555 ? 
25 AC4 6  ASN B 26 ? ASN B 23  . ? 1_555 ? 
26 AC4 6  THR B 29 ? THR B 26  . ? 1_555 ? 
27 AC4 6  GLU B 34 ? GLU B 31  . ? 1_555 ? 
28 AC4 6  HOH P .  ? HOH B 216 . ? 1_555 ? 
29 AC5 6  ASP B 64 ? ASP B 61  . ? 1_555 ? 
30 AC5 6  ASP B 66 ? ASP B 63  . ? 1_555 ? 
31 AC5 6  ASN B 68 ? ASN B 65  . ? 1_555 ? 
32 AC5 6  LYS B 70 ? LYS B 67  . ? 1_555 ? 
33 AC5 6  GLU B 75 ? GLU B 72  . ? 1_555 ? 
34 AC5 6  HOH P .  ? HOH B 217 . ? 1_555 ? 
35 AC6 6  ASP C 64 ? ASP C 61  . ? 1_555 ? 
36 AC6 6  ASP C 66 ? ASP C 63  . ? 1_555 ? 
37 AC6 6  ASN C 68 ? ASN C 65  . ? 1_555 ? 
38 AC6 6  LYS C 70 ? LYS C 67  . ? 1_555 ? 
39 AC6 6  GLU C 75 ? GLU C 72  . ? 1_555 ? 
40 AC6 6  HOH Q .  ? HOH C 202 . ? 1_555 ? 
41 AC7 6  SER C 21 ? SER C 18  . ? 1_555 ? 
42 AC7 6  ASP C 24 ? ASP C 21  . ? 1_555 ? 
43 AC7 6  ASN C 26 ? ASN C 23  . ? 1_555 ? 
44 AC7 6  THR C 29 ? THR C 26  . ? 1_555 ? 
45 AC7 6  GLU C 34 ? GLU C 31  . ? 1_555 ? 
46 AC7 6  HOH Q .  ? HOH C 219 . ? 1_555 ? 
47 AC8 10 GLN A 85 ? GLN A 82  . ? 1_555 ? 
48 AC8 10 ILE B 65 ? ILE B 62  . ? 1_555 ? 
49 AC8 10 ASP B 66 ? ASP B 63  . ? 1_555 ? 
50 AC8 10 ILE C 46 ? ILE C 43  . ? 1_555 ? 
51 AC8 10 LEU C 47 ? LEU C 44  . ? 1_555 ? 
52 AC8 10 PHE C 59 ? PHE C 56  . ? 1_555 ? 
53 AC8 10 MET C 79 ? MET C 76  . ? 1_555 ? 
54 AC8 10 LYS C 82 ? LYS C 79  . ? 1_555 ? 
55 AC8 10 TYR C 87 ? TYR C 84  . ? 1_555 ? 
56 AC8 10 HOH Q .  ? HOH C 235 . ? 1_555 ? 
57 AC9 6  SER D 21 ? SER D 18  . ? 1_555 ? 
58 AC9 6  ASP D 24 ? ASP D 21  . ? 1_555 ? 
59 AC9 6  ASN D 26 ? ASN D 23  . ? 1_555 ? 
60 AC9 6  THR D 29 ? THR D 26  . ? 1_555 ? 
61 AC9 6  GLU D 34 ? GLU D 31  . ? 1_555 ? 
62 AC9 6  HOH R .  ? HOH D 216 . ? 1_555 ? 
63 AD1 7  ASP D 64 ? ASP D 61  . ? 1_555 ? 
64 AD1 7  ASP D 66 ? ASP D 63  . ? 1_555 ? 
65 AD1 7  ASN D 68 ? ASN D 65  . ? 1_555 ? 
66 AD1 7  LYS D 70 ? LYS D 67  . ? 1_555 ? 
67 AD1 7  ASP D 72 ? ASP D 69  . ? 1_555 ? 
68 AD1 7  GLU D 75 ? GLU D 72  . ? 1_555 ? 
69 AD1 7  HOH R .  ? HOH D 217 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4PCW 
_atom_sites.fract_transf_matrix[1][1]   0.024696 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011725 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010320 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4  ? -19.014 -7.005  33.835  1.00 42.88  ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 4  ? -19.855 -6.163  34.736  1.00 34.10  ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 4  ? -19.560 -4.678  34.529  1.00 31.87  ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 4  ? -20.442 -3.911  34.142  1.00 43.11  ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 4  ? -19.623 -6.554  36.194  1.00 43.77  ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 4  ? -19.961 -7.914  36.408  1.00 48.30  ? 1   SER A OG  1 
ATOM   7    N  N   . THR A 1 5  ? -18.320 -4.279  34.796  1.00 26.73  ? 2   THR A N   1 
ATOM   8    C  CA  . THR A 1 5  ? -17.868 -2.921  34.511  1.00 30.71  ? 2   THR A CA  1 
ATOM   9    C  C   . THR A 1 5  ? -17.207 -2.875  33.139  1.00 31.79  ? 2   THR A C   1 
ATOM   10   O  O   . THR A 1 5  ? -16.793 -3.906  32.611  1.00 25.02  ? 2   THR A O   1 
ATOM   11   C  CB  . THR A 1 5  ? -16.872 -2.418  35.567  1.00 32.82  ? 2   THR A CB  1 
ATOM   12   O  OG1 . THR A 1 5  ? -15.667 -3.190  35.498  1.00 34.15  ? 2   THR A OG1 1 
ATOM   13   C  CG2 . THR A 1 5  ? -17.470 -2.526  36.961  1.00 37.02  ? 2   THR A CG2 1 
ATOM   14   N  N   . LEU A 1 6  ? -17.104 -1.680  32.568  1.00 31.80  ? 3   LEU A N   1 
ATOM   15   C  CA  . LEU A 1 6  ? -16.474 -1.513  31.263  1.00 29.25  ? 3   LEU A CA  1 
ATOM   16   C  C   . LEU A 1 6  ? -15.007 -1.934  31.296  1.00 26.21  ? 3   LEU A C   1 
ATOM   17   O  O   . LEU A 1 6  ? -14.504 -2.538  30.348  1.00 34.05  ? 3   LEU A O   1 
ATOM   18   C  CB  . LEU A 1 6  ? -16.588 -0.061  30.795  1.00 33.56  ? 3   LEU A CB  1 
ATOM   19   C  CG  . LEU A 1 6  ? -15.964 0.259   29.433  1.00 26.57  ? 3   LEU A CG  1 
ATOM   20   C  CD1 . LEU A 1 6  ? -16.650 -0.524  28.324  1.00 32.60  ? 3   LEU A CD1 1 
ATOM   21   C  CD2 . LEU A 1 6  ? -16.027 1.752   29.149  1.00 30.50  ? 3   LEU A CD2 1 
ATOM   22   N  N   . LEU A 1 7  ? -14.325 -1.611  32.390  1.00 23.96  ? 4   LEU A N   1 
ATOM   23   C  CA  . LEU A 1 7  ? -12.912 -1.938  32.528  1.00 25.13  ? 4   LEU A CA  1 
ATOM   24   C  C   . LEU A 1 7  ? -12.680 -3.448  32.585  1.00 22.92  ? 4   LEU A C   1 
ATOM   25   O  O   . LEU A 1 7  ? -11.740 -3.955  31.977  1.00 26.61  ? 4   LEU A O   1 
ATOM   26   C  CB  . LEU A 1 7  ? -12.337 -1.264  33.774  1.00 25.83  ? 4   LEU A CB  1 
ATOM   27   C  CG  . LEU A 1 7  ? -12.060 0.228   33.586  1.00 31.40  ? 4   LEU A CG  1 
ATOM   28   C  CD1 . LEU A 1 7  ? -12.022 0.958   34.916  1.00 28.70  ? 4   LEU A CD1 1 
ATOM   29   C  CD2 . LEU A 1 7  ? -10.754 0.425   32.837  1.00 41.67  ? 4   LEU A CD2 1 
ATOM   30   N  N   . GLU A 1 8  ? -13.542 -4.161  33.306  1.00 21.07  ? 5   GLU A N   1 
ATOM   31   C  CA  . GLU A 1 8  ? -13.434 -5.614  33.410  1.00 32.77  ? 5   GLU A CA  1 
ATOM   32   C  C   . GLU A 1 8  ? -13.555 -6.270  32.041  1.00 30.78  ? 5   GLU A C   1 
ATOM   33   O  O   . GLU A 1 8  ? -12.860 -7.239  31.743  1.00 27.90  ? 5   GLU A O   1 
ATOM   34   C  CB  . GLU A 1 8  ? -14.507 -6.174  34.349  1.00 24.76  ? 5   GLU A CB  1 
ATOM   35   C  CG  . GLU A 1 8  ? -14.201 -5.994  35.829  1.00 29.58  ? 5   GLU A CG  1 
ATOM   36   C  CD  . GLU A 1 8  ? -15.346 -6.439  36.720  1.00 42.54  ? 5   GLU A CD  1 
ATOM   37   O  OE1 . GLU A 1 8  ? -16.271 -5.629  36.946  1.00 36.53  ? 5   GLU A OE1 1 
ATOM   38   O  OE2 . GLU A 1 8  ? -15.323 -7.597  37.192  1.00 34.21  ? 5   GLU A OE2 1 
ATOM   39   N  N   . ASN A 1 9  ? -14.444 -5.739  31.211  1.00 31.45  ? 6   ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9  ? -14.626 -6.262  29.867  1.00 29.81  ? 6   ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9  ? -13.382 -6.024  29.017  1.00 30.58  ? 6   ASN A C   1 
ATOM   42   O  O   . ASN A 1 9  ? -12.966 -6.898  28.257  1.00 29.92  ? 6   ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9  ? -15.853 -5.628  29.210  1.00 30.66  ? 6   ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9  ? -17.145 -5.993  29.917  1.00 39.42  ? 6   ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9  ? -17.906 -5.122  30.334  1.00 43.32  ? 6   ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9  ? -17.394 -7.290  30.058  1.00 33.50  ? 6   ASN A ND2 1 
ATOM   47   N  N   . ILE A 1 10 ? -12.785 -4.846  29.160  1.00 24.96  ? 7   ILE A N   1 
ATOM   48   C  CA  . ILE A 1 10 ? -11.592 -4.497  28.395  1.00 19.72  ? 7   ILE A CA  1 
ATOM   49   C  C   . ILE A 1 10 ? -10.403 -5.369  28.782  1.00 23.52  ? 7   ILE A C   1 
ATOM   50   O  O   . ILE A 1 10 ? -9.654  -5.818  27.918  1.00 22.30  ? 7   ILE A O   1 
ATOM   51   C  CB  . ILE A 1 10 ? -11.221 -3.011  28.582  1.00 24.02  ? 7   ILE A CB  1 
ATOM   52   C  CG1 . ILE A 1 10 ? -12.218 -2.135  27.819  1.00 23.06  ? 7   ILE A CG1 1 
ATOM   53   C  CG2 . ILE A 1 10 ? -9.790  -2.734  28.093  1.00 24.63  ? 7   ILE A CG2 1 
ATOM   54   C  CD1 . ILE A 1 10 ? -12.005 -0.640  27.992  1.00 34.84  ? 7   ILE A CD1 1 
ATOM   55   N  N   . PHE A 1 11 ? -10.213 -5.592  30.078  1.00 30.23  ? 8   PHE A N   1 
ATOM   56   C  CA  . PHE A 1 11 ? -9.139  -6.467  30.532  1.00 27.00  ? 8   PHE A CA  1 
ATOM   57   C  C   . PHE A 1 11 ? -9.382  -7.897  30.061  1.00 24.04  ? 8   PHE A C   1 
ATOM   58   O  O   . PHE A 1 11 ? -8.441  -8.616  29.724  1.00 26.29  ? 8   PHE A O   1 
ATOM   59   C  CB  . PHE A 1 11 ? -9.008  -6.427  32.056  1.00 30.70  ? 8   PHE A CB  1 
ATOM   60   C  CG  . PHE A 1 11 ? -8.452  -5.133  32.582  1.00 29.40  ? 8   PHE A CG  1 
ATOM   61   C  CD1 . PHE A 1 11 ? -7.203  -4.687  32.183  1.00 26.11  ? 8   PHE A CD1 1 
ATOM   62   C  CD2 . PHE A 1 11 ? -9.173  -4.370  33.486  1.00 32.82  ? 8   PHE A CD2 1 
ATOM   63   C  CE1 . PHE A 1 11 ? -6.689  -3.498  32.666  1.00 35.86  ? 8   PHE A CE1 1 
ATOM   64   C  CE2 . PHE A 1 11 ? -8.664  -3.181  33.973  1.00 34.71  ? 8   PHE A CE2 1 
ATOM   65   C  CZ  . PHE A 1 11 ? -7.419  -2.745  33.563  1.00 40.44  ? 8   PHE A CZ  1 
ATOM   66   N  N   . ALA A 1 12 ? -10.646 -8.305  30.033  1.00 26.05  ? 9   ALA A N   1 
ATOM   67   C  CA  . ALA A 1 12 ? -11.003 -9.646  29.581  1.00 31.82  ? 9   ALA A CA  1 
ATOM   68   C  C   . ALA A 1 12 ? -10.654 -9.828  28.107  1.00 30.50  ? 9   ALA A C   1 
ATOM   69   O  O   . ALA A 1 12 ? -10.179 -10.889 27.697  1.00 20.97  ? 9   ALA A O   1 
ATOM   70   C  CB  . ALA A 1 12 ? -12.479 -9.909  29.813  1.00 32.39  ? 9   ALA A CB  1 
ATOM   71   N  N   . ILE A 1 13 ? -10.888 -8.788  27.315  1.00 27.05  ? 10  ILE A N   1 
ATOM   72   C  CA  . ILE A 1 13 ? -10.546 -8.821  25.899  1.00 18.91  ? 10  ILE A CA  1 
ATOM   73   C  C   . ILE A 1 13 ? -9.030  -8.913  25.739  1.00 25.84  ? 10  ILE A C   1 
ATOM   74   O  O   . ILE A 1 13 ? -8.530  -9.688  24.924  1.00 19.92  ? 10  ILE A O   1 
ATOM   75   C  CB  . ILE A 1 13 ? -11.090 -7.580  25.160  1.00 22.67  ? 10  ILE A CB  1 
ATOM   76   C  CG1 . ILE A 1 13 ? -12.617 -7.639  25.097  1.00 21.02  ? 10  ILE A CG1 1 
ATOM   77   C  CG2 . ILE A 1 13 ? -10.524 -7.498  23.741  1.00 23.50  ? 10  ILE A CG2 1 
ATOM   78   C  CD1 . ILE A 1 13 ? -13.282 -6.347  24.647  1.00 28.56  ? 10  ILE A CD1 1 
ATOM   79   N  N   . ILE A 1 14 ? -8.306  -8.122  26.524  1.00 28.24  ? 11  ILE A N   1 
ATOM   80   C  CA  . ILE A 1 14 ? -6.847  -8.144  26.504  1.00 28.60  ? 11  ILE A CA  1 
ATOM   81   C  C   . ILE A 1 14 ? -6.307  -9.531  26.858  1.00 31.53  ? 11  ILE A C   1 
ATOM   82   O  O   . ILE A 1 14 ? -5.478  -10.083 26.137  1.00 25.30  ? 11  ILE A O   1 
ATOM   83   C  CB  . ILE A 1 14 ? -6.261  -7.103  27.480  1.00 22.09  ? 11  ILE A CB  1 
ATOM   84   C  CG1 . ILE A 1 14 ? -6.578  -5.688  26.992  1.00 27.09  ? 11  ILE A CG1 1 
ATOM   85   C  CG2 . ILE A 1 14 ? -4.746  -7.274  27.619  1.00 25.14  ? 11  ILE A CG2 1 
ATOM   86   C  CD1 . ILE A 1 14 ? -6.346  -4.605  28.034  1.00 29.29  ? 11  ILE A CD1 1 
ATOM   87   N  N   . ASN A 1 15 ? -6.777  -10.085 27.972  1.00 26.79  ? 12  ASN A N   1 
ATOM   88   C  CA  . ASN A 1 15 ? -6.321  -11.391 28.436  1.00 27.97  ? 12  ASN A CA  1 
ATOM   89   C  C   . ASN A 1 15 ? -6.707  -12.507 27.475  1.00 34.17  ? 12  ASN A C   1 
ATOM   90   O  O   . ASN A 1 15 ? -5.991  -13.499 27.336  1.00 39.07  ? 12  ASN A O   1 
ATOM   91   C  CB  . ASN A 1 15 ? -6.888  -11.683 29.825  1.00 30.69  ? 12  ASN A CB  1 
ATOM   92   C  CG  . ASN A 1 15 ? -6.406  -10.694 30.866  1.00 36.11  ? 12  ASN A CG  1 
ATOM   93   O  OD1 . ASN A 1 15 ? -5.294  -10.174 30.775  1.00 42.84  ? 12  ASN A OD1 1 
ATOM   94   N  ND2 . ASN A 1 15 ? -7.242  -10.425 31.861  1.00 44.82  ? 12  ASN A ND2 1 
ATOM   95   N  N   . LEU A 1 16 ? -7.847  -12.340 26.817  1.00 31.00  ? 13  LEU A N   1 
ATOM   96   C  CA  . LEU A 1 16 ? -8.299  -13.299 25.823  1.00 35.81  ? 13  LEU A CA  1 
ATOM   97   C  C   . LEU A 1 16 ? -7.310  -13.352 24.663  1.00 40.07  ? 13  LEU A C   1 
ATOM   98   O  O   . LEU A 1 16 ? -6.911  -14.430 24.221  1.00 29.35  ? 13  LEU A O   1 
ATOM   99   C  CB  . LEU A 1 16 ? -9.698  -12.927 25.326  1.00 39.40  ? 13  LEU A CB  1 
ATOM   100  C  CG  . LEU A 1 16 ? -10.307 -13.792 24.221  1.00 52.68  ? 13  LEU A CG  1 
ATOM   101  C  CD1 . LEU A 1 16 ? -11.795 -13.951 24.463  1.00 55.99  ? 13  LEU A CD1 1 
ATOM   102  C  CD2 . LEU A 1 16 ? -10.057 -13.188 22.844  1.00 51.03  ? 13  LEU A CD2 1 
ATOM   103  N  N   . PHE A 1 17 ? -6.910  -12.177 24.187  1.00 26.26  ? 14  PHE A N   1 
ATOM   104  C  CA  . PHE A 1 17 ? -5.984  -12.065 23.067  1.00 37.62  ? 14  PHE A CA  1 
ATOM   105  C  C   . PHE A 1 17 ? -4.627  -12.656 23.419  1.00 40.70  ? 14  PHE A C   1 
ATOM   106  O  O   . PHE A 1 17 ? -4.037  -13.394 22.630  1.00 38.24  ? 14  PHE A O   1 
ATOM   107  C  CB  . PHE A 1 17 ? -5.831  -10.598 22.653  1.00 33.31  ? 14  PHE A CB  1 
ATOM   108  C  CG  . PHE A 1 17 ? -4.776  -10.363 21.605  1.00 33.32  ? 14  PHE A CG  1 
ATOM   109  C  CD1 . PHE A 1 17 ? -5.084  -10.453 20.257  1.00 31.65  ? 14  PHE A CD1 1 
ATOM   110  C  CD2 . PHE A 1 17 ? -3.480  -10.031 21.969  1.00 34.53  ? 14  PHE A CD2 1 
ATOM   111  C  CE1 . PHE A 1 17 ? -4.116  -10.228 19.292  1.00 35.96  ? 14  PHE A CE1 1 
ATOM   112  C  CE2 . PHE A 1 17 ? -2.509  -9.806  21.008  1.00 37.73  ? 14  PHE A CE2 1 
ATOM   113  C  CZ  . PHE A 1 17 ? -2.827  -9.905  19.669  1.00 30.37  ? 14  PHE A CZ  1 
ATOM   114  N  N   . LYS A 1 18 ? -4.139  -12.334 24.611  1.00 40.09  ? 15  LYS A N   1 
ATOM   115  C  CA  . LYS A 1 18 ? -2.816  -12.770 25.034  1.00 36.97  ? 15  LYS A CA  1 
ATOM   116  C  C   . LYS A 1 18 ? -2.767  -14.279 25.260  1.00 42.18  ? 15  LYS A C   1 
ATOM   117  O  O   . LYS A 1 18 ? -1.705  -14.893 25.155  1.00 45.84  ? 15  LYS A O   1 
ATOM   118  C  CB  . LYS A 1 18 ? -2.396  -12.026 26.301  1.00 39.96  ? 15  LYS A CB  1 
ATOM   119  C  CG  . LYS A 1 18 ? -2.263  -10.530 26.090  1.00 34.98  ? 15  LYS A CG  1 
ATOM   120  C  CD  . LYS A 1 18 ? -1.775  -9.812  27.334  1.00 49.44  ? 15  LYS A CD  1 
ATOM   121  C  CE  . LYS A 1 18 ? -0.273  -9.949  27.509  1.00 60.11  ? 15  LYS A CE  1 
ATOM   122  N  NZ  . LYS A 1 18 ? 0.325   -8.707  28.063  1.00 48.62  ? 15  LYS A NZ  1 
ATOM   123  N  N   . GLN A 1 19 ? -3.919  -14.873 25.556  1.00 36.67  ? 16  GLN A N   1 
ATOM   124  C  CA  . GLN A 1 19 ? -3.998  -16.311 25.777  1.00 36.25  ? 16  GLN A CA  1 
ATOM   125  C  C   . GLN A 1 19 ? -3.588  -17.076 24.524  1.00 42.36  ? 16  GLN A C   1 
ATOM   126  O  O   . GLN A 1 19 ? -2.994  -18.152 24.611  1.00 48.48  ? 16  GLN A O   1 
ATOM   127  C  CB  . GLN A 1 19 ? -5.415  -16.715 26.197  1.00 38.08  ? 16  GLN A CB  1 
ATOM   128  C  CG  . GLN A 1 19 ? -5.603  -18.213 26.412  1.00 40.64  ? 16  GLN A CG  1 
ATOM   129  C  CD  . GLN A 1 19 ? -7.035  -18.579 26.748  1.00 48.55  ? 16  GLN A CD  1 
ATOM   130  O  OE1 . GLN A 1 19 ? -7.784  -17.770 27.295  1.00 61.49  ? 16  GLN A OE1 1 
ATOM   131  N  NE2 . GLN A 1 19 ? -7.424  -19.805 26.416  1.00 49.98  ? 16  GLN A NE2 1 
ATOM   132  N  N   . TYR A 1 20 ? -3.903  -16.514 23.362  1.00 36.65  ? 17  TYR A N   1 
ATOM   133  C  CA  . TYR A 1 20 ? -3.652  -17.190 22.097  1.00 35.61  ? 17  TYR A CA  1 
ATOM   134  C  C   . TYR A 1 20 ? -2.414  -16.642 21.395  1.00 34.63  ? 17  TYR A C   1 
ATOM   135  O  O   . TYR A 1 20 ? -1.759  -17.359 20.641  1.00 47.25  ? 17  TYR A O   1 
ATOM   136  C  CB  . TYR A 1 20 ? -4.876  -17.075 21.186  1.00 38.50  ? 17  TYR A CB  1 
ATOM   137  C  CG  . TYR A 1 20 ? -6.101  -17.769 21.744  1.00 38.20  ? 17  TYR A CG  1 
ATOM   138  C  CD1 . TYR A 1 20 ? -6.280  -19.137 21.588  1.00 44.67  ? 17  TYR A CD1 1 
ATOM   139  C  CD2 . TYR A 1 20 ? -7.073  -17.057 22.432  1.00 43.13  ? 17  TYR A CD2 1 
ATOM   140  C  CE1 . TYR A 1 20 ? -7.396  -19.776 22.100  1.00 47.25  ? 17  TYR A CE1 1 
ATOM   141  C  CE2 . TYR A 1 20 ? -8.191  -17.686 22.946  1.00 52.10  ? 17  TYR A CE2 1 
ATOM   142  C  CZ  . TYR A 1 20 ? -8.348  -19.045 22.777  1.00 52.02  ? 17  TYR A CZ  1 
ATOM   143  O  OH  . TYR A 1 20 ? -9.461  -19.672 23.289  1.00 55.97  ? 17  TYR A OH  1 
ATOM   144  N  N   . SER A 1 21 ? -2.089  -15.378 21.649  1.00 41.76  ? 18  SER A N   1 
ATOM   145  C  CA  . SER A 1 21 ? -0.953  -14.736 20.990  1.00 47.75  ? 18  SER A CA  1 
ATOM   146  C  C   . SER A 1 21 ? 0.374   -15.182 21.593  1.00 51.99  ? 18  SER A C   1 
ATOM   147  O  O   . SER A 1 21 ? 1.366   -15.348 20.881  1.00 52.00  ? 18  SER A O   1 
ATOM   148  C  CB  . SER A 1 21 ? -1.072  -13.213 21.080  1.00 42.93  ? 18  SER A CB  1 
ATOM   149  O  OG  . SER A 1 21 ? -0.796  -12.754 22.392  1.00 55.44  ? 18  SER A OG  1 
ATOM   150  N  N   . LYS A 1 22 ? 0.383   -15.380 22.906  1.00 47.38  ? 19  LYS A N   1 
ATOM   151  C  CA  . LYS A 1 22 ? 1.603   -15.729 23.623  1.00 47.67  ? 19  LYS A CA  1 
ATOM   152  C  C   . LYS A 1 22 ? 1.880   -17.229 23.566  1.00 51.39  ? 19  LYS A C   1 
ATOM   153  O  O   . LYS A 1 22 ? 2.679   -17.751 24.343  1.00 59.41  ? 19  LYS A O   1 
ATOM   154  C  CB  . LYS A 1 22 ? 1.505   -15.259 25.076  1.00 46.37  ? 19  LYS A CB  1 
ATOM   155  C  CG  . LYS A 1 22 ? 1.253   -13.762 25.203  1.00 48.45  ? 19  LYS A CG  1 
ATOM   156  C  CD  . LYS A 1 22 ? 1.000   -13.329 26.639  1.00 63.08  ? 19  LYS A CD  1 
ATOM   157  C  CE  . LYS A 1 22 ? 2.224   -13.525 27.519  1.00 75.51  ? 19  LYS A CE  1 
ATOM   158  N  NZ  . LYS A 1 22 ? 2.266   -12.534 28.632  1.00 66.78  ? 19  LYS A NZ  1 
ATOM   159  N  N   . LYS A 1 23 ? 1.218   -17.915 22.640  1.00 44.44  ? 20  LYS A N   1 
ATOM   160  C  CA  . LYS A 1 23 ? 1.410   -19.348 22.453  1.00 42.52  ? 20  LYS A CA  1 
ATOM   161  C  C   . LYS A 1 23 ? 2.749   -19.654 21.792  1.00 52.64  ? 20  LYS A C   1 
ATOM   162  O  O   . LYS A 1 23 ? 3.230   -20.785 21.857  1.00 61.79  ? 20  LYS A O   1 
ATOM   163  C  CB  . LYS A 1 23 ? 0.276   -19.932 21.603  1.00 42.75  ? 20  LYS A CB  1 
ATOM   164  C  CG  . LYS A 1 23 ? -0.579  -20.986 22.292  1.00 50.63  ? 20  LYS A CG  1 
ATOM   165  C  CD  . LYS A 1 23 ? -2.052  -20.624 22.225  1.00 43.72  ? 20  LYS A CD  1 
ATOM   166  C  CE  . LYS A 1 23 ? -2.933  -21.756 22.725  1.00 53.71  ? 20  LYS A CE  1 
ATOM   167  N  NZ  . LYS A 1 23 ? -2.824  -21.950 24.196  1.00 60.22  ? 20  LYS A NZ  1 
ATOM   168  N  N   . ASP A 1 24 ? 3.346   -18.646 21.158  1.00 56.67  ? 21  ASP A N   1 
ATOM   169  C  CA  . ASP A 1 24 ? 4.568   -18.839 20.383  1.00 56.59  ? 21  ASP A CA  1 
ATOM   170  C  C   . ASP A 1 24 ? 5.640   -17.807 20.728  1.00 65.28  ? 21  ASP A C   1 
ATOM   171  O  O   . ASP A 1 24 ? 5.588   -17.159 21.776  1.00 55.23  ? 21  ASP A O   1 
ATOM   172  C  CB  . ASP A 1 24 ? 4.250   -18.780 18.884  1.00 64.67  ? 21  ASP A CB  1 
ATOM   173  C  CG  . ASP A 1 24 ? 3.969   -17.372 18.401  1.00 57.53  ? 21  ASP A CG  1 
ATOM   174  O  OD1 . ASP A 1 24 ? 3.530   -16.543 19.221  1.00 69.62  ? 21  ASP A OD1 1 
ATOM   175  O  OD2 . ASP A 1 24 ? 4.186   -17.096 17.202  1.00 57.64  ? 21  ASP A OD2 1 
ATOM   176  N  N   . LYS A 1 25 ? 6.610   -17.666 19.830  1.00 67.80  ? 22  LYS A N   1 
ATOM   177  C  CA  . LYS A 1 25 ? 7.678   -16.687 19.973  1.00 70.60  ? 22  LYS A CA  1 
ATOM   178  C  C   . LYS A 1 25 ? 7.136   -15.268 19.825  1.00 62.70  ? 22  LYS A C   1 
ATOM   179  O  O   . LYS A 1 25 ? 7.513   -14.365 20.571  1.00 66.54  ? 22  LYS A O   1 
ATOM   180  C  CB  . LYS A 1 25 ? 8.763   -16.947 18.928  1.00 79.91  ? 22  LYS A CB  1 
ATOM   181  C  CG  . LYS A 1 25 ? 10.074  -16.216 19.172  1.00 91.61  ? 22  LYS A CG  1 
ATOM   182  C  CD  . LYS A 1 25 ? 11.119  -17.117 19.819  1.00 88.46  ? 22  LYS A CD  1 
ATOM   183  C  CE  . LYS A 1 25 ? 12.530  -16.661 19.488  1.00 96.00  ? 22  LYS A CE  1 
ATOM   184  N  NZ  . LYS A 1 25 ? 12.840  -16.812 18.037  1.00 102.54 ? 22  LYS A NZ  1 
ATOM   185  N  N   . ASN A 1 26 ? 6.253   -15.084 18.849  1.00 61.44  ? 23  ASN A N   1 
ATOM   186  C  CA  . ASN A 1 26 ? 5.645   -13.786 18.581  1.00 63.00  ? 23  ASN A CA  1 
ATOM   187  C  C   . ASN A 1 26 ? 4.483   -13.530 19.538  1.00 51.09  ? 23  ASN A C   1 
ATOM   188  O  O   . ASN A 1 26 ? 3.331   -13.817 19.221  1.00 46.51  ? 23  ASN A O   1 
ATOM   189  C  CB  . ASN A 1 26 ? 5.169   -13.719 17.128  1.00 60.40  ? 23  ASN A CB  1 
ATOM   190  C  CG  . ASN A 1 26 ? 6.257   -14.093 16.138  1.00 63.10  ? 23  ASN A CG  1 
ATOM   191  O  OD1 . ASN A 1 26 ? 7.407   -13.672 16.270  1.00 66.43  ? 23  ASN A OD1 1 
ATOM   192  N  ND2 . ASN A 1 26 ? 5.899   -14.899 15.143  1.00 54.90  ? 23  ASN A ND2 1 
ATOM   193  N  N   . THR A 1 27 ? 4.791   -12.982 20.707  1.00 53.17  ? 24  THR A N   1 
ATOM   194  C  CA  . THR A 1 27 ? 3.825   -12.911 21.800  1.00 48.09  ? 24  THR A CA  1 
ATOM   195  C  C   . THR A 1 27 ? 2.866   -11.719 21.733  1.00 49.41  ? 24  THR A C   1 
ATOM   196  O  O   . THR A 1 27 ? 1.825   -11.727 22.392  1.00 53.78  ? 24  THR A O   1 
ATOM   197  C  CB  . THR A 1 27 ? 4.551   -12.866 23.155  1.00 57.18  ? 24  THR A CB  1 
ATOM   198  O  OG1 . THR A 1 27 ? 5.462   -11.759 23.179  1.00 56.64  ? 24  THR A OG1 1 
ATOM   199  C  CG2 . THR A 1 27 ? 5.318   -14.159 23.390  1.00 58.39  ? 24  THR A CG2 1 
ATOM   200  N  N   . ASP A 1 28 ? 3.211   -10.699 20.950  1.00 58.18  ? 25  ASP A N   1 
ATOM   201  C  CA  . ASP A 1 28 ? 2.364   -9.512  20.822  1.00 52.60  ? 25  ASP A CA  1 
ATOM   202  C  C   . ASP A 1 28 ? 1.517   -9.548  19.547  1.00 48.25  ? 25  ASP A C   1 
ATOM   203  O  O   . ASP A 1 28 ? 0.928   -8.538  19.160  1.00 48.30  ? 25  ASP A O   1 
ATOM   204  C  CB  . ASP A 1 28 ? 3.218   -8.238  20.844  1.00 56.08  ? 25  ASP A CB  1 
ATOM   205  C  CG  . ASP A 1 28 ? 3.903   -8.015  22.183  1.00 61.21  ? 25  ASP A CG  1 
ATOM   206  O  OD1 . ASP A 1 28 ? 3.490   -8.644  23.180  1.00 64.26  ? 25  ASP A OD1 1 
ATOM   207  O  OD2 . ASP A 1 28 ? 4.850   -7.203  22.242  1.00 62.80  ? 25  ASP A OD2 1 
ATOM   208  N  N   . THR A 1 29 ? 1.461   -10.712 18.902  1.00 39.59  ? 26  THR A N   1 
ATOM   209  C  CA  . THR A 1 29 ? 0.662   -10.893 17.691  1.00 43.82  ? 26  THR A CA  1 
ATOM   210  C  C   . THR A 1 29 ? 0.120   -12.314 17.600  1.00 37.16  ? 26  THR A C   1 
ATOM   211  O  O   . THR A 1 29 ? 0.667   -13.233 18.207  1.00 36.57  ? 26  THR A O   1 
ATOM   212  C  CB  . THR A 1 29 ? 1.475   -10.609 16.407  1.00 39.53  ? 26  THR A CB  1 
ATOM   213  O  OG1 . THR A 1 29 ? 2.578   -11.521 16.320  1.00 41.58  ? 26  THR A OG1 1 
ATOM   214  C  CG2 . THR A 1 29 ? 1.991   -9.177  16.381  1.00 40.00  ? 26  THR A CG2 1 
ATOM   215  N  N   . LEU A 1 30 ? -0.953  -12.484 16.833  1.00 37.98  ? 27  LEU A N   1 
ATOM   216  C  CA  . LEU A 1 30 ? -1.504  -13.805 16.549  1.00 35.70  ? 27  LEU A CA  1 
ATOM   217  C  C   . LEU A 1 30 ? -0.994  -14.312 15.206  1.00 45.86  ? 27  LEU A C   1 
ATOM   218  O  O   . LEU A 1 30 ? -1.086  -13.615 14.194  1.00 32.94  ? 27  LEU A O   1 
ATOM   219  C  CB  . LEU A 1 30 ? -3.035  -13.772 16.536  1.00 41.84  ? 27  LEU A CB  1 
ATOM   220  C  CG  . LEU A 1 30 ? -3.748  -13.353 17.821  1.00 37.20  ? 27  LEU A CG  1 
ATOM   221  C  CD1 . LEU A 1 30 ? -5.157  -12.865 17.506  1.00 25.75  ? 27  LEU A CD1 1 
ATOM   222  C  CD2 . LEU A 1 30 ? -3.789  -14.509 18.803  1.00 30.56  ? 27  LEU A CD2 1 
ATOM   223  N  N   . SER A 1 31 ? -0.451  -15.524 15.202  1.00 51.20  ? 28  SER A N   1 
ATOM   224  C  CA  . SER A 1 31 ? -0.082  -16.184 13.959  1.00 45.09  ? 28  SER A CA  1 
ATOM   225  C  C   . SER A 1 31 ? -1.336  -16.787 13.350  1.00 43.77  ? 28  SER A C   1 
ATOM   226  O  O   . SER A 1 31 ? -2.417  -16.704 13.934  1.00 40.45  ? 28  SER A O   1 
ATOM   227  C  CB  . SER A 1 31 ? 0.971   -17.265 14.199  1.00 45.45  ? 28  SER A CB  1 
ATOM   228  O  OG  . SER A 1 31 ? 0.424   -18.343 14.936  1.00 54.16  ? 28  SER A OG  1 
ATOM   229  N  N   . LYS A 1 32 ? -1.192  -17.401 12.182  1.00 37.46  ? 29  LYS A N   1 
ATOM   230  C  CA  . LYS A 1 32 ? -2.331  -17.988 11.493  1.00 43.71  ? 29  LYS A CA  1 
ATOM   231  C  C   . LYS A 1 32 ? -2.968  -19.087 12.338  1.00 50.02  ? 29  LYS A C   1 
ATOM   232  O  O   . LYS A 1 32 ? -4.188  -19.138 12.489  1.00 52.05  ? 29  LYS A O   1 
ATOM   233  C  CB  . LYS A 1 32 ? -1.905  -18.550 10.138  1.00 44.76  ? 29  LYS A CB  1 
ATOM   234  C  CG  . LYS A 1 32 ? -3.069  -18.917 9.236   1.00 40.64  ? 29  LYS A CG  1 
ATOM   235  C  CD  . LYS A 1 32 ? -2.592  -19.596 7.966   1.00 47.97  ? 29  LYS A CD  1 
ATOM   236  C  CE  . LYS A 1 32 ? -3.613  -19.466 6.856   1.00 52.15  ? 29  LYS A CE  1 
ATOM   237  N  NZ  . LYS A 1 32 ? -3.706  -18.061 6.376   1.00 59.61  ? 29  LYS A NZ  1 
ATOM   238  N  N   . LYS A 1 33 ? -2.134  -19.960 12.894  1.00 45.69  ? 30  LYS A N   1 
ATOM   239  C  CA  . LYS A 1 33 ? -2.623  -21.083 13.685  1.00 47.47  ? 30  LYS A CA  1 
ATOM   240  C  C   . LYS A 1 33 ? -3.251  -20.608 14.993  1.00 44.14  ? 30  LYS A C   1 
ATOM   241  O  O   . LYS A 1 33 ? -4.245  -21.168 15.455  1.00 43.96  ? 30  LYS A O   1 
ATOM   242  C  CB  . LYS A 1 33 ? -1.488  -22.069 13.972  1.00 63.93  ? 30  LYS A CB  1 
ATOM   243  C  CG  . LYS A 1 33 ? -1.940  -23.317 14.710  1.00 77.57  ? 30  LYS A CG  1 
ATOM   244  C  CD  . LYS A 1 33 ? -0.937  -24.454 14.572  1.00 81.00  ? 30  LYS A CD  1 
ATOM   245  C  CE  . LYS A 1 33 ? -1.494  -25.754 15.132  1.00 81.31  ? 30  LYS A CE  1 
ATOM   246  N  NZ  . LYS A 1 33 ? -2.736  -26.184 14.428  1.00 92.00  ? 30  LYS A NZ  1 
ATOM   247  N  N   . GLU A 1 34 ? -2.674  -19.568 15.581  1.00 41.35  ? 31  GLU A N   1 
ATOM   248  C  CA  . GLU A 1 34 ? -3.173  -19.032 16.840  1.00 42.76  ? 31  GLU A CA  1 
ATOM   249  C  C   . GLU A 1 34 ? -4.530  -18.367 16.652  1.00 36.67  ? 31  GLU A C   1 
ATOM   250  O  O   . GLU A 1 34 ? -5.416  -18.501 17.497  1.00 39.22  ? 31  GLU A O   1 
ATOM   251  C  CB  . GLU A 1 34 ? -2.170  -18.044 17.423  1.00 43.04  ? 31  GLU A CB  1 
ATOM   252  C  CG  . GLU A 1 34 ? -0.873  -18.705 17.850  1.00 40.29  ? 31  GLU A CG  1 
ATOM   253  C  CD  . GLU A 1 34 ? 0.170   -17.709 18.285  1.00 42.29  ? 31  GLU A CD  1 
ATOM   254  O  OE1 . GLU A 1 34 ? 0.002   -16.510 17.989  1.00 38.19  ? 31  GLU A OE1 1 
ATOM   255  O  OE2 . GLU A 1 34 ? 1.155   -18.126 18.927  1.00 57.30  ? 31  GLU A OE2 1 
ATOM   256  N  N   . LEU A 1 35 ? -4.688  -17.657 15.539  1.00 44.60  ? 32  LEU A N   1 
ATOM   257  C  CA  . LEU A 1 35 ? -5.972  -17.063 15.192  1.00 40.05  ? 32  LEU A CA  1 
ATOM   258  C  C   . LEU A 1 35 ? -7.010  -18.162 15.005  1.00 38.93  ? 32  LEU A C   1 
ATOM   259  O  O   . LEU A 1 35 ? -8.111  -18.077 15.542  1.00 42.21  ? 32  LEU A O   1 
ATOM   260  C  CB  . LEU A 1 35 ? -5.861  -16.215 13.921  1.00 42.08  ? 32  LEU A CB  1 
ATOM   261  C  CG  . LEU A 1 35 ? -7.168  -15.605 13.400  1.00 39.74  ? 32  LEU A CG  1 
ATOM   262  C  CD1 . LEU A 1 35 ? -7.827  -14.716 14.447  1.00 40.34  ? 32  LEU A CD1 1 
ATOM   263  C  CD2 . LEU A 1 35 ? -6.918  -14.820 12.127  1.00 34.90  ? 32  LEU A CD2 1 
ATOM   264  N  N   . LYS A 1 36 ? -6.644  -19.195 14.252  1.00 48.47  ? 33  LYS A N   1 
ATOM   265  C  CA  . LYS A 1 36 ? -7.524  -20.339 14.028  1.00 49.33  ? 33  LYS A CA  1 
ATOM   266  C  C   . LYS A 1 36 ? -7.970  -20.949 15.353  1.00 43.59  ? 33  LYS A C   1 
ATOM   267  O  O   . LYS A 1 36 ? -9.148  -21.255 15.536  1.00 46.54  ? 33  LYS A O   1 
ATOM   268  C  CB  . LYS A 1 36 ? -6.824  -21.397 13.172  1.00 46.84  ? 33  LYS A CB  1 
ATOM   269  C  CG  . LYS A 1 36 ? -7.658  -22.647 12.931  1.00 53.48  ? 33  LYS A CG  1 
ATOM   270  C  CD  . LYS A 1 36 ? -6.930  -23.647 12.053  1.00 59.29  ? 33  LYS A CD  1 
ATOM   271  C  CE  . LYS A 1 36 ? -7.910  -24.560 11.342  1.00 63.72  ? 33  LYS A CE  1 
ATOM   272  N  NZ  . LYS A 1 36 ? -8.889  -25.188 12.272  1.00 65.91  ? 33  LYS A NZ  1 
ATOM   273  N  N   . GLU A 1 37 ? -7.020  -21.128 16.265  1.00 46.05  ? 34  GLU A N   1 
ATOM   274  C  CA  . GLU A 1 37 ? -7.324  -21.577 17.619  1.00 42.62  ? 34  GLU A CA  1 
ATOM   275  C  C   . GLU A 1 37 ? -8.365  -20.661 18.257  1.00 45.96  ? 34  GLU A C   1 
ATOM   276  O  O   . GLU A 1 37 ? -9.385  -21.120 18.773  1.00 52.53  ? 34  GLU A O   1 
ATOM   277  C  CB  . GLU A 1 37 ? -6.052  -21.603 18.474  1.00 44.88  ? 34  GLU A CB  1 
ATOM   278  C  CG  . GLU A 1 37 ? -5.572  -22.992 18.882  1.00 50.18  ? 34  GLU A CG  1 
ATOM   279  C  CD  . GLU A 1 37 ? -5.384  -23.134 20.387  1.00 67.68  ? 34  GLU A CD  1 
ATOM   280  O  OE1 . GLU A 1 37 ? -4.368  -23.728 20.804  1.00 74.32  ? 34  GLU A OE1 1 
ATOM   281  O  OE2 . GLU A 1 37 ? -6.252  -22.662 21.154  1.00 48.29  ? 34  GLU A OE2 1 
ATOM   282  N  N   . LEU A 1 38 ? -8.101  -19.360 18.203  1.00 40.89  ? 35  LEU A N   1 
ATOM   283  C  CA  . LEU A 1 38 ? -8.988  -18.357 18.779  1.00 44.29  ? 35  LEU A CA  1 
ATOM   284  C  C   . LEU A 1 38 ? -10.363 -18.388 18.112  1.00 52.82  ? 35  LEU A C   1 
ATOM   285  O  O   . LEU A 1 38 ? -11.394 -18.369 18.789  1.00 54.85  ? 35  LEU A O   1 
ATOM   286  C  CB  . LEU A 1 38 ? -8.358  -16.969 18.641  1.00 49.02  ? 35  LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 38 ? -8.829  -15.876 19.603  1.00 51.08  ? 35  LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 38 ? -7.800  -14.757 19.669  1.00 42.74  ? 35  LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 38 ? -10.176 -15.320 19.190  1.00 50.13  ? 35  LEU A CD2 1 
ATOM   290  N  N   . LEU A 1 39 ? -10.369 -18.442 16.784  1.00 52.86  ? 36  LEU A N   1 
ATOM   291  C  CA  . LEU A 1 39 ? -11.610 -18.480 16.013  1.00 55.83  ? 36  LEU A CA  1 
ATOM   292  C  C   . LEU A 1 39 ? -12.431 -19.738 16.305  1.00 63.88  ? 36  LEU A C   1 
ATOM   293  O  O   . LEU A 1 39 ? -13.628 -19.782 16.025  1.00 74.56  ? 36  LEU A O   1 
ATOM   294  C  CB  . LEU A 1 39 ? -11.311 -18.408 14.511  1.00 60.29  ? 36  LEU A CB  1 
ATOM   295  C  CG  . LEU A 1 39 ? -10.648 -17.146 13.946  1.00 55.98  ? 36  LEU A CG  1 
ATOM   296  C  CD1 . LEU A 1 39 ? -10.407 -17.298 12.449  1.00 59.26  ? 36  LEU A CD1 1 
ATOM   297  C  CD2 . LEU A 1 39 ? -11.471 -15.912 14.233  1.00 53.33  ? 36  LEU A CD2 1 
ATOM   298  N  N   . GLU A 1 40 ? -11.785 -20.757 16.864  1.00 59.09  ? 37  GLU A N   1 
ATOM   299  C  CA  . GLU A 1 40 ? -12.439 -22.043 17.100  1.00 57.96  ? 37  GLU A CA  1 
ATOM   300  C  C   . GLU A 1 40 ? -13.045 -22.157 18.497  1.00 64.35  ? 37  GLU A C   1 
ATOM   301  O  O   . GLU A 1 40 ? -13.869 -23.038 18.743  1.00 67.63  ? 37  GLU A O   1 
ATOM   302  C  CB  . GLU A 1 40 ? -11.442 -23.186 16.879  1.00 62.15  ? 37  GLU A CB  1 
ATOM   303  C  CG  . GLU A 1 40 ? -11.354 -23.662 15.429  1.00 50.01  ? 37  GLU A CG  1 
ATOM   304  C  CD  . GLU A 1 40 ? -10.243 -24.673 15.206  1.00 60.06  ? 37  GLU A CD  1 
ATOM   305  O  OE1 . GLU A 1 40 ? -9.379  -24.823 16.096  1.00 60.72  ? 37  GLU A OE1 1 
ATOM   306  O  OE2 . GLU A 1 40 ? -10.233 -25.319 14.138  1.00 70.19  ? 37  GLU A OE2 1 
ATOM   307  N  N   . LYS A 1 41 ? -12.650 -21.264 19.402  1.00 55.46  ? 38  LYS A N   1 
ATOM   308  C  CA  . LYS A 1 41 ? -13.059 -21.365 20.801  1.00 50.80  ? 38  LYS A CA  1 
ATOM   309  C  C   . LYS A 1 41 ? -13.888 -20.173 21.273  1.00 59.47  ? 38  LYS A C   1 
ATOM   310  O  O   . LYS A 1 41 ? -15.048 -20.330 21.651  1.00 58.73  ? 38  LYS A O   1 
ATOM   311  C  CB  . LYS A 1 41 ? -11.826 -21.516 21.695  1.00 49.96  ? 38  LYS A CB  1 
ATOM   312  C  CG  . LYS A 1 41 ? -10.964 -22.718 21.348  1.00 50.99  ? 38  LYS A CG  1 
ATOM   313  C  CD  . LYS A 1 41 ? -9.809  -22.870 22.322  1.00 56.81  ? 38  LYS A CD  1 
ATOM   314  C  CE  . LYS A 1 41 ? -8.874  -23.997 21.911  1.00 58.09  ? 38  LYS A CE  1 
ATOM   315  N  NZ  . LYS A 1 41 ? -9.562  -25.316 21.857  1.00 63.81  ? 38  LYS A NZ  1 
ATOM   316  N  N   . GLU A 1 42 ? -13.290 -18.986 21.251  1.00 72.82  ? 39  GLU A N   1 
ATOM   317  C  CA  . GLU A 1 42 ? -13.890 -17.809 21.876  1.00 73.66  ? 39  GLU A CA  1 
ATOM   318  C  C   . GLU A 1 42 ? -15.121 -17.287 21.135  1.00 66.79  ? 39  GLU A C   1 
ATOM   319  O  O   . GLU A 1 42 ? -16.011 -16.687 21.740  1.00 67.81  ? 39  GLU A O   1 
ATOM   320  C  CB  . GLU A 1 42 ? -12.848 -16.701 21.989  1.00 61.37  ? 39  GLU A CB  1 
ATOM   321  C  CG  . GLU A 1 42 ? -11.712 -17.037 22.939  1.00 56.01  ? 39  GLU A CG  1 
ATOM   322  C  CD  . GLU A 1 42 ? -12.184 -17.234 24.367  1.00 66.97  ? 39  GLU A CD  1 
ATOM   323  O  OE1 . GLU A 1 42 ? -13.246 -16.681 24.727  1.00 63.63  ? 39  GLU A OE1 1 
ATOM   324  O  OE2 . GLU A 1 42 ? -11.496 -17.947 25.128  1.00 81.61  ? 39  GLU A OE2 1 
ATOM   325  N  N   . PHE A 1 43 ? -15.159 -17.503 19.826  1.00 67.39  ? 40  PHE A N   1 
ATOM   326  C  CA  . PHE A 1 43 ? -16.348 -17.213 19.032  1.00 76.27  ? 40  PHE A CA  1 
ATOM   327  C  C   . PHE A 1 43 ? -16.339 -18.112 17.802  1.00 83.83  ? 40  PHE A C   1 
ATOM   328  O  O   . PHE A 1 43 ? -15.472 -17.997 16.941  1.00 76.90  ? 40  PHE A O   1 
ATOM   329  C  CB  . PHE A 1 43 ? -16.414 -15.732 18.642  1.00 95.27  ? 40  PHE A CB  1 
ATOM   330  C  CG  . PHE A 1 43 ? -15.106 -15.161 18.173  1.00 94.16  ? 40  PHE A CG  1 
ATOM   331  C  CD1 . PHE A 1 43 ? -14.211 -14.620 19.078  1.00 100.32 ? 40  PHE A CD1 1 
ATOM   332  C  CD2 . PHE A 1 43 ? -14.779 -15.149 16.829  1.00 86.89  ? 40  PHE A CD2 1 
ATOM   333  C  CE1 . PHE A 1 43 ? -13.011 -14.087 18.651  1.00 89.85  ? 40  PHE A CE1 1 
ATOM   334  C  CE2 . PHE A 1 43 ? -13.579 -14.620 16.399  1.00 83.28  ? 40  PHE A CE2 1 
ATOM   335  C  CZ  . PHE A 1 43 ? -12.694 -14.088 17.311  1.00 81.85  ? 40  PHE A CZ  1 
ATOM   336  N  N   . ARG A 1 44 ? -17.318 -19.007 17.731  1.00 88.87  ? 41  ARG A N   1 
ATOM   337  C  CA  . ARG A 1 44 ? -17.237 -20.151 16.832  1.00 94.51  ? 41  ARG A CA  1 
ATOM   338  C  C   . ARG A 1 44 ? -18.215 -20.045 15.648  1.00 99.25  ? 41  ARG A C   1 
ATOM   339  O  O   . ARG A 1 44 ? -18.113 -19.114 14.845  1.00 90.95  ? 41  ARG A O   1 
ATOM   340  C  CB  . ARG A 1 44 ? -17.478 -21.424 17.644  1.00 81.33  ? 41  ARG A CB  1 
ATOM   341  C  CG  . ARG A 1 44 ? -16.938 -22.655 16.979  1.00 72.97  ? 41  ARG A CG  1 
ATOM   342  C  CD  . ARG A 1 44 ? -17.693 -23.910 17.342  1.00 67.81  ? 41  ARG A CD  1 
ATOM   343  N  NE  . ARG A 1 44 ? -17.710 -24.823 16.207  1.00 72.31  ? 41  ARG A NE  1 
ATOM   344  C  CZ  . ARG A 1 44 ? -16.632 -25.427 15.717  1.00 76.59  ? 41  ARG A CZ  1 
ATOM   345  N  NH1 . ARG A 1 44 ? -15.439 -25.222 16.264  1.00 59.39  ? 41  ARG A NH1 1 
ATOM   346  N  NH2 . ARG A 1 44 ? -16.748 -26.238 14.675  1.00 76.46  ? 41  ARG A NH2 1 
ATOM   347  N  N   . GLN A 1 45 ? -19.150 -20.992 15.527  1.00 103.86 ? 42  GLN A N   1 
ATOM   348  C  CA  . GLN A 1 45 ? -20.175 -20.949 14.478  1.00 99.46  ? 42  GLN A CA  1 
ATOM   349  C  C   . GLN A 1 45 ? -21.001 -19.672 14.595  1.00 102.65 ? 42  GLN A C   1 
ATOM   350  O  O   . GLN A 1 45 ? -21.769 -19.325 13.698  1.00 101.66 ? 42  GLN A O   1 
ATOM   351  C  CB  . GLN A 1 45 ? -21.069 -22.190 14.549  1.00 95.36  ? 42  GLN A CB  1 
ATOM   352  C  CG  . GLN A 1 45 ? -20.288 -23.502 14.591  1.00 91.78  ? 42  GLN A CG  1 
ATOM   353  C  CD  . GLN A 1 45 ? -20.800 -24.524 13.595  1.00 91.48  ? 42  GLN A CD  1 
ATOM   354  O  OE1 . GLN A 1 45 ? -20.194 -24.743 12.546  1.00 89.77  ? 42  GLN A OE1 1 
ATOM   355  N  NE2 . GLN A 1 45 ? -21.916 -25.162 13.923  1.00 85.89  ? 42  GLN A NE2 1 
ATOM   356  N  N   . ILE A 1 46 ? -20.831 -18.991 15.720  1.00 100.05 ? 43  ILE A N   1 
ATOM   357  C  CA  . ILE A 1 46 ? -21.289 -17.625 15.899  1.00 91.24  ? 43  ILE A CA  1 
ATOM   358  C  C   . ILE A 1 46 ? -20.891 -16.745 14.713  1.00 96.00  ? 43  ILE A C   1 
ATOM   359  O  O   . ILE A 1 46 ? -21.742 -16.095 14.100  1.00 97.93  ? 43  ILE A O   1 
ATOM   360  C  CB  . ILE A 1 46 ? -20.712 -17.033 17.209  1.00 88.78  ? 43  ILE A CB  1 
ATOM   361  C  CG1 . ILE A 1 46 ? -21.591 -17.413 18.400  1.00 85.25  ? 43  ILE A CG1 1 
ATOM   362  C  CG2 . ILE A 1 46 ? -20.603 -15.515 17.143  1.00 89.91  ? 43  ILE A CG2 1 
ATOM   363  C  CD1 . ILE A 1 46 ? -21.808 -18.901 18.575  1.00 74.73  ? 43  ILE A CD1 1 
ATOM   364  N  N   . LEU A 1 47 ? -19.600 -16.747 14.389  1.00 99.23  ? 44  LEU A N   1 
ATOM   365  C  CA  . LEU A 1 47 ? -19.037 -15.811 13.417  1.00 98.50  ? 44  LEU A CA  1 
ATOM   366  C  C   . LEU A 1 47 ? -18.696 -16.444 12.071  1.00 86.31  ? 44  LEU A C   1 
ATOM   367  O  O   . LEU A 1 47 ? -19.449 -16.314 11.104  1.00 88.13  ? 44  LEU A O   1 
ATOM   368  C  CB  . LEU A 1 47 ? -17.780 -15.158 14.005  1.00 89.82  ? 44  LEU A CB  1 
ATOM   369  C  CG  . LEU A 1 47 ? -16.837 -14.397 13.064  1.00 84.07  ? 44  LEU A CG  1 
ATOM   370  C  CD1 . LEU A 1 47 ? -17.576 -13.367 12.218  1.00 73.17  ? 44  LEU A CD1 1 
ATOM   371  C  CD2 . LEU A 1 47 ? -15.741 -13.740 13.876  1.00 73.65  ? 44  LEU A CD2 1 
ATOM   372  N  N   . LYS A 1 48 ? -17.557 -17.123 12.014  1.00 80.74  ? 45  LYS A N   1 
ATOM   373  C  CA  . LYS A 1 48 ? -16.993 -17.570 10.748  1.00 74.60  ? 45  LYS A CA  1 
ATOM   374  C  C   . LYS A 1 48 ? -17.819 -18.674 10.101  1.00 84.27  ? 45  LYS A C   1 
ATOM   375  O  O   . LYS A 1 48 ? -17.599 -19.014 8.937   1.00 88.88  ? 45  LYS A O   1 
ATOM   376  C  CB  . LYS A 1 48 ? -15.557 -18.054 10.963  1.00 69.77  ? 45  LYS A CB  1 
ATOM   377  C  CG  . LYS A 1 48 ? -14.776 -18.278 9.680   1.00 64.77  ? 45  LYS A CG  1 
ATOM   378  C  CD  . LYS A 1 48 ? -13.295 -18.470 9.949   1.00 61.44  ? 45  LYS A CD  1 
ATOM   379  C  CE  . LYS A 1 48 ? -13.036 -19.640 10.883  1.00 76.78  ? 45  LYS A CE  1 
ATOM   380  N  NZ  . LYS A 1 48 ? -11.621 -20.101 10.817  1.00 80.44  ? 45  LYS A NZ  1 
ATOM   381  N  N   . ASN A 1 49 ? -18.780 -19.213 10.848  1.00 90.40  ? 46  ASN A N   1 
ATOM   382  C  CA  . ASN A 1 49 ? -19.492 -20.412 10.425  1.00 99.56  ? 46  ASN A CA  1 
ATOM   383  C  C   . ASN A 1 49 ? -18.454 -21.457 10.039  1.00 104.77 ? 46  ASN A C   1 
ATOM   384  O  O   . ASN A 1 49 ? -18.449 -21.949 8.911   1.00 105.20 ? 46  ASN A O   1 
ATOM   385  C  CB  . ASN A 1 49 ? -20.436 -20.106 9.259   1.00 100.09 ? 46  ASN A CB  1 
ATOM   386  C  CG  . ASN A 1 49 ? -21.289 -21.297 8.866   1.00 102.78 ? 46  ASN A CG  1 
ATOM   387  O  OD1 . ASN A 1 49 ? -21.626 -22.140 9.698   1.00 107.40 ? 46  ASN A OD1 1 
ATOM   388  N  ND2 . ASN A 1 49 ? -21.640 -21.372 7.588   1.00 95.19  ? 46  ASN A ND2 1 
ATOM   389  N  N   . PRO A 1 50 ? -17.552 -21.782 10.982  1.00 106.28 ? 47  PRO A N   1 
ATOM   390  C  CA  . PRO A 1 50 ? -16.310 -22.471 10.632  1.00 104.93 ? 47  PRO A CA  1 
ATOM   391  C  C   . PRO A 1 50 ? -16.472 -23.798 9.905   1.00 103.74 ? 47  PRO A C   1 
ATOM   392  O  O   . PRO A 1 50 ? -16.806 -24.825 10.497  1.00 98.02  ? 47  PRO A O   1 
ATOM   393  C  CB  . PRO A 1 50 ? -15.640 -22.695 11.997  1.00 94.48  ? 47  PRO A CB  1 
ATOM   394  C  CG  . PRO A 1 50 ? -16.225 -21.688 12.883  1.00 87.52  ? 47  PRO A CG  1 
ATOM   395  C  CD  . PRO A 1 50 ? -17.632 -21.531 12.430  1.00 94.56  ? 47  PRO A CD  1 
ATOM   396  N  N   . ASP A 1 51 ? -16.244 -23.749 8.599   1.00 100.47 ? 48  ASP A N   1 
ATOM   397  C  CA  . ASP A 1 51 ? -15.627 -24.866 7.909   1.00 104.99 ? 48  ASP A CA  1 
ATOM   398  C  C   . ASP A 1 51 ? -14.155 -24.706 8.267   1.00 101.66 ? 48  ASP A C   1 
ATOM   399  O  O   . ASP A 1 51 ? -13.317 -24.457 7.405   1.00 100.53 ? 48  ASP A O   1 
ATOM   400  C  CB  . ASP A 1 51 ? -15.869 -24.831 6.396   1.00 107.84 ? 48  ASP A CB  1 
ATOM   401  C  CG  . ASP A 1 51 ? -15.693 -23.444 5.803   1.00 114.02 ? 48  ASP A CG  1 
ATOM   402  O  OD1 . ASP A 1 51 ? -15.269 -22.527 6.540   1.00 109.11 ? 48  ASP A OD1 1 
ATOM   403  O  OD2 . ASP A 1 51 ? -15.976 -23.271 4.598   1.00 115.53 ? 48  ASP A OD2 1 
ATOM   404  N  N   . ASP A 1 52 ? -13.867 -24.840 9.562   1.00 99.81  ? 49  ASP A N   1 
ATOM   405  C  CA  . ASP A 1 52 ? -12.637 -24.321 10.157  1.00 92.85  ? 49  ASP A CA  1 
ATOM   406  C  C   . ASP A 1 52 ? -11.351 -24.746 9.441   1.00 92.19  ? 49  ASP A C   1 
ATOM   407  O  O   . ASP A 1 52 ? -10.406 -23.966 9.386   1.00 95.29  ? 49  ASP A O   1 
ATOM   408  C  CB  . ASP A 1 52 ? -12.561 -24.706 11.647  1.00 84.15  ? 49  ASP A CB  1 
ATOM   409  C  CG  . ASP A 1 52 ? -12.852 -26.173 11.900  1.00 90.03  ? 49  ASP A CG  1 
ATOM   410  O  OD1 . ASP A 1 52 ? -14.039 -26.563 11.861  1.00 97.85  ? 49  ASP A OD1 1 
ATOM   411  O  OD2 . ASP A 1 52 ? -11.896 -26.932 12.166  1.00 80.76  ? 49  ASP A OD2 1 
ATOM   412  N  N   . PRO A 1 53 ? -11.301 -25.965 8.875   1.00 96.50  ? 50  PRO A N   1 
ATOM   413  C  CA  . PRO A 1 53 ? -10.066 -26.215 8.121   1.00 100.87 ? 50  PRO A CA  1 
ATOM   414  C  C   . PRO A 1 53 ? -9.936  -25.370 6.851   1.00 99.22  ? 50  PRO A C   1 
ATOM   415  O  O   . PRO A 1 53 ? -8.831  -25.224 6.332   1.00 102.49 ? 50  PRO A O   1 
ATOM   416  C  CB  . PRO A 1 53 ? -10.170 -27.705 7.768   1.00 89.61  ? 50  PRO A CB  1 
ATOM   417  C  CG  . PRO A 1 53 ? -11.617 -28.024 7.858   1.00 89.34  ? 50  PRO A CG  1 
ATOM   418  C  CD  . PRO A 1 53 ? -12.131 -27.179 8.969   1.00 92.27  ? 50  PRO A CD  1 
ATOM   419  N  N   . ASP A 1 54 ? -11.044 -24.806 6.379   1.00 96.18  ? 51  ASP A N   1 
ATOM   420  C  CA  . ASP A 1 54 ? -11.083 -24.154 5.071   1.00 89.33  ? 51  ASP A CA  1 
ATOM   421  C  C   . ASP A 1 54 ? -10.841 -22.642 5.109   1.00 87.61  ? 51  ASP A C   1 
ATOM   422  O  O   . ASP A 1 54 ? -9.892  -22.149 4.498   1.00 82.32  ? 51  ASP A O   1 
ATOM   423  C  CB  . ASP A 1 54 ? -12.435 -24.428 4.399   1.00 93.71  ? 51  ASP A CB  1 
ATOM   424  C  CG  . ASP A 1 54 ? -12.489 -23.931 2.964   1.00 85.74  ? 51  ASP A CG  1 
ATOM   425  O  OD1 . ASP A 1 54 ? -11.443 -23.953 2.282   1.00 87.78  ? 51  ASP A OD1 1 
ATOM   426  O  OD2 . ASP A 1 54 ? -13.581 -23.520 2.518   1.00 75.98  ? 51  ASP A OD2 1 
ATOM   427  N  N   . MET A 1 55 ? -11.694 -21.914 5.827   1.00 89.53  ? 52  MET A N   1 
ATOM   428  C  CA  . MET A 1 55 ? -11.777 -20.459 5.681   1.00 80.08  ? 52  MET A CA  1 
ATOM   429  C  C   . MET A 1 55 ? -11.022 -19.657 6.746   1.00 70.07  ? 52  MET A C   1 
ATOM   430  O  O   . MET A 1 55 ? -11.464 -18.577 7.135   1.00 66.33  ? 52  MET A O   1 
ATOM   431  C  CB  . MET A 1 55 ? -13.248 -20.031 5.685   1.00 89.98  ? 52  MET A CB  1 
ATOM   432  C  CG  . MET A 1 55 ? -14.055 -20.593 4.530   1.00 90.54  ? 52  MET A CG  1 
ATOM   433  S  SD  . MET A 1 55 ? -15.792 -20.116 4.605   1.00 110.53 ? 52  MET A SD  1 
ATOM   434  C  CE  . MET A 1 55 ? -15.916 -19.050 3.170   1.00 84.21  ? 52  MET A CE  1 
ATOM   435  N  N   . VAL A 1 56 ? -9.886  -20.167 7.206   1.00 73.85  ? 53  VAL A N   1 
ATOM   436  C  CA  . VAL A 1 56 ? -9.028  -19.398 8.105   1.00 68.60  ? 53  VAL A CA  1 
ATOM   437  C  C   . VAL A 1 56 ? -8.279  -18.320 7.331   1.00 56.37  ? 53  VAL A C   1 
ATOM   438  O  O   . VAL A 1 56 ? -8.071  -17.212 7.827   1.00 51.36  ? 53  VAL A O   1 
ATOM   439  C  CB  . VAL A 1 56 ? -7.999  -20.291 8.824   1.00 68.27  ? 53  VAL A CB  1 
ATOM   440  C  CG1 . VAL A 1 56 ? -7.041  -19.443 9.663   1.00 56.17  ? 53  VAL A CG1 1 
ATOM   441  C  CG2 . VAL A 1 56 ? -8.697  -21.312 9.692   1.00 80.06  ? 53  VAL A CG2 1 
ATOM   442  N  N   . ASP A 1 57 ? -7.871  -18.664 6.115   1.00 56.55  ? 54  ASP A N   1 
ATOM   443  C  CA  . ASP A 1 57 ? -7.044  -17.791 5.293   1.00 60.97  ? 54  ASP A CA  1 
ATOM   444  C  C   . ASP A 1 57 ? -7.725  -16.472 4.950   1.00 52.88  ? 54  ASP A C   1 
ATOM   445  O  O   . ASP A 1 57 ? -7.105  -15.412 5.032   1.00 45.05  ? 54  ASP A O   1 
ATOM   446  C  CB  . ASP A 1 57 ? -6.653  -18.513 4.004   1.00 67.09  ? 54  ASP A CB  1 
ATOM   447  C  CG  . ASP A 1 57 ? -5.678  -19.645 4.245   1.00 70.38  ? 54  ASP A CG  1 
ATOM   448  O  OD1 . ASP A 1 57 ? -6.109  -20.707 4.742   1.00 81.01  ? 54  ASP A OD1 1 
ATOM   449  O  OD2 . ASP A 1 57 ? -4.481  -19.475 3.931   1.00 69.25  ? 54  ASP A OD2 1 
ATOM   450  N  N   . VAL A 1 58 ? -8.990  -16.538 4.550   1.00 52.46  ? 55  VAL A N   1 
ATOM   451  C  CA  . VAL A 1 58 ? -9.727  -15.336 4.177   1.00 56.39  ? 55  VAL A CA  1 
ATOM   452  C  C   . VAL A 1 58 ? -9.816  -14.368 5.351   1.00 49.48  ? 55  VAL A C   1 
ATOM   453  O  O   . VAL A 1 58 ? -9.744  -13.152 5.171   1.00 48.93  ? 55  VAL A O   1 
ATOM   454  C  CB  . VAL A 1 58 ? -11.156 -15.665 3.684   1.00 62.90  ? 55  VAL A CB  1 
ATOM   455  C  CG1 . VAL A 1 58 ? -11.931 -16.460 4.733   1.00 69.24  ? 55  VAL A CG1 1 
ATOM   456  C  CG2 . VAL A 1 58 ? -11.902 -14.385 3.317   1.00 54.40  ? 55  VAL A CG2 1 
ATOM   457  N  N   . PHE A 1 59 ? -9.966  -14.914 6.553   1.00 54.18  ? 56  PHE A N   1 
ATOM   458  C  CA  . PHE A 1 59 ? -10.128 -14.092 7.742   1.00 44.31  ? 56  PHE A CA  1 
ATOM   459  C  C   . PHE A 1 59 ? -8.803  -13.461 8.148   1.00 43.60  ? 56  PHE A C   1 
ATOM   460  O  O   . PHE A 1 59 ? -8.765  -12.320 8.604   1.00 40.95  ? 56  PHE A O   1 
ATOM   461  C  CB  . PHE A 1 59 ? -10.695 -14.918 8.894   1.00 49.93  ? 56  PHE A CB  1 
ATOM   462  C  CG  . PHE A 1 59 ? -11.790 -14.224 9.641   1.00 40.93  ? 56  PHE A CG  1 
ATOM   463  C  CD1 . PHE A 1 59 ? -13.065 -14.155 9.108   1.00 54.16  ? 56  PHE A CD1 1 
ATOM   464  C  CD2 . PHE A 1 59 ? -11.547 -13.631 10.866  1.00 45.58  ? 56  PHE A CD2 1 
ATOM   465  C  CE1 . PHE A 1 59 ? -14.079 -13.513 9.784   1.00 50.78  ? 56  PHE A CE1 1 
ATOM   466  C  CE2 . PHE A 1 59 ? -12.558 -12.986 11.548  1.00 50.33  ? 56  PHE A CE2 1 
ATOM   467  C  CZ  . PHE A 1 59 ? -13.825 -12.927 11.004  1.00 59.25  ? 56  PHE A CZ  1 
ATOM   468  N  N   . MET A 1 60 ? -7.720  -14.210 7.977   1.00 36.83  ? 57  MET A N   1 
ATOM   469  C  CA  . MET A 1 60 ? -6.385  -13.695 8.244   1.00 40.82  ? 57  MET A CA  1 
ATOM   470  C  C   . MET A 1 60 ? -6.110  -12.454 7.390   1.00 45.38  ? 57  MET A C   1 
ATOM   471  O  O   . MET A 1 60 ? -5.523  -11.483 7.864   1.00 39.06  ? 57  MET A O   1 
ATOM   472  C  CB  . MET A 1 60 ? -5.337  -14.776 7.969   1.00 48.96  ? 57  MET A CB  1 
ATOM   473  C  CG  . MET A 1 60 ? -3.916  -14.397 8.353   1.00 41.99  ? 57  MET A CG  1 
ATOM   474  S  SD  . MET A 1 60 ? -3.666  -14.369 10.133  1.00 49.58  ? 57  MET A SD  1 
ATOM   475  C  CE  . MET A 1 60 ? -1.909  -14.036 10.225  1.00 44.12  ? 57  MET A CE  1 
ATOM   476  N  N   . ASP A 1 61 ? -6.553  -12.489 6.134   1.00 34.42  ? 58  ASP A N   1 
ATOM   477  C  CA  . ASP A 1 61 ? -6.323  -11.385 5.203   1.00 39.16  ? 58  ASP A CA  1 
ATOM   478  C  C   . ASP A 1 61 ? -7.225  -10.189 5.496   1.00 33.11  ? 58  ASP A C   1 
ATOM   479  O  O   . ASP A 1 61 ? -6.857  -9.047  5.221   1.00 37.13  ? 58  ASP A O   1 
ATOM   480  C  CB  . ASP A 1 61 ? -6.540  -11.845 3.758   1.00 52.71  ? 58  ASP A CB  1 
ATOM   481  C  CG  . ASP A 1 61 ? -5.491  -12.841 3.294   1.00 67.77  ? 58  ASP A CG  1 
ATOM   482  O  OD1 . ASP A 1 61 ? -4.314  -12.701 3.687   1.00 58.45  ? 58  ASP A OD1 1 
ATOM   483  O  OD2 . ASP A 1 61 ? -5.846  -13.763 2.530   1.00 74.32  ? 58  ASP A OD2 1 
ATOM   484  N  N   . HIS A 1 62 ? -8.410  -10.454 6.038   1.00 33.25  ? 59  HIS A N   1 
ATOM   485  C  CA  . HIS A 1 62 ? -9.320  -9.387  6.440   1.00 35.46  ? 59  HIS A CA  1 
ATOM   486  C  C   . HIS A 1 62 ? -8.703  -8.538  7.548   1.00 28.94  ? 59  HIS A C   1 
ATOM   487  O  O   . HIS A 1 62 ? -8.724  -7.308  7.486   1.00 27.15  ? 59  HIS A O   1 
ATOM   488  C  CB  . HIS A 1 62 ? -10.657 -9.962  6.915   1.00 40.26  ? 59  HIS A CB  1 
ATOM   489  C  CG  . HIS A 1 62 ? -11.577 -10.367 5.802   1.00 40.69  ? 59  HIS A CG  1 
ATOM   490  N  ND1 . HIS A 1 62 ? -11.223 -10.285 4.475   1.00 42.93  ? 59  HIS A ND1 1 
ATOM   491  C  CD2 . HIS A 1 62 ? -12.840 -10.854 5.827   1.00 44.56  ? 59  HIS A CD2 1 
ATOM   492  C  CE1 . HIS A 1 62 ? -12.228 -10.707 3.726   1.00 36.94  ? 59  HIS A CE1 1 
ATOM   493  N  NE2 . HIS A 1 62 ? -13.221 -11.057 4.523   1.00 33.66  ? 59  HIS A NE2 1 
ATOM   494  N  N   . LEU A 1 63 ? -8.148  -9.206  8.555   1.00 24.59  ? 60  LEU A N   1 
ATOM   495  C  CA  . LEU A 1 63 ? -7.611  -8.534  9.736   1.00 32.90  ? 60  LEU A CA  1 
ATOM   496  C  C   . LEU A 1 63 ? -6.205  -7.982  9.519   1.00 27.45  ? 60  LEU A C   1 
ATOM   497  O  O   . LEU A 1 63 ? -5.841  -6.953  10.086  1.00 29.14  ? 60  LEU A O   1 
ATOM   498  C  CB  . LEU A 1 63 ? -7.590  -9.497  10.926  1.00 35.93  ? 60  LEU A CB  1 
ATOM   499  C  CG  . LEU A 1 63 ? -8.888  -9.674  11.716  1.00 35.03  ? 60  LEU A CG  1 
ATOM   500  C  CD1 . LEU A 1 63 ? -10.046 -10.068 10.814  1.00 38.38  ? 60  LEU A CD1 1 
ATOM   501  C  CD2 . LEU A 1 63 ? -8.685  -10.710 12.807  1.00 35.53  ? 60  LEU A CD2 1 
ATOM   502  N  N   . ASP A 1 64 ? -5.417  -8.680  8.710   1.00 28.42  ? 61  ASP A N   1 
ATOM   503  C  CA  . ASP A 1 64 ? -4.020  -8.322  8.498   1.00 31.58  ? 61  ASP A CA  1 
ATOM   504  C  C   . ASP A 1 64 ? -3.886  -7.166  7.508   1.00 31.72  ? 61  ASP A C   1 
ATOM   505  O  O   . ASP A 1 64 ? -3.532  -7.371  6.349   1.00 37.35  ? 61  ASP A O   1 
ATOM   506  C  CB  . ASP A 1 64 ? -3.241  -9.542  8.001   1.00 30.06  ? 61  ASP A CB  1 
ATOM   507  C  CG  . ASP A 1 64 ? -1.748  -9.300  7.950   1.00 40.09  ? 61  ASP A CG  1 
ATOM   508  O  OD1 . ASP A 1 64 ? -1.265  -8.393  8.661   1.00 32.21  ? 61  ASP A OD1 1 
ATOM   509  O  OD2 . ASP A 1 64 ? -1.057  -10.026 7.207   1.00 41.95  ? 61  ASP A OD2 1 
ATOM   510  N  N   . ILE A 1 65 ? -4.150  -5.950  7.978   1.00 33.52  ? 62  ILE A N   1 
ATOM   511  C  CA  . ILE A 1 65 ? -4.258  -4.794  7.090   1.00 33.95  ? 62  ILE A CA  1 
ATOM   512  C  C   . ILE A 1 65 ? -2.923  -4.102  6.809   1.00 29.27  ? 62  ILE A C   1 
ATOM   513  O  O   . ILE A 1 65 ? -2.869  -3.172  6.006   1.00 32.70  ? 62  ILE A O   1 
ATOM   514  C  CB  . ILE A 1 65 ? -5.245  -3.754  7.660   1.00 31.90  ? 62  ILE A CB  1 
ATOM   515  C  CG1 . ILE A 1 65 ? -4.765  -3.227  9.015   1.00 23.38  ? 62  ILE A CG1 1 
ATOM   516  C  CG2 . ILE A 1 65 ? -6.632  -4.371  7.785   1.00 22.05  ? 62  ILE A CG2 1 
ATOM   517  C  CD1 . ILE A 1 65 ? -5.601  -2.092  9.560   1.00 31.44  ? 62  ILE A CD1 1 
ATOM   518  N  N   . ASP A 1 66 ? -1.854  -4.545  7.468   1.00 37.17  ? 63  ASP A N   1 
ATOM   519  C  CA  . ASP A 1 66 ? -0.504  -4.091  7.122   1.00 32.01  ? 63  ASP A CA  1 
ATOM   520  C  C   . ASP A 1 66 ? 0.259   -5.186  6.371   1.00 33.97  ? 63  ASP A C   1 
ATOM   521  O  O   . ASP A 1 66 ? 1.376   -4.970  5.902   1.00 39.17  ? 63  ASP A O   1 
ATOM   522  C  CB  . ASP A 1 66 ? 0.271   -3.657  8.372   1.00 33.94  ? 63  ASP A CB  1 
ATOM   523  C  CG  . ASP A 1 66 ? 0.388   -4.756  9.412   1.00 30.20  ? 63  ASP A CG  1 
ATOM   524  O  OD1 . ASP A 1 66 ? 0.117   -5.930  9.092   1.00 34.19  ? 63  ASP A OD1 1 
ATOM   525  O  OD2 . ASP A 1 66 ? 0.765   -4.440  10.558  1.00 34.54  ? 63  ASP A OD2 1 
ATOM   526  N  N   . HIS A 1 67 ? -0.354  -6.363  6.275   1.00 37.24  ? 64  HIS A N   1 
ATOM   527  C  CA  . HIS A 1 67 ? 0.179   -7.468  5.483   1.00 39.81  ? 64  HIS A CA  1 
ATOM   528  C  C   . HIS A 1 67 ? 1.560   -7.942  5.945   1.00 43.27  ? 64  HIS A C   1 
ATOM   529  O  O   . HIS A 1 67 ? 2.513   -7.940  5.164   1.00 50.66  ? 64  HIS A O   1 
ATOM   530  C  CB  . HIS A 1 67 ? 0.244   -7.062  4.008   1.00 48.43  ? 64  HIS A CB  1 
ATOM   531  C  CG  . HIS A 1 67 ? -1.049  -6.533  3.471   1.00 40.03  ? 64  HIS A CG  1 
ATOM   532  N  ND1 . HIS A 1 67 ? -1.270  -5.190  3.249   1.00 44.10  ? 64  HIS A ND1 1 
ATOM   533  C  CD2 . HIS A 1 67 ? -2.187  -7.167  3.106   1.00 38.90  ? 64  HIS A CD2 1 
ATOM   534  C  CE1 . HIS A 1 67 ? -2.491  -5.021  2.773   1.00 37.95  ? 64  HIS A CE1 1 
ATOM   535  N  NE2 . HIS A 1 67 ? -3.069  -6.205  2.676   1.00 48.59  ? 64  HIS A NE2 1 
ATOM   536  N  N   . ASN A 1 68 ? 1.661   -8.349  7.210   1.00 37.27  ? 65  ASN A N   1 
ATOM   537  C  CA  . ASN A 1 68 ? 2.895   -8.929  7.741   1.00 36.14  ? 65  ASN A CA  1 
ATOM   538  C  C   . ASN A 1 68 ? 2.679   -10.340 8.295   1.00 39.73  ? 65  ASN A C   1 
ATOM   539  O  O   . ASN A 1 68 ? 3.489   -10.836 9.075   1.00 49.36  ? 65  ASN A O   1 
ATOM   540  C  CB  . ASN A 1 68 ? 3.490   -8.024  8.827   1.00 33.87  ? 65  ASN A CB  1 
ATOM   541  C  CG  . ASN A 1 68 ? 2.572   -7.855  10.023  1.00 33.56  ? 65  ASN A CG  1 
ATOM   542  O  OD1 . ASN A 1 68 ? 1.479   -8.418  10.072  1.00 30.65  ? 65  ASN A OD1 1 
ATOM   543  N  ND2 . ASN A 1 68 ? 3.022   -7.079  11.003  1.00 44.49  ? 65  ASN A ND2 1 
ATOM   544  N  N   . LYS A 1 69 ? 1.581   -10.973 7.884   1.00 46.40  ? 66  LYS A N   1 
ATOM   545  C  CA  . LYS A 1 69 ? 1.253   -12.350 8.271   1.00 57.35  ? 66  LYS A CA  1 
ATOM   546  C  C   . LYS A 1 69 ? 1.069   -12.539 9.783   1.00 44.71  ? 66  LYS A C   1 
ATOM   547  O  O   . LYS A 1 69 ? 1.146   -13.660 10.286  1.00 53.46  ? 66  LYS A O   1 
ATOM   548  C  CB  . LYS A 1 69 ? 2.331   -13.318 7.759   1.00 61.14  ? 66  LYS A CB  1 
ATOM   549  C  CG  . LYS A 1 69 ? 2.316   -13.522 6.256   1.00 61.73  ? 66  LYS A CG  1 
ATOM   550  C  CD  . LYS A 1 69 ? 3.246   -14.654 5.823   1.00 85.52  ? 66  LYS A CD  1 
ATOM   551  C  CE  . LYS A 1 69 ? 2.555   -16.017 5.834   1.00 81.95  ? 66  LYS A CE  1 
ATOM   552  N  NZ  . LYS A 1 69 ? 2.357   -16.586 7.199   1.00 61.68  ? 66  LYS A NZ  1 
ATOM   553  N  N   . LYS A 1 70 ? 0.815   -11.447 10.497  1.00 39.31  ? 67  LYS A N   1 
ATOM   554  C  CA  . LYS A 1 70 ? 0.555   -11.509 11.932  1.00 33.13  ? 67  LYS A CA  1 
ATOM   555  C  C   . LYS A 1 70 ? -0.547  -10.530 12.310  1.00 35.71  ? 67  LYS A C   1 
ATOM   556  O  O   . LYS A 1 70 ? -0.703  -9.495  11.672  1.00 34.06  ? 67  LYS A O   1 
ATOM   557  C  CB  . LYS A 1 70 ? 1.825   -11.204 12.726  1.00 42.54  ? 67  LYS A CB  1 
ATOM   558  C  CG  . LYS A 1 70 ? 2.787   -12.379 12.848  1.00 44.88  ? 67  LYS A CG  1 
ATOM   559  C  CD  . LYS A 1 70 ? 4.119   -12.090 12.175  1.00 54.83  ? 67  LYS A CD  1 
ATOM   560  C  CE  . LYS A 1 70 ? 4.903   -10.998 12.894  1.00 53.26  ? 67  LYS A CE  1 
ATOM   561  N  NZ  . LYS A 1 70 ? 5.719   -10.183 11.950  1.00 54.76  ? 67  LYS A NZ  1 
ATOM   562  N  N   . ILE A 1 71 ? -1.311  -10.862 13.347  1.00 33.39  ? 68  ILE A N   1 
ATOM   563  C  CA  . ILE A 1 71 ? -2.413  -10.014 13.786  1.00 30.94  ? 68  ILE A CA  1 
ATOM   564  C  C   . ILE A 1 71 ? -2.097  -9.396  15.140  1.00 32.45  ? 68  ILE A C   1 
ATOM   565  O  O   . ILE A 1 71 ? -2.214  -10.056 16.171  1.00 43.91  ? 68  ILE A O   1 
ATOM   566  C  CB  . ILE A 1 71 ? -3.735  -10.804 13.880  1.00 25.90  ? 68  ILE A CB  1 
ATOM   567  C  CG1 . ILE A 1 71 ? -4.006  -11.564 12.578  1.00 34.15  ? 68  ILE A CG1 1 
ATOM   568  C  CG2 . ILE A 1 71 ? -4.895  -9.876  14.209  1.00 33.03  ? 68  ILE A CG2 1 
ATOM   569  C  CD1 . ILE A 1 71 ? -4.092  -10.686 11.340  1.00 35.94  ? 68  ILE A CD1 1 
ATOM   570  N  N   . ASP A 1 72 ? -1.690  -8.130  15.139  1.00 30.74  ? 69  ASP A N   1 
ATOM   571  C  CA  . ASP A 1 72 ? -1.406  -7.443  16.393  1.00 30.93  ? 69  ASP A CA  1 
ATOM   572  C  C   . ASP A 1 72 ? -2.717  -7.084  17.081  1.00 29.33  ? 69  ASP A C   1 
ATOM   573  O  O   . ASP A 1 72 ? -3.798  -7.317  16.537  1.00 25.48  ? 69  ASP A O   1 
ATOM   574  C  CB  . ASP A 1 72 ? -0.541  -6.195  16.169  1.00 33.32  ? 69  ASP A CB  1 
ATOM   575  C  CG  . ASP A 1 72 ? -1.145  -5.214  15.175  1.00 33.32  ? 69  ASP A CG  1 
ATOM   576  O  OD1 . ASP A 1 72 ? -2.362  -4.939  15.240  1.00 32.80  ? 69  ASP A OD1 1 
ATOM   577  O  OD2 . ASP A 1 72 ? -0.385  -4.702  14.327  1.00 39.59  ? 69  ASP A OD2 1 
ATOM   578  N  N   . PHE A 1 73 ? -2.616  -6.514  18.277  1.00 30.81  ? 70  PHE A N   1 
ATOM   579  C  CA  . PHE A 1 73 ? -3.791  -6.249  19.097  1.00 24.77  ? 70  PHE A CA  1 
ATOM   580  C  C   . PHE A 1 73 ? -4.709  -5.226  18.435  1.00 21.13  ? 70  PHE A C   1 
ATOM   581  O  O   . PHE A 1 73 ? -5.929  -5.367  18.472  1.00 23.70  ? 70  PHE A O   1 
ATOM   582  C  CB  . PHE A 1 73 ? -3.368  -5.767  20.487  1.00 26.24  ? 70  PHE A CB  1 
ATOM   583  C  CG  . PHE A 1 73 ? -4.496  -5.691  21.475  1.00 25.39  ? 70  PHE A CG  1 
ATOM   584  C  CD1 . PHE A 1 73 ? -5.251  -6.815  21.774  1.00 25.35  ? 70  PHE A CD1 1 
ATOM   585  C  CD2 . PHE A 1 73 ? -4.789  -4.501  22.123  1.00 31.49  ? 70  PHE A CD2 1 
ATOM   586  C  CE1 . PHE A 1 73 ? -6.287  -6.751  22.689  1.00 29.86  ? 70  PHE A CE1 1 
ATOM   587  C  CE2 . PHE A 1 73 ? -5.823  -4.432  23.043  1.00 29.59  ? 70  PHE A CE2 1 
ATOM   588  C  CZ  . PHE A 1 73 ? -6.572  -5.558  23.325  1.00 28.56  ? 70  PHE A CZ  1 
ATOM   589  N  N   . THR A 1 74 ? -4.121  -4.208  17.816  1.00 27.90  ? 71  THR A N   1 
ATOM   590  C  CA  . THR A 1 74 ? -4.907  -3.173  17.152  1.00 30.27  ? 71  THR A CA  1 
ATOM   591  C  C   . THR A 1 74 ? -5.791  -3.775  16.064  1.00 23.86  ? 71  THR A C   1 
ATOM   592  O  O   . THR A 1 74 ? -6.993  -3.515  16.018  1.00 22.08  ? 71  THR A O   1 
ATOM   593  C  CB  . THR A 1 74 ? -4.006  -2.089  16.535  1.00 30.65  ? 71  THR A CB  1 
ATOM   594  O  OG1 . THR A 1 74 ? -3.188  -1.513  17.559  1.00 27.66  ? 71  THR A OG1 1 
ATOM   595  C  CG2 . THR A 1 74 ? -4.844  -0.992  15.886  1.00 17.86  ? 71  THR A CG2 1 
ATOM   596  N  N   . GLU A 1 75 ? -5.193  -4.586  15.198  1.00 23.18  ? 72  GLU A N   1 
ATOM   597  C  CA  . GLU A 1 75 ? -5.933  -5.257  14.134  1.00 21.00  ? 72  GLU A CA  1 
ATOM   598  C  C   . GLU A 1 75 ? -7.007  -6.173  14.704  1.00 25.46  ? 72  GLU A C   1 
ATOM   599  O  O   . GLU A 1 75 ? -8.089  -6.313  14.132  1.00 25.68  ? 72  GLU A O   1 
ATOM   600  C  CB  . GLU A 1 75 ? -4.982  -6.060  13.251  1.00 33.01  ? 72  GLU A CB  1 
ATOM   601  C  CG  . GLU A 1 75 ? -4.059  -5.201  12.414  1.00 27.31  ? 72  GLU A CG  1 
ATOM   602  C  CD  . GLU A 1 75 ? -3.017  -6.014  11.681  1.00 25.94  ? 72  GLU A CD  1 
ATOM   603  O  OE1 . GLU A 1 75 ? -2.528  -7.010  12.252  1.00 30.77  ? 72  GLU A OE1 1 
ATOM   604  O  OE2 . GLU A 1 75 ? -2.690  -5.656  10.532  1.00 27.75  ? 72  GLU A OE2 1 
ATOM   605  N  N   . PHE A 1 76 ? -6.698  -6.798  15.834  1.00 28.94  ? 73  PHE A N   1 
ATOM   606  C  CA  . PHE A 1 76 ? -7.662  -7.635  16.532  1.00 29.26  ? 73  PHE A CA  1 
ATOM   607  C  C   . PHE A 1 76 ? -8.826  -6.787  17.033  1.00 25.51  ? 73  PHE A C   1 
ATOM   608  O  O   . PHE A 1 76 ? -9.990  -7.138  16.831  1.00 27.04  ? 73  PHE A O   1 
ATOM   609  C  CB  . PHE A 1 76 ? -6.982  -8.369  17.690  1.00 27.16  ? 73  PHE A CB  1 
ATOM   610  C  CG  . PHE A 1 76 ? -7.930  -9.094  18.592  1.00 26.90  ? 73  PHE A CG  1 
ATOM   611  C  CD1 . PHE A 1 76 ? -8.506  -10.287 18.197  1.00 34.10  ? 73  PHE A CD1 1 
ATOM   612  C  CD2 . PHE A 1 76 ? -8.233  -8.590  19.847  1.00 32.95  ? 73  PHE A CD2 1 
ATOM   613  C  CE1 . PHE A 1 76 ? -9.375  -10.961 19.030  1.00 25.29  ? 73  PHE A CE1 1 
ATOM   614  C  CE2 . PHE A 1 76 ? -9.100  -9.259  20.684  1.00 29.07  ? 73  PHE A CE2 1 
ATOM   615  C  CZ  . PHE A 1 76 ? -9.673  -10.446 20.277  1.00 31.07  ? 73  PHE A CZ  1 
ATOM   616  N  N   . LEU A 1 77 ? -8.508  -5.662  17.667  1.00 21.07  ? 74  LEU A N   1 
ATOM   617  C  CA  . LEU A 1 77 ? -9.528  -4.765  18.202  1.00 23.93  ? 74  LEU A CA  1 
ATOM   618  C  C   . LEU A 1 77 ? -10.488 -4.258  17.126  1.00 23.87  ? 74  LEU A C   1 
ATOM   619  O  O   . LEU A 1 77 ? -11.697 -4.194  17.354  1.00 29.46  ? 74  LEU A O   1 
ATOM   620  C  CB  . LEU A 1 77 ? -8.878  -3.570  18.903  1.00 18.77  ? 74  LEU A CB  1 
ATOM   621  C  CG  . LEU A 1 77 ? -8.264  -3.808  20.286  1.00 23.23  ? 74  LEU A CG  1 
ATOM   622  C  CD1 . LEU A 1 77 ? -7.692  -2.509  20.825  1.00 23.63  ? 74  LEU A CD1 1 
ATOM   623  C  CD2 . LEU A 1 77 ? -9.277  -4.382  21.264  1.00 23.36  ? 74  LEU A CD2 1 
ATOM   624  N  N   . LEU A 1 78 ? -9.954  -3.891  15.963  1.00 31.11  ? 75  LEU A N   1 
ATOM   625  C  CA  . LEU A 1 78 ? -10.786 -3.386  14.875  1.00 26.94  ? 75  LEU A CA  1 
ATOM   626  C  C   . LEU A 1 78 ? -11.900 -4.376  14.548  1.00 25.52  ? 75  LEU A C   1 
ATOM   627  O  O   . LEU A 1 78 ? -13.034 -3.980  14.277  1.00 28.58  ? 75  LEU A O   1 
ATOM   628  C  CB  . LEU A 1 78 ? -9.945  -3.111  13.627  1.00 30.40  ? 75  LEU A CB  1 
ATOM   629  C  CG  . LEU A 1 78 ? -8.927  -1.968  13.690  1.00 33.32  ? 75  LEU A CG  1 
ATOM   630  C  CD1 . LEU A 1 78 ? -8.201  -1.853  12.357  1.00 26.75  ? 75  LEU A CD1 1 
ATOM   631  C  CD2 . LEU A 1 78 ? -9.580  -0.640  14.060  1.00 21.47  ? 75  LEU A CD2 1 
ATOM   632  N  N   . MET A 1 79 ? -11.576 -5.664  14.597  1.00 26.27  ? 76  MET A N   1 
ATOM   633  C  CA  . MET A 1 79 ? -12.558 -6.708  14.332  1.00 33.46  ? 76  MET A CA  1 
ATOM   634  C  C   . MET A 1 79 ? -13.538 -6.834  15.494  1.00 27.02  ? 76  MET A C   1 
ATOM   635  O  O   . MET A 1 79 ? -14.739 -6.993  15.284  1.00 30.60  ? 76  MET A O   1 
ATOM   636  C  CB  . MET A 1 79 ? -11.864 -8.048  14.077  1.00 34.64  ? 76  MET A CB  1 
ATOM   637  C  CG  . MET A 1 79 ? -12.808 -9.153  13.624  1.00 49.82  ? 76  MET A CG  1 
ATOM   638  S  SD  . MET A 1 79 ? -13.155 -10.378 14.899  1.00 59.20  ? 76  MET A SD  1 
ATOM   639  C  CE  . MET A 1 79 ? -11.598 -11.258 14.966  1.00 52.83  ? 76  MET A CE  1 
ATOM   640  N  N   . VAL A 1 80 ? -13.024 -6.760  16.718  1.00 25.18  ? 77  VAL A N   1 
ATOM   641  C  CA  . VAL A 1 80 ? -13.871 -6.852  17.899  1.00 22.57  ? 77  VAL A CA  1 
ATOM   642  C  C   . VAL A 1 80 ? -14.941 -5.764  17.883  1.00 25.82  ? 77  VAL A C   1 
ATOM   643  O  O   . VAL A 1 80 ? -16.112 -6.029  18.148  1.00 27.11  ? 77  VAL A O   1 
ATOM   644  C  CB  . VAL A 1 80 ? -13.048 -6.734  19.197  1.00 28.32  ? 77  VAL A CB  1 
ATOM   645  C  CG1 . VAL A 1 80 ? -13.965 -6.624  20.413  1.00 22.77  ? 77  VAL A CG1 1 
ATOM   646  C  CG2 . VAL A 1 80 ? -12.111 -7.924  19.344  1.00 26.14  ? 77  VAL A CG2 1 
ATOM   647  N  N   . PHE A 1 81 ? -14.538 -4.541  17.566  1.00 23.33  ? 78  PHE A N   1 
ATOM   648  C  CA  . PHE A 1 81 ? -15.460 -3.416  17.623  1.00 34.31  ? 78  PHE A CA  1 
ATOM   649  C  C   . PHE A 1 81 ? -16.348 -3.346  16.382  1.00 29.94  ? 78  PHE A C   1 
ATOM   650  O  O   . PHE A 1 81 ? -17.373 -2.666  16.390  1.00 26.45  ? 78  PHE A O   1 
ATOM   651  C  CB  . PHE A 1 81 ? -14.685 -2.112  17.816  1.00 29.92  ? 78  PHE A CB  1 
ATOM   652  C  CG  . PHE A 1 81 ? -13.990 -2.026  19.146  1.00 36.12  ? 78  PHE A CG  1 
ATOM   653  C  CD1 . PHE A 1 81 ? -14.723 -1.994  20.321  1.00 30.36  ? 78  PHE A CD1 1 
ATOM   654  C  CD2 . PHE A 1 81 ? -12.610 -1.992  19.225  1.00 26.44  ? 78  PHE A CD2 1 
ATOM   655  C  CE1 . PHE A 1 81 ? -14.092 -1.925  21.546  1.00 31.18  ? 78  PHE A CE1 1 
ATOM   656  C  CE2 . PHE A 1 81 ? -11.974 -1.923  20.448  1.00 36.72  ? 78  PHE A CE2 1 
ATOM   657  C  CZ  . PHE A 1 81 ? -12.716 -1.888  21.609  1.00 27.68  ? 78  PHE A CZ  1 
ATOM   658  N  N   . LYS A 1 82 ? -15.967 -4.060  15.326  1.00 34.41  ? 79  LYS A N   1 
ATOM   659  C  CA  . LYS A 1 82 ? -16.846 -4.223  14.171  1.00 34.25  ? 79  LYS A CA  1 
ATOM   660  C  C   . LYS A 1 82 ? -17.997 -5.156  14.514  1.00 30.74  ? 79  LYS A C   1 
ATOM   661  O  O   . LYS A 1 82 ? -19.137 -4.923  14.113  1.00 35.85  ? 79  LYS A O   1 
ATOM   662  C  CB  . LYS A 1 82 ? -16.087 -4.775  12.968  1.00 33.68  ? 79  LYS A CB  1 
ATOM   663  C  CG  . LYS A 1 82 ? -15.589 -3.723  12.003  1.00 34.25  ? 79  LYS A CG  1 
ATOM   664  C  CD  . LYS A 1 82 ? -15.645 -4.248  10.585  1.00 34.00  ? 79  LYS A CD  1 
ATOM   665  C  CE  . LYS A 1 82 ? -14.652 -3.545  9.697   1.00 31.36  ? 79  LYS A CE  1 
ATOM   666  N  NZ  . LYS A 1 82 ? -14.608 -4.167  8.344   1.00 37.58  ? 79  LYS A NZ  1 
ATOM   667  N  N   . LEU A 1 83 ? -17.690 -6.224  15.246  1.00 27.34  ? 80  LEU A N   1 
ATOM   668  C  CA  . LEU A 1 83 ? -18.716 -7.149  15.706  1.00 31.84  ? 80  LEU A CA  1 
ATOM   669  C  C   . LEU A 1 83 ? -19.654 -6.444  16.668  1.00 30.70  ? 80  LEU A C   1 
ATOM   670  O  O   . LEU A 1 83 ? -20.875 -6.555  16.554  1.00 34.44  ? 80  LEU A O   1 
ATOM   671  C  CB  . LEU A 1 83 ? -18.087 -8.368  16.380  1.00 37.01  ? 80  LEU A CB  1 
ATOM   672  C  CG  . LEU A 1 83 ? -17.614 -9.471  15.433  1.00 48.09  ? 80  LEU A CG  1 
ATOM   673  C  CD1 . LEU A 1 83 ? -16.745 -10.472 16.171  1.00 50.35  ? 80  LEU A CD1 1 
ATOM   674  C  CD2 . LEU A 1 83 ? -18.801 -10.173 14.791  1.00 47.56  ? 80  LEU A CD2 1 
ATOM   675  N  N   . ALA A 1 84 ? -19.070 -5.715  17.615  1.00 29.91  ? 81  ALA A N   1 
ATOM   676  C  CA  . ALA A 1 84 ? -19.840 -4.931  18.571  1.00 34.41  ? 81  ALA A CA  1 
ATOM   677  C  C   . ALA A 1 84 ? -20.776 -3.999  17.821  1.00 34.39  ? 81  ALA A C   1 
ATOM   678  O  O   . ALA A 1 84 ? -21.979 -3.958  18.079  1.00 30.73  ? 81  ALA A O   1 
ATOM   679  C  CB  . ALA A 1 84 ? -18.912 -4.137  19.485  1.00 25.34  ? 81  ALA A CB  1 
ATOM   680  N  N   . GLN A 1 85 ? -20.205 -3.270  16.870  1.00 27.01  ? 82  GLN A N   1 
ATOM   681  C  CA  . GLN A 1 85 ? -20.953 -2.317  16.065  1.00 40.76  ? 82  GLN A CA  1 
ATOM   682  C  C   . GLN A 1 85 ? -22.051 -3.022  15.276  1.00 35.41  ? 82  GLN A C   1 
ATOM   683  O  O   . GLN A 1 85 ? -23.124 -2.464  15.054  1.00 41.42  ? 82  GLN A O   1 
ATOM   684  C  CB  . GLN A 1 85 ? -19.999 -1.576  15.125  1.00 35.18  ? 82  GLN A CB  1 
ATOM   685  C  CG  . GLN A 1 85 ? -20.632 -0.469  14.307  1.00 51.45  ? 82  GLN A CG  1 
ATOM   686  C  CD  . GLN A 1 85 ? -19.599 0.341   13.544  1.00 57.15  ? 82  GLN A CD  1 
ATOM   687  O  OE1 . GLN A 1 85 ? -18.397 0.095   13.653  1.00 56.10  ? 82  GLN A OE1 1 
ATOM   688  N  NE2 . GLN A 1 85 ? -20.063 1.314   12.768  1.00 59.66  ? 82  GLN A NE2 1 
ATOM   689  N  N   . ALA A 1 86 ? -21.780 -4.262  14.880  1.00 37.54  ? 83  ALA A N   1 
ATOM   690  C  CA  . ALA A 1 86 ? -22.718 -5.045  14.085  1.00 38.00  ? 83  ALA A CA  1 
ATOM   691  C  C   . ALA A 1 86 ? -23.809 -5.666  14.952  1.00 40.71  ? 83  ALA A C   1 
ATOM   692  O  O   . ALA A 1 86 ? -24.978 -5.660  14.578  1.00 48.32  ? 83  ALA A O   1 
ATOM   693  C  CB  . ALA A 1 86 ? -21.979 -6.128  13.317  1.00 39.90  ? 83  ALA A CB  1 
ATOM   694  N  N   . TYR A 1 87 ? -23.426 -6.207  16.103  1.00 39.82  ? 84  TYR A N   1 
ATOM   695  C  CA  . TYR A 1 87 ? -24.389 -6.823  17.010  1.00 43.79  ? 84  TYR A CA  1 
ATOM   696  C  C   . TYR A 1 87 ? -25.346 -5.797  17.609  1.00 45.80  ? 84  TYR A C   1 
ATOM   697  O  O   . TYR A 1 87 ? -26.467 -6.136  17.988  1.00 40.04  ? 84  TYR A O   1 
ATOM   698  C  CB  . TYR A 1 87 ? -23.668 -7.567  18.137  1.00 40.28  ? 84  TYR A CB  1 
ATOM   699  C  CG  . TYR A 1 87 ? -23.266 -8.977  17.775  1.00 55.10  ? 84  TYR A CG  1 
ATOM   700  C  CD1 . TYR A 1 87 ? -24.218 -9.981  17.662  1.00 56.24  ? 84  TYR A CD1 1 
ATOM   701  C  CD2 . TYR A 1 87 ? -21.936 -9.306  17.553  1.00 50.24  ? 84  TYR A CD2 1 
ATOM   702  C  CE1 . TYR A 1 87 ? -23.858 -11.272 17.332  1.00 58.27  ? 84  TYR A CE1 1 
ATOM   703  C  CE2 . TYR A 1 87 ? -21.567 -10.594 17.222  1.00 54.00  ? 84  TYR A CE2 1 
ATOM   704  C  CZ  . TYR A 1 87 ? -22.532 -11.571 17.115  1.00 57.13  ? 84  TYR A CZ  1 
ATOM   705  O  OH  . TYR A 1 87 ? -22.170 -12.853 16.787  1.00 58.45  ? 84  TYR A OH  1 
ATOM   706  N  N   . TYR A 1 88 ? -24.899 -4.545  17.681  1.00 45.31  ? 85  TYR A N   1 
ATOM   707  C  CA  . TYR A 1 88 ? -25.654 -3.475  18.332  1.00 49.26  ? 85  TYR A CA  1 
ATOM   708  C  C   . TYR A 1 88 ? -27.099 -3.380  17.838  1.00 52.70  ? 85  TYR A C   1 
ATOM   709  O  O   . TYR A 1 88 ? -27.968 -2.862  18.540  1.00 59.77  ? 85  TYR A O   1 
ATOM   710  C  CB  . TYR A 1 88 ? -24.938 -2.139  18.121  1.00 47.69  ? 85  TYR A CB  1 
ATOM   711  C  CG  . TYR A 1 88 ? -25.672 -0.945  18.687  1.00 42.29  ? 85  TYR A CG  1 
ATOM   712  C  CD1 . TYR A 1 88 ? -25.703 -0.707  20.053  1.00 38.37  ? 85  TYR A CD1 1 
ATOM   713  C  CD2 . TYR A 1 88 ? -26.326 -0.051  17.852  1.00 53.44  ? 85  TYR A CD2 1 
ATOM   714  C  CE1 . TYR A 1 88 ? -26.372 0.383   20.572  1.00 44.09  ? 85  TYR A CE1 1 
ATOM   715  C  CE2 . TYR A 1 88 ? -26.996 1.042   18.361  1.00 52.11  ? 85  TYR A CE2 1 
ATOM   716  C  CZ  . TYR A 1 88 ? -27.016 1.255   19.720  1.00 46.98  ? 85  TYR A CZ  1 
ATOM   717  O  OH  . TYR A 1 88 ? -27.685 2.345   20.222  1.00 58.15  ? 85  TYR A OH  1 
ATOM   718  N  N   . GLU A 1 89 ? -27.351 -3.888  16.636  1.00 61.91  ? 86  GLU A N   1 
ATOM   719  C  CA  . GLU A 1 89 ? -28.708 -3.967  16.098  1.00 63.96  ? 86  GLU A CA  1 
ATOM   720  C  C   . GLU A 1 89 ? -29.640 -4.719  17.050  1.00 65.40  ? 86  GLU A C   1 
ATOM   721  O  O   . GLU A 1 89 ? -29.832 -5.927  16.930  1.00 63.10  ? 86  GLU A O   1 
ATOM   722  C  CB  . GLU A 1 89 ? -28.699 -4.639  14.719  1.00 67.55  ? 86  GLU A CB  1 
ATOM   723  C  CG  . GLU A 1 89 ? -27.902 -5.944  14.636  1.00 68.39  ? 86  GLU A CG  1 
ATOM   724  C  CD  . GLU A 1 89 ? -28.778 -7.184  14.594  1.00 84.30  ? 86  GLU A CD  1 
ATOM   725  O  OE1 . GLU A 1 89 ? -29.728 -7.222  13.782  1.00 112.27 ? 86  GLU A OE1 1 
ATOM   726  O  OE2 . GLU A 1 89 ? -28.517 -8.121  15.379  1.00 76.44  ? 86  GLU A OE2 1 
ATOM   727  N  N   . SER A 1 90 ? -30.214 -3.983  17.998  1.00 63.39  ? 87  SER A N   1 
ATOM   728  C  CA  . SER A 1 90 ? -31.138 -4.550  18.977  1.00 55.74  ? 87  SER A CA  1 
ATOM   729  C  C   . SER A 1 90 ? -30.541 -5.764  19.683  1.00 55.91  ? 87  SER A C   1 
ATOM   730  O  O   . SER A 1 90 ? -31.136 -6.310  20.611  1.00 65.20  ? 87  SER A O   1 
ATOM   731  C  CB  . SER A 1 90 ? -32.456 -4.932  18.302  1.00 54.56  ? 87  SER A CB  1 
ATOM   732  O  OG  . SER A 1 90 ? -33.149 -3.779  17.859  1.00 61.09  ? 87  SER A OG  1 
ATOM   733  N  N   . SER B 1 4  ? -15.339 -15.844 31.158  1.00 66.59  ? 1   SER B N   1 
ATOM   734  C  CA  . SER B 1 4  ? -16.254 -15.245 30.143  1.00 72.98  ? 1   SER B CA  1 
ATOM   735  C  C   . SER B 1 4  ? -15.649 -15.318 28.743  1.00 65.00  ? 1   SER B C   1 
ATOM   736  O  O   . SER B 1 4  ? -14.430 -15.385 28.588  1.00 67.54  ? 1   SER B O   1 
ATOM   737  C  CB  . SER B 1 4  ? -16.571 -13.792 30.505  1.00 68.63  ? 1   SER B CB  1 
ATOM   738  O  OG  . SER B 1 4  ? -15.383 -13.036 30.673  1.00 56.02  ? 1   SER B OG  1 
ATOM   739  N  N   . THR B 1 5  ? -16.510 -15.310 27.728  1.00 50.02  ? 2   THR B N   1 
ATOM   740  C  CA  . THR B 1 5  ? -16.070 -15.339 26.335  1.00 51.54  ? 2   THR B CA  1 
ATOM   741  C  C   . THR B 1 5  ? -15.915 -13.928 25.781  1.00 47.82  ? 2   THR B C   1 
ATOM   742  O  O   . THR B 1 5  ? -16.238 -12.947 26.453  1.00 40.33  ? 2   THR B O   1 
ATOM   743  C  CB  . THR B 1 5  ? -17.062 -16.107 25.440  1.00 42.29  ? 2   THR B CB  1 
ATOM   744  O  OG1 . THR B 1 5  ? -18.343 -15.465 25.478  1.00 45.17  ? 2   THR B OG1 1 
ATOM   745  C  CG2 . THR B 1 5  ? -17.203 -17.546 25.902  1.00 56.62  ? 2   THR B CG2 1 
ATOM   746  N  N   . LEU B 1 6  ? -15.420 -13.829 24.553  1.00 38.21  ? 3   LEU B N   1 
ATOM   747  C  CA  . LEU B 1 6  ? -15.321 -12.541 23.885  1.00 42.25  ? 3   LEU B CA  1 
ATOM   748  C  C   . LEU B 1 6  ? -16.711 -11.998 23.596  1.00 40.77  ? 3   LEU B C   1 
ATOM   749  O  O   . LEU B 1 6  ? -16.965 -10.802 23.740  1.00 40.88  ? 3   LEU B O   1 
ATOM   750  C  CB  . LEU B 1 6  ? -14.531 -12.653 22.581  1.00 45.06  ? 3   LEU B CB  1 
ATOM   751  C  CG  . LEU B 1 6  ? -14.271 -11.318 21.879  1.00 43.58  ? 3   LEU B CG  1 
ATOM   752  C  CD1 . LEU B 1 6  ? -13.276 -10.479 22.667  1.00 43.59  ? 3   LEU B CD1 1 
ATOM   753  C  CD2 . LEU B 1 6  ? -13.783 -11.537 20.464  1.00 50.46  ? 3   LEU B CD2 1 
ATOM   754  N  N   . LEU B 1 7  ? -17.610 -12.886 23.188  1.00 35.66  ? 4   LEU B N   1 
ATOM   755  C  CA  . LEU B 1 7  ? -18.945 -12.479 22.773  1.00 41.93  ? 4   LEU B CA  1 
ATOM   756  C  C   . LEU B 1 7  ? -19.759 -11.944 23.950  1.00 39.96  ? 4   LEU B C   1 
ATOM   757  O  O   . LEU B 1 7  ? -20.613 -11.074 23.778  1.00 39.28  ? 4   LEU B O   1 
ATOM   758  C  CB  . LEU B 1 7  ? -19.671 -13.654 22.116  1.00 47.60  ? 4   LEU B CB  1 
ATOM   759  C  CG  . LEU B 1 7  ? -20.805 -13.312 21.146  1.00 47.86  ? 4   LEU B CG  1 
ATOM   760  C  CD1 . LEU B 1 7  ? -20.294 -12.520 19.948  1.00 48.82  ? 4   LEU B CD1 1 
ATOM   761  C  CD2 . LEU B 1 7  ? -21.490 -14.584 20.683  1.00 55.99  ? 4   LEU B CD2 1 
ATOM   762  N  N   . GLU B 1 8  ? -19.491 -12.462 25.144  1.00 40.09  ? 5   GLU B N   1 
ATOM   763  C  CA  . GLU B 1 8  ? -20.141 -11.965 26.351  1.00 41.87  ? 5   GLU B CA  1 
ATOM   764  C  C   . GLU B 1 8  ? -19.655 -10.554 26.678  1.00 37.41  ? 5   GLU B C   1 
ATOM   765  O  O   . GLU B 1 8  ? -20.439 -9.690  27.075  1.00 34.37  ? 5   GLU B O   1 
ATOM   766  C  CB  . GLU B 1 8  ? -19.875 -12.904 27.528  1.00 39.47  ? 5   GLU B CB  1 
ATOM   767  C  CG  . GLU B 1 8  ? -20.512 -14.280 27.379  1.00 60.85  ? 5   GLU B CG  1 
ATOM   768  C  CD  . GLU B 1 8  ? -21.733 -14.464 28.264  1.00 74.97  ? 5   GLU B CD  1 
ATOM   769  O  OE1 . GLU B 1 8  ? -21.613 -14.283 29.494  1.00 88.22  ? 5   GLU B OE1 1 
ATOM   770  O  OE2 . GLU B 1 8  ? -22.814 -14.789 27.729  1.00 77.30  ? 5   GLU B OE2 1 
ATOM   771  N  N   . ASN B 1 9  ? -18.356 -10.329 26.502  1.00 33.88  ? 6   ASN B N   1 
ATOM   772  C  CA  . ASN B 1 9  ? -17.751 -9.026  26.759  1.00 40.71  ? 6   ASN B CA  1 
ATOM   773  C  C   . ASN B 1 9  ? -18.206 -7.969  25.761  1.00 34.90  ? 6   ASN B C   1 
ATOM   774  O  O   . ASN B 1 9  ? -18.413 -6.810  26.122  1.00 29.40  ? 6   ASN B O   1 
ATOM   775  C  CB  . ASN B 1 9  ? -16.226 -9.142  26.730  1.00 29.62  ? 6   ASN B CB  1 
ATOM   776  C  CG  . ASN B 1 9  ? -15.674 -9.824  27.964  1.00 43.70  ? 6   ASN B CG  1 
ATOM   777  O  OD1 . ASN B 1 9  ? -16.015 -9.463  29.091  1.00 29.13  ? 6   ASN B OD1 1 
ATOM   778  N  ND2 . ASN B 1 9  ? -14.823 -10.822 27.758  1.00 48.87  ? 6   ASN B ND2 1 
ATOM   779  N  N   . ILE B 1 10 ? -18.354 -8.372  24.505  1.00 27.70  ? 7   ILE B N   1 
ATOM   780  C  CA  . ILE B 1 10 ? -18.840 -7.468  23.472  1.00 32.25  ? 7   ILE B CA  1 
ATOM   781  C  C   . ILE B 1 10 ? -20.262 -7.025  23.806  1.00 31.76  ? 7   ILE B C   1 
ATOM   782  O  O   . ILE B 1 10 ? -20.585 -5.841  23.735  1.00 24.49  ? 7   ILE B O   1 
ATOM   783  C  CB  . ILE B 1 10 ? -18.796 -8.134  22.081  1.00 31.49  ? 7   ILE B CB  1 
ATOM   784  C  CG1 . ILE B 1 10 ? -17.343 -8.265  21.615  1.00 29.60  ? 7   ILE B CG1 1 
ATOM   785  C  CG2 . ILE B 1 10 ? -19.606 -7.329  21.065  1.00 28.31  ? 7   ILE B CG2 1 
ATOM   786  C  CD1 . ILE B 1 10 ? -17.153 -9.127  20.384  1.00 38.22  ? 7   ILE B CD1 1 
ATOM   787  N  N   . PHE B 1 11 ? -21.107 -7.980  24.179  1.00 33.70  ? 8   PHE B N   1 
ATOM   788  C  CA  . PHE B 1 11 ? -22.492 -7.679  24.524  1.00 43.58  ? 8   PHE B CA  1 
ATOM   789  C  C   . PHE B 1 11 ? -22.599 -6.879  25.821  1.00 43.99  ? 8   PHE B C   1 
ATOM   790  O  O   . PHE B 1 11 ? -23.522 -6.079  25.988  1.00 45.97  ? 8   PHE B O   1 
ATOM   791  C  CB  . PHE B 1 11 ? -23.304 -8.969  24.636  1.00 41.01  ? 8   PHE B CB  1 
ATOM   792  C  CG  . PHE B 1 11 ? -24.027 -9.332  23.373  1.00 46.17  ? 8   PHE B CG  1 
ATOM   793  C  CD1 . PHE B 1 11 ? -25.288 -8.824  23.114  1.00 39.28  ? 8   PHE B CD1 1 
ATOM   794  C  CD2 . PHE B 1 11 ? -23.442 -10.170 22.440  1.00 49.39  ? 8   PHE B CD2 1 
ATOM   795  C  CE1 . PHE B 1 11 ? -25.956 -9.149  21.951  1.00 60.37  ? 8   PHE B CE1 1 
ATOM   796  C  CE2 . PHE B 1 11 ? -24.105 -10.500 21.275  1.00 51.93  ? 8   PHE B CE2 1 
ATOM   797  C  CZ  . PHE B 1 11 ? -25.364 -9.988  21.030  1.00 48.96  ? 8   PHE B CZ  1 
ATOM   798  N  N   . ALA B 1 12 ? -21.662 -7.097  26.738  1.00 33.58  ? 9   ALA B N   1 
ATOM   799  C  CA  . ALA B 1 12 ? -21.616 -6.321  27.972  1.00 33.35  ? 9   ALA B CA  1 
ATOM   800  C  C   . ALA B 1 12 ? -21.369 -4.849  27.653  1.00 31.30  ? 9   ALA B C   1 
ATOM   801  O  O   . ALA B 1 12 ? -21.995 -3.962  28.233  1.00 28.06  ? 9   ALA B O   1 
ATOM   802  C  CB  . ALA B 1 12 ? -20.538 -6.859  28.900  1.00 29.72  ? 9   ALA B CB  1 
ATOM   803  N  N   . ILE B 1 13 ? -20.457 -4.600  26.719  1.00 31.73  ? 10  ILE B N   1 
ATOM   804  C  CA  . ILE B 1 13 ? -20.151 -3.243  26.291  1.00 30.89  ? 10  ILE B CA  1 
ATOM   805  C  C   . ILE B 1 13 ? -21.357 -2.625  25.589  1.00 26.86  ? 10  ILE B C   1 
ATOM   806  O  O   . ILE B 1 13 ? -21.646 -1.443  25.768  1.00 31.51  ? 10  ILE B O   1 
ATOM   807  C  CB  . ILE B 1 13 ? -18.922 -3.215  25.356  1.00 32.36  ? 10  ILE B CB  1 
ATOM   808  C  CG1 . ILE B 1 13 ? -17.668 -3.622  26.133  1.00 30.04  ? 10  ILE B CG1 1 
ATOM   809  C  CG2 . ILE B 1 13 ? -18.720 -1.822  24.753  1.00 27.71  ? 10  ILE B CG2 1 
ATOM   810  C  CD1 . ILE B 1 13 ? -16.465 -3.911  25.261  1.00 25.57  ? 10  ILE B CD1 1 
ATOM   811  N  N   . ILE B 1 14 ? -22.057 -3.428  24.792  1.00 33.92  ? 11  ILE B N   1 
ATOM   812  C  CA  . ILE B 1 14 ? -23.250 -2.965  24.091  1.00 32.53  ? 11  ILE B CA  1 
ATOM   813  C  C   . ILE B 1 14 ? -24.352 -2.588  25.081  1.00 43.28  ? 11  ILE B C   1 
ATOM   814  O  O   . ILE B 1 14 ? -24.956 -1.522  24.971  1.00 41.48  ? 11  ILE B O   1 
ATOM   815  C  CB  . ILE B 1 14 ? -23.780 -4.037  23.113  1.00 35.53  ? 11  ILE B CB  1 
ATOM   816  C  CG1 . ILE B 1 14 ? -22.809 -4.208  21.942  1.00 41.49  ? 11  ILE B CG1 1 
ATOM   817  C  CG2 . ILE B 1 14 ? -25.163 -3.653  22.575  1.00 45.99  ? 11  ILE B CG2 1 
ATOM   818  C  CD1 . ILE B 1 14 ? -23.111 -5.395  21.041  1.00 41.56  ? 11  ILE B CD1 1 
ATOM   819  N  N   . ASN B 1 15 ? -24.612 -3.469  26.043  1.00 40.92  ? 12  ASN B N   1 
ATOM   820  C  CA  . ASN B 1 15 ? -25.672 -3.251  27.022  1.00 45.30  ? 12  ASN B CA  1 
ATOM   821  C  C   . ASN B 1 15 ? -25.332 -2.145  28.012  1.00 35.23  ? 12  ASN B C   1 
ATOM   822  O  O   . ASN B 1 15 ? -26.225 -1.524  28.589  1.00 38.99  ? 12  ASN B O   1 
ATOM   823  C  CB  . ASN B 1 15 ? -25.965 -4.548  27.776  1.00 44.84  ? 12  ASN B CB  1 
ATOM   824  C  CG  . ASN B 1 15 ? -26.578 -5.609  26.886  1.00 47.60  ? 12  ASN B CG  1 
ATOM   825  O  OD1 . ASN B 1 15 ? -27.412 -5.312  26.030  1.00 56.48  ? 12  ASN B OD1 1 
ATOM   826  N  ND2 . ASN B 1 15 ? -26.164 -6.855  27.079  1.00 48.83  ? 12  ASN B ND2 1 
ATOM   827  N  N   . LEU B 1 16 ? -24.041 -1.908  28.213  1.00 30.10  ? 13  LEU B N   1 
ATOM   828  C  CA  . LEU B 1 16 ? -23.595 -0.803  29.048  1.00 32.88  ? 13  LEU B CA  1 
ATOM   829  C  C   . LEU B 1 16 ? -23.962 0.524   28.397  1.00 36.02  ? 13  LEU B C   1 
ATOM   830  O  O   . LEU B 1 16 ? -24.431 1.444   29.062  1.00 31.02  ? 13  LEU B O   1 
ATOM   831  C  CB  . LEU B 1 16 ? -22.086 -0.883  29.287  1.00 41.36  ? 13  LEU B CB  1 
ATOM   832  C  CG  . LEU B 1 16 ? -21.411 0.360   29.872  1.00 33.26  ? 13  LEU B CG  1 
ATOM   833  C  CD1 . LEU B 1 16 ? -20.327 -0.042  30.850  1.00 51.72  ? 13  LEU B CD1 1 
ATOM   834  C  CD2 . LEU B 1 16 ? -20.817 1.229   28.773  1.00 45.38  ? 13  LEU B CD2 1 
ATOM   835  N  N   . PHE B 1 17 ? -23.749 0.618   27.090  1.00 39.33  ? 14  PHE B N   1 
ATOM   836  C  CA  . PHE B 1 17 ? -24.070 1.837   26.360  1.00 38.05  ? 14  PHE B CA  1 
ATOM   837  C  C   . PHE B 1 17 ? -25.576 2.070   26.361  1.00 38.51  ? 14  PHE B C   1 
ATOM   838  O  O   . PHE B 1 17 ? -26.039 3.202   26.491  1.00 41.82  ? 14  PHE B O   1 
ATOM   839  C  CB  . PHE B 1 17 ? -23.537 1.755   24.927  1.00 27.62  ? 14  PHE B CB  1 
ATOM   840  C  CG  . PHE B 1 17 ? -23.958 2.904   24.052  1.00 29.90  ? 14  PHE B CG  1 
ATOM   841  C  CD1 . PHE B 1 17 ? -23.195 4.057   23.982  1.00 31.13  ? 14  PHE B CD1 1 
ATOM   842  C  CD2 . PHE B 1 17 ? -25.110 2.823   23.288  1.00 32.71  ? 14  PHE B CD2 1 
ATOM   843  C  CE1 . PHE B 1 17 ? -23.579 5.111   23.172  1.00 35.28  ? 14  PHE B CE1 1 
ATOM   844  C  CE2 . PHE B 1 17 ? -25.498 3.873   22.479  1.00 33.28  ? 14  PHE B CE2 1 
ATOM   845  C  CZ  . PHE B 1 17 ? -24.733 5.018   22.420  1.00 29.12  ? 14  PHE B CZ  1 
ATOM   846  N  N   . LYS B 1 18 ? -26.335 0.987   26.234  1.00 38.41  ? 15  LYS B N   1 
ATOM   847  C  CA  . LYS B 1 18 ? -27.785 1.080   26.123  1.00 39.14  ? 15  LYS B CA  1 
ATOM   848  C  C   . LYS B 1 18 ? -28.434 1.552   27.419  1.00 45.10  ? 15  LYS B C   1 
ATOM   849  O  O   . LYS B 1 18 ? -29.341 2.385   27.389  1.00 49.84  ? 15  LYS B O   1 
ATOM   850  C  CB  . LYS B 1 18 ? -28.372 -0.272  25.710  1.00 41.07  ? 15  LYS B CB  1 
ATOM   851  C  CG  . LYS B 1 18 ? -28.405 -0.503  24.205  1.00 49.87  ? 15  LYS B CG  1 
ATOM   852  C  CD  . LYS B 1 18 ? -28.629 -1.971  23.873  1.00 62.40  ? 15  LYS B CD  1 
ATOM   853  C  CE  . LYS B 1 18 ? -29.901 -2.186  23.069  1.00 66.50  ? 15  LYS B CE  1 
ATOM   854  N  NZ  . LYS B 1 18 ? -30.279 -3.627  23.015  1.00 74.82  ? 15  LYS B NZ  1 
ATOM   855  N  N   . GLN B 1 19 ? -27.971 1.027   28.552  1.00 44.85  ? 16  GLN B N   1 
ATOM   856  C  CA  . GLN B 1 19 ? -28.609 1.311   29.836  1.00 46.29  ? 16  GLN B CA  1 
ATOM   857  C  C   . GLN B 1 19 ? -28.539 2.799   30.179  1.00 43.48  ? 16  GLN B C   1 
ATOM   858  O  O   . GLN B 1 19 ? -29.357 3.301   30.952  1.00 52.87  ? 16  GLN B O   1 
ATOM   859  C  CB  . GLN B 1 19 ? -27.974 0.478   30.960  1.00 45.69  ? 16  GLN B CB  1 
ATOM   860  C  CG  . GLN B 1 19 ? -26.652 1.010   31.513  1.00 46.74  ? 16  GLN B CG  1 
ATOM   861  C  CD  . GLN B 1 19 ? -26.176 0.244   32.738  1.00 50.11  ? 16  GLN B CD  1 
ATOM   862  O  OE1 . GLN B 1 19 ? -25.428 -0.728  32.629  1.00 53.73  ? 16  GLN B OE1 1 
ATOM   863  N  NE2 . GLN B 1 19 ? -26.608 0.684   33.914  1.00 51.59  ? 16  GLN B NE2 1 
ATOM   864  N  N   . TYR B 1 20 ? -27.565 3.497   29.600  1.00 41.26  ? 17  TYR B N   1 
ATOM   865  C  CA  . TYR B 1 20 ? -27.399 4.930   29.838  1.00 44.97  ? 17  TYR B CA  1 
ATOM   866  C  C   . TYR B 1 20 ? -27.985 5.767   28.707  1.00 35.19  ? 17  TYR B C   1 
ATOM   867  O  O   . TYR B 1 20 ? -28.434 6.888   28.930  1.00 36.76  ? 17  TYR B O   1 
ATOM   868  C  CB  . TYR B 1 20 ? -25.919 5.277   30.019  1.00 34.87  ? 17  TYR B CB  1 
ATOM   869  C  CG  . TYR B 1 20 ? -25.350 4.849   31.352  1.00 34.22  ? 17  TYR B CG  1 
ATOM   870  C  CD1 . TYR B 1 20 ? -25.607 5.580   32.506  1.00 42.21  ? 17  TYR B CD1 1 
ATOM   871  C  CD2 . TYR B 1 20 ? -24.554 3.718   31.458  1.00 31.31  ? 17  TYR B CD2 1 
ATOM   872  C  CE1 . TYR B 1 20 ? -25.090 5.191   33.729  1.00 46.90  ? 17  TYR B CE1 1 
ATOM   873  C  CE2 . TYR B 1 20 ? -24.032 3.322   32.673  1.00 38.37  ? 17  TYR B CE2 1 
ATOM   874  C  CZ  . TYR B 1 20 ? -24.303 4.061   33.807  1.00 42.87  ? 17  TYR B CZ  1 
ATOM   875  O  OH  . TYR B 1 20 ? -23.783 3.668   35.020  1.00 41.55  ? 17  TYR B OH  1 
ATOM   876  N  N   . SER B 1 21 ? -27.981 5.226   27.494  1.00 37.81  ? 18  SER B N   1 
ATOM   877  C  CA  . SER B 1 21 ? -28.415 5.992   26.332  1.00 41.92  ? 18  SER B CA  1 
ATOM   878  C  C   . SER B 1 21 ? -29.935 6.121   26.268  1.00 35.54  ? 18  SER B C   1 
ATOM   879  O  O   . SER B 1 21 ? -30.454 7.052   25.655  1.00 33.12  ? 18  SER B O   1 
ATOM   880  C  CB  . SER B 1 21 ? -27.887 5.351   25.044  1.00 36.96  ? 18  SER B CB  1 
ATOM   881  O  OG  . SER B 1 21 ? -28.436 4.062   24.846  1.00 42.95  ? 18  SER B OG  1 
ATOM   882  N  N   . LYS B 1 22 ? -30.646 5.201   26.913  1.00 41.53  ? 19  LYS B N   1 
ATOM   883  C  CA  . LYS B 1 22 ? -32.104 5.155   26.816  1.00 47.21  ? 19  LYS B CA  1 
ATOM   884  C  C   . LYS B 1 22 ? -32.812 5.866   27.976  1.00 48.96  ? 19  LYS B C   1 
ATOM   885  O  O   . LYS B 1 22 ? -34.018 5.703   28.167  1.00 36.39  ? 19  LYS B O   1 
ATOM   886  C  CB  . LYS B 1 22 ? -32.568 3.700   26.747  1.00 41.39  ? 19  LYS B CB  1 
ATOM   887  C  CG  . LYS B 1 22 ? -32.554 2.985   28.085  1.00 49.58  ? 19  LYS B CG  1 
ATOM   888  C  CD  . LYS B 1 22 ? -32.531 1.478   27.911  1.00 57.33  ? 19  LYS B CD  1 
ATOM   889  C  CE  . LYS B 1 22 ? -32.781 0.770   29.232  1.00 64.35  ? 19  LYS B CE  1 
ATOM   890  N  NZ  . LYS B 1 22 ? -32.302 -0.640  29.214  1.00 62.28  ? 19  LYS B NZ  1 
ATOM   891  N  N   . LYS B 1 23 ? -32.070 6.660   28.743  1.00 41.77  ? 20  LYS B N   1 
ATOM   892  C  CA  . LYS B 1 23 ? -32.648 7.361   29.888  1.00 42.19  ? 20  LYS B CA  1 
ATOM   893  C  C   . LYS B 1 23 ? -33.455 8.587   29.466  1.00 46.17  ? 20  LYS B C   1 
ATOM   894  O  O   . LYS B 1 23 ? -34.123 9.211   30.292  1.00 46.20  ? 20  LYS B O   1 
ATOM   895  C  CB  . LYS B 1 23 ? -31.552 7.771   30.871  1.00 40.75  ? 20  LYS B CB  1 
ATOM   896  C  CG  . LYS B 1 23 ? -30.968 6.599   31.632  1.00 46.06  ? 20  LYS B CG  1 
ATOM   897  C  CD  . LYS B 1 23 ? -30.131 7.053   32.809  1.00 47.67  ? 20  LYS B CD  1 
ATOM   898  C  CE  . LYS B 1 23 ? -29.840 5.890   33.738  1.00 42.58  ? 20  LYS B CE  1 
ATOM   899  N  NZ  . LYS B 1 23 ? -28.963 6.284   34.865  1.00 57.03  ? 20  LYS B NZ  1 
ATOM   900  N  N   . ASP B 1 24 ? -33.384 8.927   28.182  1.00 40.09  ? 21  ASP B N   1 
ATOM   901  C  CA  . ASP B 1 24 ? -34.229 9.970   27.608  1.00 42.53  ? 21  ASP B CA  1 
ATOM   902  C  C   . ASP B 1 24 ? -34.892 9.436   26.337  1.00 48.54  ? 21  ASP B C   1 
ATOM   903  O  O   . ASP B 1 24 ? -34.933 8.224   26.122  1.00 54.09  ? 21  ASP B O   1 
ATOM   904  C  CB  . ASP B 1 24 ? -33.410 11.233  27.319  1.00 38.62  ? 21  ASP B CB  1 
ATOM   905  C  CG  . ASP B 1 24 ? -32.384 11.029  26.222  1.00 48.44  ? 21  ASP B CG  1 
ATOM   906  O  OD1 . ASP B 1 24 ? -32.118 9.865   25.858  1.00 47.37  ? 21  ASP B OD1 1 
ATOM   907  O  OD2 . ASP B 1 24 ? -31.835 12.038  25.731  1.00 42.63  ? 21  ASP B OD2 1 
ATOM   908  N  N   . LYS B 1 25 ? -35.397 10.331  25.494  1.00 54.04  ? 22  LYS B N   1 
ATOM   909  C  CA  . LYS B 1 25 ? -36.139 9.918   24.305  1.00 48.56  ? 22  LYS B CA  1 
ATOM   910  C  C   . LYS B 1 25 ? -35.232 9.642   23.107  1.00 60.88  ? 22  LYS B C   1 
ATOM   911  O  O   . LYS B 1 25 ? -35.698 9.171   22.069  1.00 62.65  ? 22  LYS B O   1 
ATOM   912  C  CB  . LYS B 1 25 ? -37.177 10.981  23.939  1.00 54.56  ? 22  LYS B CB  1 
ATOM   913  C  CG  . LYS B 1 25 ? -38.327 11.095  24.935  1.00 61.88  ? 22  LYS B CG  1 
ATOM   914  C  CD  . LYS B 1 25 ? -39.063 9.768   25.103  1.00 61.93  ? 22  LYS B CD  1 
ATOM   915  C  CE  . LYS B 1 25 ? -40.254 9.898   26.026  1.00 68.92  ? 22  LYS B CE  1 
ATOM   916  N  NZ  . LYS B 1 25 ? -40.890 8.578   26.288  1.00 69.09  ? 22  LYS B NZ  1 
ATOM   917  N  N   . ASN B 1 26 ? -33.945 9.940   23.252  1.00 59.04  ? 23  ASN B N   1 
ATOM   918  C  CA  . ASN B 1 26 ? -32.954 9.580   22.243  1.00 51.33  ? 23  ASN B CA  1 
ATOM   919  C  C   . ASN B 1 26 ? -32.247 8.295   22.651  1.00 46.10  ? 23  ASN B C   1 
ATOM   920  O  O   . ASN B 1 26 ? -31.183 8.323   23.265  1.00 42.86  ? 23  ASN B O   1 
ATOM   921  C  CB  . ASN B 1 26 ? -31.949 10.710  22.049  1.00 48.64  ? 23  ASN B CB  1 
ATOM   922  C  CG  . ASN B 1 26 ? -32.596 11.978  21.541  1.00 56.74  ? 23  ASN B CG  1 
ATOM   923  O  OD1 . ASN B 1 26 ? -33.814 12.147  21.629  1.00 60.66  ? 23  ASN B OD1 1 
ATOM   924  N  ND2 . ASN B 1 26 ? -31.786 12.880  21.003  1.00 63.32  ? 23  ASN B ND2 1 
ATOM   925  N  N   . THR B 1 27 ? -32.860 7.169   22.304  1.00 50.41  ? 24  THR B N   1 
ATOM   926  C  CA  . THR B 1 27 ? -32.413 5.853   22.750  1.00 46.33  ? 24  THR B CA  1 
ATOM   927  C  C   . THR B 1 27 ? -31.027 5.459   22.240  1.00 45.32  ? 24  THR B C   1 
ATOM   928  O  O   . THR B 1 27 ? -30.283 4.757   22.927  1.00 46.61  ? 24  THR B O   1 
ATOM   929  C  CB  . THR B 1 27 ? -33.415 4.771   22.304  1.00 54.20  ? 24  THR B CB  1 
ATOM   930  O  OG1 . THR B 1 27 ? -34.694 5.031   22.894  1.00 68.08  ? 24  THR B OG1 1 
ATOM   931  C  CG2 . THR B 1 27 ? -32.947 3.378   22.715  1.00 61.74  ? 24  THR B CG2 1 
ATOM   932  N  N   . ASP B 1 28 ? -30.690 5.901   21.034  1.00 46.68  ? 25  ASP B N   1 
ATOM   933  C  CA  . ASP B 1 28 ? -29.491 5.422   20.351  1.00 49.75  ? 25  ASP B CA  1 
ATOM   934  C  C   . ASP B 1 28 ? -28.258 6.303   20.566  1.00 43.99  ? 25  ASP B C   1 
ATOM   935  O  O   . ASP B 1 28 ? -27.236 6.103   19.909  1.00 44.01  ? 25  ASP B O   1 
ATOM   936  C  CB  . ASP B 1 28 ? -29.766 5.300   18.849  1.00 55.74  ? 25  ASP B CB  1 
ATOM   937  C  CG  . ASP B 1 28 ? -31.003 4.471   18.544  1.00 70.27  ? 25  ASP B CG  1 
ATOM   938  O  OD1 . ASP B 1 28 ? -31.363 3.604   19.369  1.00 68.23  ? 25  ASP B OD1 1 
ATOM   939  O  OD2 . ASP B 1 28 ? -31.614 4.686   17.474  1.00 71.77  ? 25  ASP B OD2 1 
ATOM   940  N  N   . THR B 1 29 ? -28.347 7.275   21.472  1.00 37.08  ? 26  THR B N   1 
ATOM   941  C  CA  . THR B 1 29 ? -27.218 8.164   21.748  1.00 39.25  ? 26  THR B CA  1 
ATOM   942  C  C   . THR B 1 29 ? -27.135 8.552   23.222  1.00 38.91  ? 26  THR B C   1 
ATOM   943  O  O   . THR B 1 29 ? -28.105 8.417   23.968  1.00 29.78  ? 26  THR B O   1 
ATOM   944  C  CB  . THR B 1 29 ? -27.293 9.459   20.906  1.00 37.36  ? 26  THR B CB  1 
ATOM   945  O  OG1 . THR B 1 29 ? -28.521 10.144  21.177  1.00 46.81  ? 26  THR B OG1 1 
ATOM   946  C  CG2 . THR B 1 29 ? -27.206 9.145   19.419  1.00 40.50  ? 26  THR B CG2 1 
ATOM   947  N  N   . LEU B 1 30 ? -25.963 9.033   23.627  1.00 31.45  ? 27  LEU B N   1 
ATOM   948  C  CA  . LEU B 1 30 ? -25.728 9.481   24.994  1.00 35.22  ? 27  LEU B CA  1 
ATOM   949  C  C   . LEU B 1 30 ? -25.728 11.001  25.053  1.00 37.26  ? 27  LEU B C   1 
ATOM   950  O  O   . LEU B 1 30 ? -24.946 11.655  24.364  1.00 31.96  ? 27  LEU B O   1 
ATOM   951  C  CB  . LEU B 1 30 ? -24.394 8.946   25.525  1.00 37.34  ? 27  LEU B CB  1 
ATOM   952  C  CG  . LEU B 1 30 ? -24.258 7.435   25.710  1.00 45.33  ? 27  LEU B CG  1 
ATOM   953  C  CD1 . LEU B 1 30 ? -22.788 7.051   25.761  1.00 30.56  ? 27  LEU B CD1 1 
ATOM   954  C  CD2 . LEU B 1 30 ? -24.974 6.980   26.973  1.00 30.66  ? 27  LEU B CD2 1 
ATOM   955  N  N   . SER B 1 31 ? -26.608 11.560  25.875  1.00 30.63  ? 28  SER B N   1 
ATOM   956  C  CA  . SER B 1 31 ? -26.616 12.996  26.106  1.00 34.70  ? 28  SER B CA  1 
ATOM   957  C  C   . SER B 1 31 ? -25.436 13.369  26.991  1.00 33.30  ? 28  SER B C   1 
ATOM   958  O  O   . SER B 1 31 ? -24.677 12.500  27.424  1.00 32.17  ? 28  SER B O   1 
ATOM   959  C  CB  . SER B 1 31 ? -27.928 13.440  26.756  1.00 40.67  ? 28  SER B CB  1 
ATOM   960  O  OG  . SER B 1 31 ? -28.037 12.940  28.077  1.00 33.06  ? 28  SER B OG  1 
ATOM   961  N  N   . LYS B 1 32 ? -25.288 14.659  27.267  1.00 45.04  ? 29  LYS B N   1 
ATOM   962  C  CA  . LYS B 1 32 ? -24.226 15.130  28.146  1.00 45.70  ? 29  LYS B CA  1 
ATOM   963  C  C   . LYS B 1 32 ? -24.449 14.598  29.561  1.00 38.07  ? 29  LYS B C   1 
ATOM   964  O  O   . LYS B 1 32 ? -23.509 14.167  30.226  1.00 40.76  ? 29  LYS B O   1 
ATOM   965  C  CB  . LYS B 1 32 ? -24.162 16.659  28.156  1.00 44.19  ? 29  LYS B CB  1 
ATOM   966  C  CG  . LYS B 1 32 ? -24.285 17.300  26.778  1.00 61.48  ? 29  LYS B CG  1 
ATOM   967  C  CD  . LYS B 1 32 ? -25.599 18.053  26.609  1.00 56.55  ? 29  LYS B CD  1 
ATOM   968  C  CE  . LYS B 1 32 ? -26.174 17.878  25.214  1.00 54.03  ? 29  LYS B CE  1 
ATOM   969  N  NZ  . LYS B 1 32 ? -26.656 16.487  24.982  1.00 41.70  ? 29  LYS B NZ  1 
ATOM   970  N  N   . LYS B 1 33 ? -25.701 14.624  30.012  1.00 41.75  ? 30  LYS B N   1 
ATOM   971  C  CA  . LYS B 1 33 ? -26.051 14.110  31.334  1.00 41.92  ? 30  LYS B CA  1 
ATOM   972  C  C   . LYS B 1 33 ? -25.843 12.601  31.411  1.00 39.49  ? 30  LYS B C   1 
ATOM   973  O  O   . LYS B 1 33 ? -25.240 12.098  32.359  1.00 36.15  ? 30  LYS B O   1 
ATOM   974  C  CB  . LYS B 1 33 ? -27.503 14.459  31.680  1.00 40.31  ? 30  LYS B CB  1 
ATOM   975  C  CG  . LYS B 1 33 ? -28.080 13.634  32.823  1.00 54.44  ? 30  LYS B CG  1 
ATOM   976  C  CD  . LYS B 1 33 ? -29.217 14.354  33.538  1.00 56.54  ? 30  LYS B CD  1 
ATOM   977  C  CE  . LYS B 1 33 ? -30.417 14.588  32.635  1.00 59.14  ? 30  LYS B CE  1 
ATOM   978  N  NZ  . LYS B 1 33 ? -31.006 13.317  32.131  1.00 63.95  ? 30  LYS B NZ  1 
ATOM   979  N  N   . GLU B 1 34 ? -26.341 11.885  30.408  1.00 32.49  ? 31  GLU B N   1 
ATOM   980  C  CA  . GLU B 1 34 ? -26.214 10.434  30.370  1.00 30.32  ? 31  GLU B CA  1 
ATOM   981  C  C   . GLU B 1 34 ? -24.749 10.021  30.304  1.00 35.25  ? 31  GLU B C   1 
ATOM   982  O  O   . GLU B 1 34 ? -24.332 9.066   30.963  1.00 23.16  ? 31  GLU B O   1 
ATOM   983  C  CB  . GLU B 1 34 ? -26.975 9.865   29.175  1.00 35.32  ? 31  GLU B CB  1 
ATOM   984  C  CG  . GLU B 1 34 ? -28.488 9.971   29.293  1.00 32.49  ? 31  GLU B CG  1 
ATOM   985  C  CD  . GLU B 1 34 ? -29.191 9.570   28.017  1.00 35.96  ? 31  GLU B CD  1 
ATOM   986  O  OE1 . GLU B 1 34 ? -28.549 9.635   26.950  1.00 34.43  ? 31  GLU B OE1 1 
ATOM   987  O  OE2 . GLU B 1 34 ? -30.376 9.181   28.078  1.00 38.19  ? 31  GLU B OE2 1 
ATOM   988  N  N   . LEU B 1 35 ? -23.972 10.753  29.511  1.00 38.73  ? 32  LEU B N   1 
ATOM   989  C  CA  . LEU B 1 35 ? -22.547 10.484  29.375  1.00 32.19  ? 32  LEU B CA  1 
ATOM   990  C  C   . LEU B 1 35 ? -21.823 10.710  30.695  1.00 30.05  ? 32  LEU B C   1 
ATOM   991  O  O   . LEU B 1 35 ? -20.966 9.920   31.081  1.00 35.22  ? 32  LEU B O   1 
ATOM   992  C  CB  . LEU B 1 35 ? -21.932 11.365  28.285  1.00 29.86  ? 32  LEU B CB  1 
ATOM   993  C  CG  . LEU B 1 35 ? -20.407 11.287  28.140  1.00 31.77  ? 32  LEU B CG  1 
ATOM   994  C  CD1 . LEU B 1 35 ? -19.962 9.858   27.871  1.00 31.11  ? 32  LEU B CD1 1 
ATOM   995  C  CD2 . LEU B 1 35 ? -19.917 12.219  27.036  1.00 33.12  ? 32  LEU B CD2 1 
ATOM   996  N  N   . LYS B 1 36 ? -22.173 11.796  31.378  1.00 37.94  ? 33  LYS B N   1 
ATOM   997  C  CA  . LYS B 1 36 ? -21.538 12.148  32.642  1.00 33.75  ? 33  LYS B CA  1 
ATOM   998  C  C   . LYS B 1 36 ? -21.691 11.022  33.663  1.00 27.14  ? 33  LYS B C   1 
ATOM   999  O  O   . LYS B 1 36 ? -20.753 10.699  34.390  1.00 23.05  ? 33  LYS B O   1 
ATOM   1000 C  CB  . LYS B 1 36 ? -22.131 13.450  33.194  1.00 47.57  ? 33  LYS B CB  1 
ATOM   1001 C  CG  . LYS B 1 36 ? -21.396 14.022  34.406  1.00 53.60  ? 33  LYS B CG  1 
ATOM   1002 C  CD  . LYS B 1 36 ? -22.304 14.121  35.624  1.00 63.17  ? 33  LYS B CD  1 
ATOM   1003 C  CE  . LYS B 1 36 ? -21.656 14.921  36.744  1.00 65.67  ? 33  LYS B CE  1 
ATOM   1004 N  NZ  . LYS B 1 36 ? -22.007 16.368  36.686  1.00 73.03  ? 33  LYS B NZ  1 
ATOM   1005 N  N   . GLU B 1 37 ? -22.873 10.418  33.704  1.00 28.51  ? 34  GLU B N   1 
ATOM   1006 C  CA  . GLU B 1 37 ? -23.148 9.364   34.670  1.00 37.53  ? 34  GLU B CA  1 
ATOM   1007 C  C   . GLU B 1 37 ? -22.350 8.105   34.344  1.00 35.83  ? 34  GLU B C   1 
ATOM   1008 O  O   . GLU B 1 37 ? -21.866 7.418   35.243  1.00 38.39  ? 34  GLU B O   1 
ATOM   1009 C  CB  . GLU B 1 37 ? -24.641 9.047   34.706  1.00 33.50  ? 34  GLU B CB  1 
ATOM   1010 C  CG  . GLU B 1 37 ? -25.038 8.115   35.839  1.00 58.62  ? 34  GLU B CG  1 
ATOM   1011 C  CD  . GLU B 1 37 ? -26.521 7.822   35.853  1.00 55.49  ? 34  GLU B CD  1 
ATOM   1012 O  OE1 . GLU B 1 37 ? -27.239 8.359   34.983  1.00 50.15  ? 34  GLU B OE1 1 
ATOM   1013 O  OE2 . GLU B 1 37 ? -26.972 7.053   36.728  1.00 53.07  ? 34  GLU B OE2 1 
ATOM   1014 N  N   . LEU B 1 38 ? -22.217 7.811   33.055  1.00 40.07  ? 35  LEU B N   1 
ATOM   1015 C  CA  . LEU B 1 38 ? -21.438 6.666   32.602  1.00 26.15  ? 35  LEU B CA  1 
ATOM   1016 C  C   . LEU B 1 38 ? -19.985 6.803   33.040  1.00 32.27  ? 35  LEU B C   1 
ATOM   1017 O  O   . LEU B 1 38 ? -19.409 5.878   33.610  1.00 26.73  ? 35  LEU B O   1 
ATOM   1018 C  CB  . LEU B 1 38 ? -21.524 6.532   31.079  1.00 33.46  ? 35  LEU B CB  1 
ATOM   1019 C  CG  . LEU B 1 38 ? -20.949 5.257   30.447  1.00 38.66  ? 35  LEU B CG  1 
ATOM   1020 C  CD1 . LEU B 1 38 ? -21.637 4.978   29.122  1.00 29.87  ? 35  LEU B CD1 1 
ATOM   1021 C  CD2 . LEU B 1 38 ? -19.440 5.345   30.237  1.00 32.76  ? 35  LEU B CD2 1 
ATOM   1022 N  N   . LEU B 1 39 ? -19.399 7.964   32.768  1.00 24.59  ? 36  LEU B N   1 
ATOM   1023 C  CA  . LEU B 1 39 ? -17.998 8.210   33.093  1.00 29.88  ? 36  LEU B CA  1 
ATOM   1024 C  C   . LEU B 1 39 ? -17.760 8.183   34.597  1.00 31.65  ? 36  LEU B C   1 
ATOM   1025 O  O   . LEU B 1 39 ? -16.704 7.751   35.059  1.00 37.89  ? 36  LEU B O   1 
ATOM   1026 C  CB  . LEU B 1 39 ? -17.544 9.556   32.526  1.00 25.94  ? 36  LEU B CB  1 
ATOM   1027 C  CG  . LEU B 1 39 ? -17.582 9.713   31.005  1.00 37.65  ? 36  LEU B CG  1 
ATOM   1028 C  CD1 . LEU B 1 39 ? -17.159 11.120  30.611  1.00 38.41  ? 36  LEU B CD1 1 
ATOM   1029 C  CD2 . LEU B 1 39 ? -16.697 8.681   30.325  1.00 40.44  ? 36  LEU B CD2 1 
ATOM   1030 N  N   . GLU B 1 40 ? -18.743 8.649   35.358  1.00 30.76  ? 37  GLU B N   1 
ATOM   1031 C  CA  . GLU B 1 40 ? -18.625 8.692   36.808  1.00 33.23  ? 37  GLU B CA  1 
ATOM   1032 C  C   . GLU B 1 40 ? -18.656 7.284   37.391  1.00 32.60  ? 37  GLU B C   1 
ATOM   1033 O  O   . GLU B 1 40 ? -17.882 6.955   38.289  1.00 36.66  ? 37  GLU B O   1 
ATOM   1034 C  CB  . GLU B 1 40 ? -19.748 9.539   37.408  1.00 42.43  ? 37  GLU B CB  1 
ATOM   1035 C  CG  . GLU B 1 40 ? -19.650 9.732   38.912  1.00 56.30  ? 37  GLU B CG  1 
ATOM   1036 C  CD  . GLU B 1 40 ? -20.886 10.389  39.488  1.00 62.38  ? 37  GLU B CD  1 
ATOM   1037 O  OE1 . GLU B 1 40 ? -21.563 11.132  38.745  1.00 57.40  ? 37  GLU B OE1 1 
ATOM   1038 O  OE2 . GLU B 1 40 ? -21.182 10.157  40.680  1.00 50.98  ? 37  GLU B OE2 1 
ATOM   1039 N  N   . LYS B 1 41 ? -19.557 6.457   36.871  1.00 33.67  ? 38  LYS B N   1 
ATOM   1040 C  CA  . LYS B 1 41 ? -19.714 5.089   37.351  1.00 37.83  ? 38  LYS B CA  1 
ATOM   1041 C  C   . LYS B 1 41 ? -18.578 4.185   36.882  1.00 34.73  ? 38  LYS B C   1 
ATOM   1042 O  O   . LYS B 1 41 ? -18.026 3.412   37.664  1.00 40.47  ? 38  LYS B O   1 
ATOM   1043 C  CB  . LYS B 1 41 ? -21.051 4.511   36.883  1.00 37.15  ? 38  LYS B CB  1 
ATOM   1044 C  CG  . LYS B 1 41 ? -22.110 4.400   37.966  1.00 42.93  ? 38  LYS B CG  1 
ATOM   1045 C  CD  . LYS B 1 41 ? -22.368 5.732   38.646  1.00 51.14  ? 38  LYS B CD  1 
ATOM   1046 C  CE  . LYS B 1 41 ? -23.729 5.747   39.320  1.00 47.83  ? 38  LYS B CE  1 
ATOM   1047 N  NZ  . LYS B 1 41 ? -23.929 6.958   40.162  1.00 57.21  ? 38  LYS B NZ  1 
ATOM   1048 N  N   . GLU B 1 42 ? -18.232 4.283   35.603  1.00 28.73  ? 39  GLU B N   1 
ATOM   1049 C  CA  . GLU B 1 42 ? -17.258 3.373   35.009  1.00 26.10  ? 39  GLU B CA  1 
ATOM   1050 C  C   . GLU B 1 42 ? -15.814 3.785   35.301  1.00 23.51  ? 39  GLU B C   1 
ATOM   1051 O  O   . GLU B 1 42 ? -14.942 2.930   35.434  1.00 25.87  ? 39  GLU B O   1 
ATOM   1052 C  CB  . GLU B 1 42 ? -17.481 3.282   33.497  1.00 27.46  ? 39  GLU B CB  1 
ATOM   1053 C  CG  . GLU B 1 42 ? -18.873 2.793   33.098  1.00 29.38  ? 39  GLU B CG  1 
ATOM   1054 C  CD  . GLU B 1 42 ? -19.188 1.400   33.616  1.00 33.34  ? 39  GLU B CD  1 
ATOM   1055 O  OE1 . GLU B 1 42 ? -18.261 0.568   33.705  1.00 32.15  ? 39  GLU B OE1 1 
ATOM   1056 O  OE2 . GLU B 1 42 ? -20.367 1.139   33.935  1.00 33.81  ? 39  GLU B OE2 1 
ATOM   1057 N  N   . PHE B 1 43 ? -15.567 5.089   35.400  1.00 29.64  ? 40  PHE B N   1 
ATOM   1058 C  CA  . PHE B 1 43 ? -14.232 5.606   35.698  1.00 22.08  ? 40  PHE B CA  1 
ATOM   1059 C  C   . PHE B 1 43 ? -14.296 6.440   36.963  1.00 38.16  ? 40  PHE B C   1 
ATOM   1060 O  O   . PHE B 1 43 ? -14.655 7.617   36.934  1.00 39.88  ? 40  PHE B O   1 
ATOM   1061 C  CB  . PHE B 1 43 ? -13.692 6.428   34.529  1.00 28.23  ? 40  PHE B CB  1 
ATOM   1062 C  CG  . PHE B 1 43 ? -13.836 5.744   33.207  1.00 30.83  ? 40  PHE B CG  1 
ATOM   1063 C  CD1 . PHE B 1 43 ? -13.108 4.602   32.923  1.00 33.48  ? 40  PHE B CD1 1 
ATOM   1064 C  CD2 . PHE B 1 43 ? -14.714 6.230   32.254  1.00 30.00  ? 40  PHE B CD2 1 
ATOM   1065 C  CE1 . PHE B 1 43 ? -13.248 3.962   31.711  1.00 37.04  ? 40  PHE B CE1 1 
ATOM   1066 C  CE2 . PHE B 1 43 ? -14.857 5.595   31.040  1.00 35.03  ? 40  PHE B CE2 1 
ATOM   1067 C  CZ  . PHE B 1 43 ? -14.124 4.461   30.767  1.00 38.32  ? 40  PHE B CZ  1 
ATOM   1068 N  N   . ARG B 1 44 ? -13.938 5.817   38.078  1.00 37.58  ? 41  ARG B N   1 
ATOM   1069 C  CA  . ARG B 1 44 ? -14.218 6.385   39.385  1.00 45.33  ? 41  ARG B CA  1 
ATOM   1070 C  C   . ARG B 1 44 ? -13.053 7.174   39.966  1.00 46.19  ? 41  ARG B C   1 
ATOM   1071 O  O   . ARG B 1 44 ? -11.963 6.646   40.176  1.00 40.13  ? 41  ARG B O   1 
ATOM   1072 C  CB  . ARG B 1 44 ? -14.630 5.269   40.338  1.00 38.15  ? 41  ARG B CB  1 
ATOM   1073 C  CG  . ARG B 1 44 ? -15.934 4.619   39.921  1.00 39.38  ? 41  ARG B CG  1 
ATOM   1074 C  CD  . ARG B 1 44 ? -16.378 3.571   40.905  1.00 40.61  ? 41  ARG B CD  1 
ATOM   1075 N  NE  . ARG B 1 44 ? -17.809 3.313   40.801  1.00 54.84  ? 41  ARG B NE  1 
ATOM   1076 C  CZ  . ARG B 1 44 ? -18.753 4.148   41.223  1.00 52.49  ? 41  ARG B CZ  1 
ATOM   1077 N  NH1 . ARG B 1 44 ? -18.422 5.311   41.771  1.00 52.59  ? 41  ARG B NH1 1 
ATOM   1078 N  NH2 . ARG B 1 44 ? -20.033 3.826   41.088  1.00 46.20  ? 41  ARG B NH2 1 
ATOM   1079 N  N   . GLN B 1 45 ? -13.307 8.455   40.211  1.00 54.49  ? 42  GLN B N   1 
ATOM   1080 C  CA  . GLN B 1 45 ? -12.344 9.326   40.865  1.00 58.02  ? 42  GLN B CA  1 
ATOM   1081 C  C   . GLN B 1 45 ? -12.511 9.197   42.378  1.00 59.92  ? 42  GLN B C   1 
ATOM   1082 O  O   . GLN B 1 45 ? -13.342 9.875   42.983  1.00 58.32  ? 42  GLN B O   1 
ATOM   1083 C  CB  . GLN B 1 45 ? -12.534 10.778  40.412  1.00 67.33  ? 42  GLN B CB  1 
ATOM   1084 C  CG  . GLN B 1 45 ? -12.822 10.944  38.919  1.00 54.30  ? 42  GLN B CG  1 
ATOM   1085 C  CD  . GLN B 1 45 ? -11.726 10.382  38.031  1.00 64.97  ? 42  GLN B CD  1 
ATOM   1086 O  OE1 . GLN B 1 45 ? -10.602 10.150  38.478  1.00 77.42  ? 42  GLN B OE1 1 
ATOM   1087 N  NE2 . GLN B 1 45 ? -12.052 10.161  36.761  1.00 56.68  ? 42  GLN B NE2 1 
ATOM   1088 N  N   . ILE B 1 46 ? -11.721 8.309   42.977  1.00 64.55  ? 43  ILE B N   1 
ATOM   1089 C  CA  . ILE B 1 46 ? -11.818 8.017   44.406  1.00 63.87  ? 43  ILE B CA  1 
ATOM   1090 C  C   . ILE B 1 46 ? -11.617 9.254   45.261  1.00 68.80  ? 43  ILE B C   1 
ATOM   1091 O  O   . ILE B 1 46 ? -12.322 9.459   46.247  1.00 75.43  ? 43  ILE B O   1 
ATOM   1092 C  CB  . ILE B 1 46 ? -10.781 6.962   44.851  1.00 57.78  ? 43  ILE B CB  1 
ATOM   1093 C  CG1 . ILE B 1 46 ? -9.413  7.226   44.208  1.00 60.30  ? 43  ILE B CG1 1 
ATOM   1094 C  CG2 . ILE B 1 46 ? -11.257 5.579   44.489  1.00 57.93  ? 43  ILE B CG2 1 
ATOM   1095 C  CD1 . ILE B 1 46 ? -8.253  6.599   44.948  1.00 51.26  ? 43  ILE B CD1 1 
ATOM   1096 N  N   . LEU B 1 47 ? -10.652 10.080  44.881  1.00 65.68  ? 44  LEU B N   1 
ATOM   1097 C  CA  . LEU B 1 47 ? -10.345 11.267  45.653  1.00 75.71  ? 44  LEU B CA  1 
ATOM   1098 C  C   . LEU B 1 47 ? -11.500 12.246  45.496  1.00 84.87  ? 44  LEU B C   1 
ATOM   1099 O  O   . LEU B 1 47 ? -11.567 12.990  44.519  1.00 90.26  ? 44  LEU B O   1 
ATOM   1100 C  CB  . LEU B 1 47 ? -9.025  11.894  45.198  1.00 77.09  ? 44  LEU B CB  1 
ATOM   1101 C  CG  . LEU B 1 47 ? -7.889  10.927  44.856  1.00 76.12  ? 44  LEU B CG  1 
ATOM   1102 C  CD1 . LEU B 1 47 ? -6.617  11.713  44.600  1.00 74.88  ? 44  LEU B CD1 1 
ATOM   1103 C  CD2 . LEU B 1 47 ? -7.680  9.874   45.947  1.00 74.60  ? 44  LEU B CD2 1 
ATOM   1104 N  N   . LYS B 1 48 ? -12.433 12.222  46.441  1.00 89.15  ? 45  LYS B N   1 
ATOM   1105 C  CA  . LYS B 1 48 ? -13.587 13.113  46.366  1.00 95.40  ? 45  LYS B CA  1 
ATOM   1106 C  C   . LYS B 1 48 ? -13.175 14.577  46.577  1.00 90.42  ? 45  LYS B C   1 
ATOM   1107 O  O   . LYS B 1 48 ? -13.618 15.238  47.520  1.00 91.70  ? 45  LYS B O   1 
ATOM   1108 C  CB  . LYS B 1 48 ? -14.657 12.703  47.381  1.00 99.18  ? 45  LYS B CB  1 
ATOM   1109 C  CG  . LYS B 1 48 ? -16.018 13.241  47.008  1.00 99.37  ? 45  LYS B CG  1 
ATOM   1110 C  CD  . LYS B 1 48 ? -17.049 13.065  48.113  1.00 93.31  ? 45  LYS B CD  1 
ATOM   1111 C  CE  . LYS B 1 48 ? -17.624 14.394  48.596  1.00 104.39 ? 45  LYS B CE  1 
ATOM   1112 N  NZ  . LYS B 1 48 ? -18.013 15.329  47.495  1.00 111.33 ? 45  LYS B NZ  1 
ATOM   1113 N  N   . ASN B 1 49 ? -12.345 15.069  45.659  1.00 96.44  ? 46  ASN B N   1 
ATOM   1114 C  CA  . ASN B 1 49 ? -11.808 16.426  45.689  1.00 108.73 ? 46  ASN B CA  1 
ATOM   1115 C  C   . ASN B 1 49 ? -12.069 17.091  44.353  1.00 111.16 ? 46  ASN B C   1 
ATOM   1116 O  O   . ASN B 1 49 ? -11.433 16.749  43.355  1.00 108.66 ? 46  ASN B O   1 
ATOM   1117 C  CB  . ASN B 1 49 ? -10.308 16.424  45.995  1.00 108.10 ? 46  ASN B CB  1 
ATOM   1118 C  CG  . ASN B 1 49 ? -9.611  17.705  45.551  1.00 108.55 ? 46  ASN B CG  1 
ATOM   1119 O  OD1 . ASN B 1 49 ? -9.160  17.824  44.413  1.00 109.22 ? 46  ASN B OD1 1 
ATOM   1120 N  ND2 . ASN B 1 49 ? -9.506  18.665  46.464  1.00 108.82 ? 46  ASN B ND2 1 
ATOM   1121 N  N   . PRO B 1 50 ? -13.042 18.013  44.316  1.00 117.21 ? 47  PRO B N   1 
ATOM   1122 C  CA  . PRO B 1 50 ? -13.285 18.707  43.055  1.00 122.90 ? 47  PRO B CA  1 
ATOM   1123 C  C   . PRO B 1 50 ? -12.735 20.119  43.003  1.00 125.45 ? 47  PRO B C   1 
ATOM   1124 O  O   . PRO B 1 50 ? -13.364 21.066  43.478  1.00 132.73 ? 47  PRO B O   1 
ATOM   1125 C  CB  . PRO B 1 50 ? -14.818 18.724  42.953  1.00 139.61 ? 47  PRO B CB  1 
ATOM   1126 C  CG  . PRO B 1 50 ? -15.340 18.262  44.307  1.00 137.64 ? 47  PRO B CG  1 
ATOM   1127 C  CD  . PRO B 1 50 ? -14.177 18.168  45.236  1.00 121.14 ? 47  PRO B CD  1 
ATOM   1128 N  N   . ASP B 1 51 ? -11.540 20.254  42.446  1.00 124.09 ? 48  ASP B N   1 
ATOM   1129 C  CA  . ASP B 1 51 ? -11.253 21.456  41.696  1.00 123.63 ? 48  ASP B CA  1 
ATOM   1130 C  C   . ASP B 1 51 ? -12.047 21.227  40.412  1.00 124.60 ? 48  ASP B C   1 
ATOM   1131 O  O   . ASP B 1 51 ? -11.729 20.295  39.673  1.00 123.78 ? 48  ASP B O   1 
ATOM   1132 C  CB  . ASP B 1 51 ? -9.766  21.658  41.419  1.00 125.10 ? 48  ASP B CB  1 
ATOM   1133 C  CG  . ASP B 1 51 ? -9.489  22.983  40.739  1.00 124.73 ? 48  ASP B CG  1 
ATOM   1134 O  OD1 . ASP B 1 51 ? -10.264 23.936  40.974  1.00 115.56 ? 48  ASP B OD1 1 
ATOM   1135 O  OD2 . ASP B 1 51 ? -8.514  23.077  39.969  1.00 124.13 ? 48  ASP B OD2 1 
ATOM   1136 N  N   . ASP B 1 52 ? -13.058 22.068  40.162  1.00 126.91 ? 49  ASP B N   1 
ATOM   1137 C  CA  . ASP B 1 52 ? -14.160 21.778  39.216  1.00 128.05 ? 49  ASP B CA  1 
ATOM   1138 C  C   . ASP B 1 52 ? -13.785 20.739  38.143  1.00 121.80 ? 49  ASP B C   1 
ATOM   1139 O  O   . ASP B 1 52 ? -13.090 21.066  37.177  1.00 110.52 ? 49  ASP B O   1 
ATOM   1140 C  CB  . ASP B 1 52 ? -14.641 23.075  38.534  1.00 126.33 ? 49  ASP B CB  1 
ATOM   1141 C  CG  . ASP B 1 52 ? -16.031 22.939  37.919  1.00 118.95 ? 49  ASP B CG  1 
ATOM   1142 O  OD1 . ASP B 1 52 ? -16.378 21.841  37.434  1.00 118.30 ? 49  ASP B OD1 1 
ATOM   1143 O  OD2 . ASP B 1 52 ? -16.781 23.937  37.920  1.00 111.35 ? 49  ASP B OD2 1 
ATOM   1144 N  N   . PRO B 1 53 ? -14.224 19.474  38.324  1.00 120.63 ? 50  PRO B N   1 
ATOM   1145 C  CA  . PRO B 1 53 ? -13.873 18.400  37.387  1.00 113.41 ? 50  PRO B CA  1 
ATOM   1146 C  C   . PRO B 1 53 ? -14.870 18.278  36.232  1.00 95.13  ? 50  PRO B C   1 
ATOM   1147 O  O   . PRO B 1 53 ? -16.016 17.884  36.453  1.00 94.94  ? 50  PRO B O   1 
ATOM   1148 C  CB  . PRO B 1 53 ? -13.899 17.154  38.277  1.00 127.77 ? 50  PRO B CB  1 
ATOM   1149 C  CG  . PRO B 1 53 ? -14.985 17.444  39.270  1.00 122.27 ? 50  PRO B CG  1 
ATOM   1150 C  CD  . PRO B 1 53 ? -15.042 18.958  39.440  1.00 118.08 ? 50  PRO B CD  1 
ATOM   1151 N  N   . ASP B 1 54 ? -14.438 18.629  35.022  1.00 95.52  ? 51  ASP B N   1 
ATOM   1152 C  CA  . ASP B 1 54 ? -15.290 18.544  33.837  1.00 94.06  ? 51  ASP B CA  1 
ATOM   1153 C  C   . ASP B 1 54 ? -14.804 17.418  32.924  1.00 94.54  ? 51  ASP B C   1 
ATOM   1154 O  O   . ASP B 1 54 ? -14.242 17.652  31.853  1.00 91.23  ? 51  ASP B O   1 
ATOM   1155 C  CB  . ASP B 1 54 ? -15.320 19.888  33.099  1.00 83.95  ? 51  ASP B CB  1 
ATOM   1156 C  CG  . ASP B 1 54 ? -14.581 20.978  33.850  1.00 91.00  ? 51  ASP B CG  1 
ATOM   1157 O  OD1 . ASP B 1 54 ? -14.830 21.120  35.066  1.00 93.90  ? 51  ASP B OD1 1 
ATOM   1158 O  OD2 . ASP B 1 54 ? -13.752 21.685  33.237  1.00 90.30  ? 51  ASP B OD2 1 
ATOM   1159 N  N   . MET B 1 55 ? -15.032 16.184  33.363  1.00 92.49  ? 52  MET B N   1 
ATOM   1160 C  CA  . MET B 1 55 ? -14.665 15.018  32.575  1.00 88.52  ? 52  MET B CA  1 
ATOM   1161 C  C   . MET B 1 55 ? -15.569 14.929  31.353  1.00 90.67  ? 52  MET B C   1 
ATOM   1162 O  O   . MET B 1 55 ? -15.161 14.417  30.316  1.00 86.76  ? 52  MET B O   1 
ATOM   1163 C  CB  . MET B 1 55 ? -14.764 13.731  33.408  1.00 82.73  ? 52  MET B CB  1 
ATOM   1164 C  CG  . MET B 1 55 ? -13.655 13.559  34.439  1.00 86.30  ? 52  MET B CG  1 
ATOM   1165 S  SD  . MET B 1 55 ? -12.023 13.442  33.679  1.00 106.60 ? 52  MET B SD  1 
ATOM   1166 C  CE  . MET B 1 55 ? -10.966 13.487  35.121  1.00 101.36 ? 52  MET B CE  1 
ATOM   1167 N  N   . VAL B 1 56 ? -16.792 15.438  31.468  1.00 96.14  ? 53  VAL B N   1 
ATOM   1168 C  CA  . VAL B 1 56 ? -17.769 15.267  30.397  1.00 88.85  ? 53  VAL B CA  1 
ATOM   1169 C  C   . VAL B 1 56 ? -17.499 16.226  29.233  1.00 78.41  ? 53  VAL B C   1 
ATOM   1170 O  O   . VAL B 1 56 ? -17.594 15.833  28.071  1.00 73.40  ? 53  VAL B O   1 
ATOM   1171 C  CB  . VAL B 1 56 ? -19.226 15.463  30.908  1.00 74.24  ? 53  VAL B CB  1 
ATOM   1172 C  CG1 . VAL B 1 56 ? -19.590 16.942  31.007  1.00 75.43  ? 53  VAL B CG1 1 
ATOM   1173 C  CG2 . VAL B 1 56 ? -20.205 14.732  29.998  1.00 65.56  ? 53  VAL B CG2 1 
ATOM   1174 N  N   . ASP B 1 57 ? -17.154 17.473  29.545  1.00 77.37  ? 54  ASP B N   1 
ATOM   1175 C  CA  . ASP B 1 57 ? -16.954 18.491  28.516  1.00 83.05  ? 54  ASP B CA  1 
ATOM   1176 C  C   . ASP B 1 57 ? -15.722 18.208  27.662  1.00 77.62  ? 54  ASP B C   1 
ATOM   1177 O  O   . ASP B 1 57 ? -15.765 18.344  26.439  1.00 59.02  ? 54  ASP B O   1 
ATOM   1178 C  CB  . ASP B 1 57 ? -16.830 19.881  29.148  1.00 82.85  ? 54  ASP B CB  1 
ATOM   1179 C  CG  . ASP B 1 57 ? -18.175 20.486  29.499  1.00 80.86  ? 54  ASP B CG  1 
ATOM   1180 O  OD1 . ASP B 1 57 ? -18.836 21.030  28.589  1.00 81.93  ? 54  ASP B OD1 1 
ATOM   1181 O  OD2 . ASP B 1 57 ? -18.567 20.427  30.682  1.00 71.91  ? 54  ASP B OD2 1 
ATOM   1182 N  N   . VAL B 1 58 ? -14.626 17.828  28.310  1.00 82.37  ? 55  VAL B N   1 
ATOM   1183 C  CA  . VAL B 1 58 ? -13.396 17.505  27.596  1.00 76.60  ? 55  VAL B CA  1 
ATOM   1184 C  C   . VAL B 1 58 ? -13.587 16.243  26.757  1.00 75.45  ? 55  VAL B C   1 
ATOM   1185 O  O   . VAL B 1 58 ? -13.062 16.142  25.648  1.00 78.55  ? 55  VAL B O   1 
ATOM   1186 C  CB  . VAL B 1 58 ? -12.204 17.315  28.567  1.00 75.90  ? 55  VAL B CB  1 
ATOM   1187 C  CG1 . VAL B 1 58 ? -12.451 16.152  29.523  1.00 75.68  ? 55  VAL B CG1 1 
ATOM   1188 C  CG2 . VAL B 1 58 ? -10.910 17.108  27.791  1.00 82.09  ? 55  VAL B CG2 1 
ATOM   1189 N  N   . PHE B 1 59 ? -14.338 15.283  27.291  1.00 72.28  ? 56  PHE B N   1 
ATOM   1190 C  CA  . PHE B 1 59 ? -14.645 14.061  26.556  1.00 67.59  ? 56  PHE B CA  1 
ATOM   1191 C  C   . PHE B 1 59 ? -15.563 14.367  25.382  1.00 65.98  ? 56  PHE B C   1 
ATOM   1192 O  O   . PHE B 1 59 ? -15.404 13.806  24.298  1.00 60.36  ? 56  PHE B O   1 
ATOM   1193 C  CB  . PHE B 1 59 ? -15.301 13.018  27.465  1.00 68.00  ? 56  PHE B CB  1 
ATOM   1194 C  CG  . PHE B 1 59 ? -14.329 12.049  28.088  1.00 73.50  ? 56  PHE B CG  1 
ATOM   1195 C  CD1 . PHE B 1 59 ? -13.400 12.473  29.026  1.00 77.04  ? 56  PHE B CD1 1 
ATOM   1196 C  CD2 . PHE B 1 59 ? -14.353 10.709  27.741  1.00 64.84  ? 56  PHE B CD2 1 
ATOM   1197 C  CE1 . PHE B 1 59 ? -12.513 11.580  29.600  1.00 74.39  ? 56  PHE B CE1 1 
ATOM   1198 C  CE2 . PHE B 1 59 ? -13.469 9.812   28.311  1.00 67.97  ? 56  PHE B CE2 1 
ATOM   1199 C  CZ  . PHE B 1 59 ? -12.549 10.247  29.241  1.00 70.68  ? 56  PHE B CZ  1 
ATOM   1200 N  N   . MET B 1 60 ? -16.523 15.259  25.605  1.00 59.16  ? 57  MET B N   1 
ATOM   1201 C  CA  . MET B 1 60 ? -17.497 15.607  24.577  1.00 63.56  ? 57  MET B CA  1 
ATOM   1202 C  C   . MET B 1 60 ? -16.802 16.138  23.333  1.00 55.50  ? 57  MET B C   1 
ATOM   1203 O  O   . MET B 1 60 ? -17.156 15.777  22.214  1.00 56.26  ? 57  MET B O   1 
ATOM   1204 C  CB  . MET B 1 60 ? -18.487 16.648  25.100  1.00 64.51  ? 57  MET B CB  1 
ATOM   1205 C  CG  . MET B 1 60 ? -19.795 16.669  24.349  1.00 44.85  ? 57  MET B CG  1 
ATOM   1206 S  SD  . MET B 1 60 ? -20.734 15.163  24.654  1.00 48.62  ? 57  MET B SD  1 
ATOM   1207 C  CE  . MET B 1 60 ? -22.052 15.357  23.466  1.00 41.55  ? 57  MET B CE  1 
ATOM   1208 N  N   . ASP B 1 61 ? -15.805 16.990  23.539  1.00 59.18  ? 58  ASP B N   1 
ATOM   1209 C  CA  . ASP B 1 61 ? -15.061 17.579  22.434  1.00 69.60  ? 58  ASP B CA  1 
ATOM   1210 C  C   . ASP B 1 61 ? -14.285 16.516  21.664  1.00 67.88  ? 58  ASP B C   1 
ATOM   1211 O  O   . ASP B 1 61 ? -14.176 16.579  20.440  1.00 67.37  ? 58  ASP B O   1 
ATOM   1212 C  CB  . ASP B 1 61 ? -14.102 18.655  22.951  1.00 73.73  ? 58  ASP B CB  1 
ATOM   1213 C  CG  . ASP B 1 61 ? -14.806 19.715  23.777  1.00 86.48  ? 58  ASP B CG  1 
ATOM   1214 O  OD1 . ASP B 1 61 ? -16.031 19.890  23.607  1.00 93.09  ? 58  ASP B OD1 1 
ATOM   1215 O  OD2 . ASP B 1 61 ? -14.133 20.375  24.597  1.00 88.02  ? 58  ASP B OD2 1 
ATOM   1216 N  N   . HIS B 1 62 ? -13.752 15.537  22.388  1.00 67.68  ? 59  HIS B N   1 
ATOM   1217 C  CA  . HIS B 1 62 ? -12.939 14.487  21.782  1.00 57.37  ? 59  HIS B CA  1 
ATOM   1218 C  C   . HIS B 1 62 ? -13.779 13.426  21.082  1.00 44.56  ? 59  HIS B C   1 
ATOM   1219 O  O   . HIS B 1 62 ? -13.389 12.917  20.032  1.00 55.03  ? 59  HIS B O   1 
ATOM   1220 C  CB  . HIS B 1 62 ? -12.060 13.817  22.841  1.00 66.00  ? 59  HIS B CB  1 
ATOM   1221 C  CG  . HIS B 1 62 ? -10.738 14.488  23.043  1.00 70.88  ? 59  HIS B CG  1 
ATOM   1222 N  ND1 . HIS B 1 62 ? -10.613 15.731  23.624  1.00 73.56  ? 59  HIS B ND1 1 
ATOM   1223 C  CD2 . HIS B 1 62 ? -9.480  14.086  22.740  1.00 77.46  ? 59  HIS B CD2 1 
ATOM   1224 C  CE1 . HIS B 1 62 ? -9.336  16.067  23.671  1.00 81.72  ? 59  HIS B CE1 1 
ATOM   1225 N  NE2 . HIS B 1 62 ? -8.627  15.086  23.142  1.00 85.34  ? 59  HIS B NE2 1 
ATOM   1226 N  N   . LEU B 1 63 ? -14.928 13.097  21.666  1.00 44.84  ? 60  LEU B N   1 
ATOM   1227 C  CA  . LEU B 1 63 ? -15.740 11.981  21.187  1.00 33.62  ? 60  LEU B CA  1 
ATOM   1228 C  C   . LEU B 1 63 ? -16.820 12.404  20.193  1.00 33.22  ? 60  LEU B C   1 
ATOM   1229 O  O   . LEU B 1 63 ? -17.146 11.651  19.276  1.00 28.29  ? 60  LEU B O   1 
ATOM   1230 C  CB  . LEU B 1 63 ? -16.391 11.262  22.372  1.00 37.33  ? 60  LEU B CB  1 
ATOM   1231 C  CG  . LEU B 1 63 ? -15.446 10.706  23.443  1.00 49.18  ? 60  LEU B CG  1 
ATOM   1232 C  CD1 . LEU B 1 63 ? -16.238 10.070  24.581  1.00 46.64  ? 60  LEU B CD1 1 
ATOM   1233 C  CD2 . LEU B 1 63 ? -14.466 9.709   22.847  1.00 44.69  ? 60  LEU B CD2 1 
ATOM   1234 N  N   . ASP B 1 64 ? -17.381 13.597  20.379  1.00 40.19  ? 61  ASP B N   1 
ATOM   1235 C  CA  . ASP B 1 64 ? -18.458 14.080  19.515  1.00 39.72  ? 61  ASP B CA  1 
ATOM   1236 C  C   . ASP B 1 64 ? -17.914 14.604  18.187  1.00 44.28  ? 61  ASP B C   1 
ATOM   1237 O  O   . ASP B 1 64 ? -17.748 15.811  17.998  1.00 33.97  ? 61  ASP B O   1 
ATOM   1238 C  CB  . ASP B 1 64 ? -19.260 15.176  20.220  1.00 41.80  ? 61  ASP B CB  1 
ATOM   1239 C  CG  . ASP B 1 64 ? -20.500 15.581  19.449  1.00 40.28  ? 61  ASP B CG  1 
ATOM   1240 O  OD1 . ASP B 1 64 ? -20.970 14.785  18.612  1.00 35.77  ? 61  ASP B OD1 1 
ATOM   1241 O  OD2 . ASP B 1 64 ? -21.008 16.696  19.685  1.00 42.94  ? 61  ASP B OD2 1 
ATOM   1242 N  N   . ILE B 1 65 ? -17.661 13.681  17.266  1.00 35.07  ? 62  ILE B N   1 
ATOM   1243 C  CA  . ILE B 1 65 ? -17.036 14.000  15.987  1.00 44.34  ? 62  ILE B CA  1 
ATOM   1244 C  C   . ILE B 1 65 ? -17.883 14.949  15.143  1.00 39.31  ? 62  ILE B C   1 
ATOM   1245 O  O   . ILE B 1 65 ? -17.390 15.965  14.654  1.00 50.82  ? 62  ILE B O   1 
ATOM   1246 C  CB  . ILE B 1 65 ? -16.774 12.717  15.169  1.00 44.88  ? 62  ILE B CB  1 
ATOM   1247 C  CG1 . ILE B 1 65 ? -15.971 11.702  15.989  1.00 51.52  ? 62  ILE B CG1 1 
ATOM   1248 C  CG2 . ILE B 1 65 ? -16.048 13.040  13.871  1.00 50.23  ? 62  ILE B CG2 1 
ATOM   1249 C  CD1 . ILE B 1 65 ? -14.637 12.218  16.503  1.00 43.73  ? 62  ILE B CD1 1 
ATOM   1250 N  N   . ASP B 1 66 ? -19.156 14.608  14.972  1.00 42.21  ? 63  ASP B N   1 
ATOM   1251 C  CA  . ASP B 1 66 ? -20.049 15.375  14.106  1.00 40.03  ? 63  ASP B CA  1 
ATOM   1252 C  C   . ASP B 1 66 ? -20.611 16.628  14.786  1.00 46.93  ? 63  ASP B C   1 
ATOM   1253 O  O   . ASP B 1 66 ? -21.399 17.361  14.188  1.00 50.92  ? 63  ASP B O   1 
ATOM   1254 C  CB  . ASP B 1 66 ? -21.199 14.485  13.624  1.00 41.93  ? 63  ASP B CB  1 
ATOM   1255 C  CG  . ASP B 1 66 ? -21.901 13.774  14.760  1.00 35.71  ? 63  ASP B CG  1 
ATOM   1256 O  OD1 . ASP B 1 66 ? -21.805 14.254  15.906  1.00 40.27  ? 63  ASP B OD1 1 
ATOM   1257 O  OD2 . ASP B 1 66 ? -22.548 12.736  14.509  1.00 41.73  ? 63  ASP B OD2 1 
ATOM   1258 N  N   . HIS B 1 67 ? -20.212 16.857  16.035  1.00 45.28  ? 64  HIS B N   1 
ATOM   1259 C  CA  . HIS B 1 67 ? -20.599 18.055  16.784  1.00 42.63  ? 64  HIS B CA  1 
ATOM   1260 C  C   . HIS B 1 67 ? -22.108 18.173  16.995  1.00 39.87  ? 64  HIS B C   1 
ATOM   1261 O  O   . HIS B 1 67 ? -22.620 19.275  17.192  1.00 55.02  ? 64  HIS B O   1 
ATOM   1262 C  CB  . HIS B 1 67 ? -20.095 19.318  16.077  1.00 51.94  ? 64  HIS B CB  1 
ATOM   1263 C  CG  . HIS B 1 67 ? -18.632 19.293  15.760  1.00 62.63  ? 64  HIS B CG  1 
ATOM   1264 N  ND1 . HIS B 1 67 ? -17.660 19.346  16.733  1.00 56.71  ? 64  HIS B ND1 1 
ATOM   1265 C  CD2 . HIS B 1 67 ? -17.978 19.234  14.575  1.00 54.71  ? 64  HIS B CD2 1 
ATOM   1266 C  CE1 . HIS B 1 67 ? -16.469 19.313  16.166  1.00 51.58  ? 64  HIS B CE1 1 
ATOM   1267 N  NE2 . HIS B 1 67 ? -16.632 19.246  14.856  1.00 60.29  ? 64  HIS B NE2 1 
ATOM   1268 N  N   . ASN B 1 68 ? -22.819 17.049  16.963  1.00 39.45  ? 65  ASN B N   1 
ATOM   1269 C  CA  . ASN B 1 68 ? -24.262 17.061  17.189  1.00 33.17  ? 65  ASN B CA  1 
ATOM   1270 C  C   . ASN B 1 68 ? -24.593 16.976  18.682  1.00 37.31  ? 65  ASN B C   1 
ATOM   1271 O  O   . ASN B 1 68 ? -25.738 16.734  19.062  1.00 42.81  ? 65  ASN B O   1 
ATOM   1272 C  CB  . ASN B 1 68 ? -24.935 15.917  16.421  1.00 35.03  ? 65  ASN B CB  1 
ATOM   1273 C  CG  . ASN B 1 68 ? -24.699 14.560  17.056  1.00 43.13  ? 65  ASN B CG  1 
ATOM   1274 O  OD1 . ASN B 1 68 ? -23.765 14.375  17.833  1.00 33.26  ? 65  ASN B OD1 1 
ATOM   1275 N  ND2 . ASN B 1 68 ? -25.553 13.599  16.724  1.00 40.78  ? 65  ASN B ND2 1 
ATOM   1276 N  N   . LYS B 1 69 ? -23.576 17.173  19.517  1.00 37.24  ? 66  LYS B N   1 
ATOM   1277 C  CA  . LYS B 1 69 ? -23.737 17.211  20.970  1.00 45.81  ? 66  LYS B CA  1 
ATOM   1278 C  C   . LYS B 1 69 ? -24.375 15.936  21.520  1.00 48.37  ? 66  LYS B C   1 
ATOM   1279 O  O   . LYS B 1 69 ? -25.028 15.959  22.564  1.00 49.76  ? 66  LYS B O   1 
ATOM   1280 C  CB  . LYS B 1 69 ? -24.564 18.432  21.377  1.00 46.80  ? 66  LYS B CB  1 
ATOM   1281 C  CG  . LYS B 1 69 ? -23.962 19.748  20.916  1.00 46.49  ? 66  LYS B CG  1 
ATOM   1282 C  CD  . LYS B 1 69 ? -24.882 20.918  21.205  1.00 60.68  ? 66  LYS B CD  1 
ATOM   1283 C  CE  . LYS B 1 69 ? -24.487 22.137  20.387  1.00 76.61  ? 66  LYS B CE  1 
ATOM   1284 N  NZ  . LYS B 1 69 ? -25.413 23.282  20.600  1.00 73.33  ? 66  LYS B NZ  1 
ATOM   1285 N  N   . LYS B 1 70 ? -24.180 14.829  20.809  1.00 39.01  ? 67  LYS B N   1 
ATOM   1286 C  CA  . LYS B 1 70 ? -24.599 13.515  21.283  1.00 35.20  ? 67  LYS B CA  1 
ATOM   1287 C  C   . LYS B 1 70 ? -23.512 12.503  20.943  1.00 41.84  ? 67  LYS B C   1 
ATOM   1288 O  O   . LYS B 1 70 ? -22.790 12.676  19.965  1.00 34.75  ? 67  LYS B O   1 
ATOM   1289 C  CB  . LYS B 1 70 ? -25.928 13.085  20.653  1.00 41.87  ? 67  LYS B CB  1 
ATOM   1290 C  CG  . LYS B 1 70 ? -26.907 14.213  20.363  1.00 48.04  ? 67  LYS B CG  1 
ATOM   1291 C  CD  . LYS B 1 70 ? -28.338 13.781  20.614  1.00 51.00  ? 67  LYS B CD  1 
ATOM   1292 C  CE  . LYS B 1 70 ? -29.314 14.589  19.779  1.00 61.62  ? 67  LYS B CE  1 
ATOM   1293 N  NZ  . LYS B 1 70 ? -29.557 13.958  18.453  1.00 68.82  ? 67  LYS B NZ  1 
ATOM   1294 N  N   . ILE B 1 71 ? -23.394 11.453  21.750  1.00 35.42  ? 68  ILE B N   1 
ATOM   1295 C  CA  . ILE B 1 71 ? -22.417 10.400  21.492  1.00 29.71  ? 68  ILE B CA  1 
ATOM   1296 C  C   . ILE B 1 71 ? -23.123 9.131   21.028  1.00 30.61  ? 68  ILE B C   1 
ATOM   1297 O  O   . ILE B 1 71 ? -23.796 8.465   21.810  1.00 38.96  ? 68  ILE B O   1 
ATOM   1298 C  CB  . ILE B 1 71 ? -21.572 10.083  22.742  1.00 41.31  ? 68  ILE B CB  1 
ATOM   1299 C  CG1 . ILE B 1 71 ? -20.993 11.366  23.349  1.00 26.97  ? 68  ILE B CG1 1 
ATOM   1300 C  CG2 . ILE B 1 71 ? -20.456 9.102   22.401  1.00 32.87  ? 68  ILE B CG2 1 
ATOM   1301 C  CD1 . ILE B 1 71 ? -20.116 12.165  22.410  1.00 36.43  ? 68  ILE B CD1 1 
ATOM   1302 N  N   . ASP B 1 72 ? -22.973 8.804   19.749  1.00 30.93  ? 69  ASP B N   1 
ATOM   1303 C  CA  . ASP B 1 72 ? -23.520 7.559   19.225  1.00 33.84  ? 69  ASP B CA  1 
ATOM   1304 C  C   . ASP B 1 72 ? -22.608 6.398   19.611  1.00 29.79  ? 69  ASP B C   1 
ATOM   1305 O  O   . ASP B 1 72 ? -21.561 6.598   20.228  1.00 31.27  ? 69  ASP B O   1 
ATOM   1306 C  CB  . ASP B 1 72 ? -23.699 7.635   17.704  1.00 41.80  ? 69  ASP B CB  1 
ATOM   1307 C  CG  . ASP B 1 72 ? -22.449 8.103   16.983  1.00 38.29  ? 69  ASP B CG  1 
ATOM   1308 O  OD1 . ASP B 1 72 ? -21.373 7.504   17.188  1.00 34.05  ? 69  ASP B OD1 1 
ATOM   1309 O  OD2 . ASP B 1 72 ? -22.547 9.079   16.208  1.00 46.14  ? 69  ASP B OD2 1 
ATOM   1310 N  N   . PHE B 1 73 ? -23.009 5.186   19.245  1.00 29.66  ? 70  PHE B N   1 
ATOM   1311 C  CA  . PHE B 1 73 ? -22.283 3.989   19.648  1.00 31.90  ? 70  PHE B CA  1 
ATOM   1312 C  C   . PHE B 1 73 ? -20.883 3.946   19.039  1.00 31.20  ? 70  PHE B C   1 
ATOM   1313 O  O   . PHE B 1 73 ? -19.918 3.597   19.717  1.00 28.62  ? 70  PHE B O   1 
ATOM   1314 C  CB  . PHE B 1 73 ? -23.069 2.738   19.253  1.00 35.35  ? 70  PHE B CB  1 
ATOM   1315 C  CG  . PHE B 1 73 ? -22.570 1.475   19.899  1.00 34.90  ? 70  PHE B CG  1 
ATOM   1316 C  CD1 . PHE B 1 73 ? -22.518 1.362   21.280  1.00 32.72  ? 70  PHE B CD1 1 
ATOM   1317 C  CD2 . PHE B 1 73 ? -22.173 0.395   19.129  1.00 35.66  ? 70  PHE B CD2 1 
ATOM   1318 C  CE1 . PHE B 1 73 ? -22.066 0.202   21.878  1.00 37.82  ? 70  PHE B CE1 1 
ATOM   1319 C  CE2 . PHE B 1 73 ? -21.720 -0.771  19.724  1.00 38.30  ? 70  PHE B CE2 1 
ATOM   1320 C  CZ  . PHE B 1 73 ? -21.667 -0.866  21.099  1.00 33.61  ? 70  PHE B CZ  1 
ATOM   1321 N  N   . THR B 1 74 ? -20.771 4.308   17.765  1.00 28.98  ? 71  THR B N   1 
ATOM   1322 C  CA  . THR B 1 74 ? -19.481 4.281   17.081  1.00 30.78  ? 71  THR B CA  1 
ATOM   1323 C  C   . THR B 1 74 ? -18.512 5.268   17.733  1.00 32.60  ? 71  THR B C   1 
ATOM   1324 O  O   . THR B 1 74 ? -17.331 4.965   17.915  1.00 24.88  ? 71  THR B O   1 
ATOM   1325 C  CB  . THR B 1 74 ? -19.624 4.611   15.581  1.00 30.50  ? 71  THR B CB  1 
ATOM   1326 O  OG1 . THR B 1 74 ? -20.573 3.720   14.981  1.00 29.00  ? 71  THR B OG1 1 
ATOM   1327 C  CG2 . THR B 1 74 ? -18.286 4.470   14.865  1.00 24.91  ? 71  THR B CG2 1 
ATOM   1328 N  N   . GLU B 1 75 ? -19.023 6.445   18.085  1.00 29.94  ? 72  GLU B N   1 
ATOM   1329 C  CA  . GLU B 1 75 ? -18.239 7.453   18.791  1.00 27.36  ? 72  GLU B CA  1 
ATOM   1330 C  C   . GLU B 1 75 ? -17.825 6.946   20.170  1.00 29.88  ? 72  GLU B C   1 
ATOM   1331 O  O   . GLU B 1 75 ? -16.723 7.223   20.642  1.00 25.53  ? 72  GLU B O   1 
ATOM   1332 C  CB  . GLU B 1 75 ? -19.034 8.757   18.924  1.00 31.84  ? 72  GLU B CB  1 
ATOM   1333 C  CG  . GLU B 1 75 ? -19.120 9.578   17.635  1.00 31.26  ? 72  GLU B CG  1 
ATOM   1334 C  CD  . GLU B 1 75 ? -20.081 10.757  17.733  1.00 37.71  ? 72  GLU B CD  1 
ATOM   1335 O  OE1 . GLU B 1 75 ? -21.118 10.636  18.419  1.00 34.45  ? 72  GLU B OE1 1 
ATOM   1336 O  OE2 . GLU B 1 75 ? -19.799 11.809  17.119  1.00 37.72  ? 72  GLU B OE2 1 
ATOM   1337 N  N   . PHE B 1 76 ? -18.719 6.197   20.806  1.00 33.19  ? 73  PHE B N   1 
ATOM   1338 C  CA  . PHE B 1 76 ? -18.447 5.608   22.110  1.00 25.05  ? 73  PHE B CA  1 
ATOM   1339 C  C   . PHE B 1 76 ? -17.369 4.536   21.991  1.00 24.91  ? 73  PHE B C   1 
ATOM   1340 O  O   . PHE B 1 76 ? -16.444 4.483   22.802  1.00 25.78  ? 73  PHE B O   1 
ATOM   1341 C  CB  . PHE B 1 76 ? -19.738 5.031   22.702  1.00 24.66  ? 73  PHE B CB  1 
ATOM   1342 C  CG  . PHE B 1 76 ? -19.523 4.093   23.855  1.00 31.50  ? 73  PHE B CG  1 
ATOM   1343 C  CD1 . PHE B 1 76 ? -19.314 4.579   25.133  1.00 26.21  ? 73  PHE B CD1 1 
ATOM   1344 C  CD2 . PHE B 1 76 ? -19.557 2.723   23.662  1.00 35.84  ? 73  PHE B CD2 1 
ATOM   1345 C  CE1 . PHE B 1 76 ? -19.130 3.715   26.196  1.00 30.94  ? 73  PHE B CE1 1 
ATOM   1346 C  CE2 . PHE B 1 76 ? -19.373 1.855   24.720  1.00 37.28  ? 73  PHE B CE2 1 
ATOM   1347 C  CZ  . PHE B 1 76 ? -19.159 2.352   25.989  1.00 31.18  ? 73  PHE B CZ  1 
ATOM   1348 N  N   . LEU B 1 77 ? -17.474 3.702   20.961  1.00 27.47  ? 74  LEU B N   1 
ATOM   1349 C  CA  . LEU B 1 77 ? -16.523 2.613   20.766  1.00 28.64  ? 74  LEU B CA  1 
ATOM   1350 C  C   . LEU B 1 77 ? -15.111 3.141   20.539  1.00 31.10  ? 74  LEU B C   1 
ATOM   1351 O  O   . LEU B 1 77 ? -14.133 2.435   20.793  1.00 31.29  ? 74  LEU B O   1 
ATOM   1352 C  CB  . LEU B 1 77 ? -16.942 1.730   19.588  1.00 25.83  ? 74  LEU B CB  1 
ATOM   1353 C  CG  . LEU B 1 77 ? -18.148 0.807   19.792  1.00 31.84  ? 74  LEU B CG  1 
ATOM   1354 C  CD1 . LEU B 1 77 ? -18.347 -0.053  18.557  1.00 30.15  ? 74  LEU B CD1 1 
ATOM   1355 C  CD2 . LEU B 1 77 ? -18.004 -0.073  21.035  1.00 30.65  ? 74  LEU B CD2 1 
ATOM   1356 N  N   . LEU B 1 78 ? -15.005 4.382   20.075  1.00 29.85  ? 75  LEU B N   1 
ATOM   1357 C  CA  . LEU B 1 78 ? -13.702 5.004   19.882  1.00 26.47  ? 75  LEU B CA  1 
ATOM   1358 C  C   . LEU B 1 78 ? -13.011 5.142   21.231  1.00 32.75  ? 75  LEU B C   1 
ATOM   1359 O  O   . LEU B 1 78 ? -11.812 4.890   21.359  1.00 29.55  ? 75  LEU B O   1 
ATOM   1360 C  CB  . LEU B 1 78 ? -13.846 6.374   19.218  1.00 33.61  ? 75  LEU B CB  1 
ATOM   1361 C  CG  . LEU B 1 78 ? -12.736 6.909   18.300  1.00 37.89  ? 75  LEU B CG  1 
ATOM   1362 C  CD1 . LEU B 1 78 ? -12.416 8.353   18.660  1.00 36.61  ? 75  LEU B CD1 1 
ATOM   1363 C  CD2 . LEU B 1 78 ? -11.463 6.066   18.312  1.00 40.16  ? 75  LEU B CD2 1 
ATOM   1364 N  N   . MET B 1 79 ? -13.784 5.534   22.238  1.00 33.35  ? 76  MET B N   1 
ATOM   1365 C  CA  . MET B 1 79 ? -13.279 5.632   23.599  1.00 21.87  ? 76  MET B CA  1 
ATOM   1366 C  C   . MET B 1 79 ? -12.797 4.265   24.071  1.00 20.31  ? 76  MET B C   1 
ATOM   1367 O  O   . MET B 1 79 ? -11.680 4.124   24.568  1.00 20.72  ? 76  MET B O   1 
ATOM   1368 C  CB  . MET B 1 79 ? -14.363 6.165   24.536  1.00 21.69  ? 76  MET B CB  1 
ATOM   1369 C  CG  . MET B 1 79 ? -13.873 6.498   25.938  1.00 36.46  ? 76  MET B CG  1 
ATOM   1370 S  SD  . MET B 1 79 ? -15.185 6.456   27.173  1.00 49.42  ? 76  MET B SD  1 
ATOM   1371 C  CE  . MET B 1 79 ? -15.502 4.695   27.266  1.00 37.98  ? 76  MET B CE  1 
ATOM   1372 N  N   . VAL B 1 80 ? -13.645 3.258   23.893  1.00 21.34  ? 77  VAL B N   1 
ATOM   1373 C  CA  . VAL B 1 80 ? -13.341 1.911   24.358  1.00 23.00  ? 77  VAL B CA  1 
ATOM   1374 C  C   . VAL B 1 80 ? -12.104 1.377   23.643  1.00 24.20  ? 77  VAL B C   1 
ATOM   1375 O  O   . VAL B 1 80 ? -11.275 0.694   24.245  1.00 27.57  ? 77  VAL B O   1 
ATOM   1376 C  CB  . VAL B 1 80 ? -14.526 0.953   24.131  1.00 20.90  ? 77  VAL B CB  1 
ATOM   1377 C  CG1 . VAL B 1 80 ? -14.229 -0.422  24.721  1.00 23.82  ? 77  VAL B CG1 1 
ATOM   1378 C  CG2 . VAL B 1 80 ? -15.793 1.524   24.746  1.00 21.06  ? 77  VAL B CG2 1 
ATOM   1379 N  N   . PHE B 1 81 ? -11.983 1.703   22.360  1.00 27.68  ? 78  PHE B N   1 
ATOM   1380 C  CA  . PHE B 1 81 ? -10.829 1.301   21.565  1.00 23.92  ? 78  PHE B CA  1 
ATOM   1381 C  C   . PHE B 1 81 ? -9.537  1.869   22.143  1.00 22.16  ? 78  PHE B C   1 
ATOM   1382 O  O   . PHE B 1 81 ? -8.556  1.149   22.310  1.00 26.37  ? 78  PHE B O   1 
ATOM   1383 C  CB  . PHE B 1 81 ? -11.000 1.754   20.112  1.00 27.89  ? 78  PHE B CB  1 
ATOM   1384 C  CG  . PHE B 1 81 ? -9.776  1.550   19.260  1.00 23.80  ? 78  PHE B CG  1 
ATOM   1385 C  CD1 . PHE B 1 81 ? -9.496  0.309   18.710  1.00 27.56  ? 78  PHE B CD1 1 
ATOM   1386 C  CD2 . PHE B 1 81 ? -8.912  2.602   19.003  1.00 28.46  ? 78  PHE B CD2 1 
ATOM   1387 C  CE1 . PHE B 1 81 ? -8.371  0.121   17.924  1.00 31.59  ? 78  PHE B CE1 1 
ATOM   1388 C  CE2 . PHE B 1 81 ? -7.789  2.421   18.218  1.00 27.44  ? 78  PHE B CE2 1 
ATOM   1389 C  CZ  . PHE B 1 81 ? -7.516  1.179   17.679  1.00 25.11  ? 78  PHE B CZ  1 
ATOM   1390 N  N   . LYS B 1 82 ? -9.546  3.164   22.443  1.00 26.24  ? 79  LYS B N   1 
ATOM   1391 C  CA  . LYS B 1 82 ? -8.377  3.833   23.006  1.00 27.35  ? 79  LYS B CA  1 
ATOM   1392 C  C   . LYS B 1 82 ? -7.962  3.236   24.350  1.00 27.61  ? 79  LYS B C   1 
ATOM   1393 O  O   . LYS B 1 82 ? -6.775  3.041   24.607  1.00 31.90  ? 79  LYS B O   1 
ATOM   1394 C  CB  . LYS B 1 82 ? -8.654  5.328   23.171  1.00 28.47  ? 79  LYS B CB  1 
ATOM   1395 C  CG  . LYS B 1 82 ? -8.749  6.082   21.861  1.00 26.75  ? 79  LYS B CG  1 
ATOM   1396 C  CD  . LYS B 1 82 ? -9.144  7.530   22.087  1.00 39.48  ? 79  LYS B CD  1 
ATOM   1397 C  CE  . LYS B 1 82 ? -9.250  8.288   20.777  1.00 40.26  ? 79  LYS B CE  1 
ATOM   1398 N  NZ  . LYS B 1 82 ? -7.958  8.296   20.035  1.00 44.65  ? 79  LYS B NZ  1 
ATOM   1399 N  N   . LEU B 1 83 ? -8.939  2.950   25.203  1.00 23.24  ? 80  LEU B N   1 
ATOM   1400 C  CA  . LEU B 1 83 ? -8.656  2.384   26.517  1.00 30.56  ? 80  LEU B CA  1 
ATOM   1401 C  C   . LEU B 1 83 ? -8.010  1.014   26.399  1.00 31.48  ? 80  LEU B C   1 
ATOM   1402 O  O   . LEU B 1 83 ? -7.065  0.701   27.124  1.00 28.78  ? 80  LEU B O   1 
ATOM   1403 C  CB  . LEU B 1 83 ? -9.934  2.280   27.351  1.00 36.13  ? 80  LEU B CB  1 
ATOM   1404 C  CG  . LEU B 1 83 ? -10.306 3.490   28.212  1.00 46.09  ? 80  LEU B CG  1 
ATOM   1405 C  CD1 . LEU B 1 83 ? -11.670 3.298   28.833  1.00 42.68  ? 80  LEU B CD1 1 
ATOM   1406 C  CD2 . LEU B 1 83 ? -9.264  3.740   29.298  1.00 41.86  ? 80  LEU B CD2 1 
ATOM   1407 N  N   . ALA B 1 84 ? -8.526  0.198   25.486  1.00 26.87  ? 81  ALA B N   1 
ATOM   1408 C  CA  . ALA B 1 84 ? -7.992  -1.140  25.273  1.00 23.26  ? 81  ALA B CA  1 
ATOM   1409 C  C   . ALA B 1 84 ? -6.521  -1.075  24.874  1.00 29.49  ? 81  ALA B C   1 
ATOM   1410 O  O   . ALA B 1 84 ? -5.696  -1.827  25.392  1.00 25.05  ? 81  ALA B O   1 
ATOM   1411 C  CB  . ALA B 1 84 ? -8.797  -1.867  24.214  1.00 28.29  ? 81  ALA B CB  1 
ATOM   1412 N  N   . GLN B 1 85 ? -6.200  -0.168  23.957  1.00 30.27  ? 82  GLN B N   1 
ATOM   1413 C  CA  . GLN B 1 85 ? -4.827  0.001   23.497  1.00 32.06  ? 82  GLN B CA  1 
ATOM   1414 C  C   . GLN B 1 85 ? -3.906  0.420   24.634  1.00 30.35  ? 82  GLN B C   1 
ATOM   1415 O  O   . GLN B 1 85 ? -2.809  -0.115  24.787  1.00 34.81  ? 82  GLN B O   1 
ATOM   1416 C  CB  . GLN B 1 85 ? -4.756  1.042   22.380  1.00 29.72  ? 82  GLN B CB  1 
ATOM   1417 C  CG  . GLN B 1 85 ? -5.270  0.567   21.040  1.00 34.78  ? 82  GLN B CG  1 
ATOM   1418 C  CD  . GLN B 1 85 ? -4.939  1.543   19.931  1.00 32.00  ? 82  GLN B CD  1 
ATOM   1419 O  OE1 . GLN B 1 85 ? -5.087  2.754   20.093  1.00 38.30  ? 82  GLN B OE1 1 
ATOM   1420 N  NE2 . GLN B 1 85 ? -4.470  1.023   18.804  1.00 32.67  ? 82  GLN B NE2 1 
ATOM   1421 N  N   . ALA B 1 86 ? -4.358  1.388   25.423  1.00 31.94  ? 83  ALA B N   1 
ATOM   1422 C  CA  . ALA B 1 86 ? -3.558  1.922   26.516  1.00 32.49  ? 83  ALA B CA  1 
ATOM   1423 C  C   . ALA B 1 86 ? -3.246  0.843   27.545  1.00 30.88  ? 83  ALA B C   1 
ATOM   1424 O  O   . ALA B 1 86 ? -2.090  0.645   27.916  1.00 29.29  ? 83  ALA B O   1 
ATOM   1425 C  CB  . ALA B 1 86 ? -4.275  3.084   27.174  1.00 34.71  ? 83  ALA B CB  1 
ATOM   1426 N  N   . TYR B 1 87 ? -4.279  0.140   27.996  1.00 26.47  ? 84  TYR B N   1 
ATOM   1427 C  CA  . TYR B 1 87 ? -4.110  -0.859  29.045  1.00 36.02  ? 84  TYR B CA  1 
ATOM   1428 C  C   . TYR B 1 87 ? -3.441  -2.132  28.539  1.00 36.12  ? 84  TYR B C   1 
ATOM   1429 O  O   . TYR B 1 87 ? -3.055  -2.991  29.332  1.00 36.73  ? 84  TYR B O   1 
ATOM   1430 C  CB  . TYR B 1 87 ? -5.460  -1.194  29.680  1.00 33.45  ? 84  TYR B CB  1 
ATOM   1431 C  CG  . TYR B 1 87 ? -5.856  -0.219  30.765  1.00 37.24  ? 84  TYR B CG  1 
ATOM   1432 C  CD1 . TYR B 1 87 ? -5.154  -0.165  31.962  1.00 37.09  ? 84  TYR B CD1 1 
ATOM   1433 C  CD2 . TYR B 1 87 ? -6.925  0.646   30.595  1.00 27.99  ? 84  TYR B CD2 1 
ATOM   1434 C  CE1 . TYR B 1 87 ? -5.504  0.724   32.959  1.00 33.17  ? 84  TYR B CE1 1 
ATOM   1435 C  CE2 . TYR B 1 87 ? -7.286  1.539   31.589  1.00 38.18  ? 84  TYR B CE2 1 
ATOM   1436 C  CZ  . TYR B 1 87 ? -6.570  1.573   32.769  1.00 38.12  ? 84  TYR B CZ  1 
ATOM   1437 O  OH  . TYR B 1 87 ? -6.917  2.456   33.765  1.00 36.68  ? 84  TYR B OH  1 
ATOM   1438 N  N   . TYR B 1 88 ? -3.298  -2.258  27.225  1.00 36.14  ? 85  TYR B N   1 
ATOM   1439 C  CA  . TYR B 1 88 ? -2.538  -3.366  26.667  1.00 35.10  ? 85  TYR B CA  1 
ATOM   1440 C  C   . TYR B 1 88 ? -1.052  -3.150  26.937  1.00 40.99  ? 85  TYR B C   1 
ATOM   1441 O  O   . TYR B 1 88 ? -0.270  -4.097  26.965  1.00 47.32  ? 85  TYR B O   1 
ATOM   1442 C  CB  . TYR B 1 88 ? -2.789  -3.509  25.166  1.00 32.14  ? 85  TYR B CB  1 
ATOM   1443 C  CG  . TYR B 1 88 ? -2.051  -4.671  24.541  1.00 31.09  ? 85  TYR B CG  1 
ATOM   1444 C  CD1 . TYR B 1 88 ? -2.619  -5.937  24.500  1.00 31.98  ? 85  TYR B CD1 1 
ATOM   1445 C  CD2 . TYR B 1 88 ? -0.784  -4.504  23.995  1.00 41.75  ? 85  TYR B CD2 1 
ATOM   1446 C  CE1 . TYR B 1 88 ? -1.949  -7.004  23.933  1.00 35.18  ? 85  TYR B CE1 1 
ATOM   1447 C  CE2 . TYR B 1 88 ? -0.105  -5.566  23.426  1.00 44.48  ? 85  TYR B CE2 1 
ATOM   1448 C  CZ  . TYR B 1 88 ? -0.693  -6.814  23.398  1.00 46.43  ? 85  TYR B CZ  1 
ATOM   1449 O  OH  . TYR B 1 88 ? -0.025  -7.876  22.832  1.00 56.19  ? 85  TYR B OH  1 
ATOM   1450 N  N   . GLU B 1 89 ? -0.667  -1.892  27.126  1.00 52.78  ? 86  GLU B N   1 
ATOM   1451 C  CA  . GLU B 1 89 ? 0.716   -1.557  27.438  1.00 55.60  ? 86  GLU B CA  1 
ATOM   1452 C  C   . GLU B 1 89 ? 0.978   -1.710  28.932  1.00 54.71  ? 86  GLU B C   1 
ATOM   1453 O  O   . GLU B 1 89 ? 2.100   -2.003  29.347  1.00 59.09  ? 86  GLU B O   1 
ATOM   1454 C  CB  . GLU B 1 89 ? 1.039   -0.131  26.988  1.00 56.25  ? 86  GLU B CB  1 
ATOM   1455 C  CG  . GLU B 1 89 ? 0.854   0.102   25.497  1.00 52.46  ? 86  GLU B CG  1 
ATOM   1456 C  CD  . GLU B 1 89 ? 1.776   -0.756  24.649  1.00 74.84  ? 86  GLU B CD  1 
ATOM   1457 O  OE1 . GLU B 1 89 ? 1.434   -1.019  23.476  1.00 73.09  ? 86  GLU B OE1 1 
ATOM   1458 O  OE2 . GLU B 1 89 ? 2.844   -1.165  25.152  1.00 81.05  ? 86  GLU B OE2 1 
ATOM   1459 N  N   . SER B 1 90 ? -0.063  -1.514  29.734  1.00 53.68  ? 87  SER B N   1 
ATOM   1460 C  CA  . SER B 1 90 ? 0.048   -1.635  31.183  1.00 63.52  ? 87  SER B CA  1 
ATOM   1461 C  C   . SER B 1 90 ? 0.096   -3.103  31.602  1.00 66.18  ? 87  SER B C   1 
ATOM   1462 O  O   . SER B 1 90 ? 1.117   -3.580  32.098  1.00 66.48  ? 87  SER B O   1 
ATOM   1463 C  CB  . SER B 1 90 ? -1.122  -0.927  31.869  1.00 54.07  ? 87  SER B CB  1 
ATOM   1464 O  OG  . SER B 1 90 ? -1.244  0.409   31.410  1.00 54.63  ? 87  SER B OG  1 
ATOM   1465 N  N   . THR B 1 91 ? -1.017  -3.804  31.397  1.00 56.98  ? 88  THR B N   1 
ATOM   1466 C  CA  . THR B 1 91 ? -1.121  -5.233  31.692  1.00 64.38  ? 88  THR B CA  1 
ATOM   1467 C  C   . THR B 1 91 ? -0.691  -5.555  33.121  1.00 69.41  ? 88  THR B C   1 
ATOM   1468 O  O   . THR B 1 91 ? -0.933  -6.654  33.619  1.00 65.27  ? 88  THR B O   1 
ATOM   1469 C  CB  . THR B 1 91 ? -0.273  -6.080  30.715  1.00 61.28  ? 88  THR B CB  1 
ATOM   1470 O  OG1 . THR B 1 91 ? 1.115   -5.745  30.847  1.00 60.92  ? 88  THR B OG1 1 
ATOM   1471 C  CG2 . THR B 1 91 ? -0.710  -5.833  29.295  1.00 57.19  ? 88  THR B CG2 1 
ATOM   1472 N  N   . SER C 1 4  ? -19.769 8.526   -12.547 1.00 46.36  ? 1   SER C N   1 
ATOM   1473 C  CA  . SER C 1 4  ? -18.477 7.872   -12.198 1.00 41.57  ? 1   SER C CA  1 
ATOM   1474 C  C   . SER C 1 4  ? -18.669 6.393   -11.876 1.00 31.12  ? 1   SER C C   1 
ATOM   1475 O  O   . SER C 1 4  ? -19.772 5.952   -11.550 1.00 39.87  ? 1   SER C O   1 
ATOM   1476 C  CB  . SER C 1 4  ? -17.823 8.583   -11.010 1.00 41.57  ? 1   SER C CB  1 
ATOM   1477 O  OG  . SER C 1 4  ? -17.447 9.906   -11.356 1.00 54.01  ? 1   SER C OG  1 
ATOM   1478 N  N   . THR C 1 5  ? -17.582 5.637   -11.990 1.00 37.39  ? 2   THR C N   1 
ATOM   1479 C  CA  . THR C 1 5  ? -17.552 4.237   -11.589 1.00 30.78  ? 2   THR C CA  1 
ATOM   1480 C  C   . THR C 1 5  ? -16.892 4.117   -10.224 1.00 26.31  ? 2   THR C C   1 
ATOM   1481 O  O   . THR C 1 5  ? -16.292 5.074   -9.737  1.00 25.56  ? 2   THR C O   1 
ATOM   1482 C  CB  . THR C 1 5  ? -16.782 3.374   -12.600 1.00 39.04  ? 2   THR C CB  1 
ATOM   1483 O  OG1 . THR C 1 5  ? -15.424 3.824   -12.678 1.00 35.89  ? 2   THR C OG1 1 
ATOM   1484 C  CG2 . THR C 1 5  ? -17.419 3.463   -13.973 1.00 41.54  ? 2   THR C CG2 1 
ATOM   1485 N  N   . LEU C 1 6  ? -16.994 2.941   -9.616  1.00 28.08  ? 3   LEU C N   1 
ATOM   1486 C  CA  . LEU C 1 6  ? -16.407 2.706   -8.301  1.00 23.71  ? 3   LEU C CA  1 
ATOM   1487 C  C   . LEU C 1 6  ? -14.894 2.884   -8.336  1.00 28.31  ? 3   LEU C C   1 
ATOM   1488 O  O   . LEU C 1 6  ? -14.305 3.461   -7.419  1.00 24.61  ? 3   LEU C O   1 
ATOM   1489 C  CB  . LEU C 1 6  ? -16.755 1.302   -7.805  1.00 25.16  ? 3   LEU C CB  1 
ATOM   1490 C  CG  . LEU C 1 6  ? -16.262 0.929   -6.406  1.00 28.68  ? 3   LEU C CG  1 
ATOM   1491 C  CD1 . LEU C 1 6  ? -16.853 1.850   -5.345  1.00 26.33  ? 3   LEU C CD1 1 
ATOM   1492 C  CD2 . LEU C 1 6  ? -16.593 -0.524  -6.094  1.00 30.51  ? 3   LEU C CD2 1 
ATOM   1493 N  N   . LEU C 1 7  ? -14.272 2.389   -9.401  1.00 22.72  ? 4   LEU C N   1 
ATOM   1494 C  CA  . LEU C 1 7  ? -12.821 2.453   -9.541  1.00 23.34  ? 4   LEU C CA  1 
ATOM   1495 C  C   . LEU C 1 7  ? -12.324 3.894   -9.650  1.00 26.01  ? 4   LEU C C   1 
ATOM   1496 O  O   . LEU C 1 7  ? -11.273 4.236   -9.108  1.00 24.67  ? 4   LEU C O   1 
ATOM   1497 C  CB  . LEU C 1 7  ? -12.374 1.648   -10.761 1.00 22.57  ? 4   LEU C CB  1 
ATOM   1498 C  CG  . LEU C 1 7  ? -12.445 0.127   -10.612 1.00 26.92  ? 4   LEU C CG  1 
ATOM   1499 C  CD1 . LEU C 1 7  ? -12.471 -0.543  -11.977 1.00 36.31  ? 4   LEU C CD1 1 
ATOM   1500 C  CD2 . LEU C 1 7  ? -11.269 -0.387  -9.791  1.00 28.60  ? 4   LEU C CD2 1 
ATOM   1501 N  N   . GLU C 1 8  ? -13.079 4.735   -10.352 1.00 25.79  ? 5   GLU C N   1 
ATOM   1502 C  CA  . GLU C 1 8  ? -12.737 6.150   -10.472 1.00 21.14  ? 5   GLU C CA  1 
ATOM   1503 C  C   . GLU C 1 8  ? -12.725 6.826   -9.103  1.00 24.80  ? 5   GLU C C   1 
ATOM   1504 O  O   . GLU C 1 8  ? -11.829 7.613   -8.797  1.00 26.35  ? 5   GLU C O   1 
ATOM   1505 C  CB  . GLU C 1 8  ? -13.720 6.867   -11.400 1.00 32.45  ? 5   GLU C CB  1 
ATOM   1506 C  CG  . GLU C 1 8  ? -13.546 6.528   -12.878 1.00 34.10  ? 5   GLU C CG  1 
ATOM   1507 C  CD  . GLU C 1 8  ? -14.555 7.236   -13.761 1.00 33.71  ? 5   GLU C CD  1 
ATOM   1508 O  OE1 . GLU C 1 8  ? -15.725 6.801   -13.796 1.00 33.97  ? 5   GLU C OE1 1 
ATOM   1509 O  OE2 . GLU C 1 8  ? -14.179 8.231   -14.416 1.00 42.42  ? 5   GLU C OE2 1 
ATOM   1510 N  N   . ASN C 1 9  ? -13.722 6.511   -8.283  1.00 25.42  ? 6   ASN C N   1 
ATOM   1511 C  CA  . ASN C 1 9  ? -13.802 7.056   -6.935  1.00 27.87  ? 6   ASN C CA  1 
ATOM   1512 C  C   . ASN C 1 9  ? -12.594 6.629   -6.112  1.00 23.63  ? 6   ASN C C   1 
ATOM   1513 O  O   . ASN C 1 9  ? -12.020 7.426   -5.370  1.00 21.77  ? 6   ASN C O   1 
ATOM   1514 C  CB  . ASN C 1 9  ? -15.097 6.609   -6.253  1.00 28.88  ? 6   ASN C CB  1 
ATOM   1515 C  CG  . ASN C 1 9  ? -16.332 6.984   -7.050  1.00 41.04  ? 6   ASN C CG  1 
ATOM   1516 O  OD1 . ASN C 1 9  ? -17.199 6.148   -7.303  1.00 44.01  ? 6   ASN C OD1 1 
ATOM   1517 N  ND2 . ASN C 1 9  ? -16.413 8.247   -7.457  1.00 36.27  ? 6   ASN C ND2 1 
ATOM   1518 N  N   . ILE C 1 10 ? -12.202 5.369   -6.265  1.00 22.41  ? 7   ILE C N   1 
ATOM   1519 C  CA  . ILE C 1 10 ? -11.057 4.830   -5.545  1.00 17.20  ? 7   ILE C CA  1 
ATOM   1520 C  C   . ILE C 1 10 ? -9.761  5.508   -5.973  1.00 23.04  ? 7   ILE C C   1 
ATOM   1521 O  O   . ILE C 1 10 ? -8.968  5.928   -5.131  1.00 23.07  ? 7   ILE C O   1 
ATOM   1522 C  CB  . ILE C 1 10 ? -10.943 3.311   -5.758  1.00 29.54  ? 7   ILE C CB  1 
ATOM   1523 C  CG1 . ILE C 1 10 ? -12.045 2.604   -4.967  1.00 26.27  ? 7   ILE C CG1 1 
ATOM   1524 C  CG2 . ILE C 1 10 ? -9.561  2.795   -5.334  1.00 26.51  ? 7   ILE C CG2 1 
ATOM   1525 C  CD1 . ILE C 1 10 ? -12.146 1.121   -5.232  1.00 38.13  ? 7   ILE C CD1 1 
ATOM   1526 N  N   . PHE C 1 11 ? -9.542  5.598   -7.282  1.00 31.86  ? 8   PHE C N   1 
ATOM   1527 C  CA  . PHE C 1 11 ? -8.355  6.258   -7.809  1.00 21.07  ? 8   PHE C CA  1 
ATOM   1528 C  C   . PHE C 1 11 ? -8.300  7.702   -7.326  1.00 23.77  ? 8   PHE C C   1 
ATOM   1529 O  O   . PHE C 1 11 ? -7.231  8.213   -6.992  1.00 22.98  ? 8   PHE C O   1 
ATOM   1530 C  CB  . PHE C 1 11 ? -8.338  6.202   -9.341  1.00 24.89  ? 8   PHE C CB  1 
ATOM   1531 C  CG  . PHE C 1 11 ? -8.027  4.838   -9.897  1.00 31.11  ? 8   PHE C CG  1 
ATOM   1532 C  CD1 . PHE C 1 11 ? -6.962  4.101   -9.408  1.00 24.82  ? 8   PHE C CD1 1 
ATOM   1533 C  CD2 . PHE C 1 11 ? -8.804  4.290   -10.904 1.00 32.98  ? 8   PHE C CD2 1 
ATOM   1534 C  CE1 . PHE C 1 11 ? -6.676  2.847   -9.912  1.00 31.53  ? 8   PHE C CE1 1 
ATOM   1535 C  CE2 . PHE C 1 11 ? -8.522  3.033   -11.413 1.00 27.26  ? 8   PHE C CE2 1 
ATOM   1536 C  CZ  . PHE C 1 11 ? -7.457  2.313   -10.915 1.00 31.46  ? 8   PHE C CZ  1 
ATOM   1537 N  N   . ALA C 1 12 ? -9.462  8.348   -7.274  1.00 24.75  ? 9   ALA C N   1 
ATOM   1538 C  CA  . ALA C 1 12 ? -9.551  9.741   -6.844  1.00 21.92  ? 9   ALA C CA  1 
ATOM   1539 C  C   . ALA C 1 12 ? -9.164  9.899   -5.381  1.00 23.01  ? 9   ALA C C   1 
ATOM   1540 O  O   . ALA C 1 12 ? -8.489  10.854  -5.015  1.00 25.58  ? 9   ALA C O   1 
ATOM   1541 C  CB  . ALA C 1 12 ? -10.951 10.271  -7.072  1.00 24.09  ? 9   ALA C CB  1 
ATOM   1542 N  N   . ILE C 1 13 ? -9.602  8.961   -4.549  1.00 25.15  ? 10  ILE C N   1 
ATOM   1543 C  CA  . ILE C 1 13 ? -9.285  8.985   -3.127  1.00 23.37  ? 10  ILE C CA  1 
ATOM   1544 C  C   . ILE C 1 13 ? -7.794  8.736   -2.910  1.00 22.57  ? 10  ILE C C   1 
ATOM   1545 O  O   . ILE C 1 13 ? -7.171  9.370   -2.061  1.00 20.82  ? 10  ILE C O   1 
ATOM   1546 C  CB  . ILE C 1 13 ? -10.123 7.941   -2.358  1.00 16.52  ? 10  ILE C CB  1 
ATOM   1547 C  CG1 . ILE C 1 13 ? -11.584 8.395   -2.297  1.00 17.23  ? 10  ILE C CG1 1 
ATOM   1548 C  CG2 . ILE C 1 13 ? -9.600  7.751   -0.939  1.00 30.60  ? 10  ILE C CG2 1 
ATOM   1549 C  CD1 . ILE C 1 13 ? -12.563 7.306   -1.904  1.00 15.73  ? 10  ILE C CD1 1 
ATOM   1550 N  N   . ILE C 1 14 ? -7.228  7.815   -3.685  1.00 24.82  ? 11  ILE C N   1 
ATOM   1551 C  CA  . ILE C 1 14 ? -5.800  7.515   -3.605  1.00 24.61  ? 11  ILE C CA  1 
ATOM   1552 C  C   . ILE C 1 14 ? -4.955  8.725   -3.989  1.00 24.85  ? 11  ILE C C   1 
ATOM   1553 O  O   . ILE C 1 14 ? -3.993  9.064   -3.306  1.00 19.05  ? 11  ILE C O   1 
ATOM   1554 C  CB  . ILE C 1 14 ? -5.417  6.335   -4.523  1.00 20.83  ? 11  ILE C CB  1 
ATOM   1555 C  CG1 . ILE C 1 14 ? -6.019  5.033   -3.997  1.00 21.93  ? 11  ILE C CG1 1 
ATOM   1556 C  CG2 . ILE C 1 14 ? -3.897  6.197   -4.618  1.00 25.17  ? 11  ILE C CG2 1 
ATOM   1557 C  CD1 . ILE C 1 14 ? -5.962  3.884   -4.996  1.00 16.54  ? 11  ILE C CD1 1 
ATOM   1558 N  N   . ASN C 1 15 ? -5.307  9.359   -5.101  1.00 26.91  ? 12  ASN C N   1 
ATOM   1559 C  CA  . ASN C 1 15 ? -4.559  10.506  -5.592  1.00 32.93  ? 12  ASN C CA  1 
ATOM   1560 C  C   . ASN C 1 15 ? -4.743  11.734  -4.702  1.00 29.92  ? 12  ASN C C   1 
ATOM   1561 O  O   . ASN C 1 15 ? -3.837  12.556  -4.575  1.00 30.13  ? 12  ASN C O   1 
ATOM   1562 C  CB  . ASN C 1 15 ? -4.973  10.815  -7.030  1.00 19.69  ? 12  ASN C CB  1 
ATOM   1563 C  CG  . ASN C 1 15 ? -4.635  9.680   -7.983  1.00 34.91  ? 12  ASN C CG  1 
ATOM   1564 O  OD1 . ASN C 1 15 ? -3.718  8.898   -7.731  1.00 32.15  ? 12  ASN C OD1 1 
ATOM   1565 N  ND2 . ASN C 1 15 ? -5.375  9.584   -9.081  1.00 36.81  ? 12  ASN C ND2 1 
ATOM   1566 N  N   . LEU C 1 16 ? -5.909  11.850  -4.077  1.00 28.98  ? 13  LEU C N   1 
ATOM   1567 C  CA  . LEU C 1 16 ? -6.168  12.952  -3.158  1.00 29.19  ? 13  LEU C CA  1 
ATOM   1568 C  C   . LEU C 1 16 ? -5.230  12.854  -1.961  1.00 33.95  ? 13  LEU C C   1 
ATOM   1569 O  O   . LEU C 1 16 ? -4.604  13.838  -1.561  1.00 30.21  ? 13  LEU C O   1 
ATOM   1570 C  CB  . LEU C 1 16 ? -7.623  12.937  -2.691  1.00 25.61  ? 13  LEU C CB  1 
ATOM   1571 C  CG  . LEU C 1 16 ? -8.215  14.281  -2.280  1.00 38.95  ? 13  LEU C CG  1 
ATOM   1572 C  CD1 . LEU C 1 16 ? -8.547  15.109  -3.512  1.00 41.61  ? 13  LEU C CD1 1 
ATOM   1573 C  CD2 . LEU C 1 16 ? -9.446  14.069  -1.423  1.00 45.21  ? 13  LEU C CD2 1 
ATOM   1574 N  N   . PHE C 1 17 ? -5.139  11.653  -1.397  1.00 23.84  ? 14  PHE C N   1 
ATOM   1575 C  CA  . PHE C 1 17 ? -4.264  11.397  -0.260  1.00 29.16  ? 14  PHE C CA  1 
ATOM   1576 C  C   . PHE C 1 17 ? -2.812  11.681  -0.621  1.00 23.08  ? 14  PHE C C   1 
ATOM   1577 O  O   . PHE C 1 17 ? -2.104  12.365  0.119   1.00 24.94  ? 14  PHE C O   1 
ATOM   1578 C  CB  . PHE C 1 17 ? -4.412  9.949   0.216   1.00 23.18  ? 14  PHE C CB  1 
ATOM   1579 C  CG  . PHE C 1 17 ? -3.462  9.574   1.317   1.00 19.25  ? 14  PHE C CG  1 
ATOM   1580 C  CD1 . PHE C 1 17 ? -3.797  9.793   2.641   1.00 21.88  ? 14  PHE C CD1 1 
ATOM   1581 C  CD2 . PHE C 1 17 ? -2.235  9.003   1.028   1.00 24.33  ? 14  PHE C CD2 1 
ATOM   1582 C  CE1 . PHE C 1 17 ? -2.926  9.450   3.656   1.00 25.96  ? 14  PHE C CE1 1 
ATOM   1583 C  CE2 . PHE C 1 17 ? -1.361  8.659   2.038   1.00 31.28  ? 14  PHE C CE2 1 
ATOM   1584 C  CZ  . PHE C 1 17 ? -1.707  8.883   3.353   1.00 23.13  ? 14  PHE C CZ  1 
ATOM   1585 N  N   . LYS C 1 18 ? -2.377  11.159  -1.764  1.00 21.65  ? 15  LYS C N   1 
ATOM   1586 C  CA  . LYS C 1 18 ? -0.997  11.333  -2.207  1.00 34.21  ? 15  LYS C CA  1 
ATOM   1587 C  C   . LYS C 1 18 ? -0.642  12.804  -2.395  1.00 30.78  ? 15  LYS C C   1 
ATOM   1588 O  O   . LYS C 1 18 ? 0.504   13.203  -2.189  1.00 26.68  ? 15  LYS C O   1 
ATOM   1589 C  CB  . LYS C 1 18 ? -0.749  10.572  -3.510  1.00 33.41  ? 15  LYS C CB  1 
ATOM   1590 C  CG  . LYS C 1 18 ? -0.633  9.071   -3.327  1.00 36.54  ? 15  LYS C CG  1 
ATOM   1591 C  CD  . LYS C 1 18 ? -0.033  8.413   -4.557  1.00 35.99  ? 15  LYS C CD  1 
ATOM   1592 C  CE  . LYS C 1 18 ? 0.168   6.923   -4.343  1.00 47.04  ? 15  LYS C CE  1 
ATOM   1593 N  NZ  . LYS C 1 18 ? 1.001   6.311   -5.416  1.00 59.68  ? 15  LYS C NZ  1 
ATOM   1594 N  N   . GLN C 1 19 ? -1.628  13.607  -2.778  1.00 26.60  ? 16  GLN C N   1 
ATOM   1595 C  CA  . GLN C 1 19 ? -1.397  15.027  -3.020  1.00 33.83  ? 16  GLN C CA  1 
ATOM   1596 C  C   . GLN C 1 19 ? -1.100  15.767  -1.713  1.00 31.79  ? 16  GLN C C   1 
ATOM   1597 O  O   . GLN C 1 19 ? -0.207  16.614  -1.663  1.00 30.38  ? 16  GLN C O   1 
ATOM   1598 C  CB  . GLN C 1 19 ? -2.606  15.651  -3.722  1.00 28.00  ? 16  GLN C CB  1 
ATOM   1599 C  CG  . GLN C 1 19 ? -2.268  16.867  -4.579  1.00 51.44  ? 16  GLN C CG  1 
ATOM   1600 C  CD  . GLN C 1 19 ? -1.422  16.521  -5.798  1.00 46.02  ? 16  GLN C CD  1 
ATOM   1601 O  OE1 . GLN C 1 19 ? -1.455  15.394  -6.295  1.00 39.97  ? 16  GLN C OE1 1 
ATOM   1602 N  NE2 . GLN C 1 19 ? -0.659  17.494  -6.281  1.00 43.63  ? 16  GLN C NE2 1 
ATOM   1603 N  N   . TYR C 1 20 ? -1.840  15.440  -0.657  1.00 27.98  ? 17  TYR C N   1 
ATOM   1604 C  CA  . TYR C 1 20 ? -1.652  16.088  0.642   1.00 34.32  ? 17  TYR C CA  1 
ATOM   1605 C  C   . TYR C 1 20 ? -0.415  15.571  1.372   1.00 23.90  ? 17  TYR C C   1 
ATOM   1606 O  O   . TYR C 1 20 ? 0.206   16.293  2.148   1.00 25.86  ? 17  TYR C O   1 
ATOM   1607 C  CB  . TYR C 1 20 ? -2.883  15.882  1.529   1.00 20.75  ? 17  TYR C CB  1 
ATOM   1608 C  CG  . TYR C 1 20 ? -4.078  16.722  1.143   1.00 27.22  ? 17  TYR C CG  1 
ATOM   1609 C  CD1 . TYR C 1 20 ? -4.113  18.084  1.415   1.00 25.79  ? 17  TYR C CD1 1 
ATOM   1610 C  CD2 . TYR C 1 20 ? -5.179  16.152  0.520   1.00 26.28  ? 17  TYR C CD2 1 
ATOM   1611 C  CE1 . TYR C 1 20 ? -5.205  18.854  1.066   1.00 22.57  ? 17  TYR C CE1 1 
ATOM   1612 C  CE2 . TYR C 1 20 ? -6.275  16.913  0.170   1.00 25.89  ? 17  TYR C CE2 1 
ATOM   1613 C  CZ  . TYR C 1 20 ? -6.284  18.261  0.446   1.00 24.86  ? 17  TYR C CZ  1 
ATOM   1614 O  OH  . TYR C 1 20 ? -7.377  19.017  0.095   1.00 36.64  ? 17  TYR C OH  1 
ATOM   1615 N  N   . SER C 1 21 ? -0.058  14.319  1.114   1.00 25.52  ? 18  SER C N   1 
ATOM   1616 C  CA  . SER C 1 21 ? 0.994   13.656  1.872   1.00 29.22  ? 18  SER C CA  1 
ATOM   1617 C  C   . SER C 1 21 ? 2.402   13.912  1.326   1.00 32.57  ? 18  SER C C   1 
ATOM   1618 O  O   . SER C 1 21 ? 3.375   13.398  1.875   1.00 31.48  ? 18  SER C O   1 
ATOM   1619 C  CB  . SER C 1 21 ? 0.720   12.148  1.912   1.00 28.41  ? 18  SER C CB  1 
ATOM   1620 O  OG  . SER C 1 21 ? 0.581   11.617  0.608   1.00 40.64  ? 18  SER C OG  1 
ATOM   1621 N  N   . LYS C 1 22 ? 2.516   14.702  0.258   1.00 33.85  ? 19  LYS C N   1 
ATOM   1622 C  CA  . LYS C 1 22 ? 3.825   14.985  -0.335  1.00 32.58  ? 19  LYS C CA  1 
ATOM   1623 C  C   . LYS C 1 22 ? 4.252   16.448  -0.172  1.00 27.46  ? 19  LYS C C   1 
ATOM   1624 O  O   . LYS C 1 22 ? 4.982   16.984  -1.003  1.00 27.00  ? 19  LYS C O   1 
ATOM   1625 C  CB  . LYS C 1 22 ? 3.834   14.596  -1.820  1.00 40.76  ? 19  LYS C CB  1 
ATOM   1626 C  CG  . LYS C 1 22 ? 2.933   15.417  -2.731  1.00 46.76  ? 19  LYS C CG  1 
ATOM   1627 C  CD  . LYS C 1 22 ? 2.952   14.845  -4.145  1.00 33.85  ? 19  LYS C CD  1 
ATOM   1628 C  CE  . LYS C 1 22 ? 2.145   15.692  -5.111  1.00 43.65  ? 19  LYS C CE  1 
ATOM   1629 N  NZ  . LYS C 1 22 ? 2.078   15.072  -6.465  1.00 45.61  ? 19  LYS C NZ  1 
ATOM   1630 N  N   . LYS C 1 23 ? 3.811   17.088  0.906   1.00 37.74  ? 20  LYS C N   1 
ATOM   1631 C  CA  . LYS C 1 23 ? 4.351   18.392  1.269   1.00 27.58  ? 20  LYS C CA  1 
ATOM   1632 C  C   . LYS C 1 23 ? 5.797   18.207  1.720   1.00 35.51  ? 20  LYS C C   1 
ATOM   1633 O  O   . LYS C 1 23 ? 6.684   18.954  1.308   1.00 32.76  ? 20  LYS C O   1 
ATOM   1634 C  CB  . LYS C 1 23 ? 3.525   19.055  2.374   1.00 36.38  ? 20  LYS C CB  1 
ATOM   1635 C  CG  . LYS C 1 23 ? 4.033   20.437  2.772   1.00 30.82  ? 20  LYS C CG  1 
ATOM   1636 C  CD  . LYS C 1 23 ? 3.255   21.022  3.942   1.00 28.98  ? 20  LYS C CD  1 
ATOM   1637 C  CE  . LYS C 1 23 ? 1.789   21.241  3.608   1.00 38.61  ? 20  LYS C CE  1 
ATOM   1638 N  NZ  . LYS C 1 23 ? 1.606   22.063  2.378   1.00 50.00  ? 20  LYS C NZ  1 
ATOM   1639 N  N   . ASP C 1 24 ? 6.020   17.204  2.568   1.00 27.74  ? 21  ASP C N   1 
ATOM   1640 C  CA  . ASP C 1 24 ? 7.365   16.831  2.997   1.00 30.49  ? 21  ASP C CA  1 
ATOM   1641 C  C   . ASP C 1 24 ? 7.861   15.652  2.160   1.00 34.75  ? 21  ASP C C   1 
ATOM   1642 O  O   . ASP C 1 24 ? 7.215   15.267  1.183   1.00 36.94  ? 21  ASP C O   1 
ATOM   1643 C  CB  . ASP C 1 24 ? 7.387   16.496  4.496   1.00 28.78  ? 21  ASP C CB  1 
ATOM   1644 C  CG  . ASP C 1 24 ? 6.391   15.414  4.879   1.00 35.20  ? 21  ASP C CG  1 
ATOM   1645 O  OD1 . ASP C 1 24 ? 6.313   14.383  4.178   1.00 31.41  ? 21  ASP C OD1 1 
ATOM   1646 O  OD2 . ASP C 1 24 ? 5.687   15.595  5.895   1.00 41.18  ? 21  ASP C OD2 1 
ATOM   1647 N  N   . LYS C 1 25 ? 8.999   15.076  2.539   1.00 37.47  ? 22  LYS C N   1 
ATOM   1648 C  CA  . LYS C 1 25 ? 9.607   14.007  1.750   1.00 41.23  ? 22  LYS C CA  1 
ATOM   1649 C  C   . LYS C 1 25 ? 9.100   12.619  2.144   1.00 47.73  ? 22  LYS C C   1 
ATOM   1650 O  O   . LYS C 1 25 ? 9.429   11.627  1.492   1.00 49.71  ? 22  LYS C O   1 
ATOM   1651 C  CB  . LYS C 1 25 ? 11.133  14.058  1.871   1.00 42.10  ? 22  LYS C CB  1 
ATOM   1652 C  CG  . LYS C 1 25 ? 11.815  14.486  0.580   1.00 56.25  ? 22  LYS C CG  1 
ATOM   1653 C  CD  . LYS C 1 25 ? 13.328  14.379  0.659   1.00 65.75  ? 22  LYS C CD  1 
ATOM   1654 C  CE  . LYS C 1 25 ? 13.926  15.500  1.492   1.00 74.26  ? 22  LYS C CE  1 
ATOM   1655 N  NZ  . LYS C 1 25 ? 15.400  15.581  1.317   1.00 73.14  ? 22  LYS C NZ  1 
ATOM   1656 N  N   . ASN C 1 26 ? 8.307   12.548  3.208   1.00 48.07  ? 23  ASN C N   1 
ATOM   1657 C  CA  . ASN C 1 26 ? 7.634   11.306  3.574   1.00 42.86  ? 23  ASN C CA  1 
ATOM   1658 C  C   . ASN C 1 26 ? 6.319   11.229  2.802   1.00 38.69  ? 23  ASN C C   1 
ATOM   1659 O  O   . ASN C 1 26 ? 5.264   11.620  3.297   1.00 36.03  ? 23  ASN C O   1 
ATOM   1660 C  CB  . ASN C 1 26 ? 7.406   11.236  5.088   1.00 47.15  ? 23  ASN C CB  1 
ATOM   1661 C  CG  . ASN C 1 26 ? 7.083   9.831   5.571   1.00 48.06  ? 23  ASN C CG  1 
ATOM   1662 O  OD1 . ASN C 1 26 ? 6.292   9.112   4.958   1.00 42.05  ? 23  ASN C OD1 1 
ATOM   1663 N  ND2 . ASN C 1 26 ? 7.705   9.432   6.675   1.00 42.98  ? 23  ASN C ND2 1 
ATOM   1664 N  N   . THR C 1 27 ? 6.398   10.724  1.575   1.00 38.24  ? 24  THR C N   1 
ATOM   1665 C  CA  . THR C 1 27 ? 5.309   10.867  0.614   1.00 42.90  ? 24  THR C CA  1 
ATOM   1666 C  C   . THR C 1 27 ? 4.179   9.852   0.782   1.00 41.18  ? 24  THR C C   1 
ATOM   1667 O  O   . THR C 1 27 ? 3.122   10.004  0.169   1.00 37.32  ? 24  THR C O   1 
ATOM   1668 C  CB  . THR C 1 27 ? 5.842   10.758  -0.829  1.00 47.05  ? 24  THR C CB  1 
ATOM   1669 O  OG1 . THR C 1 27 ? 6.369   9.445   -1.056  1.00 44.60  ? 24  THR C OG1 1 
ATOM   1670 C  CG2 . THR C 1 27 ? 6.934   11.791  -1.074  1.00 46.71  ? 24  THR C CG2 1 
ATOM   1671 N  N   . ASP C 1 28 ? 4.392   8.826   1.603   1.00 40.42  ? 25  ASP C N   1 
ATOM   1672 C  CA  . ASP C 1 28 ? 3.386   7.778   1.785   1.00 34.93  ? 25  ASP C CA  1 
ATOM   1673 C  C   . ASP C 1 28 ? 2.557   7.969   3.051   1.00 30.46  ? 25  ASP C C   1 
ATOM   1674 O  O   . ASP C 1 28 ? 1.697   7.144   3.358   1.00 38.30  ? 25  ASP C O   1 
ATOM   1675 C  CB  . ASP C 1 28 ? 4.053   6.399   1.813   1.00 39.67  ? 25  ASP C CB  1 
ATOM   1676 C  CG  . ASP C 1 28 ? 4.692   6.033   0.487   1.00 53.51  ? 25  ASP C CG  1 
ATOM   1677 O  OD1 . ASP C 1 28 ? 4.095   6.344   -0.566  1.00 51.83  ? 25  ASP C OD1 1 
ATOM   1678 O  OD2 . ASP C 1 28 ? 5.790   5.438   0.497   1.00 66.80  ? 25  ASP C OD2 1 
ATOM   1679 N  N   . THR C 1 29 ? 2.812   9.050   3.784   1.00 36.97  ? 26  THR C N   1 
ATOM   1680 C  CA  . THR C 1 29 ? 2.069   9.327   5.011   1.00 28.10  ? 26  THR C CA  1 
ATOM   1681 C  C   . THR C 1 29 ? 1.785   10.817  5.179   1.00 28.28  ? 26  THR C C   1 
ATOM   1682 O  O   . THR C 1 29 ? 2.418   11.658  4.540   1.00 23.47  ? 26  THR C O   1 
ATOM   1683 C  CB  . THR C 1 29 ? 2.828   8.826   6.262   1.00 27.17  ? 26  THR C CB  1 
ATOM   1684 O  OG1 . THR C 1 29 ? 4.029   9.587   6.436   1.00 27.28  ? 26  THR C OG1 1 
ATOM   1685 C  CG2 . THR C 1 29 ? 3.178   7.349   6.135   1.00 37.49  ? 26  THR C CG2 1 
ATOM   1686 N  N   . LEU C 1 30 ? 0.823   11.129  6.043   1.00 27.46  ? 27  LEU C N   1 
ATOM   1687 C  CA  . LEU C 1 30 ? 0.502   12.509  6.385   1.00 20.08  ? 27  LEU C CA  1 
ATOM   1688 C  C   . LEU C 1 30 ? 1.178   12.906  7.687   1.00 32.61  ? 27  LEU C C   1 
ATOM   1689 O  O   . LEU C 1 30 ? 1.114   12.178  8.679   1.00 26.25  ? 27  LEU C O   1 
ATOM   1690 C  CB  . LEU C 1 30 ? -1.006  12.706  6.524   1.00 20.12  ? 27  LEU C CB  1 
ATOM   1691 C  CG  . LEU C 1 30 ? -1.876  12.380  5.313   1.00 29.52  ? 27  LEU C CG  1 
ATOM   1692 C  CD1 . LEU C 1 30 ? -3.305  12.114  5.747   1.00 26.59  ? 27  LEU C CD1 1 
ATOM   1693 C  CD2 . LEU C 1 30 ? -1.823  13.522  4.314   1.00 28.84  ? 27  LEU C CD2 1 
ATOM   1694 N  N   . SER C 1 31 ? 1.830   14.061  7.677   1.00 35.38  ? 28  SER C N   1 
ATOM   1695 C  CA  . SER C 1 31 ? 2.305   14.679  8.904   1.00 31.45  ? 28  SER C CA  1 
ATOM   1696 C  C   . SER C 1 31 ? 1.125   15.388  9.550   1.00 27.84  ? 28  SER C C   1 
ATOM   1697 O  O   . SER C 1 31 ? 0.038   15.433  8.974   1.00 26.83  ? 28  SER C O   1 
ATOM   1698 C  CB  . SER C 1 31 ? 3.439   15.662  8.619   1.00 30.71  ? 28  SER C CB  1 
ATOM   1699 O  OG  . SER C 1 31 ? 2.981   16.728  7.804   1.00 28.82  ? 28  SER C OG  1 
ATOM   1700 N  N   . LYS C 1 32 ? 1.331   15.941  10.740  1.00 32.92  ? 29  LYS C N   1 
ATOM   1701 C  CA  . LYS C 1 32 ? 0.277   16.690  11.409  1.00 28.98  ? 29  LYS C CA  1 
ATOM   1702 C  C   . LYS C 1 32 ? -0.060  17.950  10.620  1.00 27.06  ? 29  LYS C C   1 
ATOM   1703 O  O   . LYS C 1 32 ? -1.215  18.372  10.573  1.00 36.89  ? 29  LYS C O   1 
ATOM   1704 C  CB  . LYS C 1 32 ? 0.689   17.055  12.837  1.00 39.20  ? 29  LYS C CB  1 
ATOM   1705 C  CG  . LYS C 1 32 ? -0.368  17.856  13.592  1.00 31.54  ? 29  LYS C CG  1 
ATOM   1706 C  CD  . LYS C 1 32 ? 0.003   18.069  15.053  1.00 41.87  ? 29  LYS C CD  1 
ATOM   1707 C  CE  . LYS C 1 32 ? -0.103  16.782  15.858  1.00 43.44  ? 29  LYS C CE  1 
ATOM   1708 N  NZ  . LYS C 1 32 ? 0.061   17.016  17.322  1.00 46.08  ? 29  LYS C NZ  1 
ATOM   1709 N  N   . LYS C 1 33 ? 0.955   18.548  10.003  1.00 31.15  ? 30  LYS C N   1 
ATOM   1710 C  CA  . LYS C 1 33 ? 0.755   19.746  9.193   1.00 33.46  ? 30  LYS C CA  1 
ATOM   1711 C  C   . LYS C 1 33 ? 0.014   19.408  7.903   1.00 25.25  ? 30  LYS C C   1 
ATOM   1712 O  O   . LYS C 1 33 ? -0.829  20.176  7.440   1.00 25.88  ? 30  LYS C O   1 
ATOM   1713 C  CB  . LYS C 1 33 ? 2.094   20.410  8.867   1.00 43.19  ? 30  LYS C CB  1 
ATOM   1714 C  CG  . LYS C 1 33 ? 2.086   21.917  9.054   1.00 53.47  ? 30  LYS C CG  1 
ATOM   1715 C  CD  . LYS C 1 33 ? 2.291   22.293  10.514  1.00 51.12  ? 30  LYS C CD  1 
ATOM   1716 C  CE  . LYS C 1 33 ? 1.936   23.749  10.776  1.00 48.17  ? 30  LYS C CE  1 
ATOM   1717 N  NZ  . LYS C 1 33 ? 2.265   24.151  12.171  1.00 51.79  ? 30  LYS C NZ  1 
ATOM   1718 N  N   . GLU C 1 34 ? 0.335   18.257  7.324   1.00 24.64  ? 31  GLU C N   1 
ATOM   1719 C  CA  . GLU C 1 34 ? -0.341  17.796  6.119   1.00 29.74  ? 31  GLU C CA  1 
ATOM   1720 C  C   . GLU C 1 34 ? -1.774  17.377  6.435   1.00 27.23  ? 31  GLU C C   1 
ATOM   1721 O  O   . GLU C 1 34 ? -2.687  17.628  5.649   1.00 30.00  ? 31  GLU C O   1 
ATOM   1722 C  CB  . GLU C 1 34 ? 0.429   16.638  5.487   1.00 32.10  ? 31  GLU C CB  1 
ATOM   1723 C  CG  . GLU C 1 34 ? 1.760   17.053  4.871   1.00 29.84  ? 31  GLU C CG  1 
ATOM   1724 C  CD  . GLU C 1 34 ? 2.629   15.870  4.494   1.00 27.60  ? 31  GLU C CD  1 
ATOM   1725 O  OE1 . GLU C 1 34 ? 2.474   14.798  5.110   1.00 27.62  ? 31  GLU C OE1 1 
ATOM   1726 O  OE2 . GLU C 1 34 ? 3.465   16.012  3.579   1.00 28.73  ? 31  GLU C OE2 1 
ATOM   1727 N  N   . LEU C 1 35 ? -1.969  16.747  7.588   1.00 28.24  ? 32  LEU C N   1 
ATOM   1728 C  CA  . LEU C 1 35 ? -3.305  16.357  8.022   1.00 27.52  ? 32  LEU C CA  1 
ATOM   1729 C  C   . LEU C 1 35 ? -4.178  17.588  8.252   1.00 29.57  ? 32  LEU C C   1 
ATOM   1730 O  O   . LEU C 1 35 ? -5.355  17.599  7.889   1.00 30.73  ? 32  LEU C O   1 
ATOM   1731 C  CB  . LEU C 1 35 ? -3.237  15.517  9.298   1.00 23.97  ? 32  LEU C CB  1 
ATOM   1732 C  CG  . LEU C 1 35 ? -4.592  15.081  9.858   1.00 17.72  ? 32  LEU C CG  1 
ATOM   1733 C  CD1 . LEU C 1 35 ? -5.314  14.168  8.873   1.00 20.71  ? 32  LEU C CD1 1 
ATOM   1734 C  CD2 . LEU C 1 35 ? -4.421  14.399  11.205  1.00 33.03  ? 32  LEU C CD2 1 
ATOM   1735 N  N   . LYS C 1 36 ? -3.596  18.616  8.862   1.00 32.27  ? 33  LYS C N   1 
ATOM   1736 C  CA  . LYS C 1 36 ? -4.293  19.878  9.088   1.00 25.59  ? 33  LYS C CA  1 
ATOM   1737 C  C   . LYS C 1 36 ? -4.849  20.434  7.783   1.00 27.67  ? 33  LYS C C   1 
ATOM   1738 O  O   . LYS C 1 36 ? -6.031  20.766  7.688   1.00 28.92  ? 33  LYS C O   1 
ATOM   1739 C  CB  . LYS C 1 36 ? -3.349  20.901  9.728   1.00 25.68  ? 33  LYS C CB  1 
ATOM   1740 C  CG  . LYS C 1 36 ? -3.946  22.304  9.896   1.00 29.22  ? 33  LYS C CG  1 
ATOM   1741 C  CD  . LYS C 1 36 ? -2.894  23.394  9.773   1.00 42.31  ? 33  LYS C CD  1 
ATOM   1742 C  CE  . LYS C 1 36 ? -2.408  23.853  11.132  1.00 38.49  ? 33  LYS C CE  1 
ATOM   1743 N  NZ  . LYS C 1 36 ? -3.467  24.608  11.853  1.00 49.47  ? 33  LYS C NZ  1 
ATOM   1744 N  N   . GLU C 1 37 ? -3.978  20.546  6.787   1.00 22.62  ? 34  GLU C N   1 
ATOM   1745 C  CA  . GLU C 1 37 ? -4.357  21.095  5.491   1.00 25.50  ? 34  GLU C CA  1 
ATOM   1746 C  C   . GLU C 1 37 ? -5.463  20.274  4.837   1.00 27.49  ? 34  GLU C C   1 
ATOM   1747 O  O   . GLU C 1 37 ? -6.313  20.817  4.137   1.00 29.42  ? 34  GLU C O   1 
ATOM   1748 C  CB  . GLU C 1 37 ? -3.138  21.164  4.567   1.00 29.81  ? 34  GLU C CB  1 
ATOM   1749 C  CG  . GLU C 1 37 ? -2.680  22.577  4.261   1.00 49.15  ? 34  GLU C CG  1 
ATOM   1750 C  CD  . GLU C 1 37 ? -1.338  22.614  3.558   1.00 53.08  ? 34  GLU C CD  1 
ATOM   1751 O  OE1 . GLU C 1 37 ? -1.095  21.750  2.688   1.00 50.14  ? 34  GLU C OE1 1 
ATOM   1752 O  OE2 . GLU C 1 37 ? -0.523  23.506  3.881   1.00 45.46  ? 34  GLU C OE2 1 
ATOM   1753 N  N   . LEU C 1 38 ? -5.451  18.965  5.067   1.00 25.92  ? 35  LEU C N   1 
ATOM   1754 C  CA  . LEU C 1 38 ? -6.468  18.085  4.498   1.00 30.93  ? 35  LEU C CA  1 
ATOM   1755 C  C   . LEU C 1 38 ? -7.821  18.328  5.162   1.00 27.48  ? 35  LEU C C   1 
ATOM   1756 O  O   . LEU C 1 38 ? -8.843  18.431  4.482   1.00 34.44  ? 35  LEU C O   1 
ATOM   1757 C  CB  . LEU C 1 38 ? -6.054  16.617  4.652   1.00 28.76  ? 35  LEU C CB  1 
ATOM   1758 C  CG  . LEU C 1 38 ? -6.811  15.587  3.807   1.00 28.99  ? 35  LEU C CG  1 
ATOM   1759 C  CD1 . LEU C 1 38 ? -5.930  14.369  3.568   1.00 28.36  ? 35  LEU C CD1 1 
ATOM   1760 C  CD2 . LEU C 1 38 ? -8.122  15.172  4.468   1.00 33.98  ? 35  LEU C CD2 1 
ATOM   1761 N  N   . LEU C 1 39 ? -7.824  18.417  6.489   1.00 25.94  ? 36  LEU C N   1 
ATOM   1762 C  CA  . LEU C 1 39 ? -9.050  18.683  7.232   1.00 32.57  ? 36  LEU C CA  1 
ATOM   1763 C  C   . LEU C 1 39 ? -9.629  20.044  6.853   1.00 33.36  ? 36  LEU C C   1 
ATOM   1764 O  O   . LEU C 1 39 ? -10.833 20.176  6.633   1.00 30.58  ? 36  LEU C O   1 
ATOM   1765 C  CB  . LEU C 1 39 ? -8.791  18.624  8.740   1.00 33.02  ? 36  LEU C CB  1 
ATOM   1766 C  CG  . LEU C 1 39 ? -8.324  17.283  9.319   1.00 29.57  ? 36  LEU C CG  1 
ATOM   1767 C  CD1 . LEU C 1 39 ? -8.184  17.389  10.824  1.00 29.55  ? 36  LEU C CD1 1 
ATOM   1768 C  CD2 . LEU C 1 39 ? -9.265  16.144  8.948   1.00 33.35  ? 36  LEU C CD2 1 
ATOM   1769 N  N   . GLU C 1 40 ? -8.765  21.050  6.771   1.00 34.83  ? 37  GLU C N   1 
ATOM   1770 C  CA  . GLU C 1 40 ? -9.188  22.404  6.430   1.00 38.21  ? 37  GLU C CA  1 
ATOM   1771 C  C   . GLU C 1 40 ? -9.832  22.469  5.051   1.00 41.37  ? 37  GLU C C   1 
ATOM   1772 O  O   . GLU C 1 40 ? -10.868 23.106  4.870   1.00 41.32  ? 37  GLU C O   1 
ATOM   1773 C  CB  . GLU C 1 40 ? -7.992  23.363  6.497   1.00 36.51  ? 37  GLU C CB  1 
ATOM   1774 C  CG  . GLU C 1 40 ? -8.139  24.682  5.724   1.00 57.01  ? 37  GLU C CG  1 
ATOM   1775 C  CD  . GLU C 1 40 ? -9.247  25.583  6.252   1.00 80.63  ? 37  GLU C CD  1 
ATOM   1776 O  OE1 . GLU C 1 40 ? -10.137 25.098  6.984   1.00 78.95  ? 37  GLU C OE1 1 
ATOM   1777 O  OE2 . GLU C 1 40 ? -9.222  26.793  5.937   1.00 92.66  ? 37  GLU C OE2 1 
ATOM   1778 N  N   . LYS C 1 41 ? -9.210  21.812  4.081   1.00 30.82  ? 38  LYS C N   1 
ATOM   1779 C  CA  . LYS C 1 41 ? -9.692  21.851  2.708   1.00 37.66  ? 38  LYS C CA  1 
ATOM   1780 C  C   . LYS C 1 41 ? -10.930 20.979  2.512   1.00 35.03  ? 38  LYS C C   1 
ATOM   1781 O  O   . LYS C 1 41 ? -11.984 21.466  2.105   1.00 36.63  ? 38  LYS C O   1 
ATOM   1782 C  CB  . LYS C 1 41 ? -8.592  21.396  1.747   1.00 37.90  ? 38  LYS C CB  1 
ATOM   1783 C  CG  . LYS C 1 41 ? -8.475  22.234  0.490   1.00 51.03  ? 38  LYS C CG  1 
ATOM   1784 C  CD  . LYS C 1 41 ? -7.494  23.385  0.673   1.00 63.55  ? 38  LYS C CD  1 
ATOM   1785 C  CE  . LYS C 1 41 ? -6.048  22.910  0.583   1.00 58.46  ? 38  LYS C CE  1 
ATOM   1786 N  NZ  . LYS C 1 41 ? -5.075  23.998  0.875   1.00 68.62  ? 38  LYS C NZ  1 
ATOM   1787 N  N   . GLU C 1 42 ? -10.794 19.690  2.811   1.00 33.21  ? 39  GLU C N   1 
ATOM   1788 C  CA  . GLU C 1 42 ? -11.803 18.699  2.443   1.00 29.33  ? 39  GLU C CA  1 
ATOM   1789 C  C   . GLU C 1 42 ? -13.060 18.743  3.306   1.00 37.26  ? 39  GLU C C   1 
ATOM   1790 O  O   . GLU C 1 42 ? -14.140 18.369  2.849   1.00 34.57  ? 39  GLU C O   1 
ATOM   1791 C  CB  . GLU C 1 42 ? -11.200 17.296  2.512   1.00 30.43  ? 39  GLU C CB  1 
ATOM   1792 C  CG  . GLU C 1 42 ? -10.029 17.077  1.571   1.00 32.05  ? 39  GLU C CG  1 
ATOM   1793 C  CD  . GLU C 1 42 ? -10.409 17.235  0.111   1.00 38.21  ? 39  GLU C CD  1 
ATOM   1794 O  OE1 . GLU C 1 42 ? -11.573 16.941  -0.243  1.00 27.35  ? 39  GLU C OE1 1 
ATOM   1795 O  OE2 . GLU C 1 42 ? -9.541  17.658  -0.681  1.00 27.57  ? 39  GLU C OE2 1 
ATOM   1796 N  N   . PHE C 1 43 ? -12.917 19.183  4.553   1.00 31.83  ? 40  PHE C N   1 
ATOM   1797 C  CA  . PHE C 1 43 ? -14.040 19.222  5.486   1.00 35.13  ? 40  PHE C CA  1 
ATOM   1798 C  C   . PHE C 1 43 ? -14.376 20.655  5.898   1.00 38.12  ? 40  PHE C C   1 
ATOM   1799 O  O   . PHE C 1 43 ? -14.842 20.898  7.010   1.00 41.89  ? 40  PHE C O   1 
ATOM   1800 C  CB  . PHE C 1 43 ? -13.725 18.374  6.720   1.00 33.27  ? 40  PHE C CB  1 
ATOM   1801 C  CG  . PHE C 1 43 ? -13.340 16.955  6.397   1.00 33.42  ? 40  PHE C CG  1 
ATOM   1802 C  CD1 . PHE C 1 43 ? -13.906 16.292  5.318   1.00 44.14  ? 40  PHE C CD1 1 
ATOM   1803 C  CD2 . PHE C 1 43 ? -12.406 16.285  7.170   1.00 49.32  ? 40  PHE C CD2 1 
ATOM   1804 C  CE1 . PHE C 1 43 ? -13.550 14.988  5.020   1.00 38.20  ? 40  PHE C CE1 1 
ATOM   1805 C  CE2 . PHE C 1 43 ? -12.046 14.983  6.877   1.00 44.88  ? 40  PHE C CE2 1 
ATOM   1806 C  CZ  . PHE C 1 43 ? -12.620 14.333  5.801   1.00 42.32  ? 40  PHE C CZ  1 
ATOM   1807 N  N   . ARG C 1 44 ? -14.150 21.598  4.988   1.00 34.18  ? 41  ARG C N   1 
ATOM   1808 C  CA  . ARG C 1 44 ? -14.367 23.011  5.282   1.00 42.46  ? 41  ARG C CA  1 
ATOM   1809 C  C   . ARG C 1 44 ? -15.847 23.329  5.463   1.00 39.45  ? 41  ARG C C   1 
ATOM   1810 O  O   . ARG C 1 44 ? -16.214 24.142  6.310   1.00 41.92  ? 41  ARG C O   1 
ATOM   1811 C  CB  . ARG C 1 44 ? -13.791 23.892  4.169   1.00 37.47  ? 41  ARG C CB  1 
ATOM   1812 C  CG  . ARG C 1 44 ? -13.349 25.262  4.662   1.00 46.93  ? 41  ARG C CG  1 
ATOM   1813 C  CD  . ARG C 1 44 ? -13.047 26.236  3.534   1.00 37.12  ? 41  ARG C CD  1 
ATOM   1814 N  NE  . ARG C 1 44 ? -11.768 25.967  2.869   1.00 33.35  ? 41  ARG C NE  1 
ATOM   1815 C  CZ  . ARG C 1 44 ? -11.630 25.372  1.684   1.00 39.51  ? 41  ARG C CZ  1 
ATOM   1816 N  NH1 . ARG C 1 44 ? -12.688 24.960  0.995   1.00 36.95  ? 41  ARG C NH1 1 
ATOM   1817 N  NH2 . ARG C 1 44 ? -10.418 25.189  1.182   1.00 35.49  ? 41  ARG C NH2 1 
ATOM   1818 N  N   . GLN C 1 45 ? -16.691 22.684  4.664   1.00 28.67  ? 42  GLN C N   1 
ATOM   1819 C  CA  . GLN C 1 45 ? -18.120 22.978  4.661   1.00 38.05  ? 42  GLN C CA  1 
ATOM   1820 C  C   . GLN C 1 45 ? -18.889 22.279  5.784   1.00 46.96  ? 42  GLN C C   1 
ATOM   1821 O  O   . GLN C 1 45 ? -19.973 22.723  6.160   1.00 55.77  ? 42  GLN C O   1 
ATOM   1822 C  CB  . GLN C 1 45 ? -18.733 22.581  3.317   1.00 38.01  ? 42  GLN C CB  1 
ATOM   1823 C  CG  . GLN C 1 45 ? -18.206 23.361  2.129   1.00 30.66  ? 42  GLN C CG  1 
ATOM   1824 C  CD  . GLN C 1 45 ? -18.865 22.940  0.832   1.00 35.15  ? 42  GLN C CD  1 
ATOM   1825 O  OE1 . GLN C 1 45 ? -18.834 21.767  0.458   1.00 35.18  ? 42  GLN C OE1 1 
ATOM   1826 N  NE2 . GLN C 1 45 ? -19.482 23.895  0.144   1.00 35.82  ? 42  GLN C NE2 1 
ATOM   1827 N  N   . ILE C 1 46 ? -18.331 21.194  6.315   1.00 42.70  ? 43  ILE C N   1 
ATOM   1828 C  CA  . ILE C 1 46 ? -19.075 20.322  7.223   1.00 42.73  ? 43  ILE C CA  1 
ATOM   1829 C  C   . ILE C 1 46 ? -18.663 20.456  8.688   1.00 47.87  ? 43  ILE C C   1 
ATOM   1830 O  O   . ILE C 1 46 ? -19.296 19.868  9.565   1.00 59.26  ? 43  ILE C O   1 
ATOM   1831 C  CB  . ILE C 1 46 ? -18.923 18.847  6.808   1.00 28.61  ? 43  ILE C CB  1 
ATOM   1832 C  CG1 . ILE C 1 46 ? -17.453 18.419  6.870   1.00 34.36  ? 43  ILE C CG1 1 
ATOM   1833 C  CG2 . ILE C 1 46 ? -19.488 18.644  5.406   1.00 44.83  ? 43  ILE C CG2 1 
ATOM   1834 C  CD1 . ILE C 1 46 ? -17.228 16.958  6.569   1.00 38.46  ? 43  ILE C CD1 1 
ATOM   1835 N  N   . LEU C 1 47 ? -17.606 21.219  8.951   1.00 46.69  ? 44  LEU C N   1 
ATOM   1836 C  CA  . LEU C 1 47 ? -17.134 21.424  10.317  1.00 60.05  ? 44  LEU C CA  1 
ATOM   1837 C  C   . LEU C 1 47 ? -17.552 22.786  10.858  1.00 68.02  ? 44  LEU C C   1 
ATOM   1838 O  O   . LEU C 1 47 ? -17.394 23.809  10.195  1.00 66.24  ? 44  LEU C O   1 
ATOM   1839 C  CB  . LEU C 1 47 ? -15.614 21.268  10.384  1.00 52.20  ? 44  LEU C CB  1 
ATOM   1840 C  CG  . LEU C 1 47 ? -15.141 19.816  10.482  1.00 56.32  ? 44  LEU C CG  1 
ATOM   1841 C  CD1 . LEU C 1 47 ? -13.643 19.719  10.270  1.00 55.54  ? 44  LEU C CD1 1 
ATOM   1842 C  CD2 . LEU C 1 47 ? -15.526 19.214  11.830  1.00 69.77  ? 44  LEU C CD2 1 
ATOM   1843 N  N   . LYS C 1 48 ? -18.088 22.777  12.075  1.00 76.14  ? 45  LYS C N   1 
ATOM   1844 C  CA  . LYS C 1 48 ? -18.619 23.981  12.702  1.00 78.97  ? 45  LYS C CA  1 
ATOM   1845 C  C   . LYS C 1 48 ? -17.538 25.023  12.967  1.00 81.11  ? 45  LYS C C   1 
ATOM   1846 O  O   . LYS C 1 48 ? -17.771 26.220  12.792  1.00 77.94  ? 45  LYS C O   1 
ATOM   1847 C  CB  . LYS C 1 48 ? -19.320 23.629  14.017  1.00 76.37  ? 45  LYS C CB  1 
ATOM   1848 C  CG  . LYS C 1 48 ? -20.836 23.568  13.918  1.00 70.45  ? 45  LYS C CG  1 
ATOM   1849 C  CD  . LYS C 1 48 ? -21.461 23.221  15.261  1.00 73.57  ? 45  LYS C CD  1 
ATOM   1850 C  CE  . LYS C 1 48 ? -22.976 23.141  15.173  1.00 66.47  ? 45  LYS C CE  1 
ATOM   1851 N  NZ  . LYS C 1 48 ? -23.431 21.972  14.373  1.00 61.66  ? 45  LYS C NZ  1 
ATOM   1852 N  N   . ASN C 1 49 ? -16.360 24.563  13.383  1.00 81.65  ? 46  ASN C N   1 
ATOM   1853 C  CA  . ASN C 1 49 ? -15.289 25.463  13.800  1.00 96.22  ? 46  ASN C CA  1 
ATOM   1854 C  C   . ASN C 1 49 ? -13.972 25.201  13.069  1.00 89.73  ? 46  ASN C C   1 
ATOM   1855 O  O   . ASN C 1 49 ? -13.070 24.563  13.613  1.00 84.33  ? 46  ASN C O   1 
ATOM   1856 C  CB  . ASN C 1 49 ? -15.079 25.350  15.314  1.00 100.95 ? 46  ASN C CB  1 
ATOM   1857 C  CG  . ASN C 1 49 ? -14.199 26.456  15.869  1.00 93.23  ? 46  ASN C CG  1 
ATOM   1858 O  OD1 . ASN C 1 49 ? -13.849 27.404  15.164  1.00 100.77 ? 46  ASN C OD1 1 
ATOM   1859 N  ND2 . ASN C 1 49 ? -13.849 26.348  17.146  1.00 80.16  ? 46  ASN C ND2 1 
ATOM   1860 N  N   . PRO C 1 50 ? -13.863 25.689  11.823  1.00 93.10  ? 47  PRO C N   1 
ATOM   1861 C  CA  . PRO C 1 50 ? -12.585 25.682  11.103  1.00 100.82 ? 47  PRO C CA  1 
ATOM   1862 C  C   . PRO C 1 50 ? -11.545 26.570  11.783  1.00 103.18 ? 47  PRO C C   1 
ATOM   1863 O  O   . PRO C 1 50 ? -11.894 27.328  12.688  1.00 96.88  ? 47  PRO C O   1 
ATOM   1864 C  CB  . PRO C 1 50 ? -12.954 26.229  9.719   1.00 100.04 ? 47  PRO C CB  1 
ATOM   1865 C  CG  . PRO C 1 50 ? -14.412 25.977  9.582   1.00 89.26  ? 47  PRO C CG  1 
ATOM   1866 C  CD  . PRO C 1 50 ? -14.974 26.122  10.959  1.00 90.89  ? 47  PRO C CD  1 
ATOM   1867 N  N   . ASP C 1 51 ? -10.292 26.475  11.344  1.00 105.22 ? 48  ASP C N   1 
ATOM   1868 C  CA  . ASP C 1 51 ? -9.198  27.237  11.943  1.00 99.88  ? 48  ASP C CA  1 
ATOM   1869 C  C   . ASP C 1 51 ? -9.113  26.979  13.448  1.00 94.89  ? 48  ASP C C   1 
ATOM   1870 O  O   . ASP C 1 51 ? -9.288  27.896  14.253  1.00 85.40  ? 48  ASP C O   1 
ATOM   1871 C  CB  . ASP C 1 51 ? -9.369  28.737  11.672  1.00 103.76 ? 48  ASP C CB  1 
ATOM   1872 C  CG  . ASP C 1 51 ? -9.311  29.079  10.192  1.00 102.79 ? 48  ASP C CG  1 
ATOM   1873 O  OD1 . ASP C 1 51 ? -10.363 29.012  9.521   1.00 100.67 ? 48  ASP C OD1 1 
ATOM   1874 O  OD2 . ASP C 1 51 ? -8.215  29.424  9.703   1.00 93.83  ? 48  ASP C OD2 1 
ATOM   1875 N  N   . ASP C 1 52 ? -8.850  25.727  13.816  1.00 97.88  ? 49  ASP C N   1 
ATOM   1876 C  CA  . ASP C 1 52 ? -8.751  25.327  15.219  1.00 84.84  ? 49  ASP C CA  1 
ATOM   1877 C  C   . ASP C 1 52 ? -7.668  24.262  15.411  1.00 77.37  ? 49  ASP C C   1 
ATOM   1878 O  O   . ASP C 1 52 ? -7.949  23.070  15.299  1.00 72.86  ? 49  ASP C O   1 
ATOM   1879 C  CB  . ASP C 1 52 ? -10.100 24.800  15.722  1.00 80.45  ? 49  ASP C CB  1 
ATOM   1880 C  CG  . ASP C 1 52 ? -10.054 24.381  17.182  1.00 75.77  ? 49  ASP C CG  1 
ATOM   1881 O  OD1 . ASP C 1 52 ? -9.221  24.931  17.934  1.00 66.00  ? 49  ASP C OD1 1 
ATOM   1882 O  OD2 . ASP C 1 52 ? -10.852 23.505  17.582  1.00 74.45  ? 49  ASP C OD2 1 
ATOM   1883 N  N   . PRO C 1 53 ? -6.420  24.692  15.680  1.00 77.01  ? 50  PRO C N   1 
ATOM   1884 C  CA  . PRO C 1 53 ? -5.292  23.783  15.924  1.00 70.84  ? 50  PRO C CA  1 
ATOM   1885 C  C   . PRO C 1 53 ? -5.586  22.628  16.885  1.00 57.64  ? 50  PRO C C   1 
ATOM   1886 O  O   . PRO C 1 53 ? -5.042  21.539  16.703  1.00 57.29  ? 50  PRO C O   1 
ATOM   1887 C  CB  . PRO C 1 53 ? -4.231  24.705  16.527  1.00 70.77  ? 50  PRO C CB  1 
ATOM   1888 C  CG  . PRO C 1 53 ? -4.558  26.078  16.028  1.00 72.79  ? 50  PRO C CG  1 
ATOM   1889 C  CD  . PRO C 1 53 ? -5.957  26.076  15.472  1.00 76.21  ? 50  PRO C CD  1 
ATOM   1890 N  N   . ASP C 1 54 ? -6.416  22.866  17.896  1.00 53.23  ? 51  ASP C N   1 
ATOM   1891 C  CA  . ASP C 1 54 ? -6.756  21.824  18.860  1.00 53.82  ? 51  ASP C CA  1 
ATOM   1892 C  C   . ASP C 1 54 ? -7.453  20.649  18.176  1.00 54.56  ? 51  ASP C C   1 
ATOM   1893 O  O   . ASP C 1 54 ? -7.241  19.494  18.546  1.00 50.23  ? 51  ASP C O   1 
ATOM   1894 C  CB  . ASP C 1 54 ? -7.647  22.385  19.973  1.00 70.50  ? 51  ASP C CB  1 
ATOM   1895 C  CG  . ASP C 1 54 ? -6.873  23.218  20.984  1.00 74.31  ? 51  ASP C CG  1 
ATOM   1896 O  OD1 . ASP C 1 54 ? -5.701  22.890  21.264  1.00 73.80  ? 51  ASP C OD1 1 
ATOM   1897 O  OD2 . ASP C 1 54 ? -7.444  24.200  21.505  1.00 69.52  ? 51  ASP C OD2 1 
ATOM   1898 N  N   . MET C 1 55 ? -8.284  20.948  17.181  1.00 49.00  ? 52  MET C N   1 
ATOM   1899 C  CA  . MET C 1 55 ? -8.958  19.913  16.406  1.00 52.07  ? 52  MET C CA  1 
ATOM   1900 C  C   . MET C 1 55 ? -7.940  18.998  15.739  1.00 50.04  ? 52  MET C C   1 
ATOM   1901 O  O   . MET C 1 55 ? -8.133  17.785  15.660  1.00 49.70  ? 52  MET C O   1 
ATOM   1902 C  CB  . MET C 1 55 ? -9.865  20.541  15.344  1.00 60.47  ? 52  MET C CB  1 
ATOM   1903 C  CG  . MET C 1 55 ? -10.571 19.543  14.432  1.00 64.93  ? 52  MET C CG  1 
ATOM   1904 S  SD  . MET C 1 55 ? -11.999 18.781  15.206  1.00 92.02  ? 52  MET C SD  1 
ATOM   1905 C  CE  . MET C 1 55 ? -13.284 19.843  14.566  1.00 69.75  ? 52  MET C CE  1 
ATOM   1906 N  N   . VAL C 1 56 ? -6.857  19.594  15.258  1.00 45.38  ? 53  VAL C N   1 
ATOM   1907 C  CA  . VAL C 1 56 ? -5.846  18.861  14.510  1.00 39.66  ? 53  VAL C CA  1 
ATOM   1908 C  C   . VAL C 1 56 ? -5.197  17.801  15.390  1.00 42.76  ? 53  VAL C C   1 
ATOM   1909 O  O   . VAL C 1 56 ? -5.029  16.655  14.975  1.00 39.79  ? 53  VAL C O   1 
ATOM   1910 C  CB  . VAL C 1 56 ? -4.754  19.800  13.960  1.00 32.84  ? 53  VAL C CB  1 
ATOM   1911 C  CG1 . VAL C 1 56 ? -3.827  19.045  13.020  1.00 36.15  ? 53  VAL C CG1 1 
ATOM   1912 C  CG2 . VAL C 1 56 ? -5.381  20.992  13.243  1.00 48.94  ? 53  VAL C CG2 1 
ATOM   1913 N  N   . ASP C 1 57 ? -4.839  18.192  16.608  1.00 39.67  ? 54  ASP C N   1 
ATOM   1914 C  CA  . ASP C 1 57 ? -4.181  17.288  17.543  1.00 42.30  ? 54  ASP C CA  1 
ATOM   1915 C  C   . ASP C 1 57 ? -5.082  16.109  17.894  1.00 32.75  ? 54  ASP C C   1 
ATOM   1916 O  O   . ASP C 1 57 ? -4.626  14.969  17.970  1.00 37.52  ? 54  ASP C O   1 
ATOM   1917 C  CB  . ASP C 1 57 ? -3.777  18.045  18.808  1.00 38.40  ? 54  ASP C CB  1 
ATOM   1918 C  CG  . ASP C 1 57 ? -2.820  19.185  18.520  1.00 37.18  ? 54  ASP C CG  1 
ATOM   1919 O  OD1 . ASP C 1 57 ? -1.941  19.016  17.649  1.00 40.98  ? 54  ASP C OD1 1 
ATOM   1920 O  OD2 . ASP C 1 57 ? -2.948  20.252  19.157  1.00 46.84  ? 54  ASP C OD2 1 
ATOM   1921 N  N   . VAL C 1 58 ? -6.364  16.391  18.097  1.00 33.95  ? 55  VAL C N   1 
ATOM   1922 C  CA  . VAL C 1 58 ? -7.336  15.357  18.421  1.00 33.68  ? 55  VAL C CA  1 
ATOM   1923 C  C   . VAL C 1 58 ? -7.436  14.328  17.297  1.00 37.94  ? 55  VAL C C   1 
ATOM   1924 O  O   . VAL C 1 58 ? -7.335  13.124  17.534  1.00 30.57  ? 55  VAL C O   1 
ATOM   1925 C  CB  . VAL C 1 58 ? -8.728  15.970  18.683  1.00 36.78  ? 55  VAL C CB  1 
ATOM   1926 C  CG1 . VAL C 1 58 ? -9.798  14.886  18.779  1.00 42.24  ? 55  VAL C CG1 1 
ATOM   1927 C  CG2 . VAL C 1 58 ? -8.707  16.804  19.953  1.00 46.97  ? 55  VAL C CG2 1 
ATOM   1928 N  N   . PHE C 1 59 ? -7.638  14.811  16.075  1.00 35.43  ? 56  PHE C N   1 
ATOM   1929 C  CA  . PHE C 1 59 ? -7.805  13.935  14.922  1.00 25.57  ? 56  PHE C CA  1 
ATOM   1930 C  C   . PHE C 1 59 ? -6.546  13.130  14.639  1.00 31.92  ? 56  PHE C C   1 
ATOM   1931 O  O   . PHE C 1 59 ? -6.623  11.978  14.212  1.00 29.15  ? 56  PHE C O   1 
ATOM   1932 C  CB  . PHE C 1 59 ? -8.196  14.745  13.684  1.00 39.60  ? 56  PHE C CB  1 
ATOM   1933 C  CG  . PHE C 1 59 ? -9.668  14.725  13.398  1.00 36.08  ? 56  PHE C CG  1 
ATOM   1934 C  CD1 . PHE C 1 59 ? -10.221 13.713  12.634  1.00 40.62  ? 56  PHE C CD1 1 
ATOM   1935 C  CD2 . PHE C 1 59 ? -10.500 15.709  13.902  1.00 53.56  ? 56  PHE C CD2 1 
ATOM   1936 C  CE1 . PHE C 1 59 ? -11.575 13.685  12.373  1.00 43.26  ? 56  PHE C CE1 1 
ATOM   1937 C  CE2 . PHE C 1 59 ? -11.856 15.686  13.644  1.00 55.54  ? 56  PHE C CE2 1 
ATOM   1938 C  CZ  . PHE C 1 59 ? -12.393 14.673  12.879  1.00 51.59  ? 56  PHE C CZ  1 
ATOM   1939 N  N   . MET C 1 60 ? -5.387  13.735  14.874  1.00 29.46  ? 57  MET C N   1 
ATOM   1940 C  CA  . MET C 1 60 ? -4.125  13.034  14.690  1.00 30.11  ? 57  MET C CA  1 
ATOM   1941 C  C   . MET C 1 60 ? -4.083  11.817  15.610  1.00 27.94  ? 57  MET C C   1 
ATOM   1942 O  O   . MET C 1 60 ? -3.679  10.728  15.202  1.00 24.04  ? 57  MET C O   1 
ATOM   1943 C  CB  . MET C 1 60 ? -2.941  13.963  14.971  1.00 30.78  ? 57  MET C CB  1 
ATOM   1944 C  CG  . MET C 1 60 ? -1.588  13.385  14.579  1.00 38.66  ? 57  MET C CG  1 
ATOM   1945 S  SD  . MET C 1 60 ? -1.406  13.177  12.797  1.00 46.01  ? 57  MET C SD  1 
ATOM   1946 C  CE  . MET C 1 60 ? 0.150   12.289  12.716  1.00 45.65  ? 57  MET C CE  1 
ATOM   1947 N  N   . ASP C 1 61 ? -4.525  12.005  16.848  1.00 26.32  ? 58  ASP C N   1 
ATOM   1948 C  CA  . ASP C 1 61 ? -4.513  10.928  17.828  1.00 29.67  ? 58  ASP C CA  1 
ATOM   1949 C  C   . ASP C 1 61 ? -5.585  9.893   17.494  1.00 33.38  ? 58  ASP C C   1 
ATOM   1950 O  O   . ASP C 1 61 ? -5.414  8.703   17.759  1.00 31.86  ? 58  ASP C O   1 
ATOM   1951 C  CB  . ASP C 1 61 ? -4.727  11.482  19.239  1.00 33.00  ? 58  ASP C CB  1 
ATOM   1952 C  CG  . ASP C 1 61 ? -4.356  10.483  20.321  1.00 58.75  ? 58  ASP C CG  1 
ATOM   1953 O  OD1 . ASP C 1 61 ? -3.230  9.941   20.277  1.00 49.45  ? 58  ASP C OD1 1 
ATOM   1954 O  OD2 . ASP C 1 61 ? -5.195  10.233  21.214  1.00 67.58  ? 58  ASP C OD2 1 
ATOM   1955 N  N   . HIS C 1 62 ? -6.687  10.354  16.908  1.00 33.18  ? 59  HIS C N   1 
ATOM   1956 C  CA  . HIS C 1 62 ? -7.775  9.467   16.506  1.00 30.00  ? 59  HIS C CA  1 
ATOM   1957 C  C   . HIS C 1 62 ? -7.351  8.502   15.400  1.00 27.40  ? 59  HIS C C   1 
ATOM   1958 O  O   . HIS C 1 62 ? -7.677  7.316   15.446  1.00 26.53  ? 59  HIS C O   1 
ATOM   1959 C  CB  . HIS C 1 62 ? -8.983  10.282  16.033  1.00 41.25  ? 59  HIS C CB  1 
ATOM   1960 C  CG  . HIS C 1 62 ? -9.853  10.791  17.145  1.00 37.68  ? 59  HIS C CG  1 
ATOM   1961 N  ND1 . HIS C 1 62 ? -9.640  10.471  18.466  1.00 35.63  ? 59  HIS C ND1 1 
ATOM   1962 C  CD2 . HIS C 1 62 ? -10.942 11.594  17.120  1.00 41.40  ? 59  HIS C CD2 1 
ATOM   1963 C  CE1 . HIS C 1 62 ? -10.560 11.059  19.214  1.00 34.12  ? 59  HIS C CE1 1 
ATOM   1964 N  NE2 . HIS C 1 62 ? -11.362 11.746  18.420  1.00 37.62  ? 59  HIS C NE2 1 
ATOM   1965 N  N   . LEU C 1 63 ? -6.624  9.018   14.411  1.00 20.76  ? 60  LEU C N   1 
ATOM   1966 C  CA  . LEU C 1 63 ? -6.266  8.243   13.223  1.00 22.32  ? 60  LEU C CA  1 
ATOM   1967 C  C   . LEU C 1 63 ? -4.950  7.482   13.370  1.00 24.75  ? 60  LEU C C   1 
ATOM   1968 O  O   . LEU C 1 63 ? -4.780  6.411   12.790  1.00 30.10  ? 60  LEU C O   1 
ATOM   1969 C  CB  . LEU C 1 63 ? -6.174  9.160   12.004  1.00 28.56  ? 60  LEU C CB  1 
ATOM   1970 C  CG  . LEU C 1 63 ? -7.470  9.420   11.237  1.00 26.37  ? 60  LEU C CG  1 
ATOM   1971 C  CD1 . LEU C 1 63 ? -8.483  10.165  12.086  1.00 29.27  ? 60  LEU C CD1 1 
ATOM   1972 C  CD2 . LEU C 1 63 ? -7.166  10.190  9.967   1.00 26.81  ? 60  LEU C CD2 1 
ATOM   1973 N  N   . ASP C 1 64 ? -4.020  8.048   14.133  1.00 31.89  ? 61  ASP C N   1 
ATOM   1974 C  CA  . ASP C 1 64 ? -2.704  7.445   14.323  1.00 29.14  ? 61  ASP C CA  1 
ATOM   1975 C  C   . ASP C 1 64 ? -2.773  6.302   15.338  1.00 33.47  ? 61  ASP C C   1 
ATOM   1976 O  O   . ASP C 1 64 ? -2.267  6.412   16.455  1.00 23.99  ? 61  ASP C O   1 
ATOM   1977 C  CB  . ASP C 1 64 ? -1.701  8.509   14.778  1.00 17.38  ? 61  ASP C CB  1 
ATOM   1978 C  CG  . ASP C 1 64 ? -0.273  8.011   14.766  1.00 26.07  ? 61  ASP C CG  1 
ATOM   1979 O  OD1 . ASP C 1 64 ? 0.031   7.093   13.980  1.00 25.87  ? 61  ASP C OD1 1 
ATOM   1980 O  OD2 . ASP C 1 64 ? 0.549   8.544   15.538  1.00 30.94  ? 61  ASP C OD2 1 
ATOM   1981 N  N   . ILE C 1 65 ? -3.387  5.196   14.928  1.00 24.12  ? 62  ILE C N   1 
ATOM   1982 C  CA  . ILE C 1 65 ? -3.690  4.100   15.841  1.00 28.77  ? 62  ILE C CA  1 
ATOM   1983 C  C   . ILE C 1 65 ? -2.490  3.195   16.148  1.00 29.00  ? 62  ILE C C   1 
ATOM   1984 O  O   . ILE C 1 65 ? -2.589  2.321   17.007  1.00 38.66  ? 62  ILE C O   1 
ATOM   1985 C  CB  . ILE C 1 65 ? -4.841  3.229   15.288  1.00 27.43  ? 62  ILE C CB  1 
ATOM   1986 C  CG1 . ILE C 1 65 ? -4.475  2.653   13.915  1.00 26.26  ? 62  ILE C CG1 1 
ATOM   1987 C  CG2 . ILE C 1 65 ? -6.125  4.050   15.208  1.00 31.61  ? 62  ILE C CG2 1 
ATOM   1988 C  CD1 . ILE C 1 65 ? -5.460  1.633   13.394  1.00 31.61  ? 62  ILE C CD1 1 
ATOM   1989 N  N   . ASP C 1 66 ? -1.374  3.389   15.445  1.00 29.61  ? 63  ASP C N   1 
ATOM   1990 C  CA  . ASP C 1 66 ? -0.118  2.721   15.804  1.00 24.43  ? 63  ASP C CA  1 
ATOM   1991 C  C   . ASP C 1 66 ? 0.859   3.702   16.462  1.00 25.67  ? 63  ASP C C   1 
ATOM   1992 O  O   . ASP C 1 66 ? 2.007   3.357   16.740  1.00 31.66  ? 63  ASP C O   1 
ATOM   1993 C  CB  . ASP C 1 66 ? 0.532   2.061   14.580  1.00 35.91  ? 63  ASP C CB  1 
ATOM   1994 C  CG  . ASP C 1 66 ? 0.913   3.056   13.496  1.00 30.98  ? 63  ASP C CG  1 
ATOM   1995 O  OD1 . ASP C 1 66 ? 0.780   4.279   13.711  1.00 29.43  ? 63  ASP C OD1 1 
ATOM   1996 O  OD2 . ASP C 1 66 ? 1.361   2.604   12.420  1.00 30.97  ? 63  ASP C OD2 1 
ATOM   1997 N  N   . HIS C 1 67 ? 0.391   4.928   16.685  1.00 29.89  ? 64  HIS C N   1 
ATOM   1998 C  CA  . HIS C 1 67 ? 1.122   5.928   17.464  1.00 36.15  ? 64  HIS C CA  1 
ATOM   1999 C  C   . HIS C 1 67 ? 2.550   6.172   16.974  1.00 38.04  ? 64  HIS C C   1 
ATOM   2000 O  O   . HIS C 1 67 ? 3.487   6.161   17.774  1.00 47.99  ? 64  HIS C O   1 
ATOM   2001 C  CB  . HIS C 1 67 ? 1.160   5.514   18.940  1.00 43.91  ? 64  HIS C CB  1 
ATOM   2002 C  CG  . HIS C 1 67 ? -0.192  5.252   19.529  1.00 39.82  ? 64  HIS C CG  1 
ATOM   2003 N  ND1 . HIS C 1 67 ? -0.789  4.011   19.498  1.00 37.87  ? 64  HIS C ND1 1 
ATOM   2004 C  CD2 . HIS C 1 67 ? -1.067  6.075   20.154  1.00 38.84  ? 64  HIS C CD2 1 
ATOM   2005 C  CE1 . HIS C 1 67 ? -1.972  4.078   20.084  1.00 35.25  ? 64  HIS C CE1 1 
ATOM   2006 N  NE2 . HIS C 1 67 ? -2.165  5.321   20.489  1.00 46.43  ? 64  HIS C NE2 1 
ATOM   2007 N  N   . ASN C 1 68 ? 2.714   6.394   15.671  1.00 29.56  ? 65  ASN C N   1 
ATOM   2008 C  CA  . ASN C 1 68 ? 4.029   6.709   15.112  1.00 28.07  ? 65  ASN C CA  1 
ATOM   2009 C  C   . ASN C 1 68 ? 4.085   8.130   14.541  1.00 28.04  ? 65  ASN C C   1 
ATOM   2010 O  O   . ASN C 1 68 ? 4.992   8.465   13.781  1.00 40.66  ? 65  ASN C O   1 
ATOM   2011 C  CB  . ASN C 1 68 ? 4.417   5.683   14.038  1.00 36.52  ? 65  ASN C CB  1 
ATOM   2012 C  CG  . ASN C 1 68 ? 3.594   5.804   12.768  1.00 31.22  ? 65  ASN C CG  1 
ATOM   2013 O  OD1 . ASN C 1 68 ? 2.536   6.431   12.748  1.00 26.11  ? 65  ASN C OD1 1 
ATOM   2014 N  ND2 . ASN C 1 68 ? 4.077   5.183   11.697  1.00 32.96  ? 65  ASN C ND2 1 
ATOM   2015 N  N   . LYS C 1 69 ? 3.113   8.955   14.923  1.00 32.88  ? 66  LYS C N   1 
ATOM   2016 C  CA  . LYS C 1 69 ? 3.080   10.369  14.549  1.00 28.73  ? 66  LYS C CA  1 
ATOM   2017 C  C   . LYS C 1 69 ? 2.974   10.571  13.037  1.00 35.04  ? 66  LYS C C   1 
ATOM   2018 O  O   . LYS C 1 69 ? 3.394   11.601  12.508  1.00 36.04  ? 66  LYS C O   1 
ATOM   2019 C  CB  . LYS C 1 69 ? 4.324   11.085  15.088  1.00 33.88  ? 66  LYS C CB  1 
ATOM   2020 C  CG  . LYS C 1 69 ? 4.679   10.728  16.527  1.00 29.56  ? 66  LYS C CG  1 
ATOM   2021 C  CD  . LYS C 1 69 ? 3.530   11.009  17.488  1.00 46.27  ? 66  LYS C CD  1 
ATOM   2022 C  CE  . LYS C 1 69 ? 3.743   10.336  18.832  1.00 52.91  ? 66  LYS C CE  1 
ATOM   2023 N  NZ  . LYS C 1 69 ? 2.480   9.730   19.339  1.00 62.00  ? 66  LYS C NZ  1 
ATOM   2024 N  N   . LYS C 1 70 ? 2.410   9.581   12.351  1.00 28.31  ? 67  LYS C N   1 
ATOM   2025 C  CA  . LYS C 1 70 ? 2.163   9.670   10.916  1.00 37.18  ? 67  LYS C CA  1 
ATOM   2026 C  C   . LYS C 1 70 ? 0.860   8.971   10.568  1.00 25.11  ? 67  LYS C C   1 
ATOM   2027 O  O   . LYS C 1 70 ? 0.477   8.005   11.222  1.00 30.85  ? 67  LYS C O   1 
ATOM   2028 C  CB  . LYS C 1 70 ? 3.308   9.042   10.126  1.00 28.10  ? 67  LYS C CB  1 
ATOM   2029 C  CG  . LYS C 1 70 ? 4.663   9.662   10.392  1.00 39.61  ? 67  LYS C CG  1 
ATOM   2030 C  CD  . LYS C 1 70 ? 5.754   8.997   9.567   1.00 47.31  ? 67  LYS C CD  1 
ATOM   2031 C  CE  . LYS C 1 70 ? 5.982   7.550   9.987   1.00 49.25  ? 67  LYS C CE  1 
ATOM   2032 N  NZ  . LYS C 1 70 ? 7.089   6.913   9.225   1.00 52.61  ? 67  LYS C NZ  1 
ATOM   2033 N  N   . ILE C 1 71 ? 0.180   9.463   9.538   1.00 25.60  ? 68  ILE C N   1 
ATOM   2034 C  CA  . ILE C 1 71 ? -1.034  8.822   9.055   1.00 23.07  ? 68  ILE C CA  1 
ATOM   2035 C  C   . ILE C 1 71 ? -0.755  8.160   7.710   1.00 25.27  ? 68  ILE C C   1 
ATOM   2036 O  O   . ILE C 1 71 ? -0.657  8.836   6.688   1.00 26.39  ? 68  ILE C O   1 
ATOM   2037 C  CB  . ILE C 1 71 ? -2.196  9.826   8.913   1.00 27.21  ? 68  ILE C CB  1 
ATOM   2038 C  CG1 . ILE C 1 71 ? -2.330  10.686  10.175  1.00 23.45  ? 68  ILE C CG1 1 
ATOM   2039 C  CG2 . ILE C 1 71 ? -3.499  9.096   8.621   1.00 25.85  ? 68  ILE C CG2 1 
ATOM   2040 C  CD1 . ILE C 1 71 ? -2.558  9.895   11.458  1.00 24.34  ? 68  ILE C CD1 1 
ATOM   2041 N  N   . ASP C 1 72 ? -0.605  6.838   7.715   1.00 25.57  ? 69  ASP C N   1 
ATOM   2042 C  CA  . ASP C 1 72 ? -0.428  6.106   6.469   1.00 27.84  ? 69  ASP C CA  1 
ATOM   2043 C  C   . ASP C 1 72 ? -1.774  5.989   5.768   1.00 23.79  ? 69  ASP C C   1 
ATOM   2044 O  O   . ASP C 1 72 ? -2.809  6.350   6.329   1.00 20.89  ? 69  ASP C O   1 
ATOM   2045 C  CB  . ASP C 1 72 ? 0.193   4.723   6.710   1.00 28.51  ? 69  ASP C CB  1 
ATOM   2046 C  CG  . ASP C 1 72 ? -0.633  3.849   7.641   1.00 23.09  ? 69  ASP C CG  1 
ATOM   2047 O  OD1 . ASP C 1 72 ? -1.873  3.795   7.496   1.00 29.17  ? 69  ASP C OD1 1 
ATOM   2048 O  OD2 . ASP C 1 72 ? -0.032  3.198   8.519   1.00 41.35  ? 69  ASP C OD2 1 
ATOM   2049 N  N   . PHE C 1 73 ? -1.756  5.480   4.543   1.00 28.33  ? 70  PHE C N   1 
ATOM   2050 C  CA  . PHE C 1 73 ? -2.959  5.432   3.729   1.00 25.78  ? 70  PHE C CA  1 
ATOM   2051 C  C   . PHE C 1 73 ? -4.019  4.541   4.371   1.00 29.86  ? 70  PHE C C   1 
ATOM   2052 O  O   . PHE C 1 73 ? -5.215  4.824   4.282   1.00 23.02  ? 70  PHE C O   1 
ATOM   2053 C  CB  . PHE C 1 73 ? -2.628  4.938   2.322   1.00 23.06  ? 70  PHE C CB  1 
ATOM   2054 C  CG  . PHE C 1 73 ? -3.794  4.972   1.387   1.00 19.06  ? 70  PHE C CG  1 
ATOM   2055 C  CD1 . PHE C 1 73 ? -4.401  6.174   1.064   1.00 25.86  ? 70  PHE C CD1 1 
ATOM   2056 C  CD2 . PHE C 1 73 ? -4.282  3.806   0.827   1.00 19.41  ? 70  PHE C CD2 1 
ATOM   2057 C  CE1 . PHE C 1 73 ? -5.478  6.211   0.204   1.00 25.63  ? 70  PHE C CE1 1 
ATOM   2058 C  CE2 . PHE C 1 73 ? -5.356  3.837   -0.036  1.00 25.10  ? 70  PHE C CE2 1 
ATOM   2059 C  CZ  . PHE C 1 73 ? -5.957  5.040   -0.347  1.00 26.07  ? 70  PHE C CZ  1 
ATOM   2060 N  N   . THR C 1 74 ? -3.574  3.478   5.033   1.00 23.64  ? 71  THR C N   1 
ATOM   2061 C  CA  . THR C 1 74 ? -4.487  2.546   5.690   1.00 22.58  ? 71  THR C CA  1 
ATOM   2062 C  C   . THR C 1 74 ? -5.269  3.230   6.807   1.00 18.31  ? 71  THR C C   1 
ATOM   2063 O  O   . THR C 1 74 ? -6.473  3.030   6.942   1.00 22.16  ? 71  THR C O   1 
ATOM   2064 C  CB  . THR C 1 74 ? -3.731  1.336   6.271   1.00 24.07  ? 71  THR C CB  1 
ATOM   2065 O  OG1 . THR C 1 74 ? -3.003  0.683   5.226   1.00 28.47  ? 71  THR C OG1 1 
ATOM   2066 C  CG2 . THR C 1 74 ? -4.699  0.342   6.911   1.00 28.99  ? 71  THR C CG2 1 
ATOM   2067 N  N   . GLU C 1 75 ? -4.580  4.032   7.609   1.00 26.19  ? 72  GLU C N   1 
ATOM   2068 C  CA  . GLU C 1 75 ? -5.229  4.759   8.693   1.00 26.68  ? 72  GLU C CA  1 
ATOM   2069 C  C   . GLU C 1 75 ? -6.152  5.845   8.151   1.00 22.14  ? 72  GLU C C   1 
ATOM   2070 O  O   . GLU C 1 75 ? -7.201  6.128   8.728   1.00 24.34  ? 72  GLU C O   1 
ATOM   2071 C  CB  . GLU C 1 75 ? -4.180  5.367   9.621   1.00 20.25  ? 72  GLU C CB  1 
ATOM   2072 C  CG  . GLU C 1 75 ? -3.359  4.324   10.362  1.00 24.46  ? 72  GLU C CG  1 
ATOM   2073 C  CD  . GLU C 1 75 ? -2.155  4.912   11.062  1.00 28.21  ? 72  GLU C CD  1 
ATOM   2074 O  OE1 . GLU C 1 75 ? -1.549  5.854   10.513  1.00 28.93  ? 72  GLU C OE1 1 
ATOM   2075 O  OE2 . GLU C 1 75 ? -1.816  4.432   12.164  1.00 25.30  ? 72  GLU C OE2 1 
ATOM   2076 N  N   . PHE C 1 76 ? -5.758  6.447   7.036   1.00 26.38  ? 73  PHE C N   1 
ATOM   2077 C  CA  . PHE C 1 76 ? -6.585  7.446   6.373   1.00 17.46  ? 73  PHE C CA  1 
ATOM   2078 C  C   . PHE C 1 76 ? -7.907  6.829   5.910   1.00 24.53  ? 73  PHE C C   1 
ATOM   2079 O  O   . PHE C 1 76 ? -8.968  7.434   6.059   1.00 20.68  ? 73  PHE C O   1 
ATOM   2080 C  CB  . PHE C 1 76 ? -5.821  8.058   5.196   1.00 17.23  ? 73  PHE C CB  1 
ATOM   2081 C  CG  . PHE C 1 76 ? -6.665  8.899   4.287   1.00 19.32  ? 73  PHE C CG  1 
ATOM   2082 C  CD1 . PHE C 1 76 ? -7.059  10.171  4.662   1.00 21.40  ? 73  PHE C CD1 1 
ATOM   2083 C  CD2 . PHE C 1 76 ? -7.045  8.423   3.042   1.00 23.60  ? 73  PHE C CD2 1 
ATOM   2084 C  CE1 . PHE C 1 76 ? -7.830  10.949  3.819   1.00 24.57  ? 73  PHE C CE1 1 
ATOM   2085 C  CE2 . PHE C 1 76 ? -7.813  9.195   2.194   1.00 26.92  ? 73  PHE C CE2 1 
ATOM   2086 C  CZ  . PHE C 1 76 ? -8.206  10.459  2.581   1.00 19.73  ? 73  PHE C CZ  1 
ATOM   2087 N  N   . LEU C 1 77 ? -7.845  5.614   5.372   1.00 25.68  ? 74  LEU C N   1 
ATOM   2088 C  CA  . LEU C 1 77 ? -9.042  4.943   4.871   1.00 21.45  ? 74  LEU C CA  1 
ATOM   2089 C  C   . LEU C 1 77 ? -10.028 4.603   5.989   1.00 21.99  ? 74  LEU C C   1 
ATOM   2090 O  O   . LEU C 1 77 ? -11.240 4.604   5.771   1.00 25.16  ? 74  LEU C O   1 
ATOM   2091 C  CB  . LEU C 1 77 ? -8.665  3.666   4.113   1.00 18.60  ? 74  LEU C CB  1 
ATOM   2092 C  CG  . LEU C 1 77 ? -7.999  3.817   2.741   1.00 32.75  ? 74  LEU C CG  1 
ATOM   2093 C  CD1 . LEU C 1 77 ? -7.668  2.446   2.169   1.00 25.98  ? 74  LEU C CD1 1 
ATOM   2094 C  CD2 . LEU C 1 77 ? -8.875  4.599   1.771   1.00 26.25  ? 74  LEU C CD2 1 
ATOM   2095 N  N   . LEU C 1 78 ? -9.518  4.313   7.183   1.00 26.01  ? 75  LEU C N   1 
ATOM   2096 C  CA  . LEU C 1 78 ? -10.390 4.011   8.315   1.00 22.44  ? 75  LEU C CA  1 
ATOM   2097 C  C   . LEU C 1 78 ? -11.289 5.203   8.637   1.00 16.69  ? 75  LEU C C   1 
ATOM   2098 O  O   . LEU C 1 78 ? -12.468 5.032   8.950   1.00 24.77  ? 75  LEU C O   1 
ATOM   2099 C  CB  . LEU C 1 78 ? -9.570  3.618   9.545   1.00 22.24  ? 75  LEU C CB  1 
ATOM   2100 C  CG  . LEU C 1 78 ? -8.731  2.344   9.415   1.00 22.97  ? 75  LEU C CG  1 
ATOM   2101 C  CD1 . LEU C 1 78 ? -8.084  2.014   10.742  1.00 28.40  ? 75  LEU C CD1 1 
ATOM   2102 C  CD2 . LEU C 1 78 ? -9.559  1.164   8.920   1.00 27.42  ? 75  LEU C CD2 1 
ATOM   2103 N  N   . MET C 1 79 ? -10.734 6.409   8.548   1.00 21.70  ? 76  MET C N   1 
ATOM   2104 C  CA  . MET C 1 79 ? -11.522 7.624   8.736   1.00 31.81  ? 76  MET C CA  1 
ATOM   2105 C  C   . MET C 1 79 ? -12.564 7.777   7.632   1.00 27.81  ? 76  MET C C   1 
ATOM   2106 O  O   . MET C 1 79 ? -13.738 8.030   7.905   1.00 28.22  ? 76  MET C O   1 
ATOM   2107 C  CB  . MET C 1 79 ? -10.618 8.861   8.762   1.00 28.15  ? 76  MET C CB  1 
ATOM   2108 C  CG  . MET C 1 79 ? -11.380 10.189  8.670   1.00 36.38  ? 76  MET C CG  1 
ATOM   2109 S  SD  . MET C 1 79 ? -10.332 11.650  8.675   1.00 55.49  ? 76  MET C SD  1 
ATOM   2110 C  CE  . MET C 1 79 ? -9.518  11.485  7.090   1.00 42.91  ? 76  MET C CE  1 
ATOM   2111 N  N   . VAL C 1 80 ? -12.118 7.640   6.387   1.00 24.85  ? 77  VAL C N   1 
ATOM   2112 C  CA  . VAL C 1 80 ? -12.985 7.831   5.229   1.00 27.76  ? 77  VAL C CA  1 
ATOM   2113 C  C   . VAL C 1 80 ? -14.211 6.924   5.279   1.00 28.15  ? 77  VAL C C   1 
ATOM   2114 O  O   . VAL C 1 80 ? -15.331 7.367   5.024   1.00 32.01  ? 77  VAL C O   1 
ATOM   2115 C  CB  . VAL C 1 80 ? -12.223 7.567   3.905   1.00 32.37  ? 77  VAL C CB  1 
ATOM   2116 C  CG1 . VAL C 1 80 ? -13.177 7.610   2.711   1.00 29.74  ? 77  VAL C CG1 1 
ATOM   2117 C  CG2 . VAL C 1 80 ? -11.104 8.581   3.713   1.00 28.95  ? 77  VAL C CG2 1 
ATOM   2118 N  N   . PHE C 1 81 ? -13.995 5.653   5.600   1.00 18.99  ? 78  PHE C N   1 
ATOM   2119 C  CA  . PHE C 1 81 ? -15.072 4.673   5.571   1.00 27.10  ? 78  PHE C CA  1 
ATOM   2120 C  C   . PHE C 1 81 ? -15.998 4.822   6.773   1.00 23.11  ? 78  PHE C C   1 
ATOM   2121 O  O   . PHE C 1 81 ? -17.189 4.517   6.682   1.00 22.90  ? 78  PHE C O   1 
ATOM   2122 C  CB  . PHE C 1 81 ? -14.490 3.260   5.505   1.00 26.42  ? 78  PHE C CB  1 
ATOM   2123 C  CG  . PHE C 1 81 ? -13.806 2.956   4.203   1.00 24.98  ? 78  PHE C CG  1 
ATOM   2124 C  CD1 . PHE C 1 81 ? -14.419 3.261   2.999   1.00 33.31  ? 78  PHE C CD1 1 
ATOM   2125 C  CD2 . PHE C 1 81 ? -12.545 2.385   4.177   1.00 32.94  ? 78  PHE C CD2 1 
ATOM   2126 C  CE1 . PHE C 1 81 ? -13.795 2.994   1.797   1.00 31.88  ? 78  PHE C CE1 1 
ATOM   2127 C  CE2 . PHE C 1 81 ? -11.916 2.118   2.974   1.00 27.95  ? 78  PHE C CE2 1 
ATOM   2128 C  CZ  . PHE C 1 81 ? -12.543 2.424   1.785   1.00 23.19  ? 78  PHE C CZ  1 
ATOM   2129 N  N   . LYS C 1 82 ? -15.457 5.293   7.892   1.00 22.41  ? 79  LYS C N   1 
ATOM   2130 C  CA  . LYS C 1 82 ? -16.284 5.649   9.041   1.00 22.87  ? 79  LYS C CA  1 
ATOM   2131 C  C   . LYS C 1 82 ? -17.196 6.802   8.664   1.00 23.30  ? 79  LYS C C   1 
ATOM   2132 O  O   . LYS C 1 82 ? -18.394 6.791   8.950   1.00 24.42  ? 79  LYS C O   1 
ATOM   2133 C  CB  . LYS C 1 82 ? -15.427 6.045   10.243  1.00 18.96  ? 79  LYS C CB  1 
ATOM   2134 C  CG  . LYS C 1 82 ? -15.068 4.902   11.168  1.00 25.26  ? 79  LYS C CG  1 
ATOM   2135 C  CD  . LYS C 1 82 ? -14.539 5.425   12.494  1.00 28.79  ? 79  LYS C CD  1 
ATOM   2136 C  CE  . LYS C 1 82 ? -14.082 4.302   13.408  1.00 25.82  ? 79  LYS C CE  1 
ATOM   2137 N  NZ  . LYS C 1 82 ? -13.497 4.836   14.670  1.00 32.98  ? 79  LYS C NZ  1 
ATOM   2138 N  N   . LEU C 1 83 ? -16.612 7.803   8.018   1.00 20.63  ? 80  LEU C N   1 
ATOM   2139 C  CA  . LEU C 1 83 ? -17.367 8.962   7.580   1.00 25.58  ? 80  LEU C CA  1 
ATOM   2140 C  C   . LEU C 1 83 ? -18.425 8.517   6.574   1.00 24.57  ? 80  LEU C C   1 
ATOM   2141 O  O   . LEU C 1 83 ? -19.543 9.031   6.568   1.00 26.15  ? 80  LEU C O   1 
ATOM   2142 C  CB  . LEU C 1 83 ? -16.428 10.009  6.978   1.00 22.90  ? 80  LEU C CB  1 
ATOM   2143 C  CG  . LEU C 1 83 ? -17.021 11.354  6.556   1.00 22.46  ? 80  LEU C CG  1 
ATOM   2144 C  CD1 . LEU C 1 83 ? -17.749 12.038  7.704   1.00 25.50  ? 80  LEU C CD1 1 
ATOM   2145 C  CD2 . LEU C 1 83 ? -15.914 12.249  6.017   1.00 27.39  ? 80  LEU C CD2 1 
ATOM   2146 N  N   . ALA C 1 84 ? -18.079 7.536   5.746   1.00 25.35  ? 81  ALA C N   1 
ATOM   2147 C  CA  . ALA C 1 84 ? -19.021 7.002   4.767   1.00 36.66  ? 81  ALA C CA  1 
ATOM   2148 C  C   . ALA C 1 84 ? -20.180 6.297   5.471   1.00 31.61  ? 81  ALA C C   1 
ATOM   2149 O  O   . ALA C 1 84 ? -21.340 6.444   5.081   1.00 26.05  ? 81  ALA C O   1 
ATOM   2150 C  CB  . ALA C 1 84 ? -18.315 6.050   3.808   1.00 27.38  ? 81  ALA C CB  1 
ATOM   2151 N  N   . GLN C 1 85 ? -19.855 5.532   6.509   1.00 30.42  ? 82  GLN C N   1 
ATOM   2152 C  CA  . GLN C 1 85 ? -20.862 4.870   7.338   1.00 24.73  ? 82  GLN C CA  1 
ATOM   2153 C  C   . GLN C 1 85 ? -21.809 5.870   7.991   1.00 22.92  ? 82  GLN C C   1 
ATOM   2154 O  O   . GLN C 1 85 ? -23.020 5.660   8.028   1.00 30.27  ? 82  GLN C O   1 
ATOM   2155 C  CB  . GLN C 1 85 ? -20.191 4.038   8.430   1.00 23.80  ? 82  GLN C CB  1 
ATOM   2156 C  CG  . GLN C 1 85 ? -19.909 2.604   8.052   1.00 33.73  ? 82  GLN C CG  1 
ATOM   2157 C  CD  . GLN C 1 85 ? -19.420 1.788   9.235   1.00 46.47  ? 82  GLN C CD  1 
ATOM   2158 O  OE1 . GLN C 1 85 ? -19.063 2.336   10.279  1.00 56.38  ? 82  GLN C OE1 1 
ATOM   2159 N  NE2 . GLN C 1 85 ? -19.407 0.470   9.079   1.00 45.69  ? 82  GLN C NE2 1 
ATOM   2160 N  N   . ALA C 1 86 ? -21.241 6.946   8.523   1.00 24.39  ? 83  ALA C N   1 
ATOM   2161 C  CA  . ALA C 1 86 ? -22.018 7.981   9.190   1.00 24.27  ? 83  ALA C CA  1 
ATOM   2162 C  C   . ALA C 1 86 ? -23.001 8.636   8.222   1.00 30.56  ? 83  ALA C C   1 
ATOM   2163 O  O   . ALA C 1 86 ? -24.178 8.800   8.538   1.00 30.52  ? 83  ALA C O   1 
ATOM   2164 C  CB  . ALA C 1 86 ? -21.093 9.022   9.793   1.00 20.34  ? 83  ALA C CB  1 
ATOM   2165 N  N   . TYR C 1 87 ? -22.518 9.004   7.040   1.00 32.60  ? 84  TYR C N   1 
ATOM   2166 C  CA  . TYR C 1 87 ? -23.372 9.641   6.046   1.00 29.63  ? 84  TYR C CA  1 
ATOM   2167 C  C   . TYR C 1 87 ? -24.407 8.664   5.501   1.00 33.07  ? 84  TYR C C   1 
ATOM   2168 O  O   . TYR C 1 87 ? -25.545 9.048   5.234   1.00 36.66  ? 84  TYR C O   1 
ATOM   2169 C  CB  . TYR C 1 87 ? -22.537 10.218  4.901   1.00 31.37  ? 84  TYR C CB  1 
ATOM   2170 C  CG  . TYR C 1 87 ? -22.024 11.614  5.177   1.00 32.32  ? 84  TYR C CG  1 
ATOM   2171 C  CD1 . TYR C 1 87 ? -22.905 12.675  5.347   1.00 31.79  ? 84  TYR C CD1 1 
ATOM   2172 C  CD2 . TYR C 1 87 ? -20.664 11.872  5.265   1.00 33.09  ? 84  TYR C CD2 1 
ATOM   2173 C  CE1 . TYR C 1 87 ? -22.446 13.953  5.601   1.00 32.27  ? 84  TYR C CE1 1 
ATOM   2174 C  CE2 . TYR C 1 87 ? -20.195 13.148  5.519   1.00 30.38  ? 84  TYR C CE2 1 
ATOM   2175 C  CZ  . TYR C 1 87 ? -21.091 14.184  5.687   1.00 28.90  ? 84  TYR C CZ  1 
ATOM   2176 O  OH  . TYR C 1 87 ? -20.629 15.456  5.939   1.00 42.60  ? 84  TYR C OH  1 
ATOM   2177 N  N   . TYR C 1 88 ? -24.019 7.402   5.344   1.00 30.35  ? 85  TYR C N   1 
ATOM   2178 C  CA  . TYR C 1 88 ? -24.953 6.383   4.882   1.00 29.83  ? 85  TYR C CA  1 
ATOM   2179 C  C   . TYR C 1 88 ? -26.053 6.180   5.911   1.00 32.41  ? 85  TYR C C   1 
ATOM   2180 O  O   . TYR C 1 88 ? -27.229 6.069   5.568   1.00 37.23  ? 85  TYR C O   1 
ATOM   2181 C  CB  . TYR C 1 88 ? -24.240 5.056   4.615   1.00 32.51  ? 85  TYR C CB  1 
ATOM   2182 C  CG  . TYR C 1 88 ? -25.179 3.954   4.166   1.00 31.10  ? 85  TYR C CG  1 
ATOM   2183 C  CD1 . TYR C 1 88 ? -25.469 3.769   2.821   1.00 35.89  ? 85  TYR C CD1 1 
ATOM   2184 C  CD2 . TYR C 1 88 ? -25.784 3.109   5.087   1.00 31.28  ? 85  TYR C CD2 1 
ATOM   2185 C  CE1 . TYR C 1 88 ? -26.330 2.770   2.405   1.00 44.25  ? 85  TYR C CE1 1 
ATOM   2186 C  CE2 . TYR C 1 88 ? -26.647 2.107   4.681   1.00 37.09  ? 85  TYR C CE2 1 
ATOM   2187 C  CZ  . TYR C 1 88 ? -26.916 1.942   3.339   1.00 46.87  ? 85  TYR C CZ  1 
ATOM   2188 O  OH  . TYR C 1 88 ? -27.774 0.946   2.928   1.00 53.12  ? 85  TYR C OH  1 
ATOM   2189 N  N   . GLU C 1 89 ? -25.658 6.133   7.177   1.00 37.98  ? 86  GLU C N   1 
ATOM   2190 C  CA  . GLU C 1 89 ? -26.596 5.902   8.265   1.00 45.13  ? 86  GLU C CA  1 
ATOM   2191 C  C   . GLU C 1 89 ? -27.576 7.061   8.399   1.00 39.73  ? 86  GLU C C   1 
ATOM   2192 O  O   . GLU C 1 89 ? -28.737 6.865   8.751   1.00 48.56  ? 86  GLU C O   1 
ATOM   2193 C  CB  . GLU C 1 89 ? -25.840 5.696   9.580   1.00 47.17  ? 86  GLU C CB  1 
ATOM   2194 C  CG  . GLU C 1 89 ? -26.692 5.139   10.715  1.00 72.68  ? 86  GLU C CG  1 
ATOM   2195 C  CD  . GLU C 1 89 ? -27.111 3.695   10.490  1.00 84.15  ? 86  GLU C CD  1 
ATOM   2196 O  OE1 . GLU C 1 89 ? -26.645 3.077   9.508   1.00 72.14  ? 86  GLU C OE1 1 
ATOM   2197 O  OE2 . GLU C 1 89 ? -27.908 3.177   11.301  1.00 81.64  ? 86  GLU C OE2 1 
ATOM   2198 N  N   . SER C 1 90 ? -27.106 8.270   8.109   1.00 38.37  ? 87  SER C N   1 
ATOM   2199 C  CA  . SER C 1 90 ? -27.932 9.463   8.260   1.00 44.27  ? 87  SER C CA  1 
ATOM   2200 C  C   . SER C 1 90 ? -28.850 9.683   7.059   1.00 48.66  ? 87  SER C C   1 
ATOM   2201 O  O   . SER C 1 90 ? -29.539 10.702  6.986   1.00 55.63  ? 87  SER C O   1 
ATOM   2202 C  CB  . SER C 1 90 ? -27.052 10.699  8.466   1.00 47.07  ? 87  SER C CB  1 
ATOM   2203 O  OG  . SER C 1 90 ? -26.558 11.189  7.231   1.00 48.02  ? 87  SER C OG  1 
ATOM   2204 N  N   . THR C 1 91 ? -28.860 8.733   6.124   1.00 60.38  ? 88  THR C N   1 
ATOM   2205 C  CA  . THR C 1 91 ? -29.668 8.856   4.910   1.00 60.41  ? 88  THR C CA  1 
ATOM   2206 C  C   . THR C 1 91 ? -30.424 7.569   4.564   1.00 54.57  ? 88  THR C C   1 
ATOM   2207 O  O   . THR C 1 91 ? -30.938 7.431   3.454   1.00 65.71  ? 88  THR C O   1 
ATOM   2208 C  CB  . THR C 1 91 ? -28.797 9.258   3.695   1.00 60.52  ? 88  THR C CB  1 
ATOM   2209 O  OG1 . THR C 1 91 ? -27.809 8.250   3.444   1.00 52.39  ? 88  THR C OG1 1 
ATOM   2210 C  CG2 . THR C 1 91 ? -28.109 10.596  3.942   1.00 61.76  ? 88  THR C CG2 1 
ATOM   2211 N  N   . ARG C 1 92 ? -30.489 6.633   5.508   1.00 53.08  ? 89  ARG C N   1 
ATOM   2212 C  CA  . ARG C 1 92 ? -31.301 5.424   5.340   1.00 60.32  ? 89  ARG C CA  1 
ATOM   2213 C  C   . ARG C 1 92 ? -32.620 5.590   6.098   1.00 65.54  ? 89  ARG C C   1 
ATOM   2214 O  O   . ARG C 1 92 ? -32.788 6.561   6.836   1.00 63.44  ? 89  ARG C O   1 
ATOM   2215 C  CB  . ARG C 1 92 ? -30.544 4.184   5.823   1.00 52.90  ? 89  ARG C CB  1 
ATOM   2216 C  CG  . ARG C 1 92 ? -30.218 4.183   7.302   1.00 56.54  ? 89  ARG C CG  1 
ATOM   2217 C  CD  . ARG C 1 92 ? -29.269 3.053   7.664   1.00 46.34  ? 89  ARG C CD  1 
ATOM   2218 N  NE  . ARG C 1 92 ? -29.802 1.745   7.295   1.00 55.92  ? 89  ARG C NE  1 
ATOM   2219 C  CZ  . ARG C 1 92 ? -29.327 0.587   7.743   1.00 56.41  ? 89  ARG C CZ  1 
ATOM   2220 N  NH1 . ARG C 1 92 ? -28.305 0.565   8.589   1.00 69.18  ? 89  ARG C NH1 1 
ATOM   2221 N  NH2 . ARG C 1 92 ? -29.878 -0.552  7.350   1.00 50.67  ? 89  ARG C NH2 1 
ATOM   2222 N  N   . LYS C 1 93 ? -33.550 4.653   5.920   1.00 56.91  ? 90  LYS C N   1 
ATOM   2223 C  CA  . LYS C 1 93 ? -34.908 4.833   6.432   1.00 56.78  ? 90  LYS C CA  1 
ATOM   2224 C  C   . LYS C 1 93 ? -35.097 4.268   7.844   1.00 61.98  ? 90  LYS C C   1 
ATOM   2225 O  O   . LYS C 1 93 ? -35.976 4.722   8.579   1.00 59.17  ? 90  LYS C O   1 
ATOM   2226 C  CB  . LYS C 1 93 ? -35.927 4.202   5.471   1.00 44.29  ? 90  LYS C CB  1 
ATOM   2227 C  CG  . LYS C 1 93 ? -36.225 2.724   5.708   1.00 55.27  ? 90  LYS C CG  1 
ATOM   2228 C  CD  . LYS C 1 93 ? -37.324 2.224   4.786   1.00 59.51  ? 90  LYS C CD  1 
ATOM   2229 C  CE  . LYS C 1 93 ? -36.947 2.367   3.324   1.00 58.91  ? 90  LYS C CE  1 
ATOM   2230 N  NZ  . LYS C 1 93 ? -37.568 1.305   2.488   1.00 63.59  ? 90  LYS C NZ  1 
ATOM   2231 N  N   . GLU C 1 94 ? -34.287 3.282   8.218   1.00 64.44  ? 91  GLU C N   1 
ATOM   2232 C  CA  . GLU C 1 94 ? -34.351 2.710   9.564   1.00 62.12  ? 91  GLU C CA  1 
ATOM   2233 C  C   . GLU C 1 94 ? -33.440 3.482   10.515  1.00 68.31  ? 91  GLU C C   1 
ATOM   2234 O  O   . GLU C 1 94 ? -33.885 3.984   11.548  1.00 67.15  ? 91  GLU C O   1 
ATOM   2235 C  CB  . GLU C 1 94 ? -33.975 1.220   9.537   1.00 64.58  ? 91  GLU C CB  1 
ATOM   2236 C  CG  . GLU C 1 94 ? -33.592 0.589   10.888  1.00 81.42  ? 91  GLU C CG  1 
ATOM   2237 C  CD  . GLU C 1 94 ? -34.740 0.516   11.887  1.00 86.61  ? 91  GLU C CD  1 
ATOM   2238 O  OE1 . GLU C 1 94 ? -35.687 1.326   11.795  1.00 75.29  ? 91  GLU C OE1 1 
ATOM   2239 O  OE2 . GLU C 1 94 ? -34.693 -0.365  12.774  1.00 76.35  ? 91  GLU C OE2 1 
ATOM   2240 N  N   . SER D 1 4  ? -12.310 16.931  -8.158  1.00 41.79  ? 1   SER D N   1 
ATOM   2241 C  CA  . SER D 1 4  ? -13.079 15.981  -7.303  1.00 41.42  ? 1   SER D CA  1 
ATOM   2242 C  C   . SER D 1 4  ? -12.592 16.033  -5.857  1.00 38.84  ? 1   SER D C   1 
ATOM   2243 O  O   . SER D 1 4  ? -11.407 15.839  -5.586  1.00 39.17  ? 1   SER D O   1 
ATOM   2244 C  CB  . SER D 1 4  ? -12.958 14.556  -7.844  1.00 40.61  ? 1   SER D CB  1 
ATOM   2245 O  OG  . SER D 1 4  ? -14.225 13.925  -7.911  1.00 51.58  ? 1   SER D OG  1 
ATOM   2246 N  N   . THR D 1 5  ? -13.513 16.293  -4.934  1.00 46.09  ? 2   THR D N   1 
ATOM   2247 C  CA  . THR D 1 5  ? -13.185 16.359  -3.513  1.00 33.58  ? 2   THR D CA  1 
ATOM   2248 C  C   . THR D 1 5  ? -13.462 15.029  -2.823  1.00 33.19  ? 2   THR D C   1 
ATOM   2249 O  O   . THR D 1 5  ? -14.037 14.119  -3.418  1.00 35.44  ? 2   THR D O   1 
ATOM   2250 C  CB  . THR D 1 5  ? -13.987 17.454  -2.802  1.00 21.85  ? 2   THR D CB  1 
ATOM   2251 O  OG1 . THR D 1 5  ? -15.387 17.181  -2.936  1.00 34.61  ? 2   THR D OG1 1 
ATOM   2252 C  CG2 . THR D 1 5  ? -13.670 18.823  -3.391  1.00 34.00  ? 2   THR D CG2 1 
ATOM   2253 N  N   . LEU D 1 6  ? -13.065 14.931  -1.558  1.00 33.34  ? 3   LEU D N   1 
ATOM   2254 C  CA  . LEU D 1 6  ? -13.207 13.695  -0.798  1.00 27.61  ? 3   LEU D CA  1 
ATOM   2255 C  C   . LEU D 1 6  ? -14.672 13.364  -0.521  1.00 24.33  ? 3   LEU D C   1 
ATOM   2256 O  O   . LEU D 1 6  ? -15.083 12.207  -0.621  1.00 23.58  ? 3   LEU D O   1 
ATOM   2257 C  CB  . LEU D 1 6  ? -12.435 13.796  0.519   1.00 35.21  ? 3   LEU D CB  1 
ATOM   2258 C  CG  . LEU D 1 6  ? -12.487 12.583  1.448   1.00 28.88  ? 3   LEU D CG  1 
ATOM   2259 C  CD1 . LEU D 1 6  ? -12.063 11.312  0.722   1.00 28.86  ? 3   LEU D CD1 1 
ATOM   2260 C  CD2 . LEU D 1 6  ? -11.603 12.826  2.653   1.00 23.74  ? 3   LEU D CD2 1 
ATOM   2261 N  N   . LEU D 1 7  ? -15.455 14.380  -0.174  1.00 27.36  ? 4   LEU D N   1 
ATOM   2262 C  CA  . LEU D 1 7  ? -16.874 14.189  0.111   1.00 20.96  ? 4   LEU D CA  1 
ATOM   2263 C  C   . LEU D 1 7  ? -17.624 13.663  -1.108  1.00 29.70  ? 4   LEU D C   1 
ATOM   2264 O  O   . LEU D 1 7  ? -18.470 12.777  -0.988  1.00 28.17  ? 4   LEU D O   1 
ATOM   2265 C  CB  . LEU D 1 7  ? -17.508 15.500  0.582   1.00 31.37  ? 4   LEU D CB  1 
ATOM   2266 C  CG  . LEU D 1 7  ? -17.273 15.889  2.044   1.00 47.31  ? 4   LEU D CG  1 
ATOM   2267 C  CD1 . LEU D 1 7  ? -17.749 17.311  2.298   1.00 32.61  ? 4   LEU D CD1 1 
ATOM   2268 C  CD2 . LEU D 1 7  ? -17.977 14.919  2.982   1.00 36.74  ? 4   LEU D CD2 1 
ATOM   2269 N  N   . GLU D 1 8  ? -17.311 14.213  -2.277  1.00 23.87  ? 5   GLU D N   1 
ATOM   2270 C  CA  . GLU D 1 8  ? -17.960 13.797  -3.514  1.00 29.38  ? 5   GLU D CA  1 
ATOM   2271 C  C   . GLU D 1 8  ? -17.718 12.312  -3.772  1.00 27.54  ? 5   GLU D C   1 
ATOM   2272 O  O   . GLU D 1 8  ? -18.637 11.580  -4.140  1.00 27.05  ? 5   GLU D O   1 
ATOM   2273 C  CB  . GLU D 1 8  ? -17.460 14.638  -4.693  1.00 27.59  ? 5   GLU D CB  1 
ATOM   2274 C  CG  . GLU D 1 8  ? -17.938 16.091  -4.663  1.00 44.86  ? 5   GLU D CG  1 
ATOM   2275 C  CD  . GLU D 1 8  ? -17.314 16.952  -5.752  1.00 59.36  ? 5   GLU D CD  1 
ATOM   2276 O  OE1 . GLU D 1 8  ? -16.117 16.768  -6.053  1.00 49.63  ? 5   GLU D OE1 1 
ATOM   2277 O  OE2 . GLU D 1 8  ? -18.025 17.818  -6.306  1.00 66.34  ? 5   GLU D OE2 1 
ATOM   2278 N  N   . ASN D 1 9  ? -16.485 11.868  -3.552  1.00 23.17  ? 6   ASN D N   1 
ATOM   2279 C  CA  . ASN D 1 9  ? -16.132 10.469  -3.763  1.00 26.35  ? 6   ASN D CA  1 
ATOM   2280 C  C   . ASN D 1 9  ? -16.828 9.543   -2.773  1.00 24.75  ? 6   ASN D C   1 
ATOM   2281 O  O   . ASN D 1 9  ? -17.206 8.426   -3.123  1.00 28.32  ? 6   ASN D O   1 
ATOM   2282 C  CB  . ASN D 1 9  ? -14.617 10.287  -3.671  1.00 25.58  ? 6   ASN D CB  1 
ATOM   2283 C  CG  . ASN D 1 9  ? -13.883 10.945  -4.823  1.00 36.15  ? 6   ASN D CG  1 
ATOM   2284 O  OD1 . ASN D 1 9  ? -14.379 10.977  -5.950  1.00 37.62  ? 6   ASN D OD1 1 
ATOM   2285 N  ND2 . ASN D 1 9  ? -12.699 11.478  -4.547  1.00 33.68  ? 6   ASN D ND2 1 
ATOM   2286 N  N   . ILE D 1 10 ? -16.996 10.010  -1.540  1.00 23.16  ? 7   ILE D N   1 
ATOM   2287 C  CA  . ILE D 1 10 ? -17.644 9.214   -0.505  1.00 20.51  ? 7   ILE D CA  1 
ATOM   2288 C  C   . ILE D 1 10 ? -19.116 8.990   -0.833  1.00 32.44  ? 7   ILE D C   1 
ATOM   2289 O  O   . ILE D 1 10 ? -19.614 7.868   -0.746  1.00 31.35  ? 7   ILE D O   1 
ATOM   2290 C  CB  . ILE D 1 10 ? -17.519 9.883   0.880   1.00 27.61  ? 7   ILE D CB  1 
ATOM   2291 C  CG1 . ILE D 1 10 ? -16.078 9.775   1.385   1.00 25.63  ? 7   ILE D CG1 1 
ATOM   2292 C  CG2 . ILE D 1 10 ? -18.471 9.230   1.888   1.00 24.65  ? 7   ILE D CG2 1 
ATOM   2293 C  CD1 . ILE D 1 10 ? -15.797 10.553  2.659   1.00 29.55  ? 7   ILE D CD1 1 
ATOM   2294 N  N   . PHE D 1 11 ? -19.812 10.059  -1.200  1.00 26.30  ? 8   PHE D N   1 
ATOM   2295 C  CA  . PHE D 1 11 ? -21.224 9.956   -1.541  1.00 32.34  ? 8   PHE D CA  1 
ATOM   2296 C  C   . PHE D 1 11 ? -21.420 9.182   -2.836  1.00 30.31  ? 8   PHE D C   1 
ATOM   2297 O  O   . PHE D 1 11 ? -22.422 8.485   -3.002  1.00 31.11  ? 8   PHE D O   1 
ATOM   2298 C  CB  . PHE D 1 11 ? -21.852 11.345  -1.648  1.00 32.83  ? 8   PHE D CB  1 
ATOM   2299 C  CG  . PHE D 1 11 ? -22.361 11.867  -0.339  1.00 46.75  ? 8   PHE D CG  1 
ATOM   2300 C  CD1 . PHE D 1 11 ? -23.605 11.482  0.134   1.00 46.44  ? 8   PHE D CD1 1 
ATOM   2301 C  CD2 . PHE D 1 11 ? -21.592 12.723  0.429   1.00 40.67  ? 8   PHE D CD2 1 
ATOM   2302 C  CE1 . PHE D 1 11 ? -24.076 11.949  1.343   1.00 55.06  ? 8   PHE D CE1 1 
ATOM   2303 C  CE2 . PHE D 1 11 ? -22.058 13.195  1.639   1.00 46.18  ? 8   PHE D CE2 1 
ATOM   2304 C  CZ  . PHE D 1 11 ? -23.303 12.805  2.096   1.00 51.38  ? 8   PHE D CZ  1 
ATOM   2305 N  N   . ALA D 1 12 ? -20.458 9.300   -3.746  1.00 25.55  ? 9   ALA D N   1 
ATOM   2306 C  CA  . ALA D 1 12 ? -20.488 8.524   -4.979  1.00 31.80  ? 9   ALA D CA  1 
ATOM   2307 C  C   . ALA D 1 12 ? -20.513 7.037   -4.645  1.00 27.36  ? 9   ALA D C   1 
ATOM   2308 O  O   . ALA D 1 12 ? -21.265 6.269   -5.245  1.00 27.96  ? 9   ALA D O   1 
ATOM   2309 C  CB  . ALA D 1 12 ? -19.290 8.859   -5.853  1.00 21.01  ? 9   ALA D CB  1 
ATOM   2310 N  N   . ILE D 1 13 ? -19.698 6.643   -3.670  1.00 26.27  ? 10  ILE D N   1 
ATOM   2311 C  CA  . ILE D 1 13 ? -19.618 5.247   -3.251  1.00 26.01  ? 10  ILE D CA  1 
ATOM   2312 C  C   . ILE D 1 13 ? -20.894 4.839   -2.524  1.00 26.96  ? 10  ILE D C   1 
ATOM   2313 O  O   . ILE D 1 13 ? -21.371 3.716   -2.674  1.00 27.71  ? 10  ILE D O   1 
ATOM   2314 C  CB  . ILE D 1 13 ? -18.390 5.007   -2.345  1.00 24.42  ? 10  ILE D CB  1 
ATOM   2315 C  CG1 . ILE D 1 13 ? -17.105 5.185   -3.157  1.00 27.85  ? 10  ILE D CG1 1 
ATOM   2316 C  CG2 . ILE D 1 13 ? -18.425 3.605   -1.736  1.00 23.93  ? 10  ILE D CG2 1 
ATOM   2317 C  CD1 . ILE D 1 13 ? -15.841 5.274   -2.324  1.00 23.10  ? 10  ILE D CD1 1 
ATOM   2318 N  N   . ILE D 1 14 ? -21.439 5.756   -1.733  1.00 28.65  ? 11  ILE D N   1 
ATOM   2319 C  CA  . ILE D 1 14 ? -22.707 5.522   -1.058  1.00 29.20  ? 11  ILE D CA  1 
ATOM   2320 C  C   . ILE D 1 14 ? -23.821 5.301   -2.078  1.00 31.72  ? 11  ILE D C   1 
ATOM   2321 O  O   . ILE D 1 14 ? -24.534 4.300   -2.023  1.00 34.55  ? 11  ILE D O   1 
ATOM   2322 C  CB  . ILE D 1 14 ? -23.079 6.705   -0.135  1.00 33.12  ? 11  ILE D CB  1 
ATOM   2323 C  CG1 . ILE D 1 14 ? -22.142 6.743   1.075   1.00 30.78  ? 11  ILE D CG1 1 
ATOM   2324 C  CG2 . ILE D 1 14 ? -24.532 6.593   0.335   1.00 29.93  ? 11  ILE D CG2 1 
ATOM   2325 C  CD1 . ILE D 1 14 ? -22.301 7.976   1.951   1.00 24.85  ? 11  ILE D CD1 1 
ATOM   2326 N  N   . ASN D 1 15 ? -23.968 6.245   -3.001  1.00 34.80  ? 12  ASN D N   1 
ATOM   2327 C  CA  . ASN D 1 15 ? -25.058 6.206   -3.968  1.00 38.85  ? 12  ASN D CA  1 
ATOM   2328 C  C   . ASN D 1 15 ? -24.936 5.055   -4.963  1.00 32.26  ? 12  ASN D C   1 
ATOM   2329 O  O   . ASN D 1 15 ? -25.939 4.599   -5.511  1.00 39.96  ? 12  ASN D O   1 
ATOM   2330 C  CB  . ASN D 1 15 ? -25.135 7.536   -4.719  1.00 34.65  ? 12  ASN D CB  1 
ATOM   2331 C  CG  . ASN D 1 15 ? -25.641 8.668   -3.845  1.00 36.85  ? 12  ASN D CG  1 
ATOM   2332 O  OD1 . ASN D 1 15 ? -26.281 8.438   -2.819  1.00 52.55  ? 12  ASN D OD1 1 
ATOM   2333 N  ND2 . ASN D 1 15 ? -25.361 9.899   -4.252  1.00 41.14  ? 12  ASN D ND2 1 
ATOM   2334 N  N   . LEU D 1 16 ? -23.714 4.594   -5.206  1.00 31.12  ? 13  LEU D N   1 
ATOM   2335 C  CA  . LEU D 1 16 ? -23.508 3.404   -6.022  1.00 36.51  ? 13  LEU D CA  1 
ATOM   2336 C  C   . LEU D 1 16 ? -24.168 2.206   -5.355  1.00 41.71  ? 13  LEU D C   1 
ATOM   2337 O  O   . LEU D 1 16 ? -24.970 1.503   -5.966  1.00 40.30  ? 13  LEU D O   1 
ATOM   2338 C  CB  . LEU D 1 16 ? -22.019 3.131   -6.231  1.00 32.97  ? 13  LEU D CB  1 
ATOM   2339 C  CG  . LEU D 1 16 ? -21.689 1.816   -6.947  1.00 40.10  ? 13  LEU D CG  1 
ATOM   2340 C  CD1 . LEU D 1 16 ? -22.151 1.859   -8.394  1.00 45.46  ? 13  LEU D CD1 1 
ATOM   2341 C  CD2 . LEU D 1 16 ? -20.207 1.510   -6.864  1.00 46.52  ? 13  LEU D CD2 1 
ATOM   2342 N  N   . PHE D 1 17 ? -23.810 1.980   -4.096  1.00 39.61  ? 14  PHE D N   1 
ATOM   2343 C  CA  . PHE D 1 17 ? -24.371 0.886   -3.318  1.00 29.54  ? 14  PHE D CA  1 
ATOM   2344 C  C   . PHE D 1 17 ? -25.895 0.976   -3.266  1.00 46.39  ? 14  PHE D C   1 
ATOM   2345 O  O   . PHE D 1 17 ? -26.588 -0.041  -3.317  1.00 43.10  ? 14  PHE D O   1 
ATOM   2346 C  CB  . PHE D 1 17 ? -23.790 0.899   -1.901  1.00 33.87  ? 14  PHE D CB  1 
ATOM   2347 C  CG  . PHE D 1 17 ? -24.394 -0.127  -0.989  1.00 24.62  ? 14  PHE D CG  1 
ATOM   2348 C  CD1 . PHE D 1 17 ? -23.872 -1.406  -0.922  1.00 36.08  ? 14  PHE D CD1 1 
ATOM   2349 C  CD2 . PHE D 1 17 ? -25.483 0.189   -0.196  1.00 26.32  ? 14  PHE D CD2 1 
ATOM   2350 C  CE1 . PHE D 1 17 ? -24.428 -2.352  -0.083  1.00 30.37  ? 14  PHE D CE1 1 
ATOM   2351 C  CE2 . PHE D 1 17 ? -26.042 -0.753  0.643   1.00 33.17  ? 14  PHE D CE2 1 
ATOM   2352 C  CZ  . PHE D 1 17 ? -25.513 -2.025  0.699   1.00 32.29  ? 14  PHE D CZ  1 
ATOM   2353 N  N   . LYS D 1 18 ? -26.408 2.201   -3.173  1.00 39.77  ? 15  LYS D N   1 
ATOM   2354 C  CA  . LYS D 1 18 ? -27.844 2.430   -3.050  1.00 43.54  ? 15  LYS D CA  1 
ATOM   2355 C  C   . LYS D 1 18 ? -28.603 2.050   -4.315  1.00 43.53  ? 15  LYS D C   1 
ATOM   2356 O  O   . LYS D 1 18 ? -29.702 1.503   -4.243  1.00 45.62  ? 15  LYS D O   1 
ATOM   2357 C  CB  . LYS D 1 18 ? -28.126 3.896   -2.712  1.00 51.26  ? 15  LYS D CB  1 
ATOM   2358 C  CG  . LYS D 1 18 ? -28.224 4.185   -1.224  1.00 64.54  ? 15  LYS D CG  1 
ATOM   2359 C  CD  . LYS D 1 18 ? -28.620 5.632   -0.966  1.00 61.05  ? 15  LYS D CD  1 
ATOM   2360 C  CE  . LYS D 1 18 ? -28.706 5.927   0.522   1.00 62.58  ? 15  LYS D CE  1 
ATOM   2361 N  NZ  . LYS D 1 18 ? -29.672 5.031   1.219   1.00 63.27  ? 15  LYS D NZ  1 
ATOM   2362 N  N   . GLN D 1 19 ? -28.025 2.345   -5.474  1.00 41.95  ? 16  GLN D N   1 
ATOM   2363 C  CA  . GLN D 1 19 ? -28.720 2.109   -6.731  1.00 51.99  ? 16  GLN D CA  1 
ATOM   2364 C  C   . GLN D 1 19 ? -28.869 0.608   -6.991  1.00 52.54  ? 16  GLN D C   1 
ATOM   2365 O  O   . GLN D 1 19 ? -29.814 0.178   -7.653  1.00 63.59  ? 16  GLN D O   1 
ATOM   2366 C  CB  . GLN D 1 19 ? -27.990 2.803   -7.889  1.00 54.61  ? 16  GLN D CB  1 
ATOM   2367 C  CG  . GLN D 1 19 ? -27.134 1.905   -8.773  1.00 60.78  ? 16  GLN D CG  1 
ATOM   2368 C  CD  . GLN D 1 19 ? -26.552 2.653   -9.958  1.00 59.69  ? 16  GLN D CD  1 
ATOM   2369 O  OE1 . GLN D 1 19 ? -25.791 3.607   -9.799  1.00 57.49  ? 16  GLN D OE1 1 
ATOM   2370 N  NE2 . GLN D 1 19 ? -26.922 2.226   -11.159 1.00 70.90  ? 16  GLN D NE2 1 
ATOM   2371 N  N   . TYR D 1 20 ? -27.944 -0.186  -6.459  1.00 43.11  ? 17  TYR D N   1 
ATOM   2372 C  CA  . TYR D 1 20 ? -27.993 -1.635  -6.633  1.00 45.34  ? 17  TYR D CA  1 
ATOM   2373 C  C   . TYR D 1 20 ? -28.818 -2.304  -5.540  1.00 43.72  ? 17  TYR D C   1 
ATOM   2374 O  O   . TYR D 1 20 ? -29.560 -3.245  -5.807  1.00 43.09  ? 17  TYR D O   1 
ATOM   2375 C  CB  . TYR D 1 20 ? -26.580 -2.223  -6.653  1.00 37.10  ? 17  TYR D CB  1 
ATOM   2376 C  CG  . TYR D 1 20 ? -25.840 -1.958  -7.944  1.00 46.52  ? 17  TYR D CG  1 
ATOM   2377 C  CD1 . TYR D 1 20 ? -26.011 -2.783  -9.048  1.00 50.59  ? 17  TYR D CD1 1 
ATOM   2378 C  CD2 . TYR D 1 20 ? -24.979 -0.878  -8.063  1.00 53.52  ? 17  TYR D CD2 1 
ATOM   2379 C  CE1 . TYR D 1 20 ? -25.340 -2.538  -10.231 1.00 51.46  ? 17  TYR D CE1 1 
ATOM   2380 C  CE2 . TYR D 1 20 ? -24.305 -0.626  -9.237  1.00 46.63  ? 17  TYR D CE2 1 
ATOM   2381 C  CZ  . TYR D 1 20 ? -24.488 -1.457  -10.317 1.00 49.46  ? 17  TYR D CZ  1 
ATOM   2382 O  OH  . TYR D 1 20 ? -23.812 -1.199  -11.485 1.00 46.65  ? 17  TYR D OH  1 
ATOM   2383 N  N   . SER D 1 21 ? -28.692 -1.816  -4.312  1.00 47.50  ? 18  SER D N   1 
ATOM   2384 C  CA  . SER D 1 21 ? -29.376 -2.434  -3.182  1.00 45.94  ? 18  SER D CA  1 
ATOM   2385 C  C   . SER D 1 21 ? -30.884 -2.203  -3.252  1.00 45.00  ? 18  SER D C   1 
ATOM   2386 O  O   . SER D 1 21 ? -31.666 -3.032  -2.787  1.00 52.28  ? 18  SER D O   1 
ATOM   2387 C  CB  . SER D 1 21 ? -28.821 -1.894  -1.860  1.00 42.65  ? 18  SER D CB  1 
ATOM   2388 O  OG  . SER D 1 21 ? -29.049 -0.501  -1.733  1.00 51.57  ? 18  SER D OG  1 
ATOM   2389 N  N   . LYS D 1 22 ? -31.287 -1.085  -3.849  1.00 57.12  ? 19  LYS D N   1 
ATOM   2390 C  CA  . LYS D 1 22 ? -32.693 -0.687  -3.868  1.00 59.81  ? 19  LYS D CA  1 
ATOM   2391 C  C   . LYS D 1 22 ? -33.510 -1.390  -4.952  1.00 59.27  ? 19  LYS D C   1 
ATOM   2392 O  O   . LYS D 1 22 ? -34.705 -1.127  -5.094  1.00 65.89  ? 19  LYS D O   1 
ATOM   2393 C  CB  . LYS D 1 22 ? -32.808 0.829   -4.047  1.00 56.97  ? 19  LYS D CB  1 
ATOM   2394 C  CG  . LYS D 1 22 ? -32.534 1.623   -2.778  1.00 58.42  ? 19  LYS D CG  1 
ATOM   2395 C  CD  . LYS D 1 22 ? -32.883 3.091   -2.957  1.00 60.95  ? 19  LYS D CD  1 
ATOM   2396 C  CE  . LYS D 1 22 ? -32.809 3.846   -1.642  1.00 56.17  ? 19  LYS D CE  1 
ATOM   2397 N  NZ  . LYS D 1 22 ? -33.303 5.244   -1.781  1.00 58.69  ? 19  LYS D NZ  1 
ATOM   2398 N  N   . LYS D 1 23 ? -32.880 -2.281  -5.711  1.00 55.13  ? 20  LYS D N   1 
ATOM   2399 C  CA  . LYS D 1 23 ? -33.603 -3.043  -6.724  1.00 52.08  ? 20  LYS D CA  1 
ATOM   2400 C  C   . LYS D 1 23 ? -34.534 -4.038  -6.040  1.00 61.06  ? 20  LYS D C   1 
ATOM   2401 O  O   . LYS D 1 23 ? -35.653 -4.279  -6.496  1.00 65.13  ? 20  LYS D O   1 
ATOM   2402 C  CB  . LYS D 1 23 ? -32.643 -3.783  -7.660  1.00 53.16  ? 20  LYS D CB  1 
ATOM   2403 C  CG  . LYS D 1 23 ? -31.496 -2.935  -8.205  1.00 51.73  ? 20  LYS D CG  1 
ATOM   2404 C  CD  . LYS D 1 23 ? -31.512 -2.800  -9.721  1.00 48.38  ? 20  LYS D CD  1 
ATOM   2405 C  CE  . LYS D 1 23 ? -30.135 -3.088  -10.296 1.00 48.74  ? 20  LYS D CE  1 
ATOM   2406 N  NZ  . LYS D 1 23 ? -30.062 -2.810  -11.753 1.00 54.17  ? 20  LYS D NZ  1 
ATOM   2407 N  N   . ASP D 1 24 ? -34.061 -4.613  -4.939  1.00 60.40  ? 21  ASP D N   1 
ATOM   2408 C  CA  . ASP D 1 24 ? -34.847 -5.564  -4.164  1.00 64.77  ? 21  ASP D CA  1 
ATOM   2409 C  C   . ASP D 1 24 ? -35.810 -4.864  -3.218  1.00 65.68  ? 21  ASP D C   1 
ATOM   2410 O  O   . ASP D 1 24 ? -35.818 -3.638  -3.100  1.00 60.71  ? 21  ASP D O   1 
ATOM   2411 C  CB  . ASP D 1 24 ? -33.929 -6.483  -3.355  1.00 58.55  ? 21  ASP D CB  1 
ATOM   2412 C  CG  . ASP D 1 24 ? -33.410 -7.652  -4.161  1.00 65.92  ? 21  ASP D CG  1 
ATOM   2413 O  OD1 . ASP D 1 24 ? -33.263 -7.517  -5.394  1.00 73.81  ? 21  ASP D OD1 1 
ATOM   2414 O  OD2 . ASP D 1 24 ? -33.145 -8.710  -3.553  1.00 67.09  ? 21  ASP D OD2 1 
ATOM   2415 N  N   . LYS D 1 25 ? -36.621 -5.671  -2.548  1.00 69.85  ? 22  LYS D N   1 
ATOM   2416 C  CA  . LYS D 1 25 ? -37.505 -5.204  -1.495  1.00 57.67  ? 22  LYS D CA  1 
ATOM   2417 C  C   . LYS D 1 25 ? -36.690 -4.850  -0.252  1.00 77.87  ? 22  LYS D C   1 
ATOM   2418 O  O   . LYS D 1 25 ? -37.084 -3.996  0.545   1.00 74.77  ? 22  LYS D O   1 
ATOM   2419 C  CB  . LYS D 1 25 ? -38.547 -6.282  -1.197  1.00 65.37  ? 22  LYS D CB  1 
ATOM   2420 C  CG  . LYS D 1 25 ? -39.248 -6.187  0.143   1.00 62.09  ? 22  LYS D CG  1 
ATOM   2421 C  CD  . LYS D 1 25 ? -40.290 -7.290  0.266   1.00 66.99  ? 22  LYS D CD  1 
ATOM   2422 C  CE  . LYS D 1 25 ? -39.659 -8.678  0.272   1.00 68.25  ? 22  LYS D CE  1 
ATOM   2423 N  NZ  . LYS D 1 25 ? -40.651 -9.749  0.567   1.00 80.42  ? 22  LYS D NZ  1 
ATOM   2424 N  N   . ASN D 1 26 ? -35.547 -5.515  -0.101  1.00 79.73  ? 23  ASN D N   1 
ATOM   2425 C  CA  . ASN D 1 26 ? -34.583 -5.183  0.944   1.00 66.34  ? 23  ASN D CA  1 
ATOM   2426 C  C   . ASN D 1 26 ? -33.650 -4.082  0.454   1.00 58.45  ? 23  ASN D C   1 
ATOM   2427 O  O   . ASN D 1 26 ? -32.626 -4.355  -0.170  1.00 53.67  ? 23  ASN D O   1 
ATOM   2428 C  CB  . ASN D 1 26 ? -33.779 -6.418  1.351   1.00 53.90  ? 23  ASN D CB  1 
ATOM   2429 C  CG  . ASN D 1 26 ? -34.660 -7.574  1.774   1.00 50.90  ? 23  ASN D CG  1 
ATOM   2430 O  OD1 . ASN D 1 26 ? -35.017 -8.428  0.962   1.00 55.19  ? 23  ASN D OD1 1 
ATOM   2431 N  ND2 . ASN D 1 26 ? -35.016 -7.610  3.053   1.00 60.96  ? 23  ASN D ND2 1 
ATOM   2432 N  N   . THR D 1 27 ? -34.013 -2.837  0.738   1.00 60.08  ? 24  THR D N   1 
ATOM   2433 C  CA  . THR D 1 27 ? -33.316 -1.685  0.175   1.00 58.24  ? 24  THR D CA  1 
ATOM   2434 C  C   . THR D 1 27 ? -31.932 -1.464  0.782   1.00 53.32  ? 24  THR D C   1 
ATOM   2435 O  O   . THR D 1 27 ? -31.088 -0.796  0.187   1.00 56.66  ? 24  THR D O   1 
ATOM   2436 C  CB  . THR D 1 27 ? -34.140 -0.397  0.368   1.00 55.81  ? 24  THR D CB  1 
ATOM   2437 O  OG1 . THR D 1 27 ? -34.212 -0.072  1.763   1.00 62.07  ? 24  THR D OG1 1 
ATOM   2438 C  CG2 . THR D 1 27 ? -35.547 -0.573  -0.184  1.00 67.97  ? 24  THR D CG2 1 
ATOM   2439 N  N   . ASP D 1 28 ? -31.702 -2.032  1.961   1.00 46.01  ? 25  ASP D N   1 
ATOM   2440 C  CA  . ASP D 1 28 ? -30.492 -1.749  2.727   1.00 45.40  ? 25  ASP D CA  1 
ATOM   2441 C  C   . ASP D 1 28 ? -29.326 -2.682  2.394   1.00 45.03  ? 25  ASP D C   1 
ATOM   2442 O  O   . ASP D 1 28 ? -28.214 -2.475  2.882   1.00 43.12  ? 25  ASP D O   1 
ATOM   2443 C  CB  . ASP D 1 28 ? -30.798 -1.838  4.225   1.00 60.03  ? 25  ASP D CB  1 
ATOM   2444 C  CG  . ASP D 1 28 ? -31.305 -3.209  4.638   1.00 68.40  ? 25  ASP D CG  1 
ATOM   2445 O  OD1 . ASP D 1 28 ? -32.018 -3.847  3.833   1.00 66.53  ? 25  ASP D OD1 1 
ATOM   2446 O  OD2 . ASP D 1 28 ? -30.989 -3.649  5.764   1.00 68.76  ? 25  ASP D OD2 1 
ATOM   2447 N  N   . THR D 1 29 ? -29.577 -3.699  1.571   1.00 36.73  ? 26  THR D N   1 
ATOM   2448 C  CA  . THR D 1 29 ? -28.571 -4.723  1.288   1.00 39.42  ? 26  THR D CA  1 
ATOM   2449 C  C   . THR D 1 29 ? -28.522 -5.142  -0.180  1.00 42.86  ? 26  THR D C   1 
ATOM   2450 O  O   . THR D 1 29 ? -29.451 -4.885  -0.947  1.00 34.10  ? 26  THR D O   1 
ATOM   2451 C  CB  . THR D 1 29 ? -28.819 -5.988  2.131   1.00 38.00  ? 26  THR D CB  1 
ATOM   2452 O  OG1 . THR D 1 29 ? -30.164 -6.439  1.933   1.00 41.17  ? 26  THR D OG1 1 
ATOM   2453 C  CG2 . THR D 1 29 ? -28.593 -5.705  3.611   1.00 47.10  ? 26  THR D CG2 1 
ATOM   2454 N  N   . LEU D 1 30 ? -27.424 -5.794  -0.554  1.00 31.89  ? 27  LEU D N   1 
ATOM   2455 C  CA  . LEU D 1 30 ? -27.267 -6.359  -1.887  1.00 38.17  ? 27  LEU D CA  1 
ATOM   2456 C  C   . LEU D 1 30 ? -27.559 -7.850  -1.865  1.00 34.16  ? 27  LEU D C   1 
ATOM   2457 O  O   . LEU D 1 30 ? -26.965 -8.593  -1.085  1.00 37.36  ? 27  LEU D O   1 
ATOM   2458 C  CB  . LEU D 1 30 ? -25.853 -6.129  -2.420  1.00 33.67  ? 27  LEU D CB  1 
ATOM   2459 C  CG  . LEU D 1 30 ? -25.377 -4.685  -2.548  1.00 40.32  ? 27  LEU D CG  1 
ATOM   2460 C  CD1 . LEU D 1 30 ? -23.874 -4.664  -2.773  1.00 23.33  ? 27  LEU D CD1 1 
ATOM   2461 C  CD2 . LEU D 1 30 ? -26.106 -3.968  -3.677  1.00 31.26  ? 27  LEU D CD2 1 
ATOM   2462 N  N   . SER D 1 31 ? -28.472 -8.287  -2.724  1.00 38.35  ? 28  SER D N   1 
ATOM   2463 C  CA  . SER D 1 31 ? -28.716 -9.709  -2.902  1.00 38.35  ? 28  SER D CA  1 
ATOM   2464 C  C   . SER D 1 31 ? -27.577 -10.298 -3.721  1.00 40.54  ? 28  SER D C   1 
ATOM   2465 O  O   . SER D 1 31 ? -26.676 -9.579  -4.153  1.00 35.99  ? 28  SER D O   1 
ATOM   2466 C  CB  . SER D 1 31 ? -30.057 -9.953  -3.592  1.00 38.11  ? 28  SER D CB  1 
ATOM   2467 O  OG  . SER D 1 31 ? -30.071 -9.390  -4.893  1.00 47.43  ? 28  SER D OG  1 
ATOM   2468 N  N   . LYS D 1 32 ? -27.612 -11.607 -3.932  1.00 43.59  ? 29  LYS D N   1 
ATOM   2469 C  CA  . LYS D 1 32 ? -26.606 -12.254 -4.759  1.00 53.86  ? 29  LYS D CA  1 
ATOM   2470 C  C   . LYS D 1 32 ? -26.752 -11.775 -6.200  1.00 39.62  ? 29  LYS D C   1 
ATOM   2471 O  O   . LYS D 1 32 ? -25.763 -11.609 -6.912  1.00 40.62  ? 29  LYS D O   1 
ATOM   2472 C  CB  . LYS D 1 32 ? -26.735 -13.775 -4.670  1.00 54.27  ? 29  LYS D CB  1 
ATOM   2473 C  CG  . LYS D 1 32 ? -25.503 -14.530 -5.137  1.00 56.89  ? 29  LYS D CG  1 
ATOM   2474 C  CD  . LYS D 1 32 ? -25.493 -15.957 -4.604  1.00 60.76  ? 29  LYS D CD  1 
ATOM   2475 C  CE  . LYS D 1 32 ? -24.201 -16.677 -4.957  1.00 74.06  ? 29  LYS D CE  1 
ATOM   2476 N  NZ  . LYS D 1 32 ? -24.027 -16.830 -6.428  1.00 90.34  ? 29  LYS D NZ  1 
ATOM   2477 N  N   . LYS D 1 33 ? -27.993 -11.535 -6.614  1.00 36.47  ? 30  LYS D N   1 
ATOM   2478 C  CA  . LYS D 1 33 ? -28.281 -11.052 -7.959  1.00 49.80  ? 30  LYS D CA  1 
ATOM   2479 C  C   . LYS D 1 33 ? -27.816 -9.609  -8.123  1.00 45.92  ? 30  LYS D C   1 
ATOM   2480 O  O   . LYS D 1 33 ? -27.223 -9.250  -9.140  1.00 38.29  ? 30  LYS D O   1 
ATOM   2481 C  CB  . LYS D 1 33 ? -29.780 -11.162 -8.253  1.00 52.74  ? 30  LYS D CB  1 
ATOM   2482 C  CG  . LYS D 1 33 ? -30.168 -10.849 -9.691  1.00 51.77  ? 30  LYS D CG  1 
ATOM   2483 C  CD  . LYS D 1 33 ? -31.664 -10.604 -9.813  1.00 55.68  ? 30  LYS D CD  1 
ATOM   2484 C  CE  . LYS D 1 33 ? -32.072 -10.321 -11.252 1.00 59.85  ? 30  LYS D CE  1 
ATOM   2485 N  NZ  . LYS D 1 33 ? -32.092 -11.552 -12.089 1.00 61.80  ? 30  LYS D NZ  1 
ATOM   2486 N  N   . GLU D 1 34 ? -28.091 -8.786  -7.114  1.00 42.33  ? 31  GLU D N   1 
ATOM   2487 C  CA  . GLU D 1 34 ? -27.721 -7.375  -7.145  1.00 43.92  ? 31  GLU D CA  1 
ATOM   2488 C  C   . GLU D 1 34 ? -26.206 -7.207  -7.118  1.00 40.30  ? 31  GLU D C   1 
ATOM   2489 O  O   . GLU D 1 34 ? -25.652 -6.373  -7.835  1.00 40.77  ? 31  GLU D O   1 
ATOM   2490 C  CB  . GLU D 1 34 ? -28.356 -6.632  -5.968  1.00 46.25  ? 31  GLU D CB  1 
ATOM   2491 C  CG  . GLU D 1 34 ? -29.865 -6.450  -6.092  1.00 48.35  ? 31  GLU D CG  1 
ATOM   2492 C  CD  . GLU D 1 34 ? -30.503 -5.927  -4.820  1.00 51.79  ? 31  GLU D CD  1 
ATOM   2493 O  OE1 . GLU D 1 34 ? -29.963 -6.196  -3.727  1.00 47.96  ? 31  GLU D OE1 1 
ATOM   2494 O  OE2 . GLU D 1 34 ? -31.544 -5.245  -4.911  1.00 46.96  ? 31  GLU D OE2 1 
ATOM   2495 N  N   . LEU D 1 35 ? -25.544 -8.008  -6.290  1.00 33.81  ? 32  LEU D N   1 
ATOM   2496 C  CA  . LEU D 1 35 ? -24.089 -8.007  -6.217  1.00 31.38  ? 32  LEU D CA  1 
ATOM   2497 C  C   . LEU D 1 35 ? -23.484 -8.412  -7.556  1.00 35.32  ? 32  LEU D C   1 
ATOM   2498 O  O   . LEU D 1 35 ? -22.490 -7.838  -8.000  1.00 29.68  ? 32  LEU D O   1 
ATOM   2499 C  CB  . LEU D 1 35 ? -23.614 -8.954  -5.114  1.00 39.92  ? 32  LEU D CB  1 
ATOM   2500 C  CG  . LEU D 1 35 ? -22.103 -9.127  -4.944  1.00 37.54  ? 32  LEU D CG  1 
ATOM   2501 C  CD1 . LEU D 1 35 ? -21.442 -7.813  -4.560  1.00 35.39  ? 32  LEU D CD1 1 
ATOM   2502 C  CD2 . LEU D 1 35 ? -21.813 -10.194 -3.903  1.00 49.28  ? 32  LEU D CD2 1 
ATOM   2503 N  N   . LYS D 1 36 ? -24.099 -9.402  -8.195  1.00 40.70  ? 33  LYS D N   1 
ATOM   2504 C  CA  . LYS D 1 36 ? -23.605 -9.926  -9.461  1.00 40.22  ? 33  LYS D CA  1 
ATOM   2505 C  C   . LYS D 1 36 ? -23.625 -8.845  -10.536 1.00 33.96  ? 33  LYS D C   1 
ATOM   2506 O  O   . LYS D 1 36 ? -22.684 -8.720  -11.318 1.00 39.80  ? 33  LYS D O   1 
ATOM   2507 C  CB  . LYS D 1 36 ? -24.438 -11.135 -9.900  1.00 42.32  ? 33  LYS D CB  1 
ATOM   2508 C  CG  . LYS D 1 36 ? -23.905 -11.839 -11.138 1.00 48.07  ? 33  LYS D CG  1 
ATOM   2509 C  CD  . LYS D 1 36 ? -24.643 -11.428 -12.400 1.00 54.19  ? 33  LYS D CD  1 
ATOM   2510 C  CE  . LYS D 1 36 ? -25.755 -12.413 -12.731 1.00 56.33  ? 33  LYS D CE  1 
ATOM   2511 N  NZ  . LYS D 1 36 ? -26.479 -12.047 -13.979 1.00 54.03  ? 33  LYS D NZ  1 
ATOM   2512 N  N   . GLU D 1 37 ? -24.692 -8.055  -10.561 1.00 33.69  ? 34  GLU D N   1 
ATOM   2513 C  CA  . GLU D 1 37 ? -24.811 -6.973  -11.529 1.00 42.65  ? 34  GLU D CA  1 
ATOM   2514 C  C   . GLU D 1 37 ? -23.821 -5.846  -11.225 1.00 44.02  ? 34  GLU D C   1 
ATOM   2515 O  O   . GLU D 1 37 ? -23.315 -5.194  -12.139 1.00 39.67  ? 34  GLU D O   1 
ATOM   2516 C  CB  . GLU D 1 37 ? -26.245 -6.433  -11.552 1.00 52.28  ? 34  GLU D CB  1 
ATOM   2517 C  CG  . GLU D 1 37 ? -27.273 -7.431  -12.075 1.00 54.40  ? 34  GLU D CG  1 
ATOM   2518 C  CD  . GLU D 1 37 ? -28.683 -6.872  -12.080 1.00 58.42  ? 34  GLU D CD  1 
ATOM   2519 O  OE1 . GLU D 1 37 ? -28.843 -5.654  -11.857 1.00 52.61  ? 34  GLU D OE1 1 
ATOM   2520 O  OE2 . GLU D 1 37 ? -29.632 -7.651  -12.304 1.00 61.89  ? 34  GLU D OE2 1 
ATOM   2521 N  N   . LEU D 1 38 ? -23.544 -5.627  -9.942  1.00 37.89  ? 35  LEU D N   1 
ATOM   2522 C  CA  . LEU D 1 38 ? -22.599 -4.596  -9.519  1.00 38.06  ? 35  LEU D CA  1 
ATOM   2523 C  C   . LEU D 1 38 ? -21.191 -4.920  -9.996  1.00 28.40  ? 35  LEU D C   1 
ATOM   2524 O  O   . LEU D 1 38 ? -20.526 -4.089  -10.616 1.00 31.46  ? 35  LEU D O   1 
ATOM   2525 C  CB  . LEU D 1 38 ? -22.611 -4.450  -7.993  1.00 41.34  ? 35  LEU D CB  1 
ATOM   2526 C  CG  . LEU D 1 38 ? -21.944 -3.200  -7.407  1.00 32.02  ? 35  LEU D CG  1 
ATOM   2527 C  CD1 . LEU D 1 38 ? -22.429 -2.984  -5.985  1.00 41.99  ? 35  LEU D CD1 1 
ATOM   2528 C  CD2 . LEU D 1 38 ? -20.417 -3.281  -7.432  1.00 36.16  ? 35  LEU D CD2 1 
ATOM   2529 N  N   . LEU D 1 39 ? -20.739 -6.129  -9.687  1.00 26.89  ? 36  LEU D N   1 
ATOM   2530 C  CA  . LEU D 1 39 ? -19.403 -6.570  -10.061 1.00 30.66  ? 36  LEU D CA  1 
ATOM   2531 C  C   . LEU D 1 39 ? -19.212 -6.569  -11.573 1.00 33.84  ? 36  LEU D C   1 
ATOM   2532 O  O   . LEU D 1 39 ? -18.130 -6.251  -12.065 1.00 35.15  ? 36  LEU D O   1 
ATOM   2533 C  CB  . LEU D 1 39 ? -19.137 -7.965  -9.498  1.00 27.49  ? 36  LEU D CB  1 
ATOM   2534 C  CG  . LEU D 1 39 ? -19.015 -8.024  -7.975  1.00 37.13  ? 36  LEU D CG  1 
ATOM   2535 C  CD1 . LEU D 1 39 ? -19.339 -9.416  -7.461  1.00 46.59  ? 36  LEU D CD1 1 
ATOM   2536 C  CD2 . LEU D 1 39 ? -17.617 -7.603  -7.546  1.00 35.46  ? 36  LEU D CD2 1 
ATOM   2537 N  N   . GLU D 1 40 ? -20.265 -6.917  -12.307 1.00 41.65  ? 37  GLU D N   1 
ATOM   2538 C  CA  . GLU D 1 40 ? -20.194 -6.957  -13.766 1.00 47.89  ? 37  GLU D CA  1 
ATOM   2539 C  C   . GLU D 1 40 ? -20.014 -5.562  -14.347 1.00 38.00  ? 37  GLU D C   1 
ATOM   2540 O  O   . GLU D 1 40 ? -19.167 -5.352  -15.212 1.00 39.85  ? 37  GLU D O   1 
ATOM   2541 C  CB  . GLU D 1 40 ? -21.450 -7.606  -14.358 1.00 47.88  ? 37  GLU D CB  1 
ATOM   2542 C  CG  . GLU D 1 40 ? -21.410 -9.129  -14.381 1.00 52.92  ? 37  GLU D CG  1 
ATOM   2543 C  CD  . GLU D 1 40 ? -22.598 -9.740  -15.101 1.00 61.96  ? 37  GLU D CD  1 
ATOM   2544 O  OE1 . GLU D 1 40 ? -23.485 -8.980  -15.548 1.00 60.39  ? 37  GLU D OE1 1 
ATOM   2545 O  OE2 . GLU D 1 40 ? -22.643 -10.982 -15.222 1.00 70.08  ? 37  GLU D OE2 1 
ATOM   2546 N  N   . LYS D 1 41 ? -20.806 -4.611  -13.863 1.00 38.58  ? 38  LYS D N   1 
ATOM   2547 C  CA  . LYS D 1 41 ? -20.763 -3.251  -14.386 1.00 37.18  ? 38  LYS D CA  1 
ATOM   2548 C  C   . LYS D 1 41 ? -19.524 -2.498  -13.915 1.00 40.05  ? 38  LYS D C   1 
ATOM   2549 O  O   . LYS D 1 41 ? -18.913 -1.759  -14.686 1.00 43.66  ? 38  LYS D O   1 
ATOM   2550 C  CB  . LYS D 1 41 ? -22.018 -2.477  -13.978 1.00 39.56  ? 38  LYS D CB  1 
ATOM   2551 C  CG  . LYS D 1 41 ? -22.862 -2.002  -15.152 1.00 42.66  ? 38  LYS D CG  1 
ATOM   2552 C  CD  . LYS D 1 41 ? -23.736 -0.818  -14.777 1.00 45.71  ? 38  LYS D CD  1 
ATOM   2553 C  CE  . LYS D 1 41 ? -22.934 0.474   -14.720 1.00 47.24  ? 38  LYS D CE  1 
ATOM   2554 N  NZ  . LYS D 1 41 ? -23.634 1.555   -13.976 1.00 53.70  ? 38  LYS D NZ  1 
ATOM   2555 N  N   . GLU D 1 42 ? -19.157 -2.683  -12.650 1.00 39.38  ? 39  GLU D N   1 
ATOM   2556 C  CA  . GLU D 1 42 ? -18.042 -1.941  -12.067 1.00 29.77  ? 39  GLU D CA  1 
ATOM   2557 C  C   . GLU D 1 42 ? -16.694 -2.569  -12.398 1.00 31.71  ? 39  GLU D C   1 
ATOM   2558 O  O   . GLU D 1 42 ? -15.680 -1.873  -12.447 1.00 30.35  ? 39  GLU D O   1 
ATOM   2559 C  CB  . GLU D 1 42 ? -18.208 -1.839  -10.550 1.00 28.96  ? 39  GLU D CB  1 
ATOM   2560 C  CG  . GLU D 1 42 ? -19.399 -1.001  -10.118 1.00 27.87  ? 39  GLU D CG  1 
ATOM   2561 C  CD  . GLU D 1 42 ? -19.323 0.425   -10.631 1.00 29.79  ? 39  GLU D CD  1 
ATOM   2562 O  OE1 . GLU D 1 42 ? -20.382 1.072   -10.761 1.00 42.03  ? 39  GLU D OE1 1 
ATOM   2563 O  OE2 . GLU D 1 42 ? -18.203 0.901   -10.905 1.00 30.54  ? 39  GLU D OE2 1 
ATOM   2564 N  N   . PHE D 1 43 ? -16.686 -3.882  -12.615 1.00 27.62  ? 40  PHE D N   1 
ATOM   2565 C  CA  . PHE D 1 43 ? -15.470 -4.592  -13.009 1.00 30.32  ? 40  PHE D CA  1 
ATOM   2566 C  C   . PHE D 1 43 ? -15.700 -5.345  -14.318 1.00 40.24  ? 40  PHE D C   1 
ATOM   2567 O  O   . PHE D 1 43 ? -15.977 -6.545  -14.323 1.00 34.57  ? 40  PHE D O   1 
ATOM   2568 C  CB  . PHE D 1 43 ? -15.026 -5.551  -11.905 1.00 25.69  ? 40  PHE D CB  1 
ATOM   2569 C  CG  . PHE D 1 43 ? -14.963 -4.915  -10.549 1.00 37.31  ? 40  PHE D CG  1 
ATOM   2570 C  CD1 . PHE D 1 43 ? -13.805 -4.296  -10.114 1.00 33.27  ? 40  PHE D CD1 1 
ATOM   2571 C  CD2 . PHE D 1 43 ? -16.068 -4.925  -9.714  1.00 40.40  ? 40  PHE D CD2 1 
ATOM   2572 C  CE1 . PHE D 1 43 ? -13.748 -3.706  -8.867  1.00 38.96  ? 40  PHE D CE1 1 
ATOM   2573 C  CE2 . PHE D 1 43 ? -16.017 -4.337  -8.466  1.00 33.94  ? 40  PHE D CE2 1 
ATOM   2574 C  CZ  . PHE D 1 43 ? -14.856 -3.726  -8.042  1.00 35.19  ? 40  PHE D CZ  1 
ATOM   2575 N  N   . ARG D 1 44 ? -15.586 -4.621  -15.427 1.00 35.49  ? 41  ARG D N   1 
ATOM   2576 C  CA  . ARG D 1 44 ? -15.843 -5.181  -16.748 1.00 46.29  ? 41  ARG D CA  1 
ATOM   2577 C  C   . ARG D 1 44 ? -14.832 -6.260  -17.115 1.00 43.09  ? 41  ARG D C   1 
ATOM   2578 O  O   . ARG D 1 44 ? -13.633 -6.109  -16.880 1.00 44.77  ? 41  ARG D O   1 
ATOM   2579 C  CB  . ARG D 1 44 ? -15.821 -4.078  -17.804 1.00 44.14  ? 41  ARG D CB  1 
ATOM   2580 C  CG  . ARG D 1 44 ? -16.959 -3.078  -17.691 1.00 41.87  ? 41  ARG D CG  1 
ATOM   2581 C  CD  . ARG D 1 44 ? -18.294 -3.704  -18.068 1.00 45.84  ? 41  ARG D CD  1 
ATOM   2582 N  NE  . ARG D 1 44 ? -19.368 -2.716  -18.116 1.00 55.63  ? 41  ARG D NE  1 
ATOM   2583 C  CZ  . ARG D 1 44 ? -20.648 -3.003  -18.338 1.00 59.04  ? 41  ARG D CZ  1 
ATOM   2584 N  NH1 . ARG D 1 44 ? -21.033 -4.259  -18.529 1.00 55.79  ? 41  ARG D NH1 1 
ATOM   2585 N  NH2 . ARG D 1 44 ? -21.548 -2.030  -18.365 1.00 58.92  ? 41  ARG D NH2 1 
ATOM   2586 N  N   . GLN D 1 45 ? -15.331 -7.344  -17.701 1.00 55.04  ? 42  GLN D N   1 
ATOM   2587 C  CA  . GLN D 1 45 ? -14.489 -8.458  -18.121 1.00 58.58  ? 42  GLN D CA  1 
ATOM   2588 C  C   . GLN D 1 45 ? -14.403 -8.515  -19.641 1.00 59.35  ? 42  GLN D C   1 
ATOM   2589 O  O   . GLN D 1 45 ? -15.310 -9.018  -20.302 1.00 60.74  ? 42  GLN D O   1 
ATOM   2590 C  CB  . GLN D 1 45 ? -15.034 -9.780  -17.573 1.00 69.39  ? 42  GLN D CB  1 
ATOM   2591 C  CG  . GLN D 1 45 ? -15.197 -9.807  -16.057 1.00 69.71  ? 42  GLN D CG  1 
ATOM   2592 C  CD  . GLN D 1 45 ? -13.875 -9.718  -15.318 1.00 61.04  ? 42  GLN D CD  1 
ATOM   2593 O  OE1 . GLN D 1 45 ? -12.869 -10.281 -15.749 1.00 70.13  ? 42  GLN D OE1 1 
ATOM   2594 N  NE2 . GLN D 1 45 ? -13.872 -9.005  -14.196 1.00 48.41  ? 42  GLN D NE2 1 
ATOM   2595 N  N   . ILE D 1 46 ? -13.315 -7.981  -20.188 1.00 69.29  ? 43  ILE D N   1 
ATOM   2596 C  CA  . ILE D 1 46 ? -13.060 -8.048  -21.624 1.00 70.33  ? 43  ILE D CA  1 
ATOM   2597 C  C   . ILE D 1 46 ? -13.055 -9.497  -22.082 1.00 76.42  ? 43  ILE D C   1 
ATOM   2598 O  O   . ILE D 1 46 ? -13.535 -9.819  -23.168 1.00 86.49  ? 43  ILE D O   1 
ATOM   2599 C  CB  . ILE D 1 46 ? -11.725 -7.385  -22.003 1.00 50.22  ? 43  ILE D CB  1 
ATOM   2600 C  CG1 . ILE D 1 46 ? -10.582 -7.951  -21.150 1.00 57.77  ? 43  ILE D CG1 1 
ATOM   2601 C  CG2 . ILE D 1 46 ? -11.844 -5.882  -21.855 1.00 59.24  ? 43  ILE D CG2 1 
ATOM   2602 C  CD1 . ILE D 1 46 ? -9.254  -7.286  -21.377 1.00 58.12  ? 43  ILE D CD1 1 
ATOM   2603 N  N   . LEU D 1 47 ? -12.494 -10.366 -21.250 1.00 79.39  ? 44  LEU D N   1 
ATOM   2604 C  CA  . LEU D 1 47 ? -12.682 -11.799 -21.410 1.00 92.62  ? 44  LEU D CA  1 
ATOM   2605 C  C   . LEU D 1 47 ? -14.106 -12.116 -20.974 1.00 97.40  ? 44  LEU D C   1 
ATOM   2606 O  O   . LEU D 1 47 ? -14.352 -12.440 -19.818 1.00 95.73  ? 44  LEU D O   1 
ATOM   2607 C  CB  . LEU D 1 47 ? -11.661 -12.590 -20.586 1.00 94.32  ? 44  LEU D CB  1 
ATOM   2608 C  CG  . LEU D 1 47 ? -10.277 -12.804 -21.210 1.00 84.06  ? 44  LEU D CG  1 
ATOM   2609 C  CD1 . LEU D 1 47 ? -10.351 -13.828 -22.326 1.00 85.56  ? 44  LEU D CD1 1 
ATOM   2610 C  CD2 . LEU D 1 47 ? -9.689  -11.499 -21.722 1.00 81.88  ? 44  LEU D CD2 1 
ATOM   2611 N  N   . LYS D 1 48 ? -15.045 -12.003 -21.907 1.00 104.54 ? 45  LYS D N   1 
ATOM   2612 C  CA  . LYS D 1 48 ? -16.460 -12.165 -21.581 1.00 108.37 ? 45  LYS D CA  1 
ATOM   2613 C  C   . LYS D 1 48 ? -16.838 -13.645 -21.490 1.00 117.80 ? 45  LYS D C   1 
ATOM   2614 O  O   . LYS D 1 48 ? -18.011 -13.993 -21.337 1.00 121.49 ? 45  LYS D O   1 
ATOM   2615 C  CB  . LYS D 1 48 ? -17.349 -11.440 -22.605 1.00 102.05 ? 45  LYS D CB  1 
ATOM   2616 C  CG  . LYS D 1 48 ? -16.740 -11.207 -23.988 1.00 88.19  ? 45  LYS D CG  1 
ATOM   2617 C  CD  . LYS D 1 48 ? -17.700 -10.441 -24.892 1.00 80.10  ? 45  LYS D CD  1 
ATOM   2618 C  CE  . LYS D 1 48 ? -18.594 -11.355 -25.720 1.00 75.54  ? 45  LYS D CE  1 
ATOM   2619 N  NZ  . LYS D 1 48 ? -18.987 -12.611 -25.023 1.00 71.17  ? 45  LYS D NZ  1 
ATOM   2620 N  N   . ASN D 1 49 ? -15.832 -14.511 -21.576 1.00 116.91 ? 46  ASN D N   1 
ATOM   2621 C  CA  . ASN D 1 49 ? -16.013 -15.939 -21.355 1.00 117.77 ? 46  ASN D CA  1 
ATOM   2622 C  C   . ASN D 1 49 ? -14.729 -16.549 -20.785 1.00 117.67 ? 46  ASN D C   1 
ATOM   2623 O  O   . ASN D 1 49 ? -14.040 -17.306 -21.468 1.00 113.30 ? 46  ASN D O   1 
ATOM   2624 C  CB  . ASN D 1 49 ? -16.424 -16.627 -22.658 1.00 115.91 ? 46  ASN D CB  1 
ATOM   2625 C  CG  . ASN D 1 49 ? -15.702 -16.064 -23.867 1.00 114.11 ? 46  ASN D CG  1 
ATOM   2626 O  OD1 . ASN D 1 49 ? -15.186 -14.946 -23.831 1.00 100.61 ? 46  ASN D OD1 1 
ATOM   2627 N  ND2 . ASN D 1 49 ? -15.673 -16.832 -24.951 1.00 113.41 ? 46  ASN D ND2 1 
ATOM   2628 N  N   . PRO D 1 50 ? -14.403 -16.208 -19.523 1.00 109.95 ? 47  PRO D N   1 
ATOM   2629 C  CA  . PRO D 1 50 ? -13.150 -16.654 -18.897 1.00 96.50  ? 47  PRO D CA  1 
ATOM   2630 C  C   . PRO D 1 50 ? -13.132 -18.133 -18.532 1.00 108.20 ? 47  PRO D C   1 
ATOM   2631 O  O   . PRO D 1 50 ? -12.051 -18.682 -18.313 1.00 113.66 ? 47  PRO D O   1 
ATOM   2632 C  CB  . PRO D 1 50 ? -13.065 -15.810 -17.616 1.00 105.59 ? 47  PRO D CB  1 
ATOM   2633 C  CG  . PRO D 1 50 ? -14.152 -14.800 -17.702 1.00 113.92 ? 47  PRO D CG  1 
ATOM   2634 C  CD  . PRO D 1 50 ? -15.188 -15.359 -18.612 1.00 112.36 ? 47  PRO D CD  1 
ATOM   2635 N  N   . ASP D 1 51 ? -14.307 -18.751 -18.444 1.00 111.71 ? 48  ASP D N   1 
ATOM   2636 C  CA  . ASP D 1 51 ? -14.429 -20.142 -18.011 1.00 104.45 ? 48  ASP D CA  1 
ATOM   2637 C  C   . ASP D 1 51 ? -13.984 -20.295 -16.558 1.00 98.05  ? 48  ASP D C   1 
ATOM   2638 O  O   . ASP D 1 51 ? -13.700 -21.401 -16.100 1.00 92.43  ? 48  ASP D O   1 
ATOM   2639 C  CB  . ASP D 1 51 ? -13.605 -21.068 -18.913 1.00 102.04 ? 48  ASP D CB  1 
ATOM   2640 C  CG  . ASP D 1 51 ? -13.771 -20.748 -20.385 1.00 103.95 ? 48  ASP D CG  1 
ATOM   2641 O  OD1 . ASP D 1 51 ? -14.773 -20.092 -20.742 1.00 108.79 ? 48  ASP D OD1 1 
ATOM   2642 O  OD2 . ASP D 1 51 ? -12.904 -21.161 -21.184 1.00 103.93 ? 48  ASP D OD2 1 
ATOM   2643 N  N   . ASP D 1 52 ? -13.934 -19.179 -15.837 1.00 98.17  ? 49  ASP D N   1 
ATOM   2644 C  CA  . ASP D 1 52 ? -13.468 -19.181 -14.456 1.00 106.34 ? 49  ASP D CA  1 
ATOM   2645 C  C   . ASP D 1 52 ? -14.545 -19.699 -13.506 1.00 104.02 ? 49  ASP D C   1 
ATOM   2646 O  O   . ASP D 1 52 ? -15.719 -19.764 -13.872 1.00 104.97 ? 49  ASP D O   1 
ATOM   2647 C  CB  . ASP D 1 52 ? -13.033 -17.772 -14.033 1.00 107.70 ? 49  ASP D CB  1 
ATOM   2648 C  CG  . ASP D 1 52 ? -14.091 -16.714 -14.320 1.00 112.23 ? 49  ASP D CG  1 
ATOM   2649 O  OD1 . ASP D 1 52 ? -15.288 -17.058 -14.417 1.00 105.91 ? 49  ASP D OD1 1 
ATOM   2650 O  OD2 . ASP D 1 52 ? -13.719 -15.528 -14.452 1.00 117.19 ? 49  ASP D OD2 1 
ATOM   2651 N  N   . PRO D 1 53 ? -14.144 -20.087 -12.285 1.00 103.80 ? 50  PRO D N   1 
ATOM   2652 C  CA  . PRO D 1 53 ? -15.135 -20.358 -11.239 1.00 111.15 ? 50  PRO D CA  1 
ATOM   2653 C  C   . PRO D 1 53 ? -15.955 -19.105 -10.957 1.00 109.51 ? 50  PRO D C   1 
ATOM   2654 O  O   . PRO D 1 53 ? -15.413 -18.004 -11.054 1.00 112.89 ? 50  PRO D O   1 
ATOM   2655 C  CB  . PRO D 1 53 ? -14.281 -20.760 -10.032 1.00 114.46 ? 50  PRO D CB  1 
ATOM   2656 C  CG  . PRO D 1 53 ? -12.996 -21.237 -10.619 1.00 120.27 ? 50  PRO D CG  1 
ATOM   2657 C  CD  . PRO D 1 53 ? -12.775 -20.406 -11.843 1.00 106.93 ? 50  PRO D CD  1 
ATOM   2658 N  N   . ASP D 1 54 ? -17.231 -19.271 -10.621 1.00 105.27 ? 51  ASP D N   1 
ATOM   2659 C  CA  . ASP D 1 54 ? -18.151 -18.140 -10.511 1.00 104.70 ? 51  ASP D CA  1 
ATOM   2660 C  C   . ASP D 1 54 ? -17.619 -17.059 -9.575  1.00 103.59 ? 51  ASP D C   1 
ATOM   2661 O  O   . ASP D 1 54 ? -17.249 -17.333 -8.433  1.00 99.99  ? 51  ASP D O   1 
ATOM   2662 C  CB  . ASP D 1 54 ? -19.525 -18.614 -10.030 1.00 107.26 ? 51  ASP D CB  1 
ATOM   2663 C  CG  . ASP D 1 54 ? -20.620 -17.593 -10.293 1.00 99.04  ? 51  ASP D CG  1 
ATOM   2664 O  OD1 . ASP D 1 54 ? -20.576 -16.923 -11.346 1.00 97.98  ? 51  ASP D OD1 1 
ATOM   2665 O  OD2 . ASP D 1 54 ? -21.527 -17.461 -9.445  1.00 86.24  ? 51  ASP D OD2 1 
ATOM   2666 N  N   . MET D 1 55 ? -17.581 -15.830 -10.080 1.00 103.75 ? 52  MET D N   1 
ATOM   2667 C  CA  . MET D 1 55 ? -17.045 -14.695 -9.340  1.00 97.11  ? 52  MET D CA  1 
ATOM   2668 C  C   . MET D 1 55 ? -17.976 -14.278 -8.206  1.00 90.25  ? 52  MET D C   1 
ATOM   2669 O  O   . MET D 1 55 ? -17.541 -13.682 -7.225  1.00 82.18  ? 52  MET D O   1 
ATOM   2670 C  CB  . MET D 1 55 ? -16.815 -13.516 -10.290 1.00 96.32  ? 52  MET D CB  1 
ATOM   2671 C  CG  . MET D 1 55 ? -16.035 -12.351 -9.695  1.00 99.28  ? 52  MET D CG  1 
ATOM   2672 S  SD  . MET D 1 55 ? -15.902 -10.972 -10.852 1.00 101.29 ? 52  MET D SD  1 
ATOM   2673 C  CE  . MET D 1 55 ? -14.744 -9.899  -10.004 1.00 69.45  ? 52  MET D CE  1 
ATOM   2674 N  N   . VAL D 1 56 ? -19.258 -14.607 -8.338  1.00 93.62  ? 53  VAL D N   1 
ATOM   2675 C  CA  . VAL D 1 56 ? -20.271 -14.120 -7.406  1.00 90.45  ? 53  VAL D CA  1 
ATOM   2676 C  C   . VAL D 1 56 ? -20.240 -14.899 -6.093  1.00 85.71  ? 53  VAL D C   1 
ATOM   2677 O  O   . VAL D 1 56 ? -20.411 -14.324 -5.018  1.00 75.58  ? 53  VAL D O   1 
ATOM   2678 C  CB  . VAL D 1 56 ? -21.694 -14.214 -8.001  1.00 81.32  ? 53  VAL D CB  1 
ATOM   2679 C  CG1 . VAL D 1 56 ? -22.633 -13.268 -7.268  1.00 65.02  ? 53  VAL D CG1 1 
ATOM   2680 C  CG2 . VAL D 1 56 ? -21.689 -13.890 -9.492  1.00 87.65  ? 53  VAL D CG2 1 
ATOM   2681 N  N   . ASP D 1 57 ? -20.027 -16.209 -6.183  1.00 87.92  ? 54  ASP D N   1 
ATOM   2682 C  CA  . ASP D 1 57 ? -19.989 -17.056 -4.994  1.00 82.74  ? 54  ASP D CA  1 
ATOM   2683 C  C   . ASP D 1 57 ? -18.775 -16.747 -4.127  1.00 73.54  ? 54  ASP D C   1 
ATOM   2684 O  O   . ASP D 1 57 ? -18.858 -16.773 -2.900  1.00 65.20  ? 54  ASP D O   1 
ATOM   2685 C  CB  . ASP D 1 57 ? -19.981 -18.534 -5.387  1.00 82.43  ? 54  ASP D CB  1 
ATOM   2686 C  CG  . ASP D 1 57 ? -21.311 -18.995 -5.946  1.00 90.75  ? 54  ASP D CG  1 
ATOM   2687 O  OD1 . ASP D 1 57 ? -22.228 -19.277 -5.146  1.00 90.55  ? 54  ASP D OD1 1 
ATOM   2688 O  OD2 . ASP D 1 57 ? -21.441 -19.079 -7.184  1.00 97.73  ? 54  ASP D OD2 1 
ATOM   2689 N  N   . VAL D 1 58 ? -17.648 -16.458 -4.769  1.00 69.89  ? 55  VAL D N   1 
ATOM   2690 C  CA  . VAL D 1 58 ? -16.408 -16.197 -4.048  1.00 70.62  ? 55  VAL D CA  1 
ATOM   2691 C  C   . VAL D 1 58 ? -16.517 -14.928 -3.204  1.00 66.32  ? 55  VAL D C   1 
ATOM   2692 O  O   . VAL D 1 58 ? -16.066 -14.899 -2.059  1.00 61.44  ? 55  VAL D O   1 
ATOM   2693 C  CB  . VAL D 1 58 ? -15.220 -16.073 -5.017  1.00 73.49  ? 55  VAL D CB  1 
ATOM   2694 C  CG1 . VAL D 1 58 ? -13.938 -15.741 -4.262  1.00 75.58  ? 55  VAL D CG1 1 
ATOM   2695 C  CG2 . VAL D 1 58 ? -15.050 -17.364 -5.802  1.00 82.64  ? 55  VAL D CG2 1 
ATOM   2696 N  N   . PHE D 1 59 ? -17.108 -13.882 -3.773  1.00 63.52  ? 56  PHE D N   1 
ATOM   2697 C  CA  . PHE D 1 59 ? -17.337 -12.642 -3.039  1.00 56.42  ? 56  PHE D CA  1 
ATOM   2698 C  C   . PHE D 1 59 ? -18.247 -12.881 -1.835  1.00 58.06  ? 56  PHE D C   1 
ATOM   2699 O  O   . PHE D 1 59 ? -17.991 -12.373 -0.744  1.00 57.31  ? 56  PHE D O   1 
ATOM   2700 C  CB  . PHE D 1 59 ? -17.952 -11.577 -3.951  1.00 67.29  ? 56  PHE D CB  1 
ATOM   2701 C  CG  . PHE D 1 59 ? -16.939 -10.699 -4.633  1.00 77.58  ? 56  PHE D CG  1 
ATOM   2702 C  CD1 . PHE D 1 59 ? -16.350 -11.091 -5.824  1.00 84.75  ? 56  PHE D CD1 1 
ATOM   2703 C  CD2 . PHE D 1 59 ? -16.582 -9.478  -4.087  1.00 77.03  ? 56  PHE D CD2 1 
ATOM   2704 C  CE1 . PHE D 1 59 ? -15.421 -10.285 -6.453  1.00 85.13  ? 56  PHE D CE1 1 
ATOM   2705 C  CE2 . PHE D 1 59 ? -15.653 -8.667  -4.714  1.00 76.27  ? 56  PHE D CE2 1 
ATOM   2706 C  CZ  . PHE D 1 59 ? -15.072 -9.071  -5.898  1.00 74.44  ? 56  PHE D CZ  1 
ATOM   2707 N  N   . MET D 1 60 ? -19.309 -13.654 -2.041  1.00 55.81  ? 57  MET D N   1 
ATOM   2708 C  CA  . MET D 1 60 ? -20.254 -13.964 -0.972  1.00 52.06  ? 57  MET D CA  1 
ATOM   2709 C  C   . MET D 1 60 ? -19.613 -14.814 0.117   1.00 48.23  ? 57  MET D C   1 
ATOM   2710 O  O   . MET D 1 60 ? -19.905 -14.644 1.299   1.00 49.18  ? 57  MET D O   1 
ATOM   2711 C  CB  . MET D 1 60 ? -21.475 -14.689 -1.535  1.00 49.93  ? 57  MET D CB  1 
ATOM   2712 C  CG  . MET D 1 60 ? -22.538 -13.766 -2.097  1.00 49.97  ? 57  MET D CG  1 
ATOM   2713 S  SD  . MET D 1 60 ? -23.462 -12.907 -0.808  1.00 57.17  ? 57  MET D SD  1 
ATOM   2714 C  CE  . MET D 1 60 ? -24.600 -11.943 -1.798  1.00 50.57  ? 57  MET D CE  1 
ATOM   2715 N  N   . ASP D 1 61 ? -18.751 -15.738 -0.287  1.00 48.63  ? 58  ASP D N   1 
ATOM   2716 C  CA  . ASP D 1 61 ? -18.043 -16.583 0.666   1.00 56.79  ? 58  ASP D CA  1 
ATOM   2717 C  C   . ASP D 1 61 ? -17.072 -15.758 1.506   1.00 58.12  ? 58  ASP D C   1 
ATOM   2718 O  O   . ASP D 1 61 ? -16.724 -16.139 2.623   1.00 59.08  ? 58  ASP D O   1 
ATOM   2719 C  CB  . ASP D 1 61 ? -17.289 -17.699 -0.063  1.00 54.20  ? 58  ASP D CB  1 
ATOM   2720 C  CG  . ASP D 1 61 ? -18.216 -18.760 -0.633  1.00 62.34  ? 58  ASP D CG  1 
ATOM   2721 O  OD1 . ASP D 1 61 ? -19.431 -18.495 -0.753  1.00 65.23  ? 58  ASP D OD1 1 
ATOM   2722 O  OD2 . ASP D 1 61 ? -17.727 -19.860 -0.967  1.00 60.65  ? 58  ASP D OD2 1 
ATOM   2723 N  N   . HIS D 1 62 ? -16.649 -14.621 0.961   1.00 53.46  ? 59  HIS D N   1 
ATOM   2724 C  CA  . HIS D 1 62 ? -15.638 -13.779 1.594   1.00 54.20  ? 59  HIS D CA  1 
ATOM   2725 C  C   . HIS D 1 62 ? -16.215 -12.591 2.357   1.00 47.26  ? 59  HIS D C   1 
ATOM   2726 O  O   . HIS D 1 62 ? -15.814 -12.316 3.487   1.00 44.65  ? 59  HIS D O   1 
ATOM   2727 C  CB  . HIS D 1 62 ? -14.666 -13.261 0.536   1.00 50.24  ? 59  HIS D CB  1 
ATOM   2728 C  CG  . HIS D 1 62 ? -13.542 -14.201 0.242   1.00 64.96  ? 59  HIS D CG  1 
ATOM   2729 N  ND1 . HIS D 1 62 ? -12.221 -13.815 0.287   1.00 69.53  ? 59  HIS D ND1 1 
ATOM   2730 C  CD2 . HIS D 1 62 ? -13.540 -15.515 -0.085  1.00 63.41  ? 59  HIS D CD2 1 
ATOM   2731 C  CE1 . HIS D 1 62 ? -11.453 -14.846 -0.005  1.00 67.36  ? 59  HIS D CE1 1 
ATOM   2732 N  NE2 . HIS D 1 62 ? -12.228 -15.892 -0.237  1.00 65.72  ? 59  HIS D NE2 1 
ATOM   2733 N  N   . LEU D 1 63 ? -17.151 -11.887 1.730   1.00 48.87  ? 60  LEU D N   1 
ATOM   2734 C  CA  . LEU D 1 63 ? -17.613 -10.598 2.236   1.00 49.24  ? 60  LEU D CA  1 
ATOM   2735 C  C   . LEU D 1 63 ? -18.817 -10.712 3.162   1.00 43.27  ? 60  LEU D C   1 
ATOM   2736 O  O   . LEU D 1 63 ? -19.033 -9.847  4.010   1.00 40.39  ? 60  LEU D O   1 
ATOM   2737 C  CB  . LEU D 1 63 ? -17.957 -9.673  1.068   1.00 48.79  ? 60  LEU D CB  1 
ATOM   2738 C  CG  . LEU D 1 63 ? -16.781 -8.995  0.360   1.00 52.15  ? 60  LEU D CG  1 
ATOM   2739 C  CD1 . LEU D 1 63 ? -15.684 -9.983  -0.020  1.00 65.75  ? 60  LEU D CD1 1 
ATOM   2740 C  CD2 . LEU D 1 63 ? -17.280 -8.263  -0.870  1.00 49.33  ? 60  LEU D CD2 1 
ATOM   2741 N  N   . ASP D 1 64 ? -19.605 -11.768 2.995   1.00 43.56  ? 61  ASP D N   1 
ATOM   2742 C  CA  . ASP D 1 64 ? -20.766 -11.982 3.852   1.00 49.11  ? 61  ASP D CA  1 
ATOM   2743 C  C   . ASP D 1 64 ? -20.342 -12.648 5.158   1.00 41.56  ? 61  ASP D C   1 
ATOM   2744 O  O   . ASP D 1 64 ? -20.358 -13.873 5.282   1.00 47.77  ? 61  ASP D O   1 
ATOM   2745 C  CB  . ASP D 1 64 ? -21.817 -12.828 3.133   1.00 47.08  ? 61  ASP D CB  1 
ATOM   2746 C  CG  . ASP D 1 64 ? -23.130 -12.880 3.882   1.00 46.66  ? 61  ASP D CG  1 
ATOM   2747 O  OD1 . ASP D 1 64 ? -23.383 -11.973 4.698   1.00 42.02  ? 61  ASP D OD1 1 
ATOM   2748 O  OD2 . ASP D 1 64 ? -23.912 -13.824 3.651   1.00 50.81  ? 61  ASP D OD2 1 
ATOM   2749 N  N   . ILE D 1 65 ? -19.967 -11.825 6.131   1.00 43.20  ? 62  ILE D N   1 
ATOM   2750 C  CA  . ILE D 1 65 ? -19.413 -12.314 7.387   1.00 49.34  ? 62  ILE D CA  1 
ATOM   2751 C  C   . ILE D 1 65 ? -20.457 -13.053 8.221   1.00 53.12  ? 62  ILE D C   1 
ATOM   2752 O  O   . ILE D 1 65 ? -20.197 -14.141 8.729   1.00 55.54  ? 62  ILE D O   1 
ATOM   2753 C  CB  . ILE D 1 65 ? -18.833 -11.159 8.231   1.00 50.26  ? 62  ILE D CB  1 
ATOM   2754 C  CG1 . ILE D 1 65 ? -17.883 -10.292 7.395   1.00 44.77  ? 62  ILE D CG1 1 
ATOM   2755 C  CG2 . ILE D 1 65 ? -18.115 -11.704 9.460   1.00 58.17  ? 62  ILE D CG2 1 
ATOM   2756 C  CD1 . ILE D 1 65 ? -16.692 -11.035 6.823   1.00 41.46  ? 62  ILE D CD1 1 
ATOM   2757 N  N   . ASP D 1 66 ? -21.636 -12.453 8.361   1.00 46.55  ? 63  ASP D N   1 
ATOM   2758 C  CA  . ASP D 1 66 ? -22.695 -13.023 9.192   1.00 52.87  ? 63  ASP D CA  1 
ATOM   2759 C  C   . ASP D 1 66 ? -23.508 -14.081 8.441   1.00 48.52  ? 63  ASP D C   1 
ATOM   2760 O  O   . ASP D 1 66 ? -24.465 -14.637 8.981   1.00 50.95  ? 63  ASP D O   1 
ATOM   2761 C  CB  . ASP D 1 66 ? -23.616 -11.912 9.705   1.00 55.67  ? 63  ASP D CB  1 
ATOM   2762 C  CG  . ASP D 1 66 ? -24.103 -11.002 8.597   1.00 47.67  ? 63  ASP D CG  1 
ATOM   2763 O  OD1 . ASP D 1 66 ? -23.576 -11.118 7.473   1.00 48.78  ? 63  ASP D OD1 1 
ATOM   2764 O  OD2 . ASP D 1 66 ? -24.997 -10.168 8.850   1.00 38.32  ? 63  ASP D OD2 1 
ATOM   2765 N  N   . HIS D 1 67 ? -23.119 -14.347 7.196   1.00 56.82  ? 64  HIS D N   1 
ATOM   2766 C  CA  . HIS D 1 67 ? -23.696 -15.431 6.401   1.00 54.11  ? 64  HIS D CA  1 
ATOM   2767 C  C   . HIS D 1 67 ? -25.219 -15.364 6.291   1.00 49.77  ? 64  HIS D C   1 
ATOM   2768 O  O   . HIS D 1 67 ? -25.889 -16.397 6.280   1.00 58.41  ? 64  HIS D O   1 
ATOM   2769 C  CB  . HIS D 1 67 ? -23.288 -16.788 6.986   1.00 69.84  ? 64  HIS D CB  1 
ATOM   2770 C  CG  . HIS D 1 67 ? -21.807 -17.021 6.998   1.00 71.97  ? 64  HIS D CG  1 
ATOM   2771 N  ND1 . HIS D 1 67 ? -21.036 -16.853 8.126   1.00 74.68  ? 64  HIS D ND1 1 
ATOM   2772 C  CD2 . HIS D 1 67 ? -20.961 -17.406 6.014   1.00 70.43  ? 64  HIS D CD2 1 
ATOM   2773 C  CE1 . HIS D 1 67 ? -19.774 -17.127 7.838   1.00 72.93  ? 64  HIS D CE1 1 
ATOM   2774 N  NE2 . HIS D 1 67 ? -19.702 -17.465 6.564   1.00 78.24  ? 64  HIS D NE2 1 
ATOM   2775 N  N   . ASN D 1 68 ? -25.764 -14.153 6.205   1.00 53.79  ? 65  ASN D N   1 
ATOM   2776 C  CA  . ASN D 1 68 ? -27.195 -13.979 5.965   1.00 41.98  ? 65  ASN D CA  1 
ATOM   2777 C  C   . ASN D 1 68 ? -27.471 -13.867 4.467   1.00 44.61  ? 65  ASN D C   1 
ATOM   2778 O  O   . ASN D 1 68 ? -28.551 -13.445 4.050   1.00 43.83  ? 65  ASN D O   1 
ATOM   2779 C  CB  . ASN D 1 68 ? -27.728 -12.751 6.709   1.00 43.44  ? 65  ASN D CB  1 
ATOM   2780 C  CG  . ASN D 1 68 ? -27.192 -11.448 6.153   1.00 44.91  ? 65  ASN D CG  1 
ATOM   2781 O  OD1 . ASN D 1 68 ? -26.207 -11.428 5.419   1.00 42.38  ? 65  ASN D OD1 1 
ATOM   2782 N  ND2 . ASN D 1 68 ? -27.842 -10.346 6.508   1.00 40.40  ? 65  ASN D ND2 1 
ATOM   2783 N  N   . LYS D 1 69 ? -26.475 -14.243 3.669   1.00 47.00  ? 66  LYS D N   1 
ATOM   2784 C  CA  . LYS D 1 69 ? -26.602 -14.315 2.216   1.00 45.99  ? 66  LYS D CA  1 
ATOM   2785 C  C   . LYS D 1 69 ? -26.932 -12.956 1.599   1.00 48.14  ? 66  LYS D C   1 
ATOM   2786 O  O   . LYS D 1 69 ? -27.490 -12.883 0.503   1.00 48.61  ? 66  LYS D O   1 
ATOM   2787 C  CB  . LYS D 1 69 ? -27.672 -15.339 1.827   1.00 54.73  ? 66  LYS D CB  1 
ATOM   2788 C  CG  . LYS D 1 69 ? -27.519 -16.708 2.504   1.00 68.02  ? 66  LYS D CG  1 
ATOM   2789 C  CD  . LYS D 1 69 ? -27.170 -17.822 1.518   1.00 79.54  ? 66  LYS D CD  1 
ATOM   2790 C  CE  . LYS D 1 69 ? -25.665 -18.016 1.385   1.00 82.89  ? 66  LYS D CE  1 
ATOM   2791 N  NZ  . LYS D 1 69 ? -25.096 -18.759 2.546   1.00 87.69  ? 66  LYS D NZ  1 
ATOM   2792 N  N   . LYS D 1 70 ? -26.584 -11.885 2.305   1.00 40.85  ? 67  LYS D N   1 
ATOM   2793 C  CA  . LYS D 1 70 ? -26.779 -10.531 1.800   1.00 39.09  ? 67  LYS D CA  1 
ATOM   2794 C  C   . LYS D 1 70 ? -25.589 -9.661  2.186   1.00 32.07  ? 67  LYS D C   1 
ATOM   2795 O  O   . LYS D 1 70 ? -24.896 -9.951  3.159   1.00 42.64  ? 67  LYS D O   1 
ATOM   2796 C  CB  . LYS D 1 70 ? -28.086 -9.937  2.333   1.00 36.95  ? 67  LYS D CB  1 
ATOM   2797 C  CG  . LYS D 1 70 ? -29.331 -10.652 1.818   1.00 46.79  ? 67  LYS D CG  1 
ATOM   2798 C  CD  . LYS D 1 70 ? -30.584 -9.806  1.978   1.00 43.45  ? 67  LYS D CD  1 
ATOM   2799 C  CE  . LYS D 1 70 ? -31.102 -9.818  3.404   1.00 48.50  ? 67  LYS D CE  1 
ATOM   2800 N  NZ  . LYS D 1 70 ? -31.688 -11.140 3.763   1.00 59.92  ? 67  LYS D NZ  1 
ATOM   2801 N  N   . ILE D 1 71 ? -25.351 -8.606  1.412   1.00 29.02  ? 68  ILE D N   1 
ATOM   2802 C  CA  . ILE D 1 71 ? -24.209 -7.725  1.639   1.00 36.40  ? 68  ILE D CA  1 
ATOM   2803 C  C   . ILE D 1 71 ? -24.657 -6.329  2.059   1.00 34.63  ? 68  ILE D C   1 
ATOM   2804 O  O   . ILE D 1 71 ? -25.122 -5.546  1.232   1.00 36.54  ? 68  ILE D O   1 
ATOM   2805 C  CB  . ILE D 1 71 ? -23.334 -7.603  0.377   1.00 37.80  ? 68  ILE D CB  1 
ATOM   2806 C  CG1 . ILE D 1 71 ? -22.975 -8.988  -0.174  1.00 43.58  ? 68  ILE D CG1 1 
ATOM   2807 C  CG2 . ILE D 1 71 ? -22.076 -6.796  0.675   1.00 41.87  ? 68  ILE D CG2 1 
ATOM   2808 C  CD1 . ILE D 1 71 ? -22.182 -9.862  0.781   1.00 43.19  ? 68  ILE D CD1 1 
ATOM   2809 N  N   . ASP D 1 72 ? -24.513 -6.021  3.345   1.00 36.83  ? 69  ASP D N   1 
ATOM   2810 C  CA  . ASP D 1 72 ? -24.833 -4.688  3.850   1.00 34.07  ? 69  ASP D CA  1 
ATOM   2811 C  C   . ASP D 1 72 ? -23.718 -3.709  3.487   1.00 38.99  ? 69  ASP D C   1 
ATOM   2812 O  O   . ASP D 1 72 ? -22.727 -4.090  2.862   1.00 32.37  ? 69  ASP D O   1 
ATOM   2813 C  CB  . ASP D 1 72 ? -25.054 -4.713  5.365   1.00 32.36  ? 69  ASP D CB  1 
ATOM   2814 C  CG  . ASP D 1 72 ? -23.897 -5.342  6.117   1.00 37.75  ? 69  ASP D CG  1 
ATOM   2815 O  OD1 . ASP D 1 72 ? -22.876 -4.656  6.327   1.00 38.95  ? 69  ASP D OD1 1 
ATOM   2816 O  OD2 . ASP D 1 72 ? -24.016 -6.522  6.506   1.00 53.71  ? 69  ASP D OD2 1 
ATOM   2817 N  N   . PHE D 1 73 ? -23.882 -2.449  3.878   1.00 32.71  ? 70  PHE D N   1 
ATOM   2818 C  CA  . PHE D 1 73 ? -22.961 -1.399  3.452   1.00 34.82  ? 70  PHE D CA  1 
ATOM   2819 C  C   . PHE D 1 73 ? -21.574 -1.581  4.061   1.00 31.63  ? 70  PHE D C   1 
ATOM   2820 O  O   . PHE D 1 73 ? -20.565 -1.327  3.404   1.00 25.55  ? 70  PHE D O   1 
ATOM   2821 C  CB  . PHE D 1 73 ? -23.519 -0.022  3.816   1.00 26.47  ? 70  PHE D CB  1 
ATOM   2822 C  CG  . PHE D 1 73 ? -22.765 1.120   3.197   1.00 29.04  ? 70  PHE D CG  1 
ATOM   2823 C  CD1 . PHE D 1 73 ? -22.681 1.246   1.821   1.00 26.27  ? 70  PHE D CD1 1 
ATOM   2824 C  CD2 . PHE D 1 73 ? -22.151 2.074   3.991   1.00 33.81  ? 70  PHE D CD2 1 
ATOM   2825 C  CE1 . PHE D 1 73 ? -21.990 2.295   1.246   1.00 30.46  ? 70  PHE D CE1 1 
ATOM   2826 C  CE2 . PHE D 1 73 ? -21.461 3.128   3.423   1.00 24.61  ? 70  PHE D CE2 1 
ATOM   2827 C  CZ  . PHE D 1 73 ? -21.380 3.238   2.047   1.00 32.48  ? 70  PHE D CZ  1 
ATOM   2828 N  N   . THR D 1 74 ? -21.528 -2.031  5.311   1.00 32.71  ? 71  THR D N   1 
ATOM   2829 C  CA  . THR D 1 74 ? -20.260 -2.221  6.013   1.00 31.97  ? 71  THR D CA  1 
ATOM   2830 C  C   . THR D 1 74 ? -19.422 -3.308  5.350   1.00 32.14  ? 71  THR D C   1 
ATOM   2831 O  O   . THR D 1 74 ? -18.216 -3.146  5.159   1.00 25.80  ? 71  THR D O   1 
ATOM   2832 C  CB  . THR D 1 74 ? -20.483 -2.593  7.490   1.00 36.20  ? 71  THR D CB  1 
ATOM   2833 O  OG1 . THR D 1 74 ? -21.318 -1.610  8.113   1.00 37.75  ? 71  THR D OG1 1 
ATOM   2834 C  CG2 . THR D 1 74 ? -19.155 -2.676  8.237   1.00 25.92  ? 71  THR D CG2 1 
ATOM   2835 N  N   . GLU D 1 75 ? -20.071 -4.417  5.010   1.00 32.39  ? 72  GLU D N   1 
ATOM   2836 C  CA  . GLU D 1 75 ? -19.407 -5.522  4.328   1.00 29.63  ? 72  GLU D CA  1 
ATOM   2837 C  C   . GLU D 1 75 ? -18.942 -5.093  2.945   1.00 26.67  ? 72  GLU D C   1 
ATOM   2838 O  O   . GLU D 1 75 ? -17.885 -5.510  2.474   1.00 27.32  ? 72  GLU D O   1 
ATOM   2839 C  CB  . GLU D 1 75 ? -20.347 -6.723  4.219   1.00 28.03  ? 72  GLU D CB  1 
ATOM   2840 C  CG  . GLU D 1 75 ? -20.755 -7.308  5.561   1.00 37.35  ? 72  GLU D CG  1 
ATOM   2841 C  CD  . GLU D 1 75 ? -21.799 -8.400  5.437   1.00 33.90  ? 72  GLU D CD  1 
ATOM   2842 O  OE1 . GLU D 1 75 ? -22.746 -8.233  4.643   1.00 38.58  ? 72  GLU D OE1 1 
ATOM   2843 O  OE2 . GLU D 1 75 ? -21.671 -9.426  6.135   1.00 47.68  ? 72  GLU D OE2 1 
ATOM   2844 N  N   . PHE D 1 76 ? -19.745 -4.255  2.299   1.00 31.64  ? 73  PHE D N   1 
ATOM   2845 C  CA  . PHE D 1 76 ? -19.407 -3.718  0.990   1.00 28.38  ? 73  PHE D CA  1 
ATOM   2846 C  C   . PHE D 1 76 ? -18.157 -2.844  1.075   1.00 27.47  ? 73  PHE D C   1 
ATOM   2847 O  O   . PHE D 1 76 ? -17.315 -2.870  0.178   1.00 24.45  ? 73  PHE D O   1 
ATOM   2848 C  CB  . PHE D 1 76 ? -20.593 -2.925  0.427   1.00 28.81  ? 73  PHE D CB  1 
ATOM   2849 C  CG  . PHE D 1 76 ? -20.267 -2.118  -0.798  1.00 31.05  ? 73  PHE D CG  1 
ATOM   2850 C  CD1 . PHE D 1 76 ? -20.191 -2.719  -2.044  1.00 34.94  ? 73  PHE D CD1 1 
ATOM   2851 C  CD2 . PHE D 1 76 ? -20.061 -0.752  -0.704  1.00 24.42  ? 73  PHE D CD2 1 
ATOM   2852 C  CE1 . PHE D 1 76 ? -19.900 -1.972  -3.173  1.00 37.74  ? 73  PHE D CE1 1 
ATOM   2853 C  CE2 . PHE D 1 76 ? -19.769 0.000   -1.826  1.00 34.77  ? 73  PHE D CE2 1 
ATOM   2854 C  CZ  . PHE D 1 76 ? -19.689 -0.610  -3.064  1.00 40.82  ? 73  PHE D CZ  1 
ATOM   2855 N  N   . LEU D 1 77 ? -18.025 -2.090  2.163   1.00 25.73  ? 74  LEU D N   1 
ATOM   2856 C  CA  . LEU D 1 77 ? -16.906 -1.165  2.313   1.00 19.75  ? 74  LEU D CA  1 
ATOM   2857 C  C   . LEU D 1 77 ? -15.581 -1.897  2.517   1.00 21.48  ? 74  LEU D C   1 
ATOM   2858 O  O   . LEU D 1 77 ? -14.516 -1.331  2.274   1.00 27.03  ? 74  LEU D O   1 
ATOM   2859 C  CB  . LEU D 1 77 ? -17.153 -0.200  3.476   1.00 20.88  ? 74  LEU D CB  1 
ATOM   2860 C  CG  . LEU D 1 77 ? -18.162 0.932   3.243   1.00 19.11  ? 74  LEU D CG  1 
ATOM   2861 C  CD1 . LEU D 1 77 ? -18.317 1.756   4.506   1.00 22.34  ? 74  LEU D CD1 1 
ATOM   2862 C  CD2 . LEU D 1 77 ? -17.757 1.832   2.075   1.00 29.68  ? 74  LEU D CD2 1 
ATOM   2863 N  N   . LEU D 1 78 ? -15.643 -3.152  2.954   1.00 22.19  ? 75  LEU D N   1 
ATOM   2864 C  CA  . LEU D 1 78 ? -14.436 -3.960  3.083   1.00 16.11  ? 75  LEU D CA  1 
ATOM   2865 C  C   . LEU D 1 78 ? -13.835 -4.220  1.711   1.00 20.63  ? 75  LEU D C   1 
ATOM   2866 O  O   . LEU D 1 78 ? -12.618 -4.196  1.538   1.00 23.16  ? 75  LEU D O   1 
ATOM   2867 C  CB  . LEU D 1 78 ? -14.734 -5.287  3.781   1.00 25.18  ? 75  LEU D CB  1 
ATOM   2868 C  CG  . LEU D 1 78 ? -13.519 -6.192  4.008   1.00 26.10  ? 75  LEU D CG  1 
ATOM   2869 C  CD1 . LEU D 1 78 ? -12.523 -5.534  4.958   1.00 29.49  ? 75  LEU D CD1 1 
ATOM   2870 C  CD2 . LEU D 1 78 ? -13.945 -7.552  4.536   1.00 37.61  ? 75  LEU D CD2 1 
ATOM   2871 N  N   . MET D 1 79 ? -14.701 -4.476  0.737   1.00 29.30  ? 76  MET D N   1 
ATOM   2872 C  CA  . MET D 1 79 ? -14.268 -4.649  -0.640  1.00 26.60  ? 76  MET D CA  1 
ATOM   2873 C  C   . MET D 1 79 ? -13.615 -3.369  -1.130  1.00 21.58  ? 76  MET D C   1 
ATOM   2874 O  O   . MET D 1 79 ? -12.525 -3.397  -1.701  1.00 32.73  ? 76  MET D O   1 
ATOM   2875 C  CB  . MET D 1 79 ? -15.450 -5.015  -1.537  1.00 38.02  ? 76  MET D CB  1 
ATOM   2876 C  CG  . MET D 1 79 ? -15.089 -5.262  -2.997  1.00 44.91  ? 76  MET D CG  1 
ATOM   2877 S  SD  . MET D 1 79 ? -16.367 -4.653  -4.112  1.00 51.52  ? 76  MET D SD  1 
ATOM   2878 C  CE  . MET D 1 79 ? -17.769 -5.635  -3.585  1.00 60.76  ? 76  MET D CE  1 
ATOM   2879 N  N   . VAL D 1 80 ? -14.283 -2.245  -0.893  1.00 22.85  ? 77  VAL D N   1 
ATOM   2880 C  CA  . VAL D 1 80 ? -13.776 -0.957  -1.339  1.00 21.43  ? 77  VAL D CA  1 
ATOM   2881 C  C   . VAL D 1 80 ? -12.435 -0.682  -0.673  1.00 21.89  ? 77  VAL D C   1 
ATOM   2882 O  O   . VAL D 1 80 ? -11.514 -0.161  -1.301  1.00 25.21  ? 77  VAL D O   1 
ATOM   2883 C  CB  . VAL D 1 80 ? -14.761 0.186   -1.026  1.00 35.13  ? 77  VAL D CB  1 
ATOM   2884 C  CG1 . VAL D 1 80 ? -14.235 1.516   -1.565  1.00 25.11  ? 77  VAL D CG1 1 
ATOM   2885 C  CG2 . VAL D 1 80 ? -16.130 -0.118  -1.619  1.00 32.09  ? 77  VAL D CG2 1 
ATOM   2886 N  N   . PHE D 1 81 ? -12.331 -1.058  0.599   1.00 23.71  ? 78  PHE D N   1 
ATOM   2887 C  CA  . PHE D 1 81 ? -11.108 -0.870  1.370   1.00 20.91  ? 78  PHE D CA  1 
ATOM   2888 C  C   . PHE D 1 81 ? -9.938  -1.660  0.790   1.00 16.93  ? 78  PHE D C   1 
ATOM   2889 O  O   . PHE D 1 81 ? -8.845  -1.124  0.614   1.00 27.65  ? 78  PHE D O   1 
ATOM   2890 C  CB  . PHE D 1 81 ? -11.337 -1.280  2.828   1.00 25.57  ? 78  PHE D CB  1 
ATOM   2891 C  CG  . PHE D 1 81 ? -10.079 -1.316  3.660   1.00 27.09  ? 78  PHE D CG  1 
ATOM   2892 C  CD1 . PHE D 1 81 ? -9.553  -0.153  4.203   1.00 29.83  ? 78  PHE D CD1 1 
ATOM   2893 C  CD2 . PHE D 1 81 ? -9.435  -2.517  3.916   1.00 28.63  ? 78  PHE D CD2 1 
ATOM   2894 C  CE1 . PHE D 1 81 ? -8.401  -0.187  4.977   1.00 24.43  ? 78  PHE D CE1 1 
ATOM   2895 C  CE2 . PHE D 1 81 ? -8.285  -2.555  4.690   1.00 28.54  ? 78  PHE D CE2 1 
ATOM   2896 C  CZ  . PHE D 1 81 ? -7.769  -1.388  5.220   1.00 23.53  ? 78  PHE D CZ  1 
ATOM   2897 N  N   . LYS D 1 82 ? -10.168 -2.937  0.507   1.00 20.06  ? 79  LYS D N   1 
ATOM   2898 C  CA  . LYS D 1 82 ? -9.128  -3.794  -0.059  1.00 25.28  ? 79  LYS D CA  1 
ATOM   2899 C  C   . LYS D 1 82 ? -8.686  -3.322  -1.442  1.00 17.57  ? 79  LYS D C   1 
ATOM   2900 O  O   . LYS D 1 82 ? -7.510  -3.430  -1.792  1.00 27.22  ? 79  LYS D O   1 
ATOM   2901 C  CB  . LYS D 1 82 ? -9.615  -5.239  -0.144  1.00 23.46  ? 79  LYS D CB  1 
ATOM   2902 C  CG  . LYS D 1 82 ? -9.646  -5.956  1.189   1.00 26.29  ? 79  LYS D CG  1 
ATOM   2903 C  CD  . LYS D 1 82 ? -10.263 -7.335  1.055   1.00 28.79  ? 79  LYS D CD  1 
ATOM   2904 C  CE  . LYS D 1 82 ? -10.279 -8.077  2.382   1.00 32.34  ? 79  LYS D CE  1 
ATOM   2905 N  NZ  . LYS D 1 82 ? -8.922  -8.516  2.810   1.00 33.98  ? 79  LYS D NZ  1 
ATOM   2906 N  N   . LEU D 1 83 ? -9.629  -2.810  -2.228  1.00 24.28  ? 80  LEU D N   1 
ATOM   2907 C  CA  . LEU D 1 83 ? -9.313  -2.255  -3.543  1.00 22.21  ? 80  LEU D CA  1 
ATOM   2908 C  C   . LEU D 1 83 ? -8.416  -1.033  -3.424  1.00 21.49  ? 80  LEU D C   1 
ATOM   2909 O  O   . LEU D 1 83 ? -7.416  -0.919  -4.135  1.00 27.23  ? 80  LEU D O   1 
ATOM   2910 C  CB  . LEU D 1 83 ? -10.588 -1.875  -4.299  1.00 29.48  ? 80  LEU D CB  1 
ATOM   2911 C  CG  . LEU D 1 83 ? -11.350 -2.986  -5.021  1.00 42.14  ? 80  LEU D CG  1 
ATOM   2912 C  CD1 . LEU D 1 83 ? -12.720 -2.495  -5.449  1.00 42.81  ? 80  LEU D CD1 1 
ATOM   2913 C  CD2 . LEU D 1 83 ? -10.566 -3.469  -6.231  1.00 48.32  ? 80  LEU D CD2 1 
ATOM   2914 N  N   . ALA D 1 84 ? -8.781  -0.119  -2.529  1.00 22.69  ? 81  ALA D N   1 
ATOM   2915 C  CA  . ALA D 1 84 ? -8.022  1.112   -2.347  1.00 21.88  ? 81  ALA D CA  1 
ATOM   2916 C  C   . ALA D 1 84 ? -6.583  0.794   -1.960  1.00 24.00  ? 81  ALA D C   1 
ATOM   2917 O  O   . ALA D 1 84 ? -5.643  1.317   -2.561  1.00 25.11  ? 81  ALA D O   1 
ATOM   2918 C  CB  . ALA D 1 84 ? -8.675  1.992   -1.299  1.00 17.79  ? 81  ALA D CB  1 
ATOM   2919 N  N   . GLN D 1 85 ? -6.418  -0.080  -0.971  1.00 18.61  ? 82  GLN D N   1 
ATOM   2920 C  CA  . GLN D 1 85 ? -5.091  -0.506  -0.536  1.00 21.70  ? 82  GLN D CA  1 
ATOM   2921 C  C   . GLN D 1 85 ? -4.302  -1.128  -1.680  1.00 25.72  ? 82  GLN D C   1 
ATOM   2922 O  O   . GLN D 1 85 ? -3.125  -0.829  -1.872  1.00 27.64  ? 82  GLN D O   1 
ATOM   2923 C  CB  . GLN D 1 85 ? -5.192  -1.516  0.607   1.00 22.80  ? 82  GLN D CB  1 
ATOM   2924 C  CG  . GLN D 1 85 ? -5.392  -0.913  1.980   1.00 29.21  ? 82  GLN D CG  1 
ATOM   2925 C  CD  . GLN D 1 85 ? -5.131  -1.922  3.078   1.00 34.16  ? 82  GLN D CD  1 
ATOM   2926 O  OE1 . GLN D 1 85 ? -5.351  -3.120  2.897   1.00 37.96  ? 82  GLN D OE1 1 
ATOM   2927 N  NE2 . GLN D 1 85 ? -4.641  -1.448  4.215   1.00 35.83  ? 82  GLN D NE2 1 
ATOM   2928 N  N   . ALA D 1 86 ? -4.964  -2.001  -2.431  1.00 24.41  ? 83  ALA D N   1 
ATOM   2929 C  CA  . ALA D 1 86 ? -4.315  -2.754  -3.496  1.00 31.67  ? 83  ALA D CA  1 
ATOM   2930 C  C   . ALA D 1 86 ? -3.853  -1.846  -4.635  1.00 32.81  ? 83  ALA D C   1 
ATOM   2931 O  O   . ALA D 1 86 ? -2.754  -2.014  -5.166  1.00 31.37  ? 83  ALA D O   1 
ATOM   2932 C  CB  . ALA D 1 86 ? -5.257  -3.824  -4.022  1.00 27.31  ? 83  ALA D CB  1 
ATOM   2933 N  N   . TYR D 1 87 ? -4.691  -0.883  -5.005  1.00 29.83  ? 84  TYR D N   1 
ATOM   2934 C  CA  . TYR D 1 87 ? -4.381  0.004   -6.121  1.00 28.61  ? 84  TYR D CA  1 
ATOM   2935 C  C   . TYR D 1 87 ? -3.533  1.201   -5.703  1.00 35.60  ? 84  TYR D C   1 
ATOM   2936 O  O   . TYR D 1 87 ? -3.143  2.005   -6.548  1.00 30.70  ? 84  TYR D O   1 
ATOM   2937 C  CB  . TYR D 1 87 ? -5.669  0.493   -6.787  1.00 22.00  ? 84  TYR D CB  1 
ATOM   2938 C  CG  . TYR D 1 87 ? -6.151  -0.416  -7.893  1.00 31.15  ? 84  TYR D CG  1 
ATOM   2939 C  CD1 . TYR D 1 87 ? -5.509  -0.442  -9.124  1.00 35.97  ? 84  TYR D CD1 1 
ATOM   2940 C  CD2 . TYR D 1 87 ? -7.244  -1.250  -7.707  1.00 23.53  ? 84  TYR D CD2 1 
ATOM   2941 C  CE1 . TYR D 1 87 ? -5.943  -1.273  -10.139 1.00 28.88  ? 84  TYR D CE1 1 
ATOM   2942 C  CE2 . TYR D 1 87 ? -7.685  -2.084  -8.715  1.00 32.12  ? 84  TYR D CE2 1 
ATOM   2943 C  CZ  . TYR D 1 87 ? -7.032  -2.091  -9.929  1.00 30.69  ? 84  TYR D CZ  1 
ATOM   2944 O  OH  . TYR D 1 87 ? -7.469  -2.919  -10.933 1.00 35.42  ? 84  TYR D OH  1 
ATOM   2945 N  N   . TYR D 1 88 ? -3.240  1.321   -4.411  1.00 31.92  ? 85  TYR D N   1 
ATOM   2946 C  CA  . TYR D 1 88 ? -2.407  2.421   -3.940  1.00 30.27  ? 85  TYR D CA  1 
ATOM   2947 C  C   . TYR D 1 88 ? -0.971  2.249   -4.420  1.00 40.09  ? 85  TYR D C   1 
ATOM   2948 O  O   . TYR D 1 88 ? -0.345  3.200   -4.887  1.00 46.97  ? 85  TYR D O   1 
ATOM   2949 C  CB  . TYR D 1 88 ? -2.431  2.529   -2.413  1.00 33.74  ? 85  TYR D CB  1 
ATOM   2950 C  CG  . TYR D 1 88 ? -1.562  3.656   -1.891  1.00 32.69  ? 85  TYR D CG  1 
ATOM   2951 C  CD1 . TYR D 1 88 ? -0.218  3.450   -1.606  1.00 41.32  ? 85  TYR D CD1 1 
ATOM   2952 C  CD2 . TYR D 1 88 ? -2.081  4.930   -1.701  1.00 27.90  ? 85  TYR D CD2 1 
ATOM   2953 C  CE1 . TYR D 1 88 ? 0.582   4.477   -1.140  1.00 31.81  ? 85  TYR D CE1 1 
ATOM   2954 C  CE2 . TYR D 1 88 ? -1.287  5.965   -1.234  1.00 29.39  ? 85  TYR D CE2 1 
ATOM   2955 C  CZ  . TYR D 1 88 ? 0.044   5.730   -0.955  1.00 29.70  ? 85  TYR D CZ  1 
ATOM   2956 O  OH  . TYR D 1 88 ? 0.840   6.751   -0.491  1.00 38.78  ? 85  TYR D OH  1 
ATOM   2957 N  N   . GLU D 1 89 ? -0.451  1.034   -4.299  1.00 46.29  ? 86  GLU D N   1 
ATOM   2958 C  CA  . GLU D 1 89 ? 0.932   0.758   -4.666  1.00 54.01  ? 86  GLU D CA  1 
ATOM   2959 C  C   . GLU D 1 89 ? 1.110   0.752   -6.183  1.00 60.21  ? 86  GLU D C   1 
ATOM   2960 O  O   . GLU D 1 89 ? 2.207   0.997   -6.686  1.00 67.29  ? 86  GLU D O   1 
ATOM   2961 C  CB  . GLU D 1 89 ? 1.383   -0.579  -4.074  1.00 59.83  ? 86  GLU D CB  1 
ATOM   2962 C  CG  . GLU D 1 89 ? 1.163   -0.697  -2.568  1.00 60.48  ? 86  GLU D CG  1 
ATOM   2963 C  CD  . GLU D 1 89 ? 1.892   0.376   -1.778  1.00 65.95  ? 86  GLU D CD  1 
ATOM   2964 O  OE1 . GLU D 1 89 ? 2.907   0.907   -2.279  1.00 64.52  ? 86  GLU D OE1 1 
ATOM   2965 O  OE2 . GLU D 1 89 ? 1.447   0.692   -0.654  1.00 66.67  ? 86  GLU D OE2 1 
ATOM   2966 N  N   . SER D 1 90 ? 0.029   0.475   -6.907  1.00 62.60  ? 87  SER D N   1 
ATOM   2967 C  CA  . SER D 1 90 ? 0.061   0.470   -8.367  1.00 69.96  ? 87  SER D CA  1 
ATOM   2968 C  C   . SER D 1 90 ? 0.348   1.858   -8.930  1.00 71.50  ? 87  SER D C   1 
ATOM   2969 O  O   . SER D 1 90 ? 1.051   1.998   -9.932  1.00 82.73  ? 87  SER D O   1 
ATOM   2970 C  CB  . SER D 1 90 ? -1.263  -0.049  -8.928  1.00 58.41  ? 87  SER D CB  1 
ATOM   2971 O  OG  . SER D 1 90 ? -1.353  -1.454  -8.792  1.00 60.98  ? 87  SER D OG  1 
ATOM   2972 N  N   . THR D 1 91 ? -0.203  2.879   -8.284  1.00 69.25  ? 88  THR D N   1 
ATOM   2973 C  CA  . THR D 1 91 ? 0.004   4.259   -8.706  1.00 72.11  ? 88  THR D CA  1 
ATOM   2974 C  C   . THR D 1 91 ? 1.474   4.653   -8.589  1.00 75.07  ? 88  THR D C   1 
ATOM   2975 O  O   . THR D 1 91 ? 2.239   4.023   -7.858  1.00 77.15  ? 88  THR D O   1 
ATOM   2976 C  CB  . THR D 1 91 ? -0.844  5.235   -7.870  1.00 67.67  ? 88  THR D CB  1 
ATOM   2977 O  OG1 . THR D 1 91 ? -0.618  4.992   -6.477  1.00 63.24  ? 88  THR D OG1 1 
ATOM   2978 C  CG2 . THR D 1 91 ? -2.325  5.062   -8.175  1.00 58.39  ? 88  THR D CG2 1 
HETATM 2979 CA CA  . CA  E 2 .  ? -0.549  -7.406  10.772  1.00 31.03  ? 101 CA  A CA  1 
HETATM 2980 CA CA  . CA  F 2 .  ? 1.913   -15.317 18.153  1.00 52.61  ? 102 CA  A CA  1 
HETATM 2981 O  O1  . 2PE G 3 .  ? -23.818 -11.980 13.811  1.00 72.99  ? 103 2PE A O1  1 
HETATM 2982 C  C2  . 2PE G 3 .  ? -22.958 -13.009 13.303  1.00 71.24  ? 103 2PE A C2  1 
HETATM 2983 C  C3  . 2PE G 3 .  ? -21.478 -12.607 13.418  1.00 71.49  ? 103 2PE A C3  1 
HETATM 2984 O  O4  . 2PE G 3 .  ? -21.128 -11.703 12.403  1.00 66.07  ? 103 2PE A O4  1 
HETATM 2985 C  C5  . 2PE G 3 .  ? -21.662 -10.383 12.545  1.00 60.35  ? 103 2PE A C5  1 
HETATM 2986 C  C6  . 2PE G 3 .  ? -20.921 -9.458  11.598  1.00 59.88  ? 103 2PE A C6  1 
HETATM 2987 O  O7  . 2PE G 3 .  ? -19.507 -9.545  11.866  1.00 60.19  ? 103 2PE A O7  1 
HETATM 2988 C  C8  . 2PE G 3 .  ? -18.689 -8.669  11.106  1.00 58.36  ? 103 2PE A C8  1 
HETATM 2989 C  C9  . 2PE G 3 .  ? -17.304 -8.729  11.675  1.00 52.49  ? 103 2PE A C9  1 
HETATM 2990 O  O10 . 2PE G 3 .  ? -16.310 -8.155  10.756  1.00 52.92  ? 103 2PE A O10 1 
HETATM 2991 C  C11 . 2PE G 3 .  ? -15.158 -9.026  10.512  1.00 46.97  ? 103 2PE A C11 1 
HETATM 2992 C  C12 . 2PE G 3 .  ? -14.282 -8.478  9.369   1.00 40.56  ? 103 2PE A C12 1 
HETATM 2993 O  O13 . 2PE G 3 .  ? -13.082 -7.900  9.922   1.00 49.97  ? 103 2PE A O13 1 
HETATM 2994 C  C14 . 2PE G 3 .  ? -12.830 -6.610  9.475   1.00 31.94  ? 103 2PE A C14 1 
HETATM 2995 C  C15 . 2PE G 3 .  ? -11.316 -6.290  9.562   1.00 34.86  ? 103 2PE A C15 1 
HETATM 2996 O  O16 . 2PE G 3 .  ? -11.153 -5.018  10.264  1.00 42.09  ? 103 2PE A O16 1 
HETATM 2997 C  C17 . 2PE G 3 .  ? -10.323 -4.062  9.631   1.00 33.48  ? 103 2PE A C17 1 
HETATM 2998 C  C18 . 2PE G 3 .  ? -11.219 -3.017  8.996   1.00 37.61  ? 103 2PE A C18 1 
HETATM 2999 O  O19 . 2PE G 3 .  ? -10.650 -2.520  7.804   1.00 38.96  ? 103 2PE A O19 1 
HETATM 3000 C  C20 . 2PE G 3 .  ? -11.630 -2.306  6.734   1.00 36.50  ? 103 2PE A C20 1 
HETATM 3001 C  C21 . 2PE G 3 .  ? -12.734 -1.324  7.118   1.00 31.99  ? 103 2PE A C21 1 
HETATM 3002 O  O22 . 2PE G 3 .  ? -13.792 -1.473  6.148   1.00 34.34  ? 103 2PE A O22 1 
HETATM 3003 C  C23 . 2PE G 3 .  ? -15.107 -1.504  6.659   1.00 30.79  ? 103 2PE A C23 1 
HETATM 3004 C  C24 . 2PE G 3 .  ? -15.653 -0.052  6.941   1.00 26.07  ? 103 2PE A C24 1 
HETATM 3005 O  O25 . 2PE G 3 .  ? -14.959 0.466   8.034   1.00 46.74  ? 103 2PE A O25 1 
HETATM 3006 C  C26 . 2PE G 3 .  ? -15.633 1.396   8.827   1.00 43.92  ? 103 2PE A C26 1 
HETATM 3007 C  C27 . 2PE G 3 .  ? -15.110 1.206   10.291  1.00 37.31  ? 103 2PE A C27 1 
HETATM 3008 O  O28 . 2PE G 3 .  ? -13.684 1.288   10.285  1.00 39.24  ? 103 2PE A O28 1 
HETATM 3009 CA CA  . CA  H 2 .  ? -29.960 9.301   25.186  1.00 39.36  ? 101 CA  B CA  1 
HETATM 3010 CA CA  . CA  I 2 .  ? -22.014 12.838  17.761  1.00 37.36  ? 102 CA  B CA  1 
HETATM 3011 CA CA  . CA  J 2 .  ? 0.276   5.887   12.021  1.00 24.24  ? 101 CA  C CA  1 
HETATM 3012 CA CA  . CA  K 2 .  ? 4.116   13.514  4.127   1.00 26.85  ? 102 CA  C CA  1 
HETATM 3013 O  O1  . 2PE L 3 .  ? -23.944 13.165  9.878   1.00 54.46  ? 103 2PE C O1  1 
HETATM 3014 C  C2  . 2PE L 3 .  ? -22.770 12.879  9.105   1.00 44.30  ? 103 2PE C C2  1 
HETATM 3015 C  C3  . 2PE L 3 .  ? -21.504 13.102  9.947   1.00 47.47  ? 103 2PE C C3  1 
HETATM 3016 O  O4  . 2PE L 3 .  ? -21.193 14.468  10.005  1.00 49.62  ? 103 2PE C O4  1 
HETATM 3017 C  C5  . 2PE L 3 .  ? -19.829 14.728  10.356  1.00 51.90  ? 103 2PE C C5  1 
HETATM 3018 C  C6  . 2PE L 3 .  ? -19.642 16.219  10.580  1.00 46.09  ? 103 2PE C C6  1 
HETATM 3019 O  O7  . 2PE L 3 .  ? -18.323 16.465  11.116  1.00 49.87  ? 103 2PE C O7  1 
HETATM 3020 C  C8  . 2PE L 3 .  ? -17.300 16.536  10.132  1.00 55.96  ? 103 2PE C C8  1 
HETATM 3021 C  C9  . 2PE L 3 .  ? -16.025 15.951  10.659  1.00 43.22  ? 103 2PE C C9  1 
HETATM 3022 O  O10 . 2PE L 3 .  ? -15.857 14.588  10.131  1.00 59.10  ? 103 2PE C O10 1 
HETATM 3023 C  C11 . 2PE L 3 .  ? -14.679 13.859  10.602  1.00 47.02  ? 103 2PE C C11 1 
HETATM 3024 C  C12 . 2PE L 3 .  ? -14.555 12.514  9.856   1.00 46.89  ? 103 2PE C C12 1 
HETATM 3025 O  O13 . 2PE L 3 .  ? -13.603 11.653  10.521  1.00 55.28  ? 103 2PE C O13 1 
HETATM 3026 C  C14 . 2PE L 3 .  ? -14.035 11.134  11.741  1.00 48.08  ? 103 2PE C C14 1 
HETATM 3027 C  C15 . 2PE L 3 .  ? -13.409 9.734   11.989  1.00 42.51  ? 103 2PE C C15 1 
HETATM 3028 O  O16 . 2PE L 3 .  ? -13.000 9.619   13.388  1.00 46.25  ? 103 2PE C O16 1 
HETATM 3029 C  C17 . 2PE L 3 .  ? -12.679 8.309   13.817  1.00 33.38  ? 103 2PE C C17 1 
HETATM 3030 C  C18 . 2PE L 3 .  ? -11.596 7.674   12.957  1.00 26.94  ? 103 2PE C C18 1 
HETATM 3031 O  O19 . 2PE L 3 .  ? -10.962 6.684   13.750  1.00 47.00  ? 103 2PE C O19 1 
HETATM 3032 C  C20 . 2PE L 3 .  ? -10.483 5.489   13.048  1.00 24.06  ? 103 2PE C C20 1 
HETATM 3033 C  C21 . 2PE L 3 .  ? -9.894  4.536   14.091  1.00 40.75  ? 103 2PE C C21 1 
HETATM 3034 O  O22 . 2PE L 3 .  ? -10.915 3.611   14.523  1.00 40.62  ? 103 2PE C O22 1 
HETATM 3035 C  C23 . 2PE L 3 .  ? -10.636 2.916   15.715  1.00 21.75  ? 103 2PE C C23 1 
HETATM 3036 C  C24 . 2PE L 3 .  ? -11.857 1.981   16.076  1.00 24.86  ? 103 2PE C C24 1 
HETATM 3037 O  O25 . 2PE L 3 .  ? -12.967 2.788   16.345  1.00 37.80  ? 103 2PE C O25 1 
HETATM 3038 C  C26 . 2PE L 3 .  ? -14.180 2.145   16.612  1.00 26.89  ? 103 2PE C C26 1 
HETATM 3039 C  C27 . 2PE L 3 .  ? -14.603 1.270   15.381  1.00 39.45  ? 103 2PE C C27 1 
HETATM 3040 O  O28 . 2PE L 3 .  ? -16.000 0.982   15.427  1.00 50.55  ? 103 2PE C O28 1 
HETATM 3041 CA CA  . CA  M 2 .  ? -31.488 -5.512  -2.059  1.00 42.48  ? 101 CA  D CA  1 
HETATM 3042 CA CA  . CA  N 2 .  ? -24.302 -10.053 5.473   1.00 39.69  ? 102 CA  D CA  1 
HETATM 3043 O  O   . HOH O 4 .  ? 4.570   -17.938 25.855  1.00 44.39  ? 201 HOH A O   1 
HETATM 3044 O  O   . HOH O 4 .  ? 2.160   -2.342  11.039  1.00 45.93  ? 202 HOH A O   1 
HETATM 3045 O  O   . HOH O 4 .  ? -22.736 -2.513  33.759  1.00 36.43  ? 203 HOH A O   1 
HETATM 3046 O  O   . HOH O 4 .  ? -15.405 0.304   34.071  1.00 31.81  ? 204 HOH A O   1 
HETATM 3047 O  O   . HOH O 4 .  ? -12.890 -9.089  36.167  1.00 46.30  ? 205 HOH A O   1 
HETATM 3048 O  O   . HOH O 4 .  ? -13.533 -23.300 -0.810  1.00 49.05  ? 206 HOH A O   1 
HETATM 3049 O  O   . HOH O 4 .  ? 3.428   -19.768 7.476   1.00 61.25  ? 207 HOH A O   1 
HETATM 3050 O  O   . HOH O 4 .  ? -35.760 -2.713  20.465  1.00 51.02  ? 208 HOH A O   1 
HETATM 3051 O  O   . HOH O 4 .  ? 0.396   -5.741  12.329  1.00 27.15  ? 209 HOH A O   1 
HETATM 3052 O  O   . HOH O 4 .  ? -11.989 -9.015  33.383  1.00 28.52  ? 210 HOH A O   1 
HETATM 3053 O  O   . HOH O 4 .  ? -16.661 -4.772  6.831   1.00 31.33  ? 211 HOH A O   1 
HETATM 3054 O  O   . HOH O 4 .  ? -8.262  -5.676  11.279  1.00 28.02  ? 212 HOH A O   1 
HETATM 3055 O  O   . HOH O 4 .  ? -8.865  -6.441  4.948   1.00 29.00  ? 213 HOH A O   1 
HETATM 3056 O  O   . HOH O 4 .  ? 0.885   -6.149  19.232  1.00 41.59  ? 214 HOH A O   1 
HETATM 3057 O  O   . HOH O 4 .  ? -4.170  -14.514 29.072  1.00 34.95  ? 215 HOH A O   1 
HETATM 3058 O  O   . HOH O 4 .  ? -10.130 -13.367 29.007  1.00 50.36  ? 216 HOH A O   1 
HETATM 3059 O  O   . HOH O 4 .  ? -3.399  -5.118  -0.779  1.00 32.52  ? 217 HOH A O   1 
HETATM 3060 O  O   . HOH O 4 .  ? 4.353   -10.647 18.260  1.00 44.88  ? 218 HOH A O   1 
HETATM 3061 O  O   . HOH O 4 .  ? -8.203  -17.322 30.706  1.00 53.67  ? 219 HOH A O   1 
HETATM 3062 O  O   . HOH O 4 .  ? 2.197   -14.232 15.857  1.00 41.00  ? 220 HOH A O   1 
HETATM 3063 O  O   . HOH O 4 .  ? -6.460  -21.956 24.918  1.00 49.87  ? 221 HOH A O   1 
HETATM 3064 O  O   . HOH O 4 .  ? -26.025 -13.521 12.914  1.00 52.06  ? 222 HOH A O   1 
HETATM 3065 O  O   . HOH O 4 .  ? -27.636 -6.164  20.334  1.00 47.90  ? 223 HOH A O   1 
HETATM 3066 O  O   . HOH O 4 .  ? -17.831 -0.096  11.146  1.00 46.32  ? 224 HOH A O   1 
HETATM 3067 O  O   . HOH P 4 .  ? -27.601 10.319  33.992  1.00 37.99  ? 201 HOH B O   1 
HETATM 3068 O  O   . HOH P 4 .  ? -18.094 25.973  38.258  1.00 71.36  ? 202 HOH B O   1 
HETATM 3069 O  O   . HOH P 4 .  ? -30.945 13.729  24.197  1.00 40.74  ? 203 HOH B O   1 
HETATM 3070 O  O   . HOH P 4 .  ? -19.809 12.791  37.961  1.00 42.00  ? 204 HOH B O   1 
HETATM 3071 O  O   . HOH P 4 .  ? -29.216 16.083  24.052  1.00 30.97  ? 205 HOH B O   1 
HETATM 3072 O  O   . HOH P 4 .  ? -31.804 3.624   14.823  1.00 56.85  ? 206 HOH B O   1 
HETATM 3073 O  O   . HOH P 4 .  ? -30.229 10.646  32.892  1.00 35.28  ? 207 HOH B O   1 
HETATM 3074 O  O   . HOH P 4 .  ? -14.745 24.268  32.261  1.00 49.95  ? 208 HOH B O   1 
HETATM 3075 O  O   . HOH P 4 .  ? -27.879 16.535  28.760  1.00 37.59  ? 209 HOH B O   1 
HETATM 3076 O  O   . HOH P 4 .  ? -16.443 7.604   42.996  1.00 46.71  ? 210 HOH B O   1 
HETATM 3077 O  O   . HOH P 4 .  ? -38.774 9.382   29.133  1.00 48.51  ? 211 HOH B O   1 
HETATM 3078 O  O   . HOH P 4 .  ? -9.475  5.354   37.705  1.00 48.13  ? 212 HOH B O   1 
HETATM 3079 O  O   . HOH P 4 .  ? -9.680  4.998   34.075  1.00 50.22  ? 213 HOH B O   1 
HETATM 3080 O  O   . HOH P 4 .  ? -11.355 -17.851 29.928  1.00 63.56  ? 214 HOH B O   1 
HETATM 3081 O  O   . HOH P 4 .  ? -21.637 14.535  44.789  1.00 50.26  ? 215 HOH B O   1 
HETATM 3082 O  O   . HOH P 4 .  ? -28.931 11.139  23.790  1.00 35.61  ? 216 HOH B O   1 
HETATM 3083 O  O   . HOH P 4 .  ? -23.764 11.509  16.693  1.00 37.29  ? 217 HOH B O   1 
HETATM 3084 O  O   . HOH P 4 .  ? -25.653 5.021   18.076  1.00 34.10  ? 218 HOH B O   1 
HETATM 3085 O  O   . HOH P 4 .  ? -15.909 9.314   39.665  1.00 42.45  ? 219 HOH B O   1 
HETATM 3086 O  O   . HOH P 4 .  ? -15.743 9.393   19.347  1.00 35.82  ? 220 HOH B O   1 
HETATM 3087 O  O   . HOH P 4 .  ? -15.616 -10.094 32.186  1.00 39.89  ? 221 HOH B O   1 
HETATM 3088 O  O   . HOH P 4 .  ? -14.459 -12.287 33.245  1.00 41.77  ? 222 HOH B O   1 
HETATM 3089 O  O   . HOH P 4 .  ? -31.014 8.588   19.561  1.00 32.62  ? 223 HOH B O   1 
HETATM 3090 O  O   . HOH P 4 .  ? -29.040 -2.193  29.005  1.00 47.77  ? 224 HOH B O   1 
HETATM 3091 O  O   . HOH P 4 .  ? -15.023 10.402  35.644  1.00 42.48  ? 225 HOH B O   1 
HETATM 3092 O  O   . HOH P 4 .  ? -22.681 -10.221 28.084  1.00 45.07  ? 226 HOH B O   1 
HETATM 3093 O  O   . HOH P 4 .  ? -18.972 20.011  25.463  1.00 51.83  ? 227 HOH B O   1 
HETATM 3094 O  O   . HOH P 4 .  ? -20.947 -16.785 23.973  1.00 52.01  ? 228 HOH B O   1 
HETATM 3095 O  O   . HOH P 4 .  ? 3.842   -5.010  26.104  1.00 52.76  ? 229 HOH B O   1 
HETATM 3096 O  O   . HOH Q 4 .  ? -13.242 21.261  0.164   1.00 31.34  ? 201 HOH C O   1 
HETATM 3097 O  O   . HOH Q 4 .  ? 1.228   4.248   10.406  1.00 22.76  ? 202 HOH C O   1 
HETATM 3098 O  O   . HOH Q 4 .  ? -2.102  14.564  18.319  1.00 38.68  ? 203 HOH C O   1 
HETATM 3099 O  O   . HOH Q 4 .  ? 16.986  16.886  2.930   1.00 47.80  ? 204 HOH C O   1 
HETATM 3100 O  O   . HOH Q 4 .  ? 0.552   4.778   3.232   1.00 25.94  ? 205 HOH C O   1 
HETATM 3101 O  O   . HOH Q 4 .  ? 6.739   7.857   2.593   1.00 43.45  ? 206 HOH C O   1 
HETATM 3102 O  O   . HOH Q 4 .  ? -0.926  -0.751  6.299   1.00 32.72  ? 207 HOH C O   1 
HETATM 3103 O  O   . HOH Q 4 .  ? -9.999  24.337  -1.415  1.00 38.23  ? 208 HOH C O   1 
HETATM 3104 O  O   . HOH Q 4 .  ? -0.683  1.888   4.297   1.00 32.52  ? 209 HOH C O   1 
HETATM 3105 O  O   . HOH Q 4 .  ? -15.872 20.604  3.014   1.00 37.44  ? 210 HOH C O   1 
HETATM 3106 O  O   . HOH Q 4 .  ? 0.855   24.582  1.407   1.00 54.70  ? 211 HOH C O   1 
HETATM 3107 O  O   . HOH Q 4 .  ? -0.944  18.754  2.858   1.00 41.96  ? 212 HOH C O   1 
HETATM 3108 O  O   . HOH Q 4 .  ? 2.052   -0.163  11.786  1.00 41.18  ? 213 HOH C O   1 
HETATM 3109 O  O   . HOH Q 4 .  ? -10.131 9.377   -10.475 1.00 33.04  ? 214 HOH C O   1 
HETATM 3110 O  O   . HOH Q 4 .  ? 0.354   0.396   10.309  1.00 39.97  ? 215 HOH C O   1 
HETATM 3111 O  O   . HOH Q 4 .  ? 10.892  17.648  3.682   1.00 35.56  ? 216 HOH C O   1 
HETATM 3112 O  O   . HOH Q 4 .  ? -3.413  19.928  -2.167  1.00 38.56  ? 217 HOH C O   1 
HETATM 3113 O  O   . HOH Q 4 .  ? 6.032   8.008   -6.414  1.00 41.36  ? 218 HOH C O   1 
HETATM 3114 O  O   . HOH Q 4 .  ? 4.600   12.781  6.335   1.00 29.95  ? 219 HOH C O   1 
HETATM 3115 O  O   . HOH Q 4 .  ? -7.765  13.298  -6.599  1.00 42.83  ? 220 HOH C O   1 
HETATM 3116 O  O   . HOH Q 4 .  ? -14.114 16.882  0.669   1.00 29.64  ? 221 HOH C O   1 
HETATM 3117 O  O   . HOH Q 4 .  ? -1.789  1.804   12.160  1.00 24.98  ? 222 HOH C O   1 
HETATM 3118 O  O   . HOH Q 4 .  ? -7.149  5.529   11.589  1.00 25.54  ? 223 HOH C O   1 
HETATM 3119 O  O   . HOH Q 4 .  ? -3.214  7.915   18.797  1.00 39.48  ? 224 HOH C O   1 
HETATM 3120 O  O   . HOH Q 4 .  ? 2.589   11.076  -2.439  1.00 35.75  ? 225 HOH C O   1 
HETATM 3121 O  O   . HOH Q 4 .  ? 4.979   17.798  6.512   1.00 35.89  ? 226 HOH C O   1 
HETATM 3122 O  O   . HOH Q 4 .  ? -7.362  6.295   17.865  1.00 30.84  ? 227 HOH C O   1 
HETATM 3123 O  O   . HOH Q 4 .  ? -19.591 5.851   11.821  1.00 42.46  ? 228 HOH C O   1 
HETATM 3124 O  O   . HOH Q 4 .  ? -12.881 22.270  16.896  1.00 61.35  ? 229 HOH C O   1 
HETATM 3125 O  O   . HOH Q 4 .  ? -1.220  12.669  -7.003  1.00 45.08  ? 230 HOH C O   1 
HETATM 3126 O  O   . HOH Q 4 .  ? -1.362  21.927  18.869  1.00 39.83  ? 231 HOH C O   1 
HETATM 3127 O  O   . HOH Q 4 .  ? 4.276   18.340  11.063  1.00 33.59  ? 232 HOH C O   1 
HETATM 3128 O  O   . HOH Q 4 .  ? 3.975   20.533  12.608  1.00 40.09  ? 233 HOH C O   1 
HETATM 3129 O  O   . HOH Q 4 .  ? -19.469 5.411   -9.015  1.00 38.99  ? 234 HOH C O   1 
HETATM 3130 O  O   . HOH Q 4 .  ? -14.525 -0.606  13.181  1.00 37.67  ? 235 HOH C O   1 
HETATM 3131 O  O   . HOH Q 4 .  ? 3.214   8.569   -7.008  1.00 42.17  ? 236 HOH C O   1 
HETATM 3132 O  O   . HOH Q 4 .  ? -11.840 22.351  10.627  1.00 60.12  ? 237 HOH C O   1 
HETATM 3133 O  O   . HOH Q 4 .  ? -32.697 0.939   5.846   1.00 52.26  ? 238 HOH C O   1 
HETATM 3134 O  O   . HOH R 4 .  ? -5.936  -5.039  -0.639  1.00 31.63  ? 201 HOH D O   1 
HETATM 3135 O  O   . HOH R 4 .  ? -15.677 0.432   -11.300 1.00 30.79  ? 202 HOH D O   1 
HETATM 3136 O  O   . HOH R 4 .  ? -32.189 -3.289  -13.156 1.00 41.56  ? 203 HOH D O   1 
HETATM 3137 O  O   . HOH R 4 .  ? 0.693   2.373   1.240   1.00 39.09  ? 204 HOH D O   1 
HETATM 3138 O  O   . HOH R 4 .  ? -26.174 -8.475  -15.354 1.00 49.00  ? 205 HOH D O   1 
HETATM 3139 O  O   . HOH R 4 .  ? -15.802 -19.492 -2.965  1.00 46.56  ? 206 HOH D O   1 
HETATM 3140 O  O   . HOH R 4 .  ? -19.725 -21.325 -2.501  1.00 56.20  ? 207 HOH D O   1 
HETATM 3141 O  O   . HOH R 4 .  ? -30.563 -6.701  -9.708  1.00 52.92  ? 208 HOH D O   1 
HETATM 3142 O  O   . HOH R 4 .  ? -27.439 9.376   0.039   1.00 49.15  ? 209 HOH D O   1 
HETATM 3143 O  O   . HOH R 4 .  ? -15.138 19.401  -7.921  1.00 46.30  ? 210 HOH D O   1 
HETATM 3144 O  O   . HOH R 4 .  ? -39.074 -7.445  -4.067  1.00 52.45  ? 211 HOH D O   1 
HETATM 3145 O  O   . HOH R 4 .  ? -18.432 -17.685 -17.010 1.00 52.02  ? 212 HOH D O   1 
HETATM 3146 O  O   . HOH R 4 .  ? -9.338  -7.748  -16.491 1.00 35.07  ? 213 HOH D O   1 
HETATM 3147 O  O   . HOH R 4 .  ? -29.335 -13.239 -1.815  1.00 37.17  ? 214 HOH D O   1 
HETATM 3148 O  O   . HOH R 4 .  ? -20.916 12.598  -5.406  1.00 34.06  ? 215 HOH D O   1 
HETATM 3149 O  O   . HOH R 4 .  ? -31.235 -7.576  -0.808  1.00 33.65  ? 216 HOH D O   1 
HETATM 3150 O  O   . HOH R 4 .  ? -26.161 -8.308  6.419   1.00 45.85  ? 217 HOH D O   1 
HETATM 3151 O  O   . HOH R 4 .  ? -17.070 -7.749  4.210   1.00 36.95  ? 218 HOH D O   1 
HETATM 3152 O  O   . HOH R 4 .  ? -26.416 -1.802  4.766   1.00 33.54  ? 219 HOH D O   1 
HETATM 3153 O  O   . HOH R 4 .  ? -6.586  -5.464  3.743   1.00 34.45  ? 220 HOH D O   1 
HETATM 3154 O  O   . HOH R 4 .  ? -22.924 11.044  -5.999  1.00 36.94  ? 221 HOH D O   1 
HETATM 3155 O  O   . HOH R 4 .  ? -28.434 6.009   -6.038  1.00 45.14  ? 222 HOH D O   1 
HETATM 3156 O  O   . HOH R 4 .  ? -14.442 11.401  -9.146  1.00 35.18  ? 223 HOH D O   1 
HETATM 3157 O  O   . HOH R 4 .  ? -32.781 -9.249  -0.971  1.00 38.07  ? 224 HOH D O   1 
HETATM 3158 O  O   . HOH R 4 .  ? -28.880 8.215   -4.029  1.00 44.85  ? 225 HOH D O   1 
HETATM 3159 O  O   . HOH R 4 .  ? -28.516 0.201   -12.261 1.00 57.53  ? 226 HOH D O   1 
HETATM 3160 O  O   . HOH R 4 .  ? -17.721 -22.547 0.289   1.00 37.91  ? 227 HOH D O   1 
HETATM 3161 O  O   . HOH R 4 .  ? -27.000 5.852   -9.374  1.00 53.72  ? 228 HOH D O   1 
HETATM 3162 O  O   . HOH R 4 .  ? -22.134 -16.564 1.737   1.00 49.34  ? 229 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -2 ?  ?   ?   A . n 
A 1 2  SER 2  -1 ?  ?   ?   A . n 
A 1 3  MET 3  0  ?  ?   ?   A . n 
A 1 4  SER 4  1  1  SER SER A . n 
A 1 5  THR 5  2  2  THR THR A . n 
A 1 6  LEU 6  3  3  LEU LEU A . n 
A 1 7  LEU 7  4  4  LEU LEU A . n 
A 1 8  GLU 8  5  5  GLU GLU A . n 
A 1 9  ASN 9  6  6  ASN ASN A . n 
A 1 10 ILE 10 7  7  ILE ILE A . n 
A 1 11 PHE 11 8  8  PHE PHE A . n 
A 1 12 ALA 12 9  9  ALA ALA A . n 
A 1 13 ILE 13 10 10 ILE ILE A . n 
A 1 14 ILE 14 11 11 ILE ILE A . n 
A 1 15 ASN 15 12 12 ASN ASN A . n 
A 1 16 LEU 16 13 13 LEU LEU A . n 
A 1 17 PHE 17 14 14 PHE PHE A . n 
A 1 18 LYS 18 15 15 LYS LYS A . n 
A 1 19 GLN 19 16 16 GLN GLN A . n 
A 1 20 TYR 20 17 17 TYR TYR A . n 
A 1 21 SER 21 18 18 SER SER A . n 
A 1 22 LYS 22 19 19 LYS LYS A . n 
A 1 23 LYS 23 20 20 LYS LYS A . n 
A 1 24 ASP 24 21 21 ASP ASP A . n 
A 1 25 LYS 25 22 22 LYS LYS A . n 
A 1 26 ASN 26 23 23 ASN ASN A . n 
A 1 27 THR 27 24 24 THR THR A . n 
A 1 28 ASP 28 25 25 ASP ASP A . n 
A 1 29 THR 29 26 26 THR THR A . n 
A 1 30 LEU 30 27 27 LEU LEU A . n 
A 1 31 SER 31 28 28 SER SER A . n 
A 1 32 LYS 32 29 29 LYS LYS A . n 
A 1 33 LYS 33 30 30 LYS LYS A . n 
A 1 34 GLU 34 31 31 GLU GLU A . n 
A 1 35 LEU 35 32 32 LEU LEU A . n 
A 1 36 LYS 36 33 33 LYS LYS A . n 
A 1 37 GLU 37 34 34 GLU GLU A . n 
A 1 38 LEU 38 35 35 LEU LEU A . n 
A 1 39 LEU 39 36 36 LEU LEU A . n 
A 1 40 GLU 40 37 37 GLU GLU A . n 
A 1 41 LYS 41 38 38 LYS LYS A . n 
A 1 42 GLU 42 39 39 GLU GLU A . n 
A 1 43 PHE 43 40 40 PHE PHE A . n 
A 1 44 ARG 44 41 41 ARG ARG A . n 
A 1 45 GLN 45 42 42 GLN GLN A . n 
A 1 46 ILE 46 43 43 ILE ILE A . n 
A 1 47 LEU 47 44 44 LEU LEU A . n 
A 1 48 LYS 48 45 45 LYS LYS A . n 
A 1 49 ASN 49 46 46 ASN ASN A . n 
A 1 50 PRO 50 47 47 PRO PRO A . n 
A 1 51 ASP 51 48 48 ASP ASP A . n 
A 1 52 ASP 52 49 49 ASP ASP A . n 
A 1 53 PRO 53 50 50 PRO PRO A . n 
A 1 54 ASP 54 51 51 ASP ASP A . n 
A 1 55 MET 55 52 52 MET MET A . n 
A 1 56 VAL 56 53 53 VAL VAL A . n 
A 1 57 ASP 57 54 54 ASP ASP A . n 
A 1 58 VAL 58 55 55 VAL VAL A . n 
A 1 59 PHE 59 56 56 PHE PHE A . n 
A 1 60 MET 60 57 57 MET MET A . n 
A 1 61 ASP 61 58 58 ASP ASP A . n 
A 1 62 HIS 62 59 59 HIS HIS A . n 
A 1 63 LEU 63 60 60 LEU LEU A . n 
A 1 64 ASP 64 61 61 ASP ASP A . n 
A 1 65 ILE 65 62 62 ILE ILE A . n 
A 1 66 ASP 66 63 63 ASP ASP A . n 
A 1 67 HIS 67 64 64 HIS HIS A . n 
A 1 68 ASN 68 65 65 ASN ASN A . n 
A 1 69 LYS 69 66 66 LYS LYS A . n 
A 1 70 LYS 70 67 67 LYS LYS A . n 
A 1 71 ILE 71 68 68 ILE ILE A . n 
A 1 72 ASP 72 69 69 ASP ASP A . n 
A 1 73 PHE 73 70 70 PHE PHE A . n 
A 1 74 THR 74 71 71 THR THR A . n 
A 1 75 GLU 75 72 72 GLU GLU A . n 
A 1 76 PHE 76 73 73 PHE PHE A . n 
A 1 77 LEU 77 74 74 LEU LEU A . n 
A 1 78 LEU 78 75 75 LEU LEU A . n 
A 1 79 MET 79 76 76 MET MET A . n 
A 1 80 VAL 80 77 77 VAL VAL A . n 
A 1 81 PHE 81 78 78 PHE PHE A . n 
A 1 82 LYS 82 79 79 LYS LYS A . n 
A 1 83 LEU 83 80 80 LEU LEU A . n 
A 1 84 ALA 84 81 81 ALA ALA A . n 
A 1 85 GLN 85 82 82 GLN GLN A . n 
A 1 86 ALA 86 83 83 ALA ALA A . n 
A 1 87 TYR 87 84 84 TYR TYR A . n 
A 1 88 TYR 88 85 85 TYR TYR A . n 
A 1 89 GLU 89 86 86 GLU GLU A . n 
A 1 90 SER 90 87 87 SER SER A . n 
A 1 91 THR 91 88 ?  ?   ?   A . n 
A 1 92 ARG 92 89 ?  ?   ?   A . n 
A 1 93 LYS 93 90 ?  ?   ?   A . n 
A 1 94 GLU 94 91 ?  ?   ?   A . n 
B 1 1  GLY 1  -2 ?  ?   ?   B . n 
B 1 2  SER 2  -1 ?  ?   ?   B . n 
B 1 3  MET 3  0  ?  ?   ?   B . n 
B 1 4  SER 4  1  1  SER SER B . n 
B 1 5  THR 5  2  2  THR THR B . n 
B 1 6  LEU 6  3  3  LEU LEU B . n 
B 1 7  LEU 7  4  4  LEU LEU B . n 
B 1 8  GLU 8  5  5  GLU GLU B . n 
B 1 9  ASN 9  6  6  ASN ASN B . n 
B 1 10 ILE 10 7  7  ILE ILE B . n 
B 1 11 PHE 11 8  8  PHE PHE B . n 
B 1 12 ALA 12 9  9  ALA ALA B . n 
B 1 13 ILE 13 10 10 ILE ILE B . n 
B 1 14 ILE 14 11 11 ILE ILE B . n 
B 1 15 ASN 15 12 12 ASN ASN B . n 
B 1 16 LEU 16 13 13 LEU LEU B . n 
B 1 17 PHE 17 14 14 PHE PHE B . n 
B 1 18 LYS 18 15 15 LYS LYS B . n 
B 1 19 GLN 19 16 16 GLN GLN B . n 
B 1 20 TYR 20 17 17 TYR TYR B . n 
B 1 21 SER 21 18 18 SER SER B . n 
B 1 22 LYS 22 19 19 LYS LYS B . n 
B 1 23 LYS 23 20 20 LYS LYS B . n 
B 1 24 ASP 24 21 21 ASP ASP B . n 
B 1 25 LYS 25 22 22 LYS LYS B . n 
B 1 26 ASN 26 23 23 ASN ASN B . n 
B 1 27 THR 27 24 24 THR THR B . n 
B 1 28 ASP 28 25 25 ASP ASP B . n 
B 1 29 THR 29 26 26 THR THR B . n 
B 1 30 LEU 30 27 27 LEU LEU B . n 
B 1 31 SER 31 28 28 SER SER B . n 
B 1 32 LYS 32 29 29 LYS LYS B . n 
B 1 33 LYS 33 30 30 LYS LYS B . n 
B 1 34 GLU 34 31 31 GLU GLU B . n 
B 1 35 LEU 35 32 32 LEU LEU B . n 
B 1 36 LYS 36 33 33 LYS LYS B . n 
B 1 37 GLU 37 34 34 GLU GLU B . n 
B 1 38 LEU 38 35 35 LEU LEU B . n 
B 1 39 LEU 39 36 36 LEU LEU B . n 
B 1 40 GLU 40 37 37 GLU GLU B . n 
B 1 41 LYS 41 38 38 LYS LYS B . n 
B 1 42 GLU 42 39 39 GLU GLU B . n 
B 1 43 PHE 43 40 40 PHE PHE B . n 
B 1 44 ARG 44 41 41 ARG ARG B . n 
B 1 45 GLN 45 42 42 GLN GLN B . n 
B 1 46 ILE 46 43 43 ILE ILE B . n 
B 1 47 LEU 47 44 44 LEU LEU B . n 
B 1 48 LYS 48 45 45 LYS LYS B . n 
B 1 49 ASN 49 46 46 ASN ASN B . n 
B 1 50 PRO 50 47 47 PRO PRO B . n 
B 1 51 ASP 51 48 48 ASP ASP B . n 
B 1 52 ASP 52 49 49 ASP ASP B . n 
B 1 53 PRO 53 50 50 PRO PRO B . n 
B 1 54 ASP 54 51 51 ASP ASP B . n 
B 1 55 MET 55 52 52 MET MET B . n 
B 1 56 VAL 56 53 53 VAL VAL B . n 
B 1 57 ASP 57 54 54 ASP ASP B . n 
B 1 58 VAL 58 55 55 VAL VAL B . n 
B 1 59 PHE 59 56 56 PHE PHE B . n 
B 1 60 MET 60 57 57 MET MET B . n 
B 1 61 ASP 61 58 58 ASP ASP B . n 
B 1 62 HIS 62 59 59 HIS HIS B . n 
B 1 63 LEU 63 60 60 LEU LEU B . n 
B 1 64 ASP 64 61 61 ASP ASP B . n 
B 1 65 ILE 65 62 62 ILE ILE B . n 
B 1 66 ASP 66 63 63 ASP ASP B . n 
B 1 67 HIS 67 64 64 HIS HIS B . n 
B 1 68 ASN 68 65 65 ASN ASN B . n 
B 1 69 LYS 69 66 66 LYS LYS B . n 
B 1 70 LYS 70 67 67 LYS LYS B . n 
B 1 71 ILE 71 68 68 ILE ILE B . n 
B 1 72 ASP 72 69 69 ASP ASP B . n 
B 1 73 PHE 73 70 70 PHE PHE B . n 
B 1 74 THR 74 71 71 THR THR B . n 
B 1 75 GLU 75 72 72 GLU GLU B . n 
B 1 76 PHE 76 73 73 PHE PHE B . n 
B 1 77 LEU 77 74 74 LEU LEU B . n 
B 1 78 LEU 78 75 75 LEU LEU B . n 
B 1 79 MET 79 76 76 MET MET B . n 
B 1 80 VAL 80 77 77 VAL VAL B . n 
B 1 81 PHE 81 78 78 PHE PHE B . n 
B 1 82 LYS 82 79 79 LYS LYS B . n 
B 1 83 LEU 83 80 80 LEU LEU B . n 
B 1 84 ALA 84 81 81 ALA ALA B . n 
B 1 85 GLN 85 82 82 GLN GLN B . n 
B 1 86 ALA 86 83 83 ALA ALA B . n 
B 1 87 TYR 87 84 84 TYR TYR B . n 
B 1 88 TYR 88 85 85 TYR TYR B . n 
B 1 89 GLU 89 86 86 GLU GLU B . n 
B 1 90 SER 90 87 87 SER SER B . n 
B 1 91 THR 91 88 88 THR THR B . n 
B 1 92 ARG 92 89 ?  ?   ?   B . n 
B 1 93 LYS 93 90 ?  ?   ?   B . n 
B 1 94 GLU 94 91 ?  ?   ?   B . n 
C 1 1  GLY 1  -2 ?  ?   ?   C . n 
C 1 2  SER 2  -1 ?  ?   ?   C . n 
C 1 3  MET 3  0  ?  ?   ?   C . n 
C 1 4  SER 4  1  1  SER SER C . n 
C 1 5  THR 5  2  2  THR THR C . n 
C 1 6  LEU 6  3  3  LEU LEU C . n 
C 1 7  LEU 7  4  4  LEU LEU C . n 
C 1 8  GLU 8  5  5  GLU GLU C . n 
C 1 9  ASN 9  6  6  ASN ASN C . n 
C 1 10 ILE 10 7  7  ILE ILE C . n 
C 1 11 PHE 11 8  8  PHE PHE C . n 
C 1 12 ALA 12 9  9  ALA ALA C . n 
C 1 13 ILE 13 10 10 ILE ILE C . n 
C 1 14 ILE 14 11 11 ILE ILE C . n 
C 1 15 ASN 15 12 12 ASN ASN C . n 
C 1 16 LEU 16 13 13 LEU LEU C . n 
C 1 17 PHE 17 14 14 PHE PHE C . n 
C 1 18 LYS 18 15 15 LYS LYS C . n 
C 1 19 GLN 19 16 16 GLN GLN C . n 
C 1 20 TYR 20 17 17 TYR TYR C . n 
C 1 21 SER 21 18 18 SER SER C . n 
C 1 22 LYS 22 19 19 LYS LYS C . n 
C 1 23 LYS 23 20 20 LYS LYS C . n 
C 1 24 ASP 24 21 21 ASP ASP C . n 
C 1 25 LYS 25 22 22 LYS LYS C . n 
C 1 26 ASN 26 23 23 ASN ASN C . n 
C 1 27 THR 27 24 24 THR THR C . n 
C 1 28 ASP 28 25 25 ASP ASP C . n 
C 1 29 THR 29 26 26 THR THR C . n 
C 1 30 LEU 30 27 27 LEU LEU C . n 
C 1 31 SER 31 28 28 SER SER C . n 
C 1 32 LYS 32 29 29 LYS LYS C . n 
C 1 33 LYS 33 30 30 LYS LYS C . n 
C 1 34 GLU 34 31 31 GLU GLU C . n 
C 1 35 LEU 35 32 32 LEU LEU C . n 
C 1 36 LYS 36 33 33 LYS LYS C . n 
C 1 37 GLU 37 34 34 GLU GLU C . n 
C 1 38 LEU 38 35 35 LEU LEU C . n 
C 1 39 LEU 39 36 36 LEU LEU C . n 
C 1 40 GLU 40 37 37 GLU GLU C . n 
C 1 41 LYS 41 38 38 LYS LYS C . n 
C 1 42 GLU 42 39 39 GLU GLU C . n 
C 1 43 PHE 43 40 40 PHE PHE C . n 
C 1 44 ARG 44 41 41 ARG ARG C . n 
C 1 45 GLN 45 42 42 GLN GLN C . n 
C 1 46 ILE 46 43 43 ILE ILE C . n 
C 1 47 LEU 47 44 44 LEU LEU C . n 
C 1 48 LYS 48 45 45 LYS LYS C . n 
C 1 49 ASN 49 46 46 ASN ASN C . n 
C 1 50 PRO 50 47 47 PRO PRO C . n 
C 1 51 ASP 51 48 48 ASP ASP C . n 
C 1 52 ASP 52 49 49 ASP ASP C . n 
C 1 53 PRO 53 50 50 PRO PRO C . n 
C 1 54 ASP 54 51 51 ASP ASP C . n 
C 1 55 MET 55 52 52 MET MET C . n 
C 1 56 VAL 56 53 53 VAL VAL C . n 
C 1 57 ASP 57 54 54 ASP ASP C . n 
C 1 58 VAL 58 55 55 VAL VAL C . n 
C 1 59 PHE 59 56 56 PHE PHE C . n 
C 1 60 MET 60 57 57 MET MET C . n 
C 1 61 ASP 61 58 58 ASP ASP C . n 
C 1 62 HIS 62 59 59 HIS HIS C . n 
C 1 63 LEU 63 60 60 LEU LEU C . n 
C 1 64 ASP 64 61 61 ASP ASP C . n 
C 1 65 ILE 65 62 62 ILE ILE C . n 
C 1 66 ASP 66 63 63 ASP ASP C . n 
C 1 67 HIS 67 64 64 HIS HIS C . n 
C 1 68 ASN 68 65 65 ASN ASN C . n 
C 1 69 LYS 69 66 66 LYS LYS C . n 
C 1 70 LYS 70 67 67 LYS LYS C . n 
C 1 71 ILE 71 68 68 ILE ILE C . n 
C 1 72 ASP 72 69 69 ASP ASP C . n 
C 1 73 PHE 73 70 70 PHE PHE C . n 
C 1 74 THR 74 71 71 THR THR C . n 
C 1 75 GLU 75 72 72 GLU GLU C . n 
C 1 76 PHE 76 73 73 PHE PHE C . n 
C 1 77 LEU 77 74 74 LEU LEU C . n 
C 1 78 LEU 78 75 75 LEU LEU C . n 
C 1 79 MET 79 76 76 MET MET C . n 
C 1 80 VAL 80 77 77 VAL VAL C . n 
C 1 81 PHE 81 78 78 PHE PHE C . n 
C 1 82 LYS 82 79 79 LYS LYS C . n 
C 1 83 LEU 83 80 80 LEU LEU C . n 
C 1 84 ALA 84 81 81 ALA ALA C . n 
C 1 85 GLN 85 82 82 GLN GLN C . n 
C 1 86 ALA 86 83 83 ALA ALA C . n 
C 1 87 TYR 87 84 84 TYR TYR C . n 
C 1 88 TYR 88 85 85 TYR TYR C . n 
C 1 89 GLU 89 86 86 GLU GLU C . n 
C 1 90 SER 90 87 87 SER SER C . n 
C 1 91 THR 91 88 88 THR THR C . n 
C 1 92 ARG 92 89 89 ARG ARG C . n 
C 1 93 LYS 93 90 90 LYS LYS C . n 
C 1 94 GLU 94 91 91 GLU GLU C . n 
D 1 1  GLY 1  -2 ?  ?   ?   D . n 
D 1 2  SER 2  -1 ?  ?   ?   D . n 
D 1 3  MET 3  0  ?  ?   ?   D . n 
D 1 4  SER 4  1  1  SER SER D . n 
D 1 5  THR 5  2  2  THR THR D . n 
D 1 6  LEU 6  3  3  LEU LEU D . n 
D 1 7  LEU 7  4  4  LEU LEU D . n 
D 1 8  GLU 8  5  5  GLU GLU D . n 
D 1 9  ASN 9  6  6  ASN ASN D . n 
D 1 10 ILE 10 7  7  ILE ILE D . n 
D 1 11 PHE 11 8  8  PHE PHE D . n 
D 1 12 ALA 12 9  9  ALA ALA D . n 
D 1 13 ILE 13 10 10 ILE ILE D . n 
D 1 14 ILE 14 11 11 ILE ILE D . n 
D 1 15 ASN 15 12 12 ASN ASN D . n 
D 1 16 LEU 16 13 13 LEU LEU D . n 
D 1 17 PHE 17 14 14 PHE PHE D . n 
D 1 18 LYS 18 15 15 LYS LYS D . n 
D 1 19 GLN 19 16 16 GLN GLN D . n 
D 1 20 TYR 20 17 17 TYR TYR D . n 
D 1 21 SER 21 18 18 SER SER D . n 
D 1 22 LYS 22 19 19 LYS LYS D . n 
D 1 23 LYS 23 20 20 LYS LYS D . n 
D 1 24 ASP 24 21 21 ASP ASP D . n 
D 1 25 LYS 25 22 22 LYS LYS D . n 
D 1 26 ASN 26 23 23 ASN ASN D . n 
D 1 27 THR 27 24 24 THR THR D . n 
D 1 28 ASP 28 25 25 ASP ASP D . n 
D 1 29 THR 29 26 26 THR THR D . n 
D 1 30 LEU 30 27 27 LEU LEU D . n 
D 1 31 SER 31 28 28 SER SER D . n 
D 1 32 LYS 32 29 29 LYS LYS D . n 
D 1 33 LYS 33 30 30 LYS LYS D . n 
D 1 34 GLU 34 31 31 GLU GLU D . n 
D 1 35 LEU 35 32 32 LEU LEU D . n 
D 1 36 LYS 36 33 33 LYS LYS D . n 
D 1 37 GLU 37 34 34 GLU GLU D . n 
D 1 38 LEU 38 35 35 LEU LEU D . n 
D 1 39 LEU 39 36 36 LEU LEU D . n 
D 1 40 GLU 40 37 37 GLU GLU D . n 
D 1 41 LYS 41 38 38 LYS LYS D . n 
D 1 42 GLU 42 39 39 GLU GLU D . n 
D 1 43 PHE 43 40 40 PHE PHE D . n 
D 1 44 ARG 44 41 41 ARG ARG D . n 
D 1 45 GLN 45 42 42 GLN GLN D . n 
D 1 46 ILE 46 43 43 ILE ILE D . n 
D 1 47 LEU 47 44 44 LEU LEU D . n 
D 1 48 LYS 48 45 45 LYS LYS D . n 
D 1 49 ASN 49 46 46 ASN ASN D . n 
D 1 50 PRO 50 47 47 PRO PRO D . n 
D 1 51 ASP 51 48 48 ASP ASP D . n 
D 1 52 ASP 52 49 49 ASP ASP D . n 
D 1 53 PRO 53 50 50 PRO PRO D . n 
D 1 54 ASP 54 51 51 ASP ASP D . n 
D 1 55 MET 55 52 52 MET MET D . n 
D 1 56 VAL 56 53 53 VAL VAL D . n 
D 1 57 ASP 57 54 54 ASP ASP D . n 
D 1 58 VAL 58 55 55 VAL VAL D . n 
D 1 59 PHE 59 56 56 PHE PHE D . n 
D 1 60 MET 60 57 57 MET MET D . n 
D 1 61 ASP 61 58 58 ASP ASP D . n 
D 1 62 HIS 62 59 59 HIS HIS D . n 
D 1 63 LEU 63 60 60 LEU LEU D . n 
D 1 64 ASP 64 61 61 ASP ASP D . n 
D 1 65 ILE 65 62 62 ILE ILE D . n 
D 1 66 ASP 66 63 63 ASP ASP D . n 
D 1 67 HIS 67 64 64 HIS HIS D . n 
D 1 68 ASN 68 65 65 ASN ASN D . n 
D 1 69 LYS 69 66 66 LYS LYS D . n 
D 1 70 LYS 70 67 67 LYS LYS D . n 
D 1 71 ILE 71 68 68 ILE ILE D . n 
D 1 72 ASP 72 69 69 ASP ASP D . n 
D 1 73 PHE 73 70 70 PHE PHE D . n 
D 1 74 THR 74 71 71 THR THR D . n 
D 1 75 GLU 75 72 72 GLU GLU D . n 
D 1 76 PHE 76 73 73 PHE PHE D . n 
D 1 77 LEU 77 74 74 LEU LEU D . n 
D 1 78 LEU 78 75 75 LEU LEU D . n 
D 1 79 MET 79 76 76 MET MET D . n 
D 1 80 VAL 80 77 77 VAL VAL D . n 
D 1 81 PHE 81 78 78 PHE PHE D . n 
D 1 82 LYS 82 79 79 LYS LYS D . n 
D 1 83 LEU 83 80 80 LEU LEU D . n 
D 1 84 ALA 84 81 81 ALA ALA D . n 
D 1 85 GLN 85 82 82 GLN GLN D . n 
D 1 86 ALA 86 83 83 ALA ALA D . n 
D 1 87 TYR 87 84 84 TYR TYR D . n 
D 1 88 TYR 88 85 85 TYR TYR D . n 
D 1 89 GLU 89 86 86 GLU GLU D . n 
D 1 90 SER 90 87 87 SER SER D . n 
D 1 91 THR 91 88 88 THR THR D . n 
D 1 92 ARG 92 89 ?  ?   ?   D . n 
D 1 93 LYS 93 90 ?  ?   ?   D . n 
D 1 94 GLU 94 91 ?  ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 CA  1  101 101 CA  CA  A . 
F 2 CA  1  102 102 CA  CA  A . 
G 3 2PE 1  103 103 2PE 2PE A . 
H 2 CA  1  101 101 CA  CA  B . 
I 2 CA  1  102 102 CA  CA  B . 
J 2 CA  1  101 101 CA  CA  C . 
K 2 CA  1  102 102 CA  CA  C . 
L 3 2PE 1  103 103 2PE 2PE C . 
M 2 CA  1  101 101 CA  CA  D . 
N 2 CA  1  102 102 CA  CA  D . 
O 4 HOH 1  201 201 HOH HOH A . 
O 4 HOH 2  202 202 HOH HOH A . 
O 4 HOH 3  203 203 HOH HOH A . 
O 4 HOH 4  204 204 HOH HOH A . 
O 4 HOH 5  205 205 HOH HOH A . 
O 4 HOH 6  206 207 HOH HOH A . 
O 4 HOH 7  207 208 HOH HOH A . 
O 4 HOH 8  208 209 HOH HOH A . 
O 4 HOH 9  209 210 HOH HOH A . 
O 4 HOH 10 210 211 HOH HOH A . 
O 4 HOH 11 211 212 HOH HOH A . 
O 4 HOH 12 212 213 HOH HOH A . 
O 4 HOH 13 213 214 HOH HOH A . 
O 4 HOH 14 214 215 HOH HOH A . 
O 4 HOH 15 215 216 HOH HOH A . 
O 4 HOH 16 216 217 HOH HOH A . 
O 4 HOH 17 217 218 HOH HOH A . 
O 4 HOH 18 218 219 HOH HOH A . 
O 4 HOH 19 219 220 HOH HOH A . 
O 4 HOH 20 220 221 HOH HOH A . 
O 4 HOH 21 221 222 HOH HOH A . 
O 4 HOH 22 222 223 HOH HOH A . 
O 4 HOH 23 223 224 HOH HOH A . 
O 4 HOH 24 224 235 HOH HOH A . 
P 4 HOH 1  201 201 HOH HOH B . 
P 4 HOH 2  202 206 HOH HOH B . 
P 4 HOH 3  203 202 HOH HOH B . 
P 4 HOH 4  204 203 HOH HOH B . 
P 4 HOH 5  205 204 HOH HOH B . 
P 4 HOH 6  206 227 HOH HOH B . 
P 4 HOH 7  207 205 HOH HOH B . 
P 4 HOH 8  208 206 HOH HOH B . 
P 4 HOH 9  209 206 HOH HOH B . 
P 4 HOH 10 210 207 HOH HOH B . 
P 4 HOH 11 211 208 HOH HOH B . 
P 4 HOH 12 212 209 HOH HOH B . 
P 4 HOH 13 213 210 HOH HOH B . 
P 4 HOH 14 214 211 HOH HOH B . 
P 4 HOH 15 215 212 HOH HOH B . 
P 4 HOH 16 216 213 HOH HOH B . 
P 4 HOH 17 217 214 HOH HOH B . 
P 4 HOH 18 218 215 HOH HOH B . 
P 4 HOH 19 219 216 HOH HOH B . 
P 4 HOH 20 220 217 HOH HOH B . 
P 4 HOH 21 221 218 HOH HOH B . 
P 4 HOH 22 222 219 HOH HOH B . 
P 4 HOH 23 223 220 HOH HOH B . 
P 4 HOH 24 224 221 HOH HOH B . 
P 4 HOH 25 225 222 HOH HOH B . 
P 4 HOH 26 226 223 HOH HOH B . 
P 4 HOH 27 227 224 HOH HOH B . 
P 4 HOH 28 228 225 HOH HOH B . 
P 4 HOH 29 229 226 HOH HOH B . 
Q 4 HOH 1  201 201 HOH HOH C . 
Q 4 HOH 2  202 202 HOH HOH C . 
Q 4 HOH 3  203 204 HOH HOH C . 
Q 4 HOH 4  204 205 HOH HOH C . 
Q 4 HOH 5  205 203 HOH HOH C . 
Q 4 HOH 6  206 208 HOH HOH C . 
Q 4 HOH 7  207 209 HOH HOH C . 
Q 4 HOH 8  208 206 HOH HOH C . 
Q 4 HOH 9  209 207 HOH HOH C . 
Q 4 HOH 10 210 210 HOH HOH C . 
Q 4 HOH 11 211 212 HOH HOH C . 
Q 4 HOH 12 212 211 HOH HOH C . 
Q 4 HOH 13 213 213 HOH HOH C . 
Q 4 HOH 14 214 214 HOH HOH C . 
Q 4 HOH 15 215 215 HOH HOH C . 
Q 4 HOH 16 216 216 HOH HOH C . 
Q 4 HOH 17 217 217 HOH HOH C . 
Q 4 HOH 18 218 218 HOH HOH C . 
Q 4 HOH 19 219 219 HOH HOH C . 
Q 4 HOH 20 220 220 HOH HOH C . 
Q 4 HOH 21 221 221 HOH HOH C . 
Q 4 HOH 22 222 222 HOH HOH C . 
Q 4 HOH 23 223 223 HOH HOH C . 
Q 4 HOH 24 224 224 HOH HOH C . 
Q 4 HOH 25 225 225 HOH HOH C . 
Q 4 HOH 26 226 226 HOH HOH C . 
Q 4 HOH 27 227 227 HOH HOH C . 
Q 4 HOH 28 228 228 HOH HOH C . 
Q 4 HOH 29 229 229 HOH HOH C . 
Q 4 HOH 30 230 230 HOH HOH C . 
Q 4 HOH 31 231 231 HOH HOH C . 
Q 4 HOH 32 232 232 HOH HOH C . 
Q 4 HOH 33 233 233 HOH HOH C . 
Q 4 HOH 34 234 234 HOH HOH C . 
Q 4 HOH 35 235 236 HOH HOH C . 
Q 4 HOH 36 236 237 HOH HOH C . 
Q 4 HOH 37 237 238 HOH HOH C . 
Q 4 HOH 38 238 239 HOH HOH C . 
R 4 HOH 1  201 201 HOH HOH D . 
R 4 HOH 2  202 203 HOH HOH D . 
R 4 HOH 3  203 204 HOH HOH D . 
R 4 HOH 4  204 202 HOH HOH D . 
R 4 HOH 5  205 205 HOH HOH D . 
R 4 HOH 6  206 207 HOH HOH D . 
R 4 HOH 7  207 209 HOH HOH D . 
R 4 HOH 8  208 208 HOH HOH D . 
R 4 HOH 9  209 211 HOH HOH D . 
R 4 HOH 10 210 213 HOH HOH D . 
R 4 HOH 11 211 212 HOH HOH D . 
R 4 HOH 12 212 214 HOH HOH D . 
R 4 HOH 13 213 215 HOH HOH D . 
R 4 HOH 14 214 210 HOH HOH D . 
R 4 HOH 15 215 216 HOH HOH D . 
R 4 HOH 16 216 217 HOH HOH D . 
R 4 HOH 17 217 218 HOH HOH D . 
R 4 HOH 18 218 219 HOH HOH D . 
R 4 HOH 19 219 220 HOH HOH D . 
R 4 HOH 20 220 221 HOH HOH D . 
R 4 HOH 21 221 222 HOH HOH D . 
R 4 HOH 22 222 223 HOH HOH D . 
R 4 HOH 23 223 224 HOH HOH D . 
R 4 HOH 24 224 225 HOH HOH D . 
R 4 HOH 25 225 226 HOH HOH D . 
R 4 HOH 26 226 227 HOH HOH D . 
R 4 HOH 27 227 228 HOH HOH D . 
R 4 HOH 28 228 229 HOH HOH D . 
R 4 HOH 29 229 230 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,H,I,O,P 
2 1 C,D,J,K,L,M,N,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3680  ? 
1 MORE         -83   ? 
1 'SSA (A^2)'  10650 ? 
2 'ABSA (A^2)' 3990  ? 
2 MORE         -81   ? 
2 'SSA (A^2)'  10940 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O   ? A SER 21 ? A SER 18 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OD1 ? A ASP 24 ? A ASP 21  ? 1_555 71.1  ? 
2   O   ? A SER 21 ? A SER 18 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OD2 ? A ASP 24 ? A ASP 21  ? 1_555 116.6 ? 
3   OD1 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OD2 ? A ASP 24 ? A ASP 21  ? 1_555 46.0  ? 
4   O   ? A SER 21 ? A SER 18 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? A ASN 26 ? A ASN 23  ? 1_555 71.1  ? 
5   OD1 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? A ASN 26 ? A ASN 23  ? 1_555 72.6  ? 
6   OD2 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? A ASN 26 ? A ASN 23  ? 1_555 93.7  ? 
7   O   ? A SER 21 ? A SER 18 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? A THR 29 ? A THR 26  ? 1_555 83.5  ? 
8   OD1 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? A THR 29 ? A THR 26  ? 1_555 144.1 ? 
9   OD2 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? A THR 29 ? A THR 26  ? 1_555 153.2 ? 
10  O   ? A ASN 26 ? A ASN 23 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? A THR 29 ? A THR 26  ? 1_555 75.5  ? 
11  O   ? A SER 21 ? A SER 18 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE1 ? A GLU 34 ? A GLU 31  ? 1_555 84.2  ? 
12  OD1 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE1 ? A GLU 34 ? A GLU 31  ? 1_555 110.4 ? 
13  OD2 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE1 ? A GLU 34 ? A GLU 31  ? 1_555 107.5 ? 
14  O   ? A ASN 26 ? A ASN 23 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE1 ? A GLU 34 ? A GLU 31  ? 1_555 152.9 ? 
15  O   ? A THR 29 ? A THR 26 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE1 ? A GLU 34 ? A GLU 31  ? 1_555 91.2  ? 
16  O   ? A SER 21 ? A SER 18 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE2 ? A GLU 34 ? A GLU 31  ? 1_555 71.8  ? 
17  OD1 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE2 ? A GLU 34 ? A GLU 31  ? 1_555 63.8  ? 
18  OD2 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE2 ? A GLU 34 ? A GLU 31  ? 1_555 73.9  ? 
19  O   ? A ASN 26 ? A ASN 23 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE2 ? A GLU 34 ? A GLU 31  ? 1_555 129.6 ? 
20  O   ? A THR 29 ? A THR 26 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE2 ? A GLU 34 ? A GLU 31  ? 1_555 131.7 ? 
21  OE1 ? A GLU 34 ? A GLU 31 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 OE2 ? A GLU 34 ? A GLU 31  ? 1_555 46.6  ? 
22  O   ? A SER 21 ? A SER 18 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? O HOH .  ? A HOH 220 ? 1_555 155.2 ? 
23  OD1 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? O HOH .  ? A HOH 220 ? 1_555 124.5 ? 
24  OD2 ? A ASP 24 ? A ASP 21 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? O HOH .  ? A HOH 220 ? 1_555 83.4  ? 
25  O   ? A ASN 26 ? A ASN 23 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? O HOH .  ? A HOH 220 ? 1_555 94.1  ? 
26  O   ? A THR 29 ? A THR 26 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? O HOH .  ? A HOH 220 ? 1_555 73.3  ? 
27  OE1 ? A GLU 34 ? A GLU 31 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? O HOH .  ? A HOH 220 ? 1_555 104.7 ? 
28  OE2 ? A GLU 34 ? A GLU 31 ? 1_555 CA ? F CA . ? A CA 102 ? 1_555 O   ? O HOH .  ? A HOH 220 ? 1_555 130.9 ? 
29  OD1 ? A ASP 64 ? A ASP 61 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OD1 ? A ASP 66 ? A ASP 63  ? 1_555 73.5  ? 
30  OD1 ? A ASP 64 ? A ASP 61 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OD1 ? A ASN 68 ? A ASN 65  ? 1_555 79.8  ? 
31  OD1 ? A ASP 66 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OD1 ? A ASN 68 ? A ASN 65  ? 1_555 79.2  ? 
32  OD1 ? A ASP 64 ? A ASP 61 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? A LYS 70 ? A LYS 67  ? 1_555 87.2  ? 
33  OD1 ? A ASP 66 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? A LYS 70 ? A LYS 67  ? 1_555 152.0 ? 
34  OD1 ? A ASN 68 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? A LYS 70 ? A LYS 67  ? 1_555 77.5  ? 
35  OD1 ? A ASP 64 ? A ASP 61 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE1 ? A GLU 75 ? A GLU 72  ? 1_555 110.1 ? 
36  OD1 ? A ASP 66 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE1 ? A GLU 75 ? A GLU 72  ? 1_555 123.5 ? 
37  OD1 ? A ASN 68 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE1 ? A GLU 75 ? A GLU 72  ? 1_555 156.6 ? 
38  O   ? A LYS 70 ? A LYS 67 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE1 ? A GLU 75 ? A GLU 72  ? 1_555 81.8  ? 
39  OD1 ? A ASP 64 ? A ASP 61 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE2 ? A GLU 75 ? A GLU 72  ? 1_555 87.4  ? 
40  OD1 ? A ASP 66 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE2 ? A GLU 75 ? A GLU 72  ? 1_555 76.1  ? 
41  OD1 ? A ASN 68 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE2 ? A GLU 75 ? A GLU 72  ? 1_555 154.5 ? 
42  O   ? A LYS 70 ? A LYS 67 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE2 ? A GLU 75 ? A GLU 72  ? 1_555 124.0 ? 
43  OE1 ? A GLU 75 ? A GLU 72 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 OE2 ? A GLU 75 ? A GLU 72  ? 1_555 48.8  ? 
44  OD1 ? A ASP 64 ? A ASP 61 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? O HOH .  ? A HOH 209 ? 1_555 158.7 ? 
45  OD1 ? A ASP 66 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? O HOH .  ? A HOH 209 ? 1_555 85.3  ? 
46  OD1 ? A ASN 68 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? O HOH .  ? A HOH 209 ? 1_555 98.4  ? 
47  O   ? A LYS 70 ? A LYS 67 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? O HOH .  ? A HOH 209 ? 1_555 113.3 ? 
48  OE1 ? A GLU 75 ? A GLU 72 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? O HOH .  ? A HOH 209 ? 1_555 79.8  ? 
49  OE2 ? A GLU 75 ? A GLU 72 ? 1_555 CA ? E CA . ? A CA 101 ? 1_555 O   ? O HOH .  ? A HOH 209 ? 1_555 85.7  ? 
50  O   ? B SER 21 ? B SER 18 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OD1 ? B ASP 24 ? B ASP 21  ? 1_555 88.8  ? 
51  O   ? B SER 21 ? B SER 18 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? B ASN 26 ? B ASN 23  ? 1_555 70.9  ? 
52  OD1 ? B ASP 24 ? B ASP 21 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? B ASN 26 ? B ASN 23  ? 1_555 82.1  ? 
53  O   ? B SER 21 ? B SER 18 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? B THR 29 ? B THR 26  ? 1_555 84.9  ? 
54  OD1 ? B ASP 24 ? B ASP 21 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? B THR 29 ? B THR 26  ? 1_555 163.0 ? 
55  O   ? B ASN 26 ? B ASN 23 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? B THR 29 ? B THR 26  ? 1_555 80.9  ? 
56  O   ? B SER 21 ? B SER 18 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE1 ? B GLU 34 ? B GLU 31  ? 1_555 96.6  ? 
57  OD1 ? B ASP 24 ? B ASP 21 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE1 ? B GLU 34 ? B GLU 31  ? 1_555 108.3 ? 
58  O   ? B ASN 26 ? B ASN 23 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE1 ? B GLU 34 ? B GLU 31  ? 1_555 164.0 ? 
59  O   ? B THR 29 ? B THR 26 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE1 ? B GLU 34 ? B GLU 31  ? 1_555 88.2  ? 
60  O   ? B SER 21 ? B SER 18 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE2 ? B GLU 34 ? B GLU 31  ? 1_555 74.5  ? 
61  OD1 ? B ASP 24 ? B ASP 21 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE2 ? B GLU 34 ? B GLU 31  ? 1_555 66.0  ? 
62  O   ? B ASN 26 ? B ASN 23 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE2 ? B GLU 34 ? B GLU 31  ? 1_555 132.9 ? 
63  O   ? B THR 29 ? B THR 26 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE2 ? B GLU 34 ? B GLU 31  ? 1_555 126.8 ? 
64  OE1 ? B GLU 34 ? B GLU 31 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 OE2 ? B GLU 34 ? B GLU 31  ? 1_555 47.9  ? 
65  O   ? B SER 21 ? B SER 18 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? P HOH .  ? B HOH 216 ? 1_555 153.1 ? 
66  OD1 ? B ASP 24 ? B ASP 21 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? P HOH .  ? B HOH 216 ? 1_555 111.1 ? 
67  O   ? B ASN 26 ? B ASN 23 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? P HOH .  ? B HOH 216 ? 1_555 93.4  ? 
68  O   ? B THR 29 ? B THR 26 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? P HOH .  ? B HOH 216 ? 1_555 70.8  ? 
69  OE1 ? B GLU 34 ? B GLU 31 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? P HOH .  ? B HOH 216 ? 1_555 93.9  ? 
70  OE2 ? B GLU 34 ? B GLU 31 ? 1_555 CA ? H CA . ? B CA 101 ? 1_555 O   ? P HOH .  ? B HOH 216 ? 1_555 129.4 ? 
71  OD1 ? B ASP 64 ? B ASP 61 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OD1 ? B ASP 66 ? B ASP 63  ? 1_555 75.4  ? 
72  OD1 ? B ASP 64 ? B ASP 61 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OD1 ? B ASN 68 ? B ASN 65  ? 1_555 77.2  ? 
73  OD1 ? B ASP 66 ? B ASP 63 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OD1 ? B ASN 68 ? B ASN 65  ? 1_555 72.1  ? 
74  OD1 ? B ASP 64 ? B ASP 61 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? B LYS 70 ? B LYS 67  ? 1_555 82.2  ? 
75  OD1 ? B ASP 66 ? B ASP 63 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? B LYS 70 ? B LYS 67  ? 1_555 144.7 ? 
76  OD1 ? B ASN 68 ? B ASN 65 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? B LYS 70 ? B LYS 67  ? 1_555 76.6  ? 
77  OD1 ? B ASP 64 ? B ASP 61 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE1 ? B GLU 75 ? B GLU 72  ? 1_555 118.6 ? 
78  OD1 ? B ASP 66 ? B ASP 63 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE1 ? B GLU 75 ? B GLU 72  ? 1_555 135.9 ? 
79  OD1 ? B ASN 68 ? B ASN 65 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE1 ? B GLU 75 ? B GLU 72  ? 1_555 148.6 ? 
80  O   ? B LYS 70 ? B LYS 67 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE1 ? B GLU 75 ? B GLU 72  ? 1_555 78.9  ? 
81  OD1 ? B ASP 64 ? B ASP 61 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE2 ? B GLU 75 ? B GLU 72  ? 1_555 92.3  ? 
82  OD1 ? B ASP 66 ? B ASP 63 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE2 ? B GLU 75 ? B GLU 72  ? 1_555 88.1  ? 
83  OD1 ? B ASN 68 ? B ASN 65 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE2 ? B GLU 75 ? B GLU 72  ? 1_555 159.3 ? 
84  O   ? B LYS 70 ? B LYS 67 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE2 ? B GLU 75 ? B GLU 72  ? 1_555 120.1 ? 
85  OE1 ? B GLU 75 ? B GLU 72 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 OE2 ? B GLU 75 ? B GLU 72  ? 1_555 52.1  ? 
86  OD1 ? B ASP 64 ? B ASP 61 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? P HOH .  ? B HOH 217 ? 1_555 157.0 ? 
87  OD1 ? B ASP 66 ? B ASP 63 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? P HOH .  ? B HOH 217 ? 1_555 92.7  ? 
88  OD1 ? B ASN 68 ? B ASN 65 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? P HOH .  ? B HOH 217 ? 1_555 80.5  ? 
89  O   ? B LYS 70 ? B LYS 67 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? P HOH .  ? B HOH 217 ? 1_555 97.8  ? 
90  OE1 ? B GLU 75 ? B GLU 72 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? P HOH .  ? B HOH 217 ? 1_555 83.8  ? 
91  OE2 ? B GLU 75 ? B GLU 72 ? 1_555 CA ? I CA . ? B CA 102 ? 1_555 O   ? P HOH .  ? B HOH 217 ? 1_555 107.2 ? 
92  O   ? C SER 21 ? C SER 18 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OD1 ? C ASP 24 ? C ASP 21  ? 1_555 109.2 ? 
93  O   ? C SER 21 ? C SER 18 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OD2 ? C ASP 24 ? C ASP 21  ? 1_555 136.1 ? 
94  OD1 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OD2 ? C ASP 24 ? C ASP 21  ? 1_555 44.1  ? 
95  O   ? C SER 21 ? C SER 18 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? C ASN 26 ? C ASN 23  ? 1_555 77.3  ? 
96  OD1 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? C ASN 26 ? C ASN 23  ? 1_555 81.4  ? 
97  OD2 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? C ASN 26 ? C ASN 23  ? 1_555 118.9 ? 
98  O   ? C SER 21 ? C SER 18 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? C THR 29 ? C THR 26  ? 1_555 84.8  ? 
99  OD1 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? C THR 29 ? C THR 26  ? 1_555 152.1 ? 
100 OD2 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? C THR 29 ? C THR 26  ? 1_555 136.2 ? 
101 O   ? C ASN 26 ? C ASN 23 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? C THR 29 ? C THR 26  ? 1_555 78.3  ? 
102 O   ? C SER 21 ? C SER 18 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE1 ? C GLU 34 ? C GLU 31  ? 1_555 102.1 ? 
103 OD1 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE1 ? C GLU 34 ? C GLU 31  ? 1_555 116.6 ? 
104 OD2 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE1 ? C GLU 34 ? C GLU 31  ? 1_555 75.4  ? 
105 O   ? C ASN 26 ? C ASN 23 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE1 ? C GLU 34 ? C GLU 31  ? 1_555 160.3 ? 
106 O   ? C THR 29 ? C THR 26 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE1 ? C GLU 34 ? C GLU 31  ? 1_555 82.1  ? 
107 O   ? C SER 21 ? C SER 18 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE2 ? C GLU 34 ? C GLU 31  ? 1_555 76.8  ? 
108 OD1 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE2 ? C GLU 34 ? C GLU 31  ? 1_555 83.4  ? 
109 OD2 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE2 ? C GLU 34 ? C GLU 31  ? 1_555 67.3  ? 
110 O   ? C ASN 26 ? C ASN 23 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE2 ? C GLU 34 ? C GLU 31  ? 1_555 143.6 ? 
111 O   ? C THR 29 ? C THR 26 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE2 ? C GLU 34 ? C GLU 31  ? 1_555 124.0 ? 
112 OE1 ? C GLU 34 ? C GLU 31 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 OE2 ? C GLU 34 ? C GLU 31  ? 1_555 52.1  ? 
113 O   ? C SER 21 ? C SER 18 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? Q HOH .  ? C HOH 219 ? 1_555 158.4 ? 
114 OD1 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? Q HOH .  ? C HOH 219 ? 1_555 84.5  ? 
115 OD2 ? C ASP 24 ? C ASP 21 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? Q HOH .  ? C HOH 219 ? 1_555 65.2  ? 
116 O   ? C ASN 26 ? C ASN 23 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? Q HOH .  ? C HOH 219 ? 1_555 88.9  ? 
117 O   ? C THR 29 ? C THR 26 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? Q HOH .  ? C HOH 219 ? 1_555 76.1  ? 
118 OE1 ? C GLU 34 ? C GLU 31 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? Q HOH .  ? C HOH 219 ? 1_555 85.4  ? 
119 OE2 ? C GLU 34 ? C GLU 31 ? 1_555 CA ? K CA . ? C CA 102 ? 1_555 O   ? Q HOH .  ? C HOH 219 ? 1_555 122.4 ? 
120 OD1 ? C ASP 64 ? C ASP 61 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OD1 ? C ASP 66 ? C ASP 63  ? 1_555 76.9  ? 
121 OD1 ? C ASP 64 ? C ASP 61 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OD1 ? C ASN 68 ? C ASN 65  ? 1_555 74.3  ? 
122 OD1 ? C ASP 66 ? C ASP 63 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OD1 ? C ASN 68 ? C ASN 65  ? 1_555 75.1  ? 
123 OD1 ? C ASP 64 ? C ASP 61 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? C LYS 70 ? C LYS 67  ? 1_555 79.7  ? 
124 OD1 ? C ASP 66 ? C ASP 63 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? C LYS 70 ? C LYS 67  ? 1_555 149.1 ? 
125 OD1 ? C ASN 68 ? C ASN 65 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? C LYS 70 ? C LYS 67  ? 1_555 79.3  ? 
126 OD1 ? C ASP 64 ? C ASP 61 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE1 ? C GLU 75 ? C GLU 72  ? 1_555 117.7 ? 
127 OD1 ? C ASP 66 ? C ASP 63 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE1 ? C GLU 75 ? C GLU 72  ? 1_555 127.2 ? 
128 OD1 ? C ASN 68 ? C ASN 65 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE1 ? C GLU 75 ? C GLU 72  ? 1_555 155.3 ? 
129 O   ? C LYS 70 ? C LYS 67 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE1 ? C GLU 75 ? C GLU 72  ? 1_555 81.8  ? 
130 OD1 ? C ASP 64 ? C ASP 61 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE2 ? C GLU 75 ? C GLU 72  ? 1_555 99.4  ? 
131 OD1 ? C ASP 66 ? C ASP 63 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE2 ? C GLU 75 ? C GLU 72  ? 1_555 75.5  ? 
132 OD1 ? C ASN 68 ? C ASN 65 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE2 ? C GLU 75 ? C GLU 72  ? 1_555 150.6 ? 
133 O   ? C LYS 70 ? C LYS 67 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE2 ? C GLU 75 ? C GLU 72  ? 1_555 128.6 ? 
134 OE1 ? C GLU 75 ? C GLU 72 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 OE2 ? C GLU 75 ? C GLU 72  ? 1_555 52.8  ? 
135 OD1 ? C ASP 64 ? C ASP 61 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? Q HOH .  ? C HOH 202 ? 1_555 158.9 ? 
136 OD1 ? C ASP 66 ? C ASP 63 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? Q HOH .  ? C HOH 202 ? 1_555 86.3  ? 
137 OD1 ? C ASN 68 ? C ASN 65 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? Q HOH .  ? C HOH 202 ? 1_555 89.2  ? 
138 O   ? C LYS 70 ? C LYS 67 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? Q HOH .  ? C HOH 202 ? 1_555 110.6 ? 
139 OE1 ? C GLU 75 ? C GLU 72 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? Q HOH .  ? C HOH 202 ? 1_555 82.7  ? 
140 OE2 ? C GLU 75 ? C GLU 72 ? 1_555 CA ? J CA . ? C CA 101 ? 1_555 O   ? Q HOH .  ? C HOH 202 ? 1_555 88.5  ? 
141 O   ? D SER 21 ? D SER 18 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? D ASN 26 ? D ASN 23  ? 1_555 74.8  ? 
142 O   ? D SER 21 ? D SER 18 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? D THR 29 ? D THR 26  ? 1_555 86.5  ? 
143 O   ? D ASN 26 ? D ASN 23 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? D THR 29 ? D THR 26  ? 1_555 85.1  ? 
144 O   ? D SER 21 ? D SER 18 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 OE1 ? D GLU 34 ? D GLU 31  ? 1_555 97.1  ? 
145 O   ? D ASN 26 ? D ASN 23 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 OE1 ? D GLU 34 ? D GLU 31  ? 1_555 164.9 ? 
146 O   ? D THR 29 ? D THR 26 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 OE1 ? D GLU 34 ? D GLU 31  ? 1_555 81.7  ? 
147 O   ? D SER 21 ? D SER 18 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 OE2 ? D GLU 34 ? D GLU 31  ? 1_555 68.3  ? 
148 O   ? D ASN 26 ? D ASN 23 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 OE2 ? D GLU 34 ? D GLU 31  ? 1_555 134.7 ? 
149 O   ? D THR 29 ? D THR 26 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 OE2 ? D GLU 34 ? D GLU 31  ? 1_555 116.9 ? 
150 OE1 ? D GLU 34 ? D GLU 31 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 OE2 ? D GLU 34 ? D GLU 31  ? 1_555 48.4  ? 
151 O   ? D SER 21 ? D SER 18 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? R HOH .  ? D HOH 216 ? 1_555 165.1 ? 
152 O   ? D ASN 26 ? D ASN 23 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? R HOH .  ? D HOH 216 ? 1_555 93.0  ? 
153 O   ? D THR 29 ? D THR 26 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? R HOH .  ? D HOH 216 ? 1_555 84.0  ? 
154 OE1 ? D GLU 34 ? D GLU 31 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? R HOH .  ? D HOH 216 ? 1_555 92.9  ? 
155 OE2 ? D GLU 34 ? D GLU 31 ? 1_555 CA ? M CA . ? D CA 101 ? 1_555 O   ? R HOH .  ? D HOH 216 ? 1_555 126.5 ? 
156 OD1 ? D ASP 64 ? D ASP 61 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OD1 ? D ASP 66 ? D ASP 63  ? 1_555 77.6  ? 
157 OD1 ? D ASP 64 ? D ASP 61 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OD1 ? D ASN 68 ? D ASN 65  ? 1_555 79.9  ? 
158 OD1 ? D ASP 66 ? D ASP 63 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OD1 ? D ASN 68 ? D ASN 65  ? 1_555 90.3  ? 
159 OD1 ? D ASP 64 ? D ASP 61 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? D LYS 70 ? D LYS 67  ? 1_555 78.8  ? 
160 OD1 ? D ASP 66 ? D ASP 63 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? D LYS 70 ? D LYS 67  ? 1_555 155.3 ? 
161 OD1 ? D ASN 68 ? D ASN 65 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? D LYS 70 ? D LYS 67  ? 1_555 78.5  ? 
162 OD1 ? D ASP 64 ? D ASP 61 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE1 ? D GLU 75 ? D GLU 72  ? 1_555 104.3 ? 
163 OD1 ? D ASP 66 ? D ASP 63 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE1 ? D GLU 75 ? D GLU 72  ? 1_555 114.2 ? 
164 OD1 ? D ASN 68 ? D ASN 65 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE1 ? D GLU 75 ? D GLU 72  ? 1_555 155.6 ? 
165 O   ? D LYS 70 ? D LYS 67 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE1 ? D GLU 75 ? D GLU 72  ? 1_555 78.8  ? 
166 OD1 ? D ASP 64 ? D ASP 61 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE2 ? D GLU 75 ? D GLU 72  ? 1_555 83.6  ? 
167 OD1 ? D ASP 66 ? D ASP 63 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE2 ? D GLU 75 ? D GLU 72  ? 1_555 67.2  ? 
168 OD1 ? D ASN 68 ? D ASN 65 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE2 ? D GLU 75 ? D GLU 72  ? 1_555 154.6 ? 
169 O   ? D LYS 70 ? D LYS 67 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE2 ? D GLU 75 ? D GLU 72  ? 1_555 117.1 ? 
170 OE1 ? D GLU 75 ? D GLU 72 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 OE2 ? D GLU 75 ? D GLU 72  ? 1_555 48.4  ? 
171 OD1 ? D ASP 64 ? D ASP 61 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? R HOH .  ? D HOH 217 ? 1_555 160.1 ? 
172 OD1 ? D ASP 66 ? D ASP 63 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? R HOH .  ? D HOH 217 ? 1_555 101.7 ? 
173 OD1 ? D ASN 68 ? D ASN 65 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? R HOH .  ? D HOH 217 ? 1_555 80.2  ? 
174 O   ? D LYS 70 ? D LYS 67 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? R HOH .  ? D HOH 217 ? 1_555 98.0  ? 
175 OE1 ? D GLU 75 ? D GLU 72 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? R HOH .  ? D HOH 217 ? 1_555 94.2  ? 
176 OE2 ? D GLU 75 ? D GLU 72 ? 1_555 CA ? N CA . ? D CA 102 ? 1_555 O   ? R HOH .  ? D HOH 217 ? 1_555 114.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-04-01 
2 'Structure model' 1 1 2015-06-24 
3 'Structure model' 1 2 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Derived calculations'   
3 3 'Structure model' Other                    
4 3 'Structure model' 'Refinement description' 
5 3 'Structure model' 'Source and taxonomy'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen            
2 3 'Structure model' pdbx_database_status      
3 3 'Structure model' pdbx_struct_assembly      
4 3 'Structure model' pdbx_struct_assembly_gen  
5 3 'Structure model' pdbx_struct_assembly_prop 
6 3 'Structure model' pdbx_struct_conn_angle    
7 3 'Structure model' pdbx_struct_oper_list     
8 3 'Structure model' software                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
2 3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
3 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
4 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
5 3 'Structure model' '_pdbx_struct_assembly_prop.type'             
6 3 'Structure model' '_pdbx_struct_assembly_prop.value'            
7 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
8 3 'Structure model' '_software.classification'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: 1.8.4_1496)' 1 
? 'data scaling' . . . . . . . . . . . HKL-2000 . . . 705                           2 
? phasing        . . . . . . . . . . . MOLREP   . . . 11.0.05                       3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 41 ? ? -109.45 -118.85 
2 1 LEU A 44 ? ? -106.14 -79.58  
3 1 PRO A 47 ? ? -57.05  102.84  
4 1 MET A 52 ? ? -99.19  34.85   
5 1 GLU A 86 ? ? -55.15  86.63   
6 1 LEU B 44 ? ? -69.84  95.14   
7 1 LYS B 45 ? ? -68.66  62.78   
8 1 ASP B 49 ? ? -23.49  101.15  
9 1 ASP B 51 ? ? -109.82 72.05   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 PRO A 47 ? ? ASP A 48 ? ? 144.98 
2 1 PRO B 47 ? ? ASP B 48 ? ? 146.03 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2 ? A GLY 1  
2  1 Y 1 A SER -1 ? A SER 2  
3  1 Y 1 A MET 0  ? A MET 3  
4  1 Y 1 A THR 88 ? A THR 91 
5  1 Y 1 A ARG 89 ? A ARG 92 
6  1 Y 1 A LYS 90 ? A LYS 93 
7  1 Y 1 A GLU 91 ? A GLU 94 
8  1 Y 1 B GLY -2 ? B GLY 1  
9  1 Y 1 B SER -1 ? B SER 2  
10 1 Y 1 B MET 0  ? B MET 3  
11 1 Y 1 B ARG 89 ? B ARG 92 
12 1 Y 1 B LYS 90 ? B LYS 93 
13 1 Y 1 B GLU 91 ? B GLU 94 
14 1 Y 1 C GLY -2 ? C GLY 1  
15 1 Y 1 C SER -1 ? C SER 2  
16 1 Y 1 C MET 0  ? C MET 3  
17 1 Y 1 D GLY -2 ? D GLY 1  
18 1 Y 1 D SER -1 ? D SER 2  
19 1 Y 1 D MET 0  ? D MET 3  
20 1 Y 1 D ARG 89 ? D ARG 92 
21 1 Y 1 D LYS 90 ? D LYS 93 
22 1 Y 1 D GLU 91 ? D GLU 94 
# 
_pdbx_audit_support.funding_organization   'Dermatology Foundation' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Career Development Award' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'         CA  
3 'NONAETHYLENE GLYCOL' 2PE 
4 water                 HOH 
#