data_4PDG
# 
_entry.id   4PDG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4PDG         
WWPDB D_1000201182 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4PCZ PDB . 
unspecified 4PD2 PDB . 
unspecified 4PDI PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4PDG 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coste, F.'    1 
'Castaing, B.' 2 
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.book_id_ISBN              . 
_citation.book_publisher            ? 
_citation.book_publisher_city       . 
_citation.book_title                . 
_citation.coordinate_linkage        . 
_citation.country                   UK 
_citation.database_id_Medline       . 
_citation.details                   . 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              . 
_citation.journal_issue             . 
_citation.journal_volume            42 
_citation.language                  . 
_citation.page_first                10748 
_citation.page_last                 10761 
_citation.title                     
'Zinc finger oxidation of Fpg/Nei DNA glycosylases by 2-thioxanthine: biochemical and X-ray structural characterization.' 
_citation.year                      2014 
_citation.database_id_CSD           . 
_citation.pdbx_database_id_DOI      10.1093/nar/gku613 
_citation.pdbx_database_id_PubMed   25143530 
_citation.unpublished_flag          . 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Biela, A.'        1  
primary 'Coste, F.'        2  
primary 'Culard, F.'       3  
primary 'Guerin, M.'       4  
primary 'Goffinont, S.'    5  
primary 'Gasteiger, K.'    6  
primary 'Ciesla, J.'       7  
primary 'Winczura, A.'     8  
primary 'Kazimierczuk, Z.' 9  
primary 'Gasparutto, D.'   10 
primary 'Carell, T.'       11 
primary 'Tudek, B.'        12 
primary 'Castaing, B.'     13 
# 
_cell.entry_id           4PDG 
_cell.length_a           90.550 
_cell.length_b           90.550 
_cell.length_c           139.353 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4PDG 
_symmetry.cell_setting                     . 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            . 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   . 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Formamidopyrimidine-DNA glycosylase'                          31116.217 1  3.2.2.23 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*TP*CP*TP*TP*TP*(3DR)P*TP*TP*TP*CP*TP*CP*G)-3')
;
4054.614  1  ?        ? ? ? 
3 polymer     syn 
;DNA (5'-D(*GP*CP*GP*AP*GP*AP*AP*AP*CP*AP*AP*AP*GP*A)-3')
;
4355.884  1  ?        ? ? ? 
4 non-polymer syn 2-sulfanyl-1,9-dihydro-6H-purin-6-one                          168.176   1  ?        ? ? ? 
5 non-polymer syn GLYCEROL                                                       92.094    1  ?        ? ? ? 
6 water       nat water                                                          18.015    58 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Fapy-DNA glycosylase,DNA-(apurinic or apyrimidinic site) lyase MutM,AP lyase MutM' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYL
LEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYGK
TGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
;PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYL
LEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYGK
TGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
A ? 
2 polydeoxyribonucleotide no yes '(DC)(DT)(DC)(DT)(DT)(DT)(3DR)(DT)(DT)(DT)(DC)(DT)(DC)(DG)' CTCTTTNTTTCTCG B ? 
3 polydeoxyribonucleotide no no  '(DG)(DC)(DG)(DA)(DG)(DA)(DA)(DA)(DC)(DA)(DA)(DA)(DG)(DA)' GCGAGAAACAAAGA C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   GLU n 
1 3   LEU n 
1 4   PRO n 
1 5   GLU n 
1 6   VAL n 
1 7   GLU n 
1 8   THR n 
1 9   VAL n 
1 10  ARG n 
1 11  ARG n 
1 12  GLU n 
1 13  LEU n 
1 14  GLU n 
1 15  LYS n 
1 16  ARG n 
1 17  ILE n 
1 18  VAL n 
1 19  GLY n 
1 20  GLN n 
1 21  LYS n 
1 22  ILE n 
1 23  ILE n 
1 24  SER n 
1 25  ILE n 
1 26  GLU n 
1 27  ALA n 
1 28  THR n 
1 29  TYR n 
1 30  PRO n 
1 31  ARG n 
1 32  MET n 
1 33  VAL n 
1 34  LEU n 
1 35  THR n 
1 36  GLY n 
1 37  PHE n 
1 38  GLU n 
1 39  GLN n 
1 40  LEU n 
1 41  LYS n 
1 42  LYS n 
1 43  GLU n 
1 44  LEU n 
1 45  THR n 
1 46  GLY n 
1 47  LYS n 
1 48  THR n 
1 49  ILE n 
1 50  GLN n 
1 51  GLY n 
1 52  ILE n 
1 53  SER n 
1 54  ARG n 
1 55  ARG n 
1 56  GLY n 
1 57  LYS n 
1 58  TYR n 
1 59  LEU n 
1 60  ILE n 
1 61  PHE n 
1 62  GLU n 
1 63  ILE n 
1 64  GLY n 
1 65  ASP n 
1 66  ASP n 
1 67  PHE n 
1 68  ARG n 
1 69  LEU n 
1 70  ILE n 
1 71  SER n 
1 72  HIS n 
1 73  LEU n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  GLY n 
1 78  LYS n 
1 79  TYR n 
1 80  ARG n 
1 81  LEU n 
1 82  ALA n 
1 83  THR n 
1 84  LEU n 
1 85  ASP n 
1 86  ALA n 
1 87  PRO n 
1 88  ARG n 
1 89  GLU n 
1 90  LYS n 
1 91  HIS n 
1 92  ASP n 
1 93  HIS n 
1 94  LEU n 
1 95  THR n 
1 96  MET n 
1 97  LYS n 
1 98  PHE n 
1 99  ALA n 
1 100 ASP n 
1 101 GLY n 
1 102 GLN n 
1 103 LEU n 
1 104 ILE n 
1 105 TYR n 
1 106 ALA n 
1 107 ASP n 
1 108 VAL n 
1 109 ARG n 
1 110 LYS n 
1 111 PHE n 
1 112 GLY n 
1 113 THR n 
1 114 TRP n 
1 115 GLU n 
1 116 LEU n 
1 117 ILE n 
1 118 SER n 
1 119 THR n 
1 120 ASP n 
1 121 GLN n 
1 122 VAL n 
1 123 LEU n 
1 124 PRO n 
1 125 TYR n 
1 126 PHE n 
1 127 LEU n 
1 128 LYS n 
1 129 LYS n 
1 130 LYS n 
1 131 ILE n 
1 132 GLY n 
1 133 PRO n 
1 134 GLU n 
1 135 PRO n 
1 136 THR n 
1 137 TYR n 
1 138 GLU n 
1 139 ASP n 
1 140 PHE n 
1 141 ASP n 
1 142 GLU n 
1 143 LYS n 
1 144 LEU n 
1 145 PHE n 
1 146 ARG n 
1 147 GLU n 
1 148 LYS n 
1 149 LEU n 
1 150 ARG n 
1 151 LYS n 
1 152 SER n 
1 153 THR n 
1 154 LYS n 
1 155 LYS n 
1 156 ILE n 
1 157 LYS n 
1 158 PRO n 
1 159 TYR n 
1 160 LEU n 
1 161 LEU n 
1 162 GLU n 
1 163 GLN n 
1 164 THR n 
1 165 LEU n 
1 166 VAL n 
1 167 ALA n 
1 168 GLY n 
1 169 LEU n 
1 170 GLY n 
1 171 ASN n 
1 172 ILE n 
1 173 TYR n 
1 174 VAL n 
1 175 ASP n 
1 176 GLU n 
1 177 VAL n 
1 178 LEU n 
1 179 TRP n 
1 180 LEU n 
1 181 ALA n 
1 182 LYS n 
1 183 ILE n 
1 184 HIS n 
1 185 PRO n 
1 186 GLU n 
1 187 LYS n 
1 188 GLU n 
1 189 THR n 
1 190 ASN n 
1 191 GLN n 
1 192 LEU n 
1 193 ILE n 
1 194 GLU n 
1 195 SER n 
1 196 SER n 
1 197 ILE n 
1 198 HIS n 
1 199 LEU n 
1 200 LEU n 
1 201 HIS n 
1 202 ASP n 
1 203 SER n 
1 204 ILE n 
1 205 ILE n 
1 206 GLU n 
1 207 ILE n 
1 208 LEU n 
1 209 GLN n 
1 210 LYS n 
1 211 ALA n 
1 212 ILE n 
1 213 LYS n 
1 214 LEU n 
1 215 GLY n 
1 216 GLY n 
1 217 SER n 
1 218 SER n 
1 219 ILE n 
1 220 ARG n 
1 221 THR n 
1 222 TYR n 
1 223 SER n 
1 224 ALA n 
1 225 LEU n 
1 226 GLY n 
1 227 SER n 
1 228 THR n 
1 229 GLY n 
1 230 LYS n 
1 231 MET n 
1 232 GLN n 
1 233 ASN n 
1 234 GLU n 
1 235 LEU n 
1 236 GLN n 
1 237 VAL n 
1 238 TYR n 
1 239 GLY n 
1 240 LYS n 
1 241 THR n 
1 242 GLY n 
1 243 GLU n 
1 244 LYS n 
1 245 CYS n 
1 246 SER n 
1 247 ARG n 
1 248 CYS n 
1 249 GLY n 
1 250 ALA n 
1 251 GLU n 
1 252 ILE n 
1 253 GLN n 
1 254 LYS n 
1 255 ILE n 
1 256 LYS n 
1 257 VAL n 
1 258 ALA n 
1 259 GLY n 
1 260 ARG n 
1 261 GLY n 
1 262 THR n 
1 263 HIS n 
1 264 PHE n 
1 265 CYS n 
1 266 PRO n 
1 267 VAL n 
1 268 CYS n 
1 269 GLN n 
1 270 GLN n 
1 271 LYS n 
2 1   DC  n 
2 2   DT  n 
2 3   DC  n 
2 4   DT  n 
2 5   DT  n 
2 6   DT  n 
2 7   3DR n 
2 8   DT  n 
2 9   DT  n 
2 10  DT  n 
2 11  DC  n 
2 12  DT  n 
2 13  DC  n 
2 14  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DA  n 
3 5   DG  n 
3 6   DA  n 
3 7   DA  n 
3 8   DA  n 
3 9   DC  n 
3 10  DA  n 
3 11  DA  n 
3 12  DA  n 
3 13  DG  n 
3 14  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   271 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'mutM, fpg' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lactococcus lactis subsp. cremoris' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1359 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 14 'synthetic construct' ? 32630 ? 
3 1 sample 1 14 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FPG_LACLC P42371 1 
;PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYDEDFDEKLFREKLRKSTKKIKPY
LLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYG
KTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
2 ? 
2 PDB 4PDG      4PDG   2 ? 1 ? 
3 PDB 4PDG      4PDG   3 ? 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4PDG A 1 ? 271 ? P42371 2  ? 273 ? 1  271 
2 2 4PDG B 1 ? 14  ? 4PDG   1  ? 14  ? 1  14  
3 3 4PDG C 1 ? 14  ? 4PDG   15 ? 28  ? 15 28  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             4PDG 
_struct_ref_seq_dif.mon_id                       ? 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      ? 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P42371 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          139 
_struct_ref_seq_dif.details                      deletion 
_struct_ref_seq_dif.pdbx_auth_seq_num            ? 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2ON non-polymer         . 2-sulfanyl-1,9-dihydro-6H-purin-6-one    ?                               'C5 H4 N4 O S'    168.176 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE" 'ABASIC DIDEOXYRIBOSE'          'C5 H11 O6 P'     198.111 
ALA 'L-peptide linking' y ALANINE                                  ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?                               'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4PDG 
_exptl.crystals_number            . 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            3.61 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         65.96 
_exptl_crystal.description                 . 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    'HEPES, SODIUM CITRATE' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2010-07-07 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    . 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98011 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        0.98011 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            . 
_reflns.entry_id                         4PDG 
_reflns.data_reduction_details           . 
_reflns.data_reduction_method            . 
_reflns.d_resolution_high                2.40 
_reflns.d_resolution_low                 43.06 
_reflns.details                          . 
_reflns.limit_h_max                      . 
_reflns.limit_h_min                      . 
_reflns.limit_k_max                      . 
_reflns.limit_k_min                      . 
_reflns.limit_l_max                      . 
_reflns.limit_l_min                      . 
_reflns.number_all                       . 
_reflns.number_obs                       43014 
_reflns.observed_criterion               . 
_reflns.observed_criterion_F_max         . 
_reflns.observed_criterion_F_min         . 
_reflns.observed_criterion_I_max         . 
_reflns.observed_criterion_I_min         . 
_reflns.observed_criterion_sigma_F       . 
_reflns.observed_criterion_sigma_I       . 
_reflns.percent_possible_obs             99.1 
_reflns.R_free_details                   . 
_reflns.Rmerge_F_all                     . 
_reflns.Rmerge_F_obs                     . 
_reflns.Friedel_coverage                 . 
_reflns.number_gt                        . 
_reflns.threshold_expression             . 
_reflns.pdbx_redundancy                  4.8 
_reflns.pdbx_Rmerge_I_obs                . 
_reflns.pdbx_Rmerge_I_all                . 
_reflns.pdbx_Rsym_value                  . 
_reflns.pdbx_netI_over_av_sigmaI         . 
_reflns.pdbx_netI_over_sigmaI            16.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   . 
_reflns.pdbx_res_netI_over_sigmaI_2      . 
_reflns.pdbx_chi_squared                 . 
_reflns.pdbx_scaling_rejects             . 
_reflns.pdbx_d_res_high_opt              . 
_reflns.pdbx_d_res_low_opt               . 
_reflns.pdbx_d_res_opt_method            . 
_reflns.phase_calculation_details        . 
_reflns.pdbx_Rrim_I_all                  . 
_reflns.pdbx_Rpim_I_all                  . 
_reflns.pdbx_d_opt                       . 
_reflns.pdbx_number_measured_all         . 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
# 
_reflns_shell.d_res_high                  2.40 
_reflns_shell.d_res_low                   2.53 
_reflns_shell.meanI_over_sigI_all         . 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         . 
_reflns_shell.number_measured_obs         . 
_reflns_shell.number_possible             . 
_reflns_shell.number_unique_all           . 
_reflns_shell.number_unique_obs           . 
_reflns_shell.percent_possible_all        99.5 
_reflns_shell.percent_possible_obs        . 
_reflns_shell.Rmerge_F_all                . 
_reflns_shell.Rmerge_F_obs                . 
_reflns_shell.Rmerge_I_all                . 
_reflns_shell.Rmerge_I_obs                0.871 
_reflns_shell.meanI_over_sigI_gt          . 
_reflns_shell.meanI_over_uI_all           . 
_reflns_shell.meanI_over_uI_gt            . 
_reflns_shell.number_measured_gt          . 
_reflns_shell.number_unique_gt            . 
_reflns_shell.percent_possible_gt         . 
_reflns_shell.Rmerge_F_gt                 . 
_reflns_shell.Rmerge_I_gt                 . 
_reflns_shell.pdbx_redundancy             4.9 
_reflns_shell.pdbx_Rsym_value             . 
_reflns_shell.pdbx_chi_squared            . 
_reflns_shell.pdbx_netI_over_sigmaI_all   . 
_reflns_shell.pdbx_netI_over_sigmaI_obs   . 
_reflns_shell.pdbx_Rrim_I_all             . 
_reflns_shell.pdbx_Rpim_I_all             . 
_reflns_shell.pdbx_rejects                . 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.aniso_B[1][1]                            . 
_refine.aniso_B[1][2]                            . 
_refine.aniso_B[1][3]                            . 
_refine.aniso_B[2][2]                            . 
_refine.aniso_B[2][3]                            . 
_refine.aniso_B[3][3]                            . 
_refine.B_iso_max                                . 
_refine.B_iso_mean                               . 
_refine.B_iso_min                                . 
_refine.correlation_coeff_Fo_to_Fc               . 
_refine.correlation_coeff_Fo_to_Fc_free          . 
_refine.details                                  . 
_refine.diff_density_max                         . 
_refine.diff_density_max_esd                     . 
_refine.diff_density_min                         . 
_refine.diff_density_min_esd                     . 
_refine.diff_density_rms                         . 
_refine.diff_density_rms_esd                     . 
_refine.entry_id                                 4PDG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 . 
_refine.ls_abs_structure_Flack                   . 
_refine.ls_abs_structure_Flack_esd               . 
_refine.ls_abs_structure_Rogers                  . 
_refine.ls_abs_structure_Rogers_esd              . 
_refine.ls_d_res_high                            2.4 
_refine.ls_d_res_low                             43.06 
_refine.ls_extinction_coef                       . 
_refine.ls_extinction_coef_esd                   . 
_refine.ls_extinction_expression                 . 
_refine.ls_extinction_method                     . 
_refine.ls_goodness_of_fit_all                   . 
_refine.ls_goodness_of_fit_all_esd               . 
_refine.ls_goodness_of_fit_obs                   . 
_refine.ls_goodness_of_fit_obs_esd               . 
_refine.ls_hydrogen_treatment                    . 
_refine.ls_matrix_type                           . 
_refine.ls_number_constraints                    . 
_refine.ls_number_parameters                     . 
_refine.ls_number_reflns_all                     . 
_refine.ls_number_reflns_obs                     43014 
_refine.ls_number_reflns_R_free                  2208 
_refine.ls_number_reflns_R_work                  . 
_refine.ls_number_restraints                     . 
_refine.ls_percent_reflns_obs                    99.07 
_refine.ls_percent_reflns_R_free                 5.13 
_refine.ls_R_factor_all                          . 
_refine.ls_R_factor_obs                          0.1647 
_refine.ls_R_factor_R_free                       0.1925 
_refine.ls_R_factor_R_free_error                 . 
_refine.ls_R_factor_R_free_error_details         . 
_refine.ls_R_factor_R_work                       0.1632 
_refine.ls_R_Fsqd_factor_obs                     . 
_refine.ls_R_I_factor_obs                        . 
_refine.ls_redundancy_reflns_all                 . 
_refine.ls_redundancy_reflns_obs                 . 
_refine.ls_restrained_S_all                      . 
_refine.ls_restrained_S_obs                      . 
_refine.ls_shift_over_esd_max                    . 
_refine.ls_shift_over_esd_mean                   . 
_refine.ls_structure_factor_coef                 . 
_refine.ls_weighting_details                     . 
_refine.ls_weighting_scheme                      . 
_refine.ls_wR_factor_all                         . 
_refine.ls_wR_factor_obs                         . 
_refine.ls_wR_factor_R_free                      . 
_refine.ls_wR_factor_R_work                      . 
_refine.occupancy_max                            . 
_refine.occupancy_min                            . 
_refine.overall_SU_B                             . 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_R_Cruickshank_DPI             . 
_refine.overall_SU_R_free                        . 
_refine.overall_FOM_free_R_set                   . 
_refine.overall_FOM_work_R_set                   . 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 . 
_refine.solvent_model_param_ksol                 . 
_refine.ls_R_factor_gt                           . 
_refine.ls_goodness_of_fit_gt                    . 
_refine.ls_goodness_of_fit_ref                   . 
_refine.ls_shift_over_su_max                     . 
_refine.ls_shift_over_su_max_lt                  . 
_refine.ls_shift_over_su_mean                    . 
_refine.ls_shift_over_su_mean_lt                 . 
_refine.pdbx_ls_sigma_I                          . 
_refine.pdbx_ls_sigma_F                          0.09 
_refine.pdbx_ls_sigma_Fsqd                       . 
_refine.pdbx_data_cutoff_high_absF               . 
_refine.pdbx_data_cutoff_high_rms_absF           . 
_refine.pdbx_data_cutoff_low_absF                . 
_refine.pdbx_isotropic_thermal_model             . 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1PM5' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     . 
_refine.pdbx_overall_ESU_R                       . 
_refine.pdbx_overall_ESU_R_Free                  . 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             . 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        . 
_refine.pdbx_density_correlation                 . 
_refine.pdbx_pd_number_of_powder_patterns        . 
_refine.pdbx_pd_number_of_points                 . 
_refine.pdbx_pd_meas_number_of_points            . 
_refine.pdbx_pd_proc_ls_prof_R_factor            . 
_refine.pdbx_pd_proc_ls_prof_wR_factor           . 
_refine.pdbx_pd_Marquardt_correlation_coeff      . 
_refine.pdbx_pd_Fsqrd_R_factor                   . 
_refine.pdbx_pd_ls_matrix_band_width             . 
_refine.pdbx_overall_phase_error                 19.26 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   . 
_refine.pdbx_overall_SU_R_free_Blow_DPI          . 
_refine.pdbx_overall_SU_R_Blow_DPI               . 
_refine.pdbx_TLS_residual_ADP_flag               . 
_refine.pdbx_diffrn_id                           1 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2101 
_refine_hist.pdbx_number_atoms_nucleic_acid   557 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             58 
_refine_hist.number_atoms_total               2733 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        43.06 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' . 0.012  . 2780 . f_bond_d           . . 
'X-RAY DIFFRACTION' . 1.281  . 3856 . f_angle_d          . . 
'X-RAY DIFFRACTION' . 19.950 . 1088 . f_dihedral_angle_d . . 
'X-RAY DIFFRACTION' . 0.054  . 434  . f_chiral_restr     . . 
'X-RAY DIFFRACTION' . 0.006  . 391  . f_plane_restr      . . 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.4    2.4498  . . 140 2581 99.00  . . . 0.3480 . 0.2860 . . . . . . . . 
'X-RAY DIFFRACTION' 2.4498 2.5068  . . 131 2576 100.00 . . . 0.3178 . 0.2732 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5068 2.5695  . . 165 2519 100.00 . . . 0.2750 . 0.2660 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5695 2.6390  . . 158 2536 99.00  . . . 0.2515 . 0.2451 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6390 2.7166  . . 148 2547 100.00 . . . 0.2442 . 0.2280 . . . . . . . . 
'X-RAY DIFFRACTION' 2.7166 2.8043  . . 141 2565 100.00 . . . 0.2447 . 0.2121 . . . . . . . . 
'X-RAY DIFFRACTION' 2.8043 2.9045  . . 116 2607 100.00 . . . 0.2055 . 0.2069 . . . . . . . . 
'X-RAY DIFFRACTION' 2.9045 3.0207  . . 143 2577 100.00 . . . 0.2291 . 0.1950 . . . . . . . . 
'X-RAY DIFFRACTION' 3.0207 3.1582  . . 140 2521 100.00 . . . 0.1891 . 0.1722 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1582 3.3246  . . 128 2601 100.00 . . . 0.1961 . 0.1554 . . . . . . . . 
'X-RAY DIFFRACTION' 3.3246 3.5328  . . 154 2518 99.00  . . . 0.1752 . 0.1268 . . . . . . . . 
'X-RAY DIFFRACTION' 3.5328 3.8054  . . 116 2573 99.00  . . . 0.1665 . 0.1295 . . . . . . . . 
'X-RAY DIFFRACTION' 3.8054 4.1881  . . 153 2525 98.00  . . . 0.1671 . 0.1252 . . . . . . . . 
'X-RAY DIFFRACTION' 4.1881 4.7935  . . 120 2553 98.00  . . . 0.1335 . 0.1130 . . . . . . . . 
'X-RAY DIFFRACTION' 4.7935 6.0366  . . 116 2541 98.00  . . . 0.1721 . 0.1463 . . . . . . . . 
'X-RAY DIFFRACTION' 6.0366 43.0663 . . 139 2466 96.00  . . . 0.1848 . 0.1755 . . . . . . . . 
# 
_struct.entry_id                     4PDG 
_struct.title                        'Crystal structure of a complex between an inhibited LlFpg and a THF containing DNA' 
_struct.pdbx_descriptor              'FORMAMIDOPYRIMIDINE-DNA GLYCOSYLASE/DNA Complex' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4PDG 
_struct_keywords.text            'DNA GLYCOSYLASE, Hydrolase-DNA complex' 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 2   ? VAL A 18  ? GLU A 2   VAL A 18  1 ? 17 
HELX_P HELX_P2  AA2 TYR A 29  ? VAL A 33  ? TYR A 29  VAL A 33  5 ? 5  
HELX_P HELX_P3  AA3 GLY A 36  ? THR A 45  ? GLY A 36  THR A 45  1 ? 10 
HELX_P HELX_P4  AA4 GLN A 121 ? LYS A 129 ? GLN A 121 LYS A 129 1 ? 9  
HELX_P HELX_P5  AA5 ASP A 141 ? LYS A 151 ? ASP A 141 LYS A 151 1 ? 11 
HELX_P HELX_P6  AA6 LYS A 155 ? GLU A 162 ? LYS A 155 GLU A 162 1 ? 8  
HELX_P HELX_P7  AA7 GLY A 170 ? ALA A 181 ? GLY A 170 ALA A 181 1 ? 12 
HELX_P HELX_P8  AA8 GLU A 188 ? LEU A 192 ? GLU A 188 LEU A 192 5 ? 5  
HELX_P HELX_P9  AA9 ILE A 193 ? LEU A 214 ? ILE A 193 LEU A 214 1 ? 22 
HELX_P HELX_P10 AB1 LYS A 230 ? GLU A 234 ? LYS A 230 GLU A 234 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 245 SG    ? ? ? 1_555 A CYS 265 SG ? ? A CYS 245 A CYS 265 1_555 ? ? ? ? ? ? ?            2.024 ? 
disulf2  disulf ?    ? A CYS 248 SG    ? ? ? 1_555 D 2ON .   S2 ? ? A CYS 248 A 2ON 301 1_555 ? ? ? ? ? ? ?            2.003 ? 
covale1  covale both ? B DT  6   "O3'" ? ? ? 1_555 B 3DR 7   P  ? ? B DT  6   B 3DR 7   1_555 ? ? ? ? ? ? ?            1.586 ? 
covale2  covale both ? B 3DR 7   "O3'" ? ? ? 1_555 B DT  8   P  ? ? B 3DR 7   B DT  8   1_555 ? ? ? ? ? ? ?            1.596 ? 
hydrog1  hydrog ?    ? B DT  2   N3    ? ? ? 1_555 C DA  14  N1 ? ? B DT  2   C DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DT  2   O4    ? ? ? 1_555 C DA  14  N6 ? ? B DT  2   C DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DC  3   N3    ? ? ? 1_555 C DG  13  N1 ? ? B DC  3   C DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DC  3   N4    ? ? ? 1_555 C DG  13  O6 ? ? B DC  3   C DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DC  3   O2    ? ? ? 1_555 C DG  13  N2 ? ? B DC  3   C DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DT  4   N3    ? ? ? 1_555 C DA  12  N1 ? ? B DT  4   C DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DT  4   O4    ? ? ? 1_555 C DA  12  N6 ? ? B DT  4   C DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DT  5   N3    ? ? ? 1_555 C DA  11  N1 ? ? B DT  5   C DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DT  5   O4    ? ? ? 1_555 C DA  11  N6 ? ? B DT  5   C DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DT  6   N3    ? ? ? 1_555 C DA  10  N1 ? ? B DT  6   C DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DT  6   O4    ? ? ? 1_555 C DA  10  N6 ? ? B DT  6   C DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DT  8   N3    ? ? ? 1_555 C DA  8   N1 ? ? B DT  8   C DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DT  8   O4    ? ? ? 1_555 C DA  8   N6 ? ? B DT  8   C DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DT  9   N3    ? ? ? 1_555 C DA  7   N1 ? ? B DT  9   C DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DT  9   O4    ? ? ? 1_555 C DA  7   N6 ? ? B DT  9   C DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DT  10  N3    ? ? ? 1_555 C DA  6   N1 ? ? B DT  10  C DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DT  10  O4    ? ? ? 1_555 C DA  6   N6 ? ? B DT  10  C DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DC  11  N3    ? ? ? 1_555 C DG  5   N1 ? ? B DC  11  C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DC  11  N4    ? ? ? 1_555 C DG  5   O6 ? ? B DC  11  C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DC  11  O2    ? ? ? 1_555 C DG  5   N2 ? ? B DC  11  C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DT  12  N3    ? ? ? 1_555 C DA  4   N1 ? ? B DT  12  C DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DT  12  O4    ? ? ? 1_555 C DA  4   N6 ? ? B DT  12  C DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DC  13  N3    ? ? ? 1_555 C DG  3   N1 ? ? B DC  13  C DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DC  13  N4    ? ? ? 1_555 C DG  3   O6 ? ? B DC  13  C DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DC  13  O2    ? ? ? 1_555 C DG  3   N2 ? ? B DC  13  C DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DG  14  N1    ? ? ? 1_555 C DC  2   N3 ? ? B DG  14  C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DG  14  N2    ? ? ? 1_555 C DC  2   O2 ? ? B DG  14  C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DG  14  O6    ? ? ? 1_555 C DC  2   N4 ? ? B DG  14  C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 24  ? ALA A 27  ? SER A 24  ALA A 27  
AA1 2 ASP A 92  ? LYS A 97  ? ASP A 92  LYS A 97  
AA1 3 GLN A 102 ? ALA A 106 ? GLN A 102 ALA A 106 
AA1 4 LYS A 78  ? ALA A 82  ? LYS A 78  ALA A 82  
AA2 1 ILE A 49  ? ARG A 55  ? ILE A 49  ARG A 55  
AA2 2 TYR A 58  ? ILE A 63  ? TYR A 58  ILE A 63  
AA2 3 PHE A 67  ? HIS A 72  ? PHE A 67  HIS A 72  
AA2 4 THR A 113 ? SER A 118 ? THR A 113 SER A 118 
AA3 1 GLN A 253 ? VAL A 257 ? GLN A 253 VAL A 257 
AA3 2 ARG A 260 ? PHE A 264 ? ARG A 260 PHE A 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 26  ? N GLU A 26  O THR A 95  ? O THR A 95  
AA1 2 3 N HIS A 93  ? N HIS A 93  O TYR A 105 ? O TYR A 105 
AA1 3 4 O GLN A 102 ? O GLN A 102 N ALA A 82  ? N ALA A 82  
AA2 1 2 N GLN A 50  ? N GLN A 50  O GLU A 62  ? O GLU A 62  
AA2 2 3 N PHE A 61  ? N PHE A 61  O LEU A 69  ? O LEU A 69  
AA2 3 4 N ARG A 68  ? N ARG A 68  O ILE A 117 ? O ILE A 117 
AA3 1 2 N GLN A 253 ? N GLN A 253 O PHE A 264 ? O PHE A 264 
# 
_atom_sites.entry_id                    4PDG 
_atom_sites.fract_transf_matrix[1][1]   0.011044 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011044 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007176 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PRO A 1 1   ? 13.529  89.782  22.068  1.00 49.14  ? 1   PRO A N     1 
ATOM   2    C CA    . PRO A 1 1   ? 12.451  89.327  21.181  1.00 43.54  ? 1   PRO A CA    1 
ATOM   3    C C     . PRO A 1 1   ? 12.871  89.385  19.702  1.00 41.63  ? 1   PRO A C     1 
ATOM   4    O O     . PRO A 1 1   ? 13.547  90.331  19.279  1.00 41.76  ? 1   PRO A O     1 
ATOM   5    C CB    . PRO A 1 1   ? 11.322  90.333  21.445  1.00 45.98  ? 1   PRO A CB    1 
ATOM   6    C CG    . PRO A 1 1   ? 11.635  90.968  22.734  1.00 46.26  ? 1   PRO A CG    1 
ATOM   7    C CD    . PRO A 1 1   ? 13.084  90.792  23.047  1.00 45.52  ? 1   PRO A CD    1 
ATOM   8    N N     . GLU A 1 2   ? 12.455  88.401  18.914  1.00 39.15  ? 2   GLU A N     1 
ATOM   9    C CA    . GLU A 1 2   ? 12.640  88.471  17.460  1.00 38.19  ? 2   GLU A CA    1 
ATOM   10   C C     . GLU A 1 2   ? 11.260  88.630  16.850  1.00 40.86  ? 2   GLU A C     1 
ATOM   11   O O     . GLU A 1 2   ? 10.262  88.748  17.576  1.00 43.19  ? 2   GLU A O     1 
ATOM   12   C CB    . GLU A 1 2   ? 13.393  87.246  16.925  1.00 33.10  ? 2   GLU A CB    1 
ATOM   13   C CG    . GLU A 1 2   ? 14.591  86.916  17.843  1.00 36.48  ? 2   GLU A CG    1 
ATOM   14   C CD    . GLU A 1 2   ? 15.449  85.731  17.426  1.00 48.18  ? 2   GLU A CD    1 
ATOM   15   O OE1   . GLU A 1 2   ? 15.389  85.244  16.271  1.00 45.29  ? 2   GLU A OE1   1 
ATOM   16   O OE2   . GLU A 1 2   ? 16.240  85.293  18.285  1.00 60.42  ? 2   GLU A OE2   1 
ATOM   17   N N     . LEU A 1 3   ? 11.202  88.665  15.527  1.00 41.91  ? 3   LEU A N     1 
ATOM   18   C CA    . LEU A 1 3   ? 9.978   89.045  14.844  1.00 38.73  ? 3   LEU A CA    1 
ATOM   19   C C     . LEU A 1 3   ? 8.759   88.257  15.342  1.00 36.32  ? 3   LEU A C     1 
ATOM   20   O O     . LEU A 1 3   ? 7.692   88.857  15.554  1.00 38.20  ? 3   LEU A O     1 
ATOM   21   C CB    . LEU A 1 3   ? 10.147  88.895  13.328  1.00 37.56  ? 3   LEU A CB    1 
ATOM   22   C CG    . LEU A 1 3   ? 8.991   89.265  12.391  1.00 35.92  ? 3   LEU A CG    1 
ATOM   23   C CD1   . LEU A 1 3   ? 9.492   89.713  11.029  1.00 39.32  ? 3   LEU A CD1   1 
ATOM   24   C CD2   . LEU A 1 3   ? 8.067   88.110  12.217  1.00 33.26  ? 3   LEU A CD2   1 
ATOM   25   N N     . PRO A 1 4   ? 8.897   86.932  15.547  1.00 32.88  ? 4   PRO A N     1 
ATOM   26   C CA    . PRO A 1 4   ? 7.674   86.241  15.983  1.00 35.38  ? 4   PRO A CA    1 
ATOM   27   C C     . PRO A 1 4   ? 7.175   86.715  17.341  1.00 38.42  ? 4   PRO A C     1 
ATOM   28   O O     . PRO A 1 4   ? 5.966   86.798  17.532  1.00 42.48  ? 4   PRO A O     1 
ATOM   29   C CB    . PRO A 1 4   ? 8.098   84.775  16.048  1.00 37.02  ? 4   PRO A CB    1 
ATOM   30   C CG    . PRO A 1 4   ? 9.211   84.683  15.085  1.00 39.08  ? 4   PRO A CG    1 
ATOM   31   C CD    . PRO A 1 4   ? 9.969   85.968  15.259  1.00 35.45  ? 4   PRO A CD    1 
ATOM   32   N N     . GLU A 1 5   ? 8.081   87.079  18.243  1.00 37.67  ? 5   GLU A N     1 
ATOM   33   C CA    . GLU A 1 5   ? 7.676   87.511  19.573  1.00 38.44  ? 5   GLU A CA    1 
ATOM   34   C C     . GLU A 1 5   ? 7.066   88.897  19.464  1.00 38.49  ? 5   GLU A C     1 
ATOM   35   O O     . GLU A 1 5   ? 6.054   89.206  20.107  1.00 40.77  ? 5   GLU A O     1 
ATOM   36   C CB    . GLU A 1 5   ? 8.856   87.501  20.545  1.00 38.29  ? 5   GLU A CB    1 
ATOM   37   C CG    . GLU A 1 5   ? 9.393   86.097  20.840  1.00 44.40  ? 5   GLU A CG    1 
ATOM   38   C CD    . GLU A 1 5   ? 10.100  85.463  19.647  1.00 53.04  ? 5   GLU A CD    1 
ATOM   39   O OE1   . GLU A 1 5   ? 10.011  84.222  19.492  1.00 57.64  ? 5   GLU A OE1   1 
ATOM   40   O OE2   . GLU A 1 5   ? 10.737  86.209  18.860  1.00 51.27  ? 5   GLU A OE2   1 
ATOM   41   N N     . VAL A 1 6   ? 7.667   89.722  18.620  1.00 34.98  ? 6   VAL A N     1 
ATOM   42   C CA    . VAL A 1 6   ? 7.227   91.098  18.475  1.00 35.60  ? 6   VAL A CA    1 
ATOM   43   C C     . VAL A 1 6   ? 5.853   91.109  17.804  1.00 40.34  ? 6   VAL A C     1 
ATOM   44   O O     . VAL A 1 6   ? 4.992   91.906  18.161  1.00 40.66  ? 6   VAL A O     1 
ATOM   45   C CB    . VAL A 1 6   ? 8.268   91.919  17.656  1.00 38.56  ? 6   VAL A CB    1 
ATOM   46   C CG1   . VAL A 1 6   ? 7.735   93.302  17.270  1.00 35.24  ? 6   VAL A CG1   1 
ATOM   47   C CG2   . VAL A 1 6   ? 9.606   91.981  18.411  1.00 35.08  ? 6   VAL A CG2   1 
ATOM   48   N N     . GLU A 1 7   ? 5.652   90.206  16.838  1.00 37.78  ? 7   GLU A N     1 
ATOM   49   C CA    . GLU A 1 7   ? 4.350   90.072  16.192  1.00 37.78  ? 7   GLU A CA    1 
ATOM   50   C C     . GLU A 1 7   ? 3.294   89.559  17.167  1.00 36.78  ? 7   GLU A C     1 
ATOM   51   O O     . GLU A 1 7   ? 2.131   89.957  17.092  1.00 40.42  ? 7   GLU A O     1 
ATOM   52   C CB    . GLU A 1 7   ? 4.430   89.142  14.979  1.00 34.55  ? 7   GLU A CB    1 
ATOM   53   C CG    . GLU A 1 7   ? 3.112   88.808  14.334  1.00 36.18  ? 7   GLU A CG    1 
ATOM   54   C CD    . GLU A 1 7   ? 2.356   90.049  13.820  1.00 48.16  ? 7   GLU A CD    1 
ATOM   55   O OE1   . GLU A 1 7   ? 1.126   89.943  13.586  1.00 49.20  ? 7   GLU A OE1   1 
ATOM   56   O OE2   . GLU A 1 7   ? 2.987   91.122  13.643  1.00 49.00  ? 7   GLU A OE2   1 
ATOM   57   N N     . THR A 1 8   ? 3.688   88.683  18.084  1.00 35.24  ? 8   THR A N     1 
ATOM   58   C CA    . THR A 1 8   ? 2.743   88.199  19.106  1.00 39.51  ? 8   THR A CA    1 
ATOM   59   C C     . THR A 1 8   ? 2.270   89.346  20.002  1.00 39.48  ? 8   THR A C     1 
ATOM   60   O O     . THR A 1 8   ? 1.082   89.524  20.239  1.00 42.75  ? 8   THR A O     1 
ATOM   61   C CB    . THR A 1 8   ? 3.376   87.098  19.972  1.00 44.65  ? 8   THR A CB    1 
ATOM   62   O OG1   . THR A 1 8   ? 3.865   86.063  19.117  1.00 46.65  ? 8   THR A OG1   1 
ATOM   63   C CG2   . THR A 1 8   ? 2.349   86.472  20.894  1.00 33.27  ? 8   THR A CG2   1 
ATOM   64   N N     . VAL A 1 9   ? 3.222   90.150  20.456  1.00 38.99  ? 9   VAL A N     1 
ATOM   65   C CA    . VAL A 1 9   ? 2.960   91.320  21.278  1.00 36.72  ? 9   VAL A CA    1 
ATOM   66   C C     . VAL A 1 9   ? 2.067   92.315  20.555  1.00 38.67  ? 9   VAL A C     1 
ATOM   67   O O     . VAL A 1 9   ? 1.146   92.875  21.140  1.00 40.52  ? 9   VAL A O     1 
ATOM   68   C CB    . VAL A 1 9   ? 4.290   91.994  21.674  1.00 35.61  ? 9   VAL A CB    1 
ATOM   69   C CG1   . VAL A 1 9   ? 4.045   93.301  22.376  1.00 33.67  ? 9   VAL A CG1   1 
ATOM   70   C CG2   . VAL A 1 9   ? 5.081   91.049  22.585  1.00 36.70  ? 9   VAL A CG2   1 
ATOM   71   N N     . ARG A 1 10  ? 2.349   92.535  19.275  1.00 40.27  ? 10  ARG A N     1 
ATOM   72   C CA    . ARG A 1 10  ? 1.572   93.456  18.469  1.00 39.12  ? 10  ARG A CA    1 
ATOM   73   C C     . ARG A 1 10  ? 0.122   93.015  18.425  1.00 43.17  ? 10  ARG A C     1 
ATOM   74   O O     . ARG A 1 10  ? -0.778  93.836  18.488  1.00 44.47  ? 10  ARG A O     1 
ATOM   75   C CB    . ARG A 1 10  ? 2.126   93.536  17.040  1.00 42.50  ? 10  ARG A CB    1 
ATOM   76   C CG    . ARG A 1 10  ? 1.447   94.615  16.196  1.00 39.15  ? 10  ARG A CG    1 
ATOM   77   C CD    . ARG A 1 10  ? 1.570   94.327  14.732  1.00 43.64  ? 10  ARG A CD    1 
ATOM   78   N NE    . ARG A 1 10  ? 0.807   93.146  14.343  1.00 47.71  ? 10  ARG A NE    1 
ATOM   79   C CZ    . ARG A 1 10  ? -0.512  93.109  14.187  1.00 48.49  ? 10  ARG A CZ    1 
ATOM   80   N NH1   . ARG A 1 10  ? -1.262  94.190  14.396  1.00 48.45  ? 10  ARG A NH1   1 
ATOM   81   N NH2   . ARG A 1 10  ? -1.085  91.976  13.824  1.00 52.91  ? 10  ARG A NH2   1 
ATOM   82   N N     . ARG A 1 11  ? -0.105  91.708  18.328  1.00 42.29  ? 11  ARG A N     1 
ATOM   83   C CA    . ARG A 1 11  ? -1.467  91.206  18.209  1.00 48.93  ? 11  ARG A CA    1 
ATOM   84   C C     . ARG A 1 11  ? -2.227  91.357  19.514  1.00 49.65  ? 11  ARG A C     1 
ATOM   85   O O     . ARG A 1 11  ? -3.409  91.700  19.518  1.00 55.96  ? 11  ARG A O     1 
ATOM   86   C CB    . ARG A 1 11  ? -1.463  89.736  17.759  1.00 49.79  ? 11  ARG A CB    1 
ATOM   87   C CG    . ARG A 1 11  ? -0.910  89.540  16.343  1.00 52.15  ? 11  ARG A CG    1 
ATOM   88   C CD    . ARG A 1 11  ? -0.819  88.074  15.947  1.00 51.80  ? 11  ARG A CD    1 
ATOM   89   N NE    . ARG A 1 11  ? -0.392  87.895  14.566  1.00 54.74  ? 11  ARG A NE    1 
ATOM   90   C CZ    . ARG A 1 11  ? -0.497  86.742  13.899  1.00 62.86  ? 11  ARG A CZ    1 
ATOM   91   N NH1   . ARG A 1 11  ? -1.011  85.669  14.491  1.00 64.76  ? 11  ARG A NH1   1 
ATOM   92   N NH2   . ARG A 1 11  ? -0.092  86.656  12.638  1.00 62.09  ? 11  ARG A NH2   1 
ATOM   93   N N     . GLU A 1 12  ? -1.560  91.062  20.621  1.00 46.77  ? 12  GLU A N     1 
ATOM   94   C CA    . GLU A 1 12  ? -2.186  91.199  21.925  1.00 48.83  ? 12  GLU A CA    1 
ATOM   95   C C     . GLU A 1 12  ? -2.491  92.682  22.190  1.00 47.82  ? 12  GLU A C     1 
ATOM   96   O O     . GLU A 1 12  ? -3.580  93.020  22.621  1.00 47.07  ? 12  GLU A O     1 
ATOM   97   C CB    . GLU A 1 12  ? -1.295  90.617  23.026  1.00 46.47  ? 12  GLU A CB    1 
ATOM   98   N N     . LEU A 1 13  ? -1.545  93.567  21.898  1.00 43.71  ? 13  LEU A N     1 
ATOM   99   C CA    . LEU A 1 13  ? -1.801  94.983  22.089  1.00 46.57  ? 13  LEU A CA    1 
ATOM   100  C C     . LEU A 1 13  ? -2.926  95.505  21.189  1.00 48.57  ? 13  LEU A C     1 
ATOM   101  O O     . LEU A 1 13  ? -3.724  96.355  21.599  1.00 50.57  ? 13  LEU A O     1 
ATOM   102  C CB    . LEU A 1 13  ? -0.538  95.776  21.843  1.00 48.31  ? 13  LEU A CB    1 
ATOM   103  C CG    . LEU A 1 13  ? 0.500   95.646  22.946  1.00 45.86  ? 13  LEU A CG    1 
ATOM   104  C CD1   . LEU A 1 13  ? 1.658   96.551  22.640  1.00 37.10  ? 13  LEU A CD1   1 
ATOM   105  C CD2   . LEU A 1 13  ? -0.169  96.040  24.239  1.00 52.18  ? 13  LEU A CD2   1 
ATOM   106  N N     . GLU A 1 14  ? -2.992  94.986  19.969  1.00 45.80  ? 14  GLU A N     1 
ATOM   107  C CA    . GLU A 1 14  ? -4.009  95.403  19.021  1.00 49.43  ? 14  GLU A CA    1 
ATOM   108  C C     . GLU A 1 14  ? -5.390  95.079  19.581  1.00 55.52  ? 14  GLU A C     1 
ATOM   109  O O     . GLU A 1 14  ? -6.301  95.905  19.487  1.00 55.85  ? 14  GLU A O     1 
ATOM   110  C CB    . GLU A 1 14  ? -3.786  94.732  17.665  1.00 49.14  ? 14  GLU A CB    1 
ATOM   111  C CG    . GLU A 1 14  ? -4.597  95.308  16.534  1.00 59.69  ? 14  GLU A CG    1 
ATOM   112  C CD    . GLU A 1 14  ? -4.336  94.590  15.204  1.00 72.64  ? 14  GLU A CD    1 
ATOM   113  O OE1   . GLU A 1 14  ? -3.853  95.240  14.239  1.00 76.54  ? 14  GLU A OE1   1 
ATOM   114  O OE2   . GLU A 1 14  ? -4.612  93.372  15.122  1.00 76.00  ? 14  GLU A OE2   1 
ATOM   115  N N     . LYS A 1 15  ? -5.530  93.892  20.185  1.00 54.45  ? 15  LYS A N     1 
ATOM   116  C CA    . LYS A 1 15  ? -6.799  93.463  20.787  1.00 55.77  ? 15  LYS A CA    1 
ATOM   117  C C     . LYS A 1 15  ? -7.220  94.323  21.977  1.00 56.16  ? 15  LYS A C     1 
ATOM   118  O O     . LYS A 1 15  ? -8.409  94.505  22.215  1.00 66.78  ? 15  LYS A O     1 
ATOM   119  C CB    . LYS A 1 15  ? -6.724  91.991  21.235  1.00 57.01  ? 15  LYS A CB    1 
ATOM   120  C CG    . LYS A 1 15  ? -6.701  90.946  20.110  1.00 55.92  ? 15  LYS A CG    1 
ATOM   121  N N     . ARG A 1 16  ? -6.256  94.855  22.722  1.00 53.56  ? 16  ARG A N     1 
ATOM   122  C CA    . ARG A 1 16  ? -6.541  95.509  24.002  1.00 51.18  ? 16  ARG A CA    1 
ATOM   123  C C     . ARG A 1 16  ? -6.541  97.047  24.005  1.00 51.62  ? 16  ARG A C     1 
ATOM   124  O O     . ARG A 1 16  ? -7.449  97.672  24.595  1.00 60.04  ? 16  ARG A O     1 
ATOM   125  C CB    . ARG A 1 16  ? -5.533  95.051  25.049  1.00 50.85  ? 16  ARG A CB    1 
ATOM   126  C CG    . ARG A 1 16  ? -5.282  93.572  25.103  1.00 52.14  ? 16  ARG A CG    1 
ATOM   127  C CD    . ARG A 1 16  ? -6.181  92.886  26.051  1.00 62.70  ? 16  ARG A CD    1 
ATOM   128  N NE    . ARG A 1 16  ? -5.970  93.270  27.445  1.00 69.87  ? 16  ARG A NE    1 
ATOM   129  C CZ    . ARG A 1 16  ? -4.972  92.830  28.211  1.00 64.42  ? 16  ARG A CZ    1 
ATOM   130  N NH1   . ARG A 1 16  ? -4.044  92.004  27.710  1.00 57.42  ? 16  ARG A NH1   1 
ATOM   131  N NH2   . ARG A 1 16  ? -4.905  93.235  29.476  1.00 58.23  ? 16  ARG A NH2   1 
ATOM   132  N N     . ILE A 1 17  ? -5.528  97.669  23.401  1.00 44.69  ? 17  ILE A N     1 
ATOM   133  C CA    . ILE A 1 17  ? -5.345  99.111  23.623  1.00 45.58  ? 17  ILE A CA    1 
ATOM   134  C C     . ILE A 1 17  ? -5.795  100.005 22.465  1.00 47.14  ? 17  ILE A C     1 
ATOM   135  O O     . ILE A 1 17  ? -5.870  101.227 22.603  1.00 46.33  ? 17  ILE A O     1 
ATOM   136  C CB    . ILE A 1 17  ? -3.871  99.462  23.963  1.00 42.92  ? 17  ILE A CB    1 
ATOM   137  C CG1   . ILE A 1 17  ? -2.972  99.380  22.727  1.00 43.44  ? 17  ILE A CG1   1 
ATOM   138  C CG2   . ILE A 1 17  ? -3.349  98.587  25.119  1.00 40.70  ? 17  ILE A CG2   1 
ATOM   139  C CD1   . ILE A 1 17  ? -1.523  99.801  23.019  1.00 44.20  ? 17  ILE A CD1   1 
ATOM   140  N N     . VAL A 1 18  ? -6.111  99.405  21.325  1.00 49.64  ? 18  VAL A N     1 
ATOM   141  C CA    . VAL A 1 18  ? -6.572  100.204 20.208  1.00 50.07  ? 18  VAL A CA    1 
ATOM   142  C C     . VAL A 1 18  ? -7.954  100.796 20.509  1.00 54.63  ? 18  VAL A C     1 
ATOM   143  O O     . VAL A 1 18  ? -8.907  100.085 20.837  1.00 56.23  ? 18  VAL A O     1 
ATOM   144  C CB    . VAL A 1 18  ? -6.604  99.391  18.906  1.00 52.62  ? 18  VAL A CB    1 
ATOM   145  C CG1   . VAL A 1 18  ? -7.248  100.220 17.810  1.00 53.23  ? 18  VAL A CG1   1 
ATOM   146  C CG2   . VAL A 1 18  ? -5.176  98.979  18.504  1.00 52.49  ? 18  VAL A CG2   1 
ATOM   147  N N     . GLY A 1 19  ? -8.050  102.116 20.412  1.00 52.32  ? 19  GLY A N     1 
ATOM   148  C CA    . GLY A 1 19  ? -9.299  102.792 20.660  1.00 44.70  ? 19  GLY A CA    1 
ATOM   149  C C     . GLY A 1 19  ? -9.199  103.529 21.975  1.00 48.18  ? 19  GLY A C     1 
ATOM   150  O O     . GLY A 1 19  ? -10.072 104.279 22.335  1.00 53.81  ? 19  GLY A O     1 
ATOM   151  N N     . GLN A 1 20  ? -8.123  103.327 22.707  1.00 49.07  ? 20  GLN A N     1 
ATOM   152  C CA    . GLN A 1 20  ? -8.041  103.966 23.999  1.00 53.28  ? 20  GLN A CA    1 
ATOM   153  C C     . GLN A 1 20  ? -7.290  105.294 23.939  1.00 50.53  ? 20  GLN A C     1 
ATOM   154  O O     . GLN A 1 20  ? -6.291  105.445 23.236  1.00 48.63  ? 20  GLN A O     1 
ATOM   155  C CB    . GLN A 1 20  ? -7.420  103.000 25.010  1.00 61.76  ? 20  GLN A CB    1 
ATOM   156  C CG    . GLN A 1 20  ? -8.450  101.936 25.417  1.00 74.31  ? 20  GLN A CG    1 
ATOM   157  C CD    . GLN A 1 20  ? -7.955  100.962 26.453  1.00 84.77  ? 20  GLN A CD    1 
ATOM   158  O OE1   . GLN A 1 20  ? -6.837  101.080 26.939  1.00 87.99  ? 20  GLN A OE1   1 
ATOM   159  N NE2   . GLN A 1 20  ? -8.793  99.980  26.799  1.00 92.71  ? 20  GLN A NE2   1 
ATOM   160  N N     . LYS A 1 21  ? -7.810  106.267 24.668  1.00 51.14  ? 21  LYS A N     1 
ATOM   161  C CA    . LYS A 1 21  ? -7.203  107.582 24.781  1.00 43.52  ? 21  LYS A CA    1 
ATOM   162  C C     . LYS A 1 21  ? -6.082  107.565 25.804  1.00 42.54  ? 21  LYS A C     1 
ATOM   163  O O     . LYS A 1 21  ? -6.263  107.050 26.929  1.00 42.91  ? 21  LYS A O     1 
ATOM   164  C CB    . LYS A 1 21  ? -8.263  108.589 25.176  1.00 43.06  ? 21  LYS A CB    1 
ATOM   165  C CG    . LYS A 1 21  ? -7.802  110.007 25.142  1.00 47.15  ? 21  LYS A CG    1 
ATOM   166  C CD    . LYS A 1 21  ? -8.890  110.885 25.737  1.00 58.33  ? 21  LYS A CD    1 
ATOM   167  C CE    . LYS A 1 21  ? -8.344  112.244 26.183  1.00 70.46  ? 21  LYS A CE    1 
ATOM   168  N NZ    . LYS A 1 21  ? -9.362  113.046 26.924  1.00 79.30  ? 21  LYS A NZ    1 
ATOM   169  N N     . ILE A 1 22  ? -4.915  108.078 25.419  1.00 34.60  ? 22  ILE A N     1 
ATOM   170  C CA    . ILE A 1 22  ? -3.826  108.234 26.371  1.00 33.21  ? 22  ILE A CA    1 
ATOM   171  C C     . ILE A 1 22  ? -4.139  109.359 27.337  1.00 44.73  ? 22  ILE A C     1 
ATOM   172  O O     . ILE A 1 22  ? -4.313  110.513 26.937  1.00 43.94  ? 22  ILE A O     1 
ATOM   173  C CB    . ILE A 1 22  ? -2.502  108.517 25.677  1.00 34.76  ? 22  ILE A CB    1 
ATOM   174  C CG1   . ILE A 1 22  ? -2.077  107.310 24.835  1.00 37.89  ? 22  ILE A CG1   1 
ATOM   175  C CG2   . ILE A 1 22  ? -1.436  108.853 26.698  1.00 31.28  ? 22  ILE A CG2   1 
ATOM   176  C CD1   . ILE A 1 22  ? -1.069  107.629 23.748  1.00 36.97  ? 22  ILE A CD1   1 
ATOM   177  N N     . ILE A 1 23  ? -4.245  109.027 28.618  1.00 46.87  ? 23  ILE A N     1 
ATOM   178  C CA    . ILE A 1 23  ? -4.540  110.043 29.616  1.00 36.46  ? 23  ILE A CA    1 
ATOM   179  C C     . ILE A 1 23  ? -3.262  110.737 30.085  1.00 41.52  ? 23  ILE A C     1 
ATOM   180  O O     . ILE A 1 23  ? -3.238  111.942 30.255  1.00 46.61  ? 23  ILE A O     1 
ATOM   181  C CB    . ILE A 1 23  ? -5.279  109.450 30.810  1.00 43.55  ? 23  ILE A CB    1 
ATOM   182  C CG1   . ILE A 1 23  ? -6.510  108.680 30.329  1.00 47.06  ? 23  ILE A CG1   1 
ATOM   183  C CG2   . ILE A 1 23  ? -5.733  110.540 31.730  1.00 39.76  ? 23  ILE A CG2   1 
ATOM   184  C CD1   . ILE A 1 23  ? -7.587  109.545 29.675  1.00 47.71  ? 23  ILE A CD1   1 
ATOM   185  N N     . SER A 1 24  ? -2.192  109.987 30.293  1.00 38.60  ? 24  SER A N     1 
ATOM   186  C CA    . SER A 1 24  ? -0.922  110.600 30.624  1.00 39.33  ? 24  SER A CA    1 
ATOM   187  C C     . SER A 1 24  ? 0.203   109.630 30.322  1.00 40.09  ? 24  SER A C     1 
ATOM   188  O O     . SER A 1 24  ? -0.034  108.462 30.077  1.00 40.19  ? 24  SER A O     1 
ATOM   189  C CB    . SER A 1 24  ? -0.887  111.031 32.084  1.00 46.19  ? 24  SER A CB    1 
ATOM   190  O OG    . SER A 1 24  ? -0.648  109.918 32.902  1.00 58.57  ? 24  SER A OG    1 
ATOM   191  N N     . ILE A 1 25  ? 1.426   110.142 30.293  1.00 43.06  ? 25  ILE A N     1 
ATOM   192  C CA    . ILE A 1 25  ? 2.608   109.335 30.038  1.00 41.74  ? 25  ILE A CA    1 
ATOM   193  C C     . ILE A 1 25  ? 3.660   109.686 31.082  1.00 45.79  ? 25  ILE A C     1 
ATOM   194  O O     . ILE A 1 25  ? 3.965   110.865 31.300  1.00 51.93  ? 25  ILE A O     1 
ATOM   195  C CB    . ILE A 1 25  ? 3.155   109.555 28.625  1.00 44.99  ? 25  ILE A CB    1 
ATOM   196  C CG1   . ILE A 1 25  ? 2.143   109.023 27.600  1.00 51.57  ? 25  ILE A CG1   1 
ATOM   197  C CG2   . ILE A 1 25  ? 4.494   108.855 28.464  1.00 38.50  ? 25  ILE A CG2   1 
ATOM   198  C CD1   . ILE A 1 25  ? 2.532   109.217 26.174  1.00 55.23  ? 25  ILE A CD1   1 
ATOM   199  N N     . GLU A 1 26  ? 4.183   108.674 31.764  1.00 42.05  ? 26  GLU A N     1 
ATOM   200  C CA    . GLU A 1 26  ? 5.153   108.913 32.824  1.00 46.36  ? 26  GLU A CA    1 
ATOM   201  C C     . GLU A 1 26  ? 6.377   108.063 32.623  1.00 41.83  ? 26  GLU A C     1 
ATOM   202  O O     . GLU A 1 26  ? 6.284   106.952 32.105  1.00 38.34  ? 26  GLU A O     1 
ATOM   203  C CB    . GLU A 1 26  ? 4.538   108.629 34.188  1.00 52.86  ? 26  GLU A CB    1 
ATOM   204  C CG    . GLU A 1 26  ? 3.423   109.587 34.526  1.00 66.73  ? 26  GLU A CG    1 
ATOM   205  C CD    . GLU A 1 26  ? 2.713   109.250 35.821  1.00 79.77  ? 26  GLU A CD    1 
ATOM   206  O OE1   . GLU A 1 26  ? 3.121   108.287 36.528  1.00 81.66  ? 26  GLU A OE1   1 
ATOM   207  O OE2   . GLU A 1 26  ? 1.733   109.965 36.131  1.00 87.28  ? 26  GLU A OE2   1 
ATOM   208  N N     . ALA A 1 27  ? 7.522   108.576 33.060  1.00 44.29  ? 27  ALA A N     1 
ATOM   209  C CA    . ALA A 1 27  ? 8.800   107.894 32.839  1.00 43.82  ? 27  ALA A CA    1 
ATOM   210  C C     . ALA A 1 27  ? 9.689   107.909 34.085  1.00 49.01  ? 27  ALA A C     1 
ATOM   211  O O     . ALA A 1 27  ? 9.813   108.930 34.741  1.00 50.94  ? 27  ALA A O     1 
ATOM   212  C CB    . ALA A 1 27  ? 9.535   108.537 31.665  1.00 34.44  ? 27  ALA A CB    1 
ATOM   213  N N     . THR A 1 28  ? 10.310  106.786 34.425  1.00 47.37  ? 28  THR A N     1 
ATOM   214  C CA    . THR A 1 28  ? 11.399  106.860 35.392  1.00 48.89  ? 28  THR A CA    1 
ATOM   215  C C     . THR A 1 28  ? 12.718  106.800 34.631  1.00 50.57  ? 28  THR A C     1 
ATOM   216  O O     . THR A 1 28  ? 13.771  107.072 35.198  1.00 48.56  ? 28  THR A O     1 
ATOM   217  C CB    . THR A 1 28  ? 11.358  105.739 36.447  1.00 47.57  ? 28  THR A CB    1 
ATOM   218  O OG1   . THR A 1 28  ? 11.392  104.463 35.803  1.00 48.15  ? 28  THR A OG1   1 
ATOM   219  C CG2   . THR A 1 28  ? 10.113  105.858 37.305  1.00 43.54  ? 28  THR A CG2   1 
ATOM   220  N N     . TYR A 1 29  ? 12.649  106.458 33.341  1.00 48.40  ? 29  TYR A N     1 
ATOM   221  C CA    . TYR A 1 29  ? 13.857  106.398 32.530  1.00 47.14  ? 29  TYR A CA    1 
ATOM   222  C C     . TYR A 1 29  ? 13.612  107.032 31.162  1.00 43.66  ? 29  TYR A C     1 
ATOM   223  O O     . TYR A 1 29  ? 13.457  106.337 30.159  1.00 40.83  ? 29  TYR A O     1 
ATOM   224  C CB    . TYR A 1 29  ? 14.328  104.943 32.393  1.00 43.12  ? 29  TYR A CB    1 
ATOM   225  C CG    . TYR A 1 29  ? 15.698  104.781 31.777  1.00 40.65  ? 29  TYR A CG    1 
ATOM   226  C CD1   . TYR A 1 29  ? 16.850  105.198 32.441  1.00 39.40  ? 29  TYR A CD1   1 
ATOM   227  C CD2   . TYR A 1 29  ? 15.840  104.174 30.537  1.00 43.13  ? 29  TYR A CD2   1 
ATOM   228  C CE1   . TYR A 1 29  ? 18.096  105.030 31.862  1.00 41.69  ? 29  TYR A CE1   1 
ATOM   229  C CE2   . TYR A 1 29  ? 17.069  104.003 29.961  1.00 40.78  ? 29  TYR A CE2   1 
ATOM   230  C CZ    . TYR A 1 29  ? 18.187  104.428 30.617  1.00 44.27  ? 29  TYR A CZ    1 
ATOM   231  O OH    . TYR A 1 29  ? 19.391  104.224 29.990  1.00 52.79  ? 29  TYR A OH    1 
ATOM   232  N N     . PRO A 1 30  ? 13.565  108.366 31.131  1.00 42.68  ? 30  PRO A N     1 
ATOM   233  C CA    . PRO A 1 30  ? 13.208  109.107 29.909  1.00 39.85  ? 30  PRO A CA    1 
ATOM   234  C C     . PRO A 1 30  ? 14.299  109.001 28.863  1.00 42.59  ? 30  PRO A C     1 
ATOM   235  O O     . PRO A 1 30  ? 14.009  109.259 27.710  1.00 45.55  ? 30  PRO A O     1 
ATOM   236  C CB    . PRO A 1 30  ? 13.045  110.565 30.393  1.00 41.67  ? 30  PRO A CB    1 
ATOM   237  C CG    . PRO A 1 30  ? 13.755  110.610 31.766  1.00 41.06  ? 30  PRO A CG    1 
ATOM   238  C CD    . PRO A 1 30  ? 13.763  109.230 32.319  1.00 42.14  ? 30  PRO A CD    1 
ATOM   239  N N     . ARG A 1 31  ? 15.510  108.596 29.238  1.00 41.71  ? 31  ARG A N     1 
ATOM   240  C CA    . ARG A 1 31  ? 16.603  108.468 28.265  1.00 42.90  ? 31  ARG A CA    1 
ATOM   241  C C     . ARG A 1 31  ? 16.294  107.418 27.190  1.00 48.58  ? 31  ARG A C     1 
ATOM   242  O O     . ARG A 1 31  ? 16.899  107.419 26.115  1.00 50.75  ? 31  ARG A O     1 
ATOM   243  C CB    . ARG A 1 31  ? 17.942  108.122 28.951  1.00 37.05  ? 31  ARG A CB    1 
ATOM   244  N N     . MET A 1 32  ? 15.359  106.512 27.437  1.00 41.99  ? 32  MET A N     1 
ATOM   245  C CA    . MET A 1 32  ? 15.086  105.568 26.358  1.00 38.34  ? 32  MET A CA    1 
ATOM   246  C C     . MET A 1 32  ? 14.144  106.146 25.271  1.00 36.41  ? 32  MET A C     1 
ATOM   247  O O     . MET A 1 32  ? 13.884  105.486 24.278  1.00 34.44  ? 32  MET A O     1 
ATOM   248  C CB    . MET A 1 32  ? 14.497  104.291 26.917  1.00 33.48  ? 32  MET A CB    1 
ATOM   249  C CG    . MET A 1 32  ? 13.147  104.509 27.549  1.00 34.83  ? 32  MET A CG    1 
ATOM   250  S SD    . MET A 1 32  ? 12.261  102.961 27.818  1.00 44.11  ? 32  MET A SD    1 
ATOM   251  C CE    . MET A 1 32  ? 11.786  102.511 26.110  1.00 30.10  ? 32  MET A CE    1 
ATOM   252  N N     . VAL A 1 33  ? 13.603  107.347 25.487  1.00 35.59  ? 33  VAL A N     1 
ATOM   253  C CA    . VAL A 1 33  ? 12.841  108.031 24.450  1.00 33.27  ? 33  VAL A CA    1 
ATOM   254  C C     . VAL A 1 33  ? 13.817  108.872 23.630  1.00 36.76  ? 33  VAL A C     1 
ATOM   255  O O     . VAL A 1 33  ? 14.195  109.989 24.022  1.00 39.05  ? 33  VAL A O     1 
ATOM   256  C CB    . VAL A 1 33  ? 11.719  108.908 25.031  1.00 35.73  ? 33  VAL A CB    1 
ATOM   257  C CG1   . VAL A 1 33  ? 10.877  109.548 23.888  1.00 27.12  ? 33  VAL A CG1   1 
ATOM   258  C CG2   . VAL A 1 33  ? 10.821  108.069 25.982  1.00 27.04  ? 33  VAL A CG2   1 
ATOM   259  N N     . LEU A 1 34  ? 14.260  108.314 22.507  1.00 31.87  ? 34  LEU A N     1 
ATOM   260  C CA    . LEU A 1 34  ? 15.392  108.901 21.780  1.00 33.58  ? 34  LEU A CA    1 
ATOM   261  C C     . LEU A 1 34  ? 15.062  110.268 21.182  1.00 37.38  ? 34  LEU A C     1 
ATOM   262  O O     . LEU A 1 34  ? 15.949  111.079 20.993  1.00 38.71  ? 34  LEU A O     1 
ATOM   263  C CB    . LEU A 1 34  ? 15.863  107.969 20.665  1.00 32.24  ? 34  LEU A CB    1 
ATOM   264  C CG    . LEU A 1 34  ? 16.288  106.565 21.090  1.00 35.53  ? 34  LEU A CG    1 
ATOM   265  C CD1   . LEU A 1 34  ? 17.053  105.891 19.930  1.00 35.86  ? 34  LEU A CD1   1 
ATOM   266  C CD2   . LEU A 1 34  ? 17.159  106.633 22.350  1.00 29.20  ? 34  LEU A CD2   1 
ATOM   267  N N     . THR A 1 35  ? 13.782  110.510 20.901  1.00 38.26  ? 35  THR A N     1 
ATOM   268  C CA    . THR A 1 35  ? 13.351  111.733 20.253  1.00 38.63  ? 35  THR A CA    1 
ATOM   269  C C     . THR A 1 35  ? 12.931  112.779 21.266  1.00 41.09  ? 35  THR A C     1 
ATOM   270  O O     . THR A 1 35  ? 12.448  113.853 20.879  1.00 39.71  ? 35  THR A O     1 
ATOM   271  C CB    . THR A 1 35  ? 12.173  111.470 19.315  1.00 37.28  ? 35  THR A CB    1 
ATOM   272  O OG1   . THR A 1 35  ? 11.207  110.657 20.009  1.00 34.61  ? 35  THR A OG1   1 
ATOM   273  C CG2   . THR A 1 35  ? 12.651  110.749 18.057  1.00 29.15  ? 35  THR A CG2   1 
ATOM   274  N N     . GLY A 1 36  ? 13.089  112.459 22.553  1.00 37.56  ? 36  GLY A N     1 
ATOM   275  C CA    . GLY A 1 36  ? 12.849  113.434 23.612  1.00 41.00  ? 36  GLY A CA    1 
ATOM   276  C C     . GLY A 1 36  ? 11.564  113.176 24.380  1.00 40.70  ? 36  GLY A C     1 
ATOM   277  O O     . GLY A 1 36  ? 10.475  113.188 23.816  1.00 45.64  ? 36  GLY A O     1 
ATOM   278  N N     . PHE A 1 37  ? 11.678  112.949 25.677  1.00 39.39  ? 37  PHE A N     1 
ATOM   279  C CA    . PHE A 1 37  ? 10.516  112.503 26.411  1.00 42.20  ? 37  PHE A CA    1 
ATOM   280  C C     . PHE A 1 37  ? 9.455   113.607 26.561  1.00 42.72  ? 37  PHE A C     1 
ATOM   281  O O     . PHE A 1 37  ? 8.262   113.354 26.381  1.00 44.02  ? 37  PHE A O     1 
ATOM   282  C CB    . PHE A 1 37  ? 10.921  111.955 27.784  1.00 36.51  ? 37  PHE A CB    1 
ATOM   283  C CG    . PHE A 1 37  ? 9.738   111.607 28.652  1.00 37.12  ? 37  PHE A CG    1 
ATOM   284  C CD1   . PHE A 1 37  ? 8.992   110.477 28.402  1.00 41.30  ? 37  PHE A CD1   1 
ATOM   285  C CD2   . PHE A 1 37  ? 9.359   112.426 29.691  1.00 39.77  ? 37  PHE A CD2   1 
ATOM   286  C CE1   . PHE A 1 37  ? 7.880   110.172 29.167  1.00 44.87  ? 37  PHE A CE1   1 
ATOM   287  C CE2   . PHE A 1 37  ? 8.261   112.128 30.470  1.00 46.75  ? 37  PHE A CE2   1 
ATOM   288  C CZ    . PHE A 1 37  ? 7.515   110.992 30.201  1.00 47.98  ? 37  PHE A CZ    1 
ATOM   289  N N     . GLU A 1 38  ? 9.867   114.820 26.900  1.00 45.03  ? 38  GLU A N     1 
ATOM   290  C CA    . GLU A 1 38  ? 8.904   115.907 27.077  1.00 47.65  ? 38  GLU A CA    1 
ATOM   291  C C     . GLU A 1 38  ? 8.059   116.131 25.806  1.00 48.58  ? 38  GLU A C     1 
ATOM   292  O O     . GLU A 1 38  ? 6.843   116.262 25.871  1.00 46.69  ? 38  GLU A O     1 
ATOM   293  C CB    . GLU A 1 38  ? 9.618   117.198 27.462  1.00 42.32  ? 38  GLU A CB    1 
ATOM   294  N N     . GLN A 1 39  ? 8.727   116.152 24.661  1.00 45.70  ? 39  GLN A N     1 
ATOM   295  C CA    . GLN A 1 39  ? 8.090   116.230 23.351  1.00 49.02  ? 39  GLN A CA    1 
ATOM   296  C C     . GLN A 1 39  ? 7.053   115.107 23.141  1.00 44.36  ? 39  GLN A C     1 
ATOM   297  O O     . GLN A 1 39  ? 5.916   115.350 22.742  1.00 44.72  ? 39  GLN A O     1 
ATOM   298  C CB    . GLN A 1 39  ? 9.179   116.187 22.260  1.00 53.47  ? 39  GLN A CB    1 
ATOM   299  C CG    . GLN A 1 39  ? 10.221  117.377 22.344  1.00 90.40  ? 39  GLN A CG    1 
ATOM   300  C CD    . GLN A 1 39  ? 11.546  117.126 23.173  1.00 70.35  ? 39  GLN A CD    1 
ATOM   301  O OE1   . GLN A 1 39  ? 11.531  116.715 24.339  1.00 57.28  ? 39  GLN A OE1   1 
ATOM   302  N NE2   . GLN A 1 39  ? 12.684  117.429 22.545  1.00 78.38  ? 39  GLN A NE2   1 
ATOM   303  N N     . LEU A 1 40  ? 7.447   113.879 23.428  1.00 39.18  ? 40  LEU A N     1 
ATOM   304  C CA    . LEU A 1 40  ? 6.552   112.750 23.299  1.00 44.57  ? 40  LEU A CA    1 
ATOM   305  C C     . LEU A 1 40  ? 5.335   112.883 24.236  1.00 47.16  ? 40  LEU A C     1 
ATOM   306  O O     . LEU A 1 40  ? 4.190   112.651 23.845  1.00 51.05  ? 40  LEU A O     1 
ATOM   307  C CB    . LEU A 1 40  ? 7.309   111.446 23.588  1.00 44.88  ? 40  LEU A CB    1 
ATOM   308  C CG    . LEU A 1 40  ? 6.426   110.192 23.493  1.00 45.19  ? 40  LEU A CG    1 
ATOM   309  C CD1   . LEU A 1 40  ? 7.117   109.136 22.703  1.00 38.12  ? 40  LEU A CD1   1 
ATOM   310  C CD2   . LEU A 1 40  ? 6.029   109.661 24.894  1.00 46.56  ? 40  LEU A CD2   1 
ATOM   311  N N     . LYS A 1 41  ? 5.602   113.276 25.469  1.00 41.33  ? 41  LYS A N     1 
ATOM   312  C CA    . LYS A 1 41  ? 4.569   113.490 26.451  1.00 42.05  ? 41  LYS A CA    1 
ATOM   313  C C     . LYS A 1 41  ? 3.605   114.588 25.986  1.00 46.16  ? 41  LYS A C     1 
ATOM   314  O O     . LYS A 1 41  ? 2.375   114.434 26.013  1.00 46.69  ? 41  LYS A O     1 
ATOM   315  C CB    . LYS A 1 41  ? 5.243   113.843 27.781  1.00 44.37  ? 41  LYS A CB    1 
ATOM   316  C CG    . LYS A 1 41  ? 4.371   113.988 28.994  1.00 43.39  ? 41  LYS A CG    1 
ATOM   317  C CD    . LYS A 1 41  ? 5.227   114.330 30.203  1.00 43.46  ? 41  LYS A CD    1 
ATOM   318  C CE    . LYS A 1 41  ? 4.353   114.584 31.445  1.00 55.45  ? 41  LYS A CE    1 
ATOM   319  N NZ    . LYS A 1 41  ? 3.742   113.320 31.992  1.00 65.74  ? 41  LYS A NZ    1 
ATOM   320  N N     . LYS A 1 42  ? 4.171   115.702 25.549  1.00 48.34  ? 42  LYS A N     1 
ATOM   321  C CA    . LYS A 1 42  ? 3.371   116.829 25.107  1.00 49.75  ? 42  LYS A CA    1 
ATOM   322  C C     . LYS A 1 42  ? 2.534   116.471 23.873  1.00 55.50  ? 42  LYS A C     1 
ATOM   323  O O     . LYS A 1 42  ? 1.370   116.840 23.799  1.00 60.46  ? 42  LYS A O     1 
ATOM   324  C CB    . LYS A 1 42  ? 4.273   118.030 24.832  1.00 50.27  ? 42  LYS A CB    1 
ATOM   325  C CG    . LYS A 1 42  ? 3.618   119.154 24.043  1.00 58.72  ? 42  LYS A CG    1 
ATOM   326  N N     . GLU A 1 43  ? 3.103   115.730 22.922  1.00 51.84  ? 43  GLU A N     1 
ATOM   327  C CA    . GLU A 1 43  ? 2.361   115.383 21.714  1.00 46.82  ? 43  GLU A CA    1 
ATOM   328  C C     . GLU A 1 43  ? 1.297   114.309 21.912  1.00 46.03  ? 43  GLU A C     1 
ATOM   329  O O     . GLU A 1 43  ? 0.190   114.450 21.429  1.00 47.77  ? 43  GLU A O     1 
ATOM   330  C CB    . GLU A 1 43  ? 3.306   114.899 20.607  1.00 51.16  ? 43  GLU A CB    1 
ATOM   331  C CG    . GLU A 1 43  ? 4.229   115.944 20.025  1.00 57.05  ? 43  GLU A CG    1 
ATOM   332  C CD    . GLU A 1 43  ? 3.503   117.078 19.309  1.00 65.85  ? 43  GLU A CD    1 
ATOM   333  O OE1   . GLU A 1 43  ? 2.280   116.980 19.035  1.00 65.40  ? 43  GLU A OE1   1 
ATOM   334  O OE2   . GLU A 1 43  ? 4.172   118.087 19.016  1.00 74.37  ? 43  GLU A OE2   1 
ATOM   335  N N     . LEU A 1 44  ? 1.650   113.207 22.574  1.00 44.60  ? 44  LEU A N     1 
ATOM   336  C CA    . LEU A 1 44  ? 0.793   112.024 22.574  1.00 41.74  ? 44  LEU A CA    1 
ATOM   337  C C     . LEU A 1 44  ? -0.375  112.065 23.559  1.00 43.21  ? 44  LEU A C     1 
ATOM   338  O O     . LEU A 1 44  ? -1.380  111.364 23.383  1.00 46.63  ? 44  LEU A O     1 
ATOM   339  C CB    . LEU A 1 44  ? 1.623   110.781 22.861  1.00 35.83  ? 44  LEU A CB    1 
ATOM   340  C CG    . LEU A 1 44  ? 2.653   110.430 21.801  1.00 37.75  ? 44  LEU A CG    1 
ATOM   341  C CD1   . LEU A 1 44  ? 3.064   109.012 22.047  1.00 36.74  ? 44  LEU A CD1   1 
ATOM   342  C CD2   . LEU A 1 44  ? 2.097   110.652 20.384  1.00 36.71  ? 44  LEU A CD2   1 
ATOM   343  N N     . THR A 1 45  ? -0.230  112.862 24.606  1.00 39.71  ? 45  THR A N     1 
ATOM   344  C CA    . THR A 1 45  ? -1.247  112.961 25.643  1.00 42.19  ? 45  THR A CA    1 
ATOM   345  C C     . THR A 1 45  ? -2.563  113.515 25.094  1.00 47.11  ? 45  THR A C     1 
ATOM   346  O O     . THR A 1 45  ? -2.598  114.607 24.553  1.00 52.37  ? 45  THR A O     1 
ATOM   347  C CB    . THR A 1 45  ? -0.773  113.858 26.790  1.00 43.72  ? 45  THR A CB    1 
ATOM   348  O OG1   . THR A 1 45  ? 0.468   113.352 27.306  1.00 45.83  ? 45  THR A OG1   1 
ATOM   349  C CG2   . THR A 1 45  ? -1.810  113.883 27.884  1.00 36.28  ? 45  THR A CG2   1 
ATOM   350  N N     . GLY A 1 46  ? -3.641  112.756 25.251  1.00 45.74  ? 46  GLY A N     1 
ATOM   351  C CA    . GLY A 1 46  ? -4.950  113.167 24.797  1.00 41.40  ? 46  GLY A CA    1 
ATOM   352  C C     . GLY A 1 46  ? -5.282  112.525 23.465  1.00 44.36  ? 46  GLY A C     1 
ATOM   353  O O     . GLY A 1 46  ? -6.391  112.678 22.963  1.00 48.30  ? 46  GLY A O     1 
ATOM   354  N N     . LYS A 1 47  ? -4.316  111.817 22.890  1.00 43.46  ? 47  LYS A N     1 
ATOM   355  C CA    . LYS A 1 47  ? -4.488  111.203 21.577  1.00 46.20  ? 47  LYS A CA    1 
ATOM   356  C C     . LYS A 1 47  ? -4.986  109.777 21.744  1.00 44.15  ? 47  LYS A C     1 
ATOM   357  O O     . LYS A 1 47  ? -4.738  109.153 22.756  1.00 40.49  ? 47  LYS A O     1 
ATOM   358  C CB    . LYS A 1 47  ? -3.167  111.215 20.772  1.00 48.12  ? 47  LYS A CB    1 
ATOM   359  C CG    . LYS A 1 47  ? -2.858  112.524 20.047  1.00 53.02  ? 47  LYS A CG    1 
ATOM   360  N N     . THR A 1 48  ? -5.667  109.256 20.732  1.00 46.01  ? 48  THR A N     1 
ATOM   361  C CA    . THR A 1 48  ? -6.182  107.898 20.771  1.00 43.64  ? 48  THR A CA    1 
ATOM   362  C C     . THR A 1 48  ? -5.338  106.952 19.927  1.00 45.76  ? 48  THR A C     1 
ATOM   363  O O     . THR A 1 48  ? -4.913  107.284 18.816  1.00 48.04  ? 48  THR A O     1 
ATOM   364  C CB    . THR A 1 48  ? -7.648  107.871 20.291  1.00 48.67  ? 48  THR A CB    1 
ATOM   365  O OG1   . THR A 1 48  ? -8.457  108.517 21.273  1.00 55.39  ? 48  THR A OG1   1 
ATOM   366  C CG2   . THR A 1 48  ? -8.163  106.440 20.086  1.00 43.46  ? 48  THR A CG2   1 
ATOM   367  N N     . ILE A 1 49  ? -5.072  105.769 20.463  1.00 45.19  ? 49  ILE A N     1 
ATOM   368  C CA    . ILE A 1 49  ? -4.319  104.775 19.726  1.00 40.78  ? 49  ILE A CA    1 
ATOM   369  C C     . ILE A 1 49  ? -5.202  104.207 18.634  1.00 46.95  ? 49  ILE A C     1 
ATOM   370  O O     . ILE A 1 49  ? -6.283  103.680 18.903  1.00 53.98  ? 49  ILE A O     1 
ATOM   371  C CB    . ILE A 1 49  ? -3.800  103.681 20.655  1.00 40.78  ? 49  ILE A CB    1 
ATOM   372  C CG1   . ILE A 1 49  ? -2.874  104.323 21.706  1.00 42.73  ? 49  ILE A CG1   1 
ATOM   373  C CG2   . ILE A 1 49  ? -3.042  102.604 19.873  1.00 38.42  ? 49  ILE A CG2   1 
ATOM   374  C CD1   . ILE A 1 49  ? -2.273  103.345 22.642  1.00 46.75  ? 49  ILE A CD1   1 
ATOM   375  N N     . GLN A 1 50  ? -4.750  104.345 17.391  1.00 44.82  ? 50  GLN A N     1 
ATOM   376  C CA    . GLN A 1 50  ? -5.568  104.004 16.240  1.00 48.16  ? 50  GLN A CA    1 
ATOM   377  C C     . GLN A 1 50  ? -5.193  102.634 15.682  1.00 50.11  ? 50  GLN A C     1 
ATOM   378  O O     . GLN A 1 50  ? -5.945  102.019 14.937  1.00 55.37  ? 50  GLN A O     1 
ATOM   379  C CB    . GLN A 1 50  ? -5.421  105.065 15.152  1.00 49.20  ? 50  GLN A CB    1 
ATOM   380  C CG    . GLN A 1 50  ? -6.082  106.390 15.439  1.00 62.60  ? 50  GLN A CG    1 
ATOM   381  C CD    . GLN A 1 50  ? -6.047  107.307 14.216  1.00 82.90  ? 50  GLN A CD    1 
ATOM   382  O OE1   . GLN A 1 50  ? -5.591  106.907 13.129  1.00 88.03  ? 50  GLN A OE1   1 
ATOM   383  N NE2   . GLN A 1 50  ? -6.536  108.536 14.379  1.00 90.49  ? 50  GLN A NE2   1 
ATOM   384  N N     . GLY A 1 51  ? -4.008  102.161 16.005  1.00 43.62  ? 51  GLY A N     1 
ATOM   385  C CA    . GLY A 1 51  ? -3.588  100.893 15.460  1.00 38.90  ? 51  GLY A CA    1 
ATOM   386  C C     . GLY A 1 51  ? -2.177  100.587 15.882  1.00 40.33  ? 51  GLY A C     1 
ATOM   387  O O     . GLY A 1 51  ? -1.467  101.496 16.356  1.00 39.60  ? 51  GLY A O     1 
ATOM   388  N N     . ILE A 1 52  ? -1.784  99.321  15.707  1.00 36.45  ? 52  ILE A N     1 
ATOM   389  C CA    . ILE A 1 52  ? -0.423  98.873  15.935  1.00 37.17  ? 52  ILE A CA    1 
ATOM   390  C C     . ILE A 1 52  ? 0.103   98.075  14.755  1.00 41.18  ? 52  ILE A C     1 
ATOM   391  O O     . ILE A 1 52  ? -0.495  97.073  14.334  1.00 42.50  ? 52  ILE A O     1 
ATOM   392  C CB    . ILE A 1 52  ? -0.288  97.970  17.188  1.00 38.78  ? 52  ILE A CB    1 
ATOM   393  C CG1   . ILE A 1 52  ? -1.296  98.357  18.290  1.00 45.67  ? 52  ILE A CG1   1 
ATOM   394  C CG2   . ILE A 1 52  ? 1.170   98.005  17.695  1.00 30.22  ? 52  ILE A CG2   1 
ATOM   395  C CD1   . ILE A 1 52  ? -0.925  99.625  19.043  1.00 45.69  ? 52  ILE A CD1   1 
ATOM   396  N N     . SER A 1 53  ? 1.249   98.488  14.241  1.00 37.33  ? 53  SER A N     1 
ATOM   397  C CA    . SER A 1 53  ? 1.859   97.751  13.153  1.00 36.37  ? 53  SER A CA    1 
ATOM   398  C C     . SER A 1 53  ? 3.220   97.296  13.590  1.00 36.82  ? 53  SER A C     1 
ATOM   399  O O     . SER A 1 53  ? 3.641   97.540  14.727  1.00 38.41  ? 53  SER A O     1 
ATOM   400  C CB    . SER A 1 53  ? 1.971   98.612  11.891  1.00 37.99  ? 53  SER A CB    1 
ATOM   401  O OG    . SER A 1 53  ? 0.697   99.097  11.510  1.00 50.48  ? 53  SER A OG    1 
ATOM   402  N N     . ARG A 1 54  ? 3.918   96.668  12.661  1.00 37.01  ? 54  ARG A N     1 
ATOM   403  C CA    . ARG A 1 54  ? 5.226   96.125  12.930  1.00 36.93  ? 54  ARG A CA    1 
ATOM   404  C C     . ARG A 1 54  ? 6.042   96.164  11.662  1.00 41.59  ? 54  ARG A C     1 
ATOM   405  O O     . ARG A 1 54  ? 5.512   96.062  10.581  1.00 42.51  ? 54  ARG A O     1 
ATOM   406  C CB    . ARG A 1 54  ? 5.127   94.689  13.436  1.00 38.05  ? 54  ARG A CB    1 
ATOM   407  C CG    . ARG A 1 54  ? 6.448   94.128  13.903  1.00 37.69  ? 54  ARG A CG    1 
ATOM   408  C CD    . ARG A 1 54  ? 6.382   92.611  14.058  1.00 37.27  ? 54  ARG A CD    1 
ATOM   409  N NE    . ARG A 1 54  ? 5.628   91.934  13.008  1.00 37.25  ? 54  ARG A NE    1 
ATOM   410  C CZ    . ARG A 1 54  ? 6.057   91.747  11.761  1.00 38.63  ? 54  ARG A CZ    1 
ATOM   411  N NH1   . ARG A 1 54  ? 7.239   92.211  11.365  1.00 38.25  ? 54  ARG A NH1   1 
ATOM   412  N NH2   . ARG A 1 54  ? 5.294   91.088  10.905  1.00 37.89  ? 54  ARG A NH2   1 
ATOM   413  N N     . ARG A 1 55  ? 7.344   96.325  11.804  1.00 39.56  ? 55  ARG A N     1 
ATOM   414  C CA    . ARG A 1 55  ? 8.239   96.237  10.683  1.00 34.06  ? 55  ARG A CA    1 
ATOM   415  C C     . ARG A 1 55  ? 9.534   95.605  11.197  1.00 35.77  ? 55  ARG A C     1 
ATOM   416  O O     . ARG A 1 55  ? 10.223  96.215  12.012  1.00 37.41  ? 55  ARG A O     1 
ATOM   417  C CB    . ARG A 1 55  ? 8.468   97.623  10.113  1.00 36.67  ? 55  ARG A CB    1 
ATOM   418  C CG    . ARG A 1 55  ? 9.284   97.685  8.882   1.00 37.76  ? 55  ARG A CG    1 
ATOM   419  C CD    . ARG A 1 55  ? 8.558   97.124  7.680   1.00 34.13  ? 55  ARG A CD    1 
ATOM   420  N NE    . ARG A 1 55  ? 9.442   97.253  6.527   1.00 34.85  ? 55  ARG A NE    1 
ATOM   421  C CZ    . ARG A 1 55  ? 10.328  96.337  6.113   1.00 38.16  ? 55  ARG A CZ    1 
ATOM   422  N NH1   . ARG A 1 55  ? 10.464  95.162  6.735   1.00 37.62  ? 55  ARG A NH1   1 
ATOM   423  N NH2   . ARG A 1 55  ? 11.080  96.595  5.048   1.00 38.78  ? 55  ARG A NH2   1 
ATOM   424  N N     . GLY A 1 56  ? 9.838   94.385  10.753  1.00 29.96  ? 56  GLY A N     1 
ATOM   425  C CA    . GLY A 1 56  ? 10.919  93.605  11.329  1.00 33.89  ? 56  GLY A CA    1 
ATOM   426  C C     . GLY A 1 56  ? 10.619  93.446  12.815  1.00 35.67  ? 56  GLY A C     1 
ATOM   427  O O     . GLY A 1 56  ? 9.511   93.088  13.185  1.00 36.82  ? 56  GLY A O     1 
ATOM   428  N N     . LYS A 1 57  ? 11.584  93.767  13.664  1.00 32.69  ? 57  LYS A N     1 
ATOM   429  C CA    . LYS A 1 57  ? 11.378  93.663  15.103  1.00 35.25  ? 57  LYS A CA    1 
ATOM   430  C C     . LYS A 1 57  ? 10.869  94.968  15.735  1.00 34.20  ? 57  LYS A C     1 
ATOM   431  O O     . LYS A 1 57  ? 10.791  95.055  16.948  1.00 33.70  ? 57  LYS A O     1 
ATOM   432  C CB    . LYS A 1 57  ? 12.673  93.225  15.796  1.00 32.27  ? 57  LYS A CB    1 
ATOM   433  C CG    . LYS A 1 57  ? 13.229  91.874  15.334  1.00 30.87  ? 57  LYS A CG    1 
ATOM   434  C CD    . LYS A 1 57  ? 14.694  91.727  15.761  1.00 29.18  ? 57  LYS A CD    1 
ATOM   435  C CE    . LYS A 1 57  ? 15.393  90.597  14.990  1.00 34.01  ? 57  LYS A CE    1 
ATOM   436  N NZ    . LYS A 1 57  ? 16.872  90.642  15.192  1.00 32.88  ? 57  LYS A NZ    1 
ATOM   437  N N     . TYR A 1 58  ? 10.503  95.961  14.922  1.00 33.77  ? 58  TYR A N     1 
ATOM   438  C CA    . TYR A 1 58  ? 9.960   97.227  15.441  1.00 30.20  ? 58  TYR A CA    1 
ATOM   439  C C     . TYR A 1 58  ? 8.439   97.281  15.586  1.00 34.06  ? 58  TYR A C     1 
ATOM   440  O O     . TYR A 1 58  ? 7.698   97.071  14.610  1.00 36.45  ? 58  TYR A O     1 
ATOM   441  C CB    . TYR A 1 58  ? 10.350  98.384  14.533  1.00 28.99  ? 58  TYR A CB    1 
ATOM   442  C CG    . TYR A 1 58  ? 11.828  98.587  14.366  1.00 31.51  ? 58  TYR A CG    1 
ATOM   443  C CD1   . TYR A 1 58  ? 12.597  97.714  13.570  1.00 28.14  ? 58  TYR A CD1   1 
ATOM   444  C CD2   . TYR A 1 58  ? 12.462  99.685  14.958  1.00 29.07  ? 58  TYR A CD2   1 
ATOM   445  C CE1   . TYR A 1 58  ? 13.973  97.918  13.408  1.00 33.23  ? 58  TYR A CE1   1 
ATOM   446  C CE2   . TYR A 1 58  ? 13.830  99.901  14.791  1.00 30.34  ? 58  TYR A CE2   1 
ATOM   447  C CZ    . TYR A 1 58  ? 14.578  99.014  14.023  1.00 31.80  ? 58  TYR A CZ    1 
ATOM   448  O OH    . TYR A 1 58  ? 15.914  99.231  13.868  1.00 38.11  ? 58  TYR A OH    1 
ATOM   449  N N     . LEU A 1 59  ? 7.970   97.621  16.781  1.00 32.76  ? 59  LEU A N     1 
ATOM   450  C CA    . LEU A 1 59  ? 6.564   97.951  16.961  1.00 34.98  ? 59  LEU A CA    1 
ATOM   451  C C     . LEU A 1 59  ? 6.279   99.377  16.506  1.00 36.22  ? 59  LEU A C     1 
ATOM   452  O O     . LEU A 1 59  ? 7.091   100.283 16.702  1.00 41.38  ? 59  LEU A O     1 
ATOM   453  C CB    . LEU A 1 59  ? 6.158   97.819  18.404  1.00 35.68  ? 59  LEU A CB    1 
ATOM   454  C CG    . LEU A 1 59  ? 5.894   96.417  18.859  1.00 42.76  ? 59  LEU A CG    1 
ATOM   455  C CD1   . LEU A 1 59  ? 5.570   96.503  20.348  1.00 47.26  ? 59  LEU A CD1   1 
ATOM   456  C CD2   . LEU A 1 59  ? 4.761   95.781  18.089  1.00 40.57  ? 59  LEU A CD2   1 
ATOM   457  N N     . ILE A 1 60  ? 5.120   99.581  15.909  1.00 32.79  ? 60  ILE A N     1 
ATOM   458  C CA    . ILE A 1 60  ? 4.744   100.911 15.437  1.00 30.52  ? 60  ILE A CA    1 
ATOM   459  C C     . ILE A 1 60  ? 3.361   101.241 15.982  1.00 38.97  ? 60  ILE A C     1 
ATOM   460  O O     . ILE A 1 60  ? 2.362   100.692 15.492  1.00 46.35  ? 60  ILE A O     1 
ATOM   461  C CB    . ILE A 1 60  ? 4.714   100.969 13.908  1.00 36.20  ? 60  ILE A CB    1 
ATOM   462  C CG1   . ILE A 1 60  ? 6.044   100.464 13.319  1.00 33.73  ? 60  ILE A CG1   1 
ATOM   463  C CG2   . ILE A 1 60  ? 4.312   102.375 13.396  1.00 27.45  ? 60  ILE A CG2   1 
ATOM   464  C CD1   . ILE A 1 60  ? 5.957   100.134 11.848  1.00 34.27  ? 60  ILE A CD1   1 
ATOM   465  N N     . PHE A 1 61  ? 3.291   102.083 17.016  1.00 34.15  ? 61  PHE A N     1 
ATOM   466  C CA    . PHE A 1 61  ? 2.000   102.533 17.531  1.00 32.05  ? 61  PHE A CA    1 
ATOM   467  C C     . PHE A 1 61  ? 1.523   103.670 16.656  1.00 33.01  ? 61  PHE A C     1 
ATOM   468  O O     . PHE A 1 61  ? 2.244   104.656 16.442  1.00 37.20  ? 61  PHE A O     1 
ATOM   469  C CB    . PHE A 1 61  ? 2.082   102.996 19.004  1.00 35.78  ? 61  PHE A CB    1 
ATOM   470  C CG    . PHE A 1 61  ? 2.508   101.913 19.977  1.00 35.21  ? 61  PHE A CG    1 
ATOM   471  C CD1   . PHE A 1 61  ? 3.845   101.573 20.122  1.00 33.42  ? 61  PHE A CD1   1 
ATOM   472  C CD2   . PHE A 1 61  ? 1.571   101.268 20.767  1.00 39.50  ? 61  PHE A CD2   1 
ATOM   473  C CE1   . PHE A 1 61  ? 4.249   100.586 21.026  1.00 37.39  ? 61  PHE A CE1   1 
ATOM   474  C CE2   . PHE A 1 61  ? 1.950   100.275 21.664  1.00 42.36  ? 61  PHE A CE2   1 
ATOM   475  C CZ    . PHE A 1 61  ? 3.301   99.923  21.793  1.00 40.56  ? 61  PHE A CZ    1 
ATOM   476  N N     . GLU A 1 62  ? 0.311   103.524 16.133  1.00 34.15  ? 62  GLU A N     1 
ATOM   477  C CA    . GLU A 1 62  ? -0.341  104.587 15.386  1.00 39.80  ? 62  GLU A CA    1 
ATOM   478  C C     . GLU A 1 62  ? -1.232  105.383 16.346  1.00 39.88  ? 62  GLU A C     1 
ATOM   479  O O     . GLU A 1 62  ? -2.259  104.905 16.839  1.00 40.11  ? 62  GLU A O     1 
ATOM   480  C CB    . GLU A 1 62  ? -1.105  103.977 14.204  1.00 47.11  ? 62  GLU A CB    1 
ATOM   481  C CG    . GLU A 1 62  ? -0.204  102.976 13.469  1.00 52.47  ? 62  GLU A CG    1 
ATOM   482  C CD    . GLU A 1 62  ? -0.937  102.040 12.539  1.00 61.59  ? 62  GLU A CD    1 
ATOM   483  O OE1   . GLU A 1 62  ? -2.169  101.891 12.681  1.00 63.78  ? 62  GLU A OE1   1 
ATOM   484  O OE2   . GLU A 1 62  ? -0.269  101.446 11.663  1.00 64.52  ? 62  GLU A OE2   1 
ATOM   485  N N     . ILE A 1 63  ? -0.764  106.580 16.663  1.00 39.18  ? 63  ILE A N     1 
ATOM   486  C CA    . ILE A 1 63  ? -1.358  107.410 17.688  1.00 43.50  ? 63  ILE A CA    1 
ATOM   487  C C     . ILE A 1 63  ? -1.768  108.733 17.115  1.00 49.57  ? 63  ILE A C     1 
ATOM   488  O O     . ILE A 1 63  ? -0.921  109.558 16.770  1.00 49.05  ? 63  ILE A O     1 
ATOM   489  C CB    . ILE A 1 63  ? -0.391  107.641 18.843  1.00 46.95  ? 63  ILE A CB    1 
ATOM   490  C CG1   . ILE A 1 63  ? 0.196   106.299 19.315  1.00 42.20  ? 63  ILE A CG1   1 
ATOM   491  C CG2   . ILE A 1 63  ? -1.092  108.368 19.986  1.00 45.78  ? 63  ILE A CG2   1 
ATOM   492  C CD1   . ILE A 1 63  ? 1.056   106.432 20.533  1.00 41.82  ? 63  ILE A CD1   1 
ATOM   493  N N     . GLY A 1 64  ? -3.078  108.920 17.013  1.00 58.28  ? 64  GLY A N     1 
ATOM   494  C CA    . GLY A 1 64  ? -3.647  110.037 16.280  1.00 64.48  ? 64  GLY A CA    1 
ATOM   495  C C     . GLY A 1 64  ? -3.458  109.727 14.817  1.00 68.57  ? 64  GLY A C     1 
ATOM   496  O O     . GLY A 1 64  ? -3.099  108.603 14.458  1.00 69.57  ? 64  GLY A O     1 
ATOM   497  N N     . ASP A 1 65  ? -3.670  110.716 13.962  1.00 72.16  ? 65  ASP A N     1 
ATOM   498  C CA    . ASP A 1 65  ? -3.505  110.476 12.536  1.00 73.82  ? 65  ASP A CA    1 
ATOM   499  C C     . ASP A 1 65  ? -2.077  110.751 12.091  1.00 64.57  ? 65  ASP A C     1 
ATOM   500  O O     . ASP A 1 65  ? -1.589  110.156 11.125  1.00 67.63  ? 65  ASP A O     1 
ATOM   501  C CB    . ASP A 1 65  ? -4.489  111.318 11.731  1.00 88.26  ? 65  ASP A CB    1 
ATOM   502  C CG    . ASP A 1 65  ? -5.903  110.772 11.794  1.00 98.29  ? 65  ASP A CG    1 
ATOM   503  O OD1   . ASP A 1 65  ? -6.158  109.760 11.111  1.00 98.59  ? 65  ASP A OD1   1 
ATOM   504  O OD2   . ASP A 1 65  ? -6.747  111.344 12.526  1.00 102.94 ? 65  ASP A OD2   1 
ATOM   505  N N     . ASP A 1 66  ? -1.395  111.619 12.819  1.00 53.08  ? 66  ASP A N     1 
ATOM   506  C CA    . ASP A 1 66  ? -0.144  112.157 12.330  1.00 56.09  ? 66  ASP A CA    1 
ATOM   507  C C     . ASP A 1 66  ? 1.116   111.652 13.027  1.00 47.58  ? 66  ASP A C     1 
ATOM   508  O O     . ASP A 1 66  ? 2.212   112.037 12.634  1.00 53.49  ? 66  ASP A O     1 
ATOM   509  C CB    . ASP A 1 66  ? -0.186  113.686 12.410  1.00 68.64  ? 66  ASP A CB    1 
ATOM   510  C CG    . ASP A 1 66  ? -0.542  114.204 13.806  1.00 77.65  ? 66  ASP A CG    1 
ATOM   511  O OD1   . ASP A 1 66  ? -1.178  113.469 14.607  1.00 75.28  ? 66  ASP A OD1   1 
ATOM   512  O OD2   . ASP A 1 66  ? -0.192  115.376 14.089  1.00 84.99  ? 66  ASP A OD2   1 
ATOM   513  N N     . PHE A 1 67  ? 0.980   110.795 14.040  1.00 39.48  ? 67  PHE A N     1 
ATOM   514  C CA    . PHE A 1 67  ? 2.140   110.370 14.808  1.00 41.69  ? 67  PHE A CA    1 
ATOM   515  C C     . PHE A 1 67  ? 2.300   108.877 14.836  1.00 41.74  ? 67  PHE A C     1 
ATOM   516  O O     . PHE A 1 67  ? 1.321   108.124 14.855  1.00 42.72  ? 67  PHE A O     1 
ATOM   517  C CB    . PHE A 1 67  ? 2.072   110.906 16.253  1.00 50.55  ? 67  PHE A CB    1 
ATOM   518  C CG    . PHE A 1 67  ? 2.482   112.335 16.354  1.00 61.51  ? 67  PHE A CG    1 
ATOM   519  C CD1   . PHE A 1 67  ? 3.748   112.728 15.899  1.00 61.11  ? 67  PHE A CD1   1 
ATOM   520  C CD2   . PHE A 1 67  ? 1.596   113.306 16.830  1.00 63.09  ? 67  PHE A CD2   1 
ATOM   521  C CE1   . PHE A 1 67  ? 4.132   114.054 15.936  1.00 62.76  ? 67  PHE A CE1   1 
ATOM   522  C CE2   . PHE A 1 67  ? 1.981   114.626 16.875  1.00 63.94  ? 67  PHE A CE2   1 
ATOM   523  C CZ    . PHE A 1 67  ? 3.251   115.005 16.424  1.00 63.53  ? 67  PHE A CZ    1 
ATOM   524  N N     . ARG A 1 68  ? 3.552   108.446 14.824  1.00 42.58  ? 68  ARG A N     1 
ATOM   525  C CA    . ARG A 1 68  ? 3.858   107.036 15.016  1.00 38.47  ? 68  ARG A CA    1 
ATOM   526  C C     . ARG A 1 68  ? 4.923   106.919 16.074  1.00 35.80  ? 68  ARG A C     1 
ATOM   527  O O     . ARG A 1 68  ? 5.893   107.687 16.107  1.00 35.21  ? 68  ARG A O     1 
ATOM   528  C CB    . ARG A 1 68  ? 4.312   106.380 13.718  1.00 40.90  ? 68  ARG A CB    1 
ATOM   529  C CG    . ARG A 1 68  ? 3.194   105.663 12.959  1.00 38.88  ? 68  ARG A CG    1 
ATOM   530  C CD    . ARG A 1 68  ? 2.433   106.632 12.222  1.00 40.30  ? 68  ARG A CD    1 
ATOM   531  N NE    . ARG A 1 68  ? 1.362   106.043 11.444  1.00 48.54  ? 68  ARG A NE    1 
ATOM   532  C CZ    . ARG A 1 68  ? 0.085   106.375 11.587  1.00 56.05  ? 68  ARG A CZ    1 
ATOM   533  N NH1   . ARG A 1 68  ? -0.271  107.260 12.521  1.00 57.70  ? 68  ARG A NH1   1 
ATOM   534  N NH2   . ARG A 1 68  ? -0.838  105.820 10.806  1.00 57.19  ? 68  ARG A NH2   1 
ATOM   535  N N     . LEU A 1 69  ? 4.693   105.986 16.976  1.00 29.36  ? 69  LEU A N     1 
ATOM   536  C CA    . LEU A 1 69  ? 5.615   105.716 18.026  1.00 27.70  ? 69  LEU A CA    1 
ATOM   537  C C     . LEU A 1 69  ? 6.278   104.380 17.707  1.00 30.62  ? 69  LEU A C     1 
ATOM   538  O O     . LEU A 1 69  ? 5.662   103.327 17.734  1.00 30.69  ? 69  LEU A O     1 
ATOM   539  C CB    . LEU A 1 69  ? 4.899   105.685 19.387  1.00 29.80  ? 69  LEU A CB    1 
ATOM   540  C CG    . LEU A 1 69  ? 5.731   105.233 20.594  1.00 36.87  ? 69  LEU A CG    1 
ATOM   541  C CD1   . LEU A 1 69  ? 7.025   106.061 20.677  1.00 40.81  ? 69  LEU A CD1   1 
ATOM   542  C CD2   . LEU A 1 69  ? 4.916   105.344 21.904  1.00 33.55  ? 69  LEU A CD2   1 
ATOM   543  N N     . ILE A 1 70  ? 7.547   104.453 17.399  1.00 32.34  ? 70  ILE A N     1 
ATOM   544  C CA    . ILE A 1 70  ? 8.326   103.291 17.067  1.00 30.16  ? 70  ILE A CA    1 
ATOM   545  C C     . ILE A 1 70  ? 9.040   102.787 18.294  1.00 31.56  ? 70  ILE A C     1 
ATOM   546  O O     . ILE A 1 70  ? 9.915   103.460 18.838  1.00 32.26  ? 70  ILE A O     1 
ATOM   547  C CB    . ILE A 1 70  ? 9.316   103.648 15.951  1.00 32.21  ? 70  ILE A CB    1 
ATOM   548  C CG1   . ILE A 1 70  ? 8.504   104.197 14.751  1.00 31.21  ? 70  ILE A CG1   1 
ATOM   549  C CG2   . ILE A 1 70  ? 10.198  102.447 15.595  1.00 30.83  ? 70  ILE A CG2   1 
ATOM   550  C CD1   . ILE A 1 70  ? 9.307   104.320 13.533  1.00 36.97  ? 70  ILE A CD1   1 
ATOM   551  N N     . SER A 1 71  ? 8.625   101.613 18.750  1.00 32.56  ? 71  SER A N     1 
ATOM   552  C CA    . SER A 1 71  ? 9.204   100.958 19.905  1.00 27.92  ? 71  SER A CA    1 
ATOM   553  C C     . SER A 1 71  ? 10.050  99.749  19.461  1.00 27.75  ? 71  SER A C     1 
ATOM   554  O O     . SER A 1 71  ? 9.616   98.957  18.633  1.00 30.92  ? 71  SER A O     1 
ATOM   555  C CB    . SER A 1 71  ? 8.074   100.533 20.871  1.00 31.34  ? 71  SER A CB    1 
ATOM   556  O OG    . SER A 1 71  ? 8.465   99.469  21.762  1.00 34.56  ? 71  SER A OG    1 
ATOM   557  N N     . HIS A 1 72  ? 11.247  99.621  20.005  1.00 28.49  ? 72  HIS A N     1 
ATOM   558  C CA    . HIS A 1 72  ? 12.090  98.428  19.833  1.00 26.68  ? 72  HIS A CA    1 
ATOM   559  C C     . HIS A 1 72  ? 12.404  97.854  21.241  1.00 31.30  ? 72  HIS A C     1 
ATOM   560  O O     . HIS A 1 72  ? 12.779  98.587  22.136  1.00 32.65  ? 72  HIS A O     1 
ATOM   561  C CB    . HIS A 1 72  ? 13.382  98.780  19.080  1.00 22.22  ? 72  HIS A CB    1 
ATOM   562  C CG    . HIS A 1 72  ? 14.009  97.619  18.384  1.00 33.11  ? 72  HIS A CG    1 
ATOM   563  N ND1   . HIS A 1 72  ? 14.349  96.447  19.038  1.00 34.85  ? 72  HIS A ND1   1 
ATOM   564  C CD2   . HIS A 1 72  ? 14.330  97.430  17.080  1.00 35.33  ? 72  HIS A CD2   1 
ATOM   565  C CE1   . HIS A 1 72  ? 14.864  95.596  18.174  1.00 34.39  ? 72  HIS A CE1   1 
ATOM   566  N NE2   . HIS A 1 72  ? 14.858  96.164  16.975  1.00 37.75  ? 72  HIS A NE2   1 
ATOM   567  N N     . LEU A 1 73  ? 12.214  96.555  21.417  1.00 33.61  ? 73  LEU A N     1 
ATOM   568  C CA    . LEU A 1 73  ? 12.274  95.888  22.699  1.00 31.11  ? 73  LEU A CA    1 
ATOM   569  C C     . LEU A 1 73  ? 13.686  95.384  22.930  1.00 32.82  ? 73  LEU A C     1 
ATOM   570  O O     . LEU A 1 73  ? 14.067  94.978  24.052  1.00 33.13  ? 73  LEU A O     1 
ATOM   571  C CB    . LEU A 1 73  ? 11.274  94.718  22.730  1.00 34.09  ? 73  LEU A CB    1 
ATOM   572  C CG    . LEU A 1 73  ? 9.825   94.972  23.174  1.00 39.65  ? 73  LEU A CG    1 
ATOM   573  C CD1   . LEU A 1 73  ? 9.273   96.089  22.428  1.00 46.69  ? 73  LEU A CD1   1 
ATOM   574  C CD2   . LEU A 1 73  ? 8.980   93.761  22.920  1.00 40.16  ? 73  LEU A CD2   1 
ATOM   575  N N     . ARG A 1 74  ? 14.463  95.392  21.849  1.00 30.09  ? 74  ARG A N     1 
ATOM   576  C CA    . ARG A 1 74  ? 15.843  94.915  21.884  1.00 31.03  ? 74  ARG A CA    1 
ATOM   577  C C     . ARG A 1 74  ? 15.996  93.509  22.549  1.00 30.86  ? 74  ARG A C     1 
ATOM   578  O O     . ARG A 1 74  ? 15.390  92.568  22.080  1.00 29.72  ? 74  ARG A O     1 
ATOM   579  C CB    . ARG A 1 74  ? 16.705  95.946  22.585  1.00 25.92  ? 74  ARG A CB    1 
ATOM   580  C CG    . ARG A 1 74  ? 16.805  97.243  21.807  1.00 29.73  ? 74  ARG A CG    1 
ATOM   581  C CD    . ARG A 1 74  ? 17.587  97.111  20.476  1.00 31.44  ? 74  ARG A CD    1 
ATOM   582  N NE    . ARG A 1 74  ? 17.939  98.440  20.008  1.00 32.37  ? 74  ARG A NE    1 
ATOM   583  C CZ    . ARG A 1 74  ? 19.119  99.017  20.217  1.00 34.11  ? 74  ARG A CZ    1 
ATOM   584  N NH1   . ARG A 1 74  ? 20.095  98.345  20.817  1.00 29.15  ? 74  ARG A NH1   1 
ATOM   585  N NH2   . ARG A 1 74  ? 19.330  100.262 19.803  1.00 36.96  ? 74  ARG A NH2   1 
ATOM   586  N N     . MET A 1 75  ? 16.810  93.373  23.608  1.00 29.48  ? 75  MET A N     1 
ATOM   587  C CA    . MET A 1 75  ? 17.123  92.055  24.187  1.00 32.15  ? 75  MET A CA    1 
ATOM   588  C C     . MET A 1 75  ? 16.082  91.543  25.198  1.00 32.00  ? 75  MET A C     1 
ATOM   589  O O     . MET A 1 75  ? 15.735  90.384  25.177  1.00 37.09  ? 75  MET A O     1 
ATOM   590  C CB    . MET A 1 75  ? 18.476  92.077  24.877  1.00 33.41  ? 75  MET A CB    1 
ATOM   591  C CG    . MET A 1 75  ? 19.665  92.066  23.906  1.00 40.34  ? 75  MET A CG    1 
ATOM   592  S SD    . MET A 1 75  ? 19.686  90.666  22.783  1.00 46.01  ? 75  MET A SD    1 
ATOM   593  C CE    . MET A 1 75  ? 19.978  89.327  23.900  1.00 32.96  ? 75  MET A CE    1 
ATOM   594  N N     . GLU A 1 76  ? 15.561  92.428  26.035  1.00 30.79  ? 76  GLU A N     1 
ATOM   595  C CA    . GLU A 1 76  ? 14.777  92.067  27.206  1.00 39.11  ? 76  GLU A CA    1 
ATOM   596  C C     . GLU A 1 76  ? 13.514  92.919  27.420  1.00 40.42  ? 76  GLU A C     1 
ATOM   597  O O     . GLU A 1 76  ? 12.856  92.799  28.447  1.00 47.21  ? 76  GLU A O     1 
ATOM   598  C CB    . GLU A 1 76  ? 15.649  92.204  28.457  1.00 45.53  ? 76  GLU A CB    1 
ATOM   599  C CG    . GLU A 1 76  ? 16.883  91.381  28.408  1.00 57.13  ? 76  GLU A CG    1 
ATOM   600  C CD    . GLU A 1 76  ? 17.000  90.454  29.583  1.00 75.41  ? 76  GLU A CD    1 
ATOM   601  O OE1   . GLU A 1 76  ? 16.059  90.411  30.411  1.00 80.16  ? 76  GLU A OE1   1 
ATOM   602  O OE2   . GLU A 1 76  ? 18.047  89.772  29.689  1.00 87.52  ? 76  GLU A OE2   1 
ATOM   603  N N     . GLY A 1 77  ? 13.187  93.795  26.487  1.00 33.75  ? 77  GLY A N     1 
ATOM   604  C CA    . GLY A 1 77  ? 11.999  94.611  26.649  1.00 35.17  ? 77  GLY A CA    1 
ATOM   605  C C     . GLY A 1 77  ? 10.711  93.800  26.752  1.00 34.26  ? 77  GLY A C     1 
ATOM   606  O O     . GLY A 1 77  ? 10.548  92.787  26.072  1.00 34.12  ? 77  GLY A O     1 
ATOM   607  N N     . LYS A 1 78  ? 9.799   94.262  27.605  1.00 32.80  ? 78  LYS A N     1 
ATOM   608  C CA    . LYS A 1 78  ? 8.527   93.593  27.881  1.00 37.11  ? 78  LYS A CA    1 
ATOM   609  C C     . LYS A 1 78  ? 7.445   94.642  28.087  1.00 36.80  ? 78  LYS A C     1 
ATOM   610  O O     . LYS A 1 78  ? 7.623   95.633  28.804  1.00 39.98  ? 78  LYS A O     1 
ATOM   611  C CB    . LYS A 1 78  ? 8.610   92.717  29.148  1.00 44.21  ? 78  LYS A CB    1 
ATOM   612  C CG    . LYS A 1 78  ? 9.487   91.500  29.034  1.00 53.15  ? 78  LYS A CG    1 
ATOM   613  C CD    . LYS A 1 78  ? 9.850   90.961  30.424  1.00 58.12  ? 78  LYS A CD    1 
ATOM   614  C CE    . LYS A 1 78  ? 10.621  89.620  30.347  1.00 65.52  ? 78  LYS A CE    1 
ATOM   615  N NZ    . LYS A 1 78  ? 11.839  89.653  29.466  1.00 66.14  ? 78  LYS A NZ    1 
ATOM   616  N N     . TYR A 1 79  ? 6.308   94.429  27.475  1.00 35.00  ? 79  TYR A N     1 
ATOM   617  C CA    . TYR A 1 79  ? 5.150   95.254  27.789  1.00 31.97  ? 79  TYR A CA    1 
ATOM   618  C C     . TYR A 1 79  ? 4.184   94.472  28.684  1.00 30.60  ? 79  TYR A C     1 
ATOM   619  O O     . TYR A 1 79  ? 4.062   93.252  28.550  1.00 33.54  ? 79  TYR A O     1 
ATOM   620  C CB    . TYR A 1 79  ? 4.452   95.664  26.508  1.00 31.15  ? 79  TYR A CB    1 
ATOM   621  C CG    . TYR A 1 79  ? 5.112   96.793  25.767  1.00 37.31  ? 79  TYR A CG    1 
ATOM   622  C CD1   . TYR A 1 79  ? 4.966   98.102  26.213  1.00 24.20  ? 79  TYR A CD1   1 
ATOM   623  C CD2   . TYR A 1 79  ? 5.815   96.568  24.565  1.00 33.56  ? 79  TYR A CD2   1 
ATOM   624  C CE1   . TYR A 1 79  ? 5.524   99.148  25.534  1.00 32.32  ? 79  TYR A CE1   1 
ATOM   625  C CE2   . TYR A 1 79  ? 6.390   97.635  23.871  1.00 34.31  ? 79  TYR A CE2   1 
ATOM   626  C CZ    . TYR A 1 79  ? 6.230   98.927  24.363  1.00 34.83  ? 79  TYR A CZ    1 
ATOM   627  O OH    . TYR A 1 79  ? 6.786   100.023 23.727  1.00 33.08  ? 79  TYR A OH    1 
ATOM   628  N N     . ARG A 1 80  ? 3.503   95.149  29.600  1.00 27.13  ? 80  ARG A N     1 
ATOM   629  C CA    . ARG A 1 80  ? 2.350   94.505  30.228  1.00 33.66  ? 80  ARG A CA    1 
ATOM   630  C C     . ARG A 1 80  ? 1.212   95.497  30.419  1.00 36.36  ? 80  ARG A C     1 
ATOM   631  O O     . ARG A 1 80  ? 1.435   96.696  30.538  1.00 41.67  ? 80  ARG A O     1 
ATOM   632  C CB    . ARG A 1 80  ? 2.731   93.836  31.553  1.00 34.43  ? 80  ARG A CB    1 
ATOM   633  C CG    . ARG A 1 80  ? 3.185   94.770  32.648  1.00 36.97  ? 80  ARG A CG    1 
ATOM   634  C CD    . ARG A 1 80  ? 3.722   93.990  33.862  1.00 39.21  ? 80  ARG A CD    1 
ATOM   635  N NE    . ARG A 1 80  ? 3.778   94.822  35.070  1.00 43.98  ? 80  ARG A NE    1 
ATOM   636  C CZ    . ARG A 1 80  ? 4.761   95.671  35.370  1.00 45.23  ? 80  ARG A CZ    1 
ATOM   637  N NH1   . ARG A 1 80  ? 5.798   95.817  34.548  1.00 48.07  ? 80  ARG A NH1   1 
ATOM   638  N NH2   . ARG A 1 80  ? 4.713   96.381  36.493  1.00 40.44  ? 80  ARG A NH2   1 
ATOM   639  N N     . LEU A 1 81  ? -0.010  94.985  30.379  1.00 40.01  ? 81  LEU A N     1 
ATOM   640  C CA    . LEU A 1 81  ? -1.188  95.779  30.711  1.00 42.51  ? 81  LEU A CA    1 
ATOM   641  C C     . LEU A 1 81  ? -1.531  95.567  32.153  1.00 41.88  ? 81  LEU A C     1 
ATOM   642  O O     . LEU A 1 81  ? -1.672  94.438  32.597  1.00 47.53  ? 81  LEU A O     1 
ATOM   643  C CB    . LEU A 1 81  ? -2.367  95.410  29.817  1.00 44.02  ? 81  LEU A CB    1 
ATOM   644  C CG    . LEU A 1 81  ? -2.162  96.164  28.500  1.00 51.71  ? 81  LEU A CG    1 
ATOM   645  C CD1   . LEU A 1 81  ? -2.901  95.502  27.353  1.00 51.21  ? 81  LEU A CD1   1 
ATOM   646  C CD2   . LEU A 1 81  ? -2.584  97.645  28.694  1.00 45.03  ? 81  LEU A CD2   1 
ATOM   647  N N     . ALA A 1 82  ? -1.642  96.660  32.890  1.00 39.38  ? 82  ALA A N     1 
ATOM   648  C CA    . ALA A 1 82  ? -1.903  96.600  34.319  1.00 37.16  ? 82  ALA A CA    1 
ATOM   649  C C     . ALA A 1 82  ? -3.037  97.560  34.725  1.00 39.77  ? 82  ALA A C     1 
ATOM   650  O O     . ALA A 1 82  ? -3.318  98.554  34.039  1.00 43.37  ? 82  ALA A O     1 
ATOM   651  C CB    . ALA A 1 82  ? -0.627  96.927  35.084  1.00 31.37  ? 82  ALA A CB    1 
ATOM   652  N N     . THR A 1 83  ? -3.684  97.275  35.847  1.00 36.87  ? 83  THR A N     1 
ATOM   653  C CA    . THR A 1 83  ? -4.623  98.234  36.405  1.00 42.20  ? 83  THR A CA    1 
ATOM   654  C C     . THR A 1 83  ? -3.868  99.485  36.853  1.00 45.95  ? 83  THR A C     1 
ATOM   655  O O     . THR A 1 83  ? -2.643  99.474  36.979  1.00 46.22  ? 83  THR A O     1 
ATOM   656  C CB    . THR A 1 83  ? -5.396  97.651  37.591  1.00 42.55  ? 83  THR A CB    1 
ATOM   657  O OG1   . THR A 1 83  ? -4.503  97.494  38.701  1.00 47.54  ? 83  THR A OG1   1 
ATOM   658  C CG2   . THR A 1 83  ? -6.002  96.296  37.219  1.00 42.25  ? 83  THR A CG2   1 
ATOM   659  N N     . LEU A 1 84  ? -4.601  100.562 37.100  1.00 47.96  ? 84  LEU A N     1 
ATOM   660  C CA    . LEU A 1 84  ? -3.979  101.815 37.489  1.00 45.12  ? 84  LEU A CA    1 
ATOM   661  C C     . LEU A 1 84  ? -3.368  101.791 38.889  1.00 50.68  ? 84  LEU A C     1 
ATOM   662  O O     . LEU A 1 84  ? -2.455  102.546 39.171  1.00 54.57  ? 84  LEU A O     1 
ATOM   663  C CB    . LEU A 1 84  ? -4.993  102.936 37.398  1.00 42.56  ? 84  LEU A CB    1 
ATOM   664  C CG    . LEU A 1 84  ? -5.328  103.323 35.965  1.00 45.17  ? 84  LEU A CG    1 
ATOM   665  C CD1   . LEU A 1 84  ? -6.548  104.220 35.987  1.00 50.80  ? 84  LEU A CD1   1 
ATOM   666  C CD2   . LEU A 1 84  ? -4.132  104.017 35.283  1.00 40.48  ? 84  LEU A CD2   1 
ATOM   667  N N     . ASP A 1 85  ? -3.836  100.923 39.775  1.00 54.04  ? 85  ASP A N     1 
ATOM   668  C CA    . ASP A 1 85  ? -3.242  100.901 41.113  1.00 59.69  ? 85  ASP A CA    1 
ATOM   669  C C     . ASP A 1 85  ? -2.039  99.956  41.204  1.00 58.89  ? 85  ASP A C     1 
ATOM   670  O O     . ASP A 1 85  ? -1.528  99.711  42.291  1.00 60.33  ? 85  ASP A O     1 
ATOM   671  C CB    . ASP A 1 85  ? -4.287  100.528 42.192  1.00 64.52  ? 85  ASP A CB    1 
ATOM   672  C CG    . ASP A 1 85  ? -5.088  99.250  41.867  1.00 72.02  ? 85  ASP A CG    1 
ATOM   673  O OD1   . ASP A 1 85  ? -4.610  98.367  41.122  1.00 66.09  ? 85  ASP A OD1   1 
ATOM   674  O OD2   . ASP A 1 85  ? -6.228  99.127  42.393  1.00 85.09  ? 85  ASP A OD2   1 
ATOM   675  N N     . ALA A 1 86  ? -1.593  99.418  40.072  1.00 55.97  ? 86  ALA A N     1 
ATOM   676  C CA    . ALA A 1 86  ? -0.463  98.491  40.079  1.00 52.28  ? 86  ALA A CA    1 
ATOM   677  C C     . ALA A 1 86  ? 0.814   99.187  40.560  1.00 50.47  ? 86  ALA A C     1 
ATOM   678  O O     . ALA A 1 86  ? 1.116   100.304 40.145  1.00 48.23  ? 86  ALA A O     1 
ATOM   679  C CB    . ALA A 1 86  ? -0.249  97.886  38.689  1.00 46.59  ? 86  ALA A CB    1 
ATOM   680  N N     . PRO A 1 87  ? 1.558   98.525  41.448  1.00 54.66  ? 87  PRO A N     1 
ATOM   681  C CA    . PRO A 1 87  ? 2.863   99.006  41.911  1.00 54.75  ? 87  PRO A CA    1 
ATOM   682  C C     . PRO A 1 87  ? 3.937   99.038  40.815  1.00 55.81  ? 87  PRO A C     1 
ATOM   683  O O     . PRO A 1 87  ? 3.925   98.246  39.867  1.00 57.44  ? 87  PRO A O     1 
ATOM   684  C CB    . PRO A 1 87  ? 3.238   97.988  42.998  1.00 58.54  ? 87  PRO A CB    1 
ATOM   685  C CG    . PRO A 1 87  ? 2.471   96.733  42.641  1.00 59.75  ? 87  PRO A CG    1 
ATOM   686  C CD    . PRO A 1 87  ? 1.159   97.273  42.127  1.00 60.10  ? 87  PRO A CD    1 
ATOM   687  N N     . ARG A 1 88  ? 4.870   99.972  40.950  1.00 57.13  ? 88  ARG A N     1 
ATOM   688  C CA    . ARG A 1 88  ? 6.011   100.045 40.051  1.00 56.14  ? 88  ARG A CA    1 
ATOM   689  C C     . ARG A 1 88  ? 7.013   98.975  40.456  1.00 53.54  ? 88  ARG A C     1 
ATOM   690  O O     . ARG A 1 88  ? 7.275   98.773  41.634  1.00 53.05  ? 88  ARG A O     1 
ATOM   691  C CB    . ARG A 1 88  ? 6.665   101.436 40.084  1.00 55.20  ? 88  ARG A CB    1 
ATOM   692  N N     . GLU A 1 89  ? 7.543   98.285  39.463  1.00 49.36  ? 89  GLU A N     1 
ATOM   693  C CA    . GLU A 1 89  ? 8.535   97.266  39.664  1.00 48.33  ? 89  GLU A CA    1 
ATOM   694  C C     . GLU A 1 89  ? 9.891   97.806  39.234  1.00 47.66  ? 89  GLU A C     1 
ATOM   695  O O     . GLU A 1 89  ? 9.961   98.823  38.542  1.00 47.90  ? 89  GLU A O     1 
ATOM   696  C CB    . GLU A 1 89  ? 8.158   96.028  38.874  1.00 53.32  ? 89  GLU A CB    1 
ATOM   697  C CG    . GLU A 1 89  ? 6.837   95.440  39.314  1.00 71.46  ? 89  GLU A CG    1 
ATOM   698  C CD    . GLU A 1 89  ? 6.811   93.922  39.184  1.00 88.30  ? 89  GLU A CD    1 
ATOM   699  O OE1   . GLU A 1 89  ? 7.107   93.418  38.064  1.00 88.84  ? 89  GLU A OE1   1 
ATOM   700  O OE2   . GLU A 1 89  ? 6.512   93.240  40.204  1.00 93.18  ? 89  GLU A OE2   1 
ATOM   701  N N     . LYS A 1 90  ? 10.961  97.109  39.595  1.00 45.97  ? 90  LYS A N     1 
ATOM   702  C CA    . LYS A 1 90  ? 12.309  97.687  39.543  1.00 49.97  ? 90  LYS A CA    1 
ATOM   703  C C     . LYS A 1 90  ? 12.736  98.118  38.151  1.00 51.17  ? 90  LYS A C     1 
ATOM   704  O O     . LYS A 1 90  ? 13.397  99.148  37.989  1.00 54.46  ? 90  LYS A O     1 
ATOM   705  C CB    . LYS A 1 90  ? 13.329  96.698  40.107  1.00 49.79  ? 90  LYS A CB    1 
ATOM   706  C CG    . LYS A 1 90  ? 14.712  97.254  40.310  1.00 56.41  ? 90  LYS A CG    1 
ATOM   707  C CD    . LYS A 1 90  ? 15.590  96.179  40.953  1.00 69.56  ? 90  LYS A CD    1 
ATOM   708  C CE    . LYS A 1 90  ? 17.046  96.624  41.138  1.00 77.77  ? 90  LYS A CE    1 
ATOM   709  N NZ    . LYS A 1 90  ? 17.647  97.077  39.846  1.00 80.25  ? 90  LYS A NZ    1 
ATOM   710  N N     . HIS A 1 91  ? 12.354  97.344  37.145  1.00 45.37  ? 91  HIS A N     1 
ATOM   711  C CA    . HIS A 1 91  ? 12.814  97.648  35.824  1.00 42.23  ? 91  HIS A CA    1 
ATOM   712  C C     . HIS A 1 91  ? 11.725  98.179  34.897  1.00 42.92  ? 91  HIS A C     1 
ATOM   713  O O     . HIS A 1 91  ? 11.884  98.164  33.664  1.00 43.12  ? 91  HIS A O     1 
ATOM   714  C CB    . HIS A 1 91  ? 13.469  96.416  35.239  1.00 41.63  ? 91  HIS A CB    1 
ATOM   715  C CG    . HIS A 1 91  ? 14.621  95.929  36.052  1.00 47.74  ? 91  HIS A CG    1 
ATOM   716  N ND1   . HIS A 1 91  ? 14.552  94.792  36.833  1.00 52.44  ? 91  HIS A ND1   1 
ATOM   717  C CD2   . HIS A 1 91  ? 15.867  96.429  36.222  1.00 48.47  ? 91  HIS A CD2   1 
ATOM   718  C CE1   . HIS A 1 91  ? 15.709  94.612  37.445  1.00 57.03  ? 91  HIS A CE1   1 
ATOM   719  N NE2   . HIS A 1 91  ? 16.525  95.588  37.088  1.00 57.36  ? 91  HIS A NE2   1 
ATOM   720  N N     . ASP A 1 92  ? 10.640  98.653  35.497  1.00 33.83  ? 92  ASP A N     1 
ATOM   721  C CA    . ASP A 1 92  ? 9.644   99.450  34.785  1.00 33.99  ? 92  ASP A CA    1 
ATOM   722  C C     . ASP A 1 92  ? 10.213  100.818 34.468  1.00 35.86  ? 92  ASP A C     1 
ATOM   723  O O     . ASP A 1 92  ? 10.728  101.474 35.356  1.00 41.85  ? 92  ASP A O     1 
ATOM   724  C CB    . ASP A 1 92  ? 8.389   99.595  35.614  1.00 33.55  ? 92  ASP A CB    1 
ATOM   725  C CG    . ASP A 1 92  ? 7.688   98.277  35.832  1.00 42.69  ? 92  ASP A CG    1 
ATOM   726  O OD1   . ASP A 1 92  ? 8.125   97.263  35.248  1.00 46.03  ? 92  ASP A OD1   1 
ATOM   727  O OD2   . ASP A 1 92  ? 6.675   98.253  36.568  1.00 45.79  ? 92  ASP A OD2   1 
ATOM   728  N N     . HIS A 1 93  ? 10.127  101.257 33.213  1.00 32.72  ? 93  HIS A N     1 
ATOM   729  C CA    . HIS A 1 93  ? 10.755  102.516 32.827  1.00 29.68  ? 93  HIS A CA    1 
ATOM   730  C C     . HIS A 1 93  ? 9.770   103.548 32.348  1.00 32.47  ? 93  HIS A C     1 
ATOM   731  O O     . HIS A 1 93  ? 9.986   104.768 32.512  1.00 37.05  ? 93  HIS A O     1 
ATOM   732  C CB    . HIS A 1 93  ? 11.792  102.276 31.712  1.00 33.13  ? 93  HIS A CB    1 
ATOM   733  C CG    . HIS A 1 93  ? 12.847  101.287 32.086  1.00 35.79  ? 93  HIS A CG    1 
ATOM   734  N ND1   . HIS A 1 93  ? 13.508  101.336 33.295  1.00 36.61  ? 93  HIS A ND1   1 
ATOM   735  C CD2   . HIS A 1 93  ? 13.336  100.212 31.425  1.00 35.80  ? 93  HIS A CD2   1 
ATOM   736  C CE1   . HIS A 1 93  ? 14.370  100.335 33.360  1.00 37.30  ? 93  HIS A CE1   1 
ATOM   737  N NE2   . HIS A 1 93  ? 14.287  99.645  32.238  1.00 40.86  ? 93  HIS A NE2   1 
ATOM   738  N N     . LEU A 1 94  ? 8.704   103.068 31.722  1.00 30.77  ? 94  LEU A N     1 
ATOM   739  C CA    . LEU A 1 94  ? 7.742   103.952 31.076  1.00 34.55  ? 94  LEU A CA    1 
ATOM   740  C C     . LEU A 1 94  ? 6.349   103.445 31.305  1.00 38.46  ? 94  LEU A C     1 
ATOM   741  O O     . LEU A 1 94  ? 6.123   102.223 31.316  1.00 41.51  ? 94  LEU A O     1 
ATOM   742  C CB    . LEU A 1 94  ? 7.965   104.018 29.559  1.00 37.52  ? 94  LEU A CB    1 
ATOM   743  C CG    . LEU A 1 94  ? 9.201   104.642 28.952  1.00 44.44  ? 94  LEU A CG    1 
ATOM   744  C CD1   . LEU A 1 94  ? 9.125   104.469 27.465  1.00 47.81  ? 94  LEU A CD1   1 
ATOM   745  C CD2   . LEU A 1 94  ? 9.210   106.094 29.283  1.00 48.03  ? 94  LEU A CD2   1 
ATOM   746  N N     . THR A 1 95  ? 5.397   104.366 31.410  1.00 36.59  ? 95  THR A N     1 
ATOM   747  C CA    . THR A 1 95  ? 4.024   103.943 31.477  1.00 34.92  ? 95  THR A CA    1 
ATOM   748  C C     . THR A 1 95  ? 3.107   104.893 30.700  1.00 40.17  ? 95  THR A C     1 
ATOM   749  O O     . THR A 1 95  ? 3.201   106.129 30.756  1.00 42.76  ? 95  THR A O     1 
ATOM   750  C CB    . THR A 1 95  ? 3.564   103.784 32.962  1.00 49.54  ? 95  THR A CB    1 
ATOM   751  O OG1   . THR A 1 95  ? 2.181   103.418 33.006  1.00 56.63  ? 95  THR A OG1   1 
ATOM   752  C CG2   . THR A 1 95  ? 3.742   105.052 33.739  1.00 48.06  ? 95  THR A CG2   1 
ATOM   753  N N     . MET A 1 96  ? 2.203   104.270 29.969  1.00 35.18  ? 96  MET A N     1 
ATOM   754  C CA    . MET A 1 96  ? 1.214   104.944 29.178  1.00 31.96  ? 96  MET A CA    1 
ATOM   755  C C     . MET A 1 96  ? -0.145  104.685 29.839  1.00 37.82  ? 96  MET A C     1 
ATOM   756  O O     . MET A 1 96  ? -0.670  103.559 29.848  1.00 42.41  ? 96  MET A O     1 
ATOM   757  C CB    . MET A 1 96  ? 1.304   104.422 27.731  1.00 30.51  ? 96  MET A CB    1 
ATOM   758  C CG    . MET A 1 96  ? 0.287   104.956 26.786  1.00 39.01  ? 96  MET A CG    1 
ATOM   759  S SD    . MET A 1 96  ? 0.607   104.407 25.084  1.00 50.34  ? 96  MET A SD    1 
ATOM   760  C CE    . MET A 1 96  ? 2.169   105.210 24.737  1.00 53.71  ? 96  MET A CE    1 
ATOM   761  N N     . LYS A 1 97  ? -0.697  105.718 30.455  1.00 42.65  ? 97  LYS A N     1 
ATOM   762  C CA    . LYS A 1 97  ? -1.895  105.540 31.274  1.00 48.12  ? 97  LYS A CA    1 
ATOM   763  C C     . LYS A 1 97  ? -3.157  105.825 30.510  1.00 44.59  ? 97  LYS A C     1 
ATOM   764  O O     . LYS A 1 97  ? -3.261  106.838 29.814  1.00 47.07  ? 97  LYS A O     1 
ATOM   765  C CB    . LYS A 1 97  ? -1.826  106.419 32.531  1.00 50.05  ? 97  LYS A CB    1 
ATOM   766  C CG    . LYS A 1 97  ? -0.716  105.962 33.478  1.00 52.34  ? 97  LYS A CG    1 
ATOM   767  C CD    . LYS A 1 97  ? -0.614  106.821 34.722  1.00 54.78  ? 97  LYS A CD    1 
ATOM   768  C CE    . LYS A 1 97  ? 0.300   106.157 35.739  1.00 63.27  ? 97  LYS A CE    1 
ATOM   769  N NZ    . LYS A 1 97  ? 0.405   106.909 37.035  1.00 71.01  ? 97  LYS A NZ    1 
ATOM   770  N N     . PHE A 1 98  ? -4.102  104.899 30.632  1.00 41.38  ? 98  PHE A N     1 
ATOM   771  C CA    . PHE A 1 98  ? -5.411  105.022 30.013  1.00 39.54  ? 98  PHE A CA    1 
ATOM   772  C C     . PHE A 1 98  ? -6.426  105.276 31.104  1.00 43.60  ? 98  PHE A C     1 
ATOM   773  O O     . PHE A 1 98  ? -6.061  105.369 32.262  1.00 46.23  ? 98  PHE A O     1 
ATOM   774  C CB    . PHE A 1 98  ? -5.758  103.764 29.213  1.00 36.37  ? 98  PHE A CB    1 
ATOM   775  C CG    . PHE A 1 98  ? -4.703  103.382 28.236  1.00 38.41  ? 98  PHE A CG    1 
ATOM   776  C CD1   . PHE A 1 98  ? -4.490  104.148 27.105  1.00 48.27  ? 98  PHE A CD1   1 
ATOM   777  C CD2   . PHE A 1 98  ? -3.909  102.262 28.445  1.00 37.68  ? 98  PHE A CD2   1 
ATOM   778  C CE1   . PHE A 1 98  ? -3.497  103.801 26.200  1.00 49.43  ? 98  PHE A CE1   1 
ATOM   779  C CE2   . PHE A 1 98  ? -2.932  101.904 27.552  1.00 38.70  ? 98  PHE A CE2   1 
ATOM   780  C CZ    . PHE A 1 98  ? -2.713  102.680 26.427  1.00 43.45  ? 98  PHE A CZ    1 
ATOM   781  N N     . ALA A 1 99  ? -7.697  105.400 30.748  1.00 43.44  ? 99  ALA A N     1 
ATOM   782  C CA    . ALA A 1 99  ? -8.707  105.631 31.766  1.00 49.89  ? 99  ALA A CA    1 
ATOM   783  C C     . ALA A 1 99  ? -8.892  104.393 32.639  1.00 57.27  ? 99  ALA A C     1 
ATOM   784  O O     . ALA A 1 99  ? -9.191  104.504 33.820  1.00 62.11  ? 99  ALA A O     1 
ATOM   785  C CB    . ALA A 1 99  ? -10.014 106.028 31.136  1.00 41.19  ? 99  ALA A CB    1 
ATOM   786  N N     . ASP A 1 100 ? -8.701  103.209 32.074  1.00 62.11  ? 100 ASP A N     1 
ATOM   787  C CA    . ASP A 1 100 ? -9.073  101.996 32.807  1.00 73.45  ? 100 ASP A CA    1 
ATOM   788  C C     . ASP A 1 100 ? -7.901  101.011 32.995  1.00 68.00  ? 100 ASP A C     1 
ATOM   789  O O     . ASP A 1 100 ? -8.096  99.822  33.265  1.00 70.00  ? 100 ASP A O     1 
ATOM   790  C CB    . ASP A 1 100 ? -10.255 101.302 32.101  1.00 83.07  ? 100 ASP A CB    1 
ATOM   791  C CG    . ASP A 1 100 ? -10.035 101.134 30.592  1.00 90.39  ? 100 ASP A CG    1 
ATOM   792  O OD1   . ASP A 1 100 ? -8.873  101.255 30.124  1.00 90.70  ? 100 ASP A OD1   1 
ATOM   793  O OD2   . ASP A 1 100 ? -11.030 100.867 29.877  1.00 92.48  ? 100 ASP A OD2   1 
ATOM   794  N N     . GLY A 1 101 ? -6.686  101.520 32.872  1.00 56.67  ? 101 GLY A N     1 
ATOM   795  C CA    . GLY A 1 101 ? -5.512  100.683 32.950  1.00 48.44  ? 101 GLY A CA    1 
ATOM   796  C C     . GLY A 1 101 ? -4.300  101.422 32.407  1.00 44.90  ? 101 GLY A C     1 
ATOM   797  O O     . GLY A 1 101 ? -4.401  102.583 32.015  1.00 47.94  ? 101 GLY A O     1 
ATOM   798  N N     . GLN A 1 102 ? -3.155  100.750 32.387  1.00 38.16  ? 102 GLN A N     1 
ATOM   799  C CA    . GLN A 1 102 ? -1.923  101.357 31.935  1.00 38.80  ? 102 GLN A CA    1 
ATOM   800  C C     . GLN A 1 102 ? -1.063  100.347 31.222  1.00 43.94  ? 102 GLN A C     1 
ATOM   801  O O     . GLN A 1 102 ? -1.107  99.129  31.520  1.00 43.88  ? 102 GLN A O     1 
ATOM   802  C CB    . GLN A 1 102 ? -1.137  101.956 33.094  1.00 38.24  ? 102 GLN A CB    1 
ATOM   803  C CG    . GLN A 1 102 ? -0.785  100.948 34.188  1.00 41.85  ? 102 GLN A CG    1 
ATOM   804  C CD    . GLN A 1 102 ? -0.090  101.611 35.371  1.00 46.85  ? 102 GLN A CD    1 
ATOM   805  O OE1   . GLN A 1 102 ? 0.815   102.449 35.190  1.00 50.57  ? 102 GLN A OE1   1 
ATOM   806  N NE2   . GLN A 1 102 ? -0.500  101.244 36.586  1.00 45.60  ? 102 GLN A NE2   1 
ATOM   807  N N     . LEU A 1 103 ? -0.294  100.862 30.260  1.00 40.65  ? 103 LEU A N     1 
ATOM   808  C CA    . LEU A 1 103 ? 0.626   100.041 29.507  1.00 36.46  ? 103 LEU A CA    1 
ATOM   809  C C     . LEU A 1 103 ? 2.011   100.354 30.024  1.00 35.76  ? 103 LEU A C     1 
ATOM   810  O O     . LEU A 1 103 ? 2.488   101.483 29.916  1.00 36.46  ? 103 LEU A O     1 
ATOM   811  C CB    . LEU A 1 103 ? 0.512   100.310 28.005  1.00 34.44  ? 103 LEU A CB    1 
ATOM   812  C CG    . LEU A 1 103 ? 1.535   99.582  27.133  1.00 33.34  ? 103 LEU A CG    1 
ATOM   813  C CD1   . LEU A 1 103 ? 1.228   98.087  27.085  1.00 31.80  ? 103 LEU A CD1   1 
ATOM   814  C CD2   . LEU A 1 103 ? 1.587   100.176 25.724  1.00 31.78  ? 103 LEU A CD2   1 
ATOM   815  N N     . ILE A 1 104 ? 2.651   99.359  30.606  1.00 31.26  ? 104 ILE A N     1 
ATOM   816  C CA    . ILE A 1 104 ? 3.953   99.567  31.207  1.00 31.19  ? 104 ILE A CA    1 
ATOM   817  C C     . ILE A 1 104 ? 5.069   98.935  30.358  1.00 32.83  ? 104 ILE A C     1 
ATOM   818  O O     . ILE A 1 104 ? 4.970   97.769  29.976  1.00 30.81  ? 104 ILE A O     1 
ATOM   819  C CB    . ILE A 1 104 ? 3.988   98.960  32.638  1.00 33.31  ? 104 ILE A CB    1 
ATOM   820  C CG1   . ILE A 1 104 ? 3.012   99.699  33.564  1.00 30.80  ? 104 ILE A CG1   1 
ATOM   821  C CG2   . ILE A 1 104 ? 5.421   98.984  33.213  1.00 30.64  ? 104 ILE A CG2   1 
ATOM   822  C CD1   . ILE A 1 104 ? 2.619   98.837  34.745  1.00 35.76  ? 104 ILE A CD1   1 
ATOM   823  N N     . TYR A 1 105 ? 6.133   99.688  30.091  1.00 28.75  ? 105 TYR A N     1 
ATOM   824  C CA    . TYR A 1 105 ? 7.305   99.112  29.469  1.00 28.45  ? 105 TYR A CA    1 
ATOM   825  C C     . TYR A 1 105 ? 8.409   98.880  30.492  1.00 36.51  ? 105 TYR A C     1 
ATOM   826  O O     . TYR A 1 105 ? 8.826   99.791  31.212  1.00 40.30  ? 105 TYR A O     1 
ATOM   827  C CB    . TYR A 1 105 ? 7.834   100.000 28.334  1.00 31.02  ? 105 TYR A CB    1 
ATOM   828  C CG    . TYR A 1 105 ? 9.054   99.402  27.672  1.00 34.64  ? 105 TYR A CG    1 
ATOM   829  C CD1   . TYR A 1 105 ? 8.925   98.353  26.762  1.00 36.95  ? 105 TYR A CD1   1 
ATOM   830  C CD2   . TYR A 1 105 ? 10.339  99.856  27.979  1.00 30.26  ? 105 TYR A CD2   1 
ATOM   831  C CE1   . TYR A 1 105 ? 10.033  97.785  26.167  1.00 39.25  ? 105 TYR A CE1   1 
ATOM   832  C CE2   . TYR A 1 105 ? 11.450  99.294  27.383  1.00 33.82  ? 105 TYR A CE2   1 
ATOM   833  C CZ    . TYR A 1 105 ? 11.290  98.253  26.478  1.00 39.00  ? 105 TYR A CZ    1 
ATOM   834  O OH    . TYR A 1 105 ? 12.380  97.676  25.872  1.00 41.73  ? 105 TYR A OH    1 
ATOM   835  N N     . ALA A 1 106 ? 8.906   97.656  30.518  1.00 35.12  ? 106 ALA A N     1 
ATOM   836  C CA    . ALA A 1 106 ? 9.996   97.273  31.397  1.00 39.19  ? 106 ALA A CA    1 
ATOM   837  C C     . ALA A 1 106 ? 11.150  96.673  30.583  1.00 38.28  ? 106 ALA A C     1 
ATOM   838  O O     . ALA A 1 106 ? 10.940  96.055  29.532  1.00 39.36  ? 106 ALA A O     1 
ATOM   839  C CB    . ALA A 1 106 ? 9.512   96.279  32.437  1.00 24.36  ? 106 ALA A CB    1 
ATOM   840  N N     . ASP A 1 107 ? 12.364  96.804  31.092  1.00 37.76  ? 107 ASP A N     1 
ATOM   841  C CA    . ASP A 1 107 ? 13.525  96.323  30.361  1.00 34.25  ? 107 ASP A CA    1 
ATOM   842  C C     . ASP A 1 107 ? 14.720  96.267  31.278  1.00 35.11  ? 107 ASP A C     1 
ATOM   843  O O     . ASP A 1 107 ? 15.318  97.301  31.561  1.00 39.13  ? 107 ASP A O     1 
ATOM   844  C CB    . ASP A 1 107 ? 13.789  97.253  29.169  1.00 36.62  ? 107 ASP A CB    1 
ATOM   845  C CG    . ASP A 1 107 ? 14.882  96.746  28.235  1.00 39.21  ? 107 ASP A CG    1 
ATOM   846  O OD1   . ASP A 1 107 ? 15.798  95.987  28.663  1.00 36.64  ? 107 ASP A OD1   1 
ATOM   847  O OD2   . ASP A 1 107 ? 14.807  97.133  27.043  1.00 36.37  ? 107 ASP A OD2   1 
ATOM   848  N N     . VAL A 1 108 ? 15.075  95.073  31.750  1.00 36.34  ? 108 VAL A N     1 
ATOM   849  C CA    . VAL A 1 108 ? 16.179  94.948  32.697  1.00 33.33  ? 108 VAL A CA    1 
ATOM   850  C C     . VAL A 1 108 ? 17.434  95.654  32.199  1.00 35.34  ? 108 VAL A C     1 
ATOM   851  O O     . VAL A 1 108 ? 18.075  96.399  32.933  1.00 35.28  ? 108 VAL A O     1 
ATOM   852  C CB    . VAL A 1 108 ? 16.529  93.473  32.989  1.00 41.15  ? 108 VAL A CB    1 
ATOM   853  C CG1   . VAL A 1 108 ? 17.789  93.393  33.906  1.00 39.15  ? 108 VAL A CG1   1 
ATOM   854  C CG2   . VAL A 1 108 ? 15.350  92.776  33.666  1.00 36.66  ? 108 VAL A CG2   1 
ATOM   855  N N     . ARG A 1 109 ? 17.772  95.450  30.934  1.00 37.26  ? 109 ARG A N     1 
ATOM   856  C CA    . ARG A 1 109 ? 19.047  95.934  30.447  1.00 37.72  ? 109 ARG A CA    1 
ATOM   857  C C     . ARG A 1 109 ? 18.962  97.367  29.932  1.00 33.58  ? 109 ARG A C     1 
ATOM   858  O O     . ARG A 1 109 ? 19.988  97.971  29.609  1.00 37.47  ? 109 ARG A O     1 
ATOM   859  C CB    . ARG A 1 109 ? 19.583  94.957  29.390  1.00 37.38  ? 109 ARG A CB    1 
ATOM   860  C CG    . ARG A 1 109 ? 19.769  93.543  30.001  1.00 36.26  ? 109 ARG A CG    1 
ATOM   861  C CD    . ARG A 1 109 ? 20.464  92.559  29.074  1.00 36.96  ? 109 ARG A CD    1 
ATOM   862  N NE    . ARG A 1 109 ? 21.862  92.903  28.851  1.00 38.36  ? 109 ARG A NE    1 
ATOM   863  C CZ    . ARG A 1 109 ? 22.640  92.376  27.903  1.00 36.88  ? 109 ARG A CZ    1 
ATOM   864  N NH1   . ARG A 1 109 ? 22.170  91.470  27.051  1.00 34.17  ? 109 ARG A NH1   1 
ATOM   865  N NH2   . ARG A 1 109 ? 23.889  92.792  27.793  1.00 32.21  ? 109 ARG A NH2   1 
ATOM   866  N N     . LYS A 1 110 ? 17.752  97.923  29.903  1.00 32.25  ? 110 LYS A N     1 
ATOM   867  C CA    . LYS A 1 110 ? 17.529  99.309  29.448  1.00 33.70  ? 110 LYS A CA    1 
ATOM   868  C C     . LYS A 1 110 ? 17.981  99.570  28.013  1.00 36.64  ? 110 LYS A C     1 
ATOM   869  O O     . LYS A 1 110 ? 18.384  100.692 27.708  1.00 42.68  ? 110 LYS A O     1 
ATOM   870  C CB    . LYS A 1 110 ? 18.265  100.323 30.336  1.00 33.85  ? 110 LYS A CB    1 
ATOM   871  C CG    . LYS A 1 110 ? 17.840  100.398 31.786  1.00 39.59  ? 110 LYS A CG    1 
ATOM   872  C CD    . LYS A 1 110 ? 18.727  101.406 32.489  1.00 41.65  ? 110 LYS A CD    1 
ATOM   873  C CE    . LYS A 1 110 ? 18.122  101.890 33.780  1.00 41.99  ? 110 LYS A CE    1 
ATOM   874  N NZ    . LYS A 1 110 ? 18.408  100.876 34.801  1.00 48.33  ? 110 LYS A NZ    1 
ATOM   875  N N     . PHE A 1 111 ? 17.938  98.562  27.144  1.00 32.42  ? 111 PHE A N     1 
ATOM   876  C CA    . PHE A 1 111 ? 18.342  98.735  25.747  1.00 31.47  ? 111 PHE A CA    1 
ATOM   877  C C     . PHE A 1 111 ? 17.216  99.291  24.871  1.00 33.13  ? 111 PHE A C     1 
ATOM   878  O O     . PHE A 1 111 ? 17.471  100.008 23.908  1.00 35.97  ? 111 PHE A O     1 
ATOM   879  C CB    . PHE A 1 111 ? 18.809  97.413  25.147  1.00 33.45  ? 111 PHE A CB    1 
ATOM   880  C CG    . PHE A 1 111 ? 20.115  96.897  25.704  1.00 34.72  ? 111 PHE A CG    1 
ATOM   881  C CD1   . PHE A 1 111 ? 20.926  97.693  26.489  1.00 34.78  ? 111 PHE A CD1   1 
ATOM   882  C CD2   . PHE A 1 111 ? 20.520  95.593  25.441  1.00 29.99  ? 111 PHE A CD2   1 
ATOM   883  C CE1   . PHE A 1 111 ? 22.124  97.205  26.998  1.00 31.70  ? 111 PHE A CE1   1 
ATOM   884  C CE2   . PHE A 1 111 ? 21.714  95.115  25.914  1.00 29.78  ? 111 PHE A CE2   1 
ATOM   885  C CZ    . PHE A 1 111 ? 22.519  95.925  26.700  1.00 32.96  ? 111 PHE A CZ    1 
ATOM   886  N N     . GLY A 1 112 ? 15.973  98.948  25.211  1.00 30.46  ? 112 GLY A N     1 
ATOM   887  C CA    . GLY A 1 112 ? 14.824  99.314  24.402  1.00 28.17  ? 112 GLY A CA    1 
ATOM   888  C C     . GLY A 1 112 ? 14.658  100.813 24.137  1.00 34.50  ? 112 GLY A C     1 
ATOM   889  O O     . GLY A 1 112 ? 15.068  101.669 24.940  1.00 34.77  ? 112 GLY A O     1 
ATOM   890  N N     . THR A 1 113 ? 14.028  101.144 23.014  1.00 31.01  ? 113 THR A N     1 
ATOM   891  C CA    . THR A 1 113 ? 13.936  102.534 22.624  1.00 29.81  ? 113 THR A CA    1 
ATOM   892  C C     . THR A 1 113 ? 12.514  102.915 22.217  1.00 32.39  ? 113 THR A C     1 
ATOM   893  O O     . THR A 1 113 ? 11.727  102.068 21.766  1.00 33.36  ? 113 THR A O     1 
ATOM   894  C CB    . THR A 1 113 ? 14.893  102.850 21.440  1.00 33.22  ? 113 THR A CB    1 
ATOM   895  O OG1   . THR A 1 113 ? 14.527  102.041 20.311  1.00 33.13  ? 113 THR A OG1   1 
ATOM   896  C CG2   . THR A 1 113 ? 16.358  102.595 21.813  1.00 25.23  ? 113 THR A CG2   1 
ATOM   897  N N     . TRP A 1 114 ? 12.192  104.194 22.393  1.00 29.97  ? 114 TRP A N     1 
ATOM   898  C CA    . TRP A 1 114 ? 10.987  104.784 21.817  1.00 31.34  ? 114 TRP A CA    1 
ATOM   899  C C     . TRP A 1 114 ? 11.382  105.945 20.924  1.00 34.18  ? 114 TRP A C     1 
ATOM   900  O O     . TRP A 1 114 ? 12.267  106.739 21.295  1.00 30.92  ? 114 TRP A O     1 
ATOM   901  C CB    . TRP A 1 114 ? 10.052  105.291 22.892  1.00 32.11  ? 114 TRP A CB    1 
ATOM   902  C CG    . TRP A 1 114 ? 9.128   104.286 23.476  1.00 32.20  ? 114 TRP A CG    1 
ATOM   903  C CD1   . TRP A 1 114 ? 9.212   102.928 23.397  1.00 30.16  ? 114 TRP A CD1   1 
ATOM   904  C CD2   . TRP A 1 114 ? 7.946   104.580 24.231  1.00 36.04  ? 114 TRP A CD2   1 
ATOM   905  N NE1   . TRP A 1 114 ? 8.135   102.349 24.070  1.00 34.18  ? 114 TRP A NE1   1 
ATOM   906  C CE2   . TRP A 1 114 ? 7.360   103.350 24.598  1.00 33.43  ? 114 TRP A CE2   1 
ATOM   907  C CE3   . TRP A 1 114 ? 7.339   105.774 24.656  1.00 41.09  ? 114 TRP A CE3   1 
ATOM   908  C CZ2   . TRP A 1 114 ? 6.199   103.281 25.341  1.00 33.20  ? 114 TRP A CZ2   1 
ATOM   909  C CZ3   . TRP A 1 114 ? 6.181   105.704 25.397  1.00 38.84  ? 114 TRP A CZ3   1 
ATOM   910  C CH2   . TRP A 1 114 ? 5.627   104.463 25.741  1.00 36.10  ? 114 TRP A CH2   1 
ATOM   911  N N     . GLU A 1 115 ? 10.744  106.043 19.758  1.00 34.29  ? 115 GLU A N     1 
ATOM   912  C CA    . GLU A 1 115 ? 10.968  107.172 18.871  1.00 34.27  ? 115 GLU A CA    1 
ATOM   913  C C     . GLU A 1 115 ? 9.641   107.650 18.332  1.00 35.31  ? 115 GLU A C     1 
ATOM   914  O O     . GLU A 1 115 ? 8.881   106.868 17.766  1.00 36.64  ? 115 GLU A O     1 
ATOM   915  C CB    . GLU A 1 115 ? 11.929  106.808 17.723  1.00 31.98  ? 115 GLU A CB    1 
ATOM   916  C CG    . GLU A 1 115 ? 13.372  106.525 18.189  1.00 32.13  ? 115 GLU A CG    1 
ATOM   917  C CD    . GLU A 1 115 ? 14.195  105.755 17.156  1.00 41.35  ? 115 GLU A CD    1 
ATOM   918  O OE1   . GLU A 1 115 ? 13.971  104.551 16.993  1.00 45.10  ? 115 GLU A OE1   1 
ATOM   919  O OE2   . GLU A 1 115 ? 15.080  106.349 16.502  1.00 47.15  ? 115 GLU A OE2   1 
ATOM   920  N N     . LEU A 1 116 ? 9.363   108.935 18.558  1.00 35.50  ? 116 LEU A N     1 
ATOM   921  C CA    . LEU A 1 116 ? 8.201   109.597 18.001  1.00 35.16  ? 116 LEU A CA    1 
ATOM   922  C C     . LEU A 1 116 ? 8.528   110.143 16.627  1.00 40.25  ? 116 LEU A C     1 
ATOM   923  O O     . LEU A 1 116 ? 9.412   110.968 16.486  1.00 39.67  ? 116 LEU A O     1 
ATOM   924  C CB    . LEU A 1 116 ? 7.733   110.738 18.898  1.00 36.59  ? 116 LEU A CB    1 
ATOM   925  C CG    . LEU A 1 116 ? 6.395   111.348 18.476  1.00 35.41  ? 116 LEU A CG    1 
ATOM   926  C CD1   . LEU A 1 116 ? 5.287   110.259 18.444  1.00 33.61  ? 116 LEU A CD1   1 
ATOM   927  C CD2   . LEU A 1 116 ? 6.001   112.451 19.418  1.00 44.26  ? 116 LEU A CD2   1 
ATOM   928  N N     . ILE A 1 117 ? 7.779   109.693 15.631  1.00 41.33  ? 117 ILE A N     1 
ATOM   929  C CA    . ILE A 1 117 ? 8.034   109.963 14.221  1.00 39.78  ? 117 ILE A CA    1 
ATOM   930  C C     . ILE A 1 117 ? 6.704   110.421 13.599  1.00 44.54  ? 117 ILE A C     1 
ATOM   931  O O     . ILE A 1 117 ? 5.628   109.969 14.025  1.00 43.68  ? 117 ILE A O     1 
ATOM   932  C CB    . ILE A 1 117 ? 8.570   108.670 13.519  1.00 48.73  ? 117 ILE A CB    1 
ATOM   933  C CG1   . ILE A 1 117 ? 9.973   108.361 13.997  1.00 51.59  ? 117 ILE A CG1   1 
ATOM   934  C CG2   . ILE A 1 117 ? 8.674   108.811 12.080  1.00 52.14  ? 117 ILE A CG2   1 
ATOM   935  C CD1   . ILE A 1 117 ? 10.861  109.554 13.956  1.00 47.84  ? 117 ILE A CD1   1 
ATOM   936  N N     . SER A 1 118 ? 6.754   111.327 12.628  1.00 45.50  ? 118 SER A N     1 
ATOM   937  C CA    . SER A 1 118 ? 5.546   111.685 11.885  1.00 47.31  ? 118 SER A CA    1 
ATOM   938  C C     . SER A 1 118 ? 5.154   110.529 11.003  1.00 45.47  ? 118 SER A C     1 
ATOM   939  O O     . SER A 1 118 ? 6.005   109.745 10.568  1.00 39.74  ? 118 SER A O     1 
ATOM   940  C CB    . SER A 1 118 ? 5.752   112.902 11.000  1.00 48.50  ? 118 SER A CB    1 
ATOM   941  O OG    . SER A 1 118 ? 6.186   113.992 11.759  1.00 61.03  ? 118 SER A OG    1 
ATOM   942  N N     . THR A 1 119 ? 3.867   110.457 10.713  1.00 43.18  ? 119 THR A N     1 
ATOM   943  C CA    . THR A 1 119 ? 3.345   109.417 9.860   1.00 47.75  ? 119 THR A CA    1 
ATOM   944  C C     . THR A 1 119 ? 4.075   109.339 8.521   1.00 47.70  ? 119 THR A C     1 
ATOM   945  O O     . THR A 1 119 ? 4.461   108.266 8.102   1.00 43.67  ? 119 THR A O     1 
ATOM   946  C CB    . THR A 1 119 ? 1.849   109.632 9.634   1.00 52.91  ? 119 THR A CB    1 
ATOM   947  O OG1   . THR A 1 119 ? 1.192   109.450 10.890  1.00 46.61  ? 119 THR A OG1   1 
ATOM   948  C CG2   . THR A 1 119 ? 1.281   108.633 8.572   1.00 46.95  ? 119 THR A CG2   1 
ATOM   949  N N     . ASP A 1 120 ? 4.276   110.477 7.866   1.00 54.99  ? 120 ASP A N     1 
ATOM   950  C CA    . ASP A 1 120 ? 4.977   110.494 6.584   1.00 52.35  ? 120 ASP A CA    1 
ATOM   951  C C     . ASP A 1 120 ? 6.494   110.306 6.719   1.00 50.71  ? 120 ASP A C     1 
ATOM   952  O O     . ASP A 1 120 ? 7.208   110.346 5.726   1.00 56.78  ? 120 ASP A O     1 
ATOM   953  C CB    . ASP A 1 120 ? 4.688   111.793 5.826   1.00 54.04  ? 120 ASP A CB    1 
ATOM   954  C CG    . ASP A 1 120 ? 5.087   113.031 6.610   1.00 69.01  ? 120 ASP A CG    1 
ATOM   955  O OD1   . ASP A 1 120 ? 5.271   112.942 7.836   1.00 77.34  ? 120 ASP A OD1   1 
ATOM   956  O OD2   . ASP A 1 120 ? 5.184   114.116 6.012   1.00 78.26  ? 120 ASP A OD2   1 
ATOM   957  N N     . GLN A 1 121 ? 6.998   110.092 7.924   1.00 49.06  ? 121 GLN A N     1 
ATOM   958  C CA    . GLN A 1 121 ? 8.433   109.861 8.082   1.00 47.75  ? 121 GLN A CA    1 
ATOM   959  C C     . GLN A 1 121 ? 8.740   108.400 8.395   1.00 44.59  ? 121 GLN A C     1 
ATOM   960  O O     . GLN A 1 121 ? 9.900   108.014 8.528   1.00 43.36  ? 121 GLN A O     1 
ATOM   961  C CB    . GLN A 1 121 ? 8.996   110.765 9.170   1.00 50.11  ? 121 GLN A CB    1 
ATOM   962  C CG    . GLN A 1 121 ? 9.031   112.236 8.788   1.00 61.60  ? 121 GLN A CG    1 
ATOM   963  C CD    . GLN A 1 121 ? 9.914   112.527 7.560   1.00 77.54  ? 121 GLN A CD    1 
ATOM   964  O OE1   . GLN A 1 121 ? 11.145  112.428 7.623   1.00 83.26  ? 121 GLN A OE1   1 
ATOM   965  N NE2   . GLN A 1 121 ? 9.282   112.904 6.443   1.00 81.07  ? 121 GLN A NE2   1 
ATOM   966  N N     . VAL A 1 122 ? 7.698   107.578 8.505   1.00 43.22  ? 122 VAL A N     1 
ATOM   967  C CA    . VAL A 1 122 ? 7.881   106.165 8.837   1.00 39.40  ? 122 VAL A CA    1 
ATOM   968  C C     . VAL A 1 122 ? 8.639   105.404 7.743   1.00 38.70  ? 122 VAL A C     1 
ATOM   969  O O     . VAL A 1 122 ? 9.568   104.685 8.036   1.00 44.13  ? 122 VAL A O     1 
ATOM   970  C CB    . VAL A 1 122 ? 6.525   105.478 9.137   1.00 37.79  ? 122 VAL A CB    1 
ATOM   971  C CG1   . VAL A 1 122 ? 6.701   103.963 9.299   1.00 31.18  ? 122 VAL A CG1   1 
ATOM   972  C CG2   . VAL A 1 122 ? 5.910   106.075 10.422  1.00 36.78  ? 122 VAL A CG2   1 
ATOM   973  N N     . LEU A 1 123 ? 8.295   105.589 6.480   1.00 46.60  ? 123 LEU A N     1 
ATOM   974  C CA    . LEU A 1 123 ? 9.029   104.890 5.430   1.00 49.43  ? 123 LEU A CA    1 
ATOM   975  C C     . LEU A 1 123 ? 10.492  105.374 5.343   1.00 44.07  ? 123 LEU A C     1 
ATOM   976  O O     . LEU A 1 123 ? 11.402  104.537 5.312   1.00 39.11  ? 123 LEU A O     1 
ATOM   977  C CB    . LEU A 1 123 ? 8.306   105.016 4.064   1.00 63.60  ? 123 LEU A CB    1 
ATOM   978  C CG    . LEU A 1 123 ? 6.849   104.498 4.099   1.00 73.06  ? 123 LEU A CG    1 
ATOM   979  C CD1   . LEU A 1 123 ? 6.166   104.463 2.721   1.00 73.98  ? 123 LEU A CD1   1 
ATOM   980  C CD2   . LEU A 1 123 ? 6.745   103.122 4.788   1.00 77.91  ? 123 LEU A CD2   1 
ATOM   981  N N     . PRO A 1 124 ? 10.725  106.706 5.315   1.00 39.61  ? 124 PRO A N     1 
ATOM   982  C CA    . PRO A 1 124 ? 12.123  107.178 5.336   1.00 36.26  ? 124 PRO A CA    1 
ATOM   983  C C     . PRO A 1 124 ? 12.912  106.630 6.524   1.00 41.72  ? 124 PRO A C     1 
ATOM   984  O O     . PRO A 1 124 ? 14.088  106.300 6.415   1.00 43.82  ? 124 PRO A O     1 
ATOM   985  C CB    . PRO A 1 124 ? 11.984  108.693 5.454   1.00 33.72  ? 124 PRO A CB    1 
ATOM   986  C CG    . PRO A 1 124 ? 10.642  108.988 4.783   1.00 34.53  ? 124 PRO A CG    1 
ATOM   987  C CD    . PRO A 1 124 ? 9.765   107.825 5.179   1.00 42.55  ? 124 PRO A CD    1 
ATOM   988  N N     . TYR A 1 125 ? 12.246  106.537 7.661   1.00 38.73  ? 125 TYR A N     1 
ATOM   989  C CA    . TYR A 1 125 ? 12.862  105.982 8.835   1.00 37.24  ? 125 TYR A CA    1 
ATOM   990  C C     . TYR A 1 125 ? 13.375  104.582 8.561   1.00 36.05  ? 125 TYR A C     1 
ATOM   991  O O     . TYR A 1 125 ? 14.482  104.234 8.942   1.00 42.04  ? 125 TYR A O     1 
ATOM   992  C CB    . TYR A 1 125 ? 11.867  105.961 9.995   1.00 37.56  ? 125 TYR A CB    1 
ATOM   993  C CG    . TYR A 1 125 ? 12.370  105.264 11.240  1.00 33.23  ? 125 TYR A CG    1 
ATOM   994  C CD1   . TYR A 1 125 ? 12.170  103.897 11.424  1.00 36.00  ? 125 TYR A CD1   1 
ATOM   995  C CD2   . TYR A 1 125 ? 13.023  105.977 12.244  1.00 31.84  ? 125 TYR A CD2   1 
ATOM   996  C CE1   . TYR A 1 125 ? 12.626  103.248 12.566  1.00 37.83  ? 125 TYR A CE1   1 
ATOM   997  C CE2   . TYR A 1 125 ? 13.460  105.349 13.403  1.00 32.86  ? 125 TYR A CE2   1 
ATOM   998  C CZ    . TYR A 1 125 ? 13.269  103.980 13.552  1.00 37.52  ? 125 TYR A CZ    1 
ATOM   999  O OH    . TYR A 1 125 ? 13.718  103.339 14.692  1.00 36.23  ? 125 TYR A OH    1 
ATOM   1000 N N     . PHE A 1 126 ? 12.571  103.757 7.913   1.00 35.09  ? 126 PHE A N     1 
ATOM   1001 C CA    . PHE A 1 126 ? 13.008  102.374 7.741   1.00 38.05  ? 126 PHE A CA    1 
ATOM   1002 C C     . PHE A 1 126 ? 13.956  102.243 6.554   1.00 37.67  ? 126 PHE A C     1 
ATOM   1003 O O     . PHE A 1 126 ? 14.819  101.361 6.560   1.00 37.87  ? 126 PHE A O     1 
ATOM   1004 C CB    . PHE A 1 126 ? 11.812  101.427 7.615   1.00 34.24  ? 126 PHE A CB    1 
ATOM   1005 C CG    . PHE A 1 126 ? 11.119  101.175 8.924   1.00 35.71  ? 126 PHE A CG    1 
ATOM   1006 C CD1   . PHE A 1 126 ? 11.706  100.361 9.887   1.00 36.87  ? 126 PHE A CD1   1 
ATOM   1007 C CD2   . PHE A 1 126 ? 9.898   101.771 9.214   1.00 37.42  ? 126 PHE A CD2   1 
ATOM   1008 C CE1   . PHE A 1 126 ? 11.072  100.137 11.129  1.00 37.85  ? 126 PHE A CE1   1 
ATOM   1009 C CE2   . PHE A 1 126 ? 9.254   101.543 10.451  1.00 37.22  ? 126 PHE A CE2   1 
ATOM   1010 C CZ    . PHE A 1 126 ? 9.845   100.723 11.403  1.00 34.17  ? 126 PHE A CZ    1 
ATOM   1011 N N     . LEU A 1 127 ? 13.819  103.128 5.562   1.00 38.18  ? 127 LEU A N     1 
ATOM   1012 C CA    . LEU A 1 127 ? 14.790  103.199 4.468   1.00 39.84  ? 127 LEU A CA    1 
ATOM   1013 C C     . LEU A 1 127 ? 16.184  103.539 4.984   1.00 45.22  ? 127 LEU A C     1 
ATOM   1014 O O     . LEU A 1 127 ? 17.170  102.903 4.601   1.00 46.83  ? 127 LEU A O     1 
ATOM   1015 C CB    . LEU A 1 127 ? 14.378  104.239 3.458   1.00 41.88  ? 127 LEU A CB    1 
ATOM   1016 C CG    . LEU A 1 127 ? 13.106  103.853 2.731   1.00 44.08  ? 127 LEU A CG    1 
ATOM   1017 C CD1   . LEU A 1 127 ? 12.621  105.049 1.910   1.00 46.88  ? 127 LEU A CD1   1 
ATOM   1018 C CD2   . LEU A 1 127 ? 13.363  102.661 1.849   1.00 39.78  ? 127 LEU A CD2   1 
ATOM   1019 N N     . LYS A 1 128 ? 16.265  104.542 5.860   1.00 39.57  ? 128 LYS A N     1 
ATOM   1020 C CA    . LYS A 1 128 ? 17.545  104.928 6.423   1.00 43.05  ? 128 LYS A CA    1 
ATOM   1021 C C     . LYS A 1 128 ? 18.189  103.731 7.138   1.00 46.69  ? 128 LYS A C     1 
ATOM   1022 O O     . LYS A 1 128 ? 19.397  103.579 7.147   1.00 51.40  ? 128 LYS A O     1 
ATOM   1023 C CB    . LYS A 1 128 ? 17.381  106.115 7.376   1.00 43.66  ? 128 LYS A CB    1 
ATOM   1024 C CG    . LYS A 1 128 ? 18.682  106.665 7.932   1.00 52.12  ? 128 LYS A CG    1 
ATOM   1025 C CD    . LYS A 1 128 ? 18.499  108.053 8.582   1.00 57.19  ? 128 LYS A CD    1 
ATOM   1026 C CE    . LYS A 1 128 ? 19.801  108.599 9.219   1.00 64.31  ? 128 LYS A CE    1 
ATOM   1027 N NZ    . LYS A 1 128 ? 19.636  110.005 9.784   1.00 68.07  ? 128 LYS A NZ    1 
ATOM   1028 N N     . LYS A 1 129 ? 17.383  102.853 7.713   1.00 42.50  ? 129 LYS A N     1 
ATOM   1029 C CA    . LYS A 1 129 ? 17.961  101.690 8.361   1.00 38.06  ? 129 LYS A CA    1 
ATOM   1030 C C     . LYS A 1 129 ? 18.250  100.554 7.392   1.00 40.29  ? 129 LYS A C     1 
ATOM   1031 O O     . LYS A 1 129 ? 18.872  99.596  7.764   1.00 43.49  ? 129 LYS A O     1 
ATOM   1032 C CB    . LYS A 1 129 ? 17.052  101.215 9.479   1.00 37.25  ? 129 LYS A CB    1 
ATOM   1033 C CG    . LYS A 1 129 ? 16.857  102.303 10.512  1.00 39.29  ? 129 LYS A CG    1 
ATOM   1034 C CD    . LYS A 1 129 ? 16.529  101.757 11.860  1.00 40.41  ? 129 LYS A CD    1 
ATOM   1035 C CE    . LYS A 1 129 ? 16.248  102.901 12.819  1.00 42.28  ? 129 LYS A CE    1 
ATOM   1036 N NZ    . LYS A 1 129 ? 17.489  103.640 13.088  1.00 43.04  ? 129 LYS A NZ    1 
ATOM   1037 N N     . LYS A 1 130 ? 17.828  100.680 6.143   1.00 45.34  ? 130 LYS A N     1 
ATOM   1038 C CA    . LYS A 1 130 ? 18.047  99.630  5.153   1.00 46.47  ? 130 LYS A CA    1 
ATOM   1039 C C     . LYS A 1 130 ? 17.472  98.302  5.625   1.00 45.26  ? 130 LYS A C     1 
ATOM   1040 O O     . LYS A 1 130 ? 18.044  97.259  5.373   1.00 51.63  ? 130 LYS A O     1 
ATOM   1041 C CB    . LYS A 1 130 ? 19.537  99.478  4.833   1.00 42.96  ? 130 LYS A CB    1 
ATOM   1042 C CG    . LYS A 1 130 ? 20.117  100.615 4.038   1.00 43.71  ? 130 LYS A CG    1 
ATOM   1043 N N     . ILE A 1 131 ? 16.353  98.356  6.336   1.00 38.58  ? 131 ILE A N     1 
ATOM   1044 C CA    . ILE A 1 131 ? 15.612  97.160  6.683   1.00 37.13  ? 131 ILE A CA    1 
ATOM   1045 C C     . ILE A 1 131 ? 15.134  96.395  5.430   1.00 38.03  ? 131 ILE A C     1 
ATOM   1046 O O     . ILE A 1 131 ? 14.442  96.950  4.604   1.00 31.66  ? 131 ILE A O     1 
ATOM   1047 C CB    . ILE A 1 131 ? 14.417  97.501  7.540   1.00 38.59  ? 131 ILE A CB    1 
ATOM   1048 C CG1   . ILE A 1 131 ? 14.878  98.320  8.738   1.00 44.10  ? 131 ILE A CG1   1 
ATOM   1049 C CG2   . ILE A 1 131 ? 13.795  96.238  8.127   1.00 41.24  ? 131 ILE A CG2   1 
ATOM   1050 C CD1   . ILE A 1 131 ? 15.759  97.542  9.713   1.00 39.29  ? 131 ILE A CD1   1 
ATOM   1051 N N     . GLY A 1 132 ? 15.502  95.119  5.318   1.00 35.48  ? 132 GLY A N     1 
ATOM   1052 C CA    . GLY A 1 132 ? 15.083  94.276  4.219   1.00 30.64  ? 132 GLY A CA    1 
ATOM   1053 C C     . GLY A 1 132 ? 13.600  93.940  4.265   1.00 36.59  ? 132 GLY A C     1 
ATOM   1054 O O     . GLY A 1 132 ? 12.876  94.434  5.118   1.00 35.88  ? 132 GLY A O     1 
ATOM   1055 N N     . PRO A 1 133 ? 13.133  93.104  3.318   1.00 40.27  ? 133 PRO A N     1 
ATOM   1056 C CA    . PRO A 1 133 ? 11.702  92.777  3.189   1.00 36.76  ? 133 PRO A CA    1 
ATOM   1057 C C     . PRO A 1 133 ? 11.190  91.902  4.335   1.00 40.67  ? 133 PRO A C     1 
ATOM   1058 O O     . PRO A 1 133 ? 11.965  91.221  5.025   1.00 37.89  ? 133 PRO A O     1 
ATOM   1059 C CB    . PRO A 1 133 ? 11.633  92.025  1.845   1.00 35.72  ? 133 PRO A CB    1 
ATOM   1060 C CG    . PRO A 1 133 ? 13.028  91.438  1.678   1.00 36.26  ? 133 PRO A CG    1 
ATOM   1061 C CD    . PRO A 1 133 ? 13.944  92.491  2.246   1.00 35.37  ? 133 PRO A CD    1 
ATOM   1062 N N     . GLU A 1 134 ? 9.882   91.957  4.556   1.00 38.98  ? 134 GLU A N     1 
ATOM   1063 C CA    . GLU A 1 134 ? 9.260   91.096  5.530   1.00 35.81  ? 134 GLU A CA    1 
ATOM   1064 C C     . GLU A 1 134 ? 9.367   89.644  5.039   1.00 39.43  ? 134 GLU A C     1 
ATOM   1065 O O     . GLU A 1 134 ? 9.310   89.382  3.840   1.00 35.74  ? 134 GLU A O     1 
ATOM   1066 C CB    . GLU A 1 134 ? 7.810   91.511  5.747   1.00 33.00  ? 134 GLU A CB    1 
ATOM   1067 C CG    . GLU A 1 134 ? 7.681   92.879  6.391   1.00 33.63  ? 134 GLU A CG    1 
ATOM   1068 C CD    . GLU A 1 134 ? 8.094   92.886  7.861   1.00 36.96  ? 134 GLU A CD    1 
ATOM   1069 O OE1   . GLU A 1 134 ? 7.771   91.924  8.595   1.00 42.19  ? 134 GLU A OE1   1 
ATOM   1070 O OE2   . GLU A 1 134 ? 8.754   93.863  8.287   1.00 37.49  ? 134 GLU A OE2   1 
ATOM   1071 N N     . PRO A 1 135 ? 9.534   88.698  5.975   1.00 38.34  ? 135 PRO A N     1 
ATOM   1072 C CA    . PRO A 1 135 ? 9.701   87.270  5.669   1.00 37.29  ? 135 PRO A CA    1 
ATOM   1073 C C     . PRO A 1 135 ? 8.426   86.625  5.187   1.00 43.75  ? 135 PRO A C     1 
ATOM   1074 O O     . PRO A 1 135 ? 7.915   85.721  5.849   1.00 49.16  ? 135 PRO A O     1 
ATOM   1075 C CB    . PRO A 1 135 ? 10.113  86.680  6.995   1.00 37.43  ? 135 PRO A CB    1 
ATOM   1076 C CG    . PRO A 1 135 ? 9.524   87.631  8.034   1.00 32.70  ? 135 PRO A CG    1 
ATOM   1077 C CD    . PRO A 1 135 ? 9.550   88.975  7.422   1.00 31.26  ? 135 PRO A CD    1 
ATOM   1078 N N     . THR A 1 136 ? 7.932   87.075  4.040   1.00 45.24  ? 136 THR A N     1 
ATOM   1079 C CA    . THR A 1 136 ? 6.761   86.471  3.395   1.00 48.17  ? 136 THR A CA    1 
ATOM   1080 C C     . THR A 1 136 ? 7.012   86.166  1.925   1.00 46.18  ? 136 THR A C     1 
ATOM   1081 O O     . THR A 1 136 ? 7.827   86.825  1.290   1.00 46.43  ? 136 THR A O     1 
ATOM   1082 C CB    . THR A 1 136 ? 5.542   87.406  3.462   1.00 49.63  ? 136 THR A CB    1 
ATOM   1083 O OG1   . THR A 1 136 ? 5.808   88.549  2.635   1.00 44.18  ? 136 THR A OG1   1 
ATOM   1084 C CG2   . THR A 1 136 ? 5.264   87.845  4.931   1.00 33.53  ? 136 THR A CG2   1 
ATOM   1085 N N     . TYR A 1 137 ? 6.289   85.200  1.371   1.00 46.36  ? 137 TYR A N     1 
ATOM   1086 C CA    . TYR A 1 137 ? 6.419   84.902  -0.055  1.00 48.93  ? 137 TYR A CA    1 
ATOM   1087 C C     . TYR A 1 137 ? 6.092   86.119  -0.923  1.00 52.85  ? 137 TYR A C     1 
ATOM   1088 O O     . TYR A 1 137 ? 6.696   86.296  -1.972  1.00 58.56  ? 137 TYR A O     1 
ATOM   1089 C CB    . TYR A 1 137 ? 5.535   83.709  -0.457  1.00 44.32  ? 137 TYR A CB    1 
ATOM   1090 C CG    . TYR A 1 137 ? 6.077   82.396  0.075   1.00 46.50  ? 137 TYR A CG    1 
ATOM   1091 C CD1   . TYR A 1 137 ? 7.244   81.837  -0.450  1.00 49.32  ? 137 TYR A CD1   1 
ATOM   1092 C CD2   . TYR A 1 137 ? 5.445   81.733  1.121   1.00 45.45  ? 137 TYR A CD2   1 
ATOM   1093 C CE1   . TYR A 1 137 ? 7.762   80.639  0.045   1.00 52.79  ? 137 TYR A CE1   1 
ATOM   1094 C CE2   . TYR A 1 137 ? 5.952   80.543  1.634   1.00 49.49  ? 137 TYR A CE2   1 
ATOM   1095 C CZ    . TYR A 1 137 ? 7.110   80.001  1.097   1.00 57.01  ? 137 TYR A CZ    1 
ATOM   1096 O OH    . TYR A 1 137 ? 7.604   78.813  1.606   1.00 64.17  ? 137 TYR A OH    1 
ATOM   1097 N N     . GLU A 1 138 ? 5.177   86.977  -0.474  1.00 51.54  ? 138 GLU A N     1 
ATOM   1098 C CA    . GLU A 1 138 ? 4.817   88.159  -1.258  1.00 52.15  ? 138 GLU A CA    1 
ATOM   1099 C C     . GLU A 1 138 ? 5.923   89.212  -1.267  1.00 49.22  ? 138 GLU A C     1 
ATOM   1100 O O     . GLU A 1 138 ? 6.120   89.877  -2.270  1.00 49.73  ? 138 GLU A O     1 
ATOM   1101 C CB    . GLU A 1 138 ? 3.516   88.801  -0.741  1.00 50.63  ? 138 GLU A CB    1 
ATOM   1102 N N     . ASP A 1 139 ? 6.639   89.375  -0.160  1.00 48.30  ? 139 ASP A N     1 
ATOM   1103 C CA    . ASP A 1 139 ? 7.587   90.484  -0.043  1.00 48.21  ? 139 ASP A CA    1 
ATOM   1104 C C     . ASP A 1 139 ? 9.041   90.084  -0.213  1.00 47.85  ? 139 ASP A C     1 
ATOM   1105 O O     . ASP A 1 139 ? 9.865   90.879  -0.652  1.00 47.52  ? 139 ASP A O     1 
ATOM   1106 C CB    . ASP A 1 139 ? 7.408   91.175  1.304   1.00 56.46  ? 139 ASP A CB    1 
ATOM   1107 C CG    . ASP A 1 139 ? 6.000   91.712  1.488   1.00 71.42  ? 139 ASP A CG    1 
ATOM   1108 O OD1   . ASP A 1 139 ? 5.443   92.221  0.495   1.00 79.53  ? 139 ASP A OD1   1 
ATOM   1109 O OD2   . ASP A 1 139 ? 5.438   91.611  2.603   1.00 75.17  ? 139 ASP A OD2   1 
ATOM   1110 N N     . PHE A 1 140 ? 9.355   88.848  0.142   1.00 45.40  ? 140 PHE A N     1 
ATOM   1111 C CA    . PHE A 1 140 ? 10.727  88.396  0.191   1.00 39.71  ? 140 PHE A CA    1 
ATOM   1112 C C     . PHE A 1 140 ? 11.092  87.770  -1.161  1.00 39.55  ? 140 PHE A C     1 
ATOM   1113 O O     . PHE A 1 140 ? 10.899  86.567  -1.377  1.00 39.51  ? 140 PHE A O     1 
ATOM   1114 C CB    . PHE A 1 140 ? 10.887  87.405  1.344   1.00 39.71  ? 140 PHE A CB    1 
ATOM   1115 C CG    . PHE A 1 140 ? 12.295  86.976  1.594   1.00 39.42  ? 140 PHE A CG    1 
ATOM   1116 C CD1   . PHE A 1 140 ? 13.363  87.736  1.132   1.00 36.90  ? 140 PHE A CD1   1 
ATOM   1117 C CD2   . PHE A 1 140 ? 12.556  85.803  2.315   1.00 37.07  ? 140 PHE A CD2   1 
ATOM   1118 C CE1   . PHE A 1 140 ? 14.660  87.348  1.394   1.00 31.81  ? 140 PHE A CE1   1 
ATOM   1119 C CE2   . PHE A 1 140 ? 13.856  85.401  2.585   1.00 31.15  ? 140 PHE A CE2   1 
ATOM   1120 C CZ    . PHE A 1 140 ? 14.910  86.169  2.133   1.00 31.25  ? 140 PHE A CZ    1 
ATOM   1121 N N     . ASP A 1 141 ? 11.604  88.593  -2.076  1.00 42.46  ? 141 ASP A N     1 
ATOM   1122 C CA    . ASP A 1 141 ? 11.910  88.135  -3.425  1.00 41.03  ? 141 ASP A CA    1 
ATOM   1123 C C     . ASP A 1 141 ? 13.204  87.296  -3.477  1.00 39.85  ? 141 ASP A C     1 
ATOM   1124 O O     . ASP A 1 141 ? 14.303  87.774  -3.141  1.00 41.57  ? 141 ASP A O     1 
ATOM   1125 C CB    . ASP A 1 141 ? 12.020  89.332  -4.365  1.00 44.13  ? 141 ASP A CB    1 
ATOM   1126 C CG    . ASP A 1 141 ? 12.509  88.935  -5.763  1.00 58.93  ? 141 ASP A CG    1 
ATOM   1127 O OD1   . ASP A 1 141 ? 12.362  87.758  -6.170  1.00 66.59  ? 141 ASP A OD1   1 
ATOM   1128 O OD2   . ASP A 1 141 ? 13.044  89.803  -6.473  1.00 66.01  ? 141 ASP A OD2   1 
ATOM   1129 N N     . GLU A 1 142 ? 13.092  86.050  -3.918  1.00 43.04  ? 142 GLU A N     1 
ATOM   1130 C CA    . GLU A 1 142 ? 14.277  85.185  -3.915  1.00 43.13  ? 142 GLU A CA    1 
ATOM   1131 C C     . GLU A 1 142 ? 15.395  85.719  -4.838  1.00 43.42  ? 142 GLU A C     1 
ATOM   1132 O O     . GLU A 1 142 ? 16.576  85.653  -4.503  1.00 41.32  ? 142 GLU A O     1 
ATOM   1133 C CB    . GLU A 1 142 ? 13.906  83.763  -4.303  1.00 43.93  ? 142 GLU A CB    1 
ATOM   1134 C CG    . GLU A 1 142 ? 15.133  82.868  -4.354  1.00 51.44  ? 142 GLU A CG    1 
ATOM   1135 C CD    . GLU A 1 142 ? 14.804  81.411  -4.501  1.00 62.11  ? 142 GLU A CD    1 
ATOM   1136 O OE1   . GLU A 1 142 ? 13.753  80.998  -3.980  1.00 73.08  ? 142 GLU A OE1   1 
ATOM   1137 O OE2   . GLU A 1 142 ? 15.588  80.676  -5.140  1.00 67.11  ? 142 GLU A OE2   1 
ATOM   1138 N N     . LYS A 1 143 ? 15.015  86.284  -5.979  1.00 43.05  ? 143 LYS A N     1 
ATOM   1139 C CA    . LYS A 1 143 ? 15.995  86.800  -6.929  1.00 44.53  ? 143 LYS A CA    1 
ATOM   1140 C C     . LYS A 1 143 ? 16.854  87.948  -6.379  1.00 47.55  ? 143 LYS A C     1 
ATOM   1141 O O     . LYS A 1 143 ? 18.062  87.986  -6.610  1.00 53.96  ? 143 LYS A O     1 
ATOM   1142 C CB    . LYS A 1 143 ? 15.288  87.247  -8.200  1.00 48.22  ? 143 LYS A CB    1 
ATOM   1143 C CG    . LYS A 1 143 ? 14.647  86.096  -8.958  1.00 54.28  ? 143 LYS A CG    1 
ATOM   1144 C CD    . LYS A 1 143 ? 14.579  86.380  -10.455 1.00 71.05  ? 143 LYS A CD    1 
ATOM   1145 C CE    . LYS A 1 143 ? 13.192  86.826  -10.868 1.00 76.46  ? 143 LYS A CE    1 
ATOM   1146 N NZ    . LYS A 1 143 ? 12.179  85.738  -10.786 1.00 76.97  ? 143 LYS A NZ    1 
ATOM   1147 N N     . LEU A 1 144 ? 16.246  88.885  -5.664  1.00 41.91  ? 144 LEU A N     1 
ATOM   1148 C CA    . LEU A 1 144 ? 17.012  89.958  -5.068  1.00 39.15  ? 144 LEU A CA    1 
ATOM   1149 C C     . LEU A 1 144 ? 17.923  89.387  -3.973  1.00 39.12  ? 144 LEU A C     1 
ATOM   1150 O O     . LEU A 1 144 ? 19.076  89.783  -3.820  1.00 39.39  ? 144 LEU A O     1 
ATOM   1151 C CB    . LEU A 1 144 ? 16.092  91.031  -4.492  1.00 36.35  ? 144 LEU A CB    1 
ATOM   1152 C CG    . LEU A 1 144 ? 16.862  92.176  -3.816  1.00 41.61  ? 144 LEU A CG    1 
ATOM   1153 C CD1   . LEU A 1 144 ? 17.882  92.794  -4.792  1.00 36.29  ? 144 LEU A CD1   1 
ATOM   1154 C CD2   . LEU A 1 144 ? 15.911  93.271  -3.274  1.00 37.16  ? 144 LEU A CD2   1 
ATOM   1155 N N     . PHE A 1 145 ? 17.360  88.464  -3.210  1.00 37.24  ? 145 PHE A N     1 
ATOM   1156 C CA    . PHE A 1 145 ? 18.061  87.712  -2.181  1.00 37.53  ? 145 PHE A CA    1 
ATOM   1157 C C     . PHE A 1 145 ? 19.298  87.055  -2.793  1.00 42.53  ? 145 PHE A C     1 
ATOM   1158 O O     . PHE A 1 145 ? 20.444  87.262  -2.340  1.00 41.62  ? 145 PHE A O     1 
ATOM   1159 C CB    . PHE A 1 145 ? 17.091  86.656  -1.603  1.00 37.35  ? 145 PHE A CB    1 
ATOM   1160 C CG    . PHE A 1 145 ? 17.601  85.922  -0.414  1.00 38.59  ? 145 PHE A CG    1 
ATOM   1161 C CD1   . PHE A 1 145 ? 18.144  86.621  0.684   1.00 35.31  ? 145 PHE A CD1   1 
ATOM   1162 C CD2   . PHE A 1 145 ? 17.492  84.534  -0.349  1.00 35.97  ? 145 PHE A CD2   1 
ATOM   1163 C CE1   . PHE A 1 145 ? 18.593  85.934  1.811   1.00 35.99  ? 145 PHE A CE1   1 
ATOM   1164 C CE2   . PHE A 1 145 ? 17.958  83.824  0.783   1.00 34.86  ? 145 PHE A CE2   1 
ATOM   1165 C CZ    . PHE A 1 145 ? 18.490  84.526  1.866   1.00 37.35  ? 145 PHE A CZ    1 
ATOM   1166 N N     . ARG A 1 146 ? 19.058  86.298  -3.864  1.00 41.97  ? 146 ARG A N     1 
ATOM   1167 C CA    . ARG A 1 146 ? 20.135  85.582  -4.527  1.00 45.52  ? 146 ARG A CA    1 
ATOM   1168 C C     . ARG A 1 146 ? 21.238  86.535  -4.924  1.00 43.96  ? 146 ARG A C     1 
ATOM   1169 O O     . ARG A 1 146 ? 22.432  86.257  -4.684  1.00 43.45  ? 146 ARG A O     1 
ATOM   1170 C CB    . ARG A 1 146 ? 19.620  84.819  -5.751  1.00 51.40  ? 146 ARG A CB    1 
ATOM   1171 C CG    . ARG A 1 146 ? 20.678  83.949  -6.389  1.00 56.17  ? 146 ARG A CG    1 
ATOM   1172 C CD    . ARG A 1 146 ? 20.104  82.929  -7.363  1.00 65.20  ? 146 ARG A CD    1 
ATOM   1173 N NE    . ARG A 1 146 ? 19.313  83.526  -8.432  1.00 69.52  ? 146 ARG A NE    1 
ATOM   1174 C CZ    . ARG A 1 146 ? 18.039  83.219  -8.666  1.00 73.43  ? 146 ARG A CZ    1 
ATOM   1175 N NH1   . ARG A 1 146 ? 17.428  82.321  -7.897  1.00 74.67  ? 146 ARG A NH1   1 
ATOM   1176 N NH2   . ARG A 1 146 ? 17.372  83.814  -9.658  1.00 71.22  ? 146 ARG A NH2   1 
ATOM   1177 N N     . GLU A 1 147 ? 20.854  87.659  -5.529  1.00 42.10  ? 147 GLU A N     1 
ATOM   1178 C CA    . GLU A 1 147 ? 21.872  88.587  -6.019  1.00 46.35  ? 147 GLU A CA    1 
ATOM   1179 C C     . GLU A 1 147 ? 22.632  89.274  -4.880  1.00 41.60  ? 147 GLU A C     1 
ATOM   1180 O O     . GLU A 1 147 ? 23.826  89.539  -5.015  1.00 42.49  ? 147 GLU A O     1 
ATOM   1181 C CB    . GLU A 1 147 ? 21.262  89.637  -6.937  1.00 52.74  ? 147 GLU A CB    1 
ATOM   1182 C CG    . GLU A 1 147 ? 21.012  89.114  -8.321  1.00 70.17  ? 147 GLU A CG    1 
ATOM   1183 C CD    . GLU A 1 147 ? 22.269  88.514  -8.957  1.00 81.10  ? 147 GLU A CD    1 
ATOM   1184 O OE1   . GLU A 1 147 ? 23.224  89.282  -9.219  1.00 83.68  ? 147 GLU A OE1   1 
ATOM   1185 O OE2   . GLU A 1 147 ? 22.297  87.278  -9.185  1.00 82.78  ? 147 GLU A OE2   1 
ATOM   1186 N N     . LYS A 1 148 ? 21.958  89.588  -3.775  1.00 36.54  ? 148 LYS A N     1 
ATOM   1187 C CA    . LYS A 1 148 ? 22.679  90.250  -2.704  1.00 40.67  ? 148 LYS A CA    1 
ATOM   1188 C C     . LYS A 1 148 ? 23.738  89.274  -2.136  1.00 43.23  ? 148 LYS A C     1 
ATOM   1189 O O     . LYS A 1 148 ? 24.848  89.685  -1.814  1.00 45.79  ? 148 LYS A O     1 
ATOM   1190 C CB    . LYS A 1 148 ? 21.731  90.729  -1.612  1.00 36.63  ? 148 LYS A CB    1 
ATOM   1191 C CG    . LYS A 1 148 ? 20.859  91.952  -1.963  1.00 45.58  ? 148 LYS A CG    1 
ATOM   1192 C CD    . LYS A 1 148 ? 19.978  92.246  -0.727  1.00 55.52  ? 148 LYS A CD    1 
ATOM   1193 C CE    . LYS A 1 148 ? 18.979  93.413  -0.831  1.00 60.69  ? 148 LYS A CE    1 
ATOM   1194 N NZ    . LYS A 1 148 ? 17.808  93.117  0.142   1.00 49.05  ? 148 LYS A NZ    1 
ATOM   1195 N N     . LEU A 1 149 ? 23.392  87.987  -2.062  1.00 40.23  ? 149 LEU A N     1 
ATOM   1196 C CA    . LEU A 1 149 ? 24.266  86.971  -1.479  1.00 43.37  ? 149 LEU A CA    1 
ATOM   1197 C C     . LEU A 1 149 ? 25.480  86.762  -2.356  1.00 46.99  ? 149 LEU A C     1 
ATOM   1198 O O     . LEU A 1 149 ? 26.598  86.607  -1.856  1.00 46.78  ? 149 LEU A O     1 
ATOM   1199 C CB    . LEU A 1 149 ? 23.522  85.633  -1.278  1.00 40.18  ? 149 LEU A CB    1 
ATOM   1200 C CG    . LEU A 1 149 ? 22.409  85.718  -0.212  1.00 35.43  ? 149 LEU A CG    1 
ATOM   1201 C CD1   . LEU A 1 149 ? 21.528  84.485  -0.219  1.00 32.31  ? 149 LEU A CD1   1 
ATOM   1202 C CD2   . LEU A 1 149 ? 23.008  85.938  1.184   1.00 29.75  ? 149 LEU A CD2   1 
ATOM   1203 N N     . ARG A 1 150 ? 25.268  86.788  -3.667  1.00 46.01  ? 150 ARG A N     1 
ATOM   1204 C CA    . ARG A 1 150 ? 26.356  86.522  -4.580  1.00 49.58  ? 150 ARG A CA    1 
ATOM   1205 C C     . ARG A 1 150 ? 27.366  87.658  -4.585  1.00 52.47  ? 150 ARG A C     1 
ATOM   1206 O O     . ARG A 1 150 ? 28.535  87.456  -4.874  1.00 58.90  ? 150 ARG A O     1 
ATOM   1207 C CB    . ARG A 1 150 ? 25.815  86.271  -5.991  1.00 59.76  ? 150 ARG A CB    1 
ATOM   1208 C CG    . ARG A 1 150 ? 25.022  84.962  -6.135  1.00 67.75  ? 150 ARG A CG    1 
ATOM   1209 C CD    . ARG A 1 150 ? 24.420  84.837  -7.540  1.00 80.54  ? 150 ARG A CD    1 
ATOM   1210 N NE    . ARG A 1 150 ? 23.983  83.475  -7.873  1.00 85.56  ? 150 ARG A NE    1 
ATOM   1211 C CZ    . ARG A 1 150 ? 23.252  83.164  -8.944  1.00 89.90  ? 150 ARG A CZ    1 
ATOM   1212 N NH1   . ARG A 1 150 ? 22.908  81.902  -9.175  1.00 91.65  ? 150 ARG A NH1   1 
ATOM   1213 N NH2   . ARG A 1 150 ? 22.858  84.118  -9.783  1.00 91.95  ? 150 ARG A NH2   1 
ATOM   1214 N N     . LYS A 1 151 ? 26.928  88.863  -4.260  1.00 54.61  ? 151 LYS A N     1 
ATOM   1215 C CA    . LYS A 1 151 ? 27.817  90.010  -4.374  1.00 61.65  ? 151 LYS A CA    1 
ATOM   1216 C C     . LYS A 1 151 ? 28.599  90.281  -3.099  1.00 59.29  ? 151 LYS A C     1 
ATOM   1217 O O     . LYS A 1 151 ? 29.311  91.262  -3.011  1.00 63.50  ? 151 LYS A O     1 
ATOM   1218 C CB    . LYS A 1 151 ? 27.017  91.244  -4.774  1.00 65.45  ? 151 LYS A CB    1 
ATOM   1219 C CG    . LYS A 1 151 ? 26.402  91.099  -6.145  1.00 77.85  ? 151 LYS A CG    1 
ATOM   1220 C CD    . LYS A 1 151 ? 25.559  92.299  -6.526  1.00 82.65  ? 151 LYS A CD    1 
ATOM   1221 C CE    . LYS A 1 151 ? 26.405  93.491  -6.907  1.00 85.20  ? 151 LYS A CE    1 
ATOM   1222 N NZ    . LYS A 1 151 ? 25.504  94.601  -7.331  1.00 89.03  ? 151 LYS A NZ    1 
ATOM   1223 N N     . SER A 1 152 ? 28.471  89.398  -2.122  1.00 56.81  ? 152 SER A N     1 
ATOM   1224 C CA    . SER A 1 152 ? 29.035  89.628  -0.796  1.00 51.66  ? 152 SER A CA    1 
ATOM   1225 C C     . SER A 1 152 ? 29.963  88.506  -0.347  1.00 51.71  ? 152 SER A C     1 
ATOM   1226 O O     . SER A 1 152 ? 29.741  87.335  -0.665  1.00 53.39  ? 152 SER A O     1 
ATOM   1227 C CB    . SER A 1 152 ? 27.911  89.790  0.220   1.00 48.34  ? 152 SER A CB    1 
ATOM   1228 O OG    . SER A 1 152 ? 28.343  89.431  1.527   1.00 52.97  ? 152 SER A OG    1 
ATOM   1229 N N     . THR A 1 153 ? 31.003  88.860  0.398   1.00 52.07  ? 153 THR A N     1 
ATOM   1230 C CA    . THR A 1 153 ? 31.844  87.836  1.013   1.00 55.18  ? 153 THR A CA    1 
ATOM   1231 C C     . THR A 1 153 ? 31.614  87.743  2.527   1.00 48.64  ? 153 THR A C     1 
ATOM   1232 O O     . THR A 1 153 ? 32.417  87.142  3.243   1.00 53.01  ? 153 THR A O     1 
ATOM   1233 C CB    . THR A 1 153 ? 33.329  88.096  0.753   1.00 64.95  ? 153 THR A CB    1 
ATOM   1234 O OG1   . THR A 1 153 ? 33.729  89.288  1.437   1.00 72.18  ? 153 THR A OG1   1 
ATOM   1235 C CG2   . THR A 1 153 ? 33.581  88.280  -0.740  1.00 68.50  ? 153 THR A CG2   1 
ATOM   1236 N N     . LYS A 1 154 ? 30.528  88.329  3.015   1.00 38.02  ? 154 LYS A N     1 
ATOM   1237 C CA    . LYS A 1 154 ? 30.190  88.184  4.421   1.00 41.96  ? 154 LYS A CA    1 
ATOM   1238 C C     . LYS A 1 154 ? 29.824  86.737  4.755   1.00 40.04  ? 154 LYS A C     1 
ATOM   1239 O O     . LYS A 1 154 ? 29.401  85.972  3.862   1.00 35.57  ? 154 LYS A O     1 
ATOM   1240 C CB    . LYS A 1 154 ? 29.022  89.087  4.816   1.00 36.48  ? 154 LYS A CB    1 
ATOM   1241 C CG    . LYS A 1 154 ? 29.321  90.547  4.822   1.00 37.58  ? 154 LYS A CG    1 
ATOM   1242 C CD    . LYS A 1 154 ? 28.017  91.331  4.966   1.00 43.70  ? 154 LYS A CD    1 
ATOM   1243 C CE    . LYS A 1 154 ? 28.241  92.788  4.649   1.00 48.50  ? 154 LYS A CE    1 
ATOM   1244 N NZ    . LYS A 1 154 ? 26.996  93.572  4.645   1.00 55.20  ? 154 LYS A NZ    1 
ATOM   1245 N N     . LYS A 1 155 ? 29.958  86.386  6.040   1.00 32.47  ? 155 LYS A N     1 
ATOM   1246 C CA    . LYS A 1 155 ? 29.425  85.128  6.551   1.00 34.57  ? 155 LYS A CA    1 
ATOM   1247 C C     . LYS A 1 155 ? 27.901  85.182  6.617   1.00 35.94  ? 155 LYS A C     1 
ATOM   1248 O O     . LYS A 1 155 ? 27.311  86.221  6.959   1.00 34.46  ? 155 LYS A O     1 
ATOM   1249 C CB    . LYS A 1 155 ? 30.026  84.817  7.919   1.00 37.18  ? 155 LYS A CB    1 
ATOM   1250 C CG    . LYS A 1 155 ? 31.535  84.733  7.828   1.00 44.73  ? 155 LYS A CG    1 
ATOM   1251 C CD    . LYS A 1 155 ? 32.182  84.357  9.132   1.00 47.36  ? 155 LYS A CD    1 
ATOM   1252 C CE    . LYS A 1 155 ? 33.681  84.307  8.934   1.00 53.63  ? 155 LYS A CE    1 
ATOM   1253 N NZ    . LYS A 1 155 ? 34.356  83.651  10.066  1.00 61.42  ? 155 LYS A NZ    1 
ATOM   1254 N N     . ILE A 1 156 ? 27.257  84.066  6.288   1.00 36.92  ? 156 ILE A N     1 
ATOM   1255 C CA    . ILE A 1 156 ? 25.817  84.077  6.115   1.00 31.10  ? 156 ILE A CA    1 
ATOM   1256 C C     . ILE A 1 156 ? 25.075  84.413  7.410   1.00 34.56  ? 156 ILE A C     1 
ATOM   1257 O O     . ILE A 1 156 ? 24.080  85.139  7.385   1.00 38.58  ? 156 ILE A O     1 
ATOM   1258 C CB    . ILE A 1 156 ? 25.330  82.734  5.538   1.00 33.54  ? 156 ILE A CB    1 
ATOM   1259 C CG1   . ILE A 1 156 ? 23.804  82.747  5.327   1.00 34.59  ? 156 ILE A CG1   1 
ATOM   1260 C CG2   . ILE A 1 156 ? 25.784  81.581  6.411   1.00 37.44  ? 156 ILE A CG2   1 
ATOM   1261 C CD1   . ILE A 1 156 ? 23.308  83.838  4.347   1.00 27.68  ? 156 ILE A CD1   1 
ATOM   1262 N N     . LYS A 1 157 ? 25.562  83.939  8.552   1.00 37.15  ? 157 LYS A N     1 
ATOM   1263 C CA    . LYS A 1 157 ? 24.812  84.175  9.773   1.00 35.10  ? 157 LYS A CA    1 
ATOM   1264 C C     . LYS A 1 157 ? 24.834  85.663  10.120  1.00 32.83  ? 157 LYS A C     1 
ATOM   1265 O O     . LYS A 1 157 ? 23.778  86.264  10.254  1.00 37.38  ? 157 LYS A O     1 
ATOM   1266 C CB    . LYS A 1 157 ? 25.325  83.319  10.942  1.00 35.53  ? 157 LYS A CB    1 
ATOM   1267 C CG    . LYS A 1 157 ? 24.938  83.896  12.291  1.00 32.67  ? 157 LYS A CG    1 
ATOM   1268 C CD    . LYS A 1 157 ? 24.889  82.829  13.381  1.00 38.44  ? 157 LYS A CD    1 
ATOM   1269 C CE    . LYS A 1 157 ? 24.505  83.501  14.743  1.00 35.26  ? 157 LYS A CE    1 
ATOM   1270 N NZ    . LYS A 1 157 ? 24.227  82.560  15.846  1.00 36.24  ? 157 LYS A NZ    1 
ATOM   1271 N N     . PRO A 1 158 ? 26.025  86.283  10.218  1.00 32.27  ? 158 PRO A N     1 
ATOM   1272 C CA    . PRO A 1 158 ? 25.963  87.709  10.567  1.00 25.88  ? 158 PRO A CA    1 
ATOM   1273 C C     . PRO A 1 158 ? 25.287  88.575  9.509   1.00 30.27  ? 158 PRO A C     1 
ATOM   1274 O O     . PRO A 1 158 ? 24.704  89.632  9.818   1.00 31.48  ? 158 PRO A O     1 
ATOM   1275 C CB    . PRO A 1 158 ? 27.433  88.106  10.728  1.00 31.00  ? 158 PRO A CB    1 
ATOM   1276 C CG    . PRO A 1 158 ? 28.244  86.960  10.234  1.00 30.02  ? 158 PRO A CG    1 
ATOM   1277 C CD    . PRO A 1 158 ? 27.401  85.748  10.228  1.00 29.19  ? 158 PRO A CD    1 
ATOM   1278 N N     . TYR A 1 159 ? 25.338  88.128  8.260   1.00 34.48  ? 159 TYR A N     1 
ATOM   1279 C CA    . TYR A 1 159 ? 24.651  88.847  7.190   1.00 36.20  ? 159 TYR A CA    1 
ATOM   1280 C C     . TYR A 1 159 ? 23.132  88.749  7.398   1.00 33.42  ? 159 TYR A C     1 
ATOM   1281 O O     . TYR A 1 159 ? 22.429  89.726  7.224   1.00 38.66  ? 159 TYR A O     1 
ATOM   1282 C CB    . TYR A 1 159 ? 25.060  88.300  5.816   1.00 34.74  ? 159 TYR A CB    1 
ATOM   1283 C CG    . TYR A 1 159 ? 24.803  89.256  4.653   1.00 35.83  ? 159 TYR A CG    1 
ATOM   1284 C CD1   . TYR A 1 159 ? 24.216  90.515  4.861   1.00 33.71  ? 159 TYR A CD1   1 
ATOM   1285 C CD2   . TYR A 1 159 ? 25.167  88.908  3.339   1.00 38.01  ? 159 TYR A CD2   1 
ATOM   1286 C CE1   . TYR A 1 159 ? 23.991  91.399  3.793   1.00 33.51  ? 159 TYR A CE1   1 
ATOM   1287 C CE2   . TYR A 1 159 ? 24.937  89.781  2.256   1.00 38.71  ? 159 TYR A CE2   1 
ATOM   1288 C CZ    . TYR A 1 159 ? 24.344  91.007  2.491   1.00 41.47  ? 159 TYR A CZ    1 
ATOM   1289 O OH    . TYR A 1 159 ? 24.132  91.842  1.423   1.00 47.21  ? 159 TYR A OH    1 
ATOM   1290 N N     . LEU A 1 160 ? 22.623  87.588  7.780   1.00 30.37  ? 160 LEU A N     1 
ATOM   1291 C CA    . LEU A 1 160 ? 21.179  87.484  8.046   1.00 32.22  ? 160 LEU A CA    1 
ATOM   1292 C C     . LEU A 1 160 ? 20.777  88.318  9.249   1.00 32.88  ? 160 LEU A C     1 
ATOM   1293 O O     . LEU A 1 160 ? 19.700  88.883  9.270   1.00 42.61  ? 160 LEU A O     1 
ATOM   1294 C CB    . LEU A 1 160 ? 20.743  86.033  8.255   1.00 29.41  ? 160 LEU A CB    1 
ATOM   1295 C CG    . LEU A 1 160 ? 20.805  85.166  6.988   1.00 33.23  ? 160 LEU A CG    1 
ATOM   1296 C CD1   . LEU A 1 160 ? 20.647  83.640  7.304   1.00 28.46  ? 160 LEU A CD1   1 
ATOM   1297 C CD2   . LEU A 1 160 ? 19.688  85.648  6.047   1.00 32.21  ? 160 LEU A CD2   1 
ATOM   1298 N N     . LEU A 1 161 ? 21.651  88.421  10.243  1.00 33.60  ? 161 LEU A N     1 
ATOM   1299 C CA    . LEU A 1 161 ? 21.346  89.192  11.447  1.00 34.70  ? 161 LEU A CA    1 
ATOM   1300 C C     . LEU A 1 161 ? 21.328  90.722  11.199  1.00 33.66  ? 161 LEU A C     1 
ATOM   1301 O O     . LEU A 1 161 ? 20.814  91.495  12.022  1.00 35.87  ? 161 LEU A O     1 
ATOM   1302 C CB    . LEU A 1 161 ? 22.346  88.835  12.551  1.00 34.30  ? 161 LEU A CB    1 
ATOM   1303 C CG    . LEU A 1 161 ? 22.277  87.458  13.236  1.00 36.08  ? 161 LEU A CG    1 
ATOM   1304 C CD1   . LEU A 1 161 ? 23.445  87.263  14.225  1.00 30.40  ? 161 LEU A CD1   1 
ATOM   1305 C CD2   . LEU A 1 161 ? 20.962  87.229  13.989  1.00 33.28  ? 161 LEU A CD2   1 
ATOM   1306 N N     . GLU A 1 162 ? 21.863  91.168  10.067  1.00 33.42  ? 162 GLU A N     1 
ATOM   1307 C CA    . GLU A 1 162 ? 21.934  92.618  9.769   1.00 35.95  ? 162 GLU A CA    1 
ATOM   1308 C C     . GLU A 1 162 ? 20.575  93.253  9.426   1.00 37.51  ? 162 GLU A C     1 
ATOM   1309 O O     . GLU A 1 162 ? 20.492  94.464  9.359   1.00 29.77  ? 162 GLU A O     1 
ATOM   1310 C CB    . GLU A 1 162 ? 22.874  92.900  8.601   1.00 37.08  ? 162 GLU A CB    1 
ATOM   1311 C CG    . GLU A 1 162 ? 24.334  92.671  8.845   1.00 46.69  ? 162 GLU A CG    1 
ATOM   1312 C CD    . GLU A 1 162 ? 25.183  93.069  7.628   1.00 62.42  ? 162 GLU A CD    1 
ATOM   1313 O OE1   . GLU A 1 162 ? 24.663  93.753  6.683   1.00 62.87  ? 162 GLU A OE1   1 
ATOM   1314 O OE2   . GLU A 1 162 ? 26.374  92.682  7.620   1.00 67.62  ? 162 GLU A OE2   1 
ATOM   1315 N N     . GLN A 1 163 ? 19.562  92.428  9.148   1.00 27.52  ? 163 GLN A N     1 
ATOM   1316 C CA    . GLN A 1 163 ? 18.210  92.875  8.855   1.00 27.30  ? 163 GLN A CA    1 
ATOM   1317 C C     . GLN A 1 163 ? 18.067  93.405  7.428   1.00 40.14  ? 163 GLN A C     1 
ATOM   1318 O O     . GLN A 1 163 ? 16.989  93.850  7.062   1.00 44.41  ? 163 GLN A O     1 
ATOM   1319 C CB    . GLN A 1 163 ? 17.737  93.965  9.838   1.00 27.74  ? 163 GLN A CB    1 
ATOM   1320 C CG    . GLN A 1 163 ? 17.763  93.563  11.342  1.00 38.23  ? 163 GLN A CG    1 
ATOM   1321 C CD    . GLN A 1 163 ? 17.075  92.244  11.597  1.00 37.11  ? 163 GLN A CD    1 
ATOM   1322 O OE1   . GLN A 1 163 ? 15.851  92.118  11.434  1.00 37.28  ? 163 GLN A OE1   1 
ATOM   1323 N NE2   . GLN A 1 163 ? 17.873  91.224  11.940  1.00 35.43  ? 163 GLN A NE2   1 
ATOM   1324 N N     . THR A 1 164 ? 19.143  93.405  6.637   1.00 33.60  ? 164 THR A N     1 
ATOM   1325 C CA    . THR A 1 164 ? 19.088  94.029  5.313   1.00 38.59  ? 164 THR A CA    1 
ATOM   1326 C C     . THR A 1 164 ? 18.670  93.059  4.188   1.00 35.34  ? 164 THR A C     1 
ATOM   1327 O O     . THR A 1 164 ? 18.060  93.472  3.223   1.00 36.37  ? 164 THR A O     1 
ATOM   1328 C CB    . THR A 1 164 ? 20.436  94.666  4.943   1.00 38.85  ? 164 THR A CB    1 
ATOM   1329 O OG1   . THR A 1 164 ? 21.459  93.672  5.021   1.00 44.48  ? 164 THR A OG1   1 
ATOM   1330 C CG2   . THR A 1 164 ? 20.763  95.780  5.918   1.00 35.63  ? 164 THR A CG2   1 
ATOM   1331 N N     . LEU A 1 165 ? 19.010  91.784  4.323   1.00 36.72  ? 165 LEU A N     1 
ATOM   1332 C CA    . LEU A 1 165 ? 18.573  90.740  3.393   1.00 32.80  ? 165 LEU A CA    1 
ATOM   1333 C C     . LEU A 1 165 ? 17.101  90.452  3.549   1.00 37.29  ? 165 LEU A C     1 
ATOM   1334 O O     . LEU A 1 165 ? 16.388  90.231  2.578   1.00 38.90  ? 165 LEU A O     1 
ATOM   1335 C CB    . LEU A 1 165 ? 19.350  89.455  3.634   1.00 32.15  ? 165 LEU A CB    1 
ATOM   1336 C CG    . LEU A 1 165 ? 20.832  89.574  3.275   1.00 36.97  ? 165 LEU A CG    1 
ATOM   1337 C CD1   . LEU A 1 165 ? 21.613  88.345  3.748   1.00 34.76  ? 165 LEU A CD1   1 
ATOM   1338 C CD2   . LEU A 1 165 ? 20.932  89.744  1.766   1.00 35.78  ? 165 LEU A CD2   1 
ATOM   1339 N N     . VAL A 1 166 ? 16.661  90.444  4.801   1.00 39.58  ? 166 VAL A N     1 
ATOM   1340 C CA    . VAL A 1 166 ? 15.312  90.072  5.188   1.00 34.57  ? 166 VAL A CA    1 
ATOM   1341 C C     . VAL A 1 166 ? 15.173  90.531  6.627   1.00 33.78  ? 166 VAL A C     1 
ATOM   1342 O O     . VAL A 1 166 ? 16.137  90.505  7.389   1.00 38.91  ? 166 VAL A O     1 
ATOM   1343 C CB    . VAL A 1 166 ? 15.052  88.530  5.042   1.00 37.13  ? 166 VAL A CB    1 
ATOM   1344 C CG1   . VAL A 1 166 ? 15.988  87.702  5.962   1.00 26.78  ? 166 VAL A CG1   1 
ATOM   1345 C CG2   . VAL A 1 166 ? 13.573  88.195  5.297   1.00 33.63  ? 166 VAL A CG2   1 
ATOM   1346 N N     . ALA A 1 167 ? 13.994  90.996  7.004   1.00 37.07  ? 167 ALA A N     1 
ATOM   1347 C CA    . ALA A 1 167 ? 13.812  91.575  8.338   1.00 36.18  ? 167 ALA A CA    1 
ATOM   1348 C C     . ALA A 1 167 ? 13.331  90.491  9.291   1.00 39.21  ? 167 ALA A C     1 
ATOM   1349 O O     . ALA A 1 167 ? 12.489  89.659  8.899   1.00 38.34  ? 167 ALA A O     1 
ATOM   1350 C CB    . ALA A 1 167 ? 12.806  92.749  8.294   1.00 27.52  ? 167 ALA A CB    1 
ATOM   1351 N N     . GLY A 1 168 ? 13.854  90.481  10.523  1.00 34.59  ? 168 GLY A N     1 
ATOM   1352 C CA    . GLY A 1 168 ? 13.159  89.765  11.569  1.00 32.37  ? 168 GLY A CA    1 
ATOM   1353 C C     . GLY A 1 168 ? 13.856  88.608  12.226  1.00 35.68  ? 168 GLY A C     1 
ATOM   1354 O O     . GLY A 1 168 ? 13.396  88.137  13.274  1.00 35.99  ? 168 GLY A O     1 
ATOM   1355 N N     . LEU A 1 169 ? 14.947  88.127  11.629  1.00 34.43  ? 169 LEU A N     1 
ATOM   1356 C CA    . LEU A 1 169 ? 15.715  87.063  12.250  1.00 31.69  ? 169 LEU A CA    1 
ATOM   1357 C C     . LEU A 1 169 ? 16.620  87.601  13.368  1.00 31.30  ? 169 LEU A C     1 
ATOM   1358 O O     . LEU A 1 169 ? 17.251  88.660  13.232  1.00 34.78  ? 169 LEU A O     1 
ATOM   1359 C CB    . LEU A 1 169 ? 16.566  86.337  11.199  1.00 40.20  ? 169 LEU A CB    1 
ATOM   1360 C CG    . LEU A 1 169 ? 15.879  85.558  10.083  1.00 38.72  ? 169 LEU A CG    1 
ATOM   1361 C CD1   . LEU A 1 169 ? 16.850  85.394  8.950   1.00 36.36  ? 169 LEU A CD1   1 
ATOM   1362 C CD2   . LEU A 1 169 ? 15.446  84.202  10.594  1.00 36.88  ? 169 LEU A CD2   1 
ATOM   1363 N N     . GLY A 1 170 ? 16.682  86.882  14.480  1.00 29.80  ? 170 GLY A N     1 
ATOM   1364 C CA    . GLY A 1 170 ? 17.682  87.159  15.506  1.00 26.61  ? 170 GLY A CA    1 
ATOM   1365 C C     . GLY A 1 170 ? 18.440  85.870  15.799  1.00 32.82  ? 170 GLY A C     1 
ATOM   1366 O O     . GLY A 1 170 ? 18.347  84.898  15.030  1.00 28.87  ? 170 GLY A O     1 
ATOM   1367 N N     . ASN A 1 171 ? 19.159  85.828  16.919  1.00 32.19  ? 171 ASN A N     1 
ATOM   1368 C CA    . ASN A 1 171 ? 20.074  84.711  17.145  1.00 36.65  ? 171 ASN A CA    1 
ATOM   1369 C C     . ASN A 1 171 ? 19.385  83.342  17.172  1.00 37.01  ? 171 ASN A C     1 
ATOM   1370 O O     . ASN A 1 171 ? 19.919  82.372  16.638  1.00 38.42  ? 171 ASN A O     1 
ATOM   1371 C CB    . ASN A 1 171 ? 20.848  84.912  18.434  1.00 31.09  ? 171 ASN A CB    1 
ATOM   1372 C CG    . ASN A 1 171 ? 22.232  84.313  18.355  1.00 34.11  ? 171 ASN A CG    1 
ATOM   1373 O OD1   . ASN A 1 171 ? 22.799  84.209  17.263  1.00 35.42  ? 171 ASN A OD1   1 
ATOM   1374 N ND2   . ASN A 1 171 ? 22.796  83.937  19.496  1.00 34.28  ? 171 ASN A ND2   1 
ATOM   1375 N N     . ILE A 1 172 ? 18.206  83.268  17.790  1.00 32.61  ? 172 ILE A N     1 
ATOM   1376 C CA    . ILE A 1 172 ? 17.465  82.013  17.841  1.00 39.00  ? 172 ILE A CA    1 
ATOM   1377 C C     . ILE A 1 172 ? 17.064  81.497  16.468  1.00 35.95  ? 172 ILE A C     1 
ATOM   1378 O O     . ILE A 1 172 ? 17.423  80.384  16.092  1.00 36.12  ? 172 ILE A O     1 
ATOM   1379 C CB    . ILE A 1 172 ? 16.185  82.128  18.692  1.00 39.17  ? 172 ILE A CB    1 
ATOM   1380 C CG1   . ILE A 1 172 ? 16.552  82.569  20.106  1.00 36.18  ? 172 ILE A CG1   1 
ATOM   1381 C CG2   . ILE A 1 172 ? 15.449  80.772  18.725  1.00 37.67  ? 172 ILE A CG2   1 
ATOM   1382 C CD1   . ILE A 1 172 ? 15.367  82.883  20.962  1.00 35.32  ? 172 ILE A CD1   1 
ATOM   1383 N N     . TYR A 1 173 ? 16.319  82.295  15.717  1.00 37.49  ? 173 TYR A N     1 
ATOM   1384 C CA    . TYR A 1 173 ? 15.754  81.766  14.496  1.00 35.85  ? 173 TYR A CA    1 
ATOM   1385 C C     . TYR A 1 173 ? 16.765  81.715  13.371  1.00 35.38  ? 173 TYR A C     1 
ATOM   1386 O O     . TYR A 1 173 ? 16.571  80.946  12.423  1.00 34.82  ? 173 TYR A O     1 
ATOM   1387 C CB    . TYR A 1 173 ? 14.517  82.554  14.082  1.00 31.74  ? 173 TYR A CB    1 
ATOM   1388 C CG    . TYR A 1 173 ? 13.426  82.373  15.079  1.00 36.29  ? 173 TYR A CG    1 
ATOM   1389 C CD1   . TYR A 1 173 ? 12.919  81.103  15.355  1.00 37.07  ? 173 TYR A CD1   1 
ATOM   1390 C CD2   . TYR A 1 173 ? 12.938  83.465  15.803  1.00 33.76  ? 173 TYR A CD2   1 
ATOM   1391 C CE1   . TYR A 1 173 ? 11.927  80.932  16.307  1.00 41.20  ? 173 TYR A CE1   1 
ATOM   1392 C CE2   . TYR A 1 173 ? 11.977  83.312  16.737  1.00 37.52  ? 173 TYR A CE2   1 
ATOM   1393 C CZ    . TYR A 1 173 ? 11.467  82.053  17.001  1.00 44.05  ? 173 TYR A CZ    1 
ATOM   1394 O OH    . TYR A 1 173 ? 10.494  81.945  17.966  1.00 52.87  ? 173 TYR A OH    1 
ATOM   1395 N N     . VAL A 1 174 ? 17.850  82.480  13.457  1.00 32.24  ? 174 VAL A N     1 
ATOM   1396 C CA    . VAL A 1 174 ? 18.880  82.320  12.407  1.00 35.12  ? 174 VAL A CA    1 
ATOM   1397 C C     . VAL A 1 174 ? 19.582  80.950  12.583  1.00 40.35  ? 174 VAL A C     1 
ATOM   1398 O O     . VAL A 1 174 ? 19.866  80.235  11.608  1.00 42.53  ? 174 VAL A O     1 
ATOM   1399 C CB    . VAL A 1 174 ? 19.923  83.493  12.395  1.00 35.94  ? 174 VAL A CB    1 
ATOM   1400 C CG1   . VAL A 1 174 ? 20.911  83.355  13.529  1.00 41.62  ? 174 VAL A CG1   1 
ATOM   1401 C CG2   . VAL A 1 174 ? 20.695  83.493  11.133  1.00 39.49  ? 174 VAL A CG2   1 
ATOM   1402 N N     . ASP A 1 175 ? 19.833  80.562  13.826  1.00 34.45  ? 175 ASP A N     1 
ATOM   1403 C CA    . ASP A 1 175 ? 20.409  79.253  14.072  1.00 33.92  ? 175 ASP A CA    1 
ATOM   1404 C C     . ASP A 1 175 ? 19.453  78.160  13.548  1.00 40.50  ? 175 ASP A C     1 
ATOM   1405 O O     . ASP A 1 175 ? 19.891  77.178  12.921  1.00 40.86  ? 175 ASP A O     1 
ATOM   1406 C CB    . ASP A 1 175 ? 20.695  79.069  15.552  1.00 34.85  ? 175 ASP A CB    1 
ATOM   1407 C CG    . ASP A 1 175 ? 22.026  79.686  15.982  1.00 42.32  ? 175 ASP A CG    1 
ATOM   1408 O OD1   . ASP A 1 175 ? 22.707  80.361  15.163  1.00 41.69  ? 175 ASP A OD1   1 
ATOM   1409 O OD2   . ASP A 1 175 ? 22.388  79.492  17.161  1.00 43.32  ? 175 ASP A OD2   1 
ATOM   1410 N N     . GLU A 1 176 ? 18.155  78.345  13.782  1.00 38.30  ? 176 GLU A N     1 
ATOM   1411 C CA    . GLU A 1 176 ? 17.176  77.331  13.394  1.00 39.51  ? 176 GLU A CA    1 
ATOM   1412 C C     . GLU A 1 176 ? 17.075  77.248  11.885  1.00 39.62  ? 176 GLU A C     1 
ATOM   1413 O O     . GLU A 1 176 ? 16.992  76.169  11.336  1.00 46.37  ? 176 GLU A O     1 
ATOM   1414 C CB    . GLU A 1 176 ? 15.798  77.626  14.004  1.00 37.77  ? 176 GLU A CB    1 
ATOM   1415 C CG    . GLU A 1 176 ? 15.776  77.525  15.536  1.00 37.63  ? 176 GLU A CG    1 
ATOM   1416 C CD    . GLU A 1 176 ? 15.946  76.095  16.038  1.00 41.92  ? 176 GLU A CD    1 
ATOM   1417 O OE1   . GLU A 1 176 ? 15.291  75.185  15.471  1.00 47.69  ? 176 GLU A OE1   1 
ATOM   1418 O OE2   . GLU A 1 176 ? 16.700  75.873  17.019  1.00 40.63  ? 176 GLU A OE2   1 
ATOM   1419 N N     . VAL A 1 177 ? 17.130  78.397  11.222  1.00 38.25  ? 177 VAL A N     1 
ATOM   1420 C CA    . VAL A 1 177 ? 16.988  78.489  9.777   1.00 36.27  ? 177 VAL A CA    1 
ATOM   1421 C C     . VAL A 1 177 ? 18.175  77.829  9.064   1.00 39.39  ? 177 VAL A C     1 
ATOM   1422 O O     . VAL A 1 177 ? 17.996  77.049  8.103   1.00 40.15  ? 177 VAL A O     1 
ATOM   1423 C CB    . VAL A 1 177 ? 16.844  79.962  9.348   1.00 37.07  ? 177 VAL A CB    1 
ATOM   1424 C CG1   . VAL A 1 177 ? 17.555  80.238  8.068   1.00 39.34  ? 177 VAL A CG1   1 
ATOM   1425 C CG2   . VAL A 1 177 ? 15.378  80.322  9.240   1.00 41.15  ? 177 VAL A CG2   1 
ATOM   1426 N N     . LEU A 1 178 ? 19.374  78.108  9.553   1.00 34.92  ? 178 LEU A N     1 
ATOM   1427 C CA    . LEU A 1 178 ? 20.553  77.537  8.949   1.00 37.94  ? 178 LEU A CA    1 
ATOM   1428 C C     . LEU A 1 178 ? 20.617  76.017  9.169   1.00 39.30  ? 178 LEU A C     1 
ATOM   1429 O O     . LEU A 1 178 ? 21.177  75.278  8.340   1.00 41.19  ? 178 LEU A O     1 
ATOM   1430 C CB    . LEU A 1 178 ? 21.799  78.215  9.491   1.00 41.61  ? 178 LEU A CB    1 
ATOM   1431 C CG    . LEU A 1 178 ? 21.904  79.709  9.127   1.00 38.99  ? 178 LEU A CG    1 
ATOM   1432 C CD1   . LEU A 1 178 ? 23.165  80.307  9.752   1.00 37.56  ? 178 LEU A CD1   1 
ATOM   1433 C CD2   . LEU A 1 178 ? 21.881  79.935  7.606   1.00 31.36  ? 178 LEU A CD2   1 
ATOM   1434 N N     . TRP A 1 179 ? 20.023  75.530  10.252  1.00 38.72  ? 179 TRP A N     1 
ATOM   1435 C CA    . TRP A 1 179 ? 20.012  74.082  10.468  1.00 46.00  ? 179 TRP A CA    1 
ATOM   1436 C C     . TRP A 1 179 ? 19.018  73.481  9.474   1.00 47.36  ? 179 TRP A C     1 
ATOM   1437 O O     . TRP A 1 179 ? 19.301  72.495  8.799   1.00 47.23  ? 179 TRP A O     1 
ATOM   1438 C CB    . TRP A 1 179 ? 19.627  73.684  11.904  1.00 38.65  ? 179 TRP A CB    1 
ATOM   1439 C CG    . TRP A 1 179 ? 19.515  72.193  12.006  1.00 52.39  ? 179 TRP A CG    1 
ATOM   1440 C CD1   . TRP A 1 179 ? 20.548  71.288  12.085  1.00 55.85  ? 179 TRP A CD1   1 
ATOM   1441 C CD2   . TRP A 1 179 ? 18.319  71.420  11.946  1.00 51.99  ? 179 TRP A CD2   1 
ATOM   1442 N NE1   . TRP A 1 179 ? 20.059  70.004  12.099  1.00 61.23  ? 179 TRP A NE1   1 
ATOM   1443 C CE2   . TRP A 1 179 ? 18.696  70.058  12.015  1.00 60.61  ? 179 TRP A CE2   1 
ATOM   1444 C CE3   . TRP A 1 179 ? 16.973  71.745  11.828  1.00 54.99  ? 179 TRP A CE3   1 
ATOM   1445 C CZ2   . TRP A 1 179 ? 17.764  69.028  11.984  1.00 68.28  ? 179 TRP A CZ2   1 
ATOM   1446 C CZ3   . TRP A 1 179 ? 16.046  70.728  11.801  1.00 63.76  ? 179 TRP A CZ3   1 
ATOM   1447 C CH2   . TRP A 1 179 ? 16.440  69.384  11.883  1.00 71.75  ? 179 TRP A CH2   1 
ATOM   1448 N N     . LEU A 1 180 ? 17.845  74.095  9.408   1.00 46.43  ? 180 LEU A N     1 
ATOM   1449 C CA    . LEU A 1 180 ? 16.813  73.675  8.481   1.00 49.17  ? 180 LEU A CA    1 
ATOM   1450 C C     . LEU A 1 180 ? 17.327  73.643  7.036   1.00 46.42  ? 180 LEU A C     1 
ATOM   1451 O O     . LEU A 1 180 ? 17.046  72.731  6.302   1.00 52.54  ? 180 LEU A O     1 
ATOM   1452 C CB    . LEU A 1 180 ? 15.606  74.612  8.607   1.00 48.08  ? 180 LEU A CB    1 
ATOM   1453 C CG    . LEU A 1 180 ? 14.307  74.060  8.027   1.00 53.75  ? 180 LEU A CG    1 
ATOM   1454 C CD1   . LEU A 1 180 ? 14.064  72.632  8.503   1.00 51.01  ? 180 LEU A CD1   1 
ATOM   1455 C CD2   . LEU A 1 180 ? 13.152  74.939  8.426   1.00 51.80  ? 180 LEU A CD2   1 
ATOM   1456 N N     . ALA A 1 181 ? 18.116  74.634  6.646   1.00 47.44  ? 181 ALA A N     1 
ATOM   1457 C CA    . ALA A 1 181 ? 18.631  74.720  5.280   1.00 44.84  ? 181 ALA A CA    1 
ATOM   1458 C C     . ALA A 1 181 ? 20.001  74.034  5.124   1.00 45.96  ? 181 ALA A C     1 
ATOM   1459 O O     . ALA A 1 181 ? 20.566  74.009  4.033   1.00 39.83  ? 181 ALA A O     1 
ATOM   1460 C CB    . ALA A 1 181 ? 18.718  76.171  4.840   1.00 35.98  ? 181 ALA A CB    1 
ATOM   1461 N N     . LYS A 1 182 ? 20.507  73.458  6.207   1.00 44.92  ? 182 LYS A N     1 
ATOM   1462 C CA    . LYS A 1 182 ? 21.774  72.722  6.175   1.00 45.33  ? 182 LYS A CA    1 
ATOM   1463 C C     . LYS A 1 182 ? 22.925  73.597  5.664   1.00 43.42  ? 182 LYS A C     1 
ATOM   1464 O O     . LYS A 1 182 ? 23.739  73.165  4.878   1.00 44.79  ? 182 LYS A O     1 
ATOM   1465 C CB    . LYS A 1 182 ? 21.652  71.451  5.315   1.00 50.84  ? 182 LYS A CB    1 
ATOM   1466 C CG    . LYS A 1 182 ? 20.347  70.652  5.499   1.00 60.18  ? 182 LYS A CG    1 
ATOM   1467 C CD    . LYS A 1 182 ? 20.229  69.982  6.891   1.00 65.30  ? 182 LYS A CD    1 
ATOM   1468 C CE    . LYS A 1 182 ? 18.773  69.619  7.232   1.00 58.41  ? 182 LYS A CE    1 
ATOM   1469 N NZ    . LYS A 1 182 ? 18.637  69.290  8.655   1.00 54.81  ? 182 LYS A NZ    1 
ATOM   1470 N N     . ILE A 1 183 ? 22.980  74.838  6.121   1.00 44.39  ? 183 ILE A N     1 
ATOM   1471 C CA    . ILE A 1 183 ? 24.101  75.724  5.813   1.00 41.53  ? 183 ILE A CA    1 
ATOM   1472 C C     . ILE A 1 183 ? 24.929  76.079  7.074   1.00 42.74  ? 183 ILE A C     1 
ATOM   1473 O O     . ILE A 1 183 ? 24.374  76.379  8.137   1.00 37.40  ? 183 ILE A O     1 
ATOM   1474 C CB    . ILE A 1 183 ? 23.611  77.012  5.174   1.00 39.36  ? 183 ILE A CB    1 
ATOM   1475 C CG1   . ILE A 1 183 ? 22.738  76.697  3.941   1.00 36.15  ? 183 ILE A CG1   1 
ATOM   1476 C CG2   . ILE A 1 183 ? 24.806  77.930  4.877   1.00 35.49  ? 183 ILE A CG2   1 
ATOM   1477 C CD1   . ILE A 1 183 ? 22.062  77.938  3.389   1.00 34.84  ? 183 ILE A CD1   1 
ATOM   1478 N N     . HIS A 1 184 ? 26.251  75.980  6.951   1.00 42.81  ? 184 HIS A N     1 
ATOM   1479 C CA    . HIS A 1 184 ? 27.181  76.370  7.987   1.00 38.87  ? 184 HIS A CA    1 
ATOM   1480 C C     . HIS A 1 184 ? 27.065  77.867  8.229   1.00 40.81  ? 184 HIS A C     1 
ATOM   1481 O O     . HIS A 1 184 ? 27.048  78.649  7.286   1.00 39.98  ? 184 HIS A O     1 
ATOM   1482 C CB    . HIS A 1 184 ? 28.607  76.022  7.570   1.00 40.04  ? 184 HIS A CB    1 
ATOM   1483 C CG    . HIS A 1 184 ? 29.593  76.058  8.695   1.00 47.88  ? 184 HIS A CG    1 
ATOM   1484 N ND1   . HIS A 1 184 ? 29.961  77.224  9.333   1.00 46.34  ? 184 HIS A ND1   1 
ATOM   1485 C CD2   . HIS A 1 184 ? 30.272  75.061  9.310   1.00 49.36  ? 184 HIS A CD2   1 
ATOM   1486 C CE1   . HIS A 1 184 ? 30.838  76.944  10.280  1.00 46.84  ? 184 HIS A CE1   1 
ATOM   1487 N NE2   . HIS A 1 184 ? 31.039  75.638  10.290  1.00 50.29  ? 184 HIS A NE2   1 
ATOM   1488 N N     . PRO A 1 185 ? 26.993  78.279  9.498   1.00 43.11  ? 185 PRO A N     1 
ATOM   1489 C CA    . PRO A 1 185 ? 26.811  79.708  9.798   1.00 35.93  ? 185 PRO A CA    1 
ATOM   1490 C C     . PRO A 1 185 ? 27.999  80.590  9.385   1.00 36.54  ? 185 PRO A C     1 
ATOM   1491 O O     . PRO A 1 185 ? 27.817  81.797  9.326   1.00 38.18  ? 185 PRO A O     1 
ATOM   1492 C CB    . PRO A 1 185 ? 26.636  79.721  11.302  1.00 34.37  ? 185 PRO A CB    1 
ATOM   1493 C CG    . PRO A 1 185 ? 27.283  78.455  11.772  1.00 45.04  ? 185 PRO A CG    1 
ATOM   1494 C CD    . PRO A 1 185 ? 27.004  77.449  10.715  1.00 43.63  ? 185 PRO A CD    1 
ATOM   1495 N N     . GLU A 1 186 ? 29.164  80.007  9.087   1.00 37.26  ? 186 GLU A N     1 
ATOM   1496 C CA    . GLU A 1 186 ? 30.334  80.783  8.673   1.00 40.13  ? 186 GLU A CA    1 
ATOM   1497 C C     . GLU A 1 186 ? 30.591  80.702  7.170   1.00 44.00  ? 186 GLU A C     1 
ATOM   1498 O O     . GLU A 1 186 ? 31.636  81.134  6.673   1.00 47.06  ? 186 GLU A O     1 
ATOM   1499 C CB    . GLU A 1 186 ? 31.574  80.319  9.429   1.00 43.38  ? 186 GLU A CB    1 
ATOM   1500 C CG    . GLU A 1 186 ? 31.578  80.784  10.875  1.00 50.60  ? 186 GLU A CG    1 
ATOM   1501 C CD    . GLU A 1 186 ? 32.888  80.530  11.580  1.00 59.30  ? 186 GLU A CD    1 
ATOM   1502 O OE1   . GLU A 1 186 ? 33.362  81.430  12.313  1.00 64.80  ? 186 GLU A OE1   1 
ATOM   1503 O OE2   . GLU A 1 186 ? 33.445  79.431  11.410  1.00 66.02  ? 186 GLU A OE2   1 
ATOM   1504 N N     . LYS A 1 187 ? 29.623  80.141  6.457   1.00 37.75  ? 187 LYS A N     1 
ATOM   1505 C CA    . LYS A 1 187 ? 29.676  80.039  5.017   1.00 41.66  ? 187 LYS A CA    1 
ATOM   1506 C C     . LYS A 1 187 ? 29.619  81.422  4.370   1.00 42.33  ? 187 LYS A C     1 
ATOM   1507 O O     . LYS A 1 187 ? 28.713  82.246  4.644   1.00 38.01  ? 187 LYS A O     1 
ATOM   1508 C CB    . LYS A 1 187 ? 28.509  79.180  4.520   1.00 46.09  ? 187 LYS A CB    1 
ATOM   1509 C CG    . LYS A 1 187 ? 28.420  79.057  3.012   1.00 47.05  ? 187 LYS A CG    1 
ATOM   1510 C CD    . LYS A 1 187 ? 29.439  78.058  2.520   1.00 53.14  ? 187 LYS A CD    1 
ATOM   1511 C CE    . LYS A 1 187 ? 29.152  77.646  1.080   1.00 60.34  ? 187 LYS A CE    1 
ATOM   1512 N NZ    . LYS A 1 187 ? 30.183  76.662  0.642   1.00 64.15  ? 187 LYS A NZ    1 
ATOM   1513 N N     . GLU A 1 188 ? 30.583  81.688  3.511   1.00 42.43  ? 188 GLU A N     1 
ATOM   1514 C CA    . GLU A 1 188 ? 30.569  82.951  2.801   1.00 44.49  ? 188 GLU A CA    1 
ATOM   1515 C C     . GLU A 1 188 ? 29.467  82.949  1.730   1.00 43.35  ? 188 GLU A C     1 
ATOM   1516 O O     . GLU A 1 188 ? 29.334  81.996  0.955   1.00 43.87  ? 188 GLU A O     1 
ATOM   1517 C CB    . GLU A 1 188 ? 31.937  83.212  2.207   1.00 49.11  ? 188 GLU A CB    1 
ATOM   1518 C CG    . GLU A 1 188 ? 32.965  83.411  3.275   1.00 62.33  ? 188 GLU A CG    1 
ATOM   1519 C CD    . GLU A 1 188 ? 34.254  84.007  2.758   1.00 75.16  ? 188 GLU A CD    1 
ATOM   1520 O OE1   . GLU A 1 188 ? 34.342  84.285  1.539   1.00 82.32  ? 188 GLU A OE1   1 
ATOM   1521 O OE2   . GLU A 1 188 ? 35.179  84.196  3.576   1.00 77.76  ? 188 GLU A OE2   1 
ATOM   1522 N N     . THR A 1 189 ? 28.686  84.026  1.688   1.00 40.21  ? 189 THR A N     1 
ATOM   1523 C CA    . THR A 1 189 ? 27.437  84.003  0.947   1.00 39.80  ? 189 THR A CA    1 
ATOM   1524 C C     . THR A 1 189 ? 27.653  83.843  -0.555  1.00 44.01  ? 189 THR A C     1 
ATOM   1525 O O     . THR A 1 189 ? 26.860  83.177  -1.215  1.00 49.69  ? 189 THR A O     1 
ATOM   1526 C CB    . THR A 1 189 ? 26.582  85.267  1.224   1.00 40.07  ? 189 THR A CB    1 
ATOM   1527 O OG1   . THR A 1 189 ? 27.239  86.434  0.725   1.00 40.01  ? 189 THR A OG1   1 
ATOM   1528 C CG2   . THR A 1 189 ? 26.348  85.405  2.717   1.00 39.49  ? 189 THR A CG2   1 
ATOM   1529 N N     . ASN A 1 190 ? 28.737  84.396  -1.095  1.00 44.16  ? 190 ASN A N     1 
ATOM   1530 C CA    . ASN A 1 190 ? 29.001  84.248  -2.530  1.00 49.96  ? 190 ASN A CA    1 
ATOM   1531 C C     . ASN A 1 190 ? 29.432  82.825  -2.893  1.00 52.68  ? 190 ASN A C     1 
ATOM   1532 O O     . ASN A 1 190 ? 29.707  82.525  -4.043  1.00 56.87  ? 190 ASN A O     1 
ATOM   1533 C CB    . ASN A 1 190 ? 30.056  85.250  -2.992  1.00 54.97  ? 190 ASN A CB    1 
ATOM   1534 C CG    . ASN A 1 190 ? 31.427  85.005  -2.360  1.00 63.20  ? 190 ASN A CG    1 
ATOM   1535 O OD1   . ASN A 1 190 ? 31.551  84.325  -1.346  1.00 67.31  ? 190 ASN A OD1   1 
ATOM   1536 N ND2   . ASN A 1 190 ? 32.453  85.583  -2.950  1.00 63.45  ? 190 ASN A ND2   1 
ATOM   1537 N N     . GLN A 1 191 ? 29.476  81.945  -1.902  1.00 52.67  ? 191 GLN A N     1 
ATOM   1538 C CA    . GLN A 1 191 ? 29.847  80.562  -2.134  1.00 51.62  ? 191 GLN A CA    1 
ATOM   1539 C C     . GLN A 1 191 ? 28.596  79.689  -2.196  1.00 51.03  ? 191 GLN A C     1 
ATOM   1540 O O     . GLN A 1 191 ? 28.665  78.548  -2.620  1.00 59.34  ? 191 GLN A O     1 
ATOM   1541 C CB    . GLN A 1 191 ? 30.801  80.055  -1.038  1.00 51.33  ? 191 GLN A CB    1 
ATOM   1542 C CG    . GLN A 1 191 ? 32.193  80.676  -1.047  1.00 58.40  ? 191 GLN A CG    1 
ATOM   1543 C CD    . GLN A 1 191 ? 33.065  80.157  -2.184  1.00 78.12  ? 191 GLN A CD    1 
ATOM   1544 O OE1   . GLN A 1 191 ? 33.436  78.975  -2.218  1.00 88.31  ? 191 GLN A OE1   1 
ATOM   1545 N NE2   . GLN A 1 191 ? 33.399  81.038  -3.123  1.00 82.31  ? 191 GLN A NE2   1 
ATOM   1546 N N     . LEU A 1 192 ? 27.456  80.215  -1.763  1.00 45.94  ? 192 LEU A N     1 
ATOM   1547 C CA    . LEU A 1 192 ? 26.211  79.443  -1.790  1.00 47.09  ? 192 LEU A CA    1 
ATOM   1548 C C     . LEU A 1 192 ? 25.724  79.182  -3.215  1.00 51.80  ? 192 LEU A C     1 
ATOM   1549 O O     . LEU A 1 192 ? 25.664  80.094  -4.049  1.00 49.96  ? 192 LEU A O     1 
ATOM   1550 C CB    . LEU A 1 192 ? 25.110  80.167  -1.012  1.00 45.51  ? 192 LEU A CB    1 
ATOM   1551 C CG    . LEU A 1 192 ? 25.394  80.388  0.473   1.00 48.85  ? 192 LEU A CG    1 
ATOM   1552 C CD1   . LEU A 1 192 ? 24.482  81.467  1.054   1.00 46.15  ? 192 LEU A CD1   1 
ATOM   1553 C CD2   . LEU A 1 192 ? 25.237  79.082  1.218   1.00 47.14  ? 192 LEU A CD2   1 
ATOM   1554 N N     . ILE A 1 193 ? 25.346  77.943  -3.497  1.00 55.70  ? 193 ILE A N     1 
ATOM   1555 C CA    . ILE A 1 193 ? 24.751  77.653  -4.796  1.00 53.22  ? 193 ILE A CA    1 
ATOM   1556 C C     . ILE A 1 193 ? 23.252  77.924  -4.755  1.00 50.47  ? 193 ILE A C     1 
ATOM   1557 O O     . ILE A 1 193 ? 22.630  78.007  -3.689  1.00 53.80  ? 193 ILE A O     1 
ATOM   1558 C CB    . ILE A 1 193 ? 25.016  76.213  -5.237  1.00 57.91  ? 193 ILE A CB    1 
ATOM   1559 C CG1   . ILE A 1 193 ? 24.275  75.233  -4.332  1.00 61.23  ? 193 ILE A CG1   1 
ATOM   1560 C CG2   . ILE A 1 193 ? 26.502  75.922  -5.186  1.00 51.47  ? 193 ILE A CG2   1 
ATOM   1561 C CD1   . ILE A 1 193 ? 24.609  73.823  -4.646  1.00 61.22  ? 193 ILE A CD1   1 
ATOM   1562 N N     . GLU A 1 194 ? 22.700  78.079  -5.944  1.00 56.43  ? 194 GLU A N     1 
ATOM   1563 C CA    . GLU A 1 194 ? 21.338  78.505  -6.164  1.00 56.38  ? 194 GLU A CA    1 
ATOM   1564 C C     . GLU A 1 194 ? 20.360  77.647  -5.377  1.00 54.20  ? 194 GLU A C     1 
ATOM   1565 O O     . GLU A 1 194 ? 19.409  78.145  -4.785  1.00 55.31  ? 194 GLU A O     1 
ATOM   1566 C CB    . GLU A 1 194 ? 21.039  78.450  -7.661  1.00 65.31  ? 194 GLU A CB    1 
ATOM   1567 C CG    . GLU A 1 194 ? 19.686  79.011  -8.057  1.00 79.40  ? 194 GLU A CG    1 
ATOM   1568 C CD    . GLU A 1 194 ? 19.550  79.267  -9.558  1.00 93.84  ? 194 GLU A CD    1 
ATOM   1569 O OE1   . GLU A 1 194 ? 18.428  79.096  -10.083 1.00 100.45 ? 194 GLU A OE1   1 
ATOM   1570 O OE2   . GLU A 1 194 ? 20.552  79.647  -10.212 1.00 97.71  ? 194 GLU A OE2   1 
ATOM   1571 N N     . SER A 1 195 ? 20.613  76.352  -5.333  1.00 52.51  ? 195 SER A N     1 
ATOM   1572 C CA    . SER A 1 195 ? 19.684  75.449  -4.685  1.00 52.22  ? 195 SER A CA    1 
ATOM   1573 C C     . SER A 1 195 ? 19.713  75.644  -3.173  1.00 51.27  ? 195 SER A C     1 
ATOM   1574 O O     . SER A 1 195 ? 18.671  75.590  -2.535  1.00 55.83  ? 195 SER A O     1 
ATOM   1575 C CB    . SER A 1 195 ? 20.002  74.002  -5.054  1.00 56.40  ? 195 SER A CB    1 
ATOM   1576 O OG    . SER A 1 195 ? 21.284  73.661  -4.574  1.00 64.12  ? 195 SER A OG    1 
ATOM   1577 N N     . SER A 1 196 ? 20.888  75.893  -2.597  1.00 48.37  ? 196 SER A N     1 
ATOM   1578 C CA    . SER A 1 196 ? 20.953  76.187  -1.165  1.00 44.95  ? 196 SER A CA    1 
ATOM   1579 C C     . SER A 1 196 ? 20.236  77.501  -0.876  1.00 47.62  ? 196 SER A C     1 
ATOM   1580 O O     . SER A 1 196 ? 19.609  77.673  0.172   1.00 49.64  ? 196 SER A O     1 
ATOM   1581 C CB    . SER A 1 196 ? 22.398  76.289  -0.663  1.00 44.43  ? 196 SER A CB    1 
ATOM   1582 O OG    . SER A 1 196 ? 23.147  75.100  -0.873  1.00 51.73  ? 196 SER A OG    1 
ATOM   1583 N N     . ILE A 1 197 ? 20.360  78.450  -1.794  1.00 45.60  ? 197 ILE A N     1 
ATOM   1584 C CA    . ILE A 1 197 ? 19.805  79.765  -1.546  1.00 45.08  ? 197 ILE A CA    1 
ATOM   1585 C C     . ILE A 1 197 ? 18.284  79.671  -1.552  1.00 42.30  ? 197 ILE A C     1 
ATOM   1586 O O     . ILE A 1 197 ? 17.603  80.291  -0.747  1.00 38.04  ? 197 ILE A O     1 
ATOM   1587 C CB    . ILE A 1 197 ? 20.294  80.771  -2.594  1.00 49.09  ? 197 ILE A CB    1 
ATOM   1588 C CG1   . ILE A 1 197 ? 21.770  81.074  -2.346  1.00 46.27  ? 197 ILE A CG1   1 
ATOM   1589 C CG2   . ILE A 1 197 ? 19.438  82.062  -2.581  1.00 50.61  ? 197 ILE A CG2   1 
ATOM   1590 C CD1   . ILE A 1 197 ? 22.397  81.962  -3.402  1.00 47.75  ? 197 ILE A CD1   1 
ATOM   1591 N N     . HIS A 1 198 ? 17.762  78.865  -2.462  1.00 44.94  ? 198 HIS A N     1 
ATOM   1592 C CA    . HIS A 1 198 ? 16.330  78.651  -2.554  1.00 46.67  ? 198 HIS A CA    1 
ATOM   1593 C C     . HIS A 1 198 ? 15.805  78.028  -1.256  1.00 46.50  ? 198 HIS A C     1 
ATOM   1594 O O     . HIS A 1 198 ? 14.803  78.500  -0.694  1.00 45.09  ? 198 HIS A O     1 
ATOM   1595 C CB    . HIS A 1 198 ? 15.994  77.756  -3.763  1.00 51.14  ? 198 HIS A CB    1 
ATOM   1596 C CG    . HIS A 1 198 ? 14.548  77.393  -3.839  1.00 61.73  ? 198 HIS A CG    1 
ATOM   1597 N ND1   . HIS A 1 198 ? 13.548  78.341  -3.933  1.00 65.86  ? 198 HIS A ND1   1 
ATOM   1598 C CD2   . HIS A 1 198 ? 13.923  76.196  -3.771  1.00 62.44  ? 198 HIS A CD2   1 
ATOM   1599 C CE1   . HIS A 1 198 ? 12.373  77.740  -3.951  1.00 63.95  ? 198 HIS A CE1   1 
ATOM   1600 N NE2   . HIS A 1 198 ? 12.572  76.439  -3.857  1.00 64.98  ? 198 HIS A NE2   1 
ATOM   1601 N N     . LEU A 1 199 ? 16.489  76.988  -0.771  1.00 43.39  ? 199 LEU A N     1 
ATOM   1602 C CA    . LEU A 1 199 ? 16.056  76.312  0.453   1.00 45.43  ? 199 LEU A CA    1 
ATOM   1603 C C     . LEU A 1 199 ? 16.139  77.257  1.665   1.00 45.36  ? 199 LEU A C     1 
ATOM   1604 O O     . LEU A 1 199 ? 15.201  77.319  2.485   1.00 50.03  ? 199 LEU A O     1 
ATOM   1605 C CB    . LEU A 1 199 ? 16.876  75.040  0.692   1.00 46.64  ? 199 LEU A CB    1 
ATOM   1606 C CG    . LEU A 1 199 ? 16.530  74.206  1.943   1.00 51.40  ? 199 LEU A CG    1 
ATOM   1607 C CD1   . LEU A 1 199 ? 15.064  73.758  1.991   1.00 50.37  ? 199 LEU A CD1   1 
ATOM   1608 C CD2   . LEU A 1 199 ? 17.459  73.001  2.111   1.00 47.56  ? 199 LEU A CD2   1 
ATOM   1609 N N     . LEU A 1 200 ? 17.240  78.006  1.761   1.00 39.21  ? 200 LEU A N     1 
ATOM   1610 C CA    . LEU A 1 200 ? 17.398  79.036  2.793   1.00 36.25  ? 200 LEU A CA    1 
ATOM   1611 C C     . LEU A 1 200 ? 16.247  80.052  2.776   1.00 36.18  ? 200 LEU A C     1 
ATOM   1612 O O     . LEU A 1 200 ? 15.722  80.434  3.813   1.00 40.61  ? 200 LEU A O     1 
ATOM   1613 C CB    . LEU A 1 200 ? 18.722  79.772  2.602   1.00 33.33  ? 200 LEU A CB    1 
ATOM   1614 C CG    . LEU A 1 200 ? 18.988  80.948  3.540   1.00 37.52  ? 200 LEU A CG    1 
ATOM   1615 C CD1   . LEU A 1 200 ? 19.001  80.462  4.953   1.00 32.25  ? 200 LEU A CD1   1 
ATOM   1616 C CD2   . LEU A 1 200 ? 20.298  81.630  3.199   1.00 40.74  ? 200 LEU A CD2   1 
ATOM   1617 N N     . HIS A 1 201 ? 15.878  80.491  1.584   1.00 40.04  ? 201 HIS A N     1 
ATOM   1618 C CA    . HIS A 1 201 ? 14.818  81.463  1.387   1.00 39.81  ? 201 HIS A CA    1 
ATOM   1619 C C     . HIS A 1 201 ? 13.496  80.927  1.932   1.00 42.48  ? 201 HIS A C     1 
ATOM   1620 O O     . HIS A 1 201 ? 12.816  81.571  2.725   1.00 40.19  ? 201 HIS A O     1 
ATOM   1621 C CB    . HIS A 1 201 ? 14.697  81.774  -0.109  1.00 43.26  ? 201 HIS A CB    1 
ATOM   1622 C CG    . HIS A 1 201 ? 13.461  82.532  -0.476  1.00 46.66  ? 201 HIS A CG    1 
ATOM   1623 N ND1   . HIS A 1 201 ? 12.309  81.907  -0.904  1.00 50.92  ? 201 HIS A ND1   1 
ATOM   1624 C CD2   . HIS A 1 201 ? 13.201  83.861  -0.498  1.00 42.29  ? 201 HIS A CD2   1 
ATOM   1625 C CE1   . HIS A 1 201 ? 11.388  82.819  -1.165  1.00 47.66  ? 201 HIS A CE1   1 
ATOM   1626 N NE2   . HIS A 1 201 ? 11.908  84.012  -0.937  1.00 46.87  ? 201 HIS A NE2   1 
ATOM   1627 N N     . ASP A 1 202 ? 13.144  79.727  1.492   1.00 47.47  ? 202 ASP A N     1 
ATOM   1628 C CA    . ASP A 1 202 ? 11.926  79.079  1.940   1.00 47.75  ? 202 ASP A CA    1 
ATOM   1629 C C     . ASP A 1 202 ? 12.006  78.798  3.429   1.00 48.21  ? 202 ASP A C     1 
ATOM   1630 O O     . ASP A 1 202 ? 11.021  78.946  4.126   1.00 51.91  ? 202 ASP A O     1 
ATOM   1631 C CB    . ASP A 1 202 ? 11.674  77.773  1.177   1.00 50.99  ? 202 ASP A CB    1 
ATOM   1632 C CG    . ASP A 1 202 ? 11.189  78.007  -0.248  1.00 67.12  ? 202 ASP A CG    1 
ATOM   1633 O OD1   . ASP A 1 202 ? 10.865  79.166  -0.611  1.00 73.46  ? 202 ASP A OD1   1 
ATOM   1634 O OD2   . ASP A 1 202 ? 11.119  77.026  -1.018  1.00 75.84  ? 202 ASP A OD2   1 
ATOM   1635 N N     . SER A 1 203 ? 13.172  78.402  3.921   1.00 43.29  ? 203 SER A N     1 
ATOM   1636 C CA    . SER A 1 203 ? 13.305  78.106  5.349   1.00 44.30  ? 203 SER A CA    1 
ATOM   1637 C C     . SER A 1 203 ? 13.016  79.316  6.229   1.00 48.12  ? 203 SER A C     1 
ATOM   1638 O O     . SER A 1 203 ? 12.332  79.210  7.267   1.00 48.84  ? 203 SER A O     1 
ATOM   1639 C CB    . SER A 1 203 ? 14.696  77.586  5.655   1.00 40.69  ? 203 SER A CB    1 
ATOM   1640 O OG    . SER A 1 203 ? 14.966  76.455  4.856   1.00 49.28  ? 203 SER A OG    1 
ATOM   1641 N N     . ILE A 1 204 ? 13.548  80.460  5.822   1.00 43.81  ? 204 ILE A N     1 
ATOM   1642 C CA    . ILE A 1 204 ? 13.337  81.681  6.579   1.00 42.43  ? 204 ILE A CA    1 
ATOM   1643 C C     . ILE A 1 204 ? 11.836  81.996  6.700   1.00 43.68  ? 204 ILE A C     1 
ATOM   1644 O O     . ILE A 1 204 ? 11.331  82.269  7.797   1.00 41.07  ? 204 ILE A O     1 
ATOM   1645 C CB    . ILE A 1 204 ? 14.096  82.860  5.940   1.00 38.51  ? 204 ILE A CB    1 
ATOM   1646 C CG1   . ILE A 1 204 ? 15.614  82.653  6.090   1.00 32.27  ? 204 ILE A CG1   1 
ATOM   1647 C CG2   . ILE A 1 204 ? 13.627  84.191  6.532   1.00 35.25  ? 204 ILE A CG2   1 
ATOM   1648 C CD1   . ILE A 1 204 ? 16.439  83.522  5.130   1.00 28.60  ? 204 ILE A CD1   1 
ATOM   1649 N N     . ILE A 1 205 ? 11.114  81.941  5.586   1.00 44.46  ? 205 ILE A N     1 
ATOM   1650 C CA    . ILE A 1 205 ? 9.678   82.180  5.646   1.00 44.52  ? 205 ILE A CA    1 
ATOM   1651 C C     . ILE A 1 205 ? 8.958   81.089  6.454   1.00 49.78  ? 205 ILE A C     1 
ATOM   1652 O O     . ILE A 1 205 ? 8.092   81.379  7.264   1.00 53.50  ? 205 ILE A O     1 
ATOM   1653 C CB    . ILE A 1 205 ? 9.068   82.261  4.241   1.00 46.37  ? 205 ILE A CB    1 
ATOM   1654 C CG1   . ILE A 1 205 ? 9.757   83.365  3.428   1.00 44.47  ? 205 ILE A CG1   1 
ATOM   1655 C CG2   . ILE A 1 205 ? 7.544   82.466  4.310   1.00 44.05  ? 205 ILE A CG2   1 
ATOM   1656 C CD1   . ILE A 1 205 ? 9.485   83.252  1.927   1.00 46.96  ? 205 ILE A CD1   1 
ATOM   1657 N N     . GLU A 1 206 ? 9.324   79.833  6.257   1.00 53.45  ? 206 GLU A N     1 
ATOM   1658 C CA    . GLU A 1 206 ? 8.640   78.749  6.972   1.00 57.52  ? 206 GLU A CA    1 
ATOM   1659 C C     . GLU A 1 206 ? 8.851   78.829  8.485   1.00 51.10  ? 206 GLU A C     1 
ATOM   1660 O O     . GLU A 1 206 ? 7.897   78.668  9.234   1.00 49.95  ? 206 GLU A O     1 
ATOM   1661 C CB    . GLU A 1 206 ? 9.093   77.381  6.466   1.00 59.62  ? 206 GLU A CB    1 
ATOM   1662 C CG    . GLU A 1 206 ? 8.643   77.100  5.069   1.00 77.65  ? 206 GLU A CG    1 
ATOM   1663 C CD    . GLU A 1 206 ? 7.135   77.132  4.936   1.00 94.27  ? 206 GLU A CD    1 
ATOM   1664 O OE1   . GLU A 1 206 ? 6.445   76.603  5.841   1.00 100.47 ? 206 GLU A OE1   1 
ATOM   1665 O OE2   . GLU A 1 206 ? 6.641   77.686  3.926   1.00 98.62  ? 206 GLU A OE2   1 
ATOM   1666 N N     . ILE A 1 207 ? 10.087  79.054  8.927   1.00 40.24  ? 207 ILE A N     1 
ATOM   1667 C CA    . ILE A 1 207 ? 10.363  79.050  10.358  1.00 44.48  ? 207 ILE A CA    1 
ATOM   1668 C C     . ILE A 1 207 ? 9.633   80.204  11.039  1.00 47.94  ? 207 ILE A C     1 
ATOM   1669 O O     . ILE A 1 207 ? 8.988   80.001  12.077  1.00 48.96  ? 207 ILE A O     1 
ATOM   1670 C CB    . ILE A 1 207 ? 11.879  79.152  10.671  1.00 55.25  ? 207 ILE A CB    1 
ATOM   1671 C CG1   . ILE A 1 207 ? 12.584  77.837  10.342  1.00 61.05  ? 207 ILE A CG1   1 
ATOM   1672 C CG2   . ILE A 1 207 ? 12.106  79.354  12.144  1.00 48.18  ? 207 ILE A CG2   1 
ATOM   1673 C CD1   . ILE A 1 207 ? 12.231  76.743  11.315  1.00 62.77  ? 207 ILE A CD1   1 
ATOM   1674 N N     . LEU A 1 208 ? 9.709   81.399  10.445  1.00 41.49  ? 208 LEU A N     1 
ATOM   1675 C CA    . LEU A 1 208 ? 9.141   82.580  11.078  1.00 39.39  ? 208 LEU A CA    1 
ATOM   1676 C C     . LEU A 1 208 ? 7.637   82.524  11.131  1.00 44.16  ? 208 LEU A C     1 
ATOM   1677 O O     . LEU A 1 208 ? 7.045   82.847  12.168  1.00 47.95  ? 208 LEU A O     1 
ATOM   1678 C CB    . LEU A 1 208 ? 9.595   83.849  10.374  1.00 37.31  ? 208 LEU A CB    1 
ATOM   1679 C CG    . LEU A 1 208 ? 11.094  84.068  10.599  1.00 34.52  ? 208 LEU A CG    1 
ATOM   1680 C CD1   . LEU A 1 208 ? 11.562  85.340  9.931   1.00 31.62  ? 208 LEU A CD1   1 
ATOM   1681 C CD2   . LEU A 1 208 ? 11.416  84.097  12.087  1.00 35.86  ? 208 LEU A CD2   1 
ATOM   1682 N N     . GLN A 1 209 ? 7.012   82.081  10.041  1.00 43.32  ? 209 GLN A N     1 
ATOM   1683 C CA    . GLN A 1 209 ? 5.565   81.958  10.019  1.00 43.68  ? 209 GLN A CA    1 
ATOM   1684 C C     . GLN A 1 209 ? 5.105   80.907  11.019  1.00 46.95  ? 209 GLN A C     1 
ATOM   1685 O O     . GLN A 1 209 ? 4.070   81.078  11.680  1.00 51.24  ? 209 GLN A O     1 
ATOM   1686 C CB    . GLN A 1 209 ? 5.052   81.612  8.619   1.00 52.54  ? 209 GLN A CB    1 
ATOM   1687 C CG    . GLN A 1 209 ? 5.354   82.643  7.534   1.00 58.03  ? 209 GLN A CG    1 
ATOM   1688 C CD    . GLN A 1 209 ? 4.937   84.054  7.898   1.00 67.91  ? 209 GLN A CD    1 
ATOM   1689 O OE1   . GLN A 1 209 ? 3.896   84.287  8.534   1.00 73.65  ? 209 GLN A OE1   1 
ATOM   1690 N NE2   . GLN A 1 209 ? 5.749   85.012  7.486   1.00 67.26  ? 209 GLN A NE2   1 
ATOM   1691 N N     . LYS A 1 210 ? 5.870   79.825  11.163  1.00 45.39  ? 210 LYS A N     1 
ATOM   1692 C CA    . LYS A 1 210 ? 5.505   78.799  12.156  1.00 48.69  ? 210 LYS A CA    1 
ATOM   1693 C C     . LYS A 1 210 ? 5.627   79.333  13.585  1.00 50.04  ? 210 LYS A C     1 
ATOM   1694 O O     . LYS A 1 210 ? 4.766   79.069  14.419  1.00 51.50  ? 210 LYS A O     1 
ATOM   1695 C CB    . LYS A 1 210 ? 6.365   77.545  11.999  1.00 48.07  ? 210 LYS A CB    1 
ATOM   1696 C CG    . LYS A 1 210 ? 6.158   76.510  13.076  1.00 47.70  ? 210 LYS A CG    1 
ATOM   1697 C CD    . LYS A 1 210 ? 7.253   75.464  13.025  1.00 52.38  ? 210 LYS A CD    1 
ATOM   1698 C CE    . LYS A 1 210 ? 7.012   74.390  14.060  1.00 63.06  ? 210 LYS A CE    1 
ATOM   1699 N NZ    . LYS A 1 210 ? 7.847   73.181  13.811  1.00 71.14  ? 210 LYS A NZ    1 
ATOM   1700 N N     . ALA A 1 211 ? 6.681   80.104  13.853  1.00 44.52  ? 211 ALA A N     1 
ATOM   1701 C CA    . ALA A 1 211 ? 6.901   80.670  15.185  1.00 43.05  ? 211 ALA A CA    1 
ATOM   1702 C C     . ALA A 1 211 ? 5.798   81.673  15.522  1.00 47.27  ? 211 ALA A C     1 
ATOM   1703 O O     . ALA A 1 211 ? 5.295   81.698  16.640  1.00 49.79  ? 211 ALA A O     1 
ATOM   1704 C CB    . ALA A 1 211 ? 8.269   81.326  15.272  1.00 36.74  ? 211 ALA A CB    1 
ATOM   1705 N N     . ILE A 1 212 ? 5.405   82.482  14.543  1.00 46.98  ? 212 ILE A N     1 
ATOM   1706 C CA    . ILE A 1 212 ? 4.280   83.380  14.731  1.00 45.56  ? 212 ILE A CA    1 
ATOM   1707 C C     . ILE A 1 212 ? 3.048   82.570  15.091  1.00 47.86  ? 212 ILE A C     1 
ATOM   1708 O O     . ILE A 1 212 ? 2.318   82.898  16.025  1.00 50.83  ? 212 ILE A O     1 
ATOM   1709 C CB    . ILE A 1 212 ? 3.997   84.207  13.468  1.00 47.48  ? 212 ILE A CB    1 
ATOM   1710 C CG1   . ILE A 1 212 ? 5.101   85.229  13.239  1.00 47.76  ? 212 ILE A CG1   1 
ATOM   1711 C CG2   . ILE A 1 212 ? 2.661   84.943  13.559  1.00 43.62  ? 212 ILE A CG2   1 
ATOM   1712 C CD1   . ILE A 1 212 ? 4.937   85.925  11.894  1.00 44.35  ? 212 ILE A CD1   1 
ATOM   1713 N N     . LYS A 1 213 ? 2.818   81.489  14.362  1.00 49.08  ? 213 LYS A N     1 
ATOM   1714 C CA    . LYS A 1 213 ? 1.612   80.701  14.593  1.00 48.72  ? 213 LYS A CA    1 
ATOM   1715 C C     . LYS A 1 213 ? 1.631   80.063  15.982  1.00 50.79  ? 213 LYS A C     1 
ATOM   1716 O O     . LYS A 1 213 ? 0.583   79.812  16.570  1.00 57.67  ? 213 LYS A O     1 
ATOM   1717 C CB    . LYS A 1 213 ? 1.466   79.643  13.502  1.00 53.17  ? 213 LYS A CB    1 
ATOM   1718 C CG    . LYS A 1 213 ? 0.212   78.781  13.601  1.00 59.28  ? 213 LYS A CG    1 
ATOM   1719 N N     . LEU A 1 214 ? 2.822   79.806  16.519  1.00 58.00  ? 214 LEU A N     1 
ATOM   1720 C CA    . LEU A 1 214 ? 2.930   79.175  17.839  1.00 58.44  ? 214 LEU A CA    1 
ATOM   1721 C C     . LEU A 1 214 ? 3.081   80.204  18.957  1.00 59.77  ? 214 LEU A C     1 
ATOM   1722 O O     . LEU A 1 214 ? 3.256   79.829  20.116  1.00 63.57  ? 214 LEU A O     1 
ATOM   1723 C CB    . LEU A 1 214 ? 4.108   78.192  17.892  1.00 54.80  ? 214 LEU A CB    1 
ATOM   1724 C CG    . LEU A 1 214 ? 4.053   77.025  16.913  1.00 60.98  ? 214 LEU A CG    1 
ATOM   1725 C CD1   . LEU A 1 214 ? 5.161   76.015  17.176  1.00 57.86  ? 214 LEU A CD1   1 
ATOM   1726 C CD2   . LEU A 1 214 ? 2.693   76.356  16.946  1.00 68.59  ? 214 LEU A CD2   1 
ATOM   1727 N N     . GLY A 1 215 ? 3.026   81.488  18.616  1.00 49.94  ? 215 GLY A N     1 
ATOM   1728 C CA    . GLY A 1 215 ? 3.081   82.531  19.624  1.00 48.68  ? 215 GLY A CA    1 
ATOM   1729 C C     . GLY A 1 215 ? 4.484   82.922  20.053  1.00 58.68  ? 215 GLY A C     1 
ATOM   1730 O O     . GLY A 1 215 ? 4.678   83.613  21.064  1.00 61.14  ? 215 GLY A O     1 
ATOM   1731 N N     . GLY A 1 216 ? 5.482   82.501  19.282  1.00 51.10  ? 216 GLY A N     1 
ATOM   1732 C CA    . GLY A 1 216 ? 6.859   82.837  19.594  1.00 44.99  ? 216 GLY A CA    1 
ATOM   1733 C C     . GLY A 1 216 ? 7.452   81.934  20.663  1.00 52.49  ? 216 GLY A C     1 
ATOM   1734 O O     . GLY A 1 216 ? 6.820   80.954  21.126  1.00 46.39  ? 216 GLY A O     1 
ATOM   1735 N N     . SER A 1 217 ? 8.685   82.252  21.050  1.00 52.88  ? 217 SER A N     1 
ATOM   1736 C CA    . SER A 1 217 ? 9.421   81.442  22.014  1.00 60.64  ? 217 SER A CA    1 
ATOM   1737 C C     . SER A 1 217 ? 9.452   82.092  23.387  1.00 67.53  ? 217 SER A C     1 
ATOM   1738 O O     . SER A 1 217 ? 9.789   83.266  23.521  1.00 66.68  ? 217 SER A O     1 
ATOM   1739 C CB    . SER A 1 217 ? 10.840  81.204  21.519  1.00 58.23  ? 217 SER A CB    1 
ATOM   1740 O OG    . SER A 1 217 ? 10.836  80.300  20.440  1.00 61.41  ? 217 SER A OG    1 
ATOM   1741 N N     . SER A 1 218 ? 9.105   81.324  24.410  1.00 80.72  ? 218 SER A N     1 
ATOM   1742 C CA    . SER A 1 218 ? 9.039   81.861  25.767  1.00 90.09  ? 218 SER A CA    1 
ATOM   1743 C C     . SER A 1 218 ? 9.645   80.889  26.783  1.00 97.93  ? 218 SER A C     1 
ATOM   1744 O O     . SER A 1 218 ? 10.868  80.826  26.954  1.00 99.51  ? 218 SER A O     1 
ATOM   1745 C CB    . SER A 1 218 ? 7.587   82.190  26.132  1.00 94.32  ? 218 SER A CB    1 
ATOM   1746 O OG    . SER A 1 218 ? 7.512   82.824  27.398  1.00 102.14 ? 218 SER A OG    1 
ATOM   1747 N N     . ALA A 1 224 ? 2.351   90.274  31.512  1.00 85.34  ? 224 ALA A N     1 
ATOM   1748 C CA    . ALA A 1 224 ? 3.485   90.288  30.577  1.00 87.24  ? 224 ALA A CA    1 
ATOM   1749 C C     . ALA A 1 224 ? 3.148   89.666  29.212  1.00 82.89  ? 224 ALA A C     1 
ATOM   1750 O O     . ALA A 1 224 ? 3.229   88.447  29.030  1.00 79.84  ? 224 ALA A O     1 
ATOM   1751 C CB    . ALA A 1 224 ? 4.685   89.570  31.199  1.00 92.49  ? 224 ALA A CB    1 
ATOM   1752 N N     . LEU A 1 225 ? 2.794   90.515  28.250  1.00 83.83  ? 225 LEU A N     1 
ATOM   1753 C CA    . LEU A 1 225 ? 2.402   90.071  26.906  1.00 78.91  ? 225 LEU A CA    1 
ATOM   1754 C C     . LEU A 1 225 ? 3.523   89.353  26.149  1.00 80.57  ? 225 LEU A C     1 
ATOM   1755 O O     . LEU A 1 225 ? 4.703   89.710  26.282  1.00 73.35  ? 225 LEU A O     1 
ATOM   1756 C CB    . LEU A 1 225 ? 1.915   91.265  26.096  1.00 69.49  ? 225 LEU A CB    1 
ATOM   1757 C CG    . LEU A 1 225 ? 0.911   92.098  26.887  1.00 72.66  ? 225 LEU A CG    1 
ATOM   1758 C CD1   . LEU A 1 225 ? 0.577   93.377  26.184  1.00 67.57  ? 225 LEU A CD1   1 
ATOM   1759 C CD2   . LEU A 1 225 ? -0.345  91.292  27.145  1.00 78.19  ? 225 LEU A CD2   1 
ATOM   1760 N N     . GLY A 1 226 ? 3.141   88.340  25.365  1.00 87.57  ? 226 GLY A N     1 
ATOM   1761 C CA    . GLY A 1 226 ? 4.080   87.557  24.573  1.00 92.99  ? 226 GLY A CA    1 
ATOM   1762 C C     . GLY A 1 226 ? 4.842   86.488  25.348  1.00 104.62 ? 226 GLY A C     1 
ATOM   1763 O O     . GLY A 1 226 ? 5.925   86.074  24.934  1.00 107.10 ? 226 GLY A O     1 
ATOM   1764 N N     . SER A 1 227 ? 4.284   86.035  26.470  1.00 112.31 ? 227 SER A N     1 
ATOM   1765 C CA    . SER A 1 227 ? 4.969   85.059  27.320  1.00 115.77 ? 227 SER A CA    1 
ATOM   1766 C C     . SER A 1 227 ? 4.328   83.671  27.263  1.00 119.47 ? 227 SER A C     1 
ATOM   1767 O O     . SER A 1 227 ? 4.826   82.726  27.881  1.00 122.79 ? 227 SER A O     1 
ATOM   1768 C CB    . SER A 1 227 ? 5.009   85.548  28.772  1.00 117.05 ? 227 SER A CB    1 
ATOM   1769 O OG    . SER A 1 227 ? 3.705   85.675  29.308  1.00 117.74 ? 227 SER A OG    1 
ATOM   1770 N N     . THR A 1 228 ? 3.228   83.552  26.522  1.00 116.70 ? 228 THR A N     1 
ATOM   1771 C CA    . THR A 1 228 ? 2.524   82.276  26.392  1.00 115.09 ? 228 THR A CA    1 
ATOM   1772 C C     . THR A 1 228 ? 2.832   81.585  25.052  1.00 104.51 ? 228 THR A C     1 
ATOM   1773 O O     . THR A 1 228 ? 1.996   80.850  24.520  1.00 105.25 ? 228 THR A O     1 
ATOM   1774 C CB    . THR A 1 228 ? 0.986   82.461  26.543  1.00 120.97 ? 228 THR A CB    1 
ATOM   1775 O OG1   . THR A 1 228 ? 0.571   83.645  25.851  1.00 117.24 ? 228 THR A OG1   1 
ATOM   1776 C CG2   . THR A 1 228 ? 0.594   82.596  28.013  1.00 124.64 ? 228 THR A CG2   1 
ATOM   1777 N N     . GLY A 1 229 ? 4.033   81.819  24.523  1.00 91.01  ? 229 GLY A N     1 
ATOM   1778 C CA    . GLY A 1 229 ? 4.451   81.233  23.262  1.00 80.06  ? 229 GLY A CA    1 
ATOM   1779 C C     . GLY A 1 229 ? 4.834   79.770  23.405  1.00 77.99  ? 229 GLY A C     1 
ATOM   1780 O O     . GLY A 1 229 ? 5.196   79.337  24.493  1.00 78.94  ? 229 GLY A O     1 
ATOM   1781 N N     . LYS A 1 230 ? 4.765   79.018  22.304  1.00 72.71  ? 230 LYS A N     1 
ATOM   1782 C CA    . LYS A 1 230 ? 5.041   77.582  22.308  1.00 70.30  ? 230 LYS A CA    1 
ATOM   1783 C C     . LYS A 1 230 ? 6.128   77.148  21.309  1.00 69.10  ? 230 LYS A C     1 
ATOM   1784 O O     . LYS A 1 230 ? 6.349   75.951  21.098  1.00 71.66  ? 230 LYS A O     1 
ATOM   1785 C CB    . LYS A 1 230 ? 3.748   76.803  22.021  1.00 70.21  ? 230 LYS A CB    1 
ATOM   1786 C CG    . LYS A 1 230 ? 2.687   76.922  23.097  1.00 69.80  ? 230 LYS A CG    1 
ATOM   1787 N N     . MET A 1 231 ? 6.808   78.109  20.693  1.00 65.28  ? 231 MET A N     1 
ATOM   1788 C CA    . MET A 1 231 ? 7.824   77.782  19.707  1.00 58.45  ? 231 MET A CA    1 
ATOM   1789 C C     . MET A 1 231 ? 9.063   77.188  20.367  1.00 55.45  ? 231 MET A C     1 
ATOM   1790 O O     . MET A 1 231 ? 9.846   76.493  19.718  1.00 53.25  ? 231 MET A O     1 
ATOM   1791 C CB    . MET A 1 231 ? 8.206   79.024  18.887  1.00 53.71  ? 231 MET A CB    1 
ATOM   1792 C CG    . MET A 1 231 ? 9.196   78.744  17.756  1.00 51.38  ? 231 MET A CG    1 
ATOM   1793 S SD    . MET A 1 231 ? 8.490   77.667  16.469  1.00 66.29  ? 231 MET A SD    1 
ATOM   1794 C CE    . MET A 1 231 ? 9.921   77.290  15.458  1.00 49.03  ? 231 MET A CE    1 
ATOM   1795 N N     . GLN A 1 232 ? 9.258   77.461  21.652  1.00 55.80  ? 232 GLN A N     1 
ATOM   1796 C CA    . GLN A 1 232 ? 10.469  76.992  22.321  1.00 60.17  ? 232 GLN A CA    1 
ATOM   1797 C C     . GLN A 1 232 ? 10.532  75.451  22.391  1.00 64.75  ? 232 GLN A C     1 
ATOM   1798 O O     . GLN A 1 232 ? 11.610  74.878  22.576  1.00 61.80  ? 232 GLN A O     1 
ATOM   1799 C CB    . GLN A 1 232 ? 10.589  77.596  23.726  1.00 62.55  ? 232 GLN A CB    1 
ATOM   1800 C CG    . GLN A 1 232 ? 9.527   77.152  24.714  1.00 77.12  ? 232 GLN A CG    1 
ATOM   1801 C CD    . GLN A 1 232 ? 8.213   77.916  24.559  1.00 84.71  ? 232 GLN A CD    1 
ATOM   1802 O OE1   . GLN A 1 232 ? 7.973   78.581  23.544  1.00 83.14  ? 232 GLN A OE1   1 
ATOM   1803 N NE2   . GLN A 1 232 ? 7.358   77.824  25.574  1.00 90.39  ? 232 GLN A NE2   1 
ATOM   1804 N N     . ASN A 1 233 ? 9.393   74.784  22.224  1.00 65.27  ? 233 ASN A N     1 
ATOM   1805 C CA    . ASN A 1 233 ? 9.390   73.326  22.197  1.00 70.35  ? 233 ASN A CA    1 
ATOM   1806 C C     . ASN A 1 233 ? 9.734   72.768  20.823  1.00 67.26  ? 233 ASN A C     1 
ATOM   1807 O O     . ASN A 1 233 ? 10.001  71.579  20.673  1.00 69.84  ? 233 ASN A O     1 
ATOM   1808 C CB    . ASN A 1 233 ? 8.039   72.787  22.653  1.00 78.93  ? 233 ASN A CB    1 
ATOM   1809 C CG    . ASN A 1 233 ? 7.667   73.257  24.047  1.00 84.91  ? 233 ASN A CG    1 
ATOM   1810 O OD1   . ASN A 1 233 ? 6.550   73.714  24.276  1.00 87.87  ? 233 ASN A OD1   1 
ATOM   1811 N ND2   . ASN A 1 233 ? 8.611   73.161  24.984  1.00 86.29  ? 233 ASN A ND2   1 
ATOM   1812 N N     . GLU A 1 234 ? 9.750   73.635  19.822  1.00 61.94  ? 234 GLU A N     1 
ATOM   1813 C CA    . GLU A 1 234 ? 10.044  73.210  18.461  1.00 61.96  ? 234 GLU A CA    1 
ATOM   1814 C C     . GLU A 1 234 ? 11.488  73.496  18.055  1.00 56.70  ? 234 GLU A C     1 
ATOM   1815 O O     . GLU A 1 234 ? 11.905  73.116  16.970  1.00 49.97  ? 234 GLU A O     1 
ATOM   1816 C CB    . GLU A 1 234 ? 9.090   73.894  17.480  1.00 65.52  ? 234 GLU A CB    1 
ATOM   1817 C CG    . GLU A 1 234 ? 7.626   73.633  17.781  1.00 73.70  ? 234 GLU A CG    1 
ATOM   1818 C CD    . GLU A 1 234 ? 7.209   72.193  17.494  1.00 84.80  ? 234 GLU A CD    1 
ATOM   1819 O OE1   . GLU A 1 234 ? 6.576   71.551  18.365  1.00 90.20  ? 234 GLU A OE1   1 
ATOM   1820 O OE2   . GLU A 1 234 ? 7.509   71.702  16.383  1.00 87.71  ? 234 GLU A OE2   1 
ATOM   1821 N N     . LEU A 1 235 ? 12.252  74.164  18.920  1.00 49.98  ? 235 LEU A N     1 
ATOM   1822 C CA    . LEU A 1 235 ? 13.626  74.526  18.561  1.00 48.39  ? 235 LEU A CA    1 
ATOM   1823 C C     . LEU A 1 235 ? 14.495  73.301  18.359  1.00 49.33  ? 235 LEU A C     1 
ATOM   1824 O O     . LEU A 1 235 ? 14.575  72.450  19.236  1.00 51.81  ? 235 LEU A O     1 
ATOM   1825 C CB    . LEU A 1 235 ? 14.246  75.411  19.639  1.00 52.67  ? 235 LEU A CB    1 
ATOM   1826 C CG    . LEU A 1 235 ? 13.525  76.749  19.780  1.00 53.80  ? 235 LEU A CG    1 
ATOM   1827 C CD1   . LEU A 1 235 ? 14.163  77.586  20.846  1.00 45.12  ? 235 LEU A CD1   1 
ATOM   1828 C CD2   . LEU A 1 235 ? 13.481  77.451  18.426  1.00 41.04  ? 235 LEU A CD2   1 
ATOM   1829 N N     . GLN A 1 236 ? 15.167  73.215  17.221  1.00 46.37  ? 236 GLN A N     1 
ATOM   1830 C CA    . GLN A 1 236 ? 16.029  72.059  16.968  1.00 46.70  ? 236 GLN A CA    1 
ATOM   1831 C C     . GLN A 1 236 ? 17.457  72.253  17.478  1.00 46.74  ? 236 GLN A C     1 
ATOM   1832 O O     . GLN A 1 236 ? 18.085  71.307  17.917  1.00 49.06  ? 236 GLN A O     1 
ATOM   1833 C CB    . GLN A 1 236 ? 16.057  71.734  15.477  1.00 49.68  ? 236 GLN A CB    1 
ATOM   1834 C CG    . GLN A 1 236 ? 14.676  71.435  14.899  1.00 57.75  ? 236 GLN A CG    1 
ATOM   1835 C CD    . GLN A 1 236 ? 14.101  70.143  15.434  1.00 69.65  ? 236 GLN A CD    1 
ATOM   1836 O OE1   . GLN A 1 236 ? 14.499  69.053  15.013  1.00 76.37  ? 236 GLN A OE1   1 
ATOM   1837 N NE2   . GLN A 1 236 ? 13.172  70.251  16.376  1.00 74.54  ? 236 GLN A NE2   1 
ATOM   1838 N N     . VAL A 1 237 ? 17.992  73.466  17.426  1.00 46.81  ? 237 VAL A N     1 
ATOM   1839 C CA    . VAL A 1 237 ? 19.407  73.598  17.722  1.00 41.38  ? 237 VAL A CA    1 
ATOM   1840 C C     . VAL A 1 237 ? 19.734  74.623  18.784  1.00 40.41  ? 237 VAL A C     1 
ATOM   1841 O O     . VAL A 1 237 ? 20.615  74.382  19.611  1.00 42.92  ? 237 VAL A O     1 
ATOM   1842 C CB    . VAL A 1 237 ? 20.198  73.939  16.458  1.00 42.31  ? 237 VAL A CB    1 
ATOM   1843 C CG1   . VAL A 1 237 ? 20.385  72.682  15.584  1.00 46.12  ? 237 VAL A CG1   1 
ATOM   1844 C CG2   . VAL A 1 237 ? 19.504  75.049  15.677  1.00 42.10  ? 237 VAL A CG2   1 
ATOM   1845 N N     . TYR A 1 238 ? 19.020  75.750  18.784  1.00 42.66  ? 238 TYR A N     1 
ATOM   1846 C CA    . TYR A 1 238 ? 19.392  76.881  19.636  1.00 40.97  ? 238 TYR A CA    1 
ATOM   1847 C C     . TYR A 1 238 ? 19.304  76.487  21.095  1.00 44.02  ? 238 TYR A C     1 
ATOM   1848 O O     . TYR A 1 238 ? 18.294  75.932  21.526  1.00 41.90  ? 238 TYR A O     1 
ATOM   1849 C CB    . TYR A 1 238 ? 18.508  78.101  19.387  1.00 43.17  ? 238 TYR A CB    1 
ATOM   1850 C CG    . TYR A 1 238 ? 18.868  79.233  20.309  1.00 42.19  ? 238 TYR A CG    1 
ATOM   1851 C CD1   . TYR A 1 238 ? 18.287  79.341  21.567  1.00 42.77  ? 238 TYR A CD1   1 
ATOM   1852 C CD2   . TYR A 1 238 ? 19.814  80.175  19.939  1.00 37.64  ? 238 TYR A CD2   1 
ATOM   1853 C CE1   . TYR A 1 238 ? 18.638  80.358  22.432  1.00 41.88  ? 238 TYR A CE1   1 
ATOM   1854 C CE2   . TYR A 1 238 ? 20.174  81.193  20.796  1.00 38.43  ? 238 TYR A CE2   1 
ATOM   1855 C CZ    . TYR A 1 238 ? 19.572  81.281  22.034  1.00 39.93  ? 238 TYR A CZ    1 
ATOM   1856 O OH    . TYR A 1 238 ? 19.901  82.287  22.871  1.00 42.26  ? 238 TYR A OH    1 
ATOM   1857 N N     . GLY A 1 239 ? 20.372  76.769  21.840  1.00 41.09  ? 239 GLY A N     1 
ATOM   1858 C CA    . GLY A 1 239 ? 20.437  76.453  23.242  1.00 43.33  ? 239 GLY A CA    1 
ATOM   1859 C C     . GLY A 1 239 ? 20.483  74.982  23.573  1.00 44.98  ? 239 GLY A C     1 
ATOM   1860 O O     . GLY A 1 239 ? 20.340  74.623  24.730  1.00 51.25  ? 239 GLY A O     1 
ATOM   1861 N N     . LYS A 1 240 ? 20.687  74.129  22.570  1.00 50.52  ? 240 LYS A N     1 
ATOM   1862 C CA    . LYS A 1 240 ? 20.642  72.679  22.779  1.00 51.22  ? 240 LYS A CA    1 
ATOM   1863 C C     . LYS A 1 240 ? 22.036  72.031  22.640  1.00 48.45  ? 240 LYS A C     1 
ATOM   1864 O O     . LYS A 1 240 ? 22.174  70.906  22.182  1.00 52.94  ? 240 LYS A O     1 
ATOM   1865 C CB    . LYS A 1 240 ? 19.655  72.048  21.794  1.00 55.36  ? 240 LYS A CB    1 
ATOM   1866 C CG    . LYS A 1 240 ? 18.216  72.531  21.947  1.00 61.37  ? 240 LYS A CG    1 
ATOM   1867 C CD    . LYS A 1 240 ? 17.270  71.778  21.013  1.00 74.41  ? 240 LYS A CD    1 
ATOM   1868 C CE    . LYS A 1 240 ? 16.006  71.277  21.733  1.00 87.22  ? 240 LYS A CE    1 
ATOM   1869 N NZ    . LYS A 1 240 ? 15.090  72.403  22.192  1.00 91.09  ? 240 LYS A NZ    1 
ATOM   1870 N N     . THR A 1 241 ? 23.063  72.792  22.988  1.00 45.47  ? 241 THR A N     1 
ATOM   1871 C CA    . THR A 1 241 ? 24.451  72.348  22.996  1.00 51.54  ? 241 THR A CA    1 
ATOM   1872 C C     . THR A 1 241 ? 24.626  71.011  23.670  1.00 50.01  ? 241 THR A C     1 
ATOM   1873 O O     . THR A 1 241 ? 24.261  70.857  24.835  1.00 50.37  ? 241 THR A O     1 
ATOM   1874 C CB    . THR A 1 241 ? 25.329  73.366  23.755  1.00 52.96  ? 241 THR A CB    1 
ATOM   1875 O OG1   . THR A 1 241 ? 25.094  74.666  23.219  1.00 49.80  ? 241 THR A OG1   1 
ATOM   1876 C CG2   . THR A 1 241 ? 26.802  73.001  23.666  1.00 47.01  ? 241 THR A CG2   1 
ATOM   1877 N N     . GLY A 1 242 ? 25.176  70.042  22.953  1.00 51.70  ? 242 GLY A N     1 
ATOM   1878 C CA    . GLY A 1 242 ? 25.472  68.757  23.564  1.00 50.11  ? 242 GLY A CA    1 
ATOM   1879 C C     . GLY A 1 242 ? 24.348  67.771  23.383  1.00 54.74  ? 242 GLY A C     1 
ATOM   1880 O O     . GLY A 1 242 ? 24.521  66.578  23.645  1.00 56.11  ? 242 GLY A O     1 
ATOM   1881 N N     . GLU A 1 243 ? 23.191  68.243  22.932  1.00 55.56  ? 243 GLU A N     1 
ATOM   1882 C CA    . GLU A 1 243 ? 22.090  67.324  22.646  1.00 54.39  ? 243 GLU A CA    1 
ATOM   1883 C C     . GLU A 1 243 ? 22.176  66.812  21.221  1.00 54.06  ? 243 GLU A C     1 
ATOM   1884 O O     . GLU A 1 243 ? 22.995  67.270  20.430  1.00 50.52  ? 243 GLU A O     1 
ATOM   1885 C CB    . GLU A 1 243 ? 20.748  67.990  22.873  1.00 58.22  ? 243 GLU A CB    1 
ATOM   1886 C CG    . GLU A 1 243 ? 20.600  68.575  24.244  1.00 66.04  ? 243 GLU A CG    1 
ATOM   1887 C CD    . GLU A 1 243 ? 19.291  69.305  24.404  1.00 77.07  ? 243 GLU A CD    1 
ATOM   1888 O OE1   . GLU A 1 243 ? 18.476  69.259  23.456  1.00 81.45  ? 243 GLU A OE1   1 
ATOM   1889 O OE2   . GLU A 1 243 ? 19.074  69.931  25.466  1.00 83.12  ? 243 GLU A OE2   1 
ATOM   1890 N N     . LYS A 1 244 ? 21.305  65.868  20.897  1.00 56.96  ? 244 LYS A N     1 
ATOM   1891 C CA    . LYS A 1 244 ? 21.338  65.189  19.618  1.00 54.28  ? 244 LYS A CA    1 
ATOM   1892 C C     . LYS A 1 244 ? 20.611  65.942  18.528  1.00 58.66  ? 244 LYS A C     1 
ATOM   1893 O O     . LYS A 1 244 ? 19.604  66.585  18.790  1.00 61.85  ? 244 LYS A O     1 
ATOM   1894 C CB    . LYS A 1 244 ? 20.728  63.799  19.767  1.00 58.18  ? 244 LYS A CB    1 
ATOM   1895 C CG    . LYS A 1 244 ? 21.438  62.955  20.786  1.00 61.86  ? 244 LYS A CG    1 
ATOM   1896 C CD    . LYS A 1 244 ? 22.854  62.654  20.331  1.00 63.56  ? 244 LYS A CD    1 
ATOM   1897 C CE    . LYS A 1 244 ? 23.609  61.797  21.348  1.00 61.84  ? 244 LYS A CE    1 
ATOM   1898 N NZ    . LYS A 1 244 ? 25.071  61.776  21.056  1.00 58.84  ? 244 LYS A NZ    1 
ATOM   1899 N N     . CYS A 1 245 ? 21.141  65.843  17.307  1.00 64.88  ? 245 CYS A N     1 
ATOM   1900 C CA    . CYS A 1 245 ? 20.524  66.334  16.065  1.00 62.86  ? 245 CYS A CA    1 
ATOM   1901 C C     . CYS A 1 245 ? 19.568  65.302  15.468  1.00 67.56  ? 245 CYS A C     1 
ATOM   1902 O O     . CYS A 1 245 ? 19.009  65.513  14.395  1.00 72.15  ? 245 CYS A O     1 
ATOM   1903 C CB    . CYS A 1 245 ? 21.603  66.643  15.007  1.00 51.36  ? 245 CYS A CB    1 
ATOM   1904 S SG    . CYS A 1 245 ? 23.122  67.421  15.634  1.00 73.63  ? 245 CYS A SG    1 
ATOM   1905 N N     . SER A 1 246 ? 19.424  64.164  16.135  1.00 74.94  ? 246 SER A N     1 
ATOM   1906 C CA    . SER A 1 246 ? 18.752  62.990  15.549  1.00 80.46  ? 246 SER A CA    1 
ATOM   1907 C C     . SER A 1 246 ? 19.421  62.603  14.229  1.00 75.53  ? 246 SER A C     1 
ATOM   1908 O O     . SER A 1 246 ? 18.767  62.169  13.287  1.00 70.30  ? 246 SER A O     1 
ATOM   1909 C CB    . SER A 1 246 ? 17.253  63.239  15.325  1.00 84.80  ? 246 SER A CB    1 
ATOM   1910 O OG    . SER A 1 246 ? 16.599  63.602  16.529  1.00 90.68  ? 246 SER A OG    1 
ATOM   1911 N N     . ARG A 1 247 ? 20.735  62.787  14.173  1.00 74.85  ? 247 ARG A N     1 
ATOM   1912 C CA    . ARG A 1 247 ? 21.525  62.353  13.034  1.00 69.67  ? 247 ARG A CA    1 
ATOM   1913 C C     . ARG A 1 247 ? 22.588  61.373  13.473  1.00 66.35  ? 247 ARG A C     1 
ATOM   1914 O O     . ARG A 1 247 ? 23.767  61.713  13.483  1.00 63.65  ? 247 ARG A O     1 
ATOM   1915 C CB    . ARG A 1 247 ? 22.185  63.544  12.348  1.00 70.08  ? 247 ARG A CB    1 
ATOM   1916 C CG    . ARG A 1 247 ? 21.225  64.438  11.614  1.00 74.36  ? 247 ARG A CG    1 
ATOM   1917 C CD    . ARG A 1 247 ? 20.374  63.631  10.634  1.00 83.09  ? 247 ARG A CD    1 
ATOM   1918 N NE    . ARG A 1 247 ? 19.508  64.501  9.843   1.00 85.24  ? 247 ARG A NE    1 
ATOM   1919 C CZ    . ARG A 1 247 ? 18.407  65.082  10.307  1.00 86.02  ? 247 ARG A CZ    1 
ATOM   1920 N NH1   . ARG A 1 247 ? 18.025  64.897  11.566  1.00 80.49  ? 247 ARG A NH1   1 
ATOM   1921 N NH2   . ARG A 1 247 ? 17.693  65.859  9.506   1.00 92.26  ? 247 ARG A NH2   1 
ATOM   1922 N N     . CYS A 1 248 ? 22.168  60.181  13.879  1.00 66.61  ? 248 CYS A N     1 
ATOM   1923 C CA    . CYS A 1 248 ? 23.097  59.073  14.085  1.00 68.07  ? 248 CYS A CA    1 
ATOM   1924 C C     . CYS A 1 248 ? 24.110  59.333  15.170  1.00 67.19  ? 248 CYS A C     1 
ATOM   1925 O O     . CYS A 1 248 ? 25.246  58.877  15.069  1.00 71.63  ? 248 CYS A O     1 
ATOM   1926 C CB    . CYS A 1 248 ? 23.837  58.727  12.778  1.00 69.50  ? 248 CYS A CB    1 
ATOM   1927 S SG    . CYS A 1 248 ? 22.787  57.868  11.549  1.00 104.51 ? 248 CYS A SG    1 
ATOM   1928 N N     . GLY A 1 249 ? 23.693  60.047  16.210  1.00 49.24  ? 249 GLY A N     1 
ATOM   1929 C CA    . GLY A 1 249 ? 24.539  60.269  17.366  1.00 56.18  ? 249 GLY A CA    1 
ATOM   1930 C C     . GLY A 1 249 ? 25.236  61.620  17.351  1.00 52.28  ? 249 GLY A C     1 
ATOM   1931 O O     . GLY A 1 249 ? 25.973  61.959  18.270  1.00 56.29  ? 249 GLY A O     1 
ATOM   1932 N N     . ALA A 1 250 ? 25.020  62.385  16.296  1.00 45.19  ? 250 ALA A N     1 
ATOM   1933 C CA    . ALA A 1 250 ? 25.644  63.692  16.180  1.00 56.43  ? 250 ALA A CA    1 
ATOM   1934 C C     . ALA A 1 250 ? 25.100  64.619  17.271  1.00 47.42  ? 250 ALA A C     1 
ATOM   1935 O O     . ALA A 1 250 ? 23.955  64.479  17.696  1.00 44.77  ? 250 ALA A O     1 
ATOM   1936 C CB    . ALA A 1 250 ? 25.403  64.281  14.795  1.00 43.36  ? 250 ALA A CB    1 
ATOM   1937 N N     . GLU A 1 251 ? 25.938  65.542  17.727  1.00 43.98  ? 251 GLU A N     1 
ATOM   1938 C CA    . GLU A 1 251 ? 25.555  66.490  18.755  1.00 38.71  ? 251 GLU A CA    1 
ATOM   1939 C C     . GLU A 1 251 ? 25.650  67.924  18.269  1.00 43.46  ? 251 GLU A C     1 
ATOM   1940 O O     . GLU A 1 251 ? 26.446  68.265  17.387  1.00 42.67  ? 251 GLU A O     1 
ATOM   1941 C CB    . GLU A 1 251 ? 26.419  66.312  20.000  1.00 39.44  ? 251 GLU A CB    1 
ATOM   1942 C CG    . GLU A 1 251 ? 26.268  64.967  20.611  1.00 56.93  ? 251 GLU A CG    1 
ATOM   1943 C CD    . GLU A 1 251 ? 26.934  64.875  21.960  1.00 65.07  ? 251 GLU A CD    1 
ATOM   1944 O OE1   . GLU A 1 251 ? 27.590  65.871  22.369  1.00 67.25  ? 251 GLU A OE1   1 
ATOM   1945 O OE2   . GLU A 1 251 ? 26.793  63.813  22.609  1.00 67.51  ? 251 GLU A OE2   1 
ATOM   1946 N N     . ILE A 1 252 ? 24.817  68.768  18.855  1.00 43.99  ? 252 ILE A N     1 
ATOM   1947 C CA    . ILE A 1 252 ? 24.815  70.172  18.534  1.00 39.63  ? 252 ILE A CA    1 
ATOM   1948 C C     . ILE A 1 252 ? 26.049  70.804  19.149  1.00 42.53  ? 252 ILE A C     1 
ATOM   1949 O O     . ILE A 1 252 ? 26.327  70.584  20.321  1.00 42.22  ? 252 ILE A O     1 
ATOM   1950 C CB    . ILE A 1 252 ? 23.526  70.801  19.020  1.00 43.98  ? 252 ILE A CB    1 
ATOM   1951 C CG1   . ILE A 1 252 ? 22.361  70.110  18.277  1.00 46.11  ? 252 ILE A CG1   1 
ATOM   1952 C CG2   . ILE A 1 252 ? 23.563  72.344  18.876  1.00 40.10  ? 252 ILE A CG2   1 
ATOM   1953 C CD1   . ILE A 1 252 ? 21.015  70.233  18.920  1.00 47.93  ? 252 ILE A CD1   1 
ATOM   1954 N N     . GLN A 1 253 ? 26.830  71.505  18.325  1.00 42.13  ? 253 GLN A N     1 
ATOM   1955 C CA    . GLN A 1 253 ? 27.984  72.246  18.812  1.00 46.00  ? 253 GLN A CA    1 
ATOM   1956 C C     . GLN A 1 253 ? 27.633  73.706  19.059  1.00 42.24  ? 253 GLN A C     1 
ATOM   1957 O O     . GLN A 1 253 ? 26.745  74.248  18.415  1.00 42.91  ? 253 GLN A O     1 
ATOM   1958 C CB    . GLN A 1 253 ? 29.143  72.154  17.818  1.00 55.12  ? 253 GLN A CB    1 
ATOM   1959 C CG    . GLN A 1 253 ? 29.976  70.880  17.949  1.00 71.15  ? 253 GLN A CG    1 
ATOM   1960 C CD    . GLN A 1 253 ? 31.289  70.936  17.146  1.00 81.14  ? 253 GLN A CD    1 
ATOM   1961 O OE1   . GLN A 1 253 ? 31.717  72.010  16.689  1.00 85.76  ? 253 GLN A OE1   1 
ATOM   1962 N NE2   . GLN A 1 253 ? 31.929  69.775  16.975  1.00 76.64  ? 253 GLN A NE2   1 
ATOM   1963 N N     . LYS A 1 254 ? 28.337  74.337  19.992  1.00 43.54  ? 254 LYS A N     1 
ATOM   1964 C CA    . LYS A 1 254 ? 28.268  75.785  20.134  1.00 41.41  ? 254 LYS A CA    1 
ATOM   1965 C C     . LYS A 1 254 ? 29.590  76.440  19.786  1.00 36.93  ? 254 LYS A C     1 
ATOM   1966 O O     . LYS A 1 254 ? 30.614  76.079  20.295  1.00 40.77  ? 254 LYS A O     1 
ATOM   1967 C CB    . LYS A 1 254 ? 27.879  76.203  21.549  1.00 41.84  ? 254 LYS A CB    1 
ATOM   1968 C CG    . LYS A 1 254 ? 27.414  77.664  21.606  1.00 37.84  ? 254 LYS A CG    1 
ATOM   1969 C CD    . LYS A 1 254 ? 27.150  78.148  23.019  1.00 36.59  ? 254 LYS A CD    1 
ATOM   1970 C CE    . LYS A 1 254 ? 26.538  79.564  23.004  1.00 38.25  ? 254 LYS A CE    1 
ATOM   1971 N NZ    . LYS A 1 254 ? 26.256  80.115  24.404  1.00 41.95  ? 254 LYS A NZ    1 
ATOM   1972 N N     . ILE A 1 255 ? 29.547  77.435  18.920  1.00 40.66  ? 255 ILE A N     1 
ATOM   1973 C CA    . ILE A 1 255 ? 30.712  78.265  18.655  1.00 39.66  ? 255 ILE A CA    1 
ATOM   1974 C C     . ILE A 1 255 ? 30.317  79.757  18.753  1.00 39.25  ? 255 ILE A C     1 
ATOM   1975 O O     . ILE A 1 255 ? 29.130  80.115  18.926  1.00 35.75  ? 255 ILE A O     1 
ATOM   1976 C CB    . ILE A 1 255 ? 31.315  77.959  17.245  1.00 40.71  ? 255 ILE A CB    1 
ATOM   1977 C CG1   . ILE A 1 255 ? 30.298  78.307  16.161  1.00 34.48  ? 255 ILE A CG1   1 
ATOM   1978 C CG2   . ILE A 1 255 ? 31.717  76.472  17.141  1.00 36.04  ? 255 ILE A CG2   1 
ATOM   1979 C CD1   . ILE A 1 255 ? 30.716  77.916  14.743  1.00 36.06  ? 255 ILE A CD1   1 
ATOM   1980 N N     . LYS A 1 256 ? 31.320  80.611  18.655  1.00 38.94  ? 256 LYS A N     1 
ATOM   1981 C CA    . LYS A 1 256 ? 31.103  82.032  18.527  1.00 43.36  ? 256 LYS A CA    1 
ATOM   1982 C C     . LYS A 1 256 ? 31.281  82.492  17.072  1.00 40.57  ? 256 LYS A C     1 
ATOM   1983 O O     . LYS A 1 256 ? 32.289  82.203  16.435  1.00 38.55  ? 256 LYS A O     1 
ATOM   1984 C CB    . LYS A 1 256 ? 32.059  82.786  19.451  1.00 46.12  ? 256 LYS A CB    1 
ATOM   1985 C CG    . LYS A 1 256 ? 31.511  83.055  20.835  1.00 56.61  ? 256 LYS A CG    1 
ATOM   1986 C CD    . LYS A 1 256 ? 31.905  84.493  21.266  1.00 85.61  ? 256 LYS A CD    1 
ATOM   1987 C CE    . LYS A 1 256 ? 31.096  84.989  22.465  1.00 80.98  ? 256 LYS A CE    1 
ATOM   1988 N NZ    . LYS A 1 256 ? 29.631  84.965  22.178  1.00 77.97  ? 256 LYS A NZ    1 
ATOM   1989 N N     . VAL A 1 257 ? 30.298  83.213  16.543  1.00 40.71  ? 257 VAL A N     1 
ATOM   1990 C CA    . VAL A 1 257 ? 30.415  83.707  15.181  1.00 35.87  ? 257 VAL A CA    1 
ATOM   1991 C C     . VAL A 1 257 ? 30.138  85.187  15.219  1.00 37.49  ? 257 VAL A C     1 
ATOM   1992 O O     . VAL A 1 257 ? 29.032  85.623  15.572  1.00 36.81  ? 257 VAL A O     1 
ATOM   1993 C CB    . VAL A 1 257 ? 29.464  82.959  14.205  1.00 42.76  ? 257 VAL A CB    1 
ATOM   1994 C CG1   . VAL A 1 257 ? 29.428  83.643  12.808  1.00 33.11  ? 257 VAL A CG1   1 
ATOM   1995 C CG2   . VAL A 1 257 ? 29.914  81.482  14.066  1.00 40.99  ? 257 VAL A CG2   1 
ATOM   1996 N N     . ALA A 1 258 ? 31.172  85.963  14.905  1.00 45.18  ? 258 ALA A N     1 
ATOM   1997 C CA    . ALA A 1 258 ? 31.107  87.433  15.006  1.00 48.92  ? 258 ALA A CA    1 
ATOM   1998 C C     . ALA A 1 258 ? 30.528  87.904  16.363  1.00 47.71  ? 258 ALA A C     1 
ATOM   1999 O O     . ALA A 1 258 ? 29.683  88.817  16.423  1.00 46.68  ? 258 ALA A O     1 
ATOM   2000 C CB    . ALA A 1 258 ? 30.303  87.994  13.876  1.00 34.73  ? 258 ALA A CB    1 
ATOM   2001 N N     . GLY A 1 259 ? 30.976  87.249  17.432  1.00 41.69  ? 259 GLY A N     1 
ATOM   2002 C CA    . GLY A 1 259 ? 30.604  87.604  18.782  1.00 37.93  ? 259 GLY A CA    1 
ATOM   2003 C C     . GLY A 1 259 ? 29.318  87.009  19.307  1.00 41.13  ? 259 GLY A C     1 
ATOM   2004 O O     . GLY A 1 259 ? 28.982  87.259  20.459  1.00 47.78  ? 259 GLY A O     1 
ATOM   2005 N N     . ARG A 1 260 ? 28.605  86.237  18.483  1.00 37.83  ? 260 ARG A N     1 
ATOM   2006 C CA    . ARG A 1 260 ? 27.316  85.658  18.873  1.00 38.02  ? 260 ARG A CA    1 
ATOM   2007 C C     . ARG A 1 260 ? 27.393  84.161  19.113  1.00 42.83  ? 260 ARG A C     1 
ATOM   2008 O O     . ARG A 1 260 ? 28.040  83.428  18.346  1.00 44.12  ? 260 ARG A O     1 
ATOM   2009 C CB    . ARG A 1 260 ? 26.256  85.924  17.791  1.00 35.88  ? 260 ARG A CB    1 
ATOM   2010 C CG    . ARG A 1 260 ? 26.076  87.401  17.430  1.00 35.61  ? 260 ARG A CG    1 
ATOM   2011 C CD    . ARG A 1 260 ? 25.686  88.253  18.644  1.00 34.11  ? 260 ARG A CD    1 
ATOM   2012 N NE    . ARG A 1 260 ? 24.416  87.856  19.255  1.00 38.02  ? 260 ARG A NE    1 
ATOM   2013 C CZ    . ARG A 1 260 ? 23.211  88.196  18.787  1.00 39.72  ? 260 ARG A CZ    1 
ATOM   2014 N NH1   . ARG A 1 260 ? 23.138  88.928  17.685  1.00 37.58  ? 260 ARG A NH1   1 
ATOM   2015 N NH2   . ARG A 1 260 ? 22.084  87.796  19.414  1.00 35.91  ? 260 ARG A NH2   1 
ATOM   2016 N N     . GLY A 1 261 ? 26.726  83.701  20.168  1.00 41.48  ? 261 GLY A N     1 
ATOM   2017 C CA    . GLY A 1 261 ? 26.603  82.279  20.417  1.00 34.86  ? 261 GLY A CA    1 
ATOM   2018 C C     . GLY A 1 261 ? 25.905  81.632  19.225  1.00 39.69  ? 261 GLY A C     1 
ATOM   2019 O O     . GLY A 1 261 ? 24.876  82.116  18.721  1.00 40.38  ? 261 GLY A O     1 
ATOM   2020 N N     . THR A 1 262 ? 26.454  80.509  18.786  1.00 37.41  ? 262 THR A N     1 
ATOM   2021 C CA    . THR A 1 262 ? 26.000  79.877  17.570  1.00 35.46  ? 262 THR A CA    1 
ATOM   2022 C C     . THR A 1 262 ? 25.913  78.360  17.734  1.00 34.21  ? 262 THR A C     1 
ATOM   2023 O O     . THR A 1 262 ? 26.912  77.668  17.970  1.00 34.92  ? 262 THR A O     1 
ATOM   2024 C CB    . THR A 1 262 ? 26.942  80.287  16.413  1.00 39.27  ? 262 THR A CB    1 
ATOM   2025 O OG1   . THR A 1 262 ? 26.951  81.722  16.338  1.00 41.63  ? 262 THR A OG1   1 
ATOM   2026 C CG2   . THR A 1 262 ? 26.498  79.672  15.066  1.00 32.89  ? 262 THR A CG2   1 
ATOM   2027 N N     . HIS A 1 263 ? 24.693  77.863  17.612  1.00 33.65  ? 263 HIS A N     1 
ATOM   2028 C CA    . HIS A 1 263 ? 24.378  76.454  17.757  1.00 31.58  ? 263 HIS A CA    1 
ATOM   2029 C C     . HIS A 1 263 ? 24.154  75.819  16.395  1.00 39.34  ? 263 HIS A C     1 
ATOM   2030 O O     . HIS A 1 263 ? 23.281  76.257  15.631  1.00 40.66  ? 263 HIS A O     1 
ATOM   2031 C CB    . HIS A 1 263 ? 23.137  76.294  18.624  1.00 31.71  ? 263 HIS A CB    1 
ATOM   2032 C CG    . HIS A 1 263 ? 23.220  77.047  19.908  1.00 43.64  ? 263 HIS A CG    1 
ATOM   2033 N ND1   . HIS A 1 263 ? 22.982  78.407  19.992  1.00 42.99  ? 263 HIS A ND1   1 
ATOM   2034 C CD2   . HIS A 1 263 ? 23.569  76.642  21.157  1.00 46.56  ? 263 HIS A CD2   1 
ATOM   2035 C CE1   . HIS A 1 263 ? 23.160  78.798  21.239  1.00 44.36  ? 263 HIS A CE1   1 
ATOM   2036 N NE2   . HIS A 1 263 ? 23.515  77.751  21.966  1.00 46.24  ? 263 HIS A NE2   1 
ATOM   2037 N N     . PHE A 1 264 ? 24.912  74.776  16.086  1.00 38.03  ? 264 PHE A N     1 
ATOM   2038 C CA    . PHE A 1 264 ? 24.736  74.129  14.794  1.00 38.26  ? 264 PHE A CA    1 
ATOM   2039 C C     . PHE A 1 264 ? 25.130  72.675  14.858  1.00 43.09  ? 264 PHE A C     1 
ATOM   2040 O O     . PHE A 1 264 ? 25.843  72.278  15.775  1.00 44.05  ? 264 PHE A O     1 
ATOM   2041 C CB    . PHE A 1 264 ? 25.551  74.842  13.714  1.00 35.40  ? 264 PHE A CB    1 
ATOM   2042 C CG    . PHE A 1 264 ? 27.042  74.632  13.823  1.00 39.13  ? 264 PHE A CG    1 
ATOM   2043 C CD1   . PHE A 1 264 ? 27.733  75.011  14.965  1.00 43.09  ? 264 PHE A CD1   1 
ATOM   2044 C CD2   . PHE A 1 264 ? 27.753  74.063  12.783  1.00 43.82  ? 264 PHE A CD2   1 
ATOM   2045 C CE1   . PHE A 1 264 ? 29.099  74.815  15.064  1.00 45.20  ? 264 PHE A CE1   1 
ATOM   2046 C CE2   . PHE A 1 264 ? 29.129  73.868  12.882  1.00 43.37  ? 264 PHE A CE2   1 
ATOM   2047 C CZ    . PHE A 1 264 ? 29.794  74.240  14.021  1.00 39.01  ? 264 PHE A CZ    1 
ATOM   2048 N N     . CYS A 1 265 ? 24.646  71.903  13.880  1.00 46.40  ? 265 CYS A N     1 
ATOM   2049 C CA    . CYS A 1 265 ? 25.057  70.522  13.656  1.00 47.27  ? 265 CYS A CA    1 
ATOM   2050 C C     . CYS A 1 265 ? 26.080  70.400  12.534  1.00 47.68  ? 265 CYS A C     1 
ATOM   2051 O O     . CYS A 1 265 ? 25.702  70.338  11.370  1.00 50.72  ? 265 CYS A O     1 
ATOM   2052 C CB    . CYS A 1 265 ? 23.853  69.639  13.307  1.00 53.58  ? 265 CYS A CB    1 
ATOM   2053 S SG    . CYS A 1 265 ? 22.836  69.193  14.698  1.00 148.40 ? 265 CYS A SG    1 
ATOM   2054 N N     . PRO A 1 266 ? 27.373  70.325  12.887  1.00 50.55  ? 266 PRO A N     1 
ATOM   2055 C CA    . PRO A 1 266 ? 28.516  70.234  11.971  1.00 52.27  ? 266 PRO A CA    1 
ATOM   2056 C C     . PRO A 1 266 ? 28.378  69.108  10.948  1.00 53.78  ? 266 PRO A C     1 
ATOM   2057 O O     . PRO A 1 266 ? 28.844  69.245  9.817   1.00 64.47  ? 266 PRO A O     1 
ATOM   2058 C CB    . PRO A 1 266 ? 29.704  69.941  12.899  1.00 55.83  ? 266 PRO A CB    1 
ATOM   2059 C CG    . PRO A 1 266 ? 29.251  70.234  14.249  1.00 55.89  ? 266 PRO A CG    1 
ATOM   2060 C CD    . PRO A 1 266 ? 27.772  70.161  14.294  1.00 54.48  ? 266 PRO A CD    1 
ATOM   2061 N N     . VAL A 1 267 ? 27.765  68.003  11.343  1.00 46.78  ? 267 VAL A N     1 
ATOM   2062 C CA    . VAL A 1 267 ? 27.562  66.899  10.417  1.00 53.03  ? 267 VAL A CA    1 
ATOM   2063 C C     . VAL A 1 267 ? 26.681  67.331  9.231   1.00 58.41  ? 267 VAL A C     1 
ATOM   2064 O O     . VAL A 1 267 ? 26.980  67.027  8.095   1.00 63.95  ? 267 VAL A O     1 
ATOM   2065 C CB    . VAL A 1 267 ? 26.940  65.688  11.131  1.00 52.69  ? 267 VAL A CB    1 
ATOM   2066 C CG1   . VAL A 1 267 ? 25.632  66.055  11.793  1.00 49.47  ? 267 VAL A CG1   1 
ATOM   2067 C CG2   . VAL A 1 267 ? 26.742  64.560  10.170  1.00 59.47  ? 267 VAL A CG2   1 
ATOM   2068 N N     . CYS A 1 268 ? 25.633  68.096  9.513   1.00 58.61  ? 268 CYS A N     1 
ATOM   2069 C CA    . CYS A 1 268 ? 24.667  68.530  8.526   1.00 61.63  ? 268 CYS A CA    1 
ATOM   2070 C C     . CYS A 1 268 ? 25.037  69.875  7.909   1.00 59.46  ? 268 CYS A C     1 
ATOM   2071 O O     . CYS A 1 268 ? 24.540  70.222  6.849   1.00 60.68  ? 268 CYS A O     1 
ATOM   2072 C CB    . CYS A 1 268 ? 23.272  68.643  9.163   1.00 64.52  ? 268 CYS A CB    1 
ATOM   2073 S SG    . CYS A 1 268 ? 22.454  67.073  9.501   1.00 108.85 ? 268 CYS A SG    1 
ATOM   2074 N N     . GLN A 1 269 ? 25.883  70.647  8.579   1.00 52.59  ? 269 GLN A N     1 
ATOM   2075 C CA    . GLN A 1 269 ? 26.103  72.023  8.146   1.00 52.30  ? 269 GLN A CA    1 
ATOM   2076 C C     . GLN A 1 269 ? 27.586  72.222  7.879   1.00 56.82  ? 269 GLN A C     1 
ATOM   2077 O O     . GLN A 1 269 ? 28.305  72.843  8.648   1.00 64.72  ? 269 GLN A O     1 
ATOM   2078 C CB    . GLN A 1 269 ? 25.574  73.031  9.195   1.00 46.01  ? 269 GLN A CB    1 
ATOM   2079 C CG    . GLN A 1 269 ? 24.067  72.952  9.485   1.00 41.70  ? 269 GLN A CG    1 
ATOM   2080 C CD    . GLN A 1 269 ? 23.648  73.725  10.746  1.00 43.64  ? 269 GLN A CD    1 
ATOM   2081 O OE1   . GLN A 1 269 ? 23.411  73.127  11.808  1.00 43.45  ? 269 GLN A OE1   1 
ATOM   2082 N NE2   . GLN A 1 269 ? 23.564  75.056  10.634  1.00 39.54  ? 269 GLN A NE2   1 
ATOM   2083 N N     . GLN A 1 270 ? 28.050  71.651  6.786   1.00 58.06  ? 270 GLN A N     1 
ATOM   2084 C CA    . GLN A 1 270 ? 29.415  71.835  6.349   1.00 55.62  ? 270 GLN A CA    1 
ATOM   2085 C C     . GLN A 1 270 ? 29.434  72.904  5.299   1.00 60.67  ? 270 GLN A C     1 
ATOM   2086 O O     . GLN A 1 270 ? 28.443  73.100  4.605   1.00 59.86  ? 270 GLN A O     1 
ATOM   2087 C CB    . GLN A 1 270 ? 29.978  70.529  5.793   1.00 56.08  ? 270 GLN A CB    1 
ATOM   2088 C CG    . GLN A 1 270 ? 30.389  69.542  6.881   1.00 59.71  ? 270 GLN A CG    1 
ATOM   2089 C CD    . GLN A 1 270 ? 31.627  70.001  7.601   1.00 50.99  ? 270 GLN A CD    1 
ATOM   2090 O OE1   . GLN A 1 270 ? 32.721  69.886  7.079   1.00 64.11  ? 270 GLN A OE1   1 
ATOM   2091 N NE2   . GLN A 1 270 ? 31.462  70.547  8.790   1.00 50.73  ? 270 GLN A NE2   1 
ATOM   2092 N N     . LYS A 1 271 ? 30.557  73.593  5.168   1.00 67.50  ? 271 LYS A N     1 
ATOM   2093 C CA    . LYS A 1 271 ? 30.705  74.550  4.070   1.00 77.56  ? 271 LYS A CA    1 
ATOM   2094 C C     . LYS A 1 271 ? 30.753  73.862  2.692   1.00 85.02  ? 271 LYS A C     1 
ATOM   2095 O O     . LYS A 1 271 ? 30.581  74.524  1.665   1.00 87.25  ? 271 LYS A O     1 
ATOM   2096 C CB    . LYS A 1 271 ? 31.954  75.413  4.279   1.00 75.99  ? 271 LYS A CB    1 
ATOM   2097 C CG    . LYS A 1 271 ? 31.918  76.178  5.586   1.00 66.90  ? 271 LYS A CG    1 
ATOM   2098 C CD    . LYS A 1 271 ? 33.139  77.028  5.791   1.00 63.52  ? 271 LYS A CD    1 
ATOM   2099 C CE    . LYS A 1 271 ? 33.213  77.438  7.235   1.00 61.35  ? 271 LYS A CE    1 
ATOM   2100 N NZ    . LYS A 1 271 ? 34.546  77.973  7.566   1.00 68.19  ? 271 LYS A NZ    1 
ATOM   2101 O OXT   . LYS A 1 271 ? 30.943  72.644  2.561   1.00 87.68  ? 271 LYS A OXT   1 
ATOM   2102 O "O5'" . DC  B 2 1   ? 35.685  91.391  45.685  1.00 110.18 ? 1   DC  B "O5'" 1 
ATOM   2103 C "C5'" . DC  B 2 1   ? 35.855  91.275  44.272  1.00 105.91 ? 1   DC  B "C5'" 1 
ATOM   2104 C "C4'" . DC  B 2 1   ? 37.144  90.535  43.938  1.00 107.53 ? 1   DC  B "C4'" 1 
ATOM   2105 O "O4'" . DC  B 2 1   ? 37.155  89.241  44.603  1.00 105.89 ? 1   DC  B "O4'" 1 
ATOM   2106 C "C3'" . DC  B 2 1   ? 37.334  90.245  42.454  1.00 104.53 ? 1   DC  B "C3'" 1 
ATOM   2107 O "O3'" . DC  B 2 1   ? 38.149  91.256  41.871  1.00 108.85 ? 1   DC  B "O3'" 1 
ATOM   2108 C "C2'" . DC  B 2 1   ? 38.041  88.894  42.452  1.00 102.48 ? 1   DC  B "C2'" 1 
ATOM   2109 C "C1'" . DC  B 2 1   ? 37.429  88.217  43.668  1.00 101.44 ? 1   DC  B "C1'" 1 
ATOM   2110 N N1    . DC  B 2 1   ? 36.150  87.442  43.383  1.00 90.84  ? 1   DC  B N1    1 
ATOM   2111 C C2    . DC  B 2 1   ? 36.195  86.293  42.581  1.00 87.43  ? 1   DC  B C2    1 
ATOM   2112 O O2    . DC  B 2 1   ? 37.271  85.930  42.082  1.00 87.18  ? 1   DC  B O2    1 
ATOM   2113 N N3    . DC  B 2 1   ? 35.048  85.610  42.361  1.00 86.08  ? 1   DC  B N3    1 
ATOM   2114 C C4    . DC  B 2 1   ? 33.900  86.012  42.909  1.00 77.87  ? 1   DC  B C4    1 
ATOM   2115 N N4    . DC  B 2 1   ? 32.803  85.289  42.647  1.00 74.00  ? 1   DC  B N4    1 
ATOM   2116 C C5    . DC  B 2 1   ? 33.827  87.168  43.731  1.00 73.86  ? 1   DC  B C5    1 
ATOM   2117 C C6    . DC  B 2 1   ? 34.963  87.847  43.940  1.00 83.20  ? 1   DC  B C6    1 
ATOM   2118 P P     . DT  B 2 2   ? 37.709  91.963  40.497  1.00 108.44 ? 2   DT  B P     1 
ATOM   2119 O OP1   . DT  B 2 2   ? 38.720  93.010  40.235  1.00 111.70 ? 2   DT  B OP1   1 
ATOM   2120 O OP2   . DT  B 2 2   ? 36.270  92.303  40.602  1.00 102.65 ? 2   DT  B OP2   1 
ATOM   2121 O "O5'" . DT  B 2 2   ? 37.894  90.816  39.391  1.00 90.60  ? 2   DT  B "O5'" 1 
ATOM   2122 C "C5'" . DT  B 2 2   ? 39.145  90.103  39.314  1.00 94.03  ? 2   DT  B "C5'" 1 
ATOM   2123 C "C4'" . DT  B 2 2   ? 39.082  89.014  38.258  1.00 89.18  ? 2   DT  B "C4'" 1 
ATOM   2124 O "O4'" . DT  B 2 2   ? 38.191  87.956  38.703  1.00 84.44  ? 2   DT  B "O4'" 1 
ATOM   2125 C "C3'" . DT  B 2 2   ? 38.570  89.493  36.904  1.00 84.70  ? 2   DT  B "C3'" 1 
ATOM   2126 O "O3'" . DT  B 2 2   ? 39.421  89.071  35.869  1.00 85.80  ? 2   DT  B "O3'" 1 
ATOM   2127 C "C2'" . DT  B 2 2   ? 37.188  88.877  36.777  1.00 79.99  ? 2   DT  B "C2'" 1 
ATOM   2128 C "C1'" . DT  B 2 2   ? 37.233  87.675  37.717  1.00 80.61  ? 2   DT  B "C1'" 1 
ATOM   2129 N N1    . DT  B 2 2   ? 35.915  87.439  38.379  1.00 76.05  ? 2   DT  B N1    1 
ATOM   2130 C C2    . DT  B 2 2   ? 35.188  86.309  38.058  1.00 72.87  ? 2   DT  B C2    1 
ATOM   2131 O O2    . DT  B 2 2   ? 35.579  85.451  37.270  1.00 73.28  ? 2   DT  B O2    1 
ATOM   2132 N N3    . DT  B 2 2   ? 33.980  86.211  38.696  1.00 68.82  ? 2   DT  B N3    1 
ATOM   2133 C C4    . DT  B 2 2   ? 33.425  87.113  39.586  1.00 72.20  ? 2   DT  B C4    1 
ATOM   2134 O O4    . DT  B 2 2   ? 32.322  86.929  40.105  1.00 72.79  ? 2   DT  B O4    1 
ATOM   2135 C C5    . DT  B 2 2   ? 34.229  88.286  39.867  1.00 75.36  ? 2   DT  B C5    1 
ATOM   2136 C C7    . DT  B 2 2   ? 33.728  89.338  40.817  1.00 67.34  ? 2   DT  B C7    1 
ATOM   2137 C C6    . DT  B 2 2   ? 35.417  88.395  39.248  1.00 75.50  ? 2   DT  B C6    1 
ATOM   2138 P P     . DC  B 2 3   ? 39.392  89.845  34.463  1.00 100.54 ? 3   DC  B P     1 
ATOM   2139 O OP1   . DC  B 2 3   ? 40.767  89.765  33.913  1.00 103.64 ? 3   DC  B OP1   1 
ATOM   2140 O OP2   . DC  B 2 3   ? 38.689  91.132  34.635  1.00 98.06  ? 3   DC  B OP2   1 
ATOM   2141 O "O5'" . DC  B 2 3   ? 38.430  88.961  33.580  1.00 88.25  ? 3   DC  B "O5'" 1 
ATOM   2142 C "C5'" . DC  B 2 3   ? 38.714  87.600  33.435  1.00 90.47  ? 3   DC  B "C5'" 1 
ATOM   2143 C "C4'" . DC  B 2 3   ? 37.476  86.863  33.006  1.00 84.64  ? 3   DC  B "C4'" 1 
ATOM   2144 O "O4'" . DC  B 2 3   ? 36.507  86.895  34.063  1.00 81.97  ? 3   DC  B "O4'" 1 
ATOM   2145 C "C3'" . DC  B 2 3   ? 36.782  87.451  31.785  1.00 79.74  ? 3   DC  B "C3'" 1 
ATOM   2146 O "O3'" . DC  B 2 3   ? 36.907  86.536  30.741  1.00 86.54  ? 3   DC  B "O3'" 1 
ATOM   2147 C "C2'" . DC  B 2 3   ? 35.317  87.621  32.221  1.00 74.51  ? 3   DC  B "C2'" 1 
ATOM   2148 C "C1'" . DC  B 2 3   ? 35.252  86.775  33.489  1.00 74.19  ? 3   DC  B "C1'" 1 
ATOM   2149 N N1    . DC  B 2 3   ? 34.281  87.247  34.475  1.00 67.06  ? 3   DC  B N1    1 
ATOM   2150 C C2    . DC  B 2 3   ? 33.196  86.444  34.798  1.00 63.76  ? 3   DC  B C2    1 
ATOM   2151 O O2    . DC  B 2 3   ? 33.079  85.346  34.228  1.00 63.61  ? 3   DC  B O2    1 
ATOM   2152 N N3    . DC  B 2 3   ? 32.302  86.890  35.728  1.00 55.94  ? 3   DC  B N3    1 
ATOM   2153 C C4    . DC  B 2 3   ? 32.475  88.082  36.303  1.00 57.73  ? 3   DC  B C4    1 
ATOM   2154 N N4    . DC  B 2 3   ? 31.574  88.488  37.210  1.00 55.42  ? 3   DC  B N4    1 
ATOM   2155 C C5    . DC  B 2 3   ? 33.591  88.908  35.986  1.00 65.08  ? 3   DC  B C5    1 
ATOM   2156 C C6    . DC  B 2 3   ? 34.457  88.453  35.071  1.00 67.95  ? 3   DC  B C6    1 
ATOM   2157 P P     . DT  B 2 4   ? 36.473  86.921  29.248  1.00 95.80  ? 4   DT  B P     1 
ATOM   2158 O OP1   . DT  B 2 4   ? 37.523  86.295  28.407  1.00 97.84  ? 4   DT  B OP1   1 
ATOM   2159 O OP2   . DT  B 2 4   ? 36.129  88.369  29.149  1.00 90.19  ? 4   DT  B OP2   1 
ATOM   2160 O "O5'" . DT  B 2 4   ? 35.109  86.114  29.051  1.00 77.40  ? 4   DT  B "O5'" 1 
ATOM   2161 C "C5'" . DT  B 2 4   ? 34.989  84.784  29.544  1.00 73.42  ? 4   DT  B "C5'" 1 
ATOM   2162 C "C4'" . DT  B 2 4   ? 33.536  84.363  29.524  1.00 64.81  ? 4   DT  B "C4'" 1 
ATOM   2163 O "O4'" . DT  B 2 4   ? 32.886  84.871  30.703  1.00 61.43  ? 4   DT  B "O4'" 1 
ATOM   2164 C "C3'" . DT  B 2 4   ? 32.754  84.909  28.335  1.00 62.17  ? 4   DT  B "C3'" 1 
ATOM   2165 O "O3'" . DT  B 2 4   ? 32.340  83.837  27.484  1.00 66.80  ? 4   DT  B "O3'" 1 
ATOM   2166 C "C2'" . DT  B 2 4   ? 31.562  85.643  28.951  1.00 58.21  ? 4   DT  B "C2'" 1 
ATOM   2167 C "C1'" . DT  B 2 4   ? 31.562  85.176  30.399  1.00 56.66  ? 4   DT  B "C1'" 1 
ATOM   2168 N N1    . DT  B 2 4   ? 31.127  86.239  31.317  1.00 57.40  ? 4   DT  B N1    1 
ATOM   2169 C C2    . DT  B 2 4   ? 29.966  86.078  32.027  1.00 53.15  ? 4   DT  B C2    1 
ATOM   2170 O O2    . DT  B 2 4   ? 29.285  85.095  31.940  1.00 51.07  ? 4   DT  B O2    1 
ATOM   2171 N N3    . DT  B 2 4   ? 29.636  87.125  32.846  1.00 50.43  ? 4   DT  B N3    1 
ATOM   2172 C C4    . DT  B 2 4   ? 30.329  88.304  32.992  1.00 52.30  ? 4   DT  B C4    1 
ATOM   2173 O O4    . DT  B 2 4   ? 29.953  89.189  33.742  1.00 59.48  ? 4   DT  B O4    1 
ATOM   2174 C C5    . DT  B 2 4   ? 31.542  88.419  32.209  1.00 53.01  ? 4   DT  B C5    1 
ATOM   2175 C C7    . DT  B 2 4   ? 32.382  89.649  32.309  1.00 52.66  ? 4   DT  B C7    1 
ATOM   2176 C C6    . DT  B 2 4   ? 31.882  87.394  31.420  1.00 57.11  ? 4   DT  B C6    1 
ATOM   2177 P P     . DT  B 2 5   ? 31.457  84.122  26.171  1.00 77.43  ? 5   DT  B P     1 
ATOM   2178 O OP1   . DT  B 2 5   ? 31.703  82.949  25.302  1.00 72.77  ? 5   DT  B OP1   1 
ATOM   2179 O OP2   . DT  B 2 5   ? 31.713  85.476  25.629  1.00 73.36  ? 5   DT  B OP2   1 
ATOM   2180 O "O5'" . DT  B 2 5   ? 29.958  84.147  26.754  1.00 58.86  ? 5   DT  B "O5'" 1 
ATOM   2181 C "C5'" . DT  B 2 5   ? 29.327  82.935  27.110  1.00 53.05  ? 5   DT  B "C5'" 1 
ATOM   2182 C "C4'" . DT  B 2 5   ? 27.904  83.189  27.547  1.00 53.25  ? 5   DT  B "C4'" 1 
ATOM   2183 O "O4'" . DT  B 2 5   ? 27.923  83.902  28.787  1.00 57.86  ? 5   DT  B "O4'" 1 
ATOM   2184 C "C3'" . DT  B 2 5   ? 27.075  84.043  26.596  1.00 51.70  ? 5   DT  B "C3'" 1 
ATOM   2185 O "O3'" . DT  B 2 5   ? 26.422  83.193  25.684  1.00 48.13  ? 5   DT  B "O3'" 1 
ATOM   2186 C "C2'" . DT  B 2 5   ? 26.074  84.719  27.532  1.00 52.97  ? 5   DT  B "C2'" 1 
ATOM   2187 C "C1'" . DT  B 2 5   ? 26.782  84.706  28.896  1.00 54.55  ? 5   DT  B "C1'" 1 
ATOM   2188 N N1    . DT  B 2 5   ? 27.215  86.043  29.404  1.00 51.57  ? 5   DT  B N1    1 
ATOM   2189 C C2    . DT  B 2 5   ? 26.580  86.549  30.510  1.00 49.20  ? 5   DT  B C2    1 
ATOM   2190 O O2    . DT  B 2 5   ? 25.672  85.960  31.061  1.00 50.94  ? 5   DT  B O2    1 
ATOM   2191 N N3    . DT  B 2 5   ? 27.028  87.780  30.933  1.00 41.60  ? 5   DT  B N3    1 
ATOM   2192 C C4    . DT  B 2 5   ? 28.042  88.523  30.374  1.00 44.69  ? 5   DT  B C4    1 
ATOM   2193 O O4    . DT  B 2 5   ? 28.381  89.614  30.824  1.00 47.01  ? 5   DT  B O4    1 
ATOM   2194 C C5    . DT  B 2 5   ? 28.680  87.932  29.207  1.00 42.81  ? 5   DT  B C5    1 
ATOM   2195 C C7    . DT  B 2 5   ? 29.792  88.660  28.521  1.00 41.48  ? 5   DT  B C7    1 
ATOM   2196 C C6    . DT  B 2 5   ? 28.236  86.736  28.774  1.00 44.29  ? 5   DT  B C6    1 
ATOM   2197 P P     . DT  B 2 6   ? 25.832  83.723  24.301  1.00 44.95  ? 6   DT  B P     1 
ATOM   2198 O OP1   . DT  B 2 6   ? 25.528  82.524  23.509  1.00 48.79  ? 6   DT  B OP1   1 
ATOM   2199 O OP2   . DT  B 2 6   ? 26.680  84.783  23.734  1.00 55.45  ? 6   DT  B OP2   1 
ATOM   2200 O "O5'" . DT  B 2 6   ? 24.477  84.462  24.694  1.00 37.98  ? 6   DT  B "O5'" 1 
ATOM   2201 C "C5'" . DT  B 2 6   ? 23.433  83.759  25.302  1.00 33.12  ? 6   DT  B "C5'" 1 
ATOM   2202 C "C4'" . DT  B 2 6   ? 22.410  84.732  25.789  1.00 31.97  ? 6   DT  B "C4'" 1 
ATOM   2203 O "O4'" . DT  B 2 6   ? 22.934  85.363  26.954  1.00 34.35  ? 6   DT  B "O4'" 1 
ATOM   2204 C "C3'" . DT  B 2 6   ? 22.138  85.894  24.840  1.00 40.80  ? 6   DT  B "C3'" 1 
ATOM   2205 O "O3'" . DT  B 2 6   ? 21.129  85.515  23.925  1.00 40.93  ? 6   DT  B "O3'" 1 
ATOM   2206 C "C2'" . DT  B 2 6   ? 21.635  86.982  25.799  1.00 30.72  ? 6   DT  B "C2'" 1 
ATOM   2207 C "C1'" . DT  B 2 6   ? 22.348  86.626  27.131  1.00 36.99  ? 6   DT  B "C1'" 1 
ATOM   2208 N N1    . DT  B 2 6   ? 23.442  87.584  27.502  1.00 40.26  ? 6   DT  B N1    1 
ATOM   2209 C C2    . DT  B 2 6   ? 23.305  88.373  28.615  1.00 41.82  ? 6   DT  B C2    1 
ATOM   2210 O O2    . DT  B 2 6   ? 22.355  88.319  29.360  1.00 46.36  ? 6   DT  B O2    1 
ATOM   2211 N N3    . DT  B 2 6   ? 24.334  89.217  28.850  1.00 42.36  ? 6   DT  B N3    1 
ATOM   2212 C C4    . DT  B 2 6   ? 25.469  89.382  28.107  1.00 43.55  ? 6   DT  B C4    1 
ATOM   2213 O O4    . DT  B 2 6   ? 26.333  90.187  28.430  1.00 43.41  ? 6   DT  B O4    1 
ATOM   2214 C C5    . DT  B 2 6   ? 25.568  88.533  26.934  1.00 45.39  ? 6   DT  B C5    1 
ATOM   2215 C C7    . DT  B 2 6   ? 26.756  88.624  26.014  1.00 35.32  ? 6   DT  B C7    1 
ATOM   2216 C C6    . DT  B 2 6   ? 24.557  87.679  26.692  1.00 42.19  ? 6   DT  B C6    1 
HETATM 2217 O "O5'" . 3DR B 2 7   ? 20.094  86.371  21.840  1.00 51.79  ? 7   3DR B "O5'" 1 
HETATM 2218 P P     . 3DR B 2 7   ? 21.352  85.605  22.357  1.00 44.50  ? 7   3DR B P     1 
HETATM 2219 O OP1   . 3DR B 2 7   ? 21.422  84.211  21.842  1.00 41.24  ? 7   3DR B OP1   1 
HETATM 2220 O OP2   . 3DR B 2 7   ? 22.603  86.379  21.996  1.00 47.62  ? 7   3DR B OP2   1 
HETATM 2221 C "C2'" . 3DR B 2 7   ? 16.994  88.258  21.925  1.00 47.65  ? 7   3DR B "C2'" 1 
HETATM 2222 C "C5'" . 3DR B 2 7   ? 18.828  85.853  21.952  1.00 46.12  ? 7   3DR B "C5'" 1 
HETATM 2223 C "C4'" . 3DR B 2 7   ? 17.843  86.373  20.966  1.00 44.50  ? 7   3DR B "C4'" 1 
HETATM 2224 O "O4'" . 3DR B 2 7   ? 16.558  86.031  21.362  1.00 48.56  ? 7   3DR B "O4'" 1 
HETATM 2225 C "C1'" . 3DR B 2 7   ? 15.994  87.155  21.985  1.00 49.65  ? 7   3DR B "C1'" 1 
HETATM 2226 C "C3'" . 3DR B 2 7   ? 17.859  87.865  20.907  1.00 42.64  ? 7   3DR B "C3'" 1 
HETATM 2227 O "O3'" . 3DR B 2 7   ? 17.266  88.253  19.719  1.00 37.55  ? 7   3DR B "O3'" 1 
ATOM   2228 P P     . DT  B 2 8   ? 18.112  89.074  18.643  1.00 34.82  ? 8   DT  B P     1 
ATOM   2229 O OP1   . DT  B 2 8   ? 17.200  89.468  17.526  1.00 35.26  ? 8   DT  B OP1   1 
ATOM   2230 O OP2   . DT  B 2 8   ? 19.359  88.330  18.364  1.00 37.46  ? 8   DT  B OP2   1 
ATOM   2231 O "O5'" . DT  B 2 8   ? 18.471  90.420  19.431  1.00 31.71  ? 8   DT  B "O5'" 1 
ATOM   2232 C "C5'" . DT  B 2 8   ? 17.431  91.260  19.836  1.00 29.32  ? 8   DT  B "C5'" 1 
ATOM   2233 C "C4'" . DT  B 2 8   ? 17.611  92.648  19.291  1.00 30.32  ? 8   DT  B "C4'" 1 
ATOM   2234 O "O4'" . DT  B 2 8   ? 18.494  93.419  20.152  1.00 32.14  ? 8   DT  B "O4'" 1 
ATOM   2235 C "C3'" . DT  B 2 8   ? 18.155  92.768  17.871  1.00 31.78  ? 8   DT  B "C3'" 1 
ATOM   2236 O "O3'" . DT  B 2 8   ? 17.408  93.828  17.191  1.00 41.81  ? 8   DT  B "O3'" 1 
ATOM   2237 C "C2'" . DT  B 2 8   ? 19.623  93.150  18.068  1.00 32.13  ? 8   DT  B "C2'" 1 
ATOM   2238 C "C1'" . DT  B 2 8   ? 19.602  93.909  19.412  1.00 37.98  ? 8   DT  B "C1'" 1 
ATOM   2239 N N1    . DT  B 2 8   ? 20.795  93.663  20.261  1.00 40.01  ? 8   DT  B N1    1 
ATOM   2240 C C2    . DT  B 2 8   ? 21.317  94.704  21.018  1.00 37.97  ? 8   DT  B C2    1 
ATOM   2241 O O2    . DT  B 2 8   ? 20.874  95.837  21.005  1.00 37.03  ? 8   DT  B O2    1 
ATOM   2242 N N3    . DT  B 2 8   ? 22.385  94.368  21.785  1.00 31.95  ? 8   DT  B N3    1 
ATOM   2243 C C4    . DT  B 2 8   ? 22.984  93.128  21.889  1.00 38.34  ? 8   DT  B C4    1 
ATOM   2244 O O4    . DT  B 2 8   ? 23.941  92.923  22.620  1.00 39.42  ? 8   DT  B O4    1 
ATOM   2245 C C5    . DT  B 2 8   ? 22.409  92.080  21.081  1.00 39.34  ? 8   DT  B C5    1 
ATOM   2246 C C7    . DT  B 2 8   ? 23.005  90.701  21.135  1.00 30.74  ? 8   DT  B C7    1 
ATOM   2247 C C6    . DT  B 2 8   ? 21.331  92.384  20.320  1.00 35.86  ? 8   DT  B C6    1 
ATOM   2248 P P     . DT  B 2 9   ? 17.637  94.173  15.640  1.00 38.89  ? 9   DT  B P     1 
ATOM   2249 O OP1   . DT  B 2 9   ? 16.335  94.676  15.119  1.00 35.10  ? 9   DT  B OP1   1 
ATOM   2250 O OP2   . DT  B 2 9   ? 18.354  93.041  15.030  1.00 41.96  ? 9   DT  B OP2   1 
ATOM   2251 O "O5'" . DT  B 2 9   ? 18.581  95.447  15.705  1.00 36.21  ? 9   DT  B "O5'" 1 
ATOM   2252 C "C5'" . DT  B 2 9   ? 18.105  96.581  16.433  1.00 33.37  ? 9   DT  B "C5'" 1 
ATOM   2253 C "C4'" . DT  B 2 9   ? 19.218  97.532  16.753  1.00 34.21  ? 9   DT  B "C4'" 1 
ATOM   2254 O "O4'" . DT  B 2 9   ? 20.179  96.917  17.644  1.00 33.50  ? 9   DT  B "O4'" 1 
ATOM   2255 C "C3'" . DT  B 2 9   ? 19.988  98.056  15.549  1.00 35.49  ? 9   DT  B "C3'" 1 
ATOM   2256 O "O3'" . DT  B 2 9   ? 19.779  99.440  15.521  1.00 41.20  ? 9   DT  B "O3'" 1 
ATOM   2257 C "C2'" . DT  B 2 9   ? 21.459  97.693  15.843  1.00 38.15  ? 9   DT  B "C2'" 1 
ATOM   2258 C "C1'" . DT  B 2 9   ? 21.450  97.434  17.360  1.00 34.61  ? 9   DT  B "C1'" 1 
ATOM   2259 N N1    . DT  B 2 9   ? 22.453  96.429  17.830  1.00 34.55  ? 9   DT  B N1    1 
ATOM   2260 C C2    . DT  B 2 9   ? 23.330  96.770  18.856  1.00 36.46  ? 9   DT  B C2    1 
ATOM   2261 O O2    . DT  B 2 9   ? 23.353  97.856  19.378  1.00 41.27  ? 9   DT  B O2    1 
ATOM   2262 N N3    . DT  B 2 9   ? 24.185  95.787  19.239  1.00 34.55  ? 9   DT  B N3    1 
ATOM   2263 C C4    . DT  B 2 9   ? 24.247  94.509  18.736  1.00 42.85  ? 9   DT  B C4    1 
ATOM   2264 O O4    . DT  B 2 9   ? 25.044  93.691  19.150  1.00 52.34  ? 9   DT  B O4    1 
ATOM   2265 C C5    . DT  B 2 9   ? 23.312  94.196  17.683  1.00 37.98  ? 9   DT  B C5    1 
ATOM   2266 C C7    . DT  B 2 9   ? 23.324  92.832  17.086  1.00 36.06  ? 9   DT  B C7    1 
ATOM   2267 C C6    . DT  B 2 9   ? 22.453  95.161  17.277  1.00 35.24  ? 9   DT  B C6    1 
ATOM   2268 P P     . DT  B 2 10  ? 20.432  100.374 14.410  1.00 40.92  ? 10  DT  B P     1 
ATOM   2269 O OP1   . DT  B 2 10  ? 19.396  101.393 14.164  1.00 55.48  ? 10  DT  B OP1   1 
ATOM   2270 O OP2   . DT  B 2 10  ? 21.015  99.596  13.296  1.00 50.35  ? 10  DT  B OP2   1 
ATOM   2271 O "O5'" . DT  B 2 10  ? 21.655  101.051 15.179  1.00 47.64  ? 10  DT  B "O5'" 1 
ATOM   2272 C "C5'" . DT  B 2 10  ? 21.520  101.401 16.534  1.00 43.14  ? 10  DT  B "C5'" 1 
ATOM   2273 C "C4'" . DT  B 2 10  ? 22.852  101.850 17.092  1.00 45.96  ? 10  DT  B "C4'" 1 
ATOM   2274 O "O4'" . DT  B 2 10  ? 23.648  100.709 17.512  1.00 45.62  ? 10  DT  B "O4'" 1 
ATOM   2275 C "C3'" . DT  B 2 10  ? 23.723  102.656 16.141  1.00 50.67  ? 10  DT  B "C3'" 1 
ATOM   2276 O "O3'" . DT  B 2 10  ? 24.175  103.801 16.865  1.00 50.88  ? 10  DT  B "O3'" 1 
ATOM   2277 C "C2'" . DT  B 2 10  ? 24.866  101.695 15.781  1.00 43.35  ? 10  DT  B "C2'" 1 
ATOM   2278 C "C1'" . DT  B 2 10  ? 24.974  100.849 17.036  1.00 45.19  ? 10  DT  B "C1'" 1 
ATOM   2279 N N1    . DT  B 2 10  ? 25.498  99.433  16.848  1.00 45.28  ? 10  DT  B N1    1 
ATOM   2280 C C2    . DT  B 2 10  ? 26.442  98.955  17.732  1.00 44.76  ? 10  DT  B C2    1 
ATOM   2281 O O2    . DT  B 2 10  ? 26.933  99.644  18.587  1.00 47.81  ? 10  DT  B O2    1 
ATOM   2282 N N3    . DT  B 2 10  ? 26.816  97.637  17.539  1.00 46.58  ? 10  DT  B N3    1 
ATOM   2283 C C4    . DT  B 2 10  ? 26.316  96.766  16.554  1.00 47.63  ? 10  DT  B C4    1 
ATOM   2284 O O4    . DT  B 2 10  ? 26.686  95.605  16.437  1.00 42.05  ? 10  DT  B O4    1 
ATOM   2285 C C5    . DT  B 2 10  ? 25.322  97.324  15.675  1.00 38.40  ? 10  DT  B C5    1 
ATOM   2286 C C7    . DT  B 2 10  ? 24.745  96.471  14.606  1.00 37.69  ? 10  DT  B C7    1 
ATOM   2287 C C6    . DT  B 2 10  ? 24.946  98.609  15.861  1.00 39.24  ? 10  DT  B C6    1 
ATOM   2288 P P     . DC  B 2 11  ? 25.054  104.946 16.188  1.00 59.98  ? 11  DC  B P     1 
ATOM   2289 O OP1   . DC  B 2 11  ? 24.571  106.132 16.931  1.00 72.14  ? 11  DC  B OP1   1 
ATOM   2290 O OP2   . DC  B 2 11  ? 25.102  104.837 14.712  1.00 60.41  ? 11  DC  B OP2   1 
ATOM   2291 O "O5'" . DC  B 2 11  ? 26.532  104.601 16.644  1.00 64.23  ? 11  DC  B "O5'" 1 
ATOM   2292 C "C5'" . DC  B 2 11  ? 26.793  104.347 18.007  1.00 62.46  ? 11  DC  B "C5'" 1 
ATOM   2293 C "C4'" . DC  B 2 11  ? 28.207  103.875 18.173  1.00 62.73  ? 11  DC  B "C4'" 1 
ATOM   2294 O "O4'" . DC  B 2 11  ? 28.297  102.477 17.820  1.00 62.19  ? 11  DC  B "O4'" 1 
ATOM   2295 C "C3'" . DC  B 2 11  ? 29.206  104.601 17.287  1.00 68.75  ? 11  DC  B "C3'" 1 
ATOM   2296 O "O3'" . DC  B 2 11  ? 30.286  104.966 18.072  1.00 75.16  ? 11  DC  B "O3'" 1 
ATOM   2297 C "C2'" . DC  B 2 11  ? 29.594  103.556 16.233  1.00 65.50  ? 11  DC  B "C2'" 1 
ATOM   2298 C "C1'" . DC  B 2 11  ? 29.429  102.266 17.011  1.00 62.30  ? 11  DC  B "C1'" 1 
ATOM   2299 N N1    . DC  B 2 11  ? 29.140  101.076 16.160  1.00 57.28  ? 11  DC  B N1    1 
ATOM   2300 C C2    . DC  B 2 11  ? 29.772  99.846  16.439  1.00 55.98  ? 11  DC  B C2    1 
ATOM   2301 O O2    . DC  B 2 11  ? 30.576  99.786  17.367  1.00 56.01  ? 11  DC  B O2    1 
ATOM   2302 N N3    . DC  B 2 11  ? 29.463  98.754  15.683  1.00 52.74  ? 11  DC  B N3    1 
ATOM   2303 C C4    . DC  B 2 11  ? 28.567  98.870  14.691  1.00 55.72  ? 11  DC  B C4    1 
ATOM   2304 N N4    . DC  B 2 11  ? 28.293  97.775  13.941  1.00 56.50  ? 11  DC  B N4    1 
ATOM   2305 C C5    . DC  B 2 11  ? 27.917  100.119 14.405  1.00 51.56  ? 11  DC  B C5    1 
ATOM   2306 C C6    . DC  B 2 11  ? 28.221  101.173 15.165  1.00 49.66  ? 11  DC  B C6    1 
ATOM   2307 P P     . DT  B 2 12  ? 31.365  106.021 17.547  1.00 75.51  ? 12  DT  B P     1 
ATOM   2308 O OP1   . DT  B 2 12  ? 31.236  107.148 18.492  1.00 82.40  ? 12  DT  B OP1   1 
ATOM   2309 O OP2   . DT  B 2 12  ? 31.256  106.251 16.069  1.00 73.70  ? 12  DT  B OP2   1 
ATOM   2310 O "O5'" . DT  B 2 12  ? 32.745  105.253 17.780  1.00 84.49  ? 12  DT  B "O5'" 1 
ATOM   2311 C "C5'" . DT  B 2 12  ? 32.945  104.476 18.958  1.00 80.69  ? 12  DT  B "C5'" 1 
ATOM   2312 C "C4'" . DT  B 2 12  ? 34.106  103.520 18.765  1.00 80.61  ? 12  DT  B "C4'" 1 
ATOM   2313 O "O4'" . DT  B 2 12  ? 33.666  102.359 18.018  1.00 79.81  ? 12  DT  B "O4'" 1 
ATOM   2314 C "C3'" . DT  B 2 12  ? 35.291  104.095 17.995  1.00 84.48  ? 12  DT  B "C3'" 1 
ATOM   2315 O "O3'" . DT  B 2 12  ? 36.477  103.790 18.698  1.00 92.57  ? 12  DT  B "O3'" 1 
ATOM   2316 C "C2'" . DT  B 2 12  ? 35.222  103.401 16.618  1.00 79.91  ? 12  DT  B "C2'" 1 
ATOM   2317 C "C1'" . DT  B 2 12  ? 34.587  102.072 16.975  1.00 78.25  ? 12  DT  B "C1'" 1 
ATOM   2318 N N1    . DT  B 2 12  ? 33.804  101.426 15.879  1.00 68.09  ? 12  DT  B N1    1 
ATOM   2319 C C2    . DT  B 2 12  ? 33.871  100.055 15.721  1.00 64.81  ? 12  DT  B C2    1 
ATOM   2320 O O2    . DT  B 2 12  ? 34.590  99.339  16.384  1.00 61.88  ? 12  DT  B O2    1 
ATOM   2321 N N3    . DT  B 2 12  ? 33.073  99.549  14.734  1.00 63.67  ? 12  DT  B N3    1 
ATOM   2322 C C4    . DT  B 2 12  ? 32.219  100.250 13.916  1.00 60.65  ? 12  DT  B C4    1 
ATOM   2323 O O4    . DT  B 2 12  ? 31.536  99.695  13.054  1.00 58.73  ? 12  DT  B O4    1 
ATOM   2324 C C5    . DT  B 2 12  ? 32.179  101.685 14.145  1.00 61.44  ? 12  DT  B C5    1 
ATOM   2325 C C7    . DT  B 2 12  ? 31.279  102.561 13.312  1.00 56.13  ? 12  DT  B C7    1 
ATOM   2326 C C6    . DT  B 2 12  ? 32.957  102.193 15.114  1.00 60.56  ? 12  DT  B C6    1 
ATOM   2327 P P     . DC  B 2 13  ? 37.874  104.481 18.298  1.00 96.14  ? 13  DC  B P     1 
ATOM   2328 O OP1   . DC  B 2 13  ? 38.382  105.177 19.500  1.00 102.98 ? 13  DC  B OP1   1 
ATOM   2329 O OP2   . DC  B 2 13  ? 37.699  105.261 17.047  1.00 89.91  ? 13  DC  B OP2   1 
ATOM   2330 O "O5'" . DC  B 2 13  ? 38.796  103.208 17.975  1.00 107.75 ? 13  DC  B "O5'" 1 
ATOM   2331 C "C5'" . DC  B 2 13  ? 38.494  101.920 18.566  1.00 98.72  ? 13  DC  B "C5'" 1 
ATOM   2332 C "C4'" . DC  B 2 13  ? 39.172  100.791 17.792  1.00 97.00  ? 13  DC  B "C4'" 1 
ATOM   2333 O "O4'" . DC  B 2 13  ? 38.238  100.202 16.846  1.00 90.35  ? 13  DC  B "O4'" 1 
ATOM   2334 C "C3'" . DC  B 2 13  ? 40.397  101.215 16.977  1.00 102.08 ? 13  DC  B "C3'" 1 
ATOM   2335 O "O3'" . DC  B 2 13  ? 41.463  100.274 17.152  1.00 106.02 ? 13  DC  B "O3'" 1 
ATOM   2336 C "C2'" . DC  B 2 13  ? 39.882  101.242 15.535  1.00 96.56  ? 13  DC  B "C2'" 1 
ATOM   2337 C "C1'" . DC  B 2 13  ? 38.823  100.155 15.560  1.00 89.87  ? 13  DC  B "C1'" 1 
ATOM   2338 N N1    . DC  B 2 13  ? 37.740  100.363 14.571  1.00 84.86  ? 13  DC  B N1    1 
ATOM   2339 C C2    . DC  B 2 13  ? 37.141  99.256  13.959  1.00 81.55  ? 13  DC  B C2    1 
ATOM   2340 O O2    . DC  B 2 13  ? 37.545  98.121  14.237  1.00 82.57  ? 13  DC  B O2    1 
ATOM   2341 N N3    . DC  B 2 13  ? 36.141  99.460  13.068  1.00 74.53  ? 13  DC  B N3    1 
ATOM   2342 C C4    . DC  B 2 13  ? 35.736  100.698 12.791  1.00 69.45  ? 13  DC  B C4    1 
ATOM   2343 N N4    . DC  B 2 13  ? 34.744  100.838 11.918  1.00 66.59  ? 13  DC  B N4    1 
ATOM   2344 C C5    . DC  B 2 13  ? 36.328  101.841 13.401  1.00 71.83  ? 13  DC  B C5    1 
ATOM   2345 C C6    . DC  B 2 13  ? 37.317  101.631 14.280  1.00 79.73  ? 13  DC  B C6    1 
ATOM   2346 P P     . DG  B 2 14  ? 42.997  100.769 17.120  1.00 125.23 ? 14  DG  B P     1 
ATOM   2347 O OP1   . DG  B 2 14  ? 43.399  100.917 18.537  1.00 126.12 ? 14  DG  B OP1   1 
ATOM   2348 O OP2   . DG  B 2 14  ? 43.168  101.897 16.161  1.00 121.92 ? 14  DG  B OP2   1 
ATOM   2349 O "O5'" . DG  B 2 14  ? 43.777  99.517  16.490  1.00 119.03 ? 14  DG  B "O5'" 1 
ATOM   2350 C "C5'" . DG  B 2 14  ? 43.038  98.402  15.954  1.00 109.58 ? 14  DG  B "C5'" 1 
ATOM   2351 C "C4'" . DG  B 2 14  ? 43.355  98.214  14.481  1.00 105.10 ? 14  DG  B "C4'" 1 
ATOM   2352 O "O4'" . DG  B 2 14  ? 42.177  98.525  13.685  1.00 99.83  ? 14  DG  B "O4'" 1 
ATOM   2353 C "C3'" . DG  B 2 14  ? 44.482  99.113  13.951  1.00 105.56 ? 14  DG  B "C3'" 1 
ATOM   2354 O "O3'" . DG  B 2 14  ? 45.346  98.359  13.122  1.00 111.51 ? 14  DG  B "O3'" 1 
ATOM   2355 C "C2'" . DG  B 2 14  ? 43.738  100.177 13.154  1.00 101.63 ? 14  DG  B "C2'" 1 
ATOM   2356 C "C1'" . DG  B 2 14  ? 42.569  99.362  12.621  1.00 99.31  ? 14  DG  B "C1'" 1 
ATOM   2357 N N9    . DG  B 2 14  ? 41.434  100.173 12.185  1.00 93.19  ? 14  DG  B N9    1 
ATOM   2358 C C8    . DG  B 2 14  ? 41.241  101.514 12.414  1.00 92.88  ? 14  DG  B C8    1 
ATOM   2359 N N7    . DG  B 2 14  ? 40.146  101.982 11.885  1.00 85.75  ? 14  DG  B N7    1 
ATOM   2360 C C5    . DG  B 2 14  ? 39.581  100.887 11.255  1.00 82.10  ? 14  DG  B C5    1 
ATOM   2361 C C6    . DG  B 2 14  ? 38.391  100.791 10.505  1.00 74.84  ? 14  DG  B C6    1 
ATOM   2362 O O6    . DG  B 2 14  ? 37.568  101.682 10.242  1.00 73.79  ? 14  DG  B O6    1 
ATOM   2363 N N1    . DG  B 2 14  ? 38.188  99.501  10.039  1.00 75.45  ? 14  DG  B N1    1 
ATOM   2364 C C2    . DG  B 2 14  ? 39.028  98.436  10.263  1.00 77.60  ? 14  DG  B C2    1 
ATOM   2365 N N2    . DG  B 2 14  ? 38.645  97.265  9.736   1.00 77.43  ? 14  DG  B N2    1 
ATOM   2366 N N3    . DG  B 2 14  ? 40.160  98.512  10.957  1.00 80.70  ? 14  DG  B N3    1 
ATOM   2367 C C4    . DG  B 2 14  ? 40.365  99.762  11.428  1.00 84.28  ? 14  DG  B C4    1 
ATOM   2368 O "O5'" . DG  C 3 1   ? 30.849  101.809 3.294   1.00 95.77  ? 15  DG  C "O5'" 1 
ATOM   2369 C "C5'" . DG  C 3 1   ? 31.084  101.421 1.932   1.00 102.70 ? 15  DG  C "C5'" 1 
ATOM   2370 C "C4'" . DG  C 3 1   ? 32.294  100.493 1.829   1.00 105.42 ? 15  DG  C "C4'" 1 
ATOM   2371 O "O4'" . DG  C 3 1   ? 33.524  101.261 1.977   1.00 104.60 ? 15  DG  C "O4'" 1 
ATOM   2372 C "C3'" . DG  C 3 1   ? 32.352  99.400  2.895   1.00 99.74  ? 15  DG  C "C3'" 1 
ATOM   2373 O "O3'" . DG  C 3 1   ? 31.683  98.205  2.427   1.00 101.67 ? 15  DG  C "O3'" 1 
ATOM   2374 C "C2'" . DG  C 3 1   ? 33.854  99.168  3.087   1.00 97.53  ? 15  DG  C "C2'" 1 
ATOM   2375 C "C1'" . DG  C 3 1   ? 34.471  100.526 2.754   1.00 98.46  ? 15  DG  C "C1'" 1 
ATOM   2376 N N9    . DG  C 3 1   ? 34.880  101.328 3.924   1.00 87.39  ? 15  DG  C N9    1 
ATOM   2377 C C8    . DG  C 3 1   ? 34.233  102.425 4.449   1.00 81.67  ? 15  DG  C C8    1 
ATOM   2378 N N7    . DG  C 3 1   ? 34.846  102.954 5.469   1.00 74.47  ? 15  DG  C N7    1 
ATOM   2379 C C5    . DG  C 3 1   ? 35.975  102.173 5.628   1.00 74.24  ? 15  DG  C C5    1 
ATOM   2380 C C6    . DG  C 3 1   ? 37.015  102.275 6.575   1.00 77.66  ? 15  DG  C C6    1 
ATOM   2381 O O6    . DG  C 3 1   ? 37.140  103.107 7.485   1.00 78.42  ? 15  DG  C O6    1 
ATOM   2382 N N1    . DG  C 3 1   ? 37.977  101.281 6.392   1.00 76.66  ? 15  DG  C N1    1 
ATOM   2383 C C2    . DG  C 3 1   ? 37.926  100.304 5.421   1.00 79.83  ? 15  DG  C C2    1 
ATOM   2384 N N2    . DG  C 3 1   ? 38.945  99.425  5.401   1.00 80.54  ? 15  DG  C N2    1 
ATOM   2385 N N3    . DG  C 3 1   ? 36.950  100.201 4.526   1.00 81.19  ? 15  DG  C N3    1 
ATOM   2386 C C4    . DG  C 3 1   ? 36.013  101.165 4.688   1.00 80.67  ? 15  DG  C C4    1 
ATOM   2387 P P     . DC  C 3 2   ? 30.958  97.212  3.471   1.00 140.06 ? 16  DC  C P     1 
ATOM   2388 O OP1   . DC  C 3 2   ? 29.994  96.370  2.725   1.00 145.41 ? 16  DC  C OP1   1 
ATOM   2389 O OP2   . DC  C 3 2   ? 30.464  98.026  4.607   1.00 130.39 ? 16  DC  C OP2   1 
ATOM   2390 O "O5'" . DC  C 3 2   ? 32.154  96.282  4.006   1.00 120.71 ? 16  DC  C "O5'" 1 
ATOM   2391 C "C5'" . DC  C 3 2   ? 33.217  95.843  3.108   1.00 116.49 ? 16  DC  C "C5'" 1 
ATOM   2392 C "C4'" . DC  C 3 2   ? 34.385  95.286  3.910   1.00 107.00 ? 16  DC  C "C4'" 1 
ATOM   2393 O "O4'" . DC  C 3 2   ? 35.194  96.370  4.396   1.00 98.01  ? 16  DC  C "O4'" 1 
ATOM   2394 C "C3'" . DC  C 3 2   ? 33.954  94.500  5.135   1.00 105.33 ? 16  DC  C "C3'" 1 
ATOM   2395 O "O3'" . DC  C 3 2   ? 33.997  93.127  4.850   1.00 111.83 ? 16  DC  C "O3'" 1 
ATOM   2396 C "C2'" . DC  C 3 2   ? 34.948  94.866  6.236   1.00 100.16 ? 16  DC  C "C2'" 1 
ATOM   2397 C "C1'" . DC  C 3 2   ? 35.665  96.093  5.703   1.00 95.21  ? 16  DC  C "C1'" 1 
ATOM   2398 N N1    . DC  C 3 2   ? 35.491  97.309  6.531   1.00 86.22  ? 16  DC  C N1    1 
ATOM   2399 C C2    . DC  C 3 2   ? 36.445  97.616  7.492   1.00 80.49  ? 16  DC  C C2    1 
ATOM   2400 O O2    . DC  C 3 2   ? 37.381  96.844  7.657   1.00 79.29  ? 16  DC  C O2    1 
ATOM   2401 N N3    . DC  C 3 2   ? 36.312  98.751  8.217   1.00 70.05  ? 16  DC  C N3    1 
ATOM   2402 C C4    . DC  C 3 2   ? 35.279  99.563  7.995   1.00 70.30  ? 16  DC  C C4    1 
ATOM   2403 N N4    . DC  C 3 2   ? 35.193  100.677 8.723   1.00 66.50  ? 16  DC  C N4    1 
ATOM   2404 C C5    . DC  C 3 2   ? 34.284  99.267  7.017   1.00 72.26  ? 16  DC  C C5    1 
ATOM   2405 C C6    . DC  C 3 2   ? 34.430  98.138  6.313   1.00 80.58  ? 16  DC  C C6    1 
ATOM   2406 P P     . DG  C 3 3   ? 32.735  92.213  5.213   1.00 133.02 ? 17  DG  C P     1 
ATOM   2407 O OP1   . DG  C 3 3   ? 32.297  91.621  3.922   1.00 137.71 ? 17  DG  C OP1   1 
ATOM   2408 O OP2   . DG  C 3 3   ? 31.825  93.007  6.079   1.00 124.74 ? 17  DG  C OP2   1 
ATOM   2409 O "O5'" . DG  C 3 3   ? 33.349  91.083  6.147   1.00 108.78 ? 17  DG  C "O5'" 1 
ATOM   2410 C "C5'" . DG  C 3 3   ? 34.721  91.108  6.435   1.00 108.24 ? 17  DG  C "C5'" 1 
ATOM   2411 C "C4'" . DG  C 3 3   ? 34.933  91.102  7.925   1.00 102.63 ? 17  DG  C "C4'" 1 
ATOM   2412 O "O4'" . DG  C 3 3   ? 35.108  92.456  8.411   1.00 97.90  ? 17  DG  C "O4'" 1 
ATOM   2413 C "C3'" . DG  C 3 3   ? 33.781  90.513  8.721   1.00 100.32 ? 17  DG  C "C3'" 1 
ATOM   2414 O "O3'" . DG  C 3 3   ? 34.320  89.691  9.702   1.00 105.65 ? 17  DG  C "O3'" 1 
ATOM   2415 C "C2'" . DG  C 3 3   ? 33.110  91.745  9.333   1.00 91.81  ? 17  DG  C "C2'" 1 
ATOM   2416 C "C1'" . DG  C 3 3   ? 34.305  92.647  9.549   1.00 89.44  ? 17  DG  C "C1'" 1 
ATOM   2417 N N9    . DG  C 3 3   ? 33.966  94.065  9.638   1.00 83.37  ? 17  DG  C N9    1 
ATOM   2418 C C8    . DG  C 3 3   ? 32.946  94.724  8.988   1.00 81.51  ? 17  DG  C C8    1 
ATOM   2419 N N7    . DG  C 3 3   ? 32.897  96.003  9.257   1.00 77.40  ? 17  DG  C N7    1 
ATOM   2420 C C5    . DG  C 3 3   ? 33.958  96.204  10.134  1.00 74.23  ? 17  DG  C C5    1 
ATOM   2421 C C6    . DG  C 3 3   ? 34.411  97.388  10.767  1.00 68.87  ? 17  DG  C C6    1 
ATOM   2422 O O6    . DG  C 3 3   ? 33.945  98.533  10.689  1.00 62.20  ? 17  DG  C O6    1 
ATOM   2423 N N1    . DG  C 3 3   ? 35.518  97.144  11.568  1.00 65.58  ? 17  DG  C N1    1 
ATOM   2424 C C2    . DG  C 3 3   ? 36.108  95.917  11.743  1.00 66.97  ? 17  DG  C C2    1 
ATOM   2425 N N2    . DG  C 3 3   ? 37.165  95.883  12.556  1.00 68.71  ? 17  DG  C N2    1 
ATOM   2426 N N3    . DG  C 3 3   ? 35.699  94.804  11.161  1.00 69.64  ? 17  DG  C N3    1 
ATOM   2427 C C4    . DG  C 3 3   ? 34.624  95.020  10.374  1.00 75.82  ? 17  DG  C C4    1 
ATOM   2428 P P     . DA  C 3 4   ? 33.431  88.596  10.467  1.00 97.71  ? 18  DA  C P     1 
ATOM   2429 O OP1   . DA  C 3 4   ? 33.609  87.367  9.661   1.00 101.35 ? 18  DA  C OP1   1 
ATOM   2430 O OP2   . DA  C 3 4   ? 32.061  89.122  10.793  1.00 89.70  ? 18  DA  C OP2   1 
ATOM   2431 O "O5'" . DA  C 3 4   ? 34.236  88.461  11.845  1.00 101.22 ? 18  DA  C "O5'" 1 
ATOM   2432 C "C5'" . DA  C 3 4   ? 35.583  88.965  11.910  1.00 94.14  ? 18  DA  C "C5'" 1 
ATOM   2433 C "C4'" . DA  C 3 4   ? 35.818  89.742  13.195  1.00 85.86  ? 18  DA  C "C4'" 1 
ATOM   2434 O "O4'" . DA  C 3 4   ? 35.433  91.128  13.033  1.00 82.50  ? 18  DA  C "O4'" 1 
ATOM   2435 C "C3'" . DA  C 3 4   ? 35.053  89.234  14.407  1.00 81.21  ? 18  DA  C "C3'" 1 
ATOM   2436 O "O3'" . DA  C 3 4   ? 35.943  89.136  15.480  1.00 81.27  ? 18  DA  C "O3'" 1 
ATOM   2437 C "C2'" . DA  C 3 4   ? 33.982  90.308  14.658  1.00 76.10  ? 18  DA  C "C2'" 1 
ATOM   2438 C "C1'" . DA  C 3 4   ? 34.682  91.552  14.160  1.00 78.63  ? 18  DA  C "C1'" 1 
ATOM   2439 N N9    . DA  C 3 4   ? 33.779  92.603  13.699  1.00 79.04  ? 18  DA  C N9    1 
ATOM   2440 C C8    . DA  C 3 4   ? 32.760  92.465  12.797  1.00 80.54  ? 18  DA  C C8    1 
ATOM   2441 N N7    . DA  C 3 4   ? 32.136  93.585  12.520  1.00 77.37  ? 18  DA  C N7    1 
ATOM   2442 C C5    . DA  C 3 4   ? 32.798  94.532  13.279  1.00 71.13  ? 18  DA  C C5    1 
ATOM   2443 C C6    . DA  C 3 4   ? 32.614  95.916  13.426  1.00 60.15  ? 18  DA  C C6    1 
ATOM   2444 N N6    . DA  C 3 4   ? 31.670  96.593  12.783  1.00 57.89  ? 18  DA  C N6    1 
ATOM   2445 N N1    . DA  C 3 4   ? 33.433  96.572  14.267  1.00 58.84  ? 18  DA  C N1    1 
ATOM   2446 C C2    . DA  C 3 4   ? 34.387  95.883  14.906  1.00 64.19  ? 18  DA  C C2    1 
ATOM   2447 N N3    . DA  C 3 4   ? 34.663  94.576  14.852  1.00 71.04  ? 18  DA  C N3    1 
ATOM   2448 C C4    . DA  C 3 4   ? 33.820  93.950  14.012  1.00 75.38  ? 18  DA  C C4    1 
ATOM   2449 P P     . DG  C 3 5   ? 35.571  88.229  16.742  1.00 87.30  ? 19  DG  C P     1 
ATOM   2450 O OP1   . DG  C 3 5   ? 36.827  87.594  17.215  1.00 96.24  ? 19  DG  C OP1   1 
ATOM   2451 O OP2   . DG  C 3 5   ? 34.428  87.373  16.364  1.00 90.57  ? 19  DG  C OP2   1 
ATOM   2452 O "O5'" . DG  C 3 5   ? 35.059  89.293  17.811  1.00 82.17  ? 19  DG  C "O5'" 1 
ATOM   2453 C "C5'" . DG  C 3 5   ? 35.841  90.419  18.066  1.00 84.58  ? 19  DG  C "C5'" 1 
ATOM   2454 C "C4'" . DG  C 3 5   ? 35.056  91.441  18.827  1.00 85.09  ? 19  DG  C "C4'" 1 
ATOM   2455 O "O4'" . DG  C 3 5   ? 34.250  92.228  17.907  1.00 81.53  ? 19  DG  C "O4'" 1 
ATOM   2456 C "C3'" . DG  C 3 5   ? 34.071  90.870  19.855  1.00 84.86  ? 19  DG  C "C3'" 1 
ATOM   2457 O "O3'" . DG  C 3 5   ? 34.055  91.732  20.953  1.00 86.50  ? 19  DG  C "O3'" 1 
ATOM   2458 C "C2'" . DG  C 3 5   ? 32.747  90.960  19.111  1.00 80.69  ? 19  DG  C "C2'" 1 
ATOM   2459 C "C1'" . DG  C 3 5   ? 32.965  92.309  18.455  1.00 78.86  ? 19  DG  C "C1'" 1 
ATOM   2460 N N9    . DG  C 3 5   ? 32.021  92.660  17.419  1.00 75.81  ? 19  DG  C N9    1 
ATOM   2461 C C8    . DG  C 3 5   ? 31.282  91.815  16.611  1.00 73.56  ? 19  DG  C C8    1 
ATOM   2462 N N7    . DG  C 3 5   ? 30.499  92.452  15.775  1.00 68.36  ? 19  DG  C N7    1 
ATOM   2463 C C5    . DG  C 3 5   ? 30.744  93.800  16.051  1.00 69.23  ? 19  DG  C C5    1 
ATOM   2464 C C6    . DG  C 3 5   ? 30.201  94.969  15.472  1.00 62.86  ? 19  DG  C C6    1 
ATOM   2465 O O6    . DG  C 3 5   ? 29.363  95.055  14.554  1.00 60.95  ? 19  DG  C O6    1 
ATOM   2466 N N1    . DG  C 3 5   ? 30.731  96.131  16.067  1.00 56.67  ? 19  DG  C N1    1 
ATOM   2467 C C2    . DG  C 3 5   ? 31.676  96.148  17.080  1.00 57.55  ? 19  DG  C C2    1 
ATOM   2468 N N2    . DG  C 3 5   ? 32.079  97.349  17.520  1.00 56.64  ? 19  DG  C N2    1 
ATOM   2469 N N3    . DG  C 3 5   ? 32.194  95.066  17.615  1.00 65.11  ? 19  DG  C N3    1 
ATOM   2470 C C4    . DG  C 3 5   ? 31.683  93.933  17.060  1.00 72.54  ? 19  DG  C C4    1 
ATOM   2471 P P     . DA  C 3 6   ? 34.159  91.172  22.445  1.00 87.59  ? 20  DA  C P     1 
ATOM   2472 O OP1   . DA  C 3 6   ? 35.379  90.332  22.517  1.00 95.37  ? 20  DA  C OP1   1 
ATOM   2473 O OP2   . DA  C 3 6   ? 32.836  90.607  22.782  1.00 82.54  ? 20  DA  C OP2   1 
ATOM   2474 O "O5'" . DA  C 3 6   ? 34.364  92.510  23.317  1.00 88.34  ? 20  DA  C "O5'" 1 
ATOM   2475 C "C5'" . DA  C 3 6   ? 35.299  93.516  22.884  1.00 84.44  ? 20  DA  C "C5'" 1 
ATOM   2476 C "C4'" . DA  C 3 6   ? 34.733  94.915  23.094  1.00 78.58  ? 20  DA  C "C4'" 1 
ATOM   2477 O "O4'" . DA  C 3 6   ? 33.809  95.249  22.020  1.00 73.63  ? 20  DA  C "O4'" 1 
ATOM   2478 C "C3'" . DA  C 3 6   ? 33.955  95.124  24.388  1.00 79.54  ? 20  DA  C "C3'" 1 
ATOM   2479 O "O3'" . DA  C 3 6   ? 34.203  96.438  24.880  1.00 81.62  ? 20  DA  C "O3'" 1 
ATOM   2480 C "C2'" . DA  C 3 6   ? 32.497  94.956  23.944  1.00 73.99  ? 20  DA  C "C2'" 1 
ATOM   2481 C "C1'" . DA  C 3 6   ? 32.536  95.568  22.553  1.00 68.70  ? 20  DA  C "C1'" 1 
ATOM   2482 N N9    . DA  C 3 6   ? 31.535  95.033  21.645  1.00 62.87  ? 20  DA  C N9    1 
ATOM   2483 C C8    . DA  C 3 6   ? 31.262  93.718  21.411  1.00 68.05  ? 20  DA  C C8    1 
ATOM   2484 N N7    . DA  C 3 6   ? 30.326  93.521  20.521  1.00 67.44  ? 20  DA  C N7    1 
ATOM   2485 C C5    . DA  C 3 6   ? 29.964  94.804  20.138  1.00 61.69  ? 20  DA  C C5    1 
ATOM   2486 C C6    . DA  C 3 6   ? 29.018  95.287  19.219  1.00 57.35  ? 20  DA  C C6    1 
ATOM   2487 N N6    . DA  C 3 6   ? 28.234  94.490  18.488  1.00 52.22  ? 20  DA  C N6    1 
ATOM   2488 N N1    . DA  C 3 6   ? 28.910  96.622  19.081  1.00 50.31  ? 20  DA  C N1    1 
ATOM   2489 C C2    . DA  C 3 6   ? 29.691  97.406  19.816  1.00 50.61  ? 20  DA  C C2    1 
ATOM   2490 N N3    . DA  C 3 6   ? 30.616  97.072  20.700  1.00 53.53  ? 20  DA  C N3    1 
ATOM   2491 C C4    . DA  C 3 6   ? 30.703  95.744  20.819  1.00 58.84  ? 20  DA  C C4    1 
ATOM   2492 P P     . DA  C 3 7   ? 33.644  96.896  26.317  1.00 94.93  ? 21  DA  C P     1 
ATOM   2493 O OP1   . DA  C 3 7   ? 34.695  97.747  26.905  1.00 101.09 ? 21  DA  C OP1   1 
ATOM   2494 O OP2   . DA  C 3 7   ? 33.093  95.728  27.040  1.00 92.04  ? 21  DA  C OP2   1 
ATOM   2495 O "O5'" . DA  C 3 7   ? 32.419  97.852  25.969  1.00 84.17  ? 21  DA  C "O5'" 1 
ATOM   2496 C "C5'" . DA  C 3 7   ? 32.620  99.002  25.176  1.00 84.45  ? 21  DA  C "C5'" 1 
ATOM   2497 C "C4'" . DA  C 3 7   ? 31.317  99.751  25.033  1.00 87.87  ? 21  DA  C "C4'" 1 
ATOM   2498 O "O4'" . DA  C 3 7   ? 30.505  99.121  23.996  1.00 85.86  ? 21  DA  C "O4'" 1 
ATOM   2499 C "C3'" . DA  C 3 7   ? 30.468  99.741  26.302  1.00 89.29  ? 21  DA  C "C3'" 1 
ATOM   2500 O "O3'" . DA  C 3 7   ? 29.871  101.000 26.513  1.00 90.69  ? 21  DA  C "O3'" 1 
ATOM   2501 C "C2'" . DA  C 3 7   ? 29.422  98.670  26.023  1.00 83.55  ? 21  DA  C "C2'" 1 
ATOM   2502 C "C1'" . DA  C 3 7   ? 29.244  98.793  24.518  1.00 76.74  ? 21  DA  C "C1'" 1 
ATOM   2503 N N9    . DA  C 3 7   ? 28.772  97.552  23.922  1.00 65.42  ? 21  DA  C N9    1 
ATOM   2504 C C8    . DA  C 3 7   ? 29.075  96.276  24.325  1.00 64.10  ? 21  DA  C C8    1 
ATOM   2505 N N7    . DA  C 3 7   ? 28.441  95.341  23.656  1.00 60.93  ? 21  DA  C N7    1 
ATOM   2506 C C5    . DA  C 3 7   ? 27.649  96.061  22.762  1.00 59.23  ? 21  DA  C C5    1 
ATOM   2507 C C6    . DA  C 3 7   ? 26.748  95.665  21.760  1.00 49.35  ? 21  DA  C C6    1 
ATOM   2508 N N6    . DA  C 3 7   ? 26.479  94.382  21.465  1.00 50.64  ? 21  DA  C N6    1 
ATOM   2509 N N1    . DA  C 3 7   ? 26.125  96.636  21.068  1.00 49.54  ? 21  DA  C N1    1 
ATOM   2510 C C2    . DA  C 3 7   ? 26.401  97.916  21.340  1.00 50.34  ? 21  DA  C C2    1 
ATOM   2511 N N3    . DA  C 3 7   ? 27.236  98.416  22.248  1.00 55.11  ? 21  DA  C N3    1 
ATOM   2512 C C4    . DA  C 3 7   ? 27.832  97.425  22.932  1.00 59.10  ? 21  DA  C C4    1 
ATOM   2513 P P     . DA  C 3 8   ? 29.318  101.363 27.975  1.00 70.37  ? 22  DA  C P     1 
ATOM   2514 O OP1   . DA  C 3 8   ? 29.850  102.704 28.291  1.00 81.37  ? 22  DA  C OP1   1 
ATOM   2515 O OP2   . DA  C 3 8   ? 29.530  100.187 28.856  1.00 71.17  ? 22  DA  C OP2   1 
ATOM   2516 O "O5'" . DA  C 3 8   ? 27.748  101.514 27.784  1.00 58.54  ? 22  DA  C "O5'" 1 
ATOM   2517 C "C5'" . DA  C 3 8   ? 27.222  102.692 27.206  1.00 52.85  ? 22  DA  C "C5'" 1 
ATOM   2518 C "C4'" . DA  C 3 8   ? 25.794  102.447 26.825  1.00 53.57  ? 22  DA  C "C4'" 1 
ATOM   2519 O "O4'" . DA  C 3 8   ? 25.780  101.483 25.740  1.00 53.90  ? 22  DA  C "O4'" 1 
ATOM   2520 C "C3'" . DA  C 3 8   ? 24.984  101.795 27.912  1.00 54.31  ? 22  DA  C "C3'" 1 
ATOM   2521 O "O3'" . DA  C 3 8   ? 24.452  102.798 28.778  1.00 55.71  ? 22  DA  C "O3'" 1 
ATOM   2522 C "C2'" . DA  C 3 8   ? 23.891  101.067 27.108  1.00 50.04  ? 22  DA  C "C2'" 1 
ATOM   2523 C "C1'" . DA  C 3 8   ? 24.603  100.721 25.784  1.00 50.51  ? 22  DA  C "C1'" 1 
ATOM   2524 N N9    . DA  C 3 8   ? 24.958  99.297  25.651  1.00 55.59  ? 22  DA  C N9    1 
ATOM   2525 C C8    . DA  C 3 8   ? 25.896  98.604  26.365  1.00 58.02  ? 22  DA  C C8    1 
ATOM   2526 N N7    . DA  C 3 8   ? 25.987  97.338  26.040  1.00 50.25  ? 22  DA  C N7    1 
ATOM   2527 C C5    . DA  C 3 8   ? 25.047  97.181  25.049  1.00 56.00  ? 22  DA  C C5    1 
ATOM   2528 C C6    . DA  C 3 8   ? 24.650  96.063  24.286  1.00 52.98  ? 22  DA  C C6    1 
ATOM   2529 N N6    . DA  C 3 8   ? 25.176  94.857  24.434  1.00 50.33  ? 22  DA  C N6    1 
ATOM   2530 N N1    . DA  C 3 8   ? 23.672  96.246  23.371  1.00 47.54  ? 22  DA  C N1    1 
ATOM   2531 C C2    . DA  C 3 8   ? 23.146  97.467  23.225  1.00 46.43  ? 22  DA  C C2    1 
ATOM   2532 N N3    . DA  C 3 8   ? 23.445  98.595  23.862  1.00 50.14  ? 22  DA  C N3    1 
ATOM   2533 C C4    . DA  C 3 8   ? 24.404  98.379  24.783  1.00 56.24  ? 22  DA  C C4    1 
ATOM   2534 P P     . DC  C 3 9   ? 24.733  102.757 30.368  1.00 57.59  ? 23  DC  C P     1 
ATOM   2535 O OP1   . DC  C 3 9   ? 23.950  103.864 30.956  1.00 61.31  ? 23  DC  C OP1   1 
ATOM   2536 O OP2   . DC  C 3 9   ? 26.187  102.602 30.640  1.00 46.80  ? 23  DC  C OP2   1 
ATOM   2537 O "O5'" . DC  C 3 9   ? 24.049  101.389 30.841  1.00 58.44  ? 23  DC  C "O5'" 1 
ATOM   2538 C "C5'" . DC  C 3 9   ? 22.663  101.210 30.759  1.00 46.54  ? 23  DC  C "C5'" 1 
ATOM   2539 C "C4'" . DC  C 3 9   ? 22.335  99.775  31.066  1.00 45.71  ? 23  DC  C "C4'" 1 
ATOM   2540 O "O4'" . DC  C 3 9   ? 22.992  98.904  30.117  1.00 46.50  ? 23  DC  C "O4'" 1 
ATOM   2541 C "C3'" . DC  C 3 9   ? 22.838  99.303  32.403  1.00 42.10  ? 23  DC  C "C3'" 1 
ATOM   2542 O "O3'" . DC  C 3 9   ? 21.865  99.592  33.360  1.00 41.54  ? 23  DC  C "O3'" 1 
ATOM   2543 C "C2'" . DC  C 3 9   ? 23.018  97.784  32.205  1.00 43.45  ? 23  DC  C "C2'" 1 
ATOM   2544 C "C1'" . DC  C 3 9   ? 23.028  97.613  30.679  1.00 45.42  ? 23  DC  C "C1'" 1 
ATOM   2545 N N1    . DC  C 3 9   ? 24.205  96.908  30.147  1.00 41.48  ? 23  DC  C N1    1 
ATOM   2546 C C2    . DC  C 3 9   ? 24.069  95.608  29.674  1.00 39.42  ? 23  DC  C C2    1 
ATOM   2547 O O2    . DC  C 3 9   ? 22.955  95.057  29.717  1.00 44.11  ? 23  DC  C O2    1 
ATOM   2548 N N3    . DC  C 3 9   ? 25.146  94.990  29.163  1.00 38.95  ? 23  DC  C N3    1 
ATOM   2549 C C4    . DC  C 3 9   ? 26.323  95.608  29.139  1.00 42.07  ? 23  DC  C C4    1 
ATOM   2550 N N4    . DC  C 3 9   ? 27.351  94.949  28.631  1.00 50.43  ? 23  DC  C N4    1 
ATOM   2551 C C5    . DC  C 3 9   ? 26.495  96.925  29.631  1.00 39.86  ? 23  DC  C C5    1 
ATOM   2552 C C6    . DC  C 3 9   ? 25.409  97.539  30.112  1.00 44.23  ? 23  DC  C C6    1 
ATOM   2553 P P     . DA  C 3 10  ? 22.132  99.338  34.912  1.00 49.28  ? 24  DA  C P     1 
ATOM   2554 O OP1   . DA  C 3 10  ? 21.164  100.139 35.667  1.00 58.24  ? 24  DA  C OP1   1 
ATOM   2555 O OP2   . DA  C 3 10  ? 23.575  99.431  35.198  1.00 57.57  ? 24  DA  C OP2   1 
ATOM   2556 O "O5'" . DA  C 3 10  ? 21.729  97.807  35.119  1.00 51.23  ? 24  DA  C "O5'" 1 
ATOM   2557 C "C5'" . DA  C 3 10  ? 20.457  97.382  34.796  1.00 41.59  ? 24  DA  C "C5'" 1 
ATOM   2558 C "C4'" . DA  C 3 10  ? 20.394  95.889  34.921  1.00 47.93  ? 24  DA  C "C4'" 1 
ATOM   2559 O "O4'" . DA  C 3 10  ? 21.178  95.296  33.868  1.00 41.19  ? 24  DA  C "O4'" 1 
ATOM   2560 C "C3'" . DA  C 3 10  ? 20.913  95.306  36.249  1.00 46.91  ? 24  DA  C "C3'" 1 
ATOM   2561 O "O3'" . DA  C 3 10  ? 19.852  94.638  36.865  1.00 51.64  ? 24  DA  C "O3'" 1 
ATOM   2562 C "C2'" . DA  C 3 10  ? 22.025  94.322  35.843  1.00 46.77  ? 24  DA  C "C2'" 1 
ATOM   2563 C "C1'" . DA  C 3 10  ? 21.758  94.106  34.344  1.00 52.31  ? 24  DA  C "C1'" 1 
ATOM   2564 N N9    . DA  C 3 10  ? 22.958  93.850  33.537  1.00 48.21  ? 24  DA  C N9    1 
ATOM   2565 C C8    . DA  C 3 10  ? 24.105  94.588  33.511  1.00 42.09  ? 24  DA  C C8    1 
ATOM   2566 N N7    . DA  C 3 10  ? 25.005  94.136  32.672  1.00 49.88  ? 24  DA  C N7    1 
ATOM   2567 C C5    . DA  C 3 10  ? 24.393  93.029  32.093  1.00 44.73  ? 24  DA  C C5    1 
ATOM   2568 C C6    . DA  C 3 10  ? 24.820  92.109  31.124  1.00 42.73  ? 24  DA  C C6    1 
ATOM   2569 N N6    . DA  C 3 10  ? 26.011  92.170  30.535  1.00 44.74  ? 24  DA  C N6    1 
ATOM   2570 N N1    . DA  C 3 10  ? 23.973  91.120  30.782  1.00 41.03  ? 24  DA  C N1    1 
ATOM   2571 C C2    . DA  C 3 10  ? 22.779  91.069  31.368  1.00 41.62  ? 24  DA  C C2    1 
ATOM   2572 N N3    . DA  C 3 10  ? 22.261  91.883  32.288  1.00 41.93  ? 24  DA  C N3    1 
ATOM   2573 C C4    . DA  C 3 10  ? 23.129  92.847  32.608  1.00 41.52  ? 24  DA  C C4    1 
ATOM   2574 P P     . DA  C 3 11  ? 19.958  94.087  38.370  1.00 54.75  ? 25  DA  C P     1 
ATOM   2575 O OP1   . DA  C 3 11  ? 18.666  94.378  38.993  1.00 60.37  ? 25  DA  C OP1   1 
ATOM   2576 O OP2   . DA  C 3 11  ? 21.208  94.574  38.987  1.00 58.92  ? 25  DA  C OP2   1 
ATOM   2577 O "O5'" . DA  C 3 11  ? 20.010  92.509  38.192  1.00 55.15  ? 25  DA  C "O5'" 1 
ATOM   2578 C "C5'" . DA  C 3 11  ? 19.228  91.928  37.184  1.00 56.84  ? 25  DA  C "C5'" 1 
ATOM   2579 C "C4'" . DA  C 3 11  ? 19.756  90.564  36.841  1.00 57.16  ? 25  DA  C "C4'" 1 
ATOM   2580 O "O4'" . DA  C 3 11  ? 20.844  90.676  35.869  1.00 56.98  ? 25  DA  C "O4'" 1 
ATOM   2581 C "C3'" . DA  C 3 11  ? 20.319  89.818  38.037  1.00 61.65  ? 25  DA  C "C3'" 1 
ATOM   2582 O "O3'" . DA  C 3 11  ? 19.723  88.554  38.091  1.00 73.78  ? 25  DA  C "O3'" 1 
ATOM   2583 C "C2'" . DA  C 3 11  ? 21.822  89.721  37.745  1.00 57.60  ? 25  DA  C "C2'" 1 
ATOM   2584 C "C1'" . DA  C 3 11  ? 21.861  89.780  36.224  1.00 54.97  ? 25  DA  C "C1'" 1 
ATOM   2585 N N9    . DA  C 3 11  ? 23.147  90.257  35.700  1.00 50.57  ? 25  DA  C N9    1 
ATOM   2586 C C8    . DA  C 3 11  ? 23.894  91.304  36.164  1.00 51.32  ? 25  DA  C C8    1 
ATOM   2587 N N7    . DA  C 3 11  ? 25.038  91.470  35.529  1.00 52.66  ? 25  DA  C N7    1 
ATOM   2588 C C5    . DA  C 3 11  ? 25.035  90.453  34.581  1.00 55.59  ? 25  DA  C C5    1 
ATOM   2589 C C6    . DA  C 3 11  ? 25.954  90.077  33.581  1.00 51.10  ? 25  DA  C C6    1 
ATOM   2590 N N6    . DA  C 3 11  ? 27.106  90.709  33.348  1.00 47.19  ? 25  DA  C N6    1 
ATOM   2591 N N1    . DA  C 3 11  ? 25.650  89.014  32.841  1.00 49.25  ? 25  DA  C N1    1 
ATOM   2592 C C2    . DA  C 3 11  ? 24.504  88.377  33.064  1.00 48.03  ? 25  DA  C C2    1 
ATOM   2593 N N3    . DA  C 3 11  ? 23.559  88.639  33.943  1.00 49.08  ? 25  DA  C N3    1 
ATOM   2594 C C4    . DA  C 3 11  ? 23.887  89.692  34.685  1.00 49.14  ? 25  DA  C C4    1 
ATOM   2595 P P     . DA  C 3 12  ? 19.822  87.654  39.414  1.00 80.15  ? 26  DA  C P     1 
ATOM   2596 O OP1   . DA  C 3 12  ? 18.451  87.636  39.973  1.00 82.94  ? 26  DA  C OP1   1 
ATOM   2597 O OP2   . DA  C 3 12  ? 20.957  88.080  40.269  1.00 75.46  ? 26  DA  C OP2   1 
ATOM   2598 O "O5'" . DA  C 3 12  ? 20.211  86.221  38.824  1.00 83.49  ? 26  DA  C "O5'" 1 
ATOM   2599 C "C5'" . DA  C 3 12  ? 19.839  85.873  37.491  1.00 74.03  ? 26  DA  C "C5'" 1 
ATOM   2600 C "C4'" . DA  C 3 12  ? 20.933  85.051  36.842  1.00 73.72  ? 26  DA  C "C4'" 1 
ATOM   2601 O "O4'" . DA  C 3 12  ? 21.981  85.935  36.403  1.00 74.75  ? 26  DA  C "O4'" 1 
ATOM   2602 C "C3'" . DA  C 3 12  ? 21.613  84.030  37.772  1.00 78.32  ? 26  DA  C "C3'" 1 
ATOM   2603 O "O3'" . DA  C 3 12  ? 21.326  82.695  37.347  1.00 83.84  ? 26  DA  C "O3'" 1 
ATOM   2604 C "C2'" . DA  C 3 12  ? 23.115  84.344  37.683  1.00 74.12  ? 26  DA  C "C2'" 1 
ATOM   2605 C "C1'" . DA  C 3 12  ? 23.205  85.244  36.469  1.00 73.93  ? 26  DA  C "C1'" 1 
ATOM   2606 N N9    . DA  C 3 12  ? 24.283  86.222  36.554  1.00 67.96  ? 26  DA  C N9    1 
ATOM   2607 C C8    . DA  C 3 12  ? 24.409  87.244  37.452  1.00 66.09  ? 26  DA  C C8    1 
ATOM   2608 N N7    . DA  C 3 12  ? 25.495  87.965  37.282  1.00 61.68  ? 26  DA  C N7    1 
ATOM   2609 C C5    . DA  C 3 12  ? 26.111  87.372  36.194  1.00 58.22  ? 26  DA  C C5    1 
ATOM   2610 C C6    . DA  C 3 12  ? 27.286  87.665  35.505  1.00 54.36  ? 26  DA  C C6    1 
ATOM   2611 N N6    . DA  C 3 12  ? 28.090  88.667  35.828  1.00 54.61  ? 26  DA  C N6    1 
ATOM   2612 N N1    . DA  C 3 12  ? 27.607  86.879  34.459  1.00 62.31  ? 26  DA  C N1    1 
ATOM   2613 C C2    . DA  C 3 12  ? 26.793  85.871  34.129  1.00 56.95  ? 26  DA  C C2    1 
ATOM   2614 N N3    . DA  C 3 12  ? 25.659  85.499  34.702  1.00 57.12  ? 26  DA  C N3    1 
ATOM   2615 C C4    . DA  C 3 12  ? 25.372  86.299  35.736  1.00 60.45  ? 26  DA  C C4    1 
ATOM   2616 P P     . DG  C 3 13  ? 21.756  81.438  38.253  1.00 107.84 ? 27  DG  C P     1 
ATOM   2617 O OP1   . DG  C 3 13  ? 20.738  80.389  38.021  1.00 113.10 ? 27  DG  C OP1   1 
ATOM   2618 O OP2   . DG  C 3 13  ? 22.101  81.897  39.625  1.00 106.38 ? 27  DG  C OP2   1 
ATOM   2619 O "O5'" . DG  C 3 13  ? 23.119  80.960  37.593  1.00 96.02  ? 27  DG  C "O5'" 1 
ATOM   2620 C "C5'" . DG  C 3 13  ? 23.244  80.954  36.182  1.00 91.36  ? 27  DG  C "C5'" 1 
ATOM   2621 C "C4'" . DG  C 3 13  ? 24.687  80.799  35.811  1.00 85.97  ? 27  DG  C "C4'" 1 
ATOM   2622 O "O4'" . DG  C 3 13  ? 25.353  82.083  35.924  1.00 82.22  ? 27  DG  C "O4'" 1 
ATOM   2623 C "C3'" . DG  C 3 13  ? 25.446  79.842  36.727  1.00 92.13  ? 27  DG  C "C3'" 1 
ATOM   2624 O "O3'" . DG  C 3 13  ? 26.143  78.898  35.948  1.00 93.70  ? 27  DG  C "O3'" 1 
ATOM   2625 C "C2'" . DG  C 3 13  ? 26.397  80.752  37.520  1.00 91.05  ? 27  DG  C "C2'" 1 
ATOM   2626 C "C1'" . DG  C 3 13  ? 26.604  81.886  36.538  1.00 82.78  ? 27  DG  C "C1'" 1 
ATOM   2627 N N9    . DG  C 3 13  ? 27.040  83.133  37.154  1.00 76.86  ? 27  DG  C N9    1 
ATOM   2628 C C8    . DG  C 3 13  ? 26.465  83.804  38.209  1.00 75.20  ? 27  DG  C C8    1 
ATOM   2629 N N7    . DG  C 3 13  ? 27.095  84.901  38.532  1.00 69.26  ? 27  DG  C N7    1 
ATOM   2630 C C5    . DG  C 3 13  ? 28.148  84.953  37.633  1.00 67.59  ? 27  DG  C C5    1 
ATOM   2631 C C6    . DG  C 3 13  ? 29.175  85.905  37.491  1.00 65.96  ? 27  DG  C C6    1 
ATOM   2632 O O6    . DG  C 3 13  ? 29.363  86.938  38.157  1.00 66.61  ? 27  DG  C O6    1 
ATOM   2633 N N1    . DG  C 3 13  ? 30.044  85.569  36.449  1.00 67.07  ? 27  DG  C N1    1 
ATOM   2634 C C2    . DG  C 3 13  ? 29.929  84.448  35.652  1.00 67.99  ? 27  DG  C C2    1 
ATOM   2635 N N2    . DG  C 3 13  ? 30.856  84.284  34.699  1.00 67.27  ? 27  DG  C N2    1 
ATOM   2636 N N3    . DG  C 3 13  ? 28.976  83.553  35.781  1.00 71.85  ? 27  DG  C N3    1 
ATOM   2637 C C4    . DG  C 3 13  ? 28.124  83.869  36.785  1.00 72.91  ? 27  DG  C C4    1 
ATOM   2638 P P     . DA  C 3 14  ? 26.806  77.614  36.637  1.00 115.39 ? 28  DA  C P     1 
ATOM   2639 O OP1   . DA  C 3 14  ? 26.097  76.451  36.067  1.00 120.92 ? 28  DA  C OP1   1 
ATOM   2640 O OP2   . DA  C 3 14  ? 26.843  77.792  38.109  1.00 114.90 ? 28  DA  C OP2   1 
ATOM   2641 O "O5'" . DA  C 3 14  ? 28.309  77.640  36.089  1.00 113.84 ? 28  DA  C "O5'" 1 
ATOM   2642 C "C5'" . DA  C 3 14  ? 28.573  77.985  34.718  1.00 108.38 ? 28  DA  C "C5'" 1 
ATOM   2643 C "C4'" . DA  C 3 14  ? 30.029  78.391  34.538  1.00 105.69 ? 28  DA  C "C4'" 1 
ATOM   2644 O "O4'" . DA  C 3 14  ? 30.233  79.735  35.063  1.00 103.45 ? 28  DA  C "O4'" 1 
ATOM   2645 C "C3'" . DA  C 3 14  ? 31.042  77.502  35.269  1.00 106.59 ? 28  DA  C "C3'" 1 
ATOM   2646 O "O3'" . DA  C 3 14  ? 32.234  77.389  34.496  1.00 109.84 ? 28  DA  C "O3'" 1 
ATOM   2647 C "C2'" . DA  C 3 14  ? 31.289  78.267  36.568  1.00 103.89 ? 28  DA  C "C2'" 1 
ATOM   2648 C "C1'" . DA  C 3 14  ? 31.247  79.700  36.065  1.00 100.59 ? 28  DA  C "C1'" 1 
ATOM   2649 N N9    . DA  C 3 14  ? 30.930  80.685  37.100  1.00 90.32  ? 28  DA  C N9    1 
ATOM   2650 C C8    . DA  C 3 14  ? 29.862  80.673  37.954  1.00 89.21  ? 28  DA  C C8    1 
ATOM   2651 N N7    . DA  C 3 14  ? 29.818  81.707  38.766  1.00 86.14  ? 28  DA  C N7    1 
ATOM   2652 C C5    . DA  C 3 14  ? 30.936  82.449  38.417  1.00 79.82  ? 28  DA  C C5    1 
ATOM   2653 C C6    . DA  C 3 14  ? 31.462  83.656  38.907  1.00 73.34  ? 28  DA  C C6    1 
ATOM   2654 N N6    . DA  C 3 14  ? 30.900  84.353  39.899  1.00 70.75  ? 28  DA  C N6    1 
ATOM   2655 N N1    . DA  C 3 14  ? 32.591  84.121  38.334  1.00 69.65  ? 28  DA  C N1    1 
ATOM   2656 C C2    . DA  C 3 14  ? 33.153  83.418  37.343  1.00 68.05  ? 28  DA  C C2    1 
ATOM   2657 N N3    . DA  C 3 14  ? 32.750  82.277  36.791  1.00 68.83  ? 28  DA  C N3    1 
ATOM   2658 C C4    . DA  C 3 14  ? 31.630  81.836  37.385  1.00 79.82  ? 28  DA  C C4    1 
HETATM 2659 C C6    . 2ON D 4 .   ? 18.813  59.248  11.624  1.00 81.06  ? 301 2ON A C6    1 
HETATM 2660 N N1    . 2ON D 4 .   ? 20.122  59.055  11.435  1.00 74.60  ? 301 2ON A N1    1 
HETATM 2661 C C2    . 2ON D 4 .   ? 20.745  59.625  10.397  1.00 78.17  ? 301 2ON A C2    1 
HETATM 2662 N N3    . 2ON D 4 .   ? 20.123  60.403  9.498   1.00 84.12  ? 301 2ON A N3    1 
HETATM 2663 C C4    . 2ON D 4 .   ? 18.804  60.625  9.647   1.00 87.71  ? 301 2ON A C4    1 
HETATM 2664 C C5    . 2ON D 4 .   ? 18.099  60.045  10.726  1.00 86.35  ? 301 2ON A C5    1 
HETATM 2665 N N9    . 2ON D 4 .   ? 17.906  61.342  8.935   1.00 91.23  ? 301 2ON A N9    1 
HETATM 2666 C C8    . 2ON D 4 .   ? 16.713  61.232  9.518   1.00 89.52  ? 301 2ON A C8    1 
HETATM 2667 N N7    . 2ON D 4 .   ? 16.816  60.457  10.598  1.00 87.41  ? 301 2ON A N7    1 
HETATM 2668 O O6    . 2ON D 4 .   ? 18.264  58.730  12.579  1.00 83.02  ? 301 2ON A O6    1 
HETATM 2669 S S2    . 2ON D 4 .   ? 22.472  59.323  10.209  1.00 134.79 ? 301 2ON A S2    1 
HETATM 2670 C C1    . GOL E 5 .   ? 16.823  100.757 17.983  1.00 51.53  ? 302 GOL A C1    1 
HETATM 2671 O O1    . GOL E 5 .   ? 16.144  100.568 19.192  1.00 50.31  ? 302 GOL A O1    1 
HETATM 2672 C C2    . GOL E 5 .   ? 16.729  102.211 17.551  1.00 55.04  ? 302 GOL A C2    1 
HETATM 2673 O O2    . GOL E 5 .   ? 17.983  102.875 17.671  1.00 53.11  ? 302 GOL A O2    1 
HETATM 2674 C C3    . GOL E 5 .   ? 16.393  102.060 16.084  1.00 61.74  ? 302 GOL A C3    1 
HETATM 2675 O O3    . GOL E 5 .   ? 17.060  100.936 15.519  1.00 53.85  ? 302 GOL A O3    1 
HETATM 2676 O O     . HOH F 6 .   ? -0.138  104.172 8.999   1.00 55.66  ? 401 HOH A O     1 
HETATM 2677 O O     . HOH F 6 .   ? 9.725   112.314 21.325  1.00 36.45  ? 402 HOH A O     1 
HETATM 2678 O O     . HOH F 6 .   ? 17.155  105.293 15.175  1.00 57.93  ? 403 HOH A O     1 
HETATM 2679 O O     . HOH F 6 .   ? 14.422  112.016 26.406  1.00 47.41  ? 404 HOH A O     1 
HETATM 2680 O O     . HOH F 6 .   ? 12.749  102.994 18.756  1.00 30.38  ? 405 HOH A O     1 
HETATM 2681 O O     . HOH F 6 .   ? 16.391  94.949  25.965  1.00 33.13  ? 406 HOH A O     1 
HETATM 2682 O O     . HOH F 6 .   ? 10.418  99.653  23.377  1.00 35.61  ? 407 HOH A O     1 
HETATM 2683 O O     . HOH F 6 .   ? 16.822  89.246  9.651   1.00 35.64  ? 408 HOH A O     1 
HETATM 2684 O O     . HOH F 6 .   ? 14.552  94.242  12.819  1.00 28.73  ? 409 HOH A O     1 
HETATM 2685 O O     . HOH F 6 .   ? 19.696  90.281  6.787   1.00 39.47  ? 410 HOH A O     1 
HETATM 2686 O O     . HOH F 6 .   ? 11.894  94.587  19.543  1.00 28.63  ? 411 HOH A O     1 
HETATM 2687 O O     . HOH F 6 .   ? 13.898  92.985  19.735  1.00 31.04  ? 412 HOH A O     1 
HETATM 2688 O O     . HOH F 6 .   ? 22.736  76.527  13.030  1.00 32.11  ? 413 HOH A O     1 
HETATM 2689 O O     . HOH F 6 .   ? 16.831  90.558  -0.137  1.00 38.50  ? 414 HOH A O     1 
HETATM 2690 O O     . HOH F 6 .   ? 23.753  90.561  24.875  1.00 39.92  ? 415 HOH A O     1 
HETATM 2691 O O     . HOH F 6 .   ? -1.450  97.236  11.725  1.00 47.69  ? 416 HOH A O     1 
HETATM 2692 O O     . HOH F 6 .   ? -6.484  111.109 18.390  1.00 44.84  ? 417 HOH A O     1 
HETATM 2693 O O     . HOH F 6 .   ? 21.606  94.247  13.506  1.00 54.37  ? 418 HOH A O     1 
HETATM 2694 O O     . HOH F 6 .   ? 6.023   92.183  25.912  1.00 47.85  ? 419 HOH A O     1 
HETATM 2695 O O     . HOH F 6 .   ? 25.663  90.914  12.073  1.00 46.07  ? 420 HOH A O     1 
HETATM 2696 O O     . HOH F 6 .   ? 17.415  102.808 25.790  1.00 38.81  ? 421 HOH A O     1 
HETATM 2697 O O     . HOH F 6 .   ? 31.039  88.151  7.660   1.00 52.23  ? 422 HOH A O     1 
HETATM 2698 O O     . HOH F 6 .   ? -8.234  106.054 28.014  1.00 64.18  ? 423 HOH A O     1 
HETATM 2699 O O     . HOH F 6 .   ? 24.007  78.658  24.642  1.00 47.93  ? 424 HOH A O     1 
HETATM 2700 O O     . HOH F 6 .   ? 25.390  92.033  -0.913  1.00 51.54  ? 425 HOH A O     1 
HETATM 2701 O O     . HOH F 6 .   ? 23.927  78.988  12.936  1.00 43.09  ? 426 HOH A O     1 
HETATM 2702 O O     . HOH F 6 .   ? 27.159  75.419  4.315   1.00 45.51  ? 427 HOH A O     1 
HETATM 2703 O O     . HOH F 6 .   ? 24.126  92.526  13.796  1.00 51.49  ? 428 HOH A O     1 
HETATM 2704 O O     . HOH F 6 .   ? 12.254  91.582  -1.703  1.00 55.63  ? 429 HOH A O     1 
HETATM 2705 O O     . HOH F 6 .   ? 11.807  89.966  26.585  1.00 56.26  ? 430 HOH A O     1 
HETATM 2706 O O     . HOH F 6 .   ? 17.824  96.115  2.539   1.00 46.67  ? 431 HOH A O     1 
HETATM 2707 O O     . HOH F 6 .   ? 5.246   77.417  8.276   1.00 63.62  ? 432 HOH A O     1 
HETATM 2708 O O     . HOH F 6 .   ? 30.304  72.825  21.592  1.00 52.43  ? 433 HOH A O     1 
HETATM 2709 O O     . HOH F 6 .   ? 14.459  89.946  -1.509  1.00 46.97  ? 434 HOH A O     1 
HETATM 2710 O O     . HOH F 6 .   ? 21.977  80.206  25.044  1.00 64.19  ? 435 HOH A O     1 
HETATM 2711 O O     . HOH F 6 .   ? 25.943  75.834  -1.034  1.00 46.45  ? 436 HOH A O     1 
HETATM 2712 O O     . HOH F 6 .   ? 32.814  79.725  2.800   1.00 43.17  ? 437 HOH A O     1 
HETATM 2713 O O     . HOH F 6 .   ? 23.811  76.125  25.344  1.00 60.71  ? 438 HOH A O     1 
HETATM 2714 O O     . HOH F 6 .   ? 24.937  90.070  15.655  1.00 51.08  ? 439 HOH A O     1 
HETATM 2715 O O     . HOH F 6 .   ? 32.883  77.703  0.896   1.00 62.35  ? 440 HOH A O     1 
HETATM 2716 O O     . HOH F 6 .   ? 8.335   93.935  2.810   1.00 43.79  ? 441 HOH A O     1 
HETATM 2717 O O     . HOH F 6 .   ? 19.649  64.859  23.541  1.00 46.54  ? 442 HOH A O     1 
HETATM 2718 O O     . HOH F 6 .   ? 34.349  79.722  19.013  1.00 44.47  ? 443 HOH A O     1 
HETATM 2719 O O     . HOH F 6 .   ? 7.169   111.630 34.213  1.00 45.61  ? 444 HOH A O     1 
HETATM 2720 O O     . HOH F 6 .   ? 16.662  98.332  34.360  1.00 45.30  ? 445 HOH A O     1 
HETATM 2721 O O     . HOH F 6 .   ? 28.613  79.381  26.698  1.00 56.18  ? 446 HOH A O     1 
HETATM 2722 O O     . HOH F 6 .   ? -0.206  92.022  30.616  1.00 51.71  ? 447 HOH A O     1 
HETATM 2723 O O     . HOH F 6 .   ? 24.560  77.586  -8.496  1.00 57.05  ? 448 HOH A O     1 
HETATM 2724 O O     . HOH F 6 .   ? 14.830  100.765 27.997  1.00 42.33  ? 449 HOH A O     1 
HETATM 2725 O O     . HOH F 6 .   ? 17.032  109.110 32.110  1.00 49.34  ? 450 HOH A O     1 
HETATM 2726 O O     . HOH G 6 .   ? 22.535  100.770 20.374  1.00 45.12  ? 101 HOH B O     1 
HETATM 2727 O O     . HOH G 6 .   ? 24.878  85.743  21.342  1.00 32.44  ? 102 HOH B O     1 
HETATM 2728 O O     . HOH G 6 .   ? 26.534  93.451  14.609  1.00 41.19  ? 103 HOH B O     1 
HETATM 2729 O O     . HOH G 6 .   ? 24.161  88.204  23.391  1.00 42.50  ? 104 HOH B O     1 
HETATM 2730 O O     . HOH G 6 .   ? 20.348  90.959  15.262  1.00 42.96  ? 105 HOH B O     1 
HETATM 2731 O O     . HOH H 6 .   ? 27.811  94.054  12.607  1.00 59.31  ? 101 HOH C O     1 
HETATM 2732 O O     . HOH H 6 .   ? 31.909  99.598  9.957   1.00 54.89  ? 102 HOH C O     1 
HETATM 2733 O O     . HOH H 6 .   ? 33.208  85.834  17.619  1.00 40.17  ? 103 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . PRO A 1   ? 0.6617 0.5292 0.6760 0.0310  -0.0099 0.0436  1   PRO A N     
2    C CA    . PRO A 1   ? 0.5889 0.4549 0.6105 0.0213  0.0010  0.0335  1   PRO A CA    
3    C C     . PRO A 1   ? 0.5533 0.4363 0.5920 0.0224  0.0029  0.0166  1   PRO A C     
4    O O     . PRO A 1   ? 0.5493 0.4501 0.5874 0.0253  0.0003  0.0132  1   PRO A O     
5    C CB    . PRO A 1   ? 0.6210 0.4986 0.6276 0.0126  0.0043  0.0341  1   PRO A CB    
6    C CG    . PRO A 1   ? 0.6322 0.5062 0.6193 0.0158  -0.0014 0.0473  1   PRO A CG    
7    C CD    . PRO A 1   ? 0.6219 0.4942 0.6134 0.0275  -0.0123 0.0517  1   PRO A CD    
8    N N     . GLU A 2   ? 0.5196 0.3961 0.5718 0.0189  0.0093  0.0051  2   GLU A N     
9    C CA    . GLU A 2   ? 0.4988 0.3924 0.5598 0.0188  0.0124  -0.0129 2   GLU A CA    
10   C C     . GLU A 2   ? 0.5307 0.4354 0.5864 0.0099  0.0153  -0.0236 2   GLU A C     
11   O O     . GLU A 2   ? 0.5629 0.4643 0.6138 0.0034  0.0162  -0.0178 2   GLU A O     
12   C CB    . GLU A 2   ? 0.4309 0.3131 0.5136 0.0238  0.0158  -0.0230 2   GLU A CB    
13   C CG    . GLU A 2   ? 0.4751 0.3442 0.5666 0.0354  0.0097  -0.0102 2   GLU A CG    
14   C CD    . GLU A 2   ? 0.6189 0.4757 0.7361 0.0443  0.0120  -0.0193 2   GLU A CD    
15   O OE1   . GLU A 2   ? 0.5765 0.4383 0.7061 0.0413  0.0200  -0.0387 2   GLU A OE1   
16   O OE2   . GLU A 2   ? 0.7761 0.6187 0.9007 0.0563  0.0047  -0.0076 2   GLU A OE2   
17   N N     . LEU A 3   ? 0.5387 0.4587 0.5949 0.0103  0.0166  -0.0405 3   LEU A N     
18   C CA    . LEU A 3   ? 0.4949 0.4331 0.5436 0.0058  0.0145  -0.0520 3   LEU A CA    
19   C C     . LEU A 3   ? 0.4608 0.3940 0.5254 -0.0045 0.0171  -0.0580 3   LEU A C     
20   O O     . LEU A 3   ? 0.4810 0.4283 0.5420 -0.0081 0.0144  -0.0585 3   LEU A O     
21   C CB    . LEU A 3   ? 0.4768 0.4293 0.5209 0.0090  0.0149  -0.0713 3   LEU A CB    
22   C CG    . LEU A 3   ? 0.4522 0.4277 0.4847 0.0088  0.0085  -0.0863 3   LEU A CG    
23   C CD1   . LEU A 3   ? 0.4996 0.4867 0.5076 0.0169  0.0083  -0.0949 3   LEU A CD1   
24   C CD2   . LEU A 3   ? 0.4093 0.3885 0.4660 -0.0003 0.0087  -0.1070 3   LEU A CD2   
25   N N     . PRO A 4   ? 0.4174 0.3296 0.5022 -0.0096 0.0240  -0.0631 4   PRO A N     
26   C CA    . PRO A 4   ? 0.4454 0.3519 0.5470 -0.0226 0.0306  -0.0701 4   PRO A CA    
27   C C     . PRO A 4   ? 0.4900 0.3874 0.5823 -0.0267 0.0338  -0.0502 4   PRO A C     
28   O O     . PRO A 4   ? 0.5344 0.4437 0.6361 -0.0366 0.0377  -0.0578 4   PRO A O     
29   C CB    . PRO A 4   ? 0.4696 0.3456 0.5916 -0.0262 0.0401  -0.0749 4   PRO A CB    
30   C CG    . PRO A 4   ? 0.4942 0.3753 0.6153 -0.0157 0.0361  -0.0836 4   PRO A CG    
31   C CD    . PRO A 4   ? 0.4517 0.3460 0.5491 -0.0049 0.0280  -0.0670 4   PRO A CD    
32   N N     . GLU A 5   ? 0.4918 0.3728 0.5668 -0.0187 0.0317  -0.0278 5   GLU A N     
33   C CA    . GLU A 5   ? 0.5096 0.3808 0.5701 -0.0219 0.0350  -0.0097 5   GLU A CA    
34   C C     . GLU A 5   ? 0.5039 0.4044 0.5541 -0.0208 0.0292  -0.0119 5   GLU A C     
35   O O     . GLU A 5   ? 0.5311 0.4369 0.5812 -0.0282 0.0347  -0.0108 5   GLU A O     
36   C CB    . GLU A 5   ? 0.5209 0.3695 0.5643 -0.0118 0.0310  0.0120  5   GLU A CB    
37   C CG    . GLU A 5   ? 0.6074 0.4208 0.6589 -0.0095 0.0364  0.0182  5   GLU A CG    
38   C CD    . GLU A 5   ? 0.7087 0.5251 0.7816 -0.0042 0.0342  0.0021  5   GLU A CD    
39   O OE1   . GLU A 5   ? 0.7697 0.5613 0.8592 -0.0076 0.0428  -0.0033 5   GLU A OE1   
40   O OE2   . GLU A 5   ? 0.6778 0.5195 0.7505 0.0027  0.0260  -0.0057 5   GLU A OE2   
41   N N     . VAL A 6   ? 0.4563 0.3742 0.4987 -0.0114 0.0198  -0.0155 6   VAL A N     
42   C CA    . VAL A 6   ? 0.4613 0.4002 0.4911 -0.0073 0.0143  -0.0149 6   VAL A CA    
43   C C     . VAL A 6   ? 0.5093 0.4712 0.5522 -0.0116 0.0134  -0.0326 6   VAL A C     
44   O O     . VAL A 6   ? 0.5092 0.4848 0.5508 -0.0115 0.0124  -0.0324 6   VAL A O     
45   C CB    . VAL A 6   ? 0.5011 0.4467 0.5174 0.0030  0.0082  -0.0133 6   VAL A CB    
46   C CG1   . VAL A 6   ? 0.4583 0.4202 0.4603 0.0086  0.0037  -0.0131 6   VAL A CG1   
47   C CG2   . VAL A 6   ? 0.4638 0.3940 0.4751 0.0067  0.0078  0.0005  6   VAL A CG2   
48   N N     . GLU A 7   ? 0.4695 0.4379 0.5280 -0.0146 0.0130  -0.0505 7   GLU A N     
49   C CA    . GLU A 7   ? 0.4546 0.4496 0.5312 -0.0189 0.0098  -0.0722 7   GLU A CA    
50   C C     . GLU A 7   ? 0.4349 0.4281 0.5346 -0.0333 0.0209  -0.0754 7   GLU A C     
51   O O     . GLU A 7   ? 0.4670 0.4872 0.5817 -0.0354 0.0184  -0.0881 7   GLU A O     
52   C CB    . GLU A 7   ? 0.4072 0.4096 0.4957 -0.0204 0.0071  -0.0942 7   GLU A CB    
53   C CG    . GLU A 7   ? 0.4096 0.4425 0.5225 -0.0263 0.0022  -0.1217 7   GLU A CG    
54   C CD    . GLU A 7   ? 0.5543 0.6203 0.6552 -0.0135 -0.0129 -0.1258 7   GLU A CD    
55   O OE1   . GLU A 7   ? 0.5488 0.6453 0.6751 -0.0171 -0.0186 -0.1472 7   GLU A OE1   
56   O OE2   . GLU A 7   ? 0.5773 0.6386 0.6460 0.0005  -0.0189 -0.1086 7   GLU A OE2   
57   N N     . THR A 8   ? 0.4251 0.3862 0.5275 -0.0422 0.0340  -0.0637 8   THR A N     
58   C CA    . THR A 8   ? 0.4769 0.4293 0.5952 -0.0575 0.0498  -0.0631 8   THR A CA    
59   C C     . THR A 8   ? 0.4777 0.4401 0.5824 -0.0550 0.0507  -0.0516 8   THR A C     
60   O O     . THR A 8   ? 0.5056 0.4886 0.6303 -0.0631 0.0572  -0.0635 8   THR A O     
61   C CB    . THR A 8   ? 0.5588 0.4661 0.6715 -0.0641 0.0639  -0.0467 8   THR A CB    
62   O OG1   . THR A 8   ? 0.5829 0.4791 0.7105 -0.0648 0.0635  -0.0587 8   THR A OG1   
63   C CG2   . THR A 8   ? 0.4145 0.3079 0.5418 -0.0823 0.0851  -0.0470 8   THR A CG2   
64   N N     . VAL A 9   ? 0.4855 0.4363 0.5597 -0.0435 0.0441  -0.0316 9   VAL A N     
65   C CA    . VAL A 9   ? 0.4596 0.4174 0.5181 -0.0396 0.0441  -0.0218 9   VAL A CA    
66   C C     . VAL A 9   ? 0.4684 0.4623 0.5388 -0.0329 0.0350  -0.0369 9   VAL A C     
67   O O     . VAL A 9   ? 0.4844 0.4924 0.5628 -0.0356 0.0405  -0.0405 9   VAL A O     
68   C CB    . VAL A 9   ? 0.4610 0.4028 0.4891 -0.0284 0.0362  -0.0028 9   VAL A CB    
69   C CG1   . VAL A 9   ? 0.4385 0.3889 0.4521 -0.0241 0.0352  0.0031  9   VAL A CG1   
70   C CG2   . VAL A 9   ? 0.4905 0.3984 0.5056 -0.0317 0.0428  0.0132  9   VAL A CG2   
71   N N     . ARG A 10  ? 0.4839 0.4922 0.5539 -0.0227 0.0211  -0.0456 10  ARG A N     
72   C CA    . ARG A 10  ? 0.4572 0.4967 0.5324 -0.0117 0.0092  -0.0578 10  ARG A CA    
73   C C     . ARG A 10  ? 0.4868 0.5547 0.5986 -0.0203 0.0123  -0.0800 10  ARG A C     
74   O O     . ARG A 10  ? 0.4915 0.5840 0.6140 -0.0138 0.0079  -0.0872 10  ARG A O     
75   C CB    . ARG A 10  ? 0.5019 0.5481 0.5646 -0.0001 -0.0045 -0.0633 10  ARG A CB    
76   C CG    . ARG A 10  ? 0.4531 0.5252 0.5094 0.0164  -0.0191 -0.0704 10  ARG A CG    
77   C CD    . ARG A 10  ? 0.5084 0.5934 0.5561 0.0249  -0.0314 -0.0831 10  ARG A CD    
78   N NE    . ARG A 10  ? 0.5422 0.6484 0.6220 0.0143  -0.0326 -0.1086 10  ARG A NE    
79   C CZ    . ARG A 10  ? 0.5307 0.6718 0.6401 0.0143  -0.0399 -0.1299 10  ARG A CZ    
80   N NH1   . ARG A 10  ? 0.5236 0.6827 0.6345 0.0266  -0.0475 -0.1278 10  ARG A NH1   
81   N NH2   . ARG A 10  ? 0.5698 0.7288 0.7117 0.0017  -0.0392 -0.1557 10  ARG A NH2   
82   N N     . ARG A 11  ? 0.4689 0.5338 0.6040 -0.0353 0.0209  -0.0926 11  ARG A N     
83   C CA    . ARG A 11  ? 0.5288 0.6240 0.7064 -0.0465 0.0253  -0.1186 11  ARG A CA    
84   C C     . ARG A 11  ? 0.5338 0.6276 0.7251 -0.0584 0.0440  -0.1148 11  ARG A C     
85   O O     . ARG A 11  ? 0.5915 0.7207 0.8142 -0.0598 0.0441  -0.1336 11  ARG A O     
86   C CB    . ARG A 11  ? 0.5343 0.6220 0.7354 -0.0619 0.0326  -0.1349 11  ARG A CB    
87   C CG    . ARG A 11  ? 0.5642 0.6613 0.7560 -0.0509 0.0147  -0.1465 11  ARG A CG    
88   C CD    . ARG A 11  ? 0.5559 0.6413 0.7711 -0.0663 0.0235  -0.1639 11  ARG A CD    
89   N NE    . ARG A 11  ? 0.5915 0.6903 0.7980 -0.0562 0.0071  -0.1796 11  ARG A NE    
90   C CZ    . ARG A 11  ? 0.6857 0.7865 0.9164 -0.0671 0.0098  -0.2047 11  ARG A CZ    
91   N NH1   . ARG A 11  ? 0.7019 0.7890 0.9695 -0.0891 0.0293  -0.2157 11  ARG A NH1   
92   N NH2   . ARG A 11  ? 0.6760 0.7903 0.8930 -0.0567 -0.0049 -0.2197 11  ARG A NH2   
93   N N     . GLU A 12  ? 0.5182 0.5726 0.6862 -0.0664 0.0601  -0.0919 12  GLU A N     
94   C CA    . GLU A 12  ? 0.5455 0.5936 0.7164 -0.0778 0.0805  -0.0859 12  GLU A CA    
95   C C     . GLU A 12  ? 0.5288 0.5979 0.6903 -0.0634 0.0722  -0.0833 12  GLU A C     
96   O O     . GLU A 12  ? 0.5028 0.5962 0.6896 -0.0683 0.0816  -0.0964 12  GLU A O     
97   C CB    . GLU A 12  ? 0.5433 0.5420 0.6803 -0.0851 0.0958  -0.0593 12  GLU A CB    
98   N N     . LEU A 13  ? 0.4906 0.5505 0.6196 -0.0458 0.0559  -0.0686 13  LEU A N     
99   C CA    . LEU A 13  ? 0.5247 0.5991 0.6456 -0.0317 0.0489  -0.0666 13  LEU A CA    
100  C C     . LEU A 13  ? 0.5248 0.6424 0.6783 -0.0209 0.0361  -0.0893 13  LEU A C     
101  O O     . LEU A 13  ? 0.5390 0.6762 0.7061 -0.0150 0.0381  -0.0960 13  LEU A O     
102  C CB    . LEU A 13  ? 0.5661 0.6199 0.6497 -0.0172 0.0360  -0.0482 13  LEU A CB    
103  C CG    . LEU A 13  ? 0.5569 0.5760 0.6095 -0.0233 0.0451  -0.0276 13  LEU A CG    
104  C CD1   . LEU A 13  ? 0.4590 0.4657 0.4848 -0.0101 0.0327  -0.0153 13  LEU A CD1   
105  C CD2   . LEU A 13  ? 0.6375 0.6567 0.6886 -0.0303 0.0606  -0.0270 13  LEU A CD2   
106  N N     . GLU A 14  ? 0.4800 0.6139 0.6462 -0.0170 0.0219  -0.1025 14  GLU A N     
107  C CA    . GLU A 14  ? 0.5022 0.6796 0.6961 -0.0037 0.0048  -0.1250 14  GLU A CA    
108  C C     . GLU A 14  ? 0.5516 0.7620 0.7960 -0.0167 0.0176  -0.1483 14  GLU A C     
109  O O     . GLU A 14  ? 0.5371 0.7810 0.8040 -0.0035 0.0093  -0.1613 14  GLU A O     
110  C CB    . GLU A 14  ? 0.4948 0.6831 0.6894 0.0005  -0.0116 -0.1372 14  GLU A CB    
111  C CG    . GLU A 14  ? 0.6100 0.8401 0.8177 0.0211  -0.0361 -0.1562 14  GLU A CG    
112  C CD    . GLU A 14  ? 0.7726 1.0130 0.9745 0.0245  -0.0519 -0.1700 14  GLU A CD    
113  O OE1   . GLU A 14  ? 0.8353 1.0723 1.0005 0.0457  -0.0701 -0.1615 14  GLU A OE1   
114  O OE2   . GLU A 14  ? 0.8018 1.0514 1.0344 0.0053  -0.0444 -0.1898 14  GLU A OE2   
115  N N     . LYS A 15  ? 0.5356 0.7346 0.7984 -0.0421 0.0396  -0.1532 15  LYS A N     
116  C CA    . LYS A 15  ? 0.5265 0.7531 0.8395 -0.0599 0.0588  -0.1758 15  LYS A CA    
117  C C     . LYS A 15  ? 0.5324 0.7584 0.8430 -0.0598 0.0749  -0.1684 15  LYS A C     
118  O O     . LYS A 15  ? 0.6391 0.9032 0.9950 -0.0639 0.0830  -0.1912 15  LYS A O     
119  C CB    . LYS A 15  ? 0.5465 0.7478 0.8716 -0.0886 0.0839  -0.1775 15  LYS A CB    
120  C CG    . LYS A 15  ? 0.5219 0.7333 0.8697 -0.0948 0.0738  -0.1973 15  LYS A CG    
121  N N     . ARG A 16  ? 0.5295 0.7154 0.7902 -0.0552 0.0797  -0.1395 16  ARG A N     
122  C CA    . ARG A 16  ? 0.5048 0.6833 0.7567 -0.0590 0.0991  -0.1324 16  ARG A CA    
123  C C     . ARG A 16  ? 0.5112 0.6996 0.7506 -0.0352 0.0849  -0.1288 16  ARG A C     
124  O O     . ARG A 16  ? 0.6022 0.8135 0.8657 -0.0338 0.0955  -0.1416 16  ARG A O     
125  C CB    . ARG A 16  ? 0.5336 0.6607 0.7376 -0.0712 0.1162  -0.1051 16  ARG A CB    
126  C CG    . ARG A 16  ? 0.5580 0.6604 0.7628 -0.0912 0.1300  -0.1011 16  ARG A CG    
127  C CD    . ARG A 16  ? 0.6853 0.7859 0.9110 -0.1151 0.1633  -0.1088 16  ARG A CD    
128  N NE    . ARG A 16  ? 0.7985 0.8718 0.9845 -0.1193 0.1830  -0.0901 16  ARG A NE    
129  C CZ    . ARG A 16  ? 0.7632 0.7877 0.8966 -0.1226 0.1901  -0.0623 16  ARG A CZ    
130  N NH1   . ARG A 16  ? 0.6891 0.6856 0.8068 -0.1212 0.1793  -0.0491 16  ARG A NH1   
131  N NH2   . ARG A 16  ? 0.7034 0.7089 0.8001 -0.1256 0.2069  -0.0492 16  ARG A NH2   
132  N N     . ILE A 17  ? 0.4420 0.6109 0.6452 -0.0173 0.0641  -0.1119 17  ILE A N     
133  C CA    . ILE A 17  ? 0.4612 0.6250 0.6455 0.0016  0.0568  -0.1040 17  ILE A CA    
134  C C     . ILE A 17  ? 0.4675 0.6573 0.6664 0.0279  0.0321  -0.1133 17  ILE A C     
135  O O     . ILE A 17  ? 0.4606 0.6476 0.6520 0.0451  0.0274  -0.1098 17  ILE A O     
136  C CB    . ILE A 17  ? 0.4598 0.5794 0.5916 0.0036  0.0547  -0.0777 17  ILE A CB    
137  C CG1   . ILE A 17  ? 0.4760 0.5850 0.5893 0.0146  0.0343  -0.0684 17  ILE A CG1   
138  C CG2   . ILE A 17  ? 0.4481 0.5400 0.5584 -0.0178 0.0750  -0.0660 17  ILE A CG2   
139  C CD1   . ILE A 17  ? 0.5125 0.5840 0.5830 0.0163  0.0328  -0.0464 17  ILE A CD1   
140  N N     . VAL A 18  ? 0.4848 0.6983 0.7029 0.0322  0.0161  -0.1257 18  VAL A N     
141  C CA    . VAL A 18  ? 0.4795 0.7175 0.7054 0.0598  -0.0094 -0.1335 18  VAL A CA    
142  C C     . VAL A 18  ? 0.5077 0.7873 0.7808 0.0697  -0.0091 -0.1559 18  VAL A C     
143  O O     . VAL A 18  ? 0.5007 0.8147 0.8212 0.0545  0.0020  -0.1794 18  VAL A O     
144  C CB    . VAL A 18  ? 0.5034 0.7606 0.7355 0.0628  -0.0283 -0.1445 18  VAL A CB    
145  C CG1   . VAL A 18  ? 0.4991 0.7857 0.7376 0.0940  -0.0563 -0.1540 18  VAL A CG1   
146  C CG2   . VAL A 18  ? 0.5311 0.7473 0.7160 0.0576  -0.0295 -0.1226 18  VAL A CG2   
147  N N     . GLY A 19  ? 0.4835 0.7584 0.7460 0.0950  -0.0194 -0.1493 19  GLY A N     
148  C CA    . GLY A 19  ? 0.3592 0.6722 0.6669 0.1093  -0.0209 -0.1701 19  GLY A CA    
149  C C     . GLY A 19  ? 0.4132 0.7037 0.7136 0.1033  0.0025  -0.1631 19  GLY A C     
150  O O     . GLY A 19  ? 0.4663 0.7796 0.7985 0.1162  0.0051  -0.1776 19  GLY A O     
151  N N     . GLN A 20  ? 0.4528 0.6999 0.7116 0.0847  0.0190  -0.1428 20  GLN A N     
152  C CA    . GLN A 20  ? 0.5153 0.7440 0.7649 0.0777  0.0409  -0.1396 20  GLN A CA    
153  C C     . GLN A 20  ? 0.5045 0.6972 0.7182 0.0972  0.0330  -0.1222 20  GLN A C     
154  O O     . GLN A 20  ? 0.5023 0.6657 0.6796 0.1038  0.0199  -0.1030 20  GLN A O     
155  C CB    . GLN A 20  ? 0.6382 0.8436 0.8647 0.0468  0.0643  -0.1305 20  GLN A CB    
156  C CG    . GLN A 20  ? 0.7718 1.0105 1.0413 0.0260  0.0827  -0.1512 20  GLN A CG    
157  C CD    . GLN A 20  ? 0.9219 1.1333 1.1658 -0.0028 0.1081  -0.1403 20  GLN A CD    
158  O OE1   . GLN A 20  ? 0.9924 1.1638 1.1869 -0.0060 0.1098  -0.1185 20  GLN A OE1   
159  N NE2   . GLN A 20  ? 1.0040 1.2366 1.2820 -0.0236 0.1284  -0.1560 20  GLN A NE2   
160  N N     . LYS A 21  ? 0.5068 0.7019 0.7343 0.1058  0.0431  -0.1312 21  LYS A N     
161  C CA    . LYS A 21  ? 0.4315 0.5906 0.6314 0.1218  0.0407  -0.1188 21  LYS A CA    
162  C C     . LYS A 21  ? 0.4450 0.5667 0.6045 0.1006  0.0575  -0.1060 21  LYS A C     
163  O O     . LYS A 21  ? 0.4469 0.5751 0.6082 0.0798  0.0781  -0.1139 21  LYS A O     
164  C CB    . LYS A 21  ? 0.4074 0.5856 0.6431 0.1398  0.0455  -0.1372 21  LYS A CB    
165  C CG    . LYS A 21  ? 0.4789 0.6193 0.6933 0.1600  0.0421  -0.1270 21  LYS A CG    
166  C CD    . LYS A 21  ? 0.6005 0.7608 0.8549 0.1752  0.0513  -0.1487 21  LYS A CD    
167  C CE    . LYS A 21  ? 0.7764 0.8921 1.0087 0.1858  0.0587  -0.1424 21  LYS A CE    
168  N NZ    . LYS A 21  ? 0.8692 1.0029 1.1408 0.1979  0.0719  -0.1664 21  LYS A NZ    
169  N N     . ILE A 22  ? 0.3696 0.4530 0.4918 0.1053  0.0493  -0.0869 22  ILE A N     
170  C CA    . ILE A 22  ? 0.3740 0.4256 0.4621 0.0886  0.0616  -0.0783 22  ILE A CA    
171  C C     . ILE A 22  ? 0.5209 0.5645 0.6141 0.0929  0.0753  -0.0904 22  ILE A C     
172  O O     . ILE A 22  ? 0.5128 0.5435 0.6132 0.1135  0.0701  -0.0914 22  ILE A O     
173  C CB    . ILE A 22  ? 0.4161 0.4332 0.4713 0.0912  0.0509  -0.0588 22  ILE A CB    
174  C CG1   . ILE A 22  ? 0.4560 0.4801 0.5037 0.0842  0.0403  -0.0486 22  ILE A CG1   
175  C CG2   . ILE A 22  ? 0.3900 0.3803 0.4181 0.0763  0.0616  -0.0554 22  ILE A CG2   
176  C CD1   . ILE A 22  ? 0.4611 0.4592 0.4846 0.0928  0.0285  -0.0318 22  ILE A CD1   
177  N N     . ILE A 23  ? 0.5480 0.5973 0.6357 0.0745  0.0938  -0.0998 23  ILE A N     
178  C CA    . ILE A 23  ? 0.4172 0.4606 0.5076 0.0768  0.1088  -0.1147 23  ILE A CA    
179  C C     . ILE A 23  ? 0.5058 0.5117 0.5599 0.0711  0.1093  -0.1077 23  ILE A C     
180  O O     . ILE A 23  ? 0.5748 0.5636 0.6328 0.0817  0.1127  -0.1155 23  ILE A O     
181  C CB    . ILE A 23  ? 0.4971 0.5635 0.5941 0.0598  0.1311  -0.1301 23  ILE A CB    
182  C CG1   . ILE A 23  ? 0.5138 0.6204 0.6537 0.0615  0.1326  -0.1400 23  ILE A CG1   
183  C CG2   . ILE A 23  ? 0.4472 0.5120 0.5516 0.0648  0.1471  -0.1494 23  ILE A CG2   
184  C CD1   . ILE A 23  ? 0.4985 0.6285 0.6858 0.0875  0.1250  -0.1554 23  ILE A CD1   
185  N N     . SER A 24  ? 0.4834 0.4773 0.5058 0.0547  0.1058  -0.0947 24  SER A N     
186  C CA    . SER A 24  ? 0.5118 0.4762 0.5065 0.0494  0.1032  -0.0905 24  SER A CA    
187  C C     . SER A 24  ? 0.5315 0.4889 0.5028 0.0381  0.0923  -0.0732 24  SER A C     
188  O O     . SER A 24  ? 0.5275 0.4997 0.4998 0.0326  0.0897  -0.0655 24  SER A O     
189  C CB    . SER A 24  ? 0.6047 0.5668 0.5834 0.0389  0.1183  -0.1070 24  SER A CB    
190  O OG    . SER A 24  ? 0.7674 0.7384 0.7196 0.0220  0.1228  -0.1030 24  SER A OG    
191  N N     . ILE A 25  ? 0.5820 0.5169 0.5370 0.0349  0.0865  -0.0690 25  ILE A N     
192  C CA    . ILE A 25  ? 0.5731 0.5026 0.5103 0.0256  0.0760  -0.0554 25  ILE A CA    
193  C C     . ILE A 25  ? 0.6347 0.5546 0.5506 0.0145  0.0764  -0.0632 25  ILE A C     
194  O O     . ILE A 25  ? 0.7159 0.6215 0.6357 0.0158  0.0803  -0.0748 25  ILE A O     
195  C CB    . ILE A 25  ? 0.6160 0.5321 0.5613 0.0343  0.0663  -0.0426 25  ILE A CB    
196  C CG1   . ILE A 25  ? 0.6889 0.6198 0.6507 0.0457  0.0617  -0.0361 25  ILE A CG1   
197  C CG2   . ILE A 25  ? 0.5401 0.4515 0.4711 0.0241  0.0577  -0.0327 25  ILE A CG2   
198  C CD1   . ILE A 25  ? 0.7392 0.6575 0.7019 0.0565  0.0526  -0.0234 25  ILE A CD1   
199  N N     . GLU A 26  ? 0.5924 0.5197 0.4857 0.0043  0.0721  -0.0584 26  GLU A N     
200  C CA    . GLU A 26  ? 0.6556 0.5797 0.5261 -0.0042 0.0685  -0.0675 26  GLU A CA    
201  C C     . GLU A 26  ? 0.6014 0.5262 0.4616 -0.0084 0.0535  -0.0557 26  GLU A C     
202  O O     . GLU A 26  ? 0.5561 0.4847 0.4161 -0.0073 0.0494  -0.0402 26  GLU A O     
203  C CB    . GLU A 26  ? 0.7437 0.6763 0.5883 -0.0098 0.0783  -0.0761 26  GLU A CB    
204  C CG    . GLU A 26  ? 0.9145 0.8489 0.7722 -0.0060 0.0947  -0.0931 26  GLU A CG    
205  C CD    . GLU A 26  ? 1.0853 1.0290 0.9166 -0.0125 0.1091  -0.1018 26  GLU A CD    
206  O OE1   . GLU A 26  ? 1.1206 1.0655 0.9165 -0.0196 0.1059  -0.0927 26  GLU A OE1   
207  O OE2   . GLU A 26  ? 1.1743 1.1227 1.0194 -0.0094 0.1247  -0.1177 26  GLU A OE2   
208  N N     . ALA A 27  ? 0.6350 0.5578 0.4900 -0.0130 0.0454  -0.0657 27  ALA A N     
209  C CA    . ALA A 27  ? 0.6282 0.5554 0.4815 -0.0153 0.0299  -0.0582 27  ALA A CA    
210  C C     . ALA A 27  ? 0.6984 0.6350 0.5290 -0.0200 0.0186  -0.0709 27  ALA A C     
211  O O     . ALA A 27  ? 0.7231 0.6599 0.5526 -0.0241 0.0215  -0.0913 27  ALA A O     
212  C CB    . ALA A 27  ? 0.5024 0.4211 0.3852 -0.0152 0.0290  -0.0583 27  ALA A CB    
213  N N     . THR A 28  ? 0.6812 0.6255 0.4932 -0.0180 0.0046  -0.0601 28  THR A N     
214  C CA    . THR A 28  ? 0.7016 0.6585 0.4975 -0.0191 -0.0122 -0.0730 28  THR A CA    
215  C C     . THR A 28  ? 0.7093 0.6752 0.5369 -0.0193 -0.0257 -0.0748 28  THR A C     
216  O O     . THR A 28  ? 0.6777 0.6594 0.5081 -0.0209 -0.0408 -0.0910 28  THR A O     
217  C CB    . THR A 28  ? 0.6996 0.6588 0.4493 -0.0137 -0.0215 -0.0614 28  THR A CB    
218  O OG1   . THR A 28  ? 0.7084 0.6613 0.4599 -0.0082 -0.0250 -0.0373 28  THR A OG1   
219  C CG2   . THR A 28  ? 0.6621 0.6134 0.3789 -0.0161 -0.0043 -0.0626 28  THR A CG2   
220  N N     . TYR A 29  ? 0.6760 0.6343 0.5287 -0.0178 -0.0198 -0.0603 29  TYR A N     
221  C CA    . TYR A 29  ? 0.6468 0.6132 0.5311 -0.0190 -0.0279 -0.0624 29  TYR A CA    
222  C C     . TYR A 29  ? 0.5982 0.5501 0.5108 -0.0222 -0.0116 -0.0587 29  TYR A C     
223  O O     . TYR A 29  ? 0.5617 0.5086 0.4813 -0.0181 -0.0089 -0.0426 29  TYR A O     
224  C CB    . TYR A 29  ? 0.5958 0.5688 0.4736 -0.0108 -0.0416 -0.0457 29  TYR A CB    
225  C CG    . TYR A 29  ? 0.5485 0.5364 0.4597 -0.0108 -0.0520 -0.0516 29  TYR A CG    
226  C CD1   . TYR A 29  ? 0.5208 0.5310 0.4451 -0.0128 -0.0672 -0.0723 29  TYR A CD1   
227  C CD2   . TYR A 29  ? 0.5748 0.5577 0.5062 -0.0087 -0.0465 -0.0389 29  TYR A CD2   
228  C CE1   . TYR A 29  ? 0.5313 0.5595 0.4933 -0.0133 -0.0751 -0.0803 29  TYR A CE1   
229  C CE2   . TYR A 29  ? 0.5293 0.5271 0.4931 -0.0090 -0.0528 -0.0456 29  TYR A CE2   
230  C CZ    . TYR A 29  ? 0.5600 0.5809 0.5413 -0.0115 -0.0664 -0.0661 29  TYR A CZ    
231  O OH    . TYR A 29  ? 0.6488 0.6880 0.6691 -0.0123 -0.0706 -0.0746 29  TYR A OH    
232  N N     . PRO A 30  ? 0.5844 0.5270 0.5103 -0.0288 -0.0005 -0.0737 30  PRO A N     
233  C CA    . PRO A 30  ? 0.5496 0.4709 0.4936 -0.0293 0.0165  -0.0678 30  PRO A CA    
234  C C     . PRO A 30  ? 0.5757 0.4979 0.5448 -0.0333 0.0178  -0.0651 30  PRO A C     
235  O O     . PRO A 30  ? 0.6173 0.5214 0.5920 -0.0310 0.0303  -0.0536 30  PRO A O     
236  C CB    . PRO A 30  ? 0.5748 0.4831 0.5254 -0.0356 0.0275  -0.0870 30  PRO A CB    
237  C CG    . PRO A 30  ? 0.5618 0.4918 0.5064 -0.0420 0.0139  -0.1090 30  PRO A CG    
238  C CD    . PRO A 30  ? 0.5774 0.5264 0.4973 -0.0349 -0.0031 -0.0973 30  PRO A CD    
239  N N     . ARG A 31  ? 0.5526 0.4967 0.5357 -0.0378 0.0050  -0.0755 31  ARG A N     
240  C CA    . ARG A 31  ? 0.5563 0.5053 0.5685 -0.0426 0.0086  -0.0759 31  ARG A CA    
241  C C     . ARG A 31  ? 0.6319 0.5763 0.6377 -0.0339 0.0100  -0.0537 31  ARG A C     
242  O O     . ARG A 31  ? 0.6546 0.5953 0.6784 -0.0371 0.0197  -0.0507 31  ARG A O     
243  C CB    . ARG A 31  ? 0.4643 0.4453 0.4980 -0.0464 -0.0088 -0.0941 31  ARG A CB    
244  N N     . MET A 32  ? 0.5568 0.5010 0.5375 -0.0243 0.0026  -0.0396 32  MET A N     
245  C CA    . MET A 32  ? 0.5127 0.4527 0.4913 -0.0178 0.0048  -0.0229 32  MET A CA    
246  C C     . MET A 32  ? 0.4979 0.4161 0.4693 -0.0150 0.0203  -0.0128 32  MET A C     
247  O O     . MET A 32  ? 0.4750 0.3903 0.4433 -0.0098 0.0224  -0.0016 32  MET A O     
248  C CB    . MET A 32  ? 0.4555 0.4018 0.4146 -0.0101 -0.0069 -0.0124 32  MET A CB    
249  C CG    . MET A 32  ? 0.4831 0.4209 0.4192 -0.0082 -0.0031 -0.0089 32  MET A CG    
250  S SD    . MET A 32  ? 0.6072 0.5451 0.5238 -0.0021 -0.0079 0.0062  32  MET A SD    
251  C CE    . MET A 32  ? 0.4272 0.3594 0.3571 0.0013  -0.0001 0.0154  32  MET A CE    
252  N N     . VAL A 33  ? 0.4940 0.3969 0.4614 -0.0167 0.0296  -0.0176 33  VAL A N     
253  C CA    . VAL A 33  ? 0.4745 0.3546 0.4350 -0.0108 0.0425  -0.0078 33  VAL A CA    
254  C C     . VAL A 33  ? 0.5198 0.3834 0.4935 -0.0181 0.0570  -0.0099 33  VAL A C     
255  O O     . VAL A 33  ? 0.5496 0.4006 0.5337 -0.0261 0.0664  -0.0211 33  VAL A O     
256  C CB    . VAL A 33  ? 0.5126 0.3810 0.4638 -0.0061 0.0466  -0.0110 33  VAL A CB    
257  C CG1   . VAL A 33  ? 0.4141 0.2592 0.3571 0.0053  0.0563  0.0012  33  VAL A CG1   
258  C CG2   . VAL A 33  ? 0.4004 0.2868 0.3401 -0.0024 0.0364  -0.0114 33  VAL A CG2   
259  N N     . LEU A 34  ? 0.4579 0.3211 0.4320 -0.0167 0.0610  -0.0008 34  LEU A N     
260  C CA    . LEU A 34  ? 0.4786 0.3302 0.4673 -0.0267 0.0774  -0.0040 34  LEU A CA    
261  C C     . LEU A 34  ? 0.5431 0.3564 0.5208 -0.0262 0.0970  0.0025  34  LEU A C     
262  O O     . LEU A 34  ? 0.5598 0.3581 0.5529 -0.0387 0.1142  -0.0043 34  LEU A O     
263  C CB    . LEU A 34  ? 0.4595 0.3183 0.4470 -0.0246 0.0796  0.0041  34  LEU A CB    
264  C CG    . LEU A 34  ? 0.4863 0.3772 0.4865 -0.0234 0.0623  -0.0010 34  LEU A CG    
265  C CD1   . LEU A 34  ? 0.4864 0.3823 0.4936 -0.0243 0.0704  0.0015  34  LEU A CD1   
266  C CD2   . LEU A 34  ? 0.3905 0.3028 0.4162 -0.0319 0.0524  -0.0186 34  LEU A CD2   
267  N N     . THR A 35  ? 0.5677 0.3649 0.5210 -0.0113 0.0947  0.0152  35  THR A N     
268  C CA    . THR A 35  ? 0.5912 0.3479 0.5288 -0.0050 0.1110  0.0255  35  THR A CA    
269  C C     . THR A 35  ? 0.6238 0.3674 0.5702 -0.0065 0.1136  0.0147  35  THR A C     
270  O O     . THR A 35  ? 0.6225 0.3290 0.5573 0.0013  0.1262  0.0228  35  THR A O     
271  C CB    . THR A 35  ? 0.5868 0.3351 0.4945 0.0159  0.1046  0.0440  35  THR A CB    
272  O OG1   . THR A 35  ? 0.5421 0.3206 0.4524 0.0236  0.0847  0.0393  35  THR A OG1   
273  C CG2   . THR A 35  ? 0.4882 0.2383 0.3811 0.0174  0.1082  0.0547  35  THR A CG2   
274  N N     . GLY A 36  ? 0.5639 0.3357 0.5274 -0.0148 0.1017  -0.0033 36  GLY A N     
275  C CA    . GLY A 36  ? 0.6074 0.3701 0.5805 -0.0191 0.1051  -0.0190 36  GLY A CA    
276  C C     . GLY A 36  ? 0.6024 0.3790 0.5649 -0.0070 0.0923  -0.0205 36  GLY A C     
277  O O     . GLY A 36  ? 0.6729 0.4401 0.6210 0.0095  0.0910  -0.0070 36  GLY A O     
278  N N     . PHE A 37  ? 0.5756 0.3760 0.5448 -0.0147 0.0831  -0.0380 37  PHE A N     
279  C CA    . PHE A 37  ? 0.6097 0.4264 0.5673 -0.0056 0.0736  -0.0389 37  PHE A CA    
280  C C     . PHE A 37  ? 0.6240 0.4184 0.5808 0.0045  0.0834  -0.0424 37  PHE A C     
281  O O     . PHE A 37  ? 0.6411 0.4405 0.5910 0.0186  0.0801  -0.0346 37  PHE A O     
282  C CB    . PHE A 37  ? 0.5287 0.3735 0.4851 -0.0154 0.0623  -0.0549 37  PHE A CB    
283  C CG    . PHE A 37  ? 0.5370 0.3946 0.4788 -0.0088 0.0583  -0.0573 37  PHE A CG    
284  C CD1   . PHE A 37  ? 0.5885 0.4604 0.5202 -0.0014 0.0518  -0.0433 37  PHE A CD1   
285  C CD2   . PHE A 37  ? 0.5721 0.4268 0.5123 -0.0112 0.0638  -0.0753 37  PHE A CD2   
286  C CE1   . PHE A 37  ? 0.6333 0.5166 0.5551 0.0024  0.0526  -0.0464 37  PHE A CE1   
287  C CE2   . PHE A 37  ? 0.6608 0.5274 0.5881 -0.0062 0.0641  -0.0785 37  PHE A CE2   
288  C CZ    . PHE A 37  ? 0.6744 0.5555 0.5932 0.0001  0.0594  -0.0635 37  PHE A CZ    
289  N N     . GLU A 38  ? 0.6573 0.4285 0.6252 -0.0025 0.0956  -0.0562 38  GLU A N     
290  C CA    . GLU A 38  ? 0.6980 0.4447 0.6678 0.0084  0.1058  -0.0611 38  GLU A CA    
291  C C     . GLU A 38  ? 0.7203 0.4437 0.6817 0.0294  0.1088  -0.0381 38  GLU A C     
292  O O     . GLU A 38  ? 0.6959 0.4220 0.6563 0.0460  0.1061  -0.0367 38  GLU A O     
293  C CB    . GLU A 38  ? 0.6348 0.3529 0.6201 -0.0037 0.1210  -0.0791 38  GLU A CB    
294  N N     . GLN A 39  ? 0.6928 0.3959 0.6478 0.0290  0.1140  -0.0216 39  GLN A N     
295  C CA    . GLN A 39  ? 0.7472 0.4297 0.6855 0.0495  0.1141  0.0021  39  GLN A CA    
296  C C     . GLN A 39  ? 0.6785 0.3972 0.6098 0.0635  0.0957  0.0091  39  GLN A C     
297  O O     . GLN A 39  ? 0.6854 0.4006 0.6131 0.0847  0.0909  0.0158  39  GLN A O     
298  C CB    . GLN A 39  ? 0.8140 0.4757 0.7421 0.0418  0.1236  0.0168  39  GLN A CB    
299  C CG    . GLN A 39  ? 1.2911 0.9128 1.2309 0.0255  0.1469  0.0093  39  GLN A CG    
300  C CD    . GLN A 39  ? 1.0208 0.6662 0.9860 -0.0027 0.1492  -0.0134 39  GLN A CD    
301  O OE1   . GLN A 39  ? 0.8396 0.5196 0.8172 -0.0101 0.1365  -0.0330 39  GLN A OE1   
302  N NE2   . GLN A 39  ? 1.1268 0.7525 1.0989 -0.0174 0.1662  -0.0112 39  GLN A NE2   
303  N N     . LEU A 40  ? 0.6008 0.3545 0.5333 0.0517  0.0855  0.0059  40  LEU A N     
304  C CA    . LEU A 40  ? 0.6589 0.4456 0.5888 0.0602  0.0710  0.0097  40  LEU A CA    
305  C C     . LEU A 40  ? 0.6824 0.4860 0.6234 0.0672  0.0687  -0.0030 40  LEU A C     
306  O O     . LEU A 40  ? 0.7260 0.5432 0.6704 0.0830  0.0618  0.0001  40  LEU A O     
307  C CB    . LEU A 40  ? 0.6536 0.4680 0.5839 0.0448  0.0633  0.0078  40  LEU A CB    
308  C CG    . LEU A 40  ? 0.6473 0.4926 0.5773 0.0502  0.0513  0.0104  40  LEU A CG    
309  C CD1   . LEU A 40  ? 0.5566 0.4107 0.4810 0.0457  0.0455  0.0192  40  LEU A CD1   
310  C CD2   . LEU A 40  ? 0.6550 0.5233 0.5908 0.0414  0.0494  -0.0024 40  LEU A CD2   
311  N N     . LYS A 41  ? 0.6059 0.4108 0.5536 0.0551  0.0750  -0.0194 41  LYS A N     
312  C CA    . LYS A 41  ? 0.6074 0.4263 0.5639 0.0592  0.0773  -0.0340 41  LYS A CA    
313  C C     . LYS A 41  ? 0.6632 0.4616 0.6291 0.0804  0.0823  -0.0332 41  LYS A C     
314  O O     . LYS A 41  ? 0.6598 0.4774 0.6368 0.0942  0.0786  -0.0367 41  LYS A O     
315  C CB    . LYS A 41  ? 0.6369 0.4560 0.5928 0.0421  0.0836  -0.0528 41  LYS A CB    
316  C CG    . LYS A 41  ? 0.6183 0.4531 0.5772 0.0417  0.0887  -0.0708 41  LYS A CG    
317  C CD    . LYS A 41  ? 0.6218 0.4561 0.5734 0.0249  0.0924  -0.0897 41  LYS A CD    
318  C CE    . LYS A 41  ? 0.7701 0.6173 0.7195 0.0245  0.1006  -0.1096 41  LYS A CE    
319  N NZ    . LYS A 41  ? 0.8947 0.7726 0.8305 0.0213  0.0973  -0.1058 41  LYS A NZ    
320  N N     . LYS A 42  ? 0.7049 0.4633 0.6684 0.0834  0.0914  -0.0290 42  LYS A N     
321  C CA    . LYS A 42  ? 0.7303 0.4602 0.6999 0.1059  0.0967  -0.0258 42  LYS A CA    
322  C C     . LYS A 42  ? 0.8030 0.5393 0.7664 0.1300  0.0838  -0.0075 42  LYS A C     
323  O O     . LYS A 42  ? 0.8597 0.6019 0.8357 0.1517  0.0795  -0.0107 42  LYS A O     
324  C CB    . LYS A 42  ? 0.7554 0.4340 0.7207 0.1018  0.1119  -0.0224 42  LYS A CB    
325  C CG    . LYS A 42  ? 0.8773 0.5135 0.8403 0.1283  0.1174  -0.0099 42  LYS A CG    
326  N N     . GLU A 43  ? 0.7618 0.5006 0.7074 0.1270  0.0766  0.0091  43  GLU A N     
327  C CA    . GLU A 43  ? 0.6991 0.4454 0.6347 0.1499  0.0625  0.0243  43  GLU A CA    
328  C C     . GLU A 43  ? 0.6658 0.4643 0.6187 0.1541  0.0479  0.0142  43  GLU A C     
329  O O     . GLU A 43  ? 0.6806 0.4918 0.6426 0.1777  0.0372  0.0143  43  GLU A O     
330  C CB    . GLU A 43  ? 0.7671 0.5005 0.6761 0.1447  0.0611  0.0427  43  GLU A CB    
331  C CG    . GLU A 43  ? 0.8666 0.5454 0.7556 0.1442  0.0772  0.0572  43  GLU A CG    
332  C CD    . GLU A 43  ? 0.9957 0.6352 0.8710 0.1741  0.0782  0.0714  43  GLU A CD    
333  O OE1   . GLU A 43  ? 0.9817 0.6415 0.8617 0.1993  0.0617  0.0714  43  GLU A OE1   
334  O OE2   . GLU A 43  ? 1.1260 0.7128 0.9871 0.1729  0.0961  0.0822  43  GLU A OE2   
335  N N     . LEU A 44  ? 0.6360 0.4644 0.5941 0.1318  0.0473  0.0057  44  LEU A N     
336  C CA    . LEU A 44  ? 0.5803 0.4533 0.5524 0.1319  0.0363  -0.0011 44  LEU A CA    
337  C C     . LEU A 44  ? 0.5803 0.4810 0.5805 0.1342  0.0397  -0.0202 44  LEU A C     
338  O O     . LEU A 44  ? 0.6052 0.5417 0.6249 0.1401  0.0318  -0.0277 44  LEU A O     
339  C CB    . LEU A 44  ? 0.5029 0.3909 0.4677 0.1084  0.0361  -0.0004 44  LEU A CB    
340  C CG    . LEU A 44  ? 0.5396 0.4120 0.4828 0.1056  0.0322  0.0152  44  LEU A CG    
341  C CD1   . LEU A 44  ? 0.5183 0.4147 0.4631 0.0882  0.0287  0.0129  44  LEU A CD1   
342  C CD2   . LEU A 44  ? 0.5315 0.3991 0.4641 0.1290  0.0215  0.0262  44  LEU A CD2   
343  N N     . THR A 45  ? 0.5396 0.4256 0.5438 0.1279  0.0531  -0.0307 45  THR A N     
344  C CA    . THR A 45  ? 0.5549 0.4651 0.5832 0.1279  0.0609  -0.0506 45  THR A CA    
345  C C     . THR A 45  ? 0.6042 0.5271 0.6587 0.1559  0.0541  -0.0561 45  THR A C     
346  O O     . THR A 45  ? 0.6816 0.5746 0.7335 0.1763  0.0522  -0.0494 45  THR A O     
347  C CB    . THR A 45  ? 0.5830 0.4711 0.6069 0.1177  0.0764  -0.0625 45  THR A CB    
348  O OG1   . THR A 45  ? 0.6196 0.5006 0.6211 0.0941  0.0789  -0.0593 45  THR A OG1   
349  C CG2   . THR A 45  ? 0.4730 0.3875 0.5181 0.1163  0.0871  -0.0843 45  THR A CG2   
350  N N     . GLY A 46  ? 0.5632 0.5302 0.6447 0.1570  0.0511  -0.0689 46  GLY A N     
351  C CA    . GLY A 46  ? 0.4894 0.4796 0.6041 0.1837  0.0426  -0.0789 46  GLY A CA    
352  C C     . GLY A 46  ? 0.5198 0.5298 0.6360 0.1980  0.0207  -0.0698 46  GLY A C     
353  O O     . GLY A 46  ? 0.5504 0.5887 0.6961 0.2214  0.0082  -0.0793 46  GLY A O     
354  N N     . LYS A 47  ? 0.5227 0.5201 0.6085 0.1851  0.0153  -0.0535 47  LYS A N     
355  C CA    . LYS A 47  ? 0.5542 0.5669 0.6342 0.1975  -0.0051 -0.0453 47  LYS A CA    
356  C C     . LYS A 47  ? 0.5050 0.5638 0.6086 0.1797  -0.0067 -0.0595 47  LYS A C     
357  O O     . LYS A 47  ? 0.4558 0.5199 0.5629 0.1540  0.0091  -0.0658 47  LYS A O     
358  C CB    . LYS A 47  ? 0.6068 0.5799 0.6415 0.1935  -0.0077 -0.0216 47  LYS A CB    
359  C CG    . LYS A 47  ? 0.6925 0.6202 0.7017 0.2175  -0.0103 -0.0041 47  LYS A CG    
360  N N     . THR A 48  ? 0.5136 0.6036 0.6311 0.1936  -0.0259 -0.0647 48  THR A N     
361  C CA    . THR A 48  ? 0.4602 0.5931 0.6047 0.1764  -0.0271 -0.0806 48  THR A CA    
362  C C     . THR A 48  ? 0.4993 0.6239 0.6154 0.1660  -0.0354 -0.0688 48  THR A C     
363  O O     . THR A 48  ? 0.5438 0.6510 0.6305 0.1833  -0.0504 -0.0549 48  THR A O     
364  C CB    . THR A 48  ? 0.4912 0.6753 0.6826 0.1968  -0.0428 -0.1029 48  THR A CB    
365  O OG1   . THR A 48  ? 0.5601 0.7583 0.7864 0.2003  -0.0296 -0.1186 48  THR A OG1   
366  C CG2   . THR A 48  ? 0.4004 0.6288 0.6220 0.1788  -0.0456 -0.1213 48  THR A CG2   
367  N N     . ILE A 49  ? 0.4869 0.6207 0.6096 0.1381  -0.0239 -0.0739 49  ILE A N     
368  C CA    . ILE A 49  ? 0.4398 0.5678 0.5419 0.1276  -0.0301 -0.0663 49  ILE A CA    
369  C C     . ILE A 49  ? 0.4971 0.6650 0.6219 0.1396  -0.0500 -0.0822 49  ILE A C     
370  O O     . ILE A 49  ? 0.5575 0.7664 0.7271 0.1344  -0.0491 -0.1050 49  ILE A O     
371  C CB    . ILE A 49  ? 0.4414 0.5637 0.5443 0.0970  -0.0122 -0.0664 49  ILE A CB    
372  C CG1   . ILE A 49  ? 0.4870 0.5727 0.5637 0.0882  0.0030  -0.0523 49  ILE A CG1   
373  C CG2   . ILE A 49  ? 0.4189 0.5353 0.5056 0.0875  -0.0183 -0.0607 49  ILE A CG2   
374  C CD1   . ILE A 49  ? 0.5440 0.6197 0.6127 0.0629  0.0177  -0.0488 49  ILE A CD1   
375  N N     . GLN A 50  ? 0.4840 0.6411 0.5780 0.1557  -0.0672 -0.0716 50  GLN A N     
376  C CA    . GLN A 50  ? 0.5092 0.7039 0.6168 0.1730  -0.0910 -0.0869 50  GLN A CA    
377  C C     . GLN A 50  ? 0.5308 0.7366 0.6365 0.1549  -0.0932 -0.0947 50  GLN A C     
378  O O     . GLN A 50  ? 0.5767 0.8222 0.7050 0.1602  -0.1097 -0.1157 50  GLN A O     
379  C CB    . GLN A 50  ? 0.5420 0.7173 0.6103 0.2061  -0.1098 -0.0707 50  GLN A CB    
380  C CG    . GLN A 50  ? 0.7102 0.8809 0.7873 0.2316  -0.1137 -0.0676 50  GLN A CG    
381  C CD    . GLN A 50  ? 0.9881 1.1386 1.0232 0.2675  -0.1346 -0.0508 50  GLN A CD    
382  O OE1   . GLN A 50  ? 1.0670 1.2119 1.0656 0.2727  -0.1464 -0.0434 50  GLN A OE1   
383  N NE2   . GLN A 50  ? 1.0879 1.2250 1.1254 0.2935  -0.1382 -0.0444 50  GLN A NE2   
384  N N     . GLY A 51  ? 0.4685 0.6402 0.5488 0.1346  -0.0777 -0.0797 51  GLY A N     
385  C CA    . GLY A 51  ? 0.4074 0.5850 0.4858 0.1194  -0.0788 -0.0868 51  GLY A CA    
386  C C     . GLY A 51  ? 0.4489 0.5852 0.4983 0.1020  -0.0622 -0.0673 51  GLY A C     
387  O O     . GLY A 51  ? 0.4583 0.5626 0.4836 0.1051  -0.0538 -0.0482 51  GLY A O     
388  N N     . ILE A 52  ? 0.3970 0.5354 0.4524 0.0846  -0.0580 -0.0744 52  ILE A N     
389  C CA    . ILE A 52  ? 0.4253 0.5297 0.4571 0.0710  -0.0460 -0.0589 52  ILE A CA    
390  C C     . ILE A 52  ? 0.4804 0.5861 0.4983 0.0712  -0.0534 -0.0643 52  ILE A C     
391  O O     . ILE A 52  ? 0.4808 0.6113 0.5226 0.0647  -0.0585 -0.0851 52  ILE A O     
392  C CB    . ILE A 52  ? 0.4415 0.5380 0.4939 0.0472  -0.0283 -0.0597 52  ILE A CB    
393  C CG1   . ILE A 52  ? 0.5157 0.6258 0.5936 0.0432  -0.0198 -0.0658 52  ILE A CG1   
394  C CG2   . ILE A 52  ? 0.3545 0.4141 0.3796 0.0402  -0.0184 -0.0393 52  ILE A CG2   
395  C CD1   . ILE A 52  ? 0.5295 0.6190 0.5877 0.0506  -0.0146 -0.0501 52  ILE A CD1   
396  N N     . SER A 53  ? 0.4528 0.5314 0.4340 0.0769  -0.0517 -0.0478 53  SER A N     
397  C CA    . SER A 53  ? 0.4463 0.5239 0.4116 0.0764  -0.0552 -0.0531 53  SER A CA    
398  C C     . SER A 53  ? 0.4638 0.5133 0.4219 0.0625  -0.0403 -0.0414 53  SER A C     
399  O O     . SER A 53  ? 0.4873 0.5204 0.4515 0.0541  -0.0299 -0.0299 53  SER A O     
400  C CB    . SER A 53  ? 0.4815 0.5554 0.4066 0.0981  -0.0664 -0.0463 53  SER A CB    
401  O OG    . SER A 53  ? 0.6283 0.7296 0.5599 0.1156  -0.0840 -0.0565 53  SER A OG    
402  N N     . ARG A 54  ? 0.4719 0.5178 0.4165 0.0618  -0.0401 -0.0460 54  ARG A N     
403  C CA    . ARG A 54  ? 0.4786 0.5029 0.4218 0.0509  -0.0276 -0.0387 54  ARG A CA    
404  C C     . ARG A 54  ? 0.5495 0.5672 0.4634 0.0578  -0.0264 -0.0387 54  ARG A C     
405  O O     . ARG A 54  ? 0.5609 0.5940 0.4602 0.0670  -0.0362 -0.0502 54  ARG A O     
406  C CB    . ARG A 54  ? 0.4809 0.5089 0.4559 0.0357  -0.0233 -0.0511 54  ARG A CB    
407  C CG    . ARG A 54  ? 0.4831 0.4884 0.4606 0.0276  -0.0124 -0.0423 54  ARG A CG    
408  C CD    . ARG A 54  ? 0.4695 0.4733 0.4733 0.0163  -0.0085 -0.0553 54  ARG A CD    
409  N NE    . ARG A 54  ? 0.4597 0.4835 0.4721 0.0161  -0.0148 -0.0785 54  ARG A NE    
410  C CZ    . ARG A 54  ? 0.4804 0.5099 0.4774 0.0221  -0.0177 -0.0892 54  ARG A CZ    
411  N NH1   . ARG A 54  ? 0.4880 0.5039 0.4614 0.0281  -0.0123 -0.0779 54  ARG A NH1   
412  N NH2   . ARG A 54  ? 0.4610 0.5114 0.4671 0.0212  -0.0250 -0.1137 54  ARG A NH2   
413  N N     . ARG A 55  ? 0.5336 0.5305 0.4391 0.0534  -0.0141 -0.0272 55  ARG A N     
414  C CA    . ARG A 55  ? 0.4740 0.4643 0.3560 0.0566  -0.0076 -0.0287 55  ARG A CA    
415  C C     . ARG A 55  ? 0.4929 0.4715 0.3946 0.0454  0.0048  -0.0273 55  ARG A C     
416  O O     . ARG A 55  ? 0.5161 0.4821 0.4232 0.0418  0.0115  -0.0143 55  ARG A O     
417  C CB    . ARG A 55  ? 0.5248 0.5000 0.3684 0.0679  -0.0036 -0.0128 55  ARG A CB    
418  C CG    . ARG A 55  ? 0.5525 0.5186 0.3635 0.0717  0.0064  -0.0126 55  ARG A CG    
419  C CD    . ARG A 55  ? 0.5077 0.4918 0.2972 0.0813  -0.0055 -0.0284 55  ARG A CD    
420  N NE    . ARG A 55  ? 0.5337 0.5054 0.2850 0.0844  0.0080  -0.0265 55  ARG A NE    
421  C CZ    . ARG A 55  ? 0.5720 0.5461 0.3319 0.0755  0.0196  -0.0396 55  ARG A CZ    
422  N NH1   . ARG A 55  ? 0.5462 0.5318 0.3515 0.0641  0.0180  -0.0547 55  ARG A NH1   
423  N NH2   . ARG A 55  ? 0.5967 0.5591 0.3178 0.0786  0.0347  -0.0374 55  ARG A NH2   
424  N N     . GLY A 56  ? 0.4129 0.3972 0.3282 0.0408  0.0066  -0.0425 56  GLY A N     
425  C CA    . GLY A 56  ? 0.4571 0.4324 0.3981 0.0331  0.0149  -0.0431 56  GLY A CA    
426  C C     . GLY A 56  ? 0.4736 0.4437 0.4379 0.0274  0.0108  -0.0345 56  GLY A C     
427  O O     . GLY A 56  ? 0.4829 0.4594 0.4565 0.0248  0.0042  -0.0391 56  GLY A O     
428  N N     . LYS A 57  ? 0.4365 0.3965 0.4090 0.0255  0.0152  -0.0230 57  LYS A N     
429  C CA    . LYS A 57  ? 0.4665 0.4202 0.4526 0.0215  0.0112  -0.0138 57  LYS A CA    
430  C C     . LYS A 57  ? 0.4578 0.4114 0.4302 0.0225  0.0089  -0.0028 57  LYS A C     
431  O O     . LYS A 57  ? 0.4513 0.3998 0.4295 0.0194  0.0069  0.0047  57  LYS A O     
432  C CB    . LYS A 57  ? 0.4258 0.3715 0.4289 0.0211  0.0130  -0.0095 57  LYS A CB    
433  C CG    . LYS A 57  ? 0.4029 0.3455 0.4247 0.0221  0.0155  -0.0202 57  LYS A CG    
434  C CD    . LYS A 57  ? 0.3761 0.3169 0.4156 0.0259  0.0164  -0.0177 57  LYS A CD    
435  C CE    . LYS A 57  ? 0.4311 0.3712 0.4901 0.0293  0.0215  -0.0313 57  LYS A CE    
436  N NZ    . LYS A 57  ? 0.4075 0.3537 0.4881 0.0346  0.0230  -0.0326 57  LYS A NZ    
437  N N     . TYR A 58  ? 0.4581 0.4151 0.4100 0.0280  0.0096  -0.0017 58  TYR A N     
438  C CA    . TYR A 58  ? 0.4178 0.3717 0.3581 0.0309  0.0083  0.0076  58  TYR A CA    
439  C C     . TYR A 58  ? 0.4627 0.4276 0.4039 0.0340  0.0005  0.0036  58  TYR A C     
440  O O     . TYR A 58  ? 0.4910 0.4678 0.4260 0.0399  -0.0052 -0.0052 58  TYR A O     
441  C CB    . TYR A 58  ? 0.4133 0.3588 0.3293 0.0373  0.0144  0.0135  58  TYR A CB    
442  C CG    . TYR A 58  ? 0.4475 0.3840 0.3658 0.0325  0.0260  0.0159  58  TYR A CG    
443  C CD1   . TYR A 58  ? 0.4017 0.3424 0.3249 0.0309  0.0313  0.0076  58  TYR A CD1   
444  C CD2   . TYR A 58  ? 0.4200 0.3456 0.3391 0.0289  0.0331  0.0234  58  TYR A CD2   
445  C CE1   . TYR A 58  ? 0.4648 0.4016 0.3963 0.0261  0.0439  0.0071  58  TYR A CE1   
446  C CE2   . TYR A 58  ? 0.4343 0.3560 0.3625 0.0228  0.0451  0.0221  58  TYR A CE2   
447  C CZ    . TYR A 58  ? 0.4480 0.3766 0.3836 0.0216  0.0506  0.0141  58  TYR A CZ    
448  O OH    . TYR A 58  ? 0.5228 0.4518 0.4734 0.0151  0.0638  0.0102  58  TYR A OH    
449  N N     . LEU A 59  ? 0.4440 0.4077 0.3930 0.0306  0.0001  0.0082  59  LEU A N     
450  C CA    . LEU A 59  ? 0.4666 0.4429 0.4196 0.0342  -0.0047 0.0037  59  LEU A CA    
451  C C     . LEU A 59  ? 0.4896 0.4624 0.4244 0.0464  -0.0066 0.0096  59  LEU A C     
452  O O     . LEU A 59  ? 0.5647 0.5203 0.4874 0.0471  -0.0005 0.0195  59  LEU A O     
453  C CB    . LEU A 59  ? 0.4717 0.4468 0.4371 0.0260  -0.0011 0.0058  59  LEU A CB    
454  C CG    . LEU A 59  ? 0.5552 0.5321 0.5376 0.0157  0.0016  0.0003  59  LEU A CG    
455  C CD1   . LEU A 59  ? 0.6137 0.5844 0.5976 0.0086  0.0079  0.0060  59  LEU A CD1   
456  C CD2   . LEU A 59  ? 0.5155 0.5121 0.5140 0.0154  -0.0019 -0.0153 59  LEU A CD2   
457  N N     . ILE A 60  ? 0.4409 0.4294 0.3756 0.0566  -0.0152 0.0027  60  ILE A N     
458  C CA    . ILE A 60  ? 0.4206 0.4028 0.3362 0.0724  -0.0187 0.0098  60  ILE A CA    
459  C C     . ILE A 60  ? 0.5151 0.5159 0.4497 0.0784  -0.0251 0.0021  60  ILE A C     
460  O O     . ILE A 60  ? 0.5950 0.6224 0.5437 0.0833  -0.0355 -0.0118 60  ILE A O     
461  C CB    . ILE A 60  ? 0.5005 0.4845 0.3906 0.0860  -0.0261 0.0094  60  ILE A CB    
462  C CG1   . ILE A 60  ? 0.4787 0.4487 0.3542 0.0782  -0.0170 0.0129  60  ILE A CG1   
463  C CG2   . ILE A 60  ? 0.4028 0.3733 0.2669 0.1059  -0.0300 0.0207  60  ILE A CG2   
464  C CD1   . ILE A 60  ? 0.4915 0.4685 0.3423 0.0884  -0.0235 0.0074  60  ILE A CD1   
465  N N     . PHE A 61  ? 0.4560 0.4464 0.3952 0.0771  -0.0183 0.0076  61  PHE A N     
466  C CA    . PHE A 61  ? 0.4171 0.4251 0.3757 0.0842  -0.0219 -0.0008 61  PHE A CA    
467  C C     . PHE A 61  ? 0.4360 0.4395 0.3786 0.1078  -0.0312 0.0042  61  PHE A C     
468  O O     . PHE A 61  ? 0.5077 0.4806 0.4252 0.1142  -0.0257 0.0188  61  PHE A O     
469  C CB    . PHE A 61  ? 0.4645 0.4629 0.4319 0.0743  -0.0100 0.0010  61  PHE A CB    
470  C CG    . PHE A 61  ? 0.4541 0.4532 0.4303 0.0541  -0.0016 -0.0009 61  PHE A CG    
471  C CD1   . PHE A 61  ? 0.4425 0.4228 0.4046 0.0450  0.0023  0.0081  61  PHE A CD1   
472  C CD2   . PHE A 61  ? 0.4949 0.5124 0.4935 0.0452  0.0034  -0.0115 61  PHE A CD2   
473  C CE1   . PHE A 61  ? 0.4921 0.4701 0.4586 0.0306  0.0076  0.0086  61  PHE A CE1   
474  C CE2   . PHE A 61  ? 0.5328 0.5440 0.5326 0.0284  0.0124  -0.0096 61  PHE A CE2   
475  C CZ    . PHE A 61  ? 0.5230 0.5133 0.5049 0.0227  0.0129  0.0015  61  PHE A CZ    
476  N N     . GLU A 62  ? 0.4354 0.4687 0.3933 0.1211  -0.0451 -0.0084 62  GLU A N     
477  C CA    . GLU A 62  ? 0.5118 0.5439 0.4566 0.1482  -0.0576 -0.0043 62  GLU A CA    
478  C C     . GLU A 62  ? 0.5013 0.5411 0.4727 0.1547  -0.0548 -0.0103 62  GLU A C     
479  O O     . GLU A 62  ? 0.4797 0.5551 0.4891 0.1511  -0.0575 -0.0290 62  GLU A O     
480  C CB    . GLU A 62  ? 0.5931 0.6577 0.5393 0.1620  -0.0781 -0.0172 62  GLU A CB    
481  C CG    . GLU A 62  ? 0.6692 0.7290 0.5954 0.1498  -0.0767 -0.0165 62  GLU A CG    
482  C CD    . GLU A 62  ? 0.7685 0.8665 0.7052 0.1549  -0.0946 -0.0370 62  GLU A CD    
483  O OE1   . GLU A 62  ? 0.7718 0.9075 0.7441 0.1610  -0.1065 -0.0562 62  GLU A OE1   
484  O OE2   . GLU A 62  ? 0.8158 0.9079 0.7277 0.1520  -0.0960 -0.0365 62  GLU A OE2   
485  N N     . ILE A 63  ? 0.5103 0.5149 0.4637 0.1615  -0.0459 0.0042  63  ILE A N     
486  C CA    . ILE A 63  ? 0.5580 0.5617 0.5332 0.1650  -0.0387 -0.0011 63  ILE A CA    
487  C C     . ILE A 63  ? 0.6462 0.6300 0.6074 0.1944  -0.0461 0.0083  63  ILE A C     
488  O O     . ILE A 63  ? 0.6652 0.6054 0.5933 0.1994  -0.0390 0.0269  63  ILE A O     
489  C CB    . ILE A 63  ? 0.6121 0.5894 0.5825 0.1435  -0.0189 0.0040  63  ILE A CB    
490  C CG1   . ILE A 63  ? 0.5461 0.5356 0.5217 0.1176  -0.0132 -0.0002 63  ILE A CG1   
491  C CG2   . ILE A 63  ? 0.5880 0.5694 0.5821 0.1450  -0.0103 -0.0063 63  ILE A CG2   
492  C CD1   . ILE A 63  ? 0.5488 0.5196 0.5203 0.0988  0.0020  0.0024  63  ILE A CD1   
493  N N     . GLY A 64  ? 0.7366 0.7522 0.7256 0.2142  -0.0596 -0.0053 64  GLY A N     
494  C CA    . GLY A 64  ? 0.8238 0.8258 0.8003 0.2492  -0.0730 0.0031  64  GLY A CA    
495  C C     . GLY A 64  ? 0.8884 0.8887 0.8282 0.2646  -0.0908 0.0139  64  GLY A C     
496  O O     . GLY A 64  ? 0.8962 0.9151 0.8320 0.2479  -0.0933 0.0085  64  GLY A O     
497  N N     . ASP A 65  ? 0.9527 0.9272 0.8619 0.2971  -0.1023 0.0298  65  ASP A N     
498  C CA    . ASP A 65  ? 0.9899 0.9604 0.8547 0.3143  -0.1193 0.0413  65  ASP A CA    
499  C C     . ASP A 65  ? 0.9093 0.8235 0.7206 0.3027  -0.1004 0.0672  65  ASP A C     
500  O O     . ASP A 65  ? 0.9598 0.8734 0.7364 0.3012  -0.1053 0.0730  65  ASP A O     
501  C CB    . ASP A 65  ? 1.1750 1.1478 1.0306 0.3459  -0.1384 0.0444  65  ASP A CB    
502  C CG    . ASP A 65  ? 1.2625 1.3023 1.1698 0.3555  -0.1611 0.0146  65  ASP A CG    
503  O OD1   . ASP A 65  ? 1.2528 1.3314 1.1616 0.3523  -0.1770 0.0001  65  ASP A OD1   
504  O OD2   . ASP A 65  ? 1.3026 1.3570 1.2515 0.3643  -0.1613 0.0035  65  ASP A OD2   
505  N N     . ASP A 66  ? 0.7796 0.6493 0.5878 0.2925  -0.0772 0.0795  66  ASP A N     
506  C CA    . ASP A 66  ? 0.8526 0.6653 0.6131 0.2860  -0.0579 0.1041  66  ASP A CA    
507  C C     . ASP A 66  ? 0.7446 0.5487 0.5144 0.2475  -0.0345 0.1013  66  ASP A C     
508  O O     . ASP A 66  ? 0.8443 0.6063 0.5818 0.2388  -0.0165 0.1181  66  ASP A O     
509  C CB    . ASP A 66  ? 1.0308 0.7961 0.7811 0.2975  -0.0462 0.1187  66  ASP A CB    
510  C CG    . ASP A 66  ? 1.1312 0.8950 0.9241 0.2959  -0.0379 0.1072  66  ASP A CG    
511  O OD1   . ASP A 66  ? 1.0696 0.8836 0.9072 0.2864  -0.0455 0.0836  66  ASP A OD1   
512  O OD2   . ASP A 66  ? 1.2410 0.9597 1.0286 0.2942  -0.0205 0.1171  66  ASP A OD2   
513  N N     . PHE A 67  ? 0.6146 0.4576 0.4277 0.2252  -0.0341 0.0803  67  PHE A N     
514  C CA    . PHE A 67  ? 0.6419 0.4775 0.4647 0.1927  -0.0151 0.0775  67  PHE A CA    
515  C C     . PHE A 67  ? 0.6246 0.4988 0.4623 0.1746  -0.0211 0.0642  67  PHE A C     
516  O O     . PHE A 67  ? 0.6159 0.5309 0.4764 0.1789  -0.0362 0.0492  67  PHE A O     
517  C CB    . PHE A 67  ? 0.7446 0.5769 0.5992 0.1809  -0.0036 0.0679  67  PHE A CB    
518  C CG    . PHE A 67  ? 0.9050 0.6873 0.7450 0.1876  0.0113  0.0805  67  PHE A CG    
519  C CD1   . PHE A 67  ? 0.9224 0.6644 0.7352 0.1768  0.0283  0.0953  67  PHE A CD1   
520  C CD2   . PHE A 67  ? 0.9228 0.6966 0.7778 0.2052  0.0100  0.0769  67  PHE A CD2   
521  C CE1   . PHE A 67  ? 0.9643 0.6555 0.7648 0.1812  0.0451  0.1066  67  PHE A CE1   
522  C CE2   . PHE A 67  ? 0.9551 0.6772 0.7969 0.2115  0.0253  0.0884  67  PHE A CE2   
523  C CZ    . PHE A 67  ? 0.9736 0.6526 0.7876 0.1987  0.0435  0.1036  67  PHE A CZ    
524  N N     . ARG A 68  ? 0.6430 0.5040 0.4709 0.1541  -0.0080 0.0686  68  ARG A N     
525  C CA    . ARG A 68  ? 0.5753 0.4662 0.4200 0.1355  -0.0107 0.0566  68  ARG A CA    
526  C C     . ARG A 68  ? 0.5400 0.4212 0.3991 0.1118  0.0044  0.0551  68  ARG A C     
527  O O     . ARG A 68  ? 0.5468 0.3972 0.3937 0.1061  0.0185  0.0643  68  ARG A O     
528  C CB    . ARG A 68  ? 0.6148 0.5068 0.4326 0.1384  -0.0144 0.0606  68  ARG A CB    
529  C CG    . ARG A 68  ? 0.5769 0.5036 0.3966 0.1528  -0.0355 0.0491  68  ARG A CG    
530  C CD    . ARG A 68  ? 0.6064 0.5232 0.4017 0.1809  -0.0465 0.0580  68  ARG A CD    
531  N NE    . ARG A 68  ? 0.6977 0.6516 0.4950 0.1974  -0.0700 0.0447  68  ARG A NE    
532  C CZ    . ARG A 68  ? 0.7775 0.7561 0.5959 0.2160  -0.0867 0.0353  68  ARG A CZ    
533  N NH1   . ARG A 68  ? 0.7954 0.7631 0.6340 0.2196  -0.0804 0.0383  68  ARG A NH1   
534  N NH2   . ARG A 68  ? 0.7777 0.7948 0.6004 0.2310  -0.1099 0.0200  68  ARG A NH2   
535  N N     . LEU A 69  ? 0.4407 0.3483 0.3265 0.0984  0.0014  0.0426  69  LEU A N     
536  C CA    . LEU A 69  ? 0.4171 0.3207 0.3145 0.0789  0.0109  0.0401  69  LEU A CA    
537  C C     . LEU A 69  ? 0.4490 0.3652 0.3491 0.0679  0.0089  0.0374  69  LEU A C     
538  O O     . LEU A 69  ? 0.4381 0.3769 0.3509 0.0657  0.0016  0.0292  69  LEU A O     
539  C CB    . LEU A 69  ? 0.4318 0.3497 0.3506 0.0731  0.0111  0.0304  69  LEU A CB    
540  C CG    . LEU A 69  ? 0.5188 0.4368 0.4451 0.0548  0.0171  0.0270  69  LEU A CG    
541  C CD1   . LEU A 69  ? 0.5796 0.4736 0.4974 0.0490  0.0256  0.0319  69  LEU A CD1   
542  C CD2   . LEU A 69  ? 0.4692 0.3980 0.4077 0.0510  0.0196  0.0182  69  LEU A CD2   
543  N N     . ILE A 70  ? 0.4789 0.3796 0.3703 0.0608  0.0172  0.0428  70  ILE A N     
544  C CA    . ILE A 70  ? 0.4468 0.3566 0.3426 0.0521  0.0170  0.0397  70  ILE A CA    
545  C C     . ILE A 70  ? 0.4568 0.3713 0.3711 0.0384  0.0185  0.0356  70  ILE A C     
546  O O     . ILE A 70  ? 0.4684 0.3720 0.3855 0.0320  0.0252  0.0368  70  ILE A O     
547  C CB    . ILE A 70  ? 0.4847 0.3775 0.3618 0.0533  0.0266  0.0464  70  ILE A CB    
548  C CG1   . ILE A 70  ? 0.4840 0.3689 0.3328 0.0708  0.0231  0.0531  70  ILE A CG1   
549  C CG2   . ILE A 70  ? 0.4607 0.3643 0.3465 0.0449  0.0279  0.0407  70  ILE A CG2   
550  C CD1   . ILE A 70  ? 0.5710 0.4401 0.3936 0.0727  0.0333  0.0600  70  ILE A CD1   
551  N N     . SER A 71  ? 0.4602 0.3904 0.3866 0.0343  0.0121  0.0303  71  SER A N     
552  C CA    . SER A 71  ? 0.3969 0.3296 0.3345 0.0246  0.0113  0.0289  71  SER A CA    
553  C C     . SER A 71  ? 0.3910 0.3270 0.3363 0.0213  0.0098  0.0274  71  SER A C     
554  O O     . SER A 71  ? 0.4286 0.3708 0.3753 0.0237  0.0078  0.0237  71  SER A O     
555  C CB    . SER A 71  ? 0.4356 0.3767 0.3785 0.0223  0.0090  0.0262  71  SER A CB    
556  O OG    . SER A 71  ? 0.4750 0.4158 0.4222 0.0149  0.0077  0.0273  71  SER A OG    
557  N N     . HIS A 72  ? 0.3988 0.3324 0.3514 0.0168  0.0100  0.0278  72  HIS A N     
558  C CA    . HIS A 72  ? 0.3708 0.3076 0.3355 0.0157  0.0075  0.0257  72  HIS A CA    
559  C C     . HIS A 72  ? 0.4280 0.3642 0.3972 0.0136  0.0005  0.0285  72  HIS A C     
560  O O     . HIS A 72  ? 0.4459 0.3825 0.4123 0.0119  -0.0017 0.0288  72  HIS A O     
561  C CB    . HIS A 72  ? 0.3115 0.2490 0.2837 0.0150  0.0136  0.0225  72  HIS A CB    
562  C CG    . HIS A 72  ? 0.4439 0.3859 0.4284 0.0165  0.0140  0.0176  72  HIS A CG    
563  N ND1   . HIS A 72  ? 0.4607 0.4043 0.4590 0.0179  0.0065  0.0170  72  HIS A ND1   
564  C CD2   . HIS A 72  ? 0.4721 0.4153 0.4550 0.0179  0.0219  0.0128  72  HIS A CD2   
565  C CE1   . HIS A 72  ? 0.4503 0.3964 0.4600 0.0200  0.0096  0.0106  72  HIS A CE1   
566  N NE2   . HIS A 72  ? 0.4955 0.4431 0.4957 0.0193  0.0193  0.0069  72  HIS A NE2   
567  N N     . LEU A 73  ? 0.5060 0.3514 0.4195 0.0171  0.0029  -0.0014 73  LEU A N     
568  C CA    . LEU A 73  ? 0.4759 0.3134 0.3928 0.0180  0.0018  -0.0009 73  LEU A CA    
569  C C     . LEU A 73  ? 0.4972 0.3346 0.4150 0.0199  0.0001  -0.0072 73  LEU A C     
570  O O     . LEU A 73  ? 0.5013 0.3390 0.4187 0.0251  -0.0009 -0.0042 73  LEU A O     
571  C CB    . LEU A 73  ? 0.5108 0.3473 0.4371 0.0160  0.0011  -0.0003 73  LEU A CB    
572  C CG    . LEU A 73  ? 0.5793 0.4190 0.5082 0.0150  0.0032  0.0056  73  LEU A CG    
573  C CD1   . LEU A 73  ? 0.6657 0.5178 0.5905 0.0173  0.0026  0.0080  73  LEU A CD1   
574  C CD2   . LEU A 73  ? 0.5800 0.4221 0.5240 0.0088  0.0053  -0.0001 73  LEU A CD2   
575  N N     . ARG A 74  ? 0.4607 0.3032 0.3794 0.0175  -0.0002 -0.0150 74  ARG A N     
576  C CA    . ARG A 74  ? 0.4697 0.3168 0.3925 0.0198  -0.0018 -0.0233 74  ARG A CA    
577  C C     . ARG A 74  ? 0.4663 0.3080 0.3981 0.0276  -0.0039 -0.0201 74  ARG A C     
578  O O     . ARG A 74  ? 0.4517 0.2844 0.3929 0.0258  -0.0019 -0.0209 74  ARG A O     
579  C CB    . ARG A 74  ? 0.4034 0.2586 0.3229 0.0194  0.0006  -0.0278 74  ARG A CB    
580  C CG    . ARG A 74  ? 0.4534 0.3063 0.3700 0.0119  0.0090  -0.0303 74  ARG A CG    
581  C CD    . ARG A 74  ? 0.4729 0.3315 0.3903 0.0084  0.0113  -0.0366 74  ARG A CD    
582  N NE    . ARG A 74  ? 0.4865 0.3412 0.4023 0.0023  0.0240  -0.0364 74  ARG A NE    
583  C CZ    . ARG A 74  ? 0.5040 0.3643 0.4277 -0.0042 0.0318  -0.0495 74  ARG A CZ    
584  N NH1   . ARG A 74  ? 0.4326 0.3109 0.3642 -0.0029 0.0245  -0.0637 74  ARG A NH1   
585  N NH2   . ARG A 74  ? 0.5428 0.3926 0.4690 -0.0113 0.0489  -0.0480 74  ARG A NH2   
586  N N     . MET A 75  ? 0.4465 0.2962 0.3772 0.0369  -0.0059 -0.0169 75  MET A N     
587  C CA    . MET A 75  ? 0.4793 0.3237 0.4184 0.0498  -0.0053 -0.0078 75  MET A CA    
588  C C     . MET A 75  ? 0.4825 0.3142 0.4191 0.0549  -0.0010 0.0102  75  MET A C     
589  O O     . MET A 75  ? 0.5495 0.3615 0.4983 0.0590  0.0061  0.0183  75  MET A O     
590  C CB    . MET A 75  ? 0.4874 0.3565 0.4256 0.0623  -0.0100 -0.0092 75  MET A CB    
591  C CG    . MET A 75  ? 0.5682 0.4483 0.5161 0.0604  -0.0115 -0.0261 75  MET A CG    
592  S SD    . MET A 75  ? 0.6410 0.4987 0.6085 0.0619  -0.0058 -0.0300 75  MET A SD    
593  C CE    . MET A 75  ? 0.4748 0.3247 0.4528 0.0864  -0.0023 -0.0090 75  MET A CE    
594  N N     . GLU A 76  ? 0.4683 0.3100 0.3916 0.0531  -0.0025 0.0146  76  GLU A N     
595  C CA    . GLU A 76  ? 0.5767 0.4153 0.4939 0.0595  0.0018  0.0322  76  GLU A CA    
596  C C     . GLU A 76  ? 0.5960 0.4326 0.5071 0.0488  0.0039  0.0312  76  GLU A C     
597  O O     . GLU A 76  ? 0.6834 0.5224 0.5879 0.0525  0.0080  0.0435  76  GLU A O     
598  C CB    . GLU A 76  ? 0.6518 0.5210 0.5570 0.0746  -0.0025 0.0392  76  GLU A CB    
599  C CG    . GLU A 76  ? 0.7935 0.6719 0.7052 0.0903  -0.0050 0.0431  76  GLU A CG    
600  C CD    . GLU A 76  ? 1.0243 0.9111 0.9299 0.1129  -0.0012 0.0701  76  GLU A CD    
601  O OE1   . GLU A 76  ? 1.0892 0.9723 0.9844 0.1138  0.0047  0.0856  76  GLU A OE1   
602  O OE2   . GLU A 76  ? 1.1716 1.0713 1.0826 0.1317  -0.0030 0.0777  76  GLU A OE2   
603  N N     . GLY A 77  ? 0.5114 0.3463 0.4246 0.0376  0.0022  0.0186  77  GLY A N     
604  C CA    . GLY A 77  ? 0.5305 0.3647 0.4411 0.0311  0.0050  0.0191  77  GLY A CA    
605  C C     . GLY A 77  ? 0.5202 0.3431 0.4383 0.0282  0.0103  0.0276  77  GLY A C     
606  O O     . GLY A 77  ? 0.5180 0.3298 0.4485 0.0253  0.0130  0.0262  77  GLY A O     
607  N N     . LYS A 78  ? 0.5017 0.3293 0.4154 0.0274  0.0140  0.0328  78  LYS A N     
608  C CA    . LYS A 78  ? 0.5556 0.3765 0.4779 0.0231  0.0215  0.0397  78  LYS A CA    
609  C C     . LYS A 78  ? 0.5482 0.3798 0.4701 0.0194  0.0225  0.0362  78  LYS A C     
610  O O     . LYS A 78  ? 0.5884 0.4298 0.5007 0.0225  0.0223  0.0345  78  LYS A O     
611  C CB    . LYS A 78  ? 0.6490 0.4653 0.5656 0.0304  0.0295  0.0568  78  LYS A CB    
612  C CG    . LYS A 78  ? 0.7655 0.5667 0.6875 0.0380  0.0328  0.0657  78  LYS A CG    
613  C CD    . LYS A 78  ? 0.8312 0.6371 0.7399 0.0530  0.0392  0.0889  78  LYS A CD    
614  C CE    . LYS A 78  ? 0.9285 0.7142 0.8468 0.0652  0.0469  0.1040  78  LYS A CE    
615  N NZ    . LYS A 78  ? 0.9336 0.7226 0.8569 0.0690  0.0366  0.0907  78  LYS A NZ    
616  N N     . TYR A 79  ? 0.5202 0.3539 0.4557 0.0128  0.0248  0.0324  79  TYR A N     
617  C CA    . TYR A 79  ? 0.4766 0.3228 0.4153 0.0119  0.0273  0.0312  79  TYR A CA    
618  C C     . TYR A 79  ? 0.4571 0.3029 0.4027 0.0068  0.0377  0.0372  79  TYR A C     
619  O O     . TYR A 79  ? 0.4944 0.3292 0.4509 0.0010  0.0443  0.0391  79  TYR A O     
620  C CB    . TYR A 79  ? 0.4577 0.3182 0.4076 0.0107  0.0225  0.0233  79  TYR A CB    
621  C CG    . TYR A 79  ? 0.5379 0.3997 0.4799 0.0180  0.0172  0.0230  79  TYR A CG    
622  C CD1   . TYR A 79  ? 0.3731 0.2341 0.3122 0.0243  0.0211  0.0257  79  TYR A CD1   
623  C CD2   . TYR A 79  ? 0.4903 0.3540 0.4307 0.0180  0.0115  0.0193  79  TYR A CD2   
624  C CE1   . TYR A 79  ? 0.4786 0.3348 0.4147 0.0305  0.0220  0.0274  79  TYR A CE1   
625  C CE2   . TYR A 79  ? 0.5024 0.3658 0.4355 0.0248  0.0105  0.0224  79  TYR A CE2   
626  C CZ    . TYR A 79  ? 0.5115 0.3684 0.4433 0.0311  0.0170  0.0278  79  TYR A CZ    
627  O OH    . TYR A 79  ? 0.4928 0.3424 0.4215 0.0374  0.0219  0.0328  79  TYR A OH    
628  N N     . ARG A 80  ? 0.4109 0.2671 0.3529 0.0081  0.0422  0.0392  80  ARG A N     
629  C CA    . ARG A 80  ? 0.4890 0.3489 0.4412 0.0013  0.0536  0.0429  80  ARG A CA    
630  C C     . ARG A 80  ? 0.5138 0.3941 0.4737 0.0014  0.0550  0.0359  80  ARG A C     
631  O O     . ARG A 80  ? 0.5812 0.4673 0.5346 0.0086  0.0509  0.0321  80  ARG A O     
632  C CB    . ARG A 80  ? 0.5061 0.3582 0.4440 0.0043  0.0636  0.0592  80  ARG A CB    
633  C CG    . ARG A 80  ? 0.5399 0.4081 0.4569 0.0124  0.0616  0.0610  80  ARG A CG    
634  C CD    . ARG A 80  ? 0.5737 0.4443 0.4720 0.0196  0.0694  0.0805  80  ARG A CD    
635  N NE    . ARG A 80  ? 0.6303 0.5303 0.5106 0.0245  0.0703  0.0779  80  ARG A NE    
636  C CZ    . ARG A 80  ? 0.6435 0.5635 0.5113 0.0302  0.0614  0.0664  80  ARG A CZ    
637  N NH1   . ARG A 80  ? 0.6820 0.5927 0.5519 0.0325  0.0509  0.0595  80  ARG A NH1   
638  N NH2   . ARG A 80  ? 0.5762 0.5291 0.4315 0.0321  0.0645  0.0583  80  ARG A NH2   
639  N N     . LEU A 81  ? 0.5501 0.4413 0.5287 -0.0071 0.0626  0.0319  81  LEU A N     
640  C CA    . LEU A 81  ? 0.5707 0.4847 0.5596 -0.0061 0.0660  0.0258  81  LEU A CA    
641  C C     . LEU A 81  ? 0.5652 0.4796 0.5464 -0.0094 0.0795  0.0334  81  LEU A C     
642  O O     . LEU A 81  ? 0.6395 0.5438 0.6226 -0.0177 0.0912  0.0419  81  LEU A O     
643  C CB    . LEU A 81  ? 0.5728 0.5106 0.5891 -0.0133 0.0660  0.0134  81  LEU A CB    
644  C CG    . LEU A 81  ? 0.6648 0.6167 0.6830 -0.0028 0.0512  0.0082  81  LEU A CG    
645  C CD1   . LEU A 81  ? 0.6408 0.6231 0.6819 -0.0100 0.0474  -0.0066 81  LEU A CD1   
646  C CD2   . LEU A 81  ? 0.5764 0.5406 0.5942 0.0122  0.0495  0.0106  81  LEU A CD2   
647  N N     . ALA A 82  ? 0.5323 0.4584 0.5057 -0.0027 0.0803  0.0304  82  ALA A N     
648  C CA    . ALA A 82  ? 0.5049 0.4402 0.4668 -0.0046 0.0926  0.0356  82  ALA A CA    
649  C C     . ALA A 82  ? 0.5253 0.4845 0.5013 -0.0037 0.0984  0.0233  82  ALA A C     
650  O O     . ALA A 82  ? 0.5643 0.5292 0.5544 0.0035  0.0920  0.0130  82  ALA A O     
651  C CB    . ALA A 82  ? 0.4411 0.3746 0.3761 0.0026  0.0893  0.0400  82  ALA A CB    
652  N N     . THR A 83  ? 0.4850 0.4585 0.4576 -0.0092 0.1124  0.0262  83  THR A N     
653  C CA    . THR A 83  ? 0.5403 0.5384 0.5248 -0.0075 0.1193  0.0126  83  THR A CA    
654  C C     . THR A 83  ? 0.5904 0.5917 0.5639 0.0014  0.1160  0.0013  83  THR A C     
655  O O     . THR A 83  ? 0.6038 0.5953 0.5572 0.0040  0.1099  0.0045  83  THR A O     
656  C CB    . THR A 83  ? 0.5403 0.5559 0.5207 -0.0162 0.1370  0.0179  83  THR A CB    
657  O OG1   . THR A 83  ? 0.6129 0.6323 0.5610 -0.0134 0.1411  0.0281  83  THR A OG1   
658  C CG2   . THR A 83  ? 0.5350 0.5412 0.5292 -0.0285 0.1459  0.0283  83  THR A CG2   
659  N N     . LEU A 84  ? 0.6047 0.6217 0.5958 0.0055  0.1221  -0.0146 84  LEU A N     
660  C CA    . LEU A 84  ? 0.5688 0.5866 0.5589 0.0113  0.1243  -0.0313 84  LEU A CA    
661  C C     . LEU A 84  ? 0.6401 0.6800 0.6055 0.0062  0.1312  -0.0386 84  LEU A C     
662  O O     . LEU A 84  ? 0.6903 0.7328 0.6504 0.0075  0.1308  -0.0540 84  LEU A O     
663  C CB    . LEU A 84  ? 0.5233 0.5500 0.5439 0.0186  0.1329  -0.0463 84  LEU A CB    
664  C CG    . LEU A 84  ? 0.5541 0.5650 0.5971 0.0306  0.1250  -0.0392 84  LEU A CG    
665  C CD1   . LEU A 84  ? 0.6095 0.6366 0.6841 0.0411  0.1350  -0.0490 84  LEU A CD1   
666  C CD2   . LEU A 84  ? 0.5057 0.4875 0.5447 0.0373  0.1201  -0.0387 84  LEU A CD2   
667  N N     . ASP A 85  ? 0.6808 0.7412 0.6312 0.0004  0.1389  -0.0281 85  ASP A N     
668  C CA    . ASP A 85  ? 0.7510 0.8433 0.6736 -0.0011 0.1447  -0.0325 85  ASP A CA    
669  C C     . ASP A 85  ? 0.7525 0.8405 0.6446 0.0022  0.1358  -0.0114 85  ASP A C     
670  O O     . ASP A 85  ? 0.7688 0.8903 0.6333 0.0045  0.1392  -0.0078 85  ASP A O     
671  C CB    . ASP A 85  ? 0.8036 0.9271 0.7207 -0.0063 0.1608  -0.0292 85  ASP A CB    
672  C CG    . ASP A 85  ? 0.9028 1.0100 0.8236 -0.0116 0.1664  -0.0025 85  ASP A CG    
673  O OD1   . ASP A 85  ? 0.8389 0.9163 0.7559 -0.0112 0.1589  0.0172  85  ASP A OD1   
674  O OD2   . ASP A 85  ? 1.0588 1.1847 0.9897 -0.0179 0.1811  -0.0044 85  ASP A OD2   
675  N N     . ALA A 86  ? 0.7259 0.7780 0.6229 0.0041  0.1248  0.0027  86  ALA A N     
676  C CA    . ALA A 86  ? 0.6894 0.7347 0.5622 0.0093  0.1174  0.0231  86  ALA A CA    
677  C C     . ALA A 86  ? 0.6633 0.7340 0.5203 0.0142  0.1098  0.0066  86  ALA A C     
678  O O     . ALA A 86  ? 0.6308 0.6977 0.5041 0.0119  0.1064  -0.0191 86  ALA A O     
679  C CB    . ALA A 86  ? 0.6267 0.6306 0.5129 0.0090  0.1080  0.0346  86  ALA A CB    
680  N N     . PRO A 87  ? 0.7167 0.8165 0.5436 0.0218  0.1091  0.0215  87  PRO A N     
681  C CA    . PRO A 87  ? 0.7110 0.8467 0.5225 0.0271  0.1002  0.0052  87  PRO A CA    
682  C C     . PRO A 87  ? 0.7312 0.8380 0.5514 0.0290  0.0866  0.0026  87  PRO A C     
683  O O     . PRO A 87  ? 0.7638 0.8286 0.5900 0.0309  0.0824  0.0241  87  PRO A O     
684  C CB    . PRO A 87  ? 0.7581 0.9320 0.5340 0.0400  0.1028  0.0336  87  PRO A CB    
685  C CG    . PRO A 87  ? 0.7874 0.9183 0.5646 0.0416  0.1119  0.0720  87  PRO A CG    
686  C CD    . PRO A 87  ? 0.7905 0.8957 0.5972 0.0269  0.1194  0.0559  87  PRO A CD    
687  N N     . ARG A 88  ? 0.7382 0.8707 0.5617 0.0266  0.0816  -0.0276 88  ARG A N     
688  C CA    . ARG A 88  ? 0.7296 0.8436 0.5599 0.0277  0.0705  -0.0325 88  ARG A CA    
689  C C     . ARG A 88  ? 0.6968 0.8368 0.5005 0.0419  0.0611  -0.0098 88  ARG A C     
690  O O     . ARG A 88  ? 0.6799 0.8753 0.4603 0.0502  0.0618  -0.0077 88  ARG A O     
691  C CB    . ARG A 88  ? 0.7054 0.8382 0.5538 0.0177  0.0730  -0.0755 88  ARG A CB    
692  N N     . GLU A 89  ? 0.6550 0.7578 0.4626 0.0466  0.0533  0.0082  89  GLU A N     
693  C CA    . GLU A 89  ? 0.6428 0.7620 0.4314 0.0627  0.0454  0.0311  89  GLU A CA    
694  C C     . GLU A 89  ? 0.6262 0.7627 0.4221 0.0619  0.0343  0.0068  89  GLU A C     
695  O O     . GLU A 89  ? 0.6281 0.7461 0.4459 0.0474  0.0353  -0.0214 89  GLU A O     
696  C CB    . GLU A 89  ? 0.7226 0.7877 0.5155 0.0676  0.0478  0.0655  89  GLU A CB    
697  C CG    . GLU A 89  ? 0.9584 1.0081 0.7485 0.0658  0.0621  0.0874  89  GLU A CG    
698  C CD    . GLU A 89  ? 1.1833 1.2021 0.9694 0.0770  0.0697  0.1266  89  GLU A CD    
699  O OE1   . GLU A 89  ? 1.1983 1.1761 1.0014 0.0749  0.0662  0.1297  89  GLU A OE1   
700  O OE2   . GLU A 89  ? 1.2457 1.2818 1.0128 0.0880  0.0815  0.1542  89  GLU A OE2   
701  N N     . LYS A 90  ? 0.5988 0.7693 0.3785 0.0786  0.0256  0.0199  90  LYS A N     
702  C CA    . LYS A 90  ? 0.6342 0.8453 0.4192 0.0781  0.0156  -0.0092 90  LYS A CA    
703  C C     . LYS A 90  ? 0.6568 0.8198 0.4675 0.0652  0.0133  -0.0247 90  LYS A C     
704  O O     . LYS A 90  ? 0.6871 0.8687 0.5135 0.0526  0.0135  -0.0613 90  LYS A O     
705  C CB    . LYS A 90  ? 0.6236 0.8810 0.3873 0.1034  0.0059  0.0139  90  LYS A CB    
706  C CG    . LYS A 90  ? 0.6848 1.0059 0.4527 0.1047  -0.0050 -0.0189 90  LYS A CG    
707  C CD    . LYS A 90  ? 0.8415 1.2152 0.5861 0.1363  -0.0148 0.0111  90  LYS A CD    
708  C CE    . LYS A 90  ? 0.9185 1.3672 0.6692 0.1401  -0.0277 -0.0224 90  LYS A CE    
709  N NZ    . LYS A 90  ? 0.9547 1.3583 0.7360 0.1220  -0.0292 -0.0471 90  LYS A NZ    
710  N N     . HIS A 91  ? 0.6013 0.7047 0.4177 0.0672  0.0135  0.0013  91  HIS A N     
711  C CA    . HIS A 91  ? 0.5676 0.6334 0.4036 0.0578  0.0110  -0.0100 91  HIS A CA    
712  C C     . HIS A 91  ? 0.5883 0.6021 0.4405 0.0439  0.0187  -0.0122 91  HIS A C     
713  O O     . HIS A 91  ? 0.5986 0.5766 0.4630 0.0393  0.0171  -0.0113 91  HIS A O     
714  C CB    . HIS A 91  ? 0.5666 0.6154 0.3998 0.0715  0.0041  0.0143  91  HIS A CB    
715  C CG    . HIS A 91  ? 0.6304 0.7338 0.4499 0.0899  -0.0041 0.0186  91  HIS A CG    
716  N ND1   . HIS A 91  ? 0.6912 0.8090 0.4921 0.1120  -0.0035 0.0531  91  HIS A ND1   
717  C CD2   . HIS A 91  ? 0.6223 0.7742 0.4451 0.0911  -0.0119 -0.0066 91  HIS A CD2   
718  C CE1   . HIS A 91  ? 0.7331 0.9096 0.5243 0.1295  -0.0126 0.0517  91  HIS A CE1   
719  N NE2   . HIS A 91  ? 0.7244 0.9256 0.5296 0.1159  -0.0189 0.0129  91  HIS A NE2   
720  N N     . ASP A 92  ? 0.4758 0.4204 0.3890 0.0172  0.0208  0.0558  92  ASP A N     
721  C CA    . ASP A 92  ? 0.4719 0.4187 0.4008 0.0137  0.0237  0.0497  92  ASP A CA    
722  C C     . ASP A 92  ? 0.4958 0.4424 0.4243 0.0132  0.0152  0.0400  92  ASP A C     
723  O O     . ASP A 92  ? 0.5768 0.5232 0.4902 0.0155  0.0120  0.0351  92  ASP A O     
724  C CB    . ASP A 92  ? 0.4672 0.4157 0.3920 0.0157  0.0351  0.0495  92  ASP A CB    
725  C CG    . ASP A 92  ? 0.5823 0.5293 0.5105 0.0135  0.0466  0.0586  92  ASP A CG    
726  O OD1   . ASP A 92  ? 0.6242 0.5668 0.5581 0.0106  0.0451  0.0645  92  ASP A OD1   
727  O OD2   . ASP A 92  ? 0.6216 0.5709 0.5472 0.0141  0.0585  0.0593  92  ASP A OD2   
728  N N     . HIS A 93  ? 0.4517 0.3968 0.3949 0.0101  0.0119  0.0370  93  HIS A N     
729  C CA    . HIS A 93  ? 0.4155 0.3555 0.3568 0.0085  0.0058  0.0290  93  HIS A CA    
730  C C     . HIS A 93  ? 0.4512 0.3857 0.3966 0.0108  0.0087  0.0239  93  HIS A C     
731  O O     . HIS A 93  ? 0.5149 0.4406 0.4522 0.0113  0.0072  0.0166  93  HIS A O     
732  C CB    . HIS A 93  ? 0.4565 0.3956 0.4067 0.0040  -0.0003 0.0301  93  HIS A CB    
733  C CG    . HIS A 93  ? 0.4888 0.4347 0.4364 0.0038  -0.0041 0.0345  93  HIS A CG    
734  N ND1   . HIS A 93  ? 0.5020 0.4529 0.4361 0.0062  -0.0073 0.0324  93  HIS A ND1   
735  C CD2   . HIS A 93  ? 0.4855 0.4337 0.4409 0.0033  -0.0057 0.0405  93  HIS A CD2   
736  C CE1   . HIS A 93  ? 0.5087 0.4657 0.4427 0.0083  -0.0111 0.0375  93  HIS A CE1   
737  N NE2   . HIS A 93  ? 0.5504 0.5049 0.4974 0.0064  -0.0096 0.0425  93  HIS A NE2   
738  N N     . LEU A 94  ? 0.4239 0.3630 0.3821 0.0127  0.0125  0.0270  94  LEU A N     
739  C CA    . LEU A 94  ? 0.4707 0.4073 0.4347 0.0175  0.0135  0.0226  94  LEU A CA    
740  C C     . LEU A 94  ? 0.5121 0.4617 0.4876 0.0209  0.0203  0.0233  94  LEU A C     
741  O O     . LEU A 94  ? 0.5447 0.5030 0.5295 0.0168  0.0235  0.0283  94  LEU A O     
742  C CB    . LEU A 94  ? 0.5074 0.4389 0.4794 0.0169  0.0081  0.0234  94  LEU A CB    
743  C CG    . LEU A 94  ? 0.6019 0.5200 0.5664 0.0132  0.0034  0.0223  94  LEU A CG    
744  C CD1   . LEU A 94  ? 0.6435 0.5583 0.6149 0.0143  0.0004  0.0247  94  LEU A CD1   
745  C CD2   . LEU A 94  ? 0.6563 0.5601 0.6085 0.0159  0.0046  0.0160  94  LEU A CD2   
746  N N     . THR A 95  ? 0.4877 0.4386 0.4641 0.0282  0.0231  0.0178  95  THR A N     
747  C CA    . THR A 95  ? 0.4555 0.4234 0.4480 0.0313  0.0295  0.0167  95  THR A CA    
748  C C     . THR A 95  ? 0.5184 0.4893 0.5187 0.0414  0.0268  0.0107  95  THR A C     
749  O O     . THR A 95  ? 0.5601 0.5173 0.5474 0.0488  0.0251  0.0065  95  THR A O     
750  C CB    . THR A 95  ? 0.6408 0.6148 0.6265 0.0317  0.0401  0.0167  95  THR A CB    
751  O OG1   . THR A 95  ? 0.7179 0.7111 0.7228 0.0336  0.0482  0.0147  95  THR A OG1   
752  C CG2   . THR A 95  ? 0.6322 0.5949 0.5989 0.0381  0.0406  0.0110  95  THR A CG2   
753  N N     . MET A 96  ? 0.4421 0.4307 0.4638 0.0422  0.0262  0.0096  96  MET A N     
754  C CA    . MET A 96  ? 0.3948 0.3924 0.4270 0.0536  0.0223  0.0038  96  MET A CA    
755  C C     . MET A 96  ? 0.4540 0.4775 0.5055 0.0563  0.0312  -0.0012 96  MET A C     
756  O O     . MET A 96  ? 0.4990 0.5417 0.5708 0.0480  0.0357  -0.0010 96  MET A O     
757  C CB    . MET A 96  ? 0.3721 0.3730 0.4143 0.0526  0.0130  0.0046  96  MET A CB    
758  C CG    . MET A 96  ? 0.4721 0.4851 0.5250 0.0657  0.0066  -0.0015 96  MET A CG    
759  S SD    . MET A 96  ? 0.6149 0.6268 0.6711 0.0654  -0.0054 -0.0005 96  MET A SD    
760  C CE    . MET A 96  ? 0.6807 0.6547 0.7054 0.0647  -0.0080 0.0067  96  MET A CE    
761  N N     . LYS A 97  ? 0.5174 0.5405 0.5626 0.0672  0.0353  -0.0060 97  LYS A N     
762  C CA    . LYS A 97  ? 0.5729 0.6206 0.6347 0.0696  0.0463  -0.0107 97  LYS A CA    
763  C C     . LYS A 97  ? 0.5117 0.5848 0.5978 0.0813  0.0426  -0.0188 97  LYS A C     
764  O O     . LYS A 97  ? 0.5486 0.6130 0.6270 0.0957  0.0340  -0.0218 97  LYS A O     
765  C CB    . LYS A 97  ? 0.6083 0.6438 0.6497 0.0754  0.0544  -0.0124 97  LYS A CB    
766  C CG    . LYS A 97  ? 0.6503 0.6683 0.6702 0.0641  0.0585  -0.0058 97  LYS A CG    
767  C CD    . LYS A 97  ? 0.6926 0.6988 0.6900 0.0698  0.0653  -0.0091 97  LYS A CD    
768  C CE    . LYS A 97  ? 0.8096 0.8060 0.7882 0.0598  0.0695  -0.0031 97  LYS A CE    
769  N NZ    . LYS A 97  ? 0.9191 0.9054 0.8734 0.0652  0.0759  -0.0073 97  LYS A NZ    
770  N N     . PHE A 98  ? 0.4509 0.5550 0.5661 0.0748  0.0495  -0.0224 98  PHE A N     
771  C CA    . PHE A 98  ? 0.4066 0.5442 0.5515 0.0846  0.0465  -0.0324 98  PHE A CA    
772  C C     . PHE A 98  ? 0.4466 0.6058 0.6041 0.0890  0.0609  -0.0382 98  PHE A C     
773  O O     . PHE A 98  ? 0.4909 0.6355 0.6303 0.0849  0.0723  -0.0337 98  PHE A O     
774  C CB    . PHE A 98  ? 0.3493 0.5099 0.5227 0.0722  0.0431  -0.0351 98  PHE A CB    
775  C CG    . PHE A 98  ? 0.3871 0.5256 0.5466 0.0666  0.0312  -0.0292 98  PHE A CG    
776  C CD1   . PHE A 98  ? 0.5188 0.6476 0.6674 0.0803  0.0162  -0.0304 98  PHE A CD1   
777  C CD2   . PHE A 98  ? 0.3836 0.5093 0.5387 0.0488  0.0358  -0.0218 98  PHE A CD2   
778  C CE1   . PHE A 98  ? 0.5451 0.6533 0.6797 0.0752  0.0069  -0.0248 98  PHE A CE1   
779  C CE2   . PHE A 98  ? 0.4068 0.5136 0.5499 0.0445  0.0257  -0.0169 98  PHE A CE2   
780  C CZ    . PHE A 98  ? 0.4731 0.5717 0.6062 0.0571  0.0116  -0.0185 98  PHE A CZ    
781  N N     . ALA A 99  ? 0.4222 0.6178 0.6106 0.0983  0.0604  -0.0487 99  ALA A N     
782  C CA    . ALA A 99  ? 0.4909 0.7106 0.6942 0.1029  0.0756  -0.0550 99  ALA A CA    
783  C C     . ALA A 99  ? 0.5754 0.8074 0.7931 0.0816  0.0936  -0.0522 99  ALA A C     
784  O O     . ALA A 99  ? 0.6378 0.8717 0.8504 0.0809  0.1102  -0.0516 99  ALA A O     
785  C CB    . ALA A 99  ? 0.3562 0.6164 0.5925 0.1185  0.0701  -0.0681 99  ALA A CB    
786  N N     . ASP A 100 ? 0.6299 0.8670 0.8628 0.0646  0.0916  -0.0502 100 ASP A N     
787  C CA    . ASP A 100 ? 0.7634 1.0133 1.0139 0.0447  0.1104  -0.0485 100 ASP A CA    
788  C C     . ASP A 100 ? 0.7133 0.9296 0.9407 0.0278  0.1128  -0.0355 100 ASP A C     
789  O O     . ASP A 100 ? 0.7323 0.9537 0.9737 0.0100  0.1255  -0.0332 100 ASP A O     
790  C CB    . ASP A 100 ? 0.8540 1.1488 1.1535 0.0376  0.1108  -0.0613 100 ASP A CB    
791  C CG    . ASP A 100 ? 0.9424 1.2409 1.2512 0.0395  0.0888  -0.0658 100 ASP A CG    
792  O OD1   . ASP A 100 ? 0.9683 1.2315 1.2463 0.0411  0.0768  -0.0567 100 ASP A OD1   
793  O OD2   . ASP A 100 ? 0.9427 1.2810 1.2902 0.0394  0.0837  -0.0794 100 ASP A OD2   
794  N N     . GLY A 101 ? 0.5930 0.7747 0.7853 0.0337  0.1014  -0.0273 101 GLY A N     
795  C CA    . GLY A 101 ? 0.5058 0.6580 0.6767 0.0213  0.1008  -0.0159 101 GLY A CA    
796  C C     . GLY A 101 ? 0.4801 0.6038 0.6222 0.0298  0.0839  -0.0113 101 GLY A C     
797  O O     . GLY A 101 ? 0.5205 0.6437 0.6572 0.0445  0.0744  -0.0162 101 GLY A O     
798  N N     . GLN A 102 ? 0.4090 0.5083 0.5327 0.0208  0.0812  -0.0019 102 GLN A N     
799  C CA    . GLN A 102 ? 0.4340 0.5077 0.5324 0.0261  0.0675  0.0023  102 GLN A CA    
800  C C     . GLN A 102 ? 0.5035 0.5654 0.6007 0.0159  0.0613  0.0082  102 GLN A C     
801  O O     . GLN A 102 ? 0.5001 0.5627 0.6043 0.0041  0.0703  0.0125  102 GLN A O     
802  C CB    . GLN A 102 ? 0.4445 0.4970 0.5115 0.0296  0.0715  0.0074  102 GLN A CB    
803  C CG    . GLN A 102 ? 0.4968 0.5415 0.5520 0.0199  0.0840  0.0159  102 GLN A CG    
804  C CD    . GLN A 102 ? 0.5765 0.6039 0.5997 0.0253  0.0864  0.0187  102 GLN A CD    
805  O OE1   . GLN A 102 ? 0.6345 0.6465 0.6403 0.0305  0.0752  0.0175  102 GLN A OE1   
806  N NE2   . GLN A 102 ? 0.5629 0.5923 0.5774 0.0238  0.1017  0.0218  102 GLN A NE2   
807  N N     . LEU A 103 ? 0.4693 0.5185 0.5568 0.0210  0.0471  0.0084  103 LEU A N     
808  C CA    . LEU A 103 ? 0.4214 0.4584 0.5057 0.0135  0.0405  0.0134  103 LEU A CA    
809  C C     . LEU A 103 ? 0.4299 0.4428 0.4861 0.0138  0.0381  0.0206  103 LEU A C     
810  O O     . LEU A 103 ? 0.4470 0.4494 0.4890 0.0213  0.0318  0.0190  103 LEU A O     
811  C CB    . LEU A 103 ? 0.3912 0.4328 0.4847 0.0186  0.0274  0.0081  103 LEU A CB    
812  C CG    . LEU A 103 ? 0.3838 0.4115 0.4714 0.0126  0.0202  0.0126  103 LEU A CG    
813  C CD1   . LEU A 103 ? 0.3562 0.3914 0.4607 0.0001  0.0262  0.0128  103 LEU A CD1   
814  C CD2   . LEU A 103 ? 0.3646 0.3913 0.4515 0.0209  0.0074  0.0084  103 LEU A CD2   
815  N N     . ILE A 104 ? 0.3783 0.3824 0.4268 0.0059  0.0434  0.0279  104 ILE A N     
816  C CA    . ILE A 104 ? 0.3916 0.3781 0.4156 0.0069  0.0406  0.0336  104 ILE A CA    
817  C C     . ILE A 104 ? 0.4165 0.3927 0.4380 0.0030  0.0325  0.0378  104 ILE A C     
818  O O     . ILE A 104 ? 0.3875 0.3645 0.4188 -0.0031 0.0349  0.0407  104 ILE A O     
819  C CB    . ILE A 104 ? 0.4239 0.4067 0.4349 0.0045  0.0520  0.0398  104 ILE A CB    
820  C CG1   . ILE A 104 ? 0.3896 0.3814 0.3993 0.0093  0.0609  0.0354  104 ILE A CG1   
821  C CG2   . ILE A 104 ? 0.4032 0.3711 0.3899 0.0061  0.0467  0.0450  104 ILE A CG2   
822  C CD1   . ILE A 104 ? 0.4548 0.4463 0.4578 0.0055  0.0761  0.0415  104 ILE A CD1   
823  N N     . TYR A 105 ? 0.3726 0.3387 0.3812 0.0060  0.0240  0.0374  105 TYR A N     
824  C CA    . TYR A 105 ? 0.3726 0.3307 0.3778 0.0029  0.0180  0.0414  105 TYR A CA    
825  C C     . TYR A 105 ? 0.4825 0.4341 0.4708 0.0029  0.0181  0.0462  105 TYR A C     
826  O O     . TYR A 105 ? 0.5354 0.4849 0.5111 0.0057  0.0164  0.0434  105 TYR A O     
827  C CB    . TYR A 105 ? 0.4072 0.3599 0.4115 0.0052  0.0094  0.0377  105 TYR A CB    
828  C CG    . TYR A 105 ? 0.4558 0.4023 0.4581 0.0021  0.0046  0.0412  105 TYR A CG    
829  C CD1   . TYR A 105 ? 0.4811 0.4290 0.4937 -0.0005 0.0038  0.0428  105 TYR A CD1   
830  C CD2   . TYR A 105 ? 0.4058 0.3468 0.3971 0.0015  0.0012  0.0416  105 TYR A CD2   
831  C CE1   . TYR A 105 ? 0.5129 0.4553 0.5233 -0.0021 0.0004  0.0456  105 TYR A CE1   
832  C CE2   . TYR A 105 ? 0.4514 0.3903 0.4434 -0.0007 -0.0023 0.0441  105 TYR A CE2   
833  C CZ    . TYR A 105 ? 0.5140 0.4529 0.5147 -0.0017 -0.0024 0.0466  105 TYR A CZ    
834  O OH    . TYR A 105 ? 0.5493 0.4860 0.5503 -0.0026 -0.0051 0.0488  105 TYR A OH    
835  N N     . ALA A 106 ? 0.4662 0.4144 0.4538 0.0005  0.0195  0.0526  106 ALA A N     
836  C CA    . ALA A 106 ? 0.5246 0.4682 0.4961 0.0031  0.0181  0.0576  106 ALA A CA    
837  C C     . ALA A 106 ? 0.5132 0.4538 0.4873 0.0027  0.0114  0.0600  106 ALA A C     
838  O O     . ALA A 106 ? 0.5236 0.4622 0.5096 -0.0002 0.0115  0.0604  106 ALA A O     
839  C CB    . ALA A 106 ? 0.3411 0.2806 0.3041 0.0038  0.0281  0.0649  106 ALA A CB    
840  N N     . ASP A 107 ? 0.5098 0.4517 0.4731 0.0062  0.0058  0.0606  107 ASP A N     
841  C CA    . ASP A 107 ? 0.4639 0.4064 0.4312 0.0068  -0.0002 0.0617  107 ASP A CA    
842  C C     . ASP A 107 ? 0.4769 0.4250 0.4321 0.0125  -0.0057 0.0626  107 ASP A C     
843  O O     . ASP A 107 ? 0.5259 0.4818 0.4792 0.0116  -0.0114 0.0556  107 ASP A O     
844  C CB    . ASP A 107 ? 0.4896 0.4342 0.4674 0.0027  -0.0047 0.0550  107 ASP A CB    
845  C CG    . ASP A 107 ? 0.5200 0.4659 0.5041 0.0027  -0.0087 0.0557  107 ASP A CG    
846  O OD1   . ASP A 107 ? 0.4876 0.4369 0.4678 0.0071  -0.0110 0.0593  107 ASP A OD1   
847  O OD2   . ASP A 107 ? 0.4822 0.4256 0.4739 -0.0005 -0.0093 0.0527  107 ASP A OD2   
848  N N     . VAL A 108 ? 0.4967 0.4406 0.4434 0.0187  -0.0044 0.0706  108 VAL A N     
849  C CA    . VAL A 108 ? 0.4605 0.4119 0.3939 0.0273  -0.0110 0.0715  108 VAL A CA    
850  C C     . VAL A 108 ? 0.4773 0.4443 0.4213 0.0258  -0.0209 0.0630  108 VAL A C     
851  O O     . VAL A 108 ? 0.4741 0.4533 0.4129 0.0272  -0.0277 0.0563  108 VAL A O     
852  C CB    . VAL A 108 ? 0.5662 0.5082 0.4892 0.0366  -0.0087 0.0822  108 VAL A CB    
853  C CG1   . VAL A 108 ? 0.5415 0.4954 0.4508 0.0485  -0.0185 0.0821  108 VAL A CG1   
854  C CG2   . VAL A 108 ? 0.5194 0.4441 0.4294 0.0370  0.0034  0.0909  108 VAL A CG2   
855  N N     . ARG A 109 ? 0.4964 0.4635 0.4557 0.0220  -0.0211 0.0620  109 ARG A N     
856  C CA    . ARG A 109 ? 0.4935 0.4759 0.4639 0.0205  -0.0281 0.0550  109 ARG A CA    
857  C C     . ARG A 109 ? 0.4375 0.4221 0.4164 0.0099  -0.0281 0.0457  109 ARG A C     
858  O O     . ARG A 109 ? 0.4794 0.4762 0.4680 0.0058  -0.0320 0.0384  109 ARG A O     
859  C CB    . ARG A 109 ? 0.4865 0.4673 0.4666 0.0232  -0.0272 0.0588  109 ARG A CB    
860  C CG    . ARG A 109 ? 0.4781 0.4530 0.4467 0.0354  -0.0270 0.0682  109 ARG A CG    
861  C CD    . ARG A 109 ? 0.4847 0.4582 0.4613 0.0404  -0.0267 0.0710  109 ARG A CD    
862  N NE    . ARG A 109 ? 0.4911 0.4873 0.4793 0.0430  -0.0339 0.0642  109 ARG A NE    
863  C CZ    . ARG A 109 ? 0.4669 0.4680 0.4664 0.0460  -0.0337 0.0634  109 ARG A CZ    
864  N NH1   . ARG A 109 ? 0.4390 0.4215 0.4378 0.0469  -0.0274 0.0687  109 ARG A NH1   
865  N NH2   . ARG A 109 ? 0.3951 0.4209 0.4078 0.0472  -0.0393 0.0560  109 ARG A NH2   
866  N N     . LYS A 110 ? 0.4258 0.3985 0.4009 0.0058  -0.0230 0.0457  110 LYS A N     
867  C CA    . LYS A 110 ? 0.4442 0.4132 0.4231 -0.0021 -0.0218 0.0380  110 LYS A CA    
868  C C     . LYS A 110 ? 0.4785 0.4448 0.4688 -0.0073 -0.0204 0.0363  110 LYS A C     
869  O O     . LYS A 110 ? 0.5546 0.5195 0.5474 -0.0139 -0.0199 0.0296  110 LYS A O     
870  C CB    . LYS A 110 ? 0.4442 0.4226 0.4194 -0.0049 -0.0267 0.0287  110 LYS A CB    
871  C CG    . LYS A 110 ? 0.5214 0.5015 0.4813 0.0001  -0.0283 0.0280  110 LYS A CG    
872  C CD    . LYS A 110 ? 0.5444 0.5354 0.5026 -0.0038 -0.0345 0.0161  110 LYS A CD    
873  C CE    . LYS A 110 ? 0.5556 0.5437 0.4963 -0.0004 -0.0349 0.0126  110 LYS A CE    
874  N NZ    . LYS A 110 ? 0.6368 0.6345 0.5648 0.0103  -0.0394 0.0180  110 LYS A NZ    
875  N N     . PHE A 111 ? 0.4242 0.3877 0.4198 -0.0047 -0.0187 0.0420  111 PHE A N     
876  C CA    . PHE A 111 ? 0.4109 0.3708 0.4140 -0.0084 -0.0166 0.0408  111 PHE A CA    
877  C C     . PHE A 111 ? 0.4378 0.3829 0.4379 -0.0101 -0.0129 0.0412  111 PHE A C     
878  O O     . PHE A 111 ? 0.4759 0.4144 0.4763 -0.0135 -0.0106 0.0389  111 PHE A O     
879  C CB    . PHE A 111 ? 0.4334 0.3959 0.4415 -0.0036 -0.0166 0.0456  111 PHE A CB    
880  C CG    . PHE A 111 ? 0.4426 0.4214 0.4553 0.0004  -0.0207 0.0448  111 PHE A CG    
881  C CD1   . PHE A 111 ? 0.4377 0.4309 0.4529 -0.0024 -0.0247 0.0382  111 PHE A CD1   
882  C CD2   . PHE A 111 ? 0.3816 0.3615 0.3963 0.0077  -0.0210 0.0497  111 PHE A CD2   
883  C CE1   . PHE A 111 ? 0.3902 0.4030 0.4113 0.0029  -0.0302 0.0362  111 PHE A CE1   
884  C CE2   . PHE A 111 ? 0.3721 0.3683 0.3910 0.0142  -0.0254 0.0489  111 PHE A CE2   
885  C CZ    . PHE A 111 ? 0.4049 0.4197 0.4279 0.0121  -0.0307 0.0420  111 PHE A CZ    
886  N N     . GLY A 112 ? 0.4066 0.3473 0.4036 -0.0070 -0.0121 0.0439  112 GLY A N     
887  C CA    . GLY A 112 ? 0.3807 0.3123 0.3771 -0.0062 -0.0103 0.0435  112 GLY A CA    
888  C C     . GLY A 112 ? 0.4659 0.3887 0.4562 -0.0077 -0.0093 0.0393  112 GLY A C     
889  O O     . GLY A 112 ? 0.4708 0.3935 0.4570 -0.0105 -0.0090 0.0357  112 GLY A O     
890  N N     . THR A 113 ? 0.4256 0.3392 0.4134 -0.0050 -0.0087 0.0394  113 THR A N     
891  C CA    . THR A 113 ? 0.4182 0.3180 0.3965 -0.0046 -0.0066 0.0369  113 THR A CA    
892  C C     . THR A 113 ? 0.4539 0.3484 0.4285 0.0032  -0.0078 0.0365  113 THR A C     
893  O O     . THR A 113 ? 0.4615 0.3635 0.4425 0.0070  -0.0105 0.0373  113 THR A O     
894  C CB    . THR A 113 ? 0.4661 0.3561 0.4400 -0.0075 -0.0037 0.0378  113 THR A CB    
895  O OG1   . THR A 113 ? 0.4648 0.3548 0.4391 -0.0027 -0.0054 0.0405  113 THR A OG1   
896  C CG2   . THR A 113 ? 0.3594 0.2588 0.3405 -0.0152 -0.0022 0.0364  113 THR A CG2   
897  N N     . TRP A 114 ? 0.4308 0.3126 0.3954 0.0058  -0.0058 0.0342  114 TRP A N     
898  C CA    . TRP A 114 ? 0.4526 0.3272 0.4111 0.0161  -0.0072 0.0337  114 TRP A CA    
899  C C     . TRP A 114 ? 0.5024 0.3526 0.4437 0.0187  -0.0038 0.0349  114 TRP A C     
900  O O     . TRP A 114 ? 0.4675 0.3049 0.4023 0.0116  0.0014  0.0336  114 TRP A O     
901  C CB    . TRP A 114 ? 0.4605 0.3392 0.4202 0.0203  -0.0067 0.0303  114 TRP A CB    
902  C CG    . TRP A 114 ? 0.4497 0.3497 0.4242 0.0215  -0.0084 0.0295  114 TRP A CG    
903  C CD1   . TRP A 114 ? 0.4153 0.3289 0.4017 0.0169  -0.0097 0.0316  114 TRP A CD1   
904  C CD2   . TRP A 114 ? 0.4940 0.4025 0.4728 0.0274  -0.0072 0.0263  114 TRP A CD2   
905  N NE1   . TRP A 114 ? 0.4573 0.3862 0.4553 0.0180  -0.0085 0.0300  114 TRP A NE1   
906  C CE2   . TRP A 114 ? 0.4493 0.3773 0.4438 0.0244  -0.0068 0.0266  114 TRP A CE2   
907  C CE3   . TRP A 114 ? 0.5634 0.4637 0.5339 0.0350  -0.0052 0.0228  114 TRP A CE3   
908  C CZ2   . TRP A 114 ? 0.4386 0.3805 0.4425 0.0277  -0.0038 0.0236  114 TRP A CZ2   
909  C CZ3   . TRP A 114 ? 0.5269 0.4421 0.5065 0.0401  -0.0033 0.0195  114 TRP A CZ3   
910  C CH2   . TRP A 114 ? 0.4793 0.4163 0.4762 0.0359  -0.0022 0.0199  114 TRP A CH2   
911  N N     . GLU A 115 ? 0.5088 0.3520 0.4420 0.0287  -0.0064 0.0369  115 GLU A N     
912  C CA    . GLU A 115 ? 0.5250 0.3405 0.4367 0.0340  -0.0021 0.0397  115 GLU A CA    
913  C C     . GLU A 115 ? 0.5429 0.3538 0.4451 0.0510  -0.0071 0.0396  115 GLU A C     
914  O O     . GLU A 115 ? 0.5515 0.3793 0.4612 0.0581  -0.0146 0.0385  115 GLU A O     
915  C CB    . GLU A 115 ? 0.5008 0.3085 0.4057 0.0300  0.0009  0.0437  115 GLU A CB    
916  C CG    . GLU A 115 ? 0.4981 0.3103 0.4125 0.0142  0.0066  0.0431  115 GLU A CG    
917  C CD    . GLU A 115 ? 0.6139 0.4287 0.5285 0.0111  0.0085  0.0460  115 GLU A CD    
918  O OE1   . GLU A 115 ? 0.6516 0.4846 0.5774 0.0128  0.0026  0.0456  115 GLU A OE1   
919  O OE2   . GLU A 115 ? 0.6970 0.4943 0.6003 0.0065  0.0172  0.0484  115 GLU A OE2   
920  N N     . LEU A 116 ? 0.5578 0.3466 0.4445 0.0576  -0.0031 0.0396  116 LEU A N     
921  C CA    . LEU A 116 ? 0.5608 0.3409 0.4344 0.0769  -0.0073 0.0401  116 LEU A CA    
922  C C     . LEU A 116 ? 0.6435 0.3953 0.4904 0.0851  -0.0047 0.0465  116 LEU A C     
923  O O     . LEU A 116 ? 0.6522 0.3737 0.4816 0.0791  0.0054  0.0504  116 LEU A O     
924  C CB    . LEU A 116 ? 0.5858 0.3519 0.4524 0.0824  -0.0034 0.0373  116 LEU A CB    
925  C CG    . LEU A 116 ? 0.5752 0.3383 0.4320 0.1053  -0.0090 0.0367  116 LEU A CG    
926  C CD1   . LEU A 116 ? 0.5302 0.3347 0.4119 0.1115  -0.0199 0.0317  116 LEU A CD1   
927  C CD2   . LEU A 116 ? 0.6947 0.4425 0.5444 0.1108  -0.0040 0.0335  116 LEU A CD2   
928  N N     . ILE A 117 ? 0.6551 0.4168 0.4983 0.0990  -0.0136 0.0471  117 ILE A N     
929  C CA    . ILE A 117 ? 0.6521 0.3910 0.4682 0.1086  -0.0128 0.0534  117 ILE A CA    
930  C C     . ILE A 117 ? 0.7170 0.4557 0.5195 0.1340  -0.0227 0.0528  117 ILE A C     
931  O O     . ILE A 117 ? 0.6884 0.4588 0.5125 0.1405  -0.0327 0.0455  117 ILE A O     
932  C CB    . ILE A 117 ? 0.7562 0.5134 0.5821 0.1003  -0.0162 0.0530  117 ILE A CB    
933  C CG1   . ILE A 117 ? 0.7901 0.5446 0.6256 0.0789  -0.0060 0.0545  117 ILE A CG1   
934  C CG2   . ILE A 117 ? 0.8148 0.5533 0.6130 0.1121  -0.0167 0.0583  117 ILE A CG2   
935  C CD1   . ILE A 117 ? 0.7616 0.4801 0.5760 0.0737  0.0076  0.0599  117 ILE A CD1   
936  N N     . SER A 118 ? 0.7527 0.4566 0.5197 0.1488  -0.0193 0.0601  118 SER A N     
937  C CA    . SER A 118 ? 0.7804 0.4856 0.5316 0.1761  -0.0307 0.0597  118 SER A CA    
938  C C     . SER A 118 ? 0.7439 0.4796 0.5043 0.1807  -0.0438 0.0551  118 SER A C     
939  O O     . SER A 118 ? 0.6697 0.4077 0.4324 0.1669  -0.0408 0.0564  118 SER A O     
940  C CB    . SER A 118 ? 0.8272 0.4830 0.5325 0.1925  -0.0233 0.0703  118 SER A CB    
941  O OG    . SER A 118 ? 1.0003 0.6232 0.6955 0.1863  -0.0096 0.0738  118 SER A OG    
942  N N     . THR A 119 ? 0.7053 0.4645 0.4707 0.2007  -0.0585 0.0487  119 THR A N     
943  C CA    . THR A 119 ? 0.7497 0.5400 0.5246 0.2065  -0.0728 0.0415  119 THR A CA    
944  C C     . THR A 119 ? 0.7689 0.5340 0.5097 0.2112  -0.0711 0.0487  119 THR A C     
945  O O     . THR A 119 ? 0.7088 0.4901 0.4602 0.2000  -0.0740 0.0448  119 THR A O     
946  C CB    . THR A 119 ? 0.8046 0.6206 0.5850 0.2313  -0.0890 0.0334  119 THR A CB    
947  O OG1   . THR A 119 ? 0.7022 0.5486 0.5202 0.2234  -0.0894 0.0252  119 THR A OG1   
948  C CG2   . THR A 119 ? 0.7167 0.5640 0.5031 0.2392  -0.1058 0.0241  119 THR A CG2   
949  N N     . ASP A 120 ? 0.8896 0.6124 0.5876 0.2277  -0.0650 0.0594  120 ASP A N     
950  C CA    . ASP A 120 ? 0.8753 0.5739 0.5397 0.2301  -0.0596 0.0661  120 ASP A CA    
951  C C     . ASP A 120 ? 0.8647 0.5380 0.5242 0.2076  -0.0422 0.0744  120 ASP A C     
952  O O     . ASP A 120 ? 0.9565 0.6102 0.5909 0.2061  -0.0339 0.0797  120 ASP A O     
953  C CB    . ASP A 120 ? 0.9180 0.5888 0.5467 0.2462  -0.0536 0.0709  120 ASP A CB    
954  C CG    . ASP A 120 ? 1.1207 0.7594 0.7420 0.2392  -0.0371 0.0775  120 ASP A CG    
955  O OD1   . ASP A 120 ? 1.2158 0.8602 0.8625 0.2259  -0.0338 0.0760  120 ASP A OD1   
956  O OD2   . ASP A 120 ? 1.2592 0.8660 0.8483 0.2477  -0.0274 0.0835  120 ASP A OD2   
957  N N     . GLN A 121 ? 0.8293 0.5139 0.5209 0.1846  -0.0345 0.0715  121 GLN A N     
958  C CA    . GLN A 121 ? 0.8161 0.4873 0.5111 0.1610  -0.0187 0.0759  121 GLN A CA    
959  C C     . GLN A 121 ? 0.7513 0.4607 0.4821 0.1437  -0.0240 0.0676  121 GLN A C     
960  O O     . GLN A 121 ? 0.7343 0.4406 0.4727 0.1254  -0.0132 0.0696  121 GLN A O     
961  C CB    . GLN A 121 ? 0.8510 0.5019 0.5512 0.1475  -0.0048 0.0791  121 GLN A CB    
962  C CG    . GLN A 121 ? 1.0247 0.6290 0.6868 0.1593  0.0060  0.0881  121 GLN A CG    
963  C CD    . GLN A 121 ? 1.2442 0.8240 0.8780 0.1565  0.0190  0.0949  121 GLN A CD    
964  O OE1   . GLN A 121 ? 1.3192 0.8880 0.9563 0.1368  0.0333  0.0979  121 GLN A OE1   
965  N NE2   . GLN A 121 ? 1.3007 0.8728 0.9066 0.1768  0.0143  0.0966  121 GLN A NE2   
966  N N     . VAL A 122 ? 0.7144 0.4601 0.4678 0.1496  -0.0400 0.0577  122 VAL A N     
967  C CA    . VAL A 122 ? 0.6440 0.4226 0.4304 0.1339  -0.0445 0.0497  122 VAL A CA    
968  C C     . VAL A 122 ? 0.6411 0.4149 0.4143 0.1312  -0.0427 0.0507  122 VAL A C     
969  O O     . VAL A 122 ? 0.7030 0.4823 0.4914 0.1142  -0.0356 0.0505  122 VAL A O     
970  C CB    . VAL A 122 ? 0.6019 0.4186 0.4153 0.1399  -0.0606 0.0380  122 VAL A CB    
971  C CG1   . VAL A 122 ? 0.4994 0.3437 0.3417 0.1243  -0.0640 0.0300  122 VAL A CG1   
972  C CG2   . VAL A 122 ? 0.5801 0.4052 0.4120 0.1388  -0.0595 0.0364  122 VAL A CG2   
973  N N     . LEU A 123 ? 0.7552 0.5176 0.4979 0.1492  -0.0486 0.0520  123 LEU A N     
974  C CA    . LEU A 123 ? 0.7980 0.5545 0.5255 0.1474  -0.0459 0.0526  123 LEU A CA    
975  C C     . LEU A 123 ? 0.7455 0.4716 0.4572 0.1355  -0.0253 0.0635  123 LEU A C     
976  O O     . LEU A 123 ? 0.6761 0.4097 0.4004 0.1214  -0.0190 0.0620  123 LEU A O     
977  C CB    . LEU A 123 ? 0.9907 0.7412 0.6846 0.1715  -0.0575 0.0511  123 LEU A CB    
978  C CG    . LEU A 123 ? 1.0918 0.8785 0.8057 0.1826  -0.0790 0.0375  123 LEU A CG    
979  C CD1   . LEU A 123 ? 1.1136 0.9009 0.7966 0.2064  -0.0935 0.0331  123 LEU A CD1   
980  C CD2   . LEU A 123 ? 1.1262 0.9489 0.8851 0.1634  -0.0840 0.0254  123 LEU A CD2   
981  N N     . PRO A 124 ? 0.7091 0.4012 0.3946 0.1409  -0.0142 0.0737  124 PRO A N     
982  C CA    . PRO A 124 ? 0.6784 0.3446 0.3549 0.1259  0.0069  0.0823  124 PRO A CA    
983  C C     . PRO A 124 ? 0.7270 0.4145 0.4436 0.1020  0.0123  0.0778  124 PRO A C     
984  O O     . PRO A 124 ? 0.7523 0.4384 0.4743 0.0882  0.0242  0.0795  124 PRO A O     
985  C CB    . PRO A 124 ? 0.6672 0.2966 0.3174 0.1336  0.0161  0.0913  124 PRO A CB    
986  C CG    . PRO A 124 ? 0.6865 0.3132 0.3124 0.1612  0.0005  0.0909  124 PRO A CG    
987  C CD    . PRO A 124 ? 0.7604 0.4344 0.4218 0.1613  -0.0193 0.0777  124 PRO A CD    
988  N N     . TYR A 125 ? 0.6730 0.3816 0.4171 0.0986  0.0035  0.0720  125 TYR A N     
989  C CA    . TYR A 125 ? 0.6353 0.3651 0.4144 0.0791  0.0064  0.0677  125 TYR A CA    
990  C C     . TYR A 125 ? 0.6073 0.3594 0.4032 0.0718  0.0038  0.0631  125 TYR A C     
991  O O     . TYR A 125 ? 0.6766 0.4338 0.4870 0.0573  0.0127  0.0634  125 TYR A O     
992  C CB    . TYR A 125 ? 0.6248 0.3749 0.4272 0.0798  -0.0039 0.0619  125 TYR A CB    
993  C CG    . TYR A 125 ? 0.5511 0.3243 0.3871 0.0625  -0.0028 0.0575  125 TYR A CG    
994  C CD1   . TYR A 125 ? 0.5694 0.3704 0.4281 0.0584  -0.0109 0.0516  125 TYR A CD1   
995  C CD2   . TYR A 125 ? 0.5335 0.2994 0.3766 0.0509  0.0061  0.0589  125 TYR A CD2   
996  C CE1   . TYR A 125 ? 0.5777 0.3968 0.4627 0.0449  -0.0096 0.0490  125 TYR A CE1   
997  C CE2   . TYR A 125 ? 0.5301 0.3177 0.4007 0.0375  0.0056  0.0548  125 TYR A CE2   
998  C CZ    . TYR A 125 ? 0.5741 0.3874 0.4642 0.0355  -0.0020 0.0508  125 TYR A CZ    
999  O OH    . TYR A 125 ? 0.5439 0.3756 0.4570 0.0245  -0.0020 0.0482  125 TYR A OH    
1000 N N     . PHE A 126 ? 0.5908 0.3570 0.3856 0.0820  -0.0088 0.0577  126 PHE A N     
1001 C CA    . PHE A 126 ? 0.6162 0.4016 0.4278 0.0747  -0.0112 0.0522  126 PHE A CA    
1002 C C     . PHE A 126 ? 0.6245 0.3938 0.4131 0.0764  -0.0018 0.0561  126 PHE A C     
1003 O O     . PHE A 126 ? 0.6193 0.3983 0.4212 0.0671  0.0030  0.0540  126 PHE A O     
1004 C CB    . PHE A 126 ? 0.5561 0.3646 0.3804 0.0814  -0.0276 0.0425  126 PHE A CB    
1005 C CG    . PHE A 126 ? 0.5573 0.3870 0.4123 0.0745  -0.0333 0.0379  126 PHE A CG    
1006 C CD1   . PHE A 126 ? 0.5590 0.4020 0.4398 0.0598  -0.0294 0.0366  126 PHE A CD1   
1007 C CD2   . PHE A 126 ? 0.5764 0.4124 0.4329 0.0839  -0.0419 0.0352  126 PHE A CD2   
1008 C CE1   . PHE A 126 ? 0.5575 0.4176 0.4630 0.0539  -0.0330 0.0334  126 PHE A CE1   
1009 C CE2   . PHE A 126 ? 0.5579 0.4138 0.4424 0.0773  -0.0452 0.0310  126 PHE A CE2   
1010 C CZ    . PHE A 126 ? 0.5079 0.3746 0.4156 0.0619  -0.0402 0.0305  126 PHE A CZ    
1011 N N     . LEU A 127 ? 0.6514 0.3951 0.4042 0.0891  0.0018  0.0621  127 LEU A N     
1012 C CA    . LEU A 127 ? 0.6877 0.4115 0.4145 0.0903  0.0148  0.0676  127 LEU A CA    
1013 C C     . LEU A 127 ? 0.7540 0.4715 0.4925 0.0728  0.0333  0.0725  127 LEU A C     
1014 O O     . LEU A 127 ? 0.7714 0.4939 0.5142 0.0660  0.0419  0.0718  127 LEU A O     
1015 C CB    . LEU A 127 ? 0.7385 0.4313 0.4216 0.1075  0.0173  0.0752  127 LEU A CB    
1016 C CG    . LEU A 127 ? 0.7681 0.4699 0.4368 0.1271  -0.0020 0.0689  127 LEU A CG    
1017 C CD1   . LEU A 127 ? 0.8294 0.4989 0.4531 0.1472  -0.0006 0.0777  127 LEU A CD1   
1018 C CD2   . LEU A 127 ? 0.7110 0.4242 0.3763 0.1288  -0.0059 0.0621  127 LEU A CD2   
1019 N N     . LYS A 128 ? 0.6835 0.3918 0.4282 0.0657  0.0391  0.0762  128 LYS A N     
1020 C CA    . LYS A 128 ? 0.7237 0.4294 0.4827 0.0479  0.0553  0.0785  128 LYS A CA    
1021 C C     . LYS A 128 ? 0.7464 0.4854 0.5422 0.0360  0.0520  0.0714  128 LYS A C     
1022 O O     . LYS A 128 ? 0.8008 0.5449 0.6074 0.0248  0.0641  0.0714  128 LYS A O     
1023 C CB    . LYS A 128 ? 0.7345 0.4274 0.4968 0.0421  0.0590  0.0806  128 LYS A CB    
1024 C CG    . LYS A 128 ? 0.8382 0.5275 0.6145 0.0227  0.0758  0.0811  128 LYS A CG    
1025 C CD    . LYS A 128 ? 0.9131 0.5783 0.6818 0.0185  0.0821  0.0835  128 LYS A CD    
1026 C CE    . LYS A 128 ? 0.9971 0.6622 0.7842 -0.0034 0.0978  0.0809  128 LYS A CE    
1027 N NZ    . LYS A 128 ? 1.0578 0.6941 0.8345 -0.0084 0.1054  0.0822  128 LYS A NZ    
1028 N N     . LYS A 129 ? 0.6795 0.4411 0.4942 0.0391  0.0362  0.0652  129 LYS A N     
1029 C CA    . LYS A 129 ? 0.6044 0.3926 0.4492 0.0302  0.0336  0.0598  129 LYS A CA    
1030 C C     . LYS A 129 ? 0.6324 0.4261 0.4725 0.0352  0.0329  0.0570  129 LYS A C     
1031 O O     . LYS A 129 ? 0.6602 0.4714 0.5210 0.0296  0.0330  0.0534  129 LYS A O     
1032 C CB    . LYS A 129 ? 0.5807 0.3874 0.4472 0.0296  0.0202  0.0551  129 LYS A CB    
1033 C CG    . LYS A 129 ? 0.6064 0.4085 0.4779 0.0245  0.0217  0.0569  129 LYS A CG    
1034 C CD    . LYS A 129 ? 0.6047 0.4283 0.5024 0.0191  0.0139  0.0528  129 LYS A CD    
1035 C CE    . LYS A 129 ? 0.6303 0.4473 0.5289 0.0157  0.0152  0.0536  129 LYS A CE    
1036 N NZ    . LYS A 129 ? 0.6416 0.4517 0.5420 0.0044  0.0272  0.0549  129 LYS A NZ    
1037 N N     . LYS A 130 ? 0.7115 0.4890 0.5222 0.0470  0.0323  0.0585  130 LYS A N     
1038 C CA    . LYS A 130 ? 0.7275 0.5082 0.5300 0.0529  0.0312  0.0545  130 LYS A CA    
1039 C C     . LYS A 130 ? 0.6973 0.4997 0.5228 0.0526  0.0175  0.0458  130 LYS A C     
1040 O O     . LYS A 130 ? 0.7728 0.5831 0.6060 0.0512  0.0192  0.0417  130 LYS A O     
1041 C CB    . LYS A 130 ? 0.6823 0.4626 0.4874 0.0455  0.0479  0.0569  130 LYS A CB    
1042 C CG    . LYS A 130 ? 0.7093 0.4648 0.4868 0.0460  0.0644  0.0649  130 LYS A CG    
1043 N N     . ILE A 131 ? 0.6062 0.4169 0.4429 0.0536  0.0053  0.0429  131 ILE A N     
1044 C CA    . ILE A 131 ? 0.5759 0.4036 0.4314 0.0530  -0.0068 0.0344  131 ILE A CA    
1045 C C     . ILE A 131 ? 0.5936 0.4189 0.4326 0.0627  -0.0140 0.0269  131 ILE A C     
1046 O O     . ILE A 131 ? 0.5234 0.3402 0.3392 0.0737  -0.0197 0.0262  131 ILE A O     
1047 C CB    . ILE A 131 ? 0.5871 0.4239 0.4552 0.0530  -0.0168 0.0324  131 ILE A CB    
1048 C CG1   . ILE A 131 ? 0.6526 0.4899 0.5330 0.0445  -0.0098 0.0388  131 ILE A CG1   
1049 C CG2   . ILE A 131 ? 0.6066 0.4610 0.4992 0.0481  -0.0252 0.0244  131 ILE A CG2   
1050 C CD1   . ILE A 131 ? 0.5796 0.4293 0.4841 0.0336  -0.0053 0.0389  131 ILE A CD1   
1051 N N     . GLY A 132 ? 0.5555 0.3874 0.4053 0.0594  -0.0143 0.0208  132 GLY A N     
1052 C CA    . GLY A 132 ? 0.4993 0.3293 0.3357 0.0669  -0.0214 0.0114  132 GLY A CA    
1053 C C     . GLY A 132 ? 0.5681 0.4096 0.4125 0.0693  -0.0375 0.0014  132 GLY A C     
1054 O O     . GLY A 132 ? 0.5513 0.4018 0.4103 0.0664  -0.0422 0.0028  132 GLY A O     
1055 N N     . PRO A 133 ? 0.6174 0.4599 0.4527 0.0747  -0.0459 -0.0102 133 PRO A N     
1056 C CA    . PRO A 133 ? 0.5654 0.4222 0.4090 0.0769  -0.0620 -0.0228 133 PRO A CA    
1057 C C     . PRO A 133 ? 0.5981 0.4693 0.4780 0.0633  -0.0643 -0.0283 133 PRO A C     
1058 O O     . PRO A 133 ? 0.5594 0.4266 0.4536 0.0540  -0.0551 -0.0245 133 PRO A O     
1059 C CB    . PRO A 133 ? 0.5608 0.4127 0.3838 0.0847  -0.0682 -0.0346 133 PRO A CB    
1060 C CG    . PRO A 133 ? 0.5741 0.4121 0.3916 0.0812  -0.0538 -0.0298 133 PRO A CG    
1061 C CD    . PRO A 133 ? 0.5660 0.3968 0.3812 0.0795  -0.0404 -0.0133 133 PRO A CD    
1062 N N     . GLU A 134 ? 0.5664 0.4543 0.4604 0.0630  -0.0761 -0.0369 134 GLU A N     
1063 C CA    . GLU A 134 ? 0.5110 0.4119 0.4378 0.0496  -0.0773 -0.0434 134 GLU A CA    
1064 C C     . GLU A 134 ? 0.5570 0.4532 0.4881 0.0436  -0.0780 -0.0555 134 GLU A C     
1065 O O     . GLU A 134 ? 0.5176 0.4103 0.4301 0.0512  -0.0846 -0.0650 134 GLU A O     
1066 C CB    . GLU A 134 ? 0.4630 0.3859 0.4048 0.0511  -0.0891 -0.0515 134 GLU A CB    
1067 C CG    . GLU A 134 ? 0.4711 0.3963 0.4103 0.0567  -0.0871 -0.0398 134 GLU A CG    
1068 C CD    . GLU A 134 ? 0.5071 0.4311 0.4661 0.0449  -0.0757 -0.0297 134 GLU A CD    
1069 O OE1   . GLU A 134 ? 0.5628 0.4942 0.5461 0.0327  -0.0734 -0.0346 134 GLU A OE1   
1070 O OE2   . GLU A 134 ? 0.5205 0.4346 0.4692 0.0478  -0.0686 -0.0171 134 GLU A OE2   
1071 N N     . PRO A 135 ? 0.5365 0.4301 0.4900 0.0306  -0.0707 -0.0552 135 PRO A N     
1072 C CA    . PRO A 135 ? 0.5251 0.4086 0.4831 0.0239  -0.0687 -0.0655 135 PRO A CA    
1073 C C     . PRO A 135 ? 0.5984 0.4949 0.5691 0.0186  -0.0803 -0.0851 135 PRO A C     
1074 O O     . PRO A 135 ? 0.6586 0.5564 0.6530 0.0050  -0.0774 -0.0916 135 PRO A O     
1075 C CB    . PRO A 135 ? 0.5229 0.3994 0.5000 0.0131  -0.0572 -0.0567 135 PRO A CB    
1076 C CG    . PRO A 135 ? 0.4532 0.3450 0.4444 0.0104  -0.0576 -0.0488 135 PRO A CG    
1077 C CD    . PRO A 135 ? 0.4390 0.3368 0.4119 0.0226  -0.0633 -0.0445 135 PRO A CD    
1078 N N     . THR A 136 ? 0.6198 0.5253 0.5740 0.0293  -0.0929 -0.0949 136 THR A N     
1079 C CA    . THR A 136 ? 0.6480 0.5695 0.6128 0.0258  -0.1065 -0.1168 136 THR A CA    
1080 C C     . THR A 136 ? 0.6350 0.5485 0.5713 0.0365  -0.1144 -0.1284 136 THR A C     
1081 O O     . THR A 136 ? 0.6525 0.5536 0.5579 0.0504  -0.1119 -0.1183 136 THR A O     
1082 C CB    . THR A 136 ? 0.6532 0.6036 0.6289 0.0310  -0.1193 -0.1216 136 THR A CB    
1083 O OG1   . THR A 136 ? 0.5957 0.5439 0.5389 0.0506  -0.1254 -0.1145 136 THR A OG1   
1084 C CG2   . THR A 136 ? 0.4378 0.3969 0.4393 0.0221  -0.1109 -0.1099 136 THR A CG2   
1085 N N     . TYR A 137 ? 0.6317 0.5522 0.5777 0.0298  -0.1236 -0.1502 137 TYR A N     
1086 C CA    . TYR A 137 ? 0.6757 0.5902 0.5930 0.0406  -0.1330 -0.1638 137 TYR A CA    
1087 C C     . TYR A 137 ? 0.7302 0.6575 0.6203 0.0610  -0.1461 -0.1623 137 TYR A C     
1088 O O     . TYR A 137 ? 0.8193 0.7326 0.6729 0.0752  -0.1473 -0.1614 137 TYR A O     
1089 C CB    . TYR A 137 ? 0.6082 0.5319 0.5440 0.0284  -0.1426 -0.1908 137 TYR A CB    
1090 C CG    . TYR A 137 ? 0.6393 0.5384 0.5889 0.0120  -0.1281 -0.1925 137 TYR A CG    
1091 C CD1   . TYR A 137 ? 0.6935 0.5631 0.6174 0.0177  -0.1188 -0.1888 137 TYR A CD1   
1092 C CD2   . TYR A 137 ? 0.6121 0.5159 0.5989 -0.0081 -0.1221 -0.1967 137 TYR A CD2   
1093 C CE1   . TYR A 137 ? 0.7424 0.5869 0.6766 0.0055  -0.1053 -0.1896 137 TYR A CE1   
1094 C CE2   . TYR A 137 ? 0.6696 0.5458 0.6650 -0.0214 -0.1076 -0.1963 137 TYR A CE2   
1095 C CZ    . TYR A 137 ? 0.7836 0.6299 0.7525 -0.0137 -0.0998 -0.1927 137 TYR A CZ    
1096 O OH    . TYR A 137 ? 0.8817 0.6988 0.8575 -0.0245 -0.0856 -0.1922 137 TYR A OH    
1097 N N     . GLU A 138 ? 0.7005 0.6521 0.6056 0.0638  -0.1544 -0.1606 138 GLU A N     
1098 C CA    . GLU A 138 ? 0.7142 0.6756 0.5916 0.0854  -0.1669 -0.1582 138 GLU A CA    
1099 C C     . GLU A 138 ? 0.6959 0.6329 0.5414 0.0977  -0.1542 -0.1333 138 GLU A C     
1100 O O     . GLU A 138 ? 0.7179 0.6464 0.5253 0.1162  -0.1590 -0.1302 138 GLU A O     
1101 C CB    . GLU A 138 ? 0.6752 0.6698 0.5787 0.0867  -0.1791 -0.1635 138 GLU A CB    
1102 N N     . ASP A 139 ? 0.6832 0.6088 0.5432 0.0873  -0.1376 -0.1162 139 ASP A N     
1103 C CA    . ASP A 139 ? 0.6963 0.6032 0.5323 0.0964  -0.1256 -0.0942 139 ASP A CA    
1104 C C     . ASP A 139 ? 0.7055 0.5867 0.5258 0.0936  -0.1091 -0.0846 139 ASP A C     
1105 O O     . ASP A 139 ? 0.7166 0.5811 0.5080 0.1037  -0.1006 -0.0713 139 ASP A O     
1106 C CB    . ASP A 139 ? 0.7900 0.7043 0.6508 0.0890  -0.1193 -0.0818 139 ASP A CB    
1107 C CG    . ASP A 139 ? 0.9656 0.9066 0.8416 0.0941  -0.1342 -0.0900 139 ASP A CG    
1108 O OD1   . ASP A 139 ? 1.0739 1.0210 0.9268 0.1111  -0.1476 -0.0964 139 ASP A OD1   
1109 O OD2   . ASP A 139 ? 0.9965 0.9531 0.9064 0.0822  -0.1326 -0.0907 139 ASP A OD2   
1110 N N     . PHE A 140 ? 0.6691 0.5469 0.5091 0.0802  -0.1037 -0.0914 140 PHE A N     
1111 C CA    . PHE A 140 ? 0.6064 0.4638 0.4387 0.0773  -0.0877 -0.0824 140 PHE A CA    
1112 C C     . PHE A 140 ? 0.6180 0.4631 0.4216 0.0861  -0.0897 -0.0933 140 PHE A C     
1113 O O     . PHE A 140 ? 0.6152 0.4585 0.4277 0.0796  -0.0930 -0.1084 140 PHE A O     
1114 C CB    . PHE A 140 ? 0.5954 0.4525 0.4610 0.0608  -0.0803 -0.0826 140 PHE A CB    
1115 C CG    . PHE A 140 ? 0.5986 0.4383 0.4608 0.0592  -0.0644 -0.0723 140 PHE A CG    
1116 C CD1   . PHE A 140 ? 0.5778 0.4079 0.4164 0.0687  -0.0550 -0.0602 140 PHE A CD1   
1117 C CD2   . PHE A 140 ? 0.5641 0.3971 0.4473 0.0485  -0.0580 -0.0749 140 PHE A CD2   
1118 C CE1   . PHE A 140 ? 0.5164 0.3360 0.3562 0.0674  -0.0406 -0.0521 140 PHE A CE1   
1119 C CE2   . PHE A 140 ? 0.4943 0.3138 0.3753 0.0494  -0.0444 -0.0656 140 PHE A CE2   
1120 C CZ    . PHE A 140 ? 0.5034 0.3190 0.3649 0.0588  -0.0363 -0.0550 140 PHE A CZ    
1121 N N     . ASP A 141 ? 0.6704 0.5050 0.4378 0.1009  -0.0868 -0.0858 141 ASP A N     
1122 C CA    . ASP A 141 ? 0.6672 0.4900 0.4017 0.1117  -0.0887 -0.0956 141 ASP A CA    
1123 C C     . ASP A 141 ? 0.6585 0.4644 0.3912 0.1078  -0.0722 -0.0929 141 ASP A C     
1124 O O     . ASP A 141 ? 0.6840 0.4813 0.4143 0.1077  -0.0560 -0.0765 141 ASP A O     
1125 C CB    . ASP A 141 ? 0.7230 0.5376 0.4160 0.1298  -0.0891 -0.0868 141 ASP A CB    
1126 C CG    . ASP A 141 ? 0.9289 0.7282 0.5819 0.1424  -0.0875 -0.0942 141 ASP A CG    
1127 O OD1   . ASP A 141 ? 1.0246 0.8244 0.6811 0.1392  -0.0933 -0.1118 141 ASP A OD1   
1128 O OD2   . ASP A 141 ? 1.0358 0.8203 0.6520 0.1556  -0.0795 -0.0826 141 ASP A OD2   
1129 N N     . GLU A 142 ? 0.5921 0.4797 0.5635 0.0247  -0.1103 0.0137  142 GLU A N     
1130 C CA    . GLU A 142 ? 0.6134 0.4888 0.5365 0.0414  -0.1067 -0.0079 142 GLU A CA    
1131 C C     . GLU A 142 ? 0.6269 0.5255 0.4975 0.0629  -0.0898 -0.0102 142 GLU A C     
1132 O O     . GLU A 142 ? 0.6006 0.5136 0.4556 0.0735  -0.0664 -0.0155 142 GLU A O     
1133 C CB    . GLU A 142 ? 0.6448 0.4776 0.5469 0.0471  -0.1498 -0.0277 142 GLU A CB    
1134 C CG    . GLU A 142 ? 0.7606 0.5791 0.6146 0.0702  -0.1498 -0.0549 142 GLU A CG    
1135 C CD    . GLU A 142 ? 0.9159 0.6832 0.7607 0.0755  -0.1996 -0.0771 142 GLU A CD    
1136 O OE1   . GLU A 142 ? 1.0431 0.7923 0.9411 0.0505  -0.2255 -0.0614 142 GLU A OE1   
1137 O OE2   . GLU A 142 ? 1.0047 0.7517 0.7935 0.1062  -0.2155 -0.1090 142 GLU A OE2   
1138 N N     . LYS A 143 ? 0.6262 0.5347 0.4747 0.0680  -0.1013 -0.0004 143 LYS A N     
1139 C CA    . LYS A 143 ? 0.6493 0.5931 0.4494 0.0876  -0.0846 0.0073  143 LYS A CA    
1140 C C     . LYS A 143 ? 0.6623 0.6465 0.4979 0.0787  -0.0483 0.0341  143 LYS A C     
1141 O O     . LYS A 143 ? 0.7414 0.7573 0.5515 0.0943  -0.0268 0.0388  143 LYS A O     
1142 C CB    . LYS A 143 ? 0.7037 0.6521 0.4764 0.0905  -0.1072 0.0194  143 LYS A CB    
1143 C CG    . LYS A 143 ? 0.8115 0.7166 0.5345 0.1060  -0.1507 -0.0101 143 LYS A CG    
1144 C CD    . LYS A 143 ? 1.0414 0.9613 0.6968 0.1251  -0.1667 -0.0052 143 LYS A CD    
1145 C CE    . LYS A 143 ? 1.1077 1.0053 0.7923 0.1037  -0.2016 0.0112  143 LYS A CE    
1146 N NZ    . LYS A 143 ? 1.1314 0.9678 0.8253 0.0997  -0.2507 -0.0136 143 LYS A NZ    
1147 N N     . LEU A 144 ? 0.5702 0.5543 0.4678 0.0561  -0.0447 0.0518  144 LEU A N     
1148 C CA    . LEU A 144 ? 0.5142 0.5236 0.4498 0.0482  -0.0221 0.0732  144 LEU A CA    
1149 C C     . LEU A 144 ? 0.5152 0.5176 0.4535 0.0517  -0.0040 0.0572  144 LEU A C     
1150 O O     . LEU A 144 ? 0.5092 0.5352 0.4521 0.0553  0.0131  0.0702  144 LEU A O     
1151 C CB    . LEU A 144 ? 0.4599 0.4626 0.4587 0.0301  -0.0287 0.0859  144 LEU A CB    
1152 C CG    . LEU A 144 ? 0.5078 0.5242 0.5489 0.0239  -0.0167 0.1033  144 LEU A CG    
1153 C CD1   . LEU A 144 ? 0.4316 0.4859 0.4614 0.0259  -0.0129 0.1372  144 LEU A CD1   
1154 C CD2   . LEU A 144 ? 0.4347 0.4402 0.5368 0.0138  -0.0289 0.1081  144 LEU A CD2   
1155 N N     . PHE A 145 ? 0.5006 0.4722 0.4421 0.0483  -0.0112 0.0341  145 PHE A N     
1156 C CA    . PHE A 145 ? 0.5089 0.4681 0.4489 0.0501  -0.0007 0.0184  145 PHE A CA    
1157 C C     . PHE A 145 ? 0.5828 0.5541 0.4790 0.0710  0.0059  0.0099  145 PHE A C     
1158 O O     . PHE A 145 ? 0.5632 0.5510 0.4673 0.0744  0.0241  0.0161  145 PHE A O     
1159 C CB    . PHE A 145 ? 0.5141 0.4433 0.4618 0.0420  -0.0178 0.0029  145 PHE A CB    
1160 C CG    . PHE A 145 ? 0.5321 0.4484 0.4856 0.0383  -0.0109 -0.0069 145 PHE A CG    
1161 C CD1   . PHE A 145 ? 0.4801 0.4062 0.4554 0.0323  0.0100  -0.0007 145 PHE A CD1   
1162 C CD2   . PHE A 145 ? 0.5126 0.4024 0.4518 0.0399  -0.0319 -0.0218 145 PHE A CD2   
1163 C CE1   . PHE A 145 ? 0.4925 0.4064 0.4687 0.0279  0.0139  -0.0078 145 PHE A CE1   
1164 C CE2   . PHE A 145 ? 0.4995 0.3775 0.4476 0.0333  -0.0293 -0.0259 145 PHE A CE2   
1165 C CZ    . PHE A 145 ? 0.5209 0.4132 0.4849 0.0268  -0.0044 -0.0178 145 PHE A CZ    
1166 N N     . ARG A 146 ? 0.5932 0.5579 0.4437 0.0882  -0.0111 -0.0047 146 ARG A N     
1167 C CA    . ARG A 146 ? 0.6493 0.6289 0.4514 0.1176  -0.0057 -0.0199 146 ARG A CA    
1168 C C     . ARG A 146 ? 0.6095 0.6460 0.4148 0.1249  0.0238  0.0091  146 ARG A C     
1169 O O     . ARG A 146 ? 0.5961 0.6544 0.4003 0.1385  0.0418  0.0080  146 ARG A O     
1170 C CB    . ARG A 146 ? 0.7483 0.7124 0.4923 0.1408  -0.0330 -0.0425 146 ARG A CB    
1171 C CG    . ARG A 146 ? 0.8230 0.8004 0.5108 0.1807  -0.0298 -0.0684 146 ARG A CG    
1172 C CD    . ARG A 146 ? 0.9699 0.9107 0.5965 0.2082  -0.0695 -0.1052 146 ARG A CD    
1173 N NE    . ARG A 146 ? 1.0316 0.9823 0.6274 0.2089  -0.0820 -0.0928 146 ARG A NE    
1174 C CZ    . ARG A 146 ? 1.0972 0.9989 0.6940 0.1963  -0.1241 -0.1021 146 ARG A CZ    
1175 N NH1   . ARG A 146 ? 1.1202 0.9654 0.7514 0.1812  -0.1561 -0.1197 146 ARG A NH1   
1176 N NH2   . ARG A 146 ? 1.0750 0.9867 0.6442 0.1966  -0.1368 -0.0884 146 ARG A NH2   
1177 N N     . GLU A 147 ? 0.5731 0.6361 0.3903 0.1143  0.0260  0.0399  147 GLU A N     
1178 C CA    . GLU A 147 ? 0.6030 0.7270 0.4311 0.1178  0.0489  0.0785  147 GLU A CA    
1179 C C     . GLU A 147 ? 0.5203 0.6491 0.4111 0.0990  0.0616  0.0983  147 GLU A C     
1180 O O     . GLU A 147 ? 0.5120 0.6868 0.4156 0.1062  0.0802  0.1229  147 GLU A O     
1181 C CB    . GLU A 147 ? 0.6742 0.8234 0.5064 0.1074  0.0412  0.1125  147 GLU A CB    
1182 C CG    . GLU A 147 ? 0.9134 1.0811 0.6716 0.1334  0.0341  0.1040  147 GLU A CG    
1183 C CD    . GLU A 147 ? 1.0507 1.2722 0.7585 0.1702  0.0586  0.1011  147 GLU A CD    
1184 O OE1   . GLU A 147 ? 1.0530 1.3425 0.7837 0.1697  0.0839  0.1462  147 GLU A OE1   
1185 O OE2   . GLU A 147 ? 1.0990 1.2963 0.7500 0.2007  0.0502  0.0551  147 GLU A OE2   
1186 N N     . LYS A 148 ? 0.4575 0.5428 0.3879 0.0770  0.0505  0.0893  148 LYS A N     
1187 C CA    . LYS A 148 ? 0.4940 0.5768 0.4746 0.0633  0.0559  0.1029  148 LYS A CA    
1188 C C     . LYS A 148 ? 0.5312 0.6122 0.4992 0.0756  0.0677  0.0857  148 LYS A C     
1189 O O     . LYS A 148 ? 0.5458 0.6495 0.5446 0.0735  0.0762  0.1071  148 LYS A O     
1190 C CB    . LYS A 148 ? 0.4461 0.4860 0.4596 0.0458  0.0427  0.0902  148 LYS A CB    
1191 C CG    . LYS A 148 ? 0.5479 0.5894 0.5945 0.0338  0.0284  0.1099  148 LYS A CG    
1192 C CD    . LYS A 148 ? 0.6772 0.6808 0.7513 0.0263  0.0201  0.0880  148 LYS A CD    
1193 C CE    . LYS A 148 ? 0.7313 0.7290 0.8457 0.0193  0.0032  0.0973  148 LYS A CE    
1194 N NZ    . LYS A 148 ? 0.5897 0.5640 0.7101 0.0218  0.0040  0.0679  148 LYS A NZ    
1195 N N     . LEU A 149 ? 0.5154 0.5687 0.4446 0.0876  0.0629  0.0502  149 LEU A N     
1196 C CA    . LEU A 149 ? 0.5614 0.6043 0.4821 0.0988  0.0672  0.0306  149 LEU A CA    
1197 C C     . LEU A 149 ? 0.5951 0.6902 0.5001 0.1249  0.0848  0.0412  149 LEU A C     
1198 O O     . LEU A 149 ? 0.5800 0.6895 0.5077 0.1292  0.0948  0.0473  149 LEU A O     
1199 C CB    . LEU A 149 ? 0.5462 0.5441 0.4363 0.1041  0.0486  -0.0064 149 LEU A CB    
1200 C CG    . LEU A 149 ? 0.4910 0.4505 0.4047 0.0785  0.0364  -0.0105 149 LEU A CG    
1201 C CD1   . LEU A 149 ? 0.4695 0.3935 0.3646 0.0792  0.0129  -0.0337 149 LEU A CD1   
1202 C CD2   . LEU A 149 ? 0.4132 0.3614 0.3558 0.0649  0.0430  -0.0061 149 LEU A CD2   
1203 N N     . ARG A 150 ? 0.5840 0.7132 0.4510 0.1440  0.0890  0.0457  150 ARG A N     
1204 C CA    . ARG A 150 ? 0.6164 0.8080 0.4593 0.1767  0.1102  0.0546  150 ARG A CA    
1205 C C     . ARG A 150 ? 0.6141 0.8687 0.5110 0.1654  0.1314  0.1093  150 ARG A C     
1206 O O     . ARG A 150 ? 0.6743 0.9854 0.5782 0.1869  0.1529  0.1242  150 ARG A O     
1207 C CB    . ARG A 150 ? 0.7599 0.9736 0.5368 0.2033  0.1076  0.0446  150 ARG A CB    
1208 C CG    . ARG A 150 ? 0.8996 1.0516 0.6230 0.2219  0.0788  -0.0113 150 ARG A CG    
1209 C CD    . ARG A 150 ? 1.0798 1.2462 0.7341 0.2477  0.0685  -0.0215 150 ARG A CD    
1210 N NE    . ARG A 150 ? 1.1799 1.2932 0.7777 0.2774  0.0360  -0.0776 150 ARG A NE    
1211 C CZ    . ARG A 150 ? 1.2611 1.3604 0.7945 0.2989  0.0116  -0.0986 150 ARG A CZ    
1212 N NH1   . ARG A 150 ? 1.3172 1.3588 0.8061 0.3262  -0.0273 -0.1517 150 ARG A NH1   
1213 N NH2   . ARG A 150 ? 1.2799 1.4184 0.7954 0.2925  0.0198  -0.0658 150 ARG A NH2   
1214 N N     . LYS A 151 ? 0.6287 0.8751 0.5710 0.1325  0.1219  0.1413  151 LYS A N     
1215 C CA    . LYS A 151 ? 0.6790 0.9824 0.6810 0.1187  0.1315  0.1999  151 LYS A CA    
1216 C C     . LYS A 151 ? 0.6365 0.9163 0.7001 0.1002  0.1243  0.2080  151 LYS A C     
1217 O O     . LYS A 151 ? 0.6579 0.9711 0.7838 0.0837  0.1214  0.2569  151 LYS A O     
1218 C CB    . LYS A 151 ? 0.7186 1.0238 0.7444 0.0944  0.1161  0.2333  151 LYS A CB    
1219 C CG    . LYS A 151 ? 0.8841 1.2230 0.8510 0.1117  0.1218  0.2363  151 LYS A CG    
1220 C CD    . LYS A 151 ? 0.9363 1.2726 0.9314 0.0858  0.1020  0.2700  151 LYS A CD    
1221 C CE    . LYS A 151 ? 0.9251 1.3287 0.9835 0.0692  0.1046  0.3431  151 LYS A CE    
1222 N NZ    . LYS A 151 ? 0.9676 1.3620 1.0532 0.0448  0.0785  0.3735  151 LYS A NZ    
1223 N N     . SER A 152 ? 0.6297 0.8512 0.6775 0.1021  0.1167  0.1631  152 SER A N     
1224 C CA    . SER A 152 ? 0.5609 0.7466 0.6555 0.0837  0.1038  0.1643  152 SER A CA    
1225 C C     . SER A 152 ? 0.5639 0.7487 0.6520 0.1006  0.1121  0.1436  152 SER A C     
1226 O O     . SER A 152 ? 0.6046 0.7807 0.6434 0.1235  0.1179  0.1073  152 SER A O     
1227 C CB    . SER A 152 ? 0.5457 0.6581 0.6329 0.0650  0.0823  0.1342  152 SER A CB    
1228 O OG    . SER A 152 ? 0.6142 0.6849 0.7134 0.0578  0.0722  0.1164  152 SER A OG    
1229 N N     . THR A 153 ? 0.5491 0.7381 0.6914 0.0895  0.1065  0.1665  153 THR A N     
1230 C CA    . THR A 153 ? 0.5916 0.7694 0.7356 0.1014  0.1081  0.1465  153 THR A CA    
1231 C C     . THR A 153 ? 0.5326 0.6338 0.6816 0.0795  0.0822  0.1236  153 THR A C     
1232 O O     . THR A 153 ? 0.5878 0.6743 0.7520 0.0810  0.0759  0.1167  153 THR A O     
1233 C CB    . THR A 153 ? 0.6730 0.9184 0.8762 0.1088  0.1208  0.1902  153 THR A CB    
1234 O OG1   . THR A 153 ? 0.7466 0.9804 1.0157 0.0782  0.0985  0.2291  153 THR A OG1   
1235 C CG2   . THR A 153 ? 0.6897 1.0270 0.8862 0.1325  0.1510  0.2209  153 THR A CG2   
1236 N N     . LYS A 154 ? 0.4176 0.4743 0.5525 0.0616  0.0676  0.1123  154 LYS A N     
1237 C CA    . LYS A 154 ? 0.4919 0.4851 0.6172 0.0470  0.0476  0.0882  154 LYS A CA    
1238 C C     . LYS A 154 ? 0.4912 0.4572 0.5731 0.0552  0.0492  0.0527  154 LYS A C     
1239 O O     . LYS A 154 ? 0.4392 0.4209 0.4914 0.0714  0.0598  0.0382  154 LYS A O     
1240 C CB    . LYS A 154 ? 0.4359 0.3976 0.5525 0.0340  0.0358  0.0808  154 LYS A CB    
1241 C CG    . LYS A 154 ? 0.4322 0.3986 0.5972 0.0228  0.0191  0.1106  154 LYS A CG    
1242 C CD    . LYS A 154 ? 0.5221 0.4630 0.6753 0.0184  0.0096  0.0968  154 LYS A CD    
1243 C CE    . LYS A 154 ? 0.5623 0.5107 0.7697 0.0091  -0.0119 0.1293  154 LYS A CE    
1244 N NZ    . LYS A 154 ? 0.6555 0.5831 0.8585 0.0087  -0.0226 0.1158  154 LYS A NZ    
1245 N N     . LYS A 155 ? 0.4109 0.3337 0.4891 0.0438  0.0333  0.0402  155 LYS A N     
1246 C CA    . LYS A 155 ? 0.4593 0.3512 0.5030 0.0436  0.0275  0.0139  155 LYS A CA    
1247 C C     . LYS A 155 ? 0.4915 0.3688 0.5052 0.0365  0.0285  0.0012  155 LYS A C     
1248 O O     . LYS A 155 ? 0.4735 0.3461 0.4897 0.0284  0.0283  0.0058  155 LYS A O     
1249 C CB    . LYS A 155 ? 0.5025 0.3593 0.5510 0.0314  0.0097  0.0121  155 LYS A CB    
1250 C CG    . LYS A 155 ? 0.5792 0.4527 0.6676 0.0381  0.0064  0.0274  155 LYS A CG    
1251 C CD    . LYS A 155 ? 0.6234 0.4589 0.7170 0.0256  -0.0160 0.0264  155 LYS A CD    
1252 C CE    . LYS A 155 ? 0.6779 0.5365 0.8231 0.0331  -0.0195 0.0454  155 LYS A CE    
1253 N NZ    . LYS A 155 ? 0.7872 0.6083 0.9383 0.0232  -0.0440 0.0426  155 LYS A NZ    
1254 N N     . ILE A 156 ? 0.5140 0.3836 0.5052 0.0410  0.0256  -0.0144 156 ILE A N     
1255 C CA    . ILE A 156 ? 0.4473 0.3128 0.4214 0.0350  0.0260  -0.0201 156 ILE A CA    
1256 C C     . ILE A 156 ? 0.4982 0.3475 0.4673 0.0183  0.0237  -0.0180 156 ILE A C     
1257 O O     . ILE A 156 ? 0.5465 0.4045 0.5148 0.0158  0.0306  -0.0164 156 ILE A O     
1258 C CB    . ILE A 156 ? 0.4870 0.3414 0.4458 0.0416  0.0131  -0.0347 156 ILE A CB    
1259 C CG1   . ILE A 156 ? 0.5033 0.3557 0.4554 0.0327  0.0093  -0.0345 156 ILE A CG1   
1260 C CG2   . ILE A 156 ? 0.5448 0.3716 0.5060 0.0350  -0.0053 -0.0398 156 ILE A CG2   
1261 C CD1   . ILE A 156 ? 0.4076 0.2847 0.3594 0.0393  0.0224  -0.0291 156 ILE A CD1   
1262 N N     . LYS A 157 ? 0.5392 0.3688 0.5036 0.0097  0.0145  -0.0176 157 LYS A N     
1263 C CA    . LYS A 157 ? 0.5205 0.3440 0.4692 -0.0010 0.0152  -0.0155 157 LYS A CA    
1264 C C     . LYS A 157 ? 0.4909 0.3158 0.4406 0.0048  0.0206  -0.0179 157 LYS A C     
1265 O O     . LYS A 157 ? 0.5465 0.3832 0.4907 0.0077  0.0292  -0.0212 157 LYS A O     
1266 C CB    . LYS A 157 ? 0.5364 0.3402 0.4735 -0.0120 0.0016  -0.0113 157 LYS A CB    
1267 C CG    . LYS A 157 ? 0.5092 0.3119 0.4203 -0.0159 0.0047  -0.0097 157 LYS A CG    
1268 C CD    . LYS A 157 ? 0.5900 0.3868 0.4836 -0.0308 -0.0060 0.0029  157 LYS A CD    
1269 C CE    . LYS A 157 ? 0.5605 0.3646 0.4146 -0.0277 0.0007  0.0025  157 LYS A CE    
1270 N NZ    . LYS A 157 ? 0.5772 0.3910 0.4086 -0.0426 -0.0045 0.0229  157 LYS A NZ    
1271 N N     . PRO A 158 ? 0.4831 0.2958 0.4472 0.0077  0.0114  -0.0154 158 PRO A N     
1272 C CA    . PRO A 158 ? 0.4029 0.2076 0.3728 0.0133  0.0054  -0.0189 158 PRO A CA    
1273 C C     . PRO A 158 ? 0.4448 0.2698 0.4355 0.0191  0.0133  -0.0154 158 PRO A C     
1274 O O     . PRO A 158 ? 0.4615 0.2804 0.4543 0.0257  0.0082  -0.0235 158 PRO A O     
1275 C CB    . PRO A 158 ? 0.4648 0.2529 0.4602 0.0113  -0.0131 -0.0091 158 PRO A CB    
1276 C CG    . PRO A 158 ? 0.4449 0.2440 0.4518 0.0085  -0.0089 -0.0001 158 PRO A CG    
1277 C CD    . PRO A 158 ? 0.4421 0.2453 0.4218 0.0062  0.0008  -0.0089 158 PRO A CD    
1278 N N     . TYR A 159 ? 0.4860 0.3344 0.4896 0.0194  0.0231  -0.0054 159 TYR A N     
1279 C CA    . TYR A 159 ? 0.4957 0.3651 0.5146 0.0232  0.0291  0.0013  159 TYR A CA    
1280 C C     . TYR A 159 ? 0.4647 0.3372 0.4679 0.0238  0.0364  -0.0105 159 TYR A C     
1281 O O     . TYR A 159 ? 0.5248 0.4021 0.5420 0.0279  0.0351  -0.0114 159 TYR A O     
1282 C CB    . TYR A 159 ? 0.4667 0.3632 0.4900 0.0277  0.0378  0.0128  159 TYR A CB    
1283 C CG    . TYR A 159 ? 0.4651 0.3879 0.5083 0.0303  0.0402  0.0301  159 TYR A CG    
1284 C CD1   . TYR A 159 ? 0.4336 0.3488 0.4984 0.0266  0.0304  0.0341  159 TYR A CD1   
1285 C CD2   . TYR A 159 ? 0.4830 0.4394 0.5217 0.0391  0.0499  0.0424  159 TYR A CD2   
1286 C CE1   . TYR A 159 ? 0.4155 0.3537 0.5042 0.0258  0.0275  0.0552  159 TYR A CE1   
1287 C CE2   . TYR A 159 ? 0.4772 0.4630 0.5304 0.0399  0.0514  0.0644  159 TYR A CE2   
1288 C CZ    . TYR A 159 ? 0.5063 0.4816 0.5876 0.0304  0.0390  0.0731  159 TYR A CZ    
1289 O OH    . TYR A 159 ? 0.5634 0.5668 0.6637 0.0284  0.0361  0.0994  159 TYR A OH    
1290 N N     . LEU A 160 ? 0.4331 0.3053 0.4157 0.0191  0.0413  -0.0160 160 LEU A N     
1291 C CA    . LEU A 160 ? 0.4532 0.3386 0.4324 0.0179  0.0487  -0.0186 160 LEU A CA    
1292 C C     . LEU A 160 ? 0.4642 0.3493 0.4358 0.0258  0.0524  -0.0282 160 LEU A C     
1293 O O     . LEU A 160 ? 0.5784 0.4810 0.5594 0.0332  0.0597  -0.0316 160 LEU A O     
1294 C CB    . LEU A 160 ? 0.4201 0.3079 0.3895 0.0075  0.0471  -0.0135 160 LEU A CB    
1295 C CG    . LEU A 160 ? 0.4685 0.3527 0.4415 0.0066  0.0371  -0.0122 160 LEU A CG    
1296 C CD1   . LEU A 160 ? 0.4131 0.2855 0.3829 -0.0042 0.0221  -0.0083 160 LEU A CD1   
1297 C CD2   . LEU A 160 ? 0.4458 0.3457 0.4323 0.0089  0.0386  -0.0092 160 LEU A CD2   
1298 N N     . LEU A 161 ? 0.4862 0.3510 0.4397 0.0276  0.0451  -0.0347 161 LEU A N     
1299 C CA    . LEU A 161 ? 0.5085 0.3687 0.4415 0.0418  0.0446  -0.0505 161 LEU A CA    
1300 C C     . LEU A 161 ? 0.4929 0.3391 0.4468 0.0573  0.0314  -0.0636 161 LEU A C     
1301 O O     . LEU A 161 ? 0.5268 0.3701 0.4660 0.0773  0.0288  -0.0841 161 LEU A O     
1302 C CB    . LEU A 161 ? 0.5217 0.3571 0.4245 0.0394  0.0333  -0.0544 161 LEU A CB    
1303 C CG    . LEU A 161 ? 0.5487 0.3952 0.4268 0.0260  0.0404  -0.0419 161 LEU A CG    
1304 C CD1   . LEU A 161 ? 0.4961 0.3109 0.3481 0.0229  0.0224  -0.0449 161 LEU A CD1   
1305 C CD2   . LEU A 161 ? 0.5067 0.3931 0.3646 0.0317  0.0605  -0.0379 161 LEU A CD2   
1306 N N     . GLU A 162 ? 0.4594 0.3502 0.4600 -0.0148 -0.0281 -0.0164 162 GLU A N     
1307 C CA    . GLU A 162 ? 0.4934 0.3686 0.5041 -0.0229 -0.0147 -0.0171 162 GLU A CA    
1308 C C     . GLU A 162 ? 0.5299 0.3794 0.5158 -0.0161 -0.0113 -0.0118 162 GLU A C     
1309 O O     . GLU A 162 ? 0.4369 0.2673 0.4268 -0.0202 -0.0003 -0.0120 162 GLU A O     
1310 C CB    . GLU A 162 ? 0.5045 0.3759 0.5284 -0.0233 0.0043  -0.0084 162 GLU A CB    
1311 C CG    . GLU A 162 ? 0.6042 0.5048 0.6649 -0.0318 0.0061  -0.0140 162 GLU A CG    
1312 C CD    . GLU A 162 ? 0.8001 0.6958 0.8758 -0.0324 0.0313  -0.0028 162 GLU A CD    
1313 O OE1   . GLU A 162 ? 0.8235 0.6873 0.8781 -0.0270 0.0487  0.0095  162 GLU A OE1   
1314 O OE2   . GLU A 162 ? 0.8454 0.7708 0.9530 -0.0357 0.0349  -0.0050 162 GLU A OE2   
1315 N N     . GLN A 163 ? 0.4110 0.2605 0.3742 -0.0053 -0.0196 -0.0072 163 GLN A N     
1316 C CA    . GLN A 163 ? 0.4187 0.2556 0.3630 0.0036  -0.0201 -0.0032 163 GLN A CA    
1317 C C     . GLN A 163 ? 0.5927 0.4117 0.5208 0.0156  -0.0077 0.0085  163 GLN A C     
1318 O O     . GLN A 163 ? 0.6548 0.4661 0.5666 0.0272  -0.0086 0.0130  163 GLN A O     
1319 C CB    . GLN A 163 ? 0.4255 0.2542 0.3743 -0.0006 -0.0188 -0.0098 163 GLN A CB    
1320 C CG    . GLN A 163 ? 0.5504 0.3959 0.5062 -0.0083 -0.0307 -0.0215 163 GLN A CG    
1321 C CD    . GLN A 163 ? 0.5339 0.3950 0.4810 -0.0040 -0.0412 -0.0188 163 GLN A CD    
1322 O OE1   . GLN A 163 ? 0.5386 0.4006 0.4772 0.0025  -0.0428 -0.0153 163 GLN A OE1   
1323 N NE2   . GLN A 163 ? 0.5067 0.3806 0.4587 -0.0071 -0.0473 -0.0198 163 GLN A NE2   
1324 N N     . THR A 164 ? 0.5104 0.3245 0.4420 0.0154  0.0049  0.0146  164 THR A N     
1325 C CA    . THR A 164 ? 0.5875 0.3806 0.4980 0.0295  0.0211  0.0288  164 THR A CA    
1326 C C     . THR A 164 ? 0.5546 0.3527 0.4354 0.0464  0.0141  0.0325  164 THR A C     
1327 O O     . THR A 164 ? 0.5813 0.3671 0.4337 0.0642  0.0183  0.0418  164 THR A O     
1328 C CB    . THR A 164 ? 0.5882 0.3708 0.5172 0.0215  0.0444  0.0357  164 THR A CB    
1329 O OG1   . THR A 164 ? 0.6458 0.4517 0.5925 0.0150  0.0416  0.0306  164 THR A OG1   
1330 C CG2   . THR A 164 ? 0.5411 0.3140 0.4988 0.0039  0.0512  0.0286  164 THR A CG2   
1331 N N     . LEU A 165 ? 0.5651 0.3797 0.4504 0.0424  0.0033  0.0243  165 LEU A N     
1332 C CA    . LEU A 165 ? 0.5234 0.3406 0.3821 0.0554  -0.0063 0.0215  165 LEU A CA    
1333 C C     . LEU A 165 ? 0.5803 0.4062 0.4302 0.0584  -0.0257 0.0138  165 LEU A C     
1334 O O     . LEU A 165 ? 0.6090 0.4357 0.4333 0.0729  -0.0335 0.0123  165 LEU A O     
1335 C CB    . LEU A 165 ? 0.5088 0.3353 0.3775 0.0497  -0.0107 0.0139  165 LEU A CB    
1336 C CG    . LEU A 165 ? 0.5663 0.3926 0.4459 0.0504  0.0086  0.0210  165 LEU A CG    
1337 C CD1   . LEU A 165 ? 0.5293 0.3679 0.4236 0.0471  0.0033  0.0140  165 LEU A CD1   
1338 C CD2   . LEU A 165 ? 0.5674 0.3792 0.4130 0.0695  0.0223  0.0300  165 LEU A CD2   
1339 N N     . VAL A 166 ? 0.5984 0.4343 0.4711 0.0452  -0.0336 0.0081  166 VAL A N     
1340 C CA    . VAL A 166 ? 0.5291 0.3792 0.4051 0.0438  -0.0493 0.0006  166 VAL A CA    
1341 C C     . VAL A 166 ? 0.5103 0.3652 0.4081 0.0320  -0.0480 -0.0004 166 VAL A C     
1342 O O     . VAL A 166 ? 0.5719 0.4244 0.4821 0.0223  -0.0428 -0.0010 166 VAL A O     
1343 C CB    . VAL A 166 ? 0.5591 0.4165 0.4350 0.0385  -0.0622 -0.0104 166 VAL A CB    
1344 C CG1   . VAL A 166 ? 0.4242 0.2782 0.3151 0.0264  -0.0590 -0.0117 166 VAL A CG1   
1345 C CG2   . VAL A 166 ? 0.5053 0.3811 0.3916 0.0348  -0.0764 -0.0186 166 VAL A CG2   
1346 N N     . ALA A 167 ? 0.5474 0.4118 0.4492 0.0350  -0.0527 -0.0014 167 ALA A N     
1347 C CA    . ALA A 167 ? 0.5310 0.3971 0.4467 0.0278  -0.0492 -0.0028 167 ALA A CA    
1348 C C     . ALA A 167 ? 0.5598 0.4419 0.4880 0.0173  -0.0568 -0.0083 167 ALA A C     
1349 O O     . ALA A 167 ? 0.5431 0.4383 0.4753 0.0167  -0.0650 -0.0115 167 ALA A O     
1350 C CB    . ALA A 167 ? 0.4226 0.2881 0.3349 0.0402  -0.0460 0.0007  167 ALA A CB    
1351 N N     . GLY A 168 ? 0.4998 0.3807 0.4339 0.0094  -0.0536 -0.0099 168 GLY A N     
1352 C CA    . GLY A 168 ? 0.4653 0.3582 0.4065 0.0039  -0.0556 -0.0110 168 GLY A CA    
1353 C C     . GLY A 168 ? 0.5081 0.3989 0.4488 -0.0028 -0.0567 -0.0099 168 GLY A C     
1354 O O     . GLY A 168 ? 0.5098 0.4060 0.4518 -0.0055 -0.0542 -0.0076 168 GLY A O     
1355 N N     . LEU A 169 ? 0.4961 0.3787 0.4334 -0.0028 -0.0584 -0.0097 169 LEU A N     
1356 C CA    . LEU A 169 ? 0.4631 0.3427 0.3984 -0.0042 -0.0592 -0.0071 169 LEU A CA    
1357 C C     . LEU A 169 ? 0.4564 0.3426 0.3902 -0.0026 -0.0597 -0.0085 169 LEU A C     
1358 O O     . LEU A 169 ? 0.4980 0.3866 0.4370 -0.0034 -0.0594 -0.0137 169 LEU A O     
1359 C CB    . LEU A 169 ? 0.5747 0.4453 0.5074 -0.0014 -0.0600 -0.0072 169 LEU A CB    
1360 C CG    . LEU A 169 ? 0.5598 0.4220 0.4892 -0.0021 -0.0625 -0.0104 169 LEU A CG    
1361 C CD1   . LEU A 169 ? 0.5356 0.3894 0.4564 0.0050  -0.0611 -0.0118 169 LEU A CD1   
1362 C CD2   . LEU A 169 ? 0.5392 0.3918 0.4705 -0.0077 -0.0621 -0.0092 169 LEU A CD2   
1363 N N     . GLY A 170 ? 0.4391 0.3276 0.3654 -0.0001 -0.0604 -0.0044 170 GLY A N     
1364 C CA    . GLY A 170 ? 0.3966 0.2961 0.3182 0.0048  -0.0655 -0.0076 170 GLY A CA    
1365 C C     . GLY A 170 ? 0.4779 0.3763 0.3929 0.0131  -0.0675 0.0004  170 GLY A C     
1366 O O     . GLY A 170 ? 0.4322 0.3163 0.3483 0.0132  -0.0636 0.0063  170 GLY A O     
1367 N N     . ASN A 171 ? 0.4687 0.3805 0.3739 0.0223  -0.0741 -0.0001 171 ASN A N     
1368 C CA    . ASN A 171 ? 0.5265 0.4401 0.4258 0.0354  -0.0771 0.0083  171 ASN A CA    
1369 C C     . ASN A 171 ? 0.5451 0.4314 0.4297 0.0399  -0.0664 0.0241  171 ASN A C     
1370 O O     . ASN A 171 ? 0.5668 0.4407 0.4523 0.0465  -0.0640 0.0302  171 ASN A O     
1371 C CB    . ASN A 171 ? 0.4523 0.3894 0.3395 0.0482  -0.0886 0.0049  171 ASN A CB    
1372 C CG    . ASN A 171 ? 0.4815 0.4369 0.3775 0.0616  -0.0971 0.0064  171 ASN A CG    
1373 O OD1   . ASN A 171 ? 0.4904 0.4467 0.4087 0.0575  -0.0945 0.0046  171 ASN A OD1   
1374 N ND2   . ASN A 171 ? 0.4841 0.4567 0.3616 0.0806  -0.1070 0.0099  171 ASN A ND2   
1375 N N     . ILE A 172 ? 0.4967 0.3725 0.3699 0.0359  -0.0577 0.0302  172 ILE A N     
1376 C CA    . ILE A 172 ? 0.5893 0.4373 0.4552 0.0353  -0.0440 0.0447  172 ILE A CA    
1377 C C     . ILE A 172 ? 0.5504 0.3806 0.4348 0.0223  -0.0406 0.0402  172 ILE A C     
1378 O O     . ILE A 172 ? 0.5614 0.3685 0.4426 0.0267  -0.0362 0.0459  172 ILE A O     
1379 C CB    . ILE A 172 ? 0.5950 0.4401 0.4533 0.0305  -0.0318 0.0518  172 ILE A CB    
1380 C CG1   . ILE A 172 ? 0.5615 0.4212 0.3919 0.0470  -0.0348 0.0554  172 ILE A CG1   
1381 C CG2   . ILE A 172 ? 0.5863 0.4005 0.4444 0.0258  -0.0141 0.0672  172 ILE A CG2   
1382 C CD1   . ILE A 172 ? 0.5538 0.4145 0.3738 0.0453  -0.0213 0.0611  172 ILE A CD1   
1383 N N     . TYR A 173 ? 0.5612 0.4010 0.4621 0.0089  -0.0430 0.0292  173 TYR A N     
1384 C CA    . TYR A 173 ? 0.5407 0.3667 0.4549 -0.0020 -0.0419 0.0231  173 TYR A CA    
1385 C C     . TYR A 173 ? 0.5358 0.3585 0.4501 0.0032  -0.0486 0.0159  173 TYR A C     
1386 O O     . TYR A 173 ? 0.5342 0.3385 0.4504 -0.0008 -0.0477 0.0108  173 TYR A O     
1387 C CB    . TYR A 173 ? 0.4783 0.3194 0.4082 -0.0140 -0.0431 0.0151  173 TYR A CB    
1388 C CG    . TYR A 173 ? 0.5334 0.3774 0.4680 -0.0197 -0.0323 0.0230  173 TYR A CG    
1389 C CD1   . TYR A 173 ? 0.5487 0.3717 0.4879 -0.0270 -0.0202 0.0313  173 TYR A CD1   
1390 C CD2   . TYR A 173 ? 0.4948 0.3596 0.4285 -0.0170 -0.0308 0.0230  173 TYR A CD2   
1391 C CE1   . TYR A 173 ? 0.5978 0.4242 0.5435 -0.0325 -0.0053 0.0414  173 TYR A CE1   
1392 C CE2   . TYR A 173 ? 0.5400 0.4093 0.4764 -0.0196 -0.0177 0.0314  173 TYR A CE2   
1393 C CZ    . TYR A 173 ? 0.6260 0.4781 0.5694 -0.0276 -0.0040 0.0418  173 TYR A CZ    
1394 O OH    . TYR A 173 ? 0.7341 0.5924 0.6822 -0.0303 0.0135  0.0526  173 TYR A OH    
1395 N N     . VAL A 174 ? 0.4905 0.3307 0.4038 0.0118  -0.0543 0.0141  174 VAL A N     
1396 C CA    . VAL A 174 ? 0.5268 0.3651 0.4424 0.0182  -0.0560 0.0098  174 VAL A CA    
1397 C C     . VAL A 174 ? 0.6026 0.4218 0.5089 0.0305  -0.0520 0.0174  174 VAL A C     
1398 O O     . VAL A 174 ? 0.6373 0.4381 0.5404 0.0342  -0.0490 0.0140  174 VAL A O     
1399 C CB    . VAL A 174 ? 0.5249 0.3895 0.4511 0.0214  -0.0601 0.0057  174 VAL A CB    
1400 C CG1   . VAL A 174 ? 0.5910 0.4726 0.5177 0.0318  -0.0647 0.0098  174 VAL A CG1   
1401 C CG2   . VAL A 174 ? 0.5687 0.4322 0.4997 0.0255  -0.0568 0.0024  174 VAL A CG2   
1402 N N     . ASP A 175 ? 0.5303 0.3507 0.4278 0.0396  -0.0511 0.0281  175 ASP A N     
1403 C CA    . ASP A 175 ? 0.5355 0.3329 0.4204 0.0551  -0.0454 0.0387  175 ASP A CA    
1404 C C     . ASP A 175 ? 0.6344 0.3895 0.5148 0.0453  -0.0350 0.0391  175 ASP A C     
1405 O O     . ASP A 175 ? 0.6502 0.3776 0.5246 0.0532  -0.0299 0.0387  175 ASP A O     
1406 C CB    . ASP A 175 ? 0.5496 0.3549 0.4195 0.0696  -0.0460 0.0524  175 ASP A CB    
1407 C CG    . ASP A 175 ? 0.6290 0.4743 0.5046 0.0848  -0.0588 0.0495  175 ASP A CG    
1408 O OD1   . ASP A 175 ? 0.6066 0.4744 0.5033 0.0806  -0.0643 0.0379  175 ASP A OD1   
1409 O OD2   . ASP A 175 ? 0.6435 0.4996 0.5029 0.1014  -0.0630 0.0590  175 ASP A OD2   
1410 N N     . GLU A 176 ? 0.6058 0.3573 0.4921 0.0277  -0.0315 0.0378  176 GLU A N     
1411 C CA    . GLU A 176 ? 0.6313 0.3477 0.5220 0.0137  -0.0220 0.0357  176 GLU A CA    
1412 C C     . GLU A 176 ? 0.6327 0.3424 0.5303 0.0060  -0.0287 0.0166  176 GLU A C     
1413 O O     . GLU A 176 ? 0.7311 0.4054 0.6254 0.0035  -0.0234 0.0112  176 GLU A O     
1414 C CB    . GLU A 176 ? 0.6024 0.3269 0.5059 -0.0039 -0.0163 0.0380  176 GLU A CB    
1415 C CG    . GLU A 176 ? 0.6057 0.3294 0.4946 0.0057  -0.0053 0.0585  176 GLU A CG    
1416 C CD    . GLU A 176 ? 0.6801 0.3585 0.5541 0.0137  0.0117  0.0755  176 GLU A CD    
1417 O OE1   . GLU A 176 ? 0.7598 0.4049 0.6472 -0.0024 0.0215  0.0709  176 GLU A OE1   
1418 O OE2   . GLU A 176 ? 0.6735 0.3482 0.5221 0.0363  0.0155  0.0931  176 GLU A OE2   
1419 N N     . VAL A 177 ? 0.6031 0.3439 0.5065 0.0043  -0.0395 0.0066  177 VAL A N     
1420 C CA    . VAL A 177 ? 0.5787 0.3178 0.4818 0.0008  -0.0464 -0.0103 177 VAL A CA    
1421 C C     . VAL A 177 ? 0.6297 0.3493 0.5176 0.0172  -0.0436 -0.0126 177 VAL A C     
1422 O O     . VAL A 177 ? 0.6508 0.3443 0.5303 0.0158  -0.0438 -0.0258 177 VAL A O     
1423 C CB    . VAL A 177 ? 0.5755 0.3492 0.4836 0.0000  -0.0547 -0.0147 177 VAL A CB    
1424 C CG1   . VAL A 177 ? 0.6078 0.3825 0.5044 0.0102  -0.0574 -0.0226 177 VAL A CG1   
1425 C CG2   . VAL A 177 ? 0.6186 0.4048 0.5402 -0.0153 -0.0599 -0.0222 177 VAL A CG2   
1426 N N     . LEU A 178 ? 0.5691 0.3030 0.4547 0.0333  -0.0412 -0.0015 178 LEU A N     
1427 C CA    . LEU A 178 ? 0.6142 0.3371 0.4901 0.0516  -0.0365 -0.0019 178 LEU A CA    
1428 C C     . LEU A 178 ? 0.6505 0.3284 0.5143 0.0591  -0.0277 0.0017  178 LEU A C     
1429 O O     . LEU A 178 ? 0.6867 0.3402 0.5381 0.0713  -0.0228 -0.0052 178 LEU A O     
1430 C CB    . LEU A 178 ? 0.6459 0.4037 0.5314 0.0657  -0.0372 0.0080  178 LEU A CB    
1431 C CG    . LEU A 178 ? 0.5963 0.3900 0.4950 0.0580  -0.0417 0.0036  178 LEU A CG    
1432 C CD1   . LEU A 178 ? 0.5604 0.3900 0.4766 0.0678  -0.0427 0.0100  178 LEU A CD1   
1433 C CD2   . LEU A 178 ? 0.5047 0.2919 0.3947 0.0588  -0.0386 -0.0065 178 LEU A CD2   
1434 N N     . TRP A 179 ? 0.6480 0.3102 0.5128 0.0529  -0.0231 0.0127  179 TRP A N     
1435 C CA    . TRP A 179 ? 0.7615 0.3721 0.6142 0.0591  -0.0107 0.0183  179 TRP A CA    
1436 C C     . TRP A 179 ? 0.7893 0.3663 0.6439 0.0389  -0.0103 -0.0024 179 TRP A C     
1437 O O     . TRP A 179 ? 0.8056 0.3414 0.6475 0.0457  -0.0044 -0.0116 179 TRP A O     
1438 C CB    . TRP A 179 ? 0.6736 0.2713 0.5235 0.0593  -0.0013 0.0391  179 TRP A CB    
1439 C CG    . TRP A 179 ? 0.8727 0.4078 0.7101 0.0636  0.0154  0.0456  179 TRP A CG    
1440 C CD1   . TRP A 179 ? 0.9330 0.4375 0.7515 0.0915  0.0242  0.0563  179 TRP A CD1   
1441 C CD2   . TRP A 179 ? 0.8789 0.3716 0.7249 0.0390  0.0265  0.0401  179 TRP A CD2   
1442 N NE1   . TRP A 179 ? 1.0261 0.4642 0.8363 0.0865  0.0417  0.0589  179 TRP A NE1   
1443 C CE2   . TRP A 179 ? 1.0145 0.4446 0.8438 0.0520  0.0436  0.0483  179 TRP A CE2   
1444 C CE3   . TRP A 179 ? 0.9055 0.4087 0.7752 0.0073  0.0242  0.0285  179 TRP A CE3   
1445 C CZ2   . TRP A 179 ? 1.1280 0.5015 0.9649 0.0306  0.0597  0.0443  179 TRP A CZ2   
1446 C CZ3   . TRP A 179 ? 1.0282 0.4844 0.9100 -0.0142 0.0384  0.0238  179 TRP A CZ3   
1447 C CH2   . TRP A 179 ? 1.1568 0.5465 1.0229 -0.0046 0.0566  0.0313  179 TRP A CH2   
1448 N N     . LEU A 180 ? 0.7652 0.3623 0.6366 0.0152  -0.0176 -0.0113 180 LEU A N     
1449 C CA    . LEU A 180 ? 0.8030 0.3826 0.6826 -0.0058 -0.0226 -0.0346 180 LEU A CA    
1450 C C     . LEU A 180 ? 0.7757 0.3504 0.6376 0.0044  -0.0311 -0.0551 180 LEU A C     
1451 O O     . LEU A 180 ? 0.8678 0.4057 0.7227 -0.0014 -0.0310 -0.0741 180 LEU A O     
1452 C CB    . LEU A 180 ? 0.7682 0.3876 0.6712 -0.0267 -0.0322 -0.0397 180 LEU A CB    
1453 C CG    . LEU A 180 ? 0.8368 0.4451 0.7602 -0.0527 -0.0371 -0.0618 180 LEU A CG    
1454 C CD1   . LEU A 180 ? 0.8184 0.3719 0.7480 -0.0641 -0.0199 -0.0594 180 LEU A CD1   
1455 C CD2   . LEU A 180 ? 0.7882 0.4405 0.7396 -0.0693 -0.0431 -0.0612 180 LEU A CD2   
1456 N N     . ALA A 181 ? 0.7798 0.3894 0.6332 0.0203  -0.0365 -0.0515 181 ALA A N     
1457 C CA    . ALA A 181 ? 0.7542 0.3625 0.5869 0.0331  -0.0409 -0.0673 181 ALA A CA    
1458 C C     . ALA A 181 ? 0.7820 0.3672 0.5970 0.0590  -0.0286 -0.0608 181 ALA A C     
1459 O O     . ALA A 181 ? 0.7124 0.2936 0.5074 0.0737  -0.0276 -0.0718 181 ALA A O     
1460 C CB    . ALA A 181 ? 0.6262 0.2811 0.4599 0.0364  -0.0486 -0.0650 181 ALA A CB    
1461 N N     . LYS A 182 ? 0.7720 0.3426 0.5923 0.0672  -0.0184 -0.0424 182 LYS A N     
1462 C CA    . LYS A 182 ? 0.7883 0.3389 0.5949 0.0952  -0.0066 -0.0345 182 LYS A CA    
1463 C C     . LYS A 182 ? 0.7494 0.3434 0.5571 0.1143  -0.0063 -0.0303 182 LYS A C     
1464 O O     . LYS A 182 ? 0.7757 0.3574 0.5686 0.1346  0.0018  -0.0356 182 LYS A O     
1465 C CB    . LYS A 182 ? 0.8855 0.3765 0.6699 0.0993  -0.0001 -0.0534 182 LYS A CB    
1466 C CG    . LYS A 182 ? 1.0165 0.4640 0.8062 0.0722  -0.0008 -0.0658 182 LYS A CG    
1467 C CD    . LYS A 182 ? 1.0872 0.5077 0.8862 0.0707  0.0123  -0.0423 182 LYS A CD    
1468 C CE    . LYS A 182 ? 1.0011 0.3993 0.8191 0.0362  0.0128  -0.0501 182 LYS A CE    
1469 N NZ    . LYS A 182 ? 0.9575 0.3420 0.7830 0.0360  0.0273  -0.0217 182 LYS A NZ    
1470 N N     . ILE A 183 ? 0.7388 0.3822 0.5658 0.1070  -0.0130 -0.0211 183 ILE A N     
1471 C CA    . ILE A 183 ? 0.6847 0.3710 0.5223 0.1206  -0.0098 -0.0150 183 ILE A CA    
1472 C C     . ILE A 183 ? 0.6801 0.4027 0.5414 0.1287  -0.0111 0.0027  183 ILE A C     
1473 O O     . ILE A 183 ? 0.6065 0.3382 0.4762 0.1166  -0.0186 0.0095  183 ILE A O     
1474 C CB    . ILE A 183 ? 0.6467 0.3607 0.4882 0.1061  -0.0156 -0.0212 183 ILE A CB    
1475 C CG1   . ILE A 183 ? 0.6246 0.3096 0.4394 0.1010  -0.0189 -0.0402 183 ILE A CG1   
1476 C CG2   . ILE A 183 ? 0.5789 0.3332 0.4362 0.1174  -0.0075 -0.0133 183 ILE A CG2   
1477 C CD1   . ILE A 183 ? 0.5999 0.3097 0.4142 0.0896  -0.0261 -0.0439 183 ILE A CD1   
1478 N N     . HIS A 184 ? 0.6703 0.4149 0.5416 0.1512  -0.0038 0.0088  184 HIS A N     
1479 C CA    . HIS A 184 ? 0.5965 0.3863 0.4941 0.1610  -0.0081 0.0211  184 HIS A CA    
1480 C C     . HIS A 184 ? 0.5982 0.4321 0.5202 0.1406  -0.0160 0.0191  184 HIS A C     
1481 O O     . HIS A 184 ? 0.5832 0.4265 0.5095 0.1317  -0.0107 0.0127  184 HIS A O     
1482 C CB    . HIS A 184 ? 0.5996 0.4116 0.5101 0.1884  0.0020  0.0249  184 HIS A CB    
1483 C CG    . HIS A 184 ? 0.6751 0.5323 0.6117 0.2046  -0.0051 0.0361  184 HIS A CG    
1484 N ND1   . HIS A 184 ? 0.6255 0.5395 0.5958 0.1923  -0.0161 0.0357  184 HIS A ND1   
1485 C CD2   . HIS A 184 ? 0.6963 0.5503 0.6288 0.2340  -0.0043 0.0470  184 HIS A CD2   
1486 C CE1   . HIS A 184 ? 0.6144 0.5640 0.6014 0.2128  -0.0244 0.0435  184 HIS A CE1   
1487 N NE2   . HIS A 184 ? 0.6775 0.5925 0.6409 0.2402  -0.0173 0.0523  184 HIS A NE2   
1488 N N     . PRO A 185 ? 0.6153 0.4730 0.5495 0.1350  -0.0275 0.0247  185 PRO A N     
1489 C CA    . PRO A 185 ? 0.5060 0.3982 0.4612 0.1147  -0.0349 0.0200  185 PRO A CA    
1490 C C     . PRO A 185 ? 0.4864 0.4249 0.4769 0.1155  -0.0305 0.0172  185 PRO A C     
1491 O O     . PRO A 185 ? 0.4963 0.4518 0.5027 0.0968  -0.0315 0.0121  185 PRO A O     
1492 C CB    . PRO A 185 ? 0.4820 0.3872 0.4368 0.1152  -0.0478 0.0253  185 PRO A CB    
1493 C CG    . PRO A 185 ? 0.6235 0.5200 0.5677 0.1423  -0.0466 0.0359  185 PRO A CG    
1494 C CD    . PRO A 185 ? 0.6286 0.4770 0.5520 0.1486  -0.0331 0.0356  185 PRO A CD    
1495 N N     . GLU A 186 ? 0.4848 0.4416 0.4893 0.1366  -0.0233 0.0207  186 GLU A N     
1496 C CA    . GLU A 186 ? 0.4911 0.4965 0.5374 0.1363  -0.0156 0.0186  186 GLU A CA    
1497 C C     . GLU A 186 ? 0.5476 0.5375 0.5867 0.1423  0.0061  0.0190  186 GLU A C     
1498 O O     . GLU A 186 ? 0.5629 0.5895 0.6358 0.1462  0.0193  0.0203  186 GLU A O     
1499 C CB    . GLU A 186 ? 0.5067 0.5587 0.5828 0.1576  -0.0224 0.0221  186 GLU A CB    
1500 C CG    . GLU A 186 ? 0.5825 0.6673 0.6727 0.1510  -0.0448 0.0186  186 GLU A CG    
1501 C CD    . GLU A 186 ? 0.6606 0.8057 0.7867 0.1720  -0.0554 0.0190  186 GLU A CD    
1502 O OE1   . GLU A 186 ? 0.7009 0.8978 0.8634 0.1597  -0.0702 0.0085  186 GLU A OE1   
1503 O OE2   . GLU A 186 ? 0.7495 0.8911 0.8678 0.2019  -0.0497 0.0284  186 GLU A OE2   
1504 N N     . LYS A 187 ? 0.5006 0.4378 0.4961 0.1432  0.0099  0.0171  187 LYS A N     
1505 C CA    . LYS A 187 ? 0.5638 0.4800 0.5391 0.1509  0.0279  0.0152  187 LYS A CA    
1506 C C     . LYS A 187 ? 0.5629 0.4946 0.5507 0.1339  0.0379  0.0159  187 LYS A C     
1507 O O     . LYS A 187 ? 0.5123 0.4364 0.4956 0.1137  0.0289  0.0137  187 LYS A O     
1508 C CB    . LYS A 187 ? 0.6555 0.5140 0.5817 0.1522  0.0238  0.0079  187 LYS A CB    
1509 C CG    . LYS A 187 ? 0.6863 0.5201 0.5811 0.1617  0.0383  0.0020  187 LYS A CG    
1510 C CD    . LYS A 187 ? 0.7671 0.5957 0.6563 0.1902  0.0530  0.0026  187 LYS A CD    
1511 C CE    . LYS A 187 ? 0.8860 0.6773 0.7292 0.2029  0.0645  -0.0077 187 LYS A CE    
1512 N NZ    . LYS A 187 ? 0.9388 0.7232 0.7754 0.2334  0.0810  -0.0076 187 LYS A NZ    
1513 N N     . GLU A 188 ? 0.5525 0.5039 0.5556 0.1438  0.0594  0.0205  188 GLU A N     
1514 C CA    . GLU A 188 ? 0.5737 0.5320 0.5847 0.1304  0.0748  0.0249  188 GLU A CA    
1515 C C     . GLU A 188 ? 0.5938 0.5051 0.5483 0.1334  0.0777  0.0226  188 GLU A C     
1516 O O     . GLU A 188 ? 0.6224 0.5059 0.5384 0.1525  0.0815  0.0180  188 GLU A O     
1517 C CB    . GLU A 188 ? 0.6084 0.6027 0.6550 0.1400  0.1011  0.0326  188 GLU A CB    
1518 C CG    . GLU A 188 ? 0.7356 0.7865 0.8460 0.1334  0.0945  0.0318  188 GLU A CG    
1519 C CD    . GLU A 188 ? 0.8656 0.9622 1.0279 0.1334  0.1216  0.0387  188 GLU A CD    
1520 O OE1   . GLU A 188 ? 0.9685 1.0475 1.1118 0.1398  0.1496  0.0473  188 GLU A OE1   
1521 O OE2   . GLU A 188 ? 0.8598 1.0121 1.0825 0.1273  0.1153  0.0353  188 GLU A OE2   
1522 N N     . THR A 189 ? 0.5585 0.4618 0.5076 0.1162  0.0749  0.0244  189 THR A N     
1523 C CA    . THR A 189 ? 0.5829 0.4485 0.4809 0.1188  0.0682  0.0200  189 THR A CA    
1524 C C     . THR A 189 ? 0.6553 0.5032 0.5138 0.1402  0.0882  0.0230  189 THR A C     
1525 O O     . THR A 189 ? 0.7527 0.5711 0.5642 0.1511  0.0787  0.0127  189 THR A O     
1526 C CB    . THR A 189 ? 0.5859 0.4491 0.4873 0.1004  0.0623  0.0233  189 THR A CB    
1527 O OG1   . THR A 189 ? 0.5759 0.4497 0.4946 0.0974  0.0866  0.0362  189 THR A OG1   
1528 C CG2   . THR A 189 ? 0.5625 0.4416 0.4965 0.0819  0.0432  0.0186  189 THR A CG2   
1529 N N     . ASN A 190 ? 0.6444 0.5114 0.5219 0.1468  0.1162  0.0356  190 ASN A N     
1530 C CA    . ASN A 190 ? 0.7377 0.5879 0.5725 0.1710  0.1393  0.0406  190 ASN A CA    
1531 C C     . ASN A 190 ? 0.7830 0.6230 0.5957 0.1939  0.1398  0.0300  190 ASN A C     
1532 O O     . ASN A 190 ? 0.8542 0.6793 0.6273 0.2175  0.1583  0.0308  190 ASN A O     
1533 C CB    . ASN A 190 ? 0.7837 0.6565 0.6483 0.1708  0.1748  0.0598  190 ASN A CB    
1534 C CG    . ASN A 190 ? 0.8519 0.7687 0.7809 0.1675  0.1863  0.0624  190 ASN A CG    
1535 O OD1   . ASN A 190 ? 0.8896 0.8225 0.8452 0.1624  0.1645  0.0522  190 ASN A OD1   
1536 N ND2   . ASN A 190 ? 0.8389 0.7775 0.7946 0.1714  0.2214  0.0773  190 ASN A ND2   
1537 N N     . GLN A 191 ? 0.7741 0.6184 0.6086 0.1893  0.1208  0.0205  191 GLN A N     
1538 C CA    . GLN A 191 ? 0.7732 0.6005 0.5876 0.2114  0.1214  0.0105  191 GLN A CA    
1539 C C     . GLN A 191 ? 0.7956 0.5783 0.5649 0.2099  0.0967  -0.0084 191 GLN A C     
1540 O O     . GLN A 191 ? 0.9205 0.6743 0.6599 0.2278  0.0972  -0.0207 191 GLN A O     
1541 C CB    . GLN A 191 ? 0.7420 0.6004 0.6080 0.2126  0.1195  0.0144  191 GLN A CB    
1542 C CG    . GLN A 191 ? 0.7969 0.7068 0.7152 0.2168  0.1440  0.0286  191 GLN A CG    
1543 C CD    . GLN A 191 ? 1.0533 0.9617 0.9532 0.2473  0.1734  0.0317  191 GLN A CD    
1544 O OE1   . GLN A 191 ? 1.1911 1.0867 1.0776 0.2707  0.1739  0.0252  191 GLN A OE1   
1545 N NE2   . GLN A 191 ? 1.1043 1.0223 1.0009 0.2491  0.2009  0.0430  191 GLN A NE2   
1546 N N     . LEU A 192 ? 0.7336 0.5107 0.5014 0.1880  0.0762  -0.0118 192 LEU A N     
1547 C CA    . LEU A 192 ? 0.7706 0.5124 0.5062 0.1821  0.0529  -0.0308 192 LEU A CA    
1548 C C     . LEU A 192 ? 0.8589 0.5732 0.5360 0.1987  0.0538  -0.0451 192 LEU A C     
1549 O O     . LEU A 192 ? 0.8400 0.5626 0.4957 0.2061  0.0635  -0.0377 192 LEU A O     
1550 C CB    . LEU A 192 ? 0.7420 0.4926 0.4945 0.1563  0.0331  -0.0299 192 LEU A CB    
1551 C CG    . LEU A 192 ? 0.7602 0.5345 0.5616 0.1400  0.0277  -0.0197 192 LEU A CG    
1552 C CD1   . LEU A 192 ? 0.7166 0.5043 0.5324 0.1187  0.0156  -0.0160 192 LEU A CD1   
1553 C CD2   . LEU A 192 ? 0.7450 0.4978 0.5482 0.1398  0.0173  -0.0274 192 LEU A CD2   
1554 N N     . ILE A 193 ? 0.9296 0.6085 0.5782 0.2054  0.0436  -0.0665 193 ILE A N     
1555 C CA    . ILE A 193 ? 0.9260 0.5795 0.5166 0.2195  0.0380  -0.0866 193 ILE A CA    
1556 C C     . ILE A 193 ? 0.8942 0.5462 0.4773 0.1997  0.0096  -0.1006 193 ILE A C     
1557 O O     . ILE A 193 ? 0.9208 0.5815 0.5416 0.1750  -0.0047 -0.0982 193 ILE A O     
1558 C CB    . ILE A 193 ? 1.0089 0.6216 0.5696 0.2359  0.0398  -0.1085 193 ILE A CB    
1559 C CG1   . ILE A 193 ? 1.0532 0.6393 0.6339 0.2143  0.0199  -0.1236 193 ILE A CG1   
1560 C CG2   . ILE A 193 ? 0.9206 0.5402 0.4948 0.2580  0.0682  -0.0933 193 ILE A CG2   
1561 C CD1   . ILE A 193 ? 1.0771 0.6159 0.6330 0.2295  0.0251  -0.1432 193 ILE A CD1   
1562 N N     . GLU A 194 ? 0.9888 0.6333 0.5218 0.2136  0.0023  -0.1148 194 GLU A N     
1563 C CA    . GLU A 194 ? 0.9890 0.6425 0.5106 0.2022  -0.0241 -0.1273 194 GLU A CA    
1564 C C     . GLU A 194 ? 0.9558 0.5978 0.5059 0.1748  -0.0486 -0.1483 194 GLU A C     
1565 O O     . GLU A 194 ? 0.9536 0.6163 0.5316 0.1544  -0.0649 -0.1465 194 GLU A O     
1566 C CB    . GLU A 194 ? 1.1282 0.7712 0.5822 0.2283  -0.0299 -0.1454 194 GLU A CB    
1567 C CG    . GLU A 194 ? 1.3059 0.9673 0.7436 0.2241  -0.0582 -0.1573 194 GLU A CG    
1568 C CD    . GLU A 194 ? 1.5140 1.1732 0.8782 0.2578  -0.0608 -0.1670 194 GLU A CD    
1569 O OE1   . GLU A 194 ? 1.6012 1.2697 0.9457 0.2570  -0.0918 -0.1922 194 GLU A OE1   
1570 O OE2   . GLU A 194 ? 1.5763 1.2292 0.9072 0.2846  -0.0315 -0.1479 194 GLU A OE2   
1571 N N     . SER A 195 ? 0.9477 0.5545 0.4929 0.1747  -0.0478 -0.1667 195 SER A N     
1572 C CA    . SER A 195 ? 0.9418 0.5299 0.5122 0.1482  -0.0667 -0.1871 195 SER A CA    
1573 C C     . SER A 195 ? 0.9068 0.5081 0.5330 0.1265  -0.0616 -0.1638 195 SER A C     
1574 O O     . SER A 195 ? 0.9528 0.5610 0.6076 0.1015  -0.0771 -0.1698 195 SER A O     
1575 C CB    . SER A 195 ? 1.0194 0.5567 0.5668 0.1552  -0.0634 -0.2121 195 SER A CB    
1576 O OG    . SER A 195 ? 1.1186 0.6422 0.6755 0.1699  -0.0377 -0.1917 195 SER A OG    
1577 N N     . SER A 196 ? 0.8621 0.4710 0.5046 0.1367  -0.0403 -0.1378 196 SER A N     
1578 C CA    . SER A 196 ? 0.7975 0.4237 0.4869 0.1198  -0.0376 -0.1164 196 SER A CA    
1579 C C     . SER A 196 ? 0.8125 0.4773 0.5197 0.1064  -0.0471 -0.1057 196 SER A C     
1580 O O     . SER A 196 ? 0.8236 0.4995 0.5629 0.0863  -0.0544 -0.0994 196 SER A O     
1581 C CB    . SER A 196 ? 0.7823 0.4188 0.4871 0.1353  -0.0165 -0.0936 196 SER A CB    
1582 O OG    . SER A 196 ? 0.8912 0.4935 0.5809 0.1527  -0.0053 -0.1004 196 SER A OG    
1583 N N     . ILE A 197 ? 0.7885 0.4714 0.4725 0.1203  -0.0441 -0.1015 197 ILE A N     
1584 C CA    . ILE A 197 ? 0.7668 0.4811 0.4651 0.1122  -0.0490 -0.0884 197 ILE A CA    
1585 C C     . ILE A 197 ? 0.7288 0.4484 0.4301 0.0967  -0.0734 -0.1060 197 ILE A C     
1586 O O     . ILE A 197 ? 0.6581 0.3985 0.3886 0.0813  -0.0800 -0.0980 197 ILE A O     
1587 C CB    . ILE A 197 ? 0.8238 0.5490 0.4924 0.1335  -0.0362 -0.0773 197 ILE A CB    
1588 C CG1   . ILE A 197 ? 0.7805 0.5122 0.4652 0.1421  -0.0099 -0.0567 197 ILE A CG1   
1589 C CG2   . ILE A 197 ? 0.8342 0.5824 0.5065 0.1289  -0.0440 -0.0679 197 ILE A CG2   
1590 C CD1   . ILE A 197 ? 0.8063 0.5439 0.4640 0.1627  0.0104  -0.0430 197 ILE A CD1   
1591 N N     . HIS A 198 ? 0.7774 0.4801 0.4500 0.1011  -0.0868 -0.1322 198 HIS A N     
1592 C CA    . HIS A 198 ? 0.7929 0.5061 0.4743 0.0852  -0.1119 -0.1539 198 HIS A CA    
1593 C C     . HIS A 198 ? 0.7764 0.4847 0.5055 0.0565  -0.1142 -0.1541 198 HIS A C     
1594 O O     . HIS A 198 ? 0.7397 0.4747 0.4987 0.0403  -0.1248 -0.1524 198 HIS A O     
1595 C CB    . HIS A 198 ? 0.8689 0.5625 0.5117 0.0939  -0.1270 -0.1875 198 HIS A CB    
1596 C CG    . HIS A 198 ? 0.9919 0.7004 0.6530 0.0738  -0.1549 -0.2150 198 HIS A CG    
1597 N ND1   . HIS A 198 ? 1.0263 0.7780 0.6981 0.0726  -0.1718 -0.2132 198 HIS A ND1   
1598 C CD2   . HIS A 198 ? 1.0023 0.6901 0.6800 0.0524  -0.1675 -0.2447 198 HIS A CD2   
1599 C CE1   . HIS A 198 ? 0.9896 0.7540 0.6862 0.0518  -0.1954 -0.2417 198 HIS A CE1   
1600 N NE2   . HIS A 198 ? 1.0141 0.7389 0.7159 0.0371  -0.1928 -0.2618 198 HIS A NE2   
1601 N N     . LEU A 199 ? 0.7467 0.4205 0.4815 0.0530  -0.1018 -0.1539 199 LEU A N     
1602 C CA    . LEU A 199 ? 0.7638 0.4254 0.5370 0.0293  -0.0994 -0.1506 199 LEU A CA    
1603 C C     . LEU A 199 ? 0.7435 0.4338 0.5463 0.0234  -0.0916 -0.1223 199 LEU A C     
1604 O O     . LEU A 199 ? 0.7879 0.4913 0.6216 0.0035  -0.0964 -0.1204 199 LEU A O     
1605 C CB    . LEU A 199 ? 0.7974 0.4114 0.5635 0.0336  -0.0851 -0.1523 199 LEU A CB    
1606 C CG    . LEU A 199 ? 0.8547 0.4453 0.6529 0.0133  -0.0775 -0.1451 199 LEU A CG    
1607 C CD1   . LEU A 199 ? 0.8334 0.4230 0.6574 -0.0161 -0.0909 -0.1661 199 LEU A CD1   
1608 C CD2   . LEU A 199 ? 0.8279 0.3670 0.6122 0.0251  -0.0611 -0.1430 199 LEU A CD2   
1609 N N     . LEU A 200 ? 0.6647 0.3660 0.4592 0.0403  -0.0790 -0.1023 200 LEU A N     
1610 C CA    . LEU A 200 ? 0.6100 0.3389 0.4283 0.0361  -0.0735 -0.0800 200 LEU A CA    
1611 C C     . LEU A 200 ? 0.5955 0.3546 0.4245 0.0272  -0.0853 -0.0812 200 LEU A C     
1612 O O     . LEU A 200 ? 0.6381 0.4122 0.4927 0.0147  -0.0856 -0.0723 200 LEU A O     
1613 C CB    . LEU A 200 ? 0.5723 0.3117 0.3824 0.0538  -0.0599 -0.0644 200 LEU A CB    
1614 C CG    . LEU A 200 ? 0.6084 0.3754 0.4419 0.0491  -0.0551 -0.0462 200 LEU A CG    
1615 C CD1   . LEU A 200 ? 0.5347 0.2999 0.3906 0.0389  -0.0544 -0.0388 200 LEU A CD1   
1616 C CD2   . LEU A 200 ? 0.6461 0.4241 0.4777 0.0630  -0.0408 -0.0346 200 LEU A CD2   
1617 N N     . HIS A 201 ? 0.6492 0.4172 0.4550 0.0376  -0.0944 -0.0916 201 HIS A N     
1618 C CA    . HIS A 201 ? 0.6348 0.4322 0.4457 0.0363  -0.1064 -0.0924 201 HIS A CA    
1619 C C     . HIS A 201 ? 0.6545 0.4634 0.4963 0.0149  -0.1198 -0.1056 201 HIS A C     
1620 O O     . HIS A 201 ? 0.6091 0.4411 0.4768 0.0061  -0.1205 -0.0968 201 HIS A O     
1621 C CB    . HIS A 201 ? 0.6903 0.4913 0.4621 0.0565  -0.1150 -0.1028 201 HIS A CB    
1622 C CG    . HIS A 201 ? 0.7225 0.5545 0.4958 0.0594  -0.1321 -0.1080 201 HIS A CG    
1623 N ND1   . HIS A 201 ? 0.7694 0.6161 0.5493 0.0514  -0.1551 -0.1334 201 HIS A ND1   
1624 C CD2   . HIS A 201 ? 0.6615 0.5134 0.4319 0.0710  -0.1297 -0.0917 201 HIS A CD2   
1625 C CE1   . HIS A 201 ? 0.7161 0.5967 0.4982 0.0600  -0.1677 -0.1318 201 HIS A CE1   
1626 N NE2   . HIS A 201 ? 0.7090 0.5896 0.4823 0.0734  -0.1516 -0.1056 201 HIS A NE2   
1627 N N     . ASP A 202 ? 0.7240 0.5155 0.5644 0.0059  -0.1287 -0.1280 202 ASP A N     
1628 C CA    . ASP A 202 ? 0.7124 0.5130 0.5887 -0.0185 -0.1389 -0.1428 202 ASP A CA    
1629 C C     . ASP A 202 ? 0.7114 0.5021 0.6182 -0.0342 -0.1223 -0.1246 202 ASP A C     
1630 O O     . ASP A 202 ? 0.7395 0.5527 0.6800 -0.0500 -0.1239 -0.1229 202 ASP A O     
1631 C CB    . ASP A 202 ? 0.7643 0.5394 0.6338 -0.0275 -0.1494 -0.1729 202 ASP A CB    
1632 C CG    . ASP A 202 ? 0.9710 0.7659 0.8134 -0.0143 -0.1725 -0.1973 202 ASP A CG    
1633 O OD1   . ASP A 202 ? 1.0425 0.8735 0.8753 0.0012  -0.1807 -0.1891 202 ASP A OD1   
1634 O OD2   . ASP A 202 ? 1.0938 0.8663 0.9213 -0.0176 -0.1828 -0.2257 202 ASP A OD2   
1635 N N     . SER A 203 ? 0.6635 0.4238 0.5576 -0.0273 -0.1061 -0.1105 203 SER A N     
1636 C CA    . SER A 203 ? 0.6727 0.4230 0.5876 -0.0371 -0.0911 -0.0920 203 SER A CA    
1637 C C     . SER A 203 ? 0.7049 0.4891 0.6345 -0.0367 -0.0884 -0.0746 203 SER A C     
1638 O O     . SER A 203 ? 0.7035 0.4947 0.6574 -0.0501 -0.0822 -0.0669 203 SER A O     
1639 C CB    . SER A 203 ? 0.6436 0.3631 0.5392 -0.0231 -0.0773 -0.0795 203 SER A CB    
1640 O OG    . SER A 203 ? 0.7700 0.4531 0.6495 -0.0209 -0.0776 -0.0961 203 SER A OG    
1641 N N     . ILE A 204 ? 0.6498 0.4514 0.5634 -0.0209 -0.0906 -0.0681 204 ILE A N     
1642 C CA    . ILE A 204 ? 0.6202 0.4477 0.5443 -0.0192 -0.0877 -0.0545 204 ILE A CA    
1643 C C     . ILE A 204 ? 0.6187 0.4740 0.5670 -0.0301 -0.0959 -0.0611 204 ILE A C     
1644 O O     . ILE A 204 ? 0.5752 0.4427 0.5428 -0.0374 -0.0889 -0.0517 204 ILE A O     
1645 C CB    . ILE A 204 ? 0.5743 0.4100 0.4788 -0.0022 -0.0868 -0.0483 204 ILE A CB    
1646 C CG1   . ILE A 204 ? 0.5048 0.3235 0.3978 0.0065  -0.0759 -0.0395 204 ILE A CG1   
1647 C CG2   . ILE A 204 ? 0.5220 0.3802 0.4369 -0.0011 -0.0853 -0.0391 204 ILE A CG2   
1648 C CD1   . ILE A 204 ? 0.4634 0.2848 0.3384 0.0215  -0.0714 -0.0358 204 ILE A CD1   
1649 N N     . ILE A 205 ? 0.6246 0.4932 0.5717 -0.0292 -0.1107 -0.0779 205 ILE A N     
1650 C CA    . ILE A 205 ? 0.6038 0.5072 0.5804 -0.0384 -0.1205 -0.0861 205 ILE A CA    
1651 C C     . ILE A 205 ? 0.6597 0.5597 0.6720 -0.0631 -0.1145 -0.0906 205 ILE A C     
1652 O O     . ILE A 205 ? 0.6888 0.6133 0.7309 -0.0719 -0.1091 -0.0845 205 ILE A O     
1653 C CB    . ILE A 205 ? 0.6236 0.5471 0.5912 -0.0304 -0.1418 -0.1061 205 ILE A CB    
1654 C CG1   . ILE A 205 ? 0.6131 0.5354 0.5412 -0.0034 -0.1428 -0.0969 205 ILE A CG1   
1655 C CG2   . ILE A 205 ? 0.5660 0.5355 0.5722 -0.0393 -0.1543 -0.1164 205 ILE A CG2   
1656 C CD1   . ILE A 205 ? 0.6504 0.5816 0.5521 0.0107  -0.1621 -0.1154 205 ILE A CD1   
1657 N N     . GLU A 206 ? 0.7185 0.5848 0.7275 -0.0736 -0.1121 -0.1001 206 GLU A N     
1658 C CA    . GLU A 206 ? 0.7624 0.6175 0.8058 -0.0985 -0.1023 -0.1031 206 GLU A CA    
1659 C C     . GLU A 206 ? 0.6821 0.5279 0.7314 -0.1002 -0.0799 -0.0769 206 GLU A C     
1660 O O     . GLU A 206 ? 0.6510 0.5126 0.7342 -0.1159 -0.0704 -0.0727 206 GLU A O     
1661 C CB    . GLU A 206 ? 0.8074 0.6168 0.8411 -0.1072 -0.1013 -0.1176 206 GLU A CB    
1662 C CG    . GLU A 206 ? 1.0333 0.8522 1.0647 -0.1100 -0.1242 -0.1492 206 GLU A CG    
1663 C CD    . GLU A 206 ? 1.2128 1.0768 1.2921 -0.1304 -0.1376 -0.1673 206 GLU A CD    
1664 O OE1   . GLU A 206 ? 1.2771 1.1416 1.3986 -0.1542 -0.1233 -0.1624 206 GLU A OE1   
1665 O OE2   . GLU A 206 ? 1.2570 1.1582 1.3321 -0.1212 -0.1616 -0.1855 206 GLU A OE2   
1666 N N     . ILE A 207 ? 0.5628 0.3861 0.5802 -0.0835 -0.0713 -0.0603 207 ILE A N     
1667 C CA    . ILE A 207 ? 0.6201 0.4342 0.6358 -0.0816 -0.0529 -0.0376 207 ILE A CA    
1668 C C     . ILE A 207 ? 0.6465 0.4993 0.6758 -0.0797 -0.0511 -0.0298 207 ILE A C     
1669 O O     . ILE A 207 ? 0.6522 0.5096 0.6986 -0.0882 -0.0362 -0.0188 207 ILE A O     
1670 C CB    . ILE A 207 ? 0.7752 0.5676 0.7566 -0.0620 -0.0488 -0.0246 207 ILE A CB    
1671 C CG1   . ILE A 207 ? 0.8674 0.6165 0.8359 -0.0611 -0.0438 -0.0270 207 ILE A CG1   
1672 C CG2   . ILE A 207 ? 0.6875 0.4802 0.6629 -0.0561 -0.0350 -0.0039 207 ILE A CG2   
1673 C CD1   . ILE A 207 ? 0.8960 0.6153 0.8737 -0.0715 -0.0254 -0.0149 207 ILE A CD1   
1674 N N     . LEU A 208 ? 0.5595 0.4369 0.5800 -0.0671 -0.0637 -0.0345 208 LEU A N     
1675 C CA    . LEU A 208 ? 0.5205 0.4278 0.5485 -0.0609 -0.0609 -0.0273 208 LEU A CA    
1676 C C     . LEU A 208 ? 0.5571 0.4970 0.6237 -0.0735 -0.0607 -0.0334 208 LEU A C     
1677 O O     . LEU A 208 ? 0.5956 0.5506 0.6755 -0.0747 -0.0474 -0.0230 208 LEU A O     
1678 C CB    . LEU A 208 ? 0.4969 0.4147 0.5059 -0.0439 -0.0714 -0.0296 208 LEU A CB    
1679 C CG    . LEU A 208 ? 0.4792 0.3728 0.4595 -0.0334 -0.0675 -0.0216 208 LEU A CG    
1680 C CD1   . LEU A 208 ? 0.4454 0.3448 0.4110 -0.0197 -0.0727 -0.0223 208 LEU A CD1   
1681 C CD2   . LEU A 208 ? 0.4993 0.3876 0.4754 -0.0329 -0.0553 -0.0090 208 LEU A CD2   
1682 N N     . GLN A 209 ? 0.5357 0.4892 0.6213 -0.0825 -0.0753 -0.0516 209 GLN A N     
1683 C CA    . GLN A 209 ? 0.5116 0.5048 0.6434 -0.0965 -0.0777 -0.0609 209 GLN A CA    
1684 C C     . GLN A 209 ? 0.5471 0.5286 0.7080 -0.1187 -0.0564 -0.0534 209 GLN A C     
1685 O O     . GLN A 209 ? 0.5789 0.5925 0.7757 -0.1267 -0.0452 -0.0486 209 GLN A O     
1686 C CB    . GLN A 209 ? 0.6126 0.6251 0.7585 -0.1020 -0.1015 -0.0863 209 GLN A CB    
1687 C CG    . GLN A 209 ? 0.6882 0.7140 0.8028 -0.0769 -0.1210 -0.0917 209 GLN A CG    
1688 C CD    . GLN A 209 ? 0.8032 0.8592 0.9179 -0.0579 -0.1185 -0.0791 209 GLN A CD    
1689 O OE1   . GLN A 209 ? 0.8518 0.9431 1.0035 -0.0630 -0.1126 -0.0766 209 GLN A OE1   
1690 N NE2   . GLN A 209 ? 0.8136 0.8541 0.8880 -0.0353 -0.1208 -0.0710 209 GLN A NE2   
1691 N N     . LYS A 210 ? 0.5485 0.4826 0.6935 -0.1268 -0.0476 -0.0502 210 LYS A N     
1692 C CA    . LYS A 210 ? 0.5902 0.5031 0.7569 -0.1455 -0.0225 -0.0383 210 LYS A CA    
1693 C C     . LYS A 210 ? 0.6124 0.5256 0.7633 -0.1331 -0.0008 -0.0120 210 LYS A C     
1694 O O     . LYS A 210 ? 0.6174 0.5424 0.7970 -0.1449 0.0201  -0.0016 210 LYS A O     
1695 C CB    . LYS A 210 ? 0.6083 0.4633 0.7549 -0.1514 -0.0164 -0.0382 210 LYS A CB    
1696 C CG    . LYS A 210 ? 0.6110 0.4322 0.7693 -0.1654 0.0137  -0.0199 210 LYS A CG    
1697 C CD    . LYS A 210 ? 0.7021 0.4607 0.8273 -0.1603 0.0206  -0.0144 210 LYS A CD    
1698 C CE    . LYS A 210 ? 0.8481 0.5661 0.9819 -0.1722 0.0534  0.0066  210 LYS A CE    
1699 N NZ    . LYS A 210 ? 0.9798 0.6325 1.0905 -0.1706 0.0605  0.0075  210 LYS A NZ    
1700 N N     . ALA A 211 ? 0.5608 0.4634 0.6672 -0.1096 -0.0055 -0.0028 211 ALA A N     
1701 C CA    . ALA A 211 ? 0.5495 0.4524 0.6338 -0.0953 0.0106  0.0174  211 ALA A CA    
1702 C C     . ALA A 211 ? 0.5800 0.5282 0.6880 -0.0930 0.0141  0.0168  211 ALA A C     
1703 O O     . ALA A 211 ? 0.6086 0.5631 0.7201 -0.0919 0.0355  0.0315  211 ALA A O     
1704 C CB    . ALA A 211 ? 0.4898 0.3774 0.5289 -0.0736 0.0004  0.0207  211 ALA A CB    
1705 N N     . ILE A 212 ? 0.5612 0.5404 0.6834 -0.0894 -0.0055 0.0011  212 ILE A N     
1706 C CA    . ILE A 212 ? 0.5191 0.5436 0.6682 -0.0849 -0.0031 -0.0004 212 ILE A CA    
1707 C C     . ILE A 212 ? 0.5233 0.5714 0.7240 -0.1063 0.0135  0.0011  212 ILE A C     
1708 O O     . ILE A 212 ? 0.5485 0.6187 0.7642 -0.1035 0.0334  0.0123  212 ILE A O     
1709 C CB    . ILE A 212 ? 0.5314 0.5844 0.6884 -0.0759 -0.0278 -0.0168 212 ILE A CB    
1710 C CG1   . ILE A 212 ? 0.5575 0.5890 0.6680 -0.0544 -0.0372 -0.0149 212 ILE A CG1   
1711 C CG2   . ILE A 212 ? 0.4525 0.5582 0.6468 -0.0708 -0.0259 -0.0192 212 ILE A CG2   
1712 C CD1   . ILE A 212 ? 0.5083 0.5581 0.6185 -0.0433 -0.0587 -0.0273 212 ILE A CD1   
1713 N N     . LYS A 213 ? 0.5309 0.5733 0.7604 -0.1288 0.0074  -0.0111 213 LYS A N     
1714 C CA    . LYS A 213 ? 0.4981 0.5654 0.7876 -0.1547 0.0229  -0.0132 213 LYS A CA    
1715 C C     . LYS A 213 ? 0.5360 0.5742 0.8194 -0.1604 0.0594  0.0123  213 LYS A C     
1716 O O     . LYS A 213 ? 0.5992 0.6643 0.9276 -0.1745 0.0822  0.0193  213 LYS A O     
1717 C CB    . LYS A 213 ? 0.5474 0.6069 0.8661 -0.1795 0.0073  -0.0358 213 LYS A CB    
1718 C CG    . LYS A 213 ? 0.5913 0.6784 0.9827 -0.2125 0.0210  -0.0438 213 LYS A CG    
1719 N N     . LEU A 214 ? 0.6469 0.5791 0.9780 -0.1916 0.0008  -0.0853 214 LEU A N     
1720 C CA    . LEU A 214 ? 0.6667 0.5582 0.9957 -0.1880 0.0557  -0.0492 214 LEU A CA    
1721 C C     . LEU A 214 ? 0.7055 0.5972 0.9681 -0.1742 0.0858  -0.0167 214 LEU A C     
1722 O O     . LEU A 214 ? 0.7743 0.6333 1.0078 -0.1591 0.1308  0.0153  214 LEU A O     
1723 C CB    . LEU A 214 ? 0.6490 0.5100 0.9230 -0.1774 0.0578  -0.0455 214 LEU A CB    
1724 C CG    . LEU A 214 ? 0.7090 0.5623 1.0455 -0.1852 0.0296  -0.0801 214 LEU A CG    
1725 C CD1   . LEU A 214 ? 0.6969 0.5155 0.9861 -0.1749 0.0419  -0.0700 214 LEU A CD1   
1726 C CD2   . LEU A 214 ? 0.7592 0.6046 1.2422 -0.2028 0.0423  -0.0888 214 LEU A CD2   
1727 N N     . GLY A 215 ? 0.5774 0.5049 0.8152 -0.1741 0.0599  -0.0257 215 GLY A N     
1728 C CA    . GLY A 215 ? 0.5773 0.5067 0.7654 -0.1591 0.0799  -0.0045 215 GLY A CA    
1729 C C     . GLY A 215 ? 0.7410 0.6607 0.8280 -0.1366 0.0683  0.0026  215 GLY A C     
1730 O O     . GLY A 215 ? 0.7911 0.7026 0.8295 -0.1156 0.0815  0.0154  215 GLY A O     
1731 N N     . GLY A 216 ? 0.6540 0.5747 0.7129 -0.1369 0.0406  -0.0084 216 GLY A N     
1732 C CA    . GLY A 216 ? 0.6043 0.5169 0.5884 -0.1170 0.0264  -0.0022 216 GLY A CA    
1733 C C     . GLY A 216 ? 0.7320 0.5978 0.6644 -0.0982 0.0544  0.0152  216 GLY A C     
1734 O O     . GLY A 216 ? 0.6557 0.4946 0.6124 -0.1003 0.0912  0.0281  216 GLY A O     
1735 N N     . SER A 217 ? 0.7608 0.6169 0.6314 -0.0774 0.0371  0.0177  217 SER A N     
1736 C CA    . SER A 217 ? 0.8936 0.7061 0.7044 -0.0536 0.0555  0.0325  217 SER A CA    
1737 C C     . SER A 217 ? 1.0060 0.8010 0.7589 -0.0184 0.0647  0.0403  217 SER A C     
1738 O O     . SER A 217 ? 0.9921 0.8059 0.7354 -0.0072 0.0334  0.0263  217 SER A O     
1739 C CB    . SER A 217 ? 0.8733 0.6823 0.6570 -0.0492 0.0262  0.0269  217 SER A CB    
1740 O OG    . SER A 217 ? 0.9009 0.7142 0.7182 -0.0703 0.0252  0.0206  217 SER A OG    
1741 N N     . SER A 218 ? 1.1972 0.9557 0.9140 0.0045  0.1080  0.0630  218 SER A N     
1742 C CA    . SER A 218 ? 1.3465 1.0853 0.9911 0.0508  0.1210  0.0707  218 SER A CA    
1743 C C     . SER A 218 ? 1.4880 1.1797 1.0532 0.0915  0.1472  0.0938  218 SER A C     
1744 O O     . SER A 218 ? 1.5297 1.2070 1.0442 0.1100  0.1132  0.0828  218 SER A O     
1745 C CB    . SER A 218 ? 1.3861 1.1338 1.0638 0.0512  0.1618  0.0842  218 SER A CB    
1746 O OG    . SER A 218 ? 1.5172 1.2483 1.1152 0.1035  0.1721  0.0879  218 SER A OG    
1747 N N     . ALA A 224 ? 1.3100 1.1179 0.8147 0.2974  0.2049  0.0103  224 ALA A N     
1748 C CA    . ALA A 224 ? 1.3144 1.1376 0.8628 0.2531  0.1384  -0.0161 224 ALA A CA    
1749 C C     . ALA A 224 ? 1.2125 1.0623 0.8747 0.1742  0.1508  0.0055  224 ALA A C     
1750 O O     . ALA A 224 ? 1.1805 1.0117 0.8415 0.1609  0.1843  0.0351  224 ALA A O     
1751 C CB    . ALA A 224 ? 1.4281 1.2121 0.8742 0.2966  0.1216  -0.0191 224 ALA A CB    
1752 N N     . LEU A 225 ? 1.1774 1.0704 0.9373 0.1270  0.1202  -0.0119 225 LEU A N     
1753 C CA    . LEU A 225 ? 1.0717 0.9934 0.9333 0.0613  0.1231  0.0008  225 LEU A CA    
1754 C C     . LEU A 225 ? 1.0943 1.0126 0.9544 0.0388  0.0933  -0.0017 225 LEU A C     
1755 O O     . LEU A 225 ? 1.0176 0.9306 0.8388 0.0568  0.0486  -0.0220 225 LEU A O     
1756 C CB    . LEU A 225 ? 0.9073 0.8763 0.8569 0.0282  0.0906  -0.0182 225 LEU A CB    
1757 C CG    . LEU A 225 ? 0.9462 0.9189 0.8957 0.0539  0.1145  -0.0206 225 LEU A CG    
1758 C CD1   . LEU A 225 ? 0.8388 0.8569 0.8717 0.0266  0.0769  -0.0415 225 LEU A CD1   
1759 C CD2   . LEU A 225 ? 1.0117 0.9721 0.9870 0.0499  0.1855  0.0153  225 LEU A CD2   
1760 N N     . GLY A 226 ? 1.1655 1.0859 1.0760 0.0019  0.1165  0.0170  226 GLY A N     
1761 C CA    . GLY A 226 ? 1.2350 1.1520 1.1462 -0.0187 0.0940  0.0154  226 GLY A CA    
1762 C C     . GLY A 226 ? 1.4239 1.2953 1.2558 0.0113  0.1144  0.0303  226 GLY A C     
1763 O O     . GLY A 226 ? 1.4639 1.3290 1.2762 0.0064  0.0868  0.0238  226 GLY A O     
1764 N N     . SER A 227 ? 1.5469 1.3868 1.3336 0.0463  0.1663  0.0543  227 SER A N     
1765 C CA    . SER A 227 ? 1.6336 1.4290 1.3362 0.0844  0.1902  0.0738  227 SER A CA    
1766 C C     . SER A 227 ? 1.6723 1.4474 1.4196 0.0704  0.2500  0.1118  227 SER A C     
1767 O O     . SER A 227 ? 1.7450 1.4838 1.4365 0.0986  0.2772  0.1354  227 SER A O     
1768 C CB    . SER A 227 ? 1.6934 1.4628 1.2911 0.1531  0.2051  0.0765  227 SER A CB    
1769 O OG    . SER A 227 ? 1.6963 1.4654 1.3117 0.1682  0.2626  0.1017  227 SER A OG    
1770 N N     . THR A 228 ? 1.5927 1.3909 1.4505 0.0287  0.2678  0.1169  228 THR A N     
1771 C CA    . THR A 228 ? 1.5515 1.3330 1.4885 0.0118  0.3192  0.1484  228 THR A CA    
1772 C C     . THR A 228 ? 1.3883 1.1833 1.3994 -0.0371 0.2820  0.1261  228 THR A C     
1773 O O     . THR A 228 ? 1.3598 1.1576 1.4816 -0.0658 0.3014  0.1324  228 THR A O     
1774 C CB    . THR A 228 ? 1.5902 1.3837 1.6224 0.0035  0.3670  0.1694  228 THR A CB    
1775 O OG1   . THR A 228 ? 1.5161 1.3514 1.5870 -0.0232 0.3235  0.1358  228 THR A OG1   
1776 C CG2   . THR A 228 ? 1.6693 1.4358 1.6305 0.0638  0.4317  0.2097  228 THR A CG2   
1777 N N     . GLY A 229 ? 1.2335 1.0361 1.1884 -0.0416 0.2278  0.0989  229 GLY A N     
1778 C CA    . GLY A 229 ? 1.0750 0.8901 1.0769 -0.0764 0.1917  0.0767  229 GLY A CA    
1779 C C     . GLY A 229 ? 1.0589 0.8379 1.0665 -0.0737 0.2175  0.0943  229 GLY A C     
1780 O O     . GLY A 229 ? 1.1033 0.8478 1.0483 -0.0397 0.2537  0.1237  229 GLY A O     
1781 N N     . LYS A 230 ? 0.9652 0.7519 1.0454 -0.1046 0.1965  0.0746  230 LYS A N     
1782 C CA    . LYS A 230 ? 0.9355 0.6900 1.0456 -0.1065 0.2172  0.0862  230 LYS A CA    
1783 C C     . LYS A 230 ? 0.9278 0.6858 1.0121 -0.1171 0.1701  0.0568  230 LYS A C     
1784 O O     . LYS A 230 ? 0.9558 0.6907 1.0762 -0.1225 0.1780  0.0573  230 LYS A O     
1785 C CB    . LYS A 230 ? 0.8870 0.6396 1.1411 -0.1293 0.2437  0.0900  230 LYS A CB    
1786 C CG    . LYS A 230 ? 0.8714 0.6127 1.1680 -0.1143 0.3081  0.1325  230 LYS A CG    
1787 N N     . MET A 231 ? 0.8882 0.6748 0.9173 -0.1172 0.1244  0.0340  231 MET A N     
1788 C CA    . MET A 231 ? 0.8080 0.6009 0.8119 -0.1211 0.0859  0.0117  231 MET A CA    
1789 C C     . MET A 231 ? 0.8054 0.5639 0.7375 -0.1007 0.0964  0.0296  231 MET A C     
1790 O O     . MET A 231 ? 0.7826 0.5341 0.7065 -0.1028 0.0790  0.0178  231 MET A O     
1791 C CB    . MET A 231 ? 0.7435 0.5781 0.7193 -0.1215 0.0436  -0.0065 231 MET A CB    
1792 C CG    . MET A 231 ? 0.7183 0.5637 0.6703 -0.1187 0.0105  -0.0239 231 MET A CG    
1793 S SD    . MET A 231 ? 0.8824 0.7329 0.9035 -0.1323 -0.0089 -0.0597 231 MET A SD    
1794 C CE    . MET A 231 ? 0.6834 0.5366 0.6431 -0.1138 -0.0361 -0.0711 231 MET A CE    
1795 N N     . GLN A 232 ? 0.8358 0.5726 0.7117 -0.0760 0.1226  0.0562  232 GLN A N     
1796 C CA    . GLN A 232 ? 0.9266 0.6314 0.7284 -0.0510 0.1256  0.0708  232 GLN A CA    
1797 C C     . GLN A 232 ? 0.9861 0.6565 0.8177 -0.0540 0.1550  0.0853  232 GLN A C     
1798 O O     . GLN A 232 ? 0.9720 0.6193 0.7568 -0.0405 0.1500  0.0913  232 GLN A O     
1799 C CB    . GLN A 232 ? 0.9875 0.6744 0.7146 -0.0132 0.1426  0.0912  232 GLN A CB    
1800 C CG    . GLN A 232 ? 1.1756 0.8399 0.9146 0.0033  0.2015  0.1241  232 GLN A CG    
1801 C CD    . GLN A 232 ? 1.2426 0.9351 1.0409 -0.0121 0.2127  0.1202  232 GLN A CD    
1802 O OE1   . GLN A 232 ? 1.1951 0.9245 1.0392 -0.0417 0.1762  0.0912  232 GLN A OE1   
1803 N NE2   . GLN A 232 ? 1.3210 0.9961 1.1175 0.0124  0.2664  0.1531  232 GLN A NE2   
1804 N N     . ASN A 233 ? 0.9632 0.6306 0.8862 -0.0719 0.1836  0.0903  233 ASN A N     
1805 C CA    . ASN A 233 ? 1.0187 0.6557 0.9985 -0.0774 0.2089  0.1017  233 ASN A CA    
1806 C C     . ASN A 233 ? 0.9606 0.6097 0.9852 -0.1009 0.1665  0.0608  233 ASN A C     
1807 O O     . ASN A 233 ? 0.9884 0.6127 1.0525 -0.1041 0.1753  0.0611  233 ASN A O     
1808 C CB    . ASN A 233 ? 1.0962 0.7223 1.1802 -0.0835 0.2599  0.1272  233 ASN A CB    
1809 C CG    . ASN A 233 ? 1.1947 0.8063 1.2252 -0.0496 0.3114  0.1734  233 ASN A CG    
1810 O OD1   . ASN A 233 ? 1.2101 0.8345 1.2940 -0.0528 0.3364  0.1844  233 ASN A OD1   
1811 N ND2   . ASN A 233 ? 1.2579 0.8423 1.1785 -0.0119 0.3254  0.1990  233 ASN A ND2   
1812 N N     . GLU A 234 ? 0.8839 0.5709 0.8985 -0.1117 0.1214  0.0266  234 GLU A N     
1813 C CA    . GLU A 234 ? 0.8711 0.5724 0.9105 -0.1221 0.0801  -0.0136 234 GLU A CA    
1814 C C     . GLU A 234 ? 0.8326 0.5393 0.7824 -0.1072 0.0540  -0.0178 234 GLU A C     
1815 O O     . GLU A 234 ? 0.7439 0.4598 0.6951 -0.1062 0.0253  -0.0458 234 GLU A O     
1816 C CB    . GLU A 234 ? 0.8866 0.6275 0.9753 -0.1354 0.0484  -0.0467 234 GLU A CB    
1817 C CG    . GLU A 234 ? 0.9544 0.6926 1.1535 -0.1519 0.0702  -0.0454 234 GLU A CG    
1818 C CD    . GLU A 234 ? 1.0672 0.7802 1.3744 -0.1620 0.0735  -0.0621 234 GLU A CD    
1819 O OE1   . GLU A 234 ? 1.1179 0.8048 1.5045 -0.1670 0.1205  -0.0312 234 GLU A OE1   
1820 O OE2   . GLU A 234 ? 1.0984 0.8176 1.4166 -0.1609 0.0298  -0.1059 234 GLU A OE2   
1821 N N     . LEU A 235 ? 0.7739 0.4744 0.6507 -0.0911 0.0627  0.0086  235 LEU A N     
1822 C CA    . LEU A 235 ? 0.7722 0.4794 0.5870 -0.0772 0.0379  0.0074  235 LEU A CA    
1823 C C     . LEU A 235 ? 0.7964 0.4747 0.6033 -0.0723 0.0406  0.0063  235 LEU A C     
1824 O O     . LEU A 235 ? 0.8398 0.4816 0.6470 -0.0679 0.0683  0.0259  235 LEU A O     
1825 C CB    . LEU A 235 ? 0.8475 0.5490 0.6046 -0.0585 0.0400  0.0300  235 LEU A CB    
1826 C CG    . LEU A 235 ? 0.8491 0.5817 0.6134 -0.0607 0.0320  0.0277  235 LEU A CG    
1827 C CD1   . LEU A 235 ? 0.7590 0.4833 0.4721 -0.0369 0.0255  0.0405  235 LEU A CD1   
1828 C CD2   . LEU A 235 ? 0.6643 0.4408 0.4544 -0.0708 0.0026  0.0084  235 LEU A CD2   
1829 N N     . GLN A 236 ? 0.7567 0.4511 0.5540 -0.0682 0.0152  -0.0132 236 GLN A N     
1830 C CA    . GLN A 236 ? 0.7723 0.4399 0.5621 -0.0617 0.0167  -0.0169 236 GLN A CA    
1831 C C     . GLN A 236 ? 0.7957 0.4497 0.5304 -0.0445 0.0166  0.0069  236 GLN A C     
1832 O O     . GLN A 236 ? 0.8394 0.4597 0.5650 -0.0393 0.0288  0.0169  236 GLN A O     
1833 C CB    . GLN A 236 ? 0.7993 0.4871 0.6012 -0.0571 -0.0091 -0.0519 236 GLN A CB    
1834 C CG    . GLN A 236 ? 0.8761 0.5750 0.7432 -0.0700 -0.0207 -0.0857 236 GLN A CG    
1835 C CD    . GLN A 236 ? 1.0152 0.6770 0.9541 -0.0843 -0.0019 -0.0902 236 GLN A CD    
1836 O OE1   . GLN A 236 ? 1.1008 0.7419 1.0591 -0.0795 -0.0085 -0.1091 236 GLN A OE1   
1837 N NE2   . GLN A 236 ? 1.0645 0.7174 1.0502 -0.0991 0.0251  -0.0695 236 GLN A NE2   
1838 N N     . VAL A 237 ? 0.7964 0.4761 0.5062 -0.0349 0.0010  0.0160  237 VAL A N     
1839 C CA    . VAL A 237 ? 0.7408 0.4094 0.4222 -0.0180 -0.0062 0.0330  237 VAL A CA    
1840 C C     . VAL A 237 ? 0.7342 0.4022 0.3989 -0.0070 -0.0154 0.0484  237 VAL A C     
1841 O O     . VAL A 237 ? 0.7833 0.4232 0.4241 0.0084  -0.0187 0.0602  237 VAL A O     
1842 C CB    . VAL A 237 ? 0.7414 0.4389 0.4273 -0.0071 -0.0200 0.0303  237 VAL A CB    
1843 C CG1   . VAL A 237 ? 0.7947 0.4792 0.4784 -0.0041 -0.0151 0.0134  237 VAL A CG1   
1844 C CG2   . VAL A 237 ? 0.7181 0.4612 0.4204 -0.0086 -0.0301 0.0241  237 VAL A CG2   
1845 N N     . TYR A 238 ? 0.7483 0.4458 0.4269 -0.0116 -0.0236 0.0447  238 TYR A N     
1846 C CA    . TYR A 238 ? 0.7271 0.4292 0.4003 0.0028  -0.0419 0.0512  238 TYR A CA    
1847 C C     . TYR A 238 ? 0.7944 0.4565 0.4218 0.0189  -0.0330 0.0573  238 TYR A C     
1848 O O     . TYR A 238 ? 0.7767 0.4240 0.3912 0.0132  -0.0053 0.0608  238 TYR A O     
1849 C CB    . TYR A 238 ? 0.7333 0.4732 0.4339 -0.0055 -0.0499 0.0448  238 TYR A CB    
1850 C CG    . TYR A 238 ? 0.7194 0.4614 0.4223 0.0119  -0.0735 0.0447  238 TYR A CG    
1851 C CD1   . TYR A 238 ? 0.7475 0.4668 0.4109 0.0250  -0.0691 0.0409  238 TYR A CD1   
1852 C CD2   . TYR A 238 ? 0.6382 0.4032 0.3886 0.0208  -0.1001 0.0485  238 TYR A CD2   
1853 C CE1   . TYR A 238 ? 0.7376 0.4561 0.3976 0.0487  -0.0987 0.0319  238 TYR A CE1   
1854 C CE2   . TYR A 238 ? 0.6419 0.4068 0.4114 0.0388  -0.1303 0.0408  238 TYR A CE2   
1855 C CZ    . TYR A 238 ? 0.6857 0.4269 0.4044 0.0536  -0.1333 0.0280  238 TYR A CZ    
1856 O OH    . TYR A 238 ? 0.7110 0.4509 0.4437 0.0780  -0.1701 0.0118  238 TYR A OH    
1857 N N     . GLY A 239 ? 0.7696 0.4143 0.3774 0.0437  -0.0563 0.0600  239 GLY A N     
1858 C CA    . GLY A 239 ? 0.8307 0.4368 0.3787 0.0725  -0.0535 0.0651  239 GLY A CA    
1859 C C     . GLY A 239 ? 0.8755 0.4434 0.3902 0.0760  -0.0215 0.0815  239 GLY A C     
1860 O O     . GLY A 239 ? 0.9843 0.5202 0.4428 0.1044  -0.0076 0.0937  239 GLY A O     
1861 N N     . LYS A 240 ? 0.9335 0.5041 0.4819 0.0525  -0.0090 0.0828  240 LYS A N     
1862 C CA    . LYS A 240 ? 0.9577 0.4937 0.4949 0.0516  0.0227  0.0971  240 LYS A CA    
1863 C C     . LYS A 240 ? 0.9312 0.4472 0.4625 0.0612  0.0089  0.1008  240 LYS A C     
1864 O O     . LYS A 240 ? 0.9873 0.4882 0.5359 0.0500  0.0272  0.1044  240 LYS A O     
1865 C CB    . LYS A 240 ? 0.9880 0.5377 0.5778 0.0198  0.0458  0.0890  240 LYS A CB    
1866 C CG    . LYS A 240 ? 1.0518 0.6181 0.6620 0.0088  0.0628  0.0874  240 LYS A CG    
1867 C CD    . LYS A 240 ? 1.1916 0.7667 0.8687 -0.0195 0.0781  0.0740  240 LYS A CD    
1868 C CE    . LYS A 240 ? 1.3481 0.9064 1.0595 -0.0228 0.1192  0.0917  240 LYS A CE    
1869 N NZ    . LYS A 240 ? 1.3924 0.9717 1.0969 -0.0201 0.1237  0.0952  240 LYS A NZ    
1870 N N     . THR A 241 ? 0.8967 0.4144 0.4164 0.0819  -0.0268 0.0970  241 THR A N     
1871 C CA    . THR A 241 ? 0.9789 0.4780 0.5012 0.0951  -0.0449 0.1012  241 THR A CA    
1872 C C     . THR A 241 ? 0.9869 0.4423 0.4707 0.1078  -0.0206 0.1183  241 THR A C     
1873 O O     . THR A 241 ? 1.0185 0.4481 0.4474 0.1342  -0.0099 0.1305  241 THR A O     
1874 C CB    . THR A 241 ? 0.9991 0.4966 0.5167 0.1251  -0.0910 0.0927  241 THR A CB    
1875 O OG1   . THR A 241 ? 0.9293 0.4675 0.4953 0.1144  -0.1112 0.0802  241 THR A OG1   
1876 C CG2   . THR A 241 ? 0.9205 0.4026 0.4630 0.1369  -0.1138 0.0960  241 THR A CG2   
1877 N N     . GLY A 242 ? 1.0024 0.4491 0.5129 0.0941  -0.0091 0.1217  242 GLY A N     
1878 C CA    . GLY A 242 ? 1.0043 0.4094 0.4902 0.1065  0.0129  0.1401  242 GLY A CA    
1879 C C     . GLY A 242 ? 1.0592 0.4551 0.5655 0.0873  0.0571  0.1486  242 GLY A C     
1880 O O     . GLY A 242 ? 1.0856 0.4501 0.5960 0.0911  0.0814  0.1652  242 GLY A O     
1881 N N     . GLU A 243 ? 1.0520 0.4746 0.5843 0.0669  0.0669  0.1373  243 GLU A N     
1882 C CA    . GLU A 243 ? 1.0233 0.4394 0.6038 0.0463  0.1032  0.1400  243 GLU A CA    
1883 C C     . GLU A 243 ? 0.9952 0.4273 0.6316 0.0209  0.0937  0.1117  243 GLU A C     
1884 O O     . GLU A 243 ? 0.9461 0.3981 0.5754 0.0210  0.0664  0.0958  243 GLU A O     
1885 C CB    . GLU A 243 ? 1.0620 0.4966 0.6536 0.0390  0.1175  0.1403  243 GLU A CB    
1886 C CG    . GLU A 243 ? 1.1877 0.6084 0.7132 0.0724  0.1268  0.1647  243 GLU A CG    
1887 C CD    . GLU A 243 ? 1.3160 0.7575 0.8549 0.0659  0.1421  0.1644  243 GLU A CD    
1888 O OE1   . GLU A 243 ? 1.3405 0.8056 0.9488 0.0328  0.1452  0.1461  243 GLU A OE1   
1889 O OE2   . GLU A 243 ? 1.4149 0.8491 0.8940 0.0975  0.1483  0.1797  243 GLU A OE2   
1890 N N     . LYS A 244 ? 1.0145 0.4377 0.7120 0.0039  0.1164  0.1055  244 LYS A N     
1891 C CA    . LYS A 244 ? 0.9608 0.3921 0.7093 -0.0117 0.1038  0.0717  244 LYS A CA    
1892 C C     . LYS A 244 ? 0.9963 0.4685 0.7640 -0.0244 0.0806  0.0368  244 LYS A C     
1893 O O     . LYS A 244 ? 1.0271 0.5151 0.8077 -0.0325 0.0858  0.0384  244 LYS A O     
1894 C CB    . LYS A 244 ? 0.9947 0.3962 0.8198 -0.0215 0.1314  0.0748  244 LYS A CB    
1895 C CG    . LYS A 244 ? 1.0603 0.4210 0.8691 -0.0053 0.1583  0.1137  244 LYS A CG    
1896 C CD    . LYS A 244 ? 1.0958 0.4490 0.8702 0.0040  0.1367  0.1045  244 LYS A CD    
1897 C CE    . LYS A 244 ? 1.0935 0.4053 0.8506 0.0222  0.1599  0.1428  244 LYS A CE    
1898 N NZ    . LYS A 244 ? 1.0706 0.3779 0.7870 0.0341  0.1359  0.1380  244 LYS A NZ    
1899 N N     . CYS A 245 ? 1.0704 0.5590 0.8358 -0.0208 0.0569  0.0071  245 CYS A N     
1900 C CA    . CYS A 245 ? 1.0286 0.5539 0.8060 -0.0228 0.0326  -0.0303 245 CYS A CA    
1901 C C     . CYS A 245 ? 1.0660 0.5825 0.9184 -0.0331 0.0263  -0.0686 245 CYS A C     
1902 O O     . CYS A 245 ? 1.1115 0.6540 0.9760 -0.0288 -0.0005 -0.1084 245 CYS A O     
1903 C CB    . CYS A 245 ? 0.8913 0.4367 0.6237 -0.0012 0.0143  -0.0405 245 CYS A CB    
1904 S SG    . CYS A 245 ? 1.1903 0.7348 0.8726 0.0135  0.0191  0.0025  245 CYS A SG    
1905 N N     . SER A 246 ? 1.1533 0.6325 1.0618 -0.0421 0.0485  -0.0579 246 SER A N     
1906 C CA    . SER A 246 ? 1.1962 0.6610 1.1998 -0.0497 0.0387  -0.0974 246 SER A CA    
1907 C C     . SER A 246 ? 1.1396 0.6123 1.1180 -0.0295 0.0043  -0.1440 246 SER A C     
1908 O O     . SER A 246 ? 1.0538 0.5338 1.0834 -0.0249 -0.0269 -0.1978 246 SER A O     
1909 C CB    . SER A 246 ? 1.2195 0.7019 1.3008 -0.0651 0.0285  -0.1220 246 SER A CB    
1910 O OG    . SER A 246 ? 1.2889 0.7645 1.3921 -0.0784 0.0663  -0.0760 246 SER A OG    
1911 N N     . ARG A 247 ? 1.1577 0.6289 1.0573 -0.0123 0.0087  -0.1240 247 ARG A N     
1912 C CA    . ARG A 247 ? 1.1016 0.5761 0.9694 0.0137  -0.0128 -0.1574 247 ARG A CA    
1913 C C     . ARG A 247 ? 1.0703 0.5086 0.9419 0.0169  0.0056  -0.1381 247 ARG A C     
1914 O O     . ARG A 247 ? 1.0564 0.4968 0.8652 0.0320  0.0135  -0.1121 247 ARG A O     
1915 C CB    . ARG A 247 ? 1.1242 0.6358 0.9028 0.0379  -0.0211 -0.1481 247 ARG A CB    
1916 C CG    . ARG A 247 ? 1.1691 0.7194 0.9370 0.0440  -0.0439 -0.1736 247 ARG A CG    
1917 C CD    . ARG A 247 ? 1.2651 0.8144 1.0774 0.0558  -0.0787 -0.2402 247 ARG A CD    
1918 N NE    . ARG A 247 ? 1.2860 0.8737 1.0792 0.0690  -0.1058 -0.2674 247 ARG A NE    
1919 C CZ    . ARG A 247 ? 1.2769 0.8772 1.1144 0.0429  -0.1076 -0.2635 247 ARG A CZ    
1920 N NH1   . ARG A 247 ? 1.1939 0.7717 1.0926 0.0061  -0.0798 -0.2311 247 ARG A NH1   
1921 N NH2   . ARG A 247 ? 1.3509 0.9869 1.1676 0.0588  -0.1349 -0.2892 247 ARG A NH2   
1922 N N     . CYS A 248 ? 1.0562 0.4612 1.0136 0.0024  0.0141  -0.1467 248 CYS A N     
1923 C CA    . CYS A 248 ? 1.0808 0.4509 1.0547 0.0079  0.0268  -0.1384 248 CYS A CA    
1924 C C     . CYS A 248 ? 1.0924 0.4471 1.0133 0.0076  0.0562  -0.0774 248 CYS A C     
1925 O O     . CYS A 248 ? 1.1624 0.5016 1.0575 0.0211  0.0594  -0.0695 248 CYS A O     
1926 C CB    . CYS A 248 ? 1.1088 0.4861 1.0458 0.0381  0.0001  -0.1831 248 CYS A CB    
1927 S SG    . CYS A 248 ? 1.5253 0.9038 1.5416 0.0496  -0.0454 -0.2710 248 CYS A SG    
1928 N N     . GLY A 249 ? 0.9327 0.3044 0.6340 0.0974  -0.0152 -0.0224 249 GLY A N     
1929 C CA    . GLY A 249 ? 1.0014 0.4081 0.7253 0.1093  -0.0046 0.0007  249 GLY A CA    
1930 C C     . GLY A 249 ? 0.9267 0.3915 0.6682 0.1185  -0.0045 0.0074  249 GLY A C     
1931 O O     . GLY A 249 ? 0.9612 0.4561 0.7212 0.1258  -0.0031 0.0261  249 GLY A O     
1932 N N     . ALA A 250 ? 0.8362 0.3117 0.5691 0.1173  -0.0087 -0.0069 250 ALA A N     
1933 C CA    . ALA A 250 ? 0.9554 0.4823 0.7062 0.1249  -0.0070 -0.0008 250 ALA A CA    
1934 C C     . ALA A 250 ? 0.8170 0.3878 0.5969 0.1056  -0.0156 0.0066  250 ALA A C     
1935 O O     . ALA A 250 ? 0.7840 0.3473 0.5699 0.0845  -0.0210 0.0018  250 ALA A O     
1936 C CB    . ALA A 250 ? 0.8007 0.3199 0.5270 0.1262  -0.0096 -0.0168 250 ALA A CB    
1937 N N     . GLU A 251 ? 0.7533 0.3654 0.5525 0.1128  -0.0148 0.0190  251 GLU A N     
1938 C CA    . GLU A 251 ? 0.6714 0.3145 0.4851 0.0963  -0.0206 0.0244  251 GLU A CA    
1939 C C     . GLU A 251 ? 0.7129 0.3954 0.5429 0.0948  -0.0229 0.0204  251 GLU A C     
1940 O O     . GLU A 251 ? 0.6973 0.3918 0.5321 0.1102  -0.0192 0.0212  251 GLU A O     
1941 C CB    . GLU A 251 ? 0.6795 0.3259 0.4933 0.1008  -0.0248 0.0438  251 GLU A CB    
1942 C CG    . GLU A 251 ? 0.9209 0.5259 0.7163 0.1013  -0.0225 0.0509  251 GLU A CG    
1943 C CD    . GLU A 251 ? 1.0288 0.6302 0.8134 0.1017  -0.0327 0.0718  251 GLU A CD    
1944 O OE1   . GLU A 251 ? 1.0433 0.6752 0.8367 0.1011  -0.0451 0.0794  251 GLU A OE1   
1945 O OE2   . GLU A 251 ? 1.0792 0.6427 0.8433 0.1012  -0.0311 0.0812  251 GLU A OE2   
1946 N N     . ILE A 252 ? 0.7113 0.4099 0.5503 0.0768  -0.0247 0.0173  252 ILE A N     
1947 C CA    . ILE A 252 ? 0.6392 0.3717 0.4949 0.0738  -0.0264 0.0144  252 ILE A CA    
1948 C C     . ILE A 252 ? 0.6659 0.4211 0.5288 0.0805  -0.0303 0.0273  252 ILE A C     
1949 O O     . ILE A 252 ? 0.6690 0.4150 0.5202 0.0755  -0.0352 0.0364  252 ILE A O     
1950 C CB    . ILE A 252 ? 0.6885 0.4258 0.5567 0.0545  -0.0229 0.0081  252 ILE A CB    
1951 C CG1   . ILE A 252 ? 0.7187 0.4375 0.5959 0.0470  -0.0262 -0.0018 252 ILE A CG1   
1952 C CG2   . ILE A 252 ? 0.6227 0.3922 0.5089 0.0517  -0.0230 0.0067  252 ILE A CG2   
1953 C CD1   . ILE A 252 ? 0.7330 0.4505 0.6376 0.0283  -0.0180 -0.0034 252 ILE A CD1   
1954 N N     . GLN A 253 ? 0.6467 0.4265 0.5273 0.0917  -0.0296 0.0298  253 GLN A N     
1955 C CA    . GLN A 253 ? 0.6794 0.4862 0.5823 0.0950  -0.0367 0.0430  253 GLN A CA    
1956 C C     . GLN A 253 ? 0.6221 0.4496 0.5333 0.0808  -0.0397 0.0383  253 GLN A C     
1957 O O     . GLN A 253 ? 0.6296 0.4598 0.5408 0.0760  -0.0329 0.0274  253 GLN A O     
1958 C CB    . GLN A 253 ? 0.7814 0.6028 0.7101 0.1163  -0.0279 0.0523  253 GLN A CB    
1959 C CG    . GLN A 253 ? 0.9870 0.7935 0.9228 0.1334  -0.0254 0.0645  253 GLN A CG    
1960 C CD    . GLN A 253 ? 1.0932 0.9189 1.0707 0.1562  -0.0103 0.0788  253 GLN A CD    
1961 O OE1   . GLN A 253 ? 1.1330 0.9876 1.1379 0.1565  -0.0050 0.0827  253 GLN A OE1   
1962 N NE2   . GLN A 253 ? 1.0394 0.8467 1.0259 0.1761  0.0008  0.0881  253 GLN A NE2   
1963 N N     . LYS A 254 ? 0.6327 0.4708 0.5507 0.0736  -0.0528 0.0471  254 LYS A N     
1964 C CA    . LYS A 254 ? 0.5970 0.4515 0.5249 0.0621  -0.0553 0.0433  254 LYS A CA    
1965 C C     . LYS A 254 ? 0.5159 0.4014 0.4857 0.0686  -0.0637 0.0565  254 LYS A C     
1966 O O     . LYS A 254 ? 0.5567 0.4483 0.5442 0.0717  -0.0798 0.0711  254 LYS A O     
1967 C CB    . LYS A 254 ? 0.6223 0.4524 0.5151 0.0434  -0.0635 0.0396  254 LYS A CB    
1968 C CG    . LYS A 254 ? 0.5690 0.4041 0.4646 0.0316  -0.0575 0.0301  254 LYS A CG    
1969 C CD    . LYS A 254 ? 0.5813 0.3795 0.4293 0.0140  -0.0615 0.0250  254 LYS A CD    
1970 C CE    . LYS A 254 ? 0.6019 0.3982 0.4531 0.0046  -0.0480 0.0135  254 LYS A CE    
1971 N NZ    . LYS A 254 ? 0.6860 0.4316 0.4762 -0.0123 -0.0456 0.0056  254 LYS A NZ    
1972 N N     . ILE A 255 ? 0.5493 0.4546 0.5409 0.0700  -0.0534 0.0537  255 ILE A N     
1973 C CA    . ILE A 255 ? 0.5114 0.4461 0.5494 0.0722  -0.0579 0.0670  255 ILE A CA    
1974 C C     . ILE A 255 ? 0.5039 0.4434 0.5441 0.0571  -0.0587 0.0595  255 ILE A C     
1975 O O     . ILE A 255 ? 0.4758 0.3974 0.4854 0.0485  -0.0521 0.0448  255 ILE A O     
1976 C CB    . ILE A 255 ? 0.5102 0.4600 0.5766 0.0944  -0.0352 0.0761  255 ILE A CB    
1977 C CG1   . ILE A 255 ? 0.4450 0.3828 0.4823 0.0977  -0.0175 0.0632  255 ILE A CG1   
1978 C CG2   . ILE A 255 ? 0.4562 0.3938 0.5195 0.1114  -0.0300 0.0825  255 ILE A CG2   
1979 C CD1   . ILE A 255 ? 0.4679 0.3997 0.5027 0.1192  0.0071  0.0688  255 ILE A CD1   
1980 N N     . LYS A 256 ? 0.4773 0.4406 0.5616 0.0542  -0.0653 0.0713  256 LYS A N     
1981 C CA    . LYS A 256 ? 0.5287 0.4963 0.6225 0.0427  -0.0626 0.0665  256 LYS A CA    
1982 C C     . LYS A 256 ? 0.4774 0.4643 0.5999 0.0571  -0.0382 0.0740  256 LYS A C     
1983 O O     . LYS A 256 ? 0.4320 0.4389 0.5937 0.0703  -0.0284 0.0902  256 LYS A O     
1984 C CB    . LYS A 256 ? 0.5531 0.5261 0.6730 0.0252  -0.0897 0.0743  256 LYS A CB    
1985 C CG    . LYS A 256 ? 0.7177 0.6516 0.7818 0.0045  -0.1094 0.0600  256 LYS A CG    
1986 C CD    . LYS A 256 ? 1.0832 1.0104 1.1593 -0.0155 -0.1245 0.0579  256 LYS A CD    
1987 C CE    . LYS A 256 ? 1.0672 0.9399 1.0699 -0.0344 -0.1307 0.0382  256 LYS A CE    
1988 N NZ    . LYS A 256 ? 1.0451 0.9018 1.0157 -0.0263 -0.0956 0.0229  256 LYS A NZ    
1989 N N     . VAL A 257 ? 0.4889 0.4662 0.5919 0.0555  -0.0264 0.0641  257 VAL A N     
1990 C CA    . VAL A 257 ? 0.4206 0.4061 0.5362 0.0681  -0.0059 0.0724  257 VAL A CA    
1991 C C     . VAL A 257 ? 0.4363 0.4227 0.5656 0.0561  -0.0058 0.0709  257 VAL A C     
1992 O O     . VAL A 257 ? 0.4403 0.4108 0.5474 0.0480  -0.0091 0.0577  257 VAL A O     
1993 C CB    . VAL A 257 ? 0.5290 0.4945 0.6013 0.0818  0.0048  0.0651  257 VAL A CB    
1994 C CG1   . VAL A 257 ? 0.4108 0.3711 0.4760 0.0927  0.0223  0.0732  257 VAL A CG1   
1995 C CG2   . VAL A 257 ? 0.5134 0.4718 0.5723 0.0954  0.0088  0.0672  257 VAL A CG2   
1996 N N     . ALA A 258 ? 0.5129 0.5175 0.6864 0.0548  0.0001  0.0861  258 ALA A N     
1997 C CA    . ALA A 258 ? 0.5541 0.5575 0.7473 0.0415  -0.0005 0.0865  258 ALA A CA    
1998 C C     . ALA A 258 ? 0.5520 0.5353 0.7255 0.0211  -0.0204 0.0691  258 ALA A C     
1999 O O     . ALA A 258 ? 0.5488 0.5147 0.7100 0.0152  -0.0149 0.0600  258 ALA A O     
2000 C CB    . ALA A 258 ? 0.3843 0.3769 0.5585 0.0519  0.0175  0.0878  258 ALA A CB    
2001 N N     . GLY A 259 ? 0.4794 0.4592 0.6455 0.0118  -0.0413 0.0657  259 GLY A N     
2002 C CA    . GLY A 259 ? 0.4539 0.4021 0.5853 -0.0078 -0.0591 0.0501  259 GLY A CA    
2003 C C     . GLY A 259 ? 0.5221 0.4421 0.5988 -0.0061 -0.0512 0.0332  259 GLY A C     
2004 O O     . GLY A 259 ? 0.6314 0.5156 0.6683 -0.0209 -0.0586 0.0203  259 GLY A O     
2005 N N     . ARG A 260 ? 0.4781 0.4084 0.5507 0.0107  -0.0357 0.0336  260 ARG A N     
2006 C CA    . ARG A 260 ? 0.4993 0.4080 0.5372 0.0119  -0.0264 0.0205  260 ARG A CA    
2007 C C     . ARG A 260 ? 0.5674 0.4749 0.5851 0.0179  -0.0326 0.0216  260 ARG A C     
2008 O O     . ARG A 260 ? 0.5716 0.4995 0.6053 0.0305  -0.0348 0.0320  260 ARG A O     
2009 C CB    . ARG A 260 ? 0.4648 0.3813 0.5173 0.0230  -0.0107 0.0202  260 ARG A CB    
2010 C CG    . ARG A 260 ? 0.4538 0.3700 0.5292 0.0203  -0.0028 0.0219  260 ARG A CG    
2011 C CD    . ARG A 260 ? 0.4503 0.3351 0.5106 0.0053  0.0030  0.0090  260 ARG A CD    
2012 N NE    . ARG A 260 ? 0.5128 0.3761 0.5558 0.0051  0.0178  -0.0021 260 ARG A NE    
2013 C CZ    . ARG A 260 ? 0.5244 0.3900 0.5945 0.0126  0.0332  -0.0023 260 ARG A CZ    
2014 N NH1   . ARG A 260 ? 0.4799 0.3643 0.5837 0.0208  0.0313  0.0079  260 ARG A NH1   
2015 N NH2   . ARG A 260 ? 0.4828 0.3311 0.5504 0.0120  0.0506  -0.0098 260 ARG A NH2   
2016 N N     . GLY A 261 ? 0.5727 0.4506 0.5527 0.0098  -0.0310 0.0115  261 GLY A N     
2017 C CA    . GLY A 261 ? 0.4981 0.3692 0.4573 0.0149  -0.0338 0.0125  261 GLY A CA    
2018 C C     . GLY A 261 ? 0.5482 0.4348 0.5250 0.0288  -0.0236 0.0131  261 GLY A C     
2019 O O     . GLY A 261 ? 0.5519 0.4399 0.5425 0.0297  -0.0127 0.0082  261 GLY A O     
2020 N N     . THR A 262 ? 0.5175 0.4109 0.4929 0.0395  -0.0295 0.0197  262 THR A N     
2021 C CA    . THR A 262 ? 0.4901 0.3879 0.4695 0.0520  -0.0244 0.0195  262 THR A CA    
2022 C C     . THR A 262 ? 0.4864 0.3681 0.4455 0.0567  -0.0266 0.0186  262 THR A C     
2023 O O     . THR A 262 ? 0.4962 0.3782 0.4523 0.0634  -0.0316 0.0266  262 THR A O     
2024 C CB    . THR A 262 ? 0.5263 0.4426 0.5231 0.0646  -0.0217 0.0296  262 THR A CB    
2025 O OG1   . THR A 262 ? 0.5457 0.4735 0.5625 0.0583  -0.0192 0.0312  262 THR A OG1   
2026 C CG2   . THR A 262 ? 0.4549 0.3604 0.4345 0.0775  -0.0172 0.0281  262 THR A CG2   
2027 N N     . HIS A 263 ? 0.4860 0.3536 0.4389 0.0529  -0.0236 0.0104  263 HIS A N     
2028 C CA    . HIS A 263 ? 0.4723 0.3195 0.4081 0.0544  -0.0248 0.0082  263 HIS A CA    
2029 C C     . HIS A 263 ? 0.5757 0.4145 0.5045 0.0643  -0.0294 0.0053  263 HIS A C     
2030 O O     . HIS A 263 ? 0.5890 0.4289 0.5271 0.0613  -0.0348 0.0010  263 HIS A O     
2031 C CB    . HIS A 263 ? 0.4781 0.3103 0.4162 0.0405  -0.0170 0.0023  263 HIS A CB    
2032 C CG    . HIS A 263 ? 0.6351 0.4606 0.5626 0.0304  -0.0080 0.0025  263 HIS A CG    
2033 N ND1   . HIS A 263 ? 0.6186 0.4537 0.5610 0.0255  -0.0014 -0.0004 263 HIS A ND1   
2034 C CD2   . HIS A 263 ? 0.6918 0.4928 0.5846 0.0243  -0.0061 0.0052  263 HIS A CD2   
2035 C CE1   . HIS A 263 ? 0.6531 0.4660 0.5665 0.0161  0.0057  -0.0020 263 HIS A CE1   
2036 N NE2   . HIS A 263 ? 0.6956 0.4865 0.5749 0.0148  0.0014  0.0018  263 HIS A NE2   
2037 N N     . PHE A 264 ? 0.5705 0.3948 0.4797 0.0761  -0.0288 0.0081  264 PHE A N     
2038 C CA    . PHE A 264 ? 0.5894 0.3902 0.4741 0.0855  -0.0314 0.0027  264 PHE A CA    
2039 C C     . PHE A 264 ? 0.6678 0.4396 0.5299 0.0938  -0.0281 0.0020  264 PHE A C     
2040 O O     . PHE A 264 ? 0.6751 0.4526 0.5460 0.0970  -0.0237 0.0102  264 PHE A O     
2041 C CB    . PHE A 264 ? 0.5539 0.3610 0.4303 0.0995  -0.0237 0.0081  264 PHE A CB    
2042 C CG    . PHE A 264 ? 0.5951 0.4113 0.4805 0.1153  -0.0081 0.0199  264 PHE A CG    
2043 C CD1   . PHE A 264 ? 0.6238 0.4689 0.5444 0.1106  -0.0101 0.0297  264 PHE A CD1   
2044 C CD2   . PHE A 264 ? 0.6712 0.4630 0.5307 0.1346  0.0082  0.0223  264 PHE A CD2   
2045 C CE1   . PHE A 264 ? 0.6378 0.4962 0.5833 0.1241  -0.0015 0.0443  264 PHE A CE1   
2046 C CE2   . PHE A 264 ? 0.6524 0.4571 0.5383 0.1510  0.0267  0.0368  264 PHE A CE2   
2047 C CZ    . PHE A 264 ? 0.5677 0.4102 0.5044 0.1453  0.0190  0.0490  264 PHE A CZ    
2048 N N     . CYS A 265 ? 0.7325 0.4682 0.5624 0.0966  -0.0335 -0.0075 265 CYS A N     
2049 C CA    . CYS A 265 ? 0.7666 0.4632 0.5664 0.1075  -0.0274 -0.0103 265 CYS A CA    
2050 C C     . CYS A 265 ? 0.7902 0.4645 0.5567 0.1301  -0.0101 -0.0087 265 CYS A C     
2051 O O     . CYS A 265 ? 0.8565 0.4939 0.5767 0.1323  -0.0142 -0.0186 265 CYS A O     
2052 C CB    . CYS A 265 ? 0.8665 0.5242 0.6452 0.0942  -0.0444 -0.0237 265 CYS A CB    
2053 S SG    . CYS A 265 ? 2.0509 1.7188 1.8687 0.0726  -0.0503 -0.0223 265 CYS A SG    
2054 N N     . PRO A 266 ? 0.8132 0.5048 0.6026 0.1470  0.0095  0.0052  266 PRO A N     
2055 C CA    . PRO A 266 ? 0.8447 0.5210 0.6204 0.1719  0.0373  0.0119  266 PRO A CA    
2056 C C     . PRO A 266 ? 0.9096 0.5156 0.6184 0.1839  0.0488  -0.0013 266 PRO A C     
2057 O O     . PRO A 266 ? 1.0696 0.6433 0.7367 0.2000  0.0714  -0.0026 266 PRO A O     
2058 C CB    . PRO A 266 ? 0.8610 0.5681 0.6922 0.1837  0.0478  0.0309  266 PRO A CB    
2059 C CG    . PRO A 266 ? 0.8406 0.5804 0.7024 0.1633  0.0226  0.0340  266 PRO A CG    
2060 C CD    . PRO A 266 ? 0.8391 0.5602 0.6705 0.1426  0.0050  0.0169  266 PRO A CD    
2061 N N     . VAL A 267 ? 0.8364 0.4118 0.5293 0.1759  0.0357  -0.0108 267 VAL A N     
2062 C CA    . VAL A 267 ? 0.9641 0.4634 0.5876 0.1839  0.0424  -0.0263 267 VAL A CA    
2063 C C     . VAL A 267 ? 1.0673 0.5269 0.6253 0.1731  0.0245  -0.0424 267 VAL A C     
2064 O O     . VAL A 267 ? 1.1825 0.5796 0.6677 0.1873  0.0408  -0.0510 267 VAL A O     
2065 C CB    . VAL A 267 ? 0.9674 0.4420 0.5926 0.1723  0.0271  -0.0330 267 VAL A CB    
2066 C CG1   . VAL A 267 ? 0.9080 0.4108 0.5606 0.1418  -0.0065 -0.0376 267 VAL A CG1   
2067 C CG2   . VAL A 267 ? 1.1069 0.4956 0.6571 0.1787  0.0320  -0.0508 267 VAL A CG2   
2068 N N     . CYS A 268 ? 1.0497 0.5437 0.6336 0.1491  -0.0079 -0.0445 268 CYS A N     
2069 C CA    . CYS A 268 ? 1.1138 0.5773 0.6506 0.1356  -0.0362 -0.0560 268 CYS A CA    
2070 C C     . CYS A 268 ? 1.0807 0.5671 0.6115 0.1433  -0.0275 -0.0467 268 CYS A C     
2071 O O     . CYS A 268 ? 1.1292 0.5758 0.6006 0.1394  -0.0451 -0.0533 268 CYS A O     
2072 C CB    . CYS A 268 ? 1.1249 0.6164 0.7103 0.1065  -0.0747 -0.0594 268 CYS A CB    
2073 S SG    . CYS A 268 ? 1.7037 1.1493 1.2828 0.0903  -0.0939 -0.0725 268 CYS A SG    
2074 N N     . GLN A 269 ? 0.9534 0.5005 0.5444 0.1522  -0.0044 -0.0304 269 GLN A N     
2075 C CA    . GLN A 269 ? 0.9373 0.5128 0.5370 0.1548  0.0008  -0.0203 269 GLN A CA    
2076 C C     . GLN A 269 ? 0.9913 0.5720 0.5954 0.1799  0.0454  -0.0065 269 GLN A C     
2077 O O     . GLN A 269 ? 1.0487 0.6875 0.7231 0.1823  0.0578  0.0084  269 GLN A O     
2078 C CB    . GLN A 269 ? 0.8085 0.4537 0.4862 0.1369  -0.0169 -0.0130 269 GLN A CB    
2079 C CG    . GLN A 269 ? 0.7480 0.3952 0.4412 0.1132  -0.0542 -0.0224 269 GLN A CG    
2080 C CD    . GLN A 269 ? 0.7271 0.4346 0.4966 0.0990  -0.0584 -0.0158 269 GLN A CD    
2081 O OE1   . GLN A 269 ? 0.7106 0.4299 0.5103 0.0907  -0.0582 -0.0172 269 GLN A OE1   
2082 N NE2   . GLN A 269 ? 0.6569 0.3948 0.4507 0.0969  -0.0594 -0.0084 269 GLN A NE2   
2083 N N     . GLN A 270 ? 1.0544 0.5687 0.5830 0.1983  0.0704  -0.0113 270 GLN A N     
2084 C CA    . GLN A 270 ? 1.0228 0.5344 0.5561 0.2245  0.1208  0.0036  270 GLN A CA    
2085 C C     . GLN A 270 ? 1.1087 0.6011 0.5953 0.2281  0.1313  0.0092  270 GLN A C     
2086 O O     . GLN A 270 ? 1.1356 0.5864 0.5522 0.2158  0.1010  -0.0024 270 GLN A O     
2087 C CB    . GLN A 270 ? 1.0716 0.5123 0.5468 0.2465  0.1538  -0.0037 270 GLN A CB    
2088 C CG    . GLN A 270 ? 1.0871 0.5545 0.6272 0.2508  0.1564  -0.0001 270 GLN A CG    
2089 C CD    . GLN A 270 ? 0.9189 0.4567 0.5618 0.2641  0.1822  0.0256  270 GLN A CD    
2090 O OE1   . GLN A 270 ? 1.0864 0.6105 0.7389 0.2901  0.2297  0.0386  270 GLN A OE1   
2091 N NE2   . GLN A 270 ? 0.8659 0.4755 0.5862 0.2458  0.1514  0.0339  270 GLN A NE2   
2092 N N     . LYS A 271 ? 1.1719 0.6929 0.6999 0.2443  0.1724  0.0292  271 LYS A N     
2093 C CA    . LYS A 271 ? 1.3268 0.8185 0.8017 0.2512  0.1926  0.0374  271 LYS A CA    
2094 C C     . LYS A 271 ? 1.5022 0.8850 0.8431 0.2689  0.2202  0.0269  271 LYS A C     
2095 O O     . LYS A 271 ? 1.5728 0.9079 0.8344 0.2714  0.2268  0.0297  271 LYS A O     
2096 C CB    . LYS A 271 ? 1.2593 0.8072 0.8207 0.2636  0.2344  0.0636  271 LYS A CB    
2097 C CG    . LYS A 271 ? 1.0750 0.7160 0.7508 0.2440  0.2037  0.0722  271 LYS A CG    
2098 C CD    . LYS A 271 ? 0.9848 0.6785 0.7501 0.2520  0.2370  0.0978  271 LYS A CD    
2099 C CE    . LYS A 271 ? 0.8970 0.6688 0.7652 0.2328  0.2032  0.1027  271 LYS A CE    
2100 N NZ    . LYS A 271 ? 0.9332 0.7559 0.9017 0.2398  0.2296  0.1283  271 LYS A NZ    
2101 O OXT   . LYS A 271 ? 1.5668 0.8983 0.8661 0.2807  0.2360  0.0151  271 LYS A OXT   
2102 O "O5'" . DC  B 1   ? 1.7437 1.3937 1.0487 -0.0666 -0.5329 -0.0769 1   DC  B "O5'" 
2103 C "C5'" . DC  B 1   ? 1.6457 1.3493 1.0292 -0.0609 -0.5259 -0.0693 1   DC  B "C5'" 
2104 C "C4'" . DC  B 1   ? 1.6081 1.4081 1.0695 -0.0486 -0.5587 -0.0479 1   DC  B "C4'" 
2105 O "O4'" . DC  B 1   ? 1.5986 1.3938 1.0307 -0.0150 -0.5620 -0.0326 1   DC  B "O4'" 
2106 C "C3'" . DC  B 1   ? 1.5217 1.3828 1.0672 -0.0354 -0.5490 -0.0374 1   DC  B "C3'" 
2107 O "O3'" . DC  B 1   ? 1.5343 1.4535 1.1479 -0.0690 -0.5671 -0.0394 1   DC  B "O3'" 
2108 C "C2'" . DC  B 1   ? 1.4637 1.3830 1.0470 0.0025  -0.5630 -0.0141 1   DC  B "C2'" 
2109 C "C1'" . DC  B 1   ? 1.5043 1.3524 0.9977 0.0181  -0.5569 -0.0142 1   DC  B "C1'" 
2110 N N1    . DC  B 1   ? 1.4069 1.1899 0.8547 0.0450  -0.5161 -0.0145 1   DC  B N1    
2111 C C2    . DC  B 1   ? 1.3416 1.1518 0.8284 0.0819  -0.5047 0.0015  1   DC  B C2    
2112 O O2    . DC  B 1   ? 1.2872 1.1767 0.8483 0.0962  -0.5254 0.0156  1   DC  B O2    
2113 N N3    . DC  B 1   ? 1.3588 1.1088 0.8031 0.1013  -0.4689 0.0013  1   DC  B N3    
2114 C C4    . DC  B 1   ? 1.3037 0.9787 0.6763 0.0867  -0.4439 -0.0119 1   DC  B C4    
2115 N N4    . DC  B 1   ? 1.2815 0.9080 0.6223 0.1041  -0.4084 -0.0090 1   DC  B N4    
2116 C C5    . DC  B 1   ? 1.2749 0.9229 0.6085 0.0544  -0.4522 -0.0280 1   DC  B C5    
2117 C C6    . DC  B 1   ? 1.3644 1.0631 0.7339 0.0340  -0.4889 -0.0297 1   DC  B C6    
2118 P P     . DT  B 2   ? 1.5122 1.4371 1.1708 -0.0834 -0.5425 -0.0450 2   DT  B P     
2119 O OP1   . DT  B 2   ? 1.5130 1.4964 1.2348 -0.1245 -0.5669 -0.0441 2   DT  B OP1   
2120 O OP2   . DT  B 2   ? 1.4969 1.3236 1.0797 -0.0821 -0.5035 -0.0627 2   DT  B OP2   
2121 O "O5'" . DT  B 2   ? 1.2378 1.2315 0.9730 -0.0420 -0.5153 -0.0253 2   DT  B "O5'" 
2122 C "C5'" . DT  B 2   ? 1.2269 1.3143 1.0314 -0.0243 -0.5445 -0.0050 2   DT  B "C5'" 
2123 C "C4'" . DT  B 2   ? 1.1349 1.2620 0.9915 0.0196  -0.5096 0.0084  2   DT  B "C4'" 
2124 O "O4'" . DT  B 2   ? 1.1225 1.1782 0.9074 0.0541  -0.4934 0.0076  2   DT  B "O4'" 
2125 C "C3'" . DT  B 2   ? 1.0619 1.1965 0.9599 0.0123  -0.4638 0.0039  2   DT  B "C3'" 
2126 O "O3'" . DT  B 2   ? 1.0139 1.2422 1.0037 0.0310  -0.4543 0.0196  2   DT  B "O3'" 
2127 C "C2'" . DT  B 2   ? 1.0514 1.1029 0.8851 0.0359  -0.4250 -0.0042 2   DT  B "C2'" 
2128 C "C1'" . DT  B 2   ? 1.0836 1.1098 0.8696 0.0688  -0.4439 0.0033  2   DT  B "C1'" 
2129 N N1    . DT  B 2   ? 1.0911 1.0164 0.7821 0.0724  -0.4258 -0.0072 2   DT  B N1    
2130 C C2    . DT  B 2   ? 1.0695 0.9608 0.7384 0.1053  -0.3974 -0.0021 2   DT  B C2    
2131 O O2    . DT  B 2   ? 1.0453 0.9770 0.7619 0.1344  -0.3871 0.0088  2   DT  B O2    
2132 N N3    . DT  B 2   ? 1.0739 0.8801 0.6610 0.1025  -0.3804 -0.0101 2   DT  B N3    
2133 C C4    . DT  B 2   ? 1.1558 0.9078 0.6799 0.0755  -0.3854 -0.0238 2   DT  B C4    
2134 O O4    . DT  B 2   ? 1.2094 0.8917 0.6644 0.0777  -0.3649 -0.0289 2   DT  B O4    
2135 C C5    . DT  B 2   ? 1.1791 0.9611 0.7231 0.0438  -0.4155 -0.0316 2   DT  B C5    
2136 C C7    . DT  B 2   ? 1.1233 0.8406 0.5946 0.0145  -0.4229 -0.0497 2   DT  B C7    
2137 C C6    . DT  B 2   ? 1.1247 0.9917 0.7520 0.0414  -0.4351 -0.0224 2   DT  B C6    
2138 P P     . DC  B 3   ? 1.1669 1.4341 1.2191 0.0120  -0.4198 0.0198  3   DC  B P     
2139 O OP1   . DC  B 3   ? 1.1342 1.5188 1.2850 0.0152  -0.4325 0.0380  3   DC  B OP1   
2140 O OP2   . DC  B 3   ? 1.1701 1.3746 1.1811 -0.0312 -0.4159 0.0043  3   DC  B OP2   
2141 O "O5'" . DC  B 3   ? 1.0299 1.2599 1.0633 0.0486  -0.3729 0.0176  3   DC  B "O5'" 
2142 C "C5'" . DC  B 3   ? 1.0472 1.2986 1.0914 0.0958  -0.3684 0.0272  3   DC  B "C5'" 
2143 C "C4'" . DC  B 3   ? 1.0158 1.1932 1.0069 0.1193  -0.3318 0.0194  3   DC  B "C4'" 
2144 O "O4'" . DC  B 3   ? 1.0400 1.1281 0.9462 0.1101  -0.3391 0.0093  3   DC  B "O4'" 
2145 C "C3'" . DC  B 3   ? 0.9515 1.1212 0.9570 0.1047  -0.2930 0.0132  3   DC  B "C3'" 
2146 O "O3'" . DC  B 3   ? 1.0189 1.2161 1.0531 0.1387  -0.2669 0.0186  3   DC  B "O3'" 
2147 C "C2'" . DC  B 3   ? 0.9443 1.0160 0.8708 0.0939  -0.2787 0.0000  3   DC  B "C2'" 
2148 C "C1'" . DC  B 3   ? 0.9729 1.0022 0.8437 0.1124  -0.3022 0.0009  3   DC  B "C1'" 
2149 N N1    . DC  B 3   ? 0.9335 0.8846 0.7300 0.0928  -0.3054 -0.0100 3   DC  B N1    
2150 C C2    . DC  B 3   ? 0.9353 0.8173 0.6699 0.1094  -0.2881 -0.0124 3   DC  B C2    
2151 O O2    . DC  B 3   ? 0.9312 0.8133 0.6725 0.1381  -0.2729 -0.0060 3   DC  B O2    
2152 N N3    . DC  B 3   ? 0.8810 0.6962 0.5481 0.0931  -0.2873 -0.0215 3   DC  B N3    
2153 C C4    . DC  B 3   ? 0.9097 0.7186 0.5652 0.0635  -0.3036 -0.0306 3   DC  B C4    
2154 N N4    . DC  B 3   ? 0.9273 0.6671 0.5113 0.0520  -0.2989 -0.0409 3   DC  B N4    
2155 C C5    . DC  B 3   ? 0.9619 0.8339 0.6769 0.0437  -0.3249 -0.0294 3   DC  B C5    
2156 C C6    . DC  B 3   ? 0.9496 0.8952 0.7368 0.0583  -0.3245 -0.0177 3   DC  B C6    
2157 P P     . DT  B 4   ? 1.1234 1.3333 1.1834 0.1317  -0.2274 0.0163  4   DT  B P     
2158 O OP1   . DT  B 4   ? 1.1020 1.3911 1.2243 0.1611  -0.2180 0.0269  4   DT  B OP1   
2159 O OP2   . DT  B 4   ? 1.0539 1.2554 1.1173 0.0868  -0.2260 0.0121  4   DT  B OP2   
2160 O "O5'" . DT  B 4   ? 0.9406 1.0657 0.9345 0.1490  -0.2031 0.0071  4   DT  B "O5'" 
2161 C "C5'" . DT  B 4   ? 0.9149 1.0032 0.8716 0.1839  -0.2083 0.0079  4   DT  B "C5'" 
2162 C "C4'" . DT  B 4   ? 0.8559 0.8591 0.7476 0.1830  -0.1888 -0.0006 4   DT  B "C4'" 
2163 O "O4'" . DT  B 4   ? 0.8458 0.7986 0.6899 0.1607  -0.2035 -0.0048 4   DT  B "O4'" 
2164 C "C3'" . DT  B 4   ? 0.8216 0.8199 0.7207 0.1665  -0.1585 -0.0059 4   DT  B "C3'" 
2165 O "O3'" . DT  B 4   ? 0.8936 0.8684 0.7761 0.1912  -0.1371 -0.0081 4   DT  B "O3'" 
2166 C "C2'" . DT  B 4   ? 0.8055 0.7459 0.6604 0.1383  -0.1568 -0.0122 4   DT  B "C2'" 
2167 C "C1'" . DT  B 4   ? 0.8135 0.7154 0.6241 0.1448  -0.1802 -0.0119 4   DT  B "C1'" 
2168 N N1    . DT  B 4   ? 0.8410 0.7153 0.6248 0.1163  -0.1904 -0.0174 4   DT  B N1    
2169 C C2    . DT  B 4   ? 0.8294 0.6369 0.5532 0.1121  -0.1827 -0.0216 4   DT  B C2    
2170 O O2    . DT  B 4   ? 0.8245 0.5967 0.5193 0.1270  -0.1699 -0.0194 4   DT  B O2    
2171 N N3    . DT  B 4   ? 0.8119 0.5944 0.5097 0.0889  -0.1897 -0.0284 4   DT  B N3    
2172 C C4    . DT  B 4   ? 0.8180 0.6282 0.5408 0.0668  -0.2056 -0.0322 4   DT  B C4    
2173 O O4    . DT  B 4   ? 0.9322 0.7067 0.6211 0.0477  -0.2107 -0.0406 4   DT  B O4    
2174 C C5    . DT  B 4   ? 0.7804 0.6633 0.5704 0.0674  -0.2152 -0.0256 4   DT  B C5    
2175 C C7    . DT  B 4   ? 0.7529 0.6714 0.5765 0.0388  -0.2344 -0.0269 4   DT  B C7    
2176 C C6    . DT  B 4   ? 0.8123 0.7268 0.6307 0.0933  -0.2058 -0.0182 4   DT  B C6    
2177 P P     . DT  B 5   ? 1.0325 0.9965 0.9129 0.1790  -0.1075 -0.0129 5   DT  B P     
2178 O OP1   . DT  B 5   ? 0.9755 0.9380 0.8517 0.2110  -0.0932 -0.0148 5   DT  B OP1   
2179 O OP2   . DT  B 5   ? 0.9510 0.9624 0.8737 0.1520  -0.1024 -0.0100 5   DT  B OP2   
2180 O "O5'" . DT  B 5   ? 0.8406 0.7308 0.6652 0.1615  -0.1043 -0.0175 5   DT  B "O5'" 
2181 C "C5'" . DT  B 5   ? 0.8025 0.6344 0.5788 0.1773  -0.1033 -0.0190 5   DT  B "C5'" 
2182 C "C4'" . DT  B 5   ? 0.8354 0.6153 0.5726 0.1551  -0.0962 -0.0207 5   DT  B "C4'" 
2183 O "O4'" . DT  B 5   ? 0.8999 0.6726 0.6259 0.1419  -0.1110 -0.0198 5   DT  B "O4'" 
2184 C "C3'" . DT  B 5   ? 0.8076 0.5969 0.5597 0.1335  -0.0779 -0.0223 5   DT  B "C3'" 
2185 O "O3'" . DT  B 5   ? 0.7760 0.5421 0.5108 0.1392  -0.0640 -0.0242 5   DT  B "O3'" 
2186 C "C2'" . DT  B 5   ? 0.8428 0.5997 0.5703 0.1133  -0.0778 -0.0221 5   DT  B "C2'" 
2187 C "C1'" . DT  B 5   ? 0.8702 0.6202 0.5823 0.1188  -0.0990 -0.0218 5   DT  B "C1'" 
2188 N N1    . DT  B 5   ? 0.8193 0.5911 0.5489 0.1016  -0.1092 -0.0242 5   DT  B N1    
2189 C C2    . DT  B 5   ? 0.8142 0.5482 0.5070 0.0898  -0.1121 -0.0272 5   DT  B C2    
2190 O O2    . DT  B 5   ? 0.8641 0.5553 0.5160 0.0926  -0.1043 -0.0260 5   DT  B O2    
2191 N N3    . DT  B 5   ? 0.7103 0.4564 0.4138 0.0734  -0.1229 -0.0317 5   DT  B N3    
2192 C C4    . DT  B 5   ? 0.7176 0.5121 0.4684 0.0644  -0.1323 -0.0311 5   DT  B C4    
2193 O O4    . DT  B 5   ? 0.7455 0.5412 0.4996 0.0457  -0.1438 -0.0353 5   DT  B O4    
2194 C C5    . DT  B 5   ? 0.6638 0.5053 0.4573 0.0774  -0.1266 -0.0252 5   DT  B C5    
2195 C C7    . DT  B 5   ? 0.6080 0.5106 0.4574 0.0677  -0.1325 -0.0213 5   DT  B C7    
2196 C C6    . DT  B 5   ? 0.6927 0.5188 0.4714 0.0969  -0.1148 -0.0232 5   DT  B C6    
2197 P P     . DT  B 6   ? 0.7239 0.5083 0.4757 0.1255  -0.0468 -0.0247 6   DT  B P     
2198 O OP1   . DT  B 6   ? 0.7907 0.5469 0.5161 0.1374  -0.0396 -0.0289 6   DT  B OP1   
2199 O OP2   . DT  B 6   ? 0.8232 0.6638 0.6198 0.1204  -0.0448 -0.0224 6   DT  B OP2   
2200 O "O5'" . DT  B 6   ? 0.6467 0.4088 0.3874 0.1012  -0.0416 -0.0214 6   DT  B "O5'" 
2201 C "C5'" . DT  B 6   ? 0.6127 0.3286 0.3171 0.0970  -0.0402 -0.0201 6   DT  B "C5'" 
2202 C "C4'" . DT  B 6   ? 0.5989 0.3106 0.3053 0.0785  -0.0337 -0.0160 6   DT  B "C4'" 
2203 O "O4'" . DT  B 6   ? 0.6303 0.3410 0.3338 0.0792  -0.0426 -0.0176 6   DT  B "O4'" 
2204 C "C3'" . DT  B 6   ? 0.6888 0.4331 0.4282 0.0666  -0.0251 -0.0132 6   DT  B "C3'" 
2205 O "O3'" . DT  B 6   ? 0.6930 0.4330 0.4292 0.0589  -0.0165 -0.0094 6   DT  B "O3'" 
2206 C "C2'" . DT  B 6   ? 0.5639 0.3001 0.3034 0.0571  -0.0227 -0.0116 6   DT  B "C2'" 
2207 C "C1'" . DT  B 6   ? 0.6580 0.3743 0.3731 0.0655  -0.0354 -0.0165 6   DT  B "C1'" 
2208 N N1    . DT  B 6   ? 0.6869 0.4234 0.4194 0.0637  -0.0472 -0.0205 6   DT  B N1    
2209 C C2    . DT  B 6   ? 0.7198 0.4353 0.4341 0.0570  -0.0510 -0.0242 6   DT  B C2    
2210 O O2    . DT  B 6   ? 0.7979 0.4814 0.4822 0.0559  -0.0424 -0.0240 6   DT  B O2    
2211 N N3    . DT  B 6   ? 0.7155 0.4483 0.4457 0.0509  -0.0650 -0.0281 6   DT  B N3    
2212 C C4    . DT  B 6   ? 0.7033 0.4795 0.4720 0.0500  -0.0738 -0.0263 6   DT  B C4    
2213 O O4    . DT  B 6   ? 0.6914 0.4831 0.4750 0.0396  -0.0877 -0.0286 6   DT  B O4    
2214 C C5    . DT  B 6   ? 0.7118 0.5130 0.4998 0.0608  -0.0651 -0.0217 6   DT  B C5    
2215 C C7    . DT  B 6   ? 0.5529 0.4064 0.3828 0.0633  -0.0682 -0.0186 6   DT  B C7    
2216 C C6    . DT  B 6   ? 0.6871 0.4633 0.4526 0.0671  -0.0534 -0.0203 6   DT  B C6    
2217 O "O5'" . 3DR B 7   ? 0.8085 0.5850 0.5745 0.0417  -0.0052 0.0003  7   3DR B "O5'" 
2218 P P     . 3DR B 7   ? 0.7234 0.4910 0.4766 0.0579  -0.0124 -0.0089 7   3DR B P     
2219 O OP1   . 3DR B 7   ? 0.6987 0.4437 0.4244 0.0662  -0.0143 -0.0146 7   3DR B OP1   
2220 O OP2   . 3DR B 7   ? 0.7413 0.5455 0.5226 0.0632  -0.0135 -0.0098 7   3DR B OP2   
2221 C "C2'" . 3DR B 7   ? 0.7378 0.5314 0.5413 0.0181  0.0115  0.0265  7   3DR B "C2'" 
2222 C "C5'" . 3DR B 7   ? 0.7469 0.5056 0.4999 0.0321  -0.0031 0.0050  7   3DR B "C5'" 
2223 C "C4'" . 3DR B 7   ? 0.7138 0.4933 0.4837 0.0198  0.0004  0.0148  7   3DR B "C4'" 
2224 O "O4'" . 3DR B 7   ? 0.7692 0.5397 0.5361 0.0092  0.0025  0.0221  7   3DR B "O4'" 
2225 C "C1'" . 3DR B 7   ? 0.7711 0.5545 0.5608 0.0097  0.0110  0.0299  7   3DR B "C1'" 
2226 C "C3'" . 3DR B 7   ? 0.6726 0.4756 0.4720 0.0195  0.0054  0.0219  7   3DR B "C3'" 
2227 O "O3'" . 3DR B 7   ? 0.5965 0.4211 0.4092 0.0118  0.0056  0.0315  7   3DR B "O3'" 
2228 P P     . DT  B 8   ? 0.5495 0.3979 0.3755 0.0129  0.0062  0.0347  8   DT  B P     
2229 O OP1   . DT  B 8   ? 0.5461 0.4128 0.3808 0.0042  0.0048  0.0483  8   DT  B OP1   
2230 O OP2   . DT  B 8   ? 0.5882 0.4359 0.3991 0.0208  0.0045  0.0232  8   DT  B OP2   
2231 O "O5'" . DT  B 8   ? 0.5030 0.3517 0.3501 0.0155  0.0105  0.0376  8   DT  B "O5'" 
2232 C "C5'" . DT  B 8   ? 0.4695 0.3143 0.3302 0.0146  0.0154  0.0470  8   DT  B "C5'" 
2233 C "C4'" . DT  B 8   ? 0.4726 0.3263 0.3530 0.0130  0.0179  0.0574  8   DT  B "C4'" 
2234 O "O4'" . DT  B 8   ? 0.5008 0.3379 0.3826 0.0141  0.0184  0.0502  8   DT  B "O4'" 
2235 C "C3'" . DT  B 8   ? 0.4823 0.3590 0.3661 0.0072  0.0154  0.0648  8   DT  B "C3'" 
2236 O "O3'" . DT  B 8   ? 0.6018 0.4856 0.5012 0.0053  0.0170  0.0829  8   DT  B "O3'" 
2237 C "C2'" . DT  B 8   ? 0.4846 0.3636 0.3724 0.0056  0.0155  0.0581  8   DT  B "C2'" 
2238 C "C1'" . DT  B 8   ? 0.5663 0.4189 0.4577 0.0074  0.0159  0.0530  8   DT  B "C1'" 
2239 N N1    . DT  B 8   ? 0.5948 0.4434 0.4818 0.0071  0.0103  0.0396  8   DT  B N1    
2240 C C2    . DT  B 8   ? 0.5733 0.4044 0.4650 0.0011  0.0071  0.0368  8   DT  B C2    
2241 O O2    . DT  B 8   ? 0.5659 0.3785 0.4625 -0.0026 0.0107  0.0440  8   DT  B O2    
2242 N N3    . DT  B 8   ? 0.4975 0.3307 0.3859 -0.0003 -0.0020 0.0256  8   DT  B N3    
2243 C C4    . DT  B 8   ? 0.5744 0.4249 0.4574 0.0077  -0.0068 0.0180  8   DT  B C4    
2244 O O4    . DT  B 8   ? 0.5865 0.4414 0.4698 0.0080  -0.0170 0.0102  8   DT  B O4    
2245 C C5    . DT  B 8   ? 0.5866 0.4468 0.4614 0.0160  -0.0008 0.0201  8   DT  B C5    
2246 C C7    . DT  B 8   ? 0.4789 0.3469 0.3421 0.0278  -0.0048 0.0115  8   DT  B C7    
2247 C C6    . DT  B 8   ? 0.5426 0.4012 0.4187 0.0133  0.0065  0.0301  8   DT  B C6    
2248 P P     . DT  B 9   ? 0.5575 0.4632 0.4568 -0.0015 0.0151  0.0971  9   DT  B P     
2249 O OP1   . DT  B 9   ? 0.5035 0.4165 0.4137 -0.0002 0.0120  0.1154  9   DT  B OP1   
2250 O OP2   . DT  B 9   ? 0.5993 0.5169 0.4779 -0.0037 0.0135  0.0865  9   DT  B OP2   
2251 O "O5'" . DT  B 9   ? 0.5219 0.4204 0.4336 -0.0055 0.0195  0.1027  9   DT  B "O5'" 
2252 C "C5'" . DT  B 9   ? 0.4902 0.3633 0.4143 -0.0016 0.0219  0.1084  9   DT  B "C5'" 
2253 C "C4'" . DT  B 9   ? 0.5043 0.3619 0.4336 -0.0102 0.0233  0.1070  9   DT  B "C4'" 
2254 O "O4'" . DT  B 9   ? 0.4968 0.3542 0.4217 -0.0125 0.0207  0.0879  9   DT  B "O4'" 
2255 C "C3'" . DT  B 9   ? 0.5129 0.3889 0.4466 -0.0227 0.0246  0.1220  9   DT  B "C3'" 
2256 O "O3'" . DT  B 9   ? 0.5923 0.4403 0.5327 -0.0263 0.0257  0.1365  9   DT  B "O3'" 
2257 C "C2'" . DT  B 9   ? 0.5396 0.4322 0.4776 -0.0321 0.0245  0.1096  9   DT  B "C2'" 
2258 C "C1'" . DT  B 9   ? 0.5040 0.3724 0.4387 -0.0261 0.0197  0.0904  9   DT  B "C1'" 
2259 N N1    . DT  B 9   ? 0.4964 0.3855 0.4307 -0.0252 0.0160  0.0746  9   DT  B N1    
2260 C C2    . DT  B 9   ? 0.5219 0.4014 0.4620 -0.0324 0.0088  0.0647  9   DT  B C2    
2261 O O2    . DT  B 9   ? 0.5923 0.4423 0.5336 -0.0419 0.0055  0.0662  9   DT  B O2    
2262 N N3    . DT  B 9   ? 0.4892 0.3921 0.4313 -0.0277 0.0039  0.0529  9   DT  B N3    
2263 C C4    . DT  B 9   ? 0.5885 0.5153 0.5241 -0.0147 0.0075  0.0486  9   DT  B C4    
2264 O O4    . DT  B 9   ? 0.7027 0.6458 0.6402 -0.0073 0.0028  0.0389  9   DT  B O4    
2265 C C5    . DT  B 9   ? 0.5302 0.4587 0.4540 -0.0099 0.0153  0.0565  9   DT  B C5    
2266 C C7    . DT  B 9   ? 0.5064 0.4495 0.4141 0.0021  0.0183  0.0498  9   DT  B C7    
2267 C C6    . DT  B 9   ? 0.5002 0.4134 0.4254 -0.0161 0.0181  0.0698  9   DT  B C6    
2268 P P     . DT  B 10  ? 0.5858 0.4391 0.5298 -0.0418 0.0280  0.1580  10  DT  B P     
2269 O OP1   . DT  B 10  ? 0.7802 0.6035 0.7243 -0.0336 0.0275  0.1767  10  DT  B OP1   
2270 O OP2   . DT  B 10  ? 0.6926 0.5896 0.6308 -0.0478 0.0313  0.1621  10  DT  B OP2   
2271 O "O5'" . DT  B 10  ? 0.6739 0.5096 0.6265 -0.0589 0.0269  0.1502  10  DT  B "O5'" 
2272 C "C5'" . DT  B 10  ? 0.6313 0.4271 0.5806 -0.0553 0.0227  0.1343  10  DT  B "C5'" 
2273 C "C4'" . DT  B 10  ? 0.6663 0.4568 0.6231 -0.0772 0.0170  0.1269  10  DT  B "C4'" 
2274 O "O4'" . DT  B 10  ? 0.6468 0.4764 0.6103 -0.0771 0.0134  0.1103  10  DT  B "O4'" 
2275 C "C3'" . DT  B 10  ? 0.7176 0.5205 0.6872 -0.1012 0.0192  0.1474  10  DT  B "C3'" 
2276 O "O3'" . DT  B 10  ? 0.7366 0.4920 0.7046 -0.1198 0.0119  0.1457  10  DT  B "O3'" 
2277 C "C2'" . DT  B 10  ? 0.5978 0.4646 0.5847 -0.1089 0.0212  0.1430  10  DT  B "C2'" 
2278 C "C1'" . DT  B 10  ? 0.6224 0.4885 0.6063 -0.0979 0.0129  0.1172  10  DT  B "C1'" 
2279 N N1    . DT  B 10  ? 0.6034 0.5226 0.5943 -0.0866 0.0154  0.1073  10  DT  B N1    
2280 C C2    . DT  B 10  ? 0.5868 0.5244 0.5896 -0.0895 0.0062  0.0927  10  DT  B C2    
2281 O O2    . DT  B 10  ? 0.6303 0.5478 0.6385 -0.1050 -0.0051 0.0878  10  DT  B O2    
2282 N N3    . DT  B 10  ? 0.5950 0.5739 0.6010 -0.0733 0.0096  0.0844  10  DT  B N3    
2283 C C4    . DT  B 10  ? 0.6068 0.6033 0.5996 -0.0571 0.0211  0.0870  10  DT  B C4    
2284 O O4    . DT  B 10  ? 0.5280 0.5511 0.5185 -0.0419 0.0239  0.0777  10  DT  B O4    
2285 C C5    . DT  B 10  ? 0.5011 0.4782 0.4798 -0.0587 0.0278  0.1015  10  DT  B C5    
2286 C C7    . DT  B 10  ? 0.4936 0.4857 0.4528 -0.0457 0.0360  0.1042  10  DT  B C7    
2287 C C6    . DT  B 10  ? 0.5228 0.4650 0.5033 -0.0716 0.0248  0.1120  10  DT  B C6    
2288 P P     . DC  B 11  ? 0.8507 0.5986 0.8297 -0.1518 0.0118  0.1675  11  DC  B P     
2289 O OP1   . DC  B 11  ? 1.0387 0.7051 0.9972 -0.1543 0.0056  0.1648  11  DC  B OP1   
2290 O OP2   . DC  B 11  ? 0.8402 0.6290 0.8262 -0.1543 0.0232  0.1923  11  DC  B OP2   
2291 O "O5'" . DC  B 11  ? 0.8818 0.6732 0.8853 -0.1761 0.0040  0.1575  11  DC  B "O5'" 
2292 C "C5'" . DC  B 11  ? 0.8666 0.6413 0.8652 -0.1758 -0.0097 0.1324  11  DC  B "C5'" 
2293 C "C4'" . DC  B 11  ? 0.8391 0.6748 0.8694 -0.1958 -0.0173 0.1289  11  DC  B "C4'" 
2294 O "O4'" . DC  B 11  ? 0.8076 0.7060 0.8493 -0.1727 -0.0092 0.1235  11  DC  B "O4'" 
2295 C "C3'" . DC  B 11  ? 0.8953 0.7623 0.9545 -0.2293 -0.0134 0.1529  11  DC  B "C3'" 
2296 O "O3'" . DC  B 11  ? 0.9672 0.8422 1.0462 -0.2591 -0.0309 0.1467  11  DC  B "O3'" 
2297 C "C2'" . DC  B 11  ? 0.8194 0.7682 0.9011 -0.2162 0.0032  0.1623  11  DC  B "C2'" 
2298 C "C1'" . DC  B 11  ? 0.7742 0.7418 0.8509 -0.1875 -0.0023 0.1375  11  DC  B "C1'" 
2299 N N1    . DC  B 11  ? 0.6970 0.7087 0.7707 -0.1598 0.0136  0.1378  11  DC  B N1    
2300 C C2    . DC  B 11  ? 0.6588 0.7212 0.7472 -0.1435 0.0129  0.1243  11  DC  B C2    
2301 O O2    . DC  B 11  ? 0.6475 0.7249 0.7557 -0.1524 -0.0018 0.1148  11  DC  B O2    
2302 N N3    . DC  B 11  ? 0.6126 0.7019 0.6896 -0.1179 0.0268  0.1220  11  DC  B N3    
2303 C C4    . DC  B 11  ? 0.6642 0.7360 0.7169 -0.1113 0.0387  0.1327  11  DC  B C4    
2304 N N4    . DC  B 11  ? 0.6723 0.7663 0.7080 -0.0890 0.0500  0.1285  11  DC  B N4    
2305 C C5    . DC  B 11  ? 0.6299 0.6574 0.6716 -0.1271 0.0379  0.1487  11  DC  B C5    
2306 C C6    . DC  B 11  ? 0.6129 0.6091 0.6651 -0.1492 0.0264  0.1503  11  DC  B C6    
2307 P P     . DT  B 12  ? 0.9564 0.8473 1.0653 -0.3058 -0.0333 0.1702  12  DT  B P     
2308 O OP1   . DT  B 12  ? 1.0813 0.8858 1.1637 -0.3290 -0.0528 0.1610  12  DT  B OP1   
2309 O OP2   . DT  B 12  ? 0.9230 0.8384 1.0390 -0.3079 -0.0105 0.1990  12  DT  B OP2   
2310 O "O5'" . DT  B 12  ? 1.0220 1.0071 1.1812 -0.3179 -0.0405 0.1674  12  DT  B "O5'" 
2311 C "C5'" . DT  B 12  ? 0.9705 0.9660 1.1292 -0.3039 -0.0587 0.1420  12  DT  B "C5'" 
2312 C "C4'" . DT  B 12  ? 0.9172 1.0176 1.1281 -0.3012 -0.0570 0.1458  12  DT  B "C4'" 
2313 O "O4'" . DT  B 12  ? 0.8961 1.0337 1.1028 -0.2604 -0.0343 0.1449  12  DT  B "O4'" 
2314 C "C3'" . DT  B 12  ? 0.9264 1.0931 1.1903 -0.3389 -0.0510 0.1724  12  DT  B "C3'" 
2315 O "O3'" . DT  B 12  ? 0.9917 1.2236 1.3020 -0.3545 -0.0708 0.1686  12  DT  B "O3'" 
2316 C "C2'" . DT  B 12  ? 0.8454 1.0701 1.1207 -0.3139 -0.0176 0.1878  12  DT  B "C2'" 
2317 C "C1'" . DT  B 12  ? 0.8327 1.0566 1.0837 -0.2654 -0.0156 0.1646  12  DT  B "C1'" 
2318 N N1    . DT  B 12  ? 0.7121 0.9378 0.9372 -0.2335 0.0109  0.1686  12  DT  B N1    
2319 C C2    . DT  B 12  ? 0.6556 0.9246 0.8821 -0.1966 0.0207  0.1570  12  DT  B C2    
2320 O O2    . DT  B 12  ? 0.5959 0.9072 0.8482 -0.1863 0.0107  0.1463  12  DT  B O2    
2321 N N3    . DT  B 12  ? 0.6556 0.9140 0.8497 -0.1723 0.0414  0.1590  12  DT  B N3    
2322 C C4    . DT  B 12  ? 0.6416 0.8574 0.8055 -0.1795 0.0515  0.1728  12  DT  B C4    
2323 O O4    . DT  B 12  ? 0.6285 0.8402 0.7628 -0.1577 0.0664  0.1738  12  DT  B O4    
2324 C C5    . DT  B 12  ? 0.6653 0.8376 0.8317 -0.2147 0.0412  0.1864  12  DT  B C5    
2325 C C7    . DT  B 12  ? 0.6255 0.7468 0.7604 -0.2218 0.0498  0.2047  12  DT  B C7    
2326 C C6    . DT  B 12  ? 0.6437 0.8191 0.8382 -0.2401 0.0220  0.1824  12  DT  B C6    
2327 P P     . DC  B 13  ? 0.9900 1.2969 1.3660 -0.4037 -0.0739 0.1946  13  DC  B P     
2328 O OP1   . DC  B 13  ? 1.0851 1.3626 1.4652 -0.4423 -0.1120 0.1849  13  DC  B OP1   
2329 O OP2   . DC  B 13  ? 0.9150 1.2123 1.2890 -0.4224 -0.0481 0.2214  13  DC  B OP2   
2330 O "O5'" . DC  B 13  ? 1.0774 1.5062 1.5106 -0.3762 -0.0613 0.1987  13  DC  B "O5'" 
2331 C "C5'" . DC  B 13  ? 0.9658 1.4019 1.3832 -0.3279 -0.0659 0.1754  13  DC  B "C5'" 
2332 C "C4'" . DC  B 13  ? 0.8955 1.4336 1.3566 -0.2951 -0.0408 0.1839  13  DC  B "C4'" 
2333 O "O4'" . DC  B 13  ? 0.8348 1.3454 1.2529 -0.2581 -0.0101 0.1810  13  DC  B "O4'" 
2334 C "C3'" . DC  B 13  ? 0.9032 1.5404 1.4350 -0.3248 -0.0255 0.2133  13  DC  B "C3'" 
2335 O "O3'" . DC  B 13  ? 0.8981 1.6400 1.4903 -0.3034 -0.0257 0.2149  13  DC  B "O3'" 
2336 C "C2'" . DC  B 13  ? 0.8430 1.4751 1.3509 -0.3123 0.0148  0.2276  13  DC  B "C2'" 
2337 C "C1'" . DC  B 13  ? 0.7939 1.3762 1.2444 -0.2589 0.0224  0.2035  13  DC  B "C1'" 
2338 N N1    . DC  B 13  ? 0.7683 1.2918 1.1640 -0.2495 0.0454  0.2077  13  DC  B N1    
2339 C C2    . DC  B 13  ? 0.7390 1.2595 1.1000 -0.2039 0.0661  0.1965  13  DC  B C2    
2340 O O2    . DC  B 13  ? 0.7332 1.2956 1.1085 -0.1707 0.0673  0.1833  13  DC  B O2    
2341 N N3    . DC  B 13  ? 0.6838 1.1533 0.9948 -0.1979 0.0826  0.2013  13  DC  B N3    
2342 C C4    . DC  B 13  ? 0.6398 1.0626 0.9364 -0.2312 0.0802  0.2177  13  DC  B C4    
2343 N N4    . DC  B 13  ? 0.6348 1.0119 0.8835 -0.2217 0.0941  0.2237  13  DC  B N4    
2344 C C5    . DC  B 13  ? 0.6611 1.0785 0.9896 -0.2761 0.0614  0.2289  13  DC  B C5    
2345 C C6    . DC  B 13  ? 0.7281 1.1965 1.1048 -0.2856 0.0438  0.2226  13  DC  B C6    
2346 P P     . DG  B 14  ? 1.0722 1.9284 1.7575 -0.3440 -0.0325 0.2409  14  DG  B P     
2347 O OP1   . DG  B 14  ? 1.0804 1.9306 1.7811 -0.3640 -0.0799 0.2288  14  DG  B OP1   
2348 O OP2   . DG  B 14  ? 1.0239 1.8858 1.7228 -0.3894 -0.0126 0.2684  14  DG  B OP2   
2349 O "O5'" . DG  B 14  ? 0.9387 1.9089 1.6750 -0.2961 -0.0031 0.2474  14  DG  B "O5'" 
2350 C "C5'" . DG  B 14  ? 0.8453 1.7867 1.5316 -0.2371 0.0239  0.2313  14  DG  B "C5'" 
2351 C "C4'" . DG  B 14  ? 0.7625 1.7657 1.4650 -0.2234 0.0723  0.2503  14  DG  B "C4'" 
2352 O "O4'" . DG  B 14  ? 0.7505 1.6647 1.3778 -0.2222 0.0916  0.2472  14  DG  B "O4'" 
2353 C "C3'" . DG  B 14  ? 0.7186 1.8038 1.4885 -0.2673 0.0835  0.2806  14  DG  B "C3'" 
2354 O "O3'" . DG  B 14  ? 0.7565 1.9227 1.5575 -0.2303 0.1182  0.2860  14  DG  B "O3'" 
2355 C "C2'" . DG  B 14  ? 0.7095 1.7219 1.4302 -0.3015 0.0979  0.2928  14  DG  B "C2'" 
2356 C "C1'" . DG  B 14  ? 0.7240 1.6768 1.3726 -0.2552 0.1187  0.2762  14  DG  B "C1'" 
2357 N N9    . DG  B 14  ? 0.7029 1.5542 1.2838 -0.2750 0.1205  0.2782  14  DG  B N9    
2358 C C8    . DG  B 14  ? 0.7180 1.5171 1.2938 -0.3275 0.1023  0.2914  14  DG  B C8    
2359 N N7    . DG  B 14  ? 0.6784 1.3903 1.1893 -0.3288 0.1096  0.2922  14  DG  B N7    
2360 C C5    . DG  B 14  ? 0.6462 1.3559 1.1175 -0.2779 0.1324  0.2787  14  DG  B C5    
2361 C C6    . DG  B 14  ? 0.6013 1.2408 1.0016 -0.2581 0.1459  0.2747  14  DG  B C6    
2362 O O6    . DG  B 14  ? 0.6257 1.1919 0.9860 -0.2785 0.1412  0.2839  14  DG  B O6    
2363 N N1    . DG  B 14  ? 0.6105 1.2697 0.9864 -0.2092 0.1649  0.2587  14  DG  B N1    
2364 C C2    . DG  B 14  ? 0.6009 1.3333 1.0144 -0.1787 0.1726  0.2480  14  DG  B C2    
2365 N N2    . DG  B 14  ? 0.6138 1.3409 0.9873 -0.1321 0.1909  0.2313  14  DG  B N2    
2366 N N3    . DG  B 14  ? 0.5925 1.3967 1.0772 -0.1926 0.1613  0.2537  14  DG  B N3    
2367 C C4    . DG  B 14  ? 0.6340 1.4239 1.1444 -0.2444 0.1402  0.2689  14  DG  B C4    
2368 O "O5'" . DG  C 1   ? 0.9885 1.5317 1.1185 -0.1740 0.1540  0.5023  15  DG  C "O5'" 
2369 C "C5'" . DG  C 1   ? 1.1251 1.6376 1.1393 -0.1869 0.1760  0.5138  15  DG  C "C5'" 
2370 C "C4'" . DG  C 1   ? 1.2030 1.6477 1.1550 -0.1775 0.2276  0.4851  15  DG  C "C4'" 
2371 O "O4'" . DG  C 1   ? 1.1548 1.6102 1.2092 -0.1421 0.2632  0.4904  15  DG  C "O4'" 
2372 C "C3'" . DG  C 1   ? 1.1463 1.5615 1.0821 -0.1794 0.2298  0.4492  15  DG  C "C3'" 
2373 O "O3'" . DG  C 1   ? 1.2385 1.5985 1.0260 -0.2151 0.2275  0.4277  15  DG  C "O3'" 
2374 C "C2'" . DG  C 1   ? 1.1149 1.5060 1.0847 -0.1443 0.2825  0.4385  15  DG  C "C2'" 
2375 C "C1'" . DG  C 1   ? 1.0757 1.5112 1.1541 -0.1230 0.2913  0.4623  15  DG  C "C1'" 
2376 N N9    . DG  C 1   ? 0.8666 1.3557 1.0981 -0.0983 0.2782  0.4556  15  DG  C N9    
2377 C C8    . DG  C 1   ? 0.7519 1.2803 1.0707 -0.0991 0.2417  0.4625  15  DG  C C8    
2378 N N7    . DG  C 1   ? 0.6179 1.1687 1.0431 -0.0799 0.2387  0.4415  15  DG  C N7    
2379 C C5    . DG  C 1   ? 0.6154 1.1625 1.0427 -0.0620 0.2712  0.4263  15  DG  C C5    
2380 C C6    . DG  C 1   ? 0.6177 1.1944 1.1389 -0.0380 0.2762  0.4002  15  DG  C C6    
2381 O O6    . DG  C 1   ? 0.5928 1.1913 1.1955 -0.0360 0.2513  0.3768  15  DG  C O6    
2382 N N1    . DG  C 1   ? 0.6134 1.1853 1.1140 -0.0154 0.3152  0.3981  15  DG  C N1    
2383 C C2    . DG  C 1   ? 0.7111 1.2295 1.0927 -0.0186 0.3515  0.4128  15  DG  C C2    
2384 N N2    . DG  C 1   ? 0.7284 1.2315 1.1001 0.0128  0.3949  0.4062  15  DG  C N2    
2385 N N3    . DG  C 1   ? 0.7794 1.2550 1.0505 -0.0502 0.3439  0.4276  15  DG  C N3    
2386 C C4    . DG  C 1   ? 0.7502 1.2545 1.0602 -0.0694 0.3007  0.4367  15  DG  C C4    
2387 P P     . DC  C 2   ? 1.7425 2.0791 1.5002 -0.2336 0.2094  0.3952  16  DC  C P     
2388 O OP1   . DC  C 2   ? 1.8668 2.1680 1.4902 -0.2819 0.1956  0.3750  16  DC  C OP1   
2389 O OP2   . DC  C 2   ? 1.5531 1.9560 1.4450 -0.2229 0.1707  0.4067  16  DC  C OP2   
2390 O "O5'" . DC  C 2   ? 1.5274 1.7992 1.2597 -0.2018 0.2656  0.3720  16  DC  C "O5'" 
2391 C "C5'" . DC  C 2   ? 1.5174 1.7302 1.1786 -0.1872 0.3237  0.3687  16  DC  C "C5'" 
2392 C "C4'" . DC  C 2   ? 1.3901 1.5814 1.0940 -0.1380 0.3681  0.3595  16  DC  C "C4'" 
2393 O "O4'" . DC  C 2   ? 1.1950 1.4691 1.0600 -0.0992 0.3617  0.3825  16  DC  C "O4'" 
2394 C "C3'" . DC  C 2   ? 1.3811 1.5426 1.0784 -0.1285 0.3543  0.3321  16  DC  C "C3'" 
2395 O "O3'" . DC  C 2   ? 1.5469 1.5982 1.1039 -0.1355 0.4022  0.3022  16  DC  C "O3'" 
2396 C "C2'" . DC  C 2   ? 1.2540 1.4636 1.0879 -0.0687 0.3532  0.3355  16  DC  C "C2'" 
2397 C "C1'" . DC  C 2   ? 1.1289 1.4175 1.0711 -0.0587 0.3564  0.3664  16  DC  C "C1'" 
2398 N N1    . DC  C 2   ? 0.9349 1.3173 1.0238 -0.0549 0.3105  0.3783  16  DC  C N1    
2399 C C2    . DC  C 2   ? 0.8050 1.2391 1.0141 -0.0130 0.3088  0.3703  16  DC  C C2    
2400 O O2    . DC  C 2   ? 0.8021 1.2114 0.9993 0.0261  0.3407  0.3592  16  DC  C O2    
2401 N N3    . DC  C 2   ? 0.6047 1.1166 0.9403 -0.0172 0.2738  0.3748  16  DC  C N3    
2402 C C4    . DC  C 2   ? 0.5970 1.1283 0.9457 -0.0540 0.2467  0.3918  16  DC  C C4    
2403 N N4    . DC  C 2   ? 0.5014 1.0713 0.9540 -0.0533 0.2132  0.3800  16  DC  C N4    
2404 C C5    . DC  C 2   ? 0.6754 1.1607 0.9096 -0.0889 0.2408  0.4030  16  DC  C C5    
2405 C C6    . DC  C 2   ? 0.8447 1.2653 0.9517 -0.0929 0.2736  0.3978  16  DC  C C6    
2406 P P     . DG  C 3   ? 1.8679 1.8589 1.3274 -0.1783 0.3849  0.2668  17  DG  C P     
2407 O OP1   . DG  C 3   ? 1.9779 1.9248 1.3297 -0.2162 0.3898  0.2447  17  DG  C OP1   
2408 O OP2   . DG  C 3   ? 1.7055 1.7740 1.2602 -0.1913 0.3204  0.2763  17  DG  C OP2   
2409 O "O5'" . DG  C 3   ? 1.5940 1.5039 1.0353 -0.1279 0.4251  0.2410  17  DG  C "O5'" 
2410 C "C5'" . DG  C 3   ? 1.5635 1.4800 1.0691 -0.0615 0.4609  0.2573  17  DG  C "C5'" 
2411 C "C4'" . DG  C 3   ? 1.4572 1.3985 1.0437 -0.0094 0.4435  0.2609  17  DG  C "C4'" 
2412 O "O4'" . DG  C 3   ? 1.3049 1.3712 1.0435 0.0014  0.3862  0.2822  17  DG  C "O4'" 
2413 C "C3'" . DG  C 3   ? 1.4658 1.3533 0.9926 -0.0336 0.4252  0.2357  17  DG  C "C3'" 
2414 O "O3'" . DG  C 3   ? 1.5552 1.3885 1.0706 0.0263  0.4550  0.2311  17  DG  C "O3'" 
2415 C "C2'" . DG  C 3   ? 1.2844 1.2775 0.9263 -0.0521 0.3505  0.2474  17  DG  C "C2'" 
2416 C "C1'" . DG  C 3   ? 1.1797 1.2655 0.9531 -0.0038 0.3391  0.2725  17  DG  C "C1'" 
2417 N N9    . DG  C 3   ? 1.0289 1.2195 0.9192 -0.0262 0.2861  0.2897  17  DG  C N9    
2418 C C8    . DG  C 3   ? 0.9964 1.2167 0.8840 -0.0814 0.2577  0.3000  17  DG  C C8    
2419 N N7    . DG  C 3   ? 0.8737 1.1833 0.8839 -0.0836 0.2228  0.3198  17  DG  C N7    
2420 C C5    . DG  C 3   ? 0.7933 1.1371 0.8900 -0.0342 0.2250  0.3154  17  DG  C C5    
2421 C C6    . DG  C 3   ? 0.6487 1.0812 0.8868 -0.0213 0.2003  0.3232  17  DG  C C6    
2422 O O6    . DG  C 3   ? 0.5195 1.0071 0.8368 -0.0476 0.1791  0.3388  17  DG  C O6    
2423 N N1    . DG  C 3   ? 0.5831 1.0388 0.8697 0.0274  0.2053  0.3109  17  DG  C N1    
2424 C C2    . DG  C 3   ? 0.6442 1.0438 0.8566 0.0682  0.2332  0.3014  17  DG  C C2    
2425 N N2    . DG  C 3   ? 0.6258 1.0761 0.9088 0.1177  0.2280  0.2969  17  DG  C N2    
2426 N N3    . DG  C 3   ? 0.7547 1.0570 0.8343 0.0605  0.2665  0.2967  17  DG  C N3    
2427 C C4    . DG  C 3   ? 0.8581 1.1378 0.8849 0.0042  0.2592  0.3001  17  DG  C C4    
2428 P P     . DA  C 4   ? 1.5207 1.2487 0.9432 0.0175  0.4691  0.2002  18  DA  C P     
2429 O OP1   . DA  C 4   ? 1.6300 1.2571 0.9636 0.0081  0.5140  0.1701  18  DA  C OP1   
2430 O OP2   . DA  C 4   ? 1.4069 1.1629 0.8382 -0.0407 0.4202  0.1895  18  DA  C OP2   
2431 O "O5'" . DA  C 4   ? 1.5422 1.2834 1.0205 0.1037  0.4715  0.2199  18  DA  C "O5'" 
2432 C "C5'" . DA  C 4   ? 1.3887 1.2174 0.9707 0.1631  0.4657  0.2480  18  DA  C "C5'" 
2433 C "C4'" . DA  C 4   ? 1.2124 1.1411 0.9089 0.2000  0.4027  0.2587  18  DA  C "C4'" 
2434 O "O4'" . DA  C 4   ? 1.1008 1.1353 0.8986 0.1533  0.3424  0.2598  18  DA  C "O4'" 
2435 C "C3'" . DA  C 4   ? 1.1917 1.0599 0.8340 0.2112  0.3916  0.2461  18  DA  C "C3'" 
2436 O "O3'" . DA  C 4   ? 1.1630 1.0727 0.8523 0.2872  0.3789  0.2635  18  DA  C "O3'" 
2437 C "C2'" . DA  C 4   ? 1.0884 1.0157 0.7874 0.1502  0.3292  0.2344  18  DA  C "C2'" 
2438 C "C1'" . DA  C 4   ? 1.0350 1.0904 0.8621 0.1441  0.2943  0.2504  18  DA  C "C1'" 
2439 N N9    . DA  C 4   ? 1.0066 1.1134 0.8830 0.0782  0.2566  0.2485  18  DA  C N9    
2440 C C8    . DA  C 4   ? 1.0614 1.1264 0.8723 0.0175  0.2648  0.2415  18  DA  C C8    
2441 N N7    . DA  C 4   ? 0.9722 1.1104 0.8571 -0.0251 0.2249  0.2513  18  DA  C N7    
2442 C C5    . DA  C 4   ? 0.8254 1.0476 0.8297 0.0051  0.1954  0.2606  18  DA  C C5    
2443 C C6    . DA  C 4   ? 0.6172 0.9288 0.7394 -0.0156 0.1590  0.2726  18  DA  C C6    
2444 N N6    . DA  C 4   ? 0.5741 0.9094 0.7162 -0.0641 0.1442  0.2862  18  DA  C N6    
2445 N N1    . DA  C 4   ? 0.5466 0.9235 0.7655 0.0156  0.1407  0.2704  18  DA  C N1    
2446 C C2    . DA  C 4   ? 0.6226 0.9914 0.8250 0.0686  0.1496  0.2619  18  DA  C C2    
2447 N N3    . DA  C 4   ? 0.7693 1.0605 0.8694 0.1021  0.1832  0.2589  18  DA  C N3    
2448 C C4    . DA  C 4   ? 0.8837 1.0954 0.8850 0.0657  0.2094  0.2565  18  DA  C C4    
2449 P P     . DG  C 5   ? 1.2977 1.1179 0.9014 0.3311  0.3929  0.2616  19  DG  C P     
2450 O OP1   . DG  C 5   ? 1.4046 1.2365 1.0157 0.4248  0.4178  0.2913  19  DG  C OP1   
2451 O OP2   . DG  C 5   ? 1.4286 1.1077 0.9051 0.2829  0.4421  0.2375  19  DG  C OP2   
2452 O "O5'" . DG  C 5   ? 1.1807 1.0826 0.8586 0.3128  0.3165  0.2530  19  DG  C "O5'" 
2453 C "C5'" . DG  C 5   ? 1.1189 1.1654 0.9293 0.3240  0.2604  0.2613  19  DG  C "C5'" 
2454 C "C4'" . DG  C 5   ? 1.0930 1.1856 0.9543 0.2820  0.2038  0.2445  19  DG  C "C4'" 
2455 O "O4'" . DG  C 5   ? 1.0290 1.1396 0.9291 0.2061  0.1948  0.2351  19  DG  C "O4'" 
2456 C "C3'" . DG  C 5   ? 1.1562 1.1473 0.9209 0.2839  0.2099  0.2324  19  DG  C "C3'" 
2457 O "O3'" . DG  C 5   ? 1.1350 1.1935 0.9580 0.2858  0.1565  0.2250  19  DG  C "O3'" 
2458 C "C2'" . DG  C 5   ? 1.1332 1.0651 0.8674 0.2064  0.2247  0.2154  19  DG  C "C2'" 
2459 C "C1'" . DG  C 5   ? 1.0268 1.0815 0.8881 0.1668  0.1843  0.2192  19  DG  C "C1'" 
2460 N N9    . DG  C 5   ? 0.9889 1.0366 0.8549 0.0980  0.1881  0.2151  19  DG  C N9    
2461 C C8    . DG  C 5   ? 1.0207 0.9818 0.7924 0.0636  0.2261  0.2065  19  DG  C C8    
2462 N N7    . DG  C 5   ? 0.9317 0.9290 0.7367 0.0022  0.2096  0.2074  19  DG  C N7    
2463 C C5    . DG  C 5   ? 0.8658 0.9688 0.7956 0.0002  0.1662  0.2205  19  DG  C C5    
2464 C C6    . DG  C 5   ? 0.7312 0.9096 0.7475 -0.0458 0.1386  0.2341  19  DG  C C6    
2465 O O6    . DG  C 5   ? 0.7118 0.8920 0.7121 -0.0935 0.1380  0.2409  19  DG  C O6    
2466 N N1    . DG  C 5   ? 0.5870 0.8479 0.7180 -0.0319 0.1106  0.2411  19  DG  C N1    
2467 C C2    . DG  C 5   ? 0.5828 0.8642 0.7397 0.0149  0.1013  0.2316  19  DG  C C2    
2468 N N2    . DG  C 5   ? 0.5061 0.8709 0.7751 0.0116  0.0757  0.2318  19  DG  C N2    
2469 N N3    . DG  C 5   ? 0.7232 0.9497 0.8010 0.0616  0.1176  0.2233  19  DG  C N3    
2470 C C4    . DG  C 5   ? 0.8854 1.0183 0.8524 0.0539  0.1536  0.2203  19  DG  C C4    
2471 P P     . DA  C 6   ? 1.1883 1.2027 0.9371 0.3449  0.1488  0.2277  20  DA  C P     
2472 O OP1   . DA  C 6   ? 1.2896 1.3190 1.0148 0.4270  0.1667  0.2547  20  DA  C OP1   
2473 O OP2   . DA  C 6   ? 1.2032 1.0826 0.8501 0.3172  0.1818  0.2139  20  DA  C OP2   
2474 O "O5'" . DA  C 6   ? 1.1266 1.2565 0.9734 0.3274  0.0814  0.2131  20  DA  C "O5'" 
2475 C "C5'" . DA  C 6   ? 0.9846 1.2578 0.9659 0.3162  0.0454  0.2123  20  DA  C "C5'" 
2476 C "C4'" . DA  C 6   ? 0.8631 1.1906 0.9319 0.2498  0.0116  0.1887  20  DA  C "C4'" 
2477 O "O4'" . DA  C 6   ? 0.8052 1.0974 0.8951 0.1896  0.0358  0.1897  20  DA  C "O4'" 
2478 C "C3'" . DA  C 6   ? 0.9103 1.1861 0.9258 0.2392  -0.0053 0.1698  20  DA  C "C3'" 
2479 O "O3'" . DA  C 6   ? 0.8719 1.2427 0.9864 0.2050  -0.0453 0.1477  20  DA  C "O3'" 
2480 C "C2'" . DA  C 6   ? 0.8910 1.0591 0.8611 0.1901  0.0305  0.1674  20  DA  C "C2'" 
2481 C "C1'" . DA  C 6   ? 0.7730 1.0013 0.8362 0.1481  0.0361  0.1759  20  DA  C "C1'" 
2482 N N9    . DA  C 6   ? 0.7418 0.8912 0.7556 0.1152  0.0715  0.1829  20  DA  C N9    
2483 C C8    . DA  C 6   ? 0.8786 0.9273 0.7797 0.1353  0.1107  0.1866  20  DA  C C8    
2484 N N7    . DA  C 6   ? 0.8920 0.8972 0.7732 0.0873  0.1333  0.1858  20  DA  C N7    
2485 C C5    . DA  C 6   ? 0.7557 0.8424 0.7458 0.0401  0.1052  0.1893  20  DA  C C5    
2486 C C6    . DA  C 6   ? 0.6821 0.7853 0.7116 -0.0175 0.1055  0.1965  20  DA  C C6    
2487 N N6    . DA  C 6   ? 0.6606 0.7036 0.6200 -0.0464 0.1301  0.1941  20  DA  C N6    
2488 N N1    . DA  C 6   ? 0.5273 0.7137 0.6707 -0.0448 0.0811  0.2067  20  DA  C N1    
2489 C C2    . DA  C 6   ? 0.4896 0.7329 0.7005 -0.0245 0.0607  0.2012  20  DA  C C2    
2490 N N3    . DA  C 6   ? 0.5347 0.7802 0.7190 0.0214  0.0515  0.1883  20  DA  C N3    
2491 C C4    . DA  C 6   ? 0.6654 0.8328 0.7375 0.0562  0.0729  0.1867  20  DA  C C4    
2492 P P     . DA  C 7   ? 1.0659 1.4030 1.1379 0.1906  -0.0664 0.1217  21  DA  C P     
2493 O OP1   . DA  C 7   ? 1.0753 1.5393 1.2265 0.1907  -0.1138 0.1006  21  DA  C OP1   
2494 O OP2   . DA  C 7   ? 1.1195 1.3331 1.0443 0.2318  -0.0444 0.1304  21  DA  C OP2   
2495 O "O5'" . DA  C 7   ? 0.9233 1.2234 1.0512 0.1163  -0.0466 0.1109  21  DA  C "O5'" 
2496 C "C5'" . DA  C 7   ? 0.8541 1.2402 1.1146 0.0713  -0.0507 0.1086  21  DA  C "C5'" 
2497 C "C4'" . DA  C 7   ? 0.9033 1.2376 1.1980 0.0144  -0.0268 0.1074  21  DA  C "C4'" 
2498 O "O4'" . DA  C 7   ? 0.9057 1.1845 1.1722 0.0057  0.0017  0.1334  21  DA  C "O4'" 
2499 C "C3'" . DA  C 7   ? 0.9744 1.2212 1.1970 0.0062  -0.0205 0.0880  21  DA  C "C3'" 
2500 O "O3'" . DA  C 7   ? 0.9624 1.2161 1.2672 -0.0463 -0.0094 0.0754  21  DA  C "O3'" 
2501 C "C2'" . DA  C 7   ? 0.9677 1.1057 1.1011 0.0135  0.0116  0.1056  21  DA  C "C2'" 
2502 C "C1'" . DA  C 7   ? 0.8448 1.0232 1.0479 -0.0101 0.0229  0.1302  21  DA  C "C1'" 
2503 N N9    . DA  C 7   ? 0.7538 0.8610 0.8710 0.0031  0.0466  0.1440  21  DA  C N9    
2504 C C8    . DA  C 7   ? 0.7989 0.8374 0.7992 0.0505  0.0583  0.1423  21  DA  C C8    
2505 N N7    . DA  C 7   ? 0.8027 0.7712 0.7413 0.0434  0.0900  0.1500  21  DA  C N7    
2506 C C5    . DA  C 7   ? 0.7411 0.7472 0.7622 -0.0126 0.0900  0.1583  21  DA  C C5    
2507 C C6    . DA  C 7   ? 0.6275 0.6089 0.6387 -0.0504 0.1093  0.1664  21  DA  C C6    
2508 N N6    . DA  C 7   ? 0.7056 0.6042 0.6141 -0.0443 0.1404  0.1599  21  DA  C N6    
2509 N N1    . DA  C 7   ? 0.5755 0.6217 0.6851 -0.0959 0.0975  0.1813  21  DA  C N1    
2510 C C2    . DA  C 7   ? 0.5282 0.6448 0.7396 -0.1026 0.0782  0.1874  21  DA  C C2    
2511 N N3    . DA  C 7   ? 0.5746 0.7137 0.8058 -0.0775 0.0642  0.1736  21  DA  C N3    
2512 C C4    . DA  C 7   ? 0.6755 0.7629 0.8069 -0.0331 0.0660  0.1590  21  DA  C C4    
2513 P P     . DA  C 8   ? 0.7463 0.9298 0.9976 -0.0613 -0.0033 0.0452  22  DA  C P     
2514 O OP1   . DA  C 8   ? 0.8301 1.0858 1.1760 -0.0984 -0.0126 0.0178  22  DA  C OP1   
2515 O OP2   . DA  C 8   ? 0.8243 0.9466 0.9334 -0.0105 -0.0153 0.0397  22  DA  C OP2   
2516 O "O5'" . DA  C 8   ? 0.6223 0.7166 0.8855 -0.0958 0.0412  0.0608  22  DA  C "O5'" 
2517 C "C5'" . DA  C 8   ? 0.4978 0.6248 0.8853 -0.1415 0.0631  0.0721  22  DA  C "C5'" 
2518 C "C4'" . DA  C 8   ? 0.5275 0.5880 0.9201 -0.1591 0.0969  0.0981  22  DA  C "C4'" 
2519 O "O4'" . DA  C 8   ? 0.5351 0.6115 0.9013 -0.1415 0.0876  0.1236  22  DA  C "O4'" 
2520 C "C3'" . DA  C 8   ? 0.6095 0.5542 0.8998 -0.1522 0.1190  0.0826  22  DA  C "C3'" 
2521 O "O3'" . DA  C 8   ? 0.6283 0.5328 0.9556 -0.1832 0.1475  0.0657  22  DA  C "O3'" 
2522 C "C2'" . DA  C 8   ? 0.5671 0.4773 0.8568 -0.1599 0.1395  0.1110  22  DA  C "C2'" 
2523 C "C1'" . DA  C 8   ? 0.5367 0.5316 0.8508 -0.1479 0.1120  0.1319  22  DA  C "C1'" 
2524 N N9    . DA  C 8   ? 0.6531 0.6072 0.8519 -0.1125 0.1059  0.1284  22  DA  C N9    
2525 C C8    . DA  C 8   ? 0.7242 0.6540 0.8262 -0.0672 0.0921  0.1113  22  DA  C C8    
2526 N N7    . DA  C 8   ? 0.6715 0.5544 0.6832 -0.0389 0.1017  0.1169  22  DA  C N7    
2527 C C5    . DA  C 8   ? 0.7341 0.6123 0.7814 -0.0753 0.1196  0.1319  22  DA  C C5    
2528 C C6    . DA  C 8   ? 0.7310 0.5649 0.7172 -0.0782 0.1399  0.1370  22  DA  C C6    
2529 N N6    . DA  C 8   ? 0.7562 0.5263 0.6298 -0.0375 0.1554  0.1306  22  DA  C N6    
2530 N N1    . DA  C 8   ? 0.6341 0.4926 0.6796 -0.1258 0.1463  0.1492  22  DA  C N1    
2531 C C2    . DA  C 8   ? 0.5595 0.4822 0.7224 -0.1585 0.1355  0.1639  22  DA  C C2    
2532 N N3    . DA  C 8   ? 0.5722 0.5291 0.8037 -0.1567 0.1261  0.1635  22  DA  C N3    
2533 C C4    . DA  C 8   ? 0.6805 0.6108 0.8455 -0.1181 0.1178  0.1426  22  DA  C C4    
2534 P P     . DC  C 9   ? 0.8334 0.7637 0.5909 -0.0230 -0.1791 -0.1073 23  DC  C P     
2535 O OP1   . DC  C 9   ? 0.9079 0.8109 0.6105 -0.0306 -0.1519 -0.1111 23  DC  C OP1   
2536 O OP2   . DC  C 9   ? 0.6765 0.6225 0.4791 -0.0351 -0.2278 -0.0872 23  DC  C OP2   
2537 O "O5'" . DC  C 9   ? 0.8536 0.7698 0.5969 -0.0111 -0.1753 -0.1030 23  DC  C "O5'" 
2538 C "C5'" . DC  C 9   ? 0.7171 0.6171 0.4340 0.0001  -0.1389 -0.1145 23  DC  C "C5'" 
2539 C "C4'" . DC  C 9   ? 0.6942 0.5973 0.4453 0.0095  -0.1355 -0.0993 23  DC  C "C4'" 
2540 O "O4'" . DC  C 9   ? 0.6602 0.6077 0.4990 0.0216  -0.1449 -0.1007 23  DC  C "O4'" 
2541 C "C3'" . DC  C 9   ? 0.6731 0.5453 0.3813 0.0022  -0.1599 -0.0727 23  DC  C "C3'" 
2542 O "O3'" . DC  C 9   ? 0.7105 0.5324 0.3353 0.0057  -0.1387 -0.0645 23  DC  C "O3'" 
2543 C "C2'" . DC  C 9   ? 0.6560 0.5545 0.4405 0.0124  -0.1630 -0.0586 23  DC  C "C2'" 
2544 C "C1'" . DC  C 9   ? 0.6397 0.5826 0.5035 0.0251  -0.1537 -0.0810 23  DC  C "C1'" 
2545 N N1    . DC  C 9   ? 0.5564 0.5348 0.4847 0.0336  -0.1759 -0.0731 23  DC  C N1    
2546 C C2    . DC  C 9   ? 0.5068 0.4965 0.4946 0.0517  -0.1752 -0.0721 23  DC  C C2    
2547 O O2    . DC  C 9   ? 0.5690 0.5403 0.5666 0.0560  -0.1600 -0.0773 23  DC  C O2    
2548 N N3    . DC  C 9   ? 0.4742 0.4928 0.5128 0.0656  -0.1916 -0.0635 23  DC  C N3    
2549 C C4    . DC  C 9   ? 0.5033 0.5463 0.5489 0.0599  -0.2063 -0.0509 23  DC  C C4    
2550 N N4    . DC  C 9   ? 0.5797 0.6539 0.6824 0.0781  -0.2165 -0.0361 23  DC  C N4    
2551 C C5    . DC  C 9   ? 0.4933 0.5275 0.4936 0.0368  -0.2124 -0.0506 23  DC  C C5    
2552 C C6    . DC  C 9   ? 0.5824 0.5804 0.5176 0.0254  -0.1976 -0.0646 23  DC  C C6    
2553 P P     . DA  C 10  ? 0.8557 0.6231 0.3936 0.0094  -0.1568 -0.0372 24  DA  C P     
2554 O OP1   . DA  C 10  ? 1.0242 0.7336 0.4549 0.0202  -0.1297 -0.0346 24  DA  C OP1   
2555 O OP2   . DA  C 10  ? 0.9595 0.7299 0.4981 -0.0030 -0.2110 -0.0342 24  DA  C OP2   
2556 O "O5'" . DA  C 10  ? 0.8565 0.6370 0.4528 0.0217  -0.1382 -0.0114 24  DA  C "O5'" 
2557 C "C5'" . DA  C 10  ? 0.7179 0.5060 0.3563 0.0313  -0.0945 -0.0068 24  DA  C "C5'" 
2558 C "C4'" . DA  C 10  ? 0.7681 0.5709 0.4821 0.0383  -0.0910 0.0178  24  DA  C "C4'" 
2559 O "O4'" . DA  C 10  ? 0.6370 0.4869 0.4410 0.0328  -0.1181 -0.0003 24  DA  C "O4'" 
2560 C "C3'" . DA  C 10  ? 0.7869 0.5534 0.4422 0.0475  -0.1025 0.0528  24  DA  C "C3'" 
2561 O "O3'" . DA  C 10  ? 0.8511 0.5964 0.5147 0.0638  -0.0600 0.0871  24  DA  C "O3'" 
2562 C "C2'" . DA  C 10  ? 0.7472 0.5507 0.4790 0.0415  -0.1385 0.0529  24  DA  C "C2'" 
2563 C "C1'" . DA  C 10  ? 0.7667 0.6182 0.6026 0.0372  -0.1339 0.0244  24  DA  C "C1'" 
2564 N N9    . DA  C 10  ? 0.6843 0.5746 0.5728 0.0344  -0.1676 0.0098  24  DA  C N9    
2565 C C8    . DA  C 10  ? 0.6118 0.5139 0.4737 0.0255  -0.1976 0.0033  24  DA  C C8    
2566 N N7    . DA  C 10  ? 0.6738 0.6163 0.6051 0.0304  -0.2155 -0.0014 24  DA  C N7    
2567 C C5    . DA  C 10  ? 0.5850 0.5348 0.5798 0.0448  -0.2005 -0.0043 24  DA  C C5    
2568 C C6    . DA  C 10  ? 0.5261 0.5021 0.5952 0.0624  -0.2091 -0.0112 24  DA  C C6    
2569 N N6    . DA  C 10  ? 0.5320 0.5401 0.6279 0.0713  -0.2262 -0.0106 24  DA  C N6    
2570 N N1    . DA  C 10  ? 0.4925 0.4564 0.6101 0.0738  -0.2000 -0.0160 24  DA  C N1    
2571 C C2    . DA  C 10  ? 0.5116 0.4490 0.6207 0.0655  -0.1790 -0.0083 24  DA  C C2    
2572 N N3    . DA  C 10  ? 0.5448 0.4611 0.5873 0.0527  -0.1601 0.0040  24  DA  C N3    
2573 C C4    . DA  C 10  ? 0.5597 0.4795 0.5383 0.0440  -0.1740 0.0024  24  DA  C C4    
2574 P P     . DA  C 11  ? 0.9341 0.6282 0.5182 0.0867  -0.0504 0.1330  25  DA  C P     
2575 O OP1   . DA  C 11  ? 1.0324 0.6905 0.5710 0.1087  0.0067  0.1622  25  DA  C OP1   
2576 O OP2   . DA  C 11  ? 1.0283 0.6944 0.5161 0.0856  -0.1003 0.1237  25  DA  C OP2   
2577 O "O5'" . DA  C 11  ? 0.8901 0.6142 0.5913 0.0872  -0.0480 0.1569  25  DA  C "O5'" 
2578 C "C5'" . DA  C 11  ? 0.8552 0.6183 0.6863 0.0783  -0.0311 0.1494  25  DA  C "C5'" 
2579 C "C4'" . DA  C 11  ? 0.8181 0.6059 0.7476 0.0752  -0.0533 0.1565  25  DA  C "C4'" 
2580 O "O4'" . DA  C 11  ? 0.7964 0.6185 0.7501 0.0627  -0.0988 0.1164  25  DA  C "O4'" 
2581 C "C3'" . DA  C 11  ? 0.8998 0.6591 0.7835 0.0904  -0.0544 0.1978  25  DA  C "C3'" 
2582 O "O3'" . DA  C 11  ? 1.0183 0.7816 1.0035 0.0965  -0.0321 0.2306  25  DA  C "O3'" 
2583 C "C2'" . DA  C 11  ? 0.8451 0.6251 0.7185 0.0812  -0.1087 0.1748  25  DA  C "C2'" 
2584 C "C1'" . DA  C 11  ? 0.7663 0.5917 0.7308 0.0666  -0.1252 0.1325  25  DA  C "C1'" 
2585 N N9    . DA  C 11  ? 0.7072 0.5586 0.6558 0.0585  -0.1664 0.1056  25  DA  C N9    
2586 C C8    . DA  C 11  ? 0.7488 0.5901 0.6109 0.0521  -0.1888 0.0990  25  DA  C C8    
2587 N N7    . DA  C 11  ? 0.7443 0.6202 0.6365 0.0451  -0.2233 0.0829  25  DA  C N7    
2588 C C5    . DA  C 11  ? 0.7389 0.6454 0.7280 0.0527  -0.2202 0.0771  25  DA  C C5    
2589 C C6    . DA  C 11  ? 0.6471 0.5930 0.7013 0.0591  -0.2407 0.0651  25  DA  C C6    
2590 N N6    . DA  C 11  ? 0.5896 0.5626 0.6406 0.0546  -0.2656 0.0622  25  DA  C N6    
2591 N N1    . DA  C 11  ? 0.5974 0.5502 0.7235 0.0735  -0.2350 0.0595  25  DA  C N1    
2592 C C2    . DA  C 11  ? 0.5825 0.5099 0.7328 0.0749  -0.2143 0.0661  25  DA  C C2    
2593 N N3    . DA  C 11  ? 0.6175 0.5166 0.7308 0.0674  -0.1891 0.0832  25  DA  C N3    
2594 C C4    . DA  C 11  ? 0.6517 0.5400 0.6755 0.0592  -0.1909 0.0880  25  DA  C C4    
2595 P P     . DA  C 12  ? 1.1211 0.8496 1.0747 0.1202  -0.0100 0.2889  26  DA  C P     
2596 O OP1   . DA  C 12  ? 1.1578 0.8644 1.1290 0.1368  0.0523  0.3335  26  DA  C OP1   
2597 O OP2   . DA  C 12  ? 1.1155 0.8160 0.9358 0.1313  -0.0394 0.2889  26  DA  C OP2   
2598 O "O5'" . DA  C 12  ? 1.1117 0.8672 1.1934 0.1122  -0.0332 0.2910  26  DA  C "O5'" 
2599 C "C5'" . DA  C 12  ? 0.9400 0.7281 1.1445 0.0949  -0.0501 0.2573  26  DA  C "C5'" 
2600 C "C4'" . DA  C 12  ? 0.9146 0.7223 1.1643 0.0916  -0.0961 0.2354  26  DA  C "C4'" 
2601 O "O4'" . DA  C 12  ? 0.9445 0.7718 1.1239 0.0858  -0.1294 0.1970  26  DA  C "O4'" 
2602 C "C3'" . DA  C 12  ? 0.9818 0.7735 1.2205 0.1050  -0.0978 0.2766  26  DA  C "C3'" 
2603 O "O3'" . DA  C 12  ? 1.0105 0.8028 1.3723 0.1056  -0.1020 0.2881  26  DA  C "O3'" 
2604 C "C2'" . DA  C 12  ? 0.9458 0.7540 1.1166 0.1043  -0.1412 0.2534  26  DA  C "C2'" 
2605 C "C1'" . DA  C 12  ? 0.9305 0.7676 1.1110 0.0912  -0.1609 0.2013  26  DA  C "C1'" 
2606 N N9    . DA  C 12  ? 0.8778 0.7283 0.9760 0.0866  -0.1880 0.1836  26  DA  C N9    
2607 C C8    . DA  C 12  ? 0.8974 0.7258 0.8879 0.0852  -0.1865 0.1907  26  DA  C C8    
2608 N N7    . DA  C 12  ? 0.8481 0.6943 0.8013 0.0775  -0.2230 0.1717  26  DA  C N7    
2609 C C5    . DA  C 12  ? 0.7614 0.6483 0.8023 0.0772  -0.2410 0.1554  26  DA  C C5    
2610 C C6    . DA  C 12  ? 0.6922 0.6171 0.7563 0.0746  -0.2724 0.1398  26  DA  C C6    
2611 N N6    . DA  C 12  ? 0.7096 0.6413 0.7241 0.0642  -0.2986 0.1371  26  DA  C N6    
2612 N N1    . DA  C 12  ? 0.7569 0.7092 0.9014 0.0864  -0.2766 0.1298  26  DA  C N1    
2613 C C2    . DA  C 12  ? 0.6763 0.6132 0.8743 0.0960  -0.2599 0.1295  26  DA  C C2    
2614 N N3    . DA  C 12  ? 0.6881 0.5933 0.8888 0.0932  -0.2349 0.1439  26  DA  C N3    
2615 C C4    . DA  C 12  ? 0.7641 0.6485 0.8842 0.0849  -0.2220 0.1592  26  DA  C C4    
2616 P P     . DG  C 13  ? 1.3152 1.0883 1.6938 0.1208  -0.0950 0.3376  27  DG  C P     
2617 O OP1   . DG  C 13  ? 1.3394 1.1017 1.8561 0.1185  -0.0776 0.3617  27  DG  C OP1   
2618 O OP2   . DG  C 13  ? 1.3468 1.0964 1.5989 0.1378  -0.0732 0.3739  27  DG  C OP2   
2619 O "O5'" . DG  C 13  ? 1.1575 0.9509 1.5399 0.1216  -0.1455 0.3072  27  DG  C "O5'" 
2620 C "C5'" . DG  C 13  ? 1.0724 0.8856 1.5134 0.1151  -0.1774 0.2571  27  DG  C "C5'" 
2621 C "C4'" . DG  C 13  ? 1.0072 0.8413 1.4179 0.1237  -0.2136 0.2398  27  DG  C "C4'" 
2622 O "O4'" . DG  C 13  ? 0.9828 0.8389 1.3023 0.1176  -0.2221 0.2235  27  DG  C "O4'" 
2623 C "C3'" . DG  C 13  ? 1.0921 0.9164 1.4922 0.1360  -0.2162 0.2809  27  DG  C "C3'" 
2624 O "O3'" . DG  C 13  ? 1.0908 0.9215 1.5477 0.1479  -0.2443 0.2676  27  DG  C "O3'" 
2625 C "C2'" . DG  C 13  ? 1.1108 0.9477 1.4009 0.1358  -0.2261 0.2887  27  DG  C "C2'" 
2626 C "C1'" . DG  C 13  ? 1.0015 0.8673 1.2763 0.1249  -0.2424 0.2428  27  DG  C "C1'" 
2627 N N9    . DG  C 13  ? 0.9569 0.8274 1.1362 0.1166  -0.2498 0.2411  27  DG  C N9    
2628 C C8    . DG  C 13  ? 0.9738 0.8129 1.0707 0.1152  -0.2296 0.2589  27  DG  C C8    
2629 N N7    . DG  C 13  ? 0.9244 0.7657 0.9413 0.1088  -0.2524 0.2475  27  DG  C N7    
2630 C C5    . DG  C 13  ? 0.8729 0.7579 0.9372 0.1032  -0.2856 0.2261  27  DG  C C5    
2631 C C6    . DG  C 13  ? 0.8530 0.7628 0.8905 0.0934  -0.3208 0.2121  27  DG  C C6    
2632 O O6    . DG  C 13  ? 0.8936 0.7850 0.8524 0.0850  -0.3384 0.2096  27  DG  C O6    
2633 N N1    . DG  C 13  ? 0.8254 0.7819 0.9413 0.0971  -0.3371 0.2025  27  DG  C N1    
2634 C C2    . DG  C 13  ? 0.8083 0.7755 0.9995 0.1124  -0.3248 0.2008  27  DG  C C2    
2635 N N2    . DG  C 13  ? 0.7678 0.7743 1.0137 0.1240  -0.3388 0.1939  27  DG  C N2    
2636 N N3    . DG  C 13  ? 0.8595 0.7971 1.0734 0.1189  -0.3011 0.2078  27  DG  C N3    
2637 C C4    . DG  C 13  ? 0.9041 0.8060 1.0601 0.1118  -0.2809 0.2227  27  DG  C C4    
2638 P P     . DA  C 14  ? 1.3638 1.1813 1.8392 0.1632  -0.2484 0.3074  28  DA  C P     
2639 O OP1   . DA  C 14  ? 1.4111 1.2057 1.9775 0.1630  -0.2440 0.2983  28  DA  C OP1   
2640 O OP2   . DA  C 14  ? 1.3854 1.1904 1.7897 0.1648  -0.2257 0.3527  28  DA  C OP2   
2641 O "O5'" . DA  C 14  ? 1.3415 1.1925 1.7914 0.1753  -0.2814 0.2894  28  DA  C "O5'" 
2642 C "C5'" . DA  C 14  ? 1.2614 1.1339 1.7226 0.1784  -0.2935 0.2402  28  DA  C "C5'" 
2643 C "C4'" . DA  C 14  ? 1.2270 1.1416 1.6473 0.1861  -0.3077 0.2368  28  DA  C "C4'" 
2644 O "O4'" . DA  C 14  ? 1.2083 1.1434 1.5789 0.1722  -0.3172 0.2441  28  DA  C "O4'" 
2645 C "C3'" . DA  C 14  ? 1.2392 1.1602 1.6505 0.1962  -0.3124 0.2685  28  DA  C "C3'" 
2646 O "O3'" . DA  C 14  ? 1.2696 1.2246 1.6793 0.2108  -0.3168 0.2543  28  DA  C "O3'" 
2647 C "C2'" . DA  C 14  ? 1.2224 1.1481 1.5769 0.1849  -0.3222 0.3007  28  DA  C "C2'" 
2648 C "C1'" . DA  C 14  ? 1.1806 1.1297 1.5116 0.1716  -0.3306 0.2748  28  DA  C "C1'" 
2649 N N9    . DA  C 14  ? 1.0786 1.0136 1.3394 0.1561  -0.3343 0.2881  28  DA  C N9    
2650 C C8    . DA  C 14  ? 1.0911 0.9852 1.3134 0.1516  -0.3079 0.3028  28  DA  C C8    
2651 N N7    . DA  C 14  ? 1.0853 0.9663 1.2214 0.1431  -0.3117 0.3058  28  DA  C N7    
2652 C C5    . DA  C 14  ? 0.9952 0.9129 1.1247 0.1357  -0.3486 0.2908  28  DA  C C5    
2653 C C6    . DA  C 14  ? 0.9351 0.8542 0.9974 0.1237  -0.3777 0.2845  28  DA  C C6    
2654 N N6    . DA  C 14  ? 0.9502 0.8236 0.9145 0.1222  -0.3738 0.2886  28  DA  C N6    
2655 N N1    . DA  C 14  ? 0.8602 0.8261 0.9602 0.1158  -0.4062 0.2729  28  DA  C N1    
2656 C C2    . DA  C 14  ? 0.7991 0.8058 0.9807 0.1243  -0.3940 0.2665  28  DA  C C2    
2657 N N3    . DA  C 14  ? 0.7937 0.7956 1.0259 0.1409  -0.3727 0.2692  28  DA  C N3    
2658 C C4    . DA  C 14  ? 0.9553 0.9112 1.1664 0.1442  -0.3583 0.2836  28  DA  C C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  HIS 91  91  91  HIS HIS A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  HIS 93  93  93  HIS HIS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 TYR 125 125 125 TYR TYR A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ARG 150 150 150 ARG ARG A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 GLN 191 191 191 GLN GLN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 HIS 201 201 201 HIS HIS A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ILE 204 204 204 ILE ILE A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 GLN 209 209 209 GLN GLN A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ILE 212 212 212 ILE ILE A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ILE 219 219 ?   ?   ?   A . n 
A 1 220 ARG 220 220 ?   ?   ?   A . n 
A 1 221 THR 221 221 ?   ?   ?   A . n 
A 1 222 TYR 222 222 ?   ?   ?   A . n 
A 1 223 SER 223 223 ?   ?   ?   A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 LYS 230 230 230 LYS LYS A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 GLN 232 232 232 GLN GLN A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 GLN 236 236 236 GLN GLN A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 SER 246 246 246 SER SER A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 CYS 248 248 248 CYS CYS A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 GLN 253 253 253 GLN GLN A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 ALA 258 258 258 ALA ALA A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 HIS 263 263 263 HIS HIS A . n 
A 1 264 PHE 264 264 264 PHE PHE A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 CYS 268 268 268 CYS CYS A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
B 2 1   DC  1   1   1   DC  DC  B . n 
B 2 2   DT  2   2   2   DT  DT  B . n 
B 2 3   DC  3   3   3   DC  DC  B . n 
B 2 4   DT  4   4   4   DT  DT  B . n 
B 2 5   DT  5   5   5   DT  DT  B . n 
B 2 6   DT  6   6   6   DT  DT  B . n 
B 2 7   3DR 7   7   7   3DR 3DR B . n 
B 2 8   DT  8   8   8   DT  DT  B . n 
B 2 9   DT  9   9   9   DT  DT  B . n 
B 2 10  DT  10  10  10  DT  DT  B . n 
B 2 11  DC  11  11  11  DC  DC  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DC  13  13  13  DC  DC  B . n 
B 2 14  DG  14  14  14  DG  DG  B . n 
C 3 1   DG  1   15  15  DG  DG  C . n 
C 3 2   DC  2   16  16  DC  DC  C . n 
C 3 3   DG  3   17  17  DG  DG  C . n 
C 3 4   DA  4   18  18  DA  DA  C . n 
C 3 5   DG  5   19  19  DG  DG  C . n 
C 3 6   DA  6   20  20  DA  DA  C . n 
C 3 7   DA  7   21  21  DA  DA  C . n 
C 3 8   DA  8   22  22  DA  DA  C . n 
C 3 9   DC  9   23  23  DC  DC  C . n 
C 3 10  DA  10  24  24  DA  DA  C . n 
C 3 11  DA  11  25  25  DA  DA  C . n 
C 3 12  DA  12  26  26  DA  DA  C . n 
C 3 13  DG  13  27  27  DG  DG  C . n 
C 3 14  DA  14  28  28  DA  DA  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 2ON 1  301 300 2ON 2UM A . 
E 5 GOL 1  302 400 GOL GOL A . 
F 6 HOH 1  401 30  HOH HOH A . 
F 6 HOH 2  402 10  HOH HOH A . 
F 6 HOH 3  403 31  HOH HOH A . 
F 6 HOH 4  404 11  HOH HOH A . 
F 6 HOH 5  405 2   HOH HOH A . 
F 6 HOH 6  406 3   HOH HOH A . 
F 6 HOH 7  407 4   HOH HOH A . 
F 6 HOH 8  408 5   HOH HOH A . 
F 6 HOH 9  409 6   HOH HOH A . 
F 6 HOH 10 410 7   HOH HOH A . 
F 6 HOH 11 411 8   HOH HOH A . 
F 6 HOH 12 412 9   HOH HOH A . 
F 6 HOH 13 413 12  HOH HOH A . 
F 6 HOH 14 414 13  HOH HOH A . 
F 6 HOH 15 415 14  HOH HOH A . 
F 6 HOH 16 416 16  HOH HOH A . 
F 6 HOH 17 417 17  HOH HOH A . 
F 6 HOH 18 418 18  HOH HOH A . 
F 6 HOH 19 419 20  HOH HOH A . 
F 6 HOH 20 420 22  HOH HOH A . 
F 6 HOH 21 421 23  HOH HOH A . 
F 6 HOH 22 422 24  HOH HOH A . 
F 6 HOH 23 423 25  HOH HOH A . 
F 6 HOH 24 424 26  HOH HOH A . 
F 6 HOH 25 425 27  HOH HOH A . 
F 6 HOH 26 426 29  HOH HOH A . 
F 6 HOH 27 427 32  HOH HOH A . 
F 6 HOH 28 428 34  HOH HOH A . 
F 6 HOH 29 429 35  HOH HOH A . 
F 6 HOH 30 430 36  HOH HOH A . 
F 6 HOH 31 431 37  HOH HOH A . 
F 6 HOH 32 432 38  HOH HOH A . 
F 6 HOH 33 433 39  HOH HOH A . 
F 6 HOH 34 434 40  HOH HOH A . 
F 6 HOH 35 435 41  HOH HOH A . 
F 6 HOH 36 436 42  HOH HOH A . 
F 6 HOH 37 437 43  HOH HOH A . 
F 6 HOH 38 438 44  HOH HOH A . 
F 6 HOH 39 439 45  HOH HOH A . 
F 6 HOH 40 440 46  HOH HOH A . 
F 6 HOH 41 441 47  HOH HOH A . 
F 6 HOH 42 442 48  HOH HOH A . 
F 6 HOH 43 443 49  HOH HOH A . 
F 6 HOH 44 444 50  HOH HOH A . 
F 6 HOH 45 445 53  HOH HOH A . 
F 6 HOH 46 446 54  HOH HOH A . 
F 6 HOH 47 447 55  HOH HOH A . 
F 6 HOH 48 448 56  HOH HOH A . 
F 6 HOH 49 449 57  HOH HOH A . 
F 6 HOH 50 450 58  HOH HOH A . 
G 6 HOH 1  101 33  HOH HOH B . 
G 6 HOH 2  102 1   HOH HOH B . 
G 6 HOH 3  103 15  HOH HOH B . 
G 6 HOH 4  104 19  HOH HOH B . 
G 6 HOH 5  105 51  HOH HOH B . 
H 6 HOH 1  101 21  HOH HOH C . 
H 6 HOH 2  102 28  HOH HOH C . 
H 6 HOH 3  103 52  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4120  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  15310 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-04-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' . refined 3.7369  102.5461 20.6708 0.3146 . 0.0484  . 0.0058  . 0.2875 . 0.0100  . 0.2734 . 3.5509 . 
-0.5206 . -1.0385 . 3.9171 . 1.8154  . 2.9864 . 0.1625  . 0.1539  . 0.0647  . -0.1099 . -0.2740 . 0.3268  . -0.2465 . -0.4122 . 
0.1220 . 
2  'X-RAY DIFFRACTION' . refined 7.0659  96.2844  32.4553 0.4178 . 0.0299  . 0.0355  . 0.3021 . 0.0428  . 0.3028 . 6.5415 . 
-0.6407 . -2.8316 . 1.5990 . 1.3401  . 3.5200 . -0.0779 . -0.7460 . -0.1794 . 0.2843  . 0.1010  . 0.1848  . 0.2297  . 0.1424  . 
0.0457 . 
3  'X-RAY DIFFRACTION' . refined 9.0123  100.2022 17.4426 0.3074 . 0.0283  . -0.0287 . 0.2214 . 0.0295  . 0.2939 . 1.5398 . 
-0.7115 . -0.6756 . 2.0085 . 0.7939  . 2.5514 . 0.1021  . 0.0860  . -0.0500 . -0.2135 . -0.1603 . 0.1798  . -0.2378 . -0.2620 . 
0.0468 . 
4  'X-RAY DIFFRACTION' . refined 23.2033 87.2888  0.6531  0.3816 . 0.0629  . 0.0527  . 0.3604 . 0.0190  . 0.3435 . 7.5880 . 
-1.7407 . 4.9887  . 5.5424 . -2.5482 . 3.7276 . 0.2585  . 0.9977  . 0.2708  . -0.4222 . -0.3169 . -0.1125 . 0.3548  . 0.4133  . 
0.0547 . 
5  'X-RAY DIFFRACTION' . refined 18.2085 80.9239  6.6649  0.4824 . 0.0218  . -0.0582 . 0.2648 . -0.0287 . 0.3654 . 4.0332 . 
-2.0071 . -1.4028 . 4.0803 . 0.4131  . 4.3696 . 0.0704  . 0.1981  . -0.4266 . -0.3301 . -0.1891 . 0.0823  . 0.5466  . 0.0003  . 
0.1218 . 
6  'X-RAY DIFFRACTION' . refined 13.2797 74.8723  20.7108 0.7742 . -0.0573 . 0.0804  . 0.4482 . 0.0491  . 0.5471 . 8.2198 . 
-6.4095 . 0.2786  . 8.5676 . -0.5789 . 0.0275 . -0.5839 . -0.2413 . -1.1484 . 0.8222  . 0.2627  . 1.1573  . 0.6221  . -0.1846 . 
0.3432 . 
7  'X-RAY DIFFRACTION' . refined 27.4009 75.0167  15.1313 0.4923 . 0.1060  . -0.0135 . 0.3355 . 0.0268  . 0.4103 . 2.6617 . 0.1664 
. -0.5467 . 9.8229 . -1.9391 . 2.6952 . 0.1477  . 0.1057  . -0.1074 . -0.3649 . -0.3472 . -0.3838 . 0.5468  . 0.2936  . 0.2265 . 
8  'X-RAY DIFFRACTION' . refined 30.1447 93.5170  23.7699 0.5184 . -0.0228 . -0.0762 . 0.5349 . 0.0105  . 0.5196 . 2.8655 . 0.0782 
. 0.2439  . 4.3134 . -1.2960 . 5.4963 . -0.0181 . 0.1806  . 0.4279  . 0.4792  . -0.0927 . -0.8363 . -0.2410 . 1.1764  . 0.1828 . 
9  'X-RAY DIFFRACTION' . refined 32.2010 95.7052  15.4526 0.5865 . 0.0105  . 0.1322  . 0.8680 . 0.2480  . 0.7095 . 6.1792 . 0.3530 
. -6.4907 . 8.3293 . -0.5776 . 6.9171 . -0.7494 . 0.4116  . 0.5994  . -0.2838 . 0.2860  . -0.7633 . 1.8634  . 0.8929  . 0.8507 . 
10 'X-RAY DIFFRACTION' . refined 24.7144 88.8407  35.3849 0.6863 . 0.0651  . -0.2090 . 0.5706 . 0.1157  . 0.7090 . 3.7921 . 
-5.3990 . 1.0233  . 9.1850 . -3.2328 . 2.7721 . -0.0378 . -0.7845 . -1.3321 . 1.4899  . 0.0188  . 0.1955  . -0.0321 . 0.4214  . 
0.1276 . 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  . . . . . . . . . 
;chain 'A' and (resid 1 through 72 )
;
2  'X-RAY DIFFRACTION' 2  . . . . . . . . . 
;chain 'A' and (resid 73 through 91 )
;
3  'X-RAY DIFFRACTION' 3  . . . . . . . . . 
;chain 'A' and (resid 92 through 141 )
;
4  'X-RAY DIFFRACTION' 4  . . . . . . . . . 
;chain 'A' and (resid 142 through 161 )
;
5  'X-RAY DIFFRACTION' 5  . . . . . . . . . 
;chain 'A' and (resid 162 through 213 )
;
6  'X-RAY DIFFRACTION' 6  . . . . . . . . . 
;chain 'A' and (resid 214 through 248 )
;
7  'X-RAY DIFFRACTION' 7  . . . . . . . . . 
;chain 'A' and (resid 249 through 271 )
;
8  'X-RAY DIFFRACTION' 8  . . . . . . . . . 
;chain 'B' and (resid 1 through 14 )
;
9  'X-RAY DIFFRACTION' 9  . . . . . . . . . 
;chain 'C' and (resid 15 through 22 )
;
10 'X-RAY DIFFRACTION' 10 . . . . . . . . . 
;chain 'C' and (resid 23 through 28 )
;
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          . 
_software.compiler_version       . 
_software.contact_author         . 
_software.contact_author_email   . 
_software.date                   . 
_software.description            . 
_software.dependencies           . 
_software.hardware               . 
_software.language               . 
_software.location               . 
_software.mods                   . 
_software.name                   PHENIX 
_software.os                     . 
_software.os_version             . 
_software.type                   . 
_software.version                '(phenix.refine: 1.8.4_1496)' 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 74  ? ? 49.66   -122.59 
2 1 ASP A 107 ? ? -165.73 102.10  
3 1 GLN A 163 ? ? 77.84   -0.07   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 12  ? CG  ? A GLU 12  CG  
2  1 Y 1 A GLU 12  ? CD  ? A GLU 12  CD  
3  1 Y 1 A GLU 12  ? OE1 ? A GLU 12  OE1 
4  1 Y 1 A GLU 12  ? OE2 ? A GLU 12  OE2 
5  1 Y 1 A LYS 15  ? CD  ? A LYS 15  CD  
6  1 Y 1 A LYS 15  ? CE  ? A LYS 15  CE  
7  1 Y 1 A LYS 15  ? NZ  ? A LYS 15  NZ  
8  1 Y 1 A ARG 31  ? CG  ? A ARG 31  CG  
9  1 Y 1 A ARG 31  ? CD  ? A ARG 31  CD  
10 1 Y 1 A ARG 31  ? NE  ? A ARG 31  NE  
11 1 Y 1 A ARG 31  ? CZ  ? A ARG 31  CZ  
12 1 Y 1 A ARG 31  ? NH1 ? A ARG 31  NH1 
13 1 Y 1 A ARG 31  ? NH2 ? A ARG 31  NH2 
14 1 Y 1 A GLU 38  ? CG  ? A GLU 38  CG  
15 1 Y 1 A GLU 38  ? CD  ? A GLU 38  CD  
16 1 Y 1 A GLU 38  ? OE1 ? A GLU 38  OE1 
17 1 Y 1 A GLU 38  ? OE2 ? A GLU 38  OE2 
18 1 Y 1 A LYS 42  ? CD  ? A LYS 42  CD  
19 1 Y 1 A LYS 42  ? CE  ? A LYS 42  CE  
20 1 Y 1 A LYS 42  ? NZ  ? A LYS 42  NZ  
21 1 Y 1 A LYS 47  ? CD  ? A LYS 47  CD  
22 1 Y 1 A LYS 47  ? CE  ? A LYS 47  CE  
23 1 Y 1 A LYS 47  ? NZ  ? A LYS 47  NZ  
24 1 Y 1 A ARG 88  ? CG  ? A ARG 88  CG  
25 1 Y 1 A ARG 88  ? CD  ? A ARG 88  CD  
26 1 Y 1 A ARG 88  ? NE  ? A ARG 88  NE  
27 1 Y 1 A ARG 88  ? CZ  ? A ARG 88  CZ  
28 1 Y 1 A ARG 88  ? NH1 ? A ARG 88  NH1 
29 1 Y 1 A ARG 88  ? NH2 ? A ARG 88  NH2 
30 1 Y 1 A LYS 130 ? CD  ? A LYS 130 CD  
31 1 Y 1 A LYS 130 ? CE  ? A LYS 130 CE  
32 1 Y 1 A LYS 130 ? NZ  ? A LYS 130 NZ  
33 1 Y 1 A GLU 138 ? CG  ? A GLU 138 CG  
34 1 Y 1 A GLU 138 ? CD  ? A GLU 138 CD  
35 1 Y 1 A GLU 138 ? OE1 ? A GLU 138 OE1 
36 1 Y 1 A GLU 138 ? OE2 ? A GLU 138 OE2 
37 1 Y 1 A LYS 213 ? CD  ? A LYS 213 CD  
38 1 Y 1 A LYS 213 ? CE  ? A LYS 213 CE  
39 1 Y 1 A LYS 213 ? NZ  ? A LYS 213 NZ  
40 1 Y 1 A LYS 230 ? CD  ? A LYS 230 CD  
41 1 Y 1 A LYS 230 ? CE  ? A LYS 230 CE  
42 1 Y 1 A LYS 230 ? NZ  ? A LYS 230 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ILE 219 ? A ILE 219 
2 1 Y 1 A ARG 220 ? A ARG 220 
3 1 Y 1 A THR 221 ? A THR 221 
4 1 Y 1 A TYR 222 ? A TYR 222 
5 1 Y 1 A SER 223 ? A SER 223 
# 
_ndb_struct_conf_na.entry_id   4PDG 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 2  1_555 C DA 14 1_555 -0.260 -0.348 0.200  -1.617  -8.311  6.518  1  B_DT2:DA28_C  B 2  ? C 28 ? 20 1 
1 B DC 3  1_555 C DG 13 1_555 -0.224 -0.249 -0.041 -0.744  -6.933  3.472  2  B_DC3:DG27_C  B 3  ? C 27 ? 19 1 
1 B DT 4  1_555 C DA 12 1_555 -0.258 -0.353 0.363  -3.602  -13.440 0.275  3  B_DT4:DA26_C  B 4  ? C 26 ? 20 1 
1 B DT 5  1_555 C DA 11 1_555 -0.174 -0.231 -0.173 4.580   -14.526 7.129  4  B_DT5:DA25_C  B 5  ? C 25 ? 20 1 
1 B DT 6  1_555 C DA 10 1_555 -0.167 -0.192 -0.313 12.047  -4.156  2.107  5  B_DT6:DA24_C  B 6  ? C 24 ? 20 1 
1 B DT 8  1_555 C DA 8  1_555 -0.342 -0.165 -0.031 -3.787  -4.695  0.136  6  B_DT8:DA22_C  B 8  ? C 22 ? 20 1 
1 B DT 9  1_555 C DA 7  1_555 0.113  -0.234 -0.087 -1.264  -18.959 -3.413 7  B_DT9:DA21_C  B 9  ? C 21 ? 20 1 
1 B DT 10 1_555 C DA 6  1_555 -0.088 -0.216 -0.090 -4.746  -18.203 -4.651 8  B_DT10:DA20_C B 10 ? C 20 ? 20 1 
1 B DC 11 1_555 C DG 5  1_555 -0.109 -0.032 -0.123 -12.023 -6.069  1.230  9  B_DC11:DG19_C B 11 ? C 19 ? 19 1 
1 B DT 12 1_555 C DA 4  1_555 0.095  0.044  -0.104 0.818   -8.054  -1.313 10 B_DT12:DA18_C B 12 ? C 18 ? 20 1 
1 B DC 13 1_555 C DG 3  1_555 0.388  -0.303 -0.430 2.402   -8.257  -1.306 11 B_DC13:DG17_C B 13 ? C 17 ? 19 1 
1 B DG 14 1_555 C DC 2  1_555 0.106  -0.203 0.172  11.750  -13.592 6.238  12 B_DG14:DC16_C B 14 ? C 16 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 2  1_555 C DA 14 1_555 B DC 3  1_555 C DG 13 1_555 0.370  -0.202 3.240 3.416  2.235  35.768 -0.643 -0.116 3.242 3.625  
-5.539 35.993 1  BB_DT2DC3:DG27DA28_CC   B 2  ? C 28 ? B 3  ? C 27 ? 
1 B DC 3  1_555 C DG 13 1_555 B DT 4  1_555 C DA 12 1_555 -0.450 -0.587 3.460 -2.291 1.739  32.192 -1.380 0.379  3.447 3.128  
4.121  32.317 2  BB_DC3DT4:DA26DG27_CC   B 3  ? C 27 ? B 4  ? C 26 ? 
1 B DT 4  1_555 C DA 12 1_555 B DT 5  1_555 C DA 11 1_555 0.215  -0.234 2.956 4.404  0.276  35.287 -0.420 0.231  2.958 0.453  
-7.229 35.553 3  BB_DT4DT5:DA25DA26_CC   B 4  ? C 26 ? B 5  ? C 25 ? 
1 B DT 5  1_555 C DA 11 1_555 B DT 6  1_555 C DA 10 1_555 -0.194 0.190  3.252 1.260  10.472 27.125 -1.933 0.666  3.098 21.332 
-2.566 29.068 4  BB_DT5DT6:DA24DA25_CC   B 5  ? C 25 ? B 6  ? C 24 ? 
1 B DT 8  1_555 C DA 8  1_555 B DT 9  1_555 C DA 7  1_555 0.194  0.326  3.200 1.403  5.927  35.977 -0.291 -0.119 3.217 9.512  
-2.251 36.472 5  BB_DT8DT9:DA21DA22_CC   B 8  ? C 22 ? B 9  ? C 21 ? 
1 B DT 9  1_555 C DA 7  1_555 B DT 10 1_555 C DA 6  1_555 0.004  -0.167 3.368 0.310  0.272  36.148 -0.309 0.039  3.367 0.438  
-0.499 36.150 6  BB_DT9DT10:DA20DA21_CC  B 9  ? C 21 ? B 10 ? C 20 ? 
1 B DT 10 1_555 C DA 6  1_555 B DC 11 1_555 C DG 5  1_555 1.023  0.483  3.411 1.795  -0.691 40.684 0.774  -1.262 3.443 -0.994 
-2.581 40.728 7  BB_DT10DC11:DG19DA20_CC B 10 ? C 20 ? B 11 ? C 19 ? 
1 B DC 11 1_555 C DG 5  1_555 B DT 12 1_555 C DA 4  1_555 -0.849 0.265  3.097 -1.579 3.872  29.893 -0.245 1.323  3.145 7.460  
3.041  30.177 8  BB_DC11DT12:DA18DG19_CC B 11 ? C 19 ? B 12 ? C 18 ? 
1 B DT 12 1_555 C DA 4  1_555 B DC 13 1_555 C DG 3  1_555 0.116  0.428  3.255 3.259  2.699  36.122 0.309  0.268  3.275 4.334  
-5.233 36.361 9  BB_DT12DC13:DG17DA18_CC B 12 ? C 18 ? B 13 ? C 17 ? 
1 B DC 13 1_555 C DG 3  1_555 B DG 14 1_555 C DC 2  1_555 0.461  1.204  3.307 -3.135 15.354 24.486 -1.364 -1.690 3.379 32.315 
6.598  29.007 10 BB_DC13DG14:DC16DG17_CC B 13 ? C 17 ? B 14 ? C 16 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-sulfanyl-1,9-dihydro-6H-purin-6-one 2ON 
5 GLYCEROL                              GOL 
6 water                                 HOH 
#