data_4PEI
# 
_entry.id   4PEI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4PEI         
WWPDB D_1000201233 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4PEF PDB . 
unspecified 4PEG PDB . 
unspecified 4PEH PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  . 
_pdbx_database_status.entry_id                        4PEI 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  . 
_pdbx_database_status.methods_development_category    . 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Montemayor, E.J.' 1  ? 
'Katolik, A.'      2  ? 
'Clark, N.E.'      3  ? 
'Taylor, A.B.'     4  ? 
'Schuermann, J.P.' 5  ? 
'Combs, D.J.'      6  ? 
'Johnsson, R.'     7  ? 
'Holloway, S.P.'   8  ? 
'Stevens, S.W.'    9  ? 
'Damha, M.J.'      10 ? 
'Hart, P.J.'       11 ? 
# 
_citation.abstract                  . 
_citation.abstract_id_CAS           . 
_citation.book_id_ISBN              . 
_citation.book_publisher            ? 
_citation.book_publisher_city       . 
_citation.book_title                . 
_citation.coordinate_linkage        . 
_citation.country                   UK 
_citation.database_id_Medline       . 
_citation.details                   . 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              . 
_citation.journal_issue             . 
_citation.journal_volume            42 
_citation.language                  . 
_citation.page_first                10845 
_citation.page_last                 10855 
_citation.title                     'Structural basis of lariat RNA recognition by the intron debranching enzyme Dbr1.' 
_citation.year                      2014 
_citation.database_id_CSD           . 
_citation.pdbx_database_id_DOI      10.1093/nar/gku725 
_citation.pdbx_database_id_PubMed   25123664 
_citation.unpublished_flag          . 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Montemayor, E.J.' 1  
primary 'Katolik, A.'      2  
primary 'Clark, N.E.'      3  
primary 'Taylor, A.B.'     4  
primary 'Schuermann, J.P.' 5  
primary 'Combs, D.J.'      6  
primary 'Johnsson, R.'     7  
primary 'Holloway, S.P.'   8  
primary 'Stevens, S.W.'    9  
primary 'Damha, M.J.'      10 
primary 'Hart, P.J.'       11 
# 
_cell.entry_id           4PEI 
_cell.length_a           73.037 
_cell.length_b           142.479 
_cell.length_c           214.665 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4PEI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RNA lariat debranching enzyme, putative' 41197.199 5    ? C14S ? ? 
2 polymer     syn 
;RNA (5'-R(*UP*AP*AP*CP*A)-3')
;
1554.008  5    ? ?    ? ? 
3 polymer     syn 
;RNA (5'-R(*(G46)P*U)-3')
;
622.479   5    ? ?    ? ? 
4 non-polymer syn 'NICKEL (II) ION'                         58.693    5    ? ?    ? ? 
5 non-polymer syn 'SULFATE ION'                             96.063    5    ? ?    ? ? 
6 non-polymer syn GLYCEROL                                  92.094    6    ? ?    ? ? 
7 non-polymer syn 'TETRAETHYLENE GLYCOL'                    194.226   1    ? ?    ? ? 
8 water       nat water                                     18.015    1531 ? ?    ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no  
;GAMATEQIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKE
KAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTR
NYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAE
EGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELW
EKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNIN
;
;GAMATEQIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKE
KAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTR
NYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAE
EGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELW
EKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNIN
;
A,B,C,D,E ? 
2 polyribonucleotide no no  UAACA UAACA V,W,X,Y,Z ? 
3 polyribonucleotide no yes '(G46)U' GU Q,R,S,T,U ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   THR n 
1 6   GLU n 
1 7   GLN n 
1 8   ILE n 
1 9   GLN n 
1 10  HIS n 
1 11  ILE n 
1 12  ALA n 
1 13  ILE n 
1 14  VAL n 
1 15  GLY n 
1 16  SER n 
1 17  VAL n 
1 18  HIS n 
1 19  GLY n 
1 20  LYS n 
1 21  TYR n 
1 22  ARG n 
1 23  GLU n 
1 24  MET n 
1 25  TYR n 
1 26  ARG n 
1 27  GLN n 
1 28  LEU n 
1 29  SER n 
1 30  GLU n 
1 31  TYR n 
1 32  GLU n 
1 33  LYS n 
1 34  SER n 
1 35  THR n 
1 36  GLY n 
1 37  LYS n 
1 38  GLU n 
1 39  ILE n 
1 40  SER n 
1 41  PHE n 
1 42  VAL n 
1 43  ILE n 
1 44  CYS n 
1 45  THR n 
1 46  GLY n 
1 47  ASP n 
1 48  MET n 
1 49  GLN n 
1 50  THR n 
1 51  LEU n 
1 52  ARG n 
1 53  TYR n 
1 54  GLU n 
1 55  ALA n 
1 56  ASP n 
1 57  LEU n 
1 58  VAL n 
1 59  TYR n 
1 60  LEU n 
1 61  LYS n 
1 62  VAL n 
1 63  PRO n 
1 64  PRO n 
1 65  LYS n 
1 66  TYR n 
1 67  LYS n 
1 68  GLN n 
1 69  MET n 
1 70  GLY n 
1 71  ASP n 
1 72  PHE n 
1 73  HIS n 
1 74  LEU n 
1 75  TYR n 
1 76  TYR n 
1 77  GLU n 
1 78  GLY n 
1 79  LYS n 
1 80  GLU n 
1 81  LYS n 
1 82  ALA n 
1 83  PRO n 
1 84  TYR n 
1 85  LEU n 
1 86  THR n 
1 87  LEU n 
1 88  PHE n 
1 89  ILE n 
1 90  GLY n 
1 91  GLY n 
1 92  ASN n 
1 93  HIS n 
1 94  GLU n 
1 95  SER n 
1 96  SER n 
1 97  ASN n 
1 98  VAL n 
1 99  LEU n 
1 100 LEU n 
1 101 HIS n 
1 102 LEU n 
1 103 TYR n 
1 104 ASN n 
1 105 GLY n 
1 106 GLY n 
1 107 PHE n 
1 108 VAL n 
1 109 CYS n 
1 110 PHE n 
1 111 ASN n 
1 112 MET n 
1 113 TYR n 
1 114 TYR n 
1 115 LEU n 
1 116 GLY n 
1 117 VAL n 
1 118 CYS n 
1 119 SER n 
1 120 CYS n 
1 121 ILE n 
1 122 ASN n 
1 123 ILE n 
1 124 ASN n 
1 125 GLY n 
1 126 LEU n 
1 127 ARG n 
1 128 ILE n 
1 129 VAL n 
1 130 GLY n 
1 131 VAL n 
1 132 SER n 
1 133 GLY n 
1 134 ILE n 
1 135 TYR n 
1 136 LYS n 
1 137 SER n 
1 138 PHE n 
1 139 ASP n 
1 140 GLU n 
1 141 LYS n 
1 142 LYS n 
1 143 PRO n 
1 144 TYR n 
1 145 THR n 
1 146 TYR n 
1 147 PRO n 
1 148 PRO n 
1 149 SER n 
1 150 PRO n 
1 151 ASN n 
1 152 ASP n 
1 153 VAL n 
1 154 VAL n 
1 155 SER n 
1 156 LEU n 
1 157 PHE n 
1 158 HIS n 
1 159 THR n 
1 160 ARG n 
1 161 ASN n 
1 162 TYR n 
1 163 VAL n 
1 164 ILE n 
1 165 GLN n 
1 166 MET n 
1 167 LEU n 
1 168 SER n 
1 169 ASN n 
1 170 LEU n 
1 171 SER n 
1 172 GLN n 
1 173 SER n 
1 174 SER n 
1 175 GLN n 
1 176 ILE n 
1 177 ASP n 
1 178 ILE n 
1 179 SER n 
1 180 LEU n 
1 181 SER n 
1 182 HIS n 
1 183 ASP n 
1 184 TRP n 
1 185 PRO n 
1 186 GLN n 
1 187 GLY n 
1 188 ILE n 
1 189 VAL n 
1 190 MET n 
1 191 LYS n 
1 192 GLY n 
1 193 ASN n 
1 194 TYR n 
1 195 LYS n 
1 196 GLN n 
1 197 LEU n 
1 198 TYR n 
1 199 ARG n 
1 200 PHE n 
1 201 GLN n 
1 202 PRO n 
1 203 GLY n 
1 204 PHE n 
1 205 LYS n 
1 206 LYS n 
1 207 ASP n 
1 208 GLY n 
1 209 ALA n 
1 210 SER n 
1 211 LEU n 
1 212 GLY n 
1 213 SER n 
1 214 PRO n 
1 215 ILE n 
1 216 ASN n 
1 217 LYS n 
1 218 VAL n 
1 219 ILE n 
1 220 LEU n 
1 221 ASN n 
1 222 THR n 
1 223 LEU n 
1 224 LYS n 
1 225 PRO n 
1 226 LYS n 
1 227 TYR n 
1 228 TRP n 
1 229 ILE n 
1 230 SER n 
1 231 GLY n 
1 232 HIS n 
1 233 MET n 
1 234 HIS n 
1 235 CYS n 
1 236 GLU n 
1 237 TYR n 
1 238 HIS n 
1 239 ALA n 
1 240 GLU n 
1 241 GLU n 
1 242 GLY n 
1 243 PRO n 
1 244 THR n 
1 245 HIS n 
1 246 PHE n 
1 247 ILE n 
1 248 ALA n 
1 249 LEU n 
1 250 GLY n 
1 251 LYS n 
1 252 ILE n 
1 253 GLY n 
1 254 TYR n 
1 255 LYS n 
1 256 ASN n 
1 257 ALA n 
1 258 ILE n 
1 259 SER n 
1 260 TYR n 
1 261 LEU n 
1 262 ASP n 
1 263 LEU n 
1 264 PRO n 
1 265 LEU n 
1 266 LYS n 
1 267 GLN n 
1 268 LYS n 
1 269 THR n 
1 270 ASP n 
1 271 LEU n 
1 272 GLU n 
1 273 TYR n 
1 274 ASP n 
1 275 LYS n 
1 276 ASP n 
1 277 TRP n 
1 278 VAL n 
1 279 CYS n 
1 280 ASN n 
1 281 LEU n 
1 282 ILE n 
1 283 MET n 
1 284 THR n 
1 285 TRP n 
1 286 PRO n 
1 287 ALA n 
1 288 PHE n 
1 289 SER n 
1 290 ASN n 
1 291 LYS n 
1 292 ALA n 
1 293 GLN n 
1 294 PHE n 
1 295 PRO n 
1 296 ASP n 
1 297 LEU n 
1 298 SER n 
1 299 TYR n 
1 300 SER n 
1 301 ILE n 
1 302 SER n 
1 303 GLU n 
1 304 LEU n 
1 305 LEU n 
1 306 SER n 
1 307 LYS n 
1 308 ARG n 
1 309 THR n 
1 310 LYS n 
1 311 GLU n 
1 312 LEU n 
1 313 ASP n 
1 314 LYS n 
1 315 LYS n 
1 316 ILE n 
1 317 ILE n 
1 318 GLU n 
1 319 LEU n 
1 320 TRP n 
1 321 GLU n 
1 322 LYS n 
1 323 TYR n 
1 324 ILE n 
1 325 GLY n 
1 326 LEU n 
1 327 LYS n 
1 328 ILE n 
1 329 ILE n 
1 330 TYR n 
1 331 ASP n 
1 332 SER n 
1 333 ASP n 
1 334 THR n 
1 335 PHE n 
1 336 ASP n 
1 337 ILE n 
1 338 GLN n 
1 339 PHE n 
1 340 THR n 
1 341 SER n 
1 342 ARG n 
1 343 ARG n 
1 344 PHE n 
1 345 TYR n 
1 346 ILE n 
1 347 GLU n 
1 348 LYS n 
1 349 ILE n 
1 350 TYR n 
1 351 ASN n 
1 352 GLU n 
1 353 LEU n 
1 354 ASN n 
1 355 ILE n 
1 356 ASN n 
2 1   U   n 
2 2   A   n 
2 3   A   n 
2 4   C   n 
2 5   A   n 
3 1   G46 n 
3 2   U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   356 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 EHI_062730 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Entamoeba histolytica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5759 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       YEp351 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 5 'synthetic construct' ? 32630 ? 
3 1 sample 1 2 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP C4M1P9_ENTHI C4M1P9 ? 1 
;MATEQIQHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKA
PYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNY
VIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEG
PTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEK
YIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNIN
;
1 
2 PDB 4PEI         4PEI   ? 2 ? 1 
3 PDB 4PEI         4PEI   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4PEI A 3 ? 356 ? C4M1P9 1   ? 354 ? 1   354 
2  2 4PEI V 1 ? 5   ? 4PEI   499 ? 503 ? 499 503 
3  3 4PEI Q 1 ? 2   ? 4PEI   510 ? 511 ? 510 511 
4  1 4PEI B 3 ? 356 ? C4M1P9 1   ? 354 ? 1   354 
5  2 4PEI W 1 ? 5   ? 4PEI   499 ? 503 ? 499 503 
6  3 4PEI R 1 ? 2   ? 4PEI   510 ? 511 ? 510 511 
7  1 4PEI C 3 ? 356 ? C4M1P9 1   ? 354 ? 1   354 
8  2 4PEI X 1 ? 5   ? 4PEI   499 ? 503 ? 499 503 
9  3 4PEI S 1 ? 2   ? 4PEI   510 ? 511 ? 510 511 
10 1 4PEI D 3 ? 356 ? C4M1P9 1   ? 354 ? 1   354 
11 2 4PEI Y 1 ? 5   ? 4PEI   499 ? 503 ? 499 503 
12 3 4PEI T 1 ? 2   ? 4PEI   510 ? 511 ? 510 511 
13 1 4PEI E 3 ? 356 ? C4M1P9 1   ? 354 ? 1   354 
14 2 4PEI Z 1 ? 5   ? 4PEI   499 ? 503 ? 499 503 
15 3 4PEI U 1 ? 2   ? 4PEI   501 ? 502 ? 501 502 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4PEI GLY A 1  ? UNP C4M1P9 ?   ?  'expression tag'      -1 1  
1  4PEI ALA A 2  ? UNP C4M1P9 ?   ?  'expression tag'      0  2  
1  4PEI SER A 16 ? UNP C4M1P9 CYS 14 'engineered mutation' 14 3  
4  4PEI GLY B 1  ? UNP C4M1P9 ?   ?  'expression tag'      -1 4  
4  4PEI ALA B 2  ? UNP C4M1P9 ?   ?  'expression tag'      0  5  
4  4PEI SER B 16 ? UNP C4M1P9 CYS 14 'engineered mutation' 14 6  
7  4PEI GLY C 1  ? UNP C4M1P9 ?   ?  'expression tag'      -1 7  
7  4PEI ALA C 2  ? UNP C4M1P9 ?   ?  'expression tag'      0  8  
7  4PEI SER C 16 ? UNP C4M1P9 CYS 14 'engineered mutation' 14 9  
10 4PEI GLY D 1  ? UNP C4M1P9 ?   ?  'expression tag'      -1 10 
10 4PEI ALA D 2  ? UNP C4M1P9 ?   ?  'expression tag'      0  11 
10 4PEI SER D 16 ? UNP C4M1P9 CYS 14 'engineered mutation' 14 12 
13 4PEI GLY E 1  ? UNP C4M1P9 ?   ?  'expression tag'      -1 13 
13 4PEI ALA E 2  ? UNP C4M1P9 ?   ?  'expression tag'      0  14 
13 4PEI SER E 16 ? UNP C4M1P9 CYS 14 'engineered mutation' 14 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"     ?                               'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                          ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                         ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                       ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                  ?                               'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"      ?                               'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                         ?                               'C3 H7 N O2 S'      121.158 
G46 'RNA linking'       n "GUANOSINE-5'-MONOTHIOPHOSPHATE" "5'-O-thiophosphonoguanosine"   'C10 H14 N5 O7 P S' 379.286 
GLN 'L-peptide linking' y GLUTAMINE                        ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                  ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                          ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                        ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                            ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                       ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                          ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                           ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                       ?                               'C5 H11 N O2 S'     149.211 
NI  non-polymer         . 'NICKEL (II) ION'                ?                               'Ni 2'              58.693  
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'           ?                               'C8 H18 O5'         194.226 
PHE 'L-peptide linking' y PHENYLALANINE                    ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                          ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                           ?                               'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                    ?                               'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                        ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                       ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                         ?                               'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"       ?                               'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                           ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     . 
_exptl.absorpt_correction_T_max   . 
_exptl.absorpt_correction_T_min   . 
_exptl.absorpt_correction_type    . 
_exptl.absorpt_process_details    . 
_exptl.entry_id                   4PEI 
_exptl.crystals_number            . 
_exptl.details                    . 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             . 
# 
_exptl_crystal.colour                      . 
_exptl_crystal.density_diffrn              . 
_exptl_crystal.density_Matthews            2.63 
_exptl_crystal.density_method              . 
_exptl_crystal.density_percent_sol         53.26 
_exptl_crystal.description                 . 
_exptl_crystal.F_000                       . 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 . 
_exptl_crystal.size_max                    . 
_exptl_crystal.size_mid                    . 
_exptl_crystal.size_min                    . 
_exptl_crystal.size_rad                    . 
_exptl_crystal.colour_lustre               . 
_exptl_crystal.colour_modifier             . 
_exptl_crystal.colour_primary              . 
_exptl_crystal.density_meas                . 
_exptl_crystal.density_meas_esd            . 
_exptl_crystal.density_meas_gt             . 
_exptl_crystal.density_meas_lt             . 
_exptl_crystal.density_meas_temp           . 
_exptl_crystal.density_meas_temp_esd       . 
_exptl_crystal.density_meas_temp_gt        . 
_exptl_crystal.density_meas_temp_lt        . 
_exptl_crystal.pdbx_crystal_image_url      . 
_exptl_crystal.pdbx_crystal_image_format   . 
_exptl_crystal.pdbx_mosaicity              . 
_exptl_crystal.pdbx_mosaicity_esd          . 
# 
_exptl_crystal_grow.apparatus       . 
_exptl_crystal_grow.atmosphere      . 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         . 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      . 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        . 
_exptl_crystal_grow.pressure_esd    . 
_exptl_crystal_grow.seeding         . 
_exptl_crystal_grow.seeding_ref     . 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    . 
_exptl_crystal_grow.temp_esd        . 
_exptl_crystal_grow.time            . 
_exptl_crystal_grow.pdbx_details    
'0.2 M lithium sulfate, 0.1 M bis-tris, 25% PEG 3350, 8.5 % glycerol, 2.0 mM nickel sulfate, 2.0 mM AK65' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.ambient_environment    . 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   . 
_diffrn.ambient_temp_esd       . 
_diffrn.crystal_id             1 
_diffrn.crystal_support        . 
_diffrn.crystal_treatment      . 
_diffrn.details                . 
_diffrn.id                     1 
_diffrn.ambient_pressure       . 
_diffrn.ambient_pressure_esd   . 
_diffrn.ambient_pressure_gt    . 
_diffrn.ambient_pressure_lt    . 
_diffrn.ambient_temp_gt        . 
_diffrn.ambient_temp_lt        . 
# 
_diffrn_detector.details                      . 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              . 
_diffrn_detector.dtime                        . 
_diffrn_detector.pdbx_frames_total            . 
_diffrn_detector.pdbx_collection_time_total   . 
_diffrn_detector.pdbx_collection_date         2011-12-04 
# 
_diffrn_radiation.collimation                      . 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      . 
_diffrn_radiation.inhomogeneity                    . 
_diffrn_radiation.monochromator                    . 
_diffrn_radiation.polarisn_norm                    . 
_diffrn_radiation.polarisn_ratio                   . 
_diffrn_radiation.probe                            . 
_diffrn_radiation.type                             . 
_diffrn_radiation.xray_symbol                      . 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             . 
_diffrn_radiation.pdbx_wavelength                  . 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    . 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     . 
_diffrn_source.details                     . 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       . 
_diffrn_source.size                        . 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      . 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     . 
_diffrn_source.take-off_angle              . 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             . 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4PEI 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.110 
_reflns.d_resolution_high            1.950 
_reflns.number_obs                   161620 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.09700 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.1000 
_reflns.B_iso_Wilson_estimate        23.50 
_reflns.pdbx_redundancy              4.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.06 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.51000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.100 
_reflns_shell.pdbx_redundancy        4.10 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4PEI 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     161552 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.37 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.020 
_refine.ls_number_reflns_R_free                  8110 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.40 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.240 
_refine.pdbx_overall_phase_error                 22.230 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14277 
_refine_hist.pdbx_number_atoms_nucleic_acid   255 
_refine_hist.pdbx_number_atoms_ligand         79 
_refine_hist.number_atoms_solvent             1531 
_refine_hist.number_atoms_total               16142 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        46.37 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.014  ? ? 15111 'X-RAY DIFFRACTION' ? 
f_angle_d          1.498  ? ? 20478 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.611 ? ? 5636  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.103  ? ? 2152  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 2528  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.9500 1.9722  5133 0.2821 100.00 0.3249 . . 276 . . 
'X-RAY DIFFRACTION' . 1.9722 1.9954  5086 0.2593 100.00 0.3219 . . 256 . . 
'X-RAY DIFFRACTION' . 1.9954 2.0197  5110 0.2406 100.00 0.2806 . . 284 . . 
'X-RAY DIFFRACTION' . 2.0197 2.0453  5109 0.2321 100.00 0.2865 . . 319 . . 
'X-RAY DIFFRACTION' . 2.0453 2.0722  5090 0.2303 100.00 0.2749 . . 273 . . 
'X-RAY DIFFRACTION' . 2.0722 2.1006  5145 0.2252 100.00 0.2811 . . 262 . . 
'X-RAY DIFFRACTION' . 2.1006 2.1306  5124 0.2125 100.00 0.2717 . . 272 . . 
'X-RAY DIFFRACTION' . 2.1306 2.1624  5134 0.2171 100.00 0.2789 . . 264 . . 
'X-RAY DIFFRACTION' . 2.1624 2.1962  5129 0.2165 100.00 0.2735 . . 261 . . 
'X-RAY DIFFRACTION' . 2.1962 2.2322  5089 0.2003 100.00 0.2490 . . 271 . . 
'X-RAY DIFFRACTION' . 2.2322 2.2707  5131 0.2023 100.00 0.2625 . . 279 . . 
'X-RAY DIFFRACTION' . 2.2707 2.3119  5108 0.2036 100.00 0.2751 . . 260 . . 
'X-RAY DIFFRACTION' . 2.3119 2.3564  5132 0.1997 100.00 0.2404 . . 289 . . 
'X-RAY DIFFRACTION' . 2.3564 2.4045  5119 0.1924 100.00 0.2580 . . 257 . . 
'X-RAY DIFFRACTION' . 2.4045 2.4568  5112 0.2017 99.00  0.2412 . . 284 . . 
'X-RAY DIFFRACTION' . 2.4568 2.5139  5140 0.1999 99.00  0.2560 . . 267 . . 
'X-RAY DIFFRACTION' . 2.5139 2.5768  5124 0.1935 99.00  0.2494 . . 249 . . 
'X-RAY DIFFRACTION' . 2.5768 2.6465  5079 0.1909 99.00  0.2397 . . 279 . . 
'X-RAY DIFFRACTION' . 2.6465 2.7243  5147 0.1999 99.00  0.2477 . . 254 . . 
'X-RAY DIFFRACTION' . 2.7243 2.8122  5137 0.1931 99.00  0.2473 . . 272 . . 
'X-RAY DIFFRACTION' . 2.8122 2.9127  5063 0.1845 98.00  0.2311 . . 293 . . 
'X-RAY DIFFRACTION' . 2.9127 3.0293  5090 0.1833 98.00  0.2629 . . 271 . . 
'X-RAY DIFFRACTION' . 3.0293 3.1672  5107 0.1830 98.00  0.2238 . . 258 . . 
'X-RAY DIFFRACTION' . 3.1672 3.3341  5095 0.1718 98.00  0.2076 . . 260 . . 
'X-RAY DIFFRACTION' . 3.3341 3.5429  5058 0.1656 97.00  0.2023 . . 254 . . 
'X-RAY DIFFRACTION' . 3.5429 3.8164  5098 0.1642 97.00  0.2170 . . 262 . . 
'X-RAY DIFFRACTION' . 3.8164 4.2002  5057 0.1551 97.00  0.1765 . . 285 . . 
'X-RAY DIFFRACTION' . 4.2002 4.8074  5098 0.1371 97.00  0.1729 . . 262 . . 
'X-RAY DIFFRACTION' . 4.8074 6.0548  5170 0.1546 97.00  0.1874 . . 258 . . 
'X-RAY DIFFRACTION' . 6.0548 46.3847 5228 0.1718 94.00  0.1967 . . 279 . . 
# 
_struct.entry_id                     4PEI 
_struct.title                        'Dbr1 in complex with synthetic branched RNA analog' 
_struct.pdbx_descriptor              'RNA Lariat Debranching Enzyme/RNA Complex' 
_struct.pdbx_model_details           . 
_struct.pdbx_formula_weight          . 
_struct.pdbx_formula_weight_method   . 
_struct.pdbx_model_type_details      . 
_struct.pdbx_CASP_flag               . 
# 
_struct_keywords.entry_id        4PEI 
_struct_keywords.text            
'NUCLEASE, PHOSPHODIESTERASE, METALLOHYDROLASE, METALLOPHOSPHOESTERASE, LARIAT RNA, HYDROLASE, METALLOENZYME, HYDROLASE-RNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 4 ? 
Q  N N 5 ? 
R  N N 6 ? 
S  N N 6 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 7 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 4 ? 
BA N N 5 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 4 ? 
FA N N 5 ? 
GA N N 8 ? 
HA N N 8 ? 
IA N N 8 ? 
JA N N 8 ? 
KA N N 8 ? 
LA N N 8 ? 
MA N N 8 ? 
NA N N 8 ? 
OA N N 8 ? 
PA N N 8 ? 
QA N N 8 ? 
RA N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 20  ? GLY A 36  ? LYS A 18  GLY A 34  1 ? 17 
HELX_P HELX_P2  AA2 TYR A 53  ? LEU A 60  ? TYR A 51  LEU A 58  5 ? 8  
HELX_P HELX_P3  AA3 PRO A 63  ? LYS A 67  ? PRO A 61  LYS A 65  5 ? 5  
HELX_P HELX_P4  AA4 ASP A 71  ? GLU A 77  ? ASP A 69  GLU A 75  1 ? 7  
HELX_P HELX_P5  AA5 SER A 95  ? LEU A 102 ? SER A 93  LEU A 100 1 ? 8  
HELX_P HELX_P6  AA6 LYS A 136 ? GLU A 140 ? LYS A 134 GLU A 138 5 ? 5  
HELX_P HELX_P7  AA7 SER A 149 ? SER A 155 ? SER A 147 SER A 153 5 ? 7  
HELX_P HELX_P8  AA8 ASN A 161 ? SER A 168 ? ASN A 159 SER A 166 1 ? 8  
HELX_P HELX_P9  AA9 GLY A 187 ? GLY A 192 ? GLY A 185 GLY A 190 5 ? 6  
HELX_P HELX_P10 AB1 ASN A 193 ? GLN A 201 ? ASN A 191 GLN A 199 1 ? 9  
HELX_P HELX_P11 AB2 PRO A 202 ? LEU A 211 ? PRO A 200 LEU A 209 5 ? 10 
HELX_P HELX_P12 AB3 SER A 213 ? LYS A 224 ? SER A 211 LYS A 222 1 ? 12 
HELX_P HELX_P13 AB4 TYR A 254 ? ASN A 256 ? TYR A 252 ASN A 254 5 ? 3  
HELX_P HELX_P14 AB5 ASP A 274 ? THR A 284 ? ASP A 272 THR A 282 1 ? 11 
HELX_P HELX_P15 AB6 THR A 284 ? SER A 289 ? THR A 282 SER A 287 1 ? 6  
HELX_P HELX_P16 AB7 SER A 300 ? LYS A 307 ? SER A 298 LYS A 305 1 ? 8  
HELX_P HELX_P17 AB8 THR A 309 ? ILE A 324 ? THR A 307 ILE A 322 1 ? 16 
HELX_P HELX_P18 AB9 THR A 334 ? ASN A 354 ? THR A 332 ASN A 352 1 ? 21 
HELX_P HELX_P19 AC1 LYS D 20  ? GLY D 36  ? LYS B 18  GLY B 34  1 ? 17 
HELX_P HELX_P20 AC2 TYR D 53  ? LEU D 60  ? TYR B 51  LEU B 58  5 ? 8  
HELX_P HELX_P21 AC3 PRO D 63  ? LYS D 67  ? PRO B 61  LYS B 65  5 ? 5  
HELX_P HELX_P22 AC4 ASP D 71  ? GLU D 77  ? ASP B 69  GLU B 75  1 ? 7  
HELX_P HELX_P23 AC5 SER D 95  ? LEU D 102 ? SER B 93  LEU B 100 1 ? 8  
HELX_P HELX_P24 AC6 LYS D 136 ? GLU D 140 ? LYS B 134 GLU B 138 5 ? 5  
HELX_P HELX_P25 AC7 SER D 149 ? SER D 155 ? SER B 147 SER B 153 5 ? 7  
HELX_P HELX_P26 AC8 TYR D 162 ? SER D 168 ? TYR B 160 SER B 166 1 ? 7  
HELX_P HELX_P27 AC9 GLY D 187 ? GLY D 192 ? GLY B 185 GLY B 190 5 ? 6  
HELX_P HELX_P28 AD1 ASN D 193 ? GLN D 201 ? ASN B 191 GLN B 199 1 ? 9  
HELX_P HELX_P29 AD2 GLY D 203 ? GLY D 208 ? GLY B 201 GLY B 206 1 ? 6  
HELX_P HELX_P30 AD3 ALA D 209 ? LEU D 211 ? ALA B 207 LEU B 209 5 ? 3  
HELX_P HELX_P31 AD4 SER D 213 ? LYS D 224 ? SER B 211 LYS B 222 1 ? 12 
HELX_P HELX_P32 AD5 TYR D 254 ? ASN D 256 ? TYR B 252 ASN B 254 5 ? 3  
HELX_P HELX_P33 AD6 ASP D 274 ? THR D 284 ? ASP B 272 THR B 282 1 ? 11 
HELX_P HELX_P34 AD7 TRP D 285 ? PHE D 288 ? TRP B 283 PHE B 286 5 ? 4  
HELX_P HELX_P35 AD8 SER D 300 ? LYS D 307 ? SER B 298 LYS B 305 1 ? 8  
HELX_P HELX_P36 AD9 THR D 309 ? ILE D 324 ? THR B 307 ILE B 322 1 ? 16 
HELX_P HELX_P37 AE1 THR D 334 ? LEU D 353 ? THR B 332 LEU B 351 1 ? 20 
HELX_P HELX_P38 AE2 LYS G 20  ? GLY G 36  ? LYS C 18  GLY C 34  1 ? 17 
HELX_P HELX_P39 AE3 TYR G 53  ? LEU G 60  ? TYR C 51  LEU C 58  5 ? 8  
HELX_P HELX_P40 AE4 PRO G 63  ? LYS G 67  ? PRO C 61  LYS C 65  5 ? 5  
HELX_P HELX_P41 AE5 ASP G 71  ? GLU G 77  ? ASP C 69  GLU C 75  1 ? 7  
HELX_P HELX_P42 AE6 SER G 95  ? LEU G 102 ? SER C 93  LEU C 100 1 ? 8  
HELX_P HELX_P43 AE7 LYS G 136 ? GLU G 140 ? LYS C 134 GLU C 138 5 ? 5  
HELX_P HELX_P44 AE8 SER G 149 ? SER G 155 ? SER C 147 SER C 153 5 ? 7  
HELX_P HELX_P45 AE9 TYR G 162 ? SER G 168 ? TYR C 160 SER C 166 1 ? 7  
HELX_P HELX_P46 AF1 GLY G 187 ? GLY G 192 ? GLY C 185 GLY C 190 5 ? 6  
HELX_P HELX_P47 AF2 ASN G 193 ? GLN G 201 ? ASN C 191 GLN C 199 1 ? 9  
HELX_P HELX_P48 AF3 PRO G 202 ? LYS G 206 ? PRO C 200 LYS C 204 5 ? 5  
HELX_P HELX_P49 AF4 ASP G 207 ? LEU G 211 ? ASP C 205 LEU C 209 5 ? 5  
HELX_P HELX_P50 AF5 SER G 213 ? LYS G 224 ? SER C 211 LYS C 222 1 ? 12 
HELX_P HELX_P51 AF6 ASP G 274 ? THR G 284 ? ASP C 272 THR C 282 1 ? 11 
HELX_P HELX_P52 AF7 THR G 284 ? SER G 289 ? THR C 282 SER C 287 1 ? 6  
HELX_P HELX_P53 AF8 SER G 300 ? LYS G 307 ? SER C 298 LYS C 305 1 ? 8  
HELX_P HELX_P54 AF9 THR G 309 ? ILE G 324 ? THR C 307 ILE C 322 1 ? 16 
HELX_P HELX_P55 AG1 THR G 334 ? ASN G 354 ? THR C 332 ASN C 352 1 ? 21 
HELX_P HELX_P56 AG2 LYS J 20  ? GLY J 36  ? LYS D 18  GLY D 34  1 ? 17 
HELX_P HELX_P57 AG3 TYR J 53  ? LEU J 60  ? TYR D 51  LEU D 58  5 ? 8  
HELX_P HELX_P58 AG4 PRO J 63  ? LYS J 67  ? PRO D 61  LYS D 65  5 ? 5  
HELX_P HELX_P59 AG5 ASP J 71  ? GLU J 77  ? ASP D 69  GLU D 75  1 ? 7  
HELX_P HELX_P60 AG6 SER J 95  ? LEU J 102 ? SER D 93  LEU D 100 1 ? 8  
HELX_P HELX_P61 AG7 LYS J 136 ? GLU J 140 ? LYS D 134 GLU D 138 5 ? 5  
HELX_P HELX_P62 AG8 SER J 149 ? VAL J 153 ? SER D 147 VAL D 151 5 ? 5  
HELX_P HELX_P63 AG9 TYR J 162 ? SER J 168 ? TYR D 160 SER D 166 1 ? 7  
HELX_P HELX_P64 AH1 GLY J 187 ? GLY J 192 ? GLY D 185 GLY D 190 5 ? 6  
HELX_P HELX_P65 AH2 ASN J 193 ? GLN J 201 ? ASN D 191 GLN D 199 1 ? 9  
HELX_P HELX_P66 AH3 GLN J 201 ? LYS J 206 ? GLN D 199 LYS D 204 1 ? 6  
HELX_P HELX_P67 AH4 ASP J 207 ? LEU J 211 ? ASP D 205 LEU D 209 5 ? 5  
HELX_P HELX_P68 AH5 SER J 213 ? LYS J 224 ? SER D 211 LYS D 222 1 ? 12 
HELX_P HELX_P69 AH6 TYR J 254 ? ASN J 256 ? TYR D 252 ASN D 254 5 ? 3  
HELX_P HELX_P70 AH7 ASP J 274 ? THR J 284 ? ASP D 272 THR D 282 1 ? 11 
HELX_P HELX_P71 AH8 THR J 284 ? SER J 289 ? THR D 282 SER D 287 1 ? 6  
HELX_P HELX_P72 AH9 SER J 300 ? SER J 306 ? SER D 298 SER D 304 1 ? 7  
HELX_P HELX_P73 AI1 THR J 309 ? ILE J 324 ? THR D 307 ILE D 322 1 ? 16 
HELX_P HELX_P74 AI2 THR J 334 ? LEU J 353 ? THR D 332 LEU D 351 1 ? 20 
HELX_P HELX_P75 AI3 LYS M 20  ? GLY M 36  ? LYS E 18  GLY E 34  1 ? 17 
HELX_P HELX_P76 AI4 TYR M 53  ? LEU M 60  ? TYR E 51  LEU E 58  5 ? 8  
HELX_P HELX_P77 AI5 PRO M 63  ? LYS M 67  ? PRO E 61  LYS E 65  5 ? 5  
HELX_P HELX_P78 AI6 ASP M 71  ? GLU M 77  ? ASP E 69  GLU E 75  1 ? 7  
HELX_P HELX_P79 AI7 SER M 95  ? LEU M 102 ? SER E 93  LEU E 100 1 ? 8  
HELX_P HELX_P80 AI8 LYS M 136 ? GLU M 140 ? LYS E 134 GLU E 138 5 ? 5  
HELX_P HELX_P81 AI9 SER M 149 ? VAL M 153 ? SER E 147 VAL E 151 5 ? 5  
HELX_P HELX_P82 AJ1 TYR M 162 ? SER M 168 ? TYR E 160 SER E 166 1 ? 7  
HELX_P HELX_P83 AJ2 ASN M 169 ? GLN M 172 ? ASN E 167 GLN E 170 5 ? 4  
HELX_P HELX_P84 AJ3 GLY M 187 ? GLY M 192 ? GLY E 185 GLY E 190 5 ? 6  
HELX_P HELX_P85 AJ4 ASN M 193 ? GLN M 201 ? ASN E 191 GLN E 199 1 ? 9  
HELX_P HELX_P86 AJ5 PRO M 202 ? LYS M 206 ? PRO E 200 LYS E 204 5 ? 5  
HELX_P HELX_P87 AJ6 ASP M 207 ? LEU M 211 ? ASP E 205 LEU E 209 5 ? 5  
HELX_P HELX_P88 AJ7 SER M 213 ? LYS M 224 ? SER E 211 LYS E 222 1 ? 12 
HELX_P HELX_P89 AJ8 TYR M 254 ? ASN M 256 ? TYR E 252 ASN E 254 5 ? 3  
HELX_P HELX_P90 AJ9 ASP M 274 ? THR M 284 ? ASP E 272 THR E 282 1 ? 11 
HELX_P HELX_P91 AK1 TRP M 285 ? SER M 289 ? TRP E 283 SER E 287 5 ? 5  
HELX_P HELX_P92 AK2 SER M 300 ? LYS M 307 ? SER E 298 LYS E 305 1 ? 8  
HELX_P HELX_P93 AK3 THR M 309 ? ILE M 324 ? THR E 307 ILE E 322 1 ? 16 
HELX_P HELX_P94 AK4 THR M 334 ? LEU M 353 ? THR E 332 LEU E 351 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A  ASP 47  OD2   ? ? ? 1_555 P  NI  . NI  ? ? A ASP 45  A NI  401 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc2  metalc ?    ? A  ASN 92  OD1   ? ? ? 1_555 P  NI  . NI  ? ? A ASN 90  A NI  401 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc3  metalc ?    ? A  HIS 182 NE2   ? ? ? 1_555 P  NI  . NI  ? ? A HIS 180 A NI  401 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc4  metalc ?    ? A  HIS 232 ND1   ? ? ? 1_555 P  NI  . NI  ? ? A HIS 230 A NI  401 1_555 ? ? ? ? ? ? ? 2.356 ? 
covale1  covale none ? B  A   3   "C2'" ? ? ? 1_555 C  G46 1 O3P ? ? V A   501 Q G46 510 1_555 ? ? ? ? ? ? ? 1.409 ? 
metalc5  metalc ?    ? C  G46 1   O1P   ? ? ? 1_555 P  NI  . NI  ? ? Q G46 510 A NI  401 1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc6  metalc ?    ? D  ASP 47  OD2   ? ? ? 1_555 T  NI  . NI  ? ? B ASP 45  B NI  401 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc7  metalc ?    ? D  ASN 92  OD1   ? ? ? 1_555 T  NI  . NI  ? ? B ASN 90  B NI  401 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc8  metalc ?    ? D  HIS 182 NE2   ? ? ? 1_555 T  NI  . NI  ? ? B HIS 180 B NI  401 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc9  metalc ?    ? D  HIS 232 ND1   ? ? ? 1_555 T  NI  . NI  ? ? B HIS 230 B NI  401 1_555 ? ? ? ? ? ? ? 2.263 ? 
covale2  covale none ? E  A   3   "C2'" ? ? ? 1_555 F  G46 1 O3P ? ? W A   501 R G46 510 1_555 ? ? ? ? ? ? ? 1.438 ? 
metalc10 metalc ?    ? F  G46 1   O1P   ? ? ? 1_555 T  NI  . NI  ? ? R G46 510 B NI  401 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc11 metalc ?    ? G  ASP 47  OD2   ? ? ? 1_555 W  NI  . NI  ? ? C ASP 45  C NI  401 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc12 metalc ?    ? G  ASN 92  OD1   ? ? ? 1_555 W  NI  . NI  ? ? C ASN 90  C NI  401 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc13 metalc ?    ? G  HIS 182 NE2   ? ? ? 1_555 W  NI  . NI  ? ? C HIS 180 C NI  401 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc14 metalc ?    ? G  HIS 232 ND1   ? ? ? 1_555 W  NI  . NI  ? ? C HIS 230 C NI  401 1_555 ? ? ? ? ? ? ? 2.224 ? 
covale3  covale none ? H  A   3   "C2'" ? ? ? 1_555 I  G46 1 O3P ? ? X A   501 S G46 510 1_555 ? ? ? ? ? ? ? 1.415 ? 
metalc15 metalc ?    ? H  A   5   OP2   ? ? ? 1_555 W  NI  . NI  ? ? X A   503 C NI  401 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc16 metalc ?    ? J  ASP 47  OD2   ? ? ? 1_555 AA NI  . NI  ? ? D ASP 45  D NI  401 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc17 metalc ?    ? J  ASN 92  OD1   ? ? ? 1_555 AA NI  . NI  ? ? D ASN 90  D NI  401 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc18 metalc ?    ? J  HIS 182 NE2   ? ? ? 1_555 AA NI  . NI  ? ? D HIS 180 D NI  401 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc19 metalc ?    ? J  HIS 232 ND1   ? ? ? 1_555 AA NI  . NI  ? ? D HIS 230 D NI  401 1_555 ? ? ? ? ? ? ? 2.369 ? 
covale4  covale none ? K  A   3   "C2'" ? ? ? 1_555 L  G46 1 O3P ? ? Y A   501 T G46 510 1_555 ? ? ? ? ? ? ? 1.442 ? 
metalc20 metalc ?    ? L  G46 1   O1P   ? ? ? 1_555 AA NI  . NI  ? ? T G46 510 D NI  401 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc21 metalc ?    ? M  ASP 47  OD2   ? ? ? 1_555 EA NI  . NI  ? ? E ASP 45  E NI  401 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc22 metalc ?    ? M  ASN 92  OD1   ? ? ? 1_555 EA NI  . NI  ? ? E ASN 90  E NI  401 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc23 metalc ?    ? M  HIS 182 NE2   ? ? ? 1_555 EA NI  . NI  ? ? E HIS 180 E NI  401 1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc24 metalc ?    ? M  HIS 232 ND1   ? ? ? 1_555 EA NI  . NI  ? ? E HIS 230 E NI  401 1_555 ? ? ? ? ? ? ? 2.158 ? 
covale5  covale none ? N  A   3   "C2'" ? ? ? 1_555 O  G46 1 O3P ? ? Z A   501 U G46 501 1_555 ? ? ? ? ? ? ? 1.415 ? 
metalc25 metalc ?    ? N  A   5   OP2   ? ? ? 1_555 EA NI  . NI  ? ? Z A   503 E NI  401 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc26 metalc ?    ? P  NI  .   NI    ? ? ? 1_555 GA HOH . O   ? ? A NI  401 A HOH 550 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc27 metalc ?    ? T  NI  .   NI    ? ? ? 1_555 JA HOH . O   ? ? B NI  401 B HOH 511 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc28 metalc ?    ? W  NI  .   NI    ? ? ? 1_555 MA HOH . O   ? ? C NI  401 C HOH 825 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc29 metalc ?    ? AA NI  .   NI    ? ? ? 1_555 OA HOH . O   ? ? D NI  401 D HOH 800 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc30 metalc ?    ? EA NI  .   NI    ? ? ? 1_555 QA HOH . O   ? ? E NI  401 E HOH 777 1_555 ? ? ? ? ? ? ? 2.227 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 146 A . ? TYR 144 A PRO 147 A ? PRO 145 A 1 2.47  
2  PHE 294 A . ? PHE 292 A PRO 295 A ? PRO 293 A 1 -4.87 
3  TYR 146 D . ? TYR 144 B PRO 147 D ? PRO 145 B 1 -0.22 
4  PHE 294 D . ? PHE 292 B PRO 295 D ? PRO 293 B 1 -3.56 
5  TYR 146 G . ? TYR 144 C PRO 147 G ? PRO 145 C 1 2.26  
6  PHE 294 G . ? PHE 292 C PRO 295 G ? PRO 293 C 1 -4.51 
7  TYR 146 J . ? TYR 144 D PRO 147 J ? PRO 145 D 1 4.50  
8  PHE 294 J . ? PHE 292 D PRO 295 J ? PRO 293 D 1 -8.98 
9  TYR 146 M . ? TYR 144 E PRO 147 M ? PRO 145 E 1 1.80  
10 PHE 294 M . ? PHE 292 E PRO 295 M ? PRO 293 E 1 -7.83 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 7 ? 
AA3 ? 2 ? 
AA4 ? 6 ? 
AA5 ? 7 ? 
AA6 ? 2 ? 
AA7 ? 6 ? 
AA8 ? 7 ? 
AA9 ? 2 ? 
AB1 ? 6 ? 
AB2 ? 7 ? 
AB3 ? 2 ? 
AB4 ? 6 ? 
AB5 ? 7 ? 
AB6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA5 5 6 ? anti-parallel 
AA5 6 7 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA7 5 6 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? anti-parallel 
AA8 6 7 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB1 3 4 ? parallel      
AB1 4 5 ? parallel      
AB1 5 6 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? parallel      
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB4 5 6 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB5 5 6 ? anti-parallel 
AB5 6 7 ? anti-parallel 
AB6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 106 ? CYS A 109 ? GLY A 104 CYS A 107 
AA1 2 MET A 112 ? TYR A 114 ? MET A 110 TYR A 112 
AA1 3 THR A 86  ? PHE A 88  ? THR A 84  PHE A 86  
AA1 4 ILE A 39  ? CYS A 44  ? ILE A 37  CYS A 42  
AA1 5 ILE A 8   ? VAL A 14  ? ILE A 6   VAL A 12  
AA1 6 ILE A 258 ? PRO A 264 ? ILE A 256 PRO A 262 
AA2 1 TYR A 237 ? GLU A 241 ? TYR A 235 GLU A 239 
AA2 2 THR A 244 ? ALA A 248 ? THR A 242 ALA A 246 
AA2 3 TYR A 227 ? SER A 230 ? TYR A 225 SER A 228 
AA2 4 ILE A 178 ? SER A 181 ? ILE A 176 SER A 179 
AA2 5 LEU A 126 ? VAL A 131 ? LEU A 124 VAL A 129 
AA2 6 CYS A 118 ? ILE A 123 ? CYS A 116 ILE A 121 
AA2 7 GLU A 272 ? TYR A 273 ? GLU A 270 TYR A 271 
AA3 1 TYR A 144 ? THR A 145 ? TYR A 142 THR A 143 
AA3 2 GLN A 293 ? PHE A 294 ? GLN A 291 PHE A 292 
AA4 1 GLY D 106 ? CYS D 109 ? GLY B 104 CYS B 107 
AA4 2 MET D 112 ? TYR D 114 ? MET B 110 TYR B 112 
AA4 3 THR D 86  ? PHE D 88  ? THR B 84  PHE B 86  
AA4 4 ILE D 39  ? CYS D 44  ? ILE B 37  CYS B 42  
AA4 5 ILE D 8   ? VAL D 14  ? ILE B 6   VAL B 12  
AA4 6 ILE D 258 ? PRO D 264 ? ILE B 256 PRO B 262 
AA5 1 TYR D 237 ? GLU D 241 ? TYR B 235 GLU B 239 
AA5 2 THR D 244 ? ALA D 248 ? THR B 242 ALA B 246 
AA5 3 TYR D 227 ? SER D 230 ? TYR B 225 SER B 228 
AA5 4 ILE D 178 ? SER D 181 ? ILE B 176 SER B 179 
AA5 5 LEU D 126 ? VAL D 131 ? LEU B 124 VAL B 129 
AA5 6 CYS D 118 ? ILE D 123 ? CYS B 116 ILE B 121 
AA5 7 GLU D 272 ? TYR D 273 ? GLU B 270 TYR B 271 
AA6 1 TYR D 144 ? THR D 145 ? TYR B 142 THR B 143 
AA6 2 GLN D 293 ? PHE D 294 ? GLN B 291 PHE B 292 
AA7 1 GLY G 106 ? CYS G 109 ? GLY C 104 CYS C 107 
AA7 2 MET G 112 ? TYR G 114 ? MET C 110 TYR C 112 
AA7 3 THR G 86  ? PHE G 88  ? THR C 84  PHE C 86  
AA7 4 ILE G 39  ? CYS G 44  ? ILE C 37  CYS C 42  
AA7 5 ILE G 8   ? VAL G 14  ? ILE C 6   VAL C 12  
AA7 6 ILE G 258 ? PRO G 264 ? ILE C 256 PRO C 262 
AA8 1 TYR G 237 ? GLU G 241 ? TYR C 235 GLU C 239 
AA8 2 THR G 244 ? ALA G 248 ? THR C 242 ALA C 246 
AA8 3 TYR G 227 ? SER G 230 ? TYR C 225 SER C 228 
AA8 4 ILE G 178 ? SER G 181 ? ILE C 176 SER C 179 
AA8 5 LEU G 126 ? VAL G 131 ? LEU C 124 VAL C 129 
AA8 6 CYS G 118 ? ILE G 123 ? CYS C 116 ILE C 121 
AA8 7 GLU G 272 ? TYR G 273 ? GLU C 270 TYR C 271 
AA9 1 TYR G 144 ? THR G 145 ? TYR C 142 THR C 143 
AA9 2 GLN G 293 ? PHE G 294 ? GLN C 291 PHE C 292 
AB1 1 GLY J 106 ? CYS J 109 ? GLY D 104 CYS D 107 
AB1 2 MET J 112 ? TYR J 114 ? MET D 110 TYR D 112 
AB1 3 THR J 86  ? PHE J 88  ? THR D 84  PHE D 86  
AB1 4 ILE J 39  ? CYS J 44  ? ILE D 37  CYS D 42  
AB1 5 ILE J 8   ? VAL J 14  ? ILE D 6   VAL D 12  
AB1 6 ILE J 258 ? PRO J 264 ? ILE D 256 PRO D 262 
AB2 1 TYR J 237 ? GLU J 241 ? TYR D 235 GLU D 239 
AB2 2 THR J 244 ? ALA J 248 ? THR D 242 ALA D 246 
AB2 3 TYR J 227 ? SER J 230 ? TYR D 225 SER D 228 
AB2 4 ILE J 178 ? SER J 181 ? ILE D 176 SER D 179 
AB2 5 LEU J 126 ? VAL J 131 ? LEU D 124 VAL D 129 
AB2 6 CYS J 118 ? ILE J 123 ? CYS D 116 ILE D 121 
AB2 7 GLU J 272 ? TYR J 273 ? GLU D 270 TYR D 271 
AB3 1 TYR J 144 ? THR J 145 ? TYR D 142 THR D 143 
AB3 2 GLN J 293 ? PHE J 294 ? GLN D 291 PHE D 292 
AB4 1 GLY M 106 ? CYS M 109 ? GLY E 104 CYS E 107 
AB4 2 MET M 112 ? TYR M 114 ? MET E 110 TYR E 112 
AB4 3 THR M 86  ? PHE M 88  ? THR E 84  PHE E 86  
AB4 4 ILE M 39  ? CYS M 44  ? ILE E 37  CYS E 42  
AB4 5 ILE M 8   ? VAL M 14  ? ILE E 6   VAL E 12  
AB4 6 ILE M 258 ? PRO M 264 ? ILE E 256 PRO E 262 
AB5 1 TYR M 237 ? GLU M 241 ? TYR E 235 GLU E 239 
AB5 2 THR M 244 ? ALA M 248 ? THR E 242 ALA E 246 
AB5 3 TYR M 227 ? SER M 230 ? TYR E 225 SER E 228 
AB5 4 ILE M 178 ? SER M 181 ? ILE E 176 SER E 179 
AB5 5 LEU M 126 ? VAL M 131 ? LEU E 124 VAL E 129 
AB5 6 CYS M 118 ? ILE M 123 ? CYS E 116 ILE E 121 
AB5 7 GLU M 272 ? TYR M 273 ? GLU E 270 TYR E 271 
AB6 1 TYR M 144 ? THR M 145 ? TYR E 142 THR E 143 
AB6 2 GLN M 293 ? PHE M 294 ? GLN E 291 PHE E 292 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 106 ? N GLY A 104 O TYR A 114 ? O TYR A 112 
AA1 2 3 O TYR A 113 ? O TYR A 111 N THR A 86  ? N THR A 84  
AA1 3 4 O LEU A 87  ? O LEU A 85  N VAL A 42  ? N VAL A 40  
AA1 4 5 O ILE A 43  ? O ILE A 41  N ALA A 12  ? N ALA A 10  
AA1 5 6 N GLN A 9   ? N GLN A 7   O LEU A 263 ? O LEU A 261 
AA2 1 2 N TYR A 237 ? N TYR A 235 O ALA A 248 ? O ALA A 246 
AA2 2 3 O ILE A 247 ? O ILE A 245 N TRP A 228 ? N TRP A 226 
AA2 3 4 O ILE A 229 ? O ILE A 227 N SER A 179 ? N SER A 177 
AA2 4 5 O ILE A 178 ? O ILE A 176 N VAL A 129 ? N VAL A 127 
AA2 5 6 O LEU A 126 ? O LEU A 124 N ILE A 123 ? N ILE A 121 
AA2 6 7 N ASN A 122 ? N ASN A 120 O GLU A 272 ? O GLU A 270 
AA3 1 2 N TYR A 144 ? N TYR A 142 O PHE A 294 ? O PHE A 292 
AA4 1 2 N GLY D 106 ? N GLY B 104 O TYR D 114 ? O TYR B 112 
AA4 2 3 O TYR D 113 ? O TYR B 111 N THR D 86  ? N THR B 84  
AA4 3 4 O LEU D 87  ? O LEU B 85  N CYS D 44  ? N CYS B 42  
AA4 4 5 O SER D 40  ? O SER B 38  N HIS D 10  ? N HIS B 8   
AA4 5 6 N ILE D 13  ? N ILE B 11  O SER D 259 ? O SER B 257 
AA5 1 2 N TYR D 237 ? N TYR B 235 O ALA D 248 ? O ALA B 246 
AA5 2 3 O ILE D 247 ? O ILE B 245 N TRP D 228 ? N TRP B 226 
AA5 3 4 O ILE D 229 ? O ILE B 227 N SER D 179 ? N SER B 177 
AA5 4 5 O LEU D 180 ? O LEU B 178 N VAL D 131 ? N VAL B 129 
AA5 5 6 O ILE D 128 ? O ILE B 126 N ILE D 121 ? N ILE B 119 
AA5 6 7 N ASN D 122 ? N ASN B 120 O GLU D 272 ? O GLU B 270 
AA6 1 2 N TYR D 144 ? N TYR B 142 O PHE D 294 ? O PHE B 292 
AA7 1 2 N GLY G 106 ? N GLY C 104 O TYR G 114 ? O TYR C 112 
AA7 2 3 O TYR G 113 ? O TYR C 111 N THR G 86  ? N THR C 84  
AA7 3 4 O LEU G 87  ? O LEU C 85  N VAL G 42  ? N VAL C 40  
AA7 4 5 O SER G 40  ? O SER C 38  N HIS G 10  ? N HIS C 8   
AA7 5 6 N ILE G 13  ? N ILE C 11  O SER G 259 ? O SER C 257 
AA8 1 2 N TYR G 237 ? N TYR C 235 O ALA G 248 ? O ALA C 246 
AA8 2 3 O ILE G 247 ? O ILE C 245 N TRP G 228 ? N TRP C 226 
AA8 3 4 O ILE G 229 ? O ILE C 227 N SER G 179 ? N SER C 177 
AA8 4 5 O ILE G 178 ? O ILE C 176 N VAL G 129 ? N VAL C 127 
AA8 5 6 O ILE G 128 ? O ILE C 126 N ILE G 121 ? N ILE C 119 
AA8 6 7 N ASN G 122 ? N ASN C 120 O GLU G 272 ? O GLU C 270 
AA9 1 2 N TYR G 144 ? N TYR C 142 O PHE G 294 ? O PHE C 292 
AB1 1 2 N GLY J 106 ? N GLY D 104 O TYR J 114 ? O TYR D 112 
AB1 2 3 O TYR J 113 ? O TYR D 111 N THR J 86  ? N THR D 84  
AB1 3 4 O LEU J 87  ? O LEU D 85  N VAL J 42  ? N VAL D 40  
AB1 4 5 O ILE J 43  ? O ILE D 41  N ALA J 12  ? N ALA D 10  
AB1 5 6 N GLN J 9   ? N GLN D 7   O LEU J 263 ? O LEU D 261 
AB2 1 2 N ALA J 239 ? N ALA D 237 O PHE J 246 ? O PHE D 244 
AB2 2 3 O ILE J 247 ? O ILE D 245 N TRP J 228 ? N TRP D 226 
AB2 3 4 O ILE J 229 ? O ILE D 227 N SER J 179 ? N SER D 177 
AB2 4 5 O ILE J 178 ? O ILE D 176 N VAL J 129 ? N VAL D 127 
AB2 5 6 O ILE J 128 ? O ILE D 126 N ILE J 121 ? N ILE D 119 
AB2 6 7 N ASN J 122 ? N ASN D 120 O GLU J 272 ? O GLU D 270 
AB3 1 2 N TYR J 144 ? N TYR D 142 O PHE J 294 ? O PHE D 292 
AB4 1 2 N GLY M 106 ? N GLY E 104 O TYR M 114 ? O TYR E 112 
AB4 2 3 O TYR M 113 ? O TYR E 111 N THR M 86  ? N THR E 84  
AB4 3 4 O LEU M 87  ? O LEU E 85  N VAL M 42  ? N VAL E 40  
AB4 4 5 O SER M 40  ? O SER E 38  N HIS M 10  ? N HIS E 8   
AB4 5 6 N ILE M 13  ? N ILE E 11  O SER M 259 ? O SER E 257 
AB5 1 2 N TYR M 237 ? N TYR E 235 O ALA M 248 ? O ALA E 246 
AB5 2 3 O ILE M 247 ? O ILE E 245 N TRP M 228 ? N TRP E 226 
AB5 3 4 O TYR M 227 ? O TYR E 225 N SER M 179 ? N SER E 177 
AB5 4 5 O LEU M 180 ? O LEU E 178 N VAL M 129 ? N VAL E 127 
AB5 5 6 O LEU M 126 ? O LEU E 124 N ILE M 123 ? N ILE E 121 
AB5 6 7 N ASN M 122 ? N ASN E 120 O GLU M 272 ? O GLU E 270 
AB6 1 2 N TYR M 144 ? N TYR E 142 O PHE M 294 ? O PHE E 292 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NI  401 ? 6  'binding site for residue NI A 401'  
AC2 Software A SO4 402 ? 10 'binding site for residue SO4 A 402' 
AC3 Software A GOL 403 ? 6  'binding site for residue GOL A 403' 
AC4 Software A GOL 404 ? 9  'binding site for residue GOL A 404' 
AC5 Software B NI  401 ? 6  'binding site for residue NI B 401'  
AC6 Software B SO4 402 ? 8  'binding site for residue SO4 B 402' 
AC7 Software B PG4 403 ? 9  'binding site for residue PG4 B 403' 
AC8 Software C NI  401 ? 6  'binding site for residue NI C 401'  
AC9 Software C SO4 402 ? 9  'binding site for residue SO4 C 402' 
AD1 Software C GOL 403 ? 9  'binding site for residue GOL C 403' 
AD2 Software C GOL 404 ? 4  'binding site for residue GOL C 404' 
AD3 Software D NI  401 ? 6  'binding site for residue NI D 401'  
AD4 Software D SO4 402 ? 7  'binding site for residue SO4 D 402' 
AD5 Software D GOL 403 ? 5  'binding site for residue GOL D 403' 
AD6 Software D GOL 404 ? 8  'binding site for residue GOL D 404' 
AD7 Software E NI  401 ? 6  'binding site for residue NI E 401'  
AD8 Software E SO4 402 ? 9  'binding site for residue SO4 E 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ASP A  47  ? ASP A 45  . ? 1_555 ? 
2   AC1 6  ASN A  92  ? ASN A 90  . ? 1_555 ? 
3   AC1 6  HIS A  182 ? HIS A 180 . ? 1_555 ? 
4   AC1 6  HIS A  232 ? HIS A 230 . ? 1_555 ? 
5   AC1 6  HOH GA .   ? HOH A 550 . ? 1_555 ? 
6   AC1 6  G46 C  1   ? G46 Q 510 . ? 1_555 ? 
7   AC2 10 ARG A  52  ? ARG A 50  . ? 1_555 ? 
8   AC2 10 ASN A  97  ? ASN A 95  . ? 1_555 ? 
9   AC2 10 HIS A  101 ? HIS A 99  . ? 1_555 ? 
10  AC2 10 PRO A  148 ? PRO A 146 . ? 1_555 ? 
11  AC2 10 HOH GA .   ? HOH A 508 . ? 1_555 ? 
12  AC2 10 HOH GA .   ? HOH A 524 . ? 1_555 ? 
13  AC2 10 HOH GA .   ? HOH A 703 . ? 1_555 ? 
14  AC2 10 HOH GA .   ? HOH A 737 . ? 1_555 ? 
15  AC2 10 HOH GA .   ? HOH A 744 . ? 1_555 ? 
16  AC2 10 HOH GA .   ? HOH A 813 . ? 1_555 ? 
17  AC3 6  GLY A  70  ? GLY A 68  . ? 1_555 ? 
18  AC3 6  ASP A  71  ? ASP A 69  . ? 1_555 ? 
19  AC3 6  HIS A  73  ? HIS A 71  . ? 1_555 ? 
20  AC3 6  LEU A  74  ? LEU A 72  . ? 1_555 ? 
21  AC3 6  HOH GA .   ? HOH A 512 . ? 1_555 ? 
22  AC3 6  HOH OA .   ? HOH D 507 . ? 3_654 ? 
23  AC4 9  TYR A  135 ? TYR A 133 . ? 1_555 ? 
24  AC4 9  ASP A  183 ? ASP A 181 . ? 1_555 ? 
25  AC4 9  LEU A  211 ? LEU A 209 . ? 1_555 ? 
26  AC4 9  GLY A  212 ? GLY A 210 . ? 1_555 ? 
27  AC4 9  SER A  213 ? SER A 211 . ? 1_555 ? 
28  AC4 9  HOH GA .   ? HOH A 670 . ? 1_555 ? 
29  AC4 9  HOH GA .   ? HOH A 791 . ? 1_555 ? 
30  AC4 9  G46 C  1   ? G46 Q 510 . ? 1_555 ? 
31  AC4 9  HOH IA .   ? HOH Q 601 . ? 1_555 ? 
32  AC5 6  ASP D  47  ? ASP B 45  . ? 1_555 ? 
33  AC5 6  ASN D  92  ? ASN B 90  . ? 1_555 ? 
34  AC5 6  HIS D  182 ? HIS B 180 . ? 1_555 ? 
35  AC5 6  HIS D  232 ? HIS B 230 . ? 1_555 ? 
36  AC5 6  HOH JA .   ? HOH B 511 . ? 1_555 ? 
37  AC5 6  G46 F  1   ? G46 R 510 . ? 1_555 ? 
38  AC6 8  ARG D  52  ? ARG B 50  . ? 1_555 ? 
39  AC6 8  ASN D  97  ? ASN B 95  . ? 1_555 ? 
40  AC6 8  HIS D  101 ? HIS B 99  . ? 1_555 ? 
41  AC6 8  HOH JA .   ? HOH B 532 . ? 1_555 ? 
42  AC6 8  HOH JA .   ? HOH B 543 . ? 1_555 ? 
43  AC6 8  HOH JA .   ? HOH B 638 . ? 1_555 ? 
44  AC6 8  HOH JA .   ? HOH B 641 . ? 1_555 ? 
45  AC6 8  HOH JA .   ? HOH B 649 . ? 1_555 ? 
46  AC7 9  LEU D  100 ? LEU B 98  . ? 1_555 ? 
47  AC7 9  LYS D  142 ? LYS B 140 . ? 1_555 ? 
48  AC7 9  PRO D  143 ? PRO B 141 . ? 1_555 ? 
49  AC7 9  TYR D  144 ? TYR B 142 . ? 1_555 ? 
50  AC7 9  THR D  145 ? THR B 143 . ? 1_555 ? 
51  AC7 9  ASP D  152 ? ASP B 150 . ? 1_555 ? 
52  AC7 9  LEU D  156 ? LEU B 154 . ? 1_555 ? 
53  AC7 9  GLN D  293 ? GLN B 291 . ? 1_555 ? 
54  AC7 9  HOH JA .   ? HOH B 534 . ? 1_555 ? 
55  AC8 6  ASP G  47  ? ASP C 45  . ? 1_555 ? 
56  AC8 6  ASN G  92  ? ASN C 90  . ? 1_555 ? 
57  AC8 6  HIS G  182 ? HIS C 180 . ? 1_555 ? 
58  AC8 6  HIS G  232 ? HIS C 230 . ? 1_555 ? 
59  AC8 6  HOH MA .   ? HOH C 825 . ? 1_555 ? 
60  AC8 6  A   H  5   ? A   X 503 . ? 1_555 ? 
61  AC9 9  ARG G  52  ? ARG C 50  . ? 1_555 ? 
62  AC9 9  ASN G  97  ? ASN C 95  . ? 1_555 ? 
63  AC9 9  HIS G  101 ? HIS C 99  . ? 1_555 ? 
64  AC9 9  PRO G  148 ? PRO C 146 . ? 1_555 ? 
65  AC9 9  HOH MA .   ? HOH C 505 . ? 1_555 ? 
66  AC9 9  HOH MA .   ? HOH C 522 . ? 1_555 ? 
67  AC9 9  HOH MA .   ? HOH C 648 . ? 1_555 ? 
68  AC9 9  HOH MA .   ? HOH C 685 . ? 1_555 ? 
69  AC9 9  HOH MA .   ? HOH C 703 . ? 1_555 ? 
70  AD1 9  SER G  40  ? SER C 38  . ? 1_555 ? 
71  AD1 9  LEU G  85  ? LEU C 83  . ? 1_555 ? 
72  AD1 9  ASN G  124 ? ASN C 122 . ? 1_555 ? 
73  AD1 9  LYS G  268 ? LYS C 266 . ? 1_555 ? 
74  AD1 9  THR G  269 ? THR C 267 . ? 1_555 ? 
75  AD1 9  HOH MA .   ? HOH C 625 . ? 1_555 ? 
76  AD1 9  HOH MA .   ? HOH C 701 . ? 1_555 ? 
77  AD1 9  HOH MA .   ? HOH C 770 . ? 1_555 ? 
78  AD1 9  HOH MA .   ? HOH C 799 . ? 1_555 ? 
79  AD2 4  GLY G  192 ? GLY C 190 . ? 1_555 ? 
80  AD2 4  ASN G  193 ? ASN C 191 . ? 1_555 ? 
81  AD2 4  TYR G  194 ? TYR C 192 . ? 1_555 ? 
82  AD2 4  LYS G  195 ? LYS C 193 . ? 1_555 ? 
83  AD3 6  ASP J  47  ? ASP D 45  . ? 1_555 ? 
84  AD3 6  ASN J  92  ? ASN D 90  . ? 1_555 ? 
85  AD3 6  HIS J  182 ? HIS D 180 . ? 1_555 ? 
86  AD3 6  HIS J  232 ? HIS D 230 . ? 1_555 ? 
87  AD3 6  HOH OA .   ? HOH D 800 . ? 1_555 ? 
88  AD3 6  G46 L  1   ? G46 T 510 . ? 1_555 ? 
89  AD4 7  ARG J  52  ? ARG D 50  . ? 1_555 ? 
90  AD4 7  ASN J  97  ? ASN D 95  . ? 1_555 ? 
91  AD4 7  HIS J  101 ? HIS D 99  . ? 1_555 ? 
92  AD4 7  PRO J  148 ? PRO D 146 . ? 1_555 ? 
93  AD4 7  HOH OA .   ? HOH D 517 . ? 1_555 ? 
94  AD4 7  HOH OA .   ? HOH D 653 . ? 1_555 ? 
95  AD4 7  HOH OA .   ? HOH D 738 . ? 1_555 ? 
96  AD5 5  GLY J  70  ? GLY D 68  . ? 1_555 ? 
97  AD5 5  ASP J  71  ? ASP D 69  . ? 1_555 ? 
98  AD5 5  HIS J  73  ? HIS D 71  . ? 1_555 ? 
99  AD5 5  HOH OA .   ? HOH D 505 . ? 1_555 ? 
100 AD5 5  HOH OA .   ? HOH D 523 . ? 1_555 ? 
101 AD6 8  THR G  340 ? THR C 338 . ? 2_644 ? 
102 AD6 8  PHE G  344 ? PHE C 342 . ? 2_644 ? 
103 AD6 8  TYR G  345 ? TYR C 343 . ? 2_644 ? 
104 AD6 8  HOH MA .   ? HOH C 535 . ? 2_644 ? 
105 AD6 8  HIS J  73  ? HIS D 71  . ? 1_555 ? 
106 AD6 8  GLU J  77  ? GLU D 75  . ? 1_555 ? 
107 AD6 8  LYS J  79  ? LYS D 77  . ? 1_555 ? 
108 AD6 8  HOH OA .   ? HOH D 526 . ? 1_555 ? 
109 AD7 6  ASP M  47  ? ASP E 45  . ? 1_555 ? 
110 AD7 6  ASN M  92  ? ASN E 90  . ? 1_555 ? 
111 AD7 6  HIS M  182 ? HIS E 180 . ? 1_555 ? 
112 AD7 6  HIS M  232 ? HIS E 230 . ? 1_555 ? 
113 AD7 6  HOH QA .   ? HOH E 777 . ? 1_555 ? 
114 AD7 6  A   N  5   ? A   Z 503 . ? 1_555 ? 
115 AD8 9  ARG M  52  ? ARG E 50  . ? 1_555 ? 
116 AD8 9  ASN M  97  ? ASN E 95  . ? 1_555 ? 
117 AD8 9  HIS M  101 ? HIS E 99  . ? 1_555 ? 
118 AD8 9  HOH QA .   ? HOH E 557 . ? 1_555 ? 
119 AD8 9  HOH QA .   ? HOH E 584 . ? 1_555 ? 
120 AD8 9  HOH QA .   ? HOH E 627 . ? 1_555 ? 
121 AD8 9  HOH QA .   ? HOH E 673 . ? 1_555 ? 
122 AD8 9  HOH QA .   ? HOH E 688 . ? 1_555 ? 
123 AD8 9  HOH QA .   ? HOH E 768 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4PEI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4PEI 
_atom_sites.fract_transf_matrix[1][1]   0.013692 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007019 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004658 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NI 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLN A  1 7   ? -4.275  -44.472  2.485   1.00 51.43 ? 5   GLN A N     1 
ATOM   2     C  CA    . GLN A  1 7   ? -3.016  -44.019  1.910   1.00 48.58 ? 5   GLN A CA    1 
ATOM   3     C  C     . GLN A  1 7   ? -3.231  -43.210  0.634   1.00 44.43 ? 5   GLN A C     1 
ATOM   4     O  O     . GLN A  1 7   ? -4.001  -43.608  -0.233  1.00 38.67 ? 5   GLN A O     1 
ATOM   5     C  CB    . GLN A  1 7   ? -2.099  -45.205  1.640   1.00 53.00 ? 5   GLN A CB    1 
ATOM   6     C  CG    . GLN A  1 7   ? -0.820  -45.168  2.453   1.00 61.02 ? 5   GLN A CG    1 
ATOM   7     C  CD    . GLN A  1 7   ? 0.241   -46.088  1.897   1.00 67.84 ? 5   GLN A CD    1 
ATOM   8     O  OE1   . GLN A  1 7   ? -0.067  -47.095  1.261   1.00 71.99 ? 5   GLN A OE1   1 
ATOM   9     N  NE2   . GLN A  1 7   ? 1.501   -45.747  2.133   1.00 61.26 ? 5   GLN A NE2   1 
ATOM   10    N  N     . ILE A  1 8   ? -2.541  -42.077  0.536   1.00 39.31 ? 6   ILE A N     1 
ATOM   11    C  CA    . ILE A  1 8   ? -2.720  -41.142  -0.568  1.00 34.80 ? 6   ILE A CA    1 
ATOM   12    C  C     . ILE A  1 8   ? -1.460  -40.926  -1.399  1.00 38.86 ? 6   ILE A C     1 
ATOM   13    O  O     . ILE A  1 8   ? -0.358  -40.852  -0.867  1.00 31.78 ? 6   ILE A O     1 
ATOM   14    C  CB    . ILE A  1 8   ? -3.133  -39.755  -0.051  1.00 34.31 ? 6   ILE A CB    1 
ATOM   15    C  CG1   . ILE A  1 8   ? -4.520  -39.796  0.594   1.00 41.15 ? 6   ILE A CG1   1 
ATOM   16    C  CG2   . ILE A  1 8   ? -3.051  -38.725  -1.163  1.00 36.65 ? 6   ILE A CG2   1 
ATOM   17    C  CD1   . ILE A  1 8   ? -4.896  -38.547  1.358   1.00 56.18 ? 6   ILE A CD1   1 
ATOM   18    N  N     . GLN A  1 9   ? -1.642  -40.796  -2.707  1.00 32.95 ? 7   GLN A N     1 
ATOM   19    C  CA    . GLN A  1 9   ? -0.559  -40.418  -3.601  1.00 26.72 ? 7   GLN A CA    1 
ATOM   20    C  C     . GLN A  1 9   ? -0.846  -39.043  -4.199  1.00 26.54 ? 7   GLN A C     1 
ATOM   21    O  O     . GLN A  1 9   ? -1.955  -38.766  -4.623  1.00 25.88 ? 7   GLN A O     1 
ATOM   22    C  CB    . GLN A  1 9   ? -0.355  -41.462  -4.696  1.00 23.72 ? 7   GLN A CB    1 
ATOM   23    C  CG    . GLN A  1 9   ? -1.490  -41.563  -5.694  1.00 22.61 ? 7   GLN A CG    1 
ATOM   24    C  CD    . GLN A  1 9   ? -1.274  -42.662  -6.712  1.00 21.91 ? 7   GLN A CD    1 
ATOM   25    O  OE1   . GLN A  1 9   ? -0.256  -42.699  -7.390  1.00 23.75 ? 7   GLN A OE1   1 
ATOM   26    N  NE2   . GLN A  1 9   ? -2.238  -43.560  -6.823  1.00 22.99 ? 7   GLN A NE2   1 
ATOM   27    N  N     . HIS A  1 10  ? 0.163   -38.184  -4.202  1.00 23.90 ? 8   HIS A N     1 
ATOM   28    C  CA    . HIS A  1 10  ? 0.048   -36.874  -4.731  1.00 24.74 ? 8   HIS A CA    1 
ATOM   29    C  C     . HIS A  1 10  ? 0.676   -36.845  -6.077  1.00 25.53 ? 8   HIS A C     1 
ATOM   30    O  O     . HIS A  1 10  ? 1.833   -37.158  -6.227  1.00 26.50 ? 8   HIS A O     1 
ATOM   31    C  CB    . HIS A  1 10  ? 0.732   -35.884  -3.829  1.00 24.29 ? 8   HIS A CB    1 
ATOM   32    C  CG    . HIS A  1 10  ? 0.321   -35.998  -2.414  1.00 28.77 ? 8   HIS A CG    1 
ATOM   33    N  ND1   . HIS A  1 10  ? -0.833  -35.561  -1.988  1.00 30.11 ? 8   HIS A ND1   1 
ATOM   34    C  CD2   . HIS A  1 10  ? 0.936   -36.557  -1.350  1.00 25.15 ? 8   HIS A CD2   1 
ATOM   35    C  CE1   . HIS A  1 10  ? -0.957  -35.815  -0.724  1.00 33.17 ? 8   HIS A CE1   1 
ATOM   36    N  NE2   . HIS A  1 10  ? 0.135   -36.418  -0.326  1.00 32.11 ? 8   HIS A NE2   1 
ATOM   37    N  N     . ILE A  1 11  ? -0.103  -36.469  -7.059  1.00 24.14 ? 9   ILE A N     1 
ATOM   38    C  CA    . ILE A  1 11  ? 0.343   -36.439  -8.435  1.00 23.17 ? 9   ILE A CA    1 
ATOM   39    C  C     . ILE A  1 11  ? 0.352   -34.997  -8.949  1.00 26.02 ? 9   ILE A C     1 
ATOM   40    O  O     . ILE A  1 11  ? -0.684  -34.322  -9.007  1.00 22.72 ? 9   ILE A O     1 
ATOM   41    C  CB    . ILE A  1 11  ? -0.560  -37.327  -9.281  1.00 20.44 ? 9   ILE A CB    1 
ATOM   42    C  CG1   . ILE A  1 11  ? -0.473  -38.734  -8.746  1.00 22.29 ? 9   ILE A CG1   1 
ATOM   43    C  CG2   . ILE A  1 11  ? -0.149  -37.310  -10.776 1.00 18.19 ? 9   ILE A CG2   1 
ATOM   44    C  CD1   . ILE A  1 11  ? -1.466  -39.688  -9.326  1.00 22.31 ? 9   ILE A CD1   1 
ATOM   45    N  N     . ALA A  1 12  ? 1.533   -34.508  -9.295  1.00 16.69 ? 10  ALA A N     1 
ATOM   46    C  CA    . ALA A  1 12  ? 1.620   -33.172  -9.870  1.00 16.30 ? 10  ALA A CA    1 
ATOM   47    C  C     . ALA A  1 12  ? 1.028   -33.192  -11.300 1.00 19.29 ? 10  ALA A C     1 
ATOM   48    O  O     . ALA A  1 12  ? 1.397   -34.043  -12.144 1.00 16.37 ? 10  ALA A O     1 
ATOM   49    C  CB    . ALA A  1 12  ? 3.081   -32.676  -9.873  1.00 17.95 ? 10  ALA A CB    1 
ATOM   50    N  N     . ILE A  1 13  ? 0.127   -32.257  -11.593 1.00 16.97 ? 11  ILE A N     1 
ATOM   51    C  CA    . ILE A  1 13  ? -0.355  -32.127  -12.963 1.00 19.17 ? 11  ILE A CA    1 
ATOM   52    C  C     . ILE A  1 13  ? 0.058   -30.774  -13.532 1.00 20.88 ? 11  ILE A C     1 
ATOM   53    O  O     . ILE A  1 13  ? -0.170  -29.757  -12.897 1.00 18.15 ? 11  ILE A O     1 
ATOM   54    C  CB    . ILE A  1 13  ? -1.870  -32.308  -13.077 1.00 17.35 ? 11  ILE A CB    1 
ATOM   55    C  CG1   . ILE A  1 13  ? -2.576  -31.469  -12.011 1.00 20.27 ? 11  ILE A CG1   1 
ATOM   56    C  CG2   . ILE A  1 13  ? -2.256  -33.808  -12.981 1.00 20.32 ? 11  ILE A CG2   1 
ATOM   57    C  CD1   . ILE A  1 13  ? -4.083  -31.401  -12.205 1.00 23.27 ? 11  ILE A CD1   1 
ATOM   58    N  N     . VAL A  1 14  ? 0.638   -30.774  -14.735 1.00 17.23 ? 12  VAL A N     1 
ATOM   59    C  CA    . VAL A  1 14  ? 1.253   -29.570  -15.306 1.00 20.09 ? 12  VAL A CA    1 
ATOM   60    C  C     . VAL A  1 14  ? 0.705   -29.250  -16.686 1.00 16.80 ? 12  VAL A C     1 
ATOM   61    O  O     . VAL A  1 14  ? 0.522   -30.164  -17.499 1.00 17.53 ? 12  VAL A O     1 
ATOM   62    C  CB    . VAL A  1 14  ? 2.747   -29.817  -15.464 1.00 19.09 ? 12  VAL A CB    1 
ATOM   63    C  CG1   . VAL A  1 14  ? 3.491   -28.512  -15.830 1.00 20.60 ? 12  VAL A CG1   1 
ATOM   64    C  CG2   . VAL A  1 14  ? 3.304   -30.418  -14.188 1.00 20.37 ? 12  VAL A CG2   1 
ATOM   65    N  N     . GLY A  1 15  ? 0.477   -27.966  -16.971 1.00 17.55 ? 13  GLY A N     1 
ATOM   66    C  CA    . GLY A  1 15  ? 0.105   -27.522  -18.317 1.00 20.54 ? 13  GLY A CA    1 
ATOM   67    C  C     . GLY A  1 15  ? 1.329   -27.440  -19.231 1.00 19.26 ? 13  GLY A C     1 
ATOM   68    O  O     . GLY A  1 15  ? 2.131   -28.368  -19.213 1.00 26.73 ? 13  GLY A O     1 
ATOM   69    N  N     . SER A  1 16  ? 1.506   -26.350  -19.990 1.00 15.44 ? 14  SER A N     1 
ATOM   70    C  CA    . SER A  1 16  ? 2.580   -26.264  -21.003 1.00 21.75 ? 14  SER A CA    1 
ATOM   71    C  C     . SER A  1 16  ? 3.979   -25.999  -20.425 1.00 21.68 ? 14  SER A C     1 
ATOM   72    O  O     . SER A  1 16  ? 4.207   -24.972  -19.753 1.00 23.23 ? 14  SER A O     1 
ATOM   73    C  CB    . SER A  1 16  ? 2.260   -25.189  -22.042 1.00 24.29 ? 14  SER A CB    1 
ATOM   74    O  OG    . SER A  1 16  ? 0.994   -25.390  -22.638 1.00 27.49 ? 14  SER A OG    1 
ATOM   75    N  N     . VAL A  1 17  ? 4.938   -26.877  -20.709 1.00 19.40 ? 15  VAL A N     1 
ATOM   76    C  CA    . VAL A  1 17  ? 6.276   -26.702  -20.138 1.00 19.45 ? 15  VAL A CA    1 
ATOM   77    C  C     . VAL A  1 17  ? 7.147   -25.674  -20.893 1.00 20.34 ? 15  VAL A C     1 
ATOM   78    O  O     . VAL A  1 17  ? 7.873   -24.878  -20.278 1.00 17.51 ? 15  VAL A O     1 
ATOM   79    C  CB    . VAL A  1 17  ? 7.017   -28.077  -19.959 1.00 19.20 ? 15  VAL A CB    1 
ATOM   80    C  CG1   . VAL A  1 17  ? 8.414   -27.858  -19.472 1.00 20.85 ? 15  VAL A CG1   1 
ATOM   81    C  CG2   . VAL A  1 17  ? 6.243   -28.987  -18.981 1.00 19.44 ? 15  VAL A CG2   1 
ATOM   82    N  N     . HIS A  1 18  ? 7.071   -25.708  -22.221 1.00 22.59 ? 16  HIS A N     1 
ATOM   83    C  CA    . HIS A  1 18  ? 7.808   -24.805  -23.098 1.00 20.08 ? 16  HIS A CA    1 
ATOM   84    C  C     . HIS A  1 18  ? 9.313   -24.743  -22.802 1.00 25.35 ? 16  HIS A C     1 
ATOM   85    O  O     . HIS A  1 18  ? 9.937   -23.657  -22.858 1.00 29.20 ? 16  HIS A O     1 
ATOM   86    C  CB    . HIS A  1 18  ? 7.197   -23.391  -23.041 1.00 24.33 ? 16  HIS A CB    1 
ATOM   87    C  CG    . HIS A  1 18  ? 5.875   -23.279  -23.722 1.00 34.93 ? 16  HIS A CG    1 
ATOM   88    N  ND1   . HIS A  1 18  ? 5.707   -23.512  -25.074 1.00 35.06 ? 16  HIS A ND1   1 
ATOM   89    C  CD2   . HIS A  1 18  ? 4.639   -22.987  -23.240 1.00 39.55 ? 16  HIS A CD2   1 
ATOM   90    C  CE1   . HIS A  1 18  ? 4.437   -23.366  -25.389 1.00 36.68 ? 16  HIS A CE1   1 
ATOM   91    N  NE2   . HIS A  1 18  ? 3.763   -23.039  -24.296 1.00 34.34 ? 16  HIS A NE2   1 
ATOM   92    N  N     . GLY A  1 19  ? 9.904   -25.901  -22.511 1.00 23.73 ? 17  GLY A N     1 
ATOM   93    C  CA    . GLY A  1 19  ? 11.327  -25.974  -22.254 1.00 14.98 ? 17  GLY A CA    1 
ATOM   94    C  C     . GLY A  1 19  ? 11.754  -25.268  -20.972 1.00 19.02 ? 17  GLY A C     1 
ATOM   95    O  O     . GLY A  1 19  ? 12.929  -24.943  -20.834 1.00 24.00 ? 17  GLY A O     1 
ATOM   96    N  N     . LYS A  1 20  ? 10.835  -25.010  -20.041 1.00 18.81 ? 18  LYS A N     1 
ATOM   97    C  CA    . LYS A  1 20  ? 11.232  -24.479  -18.725 1.00 22.53 ? 18  LYS A CA    1 
ATOM   98    C  C     . LYS A  1 20  ? 11.301  -25.598  -17.694 1.00 16.50 ? 18  LYS A C     1 
ATOM   99    O  O     . LYS A  1 20  ? 10.561  -25.561  -16.707 1.00 19.36 ? 18  LYS A O     1 
ATOM   100   C  CB    . LYS A  1 20  ? 10.216  -23.460  -18.200 1.00 23.60 ? 18  LYS A CB    1 
ATOM   101   C  CG    . LYS A  1 20  ? 9.881   -22.327  -19.148 1.00 27.94 ? 18  LYS A CG    1 
ATOM   102   C  CD    . LYS A  1 20  ? 11.152  -21.618  -19.468 1.00 32.71 ? 18  LYS A CD    1 
ATOM   103   C  CE    . LYS A  1 20  ? 10.898  -20.243  -20.093 1.00 46.75 ? 18  LYS A CE    1 
ATOM   104   N  NZ    . LYS A  1 20  ? 12.192  -19.798  -20.712 1.00 55.51 ? 18  LYS A NZ    1 
ATOM   105   N  N     . TYR A  1 21  ? 12.149  -26.592  -17.921 1.00 13.99 ? 19  TYR A N     1 
ATOM   106   C  CA    . TYR A  1 21  ? 12.249  -27.757  -17.027 1.00 16.86 ? 19  TYR A CA    1 
ATOM   107   C  C     . TYR A  1 21  ? 12.828  -27.461  -15.647 1.00 17.98 ? 19  TYR A C     1 
ATOM   108   O  O     . TYR A  1 21  ? 12.334  -27.956  -14.632 1.00 19.67 ? 19  TYR A O     1 
ATOM   109   C  CB    . TYR A  1 21  ? 13.058  -28.870  -17.694 1.00 13.79 ? 19  TYR A CB    1 
ATOM   110   C  CG    . TYR A  1 21  ? 12.303  -29.509  -18.834 1.00 16.58 ? 19  TYR A CG    1 
ATOM   111   C  CD1   . TYR A  1 21  ? 12.401  -29.013  -20.143 1.00 17.26 ? 19  TYR A CD1   1 
ATOM   112   C  CD2   . TYR A  1 21  ? 11.458  -30.586  -18.600 1.00 14.24 ? 19  TYR A CD2   1 
ATOM   113   C  CE1   . TYR A  1 21  ? 11.656  -29.616  -21.211 1.00 18.06 ? 19  TYR A CE1   1 
ATOM   114   C  CE2   . TYR A  1 21  ? 10.715  -31.191  -19.646 1.00 16.71 ? 19  TYR A CE2   1 
ATOM   115   C  CZ    . TYR A  1 21  ? 10.828  -30.701  -20.940 1.00 18.66 ? 19  TYR A CZ    1 
ATOM   116   O  OH    . TYR A  1 21  ? 10.063  -31.288  -21.944 1.00 14.54 ? 19  TYR A OH    1 
ATOM   117   N  N     . ARG A  1 22  ? 13.930  -26.714  -15.596 1.00 17.61 ? 20  ARG A N     1 
ATOM   118   C  CA    . ARG A  1 22  ? 14.511  -26.396  -14.283 1.00 21.47 ? 20  ARG A CA    1 
ATOM   119   C  C     . ARG A  1 22  ? 13.498  -25.608  -13.431 1.00 20.39 ? 20  ARG A C     1 
ATOM   120   O  O     . ARG A  1 22  ? 13.283  -25.899  -12.260 1.00 21.49 ? 20  ARG A O     1 
ATOM   121   C  CB    . ARG A  1 22  ? 15.840  -25.635  -14.444 1.00 20.33 ? 20  ARG A CB    1 
ATOM   122   C  CG    . ARG A  1 22  ? 16.992  -26.485  -14.972 1.00 25.60 ? 20  ARG A CG    1 
ATOM   123   C  CD    . ARG A  1 22  ? 18.217  -25.608  -15.292 1.00 21.03 ? 20  ARG A CD    1 
ATOM   124   N  NE    . ARG A  1 22  ? 17.955  -24.648  -16.368 1.00 21.46 ? 20  ARG A NE    1 
ATOM   125   C  CZ    . ARG A  1 22  ? 18.840  -23.775  -16.848 1.00 25.47 ? 20  ARG A CZ    1 
ATOM   126   N  NH1   . ARG A  1 22  ? 20.067  -23.726  -16.346 1.00 27.81 ? 20  ARG A NH1   1 
ATOM   127   N  NH2   . ARG A  1 22  ? 18.505  -22.965  -17.848 1.00 25.06 ? 20  ARG A NH2   1 
ATOM   128   N  N     . GLU A  1 23  ? 12.856  -24.610  -14.022 1.00 20.53 ? 21  GLU A N     1 
ATOM   129   C  CA    A GLU A  1 23  ? 11.829  -23.882  -13.297 0.45 24.72 ? 21  GLU A CA    1 
ATOM   130   C  CA    B GLU A  1 23  ? 11.823  -23.876  -13.299 0.55 24.72 ? 21  GLU A CA    1 
ATOM   131   C  C     . GLU A  1 23  ? 10.721  -24.808  -12.798 1.00 25.12 ? 21  GLU A C     1 
ATOM   132   O  O     . GLU A  1 23  ? 10.348  -24.763  -11.636 1.00 24.28 ? 21  GLU A O     1 
ATOM   133   C  CB    A GLU A  1 23  ? 11.218  -22.786  -14.155 0.45 23.20 ? 21  GLU A CB    1 
ATOM   134   C  CB    B GLU A  1 23  ? 11.205  -22.758  -14.142 0.55 23.19 ? 21  GLU A CB    1 
ATOM   135   C  CG    A GLU A  1 23  ? 9.949   -22.242  -13.551 0.45 26.10 ? 21  GLU A CG    1 
ATOM   136   C  CG    B GLU A  1 23  ? 10.098  -22.018  -13.395 0.55 26.41 ? 21  GLU A CG    1 
ATOM   137   C  CD    A GLU A  1 23  ? 9.655   -20.842  -14.024 0.45 29.81 ? 21  GLU A CD    1 
ATOM   138   C  CD    B GLU A  1 23  ? 10.524  -21.590  -11.990 0.55 29.93 ? 21  GLU A CD    1 
ATOM   139   O  OE1   A GLU A  1 23  ? 10.350  -20.384  -14.964 0.45 27.51 ? 21  GLU A OE1   1 
ATOM   140   O  OE1   B GLU A  1 23  ? 11.746  -21.464  -11.755 0.55 30.38 ? 21  GLU A OE1   1 
ATOM   141   O  OE2   A GLU A  1 23  ? 8.744   -20.204  -13.448 0.45 28.63 ? 21  GLU A OE2   1 
ATOM   142   O  OE2   B GLU A  1 23  ? 9.637   -21.392  -11.122 0.55 27.38 ? 21  GLU A OE2   1 
ATOM   143   N  N     . MET A  1 24  ? 10.191  -25.653  -13.682 1.00 20.67 ? 22  MET A N     1 
ATOM   144   C  CA    . MET A  1 24  ? 9.112   -26.577  -13.290 1.00 18.85 ? 22  MET A CA    1 
ATOM   145   C  C     . MET A  1 24  ? 9.499   -27.405  -12.073 1.00 18.72 ? 22  MET A C     1 
ATOM   146   O  O     . MET A  1 24  ? 8.784   -27.459  -11.082 1.00 21.04 ? 22  MET A O     1 
ATOM   147   C  CB    . MET A  1 24  ? 8.791   -27.568  -14.418 1.00 16.82 ? 22  MET A CB    1 
ATOM   148   C  CG    . MET A  1 24  ? 7.746   -28.625  -14.007 1.00 18.67 ? 22  MET A CG    1 
ATOM   149   S  SD    . MET A  1 24  ? 7.212   -29.671  -15.389 1.00 19.58 ? 22  MET A SD    1 
ATOM   150   C  CE    . MET A  1 24  ? 8.858   -30.131  -16.015 1.00 15.28 ? 22  MET A CE    1 
ATOM   151   N  N     . TYR A  1 25  ? 10.646  -28.060  -12.158 1.00 18.90 ? 23  TYR A N     1 
ATOM   152   C  CA    . TYR A  1 25  ? 11.142  -28.865  -11.040 1.00 21.85 ? 23  TYR A CA    1 
ATOM   153   C  C     . TYR A  1 25  ? 11.381  -28.098  -9.713  1.00 23.58 ? 23  TYR A C     1 
ATOM   154   O  O     . TYR A  1 25  ? 11.071  -28.610  -8.617  1.00 27.40 ? 23  TYR A O     1 
ATOM   155   C  CB    . TYR A  1 25  ? 12.402  -29.634  -11.473 1.00 16.80 ? 23  TYR A CB    1 
ATOM   156   C  CG    . TYR A  1 25  ? 12.018  -30.712  -12.459 1.00 17.80 ? 23  TYR A CG    1 
ATOM   157   C  CD1   . TYR A  1 25  ? 10.943  -31.558  -12.190 1.00 17.45 ? 23  TYR A CD1   1 
ATOM   158   C  CD2   . TYR A  1 25  ? 12.664  -30.844  -13.676 1.00 16.09 ? 23  TYR A CD2   1 
ATOM   159   C  CE1   . TYR A  1 25  ? 10.552  -32.549  -13.077 1.00 21.74 ? 23  TYR A CE1   1 
ATOM   160   C  CE2   . TYR A  1 25  ? 12.290  -31.834  -14.583 1.00 15.37 ? 23  TYR A CE2   1 
ATOM   161   C  CZ    . TYR A  1 25  ? 11.228  -32.695  -14.275 1.00 18.22 ? 23  TYR A CZ    1 
ATOM   162   O  OH    . TYR A  1 25  ? 10.820  -33.691  -15.175 1.00 16.73 ? 23  TYR A OH    1 
ATOM   163   N  N     . ARG A  1 26  ? 11.969  -26.909  -9.798  1.00 23.33 ? 24  ARG A N     1 
ATOM   164   C  CA    . ARG A  1 26  ? 12.131  -26.071  -8.605  1.00 26.15 ? 24  ARG A CA    1 
ATOM   165   C  C     . ARG A  1 26  ? 10.761  -25.836  -7.978  1.00 24.90 ? 24  ARG A C     1 
ATOM   166   O  O     . ARG A  1 26  ? 10.579  -25.915  -6.759  1.00 28.41 ? 24  ARG A O     1 
ATOM   167   C  CB    . ARG A  1 26  ? 12.761  -24.719  -8.961  1.00 32.73 ? 24  ARG A CB    1 
ATOM   168   C  CG    . ARG A  1 26  ? 14.227  -24.800  -9.427  1.00 37.68 ? 24  ARG A CG    1 
ATOM   169   C  CD    . ARG A  1 26  ? 14.795  -23.404  -9.813  1.00 47.19 ? 24  ARG A CD    1 
ATOM   170   N  NE    . ARG A  1 26  ? 16.031  -23.490  -10.611 1.00 49.39 ? 24  ARG A NE    1 
ATOM   171   C  CZ    . ARG A  1 26  ? 16.229  -22.850  -11.769 1.00 47.52 ? 24  ARG A CZ    1 
ATOM   172   N  NH1   . ARG A  1 26  ? 15.273  -22.065  -12.264 1.00 41.78 ? 24  ARG A NH1   1 
ATOM   173   N  NH2   . ARG A  1 26  ? 17.385  -22.990  -12.433 1.00 51.16 ? 24  ARG A NH2   1 
ATOM   174   N  N     . GLN A  1 27  ? 9.784   -25.554  -8.822  1.00 26.31 ? 25  GLN A N     1 
ATOM   175   C  CA    . GLN A  1 27  ? 8.459   -25.234  -8.316  1.00 25.51 ? 25  GLN A CA    1 
ATOM   176   C  C     . GLN A  1 27  ? 7.821   -26.470  -7.654  1.00 25.87 ? 25  GLN A C     1 
ATOM   177   O  O     . GLN A  1 27  ? 7.241   -26.375  -6.574  1.00 29.39 ? 25  GLN A O     1 
ATOM   178   C  CB    . GLN A  1 27  ? 7.605   -24.685  -9.448  1.00 26.21 ? 25  GLN A CB    1 
ATOM   179   C  CG    . GLN A  1 27  ? 6.248   -24.255  -9.041  1.00 31.33 ? 25  GLN A CG    1 
ATOM   180   C  CD    . GLN A  1 27  ? 5.578   -23.407  -10.119 1.00 41.47 ? 25  GLN A CD    1 
ATOM   181   O  OE1   . GLN A  1 27  ? 6.264   -22.745  -10.908 1.00 35.04 ? 25  GLN A OE1   1 
ATOM   182   N  NE2   . GLN A  1 27  ? 4.238   -23.414  -10.150 1.00 35.60 ? 25  GLN A NE2   1 
ATOM   183   N  N     . LEU A  1 28  ? 7.946   -27.637  -8.275  1.00 23.45 ? 26  LEU A N     1 
ATOM   184   C  CA    . LEU A  1 28  ? 7.496   -28.876  -7.644  1.00 22.40 ? 26  LEU A CA    1 
ATOM   185   C  C     . LEU A  1 28  ? 8.286   -29.156  -6.344  1.00 28.89 ? 26  LEU A C     1 
ATOM   186   O  O     . LEU A  1 28  ? 7.726   -29.617  -5.342  1.00 24.03 ? 26  LEU A O     1 
ATOM   187   C  CB    . LEU A  1 28  ? 7.668   -30.051  -8.605  1.00 20.05 ? 26  LEU A CB    1 
ATOM   188   C  CG    . LEU A  1 28  ? 6.934   -29.909  -9.948  1.00 20.36 ? 26  LEU A CG    1 
ATOM   189   C  CD1   . LEU A  1 28  ? 7.368   -31.071  -10.883 1.00 19.58 ? 26  LEU A CD1   1 
ATOM   190   C  CD2   . LEU A  1 28  ? 5.460   -29.937  -9.733  1.00 17.11 ? 26  LEU A CD2   1 
ATOM   191   N  N     . SER A  1 29  ? 9.588   -28.895  -6.364  1.00 21.17 ? 27  SER A N     1 
ATOM   192   C  CA    . SER A  1 29  ? 10.378  -29.037  -5.146  1.00 24.42 ? 27  SER A CA    1 
ATOM   193   C  C     . SER A  1 29  ? 9.816   -28.149  -4.007  1.00 28.52 ? 27  SER A C     1 
ATOM   194   O  O     . SER A  1 29  ? 9.720   -28.572  -2.846  1.00 26.40 ? 27  SER A O     1 
ATOM   195   C  CB    . SER A  1 29  ? 11.837  -28.695  -5.444  1.00 35.13 ? 27  SER A CB    1 
ATOM   196   O  OG    . SER A  1 29  ? 12.651  -28.927  -4.314  1.00 40.38 ? 27  SER A OG    1 
ATOM   197   N  N     . GLU A  1 30  ? 9.412   -26.931  -4.352  1.00 29.49 ? 28  GLU A N     1 
ATOM   198   C  CA    . GLU A  1 30  ? 8.858   -26.001  -3.360  1.00 35.05 ? 28  GLU A CA    1 
ATOM   199   C  C     . GLU A  1 30  ? 7.589   -26.531  -2.716  1.00 35.40 ? 28  GLU A C     1 
ATOM   200   O  O     . GLU A  1 30  ? 7.346   -26.294  -1.529  1.00 34.41 ? 28  GLU A O     1 
ATOM   201   C  CB    . GLU A  1 30  ? 8.596   -24.607  -3.955  1.00 30.44 ? 28  GLU A CB    1 
ATOM   202   C  CG    . GLU A  1 30  ? 9.632   -23.606  -3.544  1.00 45.92 ? 28  GLU A CG    1 
ATOM   203   C  CD    . GLU A  1 30  ? 10.189  -23.924  -2.161  1.00 53.12 ? 28  GLU A CD    1 
ATOM   204   O  OE1   . GLU A  1 30  ? 9.454   -23.695  -1.162  1.00 49.47 ? 28  GLU A OE1   1 
ATOM   205   O  OE2   . GLU A  1 30  ? 11.343  -24.429  -2.094  1.00 54.63 ? 28  GLU A OE2   1 
ATOM   206   N  N     . TYR A  1 31  ? 6.775   -27.226  -3.509  1.00 36.64 ? 29  TYR A N     1 
ATOM   207   C  CA    . TYR A  1 31  ? 5.570   -27.897  -3.014  1.00 32.45 ? 29  TYR A CA    1 
ATOM   208   C  C     . TYR A  1 31  ? 5.895   -28.920  -1.920  1.00 32.86 ? 29  TYR A C     1 
ATOM   209   O  O     . TYR A  1 31  ? 5.217   -28.975  -0.893  1.00 32.87 ? 29  TYR A O     1 
ATOM   210   C  CB    . TYR A  1 31  ? 4.863   -28.607  -4.176  1.00 29.61 ? 29  TYR A CB    1 
ATOM   211   C  CG    . TYR A  1 31  ? 3.759   -29.593  -3.796  1.00 31.06 ? 29  TYR A CG    1 
ATOM   212   C  CD1   . TYR A  1 31  ? 2.435   -29.175  -3.652  1.00 29.76 ? 29  TYR A CD1   1 
ATOM   213   C  CD2   . TYR A  1 31  ? 4.038   -30.951  -3.647  1.00 34.07 ? 29  TYR A CD2   1 
ATOM   214   C  CE1   . TYR A  1 31  ? 1.424   -30.082  -3.342  1.00 27.80 ? 29  TYR A CE1   1 
ATOM   215   C  CE2   . TYR A  1 31  ? 3.043   -31.861  -3.337  1.00 33.79 ? 29  TYR A CE2   1 
ATOM   216   C  CZ    . TYR A  1 31  ? 1.749   -31.421  -3.176  1.00 33.70 ? 29  TYR A CZ    1 
ATOM   217   O  OH    . TYR A  1 31  ? 0.795   -32.354  -2.868  1.00 30.93 ? 29  TYR A OH    1 
ATOM   218   N  N     . GLU A  1 32  ? 6.914   -29.743  -2.145  1.00 27.18 ? 30  GLU A N     1 
ATOM   219   C  CA    . GLU A  1 32  ? 7.220   -30.778  -1.183  1.00 30.65 ? 30  GLU A CA    1 
ATOM   220   C  C     . GLU A  1 32  ? 7.814   -30.131  0.070   1.00 38.80 ? 30  GLU A C     1 
ATOM   221   O  O     . GLU A  1 32  ? 7.601   -30.598  1.185   1.00 37.39 ? 30  GLU A O     1 
ATOM   222   C  CB    . GLU A  1 32  ? 8.197   -31.803  -1.758  1.00 28.82 ? 30  GLU A CB    1 
ATOM   223   C  CG    . GLU A  1 32  ? 7.709   -32.597  -2.955  1.00 25.85 ? 30  GLU A CG    1 
ATOM   224   C  CD    . GLU A  1 32  ? 8.672   -33.719  -3.333  1.00 25.92 ? 30  GLU A CD    1 
ATOM   225   O  OE1   . GLU A  1 32  ? 9.881   -33.439  -3.521  1.00 26.70 ? 30  GLU A OE1   1 
ATOM   226   O  OE2   . GLU A  1 32  ? 8.211   -34.874  -3.450  1.00 27.89 ? 30  GLU A OE2   1 
ATOM   227   N  N     . LYS A  1 33  ? 8.585   -29.069  -0.126  1.00 37.28 ? 31  LYS A N     1 
ATOM   228   C  CA    . LYS A  1 33  ? 9.210   -28.383  1.003   1.00 39.89 ? 31  LYS A CA    1 
ATOM   229   C  C     . LYS A  1 33  ? 8.152   -27.622  1.790   1.00 40.81 ? 31  LYS A C     1 
ATOM   230   O  O     . LYS A  1 33  ? 8.086   -27.719  3.013   1.00 37.69 ? 31  LYS A O     1 
ATOM   231   C  CB    . LYS A  1 33  ? 10.294  -27.431  0.525   1.00 34.32 ? 31  LYS A CB    1 
ATOM   232   C  CG    . LYS A  1 33  ? 11.437  -28.125  -0.231  1.00 46.95 ? 31  LYS A CG    1 
ATOM   233   C  CD    . LYS A  1 33  ? 12.456  -27.080  -0.736  1.00 51.50 ? 31  LYS A CD    1 
ATOM   234   C  CE    . LYS A  1 33  ? 12.889  -27.331  -2.185  1.00 41.47 ? 31  LYS A CE    1 
ATOM   235   N  NZ    . LYS A  1 33  ? 13.673  -28.604  -2.300  1.00 50.40 ? 31  LYS A NZ    1 
ATOM   236   N  N     . SER A  1 34  ? 7.298   -26.904  1.068   1.00 38.96 ? 32  SER A N     1 
ATOM   237   C  CA    . SER A  1 34  ? 6.246   -26.105  1.678   1.00 36.55 ? 32  SER A CA    1 
ATOM   238   C  C     . SER A  1 34  ? 5.067   -26.889  2.277   1.00 43.86 ? 32  SER A C     1 
ATOM   239   O  O     . SER A  1 34  ? 4.366   -26.359  3.141   1.00 37.81 ? 32  SER A O     1 
ATOM   240   C  CB    . SER A  1 34  ? 5.708   -25.080  0.679   1.00 42.77 ? 32  SER A CB    1 
ATOM   241   O  OG    . SER A  1 34  ? 4.596   -25.599  -0.030  1.00 44.59 ? 32  SER A OG    1 
ATOM   242   N  N     . THR A  1 35  ? 4.816   -28.121  1.831   1.00 38.17 ? 33  THR A N     1 
ATOM   243   C  CA    . THR A  1 35  ? 3.685   -28.861  2.406   1.00 35.75 ? 33  THR A CA    1 
ATOM   244   C  C     . THR A  1 35  ? 4.091   -30.103  3.180   1.00 38.73 ? 33  THR A C     1 
ATOM   245   O  O     . THR A  1 35  ? 3.261   -30.646  3.925   1.00 36.66 ? 33  THR A O     1 
ATOM   246   C  CB    . THR A  1 35  ? 2.609   -29.289  1.367   1.00 38.98 ? 33  THR A CB    1 
ATOM   247   O  OG1   . THR A  1 35  ? 3.151   -30.301  0.503   1.00 31.66 ? 33  THR A OG1   1 
ATOM   248   C  CG2   . THR A  1 35  ? 2.041   -28.069  0.566   1.00 31.36 ? 33  THR A CG2   1 
ATOM   249   N  N     . GLY A  1 36  ? 5.334   -30.567  2.991   1.00 33.04 ? 34  GLY A N     1 
ATOM   250   C  CA    . GLY A  1 36  ? 5.789   -31.811  3.592   1.00 30.65 ? 34  GLY A CA    1 
ATOM   251   C  C     . GLY A  1 36  ? 5.290   -33.078  2.906   1.00 34.29 ? 34  GLY A C     1 
ATOM   252   O  O     . GLY A  1 36  ? 5.585   -34.220  3.334   1.00 34.07 ? 34  GLY A O     1 
ATOM   253   N  N     . LYS A  1 37  ? 4.528   -32.897  1.829   1.00 37.63 ? 35  LYS A N     1 
ATOM   254   C  CA    . LYS A  1 37  ? 4.055   -34.054  1.054   1.00 33.25 ? 35  LYS A CA    1 
ATOM   255   C  C     . LYS A  1 37  ? 5.115   -34.523  0.069   1.00 29.58 ? 35  LYS A C     1 
ATOM   256   O  O     . LYS A  1 37  ? 5.998   -33.754  -0.308  1.00 33.52 ? 35  LYS A O     1 
ATOM   257   C  CB    . LYS A  1 37  ? 2.805   -33.711  0.264   1.00 33.11 ? 35  LYS A CB    1 
ATOM   258   C  CG    . LYS A  1 37  ? 1.695   -33.116  1.091   1.00 33.56 ? 35  LYS A CG    1 
ATOM   259   C  CD    . LYS A  1 37  ? 0.480   -32.848  0.214   1.00 38.26 ? 35  LYS A CD    1 
ATOM   260   C  CE    . LYS A  1 37  ? -0.603  -32.146  0.974   1.00 32.94 ? 35  LYS A CE    1 
ATOM   261   N  NZ    . LYS A  1 37  ? -1.333  -31.258  0.032   1.00 32.82 ? 35  LYS A NZ    1 
ATOM   262   N  N     . GLU A  1 38  ? 4.996   -35.781  -0.344  1.00 24.05 ? 36  GLU A N     1 
ATOM   263   C  CA    . GLU A  1 38  ? 5.776   -36.356  -1.430  1.00 29.28 ? 36  GLU A CA    1 
ATOM   264   C  C     . GLU A  1 38  ? 4.972   -36.486  -2.738  1.00 26.78 ? 36  GLU A C     1 
ATOM   265   O  O     . GLU A  1 38  ? 3.850   -37.035  -2.772  1.00 29.40 ? 36  GLU A O     1 
ATOM   266   C  CB    . GLU A  1 38  ? 6.346   -37.715  -1.005  1.00 30.82 ? 36  GLU A CB    1 
ATOM   267   C  CG    . GLU A  1 38  ? 6.368   -38.810  -2.087  1.00 39.20 ? 36  GLU A CG    1 
ATOM   268   C  CD    . GLU A  1 38  ? 6.838   -40.183  -1.543  1.00 48.37 ? 36  GLU A CD    1 
ATOM   269   O  OE1   . GLU A  1 38  ? 7.362   -40.215  -0.408  1.00 46.66 ? 36  GLU A OE1   1 
ATOM   270   O  OE2   . GLU A  1 38  ? 6.678   -41.213  -2.252  1.00 53.94 ? 36  GLU A OE2   1 
ATOM   271   N  N     . ILE A  1 39  ? 5.570   -35.976  -3.813  1.00 22.82 ? 37  ILE A N     1 
ATOM   272   C  CA    . ILE A  1 39  ? 5.082   -36.180  -5.169  1.00 19.97 ? 37  ILE A CA    1 
ATOM   273   C  C     . ILE A  1 39  ? 5.380   -37.614  -5.602  1.00 25.79 ? 37  ILE A C     1 
ATOM   274   O  O     . ILE A  1 39  ? 6.542   -38.009  -5.609  1.00 27.38 ? 37  ILE A O     1 
ATOM   275   C  CB    . ILE A  1 39  ? 5.772   -35.202  -6.123  1.00 23.10 ? 37  ILE A CB    1 
ATOM   276   C  CG1   . ILE A  1 39  ? 5.278   -33.770  -5.832  1.00 28.89 ? 37  ILE A CG1   1 
ATOM   277   C  CG2   . ILE A  1 39  ? 5.518   -35.606  -7.581  1.00 21.84 ? 37  ILE A CG2   1 
ATOM   278   C  CD1   . ILE A  1 39  ? 6.084   -32.627  -6.510  1.00 28.08 ? 37  ILE A CD1   1 
ATOM   279   N  N     . SER A  1 40  ? 4.345   -38.399  -5.929  1.00 24.72 ? 38  SER A N     1 
ATOM   280   C  CA    . SER A  1 40  ? 4.572   -39.751  -6.482  1.00 28.67 ? 38  SER A CA    1 
ATOM   281   C  C     . SER A  1 40  ? 5.120   -39.668  -7.892  1.00 27.05 ? 38  SER A C     1 
ATOM   282   O  O     . SER A  1 40  ? 6.140   -40.292  -8.216  1.00 28.13 ? 38  SER A O     1 
ATOM   283   C  CB    . SER A  1 40  ? 3.305   -40.596  -6.524  1.00 25.62 ? 38  SER A CB    1 
ATOM   284   O  OG    . SER A  1 40  ? 2.767   -40.797  -5.229  1.00 41.01 ? 38  SER A OG    1 
ATOM   285   N  N     . PHE A  1 41  ? 4.429   -38.917  -8.741  1.00 18.65 ? 39  PHE A N     1 
ATOM   286   C  CA    . PHE A  1 41  ? 4.976   -38.606  -10.053 1.00 22.33 ? 39  PHE A CA    1 
ATOM   287   C  C     . PHE A  1 41  ? 4.273   -37.403  -10.681 1.00 19.09 ? 39  PHE A C     1 
ATOM   288   O  O     . PHE A  1 41  ? 3.363   -36.805  -10.090 1.00 18.93 ? 39  PHE A O     1 
ATOM   289   C  CB    . PHE A  1 41  ? 4.901   -39.828  -10.966 1.00 20.41 ? 39  PHE A CB    1 
ATOM   290   C  CG    . PHE A  1 41  ? 3.521   -40.268  -11.223 1.00 18.42 ? 39  PHE A CG    1 
ATOM   291   C  CD1   . PHE A  1 41  ? 2.873   -41.117  -10.330 1.00 25.09 ? 39  PHE A CD1   1 
ATOM   292   C  CD2   . PHE A  1 41  ? 2.816   -39.788  -12.326 1.00 19.67 ? 39  PHE A CD2   1 
ATOM   293   C  CE1   . PHE A  1 41  ? 1.533   -41.521  -10.548 1.00 21.90 ? 39  PHE A CE1   1 
ATOM   294   C  CE2   . PHE A  1 41  ? 1.492   -40.199  -12.566 1.00 16.21 ? 39  PHE A CE2   1 
ATOM   295   C  CZ    . PHE A  1 41  ? 0.847   -41.065  -11.663 1.00 20.78 ? 39  PHE A CZ    1 
ATOM   296   N  N     . VAL A  1 42  ? 4.725   -37.051  -11.872 1.00 21.13 ? 40  VAL A N     1 
ATOM   297   C  CA    . VAL A  1 42  ? 4.305   -35.837  -12.541 1.00 20.58 ? 40  VAL A CA    1 
ATOM   298   C  C     . VAL A  1 42  ? 3.724   -36.144  -13.913 1.00 15.26 ? 40  VAL A C     1 
ATOM   299   O  O     . VAL A  1 42  ? 4.271   -36.959  -14.678 1.00 17.43 ? 40  VAL A O     1 
ATOM   300   C  CB    . VAL A  1 42  ? 5.509   -34.915  -12.766 1.00 15.29 ? 40  VAL A CB    1 
ATOM   301   C  CG1   . VAL A  1 42  ? 5.067   -33.600  -13.446 1.00 12.31 ? 40  VAL A CG1   1 
ATOM   302   C  CG2   . VAL A  1 42  ? 6.282   -34.638  -11.440 1.00 16.22 ? 40  VAL A CG2   1 
ATOM   303   N  N     . ILE A  1 43  ? 2.647   -35.457  -14.248 1.00 15.20 ? 41  ILE A N     1 
ATOM   304   C  CA    . ILE A  1 43  ? 2.039   -35.606  -15.562 1.00 16.79 ? 41  ILE A CA    1 
ATOM   305   C  C     . ILE A  1 43  ? 2.016   -34.234  -16.238 1.00 18.60 ? 41  ILE A C     1 
ATOM   306   O  O     . ILE A  1 43  ? 1.661   -33.234  -15.610 1.00 16.04 ? 41  ILE A O     1 
ATOM   307   C  CB    . ILE A  1 43  ? 0.629   -36.116  -15.473 1.00 17.55 ? 41  ILE A CB    1 
ATOM   308   C  CG1   . ILE A  1 43  ? 0.557   -37.355  -14.619 1.00 20.05 ? 41  ILE A CG1   1 
ATOM   309   C  CG2   . ILE A  1 43  ? 0.095   -36.470  -16.860 1.00 24.10 ? 41  ILE A CG2   1 
ATOM   310   C  CD1   . ILE A  1 43  ? -0.879  -37.806  -14.414 1.00 20.92 ? 41  ILE A CD1   1 
ATOM   311   N  N     . CYS A  1 44  ? 2.415   -34.187  -17.506 1.00 14.39 ? 42  CYS A N     1 
ATOM   312   C  CA    . CYS A  1 44  ? 2.527   -32.921  -18.232 1.00 12.23 ? 42  CYS A CA    1 
ATOM   313   C  C     . CYS A  1 44  ? 1.752   -33.037  -19.500 1.00 13.54 ? 42  CYS A C     1 
ATOM   314   O  O     . CYS A  1 44  ? 1.868   -34.037  -20.207 1.00 13.95 ? 42  CYS A O     1 
ATOM   315   C  CB    . CYS A  1 44  ? 3.984   -32.637  -18.609 1.00 15.34 ? 42  CYS A CB    1 
ATOM   316   S  SG    . CYS A  1 44  ? 5.132   -32.308  -17.243 1.00 17.81 ? 42  CYS A SG    1 
ATOM   317   N  N     . THR A  1 45  ? 0.998   -31.990  -19.828 1.00 15.62 ? 43  THR A N     1 
ATOM   318   C  CA    . THR A  1 45  ? 0.029   -32.075  -20.909 1.00 14.76 ? 43  THR A CA    1 
ATOM   319   C  C     . THR A  1 45  ? 0.534   -31.443  -22.196 1.00 17.35 ? 43  THR A C     1 
ATOM   320   O  O     . THR A  1 45  ? -0.272  -31.119  -23.075 1.00 18.75 ? 43  THR A O     1 
ATOM   321   C  CB    . THR A  1 45  ? -1.245  -31.308  -20.534 1.00 17.81 ? 43  THR A CB    1 
ATOM   322   O  OG1   . THR A  1 45  ? -0.875  -30.007  -20.062 1.00 20.91 ? 43  THR A OG1   1 
ATOM   323   C  CG2   . THR A  1 45  ? -2.048  -32.008  -19.471 1.00 18.28 ? 43  THR A CG2   1 
ATOM   324   N  N     . GLY A  1 46  ? 1.842   -31.219  -22.318 1.00 13.78 ? 44  GLY A N     1 
ATOM   325   C  CA    . GLY A  1 46  ? 2.349   -30.863  -23.641 1.00 14.35 ? 44  GLY A CA    1 
ATOM   326   C  C     . GLY A  1 46  ? 3.191   -29.604  -23.807 1.00 14.93 ? 44  GLY A C     1 
ATOM   327   O  O     . GLY A  1 46  ? 3.538   -28.950  -22.813 1.00 14.26 ? 44  GLY A O     1 
ATOM   328   N  N     . ASP A  1 47  ? 3.519   -29.307  -25.077 1.00 11.18 ? 45  ASP A N     1 
ATOM   329   C  CA    . ASP A  1 47  ? 4.528   -28.342  -25.491 1.00 17.21 ? 45  ASP A CA    1 
ATOM   330   C  C     . ASP A  1 47  ? 5.799   -28.566  -24.706 1.00 15.91 ? 45  ASP A C     1 
ATOM   331   O  O     . ASP A  1 47  ? 6.314   -27.643  -24.051 1.00 17.49 ? 45  ASP A O     1 
ATOM   332   C  CB    . ASP A  1 47  ? 4.004   -26.895  -25.342 1.00 16.96 ? 45  ASP A CB    1 
ATOM   333   C  CG    . ASP A  1 47  ? 2.805   -26.615  -26.230 1.00 21.13 ? 45  ASP A CG    1 
ATOM   334   O  OD1   . ASP A  1 47  ? 2.571   -27.412  -27.162 1.00 21.42 ? 45  ASP A OD1   1 
ATOM   335   O  OD2   . ASP A  1 47  ? 2.094   -25.603  -25.997 1.00 22.35 ? 45  ASP A OD2   1 
ATOM   336   N  N     . MET A  1 48  ? 6.292   -29.815  -24.760 1.00 14.66 ? 46  MET A N     1 
ATOM   337   C  CA    . MET A  1 48  ? 7.488   -30.231  -24.027 1.00 16.31 ? 46  MET A CA    1 
ATOM   338   C  C     . MET A  1 48  ? 8.794   -29.685  -24.639 1.00 13.75 ? 46  MET A C     1 
ATOM   339   O  O     . MET A  1 48  ? 9.747   -29.469  -23.927 1.00 14.94 ? 46  MET A O     1 
ATOM   340   C  CB    . MET A  1 48  ? 7.528   -31.761  -23.849 1.00 14.73 ? 46  MET A CB    1 
ATOM   341   C  CG    . MET A  1 48  ? 6.192   -32.331  -23.344 1.00 15.86 ? 46  MET A CG    1 
ATOM   342   S  SD    . MET A  1 48  ? 5.715   -31.589  -21.742 1.00 17.19 ? 46  MET A SD    1 
ATOM   343   C  CE    . MET A  1 48  ? 7.067   -32.210  -20.763 1.00 11.12 ? 46  MET A CE    1 
ATOM   344   N  N     . GLN A  1 49  ? 8.832   -29.451  -25.944 1.00 11.17 ? 47  GLN A N     1 
ATOM   345   C  CA    . GLN A  1 49  ? 10.029  -28.866  -26.580 1.00 14.72 ? 47  GLN A CA    1 
ATOM   346   C  C     . GLN A  1 49  ? 11.323  -29.602  -26.201 1.00 16.78 ? 47  GLN A C     1 
ATOM   347   O  O     . GLN A  1 49  ? 12.310  -28.999  -25.722 1.00 19.74 ? 47  GLN A O     1 
ATOM   348   C  CB    . GLN A  1 49  ? 10.122  -27.351  -26.267 1.00 16.65 ? 47  GLN A CB    1 
ATOM   349   C  CG    . GLN A  1 49  ? 8.800   -26.669  -26.625 1.00 23.81 ? 47  GLN A CG    1 
ATOM   350   C  CD    . GLN A  1 49  ? 8.816   -25.144  -26.528 1.00 27.55 ? 47  GLN A CD    1 
ATOM   351   O  OE1   . GLN A  1 49  ? 7.752   -24.496  -26.588 1.00 25.64 ? 47  GLN A OE1   1 
ATOM   352   N  NE2   . GLN A  1 49  ? 10.010  -24.568  -26.387 1.00 18.79 ? 47  GLN A NE2   1 
ATOM   353   N  N     . THR A  1 50  ? 11.329  -30.907  -26.474 1.00 14.44 ? 48  THR A N     1 
ATOM   354   C  CA    . THR A  1 50  ? 12.417  -31.794  -26.093 1.00 17.55 ? 48  THR A CA    1 
ATOM   355   C  C     . THR A  1 50  ? 13.474  -31.776  -27.190 1.00 19.44 ? 48  THR A C     1 
ATOM   356   O  O     . THR A  1 50  ? 13.687  -32.783  -27.861 1.00 17.83 ? 48  THR A O     1 
ATOM   357   C  CB    . THR A  1 50  ? 11.870  -33.233  -25.830 1.00 12.92 ? 48  THR A CB    1 
ATOM   358   O  OG1   . THR A  1 50  ? 11.293  -33.764  -27.030 1.00 15.19 ? 48  THR A OG1   1 
ATOM   359   C  CG2   . THR A  1 50  ? 10.753  -33.180  -24.800 1.00 9.50  ? 48  THR A CG2   1 
ATOM   360   N  N     . LEU A  1 51  ? 14.098  -30.608  -27.392 1.00 17.69 ? 49  LEU A N     1 
ATOM   361   C  CA    . LEU A  1 51  ? 15.090  -30.459  -28.445 1.00 13.94 ? 49  LEU A CA    1 
ATOM   362   C  C     . LEU A  1 51  ? 16.415  -30.971  -27.912 1.00 18.09 ? 49  LEU A C     1 
ATOM   363   O  O     . LEU A  1 51  ? 16.925  -30.487  -26.875 1.00 16.65 ? 49  LEU A O     1 
ATOM   364   C  CB    . LEU A  1 51  ? 15.213  -28.990  -28.891 1.00 14.72 ? 49  LEU A CB    1 
ATOM   365   C  CG    . LEU A  1 51  ? 14.115  -28.438  -29.805 1.00 12.51 ? 49  LEU A CG    1 
ATOM   366   C  CD1   . LEU A  1 51  ? 12.803  -28.305  -29.007 1.00 22.52 ? 49  LEU A CD1   1 
ATOM   367   C  CD2   . LEU A  1 51  ? 14.551  -27.049  -30.311 1.00 19.84 ? 49  LEU A CD2   1 
ATOM   368   N  N     . ARG A  1 52  ? 16.981  -31.967  -28.587 1.00 14.81 ? 50  ARG A N     1 
ATOM   369   C  CA    . ARG A  1 52  ? 18.221  -32.536  -28.086 1.00 13.35 ? 50  ARG A CA    1 
ATOM   370   C  C     . ARG A  1 52  ? 19.442  -31.604  -28.287 1.00 16.65 ? 50  ARG A C     1 
ATOM   371   O  O     . ARG A  1 52  ? 20.381  -31.606  -27.482 1.00 17.97 ? 50  ARG A O     1 
ATOM   372   C  CB    . ARG A  1 52  ? 18.524  -33.828  -28.842 1.00 18.39 ? 50  ARG A CB    1 
ATOM   373   C  CG    . ARG A  1 52  ? 17.512  -34.930  -28.591 1.00 14.42 ? 50  ARG A CG    1 
ATOM   374   C  CD    . ARG A  1 52  ? 17.655  -35.975  -29.668 1.00 15.68 ? 50  ARG A CD    1 
ATOM   375   N  NE    . ARG A  1 52  ? 17.475  -35.424  -31.008 1.00 16.61 ? 50  ARG A NE    1 
ATOM   376   C  CZ    . ARG A  1 52  ? 17.223  -36.167  -32.075 1.00 23.19 ? 50  ARG A CZ    1 
ATOM   377   N  NH1   . ARG A  1 52  ? 17.140  -37.489  -31.937 1.00 18.68 ? 50  ARG A NH1   1 
ATOM   378   N  NH2   . ARG A  1 52  ? 17.065  -35.607  -33.268 1.00 14.89 ? 50  ARG A NH2   1 
ATOM   379   N  N     . TYR A  1 53  ? 19.449  -30.908  -29.414 1.00 18.12 ? 51  TYR A N     1 
ATOM   380   C  CA    . TYR A  1 53  ? 20.580  -30.068  -29.852 1.00 18.52 ? 51  TYR A CA    1 
ATOM   381   C  C     . TYR A  1 53  ? 20.105  -29.069  -30.906 1.00 17.19 ? 51  TYR A C     1 
ATOM   382   O  O     . TYR A  1 53  ? 18.912  -29.117  -31.316 1.00 17.34 ? 51  TYR A O     1 
ATOM   383   C  CB    . TYR A  1 53  ? 21.756  -30.915  -30.362 1.00 20.45 ? 51  TYR A CB    1 
ATOM   384   C  CG    . TYR A  1 53  ? 21.387  -32.297  -30.882 1.00 19.78 ? 51  TYR A CG    1 
ATOM   385   C  CD1   . TYR A  1 53  ? 20.564  -32.443  -31.986 1.00 20.65 ? 51  TYR A CD1   1 
ATOM   386   C  CD2   . TYR A  1 53  ? 21.881  -33.462  -30.257 1.00 24.75 ? 51  TYR A CD2   1 
ATOM   387   C  CE1   . TYR A  1 53  ? 20.225  -33.716  -32.484 1.00 18.56 ? 51  TYR A CE1   1 
ATOM   388   C  CE2   . TYR A  1 53  ? 21.549  -34.757  -30.749 1.00 21.64 ? 51  TYR A CE2   1 
ATOM   389   C  CZ    . TYR A  1 53  ? 20.719  -34.861  -31.862 1.00 23.30 ? 51  TYR A CZ    1 
ATOM   390   O  OH    . TYR A  1 53  ? 20.379  -36.113  -32.364 1.00 24.72 ? 51  TYR A OH    1 
ATOM   391   N  N     . GLU A  1 54  ? 20.997  -28.156  -31.315 1.00 14.90 ? 52  GLU A N     1 
ATOM   392   C  CA    . GLU A  1 54  ? 20.580  -27.026  -32.145 1.00 17.66 ? 52  GLU A CA    1 
ATOM   393   C  C     . GLU A  1 54  ? 19.853  -27.462  -33.391 1.00 18.48 ? 52  GLU A C     1 
ATOM   394   O  O     . GLU A  1 54  ? 18.850  -26.852  -33.782 1.00 18.60 ? 52  GLU A O     1 
ATOM   395   C  CB    . GLU A  1 54  ? 21.747  -26.086  -32.532 1.00 16.47 ? 52  GLU A CB    1 
ATOM   396   C  CG    . GLU A  1 54  ? 22.475  -25.413  -31.345 1.00 21.94 ? 52  GLU A CG    1 
ATOM   397   C  CD    . GLU A  1 54  ? 23.626  -24.475  -31.775 1.00 24.71 ? 52  GLU A CD    1 
ATOM   398   O  OE1   . GLU A  1 54  ? 24.383  -23.979  -30.895 1.00 21.72 ? 52  GLU A OE1   1 
ATOM   399   O  OE2   . GLU A  1 54  ? 23.756  -24.230  -32.991 1.00 25.54 ? 52  GLU A OE2   1 
ATOM   400   N  N     . ALA A  1 55  ? 20.364  -28.516  -34.026 1.00 18.65 ? 53  ALA A N     1 
ATOM   401   C  CA    . ALA A  1 55  ? 19.739  -29.036  -35.236 1.00 17.09 ? 53  ALA A CA    1 
ATOM   402   C  C     . ALA A  1 55  ? 18.217  -29.261  -35.088 1.00 17.40 ? 53  ALA A C     1 
ATOM   403   O  O     . ALA A  1 55  ? 17.452  -29.065  -36.039 1.00 16.16 ? 53  ALA A O     1 
ATOM   404   C  CB    . ALA A  1 55  ? 20.445  -30.304  -35.721 1.00 13.98 ? 53  ALA A CB    1 
ATOM   405   N  N     . ASP A  1 56  ? 17.763  -29.677  -33.908 1.00 17.28 ? 54  ASP A N     1 
ATOM   406   C  CA    . ASP A  1 56  ? 16.333  -29.983  -33.770 1.00 19.20 ? 54  ASP A CA    1 
ATOM   407   C  C     . ASP A  1 56  ? 15.484  -28.725  -33.850 1.00 20.53 ? 54  ASP A C     1 
ATOM   408   O  O     . ASP A  1 56  ? 14.283  -28.838  -33.990 1.00 19.97 ? 54  ASP A O     1 
ATOM   409   C  CB    . ASP A  1 56  ? 16.007  -30.717  -32.452 1.00 15.78 ? 54  ASP A CB    1 
ATOM   410   C  CG    . ASP A  1 56  ? 16.573  -32.170  -32.391 1.00 18.14 ? 54  ASP A CG    1 
ATOM   411   O  OD1   . ASP A  1 56  ? 16.667  -32.838  -33.456 1.00 15.01 ? 54  ASP A OD1   1 
ATOM   412   O  OD2   . ASP A  1 56  ? 16.912  -32.616  -31.261 1.00 13.68 ? 54  ASP A OD2   1 
ATOM   413   N  N     . LEU A  1 57  ? 16.078  -27.528  -33.738 1.00 20.73 ? 55  LEU A N     1 
ATOM   414   C  CA    . LEU A  1 57  ? 15.265  -26.308  -33.825 1.00 18.03 ? 55  LEU A CA    1 
ATOM   415   C  C     . LEU A  1 57  ? 14.427  -26.326  -35.101 1.00 22.20 ? 55  LEU A C     1 
ATOM   416   O  O     . LEU A  1 57  ? 13.344  -25.732  -35.158 1.00 17.11 ? 55  LEU A O     1 
ATOM   417   C  CB    . LEU A  1 57  ? 16.126  -25.038  -33.826 1.00 18.20 ? 55  LEU A CB    1 
ATOM   418   C  CG    . LEU A  1 57  ? 16.705  -24.695  -32.463 1.00 23.46 ? 55  LEU A CG    1 
ATOM   419   C  CD1   . LEU A  1 57  ? 17.837  -23.662  -32.568 1.00 27.91 ? 55  LEU A CD1   1 
ATOM   420   C  CD2   . LEU A  1 57  ? 15.582  -24.211  -31.563 1.00 21.27 ? 55  LEU A CD2   1 
ATOM   421   N  N     . VAL A  1 58  ? 14.928  -27.016  -36.126 1.00 21.31 ? 56  VAL A N     1 
ATOM   422   C  CA    . VAL A  1 58  ? 14.218  -27.100  -37.419 1.00 19.46 ? 56  VAL A CA    1 
ATOM   423   C  C     . VAL A  1 58  ? 12.806  -27.694  -37.301 1.00 23.56 ? 56  VAL A C     1 
ATOM   424   O  O     . VAL A  1 58  ? 11.920  -27.414  -38.125 1.00 19.32 ? 56  VAL A O     1 
ATOM   425   C  CB    . VAL A  1 58  ? 15.093  -27.867  -38.455 1.00 24.17 ? 56  VAL A CB    1 
ATOM   426   C  CG1   . VAL A  1 58  ? 14.359  -28.096  -39.751 1.00 28.07 ? 56  VAL A CG1   1 
ATOM   427   C  CG2   . VAL A  1 58  ? 16.389  -27.081  -38.713 1.00 16.31 ? 56  VAL A CG2   1 
ATOM   428   N  N     . TYR A  1 59  ? 12.587  -28.493  -36.259 1.00 14.32 ? 57  TYR A N     1 
ATOM   429   C  CA    . TYR A  1 59  ? 11.330  -29.207  -36.146 1.00 15.81 ? 57  TYR A CA    1 
ATOM   430   C  C     . TYR A  1 59  ? 10.314  -28.564  -35.184 1.00 20.70 ? 57  TYR A C     1 
ATOM   431   O  O     . TYR A  1 59  ? 9.236   -29.084  -34.983 1.00 18.21 ? 57  TYR A O     1 
ATOM   432   C  CB    . TYR A  1 59  ? 11.599  -30.657  -35.754 1.00 17.58 ? 57  TYR A CB    1 
ATOM   433   C  CG    . TYR A  1 59  ? 12.065  -31.497  -36.917 1.00 19.14 ? 57  TYR A CG    1 
ATOM   434   C  CD1   . TYR A  1 59  ? 11.143  -32.097  -37.776 1.00 20.60 ? 57  TYR A CD1   1 
ATOM   435   C  CD2   . TYR A  1 59  ? 13.423  -31.687  -37.161 1.00 20.27 ? 57  TYR A CD2   1 
ATOM   436   C  CE1   . TYR A  1 59  ? 11.567  -32.870  -38.854 1.00 22.97 ? 57  TYR A CE1   1 
ATOM   437   C  CE2   . TYR A  1 59  ? 13.868  -32.470  -38.230 1.00 24.22 ? 57  TYR A CE2   1 
ATOM   438   C  CZ    . TYR A  1 59  ? 12.928  -33.054  -39.071 1.00 21.92 ? 57  TYR A CZ    1 
ATOM   439   O  OH    . TYR A  1 59  ? 13.355  -33.839  -40.133 1.00 25.14 ? 57  TYR A OH    1 
ATOM   440   N  N     . LEU A  1 60  ? 10.678  -27.429  -34.597 1.00 17.93 ? 58  LEU A N     1 
ATOM   441   C  CA    . LEU A  1 60  ? 9.868   -26.783  -33.572 1.00 14.69 ? 58  LEU A CA    1 
ATOM   442   C  C     . LEU A  1 60  ? 9.072   -25.752  -34.331 1.00 21.67 ? 58  LEU A C     1 
ATOM   443   O  O     . LEU A  1 60  ? 9.628   -24.778  -34.875 1.00 20.78 ? 58  LEU A O     1 
ATOM   444   C  CB    . LEU A  1 60  ? 10.780  -26.112  -32.536 1.00 21.01 ? 58  LEU A CB    1 
ATOM   445   C  CG    . LEU A  1 60  ? 10.160  -25.232  -31.440 1.00 24.08 ? 58  LEU A CG    1 
ATOM   446   C  CD1   . LEU A  1 60  ? 9.114   -26.064  -30.684 1.00 17.47 ? 58  LEU A CD1   1 
ATOM   447   C  CD2   . LEU A  1 60  ? 11.244  -24.655  -30.477 1.00 11.96 ? 58  LEU A CD2   1 
ATOM   448   N  N     . LYS A  1 61  ? 7.770   -25.965  -34.428 1.00 21.28 ? 59  LYS A N     1 
ATOM   449   C  CA    . LYS A  1 61  ? 6.961   -25.017  -35.164 1.00 21.17 ? 59  LYS A CA    1 
ATOM   450   C  C     . LYS A  1 61  ? 6.580   -23.930  -34.176 1.00 23.34 ? 59  LYS A C     1 
ATOM   451   O  O     . LYS A  1 61  ? 5.759   -24.137  -33.299 1.00 29.18 ? 59  LYS A O     1 
ATOM   452   C  CB    . LYS A  1 61  ? 5.751   -25.701  -35.795 1.00 20.29 ? 59  LYS A CB    1 
ATOM   453   C  CG    . LYS A  1 61  ? 4.536   -24.784  -36.051 1.00 31.68 ? 59  LYS A CG    1 
ATOM   454   C  CD    . LYS A  1 61  ? 4.735   -23.787  -37.161 1.00 37.01 ? 59  LYS A CD    1 
ATOM   455   C  CE    . LYS A  1 61  ? 3.378   -23.320  -37.767 1.00 37.92 ? 59  LYS A CE    1 
ATOM   456   N  NZ    . LYS A  1 61  ? 2.380   -22.784  -36.764 1.00 39.07 ? 59  LYS A NZ    1 
ATOM   457   N  N     . VAL A  1 62  ? 7.240   -22.790  -34.270 1.00 19.47 ? 60  VAL A N     1 
ATOM   458   C  CA    . VAL A  1 62  ? 6.927   -21.670  -33.389 1.00 21.76 ? 60  VAL A CA    1 
ATOM   459   C  C     . VAL A  1 62  ? 7.244   -20.405  -34.162 1.00 25.55 ? 60  VAL A C     1 
ATOM   460   O  O     . VAL A  1 62  ? 7.950   -20.436  -35.184 1.00 22.33 ? 60  VAL A O     1 
ATOM   461   C  CB    . VAL A  1 62  ? 7.816   -21.626  -32.129 1.00 22.27 ? 60  VAL A CB    1 
ATOM   462   C  CG1   . VAL A  1 62  ? 7.497   -22.771  -31.169 1.00 23.14 ? 60  VAL A CG1   1 
ATOM   463   C  CG2   . VAL A  1 62  ? 9.323   -21.624  -32.537 1.00 23.48 ? 60  VAL A CG2   1 
ATOM   464   N  N     . PRO A  1 63  ? 6.713   -19.284  -33.685 1.00 28.36 ? 61  PRO A N     1 
ATOM   465   C  CA    . PRO A  1 63  ? 7.100   -18.035  -34.331 1.00 28.49 ? 61  PRO A CA    1 
ATOM   466   C  C     . PRO A  1 63  ? 8.549   -17.742  -33.987 1.00 28.39 ? 61  PRO A C     1 
ATOM   467   O  O     . PRO A  1 63  ? 9.074   -18.184  -32.939 1.00 28.09 ? 61  PRO A O     1 
ATOM   468   C  CB    . PRO A  1 63  ? 6.154   -17.010  -33.700 1.00 25.67 ? 61  PRO A CB    1 
ATOM   469   C  CG    . PRO A  1 63  ? 5.817   -17.570  -32.357 1.00 31.82 ? 61  PRO A CG    1 
ATOM   470   C  CD    . PRO A  1 63  ? 5.783   -19.083  -32.559 1.00 25.01 ? 61  PRO A CD    1 
ATOM   471   N  N     . PRO A  1 64  ? 9.215   -17.007  -34.876 1.00 31.31 ? 62  PRO A N     1 
ATOM   472   C  CA    . PRO A  1 64  ? 10.659  -16.776  -34.819 1.00 22.16 ? 62  PRO A CA    1 
ATOM   473   C  C     . PRO A  1 64  ? 11.104  -16.392  -33.422 1.00 21.81 ? 62  PRO A C     1 
ATOM   474   O  O     . PRO A  1 64  ? 12.099  -16.917  -32.954 1.00 17.76 ? 62  PRO A O     1 
ATOM   475   C  CB    . PRO A  1 64  ? 10.845  -15.611  -35.792 1.00 25.19 ? 62  PRO A CB    1 
ATOM   476   C  CG    . PRO A  1 64  ? 9.750   -15.820  -36.820 1.00 24.94 ? 62  PRO A CG    1 
ATOM   477   C  CD    . PRO A  1 64  ? 8.573   -16.254  -35.972 1.00 30.17 ? 62  PRO A CD    1 
ATOM   478   N  N     . LYS A  1 65  ? 10.386  -15.511  -32.736 1.00 18.52 ? 63  LYS A N     1 
ATOM   479   C  CA    . LYS A  1 65  ? 10.910  -15.059  -31.447 1.00 23.76 ? 63  LYS A CA    1 
ATOM   480   C  C     . LYS A  1 65  ? 10.971  -16.203  -30.441 1.00 25.71 ? 63  LYS A C     1 
ATOM   481   O  O     . LYS A  1 65  ? 11.577  -16.065  -29.376 1.00 21.77 ? 63  LYS A O     1 
ATOM   482   C  CB    . LYS A  1 65  ? 10.079  -13.901  -30.883 1.00 31.21 ? 63  LYS A CB    1 
ATOM   483   C  CG    . LYS A  1 65  ? 8.585   -14.141  -30.999 1.00 29.07 ? 63  LYS A CG    1 
ATOM   484   C  CD    . LYS A  1 65  ? 7.752   -12.943  -30.551 1.00 45.29 ? 63  LYS A CD    1 
ATOM   485   C  CE    . LYS A  1 65  ? 7.656   -12.859  -29.025 1.00 53.22 ? 63  LYS A CE    1 
ATOM   486   N  NZ    . LYS A  1 65  ? 8.846   -12.205  -28.383 1.00 56.50 ? 63  LYS A NZ    1 
ATOM   487   N  N     . TYR A  1 66  ? 10.337  -17.330  -30.753 1.00 20.17 ? 64  TYR A N     1 
ATOM   488   C  CA    . TYR A  1 66  ? 10.391  -18.455  -29.817 1.00 21.71 ? 64  TYR A CA    1 
ATOM   489   C  C     . TYR A  1 66  ? 11.246  -19.606  -30.325 1.00 21.77 ? 64  TYR A C     1 
ATOM   490   O  O     . TYR A  1 66  ? 11.195  -20.707  -29.802 1.00 18.49 ? 64  TYR A O     1 
ATOM   491   C  CB    . TYR A  1 66  ? 8.990   -18.966  -29.465 1.00 25.93 ? 64  TYR A CB    1 
ATOM   492   C  CG    . TYR A  1 66  ? 8.210   -18.032  -28.569 1.00 29.74 ? 64  TYR A CG    1 
ATOM   493   C  CD1   . TYR A  1 66  ? 8.590   -17.835  -27.243 1.00 29.29 ? 64  TYR A CD1   1 
ATOM   494   C  CD2   . TYR A  1 66  ? 7.078   -17.375  -29.038 1.00 36.83 ? 64  TYR A CD2   1 
ATOM   495   C  CE1   . TYR A  1 66  ? 7.879   -17.003  -26.414 1.00 36.57 ? 64  TYR A CE1   1 
ATOM   496   C  CE2   . TYR A  1 66  ? 6.361   -16.522  -28.218 1.00 44.17 ? 64  TYR A CE2   1 
ATOM   497   C  CZ    . TYR A  1 66  ? 6.758   -16.344  -26.910 1.00 47.21 ? 64  TYR A CZ    1 
ATOM   498   O  OH    . TYR A  1 66  ? 6.038   -15.506  -26.086 1.00 52.46 ? 64  TYR A OH    1 
ATOM   499   N  N     . LYS A  1 67  ? 12.077  -19.342  -31.320 1.00 18.50 ? 65  LYS A N     1 
ATOM   500   C  CA    . LYS A  1 67  ? 13.039  -20.354  -31.732 1.00 18.21 ? 65  LYS A CA    1 
ATOM   501   C  C     . LYS A  1 67  ? 14.191  -20.385  -30.726 1.00 22.16 ? 65  LYS A C     1 
ATOM   502   O  O     . LYS A  1 67  ? 15.276  -19.820  -30.970 1.00 19.99 ? 65  LYS A O     1 
ATOM   503   C  CB    . LYS A  1 67  ? 13.560  -20.106  -33.161 1.00 22.66 ? 65  LYS A CB    1 
ATOM   504   C  CG    . LYS A  1 67  ? 12.527  -20.346  -34.271 1.00 18.33 ? 65  LYS A CG    1 
ATOM   505   C  CD    . LYS A  1 67  ? 12.559  -21.826  -34.794 1.00 22.35 ? 65  LYS A CD    1 
ATOM   506   C  CE    . LYS A  1 67  ? 11.634  -21.988  -36.017 1.00 19.40 ? 65  LYS A CE    1 
ATOM   507   N  NZ    . LYS A  1 67  ? 11.573  -23.417  -36.498 1.00 19.89 ? 65  LYS A NZ    1 
ATOM   508   N  N     . GLN A  1 68  ? 13.955  -21.068  -29.603 1.00 20.32 ? 66  GLN A N     1 
ATOM   509   C  CA    . GLN A  1 68  ? 14.899  -21.105  -28.479 1.00 19.03 ? 66  GLN A CA    1 
ATOM   510   C  C     . GLN A  1 68  ? 15.093  -22.552  -28.077 1.00 24.52 ? 66  GLN A C     1 
ATOM   511   O  O     . GLN A  1 68  ? 14.155  -23.341  -28.208 1.00 17.26 ? 66  GLN A O     1 
ATOM   512   C  CB    . GLN A  1 68  ? 14.324  -20.329  -27.278 1.00 16.91 ? 66  GLN A CB    1 
ATOM   513   C  CG    . GLN A  1 68  ? 14.173  -18.831  -27.530 1.00 25.66 ? 66  GLN A CG    1 
ATOM   514   C  CD    . GLN A  1 68  ? 13.495  -18.085  -26.370 1.00 33.40 ? 66  GLN A CD    1 
ATOM   515   O  OE1   . GLN A  1 68  ? 12.746  -18.671  -25.589 1.00 37.49 ? 66  GLN A OE1   1 
ATOM   516   N  NE2   . GLN A  1 68  ? 13.766  -16.774  -26.266 1.00 33.06 ? 66  GLN A NE2   1 
ATOM   517   N  N     . MET A  1 69  ? 16.277  -22.899  -27.569 1.00 19.80 ? 67  MET A N     1 
ATOM   518   C  CA    . MET A  1 69  ? 16.552  -24.291  -27.198 1.00 17.53 ? 67  MET A CA    1 
ATOM   519   C  C     . MET A  1 69  ? 15.784  -24.711  -25.959 1.00 21.75 ? 67  MET A C     1 
ATOM   520   O  O     . MET A  1 69  ? 15.311  -25.867  -25.826 1.00 16.69 ? 67  MET A O     1 
ATOM   521   C  CB    . MET A  1 69  ? 18.045  -24.495  -26.904 1.00 23.15 ? 67  MET A CB    1 
ATOM   522   C  CG    . MET A  1 69  ? 18.933  -24.634  -28.137 1.00 24.02 ? 67  MET A CG    1 
ATOM   523   S  SD    . MET A  1 69  ? 18.411  -26.077  -29.086 1.00 25.64 ? 67  MET A SD    1 
ATOM   524   C  CE    . MET A  1 69  ? 19.128  -27.333  -28.018 1.00 19.72 ? 67  MET A CE    1 
ATOM   525   N  N     . GLY A  1 70  ? 15.724  -23.793  -24.996 1.00 17.01 ? 68  GLY A N     1 
ATOM   526   C  CA    . GLY A  1 70  ? 15.158  -24.120  -23.703 1.00 22.57 ? 68  GLY A CA    1 
ATOM   527   C  C     . GLY A  1 70  ? 16.061  -25.057  -22.916 1.00 23.02 ? 68  GLY A C     1 
ATOM   528   O  O     . GLY A  1 70  ? 17.272  -25.211  -23.229 1.00 21.02 ? 68  GLY A O     1 
ATOM   529   N  N     . ASP A  1 71  ? 15.454  -25.714  -21.922 1.00 17.85 ? 69  ASP A N     1 
ATOM   530   C  CA    . ASP A  1 71  ? 16.183  -26.473  -20.875 1.00 26.09 ? 69  ASP A CA    1 
ATOM   531   C  C     . ASP A  1 71  ? 16.444  -27.937  -21.243 1.00 21.26 ? 69  ASP A C     1 
ATOM   532   O  O     . ASP A  1 71  ? 17.361  -28.589  -20.720 1.00 21.14 ? 69  ASP A O     1 
ATOM   533   C  CB    . ASP A  1 71  ? 15.330  -26.474  -19.567 1.00 18.07 ? 69  ASP A CB    1 
ATOM   534   C  CG    . ASP A  1 71  ? 15.504  -25.219  -18.790 1.00 29.50 ? 69  ASP A CG    1 
ATOM   535   O  OD1   . ASP A  1 71  ? 15.790  -24.178  -19.449 1.00 40.20 ? 69  ASP A OD1   1 
ATOM   536   O  OD2   . ASP A  1 71  ? 15.368  -25.254  -17.546 1.00 23.94 ? 69  ASP A OD2   1 
ATOM   537   N  N     . PHE A  1 72  ? 15.577  -28.487  -22.077 1.00 17.78 ? 70  PHE A N     1 
ATOM   538   C  CA    . PHE A  1 72  ? 15.587  -29.944  -22.256 1.00 17.34 ? 70  PHE A CA    1 
ATOM   539   C  C     . PHE A  1 72  ? 16.969  -30.568  -22.482 1.00 16.39 ? 70  PHE A C     1 
ATOM   540   O  O     . PHE A  1 72  ? 17.295  -31.629  -21.927 1.00 16.29 ? 70  PHE A O     1 
ATOM   541   C  CB    . PHE A  1 72  ? 14.670  -30.400  -23.388 1.00 19.02 ? 70  PHE A CB    1 
ATOM   542   C  CG    . PHE A  1 72  ? 14.672  -31.880  -23.516 1.00 16.24 ? 70  PHE A CG    1 
ATOM   543   C  CD1   . PHE A  1 72  ? 13.920  -32.650  -22.625 1.00 17.70 ? 70  PHE A CD1   1 
ATOM   544   C  CD2   . PHE A  1 72  ? 15.519  -32.523  -24.412 1.00 14.76 ? 70  PHE A CD2   1 
ATOM   545   C  CE1   . PHE A  1 72  ? 13.964  -34.044  -22.678 1.00 13.15 ? 70  PHE A CE1   1 
ATOM   546   C  CE2   . PHE A  1 72  ? 15.559  -33.926  -24.483 1.00 19.62 ? 70  PHE A CE2   1 
ATOM   547   C  CZ    . PHE A  1 72  ? 14.757  -34.681  -23.607 1.00 16.64 ? 70  PHE A CZ    1 
ATOM   548   N  N     . HIS A  1 73  ? 17.774  -29.934  -23.317 1.00 13.78 ? 71  HIS A N     1 
ATOM   549   C  CA    . HIS A  1 73  ? 19.080  -30.529  -23.652 1.00 15.88 ? 71  HIS A CA    1 
ATOM   550   C  C     . HIS A  1 73  ? 19.957  -30.803  -22.432 1.00 17.28 ? 71  HIS A C     1 
ATOM   551   O  O     . HIS A  1 73  ? 20.700  -31.769  -22.424 1.00 14.03 ? 71  HIS A O     1 
ATOM   552   C  CB    . HIS A  1 73  ? 19.812  -29.658  -24.656 1.00 17.73 ? 71  HIS A CB    1 
ATOM   553   C  CG    . HIS A  1 73  ? 20.345  -28.391  -24.079 1.00 19.49 ? 71  HIS A CG    1 
ATOM   554   N  ND1   . HIS A  1 73  ? 21.655  -28.253  -23.667 1.00 20.38 ? 71  HIS A ND1   1 
ATOM   555   C  CD2   . HIS A  1 73  ? 19.755  -27.187  -23.853 1.00 20.00 ? 71  HIS A CD2   1 
ATOM   556   C  CE1   . HIS A  1 73  ? 21.847  -27.028  -23.215 1.00 18.60 ? 71  HIS A CE1   1 
ATOM   557   N  NE2   . HIS A  1 73  ? 20.708  -26.364  -23.302 1.00 19.39 ? 71  HIS A NE2   1 
ATOM   558   N  N     . LEU A  1 74  ? 19.854  -29.966  -21.390 1.00 18.34 ? 72  LEU A N     1 
ATOM   559   C  CA    . LEU A  1 74  ? 20.582  -30.198  -20.121 1.00 17.93 ? 72  LEU A CA    1 
ATOM   560   C  C     . LEU A  1 74  ? 20.278  -31.569  -19.543 1.00 19.16 ? 72  LEU A C     1 
ATOM   561   O  O     . LEU A  1 74  ? 21.200  -32.310  -19.064 1.00 18.96 ? 72  LEU A O     1 
ATOM   562   C  CB    . LEU A  1 74  ? 20.237  -29.122  -19.067 1.00 17.24 ? 72  LEU A CB    1 
ATOM   563   C  CG    . LEU A  1 74  ? 21.030  -27.803  -19.079 1.00 28.50 ? 72  LEU A CG    1 
ATOM   564   C  CD1   . LEU A  1 74  ? 21.538  -27.453  -20.454 1.00 36.35 ? 72  LEU A CD1   1 
ATOM   565   C  CD2   . LEU A  1 74  ? 20.272  -26.631  -18.510 1.00 25.04 ? 72  LEU A CD2   1 
ATOM   566   N  N     . TYR A  1 75  ? 18.989  -31.903  -19.568 1.00 18.20 ? 73  TYR A N     1 
ATOM   567   C  CA    . TYR A  1 75  ? 18.506  -33.200  -19.092 1.00 19.22 ? 73  TYR A CA    1 
ATOM   568   C  C     . TYR A  1 75  ? 18.941  -34.316  -20.042 1.00 14.72 ? 73  TYR A C     1 
ATOM   569   O  O     . TYR A  1 75  ? 19.317  -35.408  -19.608 1.00 18.61 ? 73  TYR A O     1 
ATOM   570   C  CB    . TYR A  1 75  ? 16.962  -33.182  -18.907 1.00 15.04 ? 73  TYR A CB    1 
ATOM   571   C  CG    . TYR A  1 75  ? 16.584  -32.241  -17.776 1.00 18.32 ? 73  TYR A CG    1 
ATOM   572   C  CD1   . TYR A  1 75  ? 16.487  -30.877  -17.992 1.00 19.01 ? 73  TYR A CD1   1 
ATOM   573   C  CD2   . TYR A  1 75  ? 16.420  -32.709  -16.475 1.00 18.52 ? 73  TYR A CD2   1 
ATOM   574   C  CE1   . TYR A  1 75  ? 16.216  -30.005  -16.954 1.00 20.70 ? 73  TYR A CE1   1 
ATOM   575   C  CE2   . TYR A  1 75  ? 16.123  -31.836  -15.428 1.00 19.58 ? 73  TYR A CE2   1 
ATOM   576   C  CZ    . TYR A  1 75  ? 16.032  -30.491  -15.692 1.00 18.48 ? 73  TYR A CZ    1 
ATOM   577   O  OH    . TYR A  1 75  ? 15.761  -29.634  -14.687 1.00 19.08 ? 73  TYR A OH    1 
ATOM   578   N  N     . TYR A  1 76  ? 18.851  -34.046  -21.347 1.00 17.70 ? 74  TYR A N     1 
ATOM   579   C  CA    . TYR A  1 76  ? 19.230  -35.031  -22.366 1.00 14.27 ? 74  TYR A CA    1 
ATOM   580   C  C     . TYR A  1 76  ? 20.708  -35.377  -22.212 1.00 19.34 ? 74  TYR A C     1 
ATOM   581   O  O     . TYR A  1 76  ? 21.119  -36.530  -22.408 1.00 15.64 ? 74  TYR A O     1 
ATOM   582   C  CB    . TYR A  1 76  ? 18.951  -34.477  -23.770 1.00 17.02 ? 74  TYR A CB    1 
ATOM   583   C  CG    . TYR A  1 76  ? 19.280  -35.454  -24.885 1.00 19.52 ? 74  TYR A CG    1 
ATOM   584   C  CD1   . TYR A  1 76  ? 18.471  -36.562  -25.117 1.00 17.75 ? 74  TYR A CD1   1 
ATOM   585   C  CD2   . TYR A  1 76  ? 20.436  -35.292  -25.678 1.00 19.84 ? 74  TYR A CD2   1 
ATOM   586   C  CE1   . TYR A  1 76  ? 18.788  -37.499  -26.144 1.00 20.14 ? 74  TYR A CE1   1 
ATOM   587   C  CE2   . TYR A  1 76  ? 20.755  -36.217  -26.705 1.00 19.99 ? 74  TYR A CE2   1 
ATOM   588   C  CZ    . TYR A  1 76  ? 19.927  -37.310  -26.921 1.00 24.58 ? 74  TYR A CZ    1 
ATOM   589   O  OH    . TYR A  1 76  ? 20.255  -38.190  -27.934 1.00 26.76 ? 74  TYR A OH    1 
ATOM   590   N  N     . GLU A  1 77  ? 21.496  -34.372  -21.838 1.00 20.94 ? 75  GLU A N     1 
ATOM   591   C  CA    . GLU A  1 77  ? 22.951  -34.514  -21.648 1.00 19.38 ? 75  GLU A CA    1 
ATOM   592   C  C     . GLU A  1 77  ? 23.369  -35.094  -20.301 1.00 21.61 ? 75  GLU A C     1 
ATOM   593   O  O     . GLU A  1 77  ? 24.528  -35.486  -20.119 1.00 27.73 ? 75  GLU A O     1 
ATOM   594   C  CB    . GLU A  1 77  ? 23.637  -33.150  -21.808 1.00 20.76 ? 75  GLU A CB    1 
ATOM   595   C  CG    . GLU A  1 77  ? 23.518  -32.541  -23.185 1.00 20.57 ? 75  GLU A CG    1 
ATOM   596   C  CD    . GLU A  1 77  ? 23.681  -31.006  -23.170 1.00 25.64 ? 75  GLU A CD    1 
ATOM   597   O  OE1   . GLU A  1 77  ? 23.323  -30.384  -24.176 1.00 20.15 ? 75  GLU A OE1   1 
ATOM   598   O  OE2   . GLU A  1 77  ? 24.150  -30.439  -22.159 1.00 23.70 ? 75  GLU A OE2   1 
ATOM   599   N  N     . GLY A  1 78  ? 22.462  -35.132  -19.329 1.00 22.66 ? 76  GLY A N     1 
ATOM   600   C  CA    . GLY A  1 78  ? 22.842  -35.670  -18.032 1.00 21.27 ? 76  GLY A CA    1 
ATOM   601   C  C     . GLY A  1 78  ? 23.397  -34.608  -17.094 1.00 22.27 ? 76  GLY A C     1 
ATOM   602   O  O     . GLY A  1 78  ? 23.803  -34.914  -15.983 1.00 24.38 ? 76  GLY A O     1 
ATOM   603   N  N     . LYS A  1 79  ? 23.415  -33.356  -17.539 1.00 18.60 ? 77  LYS A N     1 
ATOM   604   C  CA    . LYS A  1 79  ? 23.863  -32.267  -16.693 1.00 22.05 ? 77  LYS A CA    1 
ATOM   605   C  C     . LYS A  1 79  ? 22.859  -31.967  -15.597 1.00 34.72 ? 77  LYS A C     1 
ATOM   606   O  O     . LYS A  1 79  ? 23.234  -31.498  -14.520 1.00 30.54 ? 77  LYS A O     1 
ATOM   607   C  CB    . LYS A  1 79  ? 24.124  -31.020  -17.519 1.00 20.68 ? 77  LYS A CB    1 
ATOM   608   C  CG    . LYS A  1 79  ? 25.300  -31.202  -18.432 1.00 32.70 ? 77  LYS A CG    1 
ATOM   609   C  CD    . LYS A  1 79  ? 25.607  -29.902  -19.145 1.00 38.95 ? 77  LYS A CD    1 
ATOM   610   C  CE    . LYS A  1 79  ? 26.962  -29.967  -19.858 1.00 37.52 ? 77  LYS A CE    1 
ATOM   611   N  NZ    . LYS A  1 79  ? 27.462  -28.571  -20.197 1.00 44.91 ? 77  LYS A NZ    1 
ATOM   612   N  N     . GLU A  1 80  ? 21.581  -32.203  -15.887 1.00 20.75 ? 78  GLU A N     1 
ATOM   613   C  CA    . GLU A  1 80  ? 20.524  -32.075  -14.892 1.00 23.78 ? 78  GLU A CA    1 
ATOM   614   C  C     . GLU A  1 80  ? 19.848  -33.422  -14.884 1.00 21.73 ? 78  GLU A C     1 
ATOM   615   O  O     . GLU A  1 80  ? 19.945  -34.167  -15.865 1.00 22.00 ? 78  GLU A O     1 
ATOM   616   C  CB    . GLU A  1 80  ? 19.495  -31.025  -15.283 1.00 20.36 ? 78  GLU A CB    1 
ATOM   617   C  CG    . GLU A  1 80  ? 20.011  -29.601  -15.357 1.00 21.54 ? 78  GLU A CG    1 
ATOM   618   C  CD    . GLU A  1 80  ? 20.228  -28.985  -13.996 1.00 26.37 ? 78  GLU A CD    1 
ATOM   619   O  OE1   . GLU A  1 80  ? 19.756  -29.543  -12.985 1.00 32.11 ? 78  GLU A OE1   1 
ATOM   620   O  OE2   . GLU A  1 80  ? 20.880  -27.926  -13.936 1.00 33.87 ? 78  GLU A OE2   1 
ATOM   621   N  N     . LYS A  1 81  ? 19.142  -33.720  -13.804 1.00 23.41 ? 79  LYS A N     1 
ATOM   622   C  CA    . LYS A  1 81  ? 18.528  -35.030  -13.639 1.00 21.53 ? 79  LYS A CA    1 
ATOM   623   C  C     . LYS A  1 81  ? 17.135  -34.781  -13.113 1.00 25.61 ? 79  LYS A C     1 
ATOM   624   O  O     . LYS A  1 81  ? 16.972  -34.193  -12.058 1.00 26.05 ? 79  LYS A O     1 
ATOM   625   C  CB    . LYS A  1 81  ? 19.331  -35.865  -12.643 1.00 27.84 ? 79  LYS A CB    1 
ATOM   626   C  CG    . LYS A  1 81  ? 18.708  -37.195  -12.188 1.00 28.70 ? 79  LYS A CG    1 
ATOM   627   C  CD    . LYS A  1 81  ? 19.704  -37.910  -11.252 1.00 34.21 ? 79  LYS A CD    1 
ATOM   628   C  CE    . LYS A  1 81  ? 19.108  -39.161  -10.576 1.00 46.20 ? 79  LYS A CE    1 
ATOM   629   N  NZ    . LYS A  1 81  ? 20.087  -39.918  -9.714  1.00 40.68 ? 79  LYS A NZ    1 
ATOM   630   N  N     . ALA A  1 82  ? 16.119  -35.186  -13.863 1.00 22.40 ? 80  ALA A N     1 
ATOM   631   C  CA    . ALA A  1 82  ? 14.746  -34.996  -13.400 1.00 19.82 ? 80  ALA A CA    1 
ATOM   632   C  C     . ALA A  1 82  ? 14.534  -35.757  -12.089 1.00 17.30 ? 80  ALA A C     1 
ATOM   633   O  O     . ALA A  1 82  ? 14.728  -36.968  -12.058 1.00 19.90 ? 80  ALA A O     1 
ATOM   634   C  CB    . ALA A  1 82  ? 13.798  -35.477  -14.444 1.00 12.63 ? 80  ALA A CB    1 
ATOM   635   N  N     . PRO A  1 83  ? 14.078  -35.059  -11.023 1.00 22.64 ? 81  PRO A N     1 
ATOM   636   C  CA    . PRO A  1 83  ? 13.915  -35.669  -9.689  1.00 22.00 ? 81  PRO A CA    1 
ATOM   637   C  C     . PRO A  1 83  ? 12.577  -36.377  -9.511  1.00 27.24 ? 81  PRO A C     1 
ATOM   638   O  O     . PRO A  1 83  ? 12.360  -36.987  -8.452  1.00 21.24 ? 81  PRO A O     1 
ATOM   639   C  CB    . PRO A  1 83  ? 13.981  -34.464  -8.737  1.00 23.17 ? 81  PRO A CB    1 
ATOM   640   C  CG    . PRO A  1 83  ? 13.449  -33.339  -9.546  1.00 26.96 ? 81  PRO A CG    1 
ATOM   641   C  CD    . PRO A  1 83  ? 13.867  -33.600  -10.981 1.00 17.41 ? 81  PRO A CD    1 
ATOM   642   N  N     . TYR A  1 84  ? 11.692  -36.330  -10.511 1.00 18.11 ? 82  TYR A N     1 
ATOM   643   C  CA    . TYR A  1 84  ? 10.453  -37.132  -10.413 1.00 19.53 ? 82  TYR A CA    1 
ATOM   644   C  C     . TYR A  1 84  ? 10.186  -37.824  -11.731 1.00 18.10 ? 82  TYR A C     1 
ATOM   645   O  O     . TYR A  1 84  ? 10.503  -37.296  -12.791 1.00 18.12 ? 82  TYR A O     1 
ATOM   646   C  CB    . TYR A  1 84  ? 9.234   -36.268  -10.015 1.00 20.05 ? 82  TYR A CB    1 
ATOM   647   C  CG    . TYR A  1 84  ? 9.515   -35.264  -8.906  1.00 23.43 ? 82  TYR A CG    1 
ATOM   648   C  CD1   . TYR A  1 84  ? 9.380   -35.614  -7.561  1.00 30.58 ? 82  TYR A CD1   1 
ATOM   649   C  CD2   . TYR A  1 84  ? 9.964   -33.984  -9.211  1.00 26.01 ? 82  TYR A CD2   1 
ATOM   650   C  CE1   . TYR A  1 84  ? 9.677   -34.690  -6.546  1.00 25.33 ? 82  TYR A CE1   1 
ATOM   651   C  CE2   . TYR A  1 84  ? 10.266  -33.047  -8.209  1.00 22.53 ? 82  TYR A CE2   1 
ATOM   652   C  CZ    . TYR A  1 84  ? 10.116  -33.405  -6.886  1.00 23.37 ? 82  TYR A CZ    1 
ATOM   653   O  OH    . TYR A  1 84  ? 10.404  -32.467  -5.916  1.00 27.38 ? 82  TYR A OH    1 
ATOM   654   N  N     . LEU A  1 85  ? 9.622   -39.020  -11.683 1.00 17.97 ? 83  LEU A N     1 
ATOM   655   C  CA    . LEU A  1 85  ? 9.187   -39.655  -12.915 1.00 18.36 ? 83  LEU A CA    1 
ATOM   656   C  C     . LEU A  1 85  ? 8.130   -38.716  -13.571 1.00 17.56 ? 83  LEU A C     1 
ATOM   657   O  O     . LEU A  1 85  ? 7.155   -38.287  -12.938 1.00 16.02 ? 83  LEU A O     1 
ATOM   658   C  CB    . LEU A  1 85  ? 8.615   -41.032  -12.605 1.00 17.31 ? 83  LEU A CB    1 
ATOM   659   C  CG    . LEU A  1 85  ? 7.877   -41.728  -13.744 1.00 21.34 ? 83  LEU A CG    1 
ATOM   660   C  CD1   . LEU A  1 85  ? 8.755   -41.827  -14.985 1.00 12.53 ? 83  LEU A CD1   1 
ATOM   661   C  CD2   . LEU A  1 85  ? 7.411   -43.128  -13.282 1.00 23.75 ? 83  LEU A CD2   1 
ATOM   662   N  N     . THR A  1 86  ? 8.364   -38.363  -14.825 1.00 16.09 ? 84  THR A N     1 
ATOM   663   C  CA    . THR A  1 86  ? 7.546   -37.367  -15.496 1.00 13.31 ? 84  THR A CA    1 
ATOM   664   C  C     . THR A  1 86  ? 6.955   -37.988  -16.754 1.00 16.46 ? 84  THR A C     1 
ATOM   665   O  O     . THR A  1 86  ? 7.709   -38.357  -17.677 1.00 13.20 ? 84  THR A O     1 
ATOM   666   C  CB    . THR A  1 86  ? 8.400   -36.130  -15.851 1.00 19.19 ? 84  THR A CB    1 
ATOM   667   O  OG1   . THR A  1 86  ? 9.061   -35.638  -14.658 1.00 15.76 ? 84  THR A OG1   1 
ATOM   668   C  CG2   . THR A  1 86  ? 7.486   -35.032  -16.422 1.00 14.64 ? 84  THR A CG2   1 
ATOM   669   N  N     . LEU A  1 87  ? 5.623   -38.142  -16.790 1.00 11.23 ? 85  LEU A N     1 
ATOM   670   C  CA    . LEU A  1 87  ? 4.961   -38.715  -17.973 1.00 12.28 ? 85  LEU A CA    1 
ATOM   671   C  C     . LEU A  1 87  ? 4.352   -37.593  -18.758 1.00 15.33 ? 85  LEU A C     1 
ATOM   672   O  O     . LEU A  1 87  ? 3.819   -36.640  -18.179 1.00 13.04 ? 85  LEU A O     1 
ATOM   673   C  CB    . LEU A  1 87  ? 3.839   -39.677  -17.598 1.00 11.78 ? 85  LEU A CB    1 
ATOM   674   C  CG    . LEU A  1 87  ? 4.142   -40.607  -16.440 1.00 13.57 ? 85  LEU A CG    1 
ATOM   675   C  CD1   . LEU A  1 87  ? 2.921   -41.460  -16.088 1.00 16.56 ? 85  LEU A CD1   1 
ATOM   676   C  CD2   . LEU A  1 87  ? 5.271   -41.518  -16.829 1.00 12.16 ? 85  LEU A CD2   1 
ATOM   677   N  N     . PHE A  1 88  ? 4.422   -37.688  -20.085 1.00 13.38 ? 86  PHE A N     1 
ATOM   678   C  CA    . PHE A  1 88  ? 3.876   -36.603  -20.908 1.00 12.98 ? 86  PHE A CA    1 
ATOM   679   C  C     . PHE A  1 88  ? 3.341   -37.009  -22.283 1.00 15.10 ? 86  PHE A C     1 
ATOM   680   O  O     . PHE A  1 88  ? 3.684   -38.067  -22.809 1.00 14.92 ? 86  PHE A O     1 
ATOM   681   C  CB    . PHE A  1 88  ? 4.899   -35.484  -21.058 1.00 10.57 ? 86  PHE A CB    1 
ATOM   682   C  CG    . PHE A  1 88  ? 6.151   -35.880  -21.874 1.00 14.34 ? 86  PHE A CG    1 
ATOM   683   C  CD1   . PHE A  1 88  ? 6.183   -35.727  -23.253 1.00 11.81 ? 86  PHE A CD1   1 
ATOM   684   C  CD2   . PHE A  1 88  ? 7.274   -36.383  -21.253 1.00 13.33 ? 86  PHE A CD2   1 
ATOM   685   C  CE1   . PHE A  1 88  ? 7.296   -36.087  -24.004 1.00 9.60  ? 86  PHE A CE1   1 
ATOM   686   C  CE2   . PHE A  1 88  ? 8.425   -36.729  -22.008 1.00 12.36 ? 86  PHE A CE2   1 
ATOM   687   C  CZ    . PHE A  1 88  ? 8.408   -36.586  -23.392 1.00 15.63 ? 86  PHE A CZ    1 
ATOM   688   N  N     . ILE A  1 89  ? 2.511   -36.138  -22.852 1.00 13.09 ? 87  ILE A N     1 
ATOM   689   C  CA    . ILE A  1 89  ? 2.091   -36.231  -24.250 1.00 16.05 ? 87  ILE A CA    1 
ATOM   690   C  C     . ILE A  1 89  ? 2.641   -35.034  -25.027 1.00 16.19 ? 87  ILE A C     1 
ATOM   691   O  O     . ILE A  1 89  ? 3.159   -34.079  -24.414 1.00 16.78 ? 87  ILE A O     1 
ATOM   692   C  CB    . ILE A  1 89  ? 0.587   -36.186  -24.330 1.00 11.83 ? 87  ILE A CB    1 
ATOM   693   C  CG1   . ILE A  1 89  ? 0.059   -35.038  -23.456 1.00 14.29 ? 87  ILE A CG1   1 
ATOM   694   C  CG2   . ILE A  1 89  ? 0.005   -37.474  -23.783 1.00 14.19 ? 87  ILE A CG2   1 
ATOM   695   C  CD1   . ILE A  1 89  ? -1.249  -34.456  -23.934 1.00 18.14 ? 87  ILE A CD1   1 
ATOM   696   N  N     . GLY A  1 90  ? 2.525   -35.059  -26.355 1.00 14.92 ? 88  GLY A N     1 
ATOM   697   C  CA    . GLY A  1 90  ? 2.986   -33.926  -27.161 1.00 12.12 ? 88  GLY A CA    1 
ATOM   698   C  C     . GLY A  1 90  ? 1.870   -32.909  -27.315 1.00 17.58 ? 88  GLY A C     1 
ATOM   699   O  O     . GLY A  1 90  ? 0.665   -33.264  -27.302 1.00 16.03 ? 88  GLY A O     1 
ATOM   700   N  N     . GLY A  1 91  ? 2.260   -31.646  -27.475 1.00 15.28 ? 89  GLY A N     1 
ATOM   701   C  CA    . GLY A  1 91  ? 1.322   -30.589  -27.816 1.00 11.92 ? 89  GLY A CA    1 
ATOM   702   C  C     . GLY A  1 91  ? 1.648   -30.076  -29.224 1.00 17.24 ? 89  GLY A C     1 
ATOM   703   O  O     . GLY A  1 91  ? 1.820   -30.856  -30.180 1.00 15.58 ? 89  GLY A O     1 
ATOM   704   N  N     . ASN A  1 92  ? 1.741   -28.768  -29.381 1.00 14.63 ? 90  ASN A N     1 
ATOM   705   C  CA    . ASN A  1 92  ? 1.909   -28.222  -30.738 1.00 15.68 ? 90  ASN A CA    1 
ATOM   706   C  C     . ASN A  1 92  ? 3.235   -27.502  -30.889 1.00 20.39 ? 90  ASN A C     1 
ATOM   707   O  O     . ASN A  1 92  ? 3.572   -27.044  -31.996 1.00 21.57 ? 90  ASN A O     1 
ATOM   708   C  CB    . ASN A  1 92  ? 0.740   -27.279  -31.124 1.00 18.42 ? 90  ASN A CB    1 
ATOM   709   C  CG    . ASN A  1 92  ? 0.616   -26.107  -30.179 1.00 19.59 ? 90  ASN A CG    1 
ATOM   710   O  OD1   . ASN A  1 92  ? 0.283   -26.307  -29.014 1.00 19.01 ? 90  ASN A OD1   1 
ATOM   711   N  ND2   . ASN A  1 92  ? 0.863   -24.879  -30.665 1.00 23.85 ? 90  ASN A ND2   1 
ATOM   712   N  N     . HIS A  1 93  ? 3.982   -27.433  -29.785 1.00 14.23 ? 91  HIS A N     1 
ATOM   713   C  CA    . HIS A  1 93  ? 5.296   -26.842  -29.767 1.00 19.22 ? 91  HIS A CA    1 
ATOM   714   C  C     . HIS A  1 93  ? 6.275   -27.934  -29.324 1.00 19.00 ? 91  HIS A C     1 
ATOM   715   O  O     . HIS A  1 93  ? 6.460   -28.161  -28.135 1.00 15.76 ? 91  HIS A O     1 
ATOM   716   C  CB    . HIS A  1 93  ? 5.337   -25.682  -28.760 1.00 22.22 ? 91  HIS A CB    1 
ATOM   717   C  CG    . HIS A  1 93  ? 4.519   -24.494  -29.156 1.00 27.35 ? 91  HIS A CG    1 
ATOM   718   N  ND1   . HIS A  1 93  ? 4.458   -24.010  -30.452 1.00 32.90 ? 91  HIS A ND1   1 
ATOM   719   C  CD2   . HIS A  1 93  ? 3.724   -23.672  -28.420 1.00 30.23 ? 91  HIS A CD2   1 
ATOM   720   C  CE1   . HIS A  1 93  ? 3.664   -22.956  -30.495 1.00 29.38 ? 91  HIS A CE1   1 
ATOM   721   N  NE2   . HIS A  1 93  ? 3.213   -22.722  -29.271 1.00 27.93 ? 91  HIS A NE2   1 
ATOM   722   N  N     . GLU A  1 94  ? 6.855   -28.651  -30.275 1.00 14.68 ? 92  GLU A N     1 
ATOM   723   C  CA    . GLU A  1 94  ? 7.576   -29.868  -29.909 1.00 13.33 ? 92  GLU A CA    1 
ATOM   724   C  C     . GLU A  1 94  ? 8.723   -30.013  -30.858 1.00 18.47 ? 92  GLU A C     1 
ATOM   725   O  O     . GLU A  1 94  ? 8.685   -29.442  -31.958 1.00 17.04 ? 92  GLU A O     1 
ATOM   726   C  CB    . GLU A  1 94  ? 6.656   -31.111  -30.036 1.00 16.22 ? 92  GLU A CB    1 
ATOM   727   C  CG    . GLU A  1 94  ? 5.434   -31.119  -29.118 1.00 15.55 ? 92  GLU A CG    1 
ATOM   728   C  CD    . GLU A  1 94  ? 5.805   -31.195  -27.625 1.00 13.02 ? 92  GLU A CD    1 
ATOM   729   O  OE1   . GLU A  1 94  ? 7.010   -31.414  -27.287 1.00 15.94 ? 92  GLU A OE1   1 
ATOM   730   O  OE2   . GLU A  1 94  ? 4.873   -31.108  -26.794 1.00 17.59 ? 92  GLU A OE2   1 
ATOM   731   N  N     . SER A  1 95  ? 9.735   -30.775  -30.445 1.00 13.62 ? 93  SER A N     1 
ATOM   732   C  CA    . SER A  1 95  ? 10.750  -31.217  -31.392 1.00 16.22 ? 93  SER A CA    1 
ATOM   733   C  C     . SER A  1 95  ? 10.046  -32.400  -32.052 1.00 16.97 ? 93  SER A C     1 
ATOM   734   O  O     . SER A  1 95  ? 10.180  -33.545  -31.603 1.00 13.86 ? 93  SER A O     1 
ATOM   735   C  CB    . SER A  1 95  ? 12.026  -31.653  -30.624 1.00 16.26 ? 93  SER A CB    1 
ATOM   736   O  OG    . SER A  1 95  ? 13.096  -32.086  -31.450 1.00 20.02 ? 93  SER A OG    1 
ATOM   737   N  N     . SER A  1 96  ? 9.264   -32.127  -33.093 1.00 17.31 ? 94  SER A N     1 
ATOM   738   C  CA    . SER A  1 96  ? 8.344   -33.143  -33.622 1.00 17.31 ? 94  SER A CA    1 
ATOM   739   C  C     . SER A  1 96  ? 9.056   -34.367  -34.188 1.00 17.82 ? 94  SER A C     1 
ATOM   740   O  O     . SER A  1 96  ? 8.532   -35.491  -34.135 1.00 15.60 ? 94  SER A O     1 
ATOM   741   C  CB    . SER A  1 96  ? 7.381   -32.523  -34.635 1.00 15.15 ? 94  SER A CB    1 
ATOM   742   O  OG    . SER A  1 96  ? 6.395   -31.750  -33.981 1.00 17.29 ? 94  SER A OG    1 
ATOM   743   N  N     . ASN A  1 97  ? 10.261  -34.164  -34.715 1.00 14.95 ? 95  ASN A N     1 
ATOM   744   C  CA    . ASN A  1 97  ? 11.065  -35.302  -35.170 1.00 16.32 ? 95  ASN A CA    1 
ATOM   745   C  C     . ASN A  1 97  ? 11.309  -36.340  -34.061 1.00 20.51 ? 95  ASN A C     1 
ATOM   746   O  O     . ASN A  1 97  ? 11.161  -37.587  -34.264 1.00 14.91 ? 95  ASN A O     1 
ATOM   747   C  CB    . ASN A  1 97  ? 12.388  -34.812  -35.749 1.00 17.77 ? 95  ASN A CB    1 
ATOM   748   C  CG    . ASN A  1 97  ? 13.239  -34.063  -34.731 1.00 15.51 ? 95  ASN A CG    1 
ATOM   749   O  OD1   . ASN A  1 97  ? 12.736  -33.353  -33.842 1.00 14.21 ? 95  ASN A OD1   1 
ATOM   750   N  ND2   . ASN A  1 97  ? 14.549  -34.208  -34.874 1.00 19.06 ? 95  ASN A ND2   1 
ATOM   751   N  N     . VAL A  1 98  ? 11.670  -35.851  -32.879 1.00 12.03 ? 96  VAL A N     1 
ATOM   752   C  CA    . VAL A  1 98  ? 11.941  -36.772  -31.754 1.00 14.81 ? 96  VAL A CA    1 
ATOM   753   C  C     . VAL A  1 98  ? 10.682  -37.584  -31.400 1.00 15.84 ? 96  VAL A C     1 
ATOM   754   O  O     . VAL A  1 98  ? 10.738  -38.814  -31.139 1.00 13.87 ? 96  VAL A O     1 
ATOM   755   C  CB    . VAL A  1 98  ? 12.409  -35.984  -30.505 1.00 12.57 ? 96  VAL A CB    1 
ATOM   756   C  CG1   . VAL A  1 98  ? 12.390  -36.829  -29.276 1.00 13.63 ? 96  VAL A CG1   1 
ATOM   757   C  CG2   . VAL A  1 98  ? 13.807  -35.378  -30.730 1.00 13.16 ? 96  VAL A CG2   1 
ATOM   758   N  N     . LEU A  1 99  ? 9.539   -36.896  -31.341 1.00 16.07 ? 97  LEU A N     1 
ATOM   759   C  CA    . LEU A  1 99  ? 8.322   -37.578  -30.929 1.00 19.06 ? 97  LEU A CA    1 
ATOM   760   C  C     . LEU A  1 99  ? 7.880   -38.631  -31.955 1.00 17.65 ? 97  LEU A C     1 
ATOM   761   O  O     . LEU A  1 99  ? 7.270   -39.617  -31.578 1.00 16.43 ? 97  LEU A O     1 
ATOM   762   C  CB    . LEU A  1 99  ? 7.191   -36.602  -30.641 1.00 14.10 ? 97  LEU A CB    1 
ATOM   763   C  CG    . LEU A  1 99  ? 7.530   -35.571  -29.533 1.00 16.09 ? 97  LEU A CG    1 
ATOM   764   C  CD1   . LEU A  1 99  ? 6.338   -34.637  -29.218 1.00 11.10 ? 97  LEU A CD1   1 
ATOM   765   C  CD2   . LEU A  1 99  ? 7.990   -36.274  -28.234 1.00 11.91 ? 97  LEU A CD2   1 
ATOM   766   N  N     . LEU A  1 100 ? 8.151   -38.401  -33.237 1.00 13.63 ? 98  LEU A N     1 
ATOM   767   C  CA    . LEU A  1 100 ? 7.824   -39.367  -34.309 1.00 14.61 ? 98  LEU A CA    1 
ATOM   768   C  C     . LEU A  1 100 ? 8.673   -40.636  -34.196 1.00 15.41 ? 98  LEU A C     1 
ATOM   769   O  O     . LEU A  1 100 ? 8.149   -41.756  -34.343 1.00 18.16 ? 98  LEU A O     1 
ATOM   770   C  CB    . LEU A  1 100 ? 8.033   -38.746  -35.702 1.00 13.89 ? 98  LEU A CB    1 
ATOM   771   C  CG    . LEU A  1 100 ? 7.660   -39.653  -36.913 1.00 17.68 ? 98  LEU A CG    1 
ATOM   772   C  CD1   . LEU A  1 100 ? 6.139   -39.833  -37.048 1.00 15.27 ? 98  LEU A CD1   1 
ATOM   773   C  CD2   . LEU A  1 100 ? 8.195   -39.098  -38.211 1.00 18.09 ? 98  LEU A CD2   1 
ATOM   774   N  N     . HIS A  1 101 ? 9.979   -40.470  -33.971 1.00 16.03 ? 99  HIS A N     1 
ATOM   775   C  CA    . HIS A  1 101 ? 10.830  -41.621  -33.670 1.00 17.84 ? 99  HIS A CA    1 
ATOM   776   C  C     . HIS A  1 101 ? 10.188  -42.418  -32.530 1.00 17.91 ? 99  HIS A C     1 
ATOM   777   O  O     . HIS A  1 101 ? 10.217  -43.654  -32.534 1.00 16.02 ? 99  HIS A O     1 
ATOM   778   C  CB    . HIS A  1 101 ? 12.265  -41.204  -33.285 1.00 21.93 ? 99  HIS A CB    1 
ATOM   779   C  CG    . HIS A  1 101 ? 13.066  -40.642  -34.423 1.00 21.73 ? 99  HIS A CG    1 
ATOM   780   N  ND1   . HIS A  1 101 ? 13.374  -41.370  -35.555 1.00 22.51 ? 99  HIS A ND1   1 
ATOM   781   C  CD2   . HIS A  1 101 ? 13.631  -39.421  -34.604 1.00 27.45 ? 99  HIS A CD2   1 
ATOM   782   C  CE1   . HIS A  1 101 ? 14.064  -40.620  -36.390 1.00 23.28 ? 99  HIS A CE1   1 
ATOM   783   N  NE2   . HIS A  1 101 ? 14.245  -39.434  -35.833 1.00 28.56 ? 99  HIS A NE2   1 
ATOM   784   N  N     . LEU A  1 102 ? 9.599   -41.705  -31.566 1.00 18.97 ? 100 LEU A N     1 
ATOM   785   C  CA    . LEU A  1 102 ? 8.993   -42.321  -30.384 1.00 12.01 ? 100 LEU A CA    1 
ATOM   786   C  C     . LEU A  1 102 ? 7.473   -42.398  -30.481 1.00 13.96 ? 100 LEU A C     1 
ATOM   787   O  O     . LEU A  1 102 ? 6.762   -42.291  -29.462 1.00 14.90 ? 100 LEU A O     1 
ATOM   788   C  CB    . LEU A  1 102 ? 9.434   -41.587  -29.096 1.00 14.12 ? 100 LEU A CB    1 
ATOM   789   C  CG    . LEU A  1 102 ? 10.946  -41.509  -28.886 1.00 16.12 ? 100 LEU A CG    1 
ATOM   790   C  CD1   . LEU A  1 102 ? 11.322  -40.784  -27.582 1.00 13.58 ? 100 LEU A CD1   1 
ATOM   791   C  CD2   . LEU A  1 102 ? 11.542  -42.934  -28.861 1.00 18.23 ? 100 LEU A CD2   1 
ATOM   792   N  N     . TYR A  1 103 ? 6.941   -42.616  -31.685 1.00 15.35 ? 101 TYR A N     1 
ATOM   793   C  CA    . TYR A  1 103 ? 5.483   -42.592  -31.804 1.00 17.47 ? 101 TYR A CA    1 
ATOM   794   C  C     . TYR A  1 103 ? 4.834   -43.692  -30.965 1.00 15.46 ? 101 TYR A C     1 
ATOM   795   O  O     . TYR A  1 103 ? 3.648   -43.598  -30.578 1.00 15.14 ? 101 TYR A O     1 
ATOM   796   C  CB    . TYR A  1 103 ? 5.026   -42.650  -33.263 1.00 14.61 ? 101 TYR A CB    1 
ATOM   797   C  CG    . TYR A  1 103 ? 5.012   -44.006  -33.864 1.00 14.11 ? 101 TYR A CG    1 
ATOM   798   C  CD1   . TYR A  1 103 ? 6.195   -44.655  -34.245 1.00 14.93 ? 101 TYR A CD1   1 
ATOM   799   C  CD2   . TYR A  1 103 ? 3.807   -44.640  -34.115 1.00 19.32 ? 101 TYR A CD2   1 
ATOM   800   C  CE1   . TYR A  1 103 ? 6.149   -45.950  -34.806 1.00 16.34 ? 101 TYR A CE1   1 
ATOM   801   C  CE2   . TYR A  1 103 ? 3.759   -45.897  -34.673 1.00 17.91 ? 101 TYR A CE2   1 
ATOM   802   C  CZ    . TYR A  1 103 ? 4.903   -46.552  -35.011 1.00 20.56 ? 101 TYR A CZ    1 
ATOM   803   O  OH    . TYR A  1 103 ? 4.747   -47.816  -35.572 1.00 20.17 ? 101 TYR A OH    1 
ATOM   804   N  N     . ASN A  1 104 ? 5.616   -44.725  -30.661 1.00 14.23 ? 102 ASN A N     1 
ATOM   805   C  CA    . ASN A  1 104 ? 5.131   -45.801  -29.802 1.00 14.49 ? 102 ASN A CA    1 
ATOM   806   C  C     . ASN A  1 104 ? 5.557   -45.581  -28.367 1.00 16.41 ? 102 ASN A C     1 
ATOM   807   O  O     . ASN A  1 104 ? 5.541   -46.524  -27.556 1.00 20.55 ? 102 ASN A O     1 
ATOM   808   C  CB    . ASN A  1 104 ? 5.613   -47.178  -30.326 1.00 15.99 ? 102 ASN A CB    1 
ATOM   809   C  CG    . ASN A  1 104 ? 4.724   -47.706  -31.411 1.00 18.44 ? 102 ASN A CG    1 
ATOM   810   O  OD1   . ASN A  1 104 ? 3.492   -47.543  -31.353 1.00 17.01 ? 102 ASN A OD1   1 
ATOM   811   N  ND2   . ASN A  1 104 ? 5.326   -48.325  -32.427 1.00 16.77 ? 102 ASN A ND2   1 
ATOM   812   N  N     . GLY A  1 105 ? 5.960   -44.342  -28.060 1.00 15.84 ? 103 GLY A N     1 
ATOM   813   C  CA    . GLY A  1 105 ? 6.330   -43.986  -26.701 1.00 14.66 ? 103 GLY A CA    1 
ATOM   814   C  C     . GLY A  1 105 ? 7.781   -44.265  -26.430 1.00 16.50 ? 103 GLY A C     1 
ATOM   815   O  O     . GLY A  1 105 ? 8.467   -44.951  -27.203 1.00 16.14 ? 103 GLY A O     1 
ATOM   816   N  N     . GLY A  1 106 ? 8.283   -43.700  -25.332 1.00 18.99 ? 104 GLY A N     1 
ATOM   817   C  CA    . GLY A  1 106 ? 9.666   -43.917  -24.964 1.00 14.18 ? 104 GLY A CA    1 
ATOM   818   C  C     . GLY A  1 106 ? 10.215  -42.831  -24.063 1.00 17.05 ? 104 GLY A C     1 
ATOM   819   O  O     . GLY A  1 106 ? 9.678   -41.721  -23.966 1.00 12.14 ? 104 GLY A O     1 
ATOM   820   N  N     . PHE A  1 107 ? 11.308  -43.149  -23.386 1.00 13.91 ? 105 PHE A N     1 
ATOM   821   C  CA    . PHE A  1 107 ? 11.957  -42.151  -22.589 1.00 15.76 ? 105 PHE A CA    1 
ATOM   822   C  C     . PHE A  1 107 ? 12.819  -41.239  -23.482 1.00 14.13 ? 105 PHE A C     1 
ATOM   823   O  O     . PHE A  1 107 ? 13.641  -41.717  -24.253 1.00 15.90 ? 105 PHE A O     1 
ATOM   824   C  CB    . PHE A  1 107 ? 12.858  -42.838  -21.557 1.00 17.66 ? 105 PHE A CB    1 
ATOM   825   C  CG    . PHE A  1 107 ? 12.106  -43.416  -20.382 1.00 16.76 ? 105 PHE A CG    1 
ATOM   826   C  CD1   . PHE A  1 107 ? 11.764  -42.607  -19.297 1.00 15.62 ? 105 PHE A CD1   1 
ATOM   827   C  CD2   . PHE A  1 107 ? 11.772  -44.773  -20.363 1.00 13.41 ? 105 PHE A CD2   1 
ATOM   828   C  CE1   . PHE A  1 107 ? 11.126  -43.135  -18.188 1.00 14.34 ? 105 PHE A CE1   1 
ATOM   829   C  CE2   . PHE A  1 107 ? 11.127  -45.328  -19.263 1.00 16.55 ? 105 PHE A CE2   1 
ATOM   830   C  CZ    . PHE A  1 107 ? 10.799  -44.506  -18.171 1.00 16.46 ? 105 PHE A CZ    1 
ATOM   831   N  N     . VAL A  1 108 ? 12.636  -39.926  -23.360 1.00 19.07 ? 106 VAL A N     1 
ATOM   832   C  CA    . VAL A  1 108 ? 13.468  -38.975  -24.097 1.00 9.27  ? 106 VAL A CA    1 
ATOM   833   C  C     . VAL A  1 108 ? 14.721  -38.752  -23.281 1.00 15.45 ? 106 VAL A C     1 
ATOM   834   O  O     . VAL A  1 108 ? 15.725  -38.247  -23.787 1.00 15.18 ? 106 VAL A O     1 
ATOM   835   C  CB    . VAL A  1 108 ? 12.723  -37.642  -24.306 1.00 10.97 ? 106 VAL A CB    1 
ATOM   836   C  CG1   . VAL A  1 108 ? 11.567  -37.832  -25.287 1.00 11.18 ? 106 VAL A CG1   1 
ATOM   837   C  CG2   . VAL A  1 108 ? 12.180  -37.163  -22.937 1.00 14.14 ? 106 VAL A CG2   1 
ATOM   838   N  N     . CYS A  1 109 ? 14.657  -39.103  -22.005 1.00 18.23 ? 107 CYS A N     1 
ATOM   839   C  CA    . CYS A  1 109 ? 15.831  -39.064  -21.125 1.00 19.90 ? 107 CYS A CA    1 
ATOM   840   C  C     . CYS A  1 109 ? 15.410  -39.633  -19.796 1.00 21.37 ? 107 CYS A C     1 
ATOM   841   O  O     . CYS A  1 109 ? 14.226  -39.930  -19.624 1.00 17.12 ? 107 CYS A O     1 
ATOM   842   C  CB    . CYS A  1 109 ? 16.377  -37.636  -20.939 1.00 20.49 ? 107 CYS A CB    1 
ATOM   843   S  SG    . CYS A  1 109 ? 15.245  -36.521  -20.021 1.00 16.18 ? 107 CYS A SG    1 
ATOM   844   N  N     . PHE A  1 110 ? 16.361  -39.774  -18.853 1.00 19.71 ? 108 PHE A N     1 
ATOM   845   C  CA    . PHE A  1 110 ? 16.044  -40.403  -17.578 1.00 17.75 ? 108 PHE A CA    1 
ATOM   846   C  C     . PHE A  1 110 ? 14.853  -39.706  -16.908 1.00 17.83 ? 108 PHE A C     1 
ATOM   847   O  O     . PHE A  1 110 ? 14.843  -38.479  -16.774 1.00 14.29 ? 108 PHE A O     1 
ATOM   848   C  CB    . PHE A  1 110 ? 17.225  -40.338  -16.617 1.00 23.19 ? 108 PHE A CB    1 
ATOM   849   C  CG    . PHE A  1 110 ? 16.961  -41.021  -15.291 1.00 17.29 ? 108 PHE A CG    1 
ATOM   850   C  CD1   . PHE A  1 110 ? 16.942  -42.412  -15.197 1.00 25.46 ? 108 PHE A CD1   1 
ATOM   851   C  CD2   . PHE A  1 110 ? 16.774  -40.268  -14.142 1.00 19.75 ? 108 PHE A CD2   1 
ATOM   852   C  CE1   . PHE A  1 110 ? 16.702  -43.042  -13.971 1.00 28.46 ? 108 PHE A CE1   1 
ATOM   853   C  CE2   . PHE A  1 110 ? 16.525  -40.880  -12.907 1.00 24.24 ? 108 PHE A CE2   1 
ATOM   854   C  CZ    . PHE A  1 110 ? 16.487  -42.267  -12.825 1.00 28.01 ? 108 PHE A CZ    1 
ATOM   855   N  N     . ASN A  1 111 ? 13.882  -40.479  -16.437 1.00 13.18 ? 109 ASN A N     1 
ATOM   856   C  CA    . ASN A  1 111 ? 12.696  -39.927  -15.732 1.00 16.13 ? 109 ASN A CA    1 
ATOM   857   C  C     . ASN A  1 111 ? 11.669  -39.169  -16.582 1.00 18.24 ? 109 ASN A C     1 
ATOM   858   O  O     . ASN A  1 111 ? 10.676  -38.675  -16.037 1.00 16.06 ? 109 ASN A O     1 
ATOM   859   C  CB    . ASN A  1 111 ? 13.049  -39.092  -14.472 1.00 12.73 ? 109 ASN A CB    1 
ATOM   860   C  CG    . ASN A  1 111 ? 12.885  -39.902  -13.176 1.00 21.27 ? 109 ASN A CG    1 
ATOM   861   O  OD1   . ASN A  1 111 ? 12.345  -41.014  -13.200 1.00 18.91 ? 109 ASN A OD1   1 
ATOM   862   N  ND2   . ASN A  1 111 ? 13.372  -39.371  -12.065 1.00 15.94 ? 109 ASN A ND2   1 
ATOM   863   N  N     . MET A  1 112 ? 11.891  -39.072  -17.893 1.00 15.09 ? 110 MET A N     1 
ATOM   864   C  CA    . MET A  1 112 ? 10.878  -38.425  -18.734 1.00 17.97 ? 110 MET A CA    1 
ATOM   865   C  C     . MET A  1 112 ? 10.334  -39.367  -19.795 1.00 12.71 ? 110 MET A C     1 
ATOM   866   O  O     . MET A  1 112 ? 11.008  -39.667  -20.782 1.00 11.22 ? 110 MET A O     1 
ATOM   867   C  CB    . MET A  1 112 ? 11.454  -37.189  -19.413 1.00 13.53 ? 110 MET A CB    1 
ATOM   868   C  CG    . MET A  1 112 ? 12.126  -36.245  -18.420 1.00 14.14 ? 110 MET A CG    1 
ATOM   869   S  SD    . MET A  1 112 ? 12.249  -34.600  -19.144 1.00 16.66 ? 110 MET A SD    1 
ATOM   870   C  CE    . MET A  1 112 ? 13.166  -33.682  -17.919 1.00 19.32 ? 110 MET A CE    1 
ATOM   871   N  N     . TYR A  1 113 ? 9.088   -39.767  -19.633 1.00 11.30 ? 111 TYR A N     1 
ATOM   872   C  CA    . TYR A  1 113 ? 8.500   -40.787  -20.532 1.00 12.76 ? 111 TYR A CA    1 
ATOM   873   C  C     . TYR A  1 113 ? 7.360   -40.215  -21.381 1.00 14.74 ? 111 TYR A C     1 
ATOM   874   O  O     . TYR A  1 113 ? 6.368   -39.743  -20.834 1.00 14.22 ? 111 TYR A O     1 
ATOM   875   C  CB    . TYR A  1 113 ? 7.965   -41.973  -19.740 1.00 11.32 ? 111 TYR A CB    1 
ATOM   876   C  CG    . TYR A  1 113 ? 7.326   -43.005  -20.656 1.00 13.92 ? 111 TYR A CG    1 
ATOM   877   C  CD1   . TYR A  1 113 ? 8.108   -43.839  -21.449 1.00 13.63 ? 111 TYR A CD1   1 
ATOM   878   C  CD2   . TYR A  1 113 ? 5.949   -43.111  -20.761 1.00 13.61 ? 111 TYR A CD2   1 
ATOM   879   C  CE1   . TYR A  1 113 ? 7.517   -44.786  -22.330 1.00 13.20 ? 111 TYR A CE1   1 
ATOM   880   C  CE2   . TYR A  1 113 ? 5.339   -44.069  -21.608 1.00 13.87 ? 111 TYR A CE2   1 
ATOM   881   C  CZ    . TYR A  1 113 ? 6.137   -44.891  -22.385 1.00 15.51 ? 111 TYR A CZ    1 
ATOM   882   O  OH    . TYR A  1 113 ? 5.523   -45.794  -23.232 1.00 17.76 ? 111 TYR A OH    1 
ATOM   883   N  N     . TYR A  1 114 ? 7.514   -40.303  -22.710 1.00 14.55 ? 112 TYR A N     1 
ATOM   884   C  CA    . TYR A  1 114 ? 6.526   -39.803  -23.678 1.00 14.19 ? 112 TYR A CA    1 
ATOM   885   C  C     . TYR A  1 114 ? 5.569   -40.922  -23.987 1.00 11.28 ? 112 TYR A C     1 
ATOM   886   O  O     . TYR A  1 114 ? 6.007   -42.057  -24.223 1.00 11.23 ? 112 TYR A O     1 
ATOM   887   C  CB    . TYR A  1 114 ? 7.260   -39.418  -24.968 1.00 14.38 ? 112 TYR A CB    1 
ATOM   888   C  CG    . TYR A  1 114 ? 6.365   -39.103  -26.153 1.00 16.53 ? 112 TYR A CG    1 
ATOM   889   C  CD1   . TYR A  1 114 ? 5.370   -38.134  -26.045 1.00 12.86 ? 112 TYR A CD1   1 
ATOM   890   C  CD2   . TYR A  1 114 ? 6.557   -39.734  -27.404 1.00 15.15 ? 112 TYR A CD2   1 
ATOM   891   C  CE1   . TYR A  1 114 ? 4.569   -37.823  -27.115 1.00 15.07 ? 112 TYR A CE1   1 
ATOM   892   C  CE2   . TYR A  1 114 ? 5.752   -39.415  -28.497 1.00 12.34 ? 112 TYR A CE2   1 
ATOM   893   C  CZ    . TYR A  1 114 ? 4.761   -38.447  -28.336 1.00 15.11 ? 112 TYR A CZ    1 
ATOM   894   O  OH    . TYR A  1 114 ? 3.921   -38.048  -29.347 1.00 16.99 ? 112 TYR A OH    1 
ATOM   895   N  N     . LEU A  1 115 ? 4.270   -40.638  -23.988 1.00 14.54 ? 113 LEU A N     1 
ATOM   896   C  CA    . LEU A  1 115 ? 3.275   -41.706  -24.164 1.00 14.43 ? 113 LEU A CA    1 
ATOM   897   C  C     . LEU A  1 115 ? 3.051   -42.097  -25.615 1.00 18.30 ? 113 LEU A C     1 
ATOM   898   O  O     . LEU A  1 115 ? 2.276   -43.013  -25.889 1.00 19.92 ? 113 LEU A O     1 
ATOM   899   C  CB    . LEU A  1 115 ? 1.914   -41.317  -23.551 1.00 14.43 ? 113 LEU A CB    1 
ATOM   900   C  CG    . LEU A  1 115 ? 1.680   -41.930  -22.170 1.00 18.45 ? 113 LEU A CG    1 
ATOM   901   C  CD1   . LEU A  1 115 ? 2.565   -41.360  -21.074 1.00 13.13 ? 113 LEU A CD1   1 
ATOM   902   C  CD2   . LEU A  1 115 ? 0.274   -41.785  -21.794 1.00 16.42 ? 113 LEU A CD2   1 
ATOM   903   N  N     . GLY A  1 116 ? 3.678   -41.398  -26.567 1.00 12.43 ? 114 GLY A N     1 
ATOM   904   C  CA    . GLY A  1 116 ? 3.466   -41.780  -27.946 1.00 11.08 ? 114 GLY A CA    1 
ATOM   905   C  C     . GLY A  1 116 ? 2.410   -40.910  -28.596 1.00 17.49 ? 114 GLY A C     1 
ATOM   906   O  O     . GLY A  1 116 ? 1.887   -39.951  -27.987 1.00 14.87 ? 114 GLY A O     1 
ATOM   907   N  N     . VAL A  1 117 ? 2.099   -41.220  -29.845 1.00 13.87 ? 115 VAL A N     1 
ATOM   908   C  CA    . VAL A  1 117 ? 0.916   -40.604  -30.460 1.00 15.36 ? 115 VAL A CA    1 
ATOM   909   C  C     . VAL A  1 117 ? -0.302  -40.738  -29.529 1.00 15.69 ? 115 VAL A C     1 
ATOM   910   O  O     . VAL A  1 117 ? -1.073  -39.775  -29.308 1.00 14.66 ? 115 VAL A O     1 
ATOM   911   C  CB    . VAL A  1 117 ? 0.630   -41.292  -31.801 1.00 15.57 ? 115 VAL A CB    1 
ATOM   912   C  CG1   . VAL A  1 117 ? -0.681  -40.775  -32.429 1.00 14.96 ? 115 VAL A CG1   1 
ATOM   913   C  CG2   . VAL A  1 117 ? 1.788   -41.050  -32.767 1.00 21.00 ? 115 VAL A CG2   1 
ATOM   914   N  N     . CYS A  1 118 ? -0.492  -41.955  -29.010 1.00 14.13 ? 116 CYS A N     1 
ATOM   915   C  CA    . CYS A  1 118 ? -1.512  -42.235  -27.989 1.00 15.00 ? 116 CYS A CA    1 
ATOM   916   C  C     . CYS A  1 118 ? -1.152  -43.568  -27.360 1.00 13.91 ? 116 CYS A C     1 
ATOM   917   O  O     . CYS A  1 118 ? -0.458  -44.364  -27.974 1.00 14.07 ? 116 CYS A O     1 
ATOM   918   C  CB    . CYS A  1 118 ? -2.931  -42.260  -28.559 1.00 20.47 ? 116 CYS A CB    1 
ATOM   919   S  SG    . CYS A  1 118 ? -3.177  -43.624  -29.724 1.00 18.27 ? 116 CYS A SG    1 
ATOM   920   N  N     . SER A  1 119 ? -1.582  -43.774  -26.115 1.00 13.31 ? 117 SER A N     1 
ATOM   921   C  CA    . SER A  1 119 ? -1.449  -45.068  -25.430 1.00 13.21 ? 117 SER A CA    1 
ATOM   922   C  C     . SER A  1 119 ? -2.086  -45.022  -24.058 1.00 14.88 ? 117 SER A C     1 
ATOM   923   O  O     . SER A  1 119 ? -2.543  -43.970  -23.584 1.00 14.21 ? 117 SER A O     1 
ATOM   924   C  CB    . SER A  1 119 ? 0.026   -45.524  -25.319 1.00 14.46 ? 117 SER A CB    1 
ATOM   925   O  OG    . SER A  1 119 ? 0.800   -44.674  -24.473 1.00 10.62 ? 117 SER A OG    1 
ATOM   926   N  N     . CYS A  1 120 ? -2.094  -46.178  -23.400 1.00 12.04 ? 118 CYS A N     1 
ATOM   927   C  CA    . CYS A  1 120 ? -2.489  -46.248  -22.011 1.00 11.63 ? 118 CYS A CA    1 
ATOM   928   C  C     . CYS A  1 120 ? -1.317  -46.876  -21.260 1.00 14.59 ? 118 CYS A C     1 
ATOM   929   O  O     . CYS A  1 120 ? -0.706  -47.859  -21.710 1.00 13.70 ? 118 CYS A O     1 
ATOM   930   C  CB    . CYS A  1 120 ? -3.770  -47.099  -21.823 1.00 10.10 ? 118 CYS A CB    1 
ATOM   931   S  SG    . CYS A  1 120 ? -4.443  -47.109  -20.134 1.00 14.37 ? 118 CYS A SG    1 
ATOM   932   N  N     . ILE A  1 121 ? -0.986  -46.302  -20.119 1.00 12.50 ? 119 ILE A N     1 
ATOM   933   C  CA    . ILE A  1 121 ? -0.012  -46.918  -19.230 1.00 14.86 ? 119 ILE A CA    1 
ATOM   934   C  C     . ILE A  1 121 ? -0.650  -47.255  -17.897 1.00 14.92 ? 119 ILE A C     1 
ATOM   935   O  O     . ILE A  1 121 ? -1.798  -46.866  -17.630 1.00 17.11 ? 119 ILE A O     1 
ATOM   936   C  CB    . ILE A  1 121 ? 1.280   -46.049  -19.065 1.00 16.58 ? 119 ILE A CB    1 
ATOM   937   C  CG1   . ILE A  1 121 ? 0.972   -44.635  -18.551 1.00 17.55 ? 119 ILE A CG1   1 
ATOM   938   C  CG2   . ILE A  1 121 ? 2.064   -45.981  -20.386 1.00 14.89 ? 119 ILE A CG2   1 
ATOM   939   C  CD1   . ILE A  1 121 ? 0.535   -44.567  -17.083 1.00 17.57 ? 119 ILE A CD1   1 
ATOM   940   N  N     . ASN A  1 122 ? 0.108   -47.980  -17.080 1.00 14.09 ? 120 ASN A N     1 
ATOM   941   C  CA    . ASN A  1 122 ? -0.250  -48.317  -15.719 1.00 13.15 ? 120 ASN A CA    1 
ATOM   942   C  C     . ASN A  1 122 ? 0.786   -47.768  -14.749 1.00 16.77 ? 120 ASN A C     1 
ATOM   943   O  O     . ASN A  1 122 ? 2.001   -47.848  -15.009 1.00 17.90 ? 120 ASN A O     1 
ATOM   944   C  CB    . ASN A  1 122 ? -0.287  -49.842  -15.563 1.00 16.94 ? 120 ASN A CB    1 
ATOM   945   C  CG    . ASN A  1 122 ? -1.394  -50.488  -16.354 1.00 20.10 ? 120 ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1 122 ? -2.196  -49.818  -17.059 1.00 19.10 ? 120 ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1 122 ? -1.457  -51.813  -16.255 1.00 18.00 ? 120 ASN A ND2   1 
ATOM   948   N  N     . ILE A  1 123 ? 0.320   -47.219  -13.636 1.00 16.16 ? 121 ILE A N     1 
ATOM   949   C  CA    . ILE A  1 123 ? 1.226   -46.834  -12.562 1.00 16.90 ? 121 ILE A CA    1 
ATOM   950   C  C     . ILE A  1 123 ? 0.444   -46.727  -11.257 1.00 19.50 ? 121 ILE A C     1 
ATOM   951   O  O     . ILE A  1 123 ? -0.678  -46.174  -11.255 1.00 19.47 ? 121 ILE A O     1 
ATOM   952   C  CB    . ILE A  1 123 ? 1.972   -45.527  -12.897 1.00 19.63 ? 121 ILE A CB    1 
ATOM   953   C  CG1   . ILE A  1 123 ? 2.971   -45.174  -11.775 1.00 22.03 ? 121 ILE A CG1   1 
ATOM   954   C  CG2   . ILE A  1 123 ? 0.978   -44.380  -13.157 1.00 14.86 ? 121 ILE A CG2   1 
ATOM   955   C  CD1   . ILE A  1 123 ? 3.930   -44.049  -12.151 1.00 22.94 ? 121 ILE A CD1   1 
ATOM   956   N  N     . ASN A  1 124 ? 1.003   -47.263  -10.155 1.00 21.43 ? 122 ASN A N     1 
ATOM   957   C  CA    . ASN A  1 124 ? 0.355   -47.194  -8.830  1.00 18.98 ? 122 ASN A CA    1 
ATOM   958   C  C     . ASN A  1 124 ? -1.148  -47.565  -8.849  1.00 22.92 ? 122 ASN A C     1 
ATOM   959   O  O     . ASN A  1 124 ? -1.944  -46.943  -8.149  1.00 23.87 ? 122 ASN A O     1 
ATOM   960   C  CB    . ASN A  1 124 ? 0.496   -45.794  -8.208  1.00 22.50 ? 122 ASN A CB    1 
ATOM   961   C  CG    . ASN A  1 124 ? 1.898   -45.479  -7.788  1.00 24.20 ? 122 ASN A CG    1 
ATOM   962   O  OD1   . ASN A  1 124 ? 2.752   -46.349  -7.802  1.00 23.78 ? 122 ASN A OD1   1 
ATOM   963   N  ND2   . ASN A  1 124 ? 2.147   -44.221  -7.397  1.00 23.73 ? 122 ASN A ND2   1 
ATOM   964   N  N     . GLY A  1 125 ? -1.529  -48.539  -9.671  1.00 22.53 ? 123 GLY A N     1 
ATOM   965   C  CA    . GLY A  1 125 ? -2.898  -49.040  -9.689  1.00 26.87 ? 123 GLY A CA    1 
ATOM   966   C  C     . GLY A  1 125 ? -3.788  -48.178  -10.559 1.00 22.82 ? 123 GLY A C     1 
ATOM   967   O  O     . GLY A  1 125 ? -5.003  -48.394  -10.610 1.00 23.40 ? 123 GLY A O     1 
ATOM   968   N  N     . LEU A  1 126 ? -3.178  -47.196  -11.236 1.00 17.41 ? 124 LEU A N     1 
ATOM   969   C  CA    . LEU A  1 126 ? -3.909  -46.261  -12.130 1.00 16.96 ? 124 LEU A CA    1 
ATOM   970   C  C     . LEU A  1 126 ? -3.748  -46.640  -13.607 1.00 21.45 ? 124 LEU A C     1 
ATOM   971   O  O     . LEU A  1 126 ? -2.703  -47.212  -14.021 1.00 14.17 ? 124 LEU A O     1 
ATOM   972   C  CB    . LEU A  1 126 ? -3.378  -44.827  -11.928 1.00 15.81 ? 124 LEU A CB    1 
ATOM   973   C  CG    . LEU A  1 126 ? -3.560  -44.155  -10.569 1.00 20.21 ? 124 LEU A CG    1 
ATOM   974   C  CD1   . LEU A  1 126 ? -2.920  -42.730  -10.505 1.00 20.00 ? 124 LEU A CD1   1 
ATOM   975   C  CD2   . LEU A  1 126 ? -5.050  -44.056  -10.242 1.00 22.70 ? 124 LEU A CD2   1 
ATOM   976   N  N     . ARG A  1 127 ? -4.774  -46.350  -14.411 1.00 15.32 ? 125 ARG A N     1 
ATOM   977   C  CA    . ARG A  1 127 ? -4.647  -46.489  -15.844 1.00 17.39 ? 125 ARG A CA    1 
ATOM   978   C  C     . ARG A  1 127 ? -4.746  -45.091  -16.436 1.00 15.33 ? 125 ARG A C     1 
ATOM   979   O  O     . ARG A  1 127 ? -5.705  -44.372  -16.164 1.00 16.48 ? 125 ARG A O     1 
ATOM   980   C  CB    . ARG A  1 127 ? -5.685  -47.456  -16.419 1.00 13.58 ? 125 ARG A CB    1 
ATOM   981   C  CG    . ARG A  1 127 ? -5.672  -48.806  -15.746 1.00 18.26 ? 125 ARG A CG    1 
ATOM   982   C  CD    . ARG A  1 127 ? -6.792  -49.750  -16.316 1.00 19.08 ? 125 ARG A CD    1 
ATOM   983   N  NE    . ARG A  1 127 ? -6.565  -50.047  -17.734 1.00 20.11 ? 125 ARG A NE    1 
ATOM   984   C  CZ    . ARG A  1 127 ? -7.480  -50.008  -18.710 1.00 19.76 ? 125 ARG A CZ    1 
ATOM   985   N  NH1   . ARG A  1 127 ? -8.767  -49.715  -18.468 1.00 19.59 ? 125 ARG A NH1   1 
ATOM   986   N  NH2   . ARG A  1 127 ? -7.082  -50.264  -19.951 1.00 14.49 ? 125 ARG A NH2   1 
ATOM   987   N  N     . ILE A  1 128 ? -3.698  -44.694  -17.160 1.00 15.43 ? 126 ILE A N     1 
ATOM   988   C  CA    . ILE A  1 128 ? -3.586  -43.323  -17.672 1.00 17.66 ? 126 ILE A CA    1 
ATOM   989   C  C     . ILE A  1 128 ? -3.502  -43.314  -19.213 1.00 17.94 ? 126 ILE A C     1 
ATOM   990   O  O     . ILE A  1 128 ? -2.592  -43.886  -19.798 1.00 13.38 ? 126 ILE A O     1 
ATOM   991   C  CB    . ILE A  1 128 ? -2.350  -42.595  -17.093 1.00 17.36 ? 126 ILE A CB    1 
ATOM   992   C  CG1   . ILE A  1 128 ? -2.349  -42.675  -15.555 1.00 19.46 ? 126 ILE A CG1   1 
ATOM   993   C  CG2   . ILE A  1 128 ? -2.300  -41.135  -17.630 1.00 14.19 ? 126 ILE A CG2   1 
ATOM   994   C  CD1   . ILE A  1 128 ? -1.353  -41.700  -14.790 1.00 13.58 ? 126 ILE A CD1   1 
ATOM   995   N  N     . VAL A  1 129 ? -4.453  -42.644  -19.860 1.00 12.42 ? 127 VAL A N     1 
ATOM   996   C  CA    . VAL A  1 129 ? -4.528  -42.549  -21.314 1.00 12.83 ? 127 VAL A CA    1 
ATOM   997   C  C     . VAL A  1 129 ? -3.977  -41.197  -21.768 1.00 12.86 ? 127 VAL A C     1 
ATOM   998   O  O     . VAL A  1 129 ? -4.123  -40.188  -21.062 1.00 16.67 ? 127 VAL A O     1 
ATOM   999   C  CB    . VAL A  1 129 ? -5.992  -42.695  -21.773 1.00 21.89 ? 127 VAL A CB    1 
ATOM   1000  C  CG1   . VAL A  1 129 ? -6.195  -42.108  -23.202 1.00 15.53 ? 127 VAL A CG1   1 
ATOM   1001  C  CG2   . VAL A  1 129 ? -6.415  -44.179  -21.688 1.00 16.37 ? 127 VAL A CG2   1 
ATOM   1002  N  N     . GLY A  1 130 ? -3.311  -41.183  -22.921 1.00 17.26 ? 128 GLY A N     1 
ATOM   1003  C  CA    . GLY A  1 130 ? -2.711  -39.961  -23.451 1.00 12.67 ? 128 GLY A CA    1 
ATOM   1004  C  C     . GLY A  1 130 ? -2.999  -39.816  -24.940 1.00 14.74 ? 128 GLY A C     1 
ATOM   1005  O  O     . GLY A  1 130 ? -2.919  -40.797  -25.697 1.00 13.48 ? 128 GLY A O     1 
ATOM   1006  N  N     . VAL A  1 131 ? -3.333  -38.588  -25.358 1.00 13.00 ? 129 VAL A N     1 
ATOM   1007  C  CA    . VAL A  1 131 ? -3.615  -38.252  -26.762 1.00 13.49 ? 129 VAL A CA    1 
ATOM   1008  C  C     . VAL A  1 131 ? -2.763  -37.018  -27.132 1.00 14.14 ? 129 VAL A C     1 
ATOM   1009  O  O     . VAL A  1 131 ? -2.980  -35.916  -26.617 1.00 16.03 ? 129 VAL A O     1 
ATOM   1010  C  CB    . VAL A  1 131 ? -5.105  -37.877  -26.977 1.00 14.19 ? 129 VAL A CB    1 
ATOM   1011  C  CG1   . VAL A  1 131 ? -5.408  -37.744  -28.476 1.00 16.25 ? 129 VAL A CG1   1 
ATOM   1012  C  CG2   . VAL A  1 131 ? -6.015  -38.904  -26.385 1.00 14.24 ? 129 VAL A CG2   1 
ATOM   1013  N  N     . SER A  1 132 ? -1.772  -37.203  -27.988 1.00 15.16 ? 130 SER A N     1 
ATOM   1014  C  CA    . SER A  1 132 ? -0.883  -36.113  -28.307 1.00 15.93 ? 130 SER A CA    1 
ATOM   1015  C  C     . SER A  1 132 ? -1.433  -35.204  -29.411 1.00 18.11 ? 130 SER A C     1 
ATOM   1016  O  O     . SER A  1 132 ? -2.310  -35.619  -30.171 1.00 12.00 ? 130 SER A O     1 
ATOM   1017  C  CB    . SER A  1 132 ? 0.479   -36.685  -28.726 1.00 12.09 ? 130 SER A CB    1 
ATOM   1018  O  OG    . SER A  1 132 ? 1.110   -37.294  -27.615 1.00 16.22 ? 130 SER A OG    1 
ATOM   1019  N  N     . GLY A  1 133 ? -0.870  -33.996  -29.526 1.00 15.64 ? 131 GLY A N     1 
ATOM   1020  C  CA    . GLY A  1 133 ? -1.175  -33.076  -30.615 1.00 14.06 ? 131 GLY A CA    1 
ATOM   1021  C  C     . GLY A  1 133 ? -2.338  -32.113  -30.389 1.00 21.04 ? 131 GLY A C     1 
ATOM   1022  O  O     . GLY A  1 133 ? -3.015  -32.113  -29.341 1.00 14.60 ? 131 GLY A O     1 
ATOM   1023  N  N     . ILE A  1 134 ? -2.559  -31.268  -31.394 1.00 14.80 ? 132 ILE A N     1 
ATOM   1024  C  CA    . ILE A  1 134 ? -3.761  -30.475  -31.470 1.00 12.46 ? 132 ILE A CA    1 
ATOM   1025  C  C     . ILE A  1 134 ? -4.441  -30.761  -32.809 1.00 14.94 ? 132 ILE A C     1 
ATOM   1026  O  O     . ILE A  1 134 ? -3.817  -31.238  -33.790 1.00 14.44 ? 132 ILE A O     1 
ATOM   1027  C  CB    . ILE A  1 134 ? -3.474  -28.966  -31.332 1.00 20.78 ? 132 ILE A CB    1 
ATOM   1028  C  CG1   . ILE A  1 134 ? -2.631  -28.486  -32.509 1.00 15.01 ? 132 ILE A CG1   1 
ATOM   1029  C  CG2   . ILE A  1 134 ? -2.725  -28.665  -30.032 1.00 13.83 ? 132 ILE A CG2   1 
ATOM   1030  C  CD1   . ILE A  1 134 ? -2.573  -26.933  -32.591 1.00 23.97 ? 132 ILE A CD1   1 
ATOM   1031  N  N     . TYR A  1 135 ? -5.726  -30.449  -32.828 1.00 13.25 ? 133 TYR A N     1 
ATOM   1032  C  CA    . TYR A  1 135 ? -6.602  -30.767  -33.939 1.00 17.48 ? 133 TYR A CA    1 
ATOM   1033  C  C     . TYR A  1 135 ? -6.610  -29.734  -35.079 1.00 21.09 ? 133 TYR A C     1 
ATOM   1034  O  O     . TYR A  1 135 ? -6.803  -28.537  -34.847 1.00 21.65 ? 133 TYR A O     1 
ATOM   1035  C  CB    . TYR A  1 135 ? -8.024  -30.935  -33.411 1.00 16.07 ? 133 TYR A CB    1 
ATOM   1036  C  CG    . TYR A  1 135 ? -9.022  -31.272  -34.480 1.00 20.29 ? 133 TYR A CG    1 
ATOM   1037  C  CD1   . TYR A  1 135 ? -9.169  -32.590  -34.912 1.00 24.12 ? 133 TYR A CD1   1 
ATOM   1038  C  CD2   . TYR A  1 135 ? -9.819  -30.292  -35.057 1.00 21.06 ? 133 TYR A CD2   1 
ATOM   1039  C  CE1   . TYR A  1 135 ? -10.073 -32.925  -35.889 1.00 23.34 ? 133 TYR A CE1   1 
ATOM   1040  C  CE2   . TYR A  1 135 ? -10.741 -30.622  -36.046 1.00 22.51 ? 133 TYR A CE2   1 
ATOM   1041  C  CZ    . TYR A  1 135 ? -10.862 -31.939  -36.453 1.00 24.45 ? 133 TYR A CZ    1 
ATOM   1042  O  OH    . TYR A  1 135 ? -11.761 -32.329  -37.422 1.00 28.87 ? 133 TYR A OH    1 
ATOM   1043  N  N     . LYS A  1 136 ? -6.380  -30.214  -36.304 1.00 17.75 ? 134 LYS A N     1 
ATOM   1044  C  CA    . LYS A  1 136 ? -6.702  -29.464  -37.525 1.00 18.81 ? 134 LYS A CA    1 
ATOM   1045  C  C     . LYS A  1 136 ? -7.337  -30.423  -38.523 1.00 20.79 ? 134 LYS A C     1 
ATOM   1046  O  O     . LYS A  1 136 ? -6.699  -31.400  -38.945 1.00 22.89 ? 134 LYS A O     1 
ATOM   1047  C  CB    . LYS A  1 136 ? -5.465  -28.783  -38.131 1.00 20.44 ? 134 LYS A CB    1 
ATOM   1048  C  CG    . LYS A  1 136 ? -4.836  -27.711  -37.239 1.00 27.33 ? 134 LYS A CG    1 
ATOM   1049  C  CD    . LYS A  1 136 ? -5.520  -26.336  -37.327 1.00 27.71 ? 134 LYS A CD    1 
ATOM   1050  C  CE    . LYS A  1 136 ? -4.880  -25.374  -36.302 1.00 33.75 ? 134 LYS A CE    1 
ATOM   1051  N  NZ    . LYS A  1 136 ? -5.314  -23.936  -36.425 1.00 34.15 ? 134 LYS A NZ    1 
ATOM   1052  N  N     . SER A  1 137 ? -8.606  -30.178  -38.855 1.00 21.29 ? 135 SER A N     1 
ATOM   1053  C  CA    . SER A  1 137 ? -9.379  -31.068  -39.739 1.00 21.85 ? 135 SER A CA    1 
ATOM   1054  C  C     . SER A  1 137 ? -8.673  -31.382  -41.059 1.00 22.85 ? 135 SER A C     1 
ATOM   1055  O  O     . SER A  1 137 ? -8.742  -32.512  -41.546 1.00 25.28 ? 135 SER A O     1 
ATOM   1056  C  CB    . SER A  1 137 ? -10.750 -30.458  -40.026 1.00 26.67 ? 135 SER A CB    1 
ATOM   1057  O  OG    . SER A  1 137 ? -10.577 -29.171  -40.591 1.00 25.14 ? 135 SER A OG    1 
ATOM   1058  N  N     . PHE A  1 138 ? -7.969  -30.404  -41.638 1.00 26.35 ? 136 PHE A N     1 
ATOM   1059  C  CA    . PHE A  1 138 ? -7.243  -30.673  -42.889 1.00 25.81 ? 136 PHE A CA    1 
ATOM   1060  C  C     . PHE A  1 138 ? -6.177  -31.794  -42.809 1.00 28.96 ? 136 PHE A C     1 
ATOM   1061  O  O     . PHE A  1 138 ? -5.748  -32.323  -43.842 1.00 28.10 ? 136 PHE A O     1 
ATOM   1062  C  CB    . PHE A  1 138 ? -6.697  -29.396  -43.574 1.00 27.39 ? 136 PHE A CB    1 
ATOM   1063  C  CG    . PHE A  1 138 ? -5.652  -28.638  -42.770 1.00 23.43 ? 136 PHE A CG    1 
ATOM   1064  C  CD1   . PHE A  1 138 ? -4.315  -29.035  -42.780 1.00 28.71 ? 136 PHE A CD1   1 
ATOM   1065  C  CD2   . PHE A  1 138 ? -6.007  -27.504  -42.041 1.00 23.73 ? 136 PHE A CD2   1 
ATOM   1066  C  CE1   . PHE A  1 138 ? -3.345  -28.324  -42.039 1.00 27.15 ? 136 PHE A CE1   1 
ATOM   1067  C  CE2   . PHE A  1 138 ? -5.048  -26.777  -41.275 1.00 25.09 ? 136 PHE A CE2   1 
ATOM   1068  C  CZ    . PHE A  1 138 ? -3.725  -27.190  -41.278 1.00 22.45 ? 136 PHE A CZ    1 
ATOM   1069  N  N     . ASP A  1 139 ? -5.772  -32.173  -41.600 1.00 23.07 ? 137 ASP A N     1 
ATOM   1070  C  CA    . ASP A  1 139 ? -4.690  -33.139  -41.425 1.00 24.79 ? 137 ASP A CA    1 
ATOM   1071  C  C     . ASP A  1 139 ? -5.115  -34.404  -40.680 1.00 23.88 ? 137 ASP A C     1 
ATOM   1072  O  O     . ASP A  1 139 ? -4.290  -35.284  -40.451 1.00 23.68 ? 137 ASP A O     1 
ATOM   1073  C  CB    . ASP A  1 139 ? -3.511  -32.471  -40.685 1.00 22.89 ? 137 ASP A CB    1 
ATOM   1074  C  CG    . ASP A  1 139 ? -2.559  -31.745  -41.623 1.00 27.27 ? 137 ASP A CG    1 
ATOM   1075  O  OD1   . ASP A  1 139 ? -2.596  -32.006  -42.846 1.00 27.65 ? 137 ASP A OD1   1 
ATOM   1076  O  OD2   . ASP A  1 139 ? -1.741  -30.940  -41.116 1.00 22.74 ? 137 ASP A OD2   1 
ATOM   1077  N  N     . GLU A  1 140 ? -6.393  -34.511  -40.316 1.00 21.63 ? 138 GLU A N     1 
ATOM   1078  C  CA    . GLU A  1 140 ? -6.831  -35.612  -39.420 1.00 21.53 ? 138 GLU A CA    1 
ATOM   1079  C  C     . GLU A  1 140 ? -6.806  -37.012  -40.050 1.00 24.21 ? 138 GLU A C     1 
ATOM   1080  O  O     . GLU A  1 140 ? -6.877  -38.025  -39.327 1.00 20.53 ? 138 GLU A O     1 
ATOM   1081  C  CB    . GLU A  1 140 ? -8.199  -35.337  -38.806 1.00 21.92 ? 138 GLU A CB    1 
ATOM   1082  C  CG    . GLU A  1 140 ? -9.340  -35.422  -39.797 1.00 29.87 ? 138 GLU A CG    1 
ATOM   1083  C  CD    . GLU A  1 140 ? -10.654 -34.988  -39.182 1.00 31.38 ? 138 GLU A CD    1 
ATOM   1084  O  OE1   . GLU A  1 140 ? -10.928 -35.351  -38.015 1.00 37.85 ? 138 GLU A OE1   1 
ATOM   1085  O  OE2   . GLU A  1 140 ? -11.399 -34.265  -39.868 1.00 43.41 ? 138 GLU A OE2   1 
ATOM   1086  N  N     . LYS A  1 141 ? -6.660  -37.065  -41.377 1.00 20.46 ? 139 LYS A N     1 
ATOM   1087  C  CA    . LYS A  1 141 ? -6.578  -38.330  -42.108 1.00 22.80 ? 139 LYS A CA    1 
ATOM   1088  C  C     . LYS A  1 141 ? -5.243  -38.456  -42.810 1.00 26.62 ? 139 LYS A C     1 
ATOM   1089  O  O     . LYS A  1 141 ? -5.076  -39.298  -43.680 1.00 25.32 ? 139 LYS A O     1 
ATOM   1090  C  CB    . LYS A  1 141 ? -7.652  -38.399  -43.178 1.00 31.61 ? 139 LYS A CB    1 
ATOM   1091  C  CG    . LYS A  1 141 ? -9.050  -38.342  -42.653 1.00 34.39 ? 139 LYS A CG    1 
ATOM   1092  C  CD    . LYS A  1 141 ? -9.413  -39.622  -41.945 1.00 36.81 ? 139 LYS A CD    1 
ATOM   1093  C  CE    . LYS A  1 141 ? -10.871 -39.560  -41.484 1.00 41.75 ? 139 LYS A CE    1 
ATOM   1094  N  NZ    . LYS A  1 141 ? -11.691 -38.644  -42.351 1.00 49.72 ? 139 LYS A NZ    1 
ATOM   1095  N  N     . LYS A  1 142 ? -4.301  -37.600  -42.451 1.00 23.23 ? 140 LYS A N     1 
ATOM   1096  C  CA    . LYS A  1 142 ? -2.973  -37.670  -43.023 1.00 30.55 ? 140 LYS A CA    1 
ATOM   1097  C  C     . LYS A  1 142 ? -2.205  -38.801  -42.356 1.00 28.52 ? 140 LYS A C     1 
ATOM   1098  O  O     . LYS A  1 142 ? -2.284  -38.978  -41.142 1.00 26.32 ? 140 LYS A O     1 
ATOM   1099  C  CB    . LYS A  1 142 ? -2.247  -36.348  -42.787 1.00 29.84 ? 140 LYS A CB    1 
ATOM   1100  C  CG    . LYS A  1 142 ? -1.085  -36.080  -43.720 1.00 33.41 ? 140 LYS A CG    1 
ATOM   1101  C  CD    . LYS A  1 142 ? -0.673  -34.598  -43.594 1.00 37.64 ? 140 LYS A CD    1 
ATOM   1102  C  CE    . LYS A  1 142 ? 0.867   -34.394  -43.617 1.00 36.04 ? 140 LYS A CE    1 
ATOM   1103  N  NZ    . LYS A  1 142 ? 1.507   -34.641  -44.973 1.00 43.53 ? 140 LYS A NZ    1 
ATOM   1104  N  N     . PRO A  1 143 ? -1.480  -39.598  -43.152 1.00 32.40 ? 141 PRO A N     1 
ATOM   1105  C  CA    . PRO A  1 143 ? -0.577  -40.577  -42.528 1.00 21.68 ? 141 PRO A CA    1 
ATOM   1106  C  C     . PRO A  1 143 ? 0.644   -39.874  -41.960 1.00 20.23 ? 141 PRO A C     1 
ATOM   1107  O  O     . PRO A  1 143 ? 0.909   -38.727  -42.326 1.00 24.16 ? 141 PRO A O     1 
ATOM   1108  C  CB    . PRO A  1 143 ? -0.138  -41.469  -43.705 1.00 30.96 ? 141 PRO A CB    1 
ATOM   1109  C  CG    . PRO A  1 143 ? -0.372  -40.604  -44.965 1.00 27.37 ? 141 PRO A CG    1 
ATOM   1110  C  CD    . PRO A  1 143 ? -1.518  -39.681  -44.629 1.00 30.93 ? 141 PRO A CD    1 
ATOM   1111  N  N     . TYR A  1 144 ? 1.381   -40.548  -41.081 1.00 21.61 ? 142 TYR A N     1 
ATOM   1112  C  CA    . TYR A  1 144 ? 2.751   -40.157  -40.765 1.00 17.66 ? 142 TYR A CA    1 
ATOM   1113  C  C     . TYR A  1 144 ? 3.677   -40.670  -41.878 1.00 23.66 ? 142 TYR A C     1 
ATOM   1114  O  O     . TYR A  1 144 ? 3.456   -41.762  -42.414 1.00 24.56 ? 142 TYR A O     1 
ATOM   1115  C  CB    . TYR A  1 144 ? 3.171   -40.712  -39.383 1.00 17.08 ? 142 TYR A CB    1 
ATOM   1116  C  CG    . TYR A  1 144 ? 2.403   -40.064  -38.228 1.00 21.79 ? 142 TYR A CG    1 
ATOM   1117  C  CD1   . TYR A  1 144 ? 2.633   -38.737  -37.862 1.00 21.75 ? 142 TYR A CD1   1 
ATOM   1118  C  CD2   . TYR A  1 144 ? 1.445   -40.768  -37.518 1.00 21.57 ? 142 TYR A CD2   1 
ATOM   1119  C  CE1   . TYR A  1 144 ? 1.911   -38.134  -36.815 1.00 18.26 ? 142 TYR A CE1   1 
ATOM   1120  C  CE2   . TYR A  1 144 ? 0.709   -40.170  -36.464 1.00 18.06 ? 142 TYR A CE2   1 
ATOM   1121  C  CZ    . TYR A  1 144 ? 0.966   -38.866  -36.114 1.00 16.33 ? 142 TYR A CZ    1 
ATOM   1122  O  OH    . TYR A  1 144 ? 0.260   -38.286  -35.088 1.00 22.61 ? 142 TYR A OH    1 
ATOM   1123  N  N     . THR A  1 145 ? 4.683   -39.877  -42.242 1.00 23.96 ? 143 THR A N     1 
ATOM   1124  C  CA    . THR A  1 145 ? 5.736   -40.315  -43.154 1.00 25.10 ? 143 THR A CA    1 
ATOM   1125  C  C     . THR A  1 145 ? 7.058   -40.334  -42.392 1.00 26.30 ? 143 THR A C     1 
ATOM   1126  O  O     . THR A  1 145 ? 7.331   -39.449  -41.570 1.00 24.54 ? 143 THR A O     1 
ATOM   1127  C  CB    . THR A  1 145 ? 5.819   -39.446  -44.430 1.00 29.20 ? 143 THR A CB    1 
ATOM   1128  O  OG1   . THR A  1 145 ? 5.659   -38.067  -44.099 1.00 32.39 ? 143 THR A OG1   1 
ATOM   1129  C  CG2   . THR A  1 145 ? 4.714   -39.784  -45.366 1.00 21.55 ? 143 THR A CG2   1 
ATOM   1130  N  N     . TYR A  1 146 ? 7.865   -41.351  -42.643 1.00 22.45 ? 144 TYR A N     1 
ATOM   1131  C  CA    . TYR A  1 146 ? 9.100   -41.571  -41.893 1.00 25.50 ? 144 TYR A CA    1 
ATOM   1132  C  C     . TYR A  1 146 ? 10.198  -41.988  -42.865 1.00 30.20 ? 144 TYR A C     1 
ATOM   1133  O  O     . TYR A  1 146 ? 9.927   -42.701  -43.835 1.00 27.57 ? 144 TYR A O     1 
ATOM   1134  C  CB    . TYR A  1 146 ? 8.865   -42.696  -40.885 1.00 20.92 ? 144 TYR A CB    1 
ATOM   1135  C  CG    . TYR A  1 146 ? 9.956   -42.856  -39.856 1.00 22.00 ? 144 TYR A CG    1 
ATOM   1136  C  CD1   . TYR A  1 146 ? 11.023  -43.687  -40.094 1.00 21.16 ? 144 TYR A CD1   1 
ATOM   1137  C  CD2   . TYR A  1 146 ? 9.904   -42.192  -38.630 1.00 19.00 ? 144 TYR A CD2   1 
ATOM   1138  C  CE1   . TYR A  1 146 ? 12.008  -43.858  -39.181 1.00 19.90 ? 144 TYR A CE1   1 
ATOM   1139  C  CE2   . TYR A  1 146 ? 10.925  -42.358  -37.671 1.00 17.76 ? 144 TYR A CE2   1 
ATOM   1140  C  CZ    . TYR A  1 146 ? 11.965  -43.198  -37.960 1.00 17.67 ? 144 TYR A CZ    1 
ATOM   1141  O  OH    . TYR A  1 146 ? 13.002  -43.394  -37.060 1.00 23.53 ? 144 TYR A OH    1 
ATOM   1142  N  N     . PRO A  1 147 ? 11.434  -41.544  -42.619 1.00 23.86 ? 145 PRO A N     1 
ATOM   1143  C  CA    . PRO A  1 147 ? 11.791  -40.731  -41.448 1.00 24.63 ? 145 PRO A CA    1 
ATOM   1144  C  C     . PRO A  1 147 ? 11.295  -39.294  -41.517 1.00 25.12 ? 145 PRO A C     1 
ATOM   1145  O  O     . PRO A  1 147 ? 10.856  -38.832  -42.575 1.00 24.32 ? 145 PRO A O     1 
ATOM   1146  C  CB    . PRO A  1 147 ? 13.327  -40.717  -41.470 1.00 21.81 ? 145 PRO A CB    1 
ATOM   1147  C  CG    . PRO A  1 147 ? 13.723  -41.140  -42.867 1.00 26.00 ? 145 PRO A CG    1 
ATOM   1148  C  CD    . PRO A  1 147 ? 12.518  -41.612  -43.614 1.00 29.33 ? 145 PRO A CD    1 
ATOM   1149  N  N     . PRO A  1 148 ? 11.415  -38.571  -40.393 1.00 25.35 ? 146 PRO A N     1 
ATOM   1150  C  CA    . PRO A  1 148 ? 10.957  -37.178  -40.315 1.00 29.01 ? 146 PRO A CA    1 
ATOM   1151  C  C     . PRO A  1 148 ? 11.645  -36.327  -41.363 1.00 28.37 ? 146 PRO A C     1 
ATOM   1152  O  O     . PRO A  1 148 ? 12.849  -36.518  -41.609 1.00 22.76 ? 146 PRO A O     1 
ATOM   1153  C  CB    . PRO A  1 148 ? 11.403  -36.713  -38.915 1.00 26.13 ? 146 PRO A CB    1 
ATOM   1154  C  CG    . PRO A  1 148 ? 12.344  -37.752  -38.393 1.00 25.99 ? 146 PRO A CG    1 
ATOM   1155  C  CD    . PRO A  1 148 ? 12.110  -39.027  -39.180 1.00 22.86 ? 146 PRO A CD    1 
ATOM   1156  N  N     . SER A  1 149 ? 10.893  -35.394  -41.939 1.00 21.75 ? 147 SER A N     1 
ATOM   1157  C  CA    . SER A  1 149 ? 11.421  -34.455  -42.911 1.00 29.76 ? 147 SER A CA    1 
ATOM   1158  C  C     . SER A  1 149 ? 11.089  -33.013  -42.474 1.00 28.20 ? 147 SER A C     1 
ATOM   1159  O  O     . SER A  1 149 ? 10.025  -32.779  -41.947 1.00 26.51 ? 147 SER A O     1 
ATOM   1160  C  CB    . SER A  1 149 ? 10.824  -34.748  -44.284 1.00 31.87 ? 147 SER A CB    1 
ATOM   1161  O  OG    . SER A  1 149 ? 11.081  -33.673  -45.178 1.00 44.30 ? 147 SER A OG    1 
ATOM   1162  N  N     . PRO A  1 150 ? 12.020  -32.055  -42.677 1.00 30.90 ? 148 PRO A N     1 
ATOM   1163  C  CA    . PRO A  1 150 ? 11.799  -30.664  -42.247 1.00 25.92 ? 148 PRO A CA    1 
ATOM   1164  C  C     . PRO A  1 150 ? 10.530  -30.107  -42.853 1.00 30.40 ? 148 PRO A C     1 
ATOM   1165  O  O     . PRO A  1 150 ? 9.887   -29.253  -42.269 1.00 33.50 ? 148 PRO A O     1 
ATOM   1166  C  CB    . PRO A  1 150 ? 12.996  -29.926  -42.837 1.00 27.15 ? 148 PRO A CB    1 
ATOM   1167  C  CG    . PRO A  1 150 ? 14.118  -30.973  -42.803 1.00 32.64 ? 148 PRO A CG    1 
ATOM   1168  C  CD    . PRO A  1 150 ? 13.388  -32.260  -43.194 1.00 31.52 ? 148 PRO A CD    1 
ATOM   1169  N  N     . ASN A  1 151 ? 10.155  -30.584  -44.024 1.00 31.04 ? 149 ASN A N     1 
ATOM   1170  C  CA    . ASN A  1 151 ? 8.889   -30.151  -44.577 1.00 32.36 ? 149 ASN A CA    1 
ATOM   1171  C  C     . ASN A  1 151 ? 7.693   -30.525  -43.707 1.00 40.47 ? 149 ASN A C     1 
ATOM   1172  O  O     . ASN A  1 151 ? 6.599   -29.992  -43.906 1.00 36.17 ? 149 ASN A O     1 
ATOM   1173  C  CB    . ASN A  1 151 ? 8.696   -30.707  -45.977 1.00 34.25 ? 149 ASN A CB    1 
ATOM   1174  C  CG    . ASN A  1 151 ? 9.478   -29.938  -47.004 1.00 41.56 ? 149 ASN A CG    1 
ATOM   1175  O  OD1   . ASN A  1 151 ? 9.918   -28.799  -46.753 1.00 32.96 ? 149 ASN A OD1   1 
ATOM   1176  N  ND2   . ASN A  1 151 ? 9.656   -30.544  -48.176 1.00 44.53 ? 149 ASN A ND2   1 
ATOM   1177  N  N     . ASP A  1 152 ? 7.891   -31.440  -42.758 1.00 33.55 ? 150 ASP A N     1 
ATOM   1178  C  CA    . ASP A  1 152 ? 6.755   -31.945  -41.997 1.00 31.45 ? 150 ASP A CA    1 
ATOM   1179  C  C     . ASP A  1 152 ? 6.546   -31.159  -40.712 1.00 25.39 ? 150 ASP A C     1 
ATOM   1180  O  O     . ASP A  1 152 ? 5.646   -31.464  -39.926 1.00 28.95 ? 150 ASP A O     1 
ATOM   1181  C  CB    . ASP A  1 152 ? 6.937   -33.438  -41.714 1.00 27.85 ? 150 ASP A CB    1 
ATOM   1182  C  CG    . ASP A  1 152 ? 7.131   -34.241  -42.998 1.00 38.11 ? 150 ASP A CG    1 
ATOM   1183  O  OD1   . ASP A  1 152 ? 6.328   -34.014  -43.936 1.00 38.18 ? 150 ASP A OD1   1 
ATOM   1184  O  OD2   . ASP A  1 152 ? 8.096   -35.052  -43.064 1.00 35.99 ? 150 ASP A OD2   1 
ATOM   1185  N  N     . VAL A  1 153 ? 7.372   -30.137  -40.508 1.00 26.10 ? 151 VAL A N     1 
ATOM   1186  C  CA    . VAL A  1 153 ? 7.308   -29.364  -39.282 1.00 28.88 ? 151 VAL A CA    1 
ATOM   1187  C  C     . VAL A  1 153 ? 5.904   -28.830  -39.032 1.00 23.98 ? 151 VAL A C     1 
ATOM   1188  O  O     . VAL A  1 153 ? 5.458   -28.757  -37.885 1.00 25.00 ? 151 VAL A O     1 
ATOM   1189  C  CB    . VAL A  1 153 ? 8.347   -28.219  -39.267 1.00 29.58 ? 151 VAL A CB    1 
ATOM   1190  C  CG1   . VAL A  1 153 ? 8.040   -27.243  -40.389 1.00 29.97 ? 151 VAL A CG1   1 
ATOM   1191  C  CG2   . VAL A  1 153 ? 8.337   -27.494  -37.928 1.00 20.52 ? 151 VAL A CG2   1 
ATOM   1192  N  N     . VAL A  1 154 ? 5.198   -28.481  -40.103 1.00 25.10 ? 152 VAL A N     1 
ATOM   1193  C  CA    . VAL A  1 154 ? 3.870   -27.898  -39.933 1.00 24.62 ? 152 VAL A CA    1 
ATOM   1194  C  C     . VAL A  1 154 ? 2.761   -28.880  -39.607 1.00 22.53 ? 152 VAL A C     1 
ATOM   1195  O  O     . VAL A  1 154 ? 1.757   -28.450  -39.095 1.00 23.90 ? 152 VAL A O     1 
ATOM   1196  C  CB    . VAL A  1 154 ? 3.439   -27.025  -41.125 1.00 30.41 ? 152 VAL A CB    1 
ATOM   1197  C  CG1   . VAL A  1 154 ? 4.368   -25.782  -41.239 1.00 31.01 ? 152 VAL A CG1   1 
ATOM   1198  C  CG2   . VAL A  1 154 ? 3.455   -27.844  -42.405 1.00 23.42 ? 152 VAL A CG2   1 
ATOM   1199  N  N     . SER A  1 155 ? 2.957   -30.182  -39.854 1.00 21.72 ? 153 SER A N     1 
ATOM   1200  C  CA    . SER A  1 155 ? 1.866   -31.151  -39.751 1.00 19.99 ? 153 SER A CA    1 
ATOM   1201  C  C     . SER A  1 155 ? 2.025   -32.285  -38.734 1.00 16.47 ? 153 SER A C     1 
ATOM   1202  O  O     . SER A  1 155 ? 1.028   -32.907  -38.360 1.00 18.74 ? 153 SER A O     1 
ATOM   1203  C  CB    . SER A  1 155 ? 1.594   -31.784  -41.120 1.00 22.16 ? 153 SER A CB    1 
ATOM   1204  O  OG    . SER A  1 155 ? 2.758   -32.429  -41.602 1.00 21.95 ? 153 SER A OG    1 
ATOM   1205  N  N     . LEU A  1 156 ? 3.253   -32.567  -38.325 1.00 21.67 ? 154 LEU A N     1 
ATOM   1206  C  CA    . LEU A  1 156 ? 3.552   -33.689  -37.432 1.00 17.15 ? 154 LEU A CA    1 
ATOM   1207  C  C     . LEU A  1 156 ? 2.745   -33.681  -36.139 1.00 21.94 ? 154 LEU A C     1 
ATOM   1208  O  O     . LEU A  1 156 ? 2.404   -34.744  -35.597 1.00 18.43 ? 154 LEU A O     1 
ATOM   1209  C  CB    . LEU A  1 156 ? 5.054   -33.737  -37.106 1.00 15.45 ? 154 LEU A CB    1 
ATOM   1210  C  CG    . LEU A  1 156 ? 5.862   -34.461  -38.183 1.00 20.15 ? 154 LEU A CG    1 
ATOM   1211  C  CD1   . LEU A  1 156 ? 7.361   -34.343  -38.012 1.00 18.82 ? 154 LEU A CD1   1 
ATOM   1212  C  CD2   . LEU A  1 156 ? 5.439   -35.954  -38.242 1.00 14.49 ? 154 LEU A CD2   1 
ATOM   1213  N  N     . PHE A  1 157 ? 2.434   -32.488  -35.640 1.00 18.77 ? 155 PHE A N     1 
ATOM   1214  C  CA    . PHE A  1 157 ? 1.844   -32.403  -34.310 1.00 17.70 ? 155 PHE A CA    1 
ATOM   1215  C  C     . PHE A  1 157 ? 0.335   -32.318  -34.356 1.00 17.70 ? 155 PHE A C     1 
ATOM   1216  O  O     . PHE A  1 157 ? -0.298  -32.100  -33.324 1.00 16.58 ? 155 PHE A O     1 
ATOM   1217  C  CB    . PHE A  1 157 ? 2.415   -31.213  -33.522 1.00 16.00 ? 155 PHE A CB    1 
ATOM   1218  C  CG    . PHE A  1 157 ? 2.258   -29.899  -34.227 1.00 19.52 ? 155 PHE A CG    1 
ATOM   1219  C  CD1   . PHE A  1 157 ? 1.084   -29.136  -34.085 1.00 19.83 ? 155 PHE A CD1   1 
ATOM   1220  C  CD2   . PHE A  1 157 ? 3.288   -29.421  -35.065 1.00 20.47 ? 155 PHE A CD2   1 
ATOM   1221  C  CE1   . PHE A  1 157 ? 0.934   -27.891  -34.763 1.00 20.59 ? 155 PHE A CE1   1 
ATOM   1222  C  CE2   . PHE A  1 157 ? 3.166   -28.176  -35.734 1.00 20.20 ? 155 PHE A CE2   1 
ATOM   1223  C  CZ    . PHE A  1 157 ? 1.973   -27.418  -35.598 1.00 24.70 ? 155 PHE A CZ    1 
ATOM   1224  N  N     . HIS A  1 158 ? -0.248  -32.451  -35.546 1.00 15.07 ? 156 HIS A N     1 
ATOM   1225  C  CA    . HIS A  1 158 ? -1.709  -32.469  -35.656 1.00 18.20 ? 156 HIS A CA    1 
ATOM   1226  C  C     . HIS A  1 158 ? -2.231  -33.848  -35.363 1.00 15.28 ? 156 HIS A C     1 
ATOM   1227  O  O     . HIS A  1 158 ? -1.719  -34.860  -35.877 1.00 13.94 ? 156 HIS A O     1 
ATOM   1228  C  CB    . HIS A  1 158 ? -2.190  -32.020  -37.043 1.00 20.58 ? 156 HIS A CB    1 
ATOM   1229  C  CG    . HIS A  1 158 ? -1.827  -30.607  -37.364 1.00 18.29 ? 156 HIS A CG    1 
ATOM   1230  N  ND1   . HIS A  1 158 ? -1.499  -30.191  -38.644 1.00 19.56 ? 156 HIS A ND1   1 
ATOM   1231  C  CD2   . HIS A  1 158 ? -1.732  -29.510  -36.572 1.00 18.61 ? 156 HIS A CD2   1 
ATOM   1232  C  CE1   . HIS A  1 158 ? -1.213  -28.902  -38.623 1.00 20.34 ? 156 HIS A CE1   1 
ATOM   1233  N  NE2   . HIS A  1 158 ? -1.340  -28.459  -37.383 1.00 22.16 ? 156 HIS A NE2   1 
ATOM   1234  N  N     . THR A  1 159 ? -3.242  -33.880  -34.513 1.00 13.77 ? 157 THR A N     1 
ATOM   1235  C  CA    . THR A  1 159 ? -3.805  -35.124  -34.054 1.00 12.99 ? 157 THR A CA    1 
ATOM   1236  C  C     . THR A  1 159 ? -4.588  -35.786  -35.184 1.00 12.56 ? 157 THR A C     1 
ATOM   1237  O  O     . THR A  1 159 ? -5.472  -35.155  -35.788 1.00 17.54 ? 157 THR A O     1 
ATOM   1238  C  CB    . THR A  1 159 ? -4.750  -34.942  -32.852 1.00 12.71 ? 157 THR A CB    1 
ATOM   1239  O  OG1   . THR A  1 159 ? -4.152  -34.105  -31.843 1.00 18.79 ? 157 THR A OG1   1 
ATOM   1240  C  CG2   . THR A  1 159 ? -5.094  -36.334  -32.247 1.00 12.11 ? 157 THR A CG2   1 
ATOM   1241  N  N     . ARG A  1 160 ? -4.295  -37.067  -35.424 1.00 14.51 ? 158 ARG A N     1 
ATOM   1242  C  CA    . ARG A  1 160 ? -5.004  -37.889  -36.425 1.00 18.03 ? 158 ARG A CA    1 
ATOM   1243  C  C     . ARG A  1 160 ? -6.254  -38.534  -35.858 1.00 20.08 ? 158 ARG A C     1 
ATOM   1244  O  O     . ARG A  1 160 ? -6.242  -39.032  -34.741 1.00 18.53 ? 158 ARG A O     1 
ATOM   1245  C  CB    . ARG A  1 160 ? -4.123  -39.036  -36.920 1.00 20.90 ? 158 ARG A CB    1 
ATOM   1246  C  CG    . ARG A  1 160 ? -3.209  -38.702  -38.068 1.00 22.84 ? 158 ARG A CG    1 
ATOM   1247  C  CD    . ARG A  1 160 ? -2.263  -37.545  -37.838 1.00 20.74 ? 158 ARG A CD    1 
ATOM   1248  N  NE    . ARG A  1 160 ? -1.358  -37.421  -38.988 1.00 20.64 ? 158 ARG A NE    1 
ATOM   1249  C  CZ    . ARG A  1 160 ? -0.462  -36.462  -39.129 1.00 21.91 ? 158 ARG A CZ    1 
ATOM   1250  N  NH1   . ARG A  1 160 ? -0.376  -35.526  -38.193 1.00 19.13 ? 158 ARG A NH1   1 
ATOM   1251  N  NH2   . ARG A  1 160 ? 0.344   -36.448  -40.190 1.00 20.53 ? 158 ARG A NH2   1 
ATOM   1252  N  N     . ASN A  1 161 ? -7.305  -38.573  -36.667 1.00 16.72 ? 159 ASN A N     1 
ATOM   1253  C  CA    . ASN A  1 161 ? -8.562  -39.258  -36.341 1.00 18.13 ? 159 ASN A CA    1 
ATOM   1254  C  C     . ASN A  1 161 ? -8.398  -40.698  -35.868 1.00 15.39 ? 159 ASN A C     1 
ATOM   1255  O  O     . ASN A  1 161 ? -9.200  -41.220  -35.080 1.00 15.96 ? 159 ASN A O     1 
ATOM   1256  C  CB    . ASN A  1 161 ? -9.501  -39.235  -37.568 1.00 19.29 ? 159 ASN A CB    1 
ATOM   1257  C  CG    . ASN A  1 161 ? -10.595 -40.289  -37.479 1.00 25.53 ? 159 ASN A CG    1 
ATOM   1258  O  OD1   . ASN A  1 161 ? -11.715 -40.006  -37.032 1.00 27.75 ? 159 ASN A OD1   1 
ATOM   1259  N  ND2   . ASN A  1 161 ? -10.263 -41.523  -37.874 1.00 22.26 ? 159 ASN A ND2   1 
ATOM   1260  N  N     . TYR A  1 162 ? -7.371  -41.366  -36.357 1.00 17.43 ? 160 TYR A N     1 
ATOM   1261  C  CA    . TYR A  1 162 ? -7.292  -42.792  -36.070 1.00 15.69 ? 160 TYR A CA    1 
ATOM   1262  C  C     . TYR A  1 162 ? -7.091  -43.098  -34.597 1.00 21.04 ? 160 TYR A C     1 
ATOM   1263  O  O     . TYR A  1 162 ? -7.343  -44.237  -34.181 1.00 19.31 ? 160 TYR A O     1 
ATOM   1264  C  CB    . TYR A  1 162 ? -6.255  -43.537  -36.926 1.00 18.67 ? 160 TYR A CB    1 
ATOM   1265  C  CG    . TYR A  1 162 ? -4.791  -43.430  -36.441 1.00 17.59 ? 160 TYR A CG    1 
ATOM   1266  C  CD1   . TYR A  1 162 ? -4.301  -44.234  -35.413 1.00 18.26 ? 160 TYR A CD1   1 
ATOM   1267  C  CD2   . TYR A  1 162 ? -3.914  -42.563  -37.056 1.00 18.57 ? 160 TYR A CD2   1 
ATOM   1268  C  CE1   . TYR A  1 162 ? -2.972  -44.133  -34.982 1.00 19.12 ? 160 TYR A CE1   1 
ATOM   1269  C  CE2   . TYR A  1 162 ? -2.589  -42.458  -36.659 1.00 19.77 ? 160 TYR A CE2   1 
ATOM   1270  C  CZ    . TYR A  1 162 ? -2.120  -43.229  -35.623 1.00 20.15 ? 160 TYR A CZ    1 
ATOM   1271  O  OH    . TYR A  1 162 ? -0.795  -43.104  -35.263 1.00 20.88 ? 160 TYR A OH    1 
ATOM   1272  N  N     . VAL A  1 163 ? -6.672  -42.119  -33.787 1.00 12.98 ? 161 VAL A N     1 
ATOM   1273  C  CA    . VAL A  1 163 ? -6.411  -42.474  -32.403 1.00 14.91 ? 161 VAL A CA    1 
ATOM   1274  C  C     . VAL A  1 163 ? -7.725  -42.852  -31.763 1.00 16.03 ? 161 VAL A C     1 
ATOM   1275  O  O     . VAL A  1 163 ? -7.757  -43.624  -30.805 1.00 15.73 ? 161 VAL A O     1 
ATOM   1276  C  CB    . VAL A  1 163 ? -5.681  -41.355  -31.587 1.00 15.72 ? 161 VAL A CB    1 
ATOM   1277  C  CG1   . VAL A  1 163 ? -4.271  -41.030  -32.211 1.00 14.05 ? 161 VAL A CG1   1 
ATOM   1278  C  CG2   . VAL A  1 163 ? -6.560  -40.087  -31.466 1.00 15.92 ? 161 VAL A CG2   1 
ATOM   1279  N  N     . ILE A  1 164 ? -8.826  -42.325  -32.307 1.00 17.58 ? 162 ILE A N     1 
ATOM   1280  C  CA    . ILE A  1 164 ? -10.133 -42.633  -31.738 1.00 18.49 ? 162 ILE A CA    1 
ATOM   1281  C  C     . ILE A  1 164 ? -10.368 -44.139  -31.786 1.00 16.11 ? 162 ILE A C     1 
ATOM   1282  O  O     . ILE A  1 164 ? -10.783 -44.756  -30.807 1.00 16.37 ? 162 ILE A O     1 
ATOM   1283  C  CB    . ILE A  1 164 ? -11.286 -41.933  -32.493 1.00 20.34 ? 162 ILE A CB    1 
ATOM   1284  C  CG1   . ILE A  1 164 ? -11.193 -40.400  -32.355 1.00 21.50 ? 162 ILE A CG1   1 
ATOM   1285  C  CG2   . ILE A  1 164 ? -12.644 -42.385  -31.917 1.00 19.82 ? 162 ILE A CG2   1 
ATOM   1286  C  CD1   . ILE A  1 164 ? -12.163 -39.657  -33.292 1.00 22.50 ? 162 ILE A CD1   1 
ATOM   1287  N  N     . GLN A  1 165 ? -10.137 -44.729  -32.940 1.00 14.77 ? 163 GLN A N     1 
ATOM   1288  C  CA    . GLN A  1 165 ? -10.238 -46.175  -33.043 1.00 18.19 ? 163 GLN A CA    1 
ATOM   1289  C  C     . GLN A  1 165 ? -9.231  -46.938  -32.174 1.00 20.58 ? 163 GLN A C     1 
ATOM   1290  O  O     . GLN A  1 165 ? -9.550  -48.020  -31.674 1.00 18.16 ? 163 GLN A O     1 
ATOM   1291  C  CB    . GLN A  1 165 ? -10.183 -46.632  -34.491 1.00 23.84 ? 163 GLN A CB    1 
ATOM   1292  C  CG    . GLN A  1 165 ? -11.477 -46.265  -35.252 1.00 27.33 ? 163 GLN A CG    1 
ATOM   1293  C  CD    . GLN A  1 165 ? -11.589 -44.770  -35.476 1.00 25.57 ? 163 GLN A CD    1 
ATOM   1294  O  OE1   . GLN A  1 165 ? -10.746 -44.172  -36.163 1.00 26.75 ? 163 GLN A OE1   1 
ATOM   1295  N  NE2   . GLN A  1 165 ? -12.621 -44.148  -34.889 1.00 24.84 ? 163 GLN A NE2   1 
ATOM   1296  N  N     . MET A  1 166 ? -8.047  -46.369  -31.942 1.00 17.08 ? 164 MET A N     1 
ATOM   1297  C  CA    . MET A  1 166 ? -7.030  -47.110  -31.167 1.00 17.60 ? 164 MET A CA    1 
ATOM   1298  C  C     . MET A  1 166 ? -7.364  -47.157  -29.681 1.00 18.37 ? 164 MET A C     1 
ATOM   1299  O  O     . MET A  1 166 ? -6.959  -48.079  -28.983 1.00 22.84 ? 164 MET A O     1 
ATOM   1300  C  CB    . MET A  1 166 ? -5.663  -46.470  -31.337 1.00 18.42 ? 164 MET A CB    1 
ATOM   1301  C  CG    . MET A  1 166 ? -5.108  -46.511  -32.740 1.00 21.03 ? 164 MET A CG    1 
ATOM   1302  S  SD    . MET A  1 166 ? -4.607  -48.200  -33.208 1.00 21.57 ? 164 MET A SD    1 
ATOM   1303  C  CE    . MET A  1 166 ? -3.158  -48.417  -32.158 1.00 22.74 ? 164 MET A CE    1 
ATOM   1304  N  N     . LEU A  1 167 ? -8.123  -46.168  -29.200 1.00 15.10 ? 165 LEU A N     1 
ATOM   1305  C  CA    . LEU A  1 167 ? -8.281  -45.954  -27.775 1.00 16.53 ? 165 LEU A CA    1 
ATOM   1306  C  C     . LEU A  1 167 ? -9.656  -46.409  -27.298 1.00 16.70 ? 165 LEU A C     1 
ATOM   1307  O  O     . LEU A  1 167 ? -9.862  -46.707  -26.116 1.00 16.84 ? 165 LEU A O     1 
ATOM   1308  C  CB    . LEU A  1 167 ? -8.131  -44.450  -27.480 1.00 14.07 ? 165 LEU A CB    1 
ATOM   1309  C  CG    . LEU A  1 167 ? -6.740  -43.853  -27.667 1.00 13.85 ? 165 LEU A CG    1 
ATOM   1310  C  CD1   . LEU A  1 167 ? -6.760  -42.340  -27.306 1.00 16.79 ? 165 LEU A CD1   1 
ATOM   1311  C  CD2   . LEU A  1 167 ? -5.718  -44.566  -26.788 1.00 16.13 ? 165 LEU A CD2   1 
ATOM   1312  N  N     . SER A  1 168 ? -10.612 -46.437  -28.228 1.00 17.36 ? 166 SER A N     1 
ATOM   1313  C  CA    . SER A  1 168 ? -12.029 -46.494  -27.868 1.00 17.45 ? 166 SER A CA    1 
ATOM   1314  C  C     . SER A  1 168 ? -12.456 -47.729  -27.069 1.00 16.06 ? 166 SER A C     1 
ATOM   1315  O  O     . SER A  1 168 ? -13.408 -47.654  -26.296 1.00 22.51 ? 166 SER A O     1 
ATOM   1316  C  CB    . SER A  1 168 ? -12.893 -46.393  -29.121 1.00 20.74 ? 166 SER A CB    1 
ATOM   1317  O  OG    . SER A  1 168 ? -12.645 -47.522  -29.919 1.00 27.96 ? 166 SER A OG    1 
ATOM   1318  N  N     . ASN A  1 169 ? -11.785 -48.864  -27.248 1.00 19.31 ? 167 ASN A N     1 
ATOM   1319  C  CA    . ASN A  1 169 ? -12.143 -50.058  -26.452 1.00 15.04 ? 167 ASN A CA    1 
ATOM   1320  C  C     . ASN A  1 169 ? -11.477 -50.155  -25.067 1.00 22.35 ? 167 ASN A C     1 
ATOM   1321  O  O     . ASN A  1 169 ? -11.736 -51.121  -24.335 1.00 25.36 ? 167 ASN A O     1 
ATOM   1322  C  CB    . ASN A  1 169 ? -11.840 -51.346  -27.216 1.00 19.70 ? 167 ASN A CB    1 
ATOM   1323  C  CG    . ASN A  1 169 ? -10.310 -51.640  -27.322 1.00 22.83 ? 167 ASN A CG    1 
ATOM   1324  O  OD1   . ASN A  1 169 ? -9.481  -51.053  -26.591 1.00 21.04 ? 167 ASN A OD1   1 
ATOM   1325  N  ND2   . ASN A  1 169 ? -9.944  -52.528  -28.262 1.00 17.09 ? 167 ASN A ND2   1 
ATOM   1326  N  N     . LEU A  1 170 ? -10.628 -49.181  -24.699 1.00 21.01 ? 168 LEU A N     1 
ATOM   1327  C  CA    . LEU A  1 170 ? -9.769  -49.341  -23.519 1.00 17.02 ? 168 LEU A CA    1 
ATOM   1328  C  C     . LEU A  1 170 ? -10.496 -49.361  -22.165 1.00 20.34 ? 168 LEU A C     1 
ATOM   1329  O  O     . LEU A  1 170 ? -9.907  -49.767  -21.183 1.00 14.62 ? 168 LEU A O     1 
ATOM   1330  C  CB    . LEU A  1 170 ? -8.610  -48.305  -23.493 1.00 17.19 ? 168 LEU A CB    1 
ATOM   1331  C  CG    . LEU A  1 170 ? -7.521  -48.418  -24.555 1.00 16.83 ? 168 LEU A CG    1 
ATOM   1332  C  CD1   . LEU A  1 170 ? -6.523  -47.210  -24.594 1.00 17.21 ? 168 LEU A CD1   1 
ATOM   1333  C  CD2   . LEU A  1 170 ? -6.709  -49.758  -24.327 1.00 18.38 ? 168 LEU A CD2   1 
ATOM   1334  N  N     . SER A  1 171 ? -11.766 -48.943  -22.096 1.00 18.97 ? 169 SER A N     1 
ATOM   1335  C  CA    . SER A  1 171 ? -12.506 -49.006  -20.816 1.00 22.60 ? 169 SER A CA    1 
ATOM   1336  C  C     . SER A  1 171 ? -13.412 -50.219  -20.713 1.00 26.30 ? 169 SER A C     1 
ATOM   1337  O  O     . SER A  1 171 ? -14.297 -50.259  -19.847 1.00 24.03 ? 169 SER A O     1 
ATOM   1338  C  CB    . SER A  1 171 ? -13.344 -47.746  -20.572 1.00 18.29 ? 169 SER A CB    1 
ATOM   1339  O  OG    . SER A  1 171 ? -14.204 -47.523  -21.665 1.00 23.52 ? 169 SER A OG    1 
ATOM   1340  N  N     . GLN A  1 172 ? -13.199 -51.203  -21.583 1.00 22.33 ? 170 GLN A N     1 
ATOM   1341  C  CA    . GLN A  1 172 ? -14.052 -52.389  -21.567 1.00 23.60 ? 170 GLN A CA    1 
ATOM   1342  C  C     . GLN A  1 172 ? -13.867 -53.185  -20.292 1.00 28.30 ? 170 GLN A C     1 
ATOM   1343  O  O     . GLN A  1 172 ? -14.861 -53.579  -19.673 1.00 26.36 ? 170 GLN A O     1 
ATOM   1344  C  CB    . GLN A  1 172 ? -13.841 -53.256  -22.807 1.00 29.09 ? 170 GLN A CB    1 
ATOM   1345  C  CG    . GLN A  1 172 ? -14.388 -52.592  -24.074 1.00 34.39 ? 170 GLN A CG    1 
ATOM   1346  C  CD    . GLN A  1 172 ? -15.875 -52.158  -23.942 1.00 37.80 ? 170 GLN A CD    1 
ATOM   1347  O  OE1   . GLN A  1 172 ? -16.213 -50.963  -24.049 1.00 36.68 ? 170 GLN A OE1   1 
ATOM   1348  N  NE2   . GLN A  1 172 ? -16.758 -53.134  -23.710 1.00 38.98 ? 170 GLN A NE2   1 
ATOM   1349  N  N     . SER A  1 173 ? -12.609 -53.371  -19.870 1.00 26.86 ? 171 SER A N     1 
ATOM   1350  C  CA    . SER A  1 173 ? -12.300 -54.251  -18.741 1.00 22.46 ? 171 SER A CA    1 
ATOM   1351  C  C     . SER A  1 173 ? -12.154 -53.566  -17.403 1.00 20.31 ? 171 SER A C     1 
ATOM   1352  O  O     . SER A  1 173 ? -12.442 -54.154  -16.375 1.00 24.96 ? 171 SER A O     1 
ATOM   1353  C  CB    . SER A  1 173 ? -11.082 -55.124  -19.039 1.00 29.94 ? 171 SER A CB    1 
ATOM   1354  O  OG    . SER A  1 173 ? -11.430 -56.077  -20.029 1.00 31.32 ? 171 SER A OG    1 
ATOM   1355  N  N     . SER A  1 174 ? -11.748 -52.307  -17.403 1.00 18.86 ? 172 SER A N     1 
ATOM   1356  C  CA    . SER A  1 174 ? -11.780 -51.569  -16.161 1.00 21.32 ? 172 SER A CA    1 
ATOM   1357  C  C     . SER A  1 174 ? -11.851 -50.090  -16.524 1.00 20.95 ? 172 SER A C     1 
ATOM   1358  O  O     . SER A  1 174 ? -11.784 -49.719  -17.696 1.00 21.03 ? 172 SER A O     1 
ATOM   1359  C  CB    . SER A  1 174 ? -10.540 -51.884  -15.335 1.00 25.47 ? 172 SER A CB    1 
ATOM   1360  O  OG    . SER A  1 174 ? -9.434  -51.375  -16.035 1.00 22.35 ? 172 SER A OG    1 
ATOM   1361  N  N     . GLN A  1 175 ? -12.000 -49.227  -15.546 1.00 20.49 ? 173 GLN A N     1 
ATOM   1362  C  CA    . GLN A  1 175 ? -12.168 -47.839  -15.927 1.00 25.32 ? 173 GLN A CA    1 
ATOM   1363  C  C     . GLN A  1 175 ? -10.802 -47.190  -16.219 1.00 27.21 ? 173 GLN A C     1 
ATOM   1364  O  O     . GLN A  1 175 ? -9.734  -47.741  -15.880 1.00 21.48 ? 173 GLN A O     1 
ATOM   1365  C  CB    . GLN A  1 175 ? -12.895 -47.087  -14.825 1.00 21.44 ? 173 GLN A CB    1 
ATOM   1366  C  CG    . GLN A  1 175 ? -11.971 -46.654  -13.736 1.00 28.23 ? 173 GLN A CG    1 
ATOM   1367  C  CD    . GLN A  1 175 ? -12.744 -46.227  -12.503 1.00 41.75 ? 173 GLN A CD    1 
ATOM   1368  O  OE1   . GLN A  1 175 ? -13.983 -46.116  -12.538 1.00 39.99 ? 173 GLN A OE1   1 
ATOM   1369  N  NE2   . GLN A  1 175 ? -12.027 -45.990  -11.400 1.00 42.39 ? 173 GLN A NE2   1 
ATOM   1370  N  N     . ILE A  1 176 ? -10.852 -46.022  -16.849 1.00 19.84 ? 174 ILE A N     1 
ATOM   1371  C  CA    . ILE A  1 176 ? -9.687  -45.177  -17.015 1.00 16.84 ? 174 ILE A CA    1 
ATOM   1372  C  C     . ILE A  1 176 ? -9.601  -44.077  -15.943 1.00 21.88 ? 174 ILE A C     1 
ATOM   1373  O  O     . ILE A  1 176 ? -10.509 -43.244  -15.842 1.00 16.32 ? 174 ILE A O     1 
ATOM   1374  C  CB    . ILE A  1 176 ? -9.689  -44.511  -18.423 1.00 22.64 ? 174 ILE A CB    1 
ATOM   1375  C  CG1   . ILE A  1 176 ? -9.721  -45.578  -19.525 1.00 13.08 ? 174 ILE A CG1   1 
ATOM   1376  C  CG2   . ILE A  1 176 ? -8.458  -43.581  -18.591 1.00 17.00 ? 174 ILE A CG2   1 
ATOM   1377  C  CD1   . ILE A  1 176 ? -8.482  -46.500  -19.510 1.00 20.69 ? 174 ILE A CD1   1 
ATOM   1378  N  N     . ASP A  1 177 ? -8.499  -44.029  -15.175 1.00 13.97 ? 175 ASP A N     1 
ATOM   1379  C  CA    . ASP A  1 177 ? -8.422  -43.029  -14.096 1.00 20.32 ? 175 ASP A CA    1 
ATOM   1380  C  C     . ASP A  1 177 ? -8.199  -41.614  -14.587 1.00 17.42 ? 175 ASP A C     1 
ATOM   1381  O  O     . ASP A  1 177 ? -8.895  -40.683  -14.162 1.00 17.84 ? 175 ASP A O     1 
ATOM   1382  C  CB    . ASP A  1 177 ? -7.374  -43.423  -13.069 1.00 21.50 ? 175 ASP A CB    1 
ATOM   1383  C  CG    . ASP A  1 177 ? -7.658  -44.785  -12.480 1.00 22.51 ? 175 ASP A CG    1 
ATOM   1384  O  OD1   . ASP A  1 177 ? -8.422  -44.824  -11.483 1.00 24.89 ? 175 ASP A OD1   1 
ATOM   1385  O  OD2   . ASP A  1 177 ? -7.148  -45.797  -13.042 1.00 18.72 ? 175 ASP A OD2   1 
ATOM   1386  N  N     . ILE A  1 178 ? -7.241  -41.452  -15.498 1.00 20.37 ? 176 ILE A N     1 
ATOM   1387  C  CA    . ILE A  1 178 ? -6.878  -40.124  -15.991 1.00 18.93 ? 176 ILE A CA    1 
ATOM   1388  C  C     . ILE A  1 178 ? -6.652  -40.203  -17.480 1.00 17.91 ? 176 ILE A C     1 
ATOM   1389  O  O     . ILE A  1 178 ? -6.032  -41.159  -17.983 1.00 17.22 ? 176 ILE A O     1 
ATOM   1390  C  CB    . ILE A  1 178 ? -5.551  -39.678  -15.358 1.00 21.24 ? 176 ILE A CB    1 
ATOM   1391  C  CG1   . ILE A  1 178 ? -5.671  -39.705  -13.836 1.00 24.21 ? 176 ILE A CG1   1 
ATOM   1392  C  CG2   . ILE A  1 178 ? -5.071  -38.282  -15.900 1.00 16.69 ? 176 ILE A CG2   1 
ATOM   1393  C  CD1   . ILE A  1 178 ? -4.325  -39.528  -13.139 1.00 14.71 ? 176 ILE A CD1   1 
ATOM   1394  N  N     . SER A  1 179 ? -7.130  -39.204  -18.198 1.00 16.46 ? 177 SER A N     1 
ATOM   1395  C  CA    . SER A  1 179 ? -6.746  -39.071  -19.603 1.00 15.13 ? 177 SER A CA    1 
ATOM   1396  C  C     . SER A  1 179 ? -6.156  -37.678  -19.829 1.00 15.85 ? 177 SER A C     1 
ATOM   1397  O  O     . SER A  1 179 ? -6.526  -36.711  -19.152 1.00 18.95 ? 177 SER A O     1 
ATOM   1398  C  CB    . SER A  1 179 ? -7.923  -39.417  -20.526 1.00 18.87 ? 177 SER A CB    1 
ATOM   1399  O  OG    . SER A  1 179 ? -7.571  -39.201  -21.888 1.00 22.93 ? 177 SER A OG    1 
ATOM   1400  N  N     . LEU A  1 180 ? -5.170  -37.600  -20.725 1.00 17.42 ? 178 LEU A N     1 
ATOM   1401  C  CA    . LEU A  1 180 ? -4.378  -36.387  -20.937 1.00 15.59 ? 178 LEU A CA    1 
ATOM   1402  C  C     . LEU A  1 180 ? -4.503  -35.981  -22.397 1.00 18.19 ? 178 LEU A C     1 
ATOM   1403  O  O     . LEU A  1 180 ? -4.459  -36.827  -23.299 1.00 14.47 ? 178 LEU A O     1 
ATOM   1404  C  CB    . LEU A  1 180 ? -2.896  -36.673  -20.716 1.00 14.88 ? 178 LEU A CB    1 
ATOM   1405  C  CG    . LEU A  1 180 ? -2.305  -36.857  -19.329 1.00 22.40 ? 178 LEU A CG    1 
ATOM   1406  C  CD1   . LEU A  1 180 ? -3.257  -37.286  -18.255 1.00 20.88 ? 178 LEU A CD1   1 
ATOM   1407  C  CD2   . LEU A  1 180 ? -1.141  -37.848  -19.405 1.00 17.45 ? 178 LEU A CD2   1 
ATOM   1408  N  N     . SER A  1 181 ? -4.622  -34.682  -22.661 1.00 15.92 ? 179 SER A N     1 
ATOM   1409  C  CA    . SER A  1 181 ? -4.566  -34.219  -24.040 1.00 13.44 ? 179 SER A CA    1 
ATOM   1410  C  C     . SER A  1 181 ? -3.985  -32.814  -24.006 1.00 14.97 ? 179 SER A C     1 
ATOM   1411  O  O     . SER A  1 181 ? -3.816  -32.235  -22.927 1.00 15.59 ? 179 SER A O     1 
ATOM   1412  C  CB    . SER A  1 181 ? -5.944  -34.207  -24.691 1.00 15.52 ? 179 SER A CB    1 
ATOM   1413  O  OG    . SER A  1 181 ? -6.720  -33.174  -24.152 1.00 15.70 ? 179 SER A OG    1 
ATOM   1414  N  N     . HIS A  1 182 ? -3.671  -32.288  -25.183 1.00 15.06 ? 180 HIS A N     1 
ATOM   1415  C  CA    . HIS A  1 182 ? -3.157  -30.940  -25.257 1.00 13.79 ? 180 HIS A CA    1 
ATOM   1416  C  C     . HIS A  1 182 ? -4.306  -29.953  -25.454 1.00 15.84 ? 180 HIS A C     1 
ATOM   1417  O  O     . HIS A  1 182 ? -4.655  -29.271  -24.508 1.00 16.97 ? 180 HIS A O     1 
ATOM   1418  C  CB    . HIS A  1 182 ? -2.020  -30.793  -26.273 1.00 15.54 ? 180 HIS A CB    1 
ATOM   1419  C  CG    . HIS A  1 182 ? -1.300  -29.479  -26.118 1.00 11.04 ? 180 HIS A CG    1 
ATOM   1420  N  ND1   . HIS A  1 182 ? -0.660  -29.151  -24.962 1.00 12.39 ? 180 HIS A ND1   1 
ATOM   1421  C  CD2   . HIS A  1 182 ? -1.250  -28.404  -26.934 1.00 14.14 ? 180 HIS A CD2   1 
ATOM   1422  C  CE1   . HIS A  1 182 ? -0.152  -27.919  -25.090 1.00 16.11 ? 180 HIS A CE1   1 
ATOM   1423  N  NE2   . HIS A  1 182 ? -0.515  -27.446  -26.249 1.00 17.17 ? 180 HIS A NE2   1 
ATOM   1424  N  N     . ASP A  1 183 ? -4.945  -29.915  -26.625 1.00 13.44 ? 181 ASP A N     1 
ATOM   1425  C  CA    . ASP A  1 183 ? -6.079  -29.021  -26.737 1.00 12.55 ? 181 ASP A CA    1 
ATOM   1426  C  C     . ASP A  1 183 ? -7.257  -29.642  -25.992 1.00 17.05 ? 181 ASP A C     1 
ATOM   1427  O  O     . ASP A  1 183 ? -7.256  -30.868  -25.686 1.00 17.47 ? 181 ASP A O     1 
ATOM   1428  C  CB    . ASP A  1 183 ? -6.432  -28.612  -28.182 1.00 16.34 ? 181 ASP A CB    1 
ATOM   1429  C  CG    . ASP A  1 183 ? -6.498  -29.785  -29.149 1.00 19.35 ? 181 ASP A CG    1 
ATOM   1430  O  OD1   . ASP A  1 183 ? -6.304  -30.951  -28.742 1.00 15.15 ? 181 ASP A OD1   1 
ATOM   1431  O  OD2   . ASP A  1 183 ? -6.801  -29.540  -30.337 1.00 19.31 ? 181 ASP A OD2   1 
ATOM   1432  N  N     . TRP A  1 184 ? -8.229  -28.798  -25.644 1.00 14.74 ? 182 TRP A N     1 
ATOM   1433  C  CA    . TRP A  1 184 ? -9.381  -29.217  -24.840 1.00 16.15 ? 182 TRP A CA    1 
ATOM   1434  C  C     . TRP A  1 184 ? -10.335 -30.095  -25.621 1.00 17.00 ? 182 TRP A C     1 
ATOM   1435  O  O     . TRP A  1 184 ? -10.506 -29.913  -26.827 1.00 18.20 ? 182 TRP A O     1 
ATOM   1436  C  CB    . TRP A  1 184 ? -10.168 -27.986  -24.402 1.00 14.83 ? 182 TRP A CB    1 
ATOM   1437  C  CG    . TRP A  1 184 ? -9.434  -27.100  -23.491 1.00 20.28 ? 182 TRP A CG    1 
ATOM   1438  C  CD1   . TRP A  1 184 ? -8.084  -27.139  -23.186 1.00 19.73 ? 182 TRP A CD1   1 
ATOM   1439  C  CD2   . TRP A  1 184 ? -9.991  -26.025  -22.735 1.00 16.91 ? 182 TRP A CD2   1 
ATOM   1440  N  NE1   . TRP A  1 184 ? -7.788  -26.135  -22.288 1.00 18.54 ? 182 TRP A NE1   1 
ATOM   1441  C  CE2   . TRP A  1 184 ? -8.945  -25.449  -21.976 1.00 21.38 ? 182 TRP A CE2   1 
ATOM   1442  C  CE3   . TRP A  1 184 ? -11.285 -25.493  -22.614 1.00 18.89 ? 182 TRP A CE3   1 
ATOM   1443  C  CZ2   . TRP A  1 184 ? -9.146  -24.346  -21.119 1.00 28.60 ? 182 TRP A CZ2   1 
ATOM   1444  C  CZ3   . TRP A  1 184 ? -11.498 -24.418  -21.746 1.00 18.30 ? 182 TRP A CZ3   1 
ATOM   1445  C  CH2   . TRP A  1 184 ? -10.432 -23.851  -21.016 1.00 25.05 ? 182 TRP A CH2   1 
ATOM   1446  N  N     . PRO A  1 185 ? -10.994 -31.045  -24.929 1.00 17.96 ? 183 PRO A N     1 
ATOM   1447  C  CA    . PRO A  1 185 ? -12.146 -31.748  -25.551 1.00 20.82 ? 183 PRO A CA    1 
ATOM   1448  C  C     . PRO A  1 185 ? -13.212 -30.714  -26.012 1.00 15.68 ? 183 PRO A C     1 
ATOM   1449  O  O     . PRO A  1 185 ? -13.595 -29.823  -25.237 1.00 15.61 ? 183 PRO A O     1 
ATOM   1450  C  CB    . PRO A  1 185 ? -12.692 -32.613  -24.400 1.00 18.59 ? 183 PRO A CB    1 
ATOM   1451  C  CG    . PRO A  1 185 ? -11.395 -32.861  -23.499 1.00 17.88 ? 183 PRO A CG    1 
ATOM   1452  C  CD    . PRO A  1 185 ? -10.725 -31.485  -23.544 1.00 13.53 ? 183 PRO A CD    1 
ATOM   1453  N  N     . GLN A  1 186 ? -13.628 -30.800  -27.271 1.00 16.47 ? 184 GLN A N     1 
ATOM   1454  C  CA    . GLN A  1 186 ? -14.464 -29.768  -27.874 1.00 19.00 ? 184 GLN A CA    1 
ATOM   1455  C  C     . GLN A  1 186 ? -15.761 -29.675  -27.052 1.00 22.51 ? 184 GLN A C     1 
ATOM   1456  O  O     . GLN A  1 186 ? -16.297 -30.698  -26.624 1.00 22.16 ? 184 GLN A O     1 
ATOM   1457  C  CB    . GLN A  1 186 ? -14.771 -30.095  -29.346 1.00 21.71 ? 184 GLN A CB    1 
ATOM   1458  C  CG    . GLN A  1 186 ? -15.550 -28.943  -30.107 1.00 19.46 ? 184 GLN A CG    1 
ATOM   1459  C  CD    . GLN A  1 186 ? -15.705 -29.240  -31.620 1.00 19.15 ? 184 GLN A CD    1 
ATOM   1460  O  OE1   . GLN A  1 186 ? -16.092 -30.348  -32.005 1.00 20.56 ? 184 GLN A OE1   1 
ATOM   1461  N  NE2   . GLN A  1 186 ? -15.348 -28.271  -32.467 1.00 17.24 ? 184 GLN A NE2   1 
ATOM   1462  N  N     . GLY A  1 187 ? -16.232 -28.462  -26.772 1.00 18.96 ? 185 GLY A N     1 
ATOM   1463  C  CA    . GLY A  1 187 ? -17.485 -28.299  -26.044 1.00 20.37 ? 185 GLY A CA    1 
ATOM   1464  C  C     . GLY A  1 187 ? -17.355 -28.213  -24.528 1.00 24.66 ? 185 GLY A C     1 
ATOM   1465  O  O     . GLY A  1 187 ? -18.208 -27.623  -23.857 1.00 22.18 ? 185 GLY A O     1 
ATOM   1466  N  N     . ILE A  1 188 ? -16.286 -28.783  -23.966 1.00 17.99 ? 186 ILE A N     1 
ATOM   1467  C  CA    . ILE A  1 188 ? -16.198 -28.869  -22.513 1.00 21.60 ? 186 ILE A CA    1 
ATOM   1468  C  C     . ILE A  1 188 ? -16.125 -27.490  -21.860 1.00 21.25 ? 186 ILE A C     1 
ATOM   1469  O  O     . ILE A  1 188 ? -16.480 -27.325  -20.668 1.00 21.27 ? 186 ILE A O     1 
ATOM   1470  C  CB    . ILE A  1 188 ? -14.983 -29.758  -22.056 1.00 25.39 ? 186 ILE A CB    1 
ATOM   1471  C  CG1   . ILE A  1 188 ? -15.176 -30.241  -20.620 1.00 28.51 ? 186 ILE A CG1   1 
ATOM   1472  C  CG2   . ILE A  1 188 ? -13.642 -29.017  -22.211 1.00 14.69 ? 186 ILE A CG2   1 
ATOM   1473  C  CD1   . ILE A  1 188 ? -15.730 -31.640  -20.567 1.00 27.75 ? 186 ILE A CD1   1 
ATOM   1474  N  N     . VAL A  1 189 ? -15.694 -26.491  -22.638 1.00 18.47 ? 187 VAL A N     1 
ATOM   1475  C  CA    . VAL A  1 189 ? -15.683 -25.104  -22.148 1.00 22.96 ? 187 VAL A CA    1 
ATOM   1476  C  C     . VAL A  1 189 ? -17.067 -24.692  -21.613 1.00 23.57 ? 187 VAL A C     1 
ATOM   1477  O  O     . VAL A  1 189 ? -17.188 -23.916  -20.654 1.00 18.03 ? 187 VAL A O     1 
ATOM   1478  C  CB    . VAL A  1 189 ? -15.158 -24.112  -23.228 1.00 21.80 ? 187 VAL A CB    1 
ATOM   1479  C  CG1   . VAL A  1 189 ? -16.056 -24.091  -24.442 1.00 22.14 ? 187 VAL A CG1   1 
ATOM   1480  C  CG2   . VAL A  1 189 ? -14.981 -22.696  -22.660 1.00 22.42 ? 187 VAL A CG2   1 
ATOM   1481  N  N     . MET A  1 190 ? -18.107 -25.237  -22.226 1.00 19.32 ? 188 MET A N     1 
ATOM   1482  C  CA    . MET A  1 190 ? -19.486 -24.909  -21.818 1.00 26.26 ? 188 MET A CA    1 
ATOM   1483  C  C     . MET A  1 190 ? -19.877 -25.558  -20.488 1.00 23.82 ? 188 MET A C     1 
ATOM   1484  O  O     . MET A  1 190 ? -20.886 -25.217  -19.903 1.00 24.80 ? 188 MET A O     1 
ATOM   1485  C  CB    . MET A  1 190 ? -20.494 -25.292  -22.922 1.00 22.32 ? 188 MET A CB    1 
ATOM   1486  C  CG    . MET A  1 190 ? -20.185 -24.643  -24.267 1.00 24.21 ? 188 MET A CG    1 
ATOM   1487  S  SD    . MET A  1 190 ? -19.747 -22.876  -24.123 1.00 27.97 ? 188 MET A SD    1 
ATOM   1488  C  CE    . MET A  1 190 ? -21.293 -22.261  -23.398 1.00 27.31 ? 188 MET A CE    1 
ATOM   1489  N  N     . LYS A  1 191 ? -19.043 -26.470  -19.991 1.00 25.07 ? 189 LYS A N     1 
ATOM   1490  C  CA    . LYS A  1 191 ? -19.438 -27.311  -18.860 1.00 21.42 ? 189 LYS A CA    1 
ATOM   1491  C  C     . LYS A  1 191 ? -18.857 -26.843  -17.499 1.00 26.25 ? 189 LYS A C     1 
ATOM   1492  O  O     . LYS A  1 191 ? -18.914 -27.591  -16.513 1.00 32.09 ? 189 LYS A O     1 
ATOM   1493  C  CB    . LYS A  1 191 ? -19.066 -28.773  -19.142 1.00 23.00 ? 189 LYS A CB    1 
ATOM   1494  C  CG    . LYS A  1 191 ? -19.944 -29.442  -20.222 1.00 28.31 ? 189 LYS A CG    1 
ATOM   1495  C  CD    . LYS A  1 191 ? -21.417 -29.343  -19.841 1.00 28.79 ? 189 LYS A CD    1 
ATOM   1496  C  CE    . LYS A  1 191 ? -22.231 -30.520  -20.382 1.00 40.06 ? 189 LYS A CE    1 
ATOM   1497  N  NZ    . LYS A  1 191 ? -22.142 -30.570  -21.869 1.00 43.56 ? 189 LYS A NZ    1 
ATOM   1498  N  N     . GLY A  1 192 ? -18.294 -25.630  -17.470 1.00 27.58 ? 190 GLY A N     1 
ATOM   1499  C  CA    . GLY A  1 192 ? -17.811 -24.990  -16.252 1.00 22.19 ? 190 GLY A CA    1 
ATOM   1500  C  C     . GLY A  1 192 ? -18.323 -23.563  -16.192 1.00 28.37 ? 190 GLY A C     1 
ATOM   1501  O  O     . GLY A  1 192 ? -19.272 -23.214  -16.910 1.00 32.32 ? 190 GLY A O     1 
ATOM   1502  N  N     . ASN A  1 193 ? -17.711 -22.735  -15.346 1.00 30.30 ? 191 ASN A N     1 
ATOM   1503  C  CA    . ASN A  1 193 ? -18.059 -21.318  -15.260 1.00 30.59 ? 191 ASN A CA    1 
ATOM   1504  C  C     . ASN A  1 193 ? -17.457 -20.536  -16.434 1.00 28.26 ? 191 ASN A C     1 
ATOM   1505  O  O     . ASN A  1 193 ? -16.432 -19.852  -16.305 1.00 32.53 ? 191 ASN A O     1 
ATOM   1506  C  CB    . ASN A  1 193 ? -17.578 -20.744  -13.928 1.00 32.09 ? 191 ASN A CB    1 
ATOM   1507  C  CG    . ASN A  1 193 ? -18.229 -19.407  -13.589 1.00 34.98 ? 191 ASN A CG    1 
ATOM   1508  O  OD1   . ASN A  1 193 ? -18.670 -18.667  -14.478 1.00 34.36 ? 191 ASN A OD1   1 
ATOM   1509  N  ND2   . ASN A  1 193 ? -18.282 -19.089  -12.293 1.00 33.02 ? 191 ASN A ND2   1 
ATOM   1510  N  N     . TYR A  1 194 ? -18.101 -20.634  -17.588 1.00 26.77 ? 192 TYR A N     1 
ATOM   1511  C  CA    . TYR A  1 194 ? -17.542 -20.048  -18.802 1.00 25.20 ? 192 TYR A CA    1 
ATOM   1512  C  C     . TYR A  1 194 ? -17.553 -18.520  -18.817 1.00 28.97 ? 192 TYR A C     1 
ATOM   1513  O  O     . TYR A  1 194 ? -16.672 -17.901  -19.416 1.00 29.91 ? 192 TYR A O     1 
ATOM   1514  C  CB    . TYR A  1 194 ? -18.207 -20.616  -20.059 1.00 28.53 ? 192 TYR A CB    1 
ATOM   1515  C  CG    . TYR A  1 194 ? -19.732 -20.616  -20.064 1.00 25.41 ? 192 TYR A CG    1 
ATOM   1516  C  CD1   . TYR A  1 194 ? -20.445 -19.517  -20.543 1.00 28.22 ? 192 TYR A CD1   1 
ATOM   1517  C  CD2   . TYR A  1 194 ? -20.449 -21.731  -19.629 1.00 32.83 ? 192 TYR A CD2   1 
ATOM   1518  C  CE1   . TYR A  1 194 ? -21.841 -19.521  -20.569 1.00 33.58 ? 192 TYR A CE1   1 
ATOM   1519  C  CE2   . TYR A  1 194 ? -21.853 -21.748  -19.643 1.00 32.84 ? 192 TYR A CE2   1 
ATOM   1520  C  CZ    . TYR A  1 194 ? -22.536 -20.631  -20.120 1.00 32.28 ? 192 TYR A CZ    1 
ATOM   1521  O  OH    . TYR A  1 194 ? -23.911 -20.627  -20.153 1.00 33.04 ? 192 TYR A OH    1 
ATOM   1522  N  N     . LYS A  1 195 ? -18.549 -17.914  -18.166 1.00 34.11 ? 193 LYS A N     1 
ATOM   1523  C  CA    . LYS A  1 195 ? -18.605 -16.455  -18.068 1.00 34.60 ? 193 LYS A CA    1 
ATOM   1524  C  C     . LYS A  1 195 ? -17.337 -15.946  -17.373 1.00 39.10 ? 193 LYS A C     1 
ATOM   1525  O  O     . LYS A  1 195 ? -16.624 -15.092  -17.916 1.00 40.43 ? 193 LYS A O     1 
ATOM   1526  C  CB    . LYS A  1 195 ? -19.852 -16.019  -17.306 1.00 38.81 ? 193 LYS A CB    1 
ATOM   1527  C  CG    . LYS A  1 195 ? -21.145 -16.424  -17.988 1.00 34.51 ? 193 LYS A CG    1 
ATOM   1528  C  CD    . LYS A  1 195 ? -22.321 -15.587  -17.505 1.00 49.07 ? 193 LYS A CD    1 
ATOM   1529  C  CE    . LYS A  1 195 ? -23.450 -15.723  -18.502 1.00 54.10 ? 193 LYS A CE    1 
ATOM   1530  N  NZ    . LYS A  1 195 ? -22.884 -15.594  -19.882 1.00 54.25 ? 193 LYS A NZ    1 
ATOM   1531  N  N     . GLN A  1 196 ? -17.050 -16.495  -16.190 1.00 35.70 ? 194 GLN A N     1 
ATOM   1532  C  CA    . GLN A  1 196 ? -15.840 -16.154  -15.440 1.00 38.05 ? 194 GLN A CA    1 
ATOM   1533  C  C     . GLN A  1 196 ? -14.576 -16.391  -16.292 1.00 44.04 ? 194 GLN A C     1 
ATOM   1534  O  O     . GLN A  1 196 ? -13.613 -15.619  -16.234 1.00 40.72 ? 194 GLN A O     1 
ATOM   1535  C  CB    . GLN A  1 196 ? -15.774 -16.958  -14.135 1.00 40.38 ? 194 GLN A CB    1 
ATOM   1536  C  CG    . GLN A  1 196 ? -14.527 -16.719  -13.282 1.00 50.22 ? 194 GLN A CG    1 
ATOM   1537  C  CD    . GLN A  1 196 ? -14.275 -17.841  -12.267 1.00 52.71 ? 194 GLN A CD    1 
ATOM   1538  O  OE1   . GLN A  1 196 ? -14.747 -18.974  -12.431 1.00 51.82 ? 194 GLN A OE1   1 
ATOM   1539  N  NE2   . GLN A  1 196 ? -13.531 -17.523  -11.210 1.00 59.79 ? 194 GLN A NE2   1 
ATOM   1540  N  N     . LEU A  1 197 ? -14.585 -17.456  -17.092 1.00 41.30 ? 195 LEU A N     1 
ATOM   1541  C  CA    . LEU A  1 197 ? -13.487 -17.711  -18.018 1.00 30.28 ? 195 LEU A CA    1 
ATOM   1542  C  C     . LEU A  1 197 ? -13.445 -16.639  -19.096 1.00 34.46 ? 195 LEU A C     1 
ATOM   1543  O  O     . LEU A  1 197 ? -12.390 -16.059  -19.348 1.00 33.87 ? 195 LEU A O     1 
ATOM   1544  C  CB    . LEU A  1 197 ? -13.633 -19.097  -18.650 1.00 28.81 ? 195 LEU A CB    1 
ATOM   1545  C  CG    . LEU A  1 197 ? -12.712 -19.468  -19.805 1.00 30.19 ? 195 LEU A CG    1 
ATOM   1546  C  CD1   . LEU A  1 197 ? -11.262 -19.605  -19.359 1.00 29.72 ? 195 LEU A CD1   1 
ATOM   1547  C  CD2   . LEU A  1 197 ? -13.201 -20.765  -20.444 1.00 26.39 ? 195 LEU A CD2   1 
ATOM   1548  N  N     . TYR A  1 198 ? -14.580 -16.368  -19.745 1.00 32.57 ? 196 TYR A N     1 
ATOM   1549  C  CA    . TYR A  1 198 ? -14.574 -15.356  -20.806 1.00 31.82 ? 196 TYR A CA    1 
ATOM   1550  C  C     . TYR A  1 198 ? -14.164 -13.980  -20.245 1.00 40.96 ? 196 TYR A C     1 
ATOM   1551  O  O     . TYR A  1 198 ? -13.654 -13.131  -20.991 1.00 36.59 ? 196 TYR A O     1 
ATOM   1552  C  CB    . TYR A  1 198 ? -15.925 -15.241  -21.524 1.00 36.91 ? 196 TYR A CB    1 
ATOM   1553  C  CG    . TYR A  1 198 ? -16.363 -16.468  -22.294 1.00 35.52 ? 196 TYR A CG    1 
ATOM   1554  C  CD1   . TYR A  1 198 ? -15.432 -17.341  -22.865 1.00 35.75 ? 196 TYR A CD1   1 
ATOM   1555  C  CD2   . TYR A  1 198 ? -17.711 -16.755  -22.448 1.00 30.86 ? 196 TYR A CD2   1 
ATOM   1556  C  CE1   . TYR A  1 198 ? -15.849 -18.478  -23.571 1.00 29.41 ? 196 TYR A CE1   1 
ATOM   1557  C  CE2   . TYR A  1 198 ? -18.141 -17.874  -23.142 1.00 30.67 ? 196 TYR A CE2   1 
ATOM   1558  C  CZ    . TYR A  1 198 ? -17.217 -18.738  -23.707 1.00 34.02 ? 196 TYR A CZ    1 
ATOM   1559  O  OH    . TYR A  1 198 ? -17.683 -19.858  -24.400 1.00 24.04 ? 196 TYR A OH    1 
ATOM   1560  N  N     . ARG A  1 199 ? -14.386 -13.753  -18.947 1.00 36.17 ? 197 ARG A N     1 
ATOM   1561  C  CA    . ARG A  1 199 ? -13.945 -12.495  -18.332 1.00 43.76 ? 197 ARG A CA    1 
ATOM   1562  C  C     . ARG A  1 199 ? -12.439 -12.375  -18.517 1.00 43.62 ? 197 ARG A C     1 
ATOM   1563  O  O     . ARG A  1 199 ? -11.922 -11.317  -18.860 1.00 45.84 ? 197 ARG A O     1 
ATOM   1564  C  CB    . ARG A  1 199 ? -14.302 -12.415  -16.842 1.00 42.88 ? 197 ARG A CB    1 
ATOM   1565  C  CG    . ARG A  1 199 ? -15.818 -12.320  -16.547 1.00 46.57 ? 197 ARG A CG    1 
ATOM   1566  C  CD    . ARG A  1 199 ? -16.141 -11.724  -15.135 1.00 43.91 ? 197 ARG A CD    1 
ATOM   1567  N  NE    . ARG A  1 199 ? -16.189 -12.712  -14.040 1.00 52.03 ? 197 ARG A NE    1 
ATOM   1568  C  CZ    . ARG A  1 199 ? -15.249 -12.840  -13.096 1.00 65.73 ? 197 ARG A CZ    1 
ATOM   1569  N  NH1   . ARG A  1 199 ? -14.181 -12.043  -13.113 1.00 65.68 ? 197 ARG A NH1   1 
ATOM   1570  N  NH2   . ARG A  1 199 ? -15.366 -13.762  -12.134 1.00 54.25 ? 197 ARG A NH2   1 
ATOM   1571  N  N     . PHE A  1 200 ? -11.741 -13.484  -18.331 1.00 49.93 ? 198 PHE A N     1 
ATOM   1572  C  CA    . PHE A  1 200 ? -10.278 -13.482  -18.330 1.00 44.06 ? 198 PHE A CA    1 
ATOM   1573  C  C     . PHE A  1 200 ? -9.657  -13.800  -19.695 1.00 43.95 ? 198 PHE A C     1 
ATOM   1574  O  O     . PHE A  1 200 ? -8.532  -13.388  -19.988 1.00 46.23 ? 198 PHE A O     1 
ATOM   1575  C  CB    . PHE A  1 200 ? -9.788  -14.450  -17.267 1.00 44.07 ? 198 PHE A CB    1 
ATOM   1576  C  CG    . PHE A  1 200 ? -10.183 -14.048  -15.864 1.00 58.79 ? 198 PHE A CG    1 
ATOM   1577  C  CD1   . PHE A  1 200 ? -11.476 -14.267  -15.390 1.00 56.01 ? 198 PHE A CD1   1 
ATOM   1578  C  CD2   . PHE A  1 200 ? -9.266  -13.428  -15.027 1.00 64.13 ? 198 PHE A CD2   1 
ATOM   1579  C  CE1   . PHE A  1 200 ? -11.838 -13.891  -14.101 1.00 54.41 ? 198 PHE A CE1   1 
ATOM   1580  C  CE2   . PHE A  1 200 ? -9.618  -13.052  -13.737 1.00 64.99 ? 198 PHE A CE2   1 
ATOM   1581  C  CZ    . PHE A  1 200 ? -10.909 -13.284  -13.276 1.00 64.26 ? 198 PHE A CZ    1 
ATOM   1582  N  N     . GLN A  1 201 ? -10.406 -14.518  -20.521 1.00 41.76 ? 199 GLN A N     1 
ATOM   1583  C  CA    . GLN A  1 201 ? -9.976  -14.889  -21.859 1.00 40.07 ? 199 GLN A CA    1 
ATOM   1584  C  C     . GLN A  1 201 ? -11.104 -14.557  -22.826 1.00 40.60 ? 199 GLN A C     1 
ATOM   1585  O  O     . GLN A  1 201 ? -11.748 -15.457  -23.358 1.00 32.76 ? 199 GLN A O     1 
ATOM   1586  C  CB    . GLN A  1 201 ? -9.688  -16.387  -21.901 1.00 42.23 ? 199 GLN A CB    1 
ATOM   1587  C  CG    . GLN A  1 201 ? -8.691  -16.857  -20.832 1.00 43.58 ? 199 GLN A CG    1 
ATOM   1588  C  CD    . GLN A  1 201 ? -7.339  -16.199  -20.998 1.00 45.17 ? 199 GLN A CD    1 
ATOM   1589  O  OE1   . GLN A  1 201 ? -7.006  -15.710  -22.085 1.00 47.23 ? 199 GLN A OE1   1 
ATOM   1590  N  NE2   . GLN A  1 201 ? -6.555  -16.164  -19.920 1.00 43.27 ? 199 GLN A NE2   1 
ATOM   1591  N  N     . PRO A  1 202 ? -11.379 -13.252  -23.022 1.00 40.03 ? 200 PRO A N     1 
ATOM   1592  C  CA    . PRO A  1 202 ? -12.443 -12.794  -23.941 1.00 41.83 ? 200 PRO A CA    1 
ATOM   1593  C  C     . PRO A  1 202 ? -12.285 -13.371  -25.360 1.00 41.00 ? 200 PRO A C     1 
ATOM   1594  O  O     . PRO A  1 202 ? -13.287 -13.582  -26.052 1.00 35.66 ? 200 PRO A O     1 
ATOM   1595  C  CB    . PRO A  1 202 ? -12.280 -11.261  -23.951 1.00 37.93 ? 200 PRO A CB    1 
ATOM   1596  C  CG    . PRO A  1 202 ? -10.974 -10.973  -23.209 1.00 36.91 ? 200 PRO A CG    1 
ATOM   1597  C  CD    . PRO A  1 202 ? -10.750 -12.137  -22.292 1.00 39.45 ? 200 PRO A CD    1 
ATOM   1598  N  N     . GLY A  1 203 ? -11.042 -13.623  -25.783 1.00 36.89 ? 201 GLY A N     1 
ATOM   1599  C  CA    . GLY A  1 203 ? -10.784 -14.277  -27.062 1.00 38.55 ? 201 GLY A CA    1 
ATOM   1600  C  C     . GLY A  1 203 ? -11.371 -15.690  -27.194 1.00 41.03 ? 201 GLY A C     1 
ATOM   1601  O  O     . GLY A  1 203 ? -11.697 -16.136  -28.306 1.00 38.33 ? 201 GLY A O     1 
ATOM   1602  N  N     . PHE A  1 204 ? -11.504 -16.413  -26.081 1.00 34.96 ? 202 PHE A N     1 
ATOM   1603  C  CA    . PHE A  1 204 ? -12.125 -17.737  -26.162 1.00 39.52 ? 202 PHE A CA    1 
ATOM   1604  C  C     . PHE A  1 204 ? -13.570 -17.634  -26.645 1.00 35.20 ? 202 PHE A C     1 
ATOM   1605  O  O     . PHE A  1 204 ? -14.143 -18.590  -27.161 1.00 38.45 ? 202 PHE A O     1 
ATOM   1606  C  CB    . PHE A  1 204 ? -12.121 -18.450  -24.812 1.00 38.19 ? 202 PHE A CB    1 
ATOM   1607  C  CG    . PHE A  1 204 ? -10.758 -18.755  -24.278 1.00 38.60 ? 202 PHE A CG    1 
ATOM   1608  C  CD1   . PHE A  1 204 ? -9.611  -18.419  -24.995 1.00 41.92 ? 202 PHE A CD1   1 
ATOM   1609  C  CD2   . PHE A  1 204 ? -10.624 -19.376  -23.038 1.00 36.72 ? 202 PHE A CD2   1 
ATOM   1610  C  CE1   . PHE A  1 204 ? -8.343  -18.687  -24.489 1.00 37.88 ? 202 PHE A CE1   1 
ATOM   1611  C  CE2   . PHE A  1 204 ? -9.358  -19.655  -22.524 1.00 46.29 ? 202 PHE A CE2   1 
ATOM   1612  C  CZ    . PHE A  1 204 ? -8.214  -19.303  -23.258 1.00 41.68 ? 202 PHE A CZ    1 
ATOM   1613  N  N     . LYS A  1 205 ? -14.172 -16.466  -26.474 1.00 38.15 ? 203 LYS A N     1 
ATOM   1614  C  CA    . LYS A  1 205 ? -15.616 -16.377  -26.635 1.00 35.29 ? 203 LYS A CA    1 
ATOM   1615  C  C     . LYS A  1 205 ? -16.123 -16.633  -28.057 1.00 36.75 ? 203 LYS A C     1 
ATOM   1616  O  O     . LYS A  1 205 ? -17.182 -17.244  -28.246 1.00 31.96 ? 203 LYS A O     1 
ATOM   1617  C  CB    . LYS A  1 205 ? -16.137 -15.049  -26.089 1.00 40.66 ? 203 LYS A CB    1 
ATOM   1618  C  CG    . LYS A  1 205 ? -17.623 -15.052  -25.835 1.00 36.19 ? 203 LYS A CG    1 
ATOM   1619  C  CD    . LYS A  1 205 ? -18.052 -13.817  -25.072 1.00 42.10 ? 203 LYS A CD    1 
ATOM   1620  C  CE    . LYS A  1 205 ? -19.580 -13.773  -24.958 1.00 41.00 ? 203 LYS A CE    1 
ATOM   1621  N  NZ    . LYS A  1 205 ? -20.063 -12.564  -24.241 1.00 41.83 ? 203 LYS A NZ    1 
ATOM   1622  N  N     . LYS A  1 206 ? -15.381 -16.184  -29.065 1.00 40.67 ? 204 LYS A N     1 
ATOM   1623  C  CA    . LYS A  1 206 ? -15.861 -16.341  -30.441 1.00 42.85 ? 204 LYS A CA    1 
ATOM   1624  C  C     . LYS A  1 206 ? -16.129 -17.811  -30.796 1.00 36.70 ? 204 LYS A C     1 
ATOM   1625  O  O     . LYS A  1 206 ? -17.116 -18.120  -31.464 1.00 41.56 ? 204 LYS A O     1 
ATOM   1626  C  CB    . LYS A  1 206 ? -14.895 -15.699  -31.449 1.00 39.70 ? 204 LYS A CB    1 
ATOM   1627  C  CG    . LYS A  1 206 ? -13.980 -16.689  -32.179 1.00 52.17 ? 204 LYS A CG    1 
ATOM   1628  C  CD    . LYS A  1 206 ? -12.838 -15.965  -32.904 1.00 52.83 ? 204 LYS A CD    1 
ATOM   1629  C  CE    . LYS A  1 206 ? -12.084 -15.069  -31.936 1.00 54.15 ? 204 LYS A CE    1 
ATOM   1630  N  NZ    . LYS A  1 206 ? -10.984 -14.336  -32.605 1.00 63.99 ? 204 LYS A NZ    1 
ATOM   1631  N  N     . ASP A  1 207 ? -15.255 -18.707  -30.355 1.00 41.71 ? 205 ASP A N     1 
ATOM   1632  C  CA    . ASP A  1 207 ? -15.382 -20.116  -30.709 1.00 32.77 ? 205 ASP A CA    1 
ATOM   1633  C  C     . ASP A  1 207 ? -16.631 -20.784  -30.113 1.00 27.59 ? 205 ASP A C     1 
ATOM   1634  O  O     . ASP A  1 207 ? -17.092 -21.806  -30.629 1.00 27.77 ? 205 ASP A O     1 
ATOM   1635  C  CB    . ASP A  1 207 ? -14.123 -20.877  -30.305 1.00 33.63 ? 205 ASP A CB    1 
ATOM   1636  C  CG    . ASP A  1 207 ? -12.849 -20.204  -30.807 1.00 48.27 ? 205 ASP A CG    1 
ATOM   1637  O  OD1   . ASP A  1 207 ? -12.493 -20.424  -31.991 1.00 46.45 ? 205 ASP A OD1   1 
ATOM   1638  O  OD2   . ASP A  1 207 ? -12.225 -19.441  -30.012 1.00 47.26 ? 205 ASP A OD2   1 
ATOM   1639  N  N     . GLY A  1 208 ? -17.192 -20.208  -29.055 1.00 31.21 ? 206 GLY A N     1 
ATOM   1640  C  CA    . GLY A  1 208 ? -18.392 -20.774  -28.451 1.00 21.57 ? 206 GLY A CA    1 
ATOM   1641  C  C     . GLY A  1 208 ? -18.100 -22.217  -28.057 1.00 25.98 ? 206 GLY A C     1 
ATOM   1642  O  O     . GLY A  1 208 ? -16.980 -22.524  -27.616 1.00 25.78 ? 206 GLY A O     1 
ATOM   1643  N  N     . ALA A  1 209 ? -19.079 -23.101  -28.224 1.00 20.87 ? 207 ALA A N     1 
ATOM   1644  C  CA    . ALA A  1 209 ? -18.931 -24.514  -27.887 1.00 25.31 ? 207 ALA A CA    1 
ATOM   1645  C  C     . ALA A  1 209 ? -17.949 -25.230  -28.801 1.00 28.12 ? 207 ALA A C     1 
ATOM   1646  O  O     . ALA A  1 209 ? -17.535 -26.344  -28.493 1.00 23.96 ? 207 ALA A O     1 
ATOM   1647  C  CB    . ALA A  1 209 ? -20.274 -25.228  -27.930 1.00 23.35 ? 207 ALA A CB    1 
ATOM   1648  N  N     . SER A  1 210 ? -17.616 -24.645  -29.949 1.00 26.82 ? 208 SER A N     1 
ATOM   1649  C  CA    . SER A  1 210 ? -16.784 -25.373  -30.913 1.00 22.56 ? 208 SER A CA    1 
ATOM   1650  C  C     . SER A  1 210 ? -15.301 -25.347  -30.481 1.00 26.27 ? 208 SER A C     1 
ATOM   1651  O  O     . SER A  1 210 ? -14.441 -26.000  -31.106 1.00 22.86 ? 208 SER A O     1 
ATOM   1652  C  CB    . SER A  1 210 ? -16.910 -24.779  -32.319 1.00 19.29 ? 208 SER A CB    1 
ATOM   1653  O  OG    . SER A  1 210 ? -16.133 -23.580  -32.389 1.00 25.96 ? 208 SER A OG    1 
ATOM   1654  N  N     . LEU A  1 211 ? -14.991 -24.583  -29.440 1.00 20.01 ? 209 LEU A N     1 
ATOM   1655  C  CA    . LEU A  1 211 ? -13.585 -24.470  -29.026 1.00 22.23 ? 209 LEU A CA    1 
ATOM   1656  C  C     . LEU A  1 211 ? -13.071 -25.857  -28.645 1.00 23.93 ? 209 LEU A C     1 
ATOM   1657  O  O     . LEU A  1 211 ? -13.742 -26.565  -27.909 1.00 20.04 ? 209 LEU A O     1 
ATOM   1658  C  CB    . LEU A  1 211 ? -13.441 -23.490  -27.852 1.00 21.89 ? 209 LEU A CB    1 
ATOM   1659  C  CG    . LEU A  1 211 ? -12.150 -23.440  -27.038 1.00 27.86 ? 209 LEU A CG    1 
ATOM   1660  C  CD1   . LEU A  1 211 ? -10.983 -23.065  -27.918 1.00 41.27 ? 209 LEU A CD1   1 
ATOM   1661  C  CD2   . LEU A  1 211 ? -12.275 -22.455  -25.899 1.00 32.91 ? 209 LEU A CD2   1 
ATOM   1662  N  N     . GLY A  1 212 ? -11.888 -26.252  -29.134 1.00 24.37 ? 210 GLY A N     1 
ATOM   1663  C  CA    . GLY A  1 212 ? -11.345 -27.547  -28.761 1.00 19.94 ? 210 GLY A CA    1 
ATOM   1664  C  C     . GLY A  1 212 ? -11.409 -28.606  -29.839 1.00 18.49 ? 210 GLY A C     1 
ATOM   1665  O  O     . GLY A  1 212 ? -11.880 -28.391  -30.967 1.00 16.98 ? 210 GLY A O     1 
ATOM   1666  N  N     . SER A  1 213 ? -10.939 -29.788  -29.470 1.00 16.60 ? 211 SER A N     1 
ATOM   1667  C  CA    . SER A  1 213 ? -10.735 -30.851  -30.428 1.00 15.63 ? 211 SER A CA    1 
ATOM   1668  C  C     . SER A  1 213 ? -11.949 -31.786  -30.437 1.00 16.02 ? 211 SER A C     1 
ATOM   1669  O  O     . SER A  1 213 ? -12.350 -32.351  -29.401 1.00 14.59 ? 211 SER A O     1 
ATOM   1670  C  CB    . SER A  1 213 ? -9.462  -31.629  -30.079 1.00 16.93 ? 211 SER A CB    1 
ATOM   1671  O  OG    . SER A  1 213 ? -9.378  -32.873  -30.775 1.00 15.72 ? 211 SER A OG    1 
ATOM   1672  N  N     . PRO A  1 214 ? -12.527 -31.980  -31.625 1.00 11.28 ? 212 PRO A N     1 
ATOM   1673  C  CA    . PRO A  1 214 ? -13.587 -32.998  -31.708 1.00 22.80 ? 212 PRO A CA    1 
ATOM   1674  C  C     . PRO A  1 214 ? -13.053 -34.416  -31.433 1.00 14.08 ? 212 PRO A C     1 
ATOM   1675  O  O     . PRO A  1 214 ? -13.837 -35.323  -31.022 1.00 16.90 ? 212 PRO A O     1 
ATOM   1676  C  CB    . PRO A  1 214 ? -14.085 -32.880  -33.156 1.00 18.64 ? 212 PRO A CB    1 
ATOM   1677  C  CG    . PRO A  1 214 ? -12.913 -32.234  -33.919 1.00 22.11 ? 212 PRO A CG    1 
ATOM   1678  C  CD    . PRO A  1 214 ? -12.240 -31.326  -32.920 1.00 17.13 ? 212 PRO A CD    1 
ATOM   1679  N  N     . ILE A  1 215 ? -11.763 -34.617  -31.696 1.00 18.96 ? 213 ILE A N     1 
ATOM   1680  C  CA    . ILE A  1 215 ? -11.171 -35.931  -31.420 1.00 19.05 ? 213 ILE A CA    1 
ATOM   1681  C  C     . ILE A  1 215 ? -11.232 -36.194  -29.912 1.00 19.37 ? 213 ILE A C     1 
ATOM   1682  O  O     . ILE A  1 215 ? -11.733 -37.258  -29.467 1.00 16.85 ? 213 ILE A O     1 
ATOM   1683  C  CB    . ILE A  1 215 ? -9.772  -36.067  -32.019 1.00 23.28 ? 213 ILE A CB    1 
ATOM   1684  C  CG1   . ILE A  1 215 ? -9.883  -36.234  -33.533 1.00 20.09 ? 213 ILE A CG1   1 
ATOM   1685  C  CG2   . ILE A  1 215 ? -9.039  -37.286  -31.439 1.00 21.12 ? 213 ILE A CG2   1 
ATOM   1686  C  CD1   . ILE A  1 215 ? -8.579  -36.103  -34.259 1.00 15.64 ? 213 ILE A CD1   1 
ATOM   1687  N  N     . ASN A  1 216 ? -10.756 -35.223  -29.119 1.00 17.88 ? 214 ASN A N     1 
ATOM   1688  C  CA    . ASN A  1 216 ? -10.773 -35.357  -27.661 1.00 18.12 ? 214 ASN A CA    1 
ATOM   1689  C  C     . ASN A  1 216 ? -12.185 -35.422  -27.082 1.00 19.07 ? 214 ASN A C     1 
ATOM   1690  O  O     . ASN A  1 216 ? -12.445 -36.152  -26.114 1.00 15.82 ? 214 ASN A O     1 
ATOM   1691  C  CB    . ASN A  1 216 ? -9.906  -34.267  -27.025 1.00 16.85 ? 214 ASN A CB    1 
ATOM   1692  C  CG    . ASN A  1 216 ? -8.414  -34.495  -27.329 1.00 17.98 ? 214 ASN A CG    1 
ATOM   1693  O  OD1   . ASN A  1 216 ? -7.975  -35.642  -27.354 1.00 19.06 ? 214 ASN A OD1   1 
ATOM   1694  N  ND2   . ASN A  1 216 ? -7.649  -33.427  -27.595 1.00 14.87 ? 214 ASN A ND2   1 
ATOM   1695  N  N     . LYS A  1 217 ? -13.113 -34.685  -27.699 1.00 14.17 ? 215 LYS A N     1 
ATOM   1696  C  CA    . LYS A  1 217 ? -14.513 -34.812  -27.301 1.00 16.50 ? 215 LYS A CA    1 
ATOM   1697  C  C     . LYS A  1 217 ? -14.967 -36.271  -27.421 1.00 15.52 ? 215 LYS A C     1 
ATOM   1698  O  O     . LYS A  1 217 ? -15.522 -36.833  -26.495 1.00 19.55 ? 215 LYS A O     1 
ATOM   1699  C  CB    . LYS A  1 217 ? -15.421 -33.887  -28.122 1.00 16.61 ? 215 LYS A CB    1 
ATOM   1700  C  CG    . LYS A  1 217 ? -16.902 -34.244  -28.019 1.00 21.60 ? 215 LYS A CG    1 
ATOM   1701  C  CD    . LYS A  1 217 ? -17.589 -34.048  -29.375 1.00 30.79 ? 215 LYS A CD    1 
ATOM   1702  C  CE    . LYS A  1 217 ? -17.877 -32.603  -29.639 1.00 31.11 ? 215 LYS A CE    1 
ATOM   1703  N  NZ    . LYS A  1 217 ? -19.084 -32.156  -28.909 1.00 43.63 ? 215 LYS A NZ    1 
ATOM   1704  N  N     . VAL A  1 218 ? -14.749 -36.890  -28.570 1.00 15.75 ? 216 VAL A N     1 
ATOM   1705  C  CA    . VAL A  1 218 ? -15.253 -38.252  -28.756 1.00 13.22 ? 216 VAL A CA    1 
ATOM   1706  C  C     . VAL A  1 218 ? -14.610 -39.164  -27.718 1.00 21.51 ? 216 VAL A C     1 
ATOM   1707  O  O     . VAL A  1 218 ? -15.306 -39.905  -27.037 1.00 19.51 ? 216 VAL A O     1 
ATOM   1708  C  CB    . VAL A  1 218 ? -14.990 -38.787  -30.170 1.00 18.85 ? 216 VAL A CB    1 
ATOM   1709  C  CG1   . VAL A  1 218 ? -15.464 -40.218  -30.284 1.00 23.02 ? 216 VAL A CG1   1 
ATOM   1710  C  CG2   . VAL A  1 218 ? -15.710 -37.923  -31.244 1.00 19.96 ? 216 VAL A CG2   1 
ATOM   1711  N  N     . ILE A  1 219 ? -13.278 -39.102  -27.591 1.00 18.07 ? 217 ILE A N     1 
ATOM   1712  C  CA    . ILE A  1 219 ? -12.531 -40.032  -26.716 1.00 12.10 ? 217 ILE A CA    1 
ATOM   1713  C  C     . ILE A  1 219 ? -13.035 -39.898  -25.283 1.00 15.16 ? 217 ILE A C     1 
ATOM   1714  O  O     . ILE A  1 219 ? -13.259 -40.910  -24.584 1.00 21.74 ? 217 ILE A O     1 
ATOM   1715  C  CB    . ILE A  1 219 ? -10.994 -39.758  -26.832 1.00 16.06 ? 217 ILE A CB    1 
ATOM   1716  C  CG1   . ILE A  1 219 ? -10.532 -40.056  -28.242 1.00 13.48 ? 217 ILE A CG1   1 
ATOM   1717  C  CG2   . ILE A  1 219 ? -10.177 -40.603  -25.850 1.00 17.20 ? 217 ILE A CG2   1 
ATOM   1718  C  CD1   . ILE A  1 219 ? -9.151  -39.653  -28.547 1.00 17.09 ? 217 ILE A CD1   1 
ATOM   1719  N  N     . LEU A  1 220 ? -13.240 -38.659  -24.830 1.00 14.78 ? 218 LEU A N     1 
ATOM   1720  C  CA    . LEU A  1 220 ? -13.797 -38.443  -23.488 1.00 15.79 ? 218 LEU A CA    1 
ATOM   1721  C  C     . LEU A  1 220 ? -15.206 -38.998  -23.356 1.00 18.31 ? 218 LEU A C     1 
ATOM   1722  O  O     . LEU A  1 220 ? -15.540 -39.547  -22.320 1.00 18.47 ? 218 LEU A O     1 
ATOM   1723  C  CB    . LEU A  1 220 ? -13.825 -36.952  -23.112 1.00 15.69 ? 218 LEU A CB    1 
ATOM   1724  C  CG    . LEU A  1 220 ? -14.140 -36.510  -21.667 1.00 17.48 ? 218 LEU A CG    1 
ATOM   1725  C  CD1   . LEU A  1 220 ? -13.651 -35.048  -21.365 1.00 19.55 ? 218 LEU A CD1   1 
ATOM   1726  C  CD2   . LEU A  1 220 ? -15.622 -36.609  -21.328 1.00 25.53 ? 218 LEU A CD2   1 
ATOM   1727  N  N     . ASN A  1 221 ? -16.050 -38.826  -24.384 1.00 16.84 ? 219 ASN A N     1 
ATOM   1728  C  CA    A ASN A  1 221 ? -17.446 -39.282  -24.289 0.51 21.04 ? 219 ASN A CA    1 
ATOM   1729  C  CA    B ASN A  1 221 ? -17.448 -39.268  -24.308 0.49 21.03 ? 219 ASN A CA    1 
ATOM   1730  C  C     . ASN A  1 221 ? -17.494 -40.797  -24.306 1.00 20.29 ? 219 ASN A C     1 
ATOM   1731  O  O     . ASN A  1 221 ? -18.343 -41.401  -23.698 1.00 21.18 ? 219 ASN A O     1 
ATOM   1732  C  CB    A ASN A  1 221 ? -18.332 -38.697  -25.406 0.51 19.44 ? 219 ASN A CB    1 
ATOM   1733  C  CB    B ASN A  1 221 ? -18.299 -38.693  -25.464 0.49 19.45 ? 219 ASN A CB    1 
ATOM   1734  C  CG    A ASN A  1 221 ? -19.769 -39.238  -25.369 0.51 24.58 ? 219 ASN A CG    1 
ATOM   1735  C  CG    B ASN A  1 221 ? -18.777 -37.248  -25.217 0.49 21.88 ? 219 ASN A CG    1 
ATOM   1736  O  OD1   A ASN A  1 221 ? -20.096 -40.220  -26.035 0.51 22.69 ? 219 ASN A OD1   1 
ATOM   1737  O  OD1   B ASN A  1 221 ? -18.996 -36.810  -24.065 0.49 18.98 ? 219 ASN A OD1   1 
ATOM   1738  N  ND2   A ASN A  1 221 ? -20.624 -38.592  -24.592 0.51 23.50 ? 219 ASN A ND2   1 
ATOM   1739  N  ND2   B ASN A  1 221 ? -18.960 -36.502  -26.318 0.49 18.91 ? 219 ASN A ND2   1 
ATOM   1740  N  N     . THR A  1 222 ? -16.532 -41.403  -24.973 1.00 20.62 ? 220 THR A N     1 
ATOM   1741  C  CA    . THR A  1 222 ? -16.470 -42.852  -25.073 1.00 18.43 ? 220 THR A CA    1 
ATOM   1742  C  C     . THR A  1 222 ? -15.905 -43.547  -23.794 1.00 26.38 ? 220 THR A C     1 
ATOM   1743  O  O     . THR A  1 222 ? -16.537 -44.471  -23.269 1.00 21.28 ? 220 THR A O     1 
ATOM   1744  C  CB    . THR A  1 222 ? -15.682 -43.210  -26.327 1.00 20.98 ? 220 THR A CB    1 
ATOM   1745  O  OG1   . THR A  1 222 ? -16.386 -42.689  -27.463 1.00 22.85 ? 220 THR A OG1   1 
ATOM   1746  C  CG2   . THR A  1 222 ? -15.467 -44.721  -26.481 1.00 22.22 ? 220 THR A CG2   1 
ATOM   1747  N  N     . LEU A  1 223 ? -14.747 -43.079  -23.295 1.00 17.72 ? 221 LEU A N     1 
ATOM   1748  C  CA    . LEU A  1 223 ? -14.058 -43.656  -22.136 1.00 16.66 ? 221 LEU A CA    1 
ATOM   1749  C  C     . LEU A  1 223 ? -14.495 -43.145  -20.770 1.00 20.45 ? 221 LEU A C     1 
ATOM   1750  O  O     . LEU A  1 223 ? -14.289 -43.825  -19.744 1.00 19.57 ? 221 LEU A O     1 
ATOM   1751  C  CB    . LEU A  1 223 ? -12.550 -43.384  -22.249 1.00 15.89 ? 221 LEU A CB    1 
ATOM   1752  C  CG    . LEU A  1 223 ? -11.879 -43.963  -23.485 1.00 15.01 ? 221 LEU A CG    1 
ATOM   1753  C  CD1   . LEU A  1 223 ? -10.387 -43.666  -23.378 1.00 19.32 ? 221 LEU A CD1   1 
ATOM   1754  C  CD2   . LEU A  1 223 ? -12.150 -45.481  -23.620 1.00 16.46 ? 221 LEU A CD2   1 
ATOM   1755  N  N     . LYS A  1 224 ? -15.040 -41.930  -20.731 1.00 14.99 ? 222 LYS A N     1 
ATOM   1756  C  CA    . LYS A  1 224 ? -15.515 -41.366  -19.455 1.00 21.41 ? 222 LYS A CA    1 
ATOM   1757  C  C     . LYS A  1 224 ? -14.528 -41.509  -18.273 1.00 16.16 ? 222 LYS A C     1 
ATOM   1758  O  O     . LYS A  1 224 ? -14.924 -41.957  -17.188 1.00 19.28 ? 222 LYS A O     1 
ATOM   1759  C  CB    . LYS A  1 224 ? -16.913 -41.950  -19.081 1.00 20.49 ? 222 LYS A CB    1 
ATOM   1760  C  CG    . LYS A  1 224 ? -18.015 -41.654  -20.133 1.00 18.07 ? 222 LYS A CG    1 
ATOM   1761  C  CD    . LYS A  1 224 ? -19.450 -41.667  -19.548 1.00 28.55 ? 222 LYS A CD    1 
ATOM   1762  C  CE    . LYS A  1 224 ? -20.502 -41.781  -20.660 1.00 21.83 ? 222 LYS A CE    1 
ATOM   1763  N  NZ    . LYS A  1 224 ? -20.529 -40.595  -21.618 1.00 28.03 ? 222 LYS A NZ    1 
ATOM   1764  N  N     . PRO A  1 225 ? -13.257 -41.073  -18.450 1.00 21.37 ? 223 PRO A N     1 
ATOM   1765  C  CA    . PRO A  1 225 ? -12.247 -41.166  -17.368 1.00 19.70 ? 223 PRO A CA    1 
ATOM   1766  C  C     . PRO A  1 225 ? -12.656 -40.338  -16.133 1.00 19.85 ? 223 PRO A C     1 
ATOM   1767  O  O     . PRO A  1 225 ? -13.438 -39.388  -16.284 1.00 20.51 ? 223 PRO A O     1 
ATOM   1768  C  CB    . PRO A  1 225 ? -10.984 -40.536  -18.000 1.00 17.04 ? 223 PRO A CB    1 
ATOM   1769  C  CG    . PRO A  1 225 ? -11.560 -39.577  -19.110 1.00 17.28 ? 223 PRO A CG    1 
ATOM   1770  C  CD    . PRO A  1 225 ? -12.803 -40.268  -19.608 1.00 19.97 ? 223 PRO A CD    1 
ATOM   1771  N  N     . LYS A  1 226 ? -12.132 -40.664  -14.948 1.00 22.44 ? 224 LYS A N     1 
ATOM   1772  C  CA    . LYS A  1 226 ? -12.407 -39.856  -13.748 1.00 21.44 ? 224 LYS A CA    1 
ATOM   1773  C  C     . LYS A  1 226 ? -11.954 -38.426  -13.966 1.00 24.49 ? 224 LYS A C     1 
ATOM   1774  O  O     . LYS A  1 226 ? -12.629 -37.468  -13.541 1.00 18.36 ? 224 LYS A O     1 
ATOM   1775  C  CB    . LYS A  1 226 ? -11.646 -40.387  -12.527 1.00 17.01 ? 224 LYS A CB    1 
ATOM   1776  C  CG    . LYS A  1 226 ? -11.992 -41.801  -12.127 1.00 33.95 ? 224 LYS A CG    1 
ATOM   1777  C  CD    . LYS A  1 226 ? -11.160 -42.282  -10.912 1.00 35.33 ? 224 LYS A CD    1 
ATOM   1778  C  CE    . LYS A  1 226 ? -11.175 -43.804  -10.819 1.00 33.32 ? 224 LYS A CE    1 
ATOM   1779  N  NZ    . LYS A  1 226 ? -11.305 -44.280  -9.392  1.00 47.45 ? 224 LYS A NZ    1 
ATOM   1780  N  N     . TYR A  1 227 ? -10.784 -38.293  -14.603 1.00 19.00 ? 225 TYR A N     1 
ATOM   1781  C  CA    . TYR A  1 227 ? -10.212 -36.989  -14.912 1.00 21.17 ? 225 TYR A CA    1 
ATOM   1782  C  C     . TYR A  1 227 ? -9.807  -36.890  -16.367 1.00 18.27 ? 225 TYR A C     1 
ATOM   1783  O  O     . TYR A  1 227 ? -9.375  -37.869  -16.981 1.00 17.08 ? 225 TYR A O     1 
ATOM   1784  C  CB    . TYR A  1 227 ? -8.973  -36.735  -14.055 1.00 19.48 ? 225 TYR A CB    1 
ATOM   1785  C  CG    . TYR A  1 227 ? -9.255  -36.741  -12.591 1.00 22.57 ? 225 TYR A CG    1 
ATOM   1786  C  CD1   . TYR A  1 227 ? -9.622  -35.579  -11.950 1.00 21.79 ? 225 TYR A CD1   1 
ATOM   1787  C  CD2   . TYR A  1 227 ? -9.173  -37.912  -11.847 1.00 19.81 ? 225 TYR A CD2   1 
ATOM   1788  C  CE1   . TYR A  1 227 ? -9.897  -35.557  -10.603 1.00 25.92 ? 225 TYR A CE1   1 
ATOM   1789  C  CE2   . TYR A  1 227 ? -9.415  -37.901  -10.485 1.00 19.64 ? 225 TYR A CE2   1 
ATOM   1790  C  CZ    . TYR A  1 227 ? -9.781  -36.703  -9.871  1.00 25.95 ? 225 TYR A CZ    1 
ATOM   1791  O  OH    . TYR A  1 227 ? -10.058 -36.635  -8.525  1.00 32.45 ? 225 TYR A OH    1 
ATOM   1792  N  N     . TRP A  1 228 ? -9.944  -35.692  -16.914 1.00 11.85 ? 226 TRP A N     1 
ATOM   1793  C  CA    . TRP A  1 228 ? -9.299  -35.366  -18.188 1.00 16.25 ? 226 TRP A CA    1 
ATOM   1794  C  C     . TRP A  1 228 ? -8.514  -34.072  -18.033 1.00 16.78 ? 226 TRP A C     1 
ATOM   1795  O  O     . TRP A  1 228 ? -9.042  -33.060  -17.563 1.00 17.89 ? 226 TRP A O     1 
ATOM   1796  C  CB    . TRP A  1 228 ? -10.335 -35.203  -19.282 1.00 14.78 ? 226 TRP A CB    1 
ATOM   1797  C  CG    . TRP A  1 228 ? -9.748  -35.087  -20.622 1.00 16.80 ? 226 TRP A CG    1 
ATOM   1798  C  CD1   . TRP A  1 228 ? -8.994  -34.039  -21.124 1.00 14.06 ? 226 TRP A CD1   1 
ATOM   1799  C  CD2   . TRP A  1 228 ? -9.857  -36.046  -21.659 1.00 11.28 ? 226 TRP A CD2   1 
ATOM   1800  N  NE1   . TRP A  1 228 ? -8.622  -34.331  -22.413 1.00 14.33 ? 226 TRP A NE1   1 
ATOM   1801  C  CE2   . TRP A  1 228 ? -9.150  -35.552  -22.768 1.00 14.65 ? 226 TRP A CE2   1 
ATOM   1802  C  CE3   . TRP A  1 228 ? -10.477 -37.300  -21.756 1.00 13.31 ? 226 TRP A CE3   1 
ATOM   1803  C  CZ2   . TRP A  1 228 ? -9.060  -36.257  -23.965 1.00 15.57 ? 226 TRP A CZ2   1 
ATOM   1804  C  CZ3   . TRP A  1 228 ? -10.394 -37.998  -22.937 1.00 15.72 ? 226 TRP A CZ3   1 
ATOM   1805  C  CH2   . TRP A  1 228 ? -9.696  -37.478  -24.030 1.00 16.38 ? 226 TRP A CH2   1 
ATOM   1806  N  N     . ILE A  1 229 ? -7.243  -34.093  -18.415 1.00 17.24 ? 227 ILE A N     1 
ATOM   1807  C  CA    . ILE A  1 229 ? -6.385  -32.984  -18.073 1.00 12.93 ? 227 ILE A CA    1 
ATOM   1808  C  C     . ILE A  1 229 ? -5.868  -32.445  -19.373 1.00 16.86 ? 227 ILE A C     1 
ATOM   1809  O  O     . ILE A  1 229 ? -5.525  -33.236  -20.240 1.00 18.05 ? 227 ILE A O     1 
ATOM   1810  C  CB    . ILE A  1 229 ? -5.270  -33.487  -17.149 1.00 17.73 ? 227 ILE A CB    1 
ATOM   1811  C  CG1   . ILE A  1 229 ? -5.946  -34.137  -15.940 1.00 20.72 ? 227 ILE A CG1   1 
ATOM   1812  C  CG2   . ILE A  1 229 ? -4.382  -32.362  -16.704 1.00 16.92 ? 227 ILE A CG2   1 
ATOM   1813  C  CD1   . ILE A  1 229 ? -4.989  -34.583  -14.883 1.00 30.16 ? 227 ILE A CD1   1 
ATOM   1814  N  N     . SER A  1 230 ? -5.861  -31.113  -19.533 1.00 15.74 ? 228 SER A N     1 
ATOM   1815  C  CA    . SER A  1 230 ? -5.425  -30.483  -20.795 1.00 18.51 ? 228 SER A CA    1 
ATOM   1816  C  C     . SER A  1 230 ? -4.609  -29.188  -20.555 1.00 17.32 ? 228 SER A C     1 
ATOM   1817  O  O     . SER A  1 230 ? -4.816  -28.489  -19.544 1.00 20.27 ? 228 SER A O     1 
ATOM   1818  C  CB    . SER A  1 230 ? -6.626  -30.192  -21.707 1.00 16.89 ? 228 SER A CB    1 
ATOM   1819  O  OG    . SER A  1 230 ? -7.323  -31.374  -22.050 1.00 19.21 ? 228 SER A OG    1 
ATOM   1820  N  N     A GLY A  1 231 ? -3.706  -28.851  -21.492 0.55 18.94 ? 229 GLY A N     1 
ATOM   1821  N  N     B GLY A  1 231 ? -3.689  -28.874  -21.441 0.45 18.93 ? 229 GLY A N     1 
ATOM   1822  C  CA    A GLY A  1 231 ? -2.766  -27.739  -21.298 0.55 19.93 ? 229 GLY A CA    1 
ATOM   1823  C  CA    B GLY A  1 231 ? -3.126  -27.554  -21.343 0.45 20.05 ? 229 GLY A CA    1 
ATOM   1824  C  C     A GLY A  1 231 ? -2.514  -26.623  -22.335 0.55 21.75 ? 229 GLY A C     1 
ATOM   1825  C  C     B GLY A  1 231 ? -3.731  -26.716  -22.439 0.45 20.61 ? 229 GLY A C     1 
ATOM   1826  O  O     A GLY A  1 231 ? -1.817  -25.668  -22.041 0.55 24.38 ? 229 GLY A O     1 
ATOM   1827  O  O     B GLY A  1 231 ? -4.822  -26.148  -22.326 0.45 22.93 ? 229 GLY A O     1 
ATOM   1828  N  N     . HIS A  1 232 ? -3.025  -26.768  -23.551 1.00 24.83 ? 230 HIS A N     1 
ATOM   1829  C  CA    . HIS A  1 232 ? -2.988  -25.744  -24.626 1.00 22.44 ? 230 HIS A CA    1 
ATOM   1830  C  C     . HIS A  1 232 ? -3.342  -24.254  -24.352 1.00 27.35 ? 230 HIS A C     1 
ATOM   1831  O  O     . HIS A  1 232 ? -2.723  -23.359  -24.941 1.00 31.78 ? 230 HIS A O     1 
ATOM   1832  C  CB    . HIS A  1 232 ? -3.784  -26.267  -25.818 1.00 18.78 ? 230 HIS A CB    1 
ATOM   1833  C  CG    . HIS A  1 232 ? -3.539  -25.536  -27.096 1.00 20.97 ? 230 HIS A CG    1 
ATOM   1834  N  ND1   . HIS A  1 232 ? -2.284  -25.150  -27.516 1.00 21.54 ? 230 HIS A ND1   1 
ATOM   1835  C  CD2   . HIS A  1 232 ? -4.390  -25.155  -28.078 1.00 24.04 ? 230 HIS A CD2   1 
ATOM   1836  C  CE1   . HIS A  1 232 ? -2.369  -24.553  -28.683 1.00 23.99 ? 230 HIS A CE1   1 
ATOM   1837  N  NE2   . HIS A  1 232 ? -3.641  -24.537  -29.049 1.00 25.10 ? 230 HIS A NE2   1 
ATOM   1838  N  N     . MET A  1 233 ? -4.292  -23.991  -23.457 1.00 25.90 ? 231 MET A N     1 
ATOM   1839  C  CA    . MET A  1 233 ? -4.968  -22.671  -23.416 1.00 32.55 ? 231 MET A CA    1 
ATOM   1840  C  C     . MET A  1 233 ? -4.369  -21.513  -22.580 1.00 35.72 ? 231 MET A C     1 
ATOM   1841  O  O     . MET A  1 233 ? -4.790  -20.353  -22.731 1.00 44.18 ? 231 MET A O     1 
ATOM   1842  C  CB    . MET A  1 233 ? -6.462  -22.834  -23.066 1.00 29.45 ? 231 MET A CB    1 
ATOM   1843  C  CG    . MET A  1 233 ? -7.270  -23.664  -24.078 1.00 24.29 ? 231 MET A CG    1 
ATOM   1844  S  SD    . MET A  1 233 ? -7.098  -23.166  -25.816 1.00 33.15 ? 231 MET A SD    1 
ATOM   1845  C  CE    . MET A  1 233 ? -8.193  -21.731  -25.844 1.00 41.03 ? 231 MET A CE    1 
ATOM   1846  N  N     . HIS A  1 234 ? -3.419  -21.805  -21.702 1.00 31.30 ? 232 HIS A N     1 
ATOM   1847  C  CA    . HIS A  1 234 ? -2.811  -20.764  -20.859 1.00 35.73 ? 232 HIS A CA    1 
ATOM   1848  C  C     . HIS A  1 234 ? -3.794  -20.168  -19.871 1.00 38.20 ? 232 HIS A C     1 
ATOM   1849  O  O     . HIS A  1 234 ? -3.883  -18.953  -19.727 1.00 38.92 ? 232 HIS A O     1 
ATOM   1850  C  CB    . HIS A  1 234 ? -2.238  -19.632  -21.702 1.00 44.65 ? 232 HIS A CB    1 
ATOM   1851  C  CG    . HIS A  1 234 ? -1.146  -20.061  -22.622 1.00 45.89 ? 232 HIS A CG    1 
ATOM   1852  N  ND1   . HIS A  1 234 ? -0.551  -19.200  -23.523 1.00 49.65 ? 232 HIS A ND1   1 
ATOM   1853  C  CD2   . HIS A  1 234 ? -0.543  -21.264  -22.792 1.00 41.25 ? 232 HIS A CD2   1 
ATOM   1854  C  CE1   . HIS A  1 234 ? 0.369   -19.852  -24.205 1.00 50.09 ? 232 HIS A CE1   1 
ATOM   1855  N  NE2   . HIS A  1 234 ? 0.397   -21.108  -23.785 1.00 48.97 ? 232 HIS A NE2   1 
ATOM   1856  N  N     . CYS A  1 235 ? -4.556  -21.017  -19.208 1.00 36.63 ? 233 CYS A N     1 
ATOM   1857  C  CA    . CYS A  1 235 ? -5.412  -20.547  -18.138 1.00 32.70 ? 233 CYS A CA    1 
ATOM   1858  C  C     . CYS A  1 235 ? -5.690  -21.762  -17.301 1.00 29.38 ? 233 CYS A C     1 
ATOM   1859  O  O     . CYS A  1 235 ? -5.404  -22.890  -17.721 1.00 29.92 ? 233 CYS A O     1 
ATOM   1860  C  CB    . CYS A  1 235 ? -6.704  -19.958  -18.691 1.00 34.56 ? 233 CYS A CB    1 
ATOM   1861  S  SG    . CYS A  1 235 ? -7.774  -21.148  -19.601 1.00 34.75 ? 233 CYS A SG    1 
ATOM   1862  N  N     . GLU A  1 236 ? -6.218  -21.560  -16.109 1.00 26.32 ? 234 GLU A N     1 
ATOM   1863  C  CA    . GLU A  1 236 ? -6.713  -22.708  -15.388 1.00 28.81 ? 234 GLU A CA    1 
ATOM   1864  C  C     . GLU A  1 236 ? -8.219  -22.696  -15.640 1.00 28.65 ? 234 GLU A C     1 
ATOM   1865  O  O     . GLU A  1 236 ? -8.795  -21.642  -15.925 1.00 30.49 ? 234 GLU A O     1 
ATOM   1866  C  CB    . GLU A  1 236 ? -6.360  -22.639  -13.903 1.00 31.43 ? 234 GLU A CB    1 
ATOM   1867  C  CG    . GLU A  1 236 ? -6.937  -23.798  -13.066 1.00 35.38 ? 234 GLU A CG    1 
ATOM   1868  C  CD    . GLU A  1 236 ? -5.924  -24.425  -12.090 1.00 53.93 ? 234 GLU A CD    1 
ATOM   1869  O  OE1   . GLU A  1 236 ? -4.749  -23.973  -12.059 1.00 49.92 ? 234 GLU A OE1   1 
ATOM   1870  O  OE2   . GLU A  1 236 ? -6.311  -25.381  -11.360 1.00 51.66 ? 234 GLU A OE2   1 
ATOM   1871  N  N     . TYR A  1 237 ? -8.838  -23.867  -15.597 1.00 22.73 ? 235 TYR A N     1 
ATOM   1872  C  CA    . TYR A  1 237 ? -10.274 -23.978  -15.797 1.00 23.68 ? 235 TYR A CA    1 
ATOM   1873  C  C     . TYR A  1 237 ? -10.678 -25.330  -15.249 1.00 26.66 ? 235 TYR A C     1 
ATOM   1874  O  O     . TYR A  1 237 ? -9.897  -26.287  -15.326 1.00 25.59 ? 235 TYR A O     1 
ATOM   1875  C  CB    . TYR A  1 237 ? -10.629 -23.903  -17.287 1.00 26.09 ? 235 TYR A CB    1 
ATOM   1876  C  CG    . TYR A  1 237 ? -12.123 -23.732  -17.564 1.00 25.07 ? 235 TYR A CG    1 
ATOM   1877  C  CD1   . TYR A  1 237 ? -12.848 -22.695  -16.974 1.00 26.66 ? 235 TYR A CD1   1 
ATOM   1878  C  CD2   . TYR A  1 237 ? -12.803 -24.599  -18.416 1.00 23.14 ? 235 TYR A CD2   1 
ATOM   1879  C  CE1   . TYR A  1 237 ? -14.197 -22.539  -17.220 1.00 24.91 ? 235 TYR A CE1   1 
ATOM   1880  C  CE2   . TYR A  1 237 ? -14.157 -24.444  -18.676 1.00 21.39 ? 235 TYR A CE2   1 
ATOM   1881  C  CZ    . TYR A  1 237 ? -14.843 -23.411  -18.078 1.00 27.33 ? 235 TYR A CZ    1 
ATOM   1882  O  OH    . TYR A  1 237 ? -16.193 -23.259  -18.351 1.00 25.45 ? 235 TYR A OH    1 
ATOM   1883  N  N     . HIS A  1 238 ? -11.877 -25.402  -14.685 1.00 23.85 ? 236 HIS A N     1 
ATOM   1884  C  CA    . HIS A  1 238 ? -12.458 -26.667  -14.260 1.00 22.71 ? 236 HIS A CA    1 
ATOM   1885  C  C     . HIS A  1 238 ? -13.853 -26.790  -14.850 1.00 27.23 ? 236 HIS A C     1 
ATOM   1886  O  O     . HIS A  1 238 ? -14.545 -25.786  -15.042 1.00 24.62 ? 236 HIS A O     1 
ATOM   1887  C  CB    . HIS A  1 238 ? -12.524 -26.730  -12.731 1.00 26.85 ? 236 HIS A CB    1 
ATOM   1888  C  CG    . HIS A  1 238 ? -11.185 -26.647  -12.074 1.00 33.01 ? 236 HIS A CG    1 
ATOM   1889  N  ND1   . HIS A  1 238 ? -10.488 -27.764  -11.651 1.00 32.61 ? 236 HIS A ND1   1 
ATOM   1890  C  CD2   . HIS A  1 238 ? -10.391 -25.584  -11.806 1.00 35.88 ? 236 HIS A CD2   1 
ATOM   1891  C  CE1   . HIS A  1 238 ? -9.331  -27.389  -11.135 1.00 27.29 ? 236 HIS A CE1   1 
ATOM   1892  N  NE2   . HIS A  1 238 ? -9.245  -26.074  -11.220 1.00 38.70 ? 236 HIS A NE2   1 
ATOM   1893  N  N     . ALA A  1 239 ? -14.267 -28.017  -15.146 1.00 22.79 ? 237 ALA A N     1 
ATOM   1894  C  CA    . ALA A  1 239 ? -15.611 -28.260  -15.645 1.00 21.41 ? 237 ALA A CA    1 
ATOM   1895  C  C     . ALA A  1 239 ? -15.938 -29.693  -15.339 1.00 23.52 ? 237 ALA A C     1 
ATOM   1896  O  O     . ALA A  1 239 ? -15.042 -30.503  -15.042 1.00 18.98 ? 237 ALA A O     1 
ATOM   1897  C  CB    . ALA A  1 239 ? -15.695 -27.989  -17.136 1.00 22.91 ? 237 ALA A CB    1 
ATOM   1898  N  N     . GLU A  1 240 ? -17.216 -30.024  -15.407 1.00 26.66 ? 238 GLU A N     1 
ATOM   1899  C  CA    . GLU A  1 240 ? -17.635 -31.398  -15.198 1.00 20.99 ? 238 GLU A CA    1 
ATOM   1900  C  C     . GLU A  1 240 ? -18.515 -31.861  -16.354 1.00 26.63 ? 238 GLU A C     1 
ATOM   1901  O  O     . GLU A  1 240 ? -19.494 -31.193  -16.682 1.00 24.72 ? 238 GLU A O     1 
ATOM   1902  C  CB    . GLU A  1 240 ? -18.402 -31.514  -13.879 1.00 26.28 ? 238 GLU A CB    1 
ATOM   1903  C  CG    . GLU A  1 240 ? -17.764 -30.777  -12.712 1.00 27.90 ? 238 GLU A CG    1 
ATOM   1904  C  CD    . GLU A  1 240 ? -16.534 -31.471  -12.171 1.00 31.19 ? 238 GLU A CD    1 
ATOM   1905  O  OE1   . GLU A  1 240 ? -16.452 -32.695  -12.373 1.00 33.39 ? 238 GLU A OE1   1 
ATOM   1906  O  OE2   . GLU A  1 240 ? -15.664 -30.811  -11.535 1.00 27.27 ? 238 GLU A OE2   1 
ATOM   1907  N  N     . GLU A  1 241 ? -18.163 -32.998  -16.963 1.00 21.23 ? 239 GLU A N     1 
ATOM   1908  C  CA    . GLU A  1 241 ? -18.957 -33.597  -18.032 1.00 23.30 ? 239 GLU A CA    1 
ATOM   1909  C  C     . GLU A  1 241 ? -19.327 -35.004  -17.578 1.00 29.18 ? 239 GLU A C     1 
ATOM   1910  O  O     . GLU A  1 241 ? -18.485 -35.913  -17.601 1.00 23.38 ? 239 GLU A O     1 
ATOM   1911  C  CB    . GLU A  1 241 ? -18.156 -33.635  -19.337 1.00 22.55 ? 239 GLU A CB    1 
ATOM   1912  C  CG    . GLU A  1 241 ? -18.828 -34.363  -20.514 1.00 25.11 ? 239 GLU A CG    1 
ATOM   1913  C  CD    . GLU A  1 241 ? -20.191 -33.787  -20.901 1.00 35.03 ? 239 GLU A CD    1 
ATOM   1914  O  OE1   . GLU A  1 241 ? -21.173 -34.578  -20.921 1.00 37.47 ? 239 GLU A OE1   1 
ATOM   1915  O  OE2   . GLU A  1 241 ? -20.267 -32.559  -21.185 1.00 31.34 ? 239 GLU A OE2   1 
ATOM   1916  N  N     . GLY A  1 242 ? -20.577 -35.165  -17.131 1.00 31.31 ? 240 GLY A N     1 
ATOM   1917  C  CA    . GLY A  1 242 ? -20.998 -36.370  -16.430 1.00 30.72 ? 240 GLY A CA    1 
ATOM   1918  C  C     . GLY A  1 242 ? -20.004 -36.727  -15.330 1.00 28.82 ? 240 GLY A C     1 
ATOM   1919  O  O     . GLY A  1 242 ? -19.607 -35.877  -14.517 1.00 29.23 ? 240 GLY A O     1 
ATOM   1920  N  N     . PRO A  1 243 ? -19.541 -37.981  -15.324 1.00 26.70 ? 241 PRO A N     1 
ATOM   1921  C  CA    . PRO A  1 243 ? -18.642 -38.443  -14.252 1.00 29.20 ? 241 PRO A CA    1 
ATOM   1922  C  C     . PRO A  1 243 ? -17.164 -37.994  -14.400 1.00 27.12 ? 241 PRO A C     1 
ATOM   1923  O  O     . PRO A  1 243 ? -16.297 -38.370  -13.586 1.00 22.85 ? 241 PRO A O     1 
ATOM   1924  C  CB    . PRO A  1 243 ? -18.753 -39.974  -14.364 1.00 25.11 ? 241 PRO A CB    1 
ATOM   1925  C  CG    . PRO A  1 243 ? -18.928 -40.196  -15.871 1.00 19.76 ? 241 PRO A CG    1 
ATOM   1926  C  CD    . PRO A  1 243 ? -19.788 -39.019  -16.347 1.00 25.54 ? 241 PRO A CD    1 
ATOM   1927  N  N     . THR A  1 244 ? -16.872 -37.181  -15.414 1.00 29.92 ? 242 THR A N     1 
ATOM   1928  C  CA    . THR A  1 244 ? -15.489 -36.797  -15.688 1.00 19.61 ? 242 THR A CA    1 
ATOM   1929  C  C     . THR A  1 244 ? -15.140 -35.404  -15.186 1.00 21.75 ? 242 THR A C     1 
ATOM   1930  O  O     . THR A  1 244 ? -15.852 -34.420  -15.489 1.00 22.46 ? 242 THR A O     1 
ATOM   1931  C  CB    . THR A  1 244 ? -15.205 -36.835  -17.196 1.00 23.81 ? 242 THR A CB    1 
ATOM   1932  O  OG1   . THR A  1 244 ? -15.283 -38.195  -17.675 1.00 21.95 ? 242 THR A OG1   1 
ATOM   1933  C  CG2   . THR A  1 244 ? -13.826 -36.213  -17.499 1.00 17.38 ? 242 THR A CG2   1 
ATOM   1934  N  N     . HIS A  1 245 ? -14.061 -35.308  -14.420 1.00 19.99 ? 243 HIS A N     1 
ATOM   1935  C  CA    . HIS A  1 245 ? -13.613 -34.008  -13.932 1.00 20.19 ? 243 HIS A CA    1 
ATOM   1936  C  C     . HIS A  1 245 ? -12.623 -33.426  -14.923 1.00 23.21 ? 243 HIS A C     1 
ATOM   1937  O  O     . HIS A  1 245 ? -11.510 -33.934  -15.056 1.00 18.33 ? 243 HIS A O     1 
ATOM   1938  C  CB    . HIS A  1 245 ? -12.936 -34.132  -12.558 1.00 21.37 ? 243 HIS A CB    1 
ATOM   1939  C  CG    . HIS A  1 245 ? -13.760 -34.831  -11.517 1.00 29.07 ? 243 HIS A CG    1 
ATOM   1940  N  ND1   . HIS A  1 245 ? -14.879 -34.260  -10.936 1.00 34.26 ? 243 HIS A ND1   1 
ATOM   1941  C  CD2   . HIS A  1 245 ? -13.610 -36.041  -10.918 1.00 34.85 ? 243 HIS A CD2   1 
ATOM   1942  C  CE1   . HIS A  1 245 ? -15.387 -35.091  -10.043 1.00 33.41 ? 243 HIS A CE1   1 
ATOM   1943  N  NE2   . HIS A  1 245 ? -14.636 -36.179  -10.011 1.00 36.55 ? 243 HIS A NE2   1 
ATOM   1944  N  N     . PHE A  1 246 ? -12.990 -32.346  -15.596 1.00 19.20 ? 244 PHE A N     1 
ATOM   1945  C  CA    . PHE A  1 246 ? -12.058 -31.693  -16.513 1.00 18.21 ? 244 PHE A CA    1 
ATOM   1946  C  C     . PHE A  1 246 ? -11.211 -30.664  -15.774 1.00 20.76 ? 244 PHE A C     1 
ATOM   1947  O  O     . PHE A  1 246 ? -11.727 -29.852  -14.994 1.00 22.79 ? 244 PHE A O     1 
ATOM   1948  C  CB    . PHE A  1 246 ? -12.782 -31.029  -17.684 1.00 16.93 ? 244 PHE A CB    1 
ATOM   1949  C  CG    . PHE A  1 246 ? -11.848 -30.298  -18.626 1.00 22.65 ? 244 PHE A CG    1 
ATOM   1950  C  CD1   . PHE A  1 246 ? -10.932 -31.005  -19.426 1.00 21.22 ? 244 PHE A CD1   1 
ATOM   1951  C  CD2   . PHE A  1 246 ? -11.845 -28.915  -18.678 1.00 17.61 ? 244 PHE A CD2   1 
ATOM   1952  C  CE1   . PHE A  1 246 ? -10.067 -30.336  -20.280 1.00 15.59 ? 244 PHE A CE1   1 
ATOM   1953  C  CE2   . PHE A  1 246 ? -10.989 -28.224  -19.541 1.00 17.31 ? 244 PHE A CE2   1 
ATOM   1954  C  CZ    . PHE A  1 246 ? -10.096 -28.934  -20.338 1.00 18.46 ? 244 PHE A CZ    1 
ATOM   1955  N  N     . ILE A  1 247 ? -9.913  -30.696  -16.024 1.00 15.63 ? 245 ILE A N     1 
ATOM   1956  C  CA    . ILE A  1 247 ? -9.003  -29.659  -15.531 1.00 16.23 ? 245 ILE A CA    1 
ATOM   1957  C  C     . ILE A  1 247 ? -8.103  -29.152  -16.650 1.00 18.04 ? 245 ILE A C     1 
ATOM   1958  O  O     . ILE A  1 247 ? -7.427  -29.952  -17.292 1.00 20.52 ? 245 ILE A O     1 
ATOM   1959  C  CB    . ILE A  1 247 ? -8.126  -30.209  -14.387 1.00 19.47 ? 245 ILE A CB    1 
ATOM   1960  C  CG1   . ILE A  1 247 ? -9.007  -30.856  -13.307 1.00 23.54 ? 245 ILE A CG1   1 
ATOM   1961  C  CG2   . ILE A  1 247 ? -7.220  -29.117  -13.793 1.00 22.13 ? 245 ILE A CG2   1 
ATOM   1962  C  CD1   . ILE A  1 247 ? -8.285  -31.951  -12.476 1.00 21.90 ? 245 ILE A CD1   1 
ATOM   1963  N  N     . ALA A  1 248 ? -8.048  -27.824  -16.845 1.00 17.54 ? 246 ALA A N     1 
ATOM   1964  C  CA    . ALA A  1 248 ? -7.091  -27.217  -17.761 1.00 18.90 ? 246 ALA A CA    1 
ATOM   1965  C  C     . ALA A  1 248 ? -6.022  -26.461  -16.967 1.00 23.24 ? 246 ALA A C     1 
ATOM   1966  O  O     . ALA A  1 248 ? -6.318  -25.871  -15.931 1.00 20.25 ? 246 ALA A O     1 
ATOM   1967  C  CB    . ALA A  1 248 ? -7.811  -26.276  -18.750 1.00 18.33 ? 246 ALA A CB    1 
ATOM   1968  N  N     . LEU A  1 249 ? -4.790  -26.443  -17.470 1.00 19.18 ? 247 LEU A N     1 
ATOM   1969  C  CA    . LEU A  1 249 ? -3.683  -25.800  -16.762 1.00 22.24 ? 247 LEU A CA    1 
ATOM   1970  C  C     . LEU A  1 249 ? -2.895  -24.844  -17.650 1.00 17.88 ? 247 LEU A C     1 
ATOM   1971  O  O     . LEU A  1 249 ? -2.801  -25.053  -18.866 1.00 22.98 ? 247 LEU A O     1 
ATOM   1972  C  CB    . LEU A  1 249 ? -2.750  -26.870  -16.193 1.00 20.25 ? 247 LEU A CB    1 
ATOM   1973  C  CG    . LEU A  1 249 ? -3.401  -27.812  -15.196 1.00 20.79 ? 247 LEU A CG    1 
ATOM   1974  C  CD1   . LEU A  1 249 ? -2.573  -29.078  -15.127 1.00 21.29 ? 247 LEU A CD1   1 
ATOM   1975  C  CD2   . LEU A  1 249 ? -3.481  -27.147  -13.820 1.00 23.55 ? 247 LEU A CD2   1 
ATOM   1976  N  N     . GLY A  1 250 ? -2.295  -23.826  -17.034 1.00 21.27 ? 248 GLY A N     1 
ATOM   1977  C  CA    . GLY A  1 250 ? -1.609  -22.758  -17.754 1.00 22.25 ? 248 GLY A CA    1 
ATOM   1978  C  C     . GLY A  1 250 ? -0.169  -23.125  -18.069 1.00 25.66 ? 248 GLY A C     1 
ATOM   1979  O  O     . GLY A  1 250 ? 0.194   -24.317  -18.023 1.00 24.37 ? 248 GLY A O     1 
ATOM   1980  N  N     . LYS A  1 251 ? 0.670   -22.139  -18.377 1.00 28.27 ? 249 LYS A N     1 
ATOM   1981  C  CA    . LYS A  1 251 ? 2.051   -22.477  -18.727 1.00 25.12 ? 249 LYS A CA    1 
ATOM   1982  C  C     . LYS A  1 251 ? 3.072   -22.138  -17.661 1.00 24.07 ? 249 LYS A C     1 
ATOM   1983  O  O     . LYS A  1 251 ? 2.935   -21.155  -16.924 1.00 26.41 ? 249 LYS A O     1 
ATOM   1984  C  CB    . LYS A  1 251 ? 2.448   -21.913  -20.091 1.00 28.40 ? 249 LYS A CB    1 
ATOM   1985  C  CG    . LYS A  1 251 ? 2.912   -20.476  -20.126 1.00 36.86 ? 249 LYS A CG    1 
ATOM   1986  C  CD    . LYS A  1 251 ? 3.133   -20.075  -21.591 1.00 33.27 ? 249 LYS A CD    1 
ATOM   1987  C  CE    . LYS A  1 251 ? 3.650   -18.654  -21.735 1.00 46.10 ? 249 LYS A CE    1 
ATOM   1988  N  NZ    . LYS A  1 251 ? 4.072   -18.412  -23.153 1.00 47.14 ? 249 LYS A NZ    1 
ATOM   1989  N  N     . ILE A  1 252 ? 4.089   -22.985  -17.573 1.00 22.86 ? 250 ILE A N     1 
ATOM   1990  C  CA    . ILE A  1 252 ? 5.148   -22.847  -16.580 1.00 24.44 ? 250 ILE A CA    1 
ATOM   1991  C  C     . ILE A  1 252 ? 5.614   -21.392  -16.561 1.00 26.36 ? 250 ILE A C     1 
ATOM   1992  O  O     . ILE A  1 252 ? 5.770   -20.786  -17.620 1.00 22.82 ? 250 ILE A O     1 
ATOM   1993  C  CB    . ILE A  1 252 ? 6.292   -23.849  -16.862 1.00 21.91 ? 250 ILE A CB    1 
ATOM   1994  C  CG1   . ILE A  1 252 ? 5.784   -25.272  -16.593 1.00 22.52 ? 250 ILE A CG1   1 
ATOM   1995  C  CG2   . ILE A  1 252 ? 7.447   -23.667  -15.917 1.00 19.17 ? 250 ILE A CG2   1 
ATOM   1996  C  CD1   . ILE A  1 252 ? 5.458   -25.517  -15.106 1.00 21.35 ? 250 ILE A CD1   1 
ATOM   1997  N  N     . GLY A  1 253 ? 5.842   -20.837  -15.367 1.00 31.81 ? 251 GLY A N     1 
ATOM   1998  C  CA    . GLY A  1 253 ? 6.083   -19.404  -15.214 1.00 26.41 ? 251 GLY A CA    1 
ATOM   1999  C  C     . GLY A  1 253 ? 4.875   -18.627  -14.667 1.00 41.86 ? 251 GLY A C     1 
ATOM   2000  O  O     . GLY A  1 253 ? 5.034   -17.505  -14.197 1.00 36.63 ? 251 GLY A O     1 
ATOM   2001  N  N     . TYR A  1 254 ? 3.671   -19.205  -14.749 1.00 33.20 ? 252 TYR A N     1 
ATOM   2002  C  CA    . TYR A  1 254 ? 2.453   -18.626  -14.154 1.00 35.12 ? 252 TYR A CA    1 
ATOM   2003  C  C     . TYR A  1 254 ? 1.856   -19.568  -13.105 1.00 44.86 ? 252 TYR A C     1 
ATOM   2004  O  O     . TYR A  1 254 ? 2.008   -20.791  -13.211 1.00 38.53 ? 252 TYR A O     1 
ATOM   2005  C  CB    . TYR A  1 254 ? 1.412   -18.324  -15.230 1.00 39.70 ? 252 TYR A CB    1 
ATOM   2006  C  CG    . TYR A  1 254 ? 1.974   -17.405  -16.257 1.00 41.78 ? 252 TYR A CG    1 
ATOM   2007  C  CD1   . TYR A  1 254 ? 1.934   -16.031  -16.073 1.00 41.29 ? 252 TYR A CD1   1 
ATOM   2008  C  CD2   . TYR A  1 254 ? 2.615   -17.909  -17.378 1.00 44.28 ? 252 TYR A CD2   1 
ATOM   2009  C  CE1   . TYR A  1 254 ? 2.483   -15.179  -17.007 1.00 54.39 ? 252 TYR A CE1   1 
ATOM   2010  C  CE2   . TYR A  1 254 ? 3.171   -17.076  -18.314 1.00 54.57 ? 252 TYR A CE2   1 
ATOM   2011  C  CZ    . TYR A  1 254 ? 3.105   -15.708  -18.126 1.00 64.78 ? 252 TYR A CZ    1 
ATOM   2012  O  OH    . TYR A  1 254 ? 3.669   -14.866  -19.061 1.00 71.65 ? 252 TYR A OH    1 
ATOM   2013  N  N     . LYS A  1 255 ? 1.160   -19.025  -12.103 1.00 40.81 ? 253 LYS A N     1 
ATOM   2014  C  CA    . LYS A  1 255 ? 0.828   -19.854  -10.938 1.00 43.42 ? 253 LYS A CA    1 
ATOM   2015  C  C     . LYS A  1 255 ? -0.289  -20.880  -11.241 1.00 43.32 ? 253 LYS A C     1 
ATOM   2016  O  O     . LYS A  1 255 ? -0.491  -21.843  -10.483 1.00 44.72 ? 253 LYS A O     1 
ATOM   2017  C  CB    . LYS A  1 255 ? 0.568   -18.976  -9.692  1.00 45.63 ? 253 LYS A CB    1 
ATOM   2018  C  CG    . LYS A  1 255 ? -0.013  -19.682  -8.449  1.00 55.88 ? 253 LYS A CG    1 
ATOM   2019  C  CD    . LYS A  1 255 ? 0.604   -21.037  -8.128  1.00 52.94 ? 253 LYS A CD    1 
ATOM   2020  C  CE    . LYS A  1 255 ? -0.106  -21.664  -6.910  1.00 63.36 ? 253 LYS A CE    1 
ATOM   2021  N  NZ    . LYS A  1 255 ? 0.411   -23.030  -6.541  1.00 55.75 ? 253 LYS A NZ    1 
ATOM   2022  N  N     . ASN A  1 256 ? -0.975  -20.690  -12.372 1.00 38.82 ? 254 ASN A N     1 
ATOM   2023  C  CA    . ASN A  1 256 ? -2.026  -21.610  -12.799 1.00 39.16 ? 254 ASN A CA    1 
ATOM   2024  C  C     . ASN A  1 256 ? -1.511  -22.761  -13.715 1.00 33.50 ? 254 ASN A C     1 
ATOM   2025  O  O     . ASN A  1 256 ? -2.284  -23.377  -14.450 1.00 31.56 ? 254 ASN A O     1 
ATOM   2026  C  CB    . ASN A  1 256 ? -3.174  -20.842  -13.477 1.00 35.97 ? 254 ASN A CB    1 
ATOM   2027  C  CG    . ASN A  1 256 ? -2.731  -20.106  -14.733 1.00 38.12 ? 254 ASN A CG    1 
ATOM   2028  O  OD1   . ASN A  1 256 ? -1.580  -20.204  -15.155 1.00 40.28 ? 254 ASN A OD1   1 
ATOM   2029  N  ND2   . ASN A  1 256 ? -3.655  -19.373  -15.345 1.00 40.21 ? 254 ASN A ND2   1 
ATOM   2030  N  N     . ALA A  1 257 ? -0.212  -23.052  -13.638 1.00 31.42 ? 255 ALA A N     1 
ATOM   2031  C  CA    . ALA A  1 257 ? 0.431   -24.070  -14.495 1.00 27.54 ? 255 ALA A CA    1 
ATOM   2032  C  C     . ALA A  1 257 ? 0.496   -25.471  -13.867 1.00 27.23 ? 255 ALA A C     1 
ATOM   2033  O  O     . ALA A  1 257 ? 0.596   -26.478  -14.576 1.00 22.39 ? 255 ALA A O     1 
ATOM   2034  C  CB    . ALA A  1 257 ? 1.827   -23.634  -14.865 1.00 20.90 ? 255 ALA A CB    1 
ATOM   2035  N  N     . ILE A  1 258 ? 0.516   -25.525  -12.540 1.00 29.34 ? 256 ILE A N     1 
ATOM   2036  C  CA    . ILE A  1 258 ? 0.730   -26.776  -11.819 1.00 20.07 ? 256 ILE A CA    1 
ATOM   2037  C  C     . ILE A  1 258 ? -0.351  -26.920  -10.803 1.00 28.25 ? 256 ILE A C     1 
ATOM   2038  O  O     . ILE A  1 258 ? -0.711  -25.956  -10.116 1.00 28.36 ? 256 ILE A O     1 
ATOM   2039  C  CB    . ILE A  1 258 ? 2.038   -26.747  -11.044 1.00 20.94 ? 256 ILE A CB    1 
ATOM   2040  C  CG1   . ILE A  1 258 ? 3.201   -26.397  -11.976 1.00 24.71 ? 256 ILE A CG1   1 
ATOM   2041  C  CG2   . ILE A  1 258 ? 2.300   -28.104  -10.372 1.00 19.11 ? 256 ILE A CG2   1 
ATOM   2042  C  CD1   . ILE A  1 258 ? 4.582   -26.776  -11.423 1.00 21.93 ? 256 ILE A CD1   1 
ATOM   2043  N  N     . SER A  1 259 ? -0.871  -28.129  -10.693 1.00 22.61 ? 257 SER A N     1 
ATOM   2044  C  CA    . SER A  1 259 ? -1.859  -28.419  -9.701  1.00 20.79 ? 257 SER A CA    1 
ATOM   2045  C  C     . SER A  1 259 ? -1.535  -29.823  -9.222  1.00 25.76 ? 257 SER A C     1 
ATOM   2046  O  O     . SER A  1 259 ? -0.522  -30.406  -9.646  1.00 20.84 ? 257 SER A O     1 
ATOM   2047  C  CB    . SER A  1 259 ? -3.248  -28.324  -10.310 1.00 29.39 ? 257 SER A CB    1 
ATOM   2048  O  OG    . SER A  1 259 ? -4.214  -28.291  -9.295  1.00 24.67 ? 257 SER A OG    1 
ATOM   2049  N  N     . TYR A  1 260 ? -2.378  -30.373  -8.349  1.00 21.58 ? 258 TYR A N     1 
ATOM   2050  C  CA    . TYR A  1 260 ? -2.097  -31.671  -7.743  1.00 23.98 ? 258 TYR A CA    1 
ATOM   2051  C  C     . TYR A  1 260 ? -3.387  -32.444  -7.547  1.00 27.86 ? 258 TYR A C     1 
ATOM   2052  O  O     . TYR A  1 260 ? -4.420  -31.878  -7.196  1.00 32.62 ? 258 TYR A O     1 
ATOM   2053  C  CB    . TYR A  1 260 ? -1.353  -31.517  -6.407  1.00 25.04 ? 258 TYR A CB    1 
ATOM   2054  C  CG    . TYR A  1 260 ? -0.084  -30.717  -6.564  1.00 25.53 ? 258 TYR A CG    1 
ATOM   2055  C  CD1   . TYR A  1 260 ? -0.138  -29.338  -6.642  1.00 24.75 ? 258 TYR A CD1   1 
ATOM   2056  C  CD2   . TYR A  1 260 ? 1.146   -31.334  -6.697  1.00 23.74 ? 258 TYR A CD2   1 
ATOM   2057  C  CE1   . TYR A  1 260 ? 1.009   -28.576  -6.822  1.00 29.97 ? 258 TYR A CE1   1 
ATOM   2058  C  CE2   . TYR A  1 260 ? 2.327   -30.580  -6.882  1.00 23.18 ? 258 TYR A CE2   1 
ATOM   2059  C  CZ    . TYR A  1 260 ? 2.239   -29.208  -6.943  1.00 28.07 ? 258 TYR A CZ    1 
ATOM   2060  O  OH    . TYR A  1 260 ? 3.349   -28.431  -7.140  1.00 22.25 ? 258 TYR A OH    1 
ATOM   2061  N  N     . LEU A  1 261 ? -3.314  -33.741  -7.797  1.00 24.99 ? 259 LEU A N     1 
ATOM   2062  C  CA    . LEU A  1 261 ? -4.430  -34.629  -7.568  1.00 21.06 ? 259 LEU A CA    1 
ATOM   2063  C  C     . LEU A  1 261 ? -4.024  -35.482  -6.382  1.00 28.46 ? 259 LEU A C     1 
ATOM   2064  O  O     . LEU A  1 261 ? -2.949  -36.109  -6.390  1.00 25.91 ? 259 LEU A O     1 
ATOM   2065  C  CB    . LEU A  1 261 ? -4.661  -35.540  -8.782  1.00 23.07 ? 259 LEU A CB    1 
ATOM   2066  C  CG    . LEU A  1 261 ? -4.965  -34.957  -10.166 1.00 27.09 ? 259 LEU A CG    1 
ATOM   2067  C  CD1   . LEU A  1 261 ? -5.304  -36.081  -11.162 1.00 30.40 ? 259 LEU A CD1   1 
ATOM   2068  C  CD2   . LEU A  1 261 ? -6.134  -33.981  -10.101 1.00 30.18 ? 259 LEU A CD2   1 
ATOM   2069  N  N     . ASP A  1 262 ? -4.871  -35.522  -5.360  1.00 26.60 ? 260 ASP A N     1 
ATOM   2070  C  CA    . ASP A  1 262 ? -4.595  -36.389  -4.240  1.00 32.93 ? 260 ASP A CA    1 
ATOM   2071  C  C     . ASP A  1 262 ? -5.486  -37.614  -4.381  1.00 30.91 ? 260 ASP A C     1 
ATOM   2072  O  O     . ASP A  1 262 ? -6.711  -37.533  -4.222  1.00 32.32 ? 260 ASP A O     1 
ATOM   2073  C  CB    . ASP A  1 262 ? -4.850  -35.623  -2.940  1.00 33.48 ? 260 ASP A CB    1 
ATOM   2074  C  CG    . ASP A  1 262 ? -4.044  -34.341  -2.861  1.00 32.28 ? 260 ASP A CG    1 
ATOM   2075  O  OD1   . ASP A  1 262 ? -2.836  -34.389  -3.153  1.00 30.62 ? 260 ASP A OD1   1 
ATOM   2076  O  OD2   . ASP A  1 262 ? -4.614  -33.286  -2.530  1.00 36.63 ? 260 ASP A OD2   1 
ATOM   2077  N  N     . LEU A  1 263 ? -4.857  -38.739  -4.706  1.00 30.47 ? 261 LEU A N     1 
ATOM   2078  C  CA    . LEU A  1 263 ? -5.578  -39.955  -5.061  1.00 25.34 ? 261 LEU A CA    1 
ATOM   2079  C  C     . LEU A  1 263 ? -5.318  -41.098  -4.077  1.00 28.32 ? 261 LEU A C     1 
ATOM   2080  O  O     . LEU A  1 263 ? -4.242  -41.205  -3.490  1.00 31.51 ? 261 LEU A O     1 
ATOM   2081  C  CB    . LEU A  1 263 ? -5.205  -40.381  -6.489  1.00 28.11 ? 261 LEU A CB    1 
ATOM   2082  C  CG    . LEU A  1 263 ? -6.113  -39.917  -7.644  1.00 39.86 ? 261 LEU A CG    1 
ATOM   2083  C  CD1   . LEU A  1 263 ? -6.792  -38.576  -7.378  1.00 33.21 ? 261 LEU A CD1   1 
ATOM   2084  C  CD2   . LEU A  1 263 ? -5.385  -39.883  -8.997  1.00 28.02 ? 261 LEU A CD2   1 
ATOM   2085  N  N     . PRO A  1 264 ? -6.322  -41.966  -3.884  1.00 34.49 ? 262 PRO A N     1 
ATOM   2086  C  CA    . PRO A  1 264 ? -6.071  -43.163  -3.076  1.00 34.50 ? 262 PRO A CA    1 
ATOM   2087  C  C     . PRO A  1 264 ? -4.899  -43.943  -3.653  1.00 33.96 ? 262 PRO A C     1 
ATOM   2088  O  O     . PRO A  1 264 ? -4.816  -44.094  -4.868  1.00 33.01 ? 262 PRO A O     1 
ATOM   2089  C  CB    . PRO A  1 264 ? -7.364  -43.981  -3.238  1.00 30.86 ? 262 PRO A CB    1 
ATOM   2090  C  CG    . PRO A  1 264 ? -8.152  -43.308  -4.354  1.00 39.73 ? 262 PRO A CG    1 
ATOM   2091  C  CD    . PRO A  1 264 ? -7.720  -41.875  -4.335  1.00 25.82 ? 262 PRO A CD    1 
ATOM   2092  N  N     . LEU A  1 265 ? -4.012  -44.434  -2.798  1.00 31.60 ? 263 LEU A N     1 
ATOM   2093  C  CA    . LEU A  1 265 ? -2.958  -45.320  -3.248  1.00 33.26 ? 263 LEU A CA    1 
ATOM   2094  C  C     . LEU A  1 265 ? -3.259  -46.746  -2.763  1.00 39.52 ? 263 LEU A C     1 
ATOM   2095  O  O     . LEU A  1 265 ? -3.044  -47.049  -1.586  1.00 34.40 ? 263 LEU A O     1 
ATOM   2096  C  CB    . LEU A  1 265 ? -1.618  -44.847  -2.702  1.00 35.20 ? 263 LEU A CB    1 
ATOM   2097  C  CG    . LEU A  1 265 ? -0.392  -45.692  -3.045  1.00 36.14 ? 263 LEU A CG    1 
ATOM   2098  C  CD1   . LEU A  1 265 ? -0.233  -45.865  -4.569  1.00 28.01 ? 263 LEU A CD1   1 
ATOM   2099  C  CD2   . LEU A  1 265 ? 0.850   -45.039  -2.420  1.00 30.60 ? 263 LEU A CD2   1 
ATOM   2100  N  N     . LYS A  1 266 ? -3.778  -47.593  -3.660  1.00 40.09 ? 264 LYS A N     1 
ATOM   2101  C  CA    . LYS A  1 266 ? -4.164  -48.976  -3.339  1.00 44.61 ? 264 LYS A CA    1 
ATOM   2102  C  C     . LYS A  1 266 ? -2.931  -49.869  -3.411  1.00 43.28 ? 264 LYS A C     1 
ATOM   2103  O  O     . LYS A  1 266 ? -2.885  -50.946  -2.817  1.00 46.79 ? 264 LYS A O     1 
ATOM   2104  C  CB    . LYS A  1 266 ? -5.261  -49.481  -4.304  1.00 46.89 ? 264 LYS A CB    1 
ATOM   2105  C  CG    . LYS A  1 266 ? -5.339  -51.017  -4.468  1.00 60.89 ? 264 LYS A CG    1 
ATOM   2106  C  CD    . LYS A  1 266 ? -6.437  -51.496  -5.461  1.00 57.83 ? 264 LYS A CD    1 
ATOM   2107  C  CE    . LYS A  1 266 ? -6.193  -51.009  -6.902  1.00 50.65 ? 264 LYS A CE    1 
ATOM   2108  N  NZ    . LYS A  1 266 ? -7.085  -51.669  -7.923  1.00 55.53 ? 264 LYS A NZ    1 
ATOM   2109  N  N     . GLN A  1 267 ? -1.920  -49.400  -4.138  1.00 46.94 ? 265 GLN A N     1 
ATOM   2110  C  CA    . GLN A  1 267 ? -0.709  -50.186  -4.396  1.00 47.35 ? 265 GLN A CA    1 
ATOM   2111  C  C     . GLN A  1 267 ? 0.363   -49.272  -4.986  1.00 37.37 ? 265 GLN A C     1 
ATOM   2112  O  O     . GLN A  1 267 ? 0.055   -48.358  -5.758  1.00 36.30 ? 265 GLN A O     1 
ATOM   2113  C  CB    . GLN A  1 267 ? -1.017  -51.314  -5.388  1.00 45.76 ? 265 GLN A CB    1 
ATOM   2114  C  CG    . GLN A  1 267 ? -1.369  -50.811  -6.810  1.00 42.40 ? 265 GLN A CG    1 
ATOM   2115  C  CD    . GLN A  1 267 ? -2.009  -51.888  -7.669  1.00 43.35 ? 265 GLN A CD    1 
ATOM   2116  O  OE1   . GLN A  1 267 ? -2.832  -52.668  -7.179  1.00 57.57 ? 265 GLN A OE1   1 
ATOM   2117  N  NE2   . GLN A  1 267 ? -1.643  -51.935  -8.965  1.00 40.73 ? 265 GLN A NE2   1 
ATOM   2118  N  N     . LYS A  1 268 ? 1.619   -49.504  -4.633  1.00 35.99 ? 266 LYS A N     1 
ATOM   2119  C  CA    . LYS A  1 268 ? 2.692   -48.750  -5.260  1.00 36.36 ? 266 LYS A CA    1 
ATOM   2120  C  C     . LYS A  1 268 ? 3.376   -49.684  -6.247  1.00 32.00 ? 266 LYS A C     1 
ATOM   2121  O  O     . LYS A  1 268 ? 3.837   -50.761  -5.871  1.00 33.80 ? 266 LYS A O     1 
ATOM   2122  C  CB    . LYS A  1 268 ? 3.658   -48.229  -4.217  1.00 34.77 ? 266 LYS A CB    1 
ATOM   2123  C  CG    . LYS A  1 268 ? 4.825   -47.472  -4.793  1.00 38.34 ? 266 LYS A CG    1 
ATOM   2124  C  CD    . LYS A  1 268 ? 5.849   -47.200  -3.702  1.00 41.01 ? 266 LYS A CD    1 
ATOM   2125  C  CE    . LYS A  1 268 ? 6.853   -46.143  -4.122  1.00 43.55 ? 266 LYS A CE    1 
ATOM   2126  N  NZ    . LYS A  1 268 ? 7.741   -45.810  -2.968  1.00 54.34 ? 266 LYS A NZ    1 
ATOM   2127  N  N     . THR A  1 269 ? 3.375   -49.306  -7.522  1.00 33.21 ? 267 THR A N     1 
ATOM   2128  C  CA    . THR A  1 269 ? 3.808   -50.221  -8.585  1.00 32.86 ? 267 THR A CA    1 
ATOM   2129  C  C     . THR A  1 269 ? 4.513   -49.452  -9.659  1.00 28.41 ? 267 THR A C     1 
ATOM   2130  O  O     . THR A  1 269 ? 3.994   -48.419  -10.093 1.00 30.44 ? 267 THR A O     1 
ATOM   2131  C  CB    . THR A  1 269 ? 2.610   -50.853  -9.311  1.00 23.95 ? 267 THR A CB    1 
ATOM   2132  O  OG1   . THR A  1 269 ? 1.659   -51.327  -8.361  1.00 40.30 ? 267 THR A OG1   1 
ATOM   2133  C  CG2   . THR A  1 269 ? 3.088   -52.016  -10.184 1.00 30.97 ? 267 THR A CG2   1 
ATOM   2134  N  N     . ASP A  1 270 ? 5.631   -49.975  -10.152 1.00 25.50 ? 268 ASP A N     1 
ATOM   2135  C  CA    . ASP A  1 270 ? 6.415   -49.259  -11.150 1.00 22.50 ? 268 ASP A CA    1 
ATOM   2136  C  C     . ASP A  1 270 ? 5.593   -48.961  -12.408 1.00 22.46 ? 268 ASP A C     1 
ATOM   2137  O  O     . ASP A  1 270 ? 4.550   -49.562  -12.637 1.00 22.78 ? 268 ASP A O     1 
ATOM   2138  C  CB    . ASP A  1 270 ? 7.619   -50.071  -11.570 1.00 26.33 ? 268 ASP A CB    1 
ATOM   2139  C  CG    . ASP A  1 270 ? 8.692   -50.145  -10.500 1.00 31.05 ? 268 ASP A CG    1 
ATOM   2140  O  OD1   . ASP A  1 270 ? 8.575   -49.483  -9.453  1.00 34.48 ? 268 ASP A OD1   1 
ATOM   2141  O  OD2   . ASP A  1 270 ? 9.662   -50.878  -10.730 1.00 35.59 ? 268 ASP A OD2   1 
ATOM   2142  N  N     . LEU A  1 271 ? 6.092   -48.047  -13.233 1.00 19.39 ? 269 LEU A N     1 
ATOM   2143  C  CA    . LEU A  1 271 ? 5.444   -47.745  -14.496 1.00 19.84 ? 269 LEU A CA    1 
ATOM   2144  C  C     . LEU A  1 271 ? 5.395   -48.993  -15.391 1.00 17.50 ? 269 LEU A C     1 
ATOM   2145  O  O     . LEU A  1 271 ? 6.440   -49.641  -15.608 1.00 18.80 ? 269 LEU A O     1 
ATOM   2146  C  CB    . LEU A  1 271 ? 6.246   -46.659  -15.187 1.00 15.65 ? 269 LEU A CB    1 
ATOM   2147  C  CG    . LEU A  1 271 ? 5.795   -46.197  -16.572 1.00 15.57 ? 269 LEU A CG    1 
ATOM   2148  C  CD1   . LEU A  1 271 ? 4.415   -45.583  -16.471 1.00 14.36 ? 269 LEU A CD1   1 
ATOM   2149  C  CD2   . LEU A  1 271 ? 6.801   -45.145  -17.070 1.00 13.14 ? 269 LEU A CD2   1 
ATOM   2150  N  N     . GLU A  1 272 ? 4.209   -49.296  -15.951 1.00 17.73 ? 270 GLU A N     1 
ATOM   2151  C  CA    . GLU A  1 272 ? 3.997   -50.519  -16.747 1.00 16.51 ? 270 GLU A CA    1 
ATOM   2152  C  C     . GLU A  1 272 ? 3.212   -50.214  -18.020 1.00 14.31 ? 270 GLU A C     1 
ATOM   2153  O  O     . GLU A  1 272 ? 2.446   -49.261  -18.066 1.00 18.92 ? 270 GLU A O     1 
ATOM   2154  C  CB    . GLU A  1 272 ? 3.298   -51.620  -15.922 1.00 18.30 ? 270 GLU A CB    1 
ATOM   2155  C  CG    . GLU A  1 272 ? 4.222   -52.518  -15.087 1.00 23.04 ? 270 GLU A CG    1 
ATOM   2156  C  CD    . GLU A  1 272 ? 3.459   -53.352  -14.031 1.00 30.30 ? 270 GLU A CD    1 
ATOM   2157  O  OE1   . GLU A  1 272 ? 2.234   -53.187  -13.883 1.00 30.76 ? 270 GLU A OE1   1 
ATOM   2158  O  OE2   . GLU A  1 272 ? 4.100   -54.156  -13.325 1.00 35.55 ? 270 GLU A OE2   1 
ATOM   2159  N  N     . TYR A  1 273 ? 3.442   -51.000  -19.063 1.00 14.99 ? 271 TYR A N     1 
ATOM   2160  C  CA    . TYR A  1 273 ? 2.564   -50.935  -20.240 1.00 17.40 ? 271 TYR A CA    1 
ATOM   2161  C  C     . TYR A  1 273 ? 1.202   -51.448  -19.813 1.00 16.23 ? 271 TYR A C     1 
ATOM   2162  O  O     . TYR A  1 273 ? 1.127   -52.376  -19.001 1.00 16.41 ? 271 TYR A O     1 
ATOM   2163  C  CB    . TYR A  1 273 ? 3.097   -51.830  -21.368 1.00 18.57 ? 271 TYR A CB    1 
ATOM   2164  C  CG    . TYR A  1 273 ? 4.453   -51.401  -21.828 1.00 14.19 ? 271 TYR A CG    1 
ATOM   2165  C  CD1   . TYR A  1 273 ? 4.614   -50.249  -22.609 1.00 12.18 ? 271 TYR A CD1   1 
ATOM   2166  C  CD2   . TYR A  1 273 ? 5.584   -52.109  -21.445 1.00 16.23 ? 271 TYR A CD2   1 
ATOM   2167  C  CE1   . TYR A  1 273 ? 5.877   -49.822  -23.019 1.00 15.56 ? 271 TYR A CE1   1 
ATOM   2168  C  CE2   . TYR A  1 273 ? 6.867   -51.690  -21.839 1.00 15.57 ? 271 TYR A CE2   1 
ATOM   2169  C  CZ    . TYR A  1 273 ? 7.012   -50.563  -22.629 1.00 15.85 ? 271 TYR A CZ    1 
ATOM   2170  O  OH    . TYR A  1 273 ? 8.294   -50.136  -22.982 1.00 15.41 ? 271 TYR A OH    1 
ATOM   2171  N  N     . ASP A  1 274 ? 0.133   -50.837  -20.329 1.00 17.57 ? 272 ASP A N     1 
ATOM   2172  C  CA    . ASP A  1 274 ? -1.247  -51.323  -20.096 1.00 16.96 ? 272 ASP A CA    1 
ATOM   2173  C  C     . ASP A  1 274 ? -1.530  -52.536  -20.992 1.00 12.78 ? 272 ASP A C     1 
ATOM   2174  O  O     . ASP A  1 274 ? -1.258  -52.512  -22.205 1.00 14.75 ? 272 ASP A O     1 
ATOM   2175  C  CB    . ASP A  1 274 ? -2.287  -50.200  -20.367 1.00 10.55 ? 272 ASP A CB    1 
ATOM   2176  C  CG    . ASP A  1 274 ? -3.723  -50.688  -20.220 1.00 16.36 ? 272 ASP A CG    1 
ATOM   2177  O  OD1   . ASP A  1 274 ? -4.162  -50.923  -19.060 1.00 14.57 ? 272 ASP A OD1   1 
ATOM   2178  O  OD2   . ASP A  1 274 ? -4.408  -50.828  -21.258 1.00 16.24 ? 272 ASP A OD2   1 
ATOM   2179  N  N     . LYS A  1 275 ? -2.089  -53.611  -20.428 1.00 14.85 ? 273 LYS A N     1 
ATOM   2180  C  CA    . LYS A  1 275 ? -2.233  -54.850  -21.203 1.00 11.73 ? 273 LYS A CA    1 
ATOM   2181  C  C     . LYS A  1 275 ? -3.235  -54.726  -22.349 1.00 16.11 ? 273 LYS A C     1 
ATOM   2182  O  O     . LYS A  1 275 ? -3.001  -55.235  -23.458 1.00 19.03 ? 273 LYS A O     1 
ATOM   2183  C  CB    . LYS A  1 275 ? -2.595  -56.031  -20.288 1.00 17.12 ? 273 LYS A CB    1 
ATOM   2184  C  CG    . LYS A  1 275 ? -1.513  -56.338  -19.243 1.00 25.00 ? 273 LYS A CG    1 
ATOM   2185  C  CD    . LYS A  1 275 ? -1.846  -57.585  -18.410 1.00 26.12 ? 273 LYS A CD    1 
ATOM   2186  C  CE    . LYS A  1 275 ? -0.820  -57.798  -17.296 1.00 33.77 ? 273 LYS A CE    1 
ATOM   2187  N  NZ    . LYS A  1 275 ? -0.792  -56.613  -16.366 1.00 43.55 ? 273 LYS A NZ    1 
ATOM   2188  N  N     . ASP A  1 276 ? -4.353  -54.045  -22.103 1.00 15.29 ? 274 ASP A N     1 
ATOM   2189  C  CA    . ASP A  1 276 ? -5.304  -53.843  -23.197 1.00 14.08 ? 274 ASP A CA    1 
ATOM   2190  C  C     . ASP A  1 276 ? -4.677  -53.045  -24.334 1.00 17.00 ? 274 ASP A C     1 
ATOM   2191  O  O     . ASP A  1 276 ? -4.879  -53.358  -25.526 1.00 17.84 ? 274 ASP A O     1 
ATOM   2192  C  CB    . ASP A  1 276 ? -6.596  -53.179  -22.710 1.00 14.90 ? 274 ASP A CB    1 
ATOM   2193  C  CG    . ASP A  1 276 ? -7.411  -54.103  -21.826 1.00 22.78 ? 274 ASP A CG    1 
ATOM   2194  O  OD1   . ASP A  1 276 ? -7.497  -55.295  -22.198 1.00 18.30 ? 274 ASP A OD1   1 
ATOM   2195  O  OD2   . ASP A  1 276 ? -7.933  -53.650  -20.782 1.00 21.77 ? 274 ASP A OD2   1 
ATOM   2196  N  N     . TRP A  1 277 ? -3.925  -52.005  -23.959 1.00 16.88 ? 275 TRP A N     1 
ATOM   2197  C  CA    . TRP A  1 277 ? -3.194  -51.189  -24.939 1.00 14.08 ? 275 TRP A CA    1 
ATOM   2198  C  C     . TRP A  1 277 ? -2.197  -52.025  -25.746 1.00 15.03 ? 275 TRP A C     1 
ATOM   2199  O  O     . TRP A  1 277 ? -2.160  -51.958  -26.975 1.00 15.61 ? 275 TRP A O     1 
ATOM   2200  C  CB    . TRP A  1 277 ? -2.461  -50.014  -24.270 1.00 13.06 ? 275 TRP A CB    1 
ATOM   2201  C  CG    . TRP A  1 277 ? -1.563  -49.353  -25.289 1.00 15.81 ? 275 TRP A CG    1 
ATOM   2202  C  CD1   . TRP A  1 277 ? -0.185  -49.349  -25.320 1.00 15.77 ? 275 TRP A CD1   1 
ATOM   2203  C  CD2   . TRP A  1 277 ? -2.003  -48.664  -26.475 1.00 12.58 ? 275 TRP A CD2   1 
ATOM   2204  N  NE1   . TRP A  1 277 ? 0.254   -48.697  -26.460 1.00 15.60 ? 275 TRP A NE1   1 
ATOM   2205  C  CE2   . TRP A  1 277 ? -0.843  -48.262  -27.187 1.00 13.42 ? 275 TRP A CE2   1 
ATOM   2206  C  CE3   . TRP A  1 277 ? -3.267  -48.347  -27.003 1.00 11.35 ? 275 TRP A CE3   1 
ATOM   2207  C  CZ2   . TRP A  1 277 ? -0.903  -47.534  -28.410 1.00 15.09 ? 275 TRP A CZ2   1 
ATOM   2208  C  CZ3   . TRP A  1 277 ? -3.343  -47.630  -28.213 1.00 14.01 ? 275 TRP A CZ3   1 
ATOM   2209  C  CH2   . TRP A  1 277 ? -2.152  -47.227  -28.902 1.00 18.45 ? 275 TRP A CH2   1 
ATOM   2210  N  N     . VAL A  1 278 ? -1.390  -52.817  -25.054 1.00 11.39 ? 276 VAL A N     1 
ATOM   2211  C  CA    . VAL A  1 278 ? -0.463  -53.719  -25.736 1.00 14.14 ? 276 VAL A CA    1 
ATOM   2212  C  C     . VAL A  1 278 ? -1.168  -54.613  -26.746 1.00 17.82 ? 276 VAL A C     1 
ATOM   2213  O  O     . VAL A  1 278 ? -0.697  -54.776  -27.868 1.00 16.32 ? 276 VAL A O     1 
ATOM   2214  C  CB    . VAL A  1 278 ? 0.348   -54.538  -24.719 1.00 14.89 ? 276 VAL A CB    1 
ATOM   2215  C  CG1   . VAL A  1 278 ? 0.971   -55.807  -25.380 1.00 12.77 ? 276 VAL A CG1   1 
ATOM   2216  C  CG2   . VAL A  1 278 ? 1.407   -53.625  -24.108 1.00 12.88 ? 276 VAL A CG2   1 
ATOM   2217  N  N     . CYS A  1 279 ? -2.309  -55.169  -26.346 1.00 18.55 ? 277 CYS A N     1 
ATOM   2218  C  CA    . CYS A  1 279 ? -3.106  -56.004  -27.237 1.00 15.38 ? 277 CYS A CA    1 
ATOM   2219  C  C     . CYS A  1 279 ? -3.574  -55.272  -28.519 1.00 16.75 ? 277 CYS A C     1 
ATOM   2220  O  O     . CYS A  1 279 ? -3.485  -55.809  -29.624 1.00 15.97 ? 277 CYS A O     1 
ATOM   2221  C  CB    . CYS A  1 279 ? -4.274  -56.622  -26.455 1.00 17.59 ? 277 CYS A CB    1 
ATOM   2222  S  SG    . CYS A  1 279 ? -3.730  -57.964  -25.312 1.00 19.80 ? 277 CYS A SG    1 
ATOM   2223  N  N     . ASN A  1 280 ? -4.030  -54.030  -28.360 1.00 17.90 ? 278 ASN A N     1 
ATOM   2224  C  CA    . ASN A  1 280 ? -4.439  -53.184  -29.477 1.00 18.82 ? 278 ASN A CA    1 
ATOM   2225  C  C     . ASN A  1 280 ? -3.236  -52.902  -30.368 1.00 20.58 ? 278 ASN A C     1 
ATOM   2226  O  O     . ASN A  1 280 ? -3.312  -52.961  -31.608 1.00 16.69 ? 278 ASN A O     1 
ATOM   2227  C  CB    . ASN A  1 280 ? -4.976  -51.858  -28.939 1.00 18.12 ? 278 ASN A CB    1 
ATOM   2228  C  CG    . ASN A  1 280 ? -6.343  -51.984  -28.334 1.00 18.59 ? 278 ASN A CG    1 
ATOM   2229  O  OD1   . ASN A  1 280 ? -6.921  -53.065  -28.318 1.00 24.32 ? 278 ASN A OD1   1 
ATOM   2230  N  ND2   . ASN A  1 280 ? -6.875  -50.878  -27.816 1.00 16.42 ? 278 ASN A ND2   1 
ATOM   2231  N  N     . LEU A  1 281 ? -2.119  -52.580  -29.720 1.00 18.86 ? 279 LEU A N     1 
ATOM   2232  C  CA    . LEU A  1 281 ? -0.878  -52.289  -30.435 1.00 17.07 ? 279 LEU A CA    1 
ATOM   2233  C  C     . LEU A  1 281 ? -0.462  -53.462  -31.319 1.00 19.14 ? 279 LEU A C     1 
ATOM   2234  O  O     . LEU A  1 281 ? -0.145  -53.265  -32.500 1.00 20.62 ? 279 LEU A O     1 
ATOM   2235  C  CB    . LEU A  1 281 ? 0.242   -51.919  -29.444 1.00 13.97 ? 279 LEU A CB    1 
ATOM   2236  C  CG    . LEU A  1 281 ? 1.526   -51.304  -30.007 1.00 20.05 ? 279 LEU A CG    1 
ATOM   2237  C  CD1   . LEU A  1 281 ? 1.222   -50.051  -30.864 1.00 18.51 ? 279 LEU A CD1   1 
ATOM   2238  C  CD2   . LEU A  1 281 ? 2.510   -50.947  -28.856 1.00 15.98 ? 279 LEU A CD2   1 
ATOM   2239  N  N     . ILE A  1 282 ? -0.456  -54.685  -30.768 1.00 17.10 ? 280 ILE A N     1 
ATOM   2240  C  CA    . ILE A  1 282 ? -0.060  -55.845  -31.567 1.00 12.25 ? 280 ILE A CA    1 
ATOM   2241  C  C     . ILE A  1 282 ? -1.059  -56.104  -32.681 1.00 15.55 ? 280 ILE A C     1 
ATOM   2242  O  O     . ILE A  1 282 ? -0.672  -56.317  -33.848 1.00 16.71 ? 280 ILE A O     1 
ATOM   2243  C  CB    . ILE A  1 282 ? 0.088   -57.155  -30.742 1.00 15.19 ? 280 ILE A CB    1 
ATOM   2244  C  CG1   . ILE A  1 282 ? 1.158   -57.014  -29.653 1.00 22.85 ? 280 ILE A CG1   1 
ATOM   2245  C  CG2   . ILE A  1 282 ? 0.447   -58.347  -31.649 1.00 18.98 ? 280 ILE A CG2   1 
ATOM   2246  C  CD1   . ILE A  1 282 ? 2.385   -56.223  -30.049 1.00 15.99 ? 280 ILE A CD1   1 
ATOM   2247  N  N     . MET A  1 283 ? -2.346  -56.107  -32.327 1.00 16.15 ? 281 MET A N     1 
ATOM   2248  C  CA    . MET A  1 283 ? -3.369  -56.494  -33.283 1.00 16.30 ? 281 MET A CA    1 
ATOM   2249  C  C     . MET A  1 283 ? -3.503  -55.530  -34.468 1.00 23.58 ? 281 MET A C     1 
ATOM   2250  O  O     . MET A  1 283 ? -3.903  -55.929  -35.568 1.00 16.66 ? 281 MET A O     1 
ATOM   2251  C  CB    . MET A  1 283 ? -4.697  -56.715  -32.568 1.00 20.00 ? 281 MET A CB    1 
ATOM   2252  C  CG    . MET A  1 283 ? -4.625  -57.875  -31.528 1.00 18.00 ? 281 MET A CG    1 
ATOM   2253  S  SD    . MET A  1 283 ? -4.273  -59.478  -32.345 1.00 23.85 ? 281 MET A SD    1 
ATOM   2254  C  CE    . MET A  1 283 ? -5.925  -59.891  -32.957 1.00 26.77 ? 281 MET A CE    1 
ATOM   2255  N  N     . THR A  1 284 ? -3.131  -54.265  -34.277 1.00 17.59 ? 282 THR A N     1 
ATOM   2256  C  CA    . THR A  1 284 ? -3.171  -53.318  -35.389 1.00 14.46 ? 282 THR A CA    1 
ATOM   2257  C  C     . THR A  1 284 ? -1.898  -53.299  -36.262 1.00 15.99 ? 282 THR A C     1 
ATOM   2258  O  O     . THR A  1 284 ? -1.796  -52.536  -37.216 1.00 20.50 ? 282 THR A O     1 
ATOM   2259  C  CB    . THR A  1 284 ? -3.535  -51.908  -34.885 1.00 19.93 ? 282 THR A CB    1 
ATOM   2260  O  OG1   . THR A  1 284 ? -2.636  -51.542  -33.817 1.00 21.00 ? 282 THR A OG1   1 
ATOM   2261  C  CG2   . THR A  1 284 ? -4.984  -51.929  -34.359 1.00 20.55 ? 282 THR A CG2   1 
ATOM   2262  N  N     . TRP A  1 285 ? -0.935  -54.153  -35.965 1.00 17.47 ? 283 TRP A N     1 
ATOM   2263  C  CA    . TRP A  1 285 ? 0.328   -54.093  -36.712 1.00 18.28 ? 283 TRP A CA    1 
ATOM   2264  C  C     . TRP A  1 285 ? 0.161   -54.078  -38.265 1.00 21.38 ? 283 TRP A C     1 
ATOM   2265  O  O     . TRP A  1 285 ? 0.850   -53.339  -38.980 1.00 25.03 ? 283 TRP A O     1 
ATOM   2266  C  CB    . TRP A  1 285 ? 1.304   -55.189  -36.251 1.00 16.82 ? 283 TRP A CB    1 
ATOM   2267  C  CG    . TRP A  1 285 ? 2.391   -55.455  -37.258 1.00 20.30 ? 283 TRP A CG    1 
ATOM   2268  C  CD1   . TRP A  1 285 ? 2.425   -56.461  -38.161 1.00 21.59 ? 283 TRP A CD1   1 
ATOM   2269  C  CD2   . TRP A  1 285 ? 3.569   -54.663  -37.497 1.00 26.01 ? 283 TRP A CD2   1 
ATOM   2270  N  NE1   . TRP A  1 285 ? 3.555   -56.371  -38.942 1.00 18.87 ? 283 TRP A NE1   1 
ATOM   2271  C  CE2   . TRP A  1 285 ? 4.286   -55.268  -38.553 1.00 22.79 ? 283 TRP A CE2   1 
ATOM   2272  C  CE3   . TRP A  1 285 ? 4.096   -53.498  -36.923 1.00 25.52 ? 283 TRP A CE3   1 
ATOM   2273  C  CZ2   . TRP A  1 285 ? 5.494   -54.764  -39.053 1.00 24.04 ? 283 TRP A CZ2   1 
ATOM   2274  C  CZ3   . TRP A  1 285 ? 5.339   -52.995  -37.420 1.00 15.52 ? 283 TRP A CZ3   1 
ATOM   2275  C  CH2   . TRP A  1 285 ? 5.995   -53.623  -38.473 1.00 22.19 ? 283 TRP A CH2   1 
ATOM   2276  N  N     . PRO A  1 286 ? -0.745  -54.904  -38.805 1.00 20.34 ? 284 PRO A N     1 
ATOM   2277  C  CA    . PRO A  1 286 ? -0.852  -54.890  -40.268 1.00 21.58 ? 284 PRO A CA    1 
ATOM   2278  C  C     . PRO A  1 286 ? -1.059  -53.480  -40.830 1.00 27.94 ? 284 PRO A C     1 
ATOM   2279  O  O     . PRO A  1 286 ? -0.528  -53.172  -41.899 1.00 28.25 ? 284 PRO A O     1 
ATOM   2280  C  CB    . PRO A  1 286 ? -2.073  -55.765  -40.515 1.00 26.16 ? 284 PRO A CB    1 
ATOM   2281  C  CG    . PRO A  1 286 ? -1.968  -56.827  -39.413 1.00 26.44 ? 284 PRO A CG    1 
ATOM   2282  C  CD    . PRO A  1 286 ? -1.495  -56.023  -38.200 1.00 24.06 ? 284 PRO A CD    1 
ATOM   2283  N  N     . ALA A  1 287 ? -1.798  -52.627  -40.119 1.00 21.67 ? 285 ALA A N     1 
ATOM   2284  C  CA    . ALA A  1 287 ? -1.970  -51.223  -40.567 1.00 23.57 ? 285 ALA A CA    1 
ATOM   2285  C  C     . ALA A  1 287 ? -0.716  -50.358  -40.438 1.00 20.65 ? 285 ALA A C     1 
ATOM   2286  O  O     . ALA A  1 287 ? -0.638  -49.287  -41.039 1.00 21.89 ? 285 ALA A O     1 
ATOM   2287  C  CB    . ALA A  1 287 ? -3.161  -50.543  -39.840 1.00 20.39 ? 285 ALA A CB    1 
ATOM   2288  N  N     . PHE A  1 288 ? 0.257   -50.825  -39.660 1.00 21.82 ? 286 PHE A N     1 
ATOM   2289  C  CA    . PHE A  1 288 ? 1.485   -50.080  -39.402 1.00 20.99 ? 286 PHE A CA    1 
ATOM   2290  C  C     . PHE A  1 288 ? 2.727   -50.738  -40.012 1.00 25.57 ? 286 PHE A C     1 
ATOM   2291  O  O     . PHE A  1 288 ? 3.882   -50.364  -39.724 1.00 22.95 ? 286 PHE A O     1 
ATOM   2292  C  CB    . PHE A  1 288 ? 1.658   -49.888  -37.891 1.00 26.49 ? 286 PHE A CB    1 
ATOM   2293  C  CG    . PHE A  1 288 ? 0.640   -48.948  -37.283 1.00 19.17 ? 286 PHE A CG    1 
ATOM   2294  C  CD1   . PHE A  1 288 ? -0.615  -49.416  -36.904 1.00 19.10 ? 286 PHE A CD1   1 
ATOM   2295  C  CD2   . PHE A  1 288 ? 0.944   -47.590  -37.107 1.00 22.97 ? 286 PHE A CD2   1 
ATOM   2296  C  CE1   . PHE A  1 288 ? -1.586  -48.540  -36.353 1.00 29.69 ? 286 PHE A CE1   1 
ATOM   2297  C  CE2   . PHE A  1 288 ? -0.003  -46.700  -36.565 1.00 22.52 ? 286 PHE A CE2   1 
ATOM   2298  C  CZ    . PHE A  1 288 ? -1.269  -47.177  -36.179 1.00 29.42 ? 286 PHE A CZ    1 
ATOM   2299  N  N     . SER A  1 289 ? 2.489   -51.715  -40.882 1.00 21.13 ? 287 SER A N     1 
ATOM   2300  C  CA    . SER A  1 289 ? 3.564   -52.538  -41.391 1.00 21.61 ? 287 SER A CA    1 
ATOM   2301  C  C     . SER A  1 289 ? 4.558   -51.827  -42.333 1.00 19.25 ? 287 SER A C     1 
ATOM   2302  O  O     . SER A  1 289 ? 5.657   -52.334  -42.561 1.00 24.28 ? 287 SER A O     1 
ATOM   2303  C  CB    . SER A  1 289 ? 2.992   -53.778  -42.080 1.00 21.10 ? 287 SER A CB    1 
ATOM   2304  O  OG    . SER A  1 289 ? 2.457   -53.388  -43.318 1.00 21.57 ? 287 SER A OG    1 
ATOM   2305  N  N     . ASN A  1 290 ? 4.178   -50.683  -42.890 1.00 21.12 ? 288 ASN A N     1 
ATOM   2306  C  CA    . ASN A  1 290 ? 5.047   -49.922  -43.800 1.00 23.57 ? 288 ASN A CA    1 
ATOM   2307  C  C     . ASN A  1 290 ? 5.729   -48.800  -43.028 1.00 19.51 ? 288 ASN A C     1 
ATOM   2308  O  O     . ASN A  1 290 ? 5.093   -47.817  -42.690 1.00 24.09 ? 288 ASN A O     1 
ATOM   2309  C  CB    . ASN A  1 290 ? 4.199   -49.318  -44.932 1.00 24.67 ? 288 ASN A CB    1 
ATOM   2310  C  CG    . ASN A  1 290 ? 5.035   -48.575  -45.988 1.00 28.83 ? 288 ASN A CG    1 
ATOM   2311  O  OD1   . ASN A  1 290 ? 6.229   -48.310  -45.794 1.00 27.57 ? 288 ASN A OD1   1 
ATOM   2312  N  ND2   . ASN A  1 290 ? 4.397   -48.235  -47.114 1.00 29.30 ? 288 ASN A ND2   1 
ATOM   2313  N  N     . LYS A  1 291 ? 7.014   -48.939  -42.751 1.00 23.55 ? 289 LYS A N     1 
ATOM   2314  C  CA    . LYS A  1 291 ? 7.702   -48.000  -41.861 1.00 27.60 ? 289 LYS A CA    1 
ATOM   2315  C  C     . LYS A  1 291 ? 7.855   -46.607  -42.468 1.00 33.71 ? 289 LYS A C     1 
ATOM   2316  O  O     . LYS A  1 291 ? 8.201   -45.651  -41.766 1.00 32.66 ? 289 LYS A O     1 
ATOM   2317  C  CB    . LYS A  1 291 ? 9.105   -48.521  -41.528 1.00 25.54 ? 289 LYS A CB    1 
ATOM   2318  C  CG    . LYS A  1 291 ? 10.099  -48.334  -42.676 1.00 30.69 ? 289 LYS A CG    1 
ATOM   2319  C  CD    . LYS A  1 291 ? 11.376  -49.137  -42.419 1.00 30.04 ? 289 LYS A CD    1 
ATOM   2320  C  CE    . LYS A  1 291 ? 12.361  -48.987  -43.570 1.00 36.77 ? 289 LYS A CE    1 
ATOM   2321  N  NZ    . LYS A  1 291 ? 13.446  -50.027  -43.509 1.00 38.45 ? 289 LYS A NZ    1 
ATOM   2322  N  N     . ALA A  1 292 ? 7.619   -46.487  -43.770 1.00 29.95 ? 290 ALA A N     1 
ATOM   2323  C  CA    . ALA A  1 292 ? 7.822   -45.209  -44.437 1.00 31.05 ? 290 ALA A CA    1 
ATOM   2324  C  C     . ALA A  1 292 ? 6.540   -44.375  -44.412 1.00 29.25 ? 290 ALA A C     1 
ATOM   2325  O  O     . ALA A  1 292 ? 6.557   -43.163  -44.680 1.00 28.12 ? 290 ALA A O     1 
ATOM   2326  C  CB    . ALA A  1 292 ? 8.336   -45.402  -45.868 1.00 30.12 ? 290 ALA A CB    1 
ATOM   2327  N  N     . GLN A  1 293 ? 5.435   -45.032  -44.090 1.00 24.31 ? 291 GLN A N     1 
ATOM   2328  C  CA    . GLN A  1 293 ? 4.151   -44.363  -44.122 1.00 26.91 ? 291 GLN A CA    1 
ATOM   2329  C  C     . GLN A  1 293 ? 3.052   -45.156  -43.376 1.00 25.97 ? 291 GLN A C     1 
ATOM   2330  O  O     . GLN A  1 293 ? 2.686   -46.257  -43.769 1.00 22.86 ? 291 GLN A O     1 
ATOM   2331  C  CB    . GLN A  1 293 ? 3.765   -44.092  -45.575 1.00 25.29 ? 291 GLN A CB    1 
ATOM   2332  C  CG    . GLN A  1 293 ? 2.338   -43.702  -45.746 1.00 24.94 ? 291 GLN A CG    1 
ATOM   2333  C  CD    . GLN A  1 293 ? 2.053   -43.138  -47.121 1.00 36.79 ? 291 GLN A CD    1 
ATOM   2334  O  OE1   . GLN A  1 293 ? 2.929   -42.544  -47.751 1.00 42.36 ? 291 GLN A OE1   1 
ATOM   2335  N  NE2   . GLN A  1 293 ? 0.818   -43.306  -47.589 1.00 39.96 ? 291 GLN A NE2   1 
ATOM   2336  N  N     . PHE A  1 294 ? 2.563   -44.598  -42.275 1.00 22.19 ? 292 PHE A N     1 
ATOM   2337  C  CA    . PHE A  1 294 ? 1.592   -45.298  -41.426 1.00 25.81 ? 292 PHE A CA    1 
ATOM   2338  C  C     . PHE A  1 294 ? 0.699   -44.295  -40.706 1.00 21.48 ? 292 PHE A C     1 
ATOM   2339  O  O     . PHE A  1 294 ? 1.094   -43.146  -40.521 1.00 21.02 ? 292 PHE A O     1 
ATOM   2340  C  CB    . PHE A  1 294 ? 2.324   -46.164  -40.399 1.00 25.54 ? 292 PHE A CB    1 
ATOM   2341  C  CG    . PHE A  1 294 ? 3.407   -45.424  -39.649 1.00 21.56 ? 292 PHE A CG    1 
ATOM   2342  C  CD1   . PHE A  1 294 ? 3.117   -44.740  -38.484 1.00 28.03 ? 292 PHE A CD1   1 
ATOM   2343  C  CD2   . PHE A  1 294 ? 4.690   -45.361  -40.149 1.00 24.80 ? 292 PHE A CD2   1 
ATOM   2344  C  CE1   . PHE A  1 294 ? 4.106   -44.036  -37.799 1.00 18.35 ? 292 PHE A CE1   1 
ATOM   2345  C  CE2   . PHE A  1 294 ? 5.696   -44.651  -39.470 1.00 28.77 ? 292 PHE A CE2   1 
ATOM   2346  C  CZ    . PHE A  1 294 ? 5.382   -43.987  -38.294 1.00 21.92 ? 292 PHE A CZ    1 
ATOM   2347  N  N     . PRO A  1 295 ? -0.503  -44.721  -40.300 1.00 21.06 ? 293 PRO A N     1 
ATOM   2348  C  CA    . PRO A  1 295 ? -1.023  -46.065  -40.612 1.00 25.23 ? 293 PRO A CA    1 
ATOM   2349  C  C     . PRO A  1 295 ? -1.501  -46.170  -42.061 1.00 25.01 ? 293 PRO A C     1 
ATOM   2350  O  O     . PRO A  1 295 ? -1.769  -45.124  -42.678 1.00 19.72 ? 293 PRO A O     1 
ATOM   2351  C  CB    . PRO A  1 295 ? -2.204  -46.215  -39.646 1.00 19.00 ? 293 PRO A CB    1 
ATOM   2352  C  CG    . PRO A  1 295 ? -2.640  -44.766  -39.327 1.00 18.73 ? 293 PRO A CG    1 
ATOM   2353  C  CD    . PRO A  1 295 ? -1.356  -43.986  -39.348 1.00 22.00 ? 293 PRO A CD    1 
ATOM   2354  N  N     . ASP A  1 296 ? -1.564  -47.396  -42.603 1.00 24.50 ? 294 ASP A N     1 
ATOM   2355  C  CA    . ASP A  1 296 ? -2.231  -47.630  -43.882 1.00 28.03 ? 294 ASP A CA    1 
ATOM   2356  C  C     . ASP A  1 296 ? -3.731  -47.788  -43.640 1.00 26.16 ? 294 ASP A C     1 
ATOM   2357  O  O     . ASP A  1 296 ? -4.214  -48.820  -43.151 1.00 25.88 ? 294 ASP A O     1 
ATOM   2358  C  CB    . ASP A  1 296 ? -1.663  -48.852  -44.620 1.00 30.15 ? 294 ASP A CB    1 
ATOM   2359  C  CG    . ASP A  1 296 ? -2.466  -49.204  -45.897 1.00 34.85 ? 294 ASP A CG    1 
ATOM   2360  O  OD1   . ASP A  1 296 ? -3.489  -48.534  -46.196 1.00 26.73 ? 294 ASP A OD1   1 
ATOM   2361  O  OD2   . ASP A  1 296 ? -2.080  -50.175  -46.583 1.00 35.17 ? 294 ASP A OD2   1 
ATOM   2362  N  N     . LEU A  1 297 ? -4.482  -46.748  -43.947 1.00 24.79 ? 295 LEU A N     1 
ATOM   2363  C  CA    . LEU A  1 297 ? -5.898  -46.781  -43.587 1.00 26.52 ? 295 LEU A CA    1 
ATOM   2364  C  C     . LEU A  1 297 ? -6.784  -47.446  -44.633 1.00 32.86 ? 295 LEU A C     1 
ATOM   2365  O  O     . LEU A  1 297 ? -8.026  -47.378  -44.540 1.00 27.80 ? 295 LEU A O     1 
ATOM   2366  C  CB    . LEU A  1 297 ? -6.433  -45.385  -43.216 1.00 25.40 ? 295 LEU A CB    1 
ATOM   2367  C  CG    . LEU A  1 297 ? -5.746  -44.831  -41.977 1.00 26.58 ? 295 LEU A CG    1 
ATOM   2368  C  CD1   . LEU A  1 297 ? -6.219  -43.440  -41.713 1.00 30.19 ? 295 LEU A CD1   1 
ATOM   2369  C  CD2   . LEU A  1 297 ? -6.002  -45.733  -40.775 1.00 27.24 ? 295 LEU A CD2   1 
ATOM   2370  N  N     . SER A  1 298 ? -6.158  -48.074  -45.629 1.00 27.21 ? 296 SER A N     1 
ATOM   2371  C  CA    . SER A  1 298 ? -6.890  -49.048  -46.418 1.00 29.27 ? 296 SER A CA    1 
ATOM   2372  C  C     . SER A  1 298 ? -7.317  -50.178  -45.460 1.00 33.54 ? 296 SER A C     1 
ATOM   2373  O  O     . SER A  1 298 ? -8.299  -50.852  -45.706 1.00 27.71 ? 296 SER A O     1 
ATOM   2374  C  CB    . SER A  1 298 ? -6.069  -49.572  -47.599 1.00 25.04 ? 296 SER A CB    1 
ATOM   2375  O  OG    . SER A  1 298 ? -5.018  -50.433  -47.208 1.00 33.53 ? 296 SER A OG    1 
ATOM   2376  N  N     . TYR A  1 299 ? -6.603  -50.365  -44.348 1.00 31.86 ? 297 TYR A N     1 
ATOM   2377  C  CA    . TYR A  1 299 ? -7.110  -51.266  -43.306 1.00 29.10 ? 297 TYR A CA    1 
ATOM   2378  C  C     . TYR A  1 299 ? -8.095  -50.512  -42.435 1.00 25.19 ? 297 TYR A C     1 
ATOM   2379  O  O     . TYR A  1 299 ? -8.046  -49.277  -42.336 1.00 26.13 ? 297 TYR A O     1 
ATOM   2380  C  CB    . TYR A  1 299 ? -5.994  -51.804  -42.410 1.00 28.05 ? 297 TYR A CB    1 
ATOM   2381  C  CG    . TYR A  1 299 ? -4.995  -52.684  -43.088 1.00 27.40 ? 297 TYR A CG    1 
ATOM   2382  C  CD1   . TYR A  1 299 ? -3.922  -52.146  -43.740 1.00 24.46 ? 297 TYR A CD1   1 
ATOM   2383  C  CD2   . TYR A  1 299 ? -5.123  -54.072  -43.053 1.00 30.56 ? 297 TYR A CD2   1 
ATOM   2384  C  CE1   . TYR A  1 299 ? -2.974  -52.973  -44.367 1.00 32.04 ? 297 TYR A CE1   1 
ATOM   2385  C  CE2   . TYR A  1 299 ? -4.198  -54.898  -43.674 1.00 29.36 ? 297 TYR A CE2   1 
ATOM   2386  C  CZ    . TYR A  1 299 ? -3.130  -54.338  -44.335 1.00 33.89 ? 297 TYR A CZ    1 
ATOM   2387  O  OH    . TYR A  1 299 ? -2.192  -55.149  -44.945 1.00 36.97 ? 297 TYR A OH    1 
ATOM   2388  N  N     . SER A  1 300 ? -9.006  -51.260  -41.823 1.00 26.43 ? 298 SER A N     1 
ATOM   2389  C  CA    . SER A  1 300 ? -9.907  -50.712  -40.816 1.00 23.18 ? 298 SER A CA    1 
ATOM   2390  C  C     . SER A  1 300 ? -9.315  -51.024  -39.442 1.00 26.51 ? 298 SER A C     1 
ATOM   2391  O  O     . SER A  1 300 ? -9.221  -52.203  -39.056 1.00 22.48 ? 298 SER A O     1 
ATOM   2392  C  CB    . SER A  1 300 ? -11.285 -51.369  -40.925 1.00 28.72 ? 298 SER A CB    1 
ATOM   2393  O  OG    . SER A  1 300 ? -12.099 -51.108  -39.791 1.00 26.44 ? 298 SER A OG    1 
ATOM   2394  N  N     . ILE A  1 301 ? -8.944  -49.988  -38.689 1.00 25.54 ? 299 ILE A N     1 
ATOM   2395  C  CA    . ILE A  1 301 ? -8.481  -50.217  -37.322 1.00 21.23 ? 299 ILE A CA    1 
ATOM   2396  C  C     . ILE A  1 301 ? -9.478  -51.016  -36.485 1.00 21.64 ? 299 ILE A C     1 
ATOM   2397  O  O     . ILE A  1 301 ? -9.086  -52.004  -35.843 1.00 22.09 ? 299 ILE A O     1 
ATOM   2398  C  CB    . ILE A  1 301 ? -8.159  -48.913  -36.584 1.00 21.44 ? 299 ILE A CB    1 
ATOM   2399  C  CG1   . ILE A  1 301 ? -7.103  -48.091  -37.344 1.00 26.86 ? 299 ILE A CG1   1 
ATOM   2400  C  CG2   . ILE A  1 301 ? -7.690  -49.226  -35.165 1.00 17.30 ? 299 ILE A CG2   1 
ATOM   2401  C  CD1   . ILE A  1 301 ? -5.669  -48.647  -37.241 1.00 27.16 ? 299 ILE A CD1   1 
ATOM   2402  N  N     . SER A  1 302 ? -10.755 -50.602  -36.457 1.00 24.45 ? 300 SER A N     1 
ATOM   2403  C  CA    . SER A  1 302 ? -11.717 -51.309  -35.608 1.00 26.82 ? 300 SER A CA    1 
ATOM   2404  C  C     . SER A  1 302 ? -11.910 -52.756  -36.096 1.00 20.45 ? 300 SER A C     1 
ATOM   2405  O  O     . SER A  1 302 ? -12.084 -53.676  -35.294 1.00 27.06 ? 300 SER A O     1 
ATOM   2406  C  CB    . SER A  1 302 ? -13.053 -50.543  -35.418 1.00 34.06 ? 300 SER A CB    1 
ATOM   2407  O  OG    . SER A  1 302 ? -13.666 -50.123  -36.626 1.00 37.00 ? 300 SER A OG    1 
ATOM   2408  N  N     . GLU A  1 303 ? -11.855 -52.964  -37.406 1.00 20.84 ? 301 GLU A N     1 
ATOM   2409  C  CA    . GLU A  1 303 ? -11.924 -54.327  -37.941 1.00 27.17 ? 301 GLU A CA    1 
ATOM   2410  C  C     . GLU A  1 303 ? -10.769 -55.156  -37.367 1.00 28.47 ? 301 GLU A C     1 
ATOM   2411  O  O     . GLU A  1 303 ? -10.967 -56.255  -36.836 1.00 21.67 ? 301 GLU A O     1 
ATOM   2412  C  CB    . GLU A  1 303 ? -11.878 -54.324  -39.479 1.00 34.67 ? 301 GLU A CB    1 
ATOM   2413  C  CG    . GLU A  1 303 ? -12.354 -55.618  -40.161 1.00 40.18 ? 301 GLU A CG    1 
ATOM   2414  C  CD    . GLU A  1 303 ? -11.290 -56.735  -40.244 1.00 55.11 ? 301 GLU A CD    1 
ATOM   2415  O  OE1   . GLU A  1 303 ? -10.095 -56.467  -40.591 1.00 51.54 ? 301 GLU A OE1   1 
ATOM   2416  O  OE2   . GLU A  1 303 ? -11.682 -57.905  -39.985 1.00 60.17 ? 301 GLU A OE2   1 
ATOM   2417  N  N     . LEU A  1 304 ? -9.557  -54.630  -37.456 1.00 26.06 ? 302 LEU A N     1 
ATOM   2418  C  CA    . LEU A  1 304 ? -8.425  -55.369  -36.905 1.00 18.93 ? 302 LEU A CA    1 
ATOM   2419  C  C     . LEU A  1 304 ? -8.598  -55.662  -35.413 1.00 18.77 ? 302 LEU A C     1 
ATOM   2420  O  O     . LEU A  1 304 ? -8.252  -56.771  -34.981 1.00 21.35 ? 302 LEU A O     1 
ATOM   2421  C  CB    . LEU A  1 304 ? -7.095  -54.637  -37.149 1.00 18.00 ? 302 LEU A CB    1 
ATOM   2422  C  CG    . LEU A  1 304 ? -6.617  -54.602  -38.588 1.00 21.20 ? 302 LEU A CG    1 
ATOM   2423  C  CD1   . LEU A  1 304 ? -5.644  -53.457  -38.790 1.00 28.42 ? 302 LEU A CD1   1 
ATOM   2424  C  CD2   . LEU A  1 304 ? -5.939  -55.924  -38.949 1.00 22.45 ? 302 LEU A CD2   1 
ATOM   2425  N  N     . LEU A  1 305 ? -9.076  -54.678  -34.631 1.00 20.26 ? 303 LEU A N     1 
ATOM   2426  C  CA    . LEU A  1 305 ? -9.238  -54.817  -33.164 1.00 21.49 ? 303 LEU A CA    1 
ATOM   2427  C  C     . LEU A  1 305 ? -10.411 -55.759  -32.805 1.00 28.25 ? 303 LEU A C     1 
ATOM   2428  O  O     . LEU A  1 305 ? -10.430 -56.361  -31.720 1.00 22.87 ? 303 LEU A O     1 
ATOM   2429  C  CB    . LEU A  1 305 ? -9.390  -53.451  -32.460 1.00 20.02 ? 303 LEU A CB    1 
ATOM   2430  C  CG    . LEU A  1 305 ? -8.118  -52.583  -32.460 1.00 15.83 ? 303 LEU A CG    1 
ATOM   2431  C  CD1   . LEU A  1 305 ? -8.379  -51.115  -32.031 1.00 22.00 ? 303 LEU A CD1   1 
ATOM   2432  C  CD2   . LEU A  1 305 ? -6.998  -53.239  -31.626 1.00 15.46 ? 303 LEU A CD2   1 
ATOM   2433  N  N     . SER A  1 306 ? -11.373 -55.892  -33.720 1.00 23.76 ? 304 SER A N     1 
ATOM   2434  C  CA    . SER A  1 306 ? -12.507 -56.795  -33.500 1.00 30.05 ? 304 SER A CA    1 
ATOM   2435  C  C     . SER A  1 306 ? -12.005 -58.239  -33.397 1.00 25.04 ? 304 SER A C     1 
ATOM   2436  O  O     . SER A  1 306 ? -12.685 -59.127  -32.838 1.00 26.08 ? 304 SER A O     1 
ATOM   2437  C  CB    . SER A  1 306 ? -13.537 -56.691  -34.638 1.00 25.08 ? 304 SER A CB    1 
ATOM   2438  O  OG    . SER A  1 306 ? -13.091 -57.356  -35.824 1.00 28.20 ? 304 SER A OG    1 
ATOM   2439  N  N     . LYS A  1 307 ? -10.832 -58.497  -33.957 1.00 28.10 ? 305 LYS A N     1 
ATOM   2440  C  CA    . LYS A  1 307 ? -10.293 -59.859  -33.912 1.00 23.95 ? 305 LYS A CA    1 
ATOM   2441  C  C     . LYS A  1 307 ? -9.750  -60.234  -32.531 1.00 25.80 ? 305 LYS A C     1 
ATOM   2442  O  O     . LYS A  1 307 ? -9.332  -61.386  -32.322 1.00 25.50 ? 305 LYS A O     1 
ATOM   2443  C  CB    . LYS A  1 307 ? -9.224  -60.061  -34.978 1.00 22.62 ? 305 LYS A CB    1 
ATOM   2444  C  CG    . LYS A  1 307 ? -9.700  -59.845  -36.417 1.00 26.11 ? 305 LYS A CG    1 
ATOM   2445  C  CD    . LYS A  1 307 ? -8.611  -60.239  -37.415 1.00 29.60 ? 305 LYS A CD    1 
ATOM   2446  C  CE    . LYS A  1 307 ? -8.916  -59.741  -38.844 1.00 45.35 ? 305 LYS A CE    1 
ATOM   2447  N  NZ    . LYS A  1 307 ? -7.879  -60.218  -39.844 1.00 52.07 ? 305 LYS A NZ    1 
ATOM   2448  N  N     . ARG A  1 308 ? -9.741  -59.278  -31.585 1.00 22.73 ? 306 ARG A N     1 
ATOM   2449  C  CA    . ARG A  1 308 ? -9.175  -59.572  -30.255 1.00 22.65 ? 306 ARG A CA    1 
ATOM   2450  C  C     . ARG A  1 308 ? -9.926  -60.704  -29.593 1.00 26.37 ? 306 ARG A C     1 
ATOM   2451  O  O     . ARG A  1 308 ? -11.162 -60.762  -29.679 1.00 24.13 ? 306 ARG A O     1 
ATOM   2452  C  CB    . ARG A  1 308 ? -9.138  -58.366  -29.301 1.00 18.46 ? 306 ARG A CB    1 
ATOM   2453  C  CG    . ARG A  1 308 ? -7.878  -57.466  -29.514 1.00 18.40 ? 306 ARG A CG    1 
ATOM   2454  C  CD    . ARG A  1 308 ? -7.828  -56.358  -28.497 1.00 18.12 ? 306 ARG A CD    1 
ATOM   2455  N  NE    . ARG A  1 308 ? -7.773  -56.893  -27.136 1.00 17.57 ? 306 ARG A NE    1 
ATOM   2456  C  CZ    . ARG A  1 308 ? -7.895  -56.151  -26.055 1.00 16.73 ? 306 ARG A CZ    1 
ATOM   2457  N  NH1   . ARG A  1 308 ? -8.049  -54.847  -26.188 1.00 20.03 ? 306 ARG A NH1   1 
ATOM   2458  N  NH2   . ARG A  1 308 ? -7.859  -56.700  -24.853 1.00 18.66 ? 306 ARG A NH2   1 
ATOM   2459  N  N     . THR A  1 309 ? -9.193  -61.609  -28.944 1.00 20.22 ? 307 THR A N     1 
ATOM   2460  C  CA    . THR A  1 309 ? -9.853  -62.613  -28.087 1.00 28.07 ? 307 THR A CA    1 
ATOM   2461  C  C     . THR A  1 309 ? -9.157  -62.781  -26.742 1.00 27.22 ? 307 THR A C     1 
ATOM   2462  O  O     . THR A  1 309 ? -7.995  -62.424  -26.591 1.00 30.29 ? 307 THR A O     1 
ATOM   2463  C  CB    . THR A  1 309 ? -10.001 -64.006  -28.783 1.00 32.17 ? 307 THR A CB    1 
ATOM   2464  O  OG1   . THR A  1 309 ? -8.741  -64.689  -28.779 1.00 33.21 ? 307 THR A OG1   1 
ATOM   2465  C  CG2   . THR A  1 309 ? -10.523 -63.865  -30.222 1.00 27.86 ? 307 THR A CG2   1 
ATOM   2466  N  N     . LYS A  1 310 ? -9.878  -63.321  -25.772 1.00 25.10 ? 308 LYS A N     1 
ATOM   2467  C  CA    . LYS A  1 310 ? -9.308  -63.695  -24.486 1.00 34.76 ? 308 LYS A CA    1 
ATOM   2468  C  C     . LYS A  1 310 ? -7.997  -64.483  -24.635 1.00 33.67 ? 308 LYS A C     1 
ATOM   2469  O  O     . LYS A  1 310 ? -7.001  -64.163  -23.974 1.00 31.82 ? 308 LYS A O     1 
ATOM   2470  C  CB    . LYS A  1 310 ? -10.311 -64.565  -23.732 1.00 29.65 ? 308 LYS A CB    1 
ATOM   2471  C  CG    . LYS A  1 310 ? -10.295 -64.375  -22.248 1.00 40.12 ? 308 LYS A CG    1 
ATOM   2472  C  CD    . LYS A  1 310 ? -10.468 -65.715  -21.535 1.00 52.37 ? 308 LYS A CD    1 
ATOM   2473  C  CE    . LYS A  1 310 ? -11.199 -65.576  -20.200 1.00 49.92 ? 308 LYS A CE    1 
ATOM   2474  N  NZ    . LYS A  1 310 ? -10.526 -64.656  -19.232 1.00 50.36 ? 308 LYS A NZ    1 
ATOM   2475  N  N     . GLU A  1 311 ? -8.023  -65.518  -25.481 1.00 33.45 ? 309 GLU A N     1 
ATOM   2476  C  CA    . GLU A  1 311 ? -6.904  -66.445  -25.653 1.00 31.34 ? 309 GLU A CA    1 
ATOM   2477  C  C     . GLU A  1 311 ? -5.783  -65.713  -26.323 1.00 32.90 ? 309 GLU A C     1 
ATOM   2478  O  O     . GLU A  1 311 ? -4.621  -65.841  -25.936 1.00 28.97 ? 309 GLU A O     1 
ATOM   2479  C  CB    . GLU A  1 311 ? -7.265  -67.603  -26.592 1.00 33.39 ? 309 GLU A CB    1 
ATOM   2480  C  CG    . GLU A  1 311 ? -8.550  -68.330  -26.276 1.00 41.39 ? 309 GLU A CG    1 
ATOM   2481  C  CD    . GLU A  1 311 ? -8.536  -68.917  -24.875 1.00 52.66 ? 309 GLU A CD    1 
ATOM   2482  O  OE1   . GLU A  1 311 ? -7.939  -70.006  -24.674 1.00 55.46 ? 309 GLU A OE1   1 
ATOM   2483  O  OE2   . GLU A  1 311 ? -9.113  -68.281  -23.961 1.00 49.43 ? 309 GLU A OE2   1 
ATOM   2484  N  N     . LEU A  1 312 ? -6.138  -64.992  -27.379 1.00 26.92 ? 310 LEU A N     1 
ATOM   2485  C  CA    . LEU A  1 312 ? -5.161  -64.221  -28.133 1.00 31.90 ? 310 LEU A CA    1 
ATOM   2486  C  C     . LEU A  1 312 ? -4.522  -63.141  -27.241 1.00 29.01 ? 310 LEU A C     1 
ATOM   2487  O  O     . LEU A  1 312 ? -3.294  -62.926  -27.295 1.00 27.31 ? 310 LEU A O     1 
ATOM   2488  C  CB    . LEU A  1 312 ? -5.819  -63.602  -29.359 1.00 24.92 ? 310 LEU A CB    1 
ATOM   2489  C  CG    . LEU A  1 312 ? -5.259  -63.872  -30.742 1.00 34.26 ? 310 LEU A CG    1 
ATOM   2490  C  CD1   . LEU A  1 312 ? -4.522  -65.174  -30.781 1.00 29.39 ? 310 LEU A CD1   1 
ATOM   2491  C  CD2   . LEU A  1 312 ? -6.381  -63.857  -31.777 1.00 33.81 ? 310 LEU A CD2   1 
ATOM   2492  N  N     . ASP A  1 313 ? -5.325  -62.477  -26.411 1.00 23.33 ? 311 ASP A N     1 
ATOM   2493  C  CA    . ASP A  1 313 ? -4.783  -61.424  -25.547 1.00 25.59 ? 311 ASP A CA    1 
ATOM   2494  C  C     . ASP A  1 313 ? -3.711  -62.014  -24.625 1.00 23.27 ? 311 ASP A C     1 
ATOM   2495  O  O     . ASP A  1 313 ? -2.689  -61.398  -24.338 1.00 19.97 ? 311 ASP A O     1 
ATOM   2496  C  CB    . ASP A  1 313 ? -5.885  -60.818  -24.675 1.00 24.24 ? 311 ASP A CB    1 
ATOM   2497  C  CG    . ASP A  1 313 ? -6.780  -59.852  -25.443 1.00 27.10 ? 311 ASP A CG    1 
ATOM   2498  O  OD1   . ASP A  1 313 ? -6.409  -59.522  -26.592 1.00 19.14 ? 311 ASP A OD1   1 
ATOM   2499  O  OD2   . ASP A  1 313 ? -7.836  -59.431  -24.893 1.00 21.16 ? 311 ASP A OD2   1 
ATOM   2500  N  N     . LYS A  1 314 ? -4.010  -63.205  -24.125 1.00 27.59 ? 312 LYS A N     1 
ATOM   2501  C  CA    . LYS A  1 314 ? -3.179  -63.896  -23.163 1.00 23.28 ? 312 LYS A CA    1 
ATOM   2502  C  C     . LYS A  1 314 ? -1.827  -64.201  -23.780 1.00 18.69 ? 312 LYS A C     1 
ATOM   2503  O  O     . LYS A  1 314 ? -0.787  -63.957  -23.167 1.00 21.94 ? 312 LYS A O     1 
ATOM   2504  C  CB    . LYS A  1 314 ? -3.893  -65.180  -22.714 1.00 27.27 ? 312 LYS A CB    1 
ATOM   2505  C  CG    . LYS A  1 314 ? -3.215  -65.915  -21.570 1.00 33.79 ? 312 LYS A CG    1 
ATOM   2506  C  CD    . LYS A  1 314 ? -4.036  -67.122  -21.090 1.00 39.75 ? 312 LYS A CD    1 
ATOM   2507  C  CE    . LYS A  1 314 ? -3.429  -67.725  -19.813 1.00 45.09 ? 312 LYS A CE    1 
ATOM   2508  N  NZ    . LYS A  1 314 ? -2.016  -68.228  -20.009 1.00 38.39 ? 312 LYS A NZ    1 
ATOM   2509  N  N     . LYS A  1 315 ? -1.839  -64.713  -25.000 1.00 22.40 ? 313 LYS A N     1 
ATOM   2510  C  CA    . LYS A  1 315 ? -0.606  -65.056  -25.690 1.00 20.84 ? 313 LYS A CA    1 
ATOM   2511  C  C     . LYS A  1 315 ? 0.149   -63.781  -25.987 1.00 23.90 ? 313 LYS A C     1 
ATOM   2512  O  O     . LYS A  1 315 ? 1.370   -63.734  -25.851 1.00 20.95 ? 313 LYS A O     1 
ATOM   2513  C  CB    . LYS A  1 315 ? -0.879  -65.777  -27.013 1.00 21.43 ? 313 LYS A CB    1 
ATOM   2514  C  CG    . LYS A  1 315 ? 0.395   -66.236  -27.783 1.00 29.47 ? 313 LYS A CG    1 
ATOM   2515  C  CD    . LYS A  1 315 ? 1.117   -67.445  -27.098 1.00 42.41 ? 313 LYS A CD    1 
ATOM   2516  C  CE    . LYS A  1 315 ? 2.374   -67.933  -27.875 1.00 43.40 ? 313 LYS A CE    1 
ATOM   2517  N  NZ    . LYS A  1 315 ? 3.251   -68.877  -27.082 1.00 37.08 ? 313 LYS A NZ    1 
ATOM   2518  N  N     . ILE A  1 316 ? -0.571  -62.751  -26.424 1.00 22.40 ? 314 ILE A N     1 
ATOM   2519  C  CA    . ILE A  1 316 ? 0.101   -61.469  -26.713 1.00 23.26 ? 314 ILE A CA    1 
ATOM   2520  C  C     . ILE A  1 316 ? 0.884   -60.965  -25.491 1.00 17.65 ? 314 ILE A C     1 
ATOM   2521  O  O     . ILE A  1 316 ? 2.070   -60.665  -25.593 1.00 20.65 ? 314 ILE A O     1 
ATOM   2522  C  CB    . ILE A  1 316 ? -0.878  -60.373  -27.181 1.00 21.58 ? 314 ILE A CB    1 
ATOM   2523  C  CG1   . ILE A  1 316 ? -1.315  -60.632  -28.626 1.00 18.02 ? 314 ILE A CG1   1 
ATOM   2524  C  CG2   . ILE A  1 316 ? -0.183  -58.997  -27.067 1.00 26.08 ? 314 ILE A CG2   1 
ATOM   2525  C  CD1   . ILE A  1 316 ? -2.450  -59.720  -29.140 1.00 18.87 ? 314 ILE A CD1   1 
ATOM   2526  N  N     . ILE A  1 317 ? 0.217   -60.892  -24.340 1.00 18.85 ? 315 ILE A N     1 
ATOM   2527  C  CA    . ILE A  1 317 ? 0.836   -60.414  -23.113 1.00 16.19 ? 315 ILE A CA    1 
ATOM   2528  C  C     . ILE A  1 317 ? 2.008   -61.310  -22.731 1.00 24.79 ? 315 ILE A C     1 
ATOM   2529  O  O     . ILE A  1 317 ? 3.066   -60.846  -22.268 1.00 25.45 ? 315 ILE A O     1 
ATOM   2530  C  CB    . ILE A  1 317 ? -0.164  -60.448  -21.958 1.00 18.54 ? 315 ILE A CB    1 
ATOM   2531  C  CG1   . ILE A  1 317 ? -1.297  -59.446  -22.210 1.00 26.96 ? 315 ILE A CG1   1 
ATOM   2532  C  CG2   . ILE A  1 317 ? 0.538   -60.189  -20.616 1.00 20.55 ? 315 ILE A CG2   1 
ATOM   2533  C  CD1   . ILE A  1 317 ? -0.818  -58.063  -22.690 1.00 23.58 ? 315 ILE A CD1   1 
ATOM   2534  N  N     . GLU A  1 318 ? 1.823   -62.606  -22.926 1.00 23.52 ? 316 GLU A N     1 
ATOM   2535  C  CA    . GLU A  1 318 ? 2.901   -63.539  -22.658 1.00 24.61 ? 316 GLU A CA    1 
ATOM   2536  C  C     . GLU A  1 318 ? 4.139   -63.153  -23.488 1.00 25.52 ? 316 GLU A C     1 
ATOM   2537  O  O     . GLU A  1 318 ? 5.223   -62.960  -22.934 1.00 24.50 ? 316 GLU A O     1 
ATOM   2538  C  CB    . GLU A  1 318 ? 2.386   -64.953  -22.948 1.00 24.37 ? 316 GLU A CB    1 
ATOM   2539  C  CG    . GLU A  1 318 ? 3.412   -66.059  -23.106 1.00 32.56 ? 316 GLU A CG    1 
ATOM   2540  C  CD    . GLU A  1 318 ? 2.736   -67.372  -23.563 1.00 41.57 ? 316 GLU A CD    1 
ATOM   2541  O  OE1   . GLU A  1 318 ? 1.521   -67.565  -23.232 1.00 41.84 ? 316 GLU A OE1   1 
ATOM   2542  O  OE2   . GLU A  1 318 ? 3.411   -68.171  -24.263 1.00 46.62 ? 316 GLU A OE2   1 
ATOM   2543  N  N     . LEU A  1 319 ? 3.978   -63.049  -24.808 1.00 16.74 ? 317 LEU A N     1 
ATOM   2544  C  CA    . LEU A  1 319 ? 5.063   -62.676  -25.694 1.00 18.55 ? 317 LEU A CA    1 
ATOM   2545  C  C     . LEU A  1 319 ? 5.631   -61.273  -25.436 1.00 22.41 ? 317 LEU A C     1 
ATOM   2546  O  O     . LEU A  1 319 ? 6.852   -61.037  -25.582 1.00 22.75 ? 317 LEU A O     1 
ATOM   2547  C  CB    . LEU A  1 319 ? 4.578   -62.737  -27.137 1.00 20.32 ? 317 LEU A CB    1 
ATOM   2548  C  CG    . LEU A  1 319 ? 4.692   -64.033  -27.938 1.00 34.83 ? 317 LEU A CG    1 
ATOM   2549  C  CD1   . LEU A  1 319 ? 5.426   -65.173  -27.202 1.00 26.28 ? 317 LEU A CD1   1 
ATOM   2550  C  CD2   . LEU A  1 319 ? 3.319   -64.437  -28.430 1.00 26.47 ? 317 LEU A CD2   1 
ATOM   2551  N  N     . TRP A  1 320 ? 4.760   -60.326  -25.115 1.00 17.40 ? 318 TRP A N     1 
ATOM   2552  C  CA    . TRP A  1 320 ? 5.249   -58.993  -24.821 1.00 17.78 ? 318 TRP A CA    1 
ATOM   2553  C  C     . TRP A  1 320 ? 6.159   -59.121  -23.605 1.00 20.14 ? 318 TRP A C     1 
ATOM   2554  O  O     . TRP A  1 320 ? 7.282   -58.608  -23.561 1.00 15.75 ? 318 TRP A O     1 
ATOM   2555  C  CB    . TRP A  1 320 ? 4.101   -58.049  -24.496 1.00 16.00 ? 318 TRP A CB    1 
ATOM   2556  C  CG    . TRP A  1 320 ? 4.563   -56.620  -24.249 1.00 15.27 ? 318 TRP A CG    1 
ATOM   2557  C  CD1   . TRP A  1 320 ? 4.971   -56.075  -23.053 1.00 15.44 ? 318 TRP A CD1   1 
ATOM   2558  C  CD2   . TRP A  1 320 ? 4.578   -55.556  -25.205 1.00 13.60 ? 318 TRP A CD2   1 
ATOM   2559  N  NE1   . TRP A  1 320 ? 5.257   -54.729  -23.226 1.00 17.47 ? 318 TRP A NE1   1 
ATOM   2560  C  CE2   . TRP A  1 320 ? 5.053   -54.395  -24.550 1.00 14.35 ? 318 TRP A CE2   1 
ATOM   2561  C  CE3   . TRP A  1 320 ? 4.271   -55.477  -26.572 1.00 12.61 ? 318 TRP A CE3   1 
ATOM   2562  C  CZ2   . TRP A  1 320 ? 5.218   -53.160  -25.205 1.00 13.81 ? 318 TRP A CZ2   1 
ATOM   2563  C  CZ3   . TRP A  1 320 ? 4.442   -54.244  -27.232 1.00 13.65 ? 318 TRP A CZ3   1 
ATOM   2564  C  CH2   . TRP A  1 320 ? 4.907   -53.111  -26.541 1.00 15.56 ? 318 TRP A CH2   1 
ATOM   2565  N  N     . GLU A  1 321 ? 5.666   -59.804  -22.595 1.00 18.06 ? 319 GLU A N     1 
ATOM   2566  C  CA    . GLU A  1 321 ? 6.479   -59.970  -21.401 1.00 24.88 ? 319 GLU A CA    1 
ATOM   2567  C  C     . GLU A  1 321 ? 7.846   -60.594  -21.716 1.00 24.29 ? 319 GLU A C     1 
ATOM   2568  O  O     . GLU A  1 321 ? 8.872   -60.224  -21.116 1.00 22.72 ? 319 GLU A O     1 
ATOM   2569  C  CB    . GLU A  1 321 ? 5.711   -60.798  -20.388 1.00 26.18 ? 319 GLU A CB    1 
ATOM   2570  C  CG    . GLU A  1 321 ? 5.824   -60.293  -19.001 1.00 39.70 ? 319 GLU A CG    1 
ATOM   2571  C  CD    . GLU A  1 321 ? 4.929   -61.061  -18.060 1.00 57.82 ? 319 GLU A CD    1 
ATOM   2572  O  OE1   . GLU A  1 321 ? 5.484   -61.690  -17.122 1.00 60.96 ? 319 GLU A OE1   1 
ATOM   2573  O  OE2   . GLU A  1 321 ? 3.687   -61.034  -18.276 1.00 45.27 ? 319 GLU A OE2   1 
ATOM   2574  N  N     . LYS A  1 322 ? 7.861   -61.556  -22.640 1.00 19.18 ? 320 LYS A N     1 
ATOM   2575  C  CA    . LYS A  1 322 ? 9.109   -62.248  -22.996 1.00 19.99 ? 320 LYS A CA    1 
ATOM   2576  C  C     . LYS A  1 322 ? 10.108  -61.310  -23.680 1.00 17.36 ? 320 LYS A C     1 
ATOM   2577  O  O     . LYS A  1 322 ? 11.294  -61.243  -23.298 1.00 22.86 ? 320 LYS A O     1 
ATOM   2578  C  CB    . LYS A  1 322 ? 8.811   -63.430  -23.942 1.00 19.76 ? 320 LYS A CB    1 
ATOM   2579  C  CG    . LYS A  1 322 ? 10.063  -64.132  -24.511 1.00 23.56 ? 320 LYS A CG    1 
ATOM   2580  C  CD    . LYS A  1 322 ? 9.638   -65.320  -25.399 1.00 24.03 ? 320 LYS A CD    1 
ATOM   2581  C  CE    . LYS A  1 322 ? 10.814  -65.925  -26.138 1.00 25.91 ? 320 LYS A CE    1 
ATOM   2582  N  NZ    . LYS A  1 322 ? 10.384  -66.770  -27.313 1.00 33.45 ? 320 LYS A NZ    1 
ATOM   2583  N  N     . TYR A  1 323 ? 9.644   -60.579  -24.692 1.00 20.52 ? 321 TYR A N     1 
ATOM   2584  C  CA    . TYR A  1 323 ? 10.565  -59.805  -25.546 1.00 19.79 ? 321 TYR A CA    1 
ATOM   2585  C  C     . TYR A  1 323 ? 10.887  -58.393  -25.037 1.00 20.28 ? 321 TYR A C     1 
ATOM   2586  O  O     . TYR A  1 323 ? 12.013  -57.887  -25.207 1.00 18.49 ? 321 TYR A O     1 
ATOM   2587  C  CB    . TYR A  1 323 ? 9.983   -59.711  -26.962 1.00 21.01 ? 321 TYR A CB    1 
ATOM   2588  C  CG    . TYR A  1 323 ? 9.859   -61.054  -27.626 1.00 21.47 ? 321 TYR A CG    1 
ATOM   2589  C  CD1   . TYR A  1 323 ? 10.936  -61.932  -27.650 1.00 24.31 ? 321 TYR A CD1   1 
ATOM   2590  C  CD2   . TYR A  1 323 ? 8.679   -61.446  -28.227 1.00 21.50 ? 321 TYR A CD2   1 
ATOM   2591  C  CE1   . TYR A  1 323 ? 10.828  -63.185  -28.252 1.00 30.16 ? 321 TYR A CE1   1 
ATOM   2592  C  CE2   . TYR A  1 323 ? 8.563   -62.686  -28.833 1.00 23.71 ? 321 TYR A CE2   1 
ATOM   2593  C  CZ    . TYR A  1 323 ? 9.629   -63.554  -28.833 1.00 26.74 ? 321 TYR A CZ    1 
ATOM   2594  O  OH    . TYR A  1 323 ? 9.502   -64.783  -29.431 1.00 26.75 ? 321 TYR A OH    1 
ATOM   2595  N  N     . ILE A  1 324 ? 9.876   -57.748  -24.457 1.00 24.25 ? 322 ILE A N     1 
ATOM   2596  C  CA    . ILE A  1 324 ? 9.975   -56.339  -24.071 1.00 19.37 ? 322 ILE A CA    1 
ATOM   2597  C  C     . ILE A  1 324 ? 9.828   -56.145  -22.577 1.00 16.23 ? 322 ILE A C     1 
ATOM   2598  O  O     . ILE A  1 324 ? 10.507  -55.308  -21.983 1.00 16.19 ? 322 ILE A O     1 
ATOM   2599  C  CB    . ILE A  1 324 ? 8.950   -55.496  -24.808 1.00 15.49 ? 322 ILE A CB    1 
ATOM   2600  C  CG1   . ILE A  1 324 ? 9.237   -55.527  -26.312 1.00 15.60 ? 322 ILE A CG1   1 
ATOM   2601  C  CG2   . ILE A  1 324 ? 8.940   -54.052  -24.254 1.00 14.83 ? 322 ILE A CG2   1 
ATOM   2602  C  CD1   . ILE A  1 324 ? 8.072   -54.980  -27.194 1.00 25.81 ? 322 ILE A CD1   1 
ATOM   2603  N  N     . GLY A  1 325 ? 8.957   -56.920  -21.948 1.00 14.21 ? 323 GLY A N     1 
ATOM   2604  C  CA    . GLY A  1 325 ? 8.762   -56.794  -20.506 1.00 12.43 ? 323 GLY A CA    1 
ATOM   2605  C  C     . GLY A  1 325 ? 7.559   -55.883  -20.280 1.00 20.08 ? 323 GLY A C     1 
ATOM   2606  O  O     . GLY A  1 325 ? 7.241   -55.012  -21.106 1.00 15.79 ? 323 GLY A O     1 
ATOM   2607  N  N     . LEU A  1 326 ? 6.895   -56.067  -19.156 1.00 16.39 ? 324 LEU A N     1 
ATOM   2608  C  CA    . LEU A  1 326 ? 5.748   -55.243  -18.844 1.00 26.74 ? 324 LEU A CA    1 
ATOM   2609  C  C     . LEU A  1 326 ? 6.162   -53.939  -18.174 1.00 17.47 ? 324 LEU A C     1 
ATOM   2610  O  O     . LEU A  1 326 ? 5.474   -52.930  -18.296 1.00 18.53 ? 324 LEU A O     1 
ATOM   2611  C  CB    . LEU A  1 326 ? 4.745   -56.034  -17.998 1.00 32.28 ? 324 LEU A CB    1 
ATOM   2612  C  CG    . LEU A  1 326 ? 3.910   -56.958  -18.900 1.00 33.69 ? 324 LEU A CG    1 
ATOM   2613  C  CD1   . LEU A  1 326 ? 3.138   -58.001  -18.095 1.00 39.14 ? 324 LEU A CD1   1 
ATOM   2614  C  CD2   . LEU A  1 326 ? 2.951   -56.126  -19.793 1.00 23.00 ? 324 LEU A CD2   1 
ATOM   2615  N  N     . LYS A  1 327 ? 7.285   -53.963  -17.473 1.00 20.97 ? 325 LYS A N     1 
ATOM   2616  C  CA    . LYS A  1 327 ? 7.842   -52.721  -16.941 1.00 22.85 ? 325 LYS A CA    1 
ATOM   2617  C  C     . LYS A  1 327 ? 8.346   -51.857  -18.082 1.00 17.01 ? 325 LYS A C     1 
ATOM   2618  O  O     . LYS A  1 327 ? 8.997   -52.346  -19.036 1.00 14.80 ? 325 LYS A O     1 
ATOM   2619  C  CB    . LYS A  1 327 ? 8.996   -52.965  -15.970 1.00 21.97 ? 325 LYS A CB    1 
ATOM   2620  C  CG    . LYS A  1 327 ? 8.688   -53.932  -14.853 1.00 28.58 ? 325 LYS A CG    1 
ATOM   2621  C  CD    . LYS A  1 327 ? 7.683   -53.371  -13.874 1.00 38.09 ? 325 LYS A CD    1 
ATOM   2622  C  CE    . LYS A  1 327 ? 7.497   -54.310  -12.670 1.00 41.45 ? 325 LYS A CE    1 
ATOM   2623  N  NZ    . LYS A  1 327 ? 8.718   -54.277  -11.812 1.00 37.35 ? 325 LYS A NZ    1 
ATOM   2624  N  N     . ILE A  1 328 ? 8.056   -50.561  -17.988 1.00 16.55 ? 326 ILE A N     1 
ATOM   2625  C  CA    . ILE A  1 328 ? 8.566   -49.611  -18.958 1.00 15.88 ? 326 ILE A CA    1 
ATOM   2626  C  C     . ILE A  1 328 ? 9.913   -49.130  -18.416 1.00 16.22 ? 326 ILE A C     1 
ATOM   2627  O  O     . ILE A  1 328 ? 9.980   -48.429  -17.408 1.00 16.44 ? 326 ILE A O     1 
ATOM   2628  C  CB    . ILE A  1 328 ? 7.637   -48.405  -19.123 1.00 15.26 ? 326 ILE A CB    1 
ATOM   2629  C  CG1   . ILE A  1 328 ? 6.216   -48.886  -19.370 1.00 16.07 ? 326 ILE A CG1   1 
ATOM   2630  C  CG2   . ILE A  1 328 ? 8.029   -47.603  -20.348 1.00 13.50 ? 326 ILE A CG2   1 
ATOM   2631  C  CD1   . ILE A  1 328 ? 5.281   -47.720  -19.893 1.00 17.39 ? 326 ILE A CD1   1 
ATOM   2632  N  N     . ILE A  1 329 ? 10.989  -49.535  -19.057 1.00 20.43 ? 327 ILE A N     1 
ATOM   2633  C  CA    . ILE A  1 329 ? 12.277  -49.256  -18.463 1.00 23.37 ? 327 ILE A CA    1 
ATOM   2634  C  C     . ILE A  1 329 ? 13.064  -48.310  -19.323 1.00 19.82 ? 327 ILE A C     1 
ATOM   2635  O  O     . ILE A  1 329 ? 12.861  -48.243  -20.550 1.00 21.69 ? 327 ILE A O     1 
ATOM   2636  C  CB    . ILE A  1 329 ? 13.095  -50.541  -18.238 1.00 27.37 ? 327 ILE A CB    1 
ATOM   2637  C  CG1   . ILE A  1 329 ? 13.446  -51.197  -19.569 1.00 23.43 ? 327 ILE A CG1   1 
ATOM   2638  C  CG2   . ILE A  1 329 ? 12.317  -51.524  -17.366 1.00 24.20 ? 327 ILE A CG2   1 
ATOM   2639  C  CD1   . ILE A  1 329 ? 14.458  -52.273  -19.389 1.00 25.58 ? 327 ILE A CD1   1 
ATOM   2640  N  N     . TYR A  1 330 ? 13.998  -47.611  -18.685 1.00 19.98 ? 328 TYR A N     1 
ATOM   2641  C  CA    . TYR A  1 330 ? 14.812  -46.636  -19.393 1.00 17.57 ? 328 TYR A CA    1 
ATOM   2642  C  C     . TYR A  1 330 ? 15.772  -47.304  -20.353 1.00 18.43 ? 328 TYR A C     1 
ATOM   2643  O  O     . TYR A  1 330 ? 16.490  -48.247  -19.988 1.00 19.68 ? 328 TYR A O     1 
ATOM   2644  C  CB    . TYR A  1 330 ? 15.610  -45.752  -18.420 1.00 19.21 ? 328 TYR A CB    1 
ATOM   2645  C  CG    . TYR A  1 330 ? 16.416  -44.748  -19.182 1.00 22.29 ? 328 TYR A CG    1 
ATOM   2646  C  CD1   . TYR A  1 330 ? 15.827  -43.604  -19.718 1.00 17.27 ? 328 TYR A CD1   1 
ATOM   2647  C  CD2   . TYR A  1 330 ? 17.763  -44.954  -19.408 1.00 20.12 ? 328 TYR A CD2   1 
ATOM   2648  C  CE1   . TYR A  1 330 ? 16.567  -42.693  -20.443 1.00 19.48 ? 328 TYR A CE1   1 
ATOM   2649  C  CE2   . TYR A  1 330 ? 18.512  -44.060  -20.132 1.00 20.86 ? 328 TYR A CE2   1 
ATOM   2650  C  CZ    . TYR A  1 330 ? 17.924  -42.928  -20.634 1.00 21.65 ? 328 TYR A CZ    1 
ATOM   2651  O  OH    . TYR A  1 330 ? 18.706  -42.066  -21.368 1.00 24.57 ? 328 TYR A OH    1 
ATOM   2652  N  N     . ASP A  1 331 ? 15.825  -46.780  -21.569 1.00 22.46 ? 329 ASP A N     1 
ATOM   2653  C  CA    . ASP A  1 331 ? 16.683  -47.317  -22.622 1.00 24.93 ? 329 ASP A CA    1 
ATOM   2654  C  C     . ASP A  1 331 ? 17.429  -46.115  -23.247 1.00 23.24 ? 329 ASP A C     1 
ATOM   2655  O  O     . ASP A  1 331 ? 16.796  -45.131  -23.628 1.00 24.19 ? 329 ASP A O     1 
ATOM   2656  C  CB    . ASP A  1 331 ? 15.767  -48.025  -23.632 1.00 27.45 ? 329 ASP A CB    1 
ATOM   2657  C  CG    . ASP A  1 331 ? 16.431  -48.325  -24.952 1.00 24.58 ? 329 ASP A CG    1 
ATOM   2658  O  OD1   . ASP A  1 331 ? 17.241  -47.515  -25.452 1.00 29.18 ? 329 ASP A OD1   1 
ATOM   2659  O  OD2   . ASP A  1 331 ? 16.073  -49.381  -25.520 1.00 34.24 ? 329 ASP A OD2   1 
ATOM   2660  N  N     . SER A  1 332 ? 18.755  -46.174  -23.339 1.00 19.67 ? 330 SER A N     1 
ATOM   2661  C  CA    . SER A  1 332 ? 19.509  -45.007  -23.841 1.00 23.39 ? 330 SER A CA    1 
ATOM   2662  C  C     . SER A  1 332 ? 19.889  -45.088  -25.323 1.00 24.30 ? 330 SER A C     1 
ATOM   2663  O  O     . SER A  1 332 ? 20.662  -44.269  -25.820 1.00 24.50 ? 330 SER A O     1 
ATOM   2664  C  CB    . SER A  1 332 ? 20.738  -44.748  -22.978 1.00 25.47 ? 330 SER A CB    1 
ATOM   2665  O  OG    . SER A  1 332 ? 21.649  -45.812  -23.138 1.00 31.31 ? 330 SER A OG    1 
ATOM   2666  N  N     . ASP A  1 333 ? 19.367  -46.061  -26.062 1.00 21.50 ? 331 ASP A N     1 
ATOM   2667  C  CA    . ASP A  1 333 ? 19.671  -46.043  -27.482 1.00 22.94 ? 331 ASP A CA    1 
ATOM   2668  C  C     . ASP A  1 333 ? 19.068  -44.788  -28.112 1.00 24.49 ? 331 ASP A C     1 
ATOM   2669  O  O     . ASP A  1 333 ? 18.097  -44.198  -27.593 1.00 20.83 ? 331 ASP A O     1 
ATOM   2670  C  CB    . ASP A  1 333 ? 19.189  -47.312  -28.185 1.00 24.54 ? 331 ASP A CB    1 
ATOM   2671  C  CG    . ASP A  1 333 ? 20.090  -48.506  -27.910 1.00 28.23 ? 331 ASP A CG    1 
ATOM   2672  O  OD1   . ASP A  1 333 ? 21.330  -48.349  -28.056 1.00 31.25 ? 331 ASP A OD1   1 
ATOM   2673  O  OD2   . ASP A  1 333 ? 19.570  -49.587  -27.534 1.00 30.61 ? 331 ASP A OD2   1 
ATOM   2674  N  N     . THR A  1 334 ? 19.638  -44.368  -29.231 1.00 17.08 ? 332 THR A N     1 
ATOM   2675  C  CA    . THR A  1 334 ? 19.119  -43.195  -29.933 1.00 23.59 ? 332 THR A CA    1 
ATOM   2676  C  C     . THR A  1 334 ? 17.685  -43.448  -30.425 1.00 22.07 ? 332 THR A C     1 
ATOM   2677  O  O     . THR A  1 334 ? 17.263  -44.594  -30.626 1.00 18.93 ? 332 THR A O     1 
ATOM   2678  C  CB    . THR A  1 334 ? 20.008  -42.853  -31.102 1.00 25.94 ? 332 THR A CB    1 
ATOM   2679  O  OG1   . THR A  1 334 ? 20.012  -43.971  -32.009 1.00 25.77 ? 332 THR A OG1   1 
ATOM   2680  C  CG2   . THR A  1 334 ? 21.419  -42.565  -30.592 1.00 24.76 ? 332 THR A CG2   1 
ATOM   2681  N  N     . PHE A  1 335 ? 16.921  -42.378  -30.591 1.00 19.19 ? 333 PHE A N     1 
ATOM   2682  C  CA    . PHE A  1 335 ? 15.516  -42.560  -30.830 1.00 15.71 ? 333 PHE A CA    1 
ATOM   2683  C  C     . PHE A  1 335 ? 15.215  -43.308  -32.134 1.00 18.69 ? 333 PHE A C     1 
ATOM   2684  O  O     . PHE A  1 335 ? 14.185  -43.990  -32.247 1.00 16.98 ? 333 PHE A O     1 
ATOM   2685  C  CB    . PHE A  1 335 ? 14.841  -41.198  -30.785 1.00 18.26 ? 333 PHE A CB    1 
ATOM   2686  C  CG    . PHE A  1 335 ? 15.040  -40.485  -29.473 1.00 12.69 ? 333 PHE A CG    1 
ATOM   2687  C  CD1   . PHE A  1 335 ? 15.342  -41.203  -28.322 1.00 14.32 ? 333 PHE A CD1   1 
ATOM   2688  C  CD2   . PHE A  1 335 ? 14.927  -39.109  -29.386 1.00 15.01 ? 333 PHE A CD2   1 
ATOM   2689  C  CE1   . PHE A  1 335 ? 15.508  -40.587  -27.088 1.00 13.31 ? 333 PHE A CE1   1 
ATOM   2690  C  CE2   . PHE A  1 335 ? 15.095  -38.483  -28.143 1.00 15.43 ? 333 PHE A CE2   1 
ATOM   2691  C  CZ    . PHE A  1 335 ? 15.379  -39.223  -26.997 1.00 18.72 ? 333 PHE A CZ    1 
ATOM   2692  N  N     . ASP A  1 336 ? 16.066  -43.157  -33.144 1.00 20.84 ? 334 ASP A N     1 
ATOM   2693  C  CA    . ASP A  1 336 ? 15.809  -43.837  -34.423 1.00 23.87 ? 334 ASP A CA    1 
ATOM   2694  C  C     . ASP A  1 336 ? 16.025  -45.342  -34.258 1.00 19.89 ? 334 ASP A C     1 
ATOM   2695  O  O     . ASP A  1 336 ? 15.314  -46.170  -34.845 1.00 22.10 ? 334 ASP A O     1 
ATOM   2696  C  CB    . ASP A  1 336 ? 16.657  -43.250  -35.566 1.00 26.66 ? 334 ASP A CB    1 
ATOM   2697  C  CG    . ASP A  1 336 ? 18.161  -43.192  -35.224 1.00 31.40 ? 334 ASP A CG    1 
ATOM   2698  O  OD1   . ASP A  1 336 ? 18.559  -42.322  -34.405 1.00 36.18 ? 334 ASP A OD1   1 
ATOM   2699  O  OD2   . ASP A  1 336 ? 18.951  -43.999  -35.775 1.00 29.82 ? 334 ASP A OD2   1 
ATOM   2700  N  N     . ILE A  1 337 ? 16.993  -45.691  -33.417 1.00 23.83 ? 335 ILE A N     1 
ATOM   2701  C  CA    . ILE A  1 337 ? 17.190  -47.084  -33.007 1.00 23.42 ? 335 ILE A CA    1 
ATOM   2702  C  C     . ILE A  1 337 ? 15.946  -47.616  -32.246 1.00 24.11 ? 335 ILE A C     1 
ATOM   2703  O  O     . ILE A  1 337 ? 15.498  -48.738  -32.501 1.00 24.84 ? 335 ILE A O     1 
ATOM   2704  C  CB    . ILE A  1 337 ? 18.482  -47.279  -32.171 1.00 25.52 ? 335 ILE A CB    1 
ATOM   2705  C  CG1   . ILE A  1 337 ? 19.723  -46.931  -32.990 1.00 27.79 ? 335 ILE A CG1   1 
ATOM   2706  C  CG2   . ILE A  1 337 ? 18.584  -48.724  -31.686 1.00 20.66 ? 335 ILE A CG2   1 
ATOM   2707  C  CD1   . ILE A  1 337 ? 19.846  -47.781  -34.240 1.00 26.11 ? 335 ILE A CD1   1 
ATOM   2708  N  N     . GLN A  1 338 ? 15.389  -46.822  -31.329 1.00 21.23 ? 336 GLN A N     1 
ATOM   2709  C  CA    . GLN A  1 338 ? 14.198  -47.261  -30.563 1.00 19.82 ? 336 GLN A CA    1 
ATOM   2710  C  C     . GLN A  1 338 ? 12.962  -47.512  -31.419 1.00 18.52 ? 336 GLN A C     1 
ATOM   2711  O  O     . GLN A  1 338 ? 12.167  -48.413  -31.153 1.00 19.70 ? 336 GLN A O     1 
ATOM   2712  C  CB    . GLN A  1 338 ? 13.879  -46.262  -29.444 1.00 16.68 ? 336 GLN A CB    1 
ATOM   2713  C  CG    . GLN A  1 338 ? 15.073  -46.047  -28.480 1.00 21.14 ? 336 GLN A CG    1 
ATOM   2714  C  CD    . GLN A  1 338 ? 14.665  -45.502  -27.112 1.00 22.72 ? 336 GLN A CD    1 
ATOM   2715  O  OE1   . GLN A  1 338 ? 13.589  -45.805  -26.587 1.00 19.53 ? 336 GLN A OE1   1 
ATOM   2716  N  NE2   . GLN A  1 338 ? 15.546  -44.699  -26.521 1.00 22.46 ? 336 GLN A NE2   1 
ATOM   2717  N  N     . PHE A  1 339 ? 12.807  -46.691  -32.443 1.00 18.18 ? 337 PHE A N     1 
ATOM   2718  C  CA    . PHE A  1 339 ? 11.677  -46.742  -33.338 1.00 14.48 ? 337 PHE A CA    1 
ATOM   2719  C  C     . PHE A  1 339 ? 11.702  -48.097  -34.030 1.00 19.42 ? 337 PHE A C     1 
ATOM   2720  O  O     . PHE A  1 339 ? 10.671  -48.765  -34.163 1.00 19.53 ? 337 PHE A O     1 
ATOM   2721  C  CB    . PHE A  1 339 ? 11.797  -45.599  -34.351 1.00 12.17 ? 337 PHE A CB    1 
ATOM   2722  C  CG    . PHE A  1 339 ? 10.990  -45.790  -35.605 1.00 17.34 ? 337 PHE A CG    1 
ATOM   2723  C  CD1   . PHE A  1 339 ? 11.503  -46.499  -36.678 1.00 15.77 ? 337 PHE A CD1   1 
ATOM   2724  C  CD2   . PHE A  1 339 ? 9.699   -45.232  -35.718 1.00 16.46 ? 337 PHE A CD2   1 
ATOM   2725  C  CE1   . PHE A  1 339 ? 10.746  -46.649  -37.861 1.00 17.67 ? 337 PHE A CE1   1 
ATOM   2726  C  CE2   . PHE A  1 339 ? 8.934   -45.371  -36.887 1.00 18.66 ? 337 PHE A CE2   1 
ATOM   2727  C  CZ    . PHE A  1 339 ? 9.451   -46.085  -37.952 1.00 16.60 ? 337 PHE A CZ    1 
ATOM   2728  N  N     . THR A  1 340 ? 12.887  -48.490  -34.468 1.00 17.27 ? 338 THR A N     1 
ATOM   2729  C  CA    . THR A  1 340 ? 13.058  -49.721  -35.261 1.00 24.16 ? 338 THR A CA    1 
ATOM   2730  C  C     . THR A  1 340 ? 12.898  -50.923  -34.339 1.00 23.22 ? 338 THR A C     1 
ATOM   2731  O  O     . THR A  1 340 ? 12.173  -51.897  -34.630 1.00 17.54 ? 338 THR A O     1 
ATOM   2732  C  CB    . THR A  1 340 ? 14.443  -49.731  -35.946 1.00 19.72 ? 338 THR A CB    1 
ATOM   2733  O  OG1   . THR A  1 340 ? 14.416  -48.802  -37.033 1.00 21.61 ? 338 THR A OG1   1 
ATOM   2734  C  CG2   . THR A  1 340 ? 14.799  -51.106  -36.480 1.00 19.70 ? 338 THR A CG2   1 
ATOM   2735  N  N     . SER A  1 341 ? 13.510  -50.802  -33.174 1.00 20.33 ? 339 SER A N     1 
ATOM   2736  C  CA    . SER A  1 341 ? 13.455  -51.870  -32.189 1.00 22.57 ? 339 SER A CA    1 
ATOM   2737  C  C     . SER A  1 341 ? 12.040  -52.176  -31.680 1.00 20.73 ? 339 SER A C     1 
ATOM   2738  O  O     . SER A  1 341 ? 11.661  -53.343  -31.527 1.00 17.07 ? 339 SER A O     1 
ATOM   2739  C  CB    . SER A  1 341 ? 14.400  -51.550  -31.032 1.00 25.13 ? 339 SER A CB    1 
ATOM   2740  O  OG    . SER A  1 341 ? 14.431  -52.627  -30.120 1.00 33.91 ? 339 SER A OG    1 
ATOM   2741  N  N     . ARG A  1 342 ? 11.245  -51.155  -31.395 1.00 19.29 ? 340 ARG A N     1 
ATOM   2742  C  CA    . ARG A  1 342 ? 9.915   -51.450  -30.853 1.00 23.48 ? 340 ARG A CA    1 
ATOM   2743  C  C     . ARG A  1 342 ? 9.014   -52.047  -31.950 1.00 23.02 ? 340 ARG A C     1 
ATOM   2744  O  O     . ARG A  1 342 ? 8.240   -52.958  -31.671 1.00 18.36 ? 340 ARG A O     1 
ATOM   2745  C  CB    . ARG A  1 342 ? 9.282   -50.227  -30.170 1.00 17.81 ? 340 ARG A CB    1 
ATOM   2746  C  CG    . ARG A  1 342 ? 7.818   -50.452  -29.706 1.00 18.87 ? 340 ARG A CG    1 
ATOM   2747  C  CD    . ARG A  1 342 ? 7.727   -51.567  -28.601 1.00 19.13 ? 340 ARG A CD    1 
ATOM   2748  N  NE    . ARG A  1 342 ? 8.773   -51.430  -27.574 1.00 16.92 ? 340 ARG A NE    1 
ATOM   2749  C  CZ    . ARG A  1 342 ? 8.650   -50.694  -26.464 1.00 18.50 ? 340 ARG A CZ    1 
ATOM   2750  N  NH1   . ARG A  1 342 ? 7.513   -50.051  -26.226 1.00 23.63 ? 340 ARG A NH1   1 
ATOM   2751  N  NH2   . ARG A  1 342 ? 9.645   -50.619  -25.576 1.00 19.44 ? 340 ARG A NH2   1 
ATOM   2752  N  N     . ARG A  1 343 ? 9.142   -51.564  -33.187 1.00 19.74 ? 341 ARG A N     1 
ATOM   2753  C  CA    . ARG A  1 343 ? 8.329   -52.109  -34.291 1.00 20.23 ? 341 ARG A CA    1 
ATOM   2754  C  C     . ARG A  1 343 ? 8.754   -53.540  -34.646 1.00 21.30 ? 341 ARG A C     1 
ATOM   2755  O  O     . ARG A  1 343 ? 7.931   -54.379  -34.967 1.00 24.15 ? 341 ARG A O     1 
ATOM   2756  C  CB    . ARG A  1 343 ? 8.370   -51.203  -35.521 1.00 18.34 ? 341 ARG A CB    1 
ATOM   2757  C  CG    . ARG A  1 343 ? 7.607   -49.904  -35.352 1.00 17.97 ? 341 ARG A CG    1 
ATOM   2758  C  CD    . ARG A  1 343 ? 8.022   -48.919  -36.426 1.00 20.71 ? 341 ARG A CD    1 
ATOM   2759  N  NE    . ARG A  1 343 ? 8.020   -49.608  -37.709 1.00 21.44 ? 341 ARG A NE    1 
ATOM   2760  C  CZ    . ARG A  1 343 ? 6.970   -49.662  -38.506 1.00 18.82 ? 341 ARG A CZ    1 
ATOM   2761  N  NH1   . ARG A  1 343 ? 5.849   -49.053  -38.136 1.00 19.13 ? 341 ARG A NH1   1 
ATOM   2762  N  NH2   . ARG A  1 343 ? 7.036   -50.326  -39.657 1.00 20.61 ? 341 ARG A NH2   1 
ATOM   2763  N  N     . PHE A  1 344 ? 10.044  -53.810  -34.561 1.00 24.39 ? 342 PHE A N     1 
ATOM   2764  C  CA    . PHE A  1 344 ? 10.556  -55.154  -34.786 1.00 22.95 ? 342 PHE A CA    1 
ATOM   2765  C  C     . PHE A  1 344 ? 9.815   -56.158  -33.914 1.00 18.31 ? 342 PHE A C     1 
ATOM   2766  O  O     . PHE A  1 344 ? 9.350   -57.186  -34.398 1.00 20.04 ? 342 PHE A O     1 
ATOM   2767  C  CB    . PHE A  1 344 ? 12.072  -55.201  -34.511 1.00 22.57 ? 342 PHE A CB    1 
ATOM   2768  C  CG    . PHE A  1 344 ? 12.669  -56.579  -34.609 1.00 21.99 ? 342 PHE A CG    1 
ATOM   2769  C  CD1   . PHE A  1 344 ? 12.946  -57.140  -35.844 1.00 22.26 ? 342 PHE A CD1   1 
ATOM   2770  C  CD2   . PHE A  1 344 ? 12.931  -57.318  -33.460 1.00 20.12 ? 342 PHE A CD2   1 
ATOM   2771  C  CE1   . PHE A  1 344 ? 13.503  -58.431  -35.943 1.00 26.66 ? 342 PHE A CE1   1 
ATOM   2772  C  CE2   . PHE A  1 344 ? 13.487  -58.622  -33.538 1.00 24.81 ? 342 PHE A CE2   1 
ATOM   2773  C  CZ    . PHE A  1 344 ? 13.772  -59.173  -34.780 1.00 22.86 ? 342 PHE A CZ    1 
ATOM   2774  N  N     . TYR A  1 345 ? 9.713   -55.859  -32.627 1.00 17.42 ? 343 TYR A N     1 
ATOM   2775  C  CA    . TYR A  1 345 ? 9.088   -56.774  -31.680 1.00 22.43 ? 343 TYR A CA    1 
ATOM   2776  C  C     . TYR A  1 345 ? 7.575   -56.802  -31.817 1.00 17.05 ? 343 TYR A C     1 
ATOM   2777  O  O     . TYR A  1 345 ? 6.935   -57.859  -31.686 1.00 20.40 ? 343 TYR A O     1 
ATOM   2778  C  CB    . TYR A  1 345 ? 9.495   -56.419  -30.254 1.00 21.22 ? 343 TYR A CB    1 
ATOM   2779  C  CG    . TYR A  1 345 ? 10.951  -56.680  -30.013 1.00 21.66 ? 343 TYR A CG    1 
ATOM   2780  C  CD1   . TYR A  1 345 ? 11.447  -57.978  -30.038 1.00 20.39 ? 343 TYR A CD1   1 
ATOM   2781  C  CD2   . TYR A  1 345 ? 11.839  -55.633  -29.752 1.00 23.85 ? 343 TYR A CD2   1 
ATOM   2782  C  CE1   . TYR A  1 345 ? 12.795  -58.244  -29.819 1.00 21.95 ? 343 TYR A CE1   1 
ATOM   2783  C  CE2   . TYR A  1 345 ? 13.201  -55.880  -29.532 1.00 23.63 ? 343 TYR A CE2   1 
ATOM   2784  C  CZ    . TYR A  1 345 ? 13.669  -57.187  -29.565 1.00 33.42 ? 343 TYR A CZ    1 
ATOM   2785  O  OH    . TYR A  1 345 ? 15.005  -57.455  -29.358 1.00 23.51 ? 343 TYR A OH    1 
ATOM   2786  N  N     . ILE A  1 346 ? 6.981   -55.652  -32.092 1.00 20.16 ? 344 ILE A N     1 
ATOM   2787  C  CA    . ILE A  1 346 ? 5.554   -55.664  -32.394 1.00 15.20 ? 344 ILE A CA    1 
ATOM   2788  C  C     . ILE A  1 346 ? 5.276   -56.629  -33.582 1.00 18.63 ? 344 ILE A C     1 
ATOM   2789  O  O     . ILE A  1 346 ? 4.391   -57.513  -33.528 1.00 21.80 ? 344 ILE A O     1 
ATOM   2790  C  CB    . ILE A  1 346 ? 5.062   -54.252  -32.727 1.00 19.85 ? 344 ILE A CB    1 
ATOM   2791  C  CG1   . ILE A  1 346 ? 5.021   -53.379  -31.453 1.00 18.52 ? 344 ILE A CG1   1 
ATOM   2792  C  CG2   . ILE A  1 346 ? 3.691   -54.340  -33.381 1.00 16.35 ? 344 ILE A CG2   1 
ATOM   2793  C  CD1   . ILE A  1 346 ? 5.062   -51.837  -31.696 1.00 18.55 ? 344 ILE A CD1   1 
ATOM   2794  N  N     . GLU A  1 347 ? 6.016   -56.455  -34.671 1.00 19.24 ? 345 GLU A N     1 
ATOM   2795  C  CA    . GLU A  1 347 ? 5.870   -57.365  -35.803 1.00 21.83 ? 345 GLU A CA    1 
ATOM   2796  C  C     . GLU A  1 347 ? 6.134   -58.838  -35.414 1.00 22.57 ? 345 GLU A C     1 
ATOM   2797  O  O     . GLU A  1 347 ? 5.377   -59.737  -35.801 1.00 20.77 ? 345 GLU A O     1 
ATOM   2798  C  CB    . GLU A  1 347 ? 6.811   -56.962  -36.915 1.00 22.67 ? 345 GLU A CB    1 
ATOM   2799  C  CG    . GLU A  1 347 ? 6.718   -57.861  -38.117 1.00 25.93 ? 345 GLU A CG    1 
ATOM   2800  C  CD    . GLU A  1 347 ? 7.812   -57.537  -39.107 1.00 34.48 ? 345 GLU A CD    1 
ATOM   2801  O  OE1   . GLU A  1 347 ? 8.685   -56.702  -38.780 1.00 28.35 ? 345 GLU A OE1   1 
ATOM   2802  O  OE2   . GLU A  1 347 ? 7.800   -58.121  -40.202 1.00 39.47 ? 345 GLU A OE2   1 
ATOM   2803  N  N     . LYS A  1 348 ? 7.215   -59.084  -34.668 1.00 20.38 ? 346 LYS A N     1 
ATOM   2804  C  CA    . LYS A  1 348 ? 7.577   -60.459  -34.291 1.00 21.38 ? 346 LYS A CA    1 
ATOM   2805  C  C     . LYS A  1 348 ? 6.436   -61.094  -33.490 1.00 24.81 ? 346 LYS A C     1 
ATOM   2806  O  O     . LYS A  1 348 ? 5.980   -62.212  -33.807 1.00 22.33 ? 346 LYS A O     1 
ATOM   2807  C  CB    . LYS A  1 348 ? 8.897   -60.478  -33.498 1.00 24.45 ? 346 LYS A CB    1 
ATOM   2808  C  CG    . LYS A  1 348 ? 9.284   -61.856  -32.873 1.00 25.24 ? 346 LYS A CG    1 
ATOM   2809  C  CD    . LYS A  1 348 ? 10.725  -61.763  -32.276 1.00 22.88 ? 346 LYS A CD    1 
ATOM   2810  C  CE    . LYS A  1 348 ? 11.313  -63.118  -31.902 1.00 28.76 ? 346 LYS A CE    1 
ATOM   2811  N  NZ    . LYS A  1 348 ? 11.855  -63.767  -33.113 1.00 31.63 ? 346 LYS A NZ    1 
ATOM   2812  N  N     . ILE A  1 349 ? 5.928   -60.363  -32.493 1.00 18.38 ? 347 ILE A N     1 
ATOM   2813  C  CA    . ILE A  1 349 ? 4.783   -60.838  -31.711 1.00 22.17 ? 347 ILE A CA    1 
ATOM   2814  C  C     . ILE A  1 349 ? 3.565   -61.128  -32.582 1.00 19.70 ? 347 ILE A C     1 
ATOM   2815  O  O     . ILE A  1 349 ? 2.933   -62.167  -32.442 1.00 22.27 ? 347 ILE A O     1 
ATOM   2816  C  CB    . ILE A  1 349 ? 4.444   -59.870  -30.576 1.00 22.27 ? 347 ILE A CB    1 
ATOM   2817  C  CG1   . ILE A  1 349 ? 5.624   -59.819  -29.574 1.00 18.49 ? 347 ILE A CG1   1 
ATOM   2818  C  CG2   . ILE A  1 349 ? 3.225   -60.318  -29.812 1.00 18.61 ? 347 ILE A CG2   1 
ATOM   2819  C  CD1   . ILE A  1 349 ? 5.416   -58.749  -28.522 1.00 15.00 ? 347 ILE A CD1   1 
ATOM   2820  N  N     . TYR A  1 350 ? 3.246   -60.212  -33.486 1.00 20.11 ? 348 TYR A N     1 
ATOM   2821  C  CA    . TYR A  1 350 ? 2.038   -60.344  -34.290 1.00 24.77 ? 348 TYR A CA    1 
ATOM   2822  C  C     . TYR A  1 350 ? 2.187   -61.631  -35.079 1.00 27.06 ? 348 TYR A C     1 
ATOM   2823  O  O     . TYR A  1 350 ? 1.272   -62.467  -35.129 1.00 25.82 ? 348 TYR A O     1 
ATOM   2824  C  CB    . TYR A  1 350 ? 1.845   -59.143  -35.267 1.00 21.57 ? 348 TYR A CB    1 
ATOM   2825  C  CG    . TYR A  1 350 ? 0.645   -59.369  -36.195 1.00 21.58 ? 348 TYR A CG    1 
ATOM   2826  C  CD1   . TYR A  1 350 ? -0.640  -59.069  -35.775 1.00 24.04 ? 348 TYR A CD1   1 
ATOM   2827  C  CD2   . TYR A  1 350 ? 0.805   -59.945  -37.460 1.00 22.31 ? 348 TYR A CD2   1 
ATOM   2828  C  CE1   . TYR A  1 350 ? -1.735  -59.304  -36.598 1.00 19.90 ? 348 TYR A CE1   1 
ATOM   2829  C  CE2   . TYR A  1 350 ? -0.284  -60.194  -38.290 1.00 19.34 ? 348 TYR A CE2   1 
ATOM   2830  C  CZ    . TYR A  1 350 ? -1.552  -59.872  -37.843 1.00 28.76 ? 348 TYR A CZ    1 
ATOM   2831  O  OH    . TYR A  1 350 ? -2.660  -60.092  -38.639 1.00 35.24 ? 348 TYR A OH    1 
ATOM   2832  N  N     . ASN A  1 351 ? 3.342   -61.785  -35.713 1.00 20.05 ? 349 ASN A N     1 
ATOM   2833  C  CA    . ASN A  1 351 ? 3.532   -62.971  -36.553 1.00 23.50 ? 349 ASN A CA    1 
ATOM   2834  C  C     . ASN A  1 351 ? 3.617   -64.303  -35.828 1.00 28.75 ? 349 ASN A C     1 
ATOM   2835  O  O     . ASN A  1 351 ? 3.449   -65.355  -36.433 1.00 34.49 ? 349 ASN A O     1 
ATOM   2836  C  CB    . ASN A  1 351 ? 4.685   -62.779  -37.507 1.00 21.23 ? 349 ASN A CB    1 
ATOM   2837  C  CG    . ASN A  1 351 ? 4.379   -61.764  -38.530 1.00 25.03 ? 349 ASN A CG    1 
ATOM   2838  O  OD1   . ASN A  1 351 ? 3.219   -61.605  -38.905 1.00 28.82 ? 349 ASN A OD1   1 
ATOM   2839  N  ND2   . ASN A  1 351 ? 5.409   -61.026  -38.987 1.00 30.68 ? 349 ASN A ND2   1 
ATOM   2840  N  N     . GLU A  1 352 ? 3.892   -64.248  -34.544 1.00 26.79 ? 350 GLU A N     1 
ATOM   2841  C  CA    . GLU A  1 352 ? 3.880   -65.425  -33.700 1.00 32.76 ? 350 GLU A CA    1 
ATOM   2842  C  C     . GLU A  1 352 ? 2.450   -65.892  -33.381 1.00 33.21 ? 350 GLU A C     1 
ATOM   2843  O  O     . GLU A  1 352 ? 2.219   -67.010  -33.075 1.00 30.81 ? 350 GLU A O     1 
ATOM   2844  C  CB    . GLU A  1 352 ? 4.681   -65.187  -32.426 1.00 23.76 ? 350 GLU A CB    1 
ATOM   2845  C  CG    . GLU A  1 352 ? 6.138   -65.490  -32.611 1.00 31.24 ? 350 GLU A CG    1 
ATOM   2846  C  CD    . GLU A  1 352 ? 6.918   -65.575  -31.331 1.00 36.12 ? 350 GLU A CD    1 
ATOM   2847  O  OE1   . GLU A  1 352 ? 6.532   -66.325  -30.456 1.00 36.94 ? 350 GLU A OE1   1 
ATOM   2848  O  OE2   . GLU A  1 352 ? 7.930   -64.919  -31.223 1.00 35.63 ? 350 GLU A OE2   1 
ATOM   2849  N  N     . LEU A  1 353 ? 1.498   -64.975  -33.490 1.00 36.18 ? 351 LEU A N     1 
ATOM   2850  C  CA    . LEU A  1 353 ? 0.108   -65.280  -33.198 1.00 27.21 ? 351 LEU A CA    1 
ATOM   2851  C  C     . LEU A  1 353 ? -0.480  -66.222  -34.241 1.00 39.48 ? 351 LEU A C     1 
ATOM   2852  O  O     . LEU A  1 353 ? -1.357  -67.018  -33.942 1.00 30.83 ? 351 LEU A O     1 
ATOM   2853  C  CB    . LEU A  1 353 ? -0.717  -63.995  -33.127 1.00 32.51 ? 351 LEU A CB    1 
ATOM   2854  C  CG    . LEU A  1 353 ? -0.365  -62.978  -32.040 1.00 23.57 ? 351 LEU A CG    1 
ATOM   2855  C  CD1   . LEU A  1 353 ? -1.392  -61.860  -31.992 1.00 25.89 ? 351 LEU A CD1   1 
ATOM   2856  C  CD2   . LEU A  1 353 ? -0.239  -63.652  -30.688 1.00 25.07 ? 351 LEU A CD2   1 
ATOM   2857  N  N     . ASN A  1 354 ? 0.017   -66.119  -35.467 1.00 41.83 ? 352 ASN A N     1 
ATOM   2858  C  CA    . ASN A  1 354 ? -0.472  -66.927  -36.581 1.00 49.06 ? 352 ASN A CA    1 
ATOM   2859  C  C     . ASN A  1 354 ? -1.896  -66.590  -37.012 1.00 51.11 ? 352 ASN A C     1 
ATOM   2860  O  O     . ASN A  1 354 ? -2.848  -67.284  -36.657 1.00 53.81 ? 352 ASN A O     1 
ATOM   2861  C  CB    . ASN A  1 354 ? -0.350  -68.422  -36.280 1.00 42.37 ? 352 ASN A CB    1 
ATOM   2862  C  CG    . ASN A  1 354 ? 1.084   -68.859  -36.065 1.00 50.34 ? 352 ASN A CG    1 
ATOM   2863  O  OD1   . ASN A  1 354 ? 1.953   -68.623  -36.898 1.00 45.27 ? 352 ASN A OD1   1 
ATOM   2864  N  ND2   . ASN A  1 354 ? 1.336   -69.502  -34.935 1.00 51.66 ? 352 ASN A ND2   1 
ATOM   2865  N  N     . ILE A  1 355 ? -2.026  -65.527  -37.793 1.00 52.32 ? 353 ILE A N     1 
ATOM   2866  C  CA    . ILE A  1 355 ? -3.300  -65.144  -38.376 1.00 48.62 ? 353 ILE A CA    1 
ATOM   2867  C  C     . ILE A  1 355 ? -3.143  -64.828  -39.858 1.00 50.89 ? 353 ILE A C     1 
ATOM   2868  O  O     . ILE A  1 355 ? -3.666  -65.537  -40.714 1.00 60.85 ? 353 ILE A O     1 
ATOM   2869  C  CB    . ILE A  1 355 ? -3.877  -63.904  -37.691 1.00 58.76 ? 353 ILE A CB    1 
ATOM   2870  C  CG1   . ILE A  1 355 ? -4.063  -64.158  -36.197 1.00 48.92 ? 353 ILE A CG1   1 
ATOM   2871  C  CG2   . ILE A  1 355 ? -5.179  -63.494  -38.364 1.00 50.95 ? 353 ILE A CG2   1 
ATOM   2872  C  CD1   . ILE A  1 355 ? -3.767  -62.949  -35.341 1.00 38.91 ? 353 ILE A CD1   1 
ATOM   2873  C  "C4'" . A   B  2 3   ? 2.218   -18.098  -30.185 0.64 47.09 ? 501 A   V "C4'" 1 
ATOM   2874  O  "O4'" . A   B  2 3   ? 3.492   -18.648  -29.777 0.64 38.21 ? 501 A   V "O4'" 1 
ATOM   2875  C  "C3'" . A   B  2 3   ? 1.284   -19.287  -30.152 0.64 43.93 ? 501 A   V "C3'" 1 
ATOM   2876  O  "O3'" . A   B  2 3   ? 1.595   -20.086  -31.286 0.64 46.89 ? 501 A   V "O3'" 1 
ATOM   2877  C  "C2'" . A   B  2 3   ? 1.746   -19.965  -28.867 0.64 42.38 ? 501 A   V "C2'" 1 
ATOM   2878  C  "C1'" . A   B  2 3   ? 3.281   -19.813  -29.005 0.64 43.04 ? 501 A   V "C1'" 1 
ATOM   2879  N  N9    . A   B  2 3   ? 4.040   -19.621  -27.768 0.64 38.26 ? 501 A   V N9    1 
ATOM   2880  C  C8    . A   B  2 3   ? 3.769   -18.730  -26.761 0.64 36.34 ? 501 A   V C8    1 
ATOM   2881  N  N7    . A   B  2 3   ? 4.626   -18.772  -25.766 0.64 36.67 ? 501 A   V N7    1 
ATOM   2882  C  C5    . A   B  2 3   ? 5.534   -19.753  -26.139 0.64 41.83 ? 501 A   V C5    1 
ATOM   2883  C  C6    . A   B  2 3   ? 6.687   -20.274  -25.496 0.64 37.30 ? 501 A   V C6    1 
ATOM   2884  N  N6    . A   B  2 3   ? 7.130   -19.843  -24.307 0.64 37.51 ? 501 A   V N6    1 
ATOM   2885  N  N1    . A   B  2 3   ? 7.375   -21.247  -26.140 0.64 36.84 ? 501 A   V N1    1 
ATOM   2886  C  C2    . A   B  2 3   ? 6.910   -21.663  -27.331 0.64 35.39 ? 501 A   V C2    1 
ATOM   2887  N  N3    . A   B  2 3   ? 5.845   -21.250  -28.032 0.64 34.71 ? 501 A   V N3    1 
ATOM   2888  C  C4    . A   B  2 3   ? 5.186   -20.283  -27.378 0.64 38.27 ? 501 A   V C4    1 
ATOM   2889  P  P     . C   B  2 4   ? 0.591   -20.161  -32.546 0.59 56.86 ? 502 C   V P     1 
ATOM   2890  O  OP1   . C   B  2 4   ? 1.251   -20.995  -33.587 0.59 49.07 ? 502 C   V OP1   1 
ATOM   2891  O  OP2   . C   B  2 4   ? 0.107   -18.792  -32.893 0.59 48.64 ? 502 C   V OP2   1 
ATOM   2892  O  "O5'" . C   B  2 4   ? -0.654  -20.980  -31.982 0.59 49.25 ? 502 C   V "O5'" 1 
ATOM   2893  C  "C5'" . C   B  2 4   ? -0.576  -22.382  -31.766 0.59 40.43 ? 502 C   V "C5'" 1 
ATOM   2894  C  "C4'" . C   B  2 4   ? -1.612  -23.118  -32.575 0.59 37.15 ? 502 C   V "C4'" 1 
ATOM   2895  O  "O4'" . C   B  2 4   ? -2.933  -22.714  -32.131 0.59 42.71 ? 502 C   V "O4'" 1 
ATOM   2896  C  "C3'" . C   B  2 4   ? -1.564  -22.864  -34.082 0.59 41.02 ? 502 C   V "C3'" 1 
ATOM   2897  O  "O3'" . C   B  2 4   ? -1.876  -24.063  -34.793 0.59 36.43 ? 502 C   V "O3'" 1 
ATOM   2898  C  "C2'" . C   B  2 4   ? -2.670  -21.837  -34.299 0.59 45.35 ? 502 C   V "C2'" 1 
ATOM   2899  O  "O2'" . C   B  2 4   ? -3.234  -21.856  -35.597 0.59 41.56 ? 502 C   V "O2'" 1 
ATOM   2900  C  "C1'" . C   B  2 4   ? -3.689  -22.247  -33.236 0.59 43.54 ? 502 C   V "C1'" 1 
ATOM   2901  P  P     . A   B  2 5   ? -0.826  -24.631  -35.868 0.69 48.98 ? 503 A   V P     1 
ATOM   2902  O  OP1   . A   B  2 5   ? -1.322  -25.897  -36.442 0.69 26.00 ? 503 A   V OP1   1 
ATOM   2903  O  OP2   . A   B  2 5   ? 0.515   -24.561  -35.200 0.69 38.40 ? 503 A   V OP2   1 
ATOM   2904  O  "O5'" . A   B  2 5   ? -0.860  -23.537  -37.043 0.69 43.61 ? 503 A   V "O5'" 1 
HETATM 2905  P  P     . G46 C  3 1   ? 0.767   -21.994  -27.466 0.70 43.63 ? 510 G46 Q P     1 
HETATM 2906  O  O1P   . G46 C  3 1   ? 0.485   -23.421  -27.744 0.70 26.77 ? 510 G46 Q O1P   1 
HETATM 2907  S  S2P   . G46 C  3 1   ? 2.025   -21.738  -25.851 0.70 46.21 ? 510 G46 Q S2P   1 
HETATM 2908  O  O3P   . G46 C  3 1   ? 1.422   -21.334  -28.783 0.70 38.07 ? 510 G46 Q O3P   1 
HETATM 2909  O  "O5'" . G46 C  3 1   ? -0.592  -21.198  -27.144 0.70 42.62 ? 510 G46 Q "O5'" 1 
HETATM 2910  C  "C5'" . G46 C  3 1   ? -1.472  -20.818  -28.187 0.70 43.30 ? 510 G46 Q "C5'" 1 
HETATM 2911  C  "C4'" . G46 C  3 1   ? -2.322  -19.689  -27.631 0.70 46.87 ? 510 G46 Q "C4'" 1 
HETATM 2912  O  "O4'" . G46 C  3 1   ? -3.482  -19.522  -28.450 0.70 47.86 ? 510 G46 Q "O4'" 1 
HETATM 2913  C  "C3'" . G46 C  3 1   ? -2.789  -19.996  -26.215 0.70 46.52 ? 510 G46 Q "C3'" 1 
HETATM 2914  O  "O3'" . G46 C  3 1   ? -2.252  -19.011  -25.315 0.70 44.26 ? 510 G46 Q "O3'" 1 
HETATM 2915  C  "C2'" . G46 C  3 1   ? -4.319  -19.987  -26.273 0.70 45.31 ? 510 G46 Q "C2'" 1 
HETATM 2916  C  "C1'" . G46 C  3 1   ? -4.687  -19.529  -27.681 0.70 45.55 ? 510 G46 Q "C1'" 1 
HETATM 2917  O  "O2'" . G46 C  3 1   ? -4.880  -19.114  -25.277 0.70 45.62 ? 510 G46 Q "O2'" 1 
HETATM 2918  N  N9    . G46 C  3 1   ? -5.567  -20.503  -28.375 0.70 47.00 ? 510 G46 Q N9    1 
HETATM 2919  C  C8    . G46 C  3 1   ? -5.213  -21.760  -28.696 0.70 41.76 ? 510 G46 Q C8    1 
HETATM 2920  N  N7    . G46 C  3 1   ? -6.221  -22.414  -29.341 0.70 46.63 ? 510 G46 Q N7    1 
HETATM 2921  C  C5    . G46 C  3 1   ? -7.254  -21.560  -29.451 0.70 44.46 ? 510 G46 Q C5    1 
HETATM 2922  C  C6    . G46 C  3 1   ? -8.627  -21.620  -30.029 0.70 47.79 ? 510 G46 Q C6    1 
HETATM 2923  O  O6    . G46 C  3 1   ? -9.077  -22.662  -30.584 0.70 44.31 ? 510 G46 Q O6    1 
HETATM 2924  N  N1    . G46 C  3 1   ? -9.377  -20.513  -29.933 0.70 47.88 ? 510 G46 Q N1    1 
HETATM 2925  C  C2    . G46 C  3 1   ? -8.937  -19.380  -29.342 0.70 49.38 ? 510 G46 Q C2    1 
HETATM 2926  N  N2    . G46 C  3 1   ? -9.787  -18.320  -29.306 0.70 47.68 ? 510 G46 Q N2    1 
HETATM 2927  N  N3    . G46 C  3 1   ? -7.691  -19.249  -28.793 0.70 43.93 ? 510 G46 Q N3    1 
HETATM 2928  C  C4    . G46 C  3 1   ? -6.820  -20.295  -28.812 0.70 47.49 ? 510 G46 Q C4    1 
ATOM   2929  N  N     . GLN D  1 7   ? 53.743  -76.663  -36.808 1.00 50.46 ? 5   GLN B N     1 
ATOM   2930  C  CA    . GLN D  1 7   ? 53.047  -75.494  -37.299 1.00 45.89 ? 5   GLN B CA    1 
ATOM   2931  C  C     . GLN D  1 7   ? 52.603  -74.586  -36.178 1.00 41.35 ? 5   GLN B C     1 
ATOM   2932  O  O     . GLN D  1 7   ? 52.915  -74.802  -35.046 1.00 38.79 ? 5   GLN B O     1 
ATOM   2933  C  CB    . GLN D  1 7   ? 51.838  -75.908  -38.075 1.00 42.02 ? 5   GLN B CB    1 
ATOM   2934  C  CG    . GLN D  1 7   ? 52.054  -77.120  -38.902 1.00 54.28 ? 5   GLN B CG    1 
ATOM   2935  C  CD    . GLN D  1 7   ? 51.144  -78.235  -38.474 1.00 62.69 ? 5   GLN B CD    1 
ATOM   2936  O  OE1   . GLN D  1 7   ? 51.448  -78.978  -37.572 1.00 64.94 ? 5   GLN B OE1   1 
ATOM   2937  N  NE2   . GLN D  1 7   ? 50.007  -78.334  -39.114 1.00 61.96 ? 5   GLN B NE2   1 
ATOM   2938  N  N     . ILE D  1 8   ? 51.864  -73.573  -36.544 1.00 40.32 ? 6   ILE B N     1 
ATOM   2939  C  CA    . ILE D  1 8   ? 51.425  -72.559  -35.639 1.00 35.21 ? 6   ILE B CA    1 
ATOM   2940  C  C     . ILE D  1 8   ? 49.955  -72.241  -35.861 1.00 33.73 ? 6   ILE B C     1 
ATOM   2941  O  O     . ILE D  1 8   ? 49.495  -72.308  -36.958 1.00 35.36 ? 6   ILE B O     1 
ATOM   2942  C  CB    . ILE D  1 8   ? 52.307  -71.319  -35.808 1.00 38.52 ? 6   ILE B CB    1 
ATOM   2943  C  CG1   . ILE D  1 8   ? 53.599  -71.541  -35.079 1.00 37.09 ? 6   ILE B CG1   1 
ATOM   2944  C  CG2   . ILE D  1 8   ? 51.666  -70.039  -35.293 1.00 37.31 ? 6   ILE B CG2   1 
ATOM   2945  C  CD1   . ILE D  1 8   ? 54.691  -70.685  -35.617 1.00 45.13 ? 6   ILE B CD1   1 
ATOM   2946  N  N     . GLN D  1 9   ? 49.270  -71.885  -34.780 1.00 30.67 ? 7   GLN B N     1 
ATOM   2947  C  CA    . GLN D  1 9   ? 47.898  -71.397  -34.769 1.00 29.37 ? 7   GLN B CA    1 
ATOM   2948  C  C     . GLN D  1 9   ? 47.880  -69.942  -34.259 1.00 30.89 ? 7   GLN B C     1 
ATOM   2949  O  O     . GLN D  1 9   ? 48.560  -69.642  -33.314 1.00 31.05 ? 7   GLN B O     1 
ATOM   2950  C  CB    . GLN D  1 9   ? 46.967  -72.310  -33.963 1.00 21.22 ? 7   GLN B CB    1 
ATOM   2951  C  CG    . GLN D  1 9   ? 47.371  -72.610  -32.547 1.00 27.99 ? 7   GLN B CG    1 
ATOM   2952  C  CD    . GLN D  1 9   ? 46.516  -73.679  -31.880 1.00 24.70 ? 7   GLN B CD    1 
ATOM   2953  O  OE1   . GLN D  1 9   ? 45.336  -73.690  -31.975 1.00 24.90 ? 7   GLN B OE1   1 
ATOM   2954  N  NE2   . GLN D  1 9   ? 47.142  -74.554  -31.215 1.00 20.47 ? 7   GLN B NE2   1 
ATOM   2955  N  N     . HIS D  1 10  ? 47.156  -69.049  -34.924 1.00 22.53 ? 8   HIS B N     1 
ATOM   2956  C  CA    . HIS D  1 10  ? 47.096  -67.666  -34.479 1.00 21.34 ? 8   HIS B CA    1 
ATOM   2957  C  C     . HIS D  1 10  ? 45.724  -67.447  -33.824 1.00 25.15 ? 8   HIS B C     1 
ATOM   2958  O  O     . HIS D  1 10  ? 44.677  -67.603  -34.462 1.00 21.98 ? 8   HIS B O     1 
ATOM   2959  C  CB    . HIS D  1 10  ? 47.320  -66.698  -35.655 1.00 25.91 ? 8   HIS B CB    1 
ATOM   2960  C  CG    . HIS D  1 10  ? 48.540  -67.009  -36.466 1.00 31.74 ? 8   HIS B CG    1 
ATOM   2961  N  ND1   . HIS D  1 10  ? 49.818  -66.817  -35.987 1.00 33.59 ? 8   HIS B ND1   1 
ATOM   2962  C  CD2   . HIS D  1 10  ? 48.675  -67.537  -37.708 1.00 30.80 ? 8   HIS B CD2   1 
ATOM   2963  C  CE1   . HIS D  1 10  ? 50.692  -67.195  -36.905 1.00 31.31 ? 8   HIS B CE1   1 
ATOM   2964  N  NE2   . HIS D  1 10  ? 50.025  -67.636  -37.957 1.00 34.79 ? 8   HIS B NE2   1 
ATOM   2965  N  N     . ILE D  1 11  ? 45.759  -67.110  -32.542 1.00 22.38 ? 9   ILE B N     1 
ATOM   2966  C  CA    . ILE D  1 11  ? 44.579  -67.026  -31.706 1.00 18.79 ? 9   ILE B CA    1 
ATOM   2967  C  C     . ILE D  1 11  ? 44.409  -65.589  -31.300 1.00 19.58 ? 9   ILE B C     1 
ATOM   2968  O  O     . ILE D  1 11  ? 45.315  -64.980  -30.706 1.00 23.07 ? 9   ILE B O     1 
ATOM   2969  C  CB    . ILE D  1 11  ? 44.741  -67.891  -30.454 1.00 19.44 ? 9   ILE B CB    1 
ATOM   2970  C  CG1   . ILE D  1 11  ? 45.085  -69.321  -30.859 1.00 22.77 ? 9   ILE B CG1   1 
ATOM   2971  C  CG2   . ILE D  1 11  ? 43.476  -67.856  -29.604 1.00 27.90 ? 9   ILE B CG2   1 
ATOM   2972  C  CD1   . ILE D  1 11  ? 45.352  -70.258  -29.702 1.00 23.53 ? 9   ILE B CD1   1 
ATOM   2973  N  N     . ALA D  1 12  ? 43.263  -65.032  -31.648 1.00 21.34 ? 10  ALA B N     1 
ATOM   2974  C  CA    . ALA D  1 12  ? 42.975  -63.654  -31.280 1.00 18.09 ? 10  ALA B CA    1 
ATOM   2975  C  C     . ALA D  1 12  ? 42.564  -63.697  -29.816 1.00 20.73 ? 10  ALA B C     1 
ATOM   2976  O  O     . ALA D  1 12  ? 41.667  -64.463  -29.428 1.00 17.20 ? 10  ALA B O     1 
ATOM   2977  C  CB    . ALA D  1 12  ? 41.822  -63.074  -32.147 1.00 19.16 ? 10  ALA B CB    1 
ATOM   2978  N  N     . ILE D  1 13  ? 43.219  -62.883  -29.004 1.00 18.90 ? 11  ILE B N     1 
ATOM   2979  C  CA    . ILE D  1 13  ? 42.751  -62.658  -27.654 1.00 19.97 ? 11  ILE B CA    1 
ATOM   2980  C  C     . ILE D  1 13  ? 42.254  -61.232  -27.493 1.00 18.20 ? 11  ILE B C     1 
ATOM   2981  O  O     . ILE D  1 13  ? 42.910  -60.289  -27.936 1.00 17.61 ? 11  ILE B O     1 
ATOM   2982  C  CB    . ILE D  1 13  ? 43.826  -62.977  -26.622 1.00 17.92 ? 11  ILE B CB    1 
ATOM   2983  C  CG1   . ILE D  1 13  ? 45.150  -62.280  -26.951 1.00 15.62 ? 11  ILE B CG1   1 
ATOM   2984  C  CG2   . ILE D  1 13  ? 44.030  -64.486  -26.583 1.00 17.54 ? 11  ILE B CG2   1 
ATOM   2985  C  CD1   . ILE D  1 13  ? 46.168  -62.389  -25.780 1.00 18.12 ? 11  ILE B CD1   1 
ATOM   2986  N  N     . VAL D  1 14  ? 41.103  -61.103  -26.824 1.00 14.56 ? 12  VAL B N     1 
ATOM   2987  C  CA    . VAL D  1 14  ? 40.321  -59.864  -26.760 1.00 16.02 ? 12  VAL B CA    1 
ATOM   2988  C  C     . VAL D  1 14  ? 39.907  -59.534  -25.343 1.00 16.70 ? 12  VAL B C     1 
ATOM   2989  O  O     . VAL D  1 14  ? 39.445  -60.400  -24.601 1.00 15.51 ? 12  VAL B O     1 
ATOM   2990  C  CB    . VAL D  1 14  ? 39.030  -60.027  -27.556 1.00 15.16 ? 12  VAL B CB    1 
ATOM   2991  C  CG1   . VAL D  1 14  ? 38.130  -58.735  -27.446 1.00 17.75 ? 12  VAL B CG1   1 
ATOM   2992  C  CG2   . VAL D  1 14  ? 39.347  -60.396  -29.003 1.00 17.27 ? 12  VAL B CG2   1 
ATOM   2993  N  N     . GLY D  1 15  ? 40.015  -58.265  -24.969 1.00 13.35 ? 13  GLY B N     1 
ATOM   2994  C  CA    . GLY D  1 15  ? 39.551  -57.850  -23.657 1.00 19.83 ? 13  GLY B CA    1 
ATOM   2995  C  C     . GLY D  1 15  ? 38.027  -57.699  -23.615 1.00 21.95 ? 13  GLY B C     1 
ATOM   2996  O  O     . GLY D  1 15  ? 37.260  -58.595  -23.971 1.00 23.92 ? 13  GLY B O     1 
ATOM   2997  N  N     . SER D  1 16  ? 37.600  -56.540  -23.175 1.00 19.66 ? 14  SER B N     1 
ATOM   2998  C  CA    . SER D  1 16  ? 36.207  -56.283  -22.878 1.00 23.38 ? 14  SER B CA    1 
ATOM   2999  C  C     . SER D  1 16  ? 35.445  -55.922  -24.154 1.00 20.91 ? 14  SER B C     1 
ATOM   3000  O  O     . SER D  1 16  ? 35.765  -54.945  -24.838 1.00 21.39 ? 14  SER B O     1 
ATOM   3001  C  CB    . SER D  1 16  ? 36.168  -55.145  -21.860 1.00 22.41 ? 14  SER B CB    1 
ATOM   3002  O  OG    . SER D  1 16  ? 34.865  -54.650  -21.676 1.00 33.99 ? 14  SER B OG    1 
ATOM   3003  N  N     . VAL D  1 17  ? 34.414  -56.692  -24.476 1.00 22.41 ? 15  VAL B N     1 
ATOM   3004  C  CA    . VAL D  1 17  ? 33.690  -56.462  -25.726 1.00 20.76 ? 15  VAL B CA    1 
ATOM   3005  C  C     . VAL D  1 17  ? 32.616  -55.385  -25.641 1.00 23.21 ? 15  VAL B C     1 
ATOM   3006  O  O     . VAL D  1 17  ? 32.420  -54.599  -26.578 1.00 21.85 ? 15  VAL B O     1 
ATOM   3007  C  CB    . VAL D  1 17  ? 33.124  -57.755  -26.229 1.00 18.69 ? 15  VAL B CB    1 
ATOM   3008  C  CG1   . VAL D  1 17  ? 32.267  -57.512  -27.448 1.00 20.51 ? 15  VAL B CG1   1 
ATOM   3009  C  CG2   . VAL D  1 17  ? 34.306  -58.725  -26.517 1.00 14.95 ? 15  VAL B CG2   1 
ATOM   3010  N  N     . HIS D  1 18  ? 31.896  -55.367  -24.532 1.00 19.27 ? 16  HIS B N     1 
ATOM   3011  C  CA    A HIS D  1 18  ? 30.843  -54.382  -24.286 0.59 22.17 ? 16  HIS B CA    1 
ATOM   3012  C  CA    B HIS D  1 18  ? 30.898  -54.329  -24.334 0.41 22.19 ? 16  HIS B CA    1 
ATOM   3013  C  C     . HIS D  1 18  ? 29.908  -54.149  -25.470 1.00 19.61 ? 16  HIS B C     1 
ATOM   3014  O  O     . HIS D  1 18  ? 29.559  -53.021  -25.792 1.00 20.11 ? 16  HIS B O     1 
ATOM   3015  C  CB    A HIS D  1 18  ? 31.391  -53.068  -23.666 0.59 25.64 ? 16  HIS B CB    1 
ATOM   3016  C  CB    B HIS D  1 18  ? 31.610  -53.004  -24.134 0.41 25.27 ? 16  HIS B CB    1 
ATOM   3017  C  CG    A HIS D  1 18  ? 32.203  -52.209  -24.586 0.59 27.40 ? 16  HIS B CG    1 
ATOM   3018  C  CG    B HIS D  1 18  ? 32.086  -52.797  -22.745 0.41 26.54 ? 16  HIS B CG    1 
ATOM   3019  N  ND1   A HIS D  1 18  ? 33.404  -52.612  -25.145 0.59 28.41 ? 16  HIS B ND1   1 
ATOM   3020  N  ND1   B HIS D  1 18  ? 31.224  -52.517  -21.700 0.41 29.06 ? 16  HIS B ND1   1 
ATOM   3021  C  CD2   A HIS D  1 18  ? 32.027  -50.924  -24.998 0.59 26.22 ? 16  HIS B CD2   1 
ATOM   3022  C  CD2   B HIS D  1 18  ? 33.326  -52.835  -22.201 0.41 28.66 ? 16  HIS B CD2   1 
ATOM   3023  C  CE1   A HIS D  1 18  ? 33.904  -51.639  -25.876 0.59 20.63 ? 16  HIS B CE1   1 
ATOM   3024  C  CE1   B HIS D  1 18  ? 31.913  -52.391  -20.588 0.41 31.44 ? 16  HIS B CE1   1 
ATOM   3025  N  NE2   A HIS D  1 18  ? 33.087  -50.598  -25.806 0.59 29.43 ? 16  HIS B NE2   1 
ATOM   3026  N  NE2   B HIS D  1 18  ? 33.193  -52.583  -20.860 0.41 29.65 ? 16  HIS B NE2   1 
ATOM   3027  N  N     . GLY D  1 19  ? 29.475  -55.248  -26.082 1.00 17.88 ? 17  GLY B N     1 
ATOM   3028  C  CA    . GLY D  1 19  ? 28.440  -55.214  -27.101 1.00 20.19 ? 17  GLY B CA    1 
ATOM   3029  C  C     . GLY D  1 19  ? 28.872  -54.725  -28.472 1.00 21.98 ? 17  GLY B C     1 
ATOM   3030  O  O     . GLY D  1 19  ? 28.048  -54.585  -29.378 1.00 24.06 ? 17  GLY B O     1 
ATOM   3031  N  N     . LYS D  1 20  ? 30.159  -54.465  -28.640 1.00 20.63 ? 18  LYS B N     1 
ATOM   3032  C  CA    . LYS D  1 20  ? 30.640  -53.988  -29.930 1.00 23.01 ? 18  LYS B CA    1 
ATOM   3033  C  C     . LYS D  1 20  ? 31.164  -55.105  -30.815 1.00 22.22 ? 18  LYS B C     1 
ATOM   3034  O  O     . LYS D  1 20  ? 32.347  -55.122  -31.229 1.00 19.98 ? 18  LYS B O     1 
ATOM   3035  C  CB    . LYS D  1 20  ? 31.662  -52.890  -29.706 1.00 20.14 ? 18  LYS B CB    1 
ATOM   3036  C  CG    . LYS D  1 20  ? 30.991  -51.733  -28.990 1.00 27.97 ? 18  LYS B CG    1 
ATOM   3037  C  CD    . LYS D  1 20  ? 31.960  -50.741  -28.437 1.00 31.78 ? 18  LYS B CD    1 
ATOM   3038  C  CE    . LYS D  1 20  ? 31.167  -49.533  -27.902 1.00 40.38 ? 18  LYS B CE    1 
ATOM   3039  N  NZ    . LYS D  1 20  ? 32.024  -48.334  -27.742 1.00 49.17 ? 18  LYS B NZ    1 
ATOM   3040  N  N     . TYR D  1 21  ? 30.271  -56.038  -31.128 1.00 18.42 ? 19  TYR B N     1 
ATOM   3041  C  CA    . TYR D  1 21  ? 30.655  -57.191  -31.909 1.00 17.24 ? 19  TYR B CA    1 
ATOM   3042  C  C     . TYR D  1 21  ? 31.072  -56.889  -33.352 1.00 22.29 ? 19  TYR B C     1 
ATOM   3043  O  O     . TYR D  1 21  ? 32.133  -57.361  -33.835 1.00 21.40 ? 19  TYR B O     1 
ATOM   3044  C  CB    . TYR D  1 21  ? 29.533  -58.213  -31.867 1.00 23.60 ? 19  TYR B CB    1 
ATOM   3045  C  CG    . TYR D  1 21  ? 29.392  -58.845  -30.501 1.00 20.69 ? 19  TYR B CG    1 
ATOM   3046  C  CD1   . TYR D  1 21  ? 30.109  -59.994  -30.180 1.00 17.81 ? 19  TYR B CD1   1 
ATOM   3047  C  CD2   . TYR D  1 21  ? 28.536  -58.304  -29.539 1.00 16.48 ? 19  TYR B CD2   1 
ATOM   3048  C  CE1   . TYR D  1 21  ? 29.984  -60.592  -28.939 1.00 19.44 ? 19  TYR B CE1   1 
ATOM   3049  C  CE2   . TYR D  1 21  ? 28.403  -58.894  -28.268 1.00 15.39 ? 19  TYR B CE2   1 
ATOM   3050  C  CZ    . TYR D  1 21  ? 29.148  -60.041  -27.984 1.00 18.80 ? 19  TYR B CZ    1 
ATOM   3051  O  OH    . TYR D  1 21  ? 29.049  -60.673  -26.768 1.00 16.71 ? 19  TYR B OH    1 
ATOM   3052  N  N     . ARG D  1 22  ? 30.253  -56.126  -34.054 1.00 15.77 ? 20  ARG B N     1 
ATOM   3053  C  CA    . ARG D  1 22  ? 30.582  -55.786  -35.434 1.00 25.21 ? 20  ARG B CA    1 
ATOM   3054  C  C     . ARG D  1 22  ? 31.949  -55.114  -35.490 1.00 23.92 ? 20  ARG B C     1 
ATOM   3055  O  O     . ARG D  1 22  ? 32.804  -55.447  -36.327 1.00 25.68 ? 20  ARG B O     1 
ATOM   3056  C  CB    . ARG D  1 22  ? 29.505  -54.890  -36.059 1.00 24.97 ? 20  ARG B CB    1 
ATOM   3057  C  CG    . ARG D  1 22  ? 28.294  -55.668  -36.519 1.00 25.71 ? 20  ARG B CG    1 
ATOM   3058  C  CD    . ARG D  1 22  ? 27.233  -54.746  -37.066 1.00 33.87 ? 20  ARG B CD    1 
ATOM   3059  N  NE    . ARG D  1 22  ? 26.836  -53.782  -36.043 1.00 38.55 ? 20  ARG B NE    1 
ATOM   3060  C  CZ    . ARG D  1 22  ? 25.944  -52.807  -36.224 1.00 45.45 ? 20  ARG B CZ    1 
ATOM   3061  N  NH1   . ARG D  1 22  ? 25.352  -52.656  -37.407 1.00 30.17 ? 20  ARG B NH1   1 
ATOM   3062  N  NH2   . ARG D  1 22  ? 25.655  -51.977  -35.221 1.00 34.10 ? 20  ARG B NH2   1 
ATOM   3063  N  N     . GLU D  1 23  ? 32.182  -54.184  -34.578 1.00 28.38 ? 21  GLU B N     1 
ATOM   3064  C  CA    . GLU D  1 23  ? 33.466  -53.507  -34.587 1.00 24.27 ? 21  GLU B CA    1 
ATOM   3065  C  C     . GLU D  1 23  ? 34.616  -54.494  -34.317 1.00 25.78 ? 21  GLU B C     1 
ATOM   3066  O  O     . GLU D  1 23  ? 35.651  -54.459  -34.976 1.00 24.40 ? 21  GLU B O     1 
ATOM   3067  C  CB    . GLU D  1 23  ? 33.479  -52.329  -33.610 1.00 26.36 ? 21  GLU B CB    1 
ATOM   3068  C  CG    . GLU D  1 23  ? 34.807  -51.573  -33.641 1.00 34.78 ? 21  GLU B CG    1 
ATOM   3069  C  CD    . GLU D  1 23  ? 34.873  -50.415  -32.650 1.00 51.18 ? 21  GLU B CD    1 
ATOM   3070  O  OE1   . GLU D  1 23  ? 33.855  -50.132  -31.969 1.00 46.61 ? 21  GLU B OE1   1 
ATOM   3071  O  OE2   . GLU D  1 23  ? 35.957  -49.787  -32.564 1.00 49.19 ? 21  GLU B OE2   1 
ATOM   3072  N  N     . MET D  1 24  ? 34.429  -55.404  -33.371 1.00 25.27 ? 22  MET B N     1 
ATOM   3073  C  CA    . MET D  1 24  ? 35.468  -56.375  -33.056 1.00 18.81 ? 22  MET B CA    1 
ATOM   3074  C  C     . MET D  1 24  ? 35.850  -57.227  -34.274 1.00 18.93 ? 22  MET B C     1 
ATOM   3075  O  O     . MET D  1 24  ? 37.057  -57.388  -34.623 1.00 21.18 ? 22  MET B O     1 
ATOM   3076  C  CB    . MET D  1 24  ? 35.012  -57.265  -31.877 1.00 17.87 ? 22  MET B CB    1 
ATOM   3077  C  CG    . MET D  1 24  ? 35.981  -58.471  -31.612 1.00 26.48 ? 22  MET B CG    1 
ATOM   3078  S  SD    . MET D  1 24  ? 35.422  -59.509  -30.234 1.00 18.52 ? 22  MET B SD    1 
ATOM   3079  C  CE    . MET D  1 24  ? 34.052  -60.340  -31.029 1.00 18.91 ? 22  MET B CE    1 
ATOM   3080  N  N     . TYR D  1 25  ? 34.831  -57.733  -34.943 1.00 19.80 ? 23  TYR B N     1 
ATOM   3081  C  CA    . TYR D  1 25  ? 35.004  -58.679  -36.036 1.00 17.40 ? 23  TYR B CA    1 
ATOM   3082  C  C     . TYR D  1 25  ? 35.519  -57.941  -37.238 1.00 25.90 ? 23  TYR B C     1 
ATOM   3083  O  O     . TYR D  1 25  ? 36.195  -58.522  -38.098 1.00 23.18 ? 23  TYR B O     1 
ATOM   3084  C  CB    . TYR D  1 25  ? 33.671  -59.378  -36.357 1.00 22.22 ? 23  TYR B CB    1 
ATOM   3085  C  CG    . TYR D  1 25  ? 33.234  -60.437  -35.314 1.00 17.92 ? 23  TYR B CG    1 
ATOM   3086  C  CD1   . TYR D  1 25  ? 34.131  -61.437  -34.879 1.00 18.72 ? 23  TYR B CD1   1 
ATOM   3087  C  CD2   . TYR D  1 25  ? 31.930  -60.427  -34.762 1.00 15.26 ? 23  TYR B CD2   1 
ATOM   3088  C  CE1   . TYR D  1 25  ? 33.734  -62.403  -33.925 1.00 16.78 ? 23  TYR B CE1   1 
ATOM   3089  C  CE2   . TYR D  1 25  ? 31.517  -61.395  -33.822 1.00 15.33 ? 23  TYR B CE2   1 
ATOM   3090  C  CZ    . TYR D  1 25  ? 32.426  -62.391  -33.410 1.00 19.22 ? 23  TYR B CZ    1 
ATOM   3091  O  OH    . TYR D  1 25  ? 32.060  -63.361  -32.474 1.00 13.68 ? 23  TYR B OH    1 
ATOM   3092  N  N     . ARG D  1 26  ? 35.203  -56.649  -37.300 1.00 20.84 ? 24  ARG B N     1 
ATOM   3093  C  CA    . ARG D  1 26  ? 35.774  -55.824  -38.347 1.00 26.38 ? 24  ARG B CA    1 
ATOM   3094  C  C     . ARG D  1 26  ? 37.286  -55.741  -38.155 1.00 28.51 ? 24  ARG B C     1 
ATOM   3095  O  O     . ARG D  1 26  ? 38.051  -56.019  -39.103 1.00 29.16 ? 24  ARG B O     1 
ATOM   3096  C  CB    . ARG D  1 26  ? 35.135  -54.433  -38.335 1.00 29.19 ? 24  ARG B CB    1 
ATOM   3097  C  CG    . ARG D  1 26  ? 34.663  -53.967  -39.699 1.00 34.52 ? 24  ARG B CG    1 
ATOM   3098  C  CD    . ARG D  1 26  ? 34.259  -52.497  -39.669 1.00 33.08 ? 24  ARG B CD    1 
ATOM   3099  N  NE    . ARG D  1 26  ? 32.874  -52.325  -39.211 1.00 45.15 ? 24  ARG B NE    1 
ATOM   3100  C  CZ    . ARG D  1 26  ? 32.521  -51.904  -37.994 1.00 39.91 ? 24  ARG B CZ    1 
ATOM   3101  N  NH1   . ARG D  1 26  ? 33.451  -51.589  -37.100 1.00 46.95 ? 24  ARG B NH1   1 
ATOM   3102  N  NH2   . ARG D  1 26  ? 31.236  -51.761  -37.676 1.00 39.29 ? 24  ARG B NH2   1 
ATOM   3103  N  N     . GLN D  1 27  ? 37.716  -55.373  -36.937 1.00 20.69 ? 25  GLN B N     1 
ATOM   3104  C  CA    . GLN D  1 27  ? 39.142  -55.291  -36.595 1.00 27.00 ? 25  GLN B CA    1 
ATOM   3105  C  C     . GLN D  1 27  ? 39.895  -56.591  -36.833 1.00 29.80 ? 25  GLN B C     1 
ATOM   3106  O  O     . GLN D  1 27  ? 41.036  -56.585  -37.350 1.00 27.26 ? 25  GLN B O     1 
ATOM   3107  C  CB    . GLN D  1 27  ? 39.357  -54.864  -35.138 1.00 30.29 ? 25  GLN B CB    1 
ATOM   3108  C  CG    . GLN D  1 27  ? 39.437  -53.362  -34.910 1.00 38.66 ? 25  GLN B CG    1 
ATOM   3109  C  CD    . GLN D  1 27  ? 39.676  -52.986  -33.442 1.00 36.55 ? 25  GLN B CD    1 
ATOM   3110  O  OE1   . GLN D  1 27  ? 40.418  -53.660  -32.732 1.00 35.37 ? 25  GLN B OE1   1 
ATOM   3111  N  NE2   . GLN D  1 27  ? 39.030  -51.905  -32.988 1.00 41.05 ? 25  GLN B NE2   1 
ATOM   3112  N  N     . LEU D  1 28  ? 39.279  -57.700  -36.421 1.00 27.42 ? 26  LEU B N     1 
ATOM   3113  C  CA    . LEU D  1 28  ? 39.880  -59.019  -36.611 1.00 27.43 ? 26  LEU B CA    1 
ATOM   3114  C  C     . LEU D  1 28  ? 40.076  -59.302  -38.101 1.00 27.54 ? 26  LEU B C     1 
ATOM   3115  O  O     . LEU D  1 28  ? 41.114  -59.823  -38.536 1.00 31.49 ? 26  LEU B O     1 
ATOM   3116  C  CB    . LEU D  1 28  ? 39.016  -60.118  -35.956 1.00 22.20 ? 26  LEU B CB    1 
ATOM   3117  C  CG    . LEU D  1 28  ? 38.951  -60.095  -34.418 1.00 20.10 ? 26  LEU B CG    1 
ATOM   3118  C  CD1   . LEU D  1 28  ? 37.713  -60.910  -33.845 1.00 18.77 ? 26  LEU B CD1   1 
ATOM   3119  C  CD2   . LEU D  1 28  ? 40.256  -60.585  -33.796 1.00 22.74 ? 26  LEU B CD2   1 
ATOM   3120  N  N     . SER D  1 29  ? 39.069  -58.951  -38.890 1.00 31.66 ? 27  SER B N     1 
ATOM   3121  C  CA    . SER D  1 29  ? 39.100  -59.261  -40.304 1.00 32.60 ? 27  SER B CA    1 
ATOM   3122  C  C     . SER D  1 29  ? 40.271  -58.487  -40.930 1.00 30.89 ? 27  SER B C     1 
ATOM   3123  O  O     . SER D  1 29  ? 41.003  -59.009  -41.785 1.00 25.83 ? 27  SER B O     1 
ATOM   3124  C  CB    . SER D  1 29  ? 37.749  -58.896  -40.942 1.00 37.59 ? 27  SER B CB    1 
ATOM   3125  O  OG    . SER D  1 29  ? 37.744  -59.123  -42.341 1.00 39.33 ? 27  SER B OG    1 
ATOM   3126  N  N     . GLU D  1 30  ? 40.459  -57.257  -40.464 1.00 27.13 ? 28  GLU B N     1 
ATOM   3127  C  CA    . GLU D  1 30  ? 41.590  -56.441  -40.891 1.00 35.38 ? 28  GLU B CA    1 
ATOM   3128  C  C     . GLU D  1 30  ? 42.962  -57.069  -40.602 1.00 34.34 ? 28  GLU B C     1 
ATOM   3129  O  O     . GLU D  1 30  ? 43.881  -56.995  -41.425 1.00 36.10 ? 28  GLU B O     1 
ATOM   3130  C  CB    . GLU D  1 30  ? 41.503  -55.064  -40.253 1.00 34.49 ? 28  GLU B CB    1 
ATOM   3131  C  CG    . GLU D  1 30  ? 40.888  -54.035  -41.174 1.00 48.01 ? 28  GLU B CG    1 
ATOM   3132  C  CD    . GLU D  1 30  ? 41.658  -53.905  -42.485 1.00 54.66 ? 28  GLU B CD    1 
ATOM   3133  O  OE1   . GLU D  1 30  ? 42.758  -54.498  -42.597 1.00 46.65 ? 28  GLU B OE1   1 
ATOM   3134  O  OE2   . GLU D  1 30  ? 41.161  -53.208  -43.395 1.00 62.46 ? 28  GLU B OE2   1 
ATOM   3135  N  N     . TYR D  1 31  ? 43.092  -57.680  -39.432 1.00 29.94 ? 29  TYR B N     1 
ATOM   3136  C  CA    . TYR D  1 31  ? 44.288  -58.420  -39.076 1.00 31.94 ? 29  TYR B CA    1 
ATOM   3137  C  C     . TYR D  1 31  ? 44.642  -59.439  -40.152 1.00 32.18 ? 29  TYR B C     1 
ATOM   3138  O  O     . TYR D  1 31  ? 45.796  -59.491  -40.603 1.00 30.91 ? 29  TYR B O     1 
ATOM   3139  C  CB    . TYR D  1 31  ? 44.079  -59.130  -37.739 1.00 29.77 ? 29  TYR B CB    1 
ATOM   3140  C  CG    . TYR D  1 31  ? 45.067  -60.230  -37.424 1.00 28.79 ? 29  TYR B CG    1 
ATOM   3141  C  CD1   . TYR D  1 31  ? 46.297  -59.937  -36.851 1.00 29.82 ? 29  TYR B CD1   1 
ATOM   3142  C  CD2   . TYR D  1 31  ? 44.751  -61.580  -37.661 1.00 32.05 ? 29  TYR B CD2   1 
ATOM   3143  C  CE1   . TYR D  1 31  ? 47.205  -60.950  -36.534 1.00 31.43 ? 29  TYR B CE1   1 
ATOM   3144  C  CE2   . TYR D  1 31  ? 45.660  -62.614  -37.342 1.00 28.61 ? 29  TYR B CE2   1 
ATOM   3145  C  CZ    . TYR D  1 31  ? 46.881  -62.284  -36.772 1.00 31.24 ? 29  TYR B CZ    1 
ATOM   3146  O  OH    . TYR D  1 31  ? 47.790  -63.283  -36.454 1.00 33.42 ? 29  TYR B OH    1 
ATOM   3147  N  N     . GLU D  1 32  ? 43.674  -60.263  -40.540 1.00 25.84 ? 30  GLU B N     1 
ATOM   3148  C  CA    . GLU D  1 32  ? 43.946  -61.329  -41.504 1.00 30.68 ? 30  GLU B CA    1 
ATOM   3149  C  C     . GLU D  1 32  ? 44.350  -60.755  -42.863 1.00 38.23 ? 30  GLU B C     1 
ATOM   3150  O  O     . GLU D  1 32  ? 45.420  -61.068  -43.402 1.00 31.34 ? 30  GLU B O     1 
ATOM   3151  C  CB    . GLU D  1 32  ? 42.733  -62.259  -41.690 1.00 32.86 ? 30  GLU B CB    1 
ATOM   3152  C  CG    . GLU D  1 32  ? 42.256  -63.006  -40.432 1.00 27.76 ? 30  GLU B CG    1 
ATOM   3153  C  CD    . GLU D  1 32  ? 41.246  -64.122  -40.745 1.00 29.50 ? 30  GLU B CD    1 
ATOM   3154  O  OE1   . GLU D  1 32  ? 40.184  -63.860  -41.370 1.00 25.56 ? 30  GLU B OE1   1 
ATOM   3155  O  OE2   . GLU D  1 32  ? 41.528  -65.274  -40.347 1.00 29.27 ? 30  GLU B OE2   1 
ATOM   3156  N  N     . LYS D  1 33  ? 43.461  -59.934  -43.418 1.00 35.12 ? 31  LYS B N     1 
ATOM   3157  C  CA    . LYS D  1 33  ? 43.667  -59.322  -44.727 1.00 37.20 ? 31  LYS B CA    1 
ATOM   3158  C  C     . LYS D  1 33  ? 45.018  -58.614  -44.775 1.00 37.48 ? 31  LYS B C     1 
ATOM   3159  O  O     . LYS D  1 33  ? 45.778  -58.733  -45.743 1.00 42.20 ? 31  LYS B O     1 
ATOM   3160  C  CB    . LYS D  1 33  ? 42.546  -58.313  -45.012 1.00 37.39 ? 31  LYS B CB    1 
ATOM   3161  C  CG    . LYS D  1 33  ? 42.743  -57.496  -46.291 1.00 56.19 ? 31  LYS B CG    1 
ATOM   3162  C  CD    . LYS D  1 33  ? 42.990  -58.390  -47.528 1.00 56.95 ? 31  LYS B CD    1 
ATOM   3163  C  CE    . LYS D  1 33  ? 43.009  -57.573  -48.821 1.00 57.48 ? 31  LYS B CE    1 
ATOM   3164  N  NZ    . LYS D  1 33  ? 43.957  -58.109  -49.846 1.00 58.39 ? 31  LYS B NZ    1 
ATOM   3165  N  N     . SER D  1 34  ? 45.322  -57.896  -43.704 1.00 36.25 ? 32  SER B N     1 
ATOM   3166  C  CA    . SER D  1 34  ? 46.521  -57.076  -43.647 1.00 30.10 ? 32  SER B CA    1 
ATOM   3167  C  C     . SER D  1 34  ? 47.785  -57.898  -43.519 1.00 39.77 ? 32  SER B C     1 
ATOM   3168  O  O     . SER D  1 34  ? 48.793  -57.560  -44.133 1.00 33.24 ? 32  SER B O     1 
ATOM   3169  C  CB    . SER D  1 34  ? 46.449  -56.100  -42.482 1.00 37.58 ? 32  SER B CB    1 
ATOM   3170  O  OG    . SER D  1 34  ? 46.742  -56.744  -41.261 1.00 47.04 ? 32  SER B OG    1 
ATOM   3171  N  N     . THR D  1 35  ? 47.737  -58.976  -42.730 1.00 35.27 ? 33  THR B N     1 
ATOM   3172  C  CA    . THR D  1 35  ? 48.958  -59.685  -42.354 1.00 34.52 ? 33  THR B CA    1 
ATOM   3173  C  C     . THR D  1 35  ? 49.154  -61.020  -43.054 1.00 35.15 ? 33  THR B C     1 
ATOM   3174  O  O     . THR D  1 35  ? 50.242  -61.608  -42.979 1.00 40.55 ? 33  THR B O     1 
ATOM   3175  C  CB    . THR D  1 35  ? 49.015  -59.987  -40.862 1.00 40.17 ? 33  THR B CB    1 
ATOM   3176  O  OG1   . THR D  1 35  ? 48.154  -61.095  -40.578 1.00 37.25 ? 33  THR B OG1   1 
ATOM   3177  C  CG2   . THR D  1 35  ? 48.614  -58.780  -40.046 1.00 38.82 ? 33  THR B CG2   1 
ATOM   3178  N  N     . GLY D  1 36  ? 48.115  -61.522  -43.702 1.00 30.14 ? 34  GLY B N     1 
ATOM   3179  C  CA    . GLY D  1 36  ? 48.227  -62.822  -44.332 1.00 37.39 ? 34  GLY B CA    1 
ATOM   3180  C  C     . GLY D  1 36  ? 48.012  -63.996  -43.383 1.00 33.27 ? 34  GLY B C     1 
ATOM   3181  O  O     . GLY D  1 36  ? 47.962  -65.136  -43.829 1.00 31.71 ? 34  GLY B O     1 
ATOM   3182  N  N     . LYS D  1 37  ? 47.866  -63.740  -42.085 1.00 38.44 ? 35  LYS B N     1 
ATOM   3183  C  CA    . LYS D  1 37  ? 47.611  -64.838  -41.157 1.00 35.02 ? 35  LYS B CA    1 
ATOM   3184  C  C     . LYS D  1 37  ? 46.122  -65.150  -41.062 1.00 33.26 ? 35  LYS B C     1 
ATOM   3185  O  O     . LYS D  1 37  ? 45.277  -64.261  -41.185 1.00 34.89 ? 35  LYS B O     1 
ATOM   3186  C  CB    . LYS D  1 37  ? 48.133  -64.521  -39.765 1.00 34.66 ? 35  LYS B CB    1 
ATOM   3187  C  CG    . LYS D  1 37  ? 49.647  -64.502  -39.604 1.00 38.74 ? 35  LYS B CG    1 
ATOM   3188  C  CD    . LYS D  1 37  ? 50.075  -63.123  -39.135 1.00 37.29 ? 35  LYS B CD    1 
ATOM   3189  C  CE    . LYS D  1 37  ? 51.151  -63.184  -38.091 1.00 38.48 ? 35  LYS B CE    1 
ATOM   3190  N  NZ    . LYS D  1 37  ? 51.124  -61.928  -37.311 1.00 43.14 ? 35  LYS B NZ    1 
ATOM   3191  N  N     . GLU D  1 38  ? 45.818  -66.421  -40.822 1.00 22.04 ? 36  GLU B N     1 
ATOM   3192  C  CA    . GLU D  1 38  ? 44.476  -66.871  -40.591 1.00 31.30 ? 36  GLU B CA    1 
ATOM   3193  C  C     . GLU D  1 38  ? 44.265  -66.986  -39.073 1.00 29.57 ? 36  GLU B C     1 
ATOM   3194  O  O     . GLU D  1 38  ? 45.137  -67.484  -38.303 1.00 27.35 ? 36  GLU B O     1 
ATOM   3195  C  CB    . GLU D  1 38  ? 44.317  -68.237  -41.253 1.00 34.82 ? 36  GLU B CB    1 
ATOM   3196  C  CG    . GLU D  1 38  ? 42.915  -68.767  -41.426 1.00 35.91 ? 36  GLU B CG    1 
ATOM   3197  C  CD    . GLU D  1 38  ? 42.960  -70.199  -41.986 1.00 59.46 ? 36  GLU B CD    1 
ATOM   3198  O  OE1   . GLU D  1 38  ? 43.381  -70.369  -43.160 1.00 61.27 ? 36  GLU B OE1   1 
ATOM   3199  O  OE2   . GLU D  1 38  ? 42.618  -71.150  -41.240 1.00 51.83 ? 36  GLU B OE2   1 
ATOM   3200  N  N     . ILE D  1 39  ? 43.103  -66.534  -38.640 1.00 23.71 ? 37  ILE B N     1 
ATOM   3201  C  CA    . ILE D  1 39  ? 42.729  -66.660  -37.247 1.00 24.22 ? 37  ILE B CA    1 
ATOM   3202  C  C     . ILE D  1 39  ? 42.086  -68.037  -37.041 1.00 23.20 ? 37  ILE B C     1 
ATOM   3203  O  O     . ILE D  1 39  ? 41.112  -68.370  -37.701 1.00 24.12 ? 37  ILE B O     1 
ATOM   3204  C  CB    . ILE D  1 39  ? 41.764  -65.552  -36.863 1.00 21.36 ? 37  ILE B CB    1 
ATOM   3205  C  CG1   . ILE D  1 39  ? 42.535  -64.234  -36.708 1.00 21.19 ? 37  ILE B CG1   1 
ATOM   3206  C  CG2   . ILE D  1 39  ? 41.069  -65.888  -35.549 1.00 17.33 ? 37  ILE B CG2   1 
ATOM   3207  C  CD1   . ILE D  1 39  ? 41.652  -62.986  -36.781 1.00 24.80 ? 37  ILE B CD1   1 
ATOM   3208  N  N     . SER D  1 40  ? 42.638  -68.833  -36.131 1.00 19.07 ? 38  SER B N     1 
ATOM   3209  C  CA    . SER D  1 40  ? 42.069  -70.148  -35.835 1.00 20.50 ? 38  SER B CA    1 
ATOM   3210  C  C     . SER D  1 40  ? 40.782  -69.988  -35.042 1.00 21.28 ? 38  SER B C     1 
ATOM   3211  O  O     . SER D  1 40  ? 39.790  -70.703  -35.252 1.00 17.02 ? 38  SER B O     1 
ATOM   3212  C  CB    . SER D  1 40  ? 43.059  -70.981  -35.006 1.00 23.65 ? 38  SER B CB    1 
ATOM   3213  O  OG    . SER D  1 40  ? 44.236  -71.235  -35.736 1.00 35.69 ? 38  SER B OG    1 
ATOM   3214  N  N     . PHE D  1 41  ? 40.816  -69.045  -34.104 1.00 18.95 ? 39  PHE B N     1 
ATOM   3215  C  CA    . PHE D  1 41  ? 39.685  -68.792  -33.234 1.00 17.15 ? 39  PHE B CA    1 
ATOM   3216  C  C     . PHE D  1 41  ? 39.987  -67.604  -32.309 1.00 15.02 ? 39  PHE B C     1 
ATOM   3217  O  O     . PHE D  1 41  ? 41.151  -67.117  -32.228 1.00 14.92 ? 39  PHE B O     1 
ATOM   3218  C  CB    . PHE D  1 41  ? 39.224  -70.079  -32.469 1.00 15.96 ? 39  PHE B CB    1 
ATOM   3219  C  CG    . PHE D  1 41  ? 40.186  -70.542  -31.389 1.00 14.44 ? 39  PHE B CG    1 
ATOM   3220  C  CD1   . PHE D  1 41  ? 41.202  -71.426  -31.685 1.00 17.97 ? 39  PHE B CD1   1 
ATOM   3221  C  CD2   . PHE D  1 41  ? 40.035  -70.111  -30.058 1.00 11.23 ? 39  PHE B CD2   1 
ATOM   3222  C  CE1   . PHE D  1 41  ? 42.097  -71.855  -30.685 1.00 18.91 ? 39  PHE B CE1   1 
ATOM   3223  C  CE2   . PHE D  1 41  ? 40.884  -70.526  -29.062 1.00 17.90 ? 39  PHE B CE2   1 
ATOM   3224  C  CZ    . PHE D  1 41  ? 41.939  -71.400  -29.375 1.00 22.96 ? 39  PHE B CZ    1 
ATOM   3225  N  N     . VAL D  1 42  ? 38.934  -67.133  -31.646 1.00 15.69 ? 40  VAL B N     1 
ATOM   3226  C  CA    . VAL D  1 42  ? 38.971  -65.917  -30.852 1.00 13.50 ? 40  VAL B CA    1 
ATOM   3227  C  C     . VAL D  1 42  ? 38.528  -66.252  -29.436 1.00 15.87 ? 40  VAL B C     1 
ATOM   3228  O  O     . VAL D  1 42  ? 37.637  -67.091  -29.248 1.00 15.32 ? 40  VAL B O     1 
ATOM   3229  C  CB    . VAL D  1 42  ? 37.976  -64.908  -31.394 1.00 16.24 ? 40  VAL B CB    1 
ATOM   3230  C  CG1   . VAL D  1 42  ? 38.069  -63.575  -30.612 1.00 12.54 ? 40  VAL B CG1   1 
ATOM   3231  C  CG2   . VAL D  1 42  ? 38.193  -64.707  -32.906 1.00 17.15 ? 40  VAL B CG2   1 
ATOM   3232  N  N     . ILE D  1 43  ? 39.140  -65.572  -28.474 1.00 15.06 ? 41  ILE B N     1 
ATOM   3233  C  CA    . ILE D  1 43  ? 38.843  -65.733  -27.082 1.00 14.96 ? 41  ILE B CA    1 
ATOM   3234  C  C     . ILE D  1 43  ? 38.531  -64.360  -26.541 1.00 21.03 ? 41  ILE B C     1 
ATOM   3235  O  O     . ILE D  1 43  ? 39.354  -63.443  -26.701 1.00 16.27 ? 41  ILE B O     1 
ATOM   3236  C  CB    . ILE D  1 43  ? 40.090  -66.184  -26.317 1.00 22.57 ? 41  ILE B CB    1 
ATOM   3237  C  CG1   . ILE D  1 43  ? 40.553  -67.556  -26.763 1.00 19.13 ? 41  ILE B CG1   1 
ATOM   3238  C  CG2   . ILE D  1 43  ? 39.838  -66.089  -24.802 1.00 25.26 ? 41  ILE B CG2   1 
ATOM   3239  C  CD1   . ILE D  1 43  ? 41.711  -68.093  -25.914 1.00 16.47 ? 41  ILE B CD1   1 
ATOM   3240  N  N     . CYS D  1 44  ? 37.356  -64.195  -25.911 1.00 14.38 ? 42  CYS B N     1 
ATOM   3241  C  CA    . CYS D  1 44  ? 37.035  -62.918  -25.255 1.00 16.20 ? 42  CYS B CA    1 
ATOM   3242  C  C     . CYS D  1 44  ? 36.979  -63.082  -23.752 1.00 17.71 ? 42  CYS B C     1 
ATOM   3243  O  O     . CYS D  1 44  ? 36.515  -64.119  -23.236 1.00 14.35 ? 42  CYS B O     1 
ATOM   3244  C  CB    . CYS D  1 44  ? 35.695  -62.381  -25.769 1.00 14.53 ? 42  CYS B CB    1 
ATOM   3245  S  SG    . CYS D  1 44  ? 35.707  -62.214  -27.587 1.00 18.66 ? 42  CYS B SG    1 
ATOM   3246  N  N     . THR D  1 45  ? 37.412  -62.053  -23.033 1.00 15.41 ? 43  THR B N     1 
ATOM   3247  C  CA    . THR D  1 45  ? 37.525  -62.142  -21.590 1.00 19.65 ? 43  THR B CA    1 
ATOM   3248  C  C     . THR D  1 45  ? 36.478  -61.381  -20.811 1.00 20.56 ? 43  THR B C     1 
ATOM   3249  O  O     . THR D  1 45  ? 36.696  -61.063  -19.642 1.00 18.26 ? 43  THR B O     1 
ATOM   3250  C  CB    . THR D  1 45  ? 38.947  -61.716  -21.092 1.00 18.32 ? 43  THR B CB    1 
ATOM   3251  O  OG1   . THR D  1 45  ? 39.341  -60.487  -21.704 1.00 21.49 ? 43  THR B OG1   1 
ATOM   3252  C  CG2   . THR D  1 45  ? 39.956  -62.789  -21.446 1.00 19.28 ? 43  THR B CG2   1 
ATOM   3253  N  N     . GLY D  1 46  ? 35.353  -61.061  -21.450 1.00 19.58 ? 44  GLY B N     1 
ATOM   3254  C  CA    . GLY D  1 46  ? 34.191  -60.682  -20.677 1.00 16.49 ? 44  GLY B CA    1 
ATOM   3255  C  C     . GLY D  1 46  ? 33.473  -59.410  -21.091 1.00 16.40 ? 44  GLY B C     1 
ATOM   3256  O  O     . GLY D  1 46  ? 33.823  -58.741  -22.087 1.00 17.84 ? 44  GLY B O     1 
ATOM   3257  N  N     . ASP D  1 47  ? 32.481  -59.071  -20.281 1.00 12.19 ? 45  ASP B N     1 
ATOM   3258  C  CA    . ASP D  1 47  ? 31.610  -57.935  -20.542 1.00 15.00 ? 45  ASP B CA    1 
ATOM   3259  C  C     . ASP D  1 47  ? 31.023  -58.105  -21.931 1.00 17.06 ? 45  ASP B C     1 
ATOM   3260  O  O     . ASP D  1 47  ? 31.171  -57.247  -22.799 1.00 18.76 ? 45  ASP B O     1 
ATOM   3261  C  CB    . ASP D  1 47  ? 32.368  -56.616  -20.379 1.00 15.87 ? 45  ASP B CB    1 
ATOM   3262  C  CG    . ASP D  1 47  ? 32.641  -56.278  -18.917 1.00 18.23 ? 45  ASP B CG    1 
ATOM   3263  O  OD1   . ASP D  1 47  ? 32.125  -56.987  -18.033 1.00 16.15 ? 45  ASP B OD1   1 
ATOM   3264  O  OD2   . ASP D  1 47  ? 33.356  -55.295  -18.645 1.00 23.01 ? 45  ASP B OD2   1 
ATOM   3265  N  N     . MET D  1 48  ? 30.340  -59.242  -22.117 1.00 14.13 ? 46  MET B N     1 
ATOM   3266  C  CA    . MET D  1 48  ? 29.924  -59.656  -23.429 1.00 14.68 ? 46  MET B CA    1 
ATOM   3267  C  C     . MET D  1 48  ? 28.543  -59.075  -23.781 1.00 18.66 ? 46  MET B C     1 
ATOM   3268  O  O     . MET D  1 48  ? 28.214  -58.927  -24.961 1.00 19.55 ? 46  MET B O     1 
ATOM   3269  C  CB    . MET D  1 48  ? 29.917  -61.192  -23.520 1.00 9.81  ? 46  MET B CB    1 
ATOM   3270  C  CG    . MET D  1 48  ? 31.278  -61.805  -23.191 1.00 14.92 ? 46  MET B CG    1 
ATOM   3271  S  SD    . MET D  1 48  ? 32.529  -61.163  -24.318 1.00 18.11 ? 46  MET B SD    1 
ATOM   3272  C  CE    . MET D  1 48  ? 32.111  -61.934  -25.895 1.00 11.35 ? 46  MET B CE    1 
ATOM   3273  N  N     . GLN D  1 49  ? 27.740  -58.731  -22.775 1.00 14.64 ? 47  GLN B N     1 
ATOM   3274  C  CA    . GLN D  1 49  ? 26.450  -58.074  -23.042 1.00 15.06 ? 47  GLN B CA    1 
ATOM   3275  C  C     . GLN D  1 49  ? 25.522  -58.833  -24.027 1.00 17.04 ? 47  GLN B C     1 
ATOM   3276  O  O     . GLN D  1 49  ? 24.983  -58.254  -24.989 1.00 14.28 ? 47  GLN B O     1 
ATOM   3277  C  CB    . GLN D  1 49  ? 26.656  -56.609  -23.497 1.00 17.45 ? 47  GLN B CB    1 
ATOM   3278  C  CG    . GLN D  1 49  ? 27.372  -55.759  -22.447 1.00 19.92 ? 47  GLN B CG    1 
ATOM   3279  C  CD    . GLN D  1 49  ? 27.252  -54.252  -22.671 1.00 25.23 ? 47  GLN B CD    1 
ATOM   3280  O  OE1   . GLN D  1 49  ? 26.346  -53.767  -23.375 1.00 27.36 ? 47  GLN B OE1   1 
ATOM   3281  N  NE2   . GLN D  1 49  ? 28.164  -53.501  -22.045 1.00 23.04 ? 47  GLN B NE2   1 
ATOM   3282  N  N     . THR D  1 50  ? 25.311  -60.124  -23.771 1.00 14.99 ? 48  THR B N     1 
ATOM   3283  C  CA    . THR D  1 50  ? 24.626  -60.975  -24.741 1.00 17.91 ? 48  THR B CA    1 
ATOM   3284  C  C     . THR D  1 50  ? 23.124  -60.885  -24.504 1.00 16.85 ? 48  THR B C     1 
ATOM   3285  O  O     . THR D  1 50  ? 22.458  -61.886  -24.232 1.00 15.44 ? 48  THR B O     1 
ATOM   3286  C  CB    . THR D  1 50  ? 25.094  -62.446  -24.671 1.00 19.58 ? 48  THR B CB    1 
ATOM   3287  O  OG1   . THR D  1 50  ? 24.659  -63.023  -23.421 1.00 15.15 ? 48  THR B OG1   1 
ATOM   3288  C  CG2   . THR D  1 50  ? 26.646  -62.537  -24.805 1.00 12.74 ? 48  THR B CG2   1 
ATOM   3289  N  N     . LEU D  1 51  ? 22.597  -59.665  -24.622 1.00 21.04 ? 49  LEU B N     1 
ATOM   3290  C  CA    . LEU D  1 51  ? 21.167  -59.415  -24.455 1.00 15.29 ? 49  LEU B CA    1 
ATOM   3291  C  C     . LEU D  1 51  ? 20.462  -59.815  -25.741 1.00 15.86 ? 49  LEU B C     1 
ATOM   3292  O  O     . LEU D  1 51  ? 20.808  -59.293  -26.837 1.00 16.67 ? 49  LEU B O     1 
ATOM   3293  C  CB    . LEU D  1 51  ? 20.918  -57.935  -24.184 1.00 18.39 ? 49  LEU B CB    1 
ATOM   3294  C  CG    . LEU D  1 51  ? 21.362  -57.422  -22.812 1.00 19.46 ? 49  LEU B CG    1 
ATOM   3295  C  CD1   . LEU D  1 51  ? 22.885  -57.208  -22.766 1.00 19.80 ? 49  LEU B CD1   1 
ATOM   3296  C  CD2   . LEU D  1 51  ? 20.676  -56.103  -22.502 1.00 22.74 ? 49  LEU B CD2   1 
ATOM   3297  N  N     . ARG D  1 52  ? 19.505  -60.752  -25.609 1.00 16.69 ? 50  ARG B N     1 
ATOM   3298  C  CA    . ARG D  1 52  ? 18.753  -61.352  -26.750 1.00 18.74 ? 50  ARG B CA    1 
ATOM   3299  C  C     . ARG D  1 52  ? 17.713  -60.422  -27.287 1.00 17.22 ? 50  ARG B C     1 
ATOM   3300  O  O     . ARG D  1 52  ? 17.501  -60.323  -28.509 1.00 15.96 ? 50  ARG B O     1 
ATOM   3301  C  CB    . ARG D  1 52  ? 17.962  -62.580  -26.298 1.00 19.87 ? 50  ARG B CB    1 
ATOM   3302  C  CG    . ARG D  1 52  ? 18.818  -63.771  -25.922 1.00 22.24 ? 50  ARG B CG    1 
ATOM   3303  C  CD    . ARG D  1 52  ? 18.018  -64.759  -25.145 1.00 15.66 ? 50  ARG B CD    1 
ATOM   3304  N  NE    . ARG D  1 52  ? 17.462  -64.152  -23.931 1.00 15.87 ? 50  ARG B NE    1 
ATOM   3305  C  CZ    . ARG D  1 52  ? 16.885  -64.842  -22.944 1.00 18.06 ? 50  ARG B CZ    1 
ATOM   3306  N  NH1   . ARG D  1 52  ? 16.753  -66.161  -23.031 1.00 12.53 ? 50  ARG B NH1   1 
ATOM   3307  N  NH2   . ARG D  1 52  ? 16.411  -64.213  -21.881 1.00 13.19 ? 50  ARG B NH2   1 
ATOM   3308  N  N     . TYR D  1 53  ? 17.022  -59.768  -26.365 1.00 15.76 ? 51  TYR B N     1 
ATOM   3309  C  CA    . TYR D  1 53  ? 15.952  -58.856  -26.753 1.00 16.37 ? 51  TYR B CA    1 
ATOM   3310  C  C     . TYR D  1 53  ? 15.687  -57.841  -25.641 1.00 20.29 ? 51  TYR B C     1 
ATOM   3311  O  O     . TYR D  1 53  ? 16.290  -57.962  -24.576 1.00 20.92 ? 51  TYR B O     1 
ATOM   3312  C  CB    . TYR D  1 53  ? 14.713  -59.652  -27.127 1.00 19.41 ? 51  TYR B CB    1 
ATOM   3313  C  CG    . TYR D  1 53  ? 14.572  -60.972  -26.403 1.00 18.74 ? 51  TYR B CG    1 
ATOM   3314  C  CD1   . TYR D  1 53  ? 14.464  -61.031  -25.010 1.00 16.32 ? 51  TYR B CD1   1 
ATOM   3315  C  CD2   . TYR D  1 53  ? 14.489  -62.168  -27.118 1.00 18.24 ? 51  TYR B CD2   1 
ATOM   3316  C  CE1   . TYR D  1 53  ? 14.269  -62.272  -24.342 1.00 17.67 ? 51  TYR B CE1   1 
ATOM   3317  C  CE2   . TYR D  1 53  ? 14.304  -63.401  -26.468 1.00 19.37 ? 51  TYR B CE2   1 
ATOM   3318  C  CZ    . TYR D  1 53  ? 14.203  -63.452  -25.085 1.00 18.07 ? 51  TYR B CZ    1 
ATOM   3319  O  OH    . TYR D  1 53  ? 14.023  -64.695  -24.456 1.00 23.90 ? 51  TYR B OH    1 
ATOM   3320  N  N     . GLU D  1 54  ? 14.855  -56.820  -25.884 1.00 16.16 ? 52  GLU B N     1 
ATOM   3321  C  CA    . GLU D  1 54  ? 14.803  -55.672  -24.951 1.00 19.66 ? 52  GLU B CA    1 
ATOM   3322  C  C     . GLU D  1 54  ? 14.647  -56.081  -23.484 1.00 16.91 ? 52  GLU B C     1 
ATOM   3323  O  O     . GLU D  1 54  ? 15.240  -55.505  -22.569 1.00 19.72 ? 52  GLU B O     1 
ATOM   3324  C  CB    . GLU D  1 54  ? 13.638  -54.724  -25.296 1.00 22.07 ? 52  GLU B CB    1 
ATOM   3325  C  CG    . GLU D  1 54  ? 13.760  -53.895  -26.582 1.00 30.55 ? 52  GLU B CG    1 
ATOM   3326  C  CD    . GLU D  1 54  ? 12.577  -52.900  -26.719 1.00 35.16 ? 52  GLU B CD    1 
ATOM   3327  O  OE1   . GLU D  1 54  ? 12.183  -52.505  -27.872 1.00 31.26 ? 52  GLU B OE1   1 
ATOM   3328  O  OE2   . GLU D  1 54  ? 12.046  -52.528  -25.638 1.00 28.36 ? 52  GLU B OE2   1 
ATOM   3329  N  N     . ALA D  1 55  ? 13.791  -57.062  -23.246 1.00 17.93 ? 53  ALA B N     1 
ATOM   3330  C  CA    . ALA D  1 55  ? 13.457  -57.426  -21.884 1.00 16.23 ? 53  ALA B CA    1 
ATOM   3331  C  C     . ALA D  1 55  ? 14.665  -57.800  -21.067 1.00 20.06 ? 53  ALA B C     1 
ATOM   3332  O  O     . ALA D  1 55  ? 14.624  -57.744  -19.829 1.00 18.76 ? 53  ALA B O     1 
ATOM   3333  C  CB    . ALA D  1 55  ? 12.432  -58.556  -21.869 1.00 18.05 ? 53  ALA B CB    1 
ATOM   3334  N  N     . ASP D  1 56  ? 15.733  -58.226  -21.744 1.00 20.48 ? 54  ASP B N     1 
ATOM   3335  C  CA    . ASP D  1 56  ? 16.990  -58.577  -21.064 1.00 22.43 ? 54  ASP B CA    1 
ATOM   3336  C  C     . ASP D  1 56  ? 17.735  -57.388  -20.403 1.00 19.75 ? 54  ASP B C     1 
ATOM   3337  O  O     . ASP D  1 56  ? 18.592  -57.581  -19.545 1.00 14.90 ? 54  ASP B O     1 
ATOM   3338  C  CB    . ASP D  1 56  ? 17.918  -59.294  -22.032 1.00 18.44 ? 54  ASP B CB    1 
ATOM   3339  C  CG    . ASP D  1 56  ? 17.498  -60.753  -22.313 1.00 17.39 ? 54  ASP B CG    1 
ATOM   3340  O  OD1   . ASP D  1 56  ? 16.752  -61.369  -21.518 1.00 14.34 ? 54  ASP B OD1   1 
ATOM   3341  O  OD2   . ASP D  1 56  ? 17.930  -61.274  -23.358 1.00 21.06 ? 54  ASP B OD2   1 
ATOM   3342  N  N     . LEU D  1 57  ? 17.414  -56.167  -20.808 1.00 20.33 ? 55  LEU B N     1 
ATOM   3343  C  CA    . LEU D  1 57  ? 18.074  -54.981  -20.239 1.00 19.71 ? 55  LEU B CA    1 
ATOM   3344  C  C     . LEU D  1 57  ? 17.966  -54.971  -18.737 1.00 19.09 ? 55  LEU B C     1 
ATOM   3345  O  O     . LEU D  1 57  ? 18.817  -54.428  -18.049 1.00 14.69 ? 55  LEU B O     1 
ATOM   3346  C  CB    . LEU D  1 57  ? 17.466  -53.712  -20.797 1.00 18.95 ? 55  LEU B CB    1 
ATOM   3347  C  CG    . LEU D  1 57  ? 17.952  -53.417  -22.200 1.00 25.63 ? 55  LEU B CG    1 
ATOM   3348  C  CD1   . LEU D  1 57  ? 17.002  -52.456  -22.865 1.00 29.62 ? 55  LEU B CD1   1 
ATOM   3349  C  CD2   . LEU D  1 57  ? 19.360  -52.810  -22.156 1.00 27.93 ? 55  LEU B CD2   1 
ATOM   3350  N  N     . VAL D  1 58  ? 16.916  -55.606  -18.222 1.00 17.14 ? 56  VAL B N     1 
ATOM   3351  C  CA    . VAL D  1 58  ? 16.669  -55.623  -16.790 1.00 18.79 ? 56  VAL B CA    1 
ATOM   3352  C  C     . VAL D  1 58  ? 17.811  -56.337  -16.044 1.00 25.62 ? 56  VAL B C     1 
ATOM   3353  O  O     . VAL D  1 58  ? 18.099  -56.035  -14.892 1.00 23.98 ? 56  VAL B O     1 
ATOM   3354  C  CB    . VAL D  1 58  ? 15.287  -56.241  -16.495 1.00 25.35 ? 56  VAL B CB    1 
ATOM   3355  C  CG1   . VAL D  1 58  ? 15.246  -56.864  -15.128 1.00 27.88 ? 56  VAL B CG1   1 
ATOM   3356  C  CG2   . VAL D  1 58  ? 14.213  -55.184  -16.659 1.00 25.71 ? 56  VAL B CG2   1 
ATOM   3357  N  N     . TYR D  1 59  ? 18.495  -57.247  -16.724 1.00 18.83 ? 57  TYR B N     1 
ATOM   3358  C  CA    . TYR D  1 59  ? 19.562  -58.015  -16.074 1.00 20.26 ? 57  TYR B CA    1 
ATOM   3359  C  C     . TYR D  1 59  ? 20.967  -57.446  -16.321 1.00 15.89 ? 57  TYR B C     1 
ATOM   3360  O  O     . TYR D  1 59  ? 21.939  -58.067  -15.905 1.00 17.43 ? 57  TYR B O     1 
ATOM   3361  C  CB    . TYR D  1 59  ? 19.517  -59.477  -16.531 1.00 18.33 ? 57  TYR B CB    1 
ATOM   3362  C  CG    . TYR D  1 59  ? 18.368  -60.238  -15.921 1.00 21.11 ? 57  TYR B CG    1 
ATOM   3363  C  CD1   . TYR D  1 59  ? 17.120  -60.264  -16.530 1.00 20.20 ? 57  TYR B CD1   1 
ATOM   3364  C  CD2   . TYR D  1 59  ? 18.528  -60.914  -14.715 1.00 20.48 ? 57  TYR B CD2   1 
ATOM   3365  C  CE1   . TYR D  1 59  ? 16.047  -60.957  -15.940 1.00 22.70 ? 57  TYR B CE1   1 
ATOM   3366  C  CE2   . TYR D  1 59  ? 17.493  -61.590  -14.142 1.00 23.96 ? 57  TYR B CE2   1 
ATOM   3367  C  CZ    . TYR D  1 59  ? 16.253  -61.615  -14.742 1.00 23.76 ? 57  TYR B CZ    1 
ATOM   3368  O  OH    . TYR D  1 59  ? 15.226  -62.315  -14.121 1.00 25.63 ? 57  TYR B OH    1 
ATOM   3369  N  N     . LEU D  1 60  ? 21.052  -56.319  -17.039 1.00 15.83 ? 58  LEU B N     1 
ATOM   3370  C  CA    . LEU D  1 60  ? 22.324  -55.661  -17.377 1.00 16.34 ? 58  LEU B CA    1 
ATOM   3371  C  C     . LEU D  1 60  ? 22.658  -54.605  -16.327 1.00 21.61 ? 58  LEU B C     1 
ATOM   3372  O  O     . LEU D  1 60  ? 21.927  -53.618  -16.170 1.00 24.06 ? 58  LEU B O     1 
ATOM   3373  C  CB    . LEU D  1 60  ? 22.278  -55.009  -18.769 1.00 15.40 ? 58  LEU B CB    1 
ATOM   3374  C  CG    . LEU D  1 60  ? 23.552  -54.213  -19.115 1.00 18.78 ? 58  LEU B CG    1 
ATOM   3375  C  CD1   . LEU D  1 60  ? 24.796  -55.129  -19.130 1.00 20.16 ? 58  LEU B CD1   1 
ATOM   3376  C  CD2   . LEU D  1 60  ? 23.418  -53.513  -20.451 1.00 19.43 ? 58  LEU B CD2   1 
ATOM   3377  N  N     . LYS D  1 61  ? 23.772  -54.815  -15.629 1.00 19.17 ? 59  LYS B N     1 
ATOM   3378  C  CA    . LYS D  1 61  ? 24.139  -53.999  -14.496 1.00 24.17 ? 59  LYS B CA    1 
ATOM   3379  C  C     . LYS D  1 61  ? 25.034  -52.868  -14.964 1.00 25.79 ? 59  LYS B C     1 
ATOM   3380  O  O     . LYS D  1 61  ? 26.275  -52.994  -14.956 1.00 26.11 ? 59  LYS B O     1 
ATOM   3381  C  CB    . LYS D  1 61  ? 24.848  -54.881  -13.481 1.00 22.90 ? 59  LYS B CB    1 
ATOM   3382  C  CG    . LYS D  1 61  ? 25.335  -54.185  -12.292 1.00 33.03 ? 59  LYS B CG    1 
ATOM   3383  C  CD    . LYS D  1 61  ? 24.331  -53.225  -11.802 1.00 36.35 ? 59  LYS B CD    1 
ATOM   3384  C  CE    . LYS D  1 61  ? 25.058  -52.300  -10.857 1.00 45.86 ? 59  LYS B CE    1 
ATOM   3385  N  NZ    . LYS D  1 61  ? 26.435  -52.851  -10.618 1.00 41.41 ? 59  LYS B NZ    1 
ATOM   3386  N  N     . VAL D  1 62  ? 24.388  -51.777  -15.389 1.00 20.52 ? 60  VAL B N     1 
ATOM   3387  C  CA    . VAL D  1 62  ? 25.050  -50.580  -15.882 1.00 20.23 ? 60  VAL B CA    1 
ATOM   3388  C  C     . VAL D  1 62  ? 24.316  -49.332  -15.392 1.00 27.25 ? 60  VAL B C     1 
ATOM   3389  O  O     . VAL D  1 62  ? 23.137  -49.390  -15.008 1.00 24.63 ? 60  VAL B O     1 
ATOM   3390  C  CB    . VAL D  1 62  ? 25.082  -50.522  -17.411 1.00 26.38 ? 60  VAL B CB    1 
ATOM   3391  C  CG1   . VAL D  1 62  ? 25.972  -51.613  -17.975 1.00 25.42 ? 60  VAL B CG1   1 
ATOM   3392  C  CG2   . VAL D  1 62  ? 23.633  -50.620  -17.996 1.00 20.77 ? 60  VAL B CG2   1 
ATOM   3393  N  N     . PRO D  1 63  ? 25.016  -48.187  -15.397 1.00 32.56 ? 61  PRO B N     1 
ATOM   3394  C  CA    . PRO D  1 63  ? 24.302  -46.931  -15.127 1.00 32.61 ? 61  PRO B CA    1 
ATOM   3395  C  C     . PRO D  1 63  ? 23.395  -46.613  -16.309 1.00 29.67 ? 61  PRO B C     1 
ATOM   3396  O  O     . PRO D  1 63  ? 23.669  -47.088  -17.431 1.00 25.30 ? 61  PRO B O     1 
ATOM   3397  C  CB    . PRO D  1 63  ? 25.433  -45.893  -15.005 1.00 36.27 ? 61  PRO B CB    1 
ATOM   3398  C  CG    . PRO D  1 63  ? 26.630  -46.512  -15.690 1.00 33.32 ? 61  PRO B CG    1 
ATOM   3399  C  CD    . PRO D  1 63  ? 26.479  -48.006  -15.494 1.00 37.14 ? 61  PRO B CD    1 
ATOM   3400  N  N     . PRO D  1 64  ? 22.314  -45.848  -16.065 1.00 28.93 ? 62  PRO B N     1 
ATOM   3401  C  CA    . PRO D  1 64  ? 21.309  -45.569  -17.089 1.00 19.92 ? 62  PRO B CA    1 
ATOM   3402  C  C     . PRO D  1 64  ? 21.893  -45.209  -18.437 1.00 25.39 ? 62  PRO B C     1 
ATOM   3403  O  O     . PRO D  1 64  ? 21.379  -45.680  -19.451 1.00 27.03 ? 62  PRO B O     1 
ATOM   3404  C  CB    . PRO D  1 64  ? 20.536  -44.398  -16.487 1.00 26.81 ? 62  PRO B CB    1 
ATOM   3405  C  CG    . PRO D  1 64  ? 20.502  -44.740  -15.018 1.00 27.31 ? 62  PRO B CG    1 
ATOM   3406  C  CD    . PRO D  1 64  ? 21.833  -45.460  -14.729 1.00 32.07 ? 62  PRO B CD    1 
ATOM   3407  N  N     . LYS D  1 65  ? 22.950  -44.403  -18.464 1.00 27.44 ? 63  LYS B N     1 
ATOM   3408  C  CA    . LYS D  1 65  ? 23.481  -43.959  -19.736 1.00 24.57 ? 63  LYS B CA    1 
ATOM   3409  C  C     . LYS D  1 65  ? 23.956  -45.143  -20.578 1.00 27.75 ? 63  LYS B C     1 
ATOM   3410  O  O     . LYS D  1 65  ? 24.119  -45.019  -21.797 1.00 23.14 ? 63  LYS B O     1 
ATOM   3411  C  CB    . LYS D  1 65  ? 24.584  -42.912  -19.548 1.00 34.40 ? 63  LYS B CB    1 
ATOM   3412  C  CG    . LYS D  1 65  ? 25.700  -43.314  -18.584 1.00 37.72 ? 63  LYS B CG    1 
ATOM   3413  C  CD    . LYS D  1 65  ? 26.985  -42.521  -18.890 1.00 45.31 ? 63  LYS B CD    1 
ATOM   3414  C  CE    . LYS D  1 65  ? 27.394  -42.739  -20.341 1.00 45.37 ? 63  LYS B CE    1 
ATOM   3415  N  NZ    . LYS D  1 65  ? 28.023  -41.549  -21.005 1.00 51.48 ? 63  LYS B NZ    1 
ATOM   3416  N  N     . TYR D  1 66  ? 24.157  -46.298  -19.944 1.00 28.42 ? 64  TYR B N     1 
ATOM   3417  C  CA    . TYR D  1 66  ? 24.626  -47.458  -20.699 1.00 29.07 ? 64  TYR B CA    1 
ATOM   3418  C  C     . TYR D  1 66  ? 23.568  -48.543  -20.907 1.00 23.31 ? 64  TYR B C     1 
ATOM   3419  O  O     . TYR D  1 66  ? 23.876  -49.629  -21.380 1.00 23.42 ? 64  TYR B O     1 
ATOM   3420  C  CB    . TYR D  1 66  ? 25.883  -48.050  -20.074 1.00 30.12 ? 64  TYR B CB    1 
ATOM   3421  C  CG    . TYR D  1 66  ? 27.058  -47.107  -20.175 1.00 36.87 ? 64  TYR B CG    1 
ATOM   3422  C  CD1   . TYR D  1 66  ? 27.492  -46.643  -21.412 1.00 35.24 ? 64  TYR B CD1   1 
ATOM   3423  C  CD2   . TYR D  1 66  ? 27.705  -46.652  -19.034 1.00 37.10 ? 64  TYR B CD2   1 
ATOM   3424  C  CE1   . TYR D  1 66  ? 28.547  -45.752  -21.506 1.00 37.89 ? 64  TYR B CE1   1 
ATOM   3425  C  CE2   . TYR D  1 66  ? 28.765  -45.772  -19.120 1.00 35.86 ? 64  TYR B CE2   1 
ATOM   3426  C  CZ    . TYR D  1 66  ? 29.179  -45.327  -20.359 1.00 42.23 ? 64  TYR B CZ    1 
ATOM   3427  O  OH    . TYR D  1 66  ? 30.236  -44.448  -20.419 1.00 53.94 ? 64  TYR B OH    1 
ATOM   3428  N  N     . LYS D  1 67  ? 22.325  -48.247  -20.576 1.00 23.32 ? 65  LYS B N     1 
ATOM   3429  C  CA    . LYS D  1 67  ? 21.259  -49.233  -20.774 1.00 21.97 ? 65  LYS B CA    1 
ATOM   3430  C  C     . LYS D  1 67  ? 20.942  -49.292  -22.267 1.00 26.61 ? 65  LYS B C     1 
ATOM   3431  O  O     . LYS D  1 67  ? 19.947  -48.682  -22.714 1.00 24.44 ? 65  LYS B O     1 
ATOM   3432  C  CB    . LYS D  1 67  ? 20.019  -48.851  -19.955 1.00 22.16 ? 65  LYS B CB    1 
ATOM   3433  C  CG    . LYS D  1 67  ? 20.179  -49.095  -18.479 1.00 25.57 ? 65  LYS B CG    1 
ATOM   3434  C  CD    . LYS D  1 67  ? 20.108  -50.616  -18.148 1.00 22.36 ? 65  LYS B CD    1 
ATOM   3435  C  CE    . LYS D  1 67  ? 20.065  -50.807  -16.622 1.00 19.71 ? 65  LYS B CE    1 
ATOM   3436  N  NZ    . LYS D  1 67  ? 19.700  -52.238  -16.290 1.00 18.79 ? 65  LYS B NZ    1 
ATOM   3437  N  N     . GLN D  1 68  ? 21.802  -49.991  -23.031 1.00 19.43 ? 66  GLN B N     1 
ATOM   3438  C  CA    . GLN D  1 68  ? 21.656  -50.158  -24.487 1.00 24.86 ? 66  GLN B CA    1 
ATOM   3439  C  C     . GLN D  1 68  ? 21.747  -51.631  -24.904 1.00 20.61 ? 66  GLN B C     1 
ATOM   3440  O  O     . GLN D  1 68  ? 22.327  -52.449  -24.187 1.00 25.62 ? 66  GLN B O     1 
ATOM   3441  C  CB    . GLN D  1 68  ? 22.742  -49.398  -25.238 1.00 24.11 ? 66  GLN B CB    1 
ATOM   3442  C  CG    . GLN D  1 68  ? 22.791  -47.925  -24.951 1.00 29.08 ? 66  GLN B CG    1 
ATOM   3443  C  CD    . GLN D  1 68  ? 24.031  -47.271  -25.530 1.00 37.24 ? 66  GLN B CD    1 
ATOM   3444  O  OE1   . GLN D  1 68  ? 24.821  -47.919  -26.225 1.00 35.05 ? 66  GLN B OE1   1 
ATOM   3445  N  NE2   . GLN D  1 68  ? 24.219  -45.982  -25.234 1.00 35.57 ? 66  GLN B NE2   1 
ATOM   3446  N  N     . MET D  1 69  ? 21.190  -51.956  -26.064 1.00 17.12 ? 67  MET B N     1 
ATOM   3447  C  CA    . MET D  1 69  ? 21.205  -53.334  -26.547 1.00 24.29 ? 67  MET B CA    1 
ATOM   3448  C  C     . MET D  1 69  ? 22.571  -53.779  -27.023 1.00 23.19 ? 67  MET B C     1 
ATOM   3449  O  O     . MET D  1 69  ? 22.947  -54.940  -26.850 1.00 24.64 ? 67  MET B O     1 
ATOM   3450  C  CB    . MET D  1 69  ? 20.199  -53.526  -27.671 1.00 23.74 ? 67  MET B CB    1 
ATOM   3451  C  CG    . MET D  1 69  ? 18.737  -53.539  -27.194 1.00 24.07 ? 67  MET B CG    1 
ATOM   3452  S  SD    . MET D  1 69  ? 18.404  -54.904  -26.022 1.00 23.98 ? 67  MET B SD    1 
ATOM   3453  C  CE    . MET D  1 69  ? 18.419  -56.340  -27.112 1.00 17.49 ? 67  MET B CE    1 
ATOM   3454  N  N     . GLY D  1 70  ? 23.312  -52.875  -27.654 1.00 19.64 ? 68  GLY B N     1 
ATOM   3455  C  CA    . GLY D  1 70  ? 24.576  -53.274  -28.252 1.00 21.79 ? 68  GLY B CA    1 
ATOM   3456  C  C     . GLY D  1 70  ? 24.283  -54.148  -29.461 1.00 24.60 ? 68  GLY B C     1 
ATOM   3457  O  O     . GLY D  1 70  ? 23.127  -54.232  -29.898 1.00 17.99 ? 68  GLY B O     1 
ATOM   3458  N  N     . ASP D  1 71  ? 25.333  -54.776  -29.994 1.00 19.57 ? 69  ASP B N     1 
ATOM   3459  C  CA    . ASP D  1 71  ? 25.289  -55.544  -31.234 1.00 18.86 ? 69  ASP B CA    1 
ATOM   3460  C  C     . ASP D  1 71  ? 24.823  -56.977  -31.056 1.00 18.14 ? 69  ASP B C     1 
ATOM   3461  O  O     . ASP D  1 71  ? 24.451  -57.610  -32.033 1.00 18.18 ? 69  ASP B O     1 
ATOM   3462  C  CB    . ASP D  1 71  ? 26.689  -55.611  -31.874 1.00 23.28 ? 69  ASP B CB    1 
ATOM   3463  C  CG    . ASP D  1 71  ? 27.119  -54.287  -32.500 1.00 32.74 ? 69  ASP B CG    1 
ATOM   3464  O  OD1   . ASP D  1 71  ? 26.508  -53.240  -32.173 1.00 41.75 ? 69  ASP B OD1   1 
ATOM   3465  O  OD2   . ASP D  1 71  ? 28.056  -54.298  -33.323 1.00 26.28 ? 69  ASP B OD2   1 
ATOM   3466  N  N     . PHE D  1 72  ? 24.843  -57.514  -29.845 1.00 15.49 ? 70  PHE B N     1 
ATOM   3467  C  CA    . PHE D  1 72  ? 24.602  -58.963  -29.738 1.00 19.48 ? 70  PHE B CA    1 
ATOM   3468  C  C     . PHE D  1 72  ? 23.317  -59.460  -30.415 1.00 16.61 ? 70  PHE B C     1 
ATOM   3469  O  O     . PHE D  1 72  ? 23.337  -60.454  -31.149 1.00 15.63 ? 70  PHE B O     1 
ATOM   3470  C  CB    . PHE D  1 72  ? 24.656  -59.501  -28.295 1.00 15.62 ? 70  PHE B CB    1 
ATOM   3471  C  CG    . PHE D  1 72  ? 24.371  -60.978  -28.240 1.00 17.16 ? 70  PHE B CG    1 
ATOM   3472  C  CD1   . PHE D  1 72  ? 25.350  -61.912  -28.607 1.00 17.80 ? 70  PHE B CD1   1 
ATOM   3473  C  CD2   . PHE D  1 72  ? 23.108  -61.438  -27.908 1.00 16.22 ? 70  PHE B CD2   1 
ATOM   3474  C  CE1   . PHE D  1 72  ? 25.061  -63.303  -28.602 1.00 10.82 ? 70  PHE B CE1   1 
ATOM   3475  C  CE2   . PHE D  1 72  ? 22.803  -62.804  -27.901 1.00 17.00 ? 70  PHE B CE2   1 
ATOM   3476  C  CZ    . PHE D  1 72  ? 23.766  -63.747  -28.264 1.00 12.89 ? 70  PHE B CZ    1 
ATOM   3477  N  N     . HIS D  1 73  ? 22.187  -58.790  -30.169 1.00 16.38 ? 71  HIS B N     1 
ATOM   3478  C  CA    . HIS D  1 73  ? 20.915  -59.302  -30.679 1.00 20.77 ? 71  HIS B CA    1 
ATOM   3479  C  C     . HIS D  1 73  ? 20.927  -59.502  -32.202 1.00 22.43 ? 71  HIS B C     1 
ATOM   3480  O  O     . HIS D  1 73  ? 20.188  -60.344  -32.743 1.00 20.90 ? 71  HIS B O     1 
ATOM   3481  C  CB    . HIS D  1 73  ? 19.780  -58.364  -30.310 1.00 19.96 ? 71  HIS B CB    1 
ATOM   3482  C  CG    . HIS D  1 73  ? 19.867  -57.041  -30.993 1.00 22.78 ? 71  HIS B CG    1 
ATOM   3483  N  ND1   . HIS D  1 73  ? 19.058  -56.702  -32.060 1.00 26.50 ? 71  HIS B ND1   1 
ATOM   3484  C  CD2   . HIS D  1 73  ? 20.687  -55.977  -30.789 1.00 24.44 ? 71  HIS B CD2   1 
ATOM   3485  C  CE1   . HIS D  1 73  ? 19.366  -55.484  -32.468 1.00 28.06 ? 71  HIS B CE1   1 
ATOM   3486  N  NE2   . HIS D  1 73  ? 20.358  -55.024  -31.720 1.00 20.53 ? 71  HIS B NE2   1 
ATOM   3487  N  N     . LEU D  1 74  ? 21.745  -58.712  -32.896 1.00 19.22 ? 72  LEU B N     1 
ATOM   3488  C  CA    . LEU D  1 74  ? 21.896  -58.857  -34.348 1.00 20.04 ? 72  LEU B CA    1 
ATOM   3489  C  C     . LEU D  1 74  ? 22.384  -60.276  -34.726 1.00 25.07 ? 72  LEU B C     1 
ATOM   3490  O  O     . LEU D  1 74  ? 21.841  -60.924  -35.644 1.00 17.89 ? 72  LEU B O     1 
ATOM   3491  C  CB    . LEU D  1 74  ? 22.915  -57.842  -34.841 1.00 21.65 ? 72  LEU B CB    1 
ATOM   3492  C  CG    . LEU D  1 74  ? 22.519  -56.545  -35.549 1.00 31.95 ? 72  LEU B CG    1 
ATOM   3493  C  CD1   . LEU D  1 74  ? 21.106  -56.075  -35.238 1.00 30.63 ? 72  LEU B CD1   1 
ATOM   3494  C  CD2   . LEU D  1 74  ? 23.529  -55.450  -35.240 1.00 26.45 ? 72  LEU B CD2   1 
ATOM   3495  N  N     . TYR D  1 75  ? 23.457  -60.729  -34.068 1.00 20.17 ? 73  TYR B N     1 
ATOM   3496  C  CA    . TYR D  1 75  ? 23.909  -62.128  -34.178 1.00 17.03 ? 73  TYR B CA    1 
ATOM   3497  C  C     . TYR D  1 75  ? 22.848  -63.151  -33.674 1.00 20.26 ? 73  TYR B C     1 
ATOM   3498  O  O     . TYR D  1 75  ? 22.556  -64.168  -34.345 1.00 17.38 ? 73  TYR B O     1 
ATOM   3499  C  CB    . TYR D  1 75  ? 25.259  -62.270  -33.450 1.00 14.06 ? 73  TYR B CB    1 
ATOM   3500  C  CG    . TYR D  1 75  ? 26.299  -61.346  -34.038 1.00 18.96 ? 73  TYR B CG    1 
ATOM   3501  C  CD1   . TYR D  1 75  ? 26.342  -59.985  -33.697 1.00 18.53 ? 73  TYR B CD1   1 
ATOM   3502  C  CD2   . TYR D  1 75  ? 27.183  -61.798  -34.985 1.00 16.94 ? 73  TYR B CD2   1 
ATOM   3503  C  CE1   . TYR D  1 75  ? 27.264  -59.140  -34.271 1.00 15.23 ? 73  TYR B CE1   1 
ATOM   3504  C  CE2   . TYR D  1 75  ? 28.103  -60.958  -35.550 1.00 15.12 ? 73  TYR B CE2   1 
ATOM   3505  C  CZ    . TYR D  1 75  ? 28.140  -59.636  -35.182 1.00 19.06 ? 73  TYR B CZ    1 
ATOM   3506  O  OH    . TYR D  1 75  ? 29.075  -58.815  -35.766 1.00 22.55 ? 73  TYR B OH    1 
ATOM   3507  N  N     . TYR D  1 76  ? 22.247  -62.877  -32.519 1.00 20.54 ? 74  TYR B N     1 
ATOM   3508  C  CA    . TYR D  1 76  ? 21.161  -63.710  -32.008 1.00 18.89 ? 74  TYR B CA    1 
ATOM   3509  C  C     . TYR D  1 76  ? 20.038  -63.923  -33.024 1.00 20.47 ? 74  TYR B C     1 
ATOM   3510  O  O     . TYR D  1 76  ? 19.553  -65.052  -33.196 1.00 17.10 ? 74  TYR B O     1 
ATOM   3511  C  CB    . TYR D  1 76  ? 20.577  -63.131  -30.726 1.00 15.26 ? 74  TYR B CB    1 
ATOM   3512  C  CG    . TYR D  1 76  ? 19.561  -64.034  -30.052 1.00 20.29 ? 74  TYR B CG    1 
ATOM   3513  C  CD1   . TYR D  1 76  ? 19.954  -65.179  -29.354 1.00 21.20 ? 74  TYR B CD1   1 
ATOM   3514  C  CD2   . TYR D  1 76  ? 18.206  -63.717  -30.072 1.00 17.85 ? 74  TYR B CD2   1 
ATOM   3515  C  CE1   . TYR D  1 76  ? 19.007  -65.995  -28.714 1.00 21.41 ? 74  TYR B CE1   1 
ATOM   3516  C  CE2   . TYR D  1 76  ? 17.260  -64.516  -29.452 1.00 16.99 ? 74  TYR B CE2   1 
ATOM   3517  C  CZ    . TYR D  1 76  ? 17.662  -65.646  -28.762 1.00 24.43 ? 74  TYR B CZ    1 
ATOM   3518  O  OH    . TYR D  1 76  ? 16.701  -66.438  -28.149 1.00 23.13 ? 74  TYR B OH    1 
ATOM   3519  N  N     . GLU D  1 77  ? 19.640  -62.841  -33.683 1.00 20.47 ? 75  GLU B N     1 
ATOM   3520  C  CA    . GLU D  1 77  ? 18.579  -62.867  -34.698 1.00 24.33 ? 75  GLU B CA    1 
ATOM   3521  C  C     . GLU D  1 77  ? 19.086  -63.440  -36.018 1.00 22.01 ? 75  GLU B C     1 
ATOM   3522  O  O     . GLU D  1 77  ? 18.302  -63.804  -36.892 1.00 26.02 ? 75  GLU B O     1 
ATOM   3523  C  CB    . GLU D  1 77  ? 18.068  -61.448  -34.958 1.00 23.72 ? 75  GLU B CB    1 
ATOM   3524  C  CG    . GLU D  1 77  ? 17.357  -60.787  -33.779 1.00 23.59 ? 75  GLU B CG    1 
ATOM   3525  C  CD    . GLU D  1 77  ? 17.557  -59.243  -33.769 1.00 25.89 ? 75  GLU B CD    1 
ATOM   3526  O  OE1   . GLU D  1 77  ? 17.228  -58.596  -32.745 1.00 23.27 ? 75  GLU B OE1   1 
ATOM   3527  O  OE2   . GLU D  1 77  ? 18.049  -58.684  -34.782 1.00 28.78 ? 75  GLU B OE2   1 
ATOM   3528  N  N     . GLY D  1 78  ? 20.395  -63.455  -36.205 1.00 22.73 ? 76  GLY B N     1 
ATOM   3529  C  CA    . GLY D  1 78  ? 20.943  -64.022  -37.428 1.00 27.53 ? 76  GLY B CA    1 
ATOM   3530  C  C     . GLY D  1 78  ? 21.006  -63.034  -38.588 1.00 26.62 ? 76  GLY B C     1 
ATOM   3531  O  O     . GLY D  1 78  ? 21.268  -63.413  -39.741 1.00 26.81 ? 76  GLY B O     1 
ATOM   3532  N  N     . LYS D  1 79  ? 20.771  -61.763  -38.293 1.00 23.89 ? 77  LYS B N     1 
ATOM   3533  C  CA    . LYS D  1 79  ? 21.019  -60.718  -39.282 1.00 25.28 ? 77  LYS B CA    1 
ATOM   3534  C  C     . LYS D  1 79  ? 22.517  -60.596  -39.494 1.00 23.96 ? 77  LYS B C     1 
ATOM   3535  O  O     . LYS D  1 79  ? 22.974  -60.195  -40.556 1.00 21.43 ? 77  LYS B O     1 
ATOM   3536  C  CB    . LYS D  1 79  ? 20.443  -59.386  -38.802 1.00 22.60 ? 77  LYS B CB    1 
ATOM   3537  C  CG    . LYS D  1 79  ? 18.915  -59.394  -38.699 1.00 31.24 ? 77  LYS B CG    1 
ATOM   3538  C  CD    . LYS D  1 79  ? 18.431  -58.321  -37.740 1.00 33.88 ? 77  LYS B CD    1 
ATOM   3539  C  CE    . LYS D  1 79  ? 16.923  -58.326  -37.621 1.00 34.88 ? 77  LYS B CE    1 
ATOM   3540  N  NZ    . LYS D  1 79  ? 16.495  -57.103  -36.868 1.00 38.95 ? 77  LYS B NZ    1 
ATOM   3541  N  N     . GLU D  1 80  ? 23.292  -60.919  -38.465 1.00 24.04 ? 78  GLU B N     1 
ATOM   3542  C  CA    . GLU D  1 80  ? 24.742  -60.896  -38.605 1.00 23.61 ? 78  GLU B CA    1 
ATOM   3543  C  C     . GLU D  1 80  ? 25.242  -62.289  -38.227 1.00 25.38 ? 78  GLU B C     1 
ATOM   3544  O  O     . GLU D  1 80  ? 24.540  -63.030  -37.531 1.00 21.80 ? 78  GLU B O     1 
ATOM   3545  C  CB    . GLU D  1 80  ? 25.370  -59.829  -37.706 1.00 20.70 ? 78  GLU B CB    1 
ATOM   3546  C  CG    . GLU D  1 80  ? 25.016  -58.408  -38.063 1.00 28.87 ? 78  GLU B CG    1 
ATOM   3547  C  CD    . GLU D  1 80  ? 25.887  -57.835  -39.177 1.00 32.93 ? 78  GLU B CD    1 
ATOM   3548  O  OE1   . GLU D  1 80  ? 26.706  -58.572  -39.763 1.00 36.68 ? 78  GLU B OE1   1 
ATOM   3549  O  OE2   . GLU D  1 80  ? 25.761  -56.630  -39.450 1.00 38.70 ? 78  GLU B OE2   1 
ATOM   3550  N  N     . LYS D  1 81  ? 26.445  -62.637  -38.679 1.00 19.41 ? 79  LYS B N     1 
ATOM   3551  C  CA    . LYS D  1 81  ? 26.970  -63.964  -38.429 1.00 23.38 ? 79  LYS B CA    1 
ATOM   3552  C  C     . LYS D  1 81  ? 28.465  -63.890  -38.072 1.00 22.27 ? 79  LYS B C     1 
ATOM   3553  O  O     . LYS D  1 81  ? 29.296  -63.384  -38.852 1.00 21.41 ? 79  LYS B O     1 
ATOM   3554  C  CB    . LYS D  1 81  ? 26.731  -64.832  -39.654 1.00 23.63 ? 79  LYS B CB    1 
ATOM   3555  C  CG    . LYS D  1 81  ? 26.975  -66.331  -39.438 1.00 24.85 ? 79  LYS B CG    1 
ATOM   3556  C  CD    . LYS D  1 81  ? 26.931  -67.061  -40.777 1.00 31.00 ? 79  LYS B CD    1 
ATOM   3557  C  CE    . LYS D  1 81  ? 26.922  -68.585  -40.564 1.00 38.95 ? 79  LYS B CE    1 
ATOM   3558  N  NZ    . LYS D  1 81  ? 26.356  -69.325  -41.739 1.00 44.96 ? 79  LYS B NZ    1 
ATOM   3559  N  N     . ALA D  1 82  ? 28.797  -64.352  -36.866 1.00 17.18 ? 80  ALA B N     1 
ATOM   3560  C  CA    . ALA D  1 82  ? 30.181  -64.371  -36.392 1.00 16.77 ? 80  ALA B CA    1 
ATOM   3561  C  C     . ALA D  1 82  ? 31.096  -65.161  -37.341 1.00 18.19 ? 80  ALA B C     1 
ATOM   3562  O  O     . ALA D  1 82  ? 30.885  -66.354  -37.543 1.00 22.22 ? 80  ALA B O     1 
ATOM   3563  C  CB    . ALA D  1 82  ? 30.260  -64.983  -34.982 1.00 16.09 ? 80  ALA B CB    1 
ATOM   3564  N  N     . PRO D  1 83  ? 32.139  -64.504  -37.879 1.00 19.11 ? 81  PRO B N     1 
ATOM   3565  C  CA    . PRO D  1 83  ? 33.059  -65.099  -38.864 1.00 22.76 ? 81  PRO B CA    1 
ATOM   3566  C  C     . PRO D  1 83  ? 34.097  -66.042  -38.246 1.00 22.13 ? 81  PRO B C     1 
ATOM   3567  O  O     . PRO D  1 83  ? 34.669  -66.846  -38.982 1.00 24.76 ? 81  PRO B O     1 
ATOM   3568  C  CB    . PRO D  1 83  ? 33.769  -63.876  -39.471 1.00 22.37 ? 81  PRO B CB    1 
ATOM   3569  C  CG    . PRO D  1 83  ? 33.759  -62.856  -38.369 1.00 24.93 ? 81  PRO B CG    1 
ATOM   3570  C  CD    . PRO D  1 83  ? 32.399  -63.063  -37.695 1.00 15.72 ? 81  PRO B CD    1 
ATOM   3571  N  N     . TYR D  1 84  ? 34.344  -65.921  -36.934 1.00 21.07 ? 82  TYR B N     1 
ATOM   3572  C  CA    . TYR D  1 84  ? 35.198  -66.863  -36.225 1.00 19.51 ? 82  TYR B CA    1 
ATOM   3573  C  C     . TYR D  1 84  ? 34.508  -67.474  -35.011 1.00 19.05 ? 82  TYR B C     1 
ATOM   3574  O  O     . TYR D  1 84  ? 33.860  -66.779  -34.236 1.00 18.06 ? 82  TYR B O     1 
ATOM   3575  C  CB    . TYR D  1 84  ? 36.471  -66.157  -35.745 1.00 20.07 ? 82  TYR B CB    1 
ATOM   3576  C  CG    . TYR D  1 84  ? 37.010  -65.187  -36.771 1.00 24.39 ? 82  TYR B CG    1 
ATOM   3577  C  CD1   . TYR D  1 84  ? 37.923  -65.606  -37.737 1.00 29.98 ? 82  TYR B CD1   1 
ATOM   3578  C  CD2   . TYR D  1 84  ? 36.597  -63.859  -36.779 1.00 26.80 ? 82  TYR B CD2   1 
ATOM   3579  C  CE1   . TYR D  1 84  ? 38.425  -64.723  -38.682 1.00 29.76 ? 82  TYR B CE1   1 
ATOM   3580  C  CE2   . TYR D  1 84  ? 37.093  -62.957  -37.719 1.00 29.92 ? 82  TYR B CE2   1 
ATOM   3581  C  CZ    . TYR D  1 84  ? 37.996  -63.397  -38.671 1.00 30.30 ? 82  TYR B CZ    1 
ATOM   3582  O  OH    . TYR D  1 84  ? 38.462  -62.512  -39.618 1.00 30.69 ? 82  TYR B OH    1 
ATOM   3583  N  N     . LEU D  1 85  ? 34.703  -68.768  -34.823 1.00 17.52 ? 83  LEU B N     1 
ATOM   3584  C  CA    . LEU D  1 85  ? 34.413  -69.393  -33.532 1.00 18.12 ? 83  LEU B CA    1 
ATOM   3585  C  C     . LEU D  1 85  ? 34.986  -68.523  -32.404 1.00 14.67 ? 83  LEU B C     1 
ATOM   3586  O  O     . LEU D  1 85  ? 36.198  -68.260  -32.342 1.00 16.95 ? 83  LEU B O     1 
ATOM   3587  C  CB    . LEU D  1 85  ? 35.069  -70.757  -33.451 1.00 17.68 ? 83  LEU B CB    1 
ATOM   3588  C  CG    . LEU D  1 85  ? 34.867  -71.443  -32.100 1.00 22.56 ? 83  LEU B CG    1 
ATOM   3589  C  CD1   . LEU D  1 85  ? 33.385  -71.458  -31.771 1.00 14.39 ? 83  LEU B CD1   1 
ATOM   3590  C  CD2   . LEU D  1 85  ? 35.480  -72.852  -32.130 1.00 21.54 ? 83  LEU B CD2   1 
ATOM   3591  N  N     . THR D  1 86  ? 34.103  -68.111  -31.504 1.00 14.95 ? 84  THR B N     1 
ATOM   3592  C  CA    . THR D  1 86  ? 34.442  -67.153  -30.472 1.00 13.29 ? 84  THR B CA    1 
ATOM   3593  C  C     . THR D  1 86  ? 34.081  -67.725  -29.090 1.00 15.46 ? 84  THR B C     1 
ATOM   3594  O  O     . THR D  1 86  ? 32.930  -68.078  -28.822 1.00 16.53 ? 84  THR B O     1 
ATOM   3595  C  CB    . THR D  1 86  ? 33.735  -65.833  -30.742 1.00 16.96 ? 84  THR B CB    1 
ATOM   3596  O  OG1   . THR D  1 86  ? 34.152  -65.330  -32.032 1.00 13.35 ? 84  THR B OG1   1 
ATOM   3597  C  CG2   . THR D  1 86  ? 34.053  -64.795  -29.617 1.00 12.14 ? 84  THR B CG2   1 
ATOM   3598  N  N     . LEU D  1 87  ? 35.090  -67.856  -28.231 1.00 13.98 ? 85  LEU B N     1 
ATOM   3599  C  CA    . LEU D  1 87  ? 34.925  -68.541  -26.947 1.00 13.79 ? 85  LEU B CA    1 
ATOM   3600  C  C     . LEU D  1 87  ? 34.982  -67.456  -25.867 1.00 11.03 ? 85  LEU B C     1 
ATOM   3601  O  O     . LEU D  1 87  ? 35.781  -66.518  -25.972 1.00 15.78 ? 85  LEU B O     1 
ATOM   3602  C  CB    . LEU D  1 87  ? 36.042  -69.583  -26.738 1.00 12.35 ? 85  LEU B CB    1 
ATOM   3603  C  CG    . LEU D  1 87  ? 36.308  -70.644  -27.804 1.00 14.02 ? 85  LEU B CG    1 
ATOM   3604  C  CD1   . LEU D  1 87  ? 37.495  -71.603  -27.374 1.00 10.94 ? 85  LEU B CD1   1 
ATOM   3605  C  CD2   . LEU D  1 87  ? 35.048  -71.427  -28.182 1.00 14.44 ? 85  LEU B CD2   1 
ATOM   3606  N  N     . PHE D  1 88  ? 34.146  -67.541  -24.841 1.00 11.05 ? 86  PHE B N     1 
ATOM   3607  C  CA    . PHE D  1 88  ? 34.125  -66.441  -23.869 1.00 13.55 ? 86  PHE B CA    1 
ATOM   3608  C  C     . PHE D  1 88  ? 33.691  -66.844  -22.451 1.00 11.27 ? 86  PHE B C     1 
ATOM   3609  O  O     . PHE D  1 88  ? 33.083  -67.918  -22.237 1.00 11.67 ? 86  PHE B O     1 
ATOM   3610  C  CB    . PHE D  1 88  ? 33.282  -65.278  -24.412 1.00 14.00 ? 86  PHE B CB    1 
ATOM   3611  C  CG    . PHE D  1 88  ? 31.779  -65.556  -24.491 1.00 14.90 ? 86  PHE B CG    1 
ATOM   3612  C  CD1   . PHE D  1 88  ? 30.947  -65.281  -23.402 1.00 10.88 ? 86  PHE B CD1   1 
ATOM   3613  C  CD2   . PHE D  1 88  ? 31.197  -66.020  -25.674 1.00 14.15 ? 86  PHE B CD2   1 
ATOM   3614  C  CE1   . PHE D  1 88  ? 29.535  -65.479  -23.491 1.00 16.45 ? 86  PHE B CE1   1 
ATOM   3615  C  CE2   . PHE D  1 88  ? 29.797  -66.217  -25.774 1.00 15.30 ? 86  PHE B CE2   1 
ATOM   3616  C  CZ    . PHE D  1 88  ? 28.967  -65.961  -24.663 1.00 16.01 ? 86  PHE B CZ    1 
ATOM   3617  N  N     . ILE D  1 89  ? 34.032  -65.980  -21.496 1.00 11.22 ? 87  ILE B N     1 
ATOM   3618  C  CA    . ILE D  1 89  ? 33.537  -66.044  -20.110 1.00 10.67 ? 87  ILE B CA    1 
ATOM   3619  C  C     . ILE D  1 89  ? 32.724  -64.796  -19.823 1.00 16.22 ? 87  ILE B C     1 
ATOM   3620  O  O     . ILE D  1 89  ? 32.759  -63.834  -20.612 1.00 13.90 ? 87  ILE B O     1 
ATOM   3621  C  CB    . ILE D  1 89  ? 34.688  -66.078  -19.102 1.00 12.80 ? 87  ILE B CB    1 
ATOM   3622  C  CG1   . ILE D  1 89  ? 35.727  -65.033  -19.475 1.00 19.07 ? 87  ILE B CG1   1 
ATOM   3623  C  CG2   . ILE D  1 89  ? 35.364  -67.451  -19.082 1.00 16.47 ? 87  ILE B CG2   1 
ATOM   3624  C  CD1   . ILE D  1 89  ? 36.642  -64.650  -18.343 1.00 17.89 ? 87  ILE B CD1   1 
ATOM   3625  N  N     . GLY D  1 90  ? 32.027  -64.785  -18.688 1.00 11.06 ? 88  GLY B N     1 
ATOM   3626  C  CA    . GLY D  1 90  ? 31.239  -63.610  -18.328 1.00 14.84 ? 88  GLY B CA    1 
ATOM   3627  C  C     . GLY D  1 90  ? 32.084  -62.624  -17.515 1.00 16.82 ? 88  GLY B C     1 
ATOM   3628  O  O     . GLY D  1 90  ? 33.030  -63.025  -16.828 1.00 13.46 ? 88  GLY B O     1 
ATOM   3629  N  N     . GLY D  1 91  ? 31.747  -61.342  -17.584 1.00 16.54 ? 89  GLY B N     1 
ATOM   3630  C  CA    . GLY D  1 91  ? 32.411  -60.344  -16.749 1.00 14.26 ? 89  GLY B CA    1 
ATOM   3631  C  C     . GLY D  1 91  ? 31.361  -59.757  -15.819 1.00 16.17 ? 89  GLY B C     1 
ATOM   3632  O  O     . GLY D  1 91  ? 30.627  -60.521  -15.173 1.00 12.16 ? 89  GLY B O     1 
ATOM   3633  N  N     . ASN D  1 92  ? 31.296  -58.421  -15.749 1.00 15.50 ? 90  ASN B N     1 
ATOM   3634  C  CA    . ASN D  1 92  ? 30.456  -57.707  -14.781 1.00 17.15 ? 90  ASN B CA    1 
ATOM   3635  C  C     . ASN D  1 92  ? 29.344  -56.950  -15.508 1.00 16.67 ? 90  ASN B C     1 
ATOM   3636  O  O     . ASN D  1 92  ? 28.401  -56.445  -14.885 1.00 18.53 ? 90  ASN B O     1 
ATOM   3637  C  CB    . ASN D  1 92  ? 31.301  -56.739  -13.929 1.00 19.26 ? 90  ASN B CB    1 
ATOM   3638  C  CG    . ASN D  1 92  ? 31.969  -55.677  -14.763 1.00 16.49 ? 90  ASN B CG    1 
ATOM   3639  O  OD1   . ASN D  1 92  ? 32.931  -55.962  -15.468 1.00 21.03 ? 90  ASN B OD1   1 
ATOM   3640  N  ND2   . ASN D  1 92  ? 31.463  -54.440  -14.697 1.00 22.02 ? 90  ASN B ND2   1 
ATOM   3641  N  N     . HIS D  1 93  ? 29.345  -56.945  -16.778 1.00 13.10 ? 91  HIS B N     1 
ATOM   3642  C  CA    . HIS D  1 93  ? 28.303  -56.347  -17.627 1.00 19.76 ? 91  HIS B CA    1 
ATOM   3643  C  C     . HIS D  1 93  ? 27.770  -57.419  -18.572 1.00 20.21 ? 91  HIS B C     1 
ATOM   3644  O  O     . HIS D  1 93  ? 28.335  -57.634  -19.636 1.00 13.87 ? 91  HIS B O     1 
ATOM   3645  C  CB    . HIS D  1 93  ? 28.909  -55.245  -18.495 1.00 18.85 ? 91  HIS B CB    1 
ATOM   3646  C  CG    . HIS D  1 93  ? 29.339  -54.034  -17.735 1.00 23.82 ? 91  HIS B CG    1 
ATOM   3647  N  ND1   . HIS D  1 93  ? 28.589  -53.472  -16.719 1.00 27.39 ? 91  HIS B ND1   1 
ATOM   3648  C  CD2   . HIS D  1 93  ? 30.445  -53.256  -17.859 1.00 23.85 ? 91  HIS B CD2   1 
ATOM   3649  C  CE1   . HIS D  1 93  ? 29.198  -52.385  -16.269 1.00 24.14 ? 91  HIS B CE1   1 
ATOM   3650  N  NE2   . HIS D  1 93  ? 30.330  -52.242  -16.935 1.00 28.20 ? 91  HIS B NE2   1 
ATOM   3651  N  N     . GLU D  1 94  ? 26.759  -58.016  -18.245 1.00 17.89 ? 92  GLU B N     1 
ATOM   3652  C  CA    . GLU D  1 94  ? 26.267  -59.172  -18.955 1.00 16.73 ? 92  GLU B CA    1 
ATOM   3653  C  C     . GLU D  1 94  ? 24.739  -59.201  -18.934 1.00 17.68 ? 92  GLU B C     1 
ATOM   3654  O  O     . GLU D  1 94  ? 24.088  -58.533  -18.103 1.00 18.00 ? 92  GLU B O     1 
ATOM   3655  C  CB    . GLU D  1 94  ? 26.775  -60.438  -18.260 1.00 13.24 ? 92  GLU B CB    1 
ATOM   3656  C  CG    . GLU D  1 94  ? 28.291  -60.545  -18.159 1.00 14.44 ? 92  GLU B CG    1 
ATOM   3657  C  CD    . GLU D  1 94  ? 28.955  -60.757  -19.500 1.00 20.33 ? 92  GLU B CD    1 
ATOM   3658  O  OE1   . GLU D  1 94  ? 28.213  -61.064  -20.475 1.00 13.39 ? 92  GLU B OE1   1 
ATOM   3659  O  OE2   . GLU D  1 94  ? 30.213  -60.597  -19.562 1.00 14.46 ? 92  GLU B OE2   1 
ATOM   3660  N  N     . SER D  1 95  ? 24.169  -59.985  -19.844 1.00 14.30 ? 93  SER B N     1 
ATOM   3661  C  CA    . SER D  1 95  ? 22.791  -60.405  -19.632 1.00 22.00 ? 93  SER B CA    1 
ATOM   3662  C  C     . SER D  1 95  ? 22.890  -61.577  -18.670 1.00 16.92 ? 93  SER B C     1 
ATOM   3663  O  O     . SER D  1 95  ? 22.872  -62.751  -19.080 1.00 15.32 ? 93  SER B O     1 
ATOM   3664  C  CB    . SER D  1 95  ? 22.087  -60.830  -20.940 1.00 22.24 ? 93  SER B CB    1 
ATOM   3665  O  OG    . SER D  1 95  ? 20.670  -60.887  -20.769 1.00 18.73 ? 93  SER B OG    1 
ATOM   3666  N  N     . SER D  1 96  ? 22.972  -61.254  -17.382 1.00 17.86 ? 94  SER B N     1 
ATOM   3667  C  CA    . SER D  1 96  ? 23.253  -62.264  -16.372 1.00 14.90 ? 94  SER B CA    1 
ATOM   3668  C  C     . SER D  1 96  ? 22.227  -63.391  -16.349 1.00 14.49 ? 94  SER B C     1 
ATOM   3669  O  O     . SER D  1 96  ? 22.561  -64.517  -15.964 1.00 15.89 ? 94  SER B O     1 
ATOM   3670  C  CB    . SER D  1 96  ? 23.404  -61.622  -15.009 1.00 13.95 ? 94  SER B CB    1 
ATOM   3671  O  OG    . SER D  1 96  ? 24.558  -60.819  -15.010 1.00 18.83 ? 94  SER B OG    1 
ATOM   3672  N  N     . ASN D  1 97  ? 20.988  -63.105  -16.760 1.00 17.34 ? 95  ASN B N     1 
ATOM   3673  C  CA    . ASN D  1 97  ? 19.978  -64.167  -16.813 1.00 19.40 ? 95  ASN B CA    1 
ATOM   3674  C  C     . ASN D  1 97  ? 20.340  -65.244  -17.834 1.00 15.36 ? 95  ASN B C     1 
ATOM   3675  O  O     . ASN D  1 97  ? 20.309  -66.437  -17.546 1.00 16.63 ? 95  ASN B O     1 
ATOM   3676  C  CB    . ASN D  1 97  ? 18.609  -63.622  -17.143 1.00 18.12 ? 95  ASN B CB    1 
ATOM   3677  C  CG    . ASN D  1 97  ? 18.590  -62.775  -18.384 1.00 20.27 ? 95  ASN B CG    1 
ATOM   3678  O  OD1   . ASN D  1 97  ? 19.582  -62.104  -18.765 1.00 18.75 ? 95  ASN B OD1   1 
ATOM   3679  N  ND2   . ASN D  1 97  ? 17.428  -62.778  -19.035 1.00 21.30 ? 95  ASN B ND2   1 
ATOM   3680  N  N     . VAL D  1 98  ? 20.676  -64.808  -19.039 1.00 18.29 ? 96  VAL B N     1 
ATOM   3681  C  CA    . VAL D  1 98  ? 21.208  -65.702  -20.061 1.00 14.61 ? 96  VAL B CA    1 
ATOM   3682  C  C     . VAL D  1 98  ? 22.361  -66.550  -19.534 1.00 14.25 ? 96  VAL B C     1 
ATOM   3683  O  O     . VAL D  1 98  ? 22.372  -67.769  -19.706 1.00 14.61 ? 96  VAL B O     1 
ATOM   3684  C  CB    . VAL D  1 98  ? 21.705  -64.899  -21.273 1.00 16.69 ? 96  VAL B CB    1 
ATOM   3685  C  CG1   . VAL D  1 98  ? 22.618  -65.780  -22.202 1.00 11.76 ? 96  VAL B CG1   1 
ATOM   3686  C  CG2   . VAL D  1 98  ? 20.503  -64.291  -22.035 1.00 12.21 ? 96  VAL B CG2   1 
ATOM   3687  N  N     . LEU D  1 99  ? 23.365  -65.922  -18.934 1.00 13.59 ? 97  LEU B N     1 
ATOM   3688  C  CA    . LEU D  1 99  ? 24.533  -66.702  -18.521 1.00 12.77 ? 97  LEU B CA    1 
ATOM   3689  C  C     . LEU D  1 99  ? 24.164  -67.687  -17.409 1.00 16.05 ? 97  LEU B C     1 
ATOM   3690  O  O     . LEU D  1 99  ? 24.790  -68.735  -17.265 1.00 14.97 ? 97  LEU B O     1 
ATOM   3691  C  CB    . LEU D  1 99  ? 25.696  -65.801  -18.084 1.00 16.24 ? 97  LEU B CB    1 
ATOM   3692  C  CG    . LEU D  1 99  ? 26.117  -64.728  -19.101 1.00 12.43 ? 97  LEU B CG    1 
ATOM   3693  C  CD1   . LEU D  1 99  ? 27.446  -64.071  -18.652 1.00 10.32 ? 97  LEU B CD1   1 
ATOM   3694  C  CD2   . LEU D  1 99  ? 26.282  -65.297  -20.514 1.00 10.56 ? 97  LEU B CD2   1 
ATOM   3695  N  N     . LEU D  1 100 ? 23.151  -67.353  -16.604 1.00 18.63 ? 98  LEU B N     1 
ATOM   3696  C  CA    . LEU D  1 100 ? 22.729  -68.325  -15.593 1.00 17.64 ? 98  LEU B CA    1 
ATOM   3697  C  C     . LEU D  1 100 ? 22.067  -69.557  -16.190 1.00 13.55 ? 98  LEU B C     1 
ATOM   3698  O  O     . LEU D  1 100 ? 22.273  -70.668  -15.689 1.00 12.22 ? 98  LEU B O     1 
ATOM   3699  C  CB    . LEU D  1 100 ? 21.826  -67.704  -14.537 1.00 15.28 ? 98  LEU B CB    1 
ATOM   3700  C  CG    . LEU D  1 100 ? 21.421  -68.652  -13.399 1.00 22.92 ? 98  LEU B CG    1 
ATOM   3701  C  CD1   . LEU D  1 100 ? 22.607  -69.236  -12.662 1.00 12.81 ? 98  LEU B CD1   1 
ATOM   3702  C  CD2   . LEU D  1 100 ? 20.484  -67.914  -12.437 1.00 21.21 ? 98  LEU B CD2   1 
ATOM   3703  N  N     . HIS D  1 101 ? 21.255  -69.376  -17.229 1.00 15.77 ? 99  HIS B N     1 
ATOM   3704  C  CA    . HIS D  1 101 ? 20.618  -70.538  -17.863 1.00 17.27 ? 99  HIS B CA    1 
ATOM   3705  C  C     . HIS D  1 101 ? 21.723  -71.431  -18.405 1.00 16.11 ? 99  HIS B C     1 
ATOM   3706  O  O     . HIS D  1 101 ? 21.639  -72.668  -18.377 1.00 14.79 ? 99  HIS B O     1 
ATOM   3707  C  CB    . HIS D  1 101 ? 19.706  -70.114  -19.010 1.00 15.32 ? 99  HIS B CB    1 
ATOM   3708  C  CG    . HIS D  1 101 ? 18.465  -69.415  -18.582 1.00 15.39 ? 99  HIS B CG    1 
ATOM   3709  N  ND1   . HIS D  1 101 ? 17.463  -70.050  -17.872 1.00 22.64 ? 99  HIS B ND1   1 
ATOM   3710  C  CD2   . HIS D  1 101 ? 18.001  -68.168  -18.848 1.00 23.89 ? 99  HIS B CD2   1 
ATOM   3711  C  CE1   . HIS D  1 101 ? 16.472  -69.201  -17.661 1.00 21.95 ? 99  HIS B CE1   1 
ATOM   3712  N  NE2   . HIS D  1 101 ? 16.772  -68.054  -18.250 1.00 22.13 ? 99  HIS B NE2   1 
ATOM   3713  N  N     . LEU D  1 102 ? 22.781  -70.796  -18.899 1.00 14.13 ? 100 LEU B N     1 
ATOM   3714  C  CA    . LEU D  1 102 ? 23.902  -71.525  -19.485 1.00 14.39 ? 100 LEU B CA    1 
ATOM   3715  C  C     . LEU D  1 102 ? 25.055  -71.682  -18.494 1.00 13.72 ? 100 LEU B C     1 
ATOM   3716  O  O     . LEU D  1 102 ? 26.226  -71.580  -18.878 1.00 14.93 ? 100 LEU B O     1 
ATOM   3717  C  CB    . LEU D  1 102 ? 24.393  -70.809  -20.738 1.00 13.09 ? 100 LEU B CB    1 
ATOM   3718  C  CG    . LEU D  1 102 ? 23.412  -70.563  -21.868 1.00 14.54 ? 100 LEU B CG    1 
ATOM   3719  C  CD1   . LEU D  1 102 ? 24.119  -69.976  -23.089 1.00 14.97 ? 100 LEU B CD1   1 
ATOM   3720  C  CD2   . LEU D  1 102 ? 22.746  -71.895  -22.242 1.00 16.64 ? 100 LEU B CD2   1 
ATOM   3721  N  N     . TYR D  1 103 ? 24.751  -71.871  -17.215 1.00 12.56 ? 101 TYR B N     1 
ATOM   3722  C  CA    . TYR D  1 103 ? 25.841  -71.911  -16.228 1.00 14.43 ? 101 TYR B CA    1 
ATOM   3723  C  C     . TYR D  1 103 ? 26.766  -73.094  -16.479 1.00 17.31 ? 101 TYR B C     1 
ATOM   3724  O  O     . TYR D  1 103 ? 27.904  -73.110  -16.027 1.00 16.76 ? 101 TYR B O     1 
ATOM   3725  C  CB    . TYR D  1 103 ? 25.332  -71.920  -14.796 1.00 13.38 ? 101 TYR B CB    1 
ATOM   3726  C  CG    . TYR D  1 103 ? 24.914  -73.299  -14.299 1.00 17.34 ? 101 TYR B CG    1 
ATOM   3727  C  CD1   . TYR D  1 103 ? 23.663  -73.807  -14.594 1.00 16.55 ? 101 TYR B CD1   1 
ATOM   3728  C  CD2   . TYR D  1 103 ? 25.785  -74.086  -13.544 1.00 13.54 ? 101 TYR B CD2   1 
ATOM   3729  C  CE1   . TYR D  1 103 ? 23.264  -75.087  -14.160 1.00 15.82 ? 101 TYR B CE1   1 
ATOM   3730  C  CE2   . TYR D  1 103 ? 25.408  -75.340  -13.084 1.00 15.46 ? 101 TYR B CE2   1 
ATOM   3731  C  CZ    . TYR D  1 103 ? 24.137  -75.830  -13.396 1.00 20.87 ? 101 TYR B CZ    1 
ATOM   3732  O  OH    . TYR D  1 103 ? 23.742  -77.070  -12.953 1.00 21.66 ? 101 TYR B OH    1 
ATOM   3733  N  N     . ASN D  1 104 ? 26.246  -74.099  -17.178 1.00 18.14 ? 102 ASN B N     1 
ATOM   3734  C  CA    . ASN D  1 104 ? 27.046  -75.233  -17.599 1.00 15.28 ? 102 ASN B CA    1 
ATOM   3735  C  C     . ASN D  1 104 ? 27.548  -75.014  -19.014 1.00 16.52 ? 102 ASN B C     1 
ATOM   3736  O  O     . ASN D  1 104 ? 28.001  -75.956  -19.705 1.00 17.69 ? 102 ASN B O     1 
ATOM   3737  C  CB    . ASN D  1 104 ? 26.231  -76.542  -17.503 1.00 18.50 ? 102 ASN B CB    1 
ATOM   3738  C  CG    . ASN D  1 104 ? 26.267  -77.132  -16.109 1.00 22.46 ? 102 ASN B CG    1 
ATOM   3739  O  OD1   . ASN D  1 104 ? 27.311  -77.099  -15.447 1.00 25.18 ? 102 ASN B OD1   1 
ATOM   3740  N  ND2   . ASN D  1 104 ? 25.137  -77.654  -15.644 1.00 16.49 ? 102 ASN B ND2   1 
ATOM   3741  N  N     . GLY D  1 105 ? 27.517  -73.755  -19.447 1.00 13.00 ? 103 GLY B N     1 
ATOM   3742  C  CA    . GLY D  1 105 ? 28.038  -73.442  -20.761 1.00 16.60 ? 103 GLY B CA    1 
ATOM   3743  C  C     . GLY D  1 105 ? 27.053  -73.611  -21.898 1.00 12.24 ? 103 GLY B C     1 
ATOM   3744  O  O     . GLY D  1 105 ? 25.940  -74.196  -21.754 1.00 18.12 ? 103 GLY B O     1 
ATOM   3745  N  N     . GLY D  1 106 ? 27.416  -73.048  -23.049 1.00 11.66 ? 104 GLY B N     1 
ATOM   3746  C  CA    . GLY D  1 106 ? 26.531  -73.122  -24.189 1.00 15.35 ? 104 GLY B CA    1 
ATOM   3747  C  C     . GLY D  1 106 ? 26.756  -72.029  -25.213 1.00 15.91 ? 104 GLY B C     1 
ATOM   3748  O  O     . GLY D  1 106 ? 27.378  -71.000  -24.924 1.00 13.62 ? 104 GLY B O     1 
ATOM   3749  N  N     . PHE D  1 107 ? 26.264  -72.289  -26.424 1.00 9.86  ? 105 PHE B N     1 
ATOM   3750  C  CA    . PHE D  1 107 ? 26.338  -71.332  -27.528 1.00 13.93 ? 105 PHE B CA    1 
ATOM   3751  C  C     . PHE D  1 107 ? 25.198  -70.376  -27.318 1.00 12.62 ? 105 PHE B C     1 
ATOM   3752  O  O     . PHE D  1 107 ? 24.034  -70.794  -27.194 1.00 19.57 ? 105 PHE B O     1 
ATOM   3753  C  CB    . PHE D  1 107 ? 26.168  -72.031  -28.869 1.00 11.37 ? 105 PHE B CB    1 
ATOM   3754  C  CG    . PHE D  1 107 ? 27.419  -72.736  -29.357 1.00 13.57 ? 105 PHE B CG    1 
ATOM   3755  C  CD1   . PHE D  1 107 ? 28.439  -72.024  -29.995 1.00 9.40  ? 105 PHE B CD1   1 
ATOM   3756  C  CD2   . PHE D  1 107 ? 27.548  -74.114  -29.209 1.00 14.08 ? 105 PHE B CD2   1 
ATOM   3757  C  CE1   . PHE D  1 107 ? 29.603  -72.674  -30.452 1.00 16.80 ? 105 PHE B CE1   1 
ATOM   3758  C  CE2   . PHE D  1 107 ? 28.688  -74.786  -29.684 1.00 15.23 ? 105 PHE B CE2   1 
ATOM   3759  C  CZ    . PHE D  1 107 ? 29.716  -74.070  -30.294 1.00 19.67 ? 105 PHE B CZ    1 
ATOM   3760  N  N     . VAL D  1 108 ? 25.522  -69.084  -27.250 1.00 14.05 ? 106 VAL B N     1 
ATOM   3761  C  CA    . VAL D  1 108 ? 24.477  -68.080  -27.135 1.00 13.63 ? 106 VAL B CA    1 
ATOM   3762  C  C     . VAL D  1 108 ? 23.962  -67.778  -28.534 1.00 13.36 ? 106 VAL B C     1 
ATOM   3763  O  O     . VAL D  1 108 ? 22.870  -67.266  -28.673 1.00 16.56 ? 106 VAL B O     1 
ATOM   3764  C  CB    . VAL D  1 108 ? 24.998  -66.766  -26.439 1.00 14.30 ? 106 VAL B CB    1 
ATOM   3765  C  CG1   . VAL D  1 108 ? 25.441  -67.027  -24.979 1.00 15.17 ? 106 VAL B CG1   1 
ATOM   3766  C  CG2   . VAL D  1 108 ? 26.138  -66.136  -27.245 1.00 15.29 ? 106 VAL B CG2   1 
ATOM   3767  N  N     . CYS D  1 109 ? 24.756  -68.081  -29.561 1.00 13.80 ? 107 CYS B N     1 
ATOM   3768  C  CA    . CYS D  1 109 ? 24.320  -68.013  -30.967 1.00 14.65 ? 107 CYS B CA    1 
ATOM   3769  C  C     . CYS D  1 109 ? 25.410  -68.657  -31.807 1.00 14.04 ? 107 CYS B C     1 
ATOM   3770  O  O     . CYS D  1 109 ? 26.454  -69.064  -31.293 1.00 19.09 ? 107 CYS B O     1 
ATOM   3771  C  CB    . CYS D  1 109 ? 24.098  -66.553  -31.439 1.00 14.02 ? 107 CYS B CB    1 
ATOM   3772  S  SG    . CYS D  1 109 ? 25.685  -65.578  -31.358 1.00 15.74 ? 107 CYS B SG    1 
ATOM   3773  N  N     . PHE D  1 110 ? 25.195  -68.737  -33.106 1.00 12.23 ? 108 PHE B N     1 
ATOM   3774  C  CA    . PHE D  1 110 ? 26.185  -69.385  -33.971 1.00 18.80 ? 108 PHE B CA    1 
ATOM   3775  C  C     . PHE D  1 110 ? 27.618  -68.861  -33.769 1.00 15.65 ? 108 PHE B C     1 
ATOM   3776  O  O     . PHE D  1 110 ? 27.880  -67.639  -33.819 1.00 15.36 ? 108 PHE B O     1 
ATOM   3777  C  CB    . PHE D  1 110 ? 25.810  -69.260  -35.446 1.00 16.35 ? 108 PHE B CB    1 
ATOM   3778  C  CG    . PHE D  1 110 ? 26.779  -69.980  -36.352 1.00 20.93 ? 108 PHE B CG    1 
ATOM   3779  C  CD1   . PHE D  1 110 ? 26.710  -71.358  -36.499 1.00 23.72 ? 108 PHE B CD1   1 
ATOM   3780  C  CD2   . PHE D  1 110 ? 27.793  -69.277  -37.014 1.00 22.93 ? 108 PHE B CD2   1 
ATOM   3781  C  CE1   . PHE D  1 110 ? 27.632  -72.037  -37.317 1.00 28.19 ? 108 PHE B CE1   1 
ATOM   3782  C  CE2   . PHE D  1 110 ? 28.713  -69.948  -37.842 1.00 20.77 ? 108 PHE B CE2   1 
ATOM   3783  C  CZ    . PHE D  1 110 ? 28.631  -71.326  -37.982 1.00 23.90 ? 108 PHE B CZ    1 
ATOM   3784  N  N     . ASN D  1 111 ? 28.558  -69.791  -33.549 1.00 13.78 ? 109 ASN B N     1 
ATOM   3785  C  CA    . ASN D  1 111 ? 29.960  -69.447  -33.328 1.00 14.88 ? 109 ASN B CA    1 
ATOM   3786  C  C     . ASN D  1 111 ? 30.299  -68.657  -32.051 1.00 12.49 ? 109 ASN B C     1 
ATOM   3787  O  O     . ASN D  1 111 ? 31.390  -68.112  -31.956 1.00 17.54 ? 109 ASN B O     1 
ATOM   3788  C  CB    . ASN D  1 111 ? 30.511  -68.663  -34.541 1.00 13.34 ? 109 ASN B CB    1 
ATOM   3789  C  CG    . ASN D  1 111 ? 31.305  -69.541  -35.474 1.00 19.02 ? 109 ASN B CG    1 
ATOM   3790  O  OD1   . ASN D  1 111 ? 31.582  -70.710  -35.159 1.00 16.00 ? 109 ASN B OD1   1 
ATOM   3791  N  ND2   . ASN D  1 111 ? 31.710  -68.983  -36.623 1.00 21.13 ? 109 ASN B ND2   1 
ATOM   3792  N  N     . MET D  1 112 ? 29.372  -68.535  -31.105 1.00 17.77 ? 110 MET B N     1 
ATOM   3793  C  CA    . MET D  1 112 ? 29.681  -67.832  -29.853 1.00 14.93 ? 110 MET B CA    1 
ATOM   3794  C  C     . MET D  1 112 ? 29.381  -68.741  -28.661 1.00 14.92 ? 110 MET B C     1 
ATOM   3795  O  O     . MET D  1 112 ? 28.224  -68.916  -28.273 1.00 11.78 ? 110 MET B O     1 
ATOM   3796  C  CB    . MET D  1 112 ? 28.902  -66.527  -29.739 1.00 12.62 ? 110 MET B CB    1 
ATOM   3797  C  CG    . MET D  1 112 ? 29.363  -65.459  -30.765 1.00 12.32 ? 110 MET B CG    1 
ATOM   3798  S  SD    . MET D  1 112 ? 28.718  -63.848  -30.271 1.00 17.56 ? 110 MET B SD    1 
ATOM   3799  C  CE    . MET D  1 112 ? 28.623  -62.912  -31.821 1.00 14.32 ? 110 MET B CE    1 
ATOM   3800  N  N     . TYR D  1 113 ? 30.445  -69.303  -28.089 1.00 12.42 ? 111 TYR B N     1 
ATOM   3801  C  CA    . TYR D  1 113 ? 30.327  -70.273  -27.011 1.00 10.30 ? 111 TYR B CA    1 
ATOM   3802  C  C     . TYR D  1 113 ? 30.819  -69.719  -25.671 1.00 12.09 ? 111 TYR B C     1 
ATOM   3803  O  O     . TYR D  1 113 ? 32.013  -69.363  -25.528 1.00 16.70 ? 111 TYR B O     1 
ATOM   3804  C  CB    . TYR D  1 113 ? 31.144  -71.551  -27.362 1.00 14.24 ? 111 TYR B CB    1 
ATOM   3805  C  CG    . TYR D  1 113 ? 31.034  -72.590  -26.253 1.00 16.17 ? 111 TYR B CG    1 
ATOM   3806  C  CD1   . TYR D  1 113 ? 29.869  -73.351  -26.112 1.00 13.98 ? 111 TYR B CD1   1 
ATOM   3807  C  CD2   . TYR D  1 113 ? 32.049  -72.771  -25.324 1.00 14.62 ? 111 TYR B CD2   1 
ATOM   3808  C  CE1   . TYR D  1 113 ? 29.708  -74.279  -25.066 1.00 14.51 ? 111 TYR B CE1   1 
ATOM   3809  C  CE2   . TYR D  1 113 ? 31.908  -73.693  -24.276 1.00 12.89 ? 111 TYR B CE2   1 
ATOM   3810  C  CZ    . TYR D  1 113 ? 30.752  -74.460  -24.168 1.00 18.36 ? 111 TYR B CZ    1 
ATOM   3811  O  OH    . TYR D  1 113 ? 30.594  -75.361  -23.127 1.00 15.63 ? 111 TYR B OH    1 
ATOM   3812  N  N     . TYR D  1 114 ? 29.913  -69.786  -24.699 1.00 14.33 ? 112 TYR B N     1 
ATOM   3813  C  CA    . TYR D  1 114 ? 30.079  -69.382  -23.335 1.00 13.70 ? 112 TYR B CA    1 
ATOM   3814  C  C     . TYR D  1 114 ? 30.628  -70.526  -22.506 1.00 12.59 ? 112 TYR B C     1 
ATOM   3815  O  O     . TYR D  1 114 ? 30.074  -71.636  -22.495 1.00 12.33 ? 112 TYR B O     1 
ATOM   3816  C  CB    . TYR D  1 114 ? 28.694  -68.960  -22.798 1.00 13.67 ? 112 TYR B CB    1 
ATOM   3817  C  CG    . TYR D  1 114 ? 28.726  -68.555  -21.340 1.00 15.84 ? 112 TYR B CG    1 
ATOM   3818  C  CD1   . TYR D  1 114 ? 29.649  -67.633  -20.874 1.00 13.62 ? 112 TYR B CD1   1 
ATOM   3819  C  CD2   . TYR D  1 114 ? 27.861  -69.127  -20.416 1.00 13.04 ? 112 TYR B CD2   1 
ATOM   3820  C  CE1   . TYR D  1 114 ? 29.674  -67.264  -19.529 1.00 13.13 ? 112 TYR B CE1   1 
ATOM   3821  C  CE2   . TYR D  1 114 ? 27.885  -68.766  -19.061 1.00 12.88 ? 112 TYR B CE2   1 
ATOM   3822  C  CZ    . TYR D  1 114 ? 28.818  -67.847  -18.630 1.00 13.08 ? 112 TYR B CZ    1 
ATOM   3823  O  OH    . TYR D  1 114 ? 28.853  -67.495  -17.294 1.00 12.38 ? 112 TYR B OH    1 
ATOM   3824  N  N     . LEU D  1 115 ? 31.728  -70.295  -21.812 1.00 14.68 ? 113 LEU B N     1 
ATOM   3825  C  CA    . LEU D  1 115 ? 32.309  -71.405  -21.056 1.00 16.17 ? 113 LEU B CA    1 
ATOM   3826  C  C     . LEU D  1 115 ? 31.560  -71.755  -19.741 1.00 14.74 ? 113 LEU B C     1 
ATOM   3827  O  O     . LEU D  1 115 ? 31.964  -72.691  -19.043 1.00 21.89 ? 113 LEU B O     1 
ATOM   3828  C  CB    . LEU D  1 115 ? 33.789  -71.129  -20.788 1.00 12.47 ? 113 LEU B CB    1 
ATOM   3829  C  CG    . LEU D  1 115 ? 34.713  -71.772  -21.857 1.00 13.61 ? 113 LEU B CG    1 
ATOM   3830  C  CD1   . LEU D  1 115 ? 34.672  -71.014  -23.160 1.00 18.23 ? 113 LEU B CD1   1 
ATOM   3831  C  CD2   . LEU D  1 115 ? 36.143  -71.869  -21.351 1.00 13.76 ? 113 LEU B CD2   1 
ATOM   3832  N  N     . GLY D  1 116 ? 30.518  -70.998  -19.380 1.00 13.44 ? 114 GLY B N     1 
ATOM   3833  C  CA    . GLY D  1 116 ? 29.817  -71.207  -18.102 1.00 14.64 ? 114 GLY B CA    1 
ATOM   3834  C  C     . GLY D  1 116 ? 30.373  -70.418  -16.901 1.00 18.49 ? 114 GLY B C     1 
ATOM   3835  O  O     . GLY D  1 116 ? 31.236  -69.563  -17.076 1.00 13.68 ? 114 GLY B O     1 
ATOM   3836  N  N     . VAL D  1 117 ? 29.864  -70.676  -15.692 1.00 16.62 ? 115 VAL B N     1 
ATOM   3837  C  CA    . VAL D  1 117 ? 30.464  -70.161  -14.444 1.00 17.12 ? 115 VAL B CA    1 
ATOM   3838  C  C     . VAL D  1 117 ? 31.946  -70.529  -14.413 1.00 16.97 ? 115 VAL B C     1 
ATOM   3839  O  O     . VAL D  1 117 ? 32.830  -69.728  -14.067 1.00 17.71 ? 115 VAL B O     1 
ATOM   3840  C  CB    . VAL D  1 117 ? 29.779  -70.802  -13.183 1.00 15.68 ? 115 VAL B CB    1 
ATOM   3841  C  CG1   . VAL D  1 117 ? 30.494  -70.428  -11.870 1.00 16.12 ? 115 VAL B CG1   1 
ATOM   3842  C  CG2   . VAL D  1 117 ? 28.366  -70.391  -13.091 1.00 15.05 ? 115 VAL B CG2   1 
ATOM   3843  N  N     . CYS D  1 118 ? 32.212  -71.783  -14.737 1.00 14.20 ? 116 CYS B N     1 
ATOM   3844  C  CA    . CYS D  1 118 ? 33.544  -72.165  -15.074 1.00 10.40 ? 116 CYS B CA    1 
ATOM   3845  C  C     . CYS D  1 118 ? 33.520  -73.475  -15.811 1.00 10.49 ? 116 CYS B C     1 
ATOM   3846  O  O     . CYS D  1 118 ? 32.501  -74.171  -15.827 1.00 18.33 ? 116 CYS B O     1 
ATOM   3847  C  CB    . CYS D  1 118 ? 34.371  -72.287  -13.815 1.00 16.38 ? 116 CYS B CB    1 
ATOM   3848  S  SG    . CYS D  1 118 ? 33.744  -73.550  -12.659 1.00 19.56 ? 116 CYS B SG    1 
ATOM   3849  N  N     . SER D  1 119 ? 34.642  -73.775  -16.437 1.00 12.45 ? 117 SER B N     1 
ATOM   3850  C  CA    . SER D  1 119 ? 34.893  -75.061  -17.074 1.00 15.33 ? 117 SER B CA    1 
ATOM   3851  C  C     . SER D  1 119 ? 36.253  -75.056  -17.778 1.00 15.25 ? 117 SER B C     1 
ATOM   3852  O  O     . SER D  1 119 ? 36.958  -74.049  -17.788 1.00 13.35 ? 117 SER B O     1 
ATOM   3853  C  CB    . SER D  1 119 ? 33.791  -75.354  -18.083 1.00 16.61 ? 117 SER B CB    1 
ATOM   3854  O  OG    . SER D  1 119 ? 33.956  -74.576  -19.258 1.00 12.24 ? 117 SER B OG    1 
ATOM   3855  N  N     . CYS D  1 120 ? 36.598  -76.184  -18.386 1.00 14.54 ? 118 CYS B N     1 
ATOM   3856  C  CA    . CYS D  1 120 ? 37.737  -76.312  -19.273 1.00 14.85 ? 118 CYS B CA    1 
ATOM   3857  C  C     . CYS D  1 120 ? 37.277  -76.962  -20.567 1.00 17.39 ? 118 CYS B C     1 
ATOM   3858  O  O     . CYS D  1 120 ? 36.504  -77.928  -20.544 1.00 15.51 ? 118 CYS B O     1 
ATOM   3859  C  CB    . CYS D  1 120 ? 38.798  -77.211  -18.619 1.00 14.40 ? 118 CYS B CB    1 
ATOM   3860  S  SG    . CYS D  1 120 ? 40.249  -77.495  -19.603 1.00 18.16 ? 118 CYS B SG    1 
ATOM   3861  N  N     . ILE D  1 121 ? 37.768  -76.450  -21.692 1.00 12.75 ? 119 ILE B N     1 
ATOM   3862  C  CA    . ILE D  1 121 ? 37.496  -77.030  -22.997 1.00 14.96 ? 119 ILE B CA    1 
ATOM   3863  C  C     . ILE D  1 121 ? 38.778  -77.447  -23.709 1.00 15.32 ? 119 ILE B C     1 
ATOM   3864  O  O     . ILE D  1 121 ? 39.906  -77.211  -23.220 1.00 19.89 ? 119 ILE B O     1 
ATOM   3865  C  CB    . ILE D  1 121 ? 36.692  -76.050  -23.883 1.00 15.60 ? 119 ILE B CB    1 
ATOM   3866  C  CG1   . ILE D  1 121 ? 37.498  -74.760  -24.131 1.00 15.35 ? 119 ILE B CG1   1 
ATOM   3867  C  CG2   . ILE D  1 121 ? 35.366  -75.761  -23.255 1.00 11.19 ? 119 ILE B CG2   1 
ATOM   3868  C  CD1   . ILE D  1 121 ? 38.404  -74.831  -25.342 1.00 14.43 ? 119 ILE B CD1   1 
ATOM   3869  N  N     . ASN D  1 122 ? 38.600  -78.112  -24.845 1.00 14.97 ? 120 ASN B N     1 
ATOM   3870  C  CA    . ASN D  1 122 ? 39.729  -78.500  -25.682 1.00 14.94 ? 120 ASN B CA    1 
ATOM   3871  C  C     . ASN D  1 122 ? 39.494  -77.982  -27.077 1.00 13.72 ? 120 ASN B C     1 
ATOM   3872  O  O     . ASN D  1 122 ? 38.380  -78.014  -27.570 1.00 19.18 ? 120 ASN B O     1 
ATOM   3873  C  CB    . ASN D  1 122 ? 39.907  -80.027  -25.776 1.00 18.89 ? 120 ASN B CB    1 
ATOM   3874  C  CG    . ASN D  1 122 ? 40.161  -80.689  -24.424 1.00 17.86 ? 120 ASN B CG    1 
ATOM   3875  O  OD1   . ASN D  1 122 ? 40.252  -80.019  -23.376 1.00 22.48 ? 120 ASN B OD1   1 
ATOM   3876  N  ND2   . ASN D  1 122 ? 40.223  -82.023  -24.437 1.00 15.00 ? 120 ASN B ND2   1 
ATOM   3877  N  N     . ILE D  1 123 ? 40.556  -77.489  -27.702 1.00 18.47 ? 121 ILE B N     1 
ATOM   3878  C  CA    . ILE D  1 123 ? 40.500  -77.119  -29.106 1.00 18.48 ? 121 ILE B CA    1 
ATOM   3879  C  C     . ILE D  1 123 ? 41.938  -77.117  -29.664 1.00 19.19 ? 121 ILE B C     1 
ATOM   3880  O  O     . ILE D  1 123 ? 42.859  -76.543  -29.057 1.00 17.86 ? 121 ILE B O     1 
ATOM   3881  C  CB    . ILE D  1 123 ? 39.769  -75.747  -29.326 1.00 17.69 ? 121 ILE B CB    1 
ATOM   3882  C  CG1   . ILE D  1 123 ? 39.699  -75.403  -30.824 1.00 17.50 ? 121 ILE B CG1   1 
ATOM   3883  C  CG2   . ILE D  1 123 ? 40.480  -74.632  -28.553 1.00 19.34 ? 121 ILE B CG2   1 
ATOM   3884  C  CD1   . ILE D  1 123 ? 38.772  -74.231  -31.169 1.00 19.98 ? 121 ILE B CD1   1 
ATOM   3885  N  N     . ASN D  1 124 ? 42.132  -77.772  -30.801 1.00 21.14 ? 122 ASN B N     1 
ATOM   3886  C  CA    . ASN D  1 124 ? 43.417  -77.701  -31.484 1.00 22.88 ? 122 ASN B CA    1 
ATOM   3887  C  C     . ASN D  1 124 ? 44.525  -78.115  -30.543 1.00 22.09 ? 122 ASN B C     1 
ATOM   3888  O  O     . ASN D  1 124 ? 45.595  -77.501  -30.540 1.00 21.69 ? 122 ASN B O     1 
ATOM   3889  C  CB    . ASN D  1 124 ? 43.715  -76.269  -31.946 1.00 19.84 ? 122 ASN B CB    1 
ATOM   3890  C  CG    . ASN D  1 124 ? 42.953  -75.862  -33.196 1.00 24.80 ? 122 ASN B CG    1 
ATOM   3891  O  OD1   . ASN D  1 124 ? 42.213  -76.651  -33.798 1.00 22.14 ? 122 ASN B OD1   1 
ATOM   3892  N  ND2   . ASN D  1 124 ? 43.126  -74.606  -33.588 1.00 22.69 ? 122 ASN B ND2   1 
ATOM   3893  N  N     . GLY D  1 125 ? 44.272  -79.127  -29.718 1.00 23.71 ? 123 GLY B N     1 
ATOM   3894  C  CA    . GLY D  1 125 ? 45.322  -79.616  -28.833 1.00 24.82 ? 123 GLY B CA    1 
ATOM   3895  C  C     . GLY D  1 125 ? 45.477  -78.841  -27.538 1.00 23.31 ? 123 GLY B C     1 
ATOM   3896  O  O     . GLY D  1 125 ? 46.211  -79.271  -26.644 1.00 22.60 ? 123 GLY B O     1 
ATOM   3897  N  N     . LEU D  1 126 ? 44.763  -77.725  -27.400 1.00 17.45 ? 124 LEU B N     1 
ATOM   3898  C  CA    . LEU D  1 126 ? 44.913  -76.897  -26.202 1.00 24.04 ? 124 LEU B CA    1 
ATOM   3899  C  C     . LEU D  1 126 ? 43.860  -77.217  -25.114 1.00 20.54 ? 124 LEU B C     1 
ATOM   3900  O  O     . LEU D  1 126 ? 42.756  -77.696  -25.410 1.00 19.69 ? 124 LEU B O     1 
ATOM   3901  C  CB    . LEU D  1 126 ? 44.847  -75.420  -26.581 1.00 19.77 ? 124 LEU B CB    1 
ATOM   3902  C  CG    . LEU D  1 126 ? 45.837  -74.956  -27.629 1.00 20.46 ? 124 LEU B CG    1 
ATOM   3903  C  CD1   . LEU D  1 126 ? 45.453  -73.594  -28.180 1.00 20.69 ? 124 LEU B CD1   1 
ATOM   3904  C  CD2   . LEU D  1 126 ? 47.284  -74.907  -27.038 1.00 20.43 ? 124 LEU B CD2   1 
ATOM   3905  N  N     . ARG D  1 127 ? 44.212  -76.971  -23.855 1.00 15.96 ? 125 ARG B N     1 
ATOM   3906  C  CA    . ARG D  1 127 ? 43.261  -77.087  -22.770 1.00 18.06 ? 125 ARG B CA    1 
ATOM   3907  C  C     . ARG D  1 127 ? 43.063  -75.674  -22.213 1.00 19.73 ? 125 ARG B C     1 
ATOM   3908  O  O     . ARG D  1 127 ? 44.016  -75.045  -21.765 1.00 18.03 ? 125 ARG B O     1 
ATOM   3909  C  CB    . ARG D  1 127 ? 43.749  -78.069  -21.704 1.00 23.20 ? 125 ARG B CB    1 
ATOM   3910  C  CG    . ARG D  1 127 ? 43.979  -79.527  -22.229 1.00 24.24 ? 125 ARG B CG    1 
ATOM   3911  C  CD    . ARG D  1 127 ? 44.326  -80.556  -21.110 1.00 16.70 ? 125 ARG B CD    1 
ATOM   3912  N  NE    . ARG D  1 127 ? 43.265  -80.625  -20.093 1.00 21.01 ? 125 ARG B NE    1 
ATOM   3913  C  CZ    . ARG D  1 127 ? 43.497  -80.616  -18.786 1.00 21.96 ? 125 ARG B CZ    1 
ATOM   3914  N  NH1   . ARG D  1 127 ? 44.742  -80.580  -18.353 1.00 21.21 ? 125 ARG B NH1   1 
ATOM   3915  N  NH2   . ARG D  1 127 ? 42.503  -80.655  -17.919 1.00 19.80 ? 125 ARG B NH2   1 
ATOM   3916  N  N     . ILE D  1 128 ? 41.814  -75.193  -22.275 1.00 17.35 ? 126 ILE B N     1 
ATOM   3917  C  CA    . ILE D  1 128 ? 41.470  -73.820  -21.926 1.00 17.16 ? 126 ILE B CA    1 
ATOM   3918  C  C     . ILE D  1 128 ? 40.414  -73.758  -20.812 1.00 13.76 ? 126 ILE B C     1 
ATOM   3919  O  O     . ILE D  1 128 ? 39.320  -74.302  -20.938 1.00 15.52 ? 126 ILE B O     1 
ATOM   3920  C  CB    . ILE D  1 128 ? 40.970  -73.075  -23.171 1.00 18.43 ? 126 ILE B CB    1 
ATOM   3921  C  CG1   . ILE D  1 128 ? 42.030  -73.210  -24.294 1.00 16.05 ? 126 ILE B CG1   1 
ATOM   3922  C  CG2   . ILE D  1 128 ? 40.645  -71.597  -22.840 1.00 16.68 ? 126 ILE B CG2   1 
ATOM   3923  C  CD1   . ILE D  1 128 ? 41.746  -72.311  -25.538 1.00 20.42 ? 126 ILE B CD1   1 
ATOM   3924  N  N     . VAL D  1 129 ? 40.775  -73.104  -19.713 1.00 13.78 ? 127 VAL B N     1 
ATOM   3925  C  CA    . VAL D  1 129 ? 39.926  -72.937  -18.557 1.00 11.04 ? 127 VAL B CA    1 
ATOM   3926  C  C     . VAL D  1 129 ? 39.387  -71.531  -18.552 1.00 14.56 ? 127 VAL B C     1 
ATOM   3927  O  O     . VAL D  1 129 ? 40.101  -70.579  -18.902 1.00 17.89 ? 127 VAL B O     1 
ATOM   3928  C  CB    . VAL D  1 129 ? 40.745  -73.127  -17.275 1.00 16.31 ? 127 VAL B CB    1 
ATOM   3929  C  CG1   . VAL D  1 129 ? 40.025  -72.470  -16.069 1.00 12.55 ? 127 VAL B CG1   1 
ATOM   3930  C  CG2   . VAL D  1 129 ? 41.073  -74.639  -17.043 1.00 15.04 ? 127 VAL B CG2   1 
ATOM   3931  N  N     . GLY D  1 130 ? 38.140  -71.398  -18.112 1.00 15.58 ? 128 GLY B N     1 
ATOM   3932  C  CA    . GLY D  1 130 ? 37.519  -70.088  -17.985 1.00 12.10 ? 128 GLY B CA    1 
ATOM   3933  C  C     . GLY D  1 130 ? 36.941  -69.917  -16.585 1.00 18.92 ? 128 GLY B C     1 
ATOM   3934  O  O     . GLY D  1 130 ? 36.369  -70.857  -16.016 1.00 15.61 ? 128 GLY B O     1 
ATOM   3935  N  N     . VAL D  1 131 ? 37.084  -68.715  -16.023 1.00 12.78 ? 129 VAL B N     1 
ATOM   3936  C  CA    . VAL D  1 131 ? 36.426  -68.386  -14.760 1.00 15.90 ? 129 VAL B CA    1 
ATOM   3937  C  C     . VAL D  1 131 ? 35.600  -67.085  -14.907 1.00 17.60 ? 129 VAL B C     1 
ATOM   3938  O  O     . VAL D  1 131 ? 36.170  -66.011  -15.153 1.00 16.14 ? 129 VAL B O     1 
ATOM   3939  C  CB    . VAL D  1 131 ? 37.460  -68.161  -13.673 1.00 15.32 ? 129 VAL B CB    1 
ATOM   3940  C  CG1   . VAL D  1 131 ? 36.771  -68.062  -12.323 1.00 15.78 ? 129 VAL B CG1   1 
ATOM   3941  C  CG2   . VAL D  1 131 ? 38.560  -69.267  -13.662 1.00 16.09 ? 129 VAL B CG2   1 
ATOM   3942  N  N     . SER D  1 132 ? 34.279  -67.150  -14.733 1.00 16.74 ? 130 SER B N     1 
ATOM   3943  C  CA    . SER D  1 132 ? 33.465  -65.945  -14.957 1.00 13.91 ? 130 SER B CA    1 
ATOM   3944  C  C     . SER D  1 132 ? 33.296  -65.003  -13.751 1.00 17.40 ? 130 SER B C     1 
ATOM   3945  O  O     . SER D  1 132 ? 33.499  -65.415  -12.599 1.00 21.72 ? 130 SER B O     1 
ATOM   3946  C  CB    . SER D  1 132 ? 32.067  -66.297  -15.486 1.00 12.07 ? 130 SER B CB    1 
ATOM   3947  O  OG    . SER D  1 132 ? 32.169  -66.934  -16.727 1.00 17.02 ? 130 SER B OG    1 
ATOM   3948  N  N     . GLY D  1 133 ? 32.907  -63.748  -14.035 1.00 12.08 ? 131 GLY B N     1 
ATOM   3949  C  CA    . GLY D  1 133 ? 32.495  -62.777  -13.023 1.00 15.19 ? 131 GLY B CA    1 
ATOM   3950  C  C     . GLY D  1 133 ? 33.644  -61.892  -12.467 1.00 14.95 ? 131 GLY B C     1 
ATOM   3951  O  O     . GLY D  1 133 ? 34.785  -61.980  -12.892 1.00 13.76 ? 131 GLY B O     1 
ATOM   3952  N  N     . ILE D  1 134 ? 33.311  -61.005  -11.539 1.00 14.90 ? 132 ILE B N     1 
ATOM   3953  C  CA    . ILE D  1 134 ? 34.328  -60.286  -10.780 1.00 16.22 ? 132 ILE B CA    1 
ATOM   3954  C  C     . ILE D  1 134 ? 34.028  -60.524  -9.303  1.00 20.56 ? 132 ILE B C     1 
ATOM   3955  O  O     . ILE D  1 134 ? 32.914  -60.956  -8.924  1.00 15.56 ? 132 ILE B O     1 
ATOM   3956  C  CB    . ILE D  1 134 ? 34.314  -58.787  -11.071 1.00 22.09 ? 132 ILE B CB    1 
ATOM   3957  C  CG1   . ILE D  1 134 ? 32.951  -58.178  -10.696 1.00 19.36 ? 132 ILE B CG1   1 
ATOM   3958  C  CG2   . ILE D  1 134 ? 34.662  -58.522  -12.543 1.00 18.08 ? 132 ILE B CG2   1 
ATOM   3959  C  CD1   . ILE D  1 134 ? 32.981  -56.640  -10.589 1.00 25.05 ? 132 ILE B CD1   1 
ATOM   3960  N  N     . TYR D  1 135 ? 35.021  -60.242  -8.474  1.00 18.11 ? 133 TYR B N     1 
ATOM   3961  C  CA    . TYR D  1 135 ? 35.025  -60.726  -7.116  1.00 19.97 ? 133 TYR B CA    1 
ATOM   3962  C  C     . TYR D  1 135 ? 34.356  -59.680  -6.234  1.00 21.93 ? 133 TYR B C     1 
ATOM   3963  O  O     . TYR D  1 135 ? 34.650  -58.480  -6.342  1.00 18.02 ? 133 TYR B O     1 
ATOM   3964  C  CB    . TYR D  1 135 ? 36.469  -60.989  -6.664  1.00 18.38 ? 133 TYR B CB    1 
ATOM   3965  C  CG    . TYR D  1 135 ? 36.530  -61.353  -5.200  1.00 20.93 ? 133 TYR B CG    1 
ATOM   3966  C  CD1   . TYR D  1 135 ? 36.199  -62.633  -4.765  1.00 20.56 ? 133 TYR B CD1   1 
ATOM   3967  C  CD2   . TYR D  1 135 ? 36.871  -60.398  -4.253  1.00 20.99 ? 133 TYR B CD2   1 
ATOM   3968  C  CE1   . TYR D  1 135 ? 36.238  -62.961  -3.392  1.00 24.39 ? 133 TYR B CE1   1 
ATOM   3969  C  CE2   . TYR D  1 135 ? 36.924  -60.702  -2.889  1.00 23.19 ? 133 TYR B CE2   1 
ATOM   3970  C  CZ    . TYR D  1 135 ? 36.606  -61.974  -2.465  1.00 23.57 ? 133 TYR B CZ    1 
ATOM   3971  O  OH    . TYR D  1 135 ? 36.668  -62.251  -1.118  1.00 26.82 ? 133 TYR B OH    1 
ATOM   3972  N  N     . LYS D  1 136 ? 33.399  -60.133  -5.429  1.00 18.68 ? 134 LYS B N     1 
ATOM   3973  C  CA    . LYS D  1 136 ? 32.921  -59.357  -4.293  1.00 25.94 ? 134 LYS B CA    1 
ATOM   3974  C  C     . LYS D  1 136 ? 32.765  -60.248  -3.072  1.00 23.08 ? 134 LYS B C     1 
ATOM   3975  O  O     . LYS D  1 136 ? 32.003  -61.215  -3.094  1.00 21.84 ? 134 LYS B O     1 
ATOM   3976  C  CB    . LYS D  1 136 ? 31.611  -58.673  -4.618  1.00 21.23 ? 134 LYS B CB    1 
ATOM   3977  C  CG    . LYS D  1 136 ? 31.807  -57.553  -5.573  1.00 32.25 ? 134 LYS B CG    1 
ATOM   3978  C  CD    . LYS D  1 136 ? 32.827  -56.542  -5.024  1.00 41.09 ? 134 LYS B CD    1 
ATOM   3979  C  CE    . LYS D  1 136 ? 33.298  -55.576  -6.128  1.00 36.70 ? 134 LYS B CE    1 
ATOM   3980  N  NZ    . LYS D  1 136 ? 32.273  -54.544  -6.445  1.00 45.82 ? 134 LYS B NZ    1 
ATOM   3981  N  N     . SER D  1 137 ? 33.496  -59.902  -2.014  1.00 21.80 ? 135 SER B N     1 
ATOM   3982  C  CA    . SER D  1 137 ? 33.594  -60.737  -0.824  1.00 28.11 ? 135 SER B CA    1 
ATOM   3983  C  C     . SER D  1 137 ? 32.216  -61.061  -0.264  1.00 20.22 ? 135 SER B C     1 
ATOM   3984  O  O     . SER D  1 137 ? 31.941  -62.194  0.144   1.00 22.68 ? 135 SER B O     1 
ATOM   3985  C  CB    . SER D  1 137 ? 34.429  -60.026  0.248   1.00 27.98 ? 135 SER B CB    1 
ATOM   3986  O  OG    . SER D  1 137 ? 33.729  -58.884  0.707   1.00 37.10 ? 135 SER B OG    1 
ATOM   3987  N  N     . PHE D  1 138 ? 31.310  -60.095  -0.277  1.00 28.30 ? 136 PHE B N     1 
ATOM   3988  C  CA    . PHE D  1 138 ? 30.015  -60.341  0.363   1.00 27.75 ? 136 PHE B CA    1 
ATOM   3989  C  C     . PHE D  1 138 ? 29.141  -61.334  -0.390  1.00 26.24 ? 136 PHE B C     1 
ATOM   3990  O  O     . PHE D  1 138 ? 28.292  -61.961  0.221   1.00 24.41 ? 136 PHE B O     1 
ATOM   3991  C  CB    . PHE D  1 138 ? 29.237  -59.059  0.547   1.00 32.00 ? 136 PHE B CB    1 
ATOM   3992  C  CG    . PHE D  1 138 ? 29.318  -58.164  -0.620  1.00 40.40 ? 136 PHE B CG    1 
ATOM   3993  C  CD1   . PHE D  1 138 ? 30.515  -57.518  -0.915  1.00 42.73 ? 136 PHE B CD1   1 
ATOM   3994  C  CD2   . PHE D  1 138 ? 28.219  -57.978  -1.447  1.00 35.79 ? 136 PHE B CD2   1 
ATOM   3995  C  CE1   . PHE D  1 138 ? 30.610  -56.672  -2.018  1.00 48.41 ? 136 PHE B CE1   1 
ATOM   3996  C  CE2   . PHE D  1 138 ? 28.296  -57.142  -2.548  1.00 44.14 ? 136 PHE B CE2   1 
ATOM   3997  C  CZ    . PHE D  1 138 ? 29.494  -56.485  -2.837  1.00 47.86 ? 136 PHE B CZ    1 
ATOM   3998  N  N     . ASP D  1 139 ? 29.325  -61.464  -1.703  1.00 21.09 ? 137 ASP B N     1 
ATOM   3999  C  CA    . ASP D  1 139 ? 28.545  -62.444  -2.477  1.00 22.46 ? 137 ASP B CA    1 
ATOM   4000  C  C     . ASP D  1 139 ? 29.264  -63.779  -2.742  1.00 20.92 ? 137 ASP B C     1 
ATOM   4001  O  O     . ASP D  1 139 ? 28.671  -64.705  -3.327  1.00 20.70 ? 137 ASP B O     1 
ATOM   4002  C  CB    . ASP D  1 139 ? 28.118  -61.821  -3.802  1.00 17.72 ? 137 ASP B CB    1 
ATOM   4003  C  CG    . ASP D  1 139 ? 26.898  -60.930  -3.658  1.00 26.43 ? 137 ASP B CG    1 
ATOM   4004  O  OD1   . ASP D  1 139 ? 26.217  -61.064  -2.629  1.00 25.55 ? 137 ASP B OD1   1 
ATOM   4005  O  OD2   . ASP D  1 139 ? 26.622  -60.106  -4.566  1.00 29.74 ? 137 ASP B OD2   1 
ATOM   4006  N  N     . GLU D  1 140 ? 30.522  -63.909  -2.321  1.00 18.41 ? 138 GLU B N     1 
ATOM   4007  C  CA    . GLU D  1 140 ? 31.315  -65.079  -2.747  1.00 16.21 ? 138 GLU B CA    1 
ATOM   4008  C  C     . GLU D  1 140 ? 30.867  -66.451  -2.196  1.00 26.13 ? 138 GLU B C     1 
ATOM   4009  O  O     . GLU D  1 140 ? 31.263  -67.511  -2.725  1.00 20.78 ? 138 GLU B O     1 
ATOM   4010  C  CB    . GLU D  1 140 ? 32.801  -64.858  -2.531  1.00 25.11 ? 138 GLU B CB    1 
ATOM   4011  C  CG    . GLU D  1 140 ? 33.279  -65.183  -1.143  1.00 28.05 ? 138 GLU B CG    1 
ATOM   4012  C  CD    . GLU D  1 140 ? 34.791  -65.175  -1.072  1.00 26.74 ? 138 GLU B CD    1 
ATOM   4013  O  OE1   . GLU D  1 140 ? 35.325  -64.271  -0.415  1.00 28.26 ? 138 GLU B OE1   1 
ATOM   4014  O  OE2   . GLU D  1 140 ? 35.455  -66.034  -1.697  1.00 28.61 ? 138 GLU B OE2   1 
ATOM   4015  N  N     . LYS D  1 141 ? 30.032  -66.446  -1.163  1.00 26.74 ? 139 LYS B N     1 
ATOM   4016  C  CA    . LYS D  1 141 ? 29.565  -67.719  -0.605  1.00 29.69 ? 139 LYS B CA    1 
ATOM   4017  C  C     . LYS D  1 141 ? 28.085  -67.950  -0.872  1.00 26.14 ? 139 LYS B C     1 
ATOM   4018  O  O     . LYS D  1 141 ? 27.523  -68.964  -0.480  1.00 28.64 ? 139 LYS B O     1 
ATOM   4019  C  CB    . LYS D  1 141 ? 29.877  -67.830  0.885   1.00 29.13 ? 139 LYS B CB    1 
ATOM   4020  C  CG    . LYS D  1 141 ? 31.272  -68.345  1.161   1.00 42.33 ? 139 LYS B CG    1 
ATOM   4021  C  CD    . LYS D  1 141 ? 31.306  -69.319  2.354   1.00 54.50 ? 139 LYS B CD    1 
ATOM   4022  C  CE    . LYS D  1 141 ? 31.542  -68.583  3.669   1.00 52.92 ? 139 LYS B CE    1 
ATOM   4023  N  NZ    . LYS D  1 141 ? 32.383  -67.360  3.433   1.00 39.20 ? 139 LYS B NZ    1 
ATOM   4024  N  N     . LYS D  1 142 ? 27.468  -67.009  -1.576  1.00 26.13 ? 140 LYS B N     1 
ATOM   4025  C  CA    . LYS D  1 142 ? 26.040  -67.034  -1.858  1.00 21.38 ? 140 LYS B CA    1 
ATOM   4026  C  C     . LYS D  1 142 ? 25.707  -68.006  -3.004  1.00 26.85 ? 140 LYS B C     1 
ATOM   4027  O  O     . LYS D  1 142 ? 26.455  -68.094  -3.976  1.00 23.38 ? 140 LYS B O     1 
ATOM   4028  C  CB    . LYS D  1 142 ? 25.617  -65.594  -2.138  1.00 29.95 ? 140 LYS B CB    1 
ATOM   4029  C  CG    . LYS D  1 142 ? 24.356  -65.369  -2.904  1.00 34.16 ? 140 LYS B CG    1 
ATOM   4030  C  CD    . LYS D  1 142 ? 23.925  -63.924  -2.669  1.00 33.48 ? 140 LYS B CD    1 
ATOM   4031  C  CE    . LYS D  1 142 ? 22.972  -63.406  -3.752  1.00 34.43 ? 140 LYS B CE    1 
ATOM   4032  N  NZ    . LYS D  1 142 ? 21.682  -62.848  -3.177  1.00 41.94 ? 140 LYS B NZ    1 
ATOM   4033  N  N     . PRO D  1 143 ? 24.620  -68.797  -2.877  1.00 26.51 ? 141 PRO B N     1 
ATOM   4034  C  CA    . PRO D  1 143 ? 24.403  -69.732  -3.991  1.00 25.83 ? 141 PRO B CA    1 
ATOM   4035  C  C     . PRO D  1 143 ? 23.737  -69.002  -5.139  1.00 22.58 ? 141 PRO B C     1 
ATOM   4036  O  O     . PRO D  1 143 ? 23.440  -67.794  -5.048  1.00 23.90 ? 141 PRO B O     1 
ATOM   4037  C  CB    . PRO D  1 143 ? 23.391  -70.740  -3.420  1.00 23.58 ? 141 PRO B CB    1 
ATOM   4038  C  CG    . PRO D  1 143 ? 22.539  -69.884  -2.511  1.00 29.27 ? 141 PRO B CG    1 
ATOM   4039  C  CD    . PRO D  1 143 ? 23.578  -68.933  -1.840  1.00 29.10 ? 141 PRO B CD    1 
ATOM   4040  N  N     . TYR D  1 144 ? 23.480  -69.733  -6.219  1.00 20.83 ? 142 TYR B N     1 
ATOM   4041  C  CA    . TYR D  1 144 ? 22.667  -69.176  -7.275  1.00 21.79 ? 142 TYR B CA    1 
ATOM   4042  C  C     . TYR D  1 144 ? 21.222  -69.612  -7.049  1.00 21.16 ? 142 TYR B C     1 
ATOM   4043  O  O     . TYR D  1 144 ? 20.957  -70.736  -6.637  1.00 24.06 ? 142 TYR B O     1 
ATOM   4044  C  CB    . TYR D  1 144 ? 23.140  -69.621  -8.664  1.00 17.83 ? 142 TYR B CB    1 
ATOM   4045  C  CG    . TYR D  1 144 ? 24.526  -69.110  -9.090  1.00 18.43 ? 142 TYR B CG    1 
ATOM   4046  C  CD1   . TYR D  1 144 ? 24.719  -67.787  -9.495  1.00 16.53 ? 142 TYR B CD1   1 
ATOM   4047  C  CD2   . TYR D  1 144 ? 25.606  -69.974  -9.135  1.00 14.63 ? 142 TYR B CD2   1 
ATOM   4048  C  CE1   . TYR D  1 144 ? 25.992  -67.335  -9.906  1.00 18.96 ? 142 TYR B CE1   1 
ATOM   4049  C  CE2   . TYR D  1 144 ? 26.888  -69.547  -9.550  1.00 15.75 ? 142 TYR B CE2   1 
ATOM   4050  C  CZ    . TYR D  1 144 ? 27.064  -68.226  -9.933  1.00 17.27 ? 142 TYR B CZ    1 
ATOM   4051  O  OH    . TYR D  1 144 ? 28.306  -67.826  -10.339 1.00 16.73 ? 142 TYR B OH    1 
ATOM   4052  N  N     . THR D  1 145 ? 20.280  -68.730  -7.327  1.00 26.52 ? 143 THR B N     1 
ATOM   4053  C  CA    . THR D  1 145 ? 18.885  -69.115  -7.231  1.00 24.48 ? 143 THR B CA    1 
ATOM   4054  C  C     . THR D  1 145 ? 18.252  -69.086  -8.619  1.00 26.80 ? 143 THR B C     1 
ATOM   4055  O  O     . THR D  1 145 ? 18.568  -68.213  -9.446  1.00 22.92 ? 143 THR B O     1 
ATOM   4056  C  CB    . THR D  1 145 ? 18.146  -68.298  -6.125  1.00 26.71 ? 143 THR B CB    1 
ATOM   4057  O  OG1   . THR D  1 145 ? 18.126  -66.907  -6.456  1.00 31.17 ? 143 THR B OG1   1 
ATOM   4058  C  CG2   . THR D  1 145 ? 18.877  -68.453  -4.837  1.00 25.72 ? 143 THR B CG2   1 
ATOM   4059  N  N     . TYR D  1 146 ? 17.424  -70.088  -8.902  1.00 23.94 ? 144 TYR B N     1 
ATOM   4060  C  CA    . TYR D  1 146 ? 16.935  -70.309  -10.252 1.00 23.64 ? 144 TYR B CA    1 
ATOM   4061  C  C     . TYR D  1 146 ? 15.425  -70.600  -10.245 1.00 26.17 ? 144 TYR B C     1 
ATOM   4062  O  O     . TYR D  1 146 ? 14.915  -71.257  -9.341  1.00 26.85 ? 144 TYR B O     1 
ATOM   4063  C  CB    . TYR D  1 146 ? 17.706  -71.479  -10.878 1.00 22.62 ? 144 TYR B CB    1 
ATOM   4064  C  CG    . TYR D  1 146 ? 17.462  -71.629  -12.356 1.00 28.95 ? 144 TYR B CG    1 
ATOM   4065  C  CD1   . TYR D  1 146 ? 16.372  -72.352  -12.824 1.00 24.21 ? 144 TYR B CD1   1 
ATOM   4066  C  CD2   . TYR D  1 146 ? 18.305  -71.035  -13.292 1.00 22.71 ? 144 TYR B CD2   1 
ATOM   4067  C  CE1   . TYR D  1 146 ? 16.130  -72.496  -14.175 1.00 22.45 ? 144 TYR B CE1   1 
ATOM   4068  C  CE2   . TYR D  1 146 ? 18.052  -71.176  -14.670 1.00 22.61 ? 144 TYR B CE2   1 
ATOM   4069  C  CZ    . TYR D  1 146 ? 16.960  -71.905  -15.092 1.00 22.19 ? 144 TYR B CZ    1 
ATOM   4070  O  OH    . TYR D  1 146 ? 16.640  -72.065  -16.430 1.00 20.69 ? 144 TYR B OH    1 
ATOM   4071  N  N     . PRO D  1 147 ? 14.700  -70.103  -11.247 1.00 27.78 ? 145 PRO B N     1 
ATOM   4072  C  CA    . PRO D  1 147 ? 15.183  -69.291  -12.376 1.00 27.66 ? 145 PRO B CA    1 
ATOM   4073  C  C     . PRO D  1 147 ? 15.628  -67.896  -11.938 1.00 28.06 ? 145 PRO B C     1 
ATOM   4074  O  O     . PRO D  1 147 ? 15.424  -67.497  -10.778 1.00 29.02 ? 145 PRO B O     1 
ATOM   4075  C  CB    . PRO D  1 147 ? 13.930  -69.150  -13.248 1.00 29.42 ? 145 PRO B CB    1 
ATOM   4076  C  CG    . PRO D  1 147 ? 12.795  -69.190  -12.240 1.00 35.27 ? 145 PRO B CG    1 
ATOM   4077  C  CD    . PRO D  1 147 ? 13.234  -70.239  -11.250 1.00 30.74 ? 145 PRO B CD    1 
ATOM   4078  N  N     . PRO D  1 148 ? 16.212  -67.137  -12.872 1.00 25.04 ? 146 PRO B N     1 
ATOM   4079  C  CA    . PRO D  1 148 ? 16.745  -65.807  -12.546 1.00 25.58 ? 146 PRO B CA    1 
ATOM   4080  C  C     . PRO D  1 148 ? 15.661  -64.815  -12.163 1.00 27.31 ? 146 PRO B C     1 
ATOM   4081  O  O     . PRO D  1 148 ? 14.515  -64.919  -12.619 1.00 26.95 ? 146 PRO B O     1 
ATOM   4082  C  CB    . PRO D  1 148 ? 17.448  -65.360  -13.837 1.00 22.13 ? 146 PRO B CB    1 
ATOM   4083  C  CG    . PRO D  1 148 ? 17.100  -66.341  -14.878 1.00 31.18 ? 146 PRO B CG    1 
ATOM   4084  C  CD    . PRO D  1 148 ? 16.571  -67.588  -14.229 1.00 27.21 ? 146 PRO B CD    1 
ATOM   4085  N  N     . SER D  1 149 ? 16.014  -63.866  -11.303 1.00 30.09 ? 147 SER B N     1 
ATOM   4086  C  CA    . SER D  1 149 ? 15.069  -62.813  -10.919 1.00 27.15 ? 147 SER B CA    1 
ATOM   4087  C  C     . SER D  1 149 ? 15.705  -61.434  -11.070 1.00 25.65 ? 147 SER B C     1 
ATOM   4088  O  O     . SER D  1 149 ? 16.864  -61.246  -10.722 1.00 27.67 ? 147 SER B O     1 
ATOM   4089  C  CB    . SER D  1 149 ? 14.616  -62.992  -9.474  1.00 30.18 ? 147 SER B CB    1 
ATOM   4090  O  OG    . SER D  1 149 ? 13.926  -61.835  -9.064  1.00 34.37 ? 147 SER B OG    1 
ATOM   4091  N  N     . PRO D  1 150 ? 14.933  -60.460  -11.576 1.00 26.00 ? 148 PRO B N     1 
ATOM   4092  C  CA    . PRO D  1 150 ? 15.472  -59.114  -11.824 1.00 28.42 ? 148 PRO B CA    1 
ATOM   4093  C  C     . PRO D  1 150 ? 16.225  -58.602  -10.603 1.00 32.82 ? 148 PRO B C     1 
ATOM   4094  O  O     . PRO D  1 150 ? 17.137  -57.768  -10.734 1.00 26.13 ? 148 PRO B O     1 
ATOM   4095  C  CB    . PRO D  1 150 ? 14.224  -58.256  -12.073 1.00 27.74 ? 148 PRO B CB    1 
ATOM   4096  C  CG    . PRO D  1 150 ? 13.164  -59.255  -12.549 1.00 25.19 ? 148 PRO B CG    1 
ATOM   4097  C  CD    . PRO D  1 150 ? 13.486  -60.570  -11.863 1.00 21.09 ? 148 PRO B CD    1 
ATOM   4098  N  N     . ASN D  1 151 ? 15.853  -59.102  -9.430  1.00 29.81 ? 149 ASN B N     1 
ATOM   4099  C  CA    . ASN D  1 151 ? 16.527  -58.730  -8.191  1.00 35.66 ? 149 ASN B CA    1 
ATOM   4100  C  C     . ASN D  1 151 ? 17.998  -59.140  -8.154  1.00 35.06 ? 149 ASN B C     1 
ATOM   4101  O  O     . ASN D  1 151 ? 18.829  -58.492  -7.505  1.00 34.12 ? 149 ASN B O     1 
ATOM   4102  C  CB    . ASN D  1 151 ? 15.785  -59.359  -7.009  1.00 37.12 ? 149 ASN B CB    1 
ATOM   4103  C  CG    . ASN D  1 151 ? 14.442  -58.728  -6.798  1.00 47.76 ? 149 ASN B CG    1 
ATOM   4104  O  OD1   . ASN D  1 151 ? 14.330  -57.497  -6.801  1.00 51.27 ? 149 ASN B OD1   1 
ATOM   4105  N  ND2   . ASN D  1 151 ? 13.396  -59.556  -6.674  1.00 56.29 ? 149 ASN B ND2   1 
ATOM   4106  N  N     . ASP D  1 152 ? 18.329  -60.229  -8.832  1.00 26.65 ? 150 ASP B N     1 
ATOM   4107  C  CA    . ASP D  1 152 ? 19.692  -60.741  -8.719  1.00 30.66 ? 150 ASP B CA    1 
ATOM   4108  C  C     . ASP D  1 152 ? 20.645  -59.978  -9.627  1.00 24.63 ? 150 ASP B C     1 
ATOM   4109  O  O     . ASP D  1 152 ? 21.818  -60.348  -9.755  1.00 25.33 ? 150 ASP B O     1 
ATOM   4110  C  CB    . ASP D  1 152 ? 19.730  -62.214  -9.080  1.00 29.95 ? 150 ASP B CB    1 
ATOM   4111  C  CG    . ASP D  1 152 ? 18.581  -62.991  -8.464  1.00 32.53 ? 150 ASP B CG    1 
ATOM   4112  O  OD1   . ASP D  1 152 ? 18.329  -62.785  -7.267  1.00 29.51 ? 150 ASP B OD1   1 
ATOM   4113  O  OD2   . ASP D  1 152 ? 17.938  -63.779  -9.190  1.00 30.75 ? 150 ASP B OD2   1 
ATOM   4114  N  N     . VAL D  1 153 ? 20.127  -58.943  -10.288 1.00 27.44 ? 151 VAL B N     1 
ATOM   4115  C  CA    . VAL D  1 153 ? 20.926  -58.197  -11.262 1.00 22.96 ? 151 VAL B CA    1 
ATOM   4116  C  C     . VAL D  1 153 ? 22.270  -57.778  -10.670 1.00 25.45 ? 151 VAL B C     1 
ATOM   4117  O  O     . VAL D  1 153 ? 23.321  -57.795  -11.351 1.00 23.02 ? 151 VAL B O     1 
ATOM   4118  C  CB    . VAL D  1 153 ? 20.145  -56.969  -11.814 1.00 26.93 ? 151 VAL B CB    1 
ATOM   4119  C  CG1   . VAL D  1 153 ? 19.899  -55.944  -10.708 1.00 23.15 ? 151 VAL B CG1   1 
ATOM   4120  C  CG2   . VAL D  1 153 ? 20.893  -56.344  -12.971 1.00 22.56 ? 151 VAL B CG2   1 
ATOM   4121  N  N     . VAL D  1 154 ? 22.257  -57.426  -9.392  1.00 24.42 ? 152 VAL B N     1 
ATOM   4122  C  CA    . VAL D  1 154 ? 23.485  -56.952  -8.737  1.00 25.18 ? 152 VAL B CA    1 
ATOM   4123  C  C     . VAL D  1 154 ? 24.426  -58.048  -8.245  1.00 25.72 ? 152 VAL B C     1 
ATOM   4124  O  O     . VAL D  1 154 ? 25.595  -57.779  -7.954  1.00 27.61 ? 152 VAL B O     1 
ATOM   4125  C  CB    . VAL D  1 154 ? 23.215  -55.996  -7.545  1.00 23.08 ? 152 VAL B CB    1 
ATOM   4126  C  CG1   . VAL D  1 154 ? 22.921  -54.592  -8.029  1.00 29.71 ? 152 VAL B CG1   1 
ATOM   4127  C  CG2   . VAL D  1 154 ? 22.117  -56.570  -6.615  1.00 30.95 ? 152 VAL B CG2   1 
ATOM   4128  N  N     . SER D  1 155 ? 23.949  -59.277  -8.133  1.00 22.76 ? 153 SER B N     1 
ATOM   4129  C  CA    . SER D  1 155 ? 24.784  -60.302  -7.511  1.00 20.33 ? 153 SER B CA    1 
ATOM   4130  C  C     . SER D  1 155 ? 25.186  -61.470  -8.445  1.00 20.92 ? 153 SER B C     1 
ATOM   4131  O  O     . SER D  1 155 ? 26.203  -62.152  -8.218  1.00 19.13 ? 153 SER B O     1 
ATOM   4132  C  CB    . SER D  1 155 ? 24.092  -60.815  -6.263  1.00 23.95 ? 153 SER B CB    1 
ATOM   4133  O  OG    . SER D  1 155 ? 23.005  -61.658  -6.605  1.00 24.90 ? 153 SER B OG    1 
ATOM   4134  N  N     . LEU D  1 156 ? 24.402  -61.694  -9.504  1.00 19.37 ? 154 LEU B N     1 
ATOM   4135  C  CA    . LEU D  1 156 ? 24.613  -62.833  -10.406 1.00 17.96 ? 154 LEU B CA    1 
ATOM   4136  C  C     . LEU D  1 156 ? 26.039  -62.963  -10.955 1.00 19.72 ? 154 LEU B C     1 
ATOM   4137  O  O     . LEU D  1 156 ? 26.567  -64.073  -11.088 1.00 21.75 ? 154 LEU B O     1 
ATOM   4138  C  CB    . LEU D  1 156 ? 23.613  -62.756  -11.572 1.00 20.07 ? 154 LEU B CB    1 
ATOM   4139  C  CG    . LEU D  1 156 ? 22.271  -63.456  -11.332 1.00 19.43 ? 154 LEU B CG    1 
ATOM   4140  C  CD1   . LEU D  1 156 ? 21.240  -63.080  -12.415 1.00 19.54 ? 154 LEU B CD1   1 
ATOM   4141  C  CD2   . LEU D  1 156 ? 22.461  -64.979  -11.262 1.00 21.41 ? 154 LEU B CD2   1 
ATOM   4142  N  N     . PHE D  1 157 ? 26.668  -61.832  -11.260 1.00 16.38 ? 155 PHE B N     1 
ATOM   4143  C  CA    . PHE D  1 157 ? 27.950  -61.838  -11.949 1.00 13.87 ? 155 PHE B CA    1 
ATOM   4144  C  C     . PHE D  1 157 ? 29.121  -61.829  -10.958 1.00 19.17 ? 155 PHE B C     1 
ATOM   4145  O  O     . PHE D  1 157 ? 30.275  -61.730  -11.352 1.00 17.66 ? 155 PHE B O     1 
ATOM   4146  C  CB    . PHE D  1 157 ? 28.036  -60.659  -12.919 1.00 14.78 ? 155 PHE B CB    1 
ATOM   4147  C  CG    . PHE D  1 157 ? 27.878  -59.297  -12.255 1.00 14.51 ? 155 PHE B CG    1 
ATOM   4148  C  CD1   . PHE D  1 157 ? 28.999  -58.639  -11.731 1.00 16.88 ? 155 PHE B CD1   1 
ATOM   4149  C  CD2   . PHE D  1 157 ? 26.628  -58.683  -12.163 1.00 15.33 ? 155 PHE B CD2   1 
ATOM   4150  C  CE1   . PHE D  1 157 ? 28.876  -57.398  -11.126 1.00 25.57 ? 155 PHE B CE1   1 
ATOM   4151  C  CE2   . PHE D  1 157 ? 26.499  -57.432  -11.558 1.00 16.53 ? 155 PHE B CE2   1 
ATOM   4152  C  CZ    . PHE D  1 157 ? 27.633  -56.789  -11.037 1.00 22.34 ? 155 PHE B CZ    1 
ATOM   4153  N  N     . HIS D  1 158 ? 28.831  -61.969  -9.670  1.00 16.01 ? 156 HIS B N     1 
ATOM   4154  C  CA    . HIS D  1 158 ? 29.906  -62.050  -8.677  1.00 19.76 ? 156 HIS B CA    1 
ATOM   4155  C  C     . HIS D  1 158 ? 30.436  -63.456  -8.562  1.00 18.62 ? 156 HIS B C     1 
ATOM   4156  O  O     . HIS D  1 158 ? 29.662  -64.401  -8.327  1.00 19.08 ? 156 HIS B O     1 
ATOM   4157  C  CB    . HIS D  1 158 ? 29.418  -61.577  -7.306  1.00 14.66 ? 156 HIS B CB    1 
ATOM   4158  C  CG    . HIS D  1 158 ? 29.190  -60.109  -7.235  1.00 20.77 ? 156 HIS B CG    1 
ATOM   4159  N  ND1   . HIS D  1 158 ? 28.368  -59.524  -6.294  1.00 20.36 ? 156 HIS B ND1   1 
ATOM   4160  C  CD2   . HIS D  1 158 ? 29.687  -59.097  -7.989  1.00 26.47 ? 156 HIS B CD2   1 
ATOM   4161  C  CE1   . HIS D  1 158 ? 28.364  -58.219  -6.480  1.00 23.95 ? 156 HIS B CE1   1 
ATOM   4162  N  NE2   . HIS D  1 158 ? 29.153  -57.935  -7.500  1.00 21.25 ? 156 HIS B NE2   1 
ATOM   4163  N  N     . THR D  1 159 ? 31.745  -63.603  -8.743  1.00 18.16 ? 157 THR B N     1 
ATOM   4164  C  CA    . THR D  1 159 ? 32.382  -64.920  -8.750  1.00 16.13 ? 157 THR B CA    1 
ATOM   4165  C  C     . THR D  1 159 ? 32.194  -65.590  -7.383  1.00 16.72 ? 157 THR B C     1 
ATOM   4166  O  O     . THR D  1 159 ? 32.408  -64.975  -6.351  1.00 20.45 ? 157 THR B O     1 
ATOM   4167  C  CB    . THR D  1 159 ? 33.903  -64.831  -9.046  1.00 18.79 ? 157 THR B CB    1 
ATOM   4168  O  OG1   . THR D  1 159 ? 34.118  -64.094  -10.260 1.00 14.77 ? 157 THR B OG1   1 
ATOM   4169  C  CG2   . THR D  1 159 ? 34.538  -66.269  -9.167  1.00 10.41 ? 157 THR B CG2   1 
ATOM   4170  N  N     . ARG D  1 160 ? 31.805  -66.865  -7.398  1.00 21.85 ? 158 ARG B N     1 
ATOM   4171  C  CA    . ARG D  1 160 ? 31.628  -67.695  -6.197  1.00 19.22 ? 158 ARG B CA    1 
ATOM   4172  C  C     . ARG D  1 160 ? 32.934  -68.442  -5.840  1.00 18.94 ? 158 ARG B C     1 
ATOM   4173  O  O     . ARG D  1 160 ? 33.653  -68.982  -6.699  1.00 14.60 ? 158 ARG B O     1 
ATOM   4174  C  CB    . ARG D  1 160 ? 30.516  -68.724  -6.428  1.00 19.63 ? 158 ARG B CB    1 
ATOM   4175  C  CG    . ARG D  1 160 ? 29.062  -68.278  -6.107  1.00 24.14 ? 158 ARG B CG    1 
ATOM   4176  C  CD    . ARG D  1 160 ? 28.651  -66.825  -6.368  1.00 24.04 ? 158 ARG B CD    1 
ATOM   4177  N  NE    . ARG D  1 160 ? 27.198  -66.686  -6.198  1.00 20.65 ? 158 ARG B NE    1 
ATOM   4178  C  CZ    . ARG D  1 160 ? 26.476  -65.681  -6.681  1.00 23.32 ? 158 ARG B CZ    1 
ATOM   4179  N  NH1   . ARG D  1 160 ? 27.078  -64.706  -7.372  1.00 16.25 ? 158 ARG B NH1   1 
ATOM   4180  N  NH2   . ARG D  1 160 ? 25.149  -65.656  -6.496  1.00 21.62 ? 158 ARG B NH2   1 
ATOM   4181  N  N     . ASN D  1 161 ? 33.232  -68.466  -4.549  1.00 16.92 ? 159 ASN B N     1 
ATOM   4182  C  CA    . ASN D  1 161 ? 34.362  -69.212  -4.031  1.00 22.78 ? 159 ASN B CA    1 
ATOM   4183  C  C     . ASN D  1 161 ? 34.430  -70.685  -4.493  1.00 24.94 ? 159 ASN B C     1 
ATOM   4184  O  O     . ASN D  1 161 ? 35.536  -71.217  -4.734  1.00 16.05 ? 159 ASN B O     1 
ATOM   4185  C  CB    . ASN D  1 161 ? 34.426  -69.073  -2.493  1.00 20.28 ? 159 ASN B CB    1 
ATOM   4186  C  CG    . ASN D  1 161 ? 35.691  -69.683  -1.910  1.00 28.30 ? 159 ASN B CG    1 
ATOM   4187  O  OD1   . ASN D  1 161 ? 35.767  -70.907  -1.732  1.00 25.54 ? 159 ASN B OD1   1 
ATOM   4188  N  ND2   . ASN D  1 161 ? 36.698  -68.843  -1.626  1.00 25.54 ? 159 ASN B ND2   1 
ATOM   4189  N  N     . TYR D  1 162 ? 33.276  -71.354  -4.631  1.00 17.96 ? 160 TYR B N     1 
ATOM   4190  C  CA    . TYR D  1 162 ? 33.326  -72.794  -4.930  1.00 19.49 ? 160 TYR B CA    1 
ATOM   4191  C  C     . TYR D  1 162 ? 34.033  -73.173  -6.232  1.00 19.55 ? 160 TYR B C     1 
ATOM   4192  O  O     . TYR D  1 162 ? 34.471  -74.329  -6.384  1.00 14.40 ? 160 TYR B O     1 
ATOM   4193  C  CB    . TYR D  1 162 ? 31.944  -73.486  -4.874  1.00 15.31 ? 160 TYR B CB    1 
ATOM   4194  C  CG    . TYR D  1 162 ? 31.115  -73.307  -6.129  1.00 21.43 ? 160 TYR B CG    1 
ATOM   4195  C  CD1   . TYR D  1 162 ? 31.305  -74.122  -7.253  1.00 19.68 ? 160 TYR B CD1   1 
ATOM   4196  C  CD2   . TYR D  1 162 ? 30.144  -72.331  -6.194  1.00 17.04 ? 160 TYR B CD2   1 
ATOM   4197  C  CE1   . TYR D  1 162 ? 30.527  -73.940  -8.410  1.00 16.92 ? 160 TYR B CE1   1 
ATOM   4198  C  CE2   . TYR D  1 162 ? 29.379  -72.151  -7.327  1.00 19.55 ? 160 TYR B CE2   1 
ATOM   4199  C  CZ    . TYR D  1 162 ? 29.574  -72.956  -8.435  1.00 16.43 ? 160 TYR B CZ    1 
ATOM   4200  O  OH    . TYR D  1 162 ? 28.783  -72.752  -9.573  1.00 15.45 ? 160 TYR B OH    1 
ATOM   4201  N  N     . VAL D  1 163 ? 34.133  -72.250  -7.193  1.00 21.31 ? 161 VAL B N     1 
ATOM   4202  C  CA    . VAL D  1 163 ? 34.859  -72.587  -8.438  1.00 16.75 ? 161 VAL B CA    1 
ATOM   4203  C  C     . VAL D  1 163 ? 36.303  -73.012  -8.216  1.00 15.59 ? 161 VAL B C     1 
ATOM   4204  O  O     . VAL D  1 163 ? 36.887  -73.825  -8.982  1.00 14.23 ? 161 VAL B O     1 
ATOM   4205  C  CB    . VAL D  1 163 ? 34.730  -71.458  -9.529  1.00 15.48 ? 161 VAL B CB    1 
ATOM   4206  C  CG1   . VAL D  1 163 ? 33.289  -70.972  -9.614  1.00 14.48 ? 161 VAL B CG1   1 
ATOM   4207  C  CG2   . VAL D  1 163 ? 35.676  -70.296  -9.224  1.00 17.80 ? 161 VAL B CG2   1 
ATOM   4208  N  N     . ILE D  1 164 ? 36.910  -72.485  -7.161  1.00 20.50 ? 162 ILE B N     1 
ATOM   4209  C  CA    . ILE D  1 164 ? 38.254  -72.941  -6.850  1.00 14.95 ? 162 ILE B CA    1 
ATOM   4210  C  C     . ILE D  1 164 ? 38.271  -74.469  -6.801  1.00 17.13 ? 162 ILE B C     1 
ATOM   4211  O  O     . ILE D  1 164 ? 39.142  -75.132  -7.389  1.00 16.84 ? 162 ILE B O     1 
ATOM   4212  C  CB    . ILE D  1 164 ? 38.755  -72.374  -5.493  1.00 16.92 ? 162 ILE B CB    1 
ATOM   4213  C  CG1   . ILE D  1 164 ? 38.927  -70.857  -5.575  1.00 15.54 ? 162 ILE B CG1   1 
ATOM   4214  C  CG2   . ILE D  1 164 ? 40.091  -73.021  -5.110  1.00 18.04 ? 162 ILE B CG2   1 
ATOM   4215  C  CD1   . ILE D  1 164 ? 39.092  -70.157  -4.207  1.00 17.47 ? 162 ILE B CD1   1 
ATOM   4216  N  N     . GLN D  1 165 ? 37.304  -75.020  -6.074  1.00 15.81 ? 163 GLN B N     1 
ATOM   4217  C  CA    A GLN D  1 165 ? 37.216  -76.477  -5.885  0.46 21.56 ? 163 GLN B CA    1 
ATOM   4218  C  CA    B GLN D  1 165 ? 37.230  -76.468  -5.872  0.54 21.57 ? 163 GLN B CA    1 
ATOM   4219  C  C     . GLN D  1 165 ? 36.919  -77.241  -7.177  1.00 19.21 ? 163 GLN B C     1 
ATOM   4220  O  O     . GLN D  1 165 ? 37.502  -78.306  -7.450  1.00 15.18 ? 163 GLN B O     1 
ATOM   4221  C  CB    A GLN D  1 165 ? 36.152  -76.825  -4.847  0.46 21.44 ? 163 GLN B CB    1 
ATOM   4222  C  CB    B GLN D  1 165 ? 36.213  -76.767  -4.762  0.54 21.47 ? 163 GLN B CB    1 
ATOM   4223  C  CG    A GLN D  1 165 ? 36.651  -76.742  -3.423  0.46 22.22 ? 163 GLN B CG    1 
ATOM   4224  C  CG    B GLN D  1 165 ? 36.672  -76.212  -3.404  0.54 21.78 ? 163 GLN B CG    1 
ATOM   4225  C  CD    A GLN D  1 165 ? 36.230  -75.472  -2.727  0.46 22.94 ? 163 GLN B CD    1 
ATOM   4226  C  CD    B GLN D  1 165 ? 35.668  -76.411  -2.278  0.54 22.57 ? 163 GLN B CD    1 
ATOM   4227  O  OE1   A GLN D  1 165 ? 36.728  -74.379  -3.031  0.46 20.04 ? 163 GLN B OE1   1 
ATOM   4228  O  OE1   B GLN D  1 165 ? 35.085  -75.440  -1.780  0.54 25.86 ? 163 GLN B OE1   1 
ATOM   4229  N  NE2   A GLN D  1 165 ? 35.307  -75.603  -1.777  0.46 25.34 ? 163 GLN B NE2   1 
ATOM   4230  N  NE2   B GLN D  1 165 ? 35.480  -77.664  -1.849  0.54 22.35 ? 163 GLN B NE2   1 
ATOM   4231  N  N     . MET D  1 166 ? 36.018  -76.692  -7.999  1.00 18.57 ? 164 MET B N     1 
ATOM   4232  C  CA    . MET D  1 166 ? 35.689  -77.317  -9.290  1.00 15.60 ? 164 MET B CA    1 
ATOM   4233  C  C     . MET D  1 166 ? 36.894  -77.376  -10.220 1.00 16.97 ? 164 MET B C     1 
ATOM   4234  O  O     . MET D  1 166 ? 37.039  -78.300  -11.047 1.00 17.48 ? 164 MET B O     1 
ATOM   4235  C  CB    . MET D  1 166 ? 34.564  -76.559  -9.974  1.00 18.44 ? 164 MET B CB    1 
ATOM   4236  C  CG    . MET D  1 166 ? 33.299  -76.405  -9.121  1.00 14.63 ? 164 MET B CG    1 
ATOM   4237  S  SD    . MET D  1 166 ? 32.464  -78.010  -8.941  1.00 23.37 ? 164 MET B SD    1 
ATOM   4238  C  CE    . MET D  1 166 ? 31.757  -78.211  -10.581 1.00 23.55 ? 164 MET B CE    1 
ATOM   4239  N  N     . LEU D  1 167 ? 37.788  -76.394  -10.104 1.00 18.81 ? 165 LEU B N     1 
ATOM   4240  C  CA    . LEU D  1 167 ? 38.843  -76.284  -11.117 1.00 16.04 ? 165 LEU B CA    1 
ATOM   4241  C  C     . LEU D  1 167 ? 40.172  -76.862  -10.632 1.00 22.13 ? 165 LEU B C     1 
ATOM   4242  O  O     . LEU D  1 167 ? 41.031  -77.222  -11.436 1.00 18.70 ? 165 LEU B O     1 
ATOM   4243  C  CB    . LEU D  1 167 ? 39.012  -74.819  -11.542 1.00 15.47 ? 165 LEU B CB    1 
ATOM   4244  C  CG    . LEU D  1 167 ? 37.759  -74.149  -12.122 1.00 13.30 ? 165 LEU B CG    1 
ATOM   4245  C  CD1   . LEU D  1 167 ? 38.013  -72.662  -12.388 1.00 13.02 ? 165 LEU B CD1   1 
ATOM   4246  C  CD2   . LEU D  1 167 ? 37.463  -74.884  -13.440 1.00 13.44 ? 165 LEU B CD2   1 
ATOM   4247  N  N     . SER D  1 168 ? 40.329  -76.963  -9.314  1.00 18.75 ? 166 SER B N     1 
ATOM   4248  C  CA    . SER D  1 168 ? 41.650  -77.228  -8.728  1.00 18.57 ? 166 SER B CA    1 
ATOM   4249  C  C     . SER D  1 168 ? 42.467  -78.401  -9.260  1.00 20.09 ? 166 SER B C     1 
ATOM   4250  O  O     . SER D  1 168 ? 43.691  -78.289  -9.333  1.00 19.35 ? 166 SER B O     1 
ATOM   4251  C  CB    . SER D  1 168 ? 41.533  -77.356  -7.210  1.00 26.00 ? 166 SER B CB    1 
ATOM   4252  O  OG    . SER D  1 168 ? 41.425  -76.080  -6.642  1.00 34.50 ? 166 SER B OG    1 
ATOM   4253  N  N     . ASN D  1 169 ? 41.820  -79.517  -9.621  1.00 17.12 ? 167 ASN B N     1 
ATOM   4254  C  CA    . ASN D  1 169 ? 42.587  -80.692  -10.049 1.00 19.29 ? 167 ASN B CA    1 
ATOM   4255  C  C     . ASN D  1 169 ? 42.916  -80.722  -11.546 1.00 24.63 ? 167 ASN B C     1 
ATOM   4256  O  O     . ASN D  1 169 ? 43.535  -81.679  -12.034 1.00 22.96 ? 167 ASN B O     1 
ATOM   4257  C  CB    . ASN D  1 169 ? 41.903  -82.003  -9.628  1.00 18.33 ? 167 ASN B CB    1 
ATOM   4258  C  CG    . ASN D  1 169 ? 40.526  -82.201  -10.319 1.00 27.49 ? 167 ASN B CG    1 
ATOM   4259  O  OD1   . ASN D  1 169 ? 40.231  -81.544  -11.331 1.00 21.12 ? 167 ASN B OD1   1 
ATOM   4260  N  ND2   . ASN D  1 169 ? 39.682  -83.088  -9.762  1.00 17.15 ? 167 ASN B ND2   1 
ATOM   4261  N  N     . LEU D  1 170 ? 42.558  -79.664  -12.272 1.00 18.31 ? 168 LEU B N     1 
ATOM   4262  C  CA    . LEU D  1 170 ? 42.591  -79.759  -13.731 1.00 21.11 ? 168 LEU B CA    1 
ATOM   4263  C  C     . LEU D  1 170 ? 43.966  -79.829  -14.352 1.00 22.85 ? 168 LEU B C     1 
ATOM   4264  O  O     . LEU D  1 170 ? 44.105  -80.278  -15.496 1.00 24.74 ? 168 LEU B O     1 
ATOM   4265  C  CB    . LEU D  1 170 ? 41.762  -78.652  -14.369 1.00 24.55 ? 168 LEU B CB    1 
ATOM   4266  C  CG    . LEU D  1 170 ? 40.273  -78.913  -14.152 1.00 15.64 ? 168 LEU B CG    1 
ATOM   4267  C  CD1   . LEU D  1 170 ? 39.453  -77.681  -14.557 1.00 17.47 ? 168 LEU B CD1   1 
ATOM   4268  C  CD2   . LEU D  1 170 ? 39.833  -80.155  -14.965 1.00 18.23 ? 168 LEU B CD2   1 
ATOM   4269  N  N     . SER D  1 171 ? 44.990  -79.364  -13.642 1.00 19.81 ? 169 SER B N     1 
ATOM   4270  C  CA    . SER D  1 171 ? 46.336  -79.485  -14.192 1.00 20.79 ? 169 SER B CA    1 
ATOM   4271  C  C     . SER D  1 171 ? 47.033  -80.828  -13.865 1.00 26.30 ? 169 SER B C     1 
ATOM   4272  O  O     . SER D  1 171 ? 48.191  -81.034  -14.219 1.00 17.88 ? 169 SER B O     1 
ATOM   4273  C  CB    . SER D  1 171 ? 47.214  -78.280  -13.784 1.00 22.89 ? 169 SER B CB    1 
ATOM   4274  O  OG    . SER D  1 171 ? 47.167  -77.243  -14.777 1.00 23.60 ? 169 SER B OG    1 
ATOM   4275  N  N     . GLN D  1 172 ? 46.321  -81.753  -13.230 1.00 24.45 ? 170 GLN B N     1 
ATOM   4276  C  CA    . GLN D  1 172 ? 46.975  -82.980  -12.788 1.00 25.46 ? 170 GLN B CA    1 
ATOM   4277  C  C     . GLN D  1 172 ? 47.401  -83.935  -13.897 1.00 25.10 ? 170 GLN B C     1 
ATOM   4278  O  O     . GLN D  1 172 ? 48.494  -84.480  -13.852 1.00 25.93 ? 170 GLN B O     1 
ATOM   4279  C  CB    . GLN D  1 172 ? 46.132  -83.681  -11.736 1.00 26.45 ? 170 GLN B CB    1 
ATOM   4280  C  CG    . GLN D  1 172 ? 46.084  -82.911  -10.413 1.00 29.44 ? 170 GLN B CG    1 
ATOM   4281  C  CD    . GLN D  1 172 ? 45.141  -83.576  -9.409  1.00 31.92 ? 170 GLN B CD    1 
ATOM   4282  O  OE1   . GLN D  1 172 ? 44.701  -84.714  -9.619  1.00 30.89 ? 170 GLN B OE1   1 
ATOM   4283  N  NE2   . GLN D  1 172 ? 44.820  -82.865  -8.328  1.00 23.83 ? 170 GLN B NE2   1 
ATOM   4284  N  N     . SER D  1 173 ? 46.557  -84.138  -14.901 1.00 29.46 ? 171 SER B N     1 
ATOM   4285  C  CA    . SER D  1 173 ? 46.912  -85.030  -16.002 1.00 29.05 ? 171 SER B CA    1 
ATOM   4286  C  C     . SER D  1 173 ? 47.801  -84.317  -17.020 1.00 27.98 ? 171 SER B C     1 
ATOM   4287  O  O     . SER D  1 173 ? 48.658  -84.948  -17.658 1.00 25.52 ? 171 SER B O     1 
ATOM   4288  C  CB    . SER D  1 173 ? 45.659  -85.550  -16.704 1.00 25.19 ? 171 SER B CB    1 
ATOM   4289  O  OG    . SER D  1 173 ? 44.950  -84.485  -17.314 1.00 36.02 ? 171 SER B OG    1 
ATOM   4290  N  N     . SER D  1 174 ? 47.565  -83.010  -17.204 1.00 25.45 ? 172 SER B N     1 
ATOM   4291  C  CA    . SER D  1 174 ? 48.454  -82.151  -18.011 1.00 21.85 ? 172 SER B CA    1 
ATOM   4292  C  C     . SER D  1 174 ? 48.259  -80.686  -17.648 1.00 19.94 ? 172 SER B C     1 
ATOM   4293  O  O     . SER D  1 174 ? 47.284  -80.329  -16.970 1.00 23.73 ? 172 SER B O     1 
ATOM   4294  C  CB    . SER D  1 174 ? 48.256  -82.374  -19.512 1.00 28.21 ? 172 SER B CB    1 
ATOM   4295  O  OG    . SER D  1 174 ? 46.995  -81.898  -19.942 1.00 25.65 ? 172 SER B OG    1 
ATOM   4296  N  N     . GLN D  1 175 ? 49.212  -79.847  -18.053 1.00 22.71 ? 173 GLN B N     1 
ATOM   4297  C  CA    . GLN D  1 175 ? 49.210  -78.418  -17.722 1.00 28.61 ? 173 GLN B CA    1 
ATOM   4298  C  C     . GLN D  1 175 ? 48.078  -77.759  -18.530 1.00 24.50 ? 173 GLN B C     1 
ATOM   4299  O  O     . GLN D  1 175 ? 47.817  -78.124  -19.684 1.00 28.66 ? 173 GLN B O     1 
ATOM   4300  C  CB    . GLN D  1 175 ? 50.582  -77.758  -18.050 1.00 37.82 ? 173 GLN B CB    1 
ATOM   4301  C  CG    . GLN D  1 175 ? 50.860  -76.323  -17.398 1.00 27.49 ? 173 GLN B CG    1 
ATOM   4302  C  CD    . GLN D  1 175 ? 52.124  -75.610  -17.954 1.00 32.52 ? 173 GLN B CD    1 
ATOM   4303  O  OE1   . GLN D  1 175 ? 52.808  -76.152  -18.812 1.00 31.70 ? 173 GLN B OE1   1 
ATOM   4304  N  NE2   . GLN D  1 175 ? 52.419  -74.375  -17.467 1.00 31.64 ? 173 GLN B NE2   1 
ATOM   4305  N  N     . ILE D  1 176 ? 47.366  -76.840  -17.907 1.00 20.48 ? 174 ILE B N     1 
ATOM   4306  C  CA    . ILE D  1 176 ? 46.413  -75.994  -18.644 1.00 18.96 ? 174 ILE B CA    1 
ATOM   4307  C  C     . ILE D  1 176 ? 47.233  -75.053  -19.524 1.00 25.28 ? 174 ILE B C     1 
ATOM   4308  O  O     . ILE D  1 176 ? 48.186  -74.437  -19.038 1.00 17.20 ? 174 ILE B O     1 
ATOM   4309  C  CB    . ILE D  1 176 ? 45.537  -75.224  -17.661 1.00 16.13 ? 174 ILE B CB    1 
ATOM   4310  C  CG1   . ILE D  1 176 ? 44.713  -76.215  -16.842 1.00 17.11 ? 174 ILE B CG1   1 
ATOM   4311  C  CG2   . ILE D  1 176 ? 44.568  -74.252  -18.381 1.00 16.62 ? 174 ILE B CG2   1 
ATOM   4312  C  CD1   . ILE D  1 176 ? 43.854  -77.101  -17.715 1.00 15.31 ? 174 ILE B CD1   1 
ATOM   4313  N  N     . ASP D  1 177 ? 46.903  -74.970  -20.812 1.00 23.88 ? 175 ASP B N     1 
ATOM   4314  C  CA    . ASP D  1 177 ? 47.584  -74.002  -21.694 1.00 20.39 ? 175 ASP B CA    1 
ATOM   4315  C  C     . ASP D  1 177 ? 47.180  -72.560  -21.420 1.00 19.29 ? 175 ASP B C     1 
ATOM   4316  O  O     . ASP D  1 177 ? 48.040  -71.666  -21.264 1.00 17.39 ? 175 ASP B O     1 
ATOM   4317  C  CB    . ASP D  1 177 ? 47.322  -74.296  -23.170 1.00 17.47 ? 175 ASP B CB    1 
ATOM   4318  C  CG    . ASP D  1 177 ? 47.756  -75.690  -23.561 1.00 26.29 ? 175 ASP B CG    1 
ATOM   4319  O  OD1   . ASP D  1 177 ? 48.984  -75.861  -23.707 1.00 23.32 ? 175 ASP B OD1   1 
ATOM   4320  O  OD2   . ASP D  1 177 ? 46.888  -76.599  -23.690 1.00 19.20 ? 175 ASP B OD2   1 
ATOM   4321  N  N     . ILE D  1 178 ? 45.879  -72.322  -21.400 1.00 15.99 ? 176 ILE B N     1 
ATOM   4322  C  CA    . ILE D  1 178 ? 45.348  -70.980  -21.196 1.00 16.83 ? 176 ILE B CA    1 
ATOM   4323  C  C     . ILE D  1 178 ? 44.229  -70.950  -20.171 1.00 15.11 ? 176 ILE B C     1 
ATOM   4324  O  O     . ILE D  1 178 ? 43.322  -71.799  -20.181 1.00 14.30 ? 176 ILE B O     1 
ATOM   4325  C  CB    . ILE D  1 178 ? 44.745  -70.382  -22.500 1.00 15.15 ? 176 ILE B CB    1 
ATOM   4326  C  CG1   . ILE D  1 178 ? 45.759  -70.344  -23.638 1.00 14.06 ? 176 ILE B CG1   1 
ATOM   4327  C  CG2   . ILE D  1 178 ? 44.225  -68.968  -22.247 1.00 11.30 ? 176 ILE B CG2   1 
ATOM   4328  C  CD1   . ILE D  1 178 ? 45.127  -70.256  -25.042 1.00 12.52 ? 176 ILE B CD1   1 
ATOM   4329  N  N     . SER D  1 179 ? 44.278  -69.961  -19.283 1.00 15.91 ? 177 SER B N     1 
ATOM   4330  C  CA    . SER D  1 179 ? 43.160  -69.744  -18.366 1.00 16.40 ? 177 SER B CA    1 
ATOM   4331  C  C     . SER D  1 179 ? 42.596  -68.323  -18.515 1.00 15.47 ? 177 SER B C     1 
ATOM   4332  O  O     . SER D  1 179 ? 43.344  -67.370  -18.721 1.00 15.64 ? 177 SER B O     1 
ATOM   4333  C  CB    . SER D  1 179 ? 43.564  -70.054  -16.912 1.00 18.97 ? 177 SER B CB    1 
ATOM   4334  O  OG    . SER D  1 179 ? 42.479  -69.741  -16.064 1.00 23.33 ? 177 SER B OG    1 
ATOM   4335  N  N     . LEU D  1 180 ? 41.276  -68.200  -18.435 1.00 18.94 ? 178 LEU B N     1 
ATOM   4336  C  CA    . LEU D  1 180 ? 40.571  -66.948  -18.742 1.00 14.76 ? 178 LEU B CA    1 
ATOM   4337  C  C     . LEU D  1 180 ? 39.829  -66.446  -17.524 1.00 16.74 ? 178 LEU B C     1 
ATOM   4338  O  O     . LEU D  1 180 ? 39.145  -67.233  -16.901 1.00 15.80 ? 178 LEU B O     1 
ATOM   4339  C  CB    . LEU D  1 180 ? 39.512  -67.213  -19.805 1.00 12.29 ? 178 LEU B CB    1 
ATOM   4340  C  CG    . LEU D  1 180 ? 39.726  -67.146  -21.309 1.00 20.24 ? 178 LEU B CG    1 
ATOM   4341  C  CD1   . LEU D  1 180 ? 41.142  -66.718  -21.742 1.00 19.31 ? 178 LEU B CD1   1 
ATOM   4342  C  CD2   . LEU D  1 180 ? 39.329  -68.393  -22.003 1.00 16.81 ? 178 LEU B CD2   1 
ATOM   4343  N  N     . SER D  1 181 ? 39.915  -65.142  -17.213 1.00 12.81 ? 179 SER B N     1 
ATOM   4344  C  CA    . SER D  1 181 ? 39.066  -64.530  -16.189 1.00 13.11 ? 179 SER B CA    1 
ATOM   4345  C  C     . SER D  1 181 ? 38.801  -63.063  -16.542 1.00 15.98 ? 179 SER B C     1 
ATOM   4346  O  O     . SER D  1 181 ? 39.499  -62.484  -17.399 1.00 17.56 ? 179 SER B O     1 
ATOM   4347  C  CB    . SER D  1 181 ? 39.753  -64.564  -14.829 1.00 14.16 ? 179 SER B CB    1 
ATOM   4348  O  OG    . SER D  1 181 ? 40.714  -63.513  -14.770 1.00 17.27 ? 179 SER B OG    1 
ATOM   4349  N  N     . HIS D  1 182 ? 37.803  -62.460  -15.900 1.00 13.15 ? 180 HIS B N     1 
ATOM   4350  C  CA    . HIS D  1 182 ? 37.470  -61.075  -16.209 1.00 12.98 ? 180 HIS B CA    1 
ATOM   4351  C  C     . HIS D  1 182 ? 38.379  -60.149  -15.388 1.00 18.29 ? 180 HIS B C     1 
ATOM   4352  O  O     . HIS D  1 182 ? 39.267  -59.512  -15.954 1.00 18.03 ? 180 HIS B O     1 
ATOM   4353  C  CB    . HIS D  1 182 ? 35.991  -60.738  -15.955 1.00 16.33 ? 180 HIS B CB    1 
ATOM   4354  C  CG    . HIS D  1 182 ? 35.601  -59.432  -16.523 1.00 15.40 ? 180 HIS B CG    1 
ATOM   4355  N  ND1   . HIS D  1 182 ? 35.779  -59.094  -17.858 1.00 19.42 ? 180 HIS B ND1   1 
ATOM   4356  C  CD2   . HIS D  1 182 ? 35.091  -58.297  -15.938 1.00 12.21 ? 180 HIS B CD2   1 
ATOM   4357  C  CE1   . HIS D  1 182 ? 35.385  -57.868  -18.066 1.00 18.10 ? 180 HIS B CE1   1 
ATOM   4358  N  NE2   . HIS D  1 182 ? 34.953  -57.367  -16.910 1.00 14.46 ? 180 HIS B NE2   1 
ATOM   4359  N  N     . ASP D  1 183 ? 38.185  -60.109  -14.066 1.00 16.38 ? 181 ASP B N     1 
ATOM   4360  C  CA    . ASP D  1 183 ? 39.105  -59.323  -13.214 1.00 16.77 ? 181 ASP B CA    1 
ATOM   4361  C  C     . ASP D  1 183 ? 40.422  -60.067  -13.004 1.00 21.00 ? 181 ASP B C     1 
ATOM   4362  O  O     . ASP D  1 183 ? 40.470  -61.299  -13.143 1.00 16.50 ? 181 ASP B O     1 
ATOM   4363  C  CB    . ASP D  1 183 ? 38.466  -58.866  -11.892 1.00 15.53 ? 181 ASP B CB    1 
ATOM   4364  C  CG    . ASP D  1 183 ? 37.860  -60.010  -11.091 1.00 18.88 ? 181 ASP B CG    1 
ATOM   4365  O  OD1   . ASP D  1 183 ? 37.779  -61.172  -11.596 1.00 15.40 ? 181 ASP B OD1   1 
ATOM   4366  O  OD2   . ASP D  1 183 ? 37.432  -59.725  -9.954  1.00 18.21 ? 181 ASP B OD2   1 
ATOM   4367  N  N     . TRP D  1 184 ? 41.503  -59.321  -12.724 1.00 18.81 ? 182 TRP B N     1 
ATOM   4368  C  CA    . TRP D  1 184 ? 42.838  -59.908  -12.660 1.00 17.08 ? 182 TRP B CA    1 
ATOM   4369  C  C     . TRP D  1 184 ? 42.950  -60.729  -11.408 1.00 16.43 ? 182 TRP B C     1 
ATOM   4370  O  O     . TRP D  1 184 ? 42.284  -60.434  -10.426 1.00 18.94 ? 182 TRP B O     1 
ATOM   4371  C  CB    . TRP D  1 184 ? 43.907  -58.813  -12.527 1.00 14.86 ? 182 TRP B CB    1 
ATOM   4372  C  CG    . TRP D  1 184 ? 44.040  -57.901  -13.729 1.00 16.01 ? 182 TRP B CG    1 
ATOM   4373  C  CD1   . TRP D  1 184 ? 43.254  -57.876  -14.845 1.00 19.46 ? 182 TRP B CD1   1 
ATOM   4374  C  CD2   . TRP D  1 184 ? 45.057  -56.903  -13.925 1.00 14.97 ? 182 TRP B CD2   1 
ATOM   4375  N  NE1   . TRP D  1 184 ? 43.707  -56.901  -15.718 1.00 21.06 ? 182 TRP B NE1   1 
ATOM   4376  C  CE2   . TRP D  1 184 ? 44.813  -56.288  -15.176 1.00 20.67 ? 182 TRP B CE2   1 
ATOM   4377  C  CE3   . TRP D  1 184 ? 46.136  -56.463  -13.157 1.00 19.98 ? 182 TRP B CE3   1 
ATOM   4378  C  CZ2   . TRP D  1 184 ? 45.623  -55.238  -15.686 1.00 19.75 ? 182 TRP B CZ2   1 
ATOM   4379  C  CZ3   . TRP D  1 184 ? 46.957  -55.421  -13.666 1.00 21.03 ? 182 TRP B CZ3   1 
ATOM   4380  C  CH2   . TRP D  1 184 ? 46.690  -54.828  -14.916 1.00 23.81 ? 182 TRP B CH2   1 
ATOM   4381  N  N     . PRO D  1 185 ? 43.817  -61.753  -11.437 1.00 14.51 ? 183 PRO B N     1 
ATOM   4382  C  CA    . PRO D  1 185 ? 44.176  -62.510  -10.235 1.00 17.78 ? 183 PRO B CA    1 
ATOM   4383  C  C     . PRO D  1 185 ? 44.834  -61.539  -9.260  1.00 24.27 ? 183 PRO B C     1 
ATOM   4384  O  O     . PRO D  1 185 ? 45.897  -60.943  -9.573  1.00 18.95 ? 183 PRO B O     1 
ATOM   4385  C  CB    . PRO D  1 185 ? 45.208  -63.543  -10.737 1.00 15.42 ? 183 PRO B CB    1 
ATOM   4386  C  CG    . PRO D  1 185 ? 44.939  -63.678  -12.238 1.00 19.11 ? 183 PRO B CG    1 
ATOM   4387  C  CD    . PRO D  1 185 ? 44.492  -62.249  -12.645 1.00 13.00 ? 183 PRO B CD    1 
ATOM   4388  N  N     . GLN D  1 186 ? 44.201  -61.371  -8.103  1.00 18.64 ? 184 GLN B N     1 
ATOM   4389  C  CA    . GLN D  1 186 ? 44.744  -60.490  -7.064  1.00 20.90 ? 184 GLN B CA    1 
ATOM   4390  C  C     . GLN D  1 186 ? 46.271  -60.631  -6.941  1.00 19.67 ? 184 GLN B C     1 
ATOM   4391  O  O     . GLN D  1 186 ? 46.774  -61.748  -6.907  1.00 17.50 ? 184 GLN B O     1 
ATOM   4392  C  CB    . GLN D  1 186 ? 44.103  -60.784  -5.703  1.00 18.66 ? 184 GLN B CB    1 
ATOM   4393  C  CG    . GLN D  1 186 ? 44.458  -59.690  -4.667  1.00 24.49 ? 184 GLN B CG    1 
ATOM   4394  C  CD    . GLN D  1 186 ? 43.640  -59.791  -3.395  1.00 30.37 ? 184 GLN B CD    1 
ATOM   4395  O  OE1   . GLN D  1 186 ? 43.756  -60.768  -2.657  1.00 24.42 ? 184 GLN B OE1   1 
ATOM   4396  N  NE2   . GLN D  1 186 ? 42.807  -58.770  -3.130  1.00 26.69 ? 184 GLN B NE2   1 
ATOM   4397  N  N     . GLY D  1 187 ? 46.986  -59.499  -6.862  1.00 22.78 ? 185 GLY B N     1 
ATOM   4398  C  CA    . GLY D  1 187 ? 48.435  -59.508  -6.663  1.00 25.39 ? 185 GLY B CA    1 
ATOM   4399  C  C     . GLY D  1 187 ? 49.257  -59.490  -7.952  1.00 24.61 ? 185 GLY B C     1 
ATOM   4400  O  O     . GLY D  1 187 ? 50.376  -58.972  -7.970  1.00 25.50 ? 185 GLY B O     1 
ATOM   4401  N  N     . ILE D  1 188 ? 48.710  -60.038  -9.036  1.00 19.39 ? 186 ILE B N     1 
ATOM   4402  C  CA    . ILE D  1 188 ? 49.479  -60.210  -10.278 1.00 19.95 ? 186 ILE B CA    1 
ATOM   4403  C  C     . ILE D  1 188 ? 50.093  -58.886  -10.797 1.00 17.92 ? 186 ILE B C     1 
ATOM   4404  O  O     . ILE D  1 188 ? 51.158  -58.897  -11.453 1.00 20.98 ? 186 ILE B O     1 
ATOM   4405  C  CB    . ILE D  1 188 ? 48.649  -60.929  -11.388 1.00 18.03 ? 186 ILE B CB    1 
ATOM   4406  C  CG1   . ILE D  1 188 ? 49.493  -61.905  -12.244 1.00 23.79 ? 186 ILE B CG1   1 
ATOM   4407  C  CG2   . ILE D  1 188 ? 48.082  -59.921  -12.340 1.00 19.85 ? 186 ILE B CG2   1 
ATOM   4408  C  CD1   . ILE D  1 188 ? 50.676  -62.606  -11.555 1.00 24.42 ? 186 ILE B CD1   1 
ATOM   4409  N  N     . VAL D  1 189 ? 49.462  -57.764  -10.455 1.00 17.86 ? 187 VAL B N     1 
ATOM   4410  C  CA    . VAL D  1 189 ? 49.981  -56.440  -10.843 1.00 22.27 ? 187 VAL B CA    1 
ATOM   4411  C  C     . VAL D  1 189 ? 51.449  -56.241  -10.430 1.00 26.01 ? 187 VAL B C     1 
ATOM   4412  O  O     . VAL D  1 189 ? 52.248  -55.589  -11.134 1.00 24.49 ? 187 VAL B O     1 
ATOM   4413  C  CB    . VAL D  1 189 ? 49.081  -55.296  -10.282 1.00 26.87 ? 187 VAL B CB    1 
ATOM   4414  C  CG1   . VAL D  1 189 ? 48.951  -55.396  -8.771  1.00 26.73 ? 187 VAL B CG1   1 
ATOM   4415  C  CG2   . VAL D  1 189 ? 49.599  -53.908  -10.697 1.00 25.38 ? 187 VAL B CG2   1 
ATOM   4416  N  N     . MET D  1 190 ? 51.808  -56.816  -9.286  1.00 27.92 ? 188 MET B N     1 
ATOM   4417  C  CA    . MET D  1 190 ? 53.176  -56.708  -8.771  1.00 26.12 ? 188 MET B CA    1 
ATOM   4418  C  C     . MET D  1 190 ? 54.207  -57.538  -9.532  1.00 29.04 ? 188 MET B C     1 
ATOM   4419  O  O     . MET D  1 190 ? 55.419  -57.380  -9.317  1.00 27.88 ? 188 MET B O     1 
ATOM   4420  C  CB    . MET D  1 190 ? 53.240  -57.136  -7.300  1.00 24.77 ? 188 MET B CB    1 
ATOM   4421  C  CG    . MET D  1 190 ? 52.364  -56.304  -6.353  1.00 28.53 ? 188 MET B CG    1 
ATOM   4422  S  SD    . MET D  1 190 ? 52.346  -54.540  -6.737  1.00 35.60 ? 188 MET B SD    1 
ATOM   4423  C  CE    . MET D  1 190 ? 53.943  -54.080  -6.046  1.00 34.43 ? 188 MET B CE    1 
ATOM   4424  N  N     . LYS D  1 191 ? 53.745  -58.450  -10.383 1.00 22.74 ? 189 LYS B N     1 
ATOM   4425  C  CA    . LYS D  1 191 ? 54.655  -59.399  -11.022 1.00 21.34 ? 189 LYS B CA    1 
ATOM   4426  C  C     . LYS D  1 191 ? 55.029  -58.943  -12.416 1.00 25.08 ? 189 LYS B C     1 
ATOM   4427  O  O     . LYS D  1 191 ? 55.556  -59.728  -13.214 1.00 27.12 ? 189 LYS B O     1 
ATOM   4428  C  CB    . LYS D  1 191 ? 54.025  -60.795  -11.103 1.00 30.66 ? 189 LYS B CB    1 
ATOM   4429  C  CG    . LYS D  1 191 ? 53.732  -61.398  -9.743  1.00 29.52 ? 189 LYS B CG    1 
ATOM   4430  C  CD    . LYS D  1 191 ? 55.024  -61.483  -8.895  1.00 40.25 ? 189 LYS B CD    1 
ATOM   4431  C  CE    . LYS D  1 191 ? 56.064  -62.400  -9.532  1.00 30.21 ? 189 LYS B CE    1 
ATOM   4432  N  NZ    . LYS D  1 191 ? 56.852  -63.224  -8.536  1.00 48.67 ? 189 LYS B NZ    1 
ATOM   4433  N  N     . GLY D  1 192 ? 54.758  -57.674  -12.713 1.00 19.01 ? 190 GLY B N     1 
ATOM   4434  C  CA    . GLY D  1 192 ? 55.119  -57.096  -13.995 1.00 21.92 ? 190 GLY B CA    1 
ATOM   4435  C  C     . GLY D  1 192 ? 55.720  -55.722  -13.734 1.00 23.13 ? 190 GLY B C     1 
ATOM   4436  O  O     . GLY D  1 192 ? 56.041  -55.382  -12.575 1.00 19.64 ? 190 GLY B O     1 
ATOM   4437  N  N     . ASN D  1 193 ? 55.857  -54.930  -14.790 1.00 20.97 ? 191 ASN B N     1 
ATOM   4438  C  CA    . ASN D  1 193 ? 56.430  -53.582  -14.657 1.00 19.64 ? 191 ASN B CA    1 
ATOM   4439  C  C     . ASN D  1 193 ? 55.390  -52.596  -14.136 1.00 22.04 ? 191 ASN B C     1 
ATOM   4440  O  O     . ASN D  1 193 ? 54.912  -51.704  -14.869 1.00 22.85 ? 191 ASN B O     1 
ATOM   4441  C  CB    . ASN D  1 193 ? 56.964  -53.161  -16.023 1.00 19.78 ? 191 ASN B CB    1 
ATOM   4442  C  CG    . ASN D  1 193 ? 57.692  -51.844  -16.001 1.00 20.64 ? 191 ASN B CG    1 
ATOM   4443  O  OD1   . ASN D  1 193 ? 57.911  -51.231  -14.943 1.00 19.17 ? 191 ASN B OD1   1 
ATOM   4444  N  ND2   . ASN D  1 193 ? 58.102  -51.404  -17.191 1.00 22.55 ? 191 ASN B ND2   1 
ATOM   4445  N  N     . TYR D  1 194 ? 55.047  -52.741  -12.859 1.00 24.08 ? 192 TYR B N     1 
ATOM   4446  C  CA    . TYR D  1 194 ? 53.943  -51.990  -12.283 1.00 22.68 ? 192 TYR B CA    1 
ATOM   4447  C  C     . TYR D  1 194 ? 54.219  -50.481  -12.217 1.00 21.49 ? 192 TYR B C     1 
ATOM   4448  O  O     . TYR D  1 194 ? 53.305  -49.659  -12.402 1.00 20.37 ? 192 TYR B O     1 
ATOM   4449  C  CB    . TYR D  1 194 ? 53.547  -52.543  -10.909 1.00 22.40 ? 192 TYR B CB    1 
ATOM   4450  C  CG    . TYR D  1 194 ? 54.668  -52.590  -9.890  1.00 28.34 ? 192 TYR B CG    1 
ATOM   4451  C  CD1   . TYR D  1 194 ? 55.542  -53.671  -9.857  1.00 28.48 ? 192 TYR B CD1   1 
ATOM   4452  C  CD2   . TYR D  1 194 ? 54.842  -51.569  -8.948  1.00 29.64 ? 192 TYR B CD2   1 
ATOM   4453  C  CE1   . TYR D  1 194 ? 56.568  -53.744  -8.929  1.00 32.89 ? 192 TYR B CE1   1 
ATOM   4454  C  CE2   . TYR D  1 194 ? 55.880  -51.640  -8.004  1.00 33.81 ? 192 TYR B CE2   1 
ATOM   4455  C  CZ    . TYR D  1 194 ? 56.734  -52.729  -8.013  1.00 29.32 ? 192 TYR B CZ    1 
ATOM   4456  O  OH    . TYR D  1 194 ? 57.761  -52.821  -7.104  1.00 43.15 ? 192 TYR B OH    1 
ATOM   4457  N  N     . LYS D  1 195 ? 55.470  -50.116  -11.954 1.00 26.77 ? 193 LYS B N     1 
ATOM   4458  C  CA    . LYS D  1 195 ? 55.870  -48.694  -11.944 1.00 26.24 ? 193 LYS B CA    1 
ATOM   4459  C  C     . LYS D  1 195 ? 55.450  -47.964  -13.223 1.00 19.06 ? 193 LYS B C     1 
ATOM   4460  O  O     . LYS D  1 195 ? 54.899  -46.860  -13.201 1.00 23.82 ? 193 LYS B O     1 
ATOM   4461  C  CB    . LYS D  1 195 ? 57.399  -48.593  -11.845 1.00 27.57 ? 193 LYS B CB    1 
ATOM   4462  C  CG    . LYS D  1 195 ? 58.027  -49.358  -10.690 1.00 36.72 ? 193 LYS B CG    1 
ATOM   4463  C  CD    . LYS D  1 195 ? 57.692  -48.731  -9.361  1.00 41.91 ? 193 LYS B CD    1 
ATOM   4464  C  CE    . LYS D  1 195 ? 58.745  -49.134  -8.343  1.00 44.77 ? 193 LYS B CE    1 
ATOM   4465  N  NZ    . LYS D  1 195 ? 60.097  -49.019  -8.951  1.00 50.78 ? 193 LYS B NZ    1 
ATOM   4466  N  N     . GLN D  1 196 ? 55.761  -48.598  -14.346 1.00 18.90 ? 194 GLN B N     1 
ATOM   4467  C  CA    . GLN D  1 196 ? 55.462  -48.066  -15.659 1.00 16.55 ? 194 GLN B CA    1 
ATOM   4468  C  C     . GLN D  1 196 ? 53.952  -48.203  -15.920 1.00 22.74 ? 194 GLN B C     1 
ATOM   4469  O  O     . GLN D  1 196 ? 53.334  -47.355  -16.578 1.00 22.13 ? 194 GLN B O     1 
ATOM   4470  C  CB    . GLN D  1 196 ? 56.277  -48.825  -16.713 1.00 19.41 ? 194 GLN B CB    1 
ATOM   4471  C  CG    . GLN D  1 196 ? 56.267  -48.195  -18.085 1.00 18.96 ? 194 GLN B CG    1 
ATOM   4472  C  CD    . GLN D  1 196 ? 57.020  -46.881  -18.100 1.00 21.26 ? 194 GLN B CD    1 
ATOM   4473  O  OE1   . GLN D  1 196 ? 57.637  -46.507  -17.103 1.00 19.69 ? 194 GLN B OE1   1 
ATOM   4474  N  NE2   . GLN D  1 196 ? 56.951  -46.162  -19.229 1.00 24.53 ? 194 GLN B NE2   1 
ATOM   4475  N  N     . LEU D  1 197 ? 53.357  -49.280  -15.412 1.00 22.78 ? 195 LEU B N     1 
ATOM   4476  C  CA    . LEU D  1 197 ? 51.913  -49.421  -15.494 1.00 21.88 ? 195 LEU B CA    1 
ATOM   4477  C  C     . LEU D  1 197 ? 51.274  -48.172  -14.882 1.00 23.17 ? 195 LEU B C     1 
ATOM   4478  O  O     . LEU D  1 197 ? 50.438  -47.535  -15.507 1.00 23.92 ? 195 LEU B O     1 
ATOM   4479  C  CB    . LEU D  1 197 ? 51.436  -50.702  -14.783 1.00 22.80 ? 195 LEU B CB    1 
ATOM   4480  C  CG    . LEU D  1 197 ? 49.910  -50.815  -14.740 1.00 25.65 ? 195 LEU B CG    1 
ATOM   4481  C  CD1   . LEU D  1 197 ? 49.294  -50.915  -16.137 1.00 24.16 ? 195 LEU B CD1   1 
ATOM   4482  C  CD2   . LEU D  1 197 ? 49.483  -51.971  -13.850 1.00 23.87 ? 195 LEU B CD2   1 
ATOM   4483  N  N     . TYR D  1 198 ? 51.723  -47.795  -13.683 1.00 22.25 ? 196 TYR B N     1 
ATOM   4484  C  CA    . TYR D  1 198 ? 51.143  -46.641  -12.985 1.00 24.30 ? 196 TYR B CA    1 
ATOM   4485  C  C     . TYR D  1 198 ? 51.436  -45.291  -13.674 1.00 26.95 ? 196 TYR B C     1 
ATOM   4486  O  O     . TYR D  1 198 ? 50.677  -44.311  -13.502 1.00 28.74 ? 196 TYR B O     1 
ATOM   4487  C  CB    . TYR D  1 198 ? 51.600  -46.585  -11.522 1.00 24.25 ? 196 TYR B CB    1 
ATOM   4488  C  CG    . TYR D  1 198 ? 51.262  -47.785  -10.652 1.00 27.92 ? 196 TYR B CG    1 
ATOM   4489  C  CD1   . TYR D  1 198 ? 50.091  -48.509  -10.834 1.00 32.11 ? 196 TYR B CD1   1 
ATOM   4490  C  CD2   . TYR D  1 198 ? 52.126  -48.188  -9.640  1.00 25.40 ? 196 TYR B CD2   1 
ATOM   4491  C  CE1   . TYR D  1 198 ? 49.777  -49.614  -10.004 1.00 29.92 ? 196 TYR B CE1   1 
ATOM   4492  C  CE2   . TYR D  1 198 ? 51.842  -49.281  -8.830  1.00 30.75 ? 196 TYR B CE2   1 
ATOM   4493  C  CZ    . TYR D  1 198 ? 50.656  -49.991  -9.010  1.00 30.23 ? 196 TYR B CZ    1 
ATOM   4494  O  OH    . TYR D  1 198 ? 50.365  -51.080  -8.198  1.00 30.16 ? 196 TYR B OH    1 
ATOM   4495  N  N     . ARG D  1 199 ? 52.526  -45.231  -14.442 1.00 22.67 ? 197 ARG B N     1 
ATOM   4496  C  CA    . ARG D  1 199 ? 52.833  -44.028  -15.211 1.00 26.10 ? 197 ARG B CA    1 
ATOM   4497  C  C     . ARG D  1 199 ? 51.827  -43.850  -16.328 1.00 32.30 ? 197 ARG B C     1 
ATOM   4498  O  O     . ARG D  1 199 ? 51.579  -42.739  -16.794 1.00 33.57 ? 197 ARG B O     1 
ATOM   4499  C  CB    . ARG D  1 199 ? 54.287  -44.042  -15.732 1.00 27.91 ? 197 ARG B CB    1 
ATOM   4500  C  CG    . ARG D  1 199 ? 55.264  -43.665  -14.621 1.00 24.23 ? 197 ARG B CG    1 
ATOM   4501  C  CD    . ARG D  1 199 ? 56.724  -44.096  -14.877 1.00 32.17 ? 197 ARG B CD    1 
ATOM   4502  N  NE    . ARG D  1 199 ? 57.480  -43.707  -13.697 1.00 30.01 ? 197 ARG B NE    1 
ATOM   4503  C  CZ    . ARG D  1 199 ? 57.677  -42.430  -13.385 1.00 39.71 ? 197 ARG B CZ    1 
ATOM   4504  N  NH1   . ARG D  1 199 ? 57.207  -41.497  -14.215 1.00 35.21 ? 197 ARG B NH1   1 
ATOM   4505  N  NH2   . ARG D  1 199 ? 58.339  -42.077  -12.278 1.00 35.39 ? 197 ARG B NH2   1 
ATOM   4506  N  N     . PHE D  1 200 ? 51.216  -44.954  -16.739 1.00 30.38 ? 198 PHE B N     1 
ATOM   4507  C  CA    . PHE D  1 200 ? 50.187  -44.898  -17.767 1.00 31.50 ? 198 PHE B CA    1 
ATOM   4508  C  C     . PHE D  1 200 ? 48.774  -44.883  -17.203 1.00 32.27 ? 198 PHE B C     1 
ATOM   4509  O  O     . PHE D  1 200 ? 47.888  -44.288  -17.794 1.00 32.89 ? 198 PHE B O     1 
ATOM   4510  C  CB    . PHE D  1 200 ? 50.345  -46.060  -18.757 1.00 27.84 ? 198 PHE B CB    1 
ATOM   4511  C  CG    . PHE D  1 200 ? 51.308  -45.766  -19.844 1.00 33.86 ? 198 PHE B CG    1 
ATOM   4512  C  CD1   . PHE D  1 200 ? 52.677  -45.762  -19.596 1.00 27.60 ? 198 PHE B CD1   1 
ATOM   4513  C  CD2   . PHE D  1 200 ? 50.850  -45.411  -21.105 1.00 34.48 ? 198 PHE B CD2   1 
ATOM   4514  C  CE1   . PHE D  1 200 ? 53.582  -45.444  -20.607 1.00 28.31 ? 198 PHE B CE1   1 
ATOM   4515  C  CE2   . PHE D  1 200 ? 51.737  -45.097  -22.120 1.00 33.44 ? 198 PHE B CE2   1 
ATOM   4516  C  CZ    . PHE D  1 200 ? 53.110  -45.115  -21.873 1.00 29.57 ? 198 PHE B CZ    1 
ATOM   4517  N  N     . GLN D  1 201 ? 48.581  -45.533  -16.060 1.00 27.77 ? 199 GLN B N     1 
ATOM   4518  C  CA    . GLN D  1 201 ? 47.255  -45.696  -15.449 1.00 32.93 ? 199 GLN B CA    1 
ATOM   4519  C  C     . GLN D  1 201 ? 47.378  -45.379  -13.967 1.00 27.28 ? 199 GLN B C     1 
ATOM   4520  O  O     . GLN D  1 201 ? 47.359  -46.282  -13.122 1.00 28.01 ? 199 GLN B O     1 
ATOM   4521  C  CB    . GLN D  1 201 ? 46.756  -47.142  -15.618 1.00 25.54 ? 199 GLN B CB    1 
ATOM   4522  C  CG    . GLN D  1 201 ? 46.975  -47.744  -17.033 1.00 25.29 ? 199 GLN B CG    1 
ATOM   4523  C  CD    . GLN D  1 201 ? 46.079  -47.127  -18.085 1.00 37.26 ? 199 GLN B CD    1 
ATOM   4524  O  OE1   . GLN D  1 201 ? 45.012  -46.579  -17.763 1.00 33.76 ? 199 GLN B OE1   1 
ATOM   4525  N  NE2   . GLN D  1 201 ? 46.504  -47.207  -19.358 1.00 36.83 ? 199 GLN B NE2   1 
ATOM   4526  N  N     . PRO D  1 202 ? 47.525  -44.089  -13.646 1.00 27.31 ? 200 PRO B N     1 
ATOM   4527  C  CA    . PRO D  1 202 ? 47.784  -43.688  -12.260 1.00 32.01 ? 200 PRO B CA    1 
ATOM   4528  C  C     . PRO D  1 202 ? 46.702  -44.173  -11.308 1.00 31.76 ? 200 PRO B C     1 
ATOM   4529  O  O     . PRO D  1 202 ? 47.031  -44.400  -10.137 1.00 31.07 ? 200 PRO B O     1 
ATOM   4530  C  CB    . PRO D  1 202 ? 47.835  -42.151  -12.320 1.00 29.07 ? 200 PRO B CB    1 
ATOM   4531  C  CG    . PRO D  1 202 ? 47.372  -41.775  -13.701 1.00 27.29 ? 200 PRO B CG    1 
ATOM   4532  C  CD    . PRO D  1 202 ? 47.589  -42.955  -14.585 1.00 28.96 ? 200 PRO B CD    1 
ATOM   4533  N  N     . GLY D  1 203 ? 45.464  -44.356  -11.795 1.00 36.17 ? 201 GLY B N     1 
ATOM   4534  C  CA    . GLY D  1 203 ? 44.372  -44.878  -10.971 1.00 31.67 ? 201 GLY B CA    1 
ATOM   4535  C  C     . GLY D  1 203 ? 44.604  -46.266  -10.369 1.00 38.25 ? 201 GLY B C     1 
ATOM   4536  O  O     . GLY D  1 203 ? 44.149  -46.570  -9.252  1.00 37.51 ? 201 GLY B O     1 
ATOM   4537  N  N     . PHE D  1 204 ? 45.311  -47.119  -11.106 1.00 36.74 ? 202 PHE B N     1 
ATOM   4538  C  CA    . PHE D  1 204 ? 45.579  -48.475  -10.643 1.00 35.71 ? 202 PHE B CA    1 
ATOM   4539  C  C     . PHE D  1 204 ? 46.348  -48.429  -9.328  1.00 39.10 ? 202 PHE B C     1 
ATOM   4540  O  O     . PHE D  1 204 ? 46.249  -49.327  -8.482  1.00 37.54 ? 202 PHE B O     1 
ATOM   4541  C  CB    . PHE D  1 204 ? 46.341  -49.260  -11.720 1.00 34.02 ? 202 PHE B CB    1 
ATOM   4542  C  CG    . PHE D  1 204 ? 45.533  -49.509  -12.971 1.00 32.84 ? 202 PHE B CG    1 
ATOM   4543  C  CD1   . PHE D  1 204 ? 44.350  -48.814  -13.205 1.00 37.85 ? 202 PHE B CD1   1 
ATOM   4544  C  CD2   . PHE D  1 204 ? 45.935  -50.454  -13.901 1.00 31.36 ? 202 PHE B CD2   1 
ATOM   4545  C  CE1   . PHE D  1 204 ? 43.593  -49.045  -14.369 1.00 35.99 ? 202 PHE B CE1   1 
ATOM   4546  C  CE2   . PHE D  1 204 ? 45.185  -50.695  -15.073 1.00 32.78 ? 202 PHE B CE2   1 
ATOM   4547  C  CZ    . PHE D  1 204 ? 44.016  -49.994  -15.304 1.00 33.46 ? 202 PHE B CZ    1 
ATOM   4548  N  N     . LYS D  1 205 ? 47.053  -47.329  -9.153  1.00 40.39 ? 203 LYS B N     1 
ATOM   4549  C  CA    . LYS D  1 205 ? 47.888  -47.057  -7.994  1.00 39.62 ? 203 LYS B CA    1 
ATOM   4550  C  C     . LYS D  1 205 ? 47.128  -47.033  -6.641  1.00 43.08 ? 203 LYS B C     1 
ATOM   4551  O  O     . LYS D  1 205 ? 47.599  -47.515  -5.649  1.00 39.85 ? 203 LYS B O     1 
ATOM   4552  C  CB    . LYS D  1 205 ? 48.562  -45.728  -8.240  1.00 31.42 ? 203 LYS B CB    1 
ATOM   4553  C  CG    . LYS D  1 205 ? 50.032  -45.691  -7.989  1.00 41.97 ? 203 LYS B CG    1 
ATOM   4554  C  CD    . LYS D  1 205 ? 50.357  -46.323  -6.643  1.00 43.92 ? 203 LYS B CD    1 
ATOM   4555  C  CE    . LYS D  1 205 ? 51.816  -46.118  -6.291  1.00 47.54 ? 203 LYS B CE    1 
ATOM   4556  N  NZ    . LYS D  1 205 ? 52.319  -44.816  -6.738  1.00 48.90 ? 203 LYS B NZ    1 
ATOM   4557  N  N     . LYS D  1 206 ? 45.929  -46.497  -6.638  1.00 41.71 ? 204 LYS B N     1 
ATOM   4558  C  CA    . LYS D  1 206 ? 45.110  -46.437  -5.454  1.00 46.08 ? 204 LYS B CA    1 
ATOM   4559  C  C     . LYS D  1 206 ? 44.836  -47.825  -4.910  1.00 51.19 ? 204 LYS B C     1 
ATOM   4560  O  O     . LYS D  1 206 ? 44.721  -48.029  -3.721  1.00 48.57 ? 204 LYS B O     1 
ATOM   4561  C  CB    . LYS D  1 206 ? 43.751  -45.839  -5.804  1.00 50.79 ? 204 LYS B CB    1 
ATOM   4562  C  CG    . LYS D  1 206 ? 43.720  -44.341  -6.046  1.00 54.32 ? 204 LYS B CG    1 
ATOM   4563  C  CD    . LYS D  1 206 ? 42.620  -43.971  -7.026  1.00 49.01 ? 204 LYS B CD    1 
ATOM   4564  C  CE    . LYS D  1 206 ? 42.076  -42.593  -6.743  1.00 54.00 ? 204 LYS B CE    1 
ATOM   4565  N  NZ    . LYS D  1 206 ? 40.607  -42.674  -6.517  1.00 55.10 ? 204 LYS B NZ    1 
ATOM   4566  N  N     . ASP D  1 207 ? 44.622  -48.764  -5.807  1.00 49.29 ? 205 ASP B N     1 
ATOM   4567  C  CA    . ASP D  1 207 ? 44.357  -50.140  -5.454  1.00 43.85 ? 205 ASP B CA    1 
ATOM   4568  C  C     . ASP D  1 207 ? 45.504  -50.875  -4.806  1.00 45.00 ? 205 ASP B C     1 
ATOM   4569  O  O     . ASP D  1 207 ? 45.284  -51.692  -3.974  1.00 47.19 ? 205 ASP B O     1 
ATOM   4570  C  CB    . ASP D  1 207 ? 43.838  -50.897  -6.660  1.00 45.40 ? 205 ASP B CB    1 
ATOM   4571  C  CG    . ASP D  1 207 ? 42.594  -50.286  -7.227  1.00 47.64 ? 205 ASP B CG    1 
ATOM   4572  O  OD1   . ASP D  1 207 ? 41.562  -50.460  -6.587  1.00 56.99 ? 205 ASP B OD1   1 
ATOM   4573  O  OD2   . ASP D  1 207 ? 42.628  -49.644  -8.288  1.00 43.95 ? 205 ASP B OD2   1 
ATOM   4574  N  N     . GLY D  1 208 ? 46.727  -50.630  -5.238  1.00 43.36 ? 206 GLY B N     1 
ATOM   4575  C  CA    . GLY D  1 208 ? 47.861  -51.337  -4.703  1.00 38.03 ? 206 GLY B CA    1 
ATOM   4576  C  C     . GLY D  1 208 ? 47.993  -52.784  -5.125  1.00 40.96 ? 206 GLY B C     1 
ATOM   4577  O  O     . GLY D  1 208 ? 47.416  -53.204  -6.106  1.00 36.78 ? 206 GLY B O     1 
ATOM   4578  N  N     . ALA D  1 209 ? 48.776  -53.540  -4.368  1.00 37.24 ? 207 ALA B N     1 
ATOM   4579  C  CA    . ALA D  1 209 ? 48.954  -54.967  -4.608  1.00 34.35 ? 207 ALA B CA    1 
ATOM   4580  C  C     . ALA D  1 209 ? 47.649  -55.731  -4.457  1.00 33.70 ? 207 ALA B C     1 
ATOM   4581  O  O     . ALA D  1 209 ? 47.564  -56.895  -4.863  1.00 30.97 ? 207 ALA B O     1 
ATOM   4582  C  CB    . ALA D  1 209 ? 49.998  -55.530  -3.678  1.00 33.21 ? 207 ALA B CB    1 
ATOM   4583  N  N     . SER D  1 210 ? 46.643  -55.084  -3.875  1.00 26.30 ? 208 SER B N     1 
ATOM   4584  C  CA    . SER D  1 210 ? 45.395  -55.779  -3.551  1.00 35.02 ? 208 SER B CA    1 
ATOM   4585  C  C     . SER D  1 210 ? 44.391  -55.778  -4.726  1.00 30.95 ? 208 SER B C     1 
ATOM   4586  O  O     . SER D  1 210 ? 43.299  -56.356  -4.640  1.00 29.27 ? 208 SER B O     1 
ATOM   4587  C  CB    . SER D  1 210 ? 44.759  -55.158  -2.314  1.00 29.16 ? 208 SER B CB    1 
ATOM   4588  O  OG    . SER D  1 210 ? 43.911  -54.078  -2.690  1.00 43.83 ? 208 SER B OG    1 
ATOM   4589  N  N     . LEU D  1 211 ? 44.776  -55.113  -5.815  1.00 28.96 ? 209 LEU B N     1 
ATOM   4590  C  CA    . LEU D  1 211 ? 43.982  -55.068  -7.044  1.00 25.91 ? 209 LEU B CA    1 
ATOM   4591  C  C     . LEU D  1 211 ? 43.651  -56.475  -7.579  1.00 25.40 ? 209 LEU B C     1 
ATOM   4592  O  O     . LEU D  1 211 ? 44.554  -57.295  -7.795  1.00 25.76 ? 209 LEU B O     1 
ATOM   4593  C  CB    . LEU D  1 211 ? 44.721  -54.265  -8.123  1.00 24.59 ? 209 LEU B CB    1 
ATOM   4594  C  CG    . LEU D  1 211 ? 44.053  -54.311  -9.509  1.00 28.90 ? 209 LEU B CG    1 
ATOM   4595  C  CD1   . LEU D  1 211 ? 42.721  -53.541  -9.495  1.00 31.08 ? 209 LEU B CD1   1 
ATOM   4596  C  CD2   . LEU D  1 211 ? 44.972  -53.744  -10.577 1.00 31.05 ? 209 LEU B CD2   1 
ATOM   4597  N  N     . GLY D  1 212 ? 42.365  -56.733  -7.807  1.00 23.54 ? 210 GLY B N     1 
ATOM   4598  C  CA    . GLY D  1 212 ? 41.928  -57.962  -8.465  1.00 25.37 ? 210 GLY B CA    1 
ATOM   4599  C  C     . GLY D  1 212 ? 41.298  -58.976  -7.528  1.00 21.26 ? 210 GLY B C     1 
ATOM   4600  O  O     . GLY D  1 212 ? 40.993  -58.639  -6.377  1.00 18.12 ? 210 GLY B O     1 
ATOM   4601  N  N     . SER D  1 213 ? 41.173  -60.220  -8.005  1.00 22.51 ? 211 SER B N     1 
ATOM   4602  C  CA    . SER D  1 213 ? 40.324  -61.273  -7.408  1.00 17.70 ? 211 SER B CA    1 
ATOM   4603  C  C     . SER D  1 213 ? 41.118  -62.350  -6.641  1.00 10.85 ? 211 SER B C     1 
ATOM   4604  O  O     . SER D  1 213 ? 41.953  -63.040  -7.207  1.00 15.04 ? 211 SER B O     1 
ATOM   4605  C  CB    . SER D  1 213 ? 39.496  -61.964  -8.520  1.00 17.57 ? 211 SER B CB    1 
ATOM   4606  O  OG    . SER D  1 213 ? 38.819  -63.133  -8.045  1.00 17.10 ? 211 SER B OG    1 
ATOM   4607  N  N     . PRO D  1 214 ? 40.856  -62.489  -5.337  1.00 16.77 ? 212 PRO B N     1 
ATOM   4608  C  CA    . PRO D  1 214 ? 41.561  -63.536  -4.604  1.00 18.21 ? 212 PRO B CA    1 
ATOM   4609  C  C     . PRO D  1 214 ? 41.180  -64.929  -5.129  1.00 18.28 ? 212 PRO B C     1 
ATOM   4610  O  O     . PRO D  1 214 ? 41.980  -65.869  -5.012  1.00 17.86 ? 212 PRO B O     1 
ATOM   4611  C  CB    . PRO D  1 214 ? 41.108  -63.322  -3.139  1.00 18.53 ? 212 PRO B CB    1 
ATOM   4612  C  CG    . PRO D  1 214 ? 39.972  -62.372  -3.179  1.00 24.25 ? 212 PRO B CG    1 
ATOM   4613  C  CD    . PRO D  1 214 ? 40.079  -61.597  -4.454  1.00 22.14 ? 212 PRO B CD    1 
ATOM   4614  N  N     . ILE D  1 215 ? 39.996  -65.065  -5.732  1.00 15.89 ? 213 ILE B N     1 
ATOM   4615  C  CA    . ILE D  1 215 ? 39.585  -66.381  -6.239  1.00 14.12 ? 213 ILE B CA    1 
ATOM   4616  C  C     . ILE D  1 215 ? 40.483  -66.715  -7.427  1.00 18.01 ? 213 ILE B C     1 
ATOM   4617  O  O     . ILE D  1 215 ? 41.119  -67.787  -7.501  1.00 19.03 ? 213 ILE B O     1 
ATOM   4618  C  CB    . ILE D  1 215 ? 38.069  -66.387  -6.585  1.00 17.78 ? 213 ILE B CB    1 
ATOM   4619  C  CG1   . ILE D  1 215 ? 37.235  -66.449  -5.297  1.00 20.13 ? 213 ILE B CG1   1 
ATOM   4620  C  CG2   . ILE D  1 215 ? 37.685  -67.574  -7.455  1.00 16.21 ? 213 ILE B CG2   1 
ATOM   4621  C  CD1   . ILE D  1 215 ? 35.690  -65.989  -5.433  1.00 16.60 ? 213 ILE B CD1   1 
ATOM   4622  N  N     . ASN D  1 216 ? 40.595  -65.764  -8.347  1.00 16.27 ? 214 ASN B N     1 
ATOM   4623  C  CA    . ASN D  1 216 ? 41.470  -65.977  -9.490  1.00 14.83 ? 214 ASN B CA    1 
ATOM   4624  C  C     . ASN D  1 216 ? 42.923  -66.169  -9.102  1.00 16.51 ? 214 ASN B C     1 
ATOM   4625  O  O     . ASN D  1 216 ? 43.640  -66.931  -9.756  1.00 18.44 ? 214 ASN B O     1 
ATOM   4626  C  CB    . ASN D  1 216 ? 41.321  -64.853  -10.513 1.00 12.95 ? 214 ASN B CB    1 
ATOM   4627  C  CG    . ASN D  1 216 ? 39.948  -64.882  -11.198 1.00 19.30 ? 214 ASN B CG    1 
ATOM   4628  O  OD1   . ASN D  1 216 ? 39.449  -65.969  -11.508 1.00 19.82 ? 214 ASN B OD1   1 
ATOM   4629  N  ND2   . ASN D  1 216 ? 39.342  -63.695  -11.438 1.00 10.37 ? 214 ASN B ND2   1 
ATOM   4630  N  N     . LYS D  1 217 ? 43.367  -65.500  -8.041  1.00 17.26 ? 215 LYS B N     1 
ATOM   4631  C  CA    . LYS D  1 217 ? 44.738  -65.732  -7.555  1.00 17.47 ? 215 LYS B CA    1 
ATOM   4632  C  C     . LYS D  1 217 ? 44.962  -67.201  -7.174  1.00 16.74 ? 215 LYS B C     1 
ATOM   4633  O  O     . LYS D  1 217 ? 45.962  -67.832  -7.538  1.00 19.39 ? 215 LYS B O     1 
ATOM   4634  C  CB    . LYS D  1 217 ? 45.000  -64.871  -6.327  1.00 15.80 ? 215 LYS B CB    1 
ATOM   4635  C  CG    . LYS D  1 217 ? 46.424  -65.045  -5.754  1.00 21.62 ? 215 LYS B CG    1 
ATOM   4636  C  CD    . LYS D  1 217 ? 46.475  -64.485  -4.305  1.00 25.64 ? 215 LYS B CD    1 
ATOM   4637  C  CE    . LYS D  1 217 ? 45.212  -64.899  -3.493  1.00 30.66 ? 215 LYS B CE    1 
ATOM   4638  N  NZ    . LYS D  1 217 ? 45.181  -64.214  -2.144  1.00 30.16 ? 215 LYS B NZ    1 
ATOM   4639  N  N     . VAL D  1 218 ? 44.028  -67.753  -6.418  1.00 16.28 ? 216 VAL B N     1 
ATOM   4640  C  CA    . VAL D  1 218 ? 44.206  -69.132  -5.946  1.00 18.39 ? 216 VAL B CA    1 
ATOM   4641  C  C     . VAL D  1 218 ? 44.214  -70.089  -7.135  1.00 19.61 ? 216 VAL B C     1 
ATOM   4642  O  O     . VAL D  1 218 ? 45.118  -70.957  -7.258  1.00 17.84 ? 216 VAL B O     1 
ATOM   4643  C  CB    . VAL D  1 218 ? 43.128  -69.499  -4.883  1.00 15.65 ? 216 VAL B CB    1 
ATOM   4644  C  CG1   . VAL D  1 218 ? 42.986  -71.049  -4.649  1.00 16.18 ? 216 VAL B CG1   1 
ATOM   4645  C  CG2   . VAL D  1 218 ? 43.423  -68.773  -3.587  1.00 17.99 ? 216 VAL B CG2   1 
ATOM   4646  N  N     . ILE D  1 219 ? 43.238  -69.927  -8.038  1.00 17.94 ? 217 ILE B N     1 
ATOM   4647  C  CA    . ILE D  1 219 ? 43.241  -70.735  -9.253  1.00 14.98 ? 217 ILE B CA    1 
ATOM   4648  C  C     . ILE D  1 219 ? 44.550  -70.595  -10.045 1.00 17.26 ? 217 ILE B C     1 
ATOM   4649  O  O     . ILE D  1 219 ? 45.123  -71.569  -10.516 1.00 13.93 ? 217 ILE B O     1 
ATOM   4650  C  CB    . ILE D  1 219 ? 42.011  -70.429  -10.111 1.00 18.00 ? 217 ILE B CB    1 
ATOM   4651  C  CG1   . ILE D  1 219 ? 40.743  -70.791  -9.326  1.00 15.65 ? 217 ILE B CG1   1 
ATOM   4652  C  CG2   . ILE D  1 219 ? 42.056  -71.228  -11.399 1.00 15.97 ? 217 ILE B CG2   1 
ATOM   4653  C  CD1   . ILE D  1 219 ? 39.491  -70.061  -9.824  1.00 13.93 ? 217 ILE B CD1   1 
ATOM   4654  N  N     . LEU D  1 220 ? 45.050  -69.373  -10.191 1.00 15.08 ? 218 LEU B N     1 
ATOM   4655  C  CA    . LEU D  1 220 ? 46.276  -69.208  -10.935 1.00 17.43 ? 218 LEU B CA    1 
ATOM   4656  C  C     . LEU D  1 220 ? 47.409  -69.985  -10.232 1.00 20.19 ? 218 LEU B C     1 
ATOM   4657  O  O     . LEU D  1 220 ? 48.203  -70.647  -10.892 1.00 18.57 ? 218 LEU B O     1 
ATOM   4658  C  CB    . LEU D  1 220 ? 46.656  -67.732  -11.048 1.00 14.37 ? 218 LEU B CB    1 
ATOM   4659  C  CG    . LEU D  1 220 ? 47.841  -67.505  -12.002 1.00 20.75 ? 218 LEU B CG    1 
ATOM   4660  C  CD1   . LEU D  1 220 ? 47.925  -66.038  -12.416 1.00 22.66 ? 218 LEU B CD1   1 
ATOM   4661  C  CD2   . LEU D  1 220 ? 49.176  -67.920  -11.393 1.00 26.57 ? 218 LEU B CD2   1 
ATOM   4662  N  N     . ASN D  1 221 ? 47.474  -69.898  -8.903  1.00 21.35 ? 219 ASN B N     1 
ATOM   4663  C  CA    . ASN D  1 221 ? 48.548  -70.577  -8.144  1.00 22.52 ? 219 ASN B CA    1 
ATOM   4664  C  C     . ASN D  1 221 ? 48.421  -72.114  -8.140  1.00 24.61 ? 219 ASN B C     1 
ATOM   4665  O  O     . ASN D  1 221 ? 49.415  -72.833  -8.041  1.00 23.71 ? 219 ASN B O     1 
ATOM   4666  C  CB    . ASN D  1 221 ? 48.599  -70.062  -6.702  1.00 21.37 ? 219 ASN B CB    1 
ATOM   4667  C  CG    . ASN D  1 221 ? 49.191  -68.673  -6.598  1.00 21.58 ? 219 ASN B CG    1 
ATOM   4668  O  OD1   . ASN D  1 221 ? 49.971  -68.263  -7.442  1.00 27.01 ? 219 ASN B OD1   1 
ATOM   4669  N  ND2   . ASN D  1 221 ? 48.811  -67.946  -5.565  1.00 24.77 ? 219 ASN B ND2   1 
ATOM   4670  N  N     . THR D  1 222 ? 47.185  -72.602  -8.256  1.00 23.43 ? 220 THR B N     1 
ATOM   4671  C  CA    . THR D  1 222 ? 46.921  -74.044  -8.288  1.00 21.38 ? 220 THR B CA    1 
ATOM   4672  C  C     . THR D  1 222 ? 47.144  -74.654  -9.681  1.00 23.94 ? 220 THR B C     1 
ATOM   4673  O  O     . THR D  1 222 ? 47.803  -75.684  -9.817  1.00 20.12 ? 220 THR B O     1 
ATOM   4674  C  CB    . THR D  1 222 ? 45.505  -74.344  -7.848  1.00 21.70 ? 220 THR B CB    1 
ATOM   4675  O  OG1   . THR D  1 222 ? 45.223  -73.629  -6.639  1.00 23.54 ? 220 THR B OG1   1 
ATOM   4676  C  CG2   . THR D  1 222 ? 45.301  -75.850  -7.623  1.00 24.66 ? 220 THR B CG2   1 
ATOM   4677  N  N     . LEU D  1 223 ? 46.599  -74.014  -10.721 1.00 24.26 ? 221 LEU B N     1 
ATOM   4678  C  CA    . LEU D  1 223 ? 46.675  -74.556  -12.086 1.00 20.87 ? 221 LEU B CA    1 
ATOM   4679  C  C     . LEU D  1 223 ? 47.970  -74.220  -12.831 1.00 19.60 ? 221 LEU B C     1 
ATOM   4680  O  O     . LEU D  1 223 ? 48.409  -74.990  -13.726 1.00 21.02 ? 221 LEU B O     1 
ATOM   4681  C  CB    . LEU D  1 223 ? 45.463  -74.102  -12.909 1.00 15.04 ? 221 LEU B CB    1 
ATOM   4682  C  CG    . LEU D  1 223 ? 44.127  -74.593  -12.375 1.00 21.23 ? 221 LEU B CG    1 
ATOM   4683  C  CD1   . LEU D  1 223 ? 42.929  -74.094  -13.233 1.00 25.15 ? 221 LEU B CD1   1 
ATOM   4684  C  CD2   . LEU D  1 223 ? 44.191  -76.088  -12.395 1.00 24.98 ? 221 LEU B CD2   1 
ATOM   4685  N  N     . LYS D  1 224 ? 48.592  -73.090  -12.477 1.00 17.91 ? 222 LYS B N     1 
ATOM   4686  C  CA    . LYS D  1 224 ? 49.854  -72.672  -13.127 1.00 21.11 ? 222 LYS B CA    1 
ATOM   4687  C  C     . LYS D  1 224 ? 49.835  -72.850  -14.643 1.00 21.93 ? 222 LYS B C     1 
ATOM   4688  O  O     . LYS D  1 224 ? 50.721  -73.500  -15.210 1.00 13.88 ? 222 LYS B O     1 
ATOM   4689  C  CB    . LYS D  1 224 ? 51.054  -73.461  -12.549 1.00 17.91 ? 222 LYS B CB    1 
ATOM   4690  C  CG    . LYS D  1 224 ? 51.166  -73.382  -10.999 1.00 21.66 ? 222 LYS B CG    1 
ATOM   4691  C  CD    . LYS D  1 224 ? 52.536  -73.862  -10.530 1.00 28.90 ? 222 LYS B CD    1 
ATOM   4692  C  CE    . LYS D  1 224 ? 52.675  -73.830  -8.986  1.00 28.97 ? 222 LYS B CE    1 
ATOM   4693  N  NZ    . LYS D  1 224 ? 52.410  -72.508  -8.355  1.00 35.19 ? 222 LYS B NZ    1 
ATOM   4694  N  N     . PRO D  1 225 ? 48.828  -72.265  -15.315 1.00 19.00 ? 223 PRO B N     1 
ATOM   4695  C  CA    . PRO D  1 225 ? 48.665  -72.390  -16.771 1.00 19.49 ? 223 PRO B CA    1 
ATOM   4696  C  C     . PRO D  1 225 ? 49.837  -71.720  -17.470 1.00 23.84 ? 223 PRO B C     1 
ATOM   4697  O  O     . PRO D  1 225 ? 50.496  -70.888  -16.847 1.00 17.80 ? 223 PRO B O     1 
ATOM   4698  C  CB    . PRO D  1 225 ? 47.404  -71.565  -17.052 1.00 17.74 ? 223 PRO B CB    1 
ATOM   4699  C  CG    . PRO D  1 225 ? 47.329  -70.575  -15.901 1.00 14.45 ? 223 PRO B CG    1 
ATOM   4700  C  CD    . PRO D  1 225 ? 47.838  -71.348  -14.706 1.00 18.61 ? 223 PRO B CD    1 
ATOM   4701  N  N     . LYS D  1 226 ? 50.087  -72.059  -18.728 1.00 18.49 ? 224 LYS B N     1 
ATOM   4702  C  CA    . LYS D  1 226 ? 51.080  -71.321  -19.526 1.00 18.93 ? 224 LYS B CA    1 
ATOM   4703  C  C     . LYS D  1 226 ? 50.709  -69.855  -19.734 1.00 23.87 ? 224 LYS B C     1 
ATOM   4704  O  O     . LYS D  1 226 ? 51.590  -68.997  -19.671 1.00 19.72 ? 224 LYS B O     1 
ATOM   4705  C  CB    . LYS D  1 226 ? 51.293  -71.991  -20.865 1.00 20.43 ? 224 LYS B CB    1 
ATOM   4706  C  CG    . LYS D  1 226 ? 51.926  -73.387  -20.749 1.00 30.12 ? 224 LYS B CG    1 
ATOM   4707  C  CD    . LYS D  1 226 ? 51.831  -74.170  -22.068 1.00 26.57 ? 224 LYS B CD    1 
ATOM   4708  C  CE    . LYS D  1 226 ? 52.048  -75.687  -21.826 1.00 41.60 ? 224 LYS B CE    1 
ATOM   4709  N  NZ    . LYS D  1 226 ? 51.691  -76.531  -23.029 1.00 44.67 ? 224 LYS B NZ    1 
ATOM   4710  N  N     . TYR D  1 227 ? 49.416  -69.586  -19.996 1.00 17.27 ? 225 TYR B N     1 
ATOM   4711  C  CA    . TYR D  1 227 ? 48.877  -68.206  -20.096 1.00 18.52 ? 225 TYR B CA    1 
ATOM   4712  C  C     . TYR D  1 227 ? 47.720  -68.005  -19.149 1.00 17.84 ? 225 TYR B C     1 
ATOM   4713  O  O     . TYR D  1 227 ? 46.907  -68.918  -18.966 1.00 18.32 ? 225 TYR B O     1 
ATOM   4714  C  CB    . TYR D  1 227 ? 48.404  -67.901  -21.529 1.00 17.08 ? 225 TYR B CB    1 
ATOM   4715  C  CG    . TYR D  1 227 ? 49.547  -67.967  -22.509 1.00 16.31 ? 225 TYR B CG    1 
ATOM   4716  C  CD1   . TYR D  1 227 ? 50.336  -66.852  -22.777 1.00 24.16 ? 225 TYR B CD1   1 
ATOM   4717  C  CD2   . TYR D  1 227 ? 49.850  -69.161  -23.158 1.00 21.80 ? 225 TYR B CD2   1 
ATOM   4718  C  CE1   . TYR D  1 227 ? 51.409  -66.934  -23.653 1.00 21.60 ? 225 TYR B CE1   1 
ATOM   4719  C  CE2   . TYR D  1 227 ? 50.899  -69.251  -24.027 1.00 30.70 ? 225 TYR B CE2   1 
ATOM   4720  C  CZ    . TYR D  1 227 ? 51.683  -68.131  -24.274 1.00 30.99 ? 225 TYR B CZ    1 
ATOM   4721  O  OH    . TYR D  1 227 ? 52.729  -68.249  -25.161 1.00 31.98 ? 225 TYR B OH    1 
ATOM   4722  N  N     . TRP D  1 228 ? 47.654  -66.821  -18.532 1.00 17.19 ? 226 TRP B N     1 
ATOM   4723  C  CA    . TRP D  1 228 ? 46.440  -66.336  -17.887 1.00 13.09 ? 226 TRP B CA    1 
ATOM   4724  C  C     . TRP D  1 228 ? 46.035  -65.013  -18.548 1.00 16.68 ? 226 TRP B C     1 
ATOM   4725  O  O     . TRP D  1 228 ? 46.807  -64.065  -18.545 1.00 18.13 ? 226 TRP B O     1 
ATOM   4726  C  CB    . TRP D  1 228 ? 46.658  -66.093  -16.372 1.00 11.66 ? 226 TRP B CB    1 
ATOM   4727  C  CG    . TRP D  1 228 ? 45.336  -65.900  -15.669 1.00 16.88 ? 226 TRP B CG    1 
ATOM   4728  C  CD1   . TRP D  1 228 ? 44.545  -64.795  -15.704 1.00 15.91 ? 226 TRP B CD1   1 
ATOM   4729  C  CD2   . TRP D  1 228 ? 44.650  -66.862  -14.842 1.00 11.60 ? 226 TRP B CD2   1 
ATOM   4730  N  NE1   . TRP D  1 228 ? 43.395  -65.011  -14.960 1.00 16.32 ? 226 TRP B NE1   1 
ATOM   4731  C  CE2   . TRP D  1 228 ? 43.451  -66.283  -14.414 1.00 15.65 ? 226 TRP B CE2   1 
ATOM   4732  C  CE3   . TRP D  1 228 ? 44.954  -68.165  -14.408 1.00 19.35 ? 226 TRP B CE3   1 
ATOM   4733  C  CZ2   . TRP D  1 228 ? 42.518  -66.962  -13.590 1.00 18.32 ? 226 TRP B CZ2   1 
ATOM   4734  C  CZ3   . TRP D  1 228 ? 44.046  -68.830  -13.582 1.00 14.23 ? 226 TRP B CZ3   1 
ATOM   4735  C  CH2   . TRP D  1 228 ? 42.842  -68.231  -13.196 1.00 14.98 ? 226 TRP B CH2   1 
ATOM   4736  N  N     . ILE D  1 229 ? 44.813  -64.927  -19.085 1.00 13.01 ? 227 ILE B N     1 
ATOM   4737  C  CA    . ILE D  1 229 ? 44.373  -63.721  -19.788 1.00 17.17 ? 227 ILE B CA    1 
ATOM   4738  C  C     . ILE D  1 229 ? 43.175  -63.092  -19.048 1.00 16.95 ? 227 ILE B C     1 
ATOM   4739  O  O     . ILE D  1 229 ? 42.264  -63.822  -18.643 1.00 18.29 ? 227 ILE B O     1 
ATOM   4740  C  CB    . ILE D  1 229 ? 43.942  -64.081  -21.224 1.00 18.62 ? 227 ILE B CB    1 
ATOM   4741  C  CG1   . ILE D  1 229 ? 45.004  -64.932  -21.915 1.00 19.03 ? 227 ILE B CG1   1 
ATOM   4742  C  CG2   . ILE D  1 229 ? 43.683  -62.817  -22.069 1.00 17.39 ? 227 ILE B CG2   1 
ATOM   4743  C  CD1   . ILE D  1 229 ? 44.494  -65.558  -23.208 1.00 23.44 ? 227 ILE B CD1   1 
ATOM   4744  N  N     . SER D  1 230 ? 43.195  -61.768  -18.862 1.00 13.55 ? 228 SER B N     1 
ATOM   4745  C  CA    . SER D  1 230 ? 42.152  -61.056  -18.154 1.00 14.63 ? 228 SER B CA    1 
ATOM   4746  C  C     . SER D  1 230 ? 41.752  -59.750  -18.900 1.00 16.53 ? 228 SER B C     1 
ATOM   4747  O  O     . SER D  1 230 ? 42.560  -59.202  -19.638 1.00 21.05 ? 228 SER B O     1 
ATOM   4748  C  CB    . SER D  1 230 ? 42.602  -60.780  -16.733 1.00 16.32 ? 228 SER B CB    1 
ATOM   4749  O  OG    . SER D  1 230 ? 42.861  -62.005  -16.066 1.00 15.47 ? 228 SER B OG    1 
ATOM   4750  N  N     . GLY D  1 231 ? 40.513  -59.279  -18.725 1.00 19.40 ? 229 GLY B N     1 
ATOM   4751  C  CA    . GLY D  1 231 ? 40.040  -58.127  -19.495 1.00 26.60 ? 229 GLY B CA    1 
ATOM   4752  C  C     . GLY D  1 231 ? 39.118  -57.090  -18.844 1.00 23.95 ? 229 GLY B C     1 
ATOM   4753  O  O     . GLY D  1 231 ? 38.419  -56.327  -19.530 1.00 28.05 ? 229 GLY B O     1 
ATOM   4754  N  N     . HIS D  1 232 ? 39.099  -57.041  -17.520 1.00 18.18 ? 230 HIS B N     1 
ATOM   4755  C  CA    . HIS D  1 232 ? 38.293  -56.030  -16.826 1.00 18.78 ? 230 HIS B CA    1 
ATOM   4756  C  C     . HIS D  1 232 ? 39.001  -54.659  -16.725 1.00 27.39 ? 230 HIS B C     1 
ATOM   4757  O  O     . HIS D  1 232 ? 38.327  -53.640  -16.700 1.00 24.92 ? 230 HIS B O     1 
ATOM   4758  C  CB    . HIS D  1 232 ? 38.009  -56.536  -15.435 1.00 17.14 ? 230 HIS B CB    1 
ATOM   4759  C  CG    . HIS D  1 232 ? 37.153  -55.645  -14.607 1.00 18.78 ? 230 HIS B CG    1 
ATOM   4760  N  ND1   . HIS D  1 232 ? 35.975  -55.085  -15.055 1.00 21.44 ? 230 HIS B ND1   1 
ATOM   4761  C  CD2   . HIS D  1 232 ? 37.270  -55.266  -13.307 1.00 26.98 ? 230 HIS B CD2   1 
ATOM   4762  C  CE1   . HIS D  1 232 ? 35.420  -54.385  -14.086 1.00 22.50 ? 230 HIS B CE1   1 
ATOM   4763  N  NE2   . HIS D  1 232 ? 36.189  -54.468  -13.016 1.00 24.21 ? 230 HIS B NE2   1 
ATOM   4764  N  N     . MET D  1 233 ? 40.347  -54.657  -16.636 1.00 23.10 ? 231 MET B N     1 
ATOM   4765  C  CA    . MET D  1 233 ? 41.155  -53.425  -16.552 1.00 24.97 ? 231 MET B CA    1 
ATOM   4766  C  C     . MET D  1 233 ? 41.491  -52.938  -17.970 1.00 34.52 ? 231 MET B C     1 
ATOM   4767  O  O     . MET D  1 233 ? 42.102  -53.688  -18.789 1.00 30.06 ? 231 MET B O     1 
ATOM   4768  C  CB    . MET D  1 233 ? 42.476  -53.663  -15.794 1.00 23.16 ? 231 MET B CB    1 
ATOM   4769  C  CG    . MET D  1 233 ? 42.328  -54.236  -14.367 1.00 25.24 ? 231 MET B CG    1 
ATOM   4770  S  SD    . MET D  1 233 ? 41.030  -53.424  -13.397 1.00 28.10 ? 231 MET B SD    1 
ATOM   4771  C  CE    . MET D  1 233 ? 41.783  -51.822  -13.058 1.00 37.05 ? 231 MET B CE    1 
ATOM   4772  N  N     . HIS D  1 234 ? 41.139  -51.684  -18.241 1.00 26.07 ? 232 HIS B N     1 
ATOM   4773  C  CA    . HIS D  1 234 ? 41.222  -51.137  -19.591 1.00 34.99 ? 232 HIS B CA    1 
ATOM   4774  C  C     . HIS D  1 234 ? 42.642  -50.720  -19.940 1.00 28.67 ? 232 HIS B C     1 
ATOM   4775  O  O     . HIS D  1 234 ? 42.923  -49.526  -20.045 1.00 29.22 ? 232 HIS B O     1 
ATOM   4776  C  CB    . HIS D  1 234 ? 40.317  -49.910  -19.703 1.00 29.84 ? 232 HIS B CB    1 
ATOM   4777  C  CG    . HIS D  1 234 ? 38.869  -50.208  -19.498 1.00 34.34 ? 232 HIS B CG    1 
ATOM   4778  N  ND1   . HIS D  1 234 ? 37.981  -49.272  -19.003 1.00 42.75 ? 232 HIS B ND1   1 
ATOM   4779  C  CD2   . HIS D  1 234 ? 38.144  -51.332  -19.729 1.00 37.52 ? 232 HIS B CD2   1 
ATOM   4780  C  CE1   . HIS D  1 234 ? 36.774  -49.810  -18.929 1.00 34.84 ? 232 HIS B CE1   1 
ATOM   4781  N  NE2   . HIS D  1 234 ? 36.843  -51.058  -19.367 1.00 39.98 ? 232 HIS B NE2   1 
ATOM   4782  N  N     . CYS D  1 235 ? 43.540  -51.688  -20.101 1.00 27.23 ? 233 CYS B N     1 
ATOM   4783  C  CA    . CYS D  1 235 ? 44.920  -51.381  -20.453 1.00 21.80 ? 233 CYS B CA    1 
ATOM   4784  C  C     . CYS D  1 235 ? 45.544  -52.623  -21.025 1.00 21.87 ? 233 CYS B C     1 
ATOM   4785  O  O     . CYS D  1 235 ? 44.970  -53.694  -20.937 1.00 27.31 ? 233 CYS B O     1 
ATOM   4786  C  CB    . CYS D  1 235 ? 45.697  -51.010  -19.199 1.00 29.00 ? 233 CYS B CB    1 
ATOM   4787  S  SG    . CYS D  1 235 ? 45.837  -52.413  -18.034 1.00 29.80 ? 233 CYS B SG    1 
ATOM   4788  N  N     . GLU D  1 236 ? 46.733  -52.497  -21.581 1.00 21.45 ? 234 GLU B N     1 
ATOM   4789  C  CA    . GLU D  1 236 ? 47.515  -53.693  -21.855 1.00 28.09 ? 234 GLU B CA    1 
ATOM   4790  C  C     . GLU D  1 236 ? 48.498  -53.878  -20.700 1.00 23.47 ? 234 GLU B C     1 
ATOM   4791  O  O     . GLU D  1 236 ? 48.997  -52.899  -20.129 1.00 21.02 ? 234 GLU B O     1 
ATOM   4792  C  CB    . GLU D  1 236 ? 48.265  -53.601  -23.181 1.00 33.72 ? 234 GLU B CB    1 
ATOM   4793  C  CG    . GLU D  1 236 ? 48.564  -54.995  -23.796 1.00 41.57 ? 234 GLU B CG    1 
ATOM   4794  C  CD    . GLU D  1 236 ? 48.753  -54.944  -25.321 1.00 49.24 ? 234 GLU B CD    1 
ATOM   4795  O  OE1   . GLU D  1 236 ? 49.528  -54.076  -25.791 1.00 55.34 ? 234 GLU B OE1   1 
ATOM   4796  O  OE2   . GLU D  1 236 ? 48.118  -55.758  -26.039 1.00 47.44 ? 234 GLU B OE2   1 
ATOM   4797  N  N     . TYR D  1 237 ? 48.777  -55.128  -20.339 1.00 17.41 ? 235 TYR B N     1 
ATOM   4798  C  CA    . TYR D  1 237 ? 49.787  -55.363  -19.315 1.00 21.62 ? 235 TYR B CA    1 
ATOM   4799  C  C     . TYR D  1 237 ? 50.195  -56.814  -19.388 1.00 21.39 ? 235 TYR B C     1 
ATOM   4800  O  O     . TYR D  1 237 ? 49.400  -57.682  -19.769 1.00 22.52 ? 235 TYR B O     1 
ATOM   4801  C  CB    . TYR D  1 237 ? 49.228  -55.009  -17.940 1.00 21.02 ? 235 TYR B CB    1 
ATOM   4802  C  CG    . TYR D  1 237 ? 50.216  -55.043  -16.773 1.00 21.74 ? 235 TYR B CG    1 
ATOM   4803  C  CD1   . TYR D  1 237 ? 51.269  -54.115  -16.686 1.00 19.22 ? 235 TYR B CD1   1 
ATOM   4804  C  CD2   . TYR D  1 237 ? 50.076  -55.975  -15.738 1.00 17.32 ? 235 TYR B CD2   1 
ATOM   4805  C  CE1   . TYR D  1 237 ? 52.158  -54.113  -15.604 1.00 20.46 ? 235 TYR B CE1   1 
ATOM   4806  C  CE2   . TYR D  1 237 ? 50.975  -55.985  -14.634 1.00 17.86 ? 235 TYR B CE2   1 
ATOM   4807  C  CZ    . TYR D  1 237 ? 52.014  -55.052  -14.575 1.00 23.18 ? 235 TYR B CZ    1 
ATOM   4808  O  OH    . TYR D  1 237 ? 52.888  -55.035  -13.487 1.00 19.88 ? 235 TYR B OH    1 
ATOM   4809  N  N     . HIS D  1 238 ? 51.440  -57.062  -19.029 1.00 16.91 ? 236 HIS B N     1 
ATOM   4810  C  CA    . HIS D  1 238 ? 52.003  -58.393  -19.068 1.00 16.90 ? 236 HIS B CA    1 
ATOM   4811  C  C     . HIS D  1 238 ? 52.697  -58.582  -17.718 1.00 16.60 ? 236 HIS B C     1 
ATOM   4812  O  O     . HIS D  1 238 ? 53.345  -57.653  -17.208 1.00 23.50 ? 236 HIS B O     1 
ATOM   4813  C  CB    . HIS D  1 238 ? 53.060  -58.496  -20.186 1.00 20.40 ? 236 HIS B CB    1 
ATOM   4814  C  CG    . HIS D  1 238 ? 52.520  -58.551  -21.588 1.00 29.41 ? 236 HIS B CG    1 
ATOM   4815  N  ND1   . HIS D  1 238 ? 51.807  -57.515  -22.172 1.00 43.75 ? 236 HIS B ND1   1 
ATOM   4816  C  CD2   . HIS D  1 238 ? 52.659  -59.496  -22.555 1.00 39.90 ? 236 HIS B CD2   1 
ATOM   4817  C  CE1   . HIS D  1 238 ? 51.493  -57.843  -23.415 1.00 33.02 ? 236 HIS B CE1   1 
ATOM   4818  N  NE2   . HIS D  1 238 ? 52.010  -59.032  -23.678 1.00 37.47 ? 236 HIS B NE2   1 
ATOM   4819  N  N     . ALA D  1 239 ? 52.596  -59.778  -17.143 1.00 19.37 ? 237 ALA B N     1 
ATOM   4820  C  CA    . ALA D  1 239 ? 53.334  -60.086  -15.924 1.00 21.92 ? 237 ALA B CA    1 
ATOM   4821  C  C     . ALA D  1 239 ? 53.760  -61.542  -15.968 1.00 27.24 ? 237 ALA B C     1 
ATOM   4822  O  O     . ALA D  1 239 ? 53.257  -62.314  -16.806 1.00 20.77 ? 237 ALA B O     1 
ATOM   4823  C  CB    . ALA D  1 239 ? 52.495  -59.801  -14.700 1.00 19.52 ? 237 ALA B CB    1 
ATOM   4824  N  N     . GLU D  1 240 ? 54.707  -61.909  -15.103 1.00 26.20 ? 238 GLU B N     1 
ATOM   4825  C  CA    . GLU D  1 240 ? 55.146  -63.300  -15.014 1.00 25.00 ? 238 GLU B CA    1 
ATOM   4826  C  C     . GLU D  1 240 ? 55.072  -63.805  -13.591 1.00 27.94 ? 238 GLU B C     1 
ATOM   4827  O  O     . GLU D  1 240 ? 55.558  -63.139  -12.649 1.00 29.27 ? 238 GLU B O     1 
ATOM   4828  C  CB    . GLU D  1 240 ? 56.590  -63.469  -15.486 1.00 27.26 ? 238 GLU B CB    1 
ATOM   4829  C  CG    . GLU D  1 240 ? 56.847  -63.031  -16.883 1.00 31.97 ? 238 GLU B CG    1 
ATOM   4830  C  CD    . GLU D  1 240 ? 56.119  -63.867  -17.899 1.00 38.59 ? 238 GLU B CD    1 
ATOM   4831  O  OE1   . GLU D  1 240 ? 55.519  -64.906  -17.520 1.00 43.55 ? 238 GLU B OE1   1 
ATOM   4832  O  OE2   . GLU D  1 240 ? 56.148  -63.477  -19.080 1.00 44.47 ? 238 GLU B OE2   1 
ATOM   4833  N  N     . GLU D  1 241 ? 54.520  -65.011  -13.451 1.00 22.80 ? 239 GLU B N     1 
ATOM   4834  C  CA    . GLU D  1 241 ? 54.345  -65.667  -12.157 1.00 26.30 ? 239 GLU B CA    1 
ATOM   4835  C  C     . GLU D  1 241 ? 54.675  -67.126  -12.389 1.00 30.07 ? 239 GLU B C     1 
ATOM   4836  O  O     . GLU D  1 241 ? 53.848  -67.896  -12.911 1.00 25.35 ? 239 GLU B O     1 
ATOM   4837  C  CB    . GLU D  1 241 ? 52.893  -65.513  -11.670 1.00 33.71 ? 239 GLU B CB    1 
ATOM   4838  C  CG    . GLU D  1 241 ? 52.545  -66.227  -10.352 1.00 32.49 ? 239 GLU B CG    1 
ATOM   4839  C  CD    . GLU D  1 241 ? 53.337  -65.701  -9.143  1.00 43.88 ? 239 GLU B CD    1 
ATOM   4840  O  OE1   . GLU D  1 241 ? 54.323  -66.362  -8.727  1.00 40.33 ? 239 GLU B OE1   1 
ATOM   4841  O  OE2   . GLU D  1 241 ? 52.975  -64.631  -8.611  1.00 43.17 ? 239 GLU B OE2   1 
ATOM   4842  N  N     . GLY D  1 242 ? 55.896  -67.518  -12.047 1.00 26.77 ? 240 GLY B N     1 
ATOM   4843  C  CA    . GLY D  1 242 ? 56.263  -68.914  -12.194 1.00 30.21 ? 240 GLY B CA    1 
ATOM   4844  C  C     . GLY D  1 242 ? 56.129  -69.271  -13.651 1.00 26.23 ? 240 GLY B C     1 
ATOM   4845  O  O     . GLY D  1 242 ? 56.552  -68.503  -14.517 1.00 27.35 ? 240 GLY B O     1 
ATOM   4846  N  N     . PRO D  1 243 ? 55.499  -70.413  -13.953 1.00 31.22 ? 241 PRO B N     1 
ATOM   4847  C  CA    . PRO D  1 243 ? 55.465  -70.692  -15.393 1.00 28.27 ? 241 PRO B CA    1 
ATOM   4848  C  C     . PRO D  1 243 ? 54.387  -69.914  -16.169 1.00 21.36 ? 241 PRO B C     1 
ATOM   4849  O  O     . PRO D  1 243 ? 54.258  -70.146  -17.387 1.00 22.71 ? 241 PRO B O     1 
ATOM   4850  C  CB    . PRO D  1 243 ? 55.153  -72.199  -15.434 1.00 23.03 ? 241 PRO B CB    1 
ATOM   4851  C  CG    . PRO D  1 243 ? 54.299  -72.406  -14.165 1.00 25.88 ? 241 PRO B CG    1 
ATOM   4852  C  CD    . PRO D  1 243 ? 54.992  -71.548  -13.142 1.00 23.29 ? 241 PRO B CD    1 
ATOM   4853  N  N     . THR D  1 244 ? 53.651  -69.020  -15.506 1.00 21.10 ? 242 THR B N     1 
ATOM   4854  C  CA    . THR D  1 244 ? 52.445  -68.421  -16.107 1.00 24.31 ? 242 THR B CA    1 
ATOM   4855  C  C     . THR D  1 244 ? 52.741  -67.034  -16.691 1.00 22.34 ? 242 THR B C     1 
ATOM   4856  O  O     . THR D  1 244 ? 53.216  -66.160  -15.960 1.00 25.16 ? 242 THR B O     1 
ATOM   4857  C  CB    . THR D  1 244 ? 51.307  -68.311  -15.060 1.00 20.68 ? 242 THR B CB    1 
ATOM   4858  O  OG1   . THR D  1 244 ? 50.956  -69.622  -14.594 1.00 23.17 ? 242 THR B OG1   1 
ATOM   4859  C  CG2   . THR D  1 244 ? 50.018  -67.645  -15.655 1.00 19.81 ? 242 THR B CG2   1 
ATOM   4860  N  N     . HIS D  1 245 ? 52.498  -66.843  -17.991 1.00 18.77 ? 243 HIS B N     1 
ATOM   4861  C  CA    . HIS D  1 245 ? 52.494  -65.493  -18.577 1.00 19.20 ? 243 HIS B CA    1 
ATOM   4862  C  C     . HIS D  1 245 ? 51.098  -64.887  -18.428 1.00 21.20 ? 243 HIS B C     1 
ATOM   4863  O  O     . HIS D  1 245 ? 50.125  -65.418  -18.969 1.00 16.75 ? 243 HIS B O     1 
ATOM   4864  C  CB    . HIS D  1 245 ? 52.823  -65.555  -20.059 1.00 24.28 ? 243 HIS B CB    1 
ATOM   4865  C  CG    . HIS D  1 245 ? 54.022  -66.389  -20.378 1.00 34.33 ? 243 HIS B CG    1 
ATOM   4866  N  ND1   . HIS D  1 245 ? 55.312  -65.985  -20.089 1.00 36.93 ? 243 HIS B ND1   1 
ATOM   4867  C  CD2   . HIS D  1 245 ? 54.138  -67.597  -20.985 1.00 40.77 ? 243 HIS B CD2   1 
ATOM   4868  C  CE1   . HIS D  1 245 ? 56.161  -66.903  -20.500 1.00 43.73 ? 243 HIS B CE1   1 
ATOM   4869  N  NE2   . HIS D  1 245 ? 55.477  -67.895  -21.051 1.00 46.53 ? 243 HIS B NE2   1 
ATOM   4870  N  N     . PHE D  1 246 ? 51.009  -63.778  -17.706 1.00 18.36 ? 244 PHE B N     1 
ATOM   4871  C  CA    . PHE D  1 246 ? 49.742  -63.088  -17.513 1.00 16.12 ? 244 PHE B CA    1 
ATOM   4872  C  C     . PHE D  1 246 ? 49.658  -62.010  -18.587 1.00 19.23 ? 244 PHE B C     1 
ATOM   4873  O  O     . PHE D  1 246 ? 50.653  -61.320  -18.851 1.00 17.04 ? 244 PHE B O     1 
ATOM   4874  C  CB    . PHE D  1 246 ? 49.703  -62.426  -16.132 1.00 15.97 ? 244 PHE B CB    1 
ATOM   4875  C  CG    . PHE D  1 246 ? 48.530  -61.490  -15.943 1.00 20.02 ? 244 PHE B CG    1 
ATOM   4876  C  CD1   . PHE D  1 246 ? 47.252  -61.995  -15.784 1.00 17.85 ? 244 PHE B CD1   1 
ATOM   4877  C  CD2   . PHE D  1 246 ? 48.708  -60.109  -15.942 1.00 17.38 ? 244 PHE B CD2   1 
ATOM   4878  C  CE1   . PHE D  1 246 ? 46.163  -61.139  -15.598 1.00 16.62 ? 244 PHE B CE1   1 
ATOM   4879  C  CE2   . PHE D  1 246 ? 47.645  -59.250  -15.771 1.00 19.53 ? 244 PHE B CE2   1 
ATOM   4880  C  CZ    . PHE D  1 246 ? 46.347  -59.783  -15.601 1.00 17.56 ? 244 PHE B CZ    1 
ATOM   4881  N  N     . ILE D  1 247 ? 48.466  -61.843  -19.164 1.00 20.36 ? 245 ILE B N     1 
ATOM   4882  C  CA    . ILE D  1 247 ? 48.241  -60.835  -20.170 1.00 15.72 ? 245 ILE B CA    1 
ATOM   4883  C  C     . ILE D  1 247 ? 46.905  -60.192  -19.851 1.00 19.20 ? 245 ILE B C     1 
ATOM   4884  O  O     . ILE D  1 247 ? 45.899  -60.893  -19.751 1.00 18.16 ? 245 ILE B O     1 
ATOM   4885  C  CB    . ILE D  1 247 ? 48.164  -61.469  -21.570 1.00 16.72 ? 245 ILE B CB    1 
ATOM   4886  C  CG1   . ILE D  1 247 ? 49.479  -62.152  -21.934 1.00 23.05 ? 245 ILE B CG1   1 
ATOM   4887  C  CG2   . ILE D  1 247 ? 47.824  -60.415  -22.660 1.00 17.03 ? 245 ILE B CG2   1 
ATOM   4888  C  CD1   . ILE D  1 247 ? 49.360  -63.033  -23.184 1.00 19.42 ? 245 ILE B CD1   1 
ATOM   4889  N  N     . ALA D  1 248 ? 46.905  -58.866  -19.731 1.00 14.07 ? 246 ALA B N     1 
ATOM   4890  C  CA    . ALA D  1 248 ? 45.684  -58.071  -19.584 1.00 19.68 ? 246 ALA B CA    1 
ATOM   4891  C  C     . ALA D  1 248 ? 45.424  -57.357  -20.916 1.00 22.48 ? 246 ALA B C     1 
ATOM   4892  O  O     . ALA D  1 248 ? 46.363  -56.858  -21.575 1.00 18.85 ? 246 ALA B O     1 
ATOM   4893  C  CB    . ALA D  1 248 ? 45.828  -57.073  -18.465 1.00 21.16 ? 246 ALA B CB    1 
ATOM   4894  N  N     . LEU D  1 249 ? 44.164  -57.331  -21.321 1.00 20.22 ? 247 LEU B N     1 
ATOM   4895  C  CA    . LEU D  1 249 ? 43.737  -56.679  -22.561 1.00 18.34 ? 247 LEU B CA    1 
ATOM   4896  C  C     . LEU D  1 249 ? 42.742  -55.535  -22.243 1.00 21.06 ? 247 LEU B C     1 
ATOM   4897  O  O     . LEU D  1 249 ? 42.061  -55.549  -21.208 1.00 21.88 ? 247 LEU B O     1 
ATOM   4898  C  CB    . LEU D  1 249 ? 43.125  -57.710  -23.511 1.00 18.80 ? 247 LEU B CB    1 
ATOM   4899  C  CG    . LEU D  1 249 ? 44.056  -58.856  -23.938 1.00 21.21 ? 247 LEU B CG    1 
ATOM   4900  C  CD1   . LEU D  1 249 ? 43.280  -60.127  -24.352 1.00 15.48 ? 247 LEU B CD1   1 
ATOM   4901  C  CD2   . LEU D  1 249 ? 44.997  -58.438  -25.049 1.00 24.40 ? 247 LEU B CD2   1 
ATOM   4902  N  N     . GLY D  1 250 ? 42.674  -54.541  -23.127 1.00 28.09 ? 248 GLY B N     1 
ATOM   4903  C  CA    . GLY D  1 250 ? 41.818  -53.387  -22.913 1.00 26.26 ? 248 GLY B CA    1 
ATOM   4904  C  C     . GLY D  1 250 ? 40.441  -53.550  -23.549 1.00 28.65 ? 248 GLY B C     1 
ATOM   4905  O  O     . GLY D  1 250 ? 39.931  -54.663  -23.745 1.00 26.35 ? 248 GLY B O     1 
ATOM   4906  N  N     . LYS D  1 251 ? 39.839  -52.427  -23.894 1.00 26.96 ? 249 LYS B N     1 
ATOM   4907  C  CA    . LYS D  1 251 ? 38.440  -52.403  -24.254 1.00 28.56 ? 249 LYS B CA    1 
ATOM   4908  C  C     . LYS D  1 251 ? 38.239  -52.216  -25.764 1.00 30.10 ? 249 LYS B C     1 
ATOM   4909  O  O     . LYS D  1 251 ? 38.981  -51.459  -26.413 1.00 27.00 ? 249 LYS B O     1 
ATOM   4910  C  CB    . LYS D  1 251 ? 37.805  -51.264  -23.451 1.00 35.55 ? 249 LYS B CB    1 
ATOM   4911  C  CG    . LYS D  1 251 ? 36.402  -50.898  -23.796 1.00 32.25 ? 249 LYS B CG    1 
ATOM   4912  C  CD    . LYS D  1 251 ? 35.975  -49.743  -22.884 1.00 35.17 ? 249 LYS B CD    1 
ATOM   4913  C  CE    . LYS D  1 251 ? 34.459  -49.565  -22.939 1.00 36.62 ? 249 LYS B CE    1 
ATOM   4914  N  NZ    . LYS D  1 251 ? 33.980  -48.565  -21.929 1.00 39.73 ? 249 LYS B NZ    1 
ATOM   4915  N  N     . ILE D  1 252 ? 37.235  -52.891  -26.331 1.00 25.47 ? 250 ILE B N     1 
ATOM   4916  C  CA    . ILE D  1 252 ? 37.014  -52.802  -27.791 1.00 26.80 ? 250 ILE B CA    1 
ATOM   4917  C  C     . ILE D  1 252 ? 36.750  -51.334  -28.092 1.00 30.25 ? 250 ILE B C     1 
ATOM   4918  O  O     . ILE D  1 252 ? 35.994  -50.680  -27.372 1.00 20.83 ? 250 ILE B O     1 
ATOM   4919  C  CB    . ILE D  1 252 ? 35.876  -53.729  -28.328 1.00 24.08 ? 250 ILE B CB    1 
ATOM   4920  C  CG1   . ILE D  1 252 ? 36.331  -55.199  -28.369 1.00 23.20 ? 250 ILE B CG1   1 
ATOM   4921  C  CG2   . ILE D  1 252 ? 35.483  -53.357  -29.754 1.00 17.05 ? 250 ILE B CG2   1 
ATOM   4922  C  CD1   . ILE D  1 252 ? 37.455  -55.467  -29.408 1.00 25.56 ? 250 ILE B CD1   1 
ATOM   4923  N  N     . GLY D  1 253 ? 37.427  -50.810  -29.115 1.00 34.61 ? 251 GLY B N     1 
ATOM   4924  C  CA    . GLY D  1 253 ? 37.381  -49.382  -29.400 1.00 36.30 ? 251 GLY B CA    1 
ATOM   4925  C  C     . GLY D  1 253 ? 38.666  -48.690  -28.960 1.00 43.55 ? 251 GLY B C     1 
ATOM   4926  O  O     . GLY D  1 253 ? 38.783  -47.462  -29.084 1.00 41.78 ? 251 GLY B O     1 
ATOM   4927  N  N     . TYR D  1 254 ? 39.613  -49.480  -28.433 1.00 33.23 ? 252 TYR B N     1 
ATOM   4928  C  CA    . TYR D  1 254 ? 40.993  -49.046  -28.189 1.00 37.81 ? 252 TYR B CA    1 
ATOM   4929  C  C     . TYR D  1 254 ? 41.985  -50.025  -28.781 1.00 37.72 ? 252 TYR B C     1 
ATOM   4930  O  O     . TYR D  1 254 ? 41.673  -51.206  -28.935 1.00 30.94 ? 252 TYR B O     1 
ATOM   4931  C  CB    . TYR D  1 254 ? 41.257  -48.909  -26.701 1.00 38.66 ? 252 TYR B CB    1 
ATOM   4932  C  CG    . TYR D  1 254 ? 40.312  -47.927  -26.102 1.00 40.41 ? 252 TYR B CG    1 
ATOM   4933  C  CD1   . TYR D  1 254 ? 39.045  -48.318  -25.705 1.00 38.10 ? 252 TYR B CD1   1 
ATOM   4934  C  CD2   . TYR D  1 254 ? 40.654  -46.584  -26.001 1.00 50.03 ? 252 TYR B CD2   1 
ATOM   4935  C  CE1   . TYR D  1 254 ? 38.156  -47.415  -25.170 1.00 39.72 ? 252 TYR B CE1   1 
ATOM   4936  C  CE2   . TYR D  1 254 ? 39.768  -45.671  -25.471 1.00 53.31 ? 252 TYR B CE2   1 
ATOM   4937  C  CZ    . TYR D  1 254 ? 38.520  -46.092  -25.054 1.00 46.86 ? 252 TYR B CZ    1 
ATOM   4938  O  OH    . TYR D  1 254 ? 37.639  -45.178  -24.525 1.00 49.63 ? 252 TYR B OH    1 
ATOM   4939  N  N     . LYS D  1 255 ? 43.182  -49.528  -29.097 1.00 39.30 ? 253 LYS B N     1 
ATOM   4940  C  CA    . LYS D  1 255 ? 44.228  -50.353  -29.698 1.00 41.57 ? 253 LYS B CA    1 
ATOM   4941  C  C     . LYS D  1 255 ? 44.619  -51.525  -28.786 1.00 38.11 ? 253 LYS B C     1 
ATOM   4942  O  O     . LYS D  1 255 ? 44.883  -52.639  -29.271 1.00 42.58 ? 253 LYS B O     1 
ATOM   4943  C  CB    . LYS D  1 255 ? 45.450  -49.497  -30.070 1.00 43.19 ? 253 LYS B CB    1 
ATOM   4944  C  CG    . LYS D  1 255 ? 46.753  -50.285  -30.257 1.00 52.59 ? 253 LYS B CG    1 
ATOM   4945  C  CD    . LYS D  1 255 ? 46.613  -51.424  -31.265 1.00 59.96 ? 253 LYS B CD    1 
ATOM   4946  C  CE    . LYS D  1 255 ? 47.912  -52.219  -31.379 1.00 57.74 ? 253 LYS B CE    1 
ATOM   4947  N  NZ    . LYS D  1 255 ? 47.628  -53.621  -31.829 1.00 67.49 ? 253 LYS B NZ    1 
ATOM   4948  N  N     . ASN D  1 256 ? 44.604  -51.300  -27.469 1.00 27.90 ? 254 ASN B N     1 
ATOM   4949  C  CA    . ASN D  1 256 ? 45.083  -52.338  -26.541 1.00 32.63 ? 254 ASN B CA    1 
ATOM   4950  C  C     . ASN D  1 256 ? 44.108  -53.527  -26.322 1.00 28.73 ? 254 ASN B C     1 
ATOM   4951  O  O     . ASN D  1 256 ? 44.421  -54.479  -25.576 1.00 22.84 ? 254 ASN B O     1 
ATOM   4952  C  CB    . ASN D  1 256 ? 45.488  -51.707  -25.202 1.00 32.48 ? 254 ASN B CB    1 
ATOM   4953  C  CG    . ASN D  1 256 ? 44.405  -50.787  -24.642 1.00 36.28 ? 254 ASN B CG    1 
ATOM   4954  O  OD1   . ASN D  1 256 ? 43.222  -50.916  -24.997 1.00 38.79 ? 254 ASN B OD1   1 
ATOM   4955  N  ND2   . ASN D  1 256 ? 44.804  -49.841  -23.765 1.00 32.15 ? 254 ASN B ND2   1 
ATOM   4956  N  N     . ALA D  1 257 ? 42.955  -53.467  -27.001 1.00 23.17 ? 255 ALA B N     1 
ATOM   4957  C  CA    . ALA D  1 257 ? 41.824  -54.399  -26.815 1.00 21.19 ? 255 ALA B CA    1 
ATOM   4958  C  C     . ALA D  1 257 ? 42.046  -55.823  -27.369 1.00 27.78 ? 255 ALA B C     1 
ATOM   4959  O  O     . ALA D  1 257 ? 41.457  -56.798  -26.863 1.00 21.93 ? 255 ALA B O     1 
ATOM   4960  C  CB    . ALA D  1 257 ? 40.569  -53.823  -27.423 1.00 25.97 ? 255 ALA B CB    1 
ATOM   4961  N  N     . ILE D  1 258 ? 42.851  -55.932  -28.425 1.00 24.23 ? 256 ILE B N     1 
ATOM   4962  C  CA    . ILE D  1 258 ? 43.049  -57.190  -29.133 1.00 17.66 ? 256 ILE B CA    1 
ATOM   4963  C  C     . ILE D  1 258 ? 44.534  -57.492  -29.321 1.00 30.12 ? 256 ILE B C     1 
ATOM   4964  O  O     . ILE D  1 258 ? 45.309  -56.626  -29.733 1.00 28.13 ? 256 ILE B O     1 
ATOM   4965  C  CB    . ILE D  1 258 ? 42.418  -57.148  -30.528 1.00 22.70 ? 256 ILE B CB    1 
ATOM   4966  C  CG1   . ILE D  1 258 ? 40.966  -56.696  -30.431 1.00 28.95 ? 256 ILE B CG1   1 
ATOM   4967  C  CG2   . ILE D  1 258 ? 42.503  -58.542  -31.205 1.00 22.11 ? 256 ILE B CG2   1 
ATOM   4968  C  CD1   . ILE D  1 258 ? 40.134  -56.912  -31.721 1.00 22.05 ? 256 ILE B CD1   1 
ATOM   4969  N  N     . SER D  1 259 ? 44.933  -58.722  -29.021 1.00 23.75 ? 257 SER B N     1 
ATOM   4970  C  CA    . SER D  1 259 ? 46.275  -59.155  -29.359 1.00 26.41 ? 257 SER B CA    1 
ATOM   4971  C  C     . SER D  1 259 ? 46.202  -60.595  -29.829 1.00 27.00 ? 257 SER B C     1 
ATOM   4972  O  O     . SER D  1 259 ? 45.117  -61.196  -29.854 1.00 28.34 ? 257 SER B O     1 
ATOM   4973  C  CB    . SER D  1 259 ? 47.241  -58.975  -28.187 1.00 28.07 ? 257 SER B CB    1 
ATOM   4974  O  OG    . SER D  1 259 ? 48.554  -59.304  -28.587 1.00 34.07 ? 257 SER B OG    1 
ATOM   4975  N  N     . TYR D  1 260 ? 47.337  -61.160  -30.211 1.00 23.82 ? 258 TYR B N     1 
ATOM   4976  C  CA    . TYR D  1 260 ? 47.322  -62.503  -30.763 1.00 25.37 ? 258 TYR B CA    1 
ATOM   4977  C  C     . TYR D  1 260 ? 48.365  -63.389  -30.081 1.00 28.84 ? 258 TYR B C     1 
ATOM   4978  O  O     . TYR D  1 260 ? 49.478  -62.957  -29.794 1.00 24.79 ? 258 TYR B O     1 
ATOM   4979  C  CB    . TYR D  1 260 ? 47.552  -62.435  -32.275 1.00 31.99 ? 258 TYR B CB    1 
ATOM   4980  C  CG    . TYR D  1 260 ? 46.536  -61.550  -32.950 1.00 26.60 ? 258 TYR B CG    1 
ATOM   4981  C  CD1   . TYR D  1 260 ? 46.661  -60.166  -32.924 1.00 29.50 ? 258 TYR B CD1   1 
ATOM   4982  C  CD2   . TYR D  1 260 ? 45.411  -62.099  -33.549 1.00 27.60 ? 258 TYR B CD2   1 
ATOM   4983  C  CE1   . TYR D  1 260 ? 45.710  -59.361  -33.513 1.00 22.50 ? 258 TYR B CE1   1 
ATOM   4984  C  CE2   . TYR D  1 260 ? 44.452  -61.313  -34.139 1.00 27.42 ? 258 TYR B CE2   1 
ATOM   4985  C  CZ    . TYR D  1 260 ? 44.594  -59.950  -34.112 1.00 27.19 ? 258 TYR B CZ    1 
ATOM   4986  O  OH    . TYR D  1 260 ? 43.604  -59.200  -34.713 1.00 27.32 ? 258 TYR B OH    1 
ATOM   4987  N  N     . LEU D  1 261 ? 47.974  -64.619  -29.783 1.00 20.78 ? 259 LEU B N     1 
ATOM   4988  C  CA    . LEU D  1 261 ? 48.926  -65.626  -29.346 1.00 24.97 ? 259 LEU B CA    1 
ATOM   4989  C  C     . LEU D  1 261 ? 49.257  -66.449  -30.575 1.00 26.46 ? 259 LEU B C     1 
ATOM   4990  O  O     . LEU D  1 261 ? 48.346  -66.881  -31.282 1.00 27.09 ? 259 LEU B O     1 
ATOM   4991  C  CB    . LEU D  1 261 ? 48.307  -66.537  -28.288 1.00 20.81 ? 259 LEU B CB    1 
ATOM   4992  C  CG    . LEU D  1 261 ? 47.913  -65.956  -26.939 1.00 26.56 ? 259 LEU B CG    1 
ATOM   4993  C  CD1   . LEU D  1 261 ? 47.080  -66.938  -26.185 1.00 23.02 ? 259 LEU B CD1   1 
ATOM   4994  C  CD2   . LEU D  1 261 ? 49.129  -65.613  -26.117 1.00 30.74 ? 259 LEU B CD2   1 
ATOM   4995  N  N     . ASP D  1 262 ? 50.539  -66.678  -30.848 1.00 29.95 ? 260 ASP B N     1 
ATOM   4996  C  CA    . ASP D  1 262 ? 50.899  -67.587  -31.925 1.00 24.08 ? 260 ASP B CA    1 
ATOM   4997  C  C     . ASP D  1 262 ? 51.412  -68.858  -31.258 1.00 30.07 ? 260 ASP B C     1 
ATOM   4998  O  O     . ASP D  1 262 ? 52.575  -68.914  -30.876 1.00 32.27 ? 260 ASP B O     1 
ATOM   4999  C  CB    . ASP D  1 262 ? 51.978  -66.957  -32.831 1.00 34.17 ? 260 ASP B CB    1 
ATOM   5000  C  CG    . ASP D  1 262 ? 51.570  -65.580  -33.370 1.00 34.49 ? 260 ASP B CG    1 
ATOM   5001  O  OD1   . ASP D  1 262 ? 50.440  -65.453  -33.890 1.00 33.54 ? 260 ASP B OD1   1 
ATOM   5002  O  OD2   . ASP D  1 262 ? 52.361  -64.615  -33.239 1.00 40.33 ? 260 ASP B OD2   1 
ATOM   5003  N  N     . LEU D  1 263 ? 50.530  -69.852  -31.092 1.00 24.29 ? 261 LEU B N     1 
ATOM   5004  C  CA    . LEU D  1 263 ? 50.854  -71.105  -30.388 1.00 31.17 ? 261 LEU B CA    1 
ATOM   5005  C  C     . LEU D  1 263 ? 51.148  -72.292  -31.333 1.00 32.90 ? 261 LEU B C     1 
ATOM   5006  O  O     . LEU D  1 263 ? 50.608  -72.356  -32.445 1.00 32.63 ? 261 LEU B O     1 
ATOM   5007  C  CB    . LEU D  1 263 ? 49.722  -71.486  -29.434 1.00 23.57 ? 261 LEU B CB    1 
ATOM   5008  C  CG    . LEU D  1 263 ? 49.757  -71.068  -27.956 1.00 27.71 ? 261 LEU B CG    1 
ATOM   5009  C  CD1   . LEU D  1 263 ? 50.491  -69.786  -27.741 1.00 23.50 ? 261 LEU B CD1   1 
ATOM   5010  C  CD2   . LEU D  1 263 ? 48.347  -71.006  -27.350 1.00 25.57 ? 261 LEU B CD2   1 
ATOM   5011  N  N     . PRO D  1 264 ? 52.020  -73.228  -30.896 1.00 32.45 ? 262 PRO B N     1 
ATOM   5012  C  CA    . PRO D  1 264 ? 52.178  -74.433  -31.707 1.00 34.70 ? 262 PRO B CA    1 
ATOM   5013  C  C     . PRO D  1 264 ? 50.845  -75.095  -32.029 1.00 32.38 ? 262 PRO B C     1 
ATOM   5014  O  O     . PRO D  1 264 ? 49.955  -75.214  -31.172 1.00 31.54 ? 262 PRO B O     1 
ATOM   5015  C  CB    . PRO D  1 264 ? 53.038  -75.362  -30.815 1.00 38.47 ? 262 PRO B CB    1 
ATOM   5016  C  CG    . PRO D  1 264 ? 53.200  -74.632  -29.488 1.00 38.53 ? 262 PRO B CG    1 
ATOM   5017  C  CD    . PRO D  1 264 ? 53.010  -73.186  -29.802 1.00 34.06 ? 262 PRO B CD    1 
ATOM   5018  N  N     . LEU D  1 265 ? 50.726  -75.526  -33.277 1.00 30.62 ? 263 LEU B N     1 
ATOM   5019  C  CA    . LEU D  1 265 ? 49.614  -76.343  -33.696 1.00 30.82 ? 263 LEU B CA    1 
ATOM   5020  C  C     . LEU D  1 265 ? 50.085  -77.794  -33.875 1.00 38.64 ? 263 LEU B C     1 
ATOM   5021  O  O     . LEU D  1 265 ? 50.669  -78.132  -34.903 1.00 41.40 ? 263 LEU B O     1 
ATOM   5022  C  CB    . LEU D  1 265 ? 49.029  -75.795  -34.998 1.00 30.31 ? 263 LEU B CB    1 
ATOM   5023  C  CG    . LEU D  1 265 ? 47.854  -76.578  -35.580 1.00 35.86 ? 263 LEU B CG    1 
ATOM   5024  C  CD1   . LEU D  1 265 ? 46.746  -76.724  -34.552 1.00 33.10 ? 263 LEU B CD1   1 
ATOM   5025  C  CD2   . LEU D  1 265 ? 47.339  -75.882  -36.820 1.00 32.32 ? 263 LEU B CD2   1 
ATOM   5026  N  N     . LYS D  1 266 ? 49.851  -78.645  -32.876 1.00 42.06 ? 264 LYS B N     1 
ATOM   5027  C  CA    . LYS D  1 266 ? 50.209  -80.065  -33.003 1.00 47.88 ? 264 LYS B CA    1 
ATOM   5028  C  C     . LYS D  1 266 ? 49.149  -80.819  -33.807 1.00 43.21 ? 264 LYS B C     1 
ATOM   5029  O  O     . LYS D  1 266 ? 49.487  -81.560  -34.729 1.00 53.11 ? 264 LYS B O     1 
ATOM   5030  C  CB    . LYS D  1 266 ? 50.443  -80.733  -31.635 1.00 52.69 ? 264 LYS B CB    1 
ATOM   5031  C  CG    . LYS D  1 266 ? 51.131  -82.108  -31.744 1.00 60.25 ? 264 LYS B CG    1 
ATOM   5032  C  CD    . LYS D  1 266 ? 51.361  -82.806  -30.388 1.00 73.01 ? 264 LYS B CD    1 
ATOM   5033  C  CE    . LYS D  1 266 ? 50.055  -83.327  -29.757 1.00 67.95 ? 264 LYS B CE    1 
ATOM   5034  N  NZ    . LYS D  1 266 ? 50.289  -84.364  -28.699 1.00 69.22 ? 264 LYS B NZ    1 
ATOM   5035  N  N     . GLN D  1 267 ? 47.873  -80.625  -33.467 1.00 45.02 ? 265 GLN B N     1 
ATOM   5036  C  CA    . GLN D  1 267 ? 46.775  -81.202  -34.259 1.00 43.43 ? 265 GLN B CA    1 
ATOM   5037  C  C     . GLN D  1 267 ? 45.589  -80.255  -34.299 1.00 38.78 ? 265 GLN B C     1 
ATOM   5038  O  O     . GLN D  1 267 ? 45.291  -79.593  -33.304 1.00 40.18 ? 265 GLN B O     1 
ATOM   5039  C  CB    . GLN D  1 267 ? 46.325  -82.545  -33.696 1.00 39.66 ? 265 GLN B CB    1 
ATOM   5040  C  CG    . GLN D  1 267 ? 45.185  -82.435  -32.686 1.00 41.62 ? 265 GLN B CG    1 
ATOM   5041  C  CD    . GLN D  1 267 ? 45.625  -82.774  -31.263 1.00 54.77 ? 265 GLN B CD    1 
ATOM   5042  O  OE1   . GLN D  1 267 ? 46.830  -82.857  -30.970 1.00 56.50 ? 265 GLN B OE1   1 
ATOM   5043  N  NE2   . GLN D  1 267 ? 44.644  -82.985  -30.368 1.00 56.09 ? 265 GLN B NE2   1 
ATOM   5044  N  N     . LYS D  1 268 ? 44.912  -80.184  -35.440 1.00 33.70 ? 266 LYS B N     1 
ATOM   5045  C  CA    . LYS D  1 268 ? 43.741  -79.335  -35.569 1.00 32.64 ? 266 LYS B CA    1 
ATOM   5046  C  C     . LYS D  1 268 ? 42.501  -80.149  -35.156 1.00 36.60 ? 266 LYS B C     1 
ATOM   5047  O  O     . LYS D  1 268 ? 42.296  -81.262  -35.645 1.00 34.34 ? 266 LYS B O     1 
ATOM   5048  C  CB    . LYS D  1 268 ? 43.636  -78.826  -37.012 1.00 34.66 ? 266 LYS B CB    1 
ATOM   5049  C  CG    . LYS D  1 268 ? 42.581  -77.749  -37.225 1.00 43.59 ? 266 LYS B CG    1 
ATOM   5050  C  CD    . LYS D  1 268 ? 42.450  -77.312  -38.696 1.00 43.18 ? 266 LYS B CD    1 
ATOM   5051  C  CE    . LYS D  1 268 ? 41.071  -76.704  -38.908 1.00 53.53 ? 266 LYS B CE    1 
ATOM   5052  N  NZ    . LYS D  1 268 ? 40.860  -76.130  -40.273 1.00 63.46 ? 266 LYS B NZ    1 
ATOM   5053  N  N     . THR D  1 269 ? 41.681  -79.611  -34.253 1.00 30.63 ? 267 THR B N     1 
ATOM   5054  C  CA    . THR D  1 269 ? 40.594  -80.384  -33.668 1.00 29.22 ? 267 THR B CA    1 
ATOM   5055  C  C     . THR D  1 269 ? 39.422  -79.507  -33.289 1.00 32.30 ? 267 THR B C     1 
ATOM   5056  O  O     . THR D  1 269 ? 39.590  -78.477  -32.644 1.00 34.23 ? 267 THR B O     1 
ATOM   5057  C  CB    . THR D  1 269 ? 41.052  -81.067  -32.383 1.00 29.15 ? 267 THR B CB    1 
ATOM   5058  O  OG1   . THR D  1 269 ? 42.470  -81.246  -32.409 1.00 35.49 ? 267 THR B OG1   1 
ATOM   5059  C  CG2   . THR D  1 269 ? 40.399  -82.401  -32.246 1.00 31.66 ? 267 THR B CG2   1 
ATOM   5060  N  N     . ASP D  1 270 ? 38.230  -79.940  -33.664 1.00 28.59 ? 268 ASP B N     1 
ATOM   5061  C  CA    . ASP D  1 270 ? 37.023  -79.230  -33.332 1.00 27.74 ? 268 ASP B CA    1 
ATOM   5062  C  C     . ASP D  1 270 ? 36.923  -78.941  -31.838 1.00 25.50 ? 268 ASP B C     1 
ATOM   5063  O  O     . ASP D  1 270 ? 37.636  -79.534  -31.027 1.00 26.31 ? 268 ASP B O     1 
ATOM   5064  C  CB    . ASP D  1 270 ? 35.822  -80.046  -33.801 1.00 32.08 ? 268 ASP B CB    1 
ATOM   5065  C  CG    . ASP D  1 270 ? 35.770  -80.175  -35.321 1.00 33.14 ? 268 ASP B CG    1 
ATOM   5066  O  OD1   . ASP D  1 270 ? 36.396  -79.327  -35.993 1.00 32.76 ? 268 ASP B OD1   1 
ATOM   5067  O  OD2   . ASP D  1 270 ? 35.114  -81.107  -35.837 1.00 41.26 ? 268 ASP B OD2   1 
ATOM   5068  N  N     . LEU D  1 271 ? 36.023  -78.036  -31.480 1.00 29.05 ? 269 LEU B N     1 
ATOM   5069  C  CA    . LEU D  1 271 ? 35.865  -77.659  -30.092 1.00 25.39 ? 269 LEU B CA    1 
ATOM   5070  C  C     . LEU D  1 271 ? 35.255  -78.849  -29.356 1.00 20.81 ? 269 LEU B C     1 
ATOM   5071  O  O     . LEU D  1 271 ? 34.238  -79.402  -29.790 1.00 15.80 ? 269 LEU B O     1 
ATOM   5072  C  CB    . LEU D  1 271 ? 34.988  -76.419  -29.980 1.00 17.22 ? 269 LEU B CB    1 
ATOM   5073  C  CG    . LEU D  1 271 ? 34.518  -76.042  -28.571 1.00 17.83 ? 269 LEU B CG    1 
ATOM   5074  C  CD1   . LEU D  1 271 ? 35.663  -75.497  -27.686 1.00 11.02 ? 269 LEU B CD1   1 
ATOM   5075  C  CD2   . LEU D  1 271 ? 33.363  -75.044  -28.646 1.00 18.38 ? 269 LEU B CD2   1 
ATOM   5076  N  N     . GLU D  1 272 ? 35.920  -79.277  -28.279 1.00 16.55 ? 270 GLU B N     1 
ATOM   5077  C  CA    . GLU D  1 272 ? 35.454  -80.396  -27.435 1.00 16.35 ? 270 GLU B CA    1 
ATOM   5078  C  C     . GLU D  1 272 ? 35.353  -80.039  -25.971 1.00 19.00 ? 270 GLU B C     1 
ATOM   5079  O  O     . GLU D  1 272 ? 36.000  -79.095  -25.508 1.00 13.46 ? 270 GLU B O     1 
ATOM   5080  C  CB    . GLU D  1 272 ? 36.393  -81.597  -27.571 1.00 15.61 ? 270 GLU B CB    1 
ATOM   5081  C  CG    . GLU D  1 272 ? 36.400  -82.128  -28.991 1.00 17.75 ? 270 GLU B CG    1 
ATOM   5082  C  CD    . GLU D  1 272 ? 37.375  -83.274  -29.204 1.00 32.43 ? 270 GLU B CD    1 
ATOM   5083  O  OE1   . GLU D  1 272 ? 37.935  -83.788  -28.207 1.00 29.05 ? 270 GLU B OE1   1 
ATOM   5084  O  OE2   . GLU D  1 272 ? 37.585  -83.632  -30.388 1.00 38.03 ? 270 GLU B OE2   1 
ATOM   5085  N  N     . TYR D  1 273 ? 34.548  -80.797  -25.234 1.00 15.07 ? 271 TYR B N     1 
ATOM   5086  C  CA    . TYR D  1 273 ? 34.585  -80.708  -23.776 1.00 15.39 ? 271 TYR B CA    1 
ATOM   5087  C  C     . TYR D  1 273 ? 35.895  -81.350  -23.296 1.00 16.87 ? 271 TYR B C     1 
ATOM   5088  O  O     . TYR D  1 273 ? 36.427  -82.249  -23.946 1.00 15.55 ? 271 TYR B O     1 
ATOM   5089  C  CB    . TYR D  1 273 ? 33.384  -81.419  -23.165 1.00 15.74 ? 271 TYR B CB    1 
ATOM   5090  C  CG    . TYR D  1 273 ? 32.050  -80.970  -23.688 1.00 17.57 ? 271 TYR B CG    1 
ATOM   5091  C  CD1   . TYR D  1 273 ? 31.432  -79.841  -23.159 1.00 15.27 ? 271 TYR B CD1   1 
ATOM   5092  C  CD2   . TYR D  1 273 ? 31.378  -81.682  -24.677 1.00 17.06 ? 271 TYR B CD2   1 
ATOM   5093  C  CE1   . TYR D  1 273 ? 30.213  -79.417  -23.596 1.00 11.57 ? 271 TYR B CE1   1 
ATOM   5094  C  CE2   . TYR D  1 273 ? 30.103  -81.235  -25.169 1.00 12.97 ? 271 TYR B CE2   1 
ATOM   5095  C  CZ    . TYR D  1 273 ? 29.550  -80.088  -24.615 1.00 16.21 ? 271 TYR B CZ    1 
ATOM   5096  O  OH    . TYR D  1 273 ? 28.283  -79.610  -24.995 1.00 20.67 ? 271 TYR B OH    1 
ATOM   5097  N  N     . ASP D  1 274 ? 36.442  -80.861  -22.186 1.00 16.61 ? 272 ASP B N     1 
ATOM   5098  C  CA    . ASP D  1 274 ? 37.659  -81.424  -21.663 1.00 18.63 ? 272 ASP B CA    1 
ATOM   5099  C  C     . ASP D  1 274 ? 37.249  -82.630  -20.830 1.00 12.58 ? 272 ASP B C     1 
ATOM   5100  O  O     . ASP D  1 274 ? 36.343  -82.515  -20.028 1.00 13.66 ? 272 ASP B O     1 
ATOM   5101  C  CB    . ASP D  1 274 ? 38.400  -80.403  -20.781 1.00 17.29 ? 272 ASP B CB    1 
ATOM   5102  C  CG    . ASP D  1 274 ? 39.656  -80.994  -20.142 1.00 14.07 ? 272 ASP B CG    1 
ATOM   5103  O  OD1   . ASP D  1 274 ? 40.642  -81.289  -20.885 1.00 17.44 ? 272 ASP B OD1   1 
ATOM   5104  O  OD2   . ASP D  1 274 ? 39.624  -81.144  -18.902 1.00 17.10 ? 272 ASP B OD2   1 
ATOM   5105  N  N     . LYS D  1 275 ? 37.900  -83.776  -21.025 1.00 18.21 ? 273 LYS B N     1 
ATOM   5106  C  CA    . LYS D  1 275 ? 37.486  -85.000  -20.322 1.00 20.13 ? 273 LYS B CA    1 
ATOM   5107  C  C     . LYS D  1 275 ? 37.556  -84.856  -18.792 1.00 15.30 ? 273 LYS B C     1 
ATOM   5108  O  O     . LYS D  1 275 ? 36.595  -85.182  -18.067 1.00 15.52 ? 273 LYS B O     1 
ATOM   5109  C  CB    . LYS D  1 275 ? 38.349  -86.180  -20.785 1.00 17.99 ? 273 LYS B CB    1 
ATOM   5110  C  CG    . LYS D  1 275 ? 37.895  -86.803  -22.102 1.00 24.88 ? 273 LYS B CG    1 
ATOM   5111  C  CD    . LYS D  1 275 ? 39.044  -87.570  -22.729 1.00 30.51 ? 273 LYS B CD    1 
ATOM   5112  C  CE    . LYS D  1 275 ? 38.815  -87.787  -24.212 1.00 32.75 ? 273 LYS B CE    1 
ATOM   5113  N  NZ    . LYS D  1 275 ? 39.408  -86.699  -25.052 1.00 29.74 ? 273 LYS B NZ    1 
ATOM   5114  N  N     . ASP D  1 276 ? 38.715  -84.414  -18.283 1.00 22.47 ? 274 ASP B N     1 
ATOM   5115  C  CA    . ASP D  1 276 ? 38.833  -84.177  -16.843 1.00 15.46 ? 274 ASP B CA    1 
ATOM   5116  C  C     . ASP D  1 276 ? 37.689  -83.295  -16.319 1.00 17.69 ? 274 ASP B C     1 
ATOM   5117  O  O     . ASP D  1 276 ? 37.112  -83.542  -15.251 1.00 15.09 ? 274 ASP B O     1 
ATOM   5118  C  CB    . ASP D  1 276 ? 40.207  -83.598  -16.480 1.00 18.81 ? 274 ASP B CB    1 
ATOM   5119  C  CG    . ASP D  1 276 ? 41.309  -84.632  -16.581 1.00 20.29 ? 274 ASP B CG    1 
ATOM   5120  O  OD1   . ASP D  1 276 ? 41.037  -85.802  -16.241 1.00 23.56 ? 274 ASP B OD1   1 
ATOM   5121  O  OD2   . ASP D  1 276 ? 42.408  -84.304  -17.050 1.00 29.16 ? 274 ASP B OD2   1 
ATOM   5122  N  N     . TRP D  1 277 ? 37.309  -82.285  -17.093 1.00 14.41 ? 275 TRP B N     1 
ATOM   5123  C  CA    . TRP D  1 277 ? 36.310  -81.366  -16.605 1.00 16.39 ? 275 TRP B CA    1 
ATOM   5124  C  C     . TRP D  1 277 ? 34.980  -82.083  -16.528 1.00 14.72 ? 275 TRP B C     1 
ATOM   5125  O  O     . TRP D  1 277 ? 34.203  -81.884  -15.592 1.00 15.29 ? 275 TRP B O     1 
ATOM   5126  C  CB    . TRP D  1 277 ? 36.208  -80.097  -17.498 1.00 15.10 ? 275 TRP B CB    1 
ATOM   5127  C  CG    . TRP D  1 277 ? 34.955  -79.350  -17.231 1.00 12.76 ? 275 TRP B CG    1 
ATOM   5128  C  CD1   . TRP D  1 277 ? 33.857  -79.250  -18.064 1.00 16.33 ? 275 TRP B CD1   1 
ATOM   5129  C  CD2   . TRP D  1 277 ? 34.608  -78.655  -16.036 1.00 13.39 ? 275 TRP B CD2   1 
ATOM   5130  N  NE1   . TRP D  1 277 ? 32.885  -78.506  -17.460 1.00 15.54 ? 275 TRP B NE1   1 
ATOM   5131  C  CE2   . TRP D  1 277 ? 33.315  -78.134  -16.204 1.00 18.14 ? 275 TRP B CE2   1 
ATOM   5132  C  CE3   . TRP D  1 277 ? 35.259  -78.440  -14.813 1.00 15.53 ? 275 TRP B CE3   1 
ATOM   5133  C  CZ2   . TRP D  1 277 ? 32.656  -77.396  -15.203 1.00 20.32 ? 275 TRP B CZ2   1 
ATOM   5134  C  CZ3   . TRP D  1 277 ? 34.624  -77.689  -13.832 1.00 13.43 ? 275 TRP B CZ3   1 
ATOM   5135  C  CH2   . TRP D  1 277 ? 33.341  -77.178  -14.031 1.00 14.42 ? 275 TRP B CH2   1 
ATOM   5136  N  N     . VAL D  1 278 ? 34.691  -82.877  -17.553 1.00 14.83 ? 276 VAL B N     1 
ATOM   5137  C  CA    . VAL D  1 278 ? 33.405  -83.582  -17.641 1.00 14.60 ? 276 VAL B CA    1 
ATOM   5138  C  C     . VAL D  1 278 ? 33.301  -84.504  -16.417 1.00 16.85 ? 276 VAL B C     1 
ATOM   5139  O  O     . VAL D  1 278 ? 32.264  -84.563  -15.745 1.00 17.58 ? 276 VAL B O     1 
ATOM   5140  C  CB    . VAL D  1 278 ? 33.324  -84.396  -18.981 1.00 13.01 ? 276 VAL B CB    1 
ATOM   5141  C  CG1   . VAL D  1 278 ? 32.468  -85.607  -18.853 1.00 12.97 ? 276 VAL B CG1   1 
ATOM   5142  C  CG2   . VAL D  1 278 ? 32.843  -83.505  -20.133 1.00 12.42 ? 276 VAL B CG2   1 
ATOM   5143  N  N     . CYS D  1 279 ? 34.399  -85.200  -16.128 1.00 14.21 ? 277 CYS B N     1 
ATOM   5144  C  CA    . CYS D  1 279 ? 34.438  -86.064  -14.921 1.00 16.03 ? 277 CYS B CA    1 
ATOM   5145  C  C     . CYS D  1 279 ? 34.102  -85.282  -13.650 1.00 14.48 ? 277 CYS B C     1 
ATOM   5146  O  O     . CYS D  1 279 ? 33.233  -85.671  -12.861 1.00 16.14 ? 277 CYS B O     1 
ATOM   5147  C  CB    . CYS D  1 279 ? 35.793  -86.757  -14.818 1.00 13.87 ? 277 CYS B CB    1 
ATOM   5148  S  SG    . CYS D  1 279 ? 35.996  -88.012  -16.158 1.00 24.45 ? 277 CYS B SG    1 
ATOM   5149  N  N     . ASN D  1 280 ? 34.722  -84.122  -13.496 1.00 13.88 ? 278 ASN B N     1 
ATOM   5150  C  CA    . ASN D  1 280 ? 34.422  -83.232  -12.382 1.00 15.96 ? 278 ASN B CA    1 
ATOM   5151  C  C     . ASN D  1 280 ? 32.983  -82.874  -12.327 1.00 16.11 ? 278 ASN B C     1 
ATOM   5152  O  O     . ASN D  1 280 ? 32.366  -82.883  -11.257 1.00 15.77 ? 278 ASN B O     1 
ATOM   5153  C  CB    . ASN D  1 280 ? 35.235  -81.927  -12.498 1.00 16.88 ? 278 ASN B CB    1 
ATOM   5154  C  CG    . ASN D  1 280 ? 36.685  -82.092  -12.054 1.00 23.07 ? 278 ASN B CG    1 
ATOM   5155  O  OD1   . ASN D  1 280 ? 37.124  -83.202  -11.755 1.00 18.60 ? 278 ASN B OD1   1 
ATOM   5156  N  ND2   . ASN D  1 280 ? 37.438  -80.977  -12.022 1.00 19.58 ? 278 ASN B ND2   1 
ATOM   5157  N  N     . LEU D  1 281 ? 32.448  -82.509  -13.491 1.00 17.45 ? 279 LEU B N     1 
ATOM   5158  C  CA    . LEU D  1 281 ? 31.076  -81.989  -13.562 1.00 15.88 ? 279 LEU B CA    1 
ATOM   5159  C  C     . LEU D  1 281 ? 30.080  -83.081  -13.115 1.00 14.03 ? 279 LEU B C     1 
ATOM   5160  O  O     . LEU D  1 281 ? 29.121  -82.813  -12.382 1.00 16.31 ? 279 LEU B O     1 
ATOM   5161  C  CB    . LEU D  1 281 ? 30.781  -81.504  -15.005 1.00 16.80 ? 279 LEU B CB    1 
ATOM   5162  C  CG    . LEU D  1 281 ? 29.405  -80.976  -15.423 1.00 18.68 ? 279 LEU B CG    1 
ATOM   5163  C  CD1   . LEU D  1 281 ? 28.975  -79.719  -14.625 1.00 16.50 ? 279 LEU B CD1   1 
ATOM   5164  C  CD2   . LEU D  1 281 ? 29.367  -80.677  -16.930 1.00 21.23 ? 279 LEU B CD2   1 
ATOM   5165  N  N     . ILE D  1 282 ? 30.306  -84.307  -13.554 1.00 18.45 ? 280 ILE B N     1 
ATOM   5166  C  CA    . ILE D  1 282 ? 29.396  -85.418  -13.167 1.00 17.67 ? 280 ILE B CA    1 
ATOM   5167  C  C     . ILE D  1 282 ? 29.630  -85.858  -11.714 1.00 16.07 ? 280 ILE B C     1 
ATOM   5168  O  O     . ILE D  1 282 ? 28.681  -86.109  -10.966 1.00 19.03 ? 280 ILE B O     1 
ATOM   5169  C  CB    . ILE D  1 282 ? 29.515  -86.632  -14.117 1.00 20.68 ? 280 ILE B CB    1 
ATOM   5170  C  CG1   . ILE D  1 282 ? 28.541  -86.478  -15.295 1.00 16.17 ? 280 ILE B CG1   1 
ATOM   5171  C  CG2   . ILE D  1 282 ? 29.203  -87.948  -13.368 1.00 18.08 ? 280 ILE B CG2   1 
ATOM   5172  C  CD1   . ILE D  1 282 ? 28.988  -85.449  -16.288 1.00 19.55 ? 280 ILE B CD1   1 
ATOM   5173  N  N     . MET D  1 283 ? 30.884  -85.922  -11.292 1.00 18.43 ? 281 MET B N     1 
ATOM   5174  C  CA    . MET D  1 283 ? 31.133  -86.369  -9.913  1.00 18.61 ? 281 MET B CA    1 
ATOM   5175  C  C     . MET D  1 283 ? 30.604  -85.371  -8.882  1.00 18.27 ? 281 MET B C     1 
ATOM   5176  O  O     . MET D  1 283 ? 30.395  -85.708  -7.727  1.00 20.55 ? 281 MET B O     1 
ATOM   5177  C  CB    . MET D  1 283 ? 32.608  -86.747  -9.716  1.00 12.95 ? 281 MET B CB    1 
ATOM   5178  C  CG    . MET D  1 283 ? 33.052  -87.896  -10.613 1.00 16.27 ? 281 MET B CG    1 
ATOM   5179  S  SD    . MET D  1 283 ? 32.202  -89.467  -10.138 1.00 20.71 ? 281 MET B SD    1 
ATOM   5180  C  CE    . MET D  1 283 ? 33.370  -89.977  -8.851  1.00 26.77 ? 281 MET B CE    1 
ATOM   5181  N  N     . THR D  1 284 ? 30.306  -84.146  -9.294  1.00 19.71 ? 282 THR B N     1 
ATOM   5182  C  CA    . THR D  1 284 ? 29.790  -83.189  -8.316  1.00 15.76 ? 282 THR B CA    1 
ATOM   5183  C  C     . THR D  1 284 ? 28.289  -82.991  -8.379  1.00 18.71 ? 282 THR B C     1 
ATOM   5184  O  O     . THR D  1 284 ? 27.747  -82.133  -7.693  1.00 16.81 ? 282 THR B O     1 
ATOM   5185  C  CB    . THR D  1 284 ? 30.501  -81.833  -8.458  1.00 23.86 ? 282 THR B CB    1 
ATOM   5186  O  OG1   . THR D  1 284 ? 30.520  -81.450  -9.842  1.00 18.21 ? 282 THR B OG1   1 
ATOM   5187  C  CG2   . THR D  1 284 ? 31.934  -81.982  -8.005  1.00 18.21 ? 282 THR B CG2   1 
ATOM   5188  N  N     . TRP D  1 285 ? 27.628  -83.778  -9.223  1.00 14.92 ? 283 TRP B N     1 
ATOM   5189  C  CA    . TRP D  1 285 ? 26.191  -83.690  -9.391  1.00 22.04 ? 283 TRP B CA    1 
ATOM   5190  C  C     . TRP D  1 285 ? 25.404  -83.553  -8.077  1.00 19.27 ? 283 TRP B C     1 
ATOM   5191  O  O     . TRP D  1 285 ? 24.463  -82.755  -7.966  1.00 17.83 ? 283 TRP B O     1 
ATOM   5192  C  CB    . TRP D  1 285 ? 25.665  -84.910  -10.166 1.00 18.56 ? 283 TRP B CB    1 
ATOM   5193  C  CG    . TRP D  1 285 ? 24.194  -85.022  -10.012 1.00 19.05 ? 283 TRP B CG    1 
ATOM   5194  C  CD1   . TRP D  1 285 ? 23.502  -85.997  -9.332  1.00 24.24 ? 283 TRP B CD1   1 
ATOM   5195  C  CD2   . TRP D  1 285 ? 23.215  -84.106  -10.510 1.00 23.09 ? 283 TRP B CD2   1 
ATOM   5196  N  NE1   . TRP D  1 285 ? 22.146  -85.748  -9.410  1.00 21.97 ? 283 TRP B NE1   1 
ATOM   5197  C  CE2   . TRP D  1 285 ? 21.947  -84.589  -10.126 1.00 24.04 ? 283 TRP B CE2   1 
ATOM   5198  C  CE3   . TRP D  1 285 ? 23.283  -82.925  -11.263 1.00 23.98 ? 283 TRP B CE3   1 
ATOM   5199  C  CZ2   . TRP D  1 285 ? 20.758  -83.920  -10.451 1.00 25.94 ? 283 TRP B CZ2   1 
ATOM   5200  C  CZ3   . TRP D  1 285 ? 22.104  -82.265  -11.599 1.00 22.78 ? 283 TRP B CZ3   1 
ATOM   5201  C  CH2   . TRP D  1 285 ? 20.854  -82.764  -11.192 1.00 23.79 ? 283 TRP B CH2   1 
ATOM   5202  N  N     . PRO D  1 286 ? 25.783  -84.331  -7.053  1.00 22.73 ? 284 PRO B N     1 
ATOM   5203  C  CA    . PRO D  1 286 ? 24.951  -84.269  -5.826  1.00 19.21 ? 284 PRO B CA    1 
ATOM   5204  C  C     . PRO D  1 286 ? 24.905  -82.866  -5.192  1.00 20.70 ? 284 PRO B C     1 
ATOM   5205  O  O     . PRO D  1 286 ? 23.971  -82.552  -4.458  1.00 21.45 ? 284 PRO B O     1 
ATOM   5206  C  CB    . PRO D  1 286 ? 25.672  -85.246  -4.862  1.00 25.92 ? 284 PRO B CB    1 
ATOM   5207  C  CG    . PRO D  1 286 ? 26.490  -86.200  -5.784  1.00 26.57 ? 284 PRO B CG    1 
ATOM   5208  C  CD    . PRO D  1 286 ? 26.894  -85.297  -6.962  1.00 18.38 ? 284 PRO B CD    1 
ATOM   5209  N  N     . ALA D  1 287 ? 25.925  -82.038  -5.454  1.00 19.25 ? 285 ALA B N     1 
ATOM   5210  C  CA    . ALA D  1 287 ? 25.995  -80.706  -4.866  1.00 17.77 ? 285 ALA B CA    1 
ATOM   5211  C  C     . ALA D  1 287 ? 25.148  -79.767  -5.698  1.00 20.93 ? 285 ALA B C     1 
ATOM   5212  O  O     . ALA D  1 287 ? 24.805  -78.664  -5.258  1.00 22.75 ? 285 ALA B O     1 
ATOM   5213  C  CB    . ALA D  1 287 ? 27.466  -80.201  -4.787  1.00 18.56 ? 285 ALA B CB    1 
ATOM   5214  N  N     . PHE D  1 288 ? 24.833  -80.199  -6.917  1.00 17.79 ? 286 PHE B N     1 
ATOM   5215  C  CA    . PHE D  1 288 ? 24.057  -79.368  -7.828  1.00 19.60 ? 286 PHE B CA    1 
ATOM   5216  C  C     . PHE D  1 288 ? 22.665  -79.906  -8.111  1.00 24.02 ? 286 PHE B C     1 
ATOM   5217  O  O     . PHE D  1 288 ? 22.012  -79.436  -9.041  1.00 20.93 ? 286 PHE B O     1 
ATOM   5218  C  CB    . PHE D  1 288 ? 24.799  -79.209  -9.171  1.00 17.83 ? 286 PHE B CB    1 
ATOM   5219  C  CG    . PHE D  1 288 ? 26.045  -78.342  -9.071  1.00 15.39 ? 286 PHE B CG    1 
ATOM   5220  C  CD1   . PHE D  1 288 ? 27.259  -78.899  -8.651  1.00 17.40 ? 286 PHE B CD1   1 
ATOM   5221  C  CD2   . PHE D  1 288 ? 25.985  -76.986  -9.351  1.00 21.81 ? 286 PHE B CD2   1 
ATOM   5222  C  CE1   . PHE D  1 288 ? 28.414  -78.121  -8.539  1.00 24.04 ? 286 PHE B CE1   1 
ATOM   5223  C  CE2   . PHE D  1 288 ? 27.146  -76.169  -9.237  1.00 17.76 ? 286 PHE B CE2   1 
ATOM   5224  C  CZ    . PHE D  1 288 ? 28.355  -76.757  -8.821  1.00 16.30 ? 286 PHE B CZ    1 
ATOM   5225  N  N     . SER D  1 289 ? 22.208  -80.875  -7.316  1.00 22.97 ? 287 SER B N     1 
ATOM   5226  C  CA    . SER D  1 289 ? 20.970  -81.613  -7.629  1.00 25.26 ? 287 SER B CA    1 
ATOM   5227  C  C     . SER D  1 289 ? 19.706  -80.813  -7.423  1.00 24.71 ? 287 SER B C     1 
ATOM   5228  O  O     . SER D  1 289 ? 18.655  -81.149  -7.975  1.00 30.88 ? 287 SER B O     1 
ATOM   5229  C  CB    . SER D  1 289 ? 20.879  -82.898  -6.794  1.00 25.38 ? 287 SER B CB    1 
ATOM   5230  O  OG    . SER D  1 289 ? 20.478  -82.570  -5.471  1.00 27.16 ? 287 SER B OG    1 
ATOM   5231  N  N     . ASN D  1 290 ? 19.769  -79.765  -6.622  1.00 22.23 ? 288 ASN B N     1 
ATOM   5232  C  CA    . ASN D  1 290 ? 18.585  -78.948  -6.444  1.00 25.09 ? 288 ASN B CA    1 
ATOM   5233  C  C     . ASN D  1 290 ? 18.491  -77.776  -7.437  1.00 28.12 ? 288 ASN B C     1 
ATOM   5234  O  O     . ASN D  1 290 ? 19.160  -76.757  -7.269  1.00 24.98 ? 288 ASN B O     1 
ATOM   5235  C  CB    . ASN D  1 290 ? 18.507  -78.422  -5.014  1.00 23.70 ? 288 ASN B CB    1 
ATOM   5236  C  CG    . ASN D  1 290 ? 17.336  -77.531  -4.825  1.00 27.60 ? 288 ASN B CG    1 
ATOM   5237  O  OD1   . ASN D  1 290 ? 16.581  -77.291  -5.769  1.00 28.61 ? 288 ASN B OD1   1 
ATOM   5238  N  ND2   . ASN D  1 290 ? 17.153  -77.027  -3.611  1.00 28.42 ? 288 ASN B ND2   1 
ATOM   5239  N  N     . LYS D  1 291 ? 17.617  -77.895  -8.437  1.00 26.08 ? 289 LYS B N     1 
ATOM   5240  C  CA    . LYS D  1 291 ? 17.641  -76.955  -9.568  1.00 30.68 ? 289 LYS B CA    1 
ATOM   5241  C  C     . LYS D  1 291 ? 17.291  -75.514  -9.205  1.00 29.00 ? 289 LYS B C     1 
ATOM   5242  O  O     . LYS D  1 291 ? 17.515  -74.605  -10.005 1.00 29.79 ? 289 LYS B O     1 
ATOM   5243  C  CB    . LYS D  1 291 ? 16.691  -77.427  -10.687 1.00 27.58 ? 289 LYS B CB    1 
ATOM   5244  C  CG    . LYS D  1 291 ? 15.203  -77.149  -10.427 1.00 26.37 ? 289 LYS B CG    1 
ATOM   5245  C  CD    . LYS D  1 291 ? 14.357  -77.608  -11.653 1.00 24.32 ? 289 LYS B CD    1 
ATOM   5246  C  CE    . LYS D  1 291 ? 12.843  -77.464  -11.400 1.00 34.44 ? 289 LYS B CE    1 
ATOM   5247  N  NZ    . LYS D  1 291 ? 12.008  -77.998  -12.549 1.00 48.43 ? 289 LYS B NZ    1 
ATOM   5248  N  N     . ALA D  1 292 ? 16.690  -75.315  -8.034  1.00 27.89 ? 290 ALA B N     1 
ATOM   5249  C  CA    . ALA D  1 292 ? 16.205  -74.001  -7.624  1.00 21.45 ? 290 ALA B CA    1 
ATOM   5250  C  C     . ALA D  1 292 ? 17.262  -73.212  -6.859  1.00 27.94 ? 290 ALA B C     1 
ATOM   5251  O  O     . ALA D  1 292 ? 17.177  -71.979  -6.780  1.00 21.52 ? 290 ALA B O     1 
ATOM   5252  C  CB    . ALA D  1 292 ? 14.958  -74.120  -6.793  1.00 27.32 ? 290 ALA B CB    1 
ATOM   5253  N  N     . GLN D  1 293 ? 18.230  -73.926  -6.282  1.00 24.82 ? 291 GLN B N     1 
ATOM   5254  C  CA    . GLN D  1 293 ? 19.293  -73.296  -5.506  1.00 26.51 ? 291 GLN B CA    1 
ATOM   5255  C  C     . GLN D  1 293 ? 20.560  -74.151  -5.531  1.00 24.69 ? 291 GLN B C     1 
ATOM   5256  O  O     . GLN D  1 293 ? 20.577  -75.298  -5.083  1.00 23.10 ? 291 GLN B O     1 
ATOM   5257  C  CB    . GLN D  1 293 ? 18.857  -73.011  -4.057  1.00 25.99 ? 291 GLN B CB    1 
ATOM   5258  C  CG    . GLN D  1 293 ? 19.903  -72.191  -3.281  1.00 27.73 ? 291 GLN B CG    1 
ATOM   5259  C  CD    . GLN D  1 293 ? 19.439  -71.744  -1.906  1.00 34.11 ? 291 GLN B CD    1 
ATOM   5260  O  OE1   . GLN D  1 293 ? 18.488  -70.973  -1.775  1.00 35.18 ? 291 GLN B OE1   1 
ATOM   5261  N  NE2   . GLN D  1 293 ? 20.104  -72.237  -0.875  1.00 28.35 ? 291 GLN B NE2   1 
ATOM   5262  N  N     . PHE D  1 294 ? 21.633  -73.611  -6.111  1.00 23.35 ? 292 PHE B N     1 
ATOM   5263  C  CA    . PHE D  1 294 ? 22.858  -74.390  -6.239  1.00 18.47 ? 292 PHE B CA    1 
ATOM   5264  C  C     . PHE D  1 294 ? 24.094  -73.481  -6.292  1.00 19.13 ? 292 PHE B C     1 
ATOM   5265  O  O     . PHE D  1 294 ? 24.004  -72.303  -6.636  1.00 18.27 ? 292 PHE B O     1 
ATOM   5266  C  CB    . PHE D  1 294 ? 22.836  -75.278  -7.500  1.00 21.29 ? 292 PHE B CB    1 
ATOM   5267  C  CG    . PHE D  1 294 ? 22.656  -74.498  -8.780  1.00 20.76 ? 292 PHE B CG    1 
ATOM   5268  C  CD1   . PHE D  1 294 ? 23.734  -73.891  -9.418  1.00 18.20 ? 292 PHE B CD1   1 
ATOM   5269  C  CD2   . PHE D  1 294 ? 21.386  -74.321  -9.306  1.00 25.66 ? 292 PHE B CD2   1 
ATOM   5270  C  CE1   . PHE D  1 294 ? 23.548  -73.155  -10.569 1.00 13.36 ? 292 PHE B CE1   1 
ATOM   5271  C  CE2   . PHE D  1 294 ? 21.185  -73.578  -10.466 1.00 24.18 ? 292 PHE B CE2   1 
ATOM   5272  C  CZ    . PHE D  1 294 ? 22.266  -73.010  -11.108 1.00 20.21 ? 292 PHE B CZ    1 
ATOM   5273  N  N     . PRO D  1 295 ? 25.246  -74.034  -5.925  1.00 18.24 ? 293 PRO B N     1 
ATOM   5274  C  CA    . PRO D  1 295 ? 25.350  -75.409  -5.417  1.00 19.84 ? 293 PRO B CA    1 
ATOM   5275  C  C     . PRO D  1 295 ? 24.912  -75.469  -3.951  1.00 24.87 ? 293 PRO B C     1 
ATOM   5276  O  O     . PRO D  1 295 ? 24.757  -74.421  -3.312  1.00 23.64 ? 293 PRO B O     1 
ATOM   5277  C  CB    . PRO D  1 295 ? 26.861  -75.685  -5.485  1.00 15.11 ? 293 PRO B CB    1 
ATOM   5278  C  CG    . PRO D  1 295 ? 27.466  -74.318  -5.254  1.00 16.34 ? 293 PRO B CG    1 
ATOM   5279  C  CD    . PRO D  1 295 ? 26.554  -73.348  -5.961  1.00 20.93 ? 293 PRO B CD    1 
ATOM   5280  N  N     . ASP D  1 296 ? 24.739  -76.677  -3.422  1.00 22.74 ? 294 ASP B N     1 
ATOM   5281  C  CA    . ASP D  1 296 ? 24.456  -76.838  -2.001  1.00 30.32 ? 294 ASP B CA    1 
ATOM   5282  C  C     . ASP D  1 296 ? 25.765  -77.200  -1.289  1.00 29.61 ? 294 ASP B C     1 
ATOM   5283  O  O     . ASP D  1 296 ? 26.311  -78.289  -1.468  1.00 26.26 ? 294 ASP B O     1 
ATOM   5284  C  CB    . ASP D  1 296 ? 23.373  -77.907  -1.802  1.00 34.80 ? 294 ASP B CB    1 
ATOM   5285  C  CG    . ASP D  1 296 ? 23.170  -78.287  -0.331  1.00 41.85 ? 294 ASP B CG    1 
ATOM   5286  O  OD1   . ASP D  1 296 ? 23.830  -77.684  0.563   1.00 28.69 ? 294 ASP B OD1   1 
ATOM   5287  O  OD2   . ASP D  1 296 ? 22.334  -79.193  -0.099  1.00 36.51 ? 294 ASP B OD2   1 
ATOM   5288  N  N     . LEU D  1 297 ? 26.310  -76.264  -0.525  1.00 31.02 ? 295 LEU B N     1 
ATOM   5289  C  CA    . LEU D  1 297 ? 27.665  -76.474  -0.014  1.00 30.45 ? 295 LEU B CA    1 
ATOM   5290  C  C     . LEU D  1 297 ? 27.747  -77.238  1.310   1.00 33.84 ? 295 LEU B C     1 
ATOM   5291  O  O     . LEU D  1 297 ? 28.843  -77.420  1.853   1.00 35.56 ? 295 LEU B O     1 
ATOM   5292  C  CB    . LEU D  1 297 ? 28.473  -75.164  -0.004  1.00 41.09 ? 295 LEU B CB    1 
ATOM   5293  C  CG    . LEU D  1 297 ? 28.839  -74.749  -1.447  1.00 38.18 ? 295 LEU B CG    1 
ATOM   5294  C  CD1   . LEU D  1 297 ? 29.368  -73.342  -1.519  1.00 26.28 ? 295 LEU B CD1   1 
ATOM   5295  C  CD2   . LEU D  1 297 ? 29.809  -75.740  -2.113  1.00 24.83 ? 295 LEU B CD2   1 
ATOM   5296  N  N     . SER D  1 298 ? 26.590  -77.690  1.804   1.00 26.43 ? 296 SER B N     1 
ATOM   5297  C  CA    . SER D  1 298 ? 26.561  -78.763  2.786   1.00 33.45 ? 296 SER B CA    1 
ATOM   5298  C  C     . SER D  1 298 ? 27.426  -79.882  2.207   1.00 32.80 ? 296 SER B C     1 
ATOM   5299  O  O     . SER D  1 298 ? 28.231  -80.479  2.918   1.00 36.72 ? 296 SER B O     1 
ATOM   5300  C  CB    . SER D  1 298 ? 25.122  -79.258  3.032   1.00 30.84 ? 296 SER B CB    1 
ATOM   5301  O  OG    . SER D  1 298 ? 24.863  -80.422  2.269   1.00 40.97 ? 296 SER B OG    1 
ATOM   5302  N  N     . TYR D  1 299 ? 27.300  -80.155  0.909   1.00 31.24 ? 297 TYR B N     1 
ATOM   5303  C  CA    . TYR D  1 299 ? 28.262  -81.060  0.259   1.00 28.39 ? 297 TYR B CA    1 
ATOM   5304  C  C     . TYR D  1 299 ? 29.630  -80.412  0.118   1.00 31.72 ? 297 TYR B C     1 
ATOM   5305  O  O     . TYR D  1 299 ? 29.741  -79.198  -0.126  1.00 30.28 ? 297 TYR B O     1 
ATOM   5306  C  CB    . TYR D  1 299 ? 27.781  -81.489  -1.127  1.00 30.06 ? 297 TYR B CB    1 
ATOM   5307  C  CG    . TYR D  1 299 ? 26.692  -82.540  -1.140  1.00 29.40 ? 297 TYR B CG    1 
ATOM   5308  C  CD1   . TYR D  1 299 ? 27.003  -83.903  -1.113  1.00 34.31 ? 297 TYR B CD1   1 
ATOM   5309  C  CD2   . TYR D  1 299 ? 25.358  -82.176  -1.202  1.00 32.91 ? 297 TYR B CD2   1 
ATOM   5310  C  CE1   . TYR D  1 299 ? 26.001  -84.870  -1.140  1.00 41.32 ? 297 TYR B CE1   1 
ATOM   5311  C  CE2   . TYR D  1 299 ? 24.354  -83.139  -1.230  1.00 32.62 ? 297 TYR B CE2   1 
ATOM   5312  C  CZ    . TYR D  1 299 ? 24.674  -84.468  -1.205  1.00 30.48 ? 297 TYR B CZ    1 
ATOM   5313  O  OH    . TYR D  1 299 ? 23.646  -85.407  -1.225  1.00 48.31 ? 297 TYR B OH    1 
ATOM   5314  N  N     . SER D  1 300 ? 30.670  -81.222  0.284   1.00 29.18 ? 298 SER B N     1 
ATOM   5315  C  CA    . SER D  1 300 ? 32.035  -80.802  0.022   1.00 30.26 ? 298 SER B CA    1 
ATOM   5316  C  C     . SER D  1 300 ? 32.367  -81.166  -1.419  1.00 22.36 ? 298 SER B C     1 
ATOM   5317  O  O     . SER D  1 300 ? 32.357  -82.347  -1.797  1.00 19.99 ? 298 SER B O     1 
ATOM   5318  C  CB    . SER D  1 300 ? 33.024  -81.508  0.956   1.00 24.97 ? 298 SER B CB    1 
ATOM   5319  O  OG    . SER D  1 300 ? 34.383  -81.209  0.615   1.00 24.86 ? 298 SER B OG    1 
ATOM   5320  N  N     . ILE D  1 301 ? 32.665  -80.145  -2.218  1.00 27.93 ? 299 ILE B N     1 
ATOM   5321  C  CA    . ILE D  1 301 ? 33.070  -80.348  -3.605  1.00 21.70 ? 299 ILE B CA    1 
ATOM   5322  C  C     . ILE D  1 301 ? 34.373  -81.123  -3.644  1.00 20.14 ? 299 ILE B C     1 
ATOM   5323  O  O     . ILE D  1 301 ? 34.552  -82.064  -4.440  1.00 18.20 ? 299 ILE B O     1 
ATOM   5324  C  CB    . ILE D  1 301 ? 33.214  -78.993  -4.354  1.00 22.81 ? 299 ILE B CB    1 
ATOM   5325  C  CG1   . ILE D  1 301 ? 31.888  -78.255  -4.386  1.00 25.39 ? 299 ILE B CG1   1 
ATOM   5326  C  CG2   . ILE D  1 301 ? 33.772  -79.197  -5.789  1.00 20.50 ? 299 ILE B CG2   1 
ATOM   5327  C  CD1   . ILE D  1 301 ? 30.744  -79.091  -4.903  1.00 27.68 ? 299 ILE B CD1   1 
ATOM   5328  N  N     A SER D  1 302 ? 35.310  -80.750  -2.783  0.53 20.02 ? 300 SER B N     1 
ATOM   5329  N  N     B SER D  1 302 ? 35.402  -80.830  -2.856  0.47 20.04 ? 300 SER B N     1 
ATOM   5330  C  CA    A SER D  1 302 ? 36.563  -81.475  -2.775  0.53 21.08 ? 300 SER B CA    1 
ATOM   5331  C  CA    B SER D  1 302 ? 36.613  -81.645  -2.861  0.47 21.08 ? 300 SER B CA    1 
ATOM   5332  C  C     A SER D  1 302 ? 36.371  -82.973  -2.419  0.53 19.88 ? 300 SER B C     1 
ATOM   5333  C  C     B SER D  1 302 ? 36.395  -83.077  -2.420  0.47 19.86 ? 300 SER B C     1 
ATOM   5334  O  O     A SER D  1 302 ? 36.997  -83.853  -3.024  0.53 20.43 ? 300 SER B O     1 
ATOM   5335  O  O     B SER D  1 302 ? 36.956  -83.955  -2.990  0.47 20.45 ? 300 SER B O     1 
ATOM   5336  C  CB    A SER D  1 302 ? 37.564  -80.800  -1.834  0.53 24.69 ? 300 SER B CB    1 
ATOM   5337  C  CB    B SER D  1 302 ? 37.754  -81.045  -2.056  0.47 24.25 ? 300 SER B CB    1 
ATOM   5338  O  OG    A SER D  1 302 ? 38.746  -81.577  -1.795  0.53 22.06 ? 300 SER B OG    1 
ATOM   5339  O  OG    B SER D  1 302 ? 37.232  -79.993  -1.347  0.47 25.34 ? 300 SER B OG    1 
ATOM   5340  N  N     . GLU D  1 303 ? 35.501  -83.261  -1.449  1.00 26.24 ? 301 GLU B N     1 
ATOM   5341  C  CA    . GLU D  1 303 ? 35.220  -84.668  -1.084  1.00 27.26 ? 301 GLU B CA    1 
ATOM   5342  C  C     . GLU D  1 303 ? 34.535  -85.412  -2.244  1.00 20.64 ? 301 GLU B C     1 
ATOM   5343  O  O     . GLU D  1 303 ? 34.937  -86.506  -2.620  1.00 19.65 ? 301 GLU B O     1 
ATOM   5344  C  CB    . GLU D  1 303 ? 34.383  -84.764  0.204   1.00 21.61 ? 301 GLU B CB    1 
ATOM   5345  C  CG    . GLU D  1 303 ? 33.148  -85.681  0.101   1.00 39.29 ? 301 GLU B CG    1 
ATOM   5346  C  CD    . GLU D  1 303 ? 33.461  -87.178  0.051   1.00 40.25 ? 301 GLU B CD    1 
ATOM   5347  O  OE1   . GLU D  1 303 ? 32.494  -87.974  -0.094  1.00 49.58 ? 301 GLU B OE1   1 
ATOM   5348  O  OE2   . GLU D  1 303 ? 34.651  -87.563  0.170   1.00 50.08 ? 301 GLU B OE2   1 
ATOM   5349  N  N     . LEU D  1 304 ? 33.514  -84.808  -2.827  1.00 20.63 ? 302 LEU B N     1 
ATOM   5350  C  CA    . LEU D  1 304 ? 32.922  -85.387  -4.023  1.00 21.30 ? 302 LEU B CA    1 
ATOM   5351  C  C     . LEU D  1 304 ? 33.981  -85.704  -5.084  1.00 22.10 ? 302 LEU B C     1 
ATOM   5352  O  O     . LEU D  1 304 ? 33.987  -86.809  -5.653  1.00 21.17 ? 302 LEU B O     1 
ATOM   5353  C  CB    . LEU D  1 304 ? 31.802  -84.504  -4.568  1.00 21.78 ? 302 LEU B CB    1 
ATOM   5354  C  CG    . LEU D  1 304 ? 30.600  -84.419  -3.640  1.00 22.29 ? 302 LEU B CG    1 
ATOM   5355  C  CD1   . LEU D  1 304 ? 29.630  -83.339  -4.073  1.00 20.56 ? 302 LEU B CD1   1 
ATOM   5356  C  CD2   . LEU D  1 304 ? 29.871  -85.776  -3.570  1.00 27.25 ? 302 LEU B CD2   1 
ATOM   5357  N  N     . LEU D  1 305 ? 34.906  -84.772  -5.333  1.00 19.65 ? 303 LEU B N     1 
ATOM   5358  C  CA    . LEU D  1 305 ? 35.927  -85.008  -6.355  1.00 19.33 ? 303 LEU B CA    1 
ATOM   5359  C  C     . LEU D  1 305 ? 36.964  -86.014  -5.951  1.00 20.09 ? 303 LEU B C     1 
ATOM   5360  O  O     . LEU D  1 305 ? 37.565  -86.631  -6.818  1.00 17.52 ? 303 LEU B O     1 
ATOM   5361  C  CB    . LEU D  1 305 ? 36.597  -83.724  -6.858  1.00 18.65 ? 303 LEU B CB    1 
ATOM   5362  C  CG    . LEU D  1 305 ? 35.686  -82.723  -7.574  1.00 21.21 ? 303 LEU B CG    1 
ATOM   5363  C  CD1   . LEU D  1 305 ? 36.472  -81.454  -8.034  1.00 20.98 ? 303 LEU B CD1   1 
ATOM   5364  C  CD2   . LEU D  1 305 ? 34.944  -83.384  -8.761  1.00 17.57 ? 303 LEU B CD2   1 
ATOM   5365  N  N     . SER D  1 306 ? 37.166  -86.190  -4.645  1.00 18.48 ? 304 SER B N     1 
ATOM   5366  C  CA    . SER D  1 306 ? 38.130  -87.171  -4.144  1.00 24.13 ? 304 SER B CA    1 
ATOM   5367  C  C     . SER D  1 306 ? 37.794  -88.574  -4.661  1.00 26.03 ? 304 SER B C     1 
ATOM   5368  O  O     . SER D  1 306 ? 38.647  -89.447  -4.769  1.00 25.18 ? 304 SER B O     1 
ATOM   5369  C  CB    . SER D  1 306 ? 38.248  -87.152  -2.599  1.00 26.45 ? 304 SER B CB    1 
ATOM   5370  O  OG    . SER D  1 306 ? 37.003  -87.303  -1.923  1.00 26.56 ? 304 SER B OG    1 
ATOM   5371  N  N     . LYS D  1 307 ? 36.545  -88.780  -5.028  1.00 23.79 ? 305 LYS B N     1 
ATOM   5372  C  CA    . LYS D  1 307 ? 36.138  -90.121  -5.430  1.00 22.55 ? 305 LYS B CA    1 
ATOM   5373  C  C     . LYS D  1 307 ? 36.339  -90.460  -6.886  1.00 20.53 ? 305 LYS B C     1 
ATOM   5374  O  O     . LYS D  1 307 ? 35.899  -91.516  -7.308  1.00 23.03 ? 305 LYS B O     1 
ATOM   5375  C  CB    . LYS D  1 307 ? 34.679  -90.317  -5.099  1.00 22.89 ? 305 LYS B CB    1 
ATOM   5376  C  CG    . LYS D  1 307 ? 34.417  -90.095  -3.628  1.00 25.80 ? 305 LYS B CG    1 
ATOM   5377  C  CD    . LYS D  1 307 ? 33.127  -89.340  -3.498  1.00 38.33 ? 305 LYS B CD    1 
ATOM   5378  C  CE    . LYS D  1 307 ? 32.377  -89.669  -2.200  1.00 43.15 ? 305 LYS B CE    1 
ATOM   5379  N  NZ    . LYS D  1 307 ? 30.936  -89.169  -2.239  1.00 49.82 ? 305 LYS B NZ    1 
ATOM   5380  N  N     . ARG D  1 308 ? 36.967  -89.592  -7.678  1.00 22.58 ? 306 ARG B N     1 
ATOM   5381  C  CA    . ARG D  1 308 ? 37.209  -89.975  -9.078  1.00 23.49 ? 306 ARG B CA    1 
ATOM   5382  C  C     . ARG D  1 308 ? 38.168  -91.171  -9.106  1.00 23.34 ? 306 ARG B C     1 
ATOM   5383  O  O     . ARG D  1 308 ? 39.094  -91.260  -8.280  1.00 25.67 ? 306 ARG B O     1 
ATOM   5384  C  CB    . ARG D  1 308 ? 37.765  -88.808  -9.908  1.00 18.99 ? 306 ARG B CB    1 
ATOM   5385  C  CG    . ARG D  1 308 ? 36.729  -87.695  -10.233 1.00 21.33 ? 306 ARG B CG    1 
ATOM   5386  C  CD    . ARG D  1 308 ? 37.357  -86.541  -11.044 1.00 16.62 ? 306 ARG B CD    1 
ATOM   5387  N  NE    . ARG D  1 308 ? 38.137  -87.077  -12.162 1.00 17.39 ? 306 ARG B NE    1 
ATOM   5388  C  CZ    . ARG D  1 308 ? 38.980  -86.374  -12.926 1.00 16.89 ? 306 ARG B CZ    1 
ATOM   5389  N  NH1   . ARG D  1 308 ? 39.158  -85.067  -12.712 1.00 18.42 ? 306 ARG B NH1   1 
ATOM   5390  N  NH2   . ARG D  1 308 ? 39.639  -86.973  -13.917 1.00 20.38 ? 306 ARG B NH2   1 
ATOM   5391  N  N     . THR D  1 309 ? 37.951  -92.082  -10.057 1.00 21.79 ? 307 THR B N     1 
ATOM   5392  C  CA    . THR D  1 309 ? 38.875  -93.165  -10.342 1.00 19.42 ? 307 THR B CA    1 
ATOM   5393  C  C     . THR D  1 309 ? 39.099  -93.321  -11.835 1.00 24.18 ? 307 THR B C     1 
ATOM   5394  O  O     . THR D  1 309 ? 38.367  -92.745  -12.642 1.00 20.45 ? 307 THR B O     1 
ATOM   5395  C  CB    . THR D  1 309 ? 38.403  -94.480  -9.719  1.00 27.23 ? 307 THR B CB    1 
ATOM   5396  O  OG1   . THR D  1 309 ? 37.142  -94.874  -10.298 1.00 28.89 ? 307 THR B OG1   1 
ATOM   5397  C  CG2   . THR D  1 309 ? 38.223  -94.282  -8.216  1.00 24.78 ? 307 THR B CG2   1 
ATOM   5398  N  N     . LYS D  1 310 ? 40.151  -94.049  -12.192 1.00 26.45 ? 308 LYS B N     1 
ATOM   5399  C  CA    . LYS D  1 310 ? 40.474  -94.322  -13.589 1.00 31.57 ? 308 LYS B CA    1 
ATOM   5400  C  C     . LYS D  1 310 ? 39.253  -95.000  -14.210 1.00 36.09 ? 308 LYS B C     1 
ATOM   5401  O  O     . LYS D  1 310 ? 38.822  -94.673  -15.326 1.00 30.76 ? 308 LYS B O     1 
ATOM   5402  C  CB    . LYS D  1 310 ? 41.663  -95.276  -13.677 1.00 34.91 ? 308 LYS B CB    1 
ATOM   5403  C  CG    . LYS D  1 310 ? 42.124  -95.642  -15.108 1.00 49.81 ? 308 LYS B CG    1 
ATOM   5404  C  CD    . LYS D  1 310 ? 42.721  -97.073  -15.214 1.00 48.89 ? 308 LYS B CD    1 
ATOM   5405  C  CE    . LYS D  1 310 ? 43.462  -97.328  -16.554 1.00 51.95 ? 308 LYS B CE    1 
ATOM   5406  N  NZ    . LYS D  1 310 ? 42.611  -97.752  -17.713 1.00 52.36 ? 308 LYS B NZ    1 
ATOM   5407  N  N     . GLU D  1 311 ? 38.686  -95.948  -13.476 1.00 28.43 ? 309 GLU B N     1 
ATOM   5408  C  CA    . GLU D  1 311 ? 37.629  -96.735  -14.063 1.00 32.24 ? 309 GLU B CA    1 
ATOM   5409  C  C     . GLU D  1 311 ? 36.360  -95.921  -14.144 1.00 30.48 ? 309 GLU B C     1 
ATOM   5410  O  O     . GLU D  1 311 ? 35.713  -95.933  -15.181 1.00 31.88 ? 309 GLU B O     1 
ATOM   5411  C  CB    . GLU D  1 311 ? 37.414  -98.068  -13.352 1.00 31.93 ? 309 GLU B CB    1 
ATOM   5412  C  CG    . GLU D  1 311 ? 38.477  -99.092  -13.704 1.00 44.92 ? 309 GLU B CG    1 
ATOM   5413  C  CD    . GLU D  1 311 ? 38.714  -99.232  -15.226 1.00 57.80 ? 309 GLU B CD    1 
ATOM   5414  O  OE1   . GLU D  1 311 ? 37.807  -99.724  -15.959 1.00 52.45 ? 309 GLU B OE1   1 
ATOM   5415  O  OE2   . GLU D  1 311 ? 39.827  -98.856  -15.678 1.00 42.36 ? 309 GLU B OE2   1 
ATOM   5416  N  N     . LEU D  1 312 ? 36.004  -95.208  -13.075 1.00 23.81 ? 310 LEU B N     1 
ATOM   5417  C  CA    . LEU D  1 312 ? 34.825  -94.344  -13.147 1.00 23.02 ? 310 LEU B CA    1 
ATOM   5418  C  C     . LEU D  1 312 ? 34.991  -93.268  -14.258 1.00 25.94 ? 310 LEU B C     1 
ATOM   5419  O  O     . LEU D  1 312 ? 34.058  -93.001  -15.022 1.00 25.12 ? 310 LEU B O     1 
ATOM   5420  C  CB    . LEU D  1 312 ? 34.548  -93.652  -11.816 1.00 27.21 ? 310 LEU B CB    1 
ATOM   5421  C  CG    . LEU D  1 312 ? 33.632  -94.211  -10.746 1.00 34.37 ? 310 LEU B CG    1 
ATOM   5422  C  CD1   . LEU D  1 312 ? 32.524  -95.126  -11.312 1.00 26.80 ? 310 LEU B CD1   1 
ATOM   5423  C  CD2   . LEU D  1 312 ? 34.450  -94.897  -9.695  1.00 31.78 ? 310 LEU B CD2   1 
ATOM   5424  N  N     . ASP D  1 313 ? 36.146  -92.618  -14.318 1.00 19.61 ? 311 ASP B N     1 
ATOM   5425  C  CA    . ASP D  1 313 ? 36.355  -91.586  -15.344 1.00 18.97 ? 311 ASP B CA    1 
ATOM   5426  C  C     . ASP D  1 313 ? 36.041  -92.147  -16.733 1.00 24.33 ? 311 ASP B C     1 
ATOM   5427  O  O     . ASP D  1 313 ? 35.446  -91.480  -17.586 1.00 21.53 ? 311 ASP B O     1 
ATOM   5428  C  CB    . ASP D  1 313 ? 37.818  -91.111  -15.360 1.00 22.94 ? 311 ASP B CB    1 
ATOM   5429  C  CG    . ASP D  1 313 ? 38.175  -90.172  -14.197 1.00 20.66 ? 311 ASP B CG    1 
ATOM   5430  O  OD1   . ASP D  1 313 ? 37.275  -89.764  -13.420 1.00 16.72 ? 311 ASP B OD1   1 
ATOM   5431  O  OD2   . ASP D  1 313 ? 39.390  -89.848  -14.082 1.00 23.89 ? 311 ASP B OD2   1 
ATOM   5432  N  N     . LYS D  1 314 ? 36.493  -93.373  -16.967 1.00 22.20 ? 312 LYS B N     1 
ATOM   5433  C  CA    . LYS D  1 314 ? 36.373  -94.012  -18.273 1.00 27.07 ? 312 LYS B CA    1 
ATOM   5434  C  C     . LYS D  1 314 ? 34.892  -94.225  -18.606 1.00 26.71 ? 312 LYS B C     1 
ATOM   5435  O  O     . LYS D  1 314 ? 34.425  -93.929  -19.717 1.00 24.50 ? 312 LYS B O     1 
ATOM   5436  C  CB    . LYS D  1 314 ? 37.157  -95.343  -18.307 1.00 32.37 ? 312 LYS B CB    1 
ATOM   5437  C  CG    . LYS D  1 314 ? 37.019  -96.136  -19.615 1.00 32.80 ? 312 LYS B CG    1 
ATOM   5438  C  CD    . LYS D  1 314 ? 37.840  -97.471  -19.603 1.00 40.45 ? 312 LYS B CD    1 
ATOM   5439  C  CE    . LYS D  1 314 ? 37.597  -98.344  -20.867 1.00 39.69 ? 312 LYS B CE    1 
ATOM   5440  N  NZ    . LYS D  1 314 ? 38.297  -99.684  -20.818 1.00 48.40 ? 312 LYS B NZ    1 
ATOM   5441  N  N     . LYS D  1 315 ? 34.148  -94.698  -17.621 1.00 21.71 ? 313 LYS B N     1 
ATOM   5442  C  CA    . LYS D  1 315 ? 32.726  -94.910  -17.809 1.00 25.34 ? 313 LYS B CA    1 
ATOM   5443  C  C     . LYS D  1 315 ? 32.043  -93.556  -18.021 1.00 24.11 ? 313 LYS B C     1 
ATOM   5444  O  O     . LYS D  1 315 ? 31.208  -93.408  -18.920 1.00 25.58 ? 313 LYS B O     1 
ATOM   5445  C  CB    . LYS D  1 315 ? 32.131  -95.651  -16.620 1.00 21.98 ? 313 LYS B CB    1 
ATOM   5446  C  CG    . LYS D  1 315 ? 30.675  -96.057  -16.795 1.00 32.82 ? 313 LYS B CG    1 
ATOM   5447  C  CD    . LYS D  1 315 ? 30.219  -96.921  -15.600 1.00 39.62 ? 313 LYS B CD    1 
ATOM   5448  C  CE    . LYS D  1 315 ? 28.703  -97.225  -15.603 1.00 38.31 ? 313 LYS B CE    1 
ATOM   5449  N  NZ    . LYS D  1 315 ? 28.357  -98.442  -16.375 1.00 41.91 ? 313 LYS B NZ    1 
ATOM   5450  N  N     . ILE D  1 316 ? 32.395  -92.562  -17.214 1.00 20.11 ? 314 ILE B N     1 
ATOM   5451  C  CA    . ILE D  1 316 ? 31.834  -91.209  -17.408 1.00 22.67 ? 314 ILE B CA    1 
ATOM   5452  C  C     . ILE D  1 316 ? 31.998  -90.724  -18.859 1.00 16.51 ? 314 ILE B C     1 
ATOM   5453  O  O     . ILE D  1 316 ? 31.040  -90.280  -19.492 1.00 21.42 ? 314 ILE B O     1 
ATOM   5454  C  CB    . ILE D  1 316 ? 32.446  -90.165  -16.386 1.00 20.06 ? 314 ILE B CB    1 
ATOM   5455  C  CG1   . ILE D  1 316 ? 31.861  -90.392  -14.973 1.00 16.67 ? 314 ILE B CG1   1 
ATOM   5456  C  CG2   . ILE D  1 316 ? 32.153  -88.724  -16.849 1.00 13.33 ? 314 ILE B CG2   1 
ATOM   5457  C  CD1   . ILE D  1 316 ? 32.582  -89.697  -13.813 1.00 15.13 ? 314 ILE B CD1   1 
ATOM   5458  N  N     . ILE D  1 317 ? 33.214  -90.774  -19.376 1.00 18.61 ? 315 ILE B N     1 
ATOM   5459  C  CA    . ILE D  1 317 ? 33.489  -90.270  -20.728 1.00 20.83 ? 315 ILE B CA    1 
ATOM   5460  C  C     . ILE D  1 317 ? 32.672  -91.071  -21.759 1.00 25.18 ? 315 ILE B C     1 
ATOM   5461  O  O     . ILE D  1 317 ? 32.206  -90.545  -22.781 1.00 17.34 ? 315 ILE B O     1 
ATOM   5462  C  CB    . ILE D  1 317 ? 35.000  -90.409  -21.078 1.00 18.78 ? 315 ILE B CB    1 
ATOM   5463  C  CG1   . ILE D  1 317 ? 35.880  -89.518  -20.194 1.00 26.32 ? 315 ILE B CG1   1 
ATOM   5464  C  CG2   . ILE D  1 317 ? 35.252  -90.152  -22.582 1.00 20.47 ? 315 ILE B CG2   1 
ATOM   5465  C  CD1   . ILE D  1 317 ? 35.163  -88.373  -19.540 1.00 20.50 ? 315 ILE B CD1   1 
ATOM   5466  N  N     . GLU D  1 318 ? 32.560  -92.369  -21.520 1.00 20.61 ? 316 GLU B N     1 
ATOM   5467  C  CA    . GLU D  1 318 ? 31.804  -93.209  -22.426 1.00 21.05 ? 316 GLU B CA    1 
ATOM   5468  C  C     . GLU D  1 318 ? 30.342  -92.756  -22.431 1.00 17.60 ? 316 GLU B C     1 
ATOM   5469  O  O     . GLU D  1 318 ? 29.757  -92.620  -23.488 1.00 22.29 ? 316 GLU B O     1 
ATOM   5470  C  CB    . GLU D  1 318 ? 31.916  -94.704  -22.044 1.00 20.88 ? 316 GLU B CB    1 
ATOM   5471  C  CG    . GLU D  1 318 ? 31.284  -95.615  -23.095 1.00 34.96 ? 316 GLU B CG    1 
ATOM   5472  C  CD    . GLU D  1 318 ? 31.062  -97.041  -22.606 1.00 47.59 ? 316 GLU B CD    1 
ATOM   5473  O  OE1   . GLU D  1 318 ? 31.297  -97.305  -21.400 1.00 47.94 ? 316 GLU B OE1   1 
ATOM   5474  O  OE2   . GLU D  1 318 ? 30.658  -97.885  -23.441 1.00 54.82 ? 316 GLU B OE2   1 
ATOM   5475  N  N     . LEU D  1 319 ? 29.747  -92.514  -21.271 1.00 13.03 ? 317 LEU B N     1 
ATOM   5476  C  CA    . LEU D  1 319 ? 28.342  -92.129  -21.264 1.00 18.32 ? 317 LEU B CA    1 
ATOM   5477  C  C     . LEU D  1 319 ? 28.179  -90.700  -21.831 1.00 18.22 ? 317 LEU B C     1 
ATOM   5478  O  O     . LEU D  1 319 ? 27.185  -90.376  -22.478 1.00 15.63 ? 317 LEU B O     1 
ATOM   5479  C  CB    . LEU D  1 319 ? 27.756  -92.227  -19.858 1.00 15.57 ? 317 LEU B CB    1 
ATOM   5480  C  CG    . LEU D  1 319 ? 27.089  -93.526  -19.384 1.00 20.07 ? 317 LEU B CG    1 
ATOM   5481  C  CD1   . LEU D  1 319 ? 27.271  -94.709  -20.353 1.00 20.53 ? 317 LEU B CD1   1 
ATOM   5482  C  CD2   . LEU D  1 319 ? 27.533  -93.890  -18.015 1.00 17.34 ? 317 LEU B CD2   1 
ATOM   5483  N  N     . TRP D  1 320 ? 29.132  -89.831  -21.539 1.00 16.34 ? 318 TRP B N     1 
ATOM   5484  C  CA    . TRP D  1 320 ? 29.020  -88.490  -22.064 1.00 14.48 ? 318 TRP B CA    1 
ATOM   5485  C  C     . TRP D  1 320 ? 29.106  -88.534  -23.601 1.00 15.93 ? 318 TRP B C     1 
ATOM   5486  O  O     . TRP D  1 320 ? 28.412  -87.807  -24.319 1.00 15.88 ? 318 TRP B O     1 
ATOM   5487  C  CB    . TRP D  1 320 ? 30.103  -87.599  -21.452 1.00 16.09 ? 318 TRP B CB    1 
ATOM   5488  C  CG    . TRP D  1 320 ? 30.027  -86.164  -21.948 1.00 17.28 ? 318 TRP B CG    1 
ATOM   5489  C  CD1   . TRP D  1 320 ? 30.430  -85.696  -23.177 1.00 20.43 ? 318 TRP B CD1   1 
ATOM   5490  C  CD2   . TRP D  1 320 ? 29.561  -85.014  -21.211 1.00 13.51 ? 318 TRP B CD2   1 
ATOM   5491  N  NE1   . TRP D  1 320 ? 30.213  -84.328  -23.258 1.00 14.83 ? 318 TRP B NE1   1 
ATOM   5492  C  CE2   . TRP D  1 320 ? 29.695  -83.881  -22.057 1.00 12.39 ? 318 TRP B CE2   1 
ATOM   5493  C  CE3   . TRP D  1 320 ? 29.042  -84.830  -19.917 1.00 12.46 ? 318 TRP B CE3   1 
ATOM   5494  C  CZ2   . TRP D  1 320 ? 29.341  -82.570  -21.656 1.00 16.99 ? 318 TRP B CZ2   1 
ATOM   5495  C  CZ3   . TRP D  1 320 ? 28.677  -83.533  -19.513 1.00 19.04 ? 318 TRP B CZ3   1 
ATOM   5496  C  CH2   . TRP D  1 320 ? 28.824  -82.411  -20.396 1.00 13.55 ? 318 TRP B CH2   1 
ATOM   5497  N  N     . GLU D  1 321 ? 29.964  -89.380  -24.121 1.00 15.11 ? 319 GLU B N     1 
ATOM   5498  C  CA    . GLU D  1 321 ? 30.066  -89.463  -25.555 1.00 22.43 ? 319 GLU B CA    1 
ATOM   5499  C  C     . GLU D  1 321 ? 28.741  -89.996  -26.101 1.00 22.79 ? 319 GLU B C     1 
ATOM   5500  O  O     . GLU D  1 321 ? 28.256  -89.548  -27.136 1.00 20.78 ? 319 GLU B O     1 
ATOM   5501  C  CB    . GLU D  1 321 ? 31.268  -90.318  -25.986 1.00 27.98 ? 319 GLU B CB    1 
ATOM   5502  C  CG    . GLU D  1 321 ? 31.486  -90.304  -27.495 1.00 33.63 ? 319 GLU B CG    1 
ATOM   5503  C  CD    . GLU D  1 321 ? 31.843  -88.898  -28.023 1.00 37.80 ? 319 GLU B CD    1 
ATOM   5504  O  OE1   . GLU D  1 321 ? 32.650  -88.224  -27.360 1.00 44.47 ? 319 GLU B OE1   1 
ATOM   5505  O  OE2   . GLU D  1 321 ? 31.324  -88.451  -29.082 1.00 39.03 ? 319 GLU B OE2   1 
ATOM   5506  N  N     . LYS D  1 322 ? 28.124  -90.907  -25.366 1.00 20.87 ? 320 LYS B N     1 
ATOM   5507  C  CA    . LYS D  1 322 ? 26.877  -91.487  -25.841 1.00 20.71 ? 320 LYS B CA    1 
ATOM   5508  C  C     . LYS D  1 322 ? 25.749  -90.443  -25.808 1.00 18.24 ? 320 LYS B C     1 
ATOM   5509  O  O     . LYS D  1 322 ? 25.150  -90.185  -26.858 1.00 16.89 ? 320 LYS B O     1 
ATOM   5510  C  CB    . LYS D  1 322 ? 26.504  -92.768  -25.069 1.00 21.60 ? 320 LYS B CB    1 
ATOM   5511  C  CG    . LYS D  1 322 ? 25.024  -93.232  -25.288 1.00 21.72 ? 320 LYS B CG    1 
ATOM   5512  C  CD    . LYS D  1 322 ? 24.688  -94.438  -24.357 1.00 23.40 ? 320 LYS B CD    1 
ATOM   5513  C  CE    . LYS D  1 322 ? 23.269  -94.961  -24.581 1.00 31.40 ? 320 LYS B CE    1 
ATOM   5514  N  NZ    . LYS D  1 322 ? 22.717  -95.608  -23.352 1.00 33.32 ? 320 LYS B NZ    1 
ATOM   5515  N  N     . TYR D  1 323 ? 25.471  -89.835  -24.646 1.00 13.47 ? 321 TYR B N     1 
ATOM   5516  C  CA    . TYR D  1 323 ? 24.345  -88.866  -24.530 1.00 14.98 ? 321 TYR B CA    1 
ATOM   5517  C  C     . TYR D  1 323 ? 24.567  -87.487  -25.149 1.00 17.05 ? 321 TYR B C     1 
ATOM   5518  O  O     . TYR D  1 323 ? 23.657  -86.876  -25.737 1.00 14.69 ? 321 TYR B O     1 
ATOM   5519  C  CB    . TYR D  1 323 ? 23.945  -88.677  -23.084 1.00 16.29 ? 321 TYR B CB    1 
ATOM   5520  C  CG    . TYR D  1 323 ? 23.534  -89.999  -22.465 1.00 23.11 ? 321 TYR B CG    1 
ATOM   5521  C  CD1   . TYR D  1 323 ? 22.484  -90.738  -23.013 1.00 21.62 ? 321 TYR B CD1   1 
ATOM   5522  C  CD2   . TYR D  1 323 ? 24.216  -90.533  -21.374 1.00 18.05 ? 321 TYR B CD2   1 
ATOM   5523  C  CE1   . TYR D  1 323 ? 22.099  -91.954  -22.485 1.00 25.78 ? 321 TYR B CE1   1 
ATOM   5524  C  CE2   . TYR D  1 323 ? 23.840  -91.791  -20.827 1.00 24.40 ? 321 TYR B CE2   1 
ATOM   5525  C  CZ    . TYR D  1 323 ? 22.769  -92.481  -21.396 1.00 28.62 ? 321 TYR B CZ    1 
ATOM   5526  O  OH    . TYR D  1 323 ? 22.345  -93.701  -20.913 1.00 24.16 ? 321 TYR B OH    1 
ATOM   5527  N  N     . ILE D  1 324 ? 25.778  -86.977  -25.000 1.00 17.74 ? 322 ILE B N     1 
ATOM   5528  C  CA    . ILE D  1 324 ? 26.041  -85.573  -25.325 1.00 13.94 ? 322 ILE B CA    1 
ATOM   5529  C  C     . ILE D  1 324 ? 26.960  -85.452  -26.523 1.00 15.72 ? 322 ILE B C     1 
ATOM   5530  O  O     . ILE D  1 324 ? 26.698  -84.660  -27.452 1.00 19.35 ? 322 ILE B O     1 
ATOM   5531  C  CB    . ILE D  1 324 ? 26.623  -84.836  -24.097 1.00 12.89 ? 322 ILE B CB    1 
ATOM   5532  C  CG1   . ILE D  1 324 ? 25.580  -84.825  -22.992 1.00 19.34 ? 322 ILE B CG1   1 
ATOM   5533  C  CG2   . ILE D  1 324 ? 26.991  -83.392  -24.443 1.00 11.77 ? 322 ILE B CG2   1 
ATOM   5534  C  CD1   . ILE D  1 324 ? 26.171  -84.572  -21.591 1.00 19.34 ? 322 ILE B CD1   1 
ATOM   5535  N  N     . GLY D  1 325 ? 28.031  -86.243  -26.508 1.00 16.55 ? 323 GLY B N     1 
ATOM   5536  C  CA    . GLY D  1 325 ? 29.082  -86.162  -27.498 1.00 20.09 ? 323 GLY B CA    1 
ATOM   5537  C  C     . GLY D  1 325 ? 30.221  -85.337  -26.933 1.00 19.28 ? 323 GLY B C     1 
ATOM   5538  O  O     . GLY D  1 325 ? 29.976  -84.390  -26.137 1.00 16.66 ? 323 GLY B O     1 
ATOM   5539  N  N     . LEU D  1 326 ? 31.450  -85.674  -27.332 1.00 15.05 ? 324 LEU B N     1 
ATOM   5540  C  CA    . LEU D  1 326 ? 32.638  -84.900  -26.890 1.00 22.23 ? 324 LEU B CA    1 
ATOM   5541  C  C     . LEU D  1 326 ? 32.821  -83.583  -27.662 1.00 22.23 ? 324 LEU B C     1 
ATOM   5542  O  O     . LEU D  1 326 ? 33.376  -82.617  -27.133 1.00 17.32 ? 324 LEU B O     1 
ATOM   5543  C  CB    . LEU D  1 326 ? 33.929  -85.724  -26.932 1.00 24.43 ? 324 LEU B CB    1 
ATOM   5544  C  CG    . LEU D  1 326 ? 34.063  -86.732  -25.784 1.00 25.07 ? 324 LEU B CG    1 
ATOM   5545  C  CD1   . LEU D  1 326 ? 35.284  -87.623  -25.994 1.00 22.99 ? 324 LEU B CD1   1 
ATOM   5546  C  CD2   . LEU D  1 326 ? 34.134  -85.988  -24.417 1.00 23.94 ? 324 LEU B CD2   1 
ATOM   5547  N  N     . LYS D  1 327 ? 32.363  -83.555  -28.911 1.00 22.16 ? 325 LYS B N     1 
ATOM   5548  C  CA    . LYS D  1 327 ? 32.287  -82.306  -29.675 1.00 21.92 ? 325 LYS B CA    1 
ATOM   5549  C  C     . LYS D  1 327 ? 31.207  -81.397  -29.070 1.00 13.82 ? 325 LYS B C     1 
ATOM   5550  O  O     . LYS D  1 327 ? 30.092  -81.828  -28.776 1.00 16.16 ? 325 LYS B O     1 
ATOM   5551  C  CB    . LYS D  1 327 ? 31.919  -82.587  -31.135 1.00 25.61 ? 325 LYS B CB    1 
ATOM   5552  C  CG    . LYS D  1 327 ? 32.788  -83.609  -31.855 1.00 29.41 ? 325 LYS B CG    1 
ATOM   5553  C  CD    . LYS D  1 327 ? 34.172  -83.065  -32.182 1.00 40.51 ? 325 LYS B CD    1 
ATOM   5554  C  CE    . LYS D  1 327 ? 35.001  -84.038  -33.058 1.00 36.75 ? 325 LYS B CE    1 
ATOM   5555  N  NZ    . LYS D  1 327 ? 34.667  -83.977  -34.539 1.00 42.70 ? 325 LYS B NZ    1 
ATOM   5556  N  N     . ILE D  1 328 ? 31.520  -80.125  -28.901 1.00 14.68 ? 326 ILE B N     1 
ATOM   5557  C  CA    . ILE D  1 328 ? 30.515  -79.181  -28.406 1.00 12.00 ? 326 ILE B CA    1 
ATOM   5558  C  C     . ILE D  1 328 ? 29.812  -78.706  -29.679 1.00 13.59 ? 326 ILE B C     1 
ATOM   5559  O  O     . ILE D  1 328 ? 30.422  -78.048  -30.530 1.00 14.91 ? 326 ILE B O     1 
ATOM   5560  C  CB    . ILE D  1 328 ? 31.214  -77.976  -27.757 1.00 16.93 ? 326 ILE B CB    1 
ATOM   5561  C  CG1   . ILE D  1 328 ? 32.380  -78.444  -26.847 1.00 16.45 ? 326 ILE B CG1   1 
ATOM   5562  C  CG2   . ILE D  1 328 ? 30.218  -77.073  -27.057 1.00 12.14 ? 326 ILE B CG2   1 
ATOM   5563  C  CD1   . ILE D  1 328 ? 32.721  -77.523  -25.646 1.00 13.05 ? 326 ILE B CD1   1 
ATOM   5564  N  N     . ILE D  1 329 ? 28.523  -79.001  -29.786 1.00 18.08 ? 327 ILE B N     1 
ATOM   5565  C  CA    . ILE D  1 329 ? 27.786  -78.753  -31.015 1.00 19.91 ? 327 ILE B CA    1 
ATOM   5566  C  C     . ILE D  1 329 ? 26.733  -77.667  -30.803 1.00 22.35 ? 327 ILE B C     1 
ATOM   5567  O  O     . ILE D  1 329 ? 26.153  -77.510  -29.713 1.00 12.89 ? 327 ILE B O     1 
ATOM   5568  C  CB    . ILE D  1 329 ? 27.117  -80.056  -31.530 1.00 21.16 ? 327 ILE B CB    1 
ATOM   5569  C  CG1   . ILE D  1 329 ? 26.172  -80.618  -30.470 1.00 23.04 ? 327 ILE B CG1   1 
ATOM   5570  C  CG2   . ILE D  1 329 ? 28.187  -81.135  -31.856 1.00 25.72 ? 327 ILE B CG2   1 
ATOM   5571  C  CD1   . ILE D  1 329 ? 25.384  -81.890  -30.935 1.00 29.50 ? 327 ILE B CD1   1 
ATOM   5572  N  N     . TYR D  1 330 ? 26.456  -76.938  -31.875 1.00 25.00 ? 328 TYR B N     1 
ATOM   5573  C  CA    . TYR D  1 330 ? 25.468  -75.884  -31.788 1.00 20.43 ? 328 TYR B CA    1 
ATOM   5574  C  C     . TYR D  1 330 ? 24.065  -76.441  -31.635 1.00 22.27 ? 328 TYR B C     1 
ATOM   5575  O  O     . TYR D  1 330 ? 23.660  -77.374  -32.329 1.00 21.18 ? 328 TYR B O     1 
ATOM   5576  C  CB    . TYR D  1 330 ? 25.574  -74.923  -32.976 1.00 22.15 ? 328 TYR B CB    1 
ATOM   5577  C  CG    . TYR D  1 330 ? 24.570  -73.831  -32.854 1.00 21.24 ? 328 TYR B CG    1 
ATOM   5578  C  CD1   . TYR D  1 330 ? 24.830  -72.711  -32.051 1.00 17.07 ? 328 TYR B CD1   1 
ATOM   5579  C  CD2   . TYR D  1 330 ? 23.308  -73.951  -33.468 1.00 20.18 ? 328 TYR B CD2   1 
ATOM   5580  C  CE1   . TYR D  1 330 ? 23.855  -71.677  -31.905 1.00 13.84 ? 328 TYR B CE1   1 
ATOM   5581  C  CE2   . TYR D  1 330 ? 22.337  -72.946  -33.322 1.00 18.59 ? 328 TYR B CE2   1 
ATOM   5582  C  CZ    . TYR D  1 330 ? 22.632  -71.805  -32.549 1.00 22.64 ? 328 TYR B CZ    1 
ATOM   5583  O  OH    . TYR D  1 330 ? 21.686  -70.823  -32.370 1.00 23.68 ? 328 TYR B OH    1 
ATOM   5584  N  N     . ASP D  1 331 ? 23.318  -75.823  -30.728 1.00 19.47 ? 329 ASP B N     1 
ATOM   5585  C  CA    . ASP D  1 331 ? 21.998  -76.260  -30.304 1.00 17.56 ? 329 ASP B CA    1 
ATOM   5586  C  C     . ASP D  1 331 ? 21.195  -74.971  -30.260 1.00 21.88 ? 329 ASP B C     1 
ATOM   5587  O  O     . ASP D  1 331 ? 21.663  -74.018  -29.653 1.00 14.75 ? 329 ASP B O     1 
ATOM   5588  C  CB    . ASP D  1 331 ? 22.204  -76.791  -28.881 1.00 24.62 ? 329 ASP B CB    1 
ATOM   5589  C  CG    . ASP D  1 331 ? 20.939  -77.197  -28.183 1.00 25.71 ? 329 ASP B CG    1 
ATOM   5590  O  OD1   . ASP D  1 331 ? 19.864  -76.560  -28.384 1.00 23.61 ? 329 ASP B OD1   1 
ATOM   5591  O  OD2   . ASP D  1 331 ? 21.060  -78.157  -27.357 1.00 30.92 ? 329 ASP B OD2   1 
ATOM   5592  N  N     . SER D  1 332 ? 20.013  -74.906  -30.888 1.00 17.57 ? 330 SER B N     1 
ATOM   5593  C  CA    . SER D  1 332 ? 19.255  -73.637  -30.906 1.00 18.48 ? 330 SER B CA    1 
ATOM   5594  C  C     . SER D  1 332 ? 17.990  -73.685  -30.066 1.00 15.83 ? 330 SER B C     1 
ATOM   5595  O  O     . SER D  1 332 ? 17.099  -72.871  -30.246 1.00 16.83 ? 330 SER B O     1 
ATOM   5596  C  CB    . SER D  1 332 ? 18.902  -73.197  -32.334 1.00 20.28 ? 330 SER B CB    1 
ATOM   5597  O  OG    . SER D  1 332 ? 17.813  -73.973  -32.819 1.00 22.15 ? 330 SER B OG    1 
ATOM   5598  N  N     . ASP D  1 333 ? 17.885  -74.640  -29.154 1.00 16.01 ? 331 ASP B N     1 
ATOM   5599  C  CA    . ASP D  1 333 ? 16.768  -74.660  -28.205 1.00 15.69 ? 331 ASP B CA    1 
ATOM   5600  C  C     . ASP D  1 333 ? 16.943  -73.431  -27.317 1.00 17.46 ? 331 ASP B C     1 
ATOM   5601  O  O     . ASP D  1 333 ? 18.075  -72.922  -27.193 1.00 15.51 ? 331 ASP B O     1 
ATOM   5602  C  CB    . ASP D  1 333 ? 16.829  -75.953  -27.363 1.00 14.36 ? 331 ASP B CB    1 
ATOM   5603  C  CG    . ASP D  1 333 ? 16.097  -77.133  -28.032 1.00 20.41 ? 331 ASP B CG    1 
ATOM   5604  O  OD1   . ASP D  1 333 ? 14.942  -76.959  -28.464 1.00 22.58 ? 331 ASP B OD1   1 
ATOM   5605  O  OD2   . ASP D  1 333 ? 16.664  -78.238  -28.134 1.00 21.21 ? 331 ASP B OD2   1 
ATOM   5606  N  N     . THR D  1 334 ? 15.851  -72.943  -26.724 1.00 18.70 ? 332 THR B N     1 
ATOM   5607  C  CA    . THR D  1 334 ? 15.901  -71.821  -25.779 1.00 18.42 ? 332 THR B CA    1 
ATOM   5608  C  C     . THR D  1 334 ? 16.842  -72.162  -24.626 1.00 22.47 ? 332 THR B C     1 
ATOM   5609  O  O     . THR D  1 334 ? 16.992  -73.344  -24.304 1.00 16.89 ? 332 THR B O     1 
ATOM   5610  C  CB    . THR D  1 334 ? 14.529  -71.490  -25.201 1.00 24.29 ? 332 THR B CB    1 
ATOM   5611  O  OG1   . THR D  1 334 ? 14.013  -72.639  -24.507 1.00 20.60 ? 332 THR B OG1   1 
ATOM   5612  C  CG2   . THR D  1 334 ? 13.561  -71.058  -26.321 1.00 23.05 ? 332 THR B CG2   1 
ATOM   5613  N  N     . PHE D  1 335 ? 17.442  -71.130  -24.011 1.00 17.41 ? 333 PHE B N     1 
ATOM   5614  C  CA    . PHE D  1 335 ? 18.403  -71.313  -22.937 1.00 24.04 ? 333 PHE B CA    1 
ATOM   5615  C  C     . PHE D  1 335 ? 17.854  -72.027  -21.701 1.00 16.04 ? 333 PHE B C     1 
ATOM   5616  O  O     . PHE D  1 335 ? 18.544  -72.840  -21.092 1.00 16.01 ? 333 PHE B O     1 
ATOM   5617  C  CB    . PHE D  1 335 ? 19.064  -69.974  -22.558 1.00 13.44 ? 333 PHE B CB    1 
ATOM   5618  C  CG    . PHE D  1 335 ? 19.791  -69.322  -23.724 1.00 18.11 ? 333 PHE B CG    1 
ATOM   5619  C  CD1   . PHE D  1 335 ? 20.325  -70.117  -24.732 1.00 18.37 ? 333 PHE B CD1   1 
ATOM   5620  C  CD2   . PHE D  1 335 ? 19.926  -67.918  -23.820 1.00 16.27 ? 333 PHE B CD2   1 
ATOM   5621  C  CE1   . PHE D  1 335 ? 21.013  -69.544  -25.831 1.00 20.92 ? 333 PHE B CE1   1 
ATOM   5622  C  CE2   . PHE D  1 335 ? 20.572  -67.344  -24.932 1.00 13.45 ? 333 PHE B CE2   1 
ATOM   5623  C  CZ    . PHE D  1 335 ? 21.115  -68.148  -25.927 1.00 18.42 ? 333 PHE B CZ    1 
ATOM   5624  N  N     . ASP D  1 336 ? 16.623  -71.732  -21.338 1.00 17.26 ? 334 ASP B N     1 
ATOM   5625  C  CA    . ASP D  1 336 ? 15.995  -72.440  -20.234 1.00 23.48 ? 334 ASP B CA    1 
ATOM   5626  C  C     . ASP D  1 336 ? 15.852  -73.940  -20.516 1.00 21.29 ? 334 ASP B C     1 
ATOM   5627  O  O     . ASP D  1 336 ? 15.883  -74.760  -19.595 1.00 19.93 ? 334 ASP B O     1 
ATOM   5628  C  CB    . ASP D  1 336 ? 14.639  -71.821  -19.909 1.00 26.17 ? 334 ASP B CB    1 
ATOM   5629  C  CG    . ASP D  1 336 ? 13.765  -71.640  -21.131 1.00 29.67 ? 334 ASP B CG    1 
ATOM   5630  O  OD1   . ASP D  1 336 ? 14.039  -70.708  -21.933 1.00 37.77 ? 334 ASP B OD1   1 
ATOM   5631  O  OD2   . ASP D  1 336 ? 12.778  -72.406  -21.266 1.00 31.07 ? 334 ASP B OD2   1 
ATOM   5632  N  N     . ILE D  1 337 ? 15.718  -74.309  -21.789 1.00 19.93 ? 335 ILE B N     1 
ATOM   5633  C  CA    . ILE D  1 337 ? 15.529  -75.716  -22.149 1.00 20.81 ? 335 ILE B CA    1 
ATOM   5634  C  C     . ILE D  1 337 ? 16.909  -76.305  -22.144 1.00 20.58 ? 335 ILE B C     1 
ATOM   5635  O  O     . ILE D  1 337 ? 17.125  -77.418  -21.671 1.00 17.55 ? 335 ILE B O     1 
ATOM   5636  C  CB    . ILE D  1 337 ? 14.890  -75.882  -23.561 1.00 22.30 ? 335 ILE B CB    1 
ATOM   5637  C  CG1   . ILE D  1 337 ? 13.445  -75.369  -23.601 1.00 24.40 ? 335 ILE B CG1   1 
ATOM   5638  C  CG2   . ILE D  1 337 ? 15.068  -77.338  -24.115 1.00 18.40 ? 335 ILE B CG2   1 
ATOM   5639  C  CD1   . ILE D  1 337 ? 12.490  -76.232  -22.839 1.00 29.57 ? 335 ILE B CD1   1 
ATOM   5640  N  N     . GLN D  1 338 ? 17.879  -75.556  -22.644 1.00 17.31 ? 336 GLN B N     1 
ATOM   5641  C  CA    . GLN D  1 338 ? 19.234  -76.092  -22.613 1.00 16.58 ? 336 GLN B CA    1 
ATOM   5642  C  C     . GLN D  1 338 ? 19.693  -76.376  -21.176 1.00 18.66 ? 336 GLN B C     1 
ATOM   5643  O  O     . GLN D  1 338 ? 20.403  -77.367  -20.925 1.00 17.84 ? 336 GLN B O     1 
ATOM   5644  C  CB    . GLN D  1 338 ? 20.203  -75.173  -23.353 1.00 18.39 ? 336 GLN B CB    1 
ATOM   5645  C  CG    . GLN D  1 338 ? 19.947  -75.067  -24.840 1.00 18.81 ? 336 GLN B CG    1 
ATOM   5646  C  CD    . GLN D  1 338 ? 21.072  -74.360  -25.549 1.00 18.12 ? 336 GLN B CD    1 
ATOM   5647  O  OE1   . GLN D  1 338 ? 22.258  -74.559  -25.225 1.00 21.23 ? 336 GLN B OE1   1 
ATOM   5648  N  NE2   . GLN D  1 338 ? 20.724  -73.520  -26.510 1.00 16.52 ? 336 GLN B NE2   1 
ATOM   5649  N  N     . PHE D  1 339 ? 19.266  -75.524  -20.240 1.00 16.37 ? 337 PHE B N     1 
ATOM   5650  C  CA    . PHE D  1 339 ? 19.566  -75.689  -18.822 1.00 18.63 ? 337 PHE B CA    1 
ATOM   5651  C  C     . PHE D  1 339 ? 19.100  -77.052  -18.390 1.00 17.31 ? 337 PHE B C     1 
ATOM   5652  O  O     . PHE D  1 339 ? 19.887  -77.829  -17.824 1.00 15.20 ? 337 PHE B O     1 
ATOM   5653  C  CB    . PHE D  1 339 ? 18.849  -74.604  -18.004 1.00 17.72 ? 337 PHE B CB    1 
ATOM   5654  C  CG    . PHE D  1 339 ? 18.920  -74.765  -16.489 1.00 17.43 ? 337 PHE B CG    1 
ATOM   5655  C  CD1   . PHE D  1 339 ? 19.931  -74.147  -15.747 1.00 16.06 ? 337 PHE B CD1   1 
ATOM   5656  C  CD2   . PHE D  1 339 ? 17.893  -75.404  -15.797 1.00 17.54 ? 337 PHE B CD2   1 
ATOM   5657  C  CE1   . PHE D  1 339 ? 19.966  -74.239  -14.348 1.00 17.66 ? 337 PHE B CE1   1 
ATOM   5658  C  CE2   . PHE D  1 339 ? 17.905  -75.494  -14.411 1.00 23.36 ? 337 PHE B CE2   1 
ATOM   5659  C  CZ    . PHE D  1 339 ? 18.967  -74.909  -13.671 1.00 23.06 ? 337 PHE B CZ    1 
ATOM   5660  N  N     . THR D  1 340 ? 17.823  -77.339  -18.680 1.00 19.38 ? 338 THR B N     1 
ATOM   5661  C  CA    . THR D  1 340 ? 17.200  -78.554  -18.174 1.00 17.87 ? 338 THR B CA    1 
ATOM   5662  C  C     . THR D  1 340 ? 17.798  -79.792  -18.846 1.00 17.67 ? 338 THR B C     1 
ATOM   5663  O  O     . THR D  1 340 ? 18.048  -80.820  -18.200 1.00 19.86 ? 338 THR B O     1 
ATOM   5664  C  CB    . THR D  1 340 ? 15.665  -78.540  -18.345 1.00 21.90 ? 338 THR B CB    1 
ATOM   5665  O  OG1   . THR D  1 340 ? 15.105  -77.477  -17.570 1.00 15.72 ? 338 THR B OG1   1 
ATOM   5666  C  CG2   . THR D  1 340 ? 15.085  -79.848  -17.883 1.00 16.85 ? 338 THR B CG2   1 
ATOM   5667  N  N     . SER D  1 341 ? 18.037  -79.703  -20.144 1.00 17.65 ? 339 SER B N     1 
ATOM   5668  C  CA    . SER D  1 341 ? 18.604  -80.843  -20.870 1.00 23.15 ? 339 SER B CA    1 
ATOM   5669  C  C     . SER D  1 341 ? 19.987  -81.253  -20.343 1.00 19.95 ? 339 SER B C     1 
ATOM   5670  O  O     . SER D  1 341 ? 20.259  -82.444  -20.078 1.00 17.44 ? 339 SER B O     1 
ATOM   5671  C  CB    . SER D  1 341 ? 18.693  -80.520  -22.362 1.00 26.24 ? 339 SER B CB    1 
ATOM   5672  O  OG    . SER D  1 341 ? 19.271  -81.621  -23.050 1.00 30.32 ? 339 SER B OG    1 
ATOM   5673  N  N     . ARG D  1 342 ? 20.879  -80.279  -20.191 1.00 19.48 ? 340 ARG B N     1 
ATOM   5674  C  CA    . ARG D  1 342 ? 22.240  -80.615  -19.799 1.00 18.99 ? 340 ARG B CA    1 
ATOM   5675  C  C     . ARG D  1 342 ? 22.273  -81.170  -18.377 1.00 19.33 ? 340 ARG B C     1 
ATOM   5676  O  O     . ARG D  1 342 ? 23.004  -82.138  -18.099 1.00 17.64 ? 340 ARG B O     1 
ATOM   5677  C  CB    . ARG D  1 342 ? 23.174  -79.400  -19.937 1.00 15.61 ? 340 ARG B CB    1 
ATOM   5678  C  CG    . ARG D  1 342 ? 24.616  -79.680  -19.524 1.00 16.91 ? 340 ARG B CG    1 
ATOM   5679  C  CD    . ARG D  1 342 ? 25.309  -80.771  -20.368 1.00 18.60 ? 340 ARG B CD    1 
ATOM   5680  N  NE    . ARG D  1 342 ? 25.039  -80.626  -21.800 1.00 17.73 ? 340 ARG B NE    1 
ATOM   5681  C  CZ    . ARG D  1 342 ? 25.854  -80.017  -22.657 1.00 20.35 ? 340 ARG B CZ    1 
ATOM   5682  N  NH1   . ARG D  1 342 ? 27.020  -79.522  -22.238 1.00 18.86 ? 340 ARG B NH1   1 
ATOM   5683  N  NH2   . ARG D  1 342 ? 25.507  -79.932  -23.931 1.00 16.68 ? 340 ARG B NH2   1 
ATOM   5684  N  N     . ARG D  1 343 ? 21.494  -80.565  -17.478 1.00 17.79 ? 341 ARG B N     1 
ATOM   5685  C  CA    . ARG D  1 343 ? 21.343  -81.133  -16.125 1.00 18.42 ? 341 ARG B CA    1 
ATOM   5686  C  C     . ARG D  1 343 ? 20.714  -82.540  -16.130 1.00 21.69 ? 341 ARG B C     1 
ATOM   5687  O  O     . ARG D  1 343 ? 21.036  -83.390  -15.284 1.00 21.07 ? 341 ARG B O     1 
ATOM   5688  C  CB    . ARG D  1 343 ? 20.577  -80.197  -15.185 1.00 18.94 ? 341 ARG B CB    1 
ATOM   5689  C  CG    . ARG D  1 343 ? 21.356  -78.918  -14.749 1.00 13.40 ? 341 ARG B CG    1 
ATOM   5690  C  CD    . ARG D  1 343 ? 20.401  -77.939  -14.139 1.00 18.23 ? 341 ARG B CD    1 
ATOM   5691  N  NE    . ARG D  1 343 ? 19.749  -78.567  -12.997 1.00 18.55 ? 341 ARG B NE    1 
ATOM   5692  C  CZ    . ARG D  1 343 ? 20.326  -78.710  -11.805 1.00 24.80 ? 341 ARG B CZ    1 
ATOM   5693  N  NH1   . ARG D  1 343 ? 21.564  -78.263  -11.622 1.00 25.33 ? 341 ARG B NH1   1 
ATOM   5694  N  NH2   . ARG D  1 343 ? 19.679  -79.314  -10.795 1.00 23.08 ? 341 ARG B NH2   1 
ATOM   5695  N  N     . PHE D  1 344 ? 19.837  -82.799  -17.085 1.00 17.61 ? 342 PHE B N     1 
ATOM   5696  C  CA    . PHE D  1 344 ? 19.208  -84.124  -17.164 1.00 18.46 ? 342 PHE B CA    1 
ATOM   5697  C  C     . PHE D  1 344 ? 20.300  -85.181  -17.425 1.00 16.96 ? 342 PHE B C     1 
ATOM   5698  O  O     . PHE D  1 344 ? 20.397  -86.218  -16.744 1.00 18.00 ? 342 PHE B O     1 
ATOM   5699  C  CB    . PHE D  1 344 ? 18.114  -84.120  -18.244 1.00 18.22 ? 342 PHE B CB    1 
ATOM   5700  C  CG    . PHE D  1 344 ? 17.501  -85.483  -18.500 1.00 24.83 ? 342 PHE B CG    1 
ATOM   5701  C  CD1   . PHE D  1 344 ? 16.590  -86.015  -17.607 1.00 22.47 ? 342 PHE B CD1   1 
ATOM   5702  C  CD2   . PHE D  1 344 ? 17.856  -86.223  -19.620 1.00 19.88 ? 342 PHE B CD2   1 
ATOM   5703  C  CE1   . PHE D  1 344 ? 16.036  -87.278  -17.826 1.00 25.81 ? 342 PHE B CE1   1 
ATOM   5704  C  CE2   . PHE D  1 344 ? 17.304  -87.470  -19.852 1.00 27.68 ? 342 PHE B CE2   1 
ATOM   5705  C  CZ    . PHE D  1 344 ? 16.387  -87.996  -18.951 1.00 21.45 ? 342 PHE B CZ    1 
ATOM   5706  N  N     . TYR D  1 345 ? 21.168  -84.894  -18.387 1.00 15.25 ? 343 TYR B N     1 
ATOM   5707  C  CA    . TYR D  1 345 ? 22.218  -85.823  -18.735 1.00 16.75 ? 343 TYR B CA    1 
ATOM   5708  C  C     . TYR D  1 345 ? 23.295  -85.965  -17.666 1.00 20.47 ? 343 TYR B C     1 
ATOM   5709  O  O     . TYR D  1 345 ? 23.876  -87.064  -17.514 1.00 19.91 ? 343 TYR B O     1 
ATOM   5710  C  CB    . TYR D  1 345 ? 22.784  -85.536  -20.153 1.00 17.07 ? 343 TYR B CB    1 
ATOM   5711  C  CG    . TYR D  1 345 ? 21.663  -85.797  -21.165 1.00 20.59 ? 343 TYR B CG    1 
ATOM   5712  C  CD1   . TYR D  1 345 ? 21.183  -87.095  -21.370 1.00 19.20 ? 343 TYR B CD1   1 
ATOM   5713  C  CD2   . TYR D  1 345 ? 21.064  -84.767  -21.858 1.00 18.73 ? 343 TYR B CD2   1 
ATOM   5714  C  CE1   . TYR D  1 345 ? 20.160  -87.363  -22.270 1.00 18.18 ? 343 TYR B CE1   1 
ATOM   5715  C  CE2   . TYR D  1 345 ? 20.028  -85.012  -22.751 1.00 24.42 ? 343 TYR B CE2   1 
ATOM   5716  C  CZ    . TYR D  1 345 ? 19.575  -86.305  -22.953 1.00 24.86 ? 343 TYR B CZ    1 
ATOM   5717  O  OH    . TYR D  1 345 ? 18.531  -86.552  -23.832 1.00 21.69 ? 343 TYR B OH    1 
ATOM   5718  N  N     . ILE D  1 346 ? 23.584  -84.881  -16.947 1.00 17.79 ? 344 ILE B N     1 
ATOM   5719  C  CA    . ILE D  1 346 ? 24.633  -84.955  -15.924 1.00 13.51 ? 344 ILE B CA    1 
ATOM   5720  C  C     . ILE D  1 346 ? 24.078  -85.900  -14.848 1.00 20.90 ? 344 ILE B C     1 
ATOM   5721  O  O     . ILE D  1 346 ? 24.742  -86.853  -14.436 1.00 17.60 ? 344 ILE B O     1 
ATOM   5722  C  CB    . ILE D  1 346 ? 24.972  -83.553  -15.343 1.00 18.49 ? 344 ILE B CB    1 
ATOM   5723  C  CG1   . ILE D  1 346 ? 25.700  -82.710  -16.398 1.00 17.28 ? 344 ILE B CG1   1 
ATOM   5724  C  CG2   . ILE D  1 346 ? 25.870  -83.674  -14.083 1.00 17.80 ? 344 ILE B CG2   1 
ATOM   5725  C  CD1   . ILE D  1 346 ? 25.694  -81.207  -16.064 1.00 19.23 ? 344 ILE B CD1   1 
ATOM   5726  N  N     . GLU D  1 347 ? 22.838  -85.660  -14.433 1.00 17.65 ? 345 GLU B N     1 
ATOM   5727  C  CA    . GLU D  1 347 ? 22.190  -86.515  -13.439 1.00 19.76 ? 345 GLU B CA    1 
ATOM   5728  C  C     . GLU D  1 347 ? 22.084  -87.995  -13.850 1.00 20.37 ? 345 GLU B C     1 
ATOM   5729  O  O     . GLU D  1 347 ? 22.308  -88.892  -13.036 1.00 17.83 ? 345 GLU B O     1 
ATOM   5730  C  CB    . GLU D  1 347 ? 20.796  -85.990  -13.111 1.00 17.20 ? 345 GLU B CB    1 
ATOM   5731  C  CG    . GLU D  1 347 ? 20.013  -86.983  -12.254 1.00 22.28 ? 345 GLU B CG    1 
ATOM   5732  C  CD    . GLU D  1 347 ? 18.678  -86.446  -11.781 1.00 20.98 ? 345 GLU B CD    1 
ATOM   5733  O  OE1   . GLU D  1 347 ? 18.083  -85.587  -12.470 1.00 28.62 ? 345 GLU B OE1   1 
ATOM   5734  O  OE2   . GLU D  1 347 ? 18.241  -86.862  -10.698 1.00 29.56 ? 345 GLU B OE2   1 
ATOM   5735  N  N     . LYS D  1 348 ? 21.743  -88.226  -15.116 1.00 18.10 ? 346 LYS B N     1 
ATOM   5736  C  CA    . LYS D  1 348 ? 21.625  -89.575  -15.683 1.00 21.23 ? 346 LYS B CA    1 
ATOM   5737  C  C     . LYS D  1 348 ? 22.939  -90.338  -15.702 1.00 26.52 ? 346 LYS B C     1 
ATOM   5738  O  O     . LYS D  1 348 ? 23.013  -91.529  -15.297 1.00 20.32 ? 346 LYS B O     1 
ATOM   5739  C  CB    . LYS D  1 348 ? 21.084  -89.491  -17.115 1.00 17.32 ? 346 LYS B CB    1 
ATOM   5740  C  CG    . LYS D  1 348 ? 20.625  -90.835  -17.690 1.00 25.33 ? 346 LYS B CG    1 
ATOM   5741  C  CD    . LYS D  1 348 ? 20.184  -90.699  -19.142 1.00 24.04 ? 346 LYS B CD    1 
ATOM   5742  C  CE    . LYS D  1 348 ? 19.638  -92.017  -19.688 1.00 29.50 ? 346 LYS B CE    1 
ATOM   5743  N  NZ    . LYS D  1 348 ? 18.381  -92.404  -18.993 1.00 31.69 ? 346 LYS B NZ    1 
ATOM   5744  N  N     . ILE D  1 349 ? 23.983  -89.683  -16.208 1.00 19.69 ? 347 ILE B N     1 
ATOM   5745  C  CA    . ILE D  1 349 ? 25.319  -90.281  -16.163 1.00 22.80 ? 347 ILE B CA    1 
ATOM   5746  C  C     . ILE D  1 349 ? 25.763  -90.606  -14.704 1.00 21.76 ? 347 ILE B C     1 
ATOM   5747  O  O     . ILE D  1 349 ? 26.249  -91.714  -14.419 1.00 23.83 ? 347 ILE B O     1 
ATOM   5748  C  CB    . ILE D  1 349 ? 26.348  -89.392  -16.879 1.00 19.73 ? 347 ILE B CB    1 
ATOM   5749  C  CG1   . ILE D  1 349 ? 25.920  -89.126  -18.328 1.00 18.49 ? 347 ILE B CG1   1 
ATOM   5750  C  CG2   . ILE D  1 349 ? 27.748  -90.013  -16.840 1.00 17.02 ? 347 ILE B CG2   1 
ATOM   5751  C  CD1   . ILE D  1 349 ? 26.823  -88.085  -19.101 1.00 16.33 ? 347 ILE B CD1   1 
ATOM   5752  N  N     . TYR D  1 350 ? 25.604  -89.649  -13.790 1.00 23.43 ? 348 TYR B N     1 
ATOM   5753  C  CA    . TYR D  1 350 ? 26.007  -89.840  -12.383 1.00 19.30 ? 348 TYR B CA    1 
ATOM   5754  C  C     . TYR D  1 350 ? 25.262  -91.062  -11.792 1.00 27.06 ? 348 TYR B C     1 
ATOM   5755  O  O     . TYR D  1 350 ? 25.866  -91.927  -11.157 1.00 20.22 ? 348 TYR B O     1 
ATOM   5756  C  CB    . TYR D  1 350 ? 25.695  -88.587  -11.516 1.00 25.28 ? 348 TYR B CB    1 
ATOM   5757  C  CG    . TYR D  1 350 ? 26.055  -88.835  -10.065 1.00 26.86 ? 348 TYR B CG    1 
ATOM   5758  C  CD1   . TYR D  1 350 ? 27.358  -88.617  -9.601  1.00 31.18 ? 348 TYR B CD1   1 
ATOM   5759  C  CD2   . TYR D  1 350 ? 25.118  -89.359  -9.177  1.00 23.84 ? 348 TYR B CD2   1 
ATOM   5760  C  CE1   . TYR D  1 350 ? 27.700  -88.893  -8.269  1.00 29.37 ? 348 TYR B CE1   1 
ATOM   5761  C  CE2   . TYR D  1 350 ? 25.447  -89.635  -7.864  1.00 31.58 ? 348 TYR B CE2   1 
ATOM   5762  C  CZ    . TYR D  1 350 ? 26.742  -89.411  -7.415  1.00 30.13 ? 348 TYR B CZ    1 
ATOM   5763  O  OH    . TYR D  1 350 ? 27.056  -89.687  -6.112  1.00 34.05 ? 348 TYR B OH    1 
ATOM   5764  N  N     . ASN D  1 351 ? 23.949  -91.115  -12.005 1.00 25.56 ? 349 ASN B N     1 
ATOM   5765  C  CA    . ASN D  1 351 ? 23.149  -92.256  -11.564 1.00 27.03 ? 349 ASN B CA    1 
ATOM   5766  C  C     . ASN D  1 351 ? 23.626  -93.572  -12.170 1.00 28.09 ? 349 ASN B C     1 
ATOM   5767  O  O     . ASN D  1 351 ? 23.602  -94.622  -11.518 1.00 32.63 ? 349 ASN B O     1 
ATOM   5768  C  CB    . ASN D  1 351 ? 21.669  -92.019  -11.858 1.00 26.47 ? 349 ASN B CB    1 
ATOM   5769  C  CG    . ASN D  1 351 ? 21.046  -91.079  -10.882 1.00 26.42 ? 349 ASN B CG    1 
ATOM   5770  O  OD1   . ASN D  1 351 ? 21.562  -90.914  -9.789  1.00 30.36 ? 349 ASN B OD1   1 
ATOM   5771  N  ND2   . ASN D  1 351 ? 19.923  -90.451  -11.255 1.00 28.78 ? 349 ASN B ND2   1 
ATOM   5772  N  N     . GLU D  1 352 ? 24.086  -93.528  -13.410 1.00 24.65 ? 350 GLU B N     1 
ATOM   5773  C  CA    . GLU D  1 352 ? 24.503  -94.764  -14.042 1.00 29.32 ? 350 GLU B CA    1 
ATOM   5774  C  C     . GLU D  1 352 ? 25.815  -95.347  -13.494 1.00 33.09 ? 350 GLU B C     1 
ATOM   5775  O  O     . GLU D  1 352 ? 26.045  -96.548  -13.632 1.00 29.66 ? 350 GLU B O     1 
ATOM   5776  C  CB    . GLU D  1 352 ? 24.559  -94.624  -15.562 1.00 29.62 ? 350 GLU B CB    1 
ATOM   5777  C  CG    . GLU D  1 352 ? 23.232  -94.937  -16.233 1.00 26.72 ? 350 GLU B CG    1 
ATOM   5778  C  CD    . GLU D  1 352 ? 23.323  -94.931  -17.755 1.00 34.99 ? 350 GLU B CD    1 
ATOM   5779  O  OE1   . GLU D  1 352 ? 24.242  -95.591  -18.316 1.00 32.86 ? 350 GLU B OE1   1 
ATOM   5780  O  OE2   . GLU D  1 352 ? 22.453  -94.267  -18.373 1.00 33.41 ? 350 GLU B OE2   1 
ATOM   5781  N  N     . LEU D  1 353 ? 26.622  -94.527  -12.828 1.00 28.68 ? 351 LEU B N     1 
ATOM   5782  C  CA    . LEU D  1 353 ? 27.857  -94.988  -12.204 1.00 32.55 ? 351 LEU B CA    1 
ATOM   5783  C  C     . LEU D  1 353 ? 27.600  -95.885  -10.995 1.00 38.51 ? 351 LEU B C     1 
ATOM   5784  O  O     . LEU D  1 353 ? 28.469  -96.651  -10.585 1.00 38.49 ? 351 LEU B O     1 
ATOM   5785  C  CB    . LEU D  1 353 ? 28.707  -93.797  -11.768 1.00 33.84 ? 351 LEU B CB    1 
ATOM   5786  C  CG    . LEU D  1 353 ? 29.004  -92.756  -12.840 1.00 25.00 ? 351 LEU B CG    1 
ATOM   5787  C  CD1   . LEU D  1 353 ? 29.678  -91.540  -12.226 1.00 24.02 ? 351 LEU B CD1   1 
ATOM   5788  C  CD2   . LEU D  1 353 ? 29.857  -93.371  -13.933 1.00 18.54 ? 351 LEU B CD2   1 
ATOM   5789  N  N     . ASN D  1 354 ? 26.411  -95.767  -10.420 1.00 36.02 ? 352 ASN B N     1 
ATOM   5790  C  CA    . ASN D  1 354 ? 26.041  -96.544  -9.245  1.00 48.43 ? 352 ASN B CA    1 
ATOM   5791  C  C     . ASN D  1 354 ? 27.049  -96.391  -8.104  1.00 56.55 ? 352 ASN B C     1 
ATOM   5792  O  O     . ASN D  1 354 ? 27.974  -97.189  -7.969  1.00 60.50 ? 352 ASN B O     1 
ATOM   5793  C  CB    . ASN D  1 354 ? 25.877  -98.027  -9.609  1.00 47.54 ? 352 ASN B CB    1 
ATOM   5794  C  CG    . ASN D  1 354 ? 24.948  -98.246  -10.794 1.00 50.96 ? 352 ASN B CG    1 
ATOM   5795  O  OD1   . ASN D  1 354 ? 23.832  -97.732  -10.830 1.00 46.97 ? 352 ASN B OD1   1 
ATOM   5796  N  ND2   . ASN D  1 354 ? 25.406  -99.022  -11.766 1.00 47.42 ? 352 ASN B ND2   1 
ATOM   5797  N  N     . ILE D  1 355 ? 26.871  -95.366  -7.280  1.00 59.71 ? 353 ILE B N     1 
ATOM   5798  C  CA    . ILE D  1 355 ? 27.785  -95.135  -6.164  1.00 58.79 ? 353 ILE B CA    1 
ATOM   5799  C  C     . ILE D  1 355 ? 27.098  -94.485  -4.966  1.00 55.68 ? 353 ILE B C     1 
ATOM   5800  O  O     . ILE D  1 355 ? 25.908  -94.182  -5.006  1.00 49.11 ? 353 ILE B O     1 
ATOM   5801  C  CB    . ILE D  1 355 ? 28.991  -94.275  -6.591  1.00 49.21 ? 353 ILE B CB    1 
ATOM   5802  C  CG1   . ILE D  1 355 ? 28.519  -92.938  -7.157  1.00 47.15 ? 353 ILE B CG1   1 
ATOM   5803  C  CG2   . ILE D  1 355 ? 29.833  -95.014  -7.615  1.00 40.46 ? 353 ILE B CG2   1 
ATOM   5804  C  CD1   . ILE D  1 355 ? 29.579  -92.188  -7.931  1.00 37.55 ? 353 ILE B CD1   1 
ATOM   5805  C  "C4'" . A   E  2 3   ? 31.118  -47.964  -15.217 0.74 43.51 ? 501 A   W "C4'" 1 
ATOM   5806  O  "O4'" . A   E  2 3   ? 30.374  -48.165  -16.443 0.74 37.51 ? 501 A   W "O4'" 1 
ATOM   5807  C  "C3'" . A   E  2 3   ? 31.822  -49.283  -14.975 0.74 38.41 ? 501 A   W "C3'" 1 
ATOM   5808  O  "O3'" . A   E  2 3   ? 30.887  -50.055  -14.284 0.74 37.32 ? 501 A   W "O3'" 1 
ATOM   5809  C  "C2'" . A   E  2 3   ? 32.131  -49.797  -16.383 0.74 38.58 ? 501 A   W "C2'" 1 
ATOM   5810  C  "C1'" . A   E  2 3   ? 30.806  -49.359  -17.056 0.74 36.62 ? 501 A   W "C1'" 1 
ATOM   5811  N  N9    . A   E  2 3   ? 30.940  -49.074  -18.482 0.74 36.69 ? 501 A   W N9    1 
ATOM   5812  C  C8    . A   E  2 3   ? 31.795  -48.175  -19.054 0.74 39.03 ? 501 A   W C8    1 
ATOM   5813  N  N7    . A   E  2 3   ? 31.730  -48.143  -20.371 0.74 44.69 ? 501 A   W N7    1 
ATOM   5814  C  C5    . A   E  2 3   ? 30.763  -49.084  -20.695 0.74 35.30 ? 501 A   W C5    1 
ATOM   5815  C  C6    . A   E  2 3   ? 30.231  -49.525  -21.935 0.74 32.45 ? 501 A   W C6    1 
ATOM   5816  N  N6    . A   E  2 3   ? 30.617  -49.046  -23.130 0.74 32.84 ? 501 A   W N6    1 
ATOM   5817  N  N1    . A   E  2 3   ? 29.262  -50.485  -21.895 0.74 33.18 ? 501 A   W N1    1 
ATOM   5818  C  C2    . A   E  2 3   ? 28.872  -50.963  -20.704 0.74 30.81 ? 501 A   W C2    1 
ATOM   5819  N  N3    . A   E  2 3   ? 29.306  -50.619  -19.480 0.74 36.76 ? 501 A   W N3    1 
ATOM   5820  C  C4    . A   E  2 3   ? 30.255  -49.664  -19.536 0.74 34.49 ? 501 A   W C4    1 
ATOM   5821  P  P     . C   E  2 4   ? 30.927  -50.078  -12.675 0.53 49.99 ? 502 C   W P     1 
ATOM   5822  O  OP1   . C   E  2 4   ? 29.741  -50.812  -12.153 0.53 46.02 ? 502 C   W OP1   1 
ATOM   5823  O  OP2   . C   E  2 4   ? 31.172  -48.690  -12.212 0.53 43.58 ? 502 C   W OP2   1 
ATOM   5824  O  "O5'" . C   E  2 4   ? 32.239  -50.926  -12.356 0.53 44.07 ? 502 C   W "O5'" 1 
ATOM   5825  C  "C5'" . C   E  2 4   ? 32.289  -52.329  -12.598 0.53 36.99 ? 502 C   W "C5'" 1 
ATOM   5826  C  "C4'" . C   E  2 4   ? 32.514  -53.084  -11.317 0.53 36.51 ? 502 C   W "C4'" 1 
ATOM   5827  O  "O4'" . C   E  2 4   ? 33.886  -52.872  -10.878 0.53 40.47 ? 502 C   W "O4'" 1 
ATOM   5828  C  "C3'" . C   E  2 4   ? 31.621  -52.635  -10.160 0.53 43.81 ? 502 C   W "C3'" 1 
ATOM   5829  O  "O3'" . C   E  2 4   ? 31.295  -53.745  -9.330  0.53 45.13 ? 502 C   W "O3'" 1 
ATOM   5830  C  "C2'" . C   E  2 4   ? 32.524  -51.689  -9.383  0.53 42.39 ? 502 C   W "C2'" 1 
ATOM   5831  O  "O2'" . C   E  2 4   ? 32.199  -51.561  -8.018  0.53 39.90 ? 502 C   W "O2'" 1 
ATOM   5832  C  "C1'" . C   E  2 4   ? 33.884  -52.349  -9.565  0.53 41.49 ? 502 C   W "C1'" 1 
ATOM   5833  P  P     . A   E  2 5   ? 29.755  -54.158  -9.139  0.71 55.78 ? 503 A   W P     1 
ATOM   5834  O  OP1   . A   E  2 5   ? 29.750  -55.398  -8.326  0.71 27.47 ? 503 A   W OP1   1 
ATOM   5835  O  OP2   . A   E  2 5   ? 29.167  -54.110  -10.510 0.71 32.89 ? 503 A   W OP2   1 
ATOM   5836  O  "O5'" . A   E  2 5   ? 29.125  -52.944  -8.298  0.71 53.30 ? 503 A   W "O5'" 1 
HETATM 5837  P  P     . G46 F  3 1   ? 33.705  -51.957  -16.879 0.67 45.19 ? 510 G46 R P     1 
HETATM 5838  O  O1P   . G46 F  3 1   ? 33.765  -53.304  -16.270 0.67 19.25 ? 510 G46 R O1P   1 
HETATM 5839  S  S2P   . G46 F  3 1   ? 34.092  -52.088  -18.915 0.67 44.44 ? 510 G46 R S2P   1 
HETATM 5840  O  O3P   . G46 F  3 1   ? 32.281  -51.223  -16.493 0.67 35.16 ? 510 G46 R O3P   1 
HETATM 5841  O  "O5'" . G46 F  3 1   ? 34.904  -51.044  -16.343 0.67 35.71 ? 510 G46 R "O5'" 1 
HETATM 5842  C  "C5'" . G46 F  3 1   ? 35.357  -51.104  -15.013 0.67 31.44 ? 510 G46 R "C5'" 1 
HETATM 5843  C  "C4'" . G46 F  3 1   ? 36.182  -49.836  -14.935 0.67 37.97 ? 510 G46 R "C4'" 1 
HETATM 5844  O  "O4'" . G46 F  3 1   ? 36.657  -49.645  -13.610 0.67 39.13 ? 510 G46 R "O4'" 1 
HETATM 5845  C  "C3'" . G46 F  3 1   ? 37.396  -49.963  -15.838 0.67 44.45 ? 510 G46 R "C3'" 1 
HETATM 5846  O  "O3'" . G46 F  3 1   ? 37.687  -48.657  -16.359 0.67 46.19 ? 510 G46 R "O3'" 1 
HETATM 5847  C  "C2'" . G46 F  3 1   ? 38.495  -50.464  -14.914 0.67 41.79 ? 510 G46 R "C2'" 1 
HETATM 5848  C  "C1'" . G46 F  3 1   ? 38.058  -49.954  -13.543 0.67 38.53 ? 510 G46 R "C1'" 1 
HETATM 5849  O  "O2'" . G46 F  3 1   ? 39.780  -49.949  -15.306 0.67 43.14 ? 510 G46 R "O2'" 1 
ATOM   5850  N  N     . GLN G  1 7   ? 77.543  -81.854  -1.654  1.00 37.55 ? 5   GLN C N     1 
ATOM   5851  C  CA    . GLN G  1 7   ? 77.657  -83.084  -0.880  1.00 45.54 ? 5   GLN C CA    1 
ATOM   5852  C  C     . GLN G  1 7   ? 76.310  -83.759  -0.579  1.00 39.54 ? 5   GLN C C     1 
ATOM   5853  O  O     . GLN G  1 7   ? 75.242  -83.333  -1.067  1.00 39.56 ? 5   GLN C O     1 
ATOM   5854  C  CB    . GLN G  1 7   ? 78.389  -82.819  0.415   1.00 43.53 ? 5   GLN C CB    1 
ATOM   5855  C  CG    . GLN G  1 7   ? 77.977  -81.512  1.028   1.00 46.75 ? 5   GLN C CG    1 
ATOM   5856  C  CD    . GLN G  1 7   ? 78.352  -81.438  2.485   1.00 53.28 ? 5   GLN C CD    1 
ATOM   5857  O  OE1   . GLN G  1 7   ? 78.338  -82.452  3.193   1.00 54.74 ? 5   GLN C OE1   1 
ATOM   5858  N  NE2   . GLN G  1 7   ? 78.709  -80.241  2.946   1.00 63.04 ? 5   GLN C NE2   1 
ATOM   5859  N  N     . ILE G  1 8   ? 76.371  -84.810  0.239   1.00 38.74 ? 6   ILE C N     1 
ATOM   5860  C  CA    . ILE G  1 8   ? 75.275  -85.764  0.336   1.00 33.95 ? 6   ILE C CA    1 
ATOM   5861  C  C     . ILE G  1 8   ? 74.859  -86.035  1.775   1.00 29.95 ? 6   ILE C C     1 
ATOM   5862  O  O     . ILE G  1 8   ? 75.704  -86.135  2.674   1.00 31.00 ? 6   ILE C O     1 
ATOM   5863  C  CB    . ILE G  1 8   ? 75.660  -87.092  -0.356  1.00 32.53 ? 6   ILE C CB    1 
ATOM   5864  C  CG1   . ILE G  1 8   ? 75.756  -86.881  -1.865  1.00 35.75 ? 6   ILE C CG1   1 
ATOM   5865  C  CG2   . ILE G  1 8   ? 74.644  -88.180  -0.059  1.00 32.79 ? 6   ILE C CG2   1 
ATOM   5866  C  CD1   . ILE G  1 8   ? 77.030  -87.377  -2.440  1.00 45.22 ? 6   ILE C CD1   1 
ATOM   5867  N  N     . GLN G  1 9   ? 73.547  -86.154  1.984   1.00 33.58 ? 7   GLN C N     1 
ATOM   5868  C  CA    . GLN G  1 9   ? 73.023  -86.604  3.271   1.00 25.06 ? 7   GLN C CA    1 
ATOM   5869  C  C     . GLN G  1 9   ? 72.509  -88.015  3.072   1.00 25.66 ? 7   GLN C C     1 
ATOM   5870  O  O     . GLN G  1 9   ? 71.974  -88.345  1.998   1.00 26.11 ? 7   GLN C O     1 
ATOM   5871  C  CB    . GLN G  1 9   ? 71.910  -85.686  3.776   1.00 20.09 ? 7   GLN C CB    1 
ATOM   5872  C  CG    . GLN G  1 9   ? 70.803  -85.395  2.765   1.00 19.37 ? 7   GLN C CG    1 
ATOM   5873  C  CD    . GLN G  1 9   ? 69.774  -84.357  3.298   1.00 22.01 ? 7   GLN C CD    1 
ATOM   5874  O  OE1   . GLN G  1 9   ? 69.465  -84.328  4.494   1.00 19.72 ? 7   GLN C OE1   1 
ATOM   5875  N  NE2   . GLN G  1 9   ? 69.274  -83.496  2.412   1.00 21.94 ? 7   GLN C NE2   1 
ATOM   5876  N  N     . HIS G  1 10  ? 72.700  -88.858  4.080   1.00 25.02 ? 8   HIS C N     1 
ATOM   5877  C  CA    . HIS G  1 10  ? 72.184  -90.204  4.004   1.00 22.15 ? 8   HIS C CA    1 
ATOM   5878  C  C     . HIS G  1 10  ? 71.018  -90.355  4.967   1.00 17.93 ? 8   HIS C C     1 
ATOM   5879  O  O     . HIS G  1 10  ? 71.163  -90.191  6.183   1.00 19.34 ? 8   HIS C O     1 
ATOM   5880  C  CB    . HIS G  1 10  ? 73.303  -91.191  4.315   1.00 22.65 ? 8   HIS C CB    1 
ATOM   5881  C  CG    . HIS G  1 10  ? 74.519  -90.977  3.480   1.00 23.71 ? 8   HIS C CG    1 
ATOM   5882  N  ND1   . HIS G  1 10  ? 74.563  -91.274  2.133   1.00 22.19 ? 8   HIS C ND1   1 
ATOM   5883  C  CD2   . HIS G  1 10  ? 75.733  -90.456  3.792   1.00 26.29 ? 8   HIS C CD2   1 
ATOM   5884  C  CE1   . HIS G  1 10  ? 75.757  -90.956  1.656   1.00 26.00 ? 8   HIS C CE1   1 
ATOM   5885  N  NE2   . HIS G  1 10  ? 76.482  -90.454  2.641   1.00 24.46 ? 8   HIS C NE2   1 
ATOM   5886  N  N     . ILE G  1 11  ? 69.845  -90.631  4.427   1.00 20.59 ? 9   ILE C N     1 
ATOM   5887  C  CA    . ILE G  1 11  ? 68.672  -90.680  5.261   1.00 15.05 ? 9   ILE C CA    1 
ATOM   5888  C  C     . ILE G  1 11  ? 68.218  -92.130  5.331   1.00 16.33 ? 9   ILE C C     1 
ATOM   5889  O  O     . ILE G  1 11  ? 68.032  -92.760  4.303   1.00 15.26 ? 9   ILE C O     1 
ATOM   5890  C  CB    . ILE G  1 11  ? 67.545  -89.787  4.662   1.00 21.44 ? 9   ILE C CB    1 
ATOM   5891  C  CG1   . ILE G  1 11  ? 68.022  -88.328  4.490   1.00 24.34 ? 9   ILE C CG1   1 
ATOM   5892  C  CG2   . ILE G  1 11  ? 66.306  -89.867  5.526   1.00 18.50 ? 9   ILE C CG2   1 
ATOM   5893  C  CD1   . ILE G  1 11  ? 67.043  -87.428  3.688   1.00 24.74 ? 9   ILE C CD1   1 
ATOM   5894  N  N     . ALA G  1 12  ? 68.070  -92.665  6.538   1.00 16.77 ? 10  ALA C N     1 
ATOM   5895  C  CA    . ALA G  1 12  ? 67.574  -94.021  6.682   1.00 19.10 ? 10  ALA C CA    1 
ATOM   5896  C  C     . ALA G  1 12  ? 66.042  -94.010  6.558   1.00 13.02 ? 10  ALA C C     1 
ATOM   5897  O  O     . ALA G  1 12  ? 65.336  -93.180  7.183   1.00 16.83 ? 10  ALA C O     1 
ATOM   5898  C  CB    . ALA G  1 12  ? 68.023  -94.665  8.027   1.00 15.42 ? 10  ALA C CB    1 
ATOM   5899  N  N     . ILE G  1 13  ? 65.530  -94.899  5.716   1.00 18.63 ? 11  ILE C N     1 
ATOM   5900  C  CA    . ILE G  1 13  ? 64.092  -95.006  5.570   1.00 18.62 ? 11  ILE C CA    1 
ATOM   5901  C  C     . ILE G  1 13  ? 63.633  -96.381  6.058   1.00 18.14 ? 11  ILE C C     1 
ATOM   5902  O  O     . ILE G  1 13  ? 64.206  -97.409  5.699   1.00 16.05 ? 11  ILE C O     1 
ATOM   5903  C  CB    . ILE G  1 13  ? 63.607  -94.677  4.138   1.00 16.77 ? 11  ILE C CB    1 
ATOM   5904  C  CG1   . ILE G  1 13  ? 64.288  -95.561  3.082   1.00 21.21 ? 11  ILE C CG1   1 
ATOM   5905  C  CG2   . ILE G  1 13  ? 63.814  -93.176  3.806   1.00 17.77 ? 11  ILE C CG2   1 
ATOM   5906  C  CD1   . ILE G  1 13  ? 63.749  -95.289  1.666   1.00 18.63 ? 11  ILE C CD1   1 
ATOM   5907  N  N     . VAL G  1 14  ? 62.602  -96.385  6.894   1.00 14.78 ? 12  VAL C N     1 
ATOM   5908  C  CA    . VAL G  1 14  ? 62.181  -97.615  7.553   1.00 19.13 ? 12  VAL C CA    1 
ATOM   5909  C  C     . VAL G  1 14  ? 60.701  -97.841  7.320   1.00 17.39 ? 12  VAL C C     1 
ATOM   5910  O  O     . VAL G  1 14  ? 59.887  -96.918  7.413   1.00 16.54 ? 12  VAL C O     1 
ATOM   5911  C  CB    . VAL G  1 14  ? 62.496  -97.586  9.068   1.00 16.70 ? 12  VAL C CB    1 
ATOM   5912  C  CG1   . VAL G  1 14  ? 62.045  -98.888  9.742   1.00 17.46 ? 12  VAL C CG1   1 
ATOM   5913  C  CG2   . VAL G  1 14  ? 63.999  -97.335  9.302   1.00 18.89 ? 12  VAL C CG2   1 
ATOM   5914  N  N     . GLY G  1 15  ? 60.355  -99.079  6.988   1.00 18.21 ? 13  GLY C N     1 
ATOM   5915  C  CA    . GLY G  1 15  ? 58.977  -99.401  6.720   1.00 20.99 ? 13  GLY C CA    1 
ATOM   5916  C  C     . GLY G  1 15  ? 58.121  -99.303  7.967   1.00 23.18 ? 13  GLY C C     1 
ATOM   5917  O  O     . GLY G  1 15  ? 57.442  -98.307  8.187   1.00 33.55 ? 13  GLY C O     1 
ATOM   5918  N  N     . SER G  1 16  ? 58.145  -100.345 8.777   1.00 23.12 ? 14  SER C N     1 
ATOM   5919  C  CA    . SER G  1 16  ? 57.186  -100.529 9.870   1.00 21.82 ? 14  SER C CA    1 
ATOM   5920  C  C     . SER G  1 16  ? 57.976  -101.061 11.090  1.00 26.11 ? 14  SER C C     1 
ATOM   5921  O  O     . SER G  1 16  ? 58.713  -102.046 10.983  1.00 21.73 ? 14  SER C O     1 
ATOM   5922  C  CB    . SER G  1 16  ? 56.075  -101.479 9.424   1.00 24.22 ? 14  SER C CB    1 
ATOM   5923  O  OG    . SER G  1 16  ? 55.485  -102.103 10.538  1.00 37.93 ? 14  SER C OG    1 
ATOM   5924  N  N     . VAL G  1 17  ? 57.887  -100.350 12.210  1.00 19.10 ? 15  VAL C N     1 
ATOM   5925  C  CA    . VAL G  1 17  ? 58.776  -100.593 13.345  1.00 17.94 ? 15  VAL C CA    1 
ATOM   5926  C  C     . VAL G  1 17  ? 58.257  -101.671 14.291  1.00 14.48 ? 15  VAL C C     1 
ATOM   5927  O  O     . VAL G  1 17  ? 59.002  -102.560 14.699  1.00 21.07 ? 15  VAL C O     1 
ATOM   5928  C  CB    . VAL G  1 17  ? 59.078  -99.285  14.111  1.00 17.00 ? 15  VAL C CB    1 
ATOM   5929  C  CG1   . VAL G  1 17  ? 59.811  -99.562  15.418  1.00 18.82 ? 15  VAL C CG1   1 
ATOM   5930  C  CG2   . VAL G  1 17  ? 59.896  -98.350  13.235  1.00 18.85 ? 15  VAL C CG2   1 
ATOM   5931  N  N     . HIS G  1 18  ? 56.986  -101.582 14.651  1.00 19.12 ? 16  HIS C N     1 
ATOM   5932  C  CA    . HIS G  1 18  ? 56.377  -102.645 15.423  1.00 24.53 ? 16  HIS C CA    1 
ATOM   5933  C  C     . HIS G  1 18  ? 56.991  -102.864 16.777  1.00 23.28 ? 16  HIS C C     1 
ATOM   5934  O  O     . HIS G  1 18  ? 57.189  -104.001 17.209  1.00 18.44 ? 16  HIS C O     1 
ATOM   5935  C  CB    . HIS G  1 18  ? 56.464  -103.950 14.605  1.00 28.87 ? 16  HIS C CB    1 
ATOM   5936  C  CG    . HIS G  1 18  ? 55.132  -104.542 14.270  1.00 29.60 ? 16  HIS C CG    1 
ATOM   5937  N  ND1   . HIS G  1 18  ? 54.513  -105.474 15.074  1.00 42.46 ? 16  HIS C ND1   1 
ATOM   5938  C  CD2   . HIS G  1 18  ? 54.291  -104.324 13.231  1.00 36.80 ? 16  HIS C CD2   1 
ATOM   5939  C  CE1   . HIS G  1 18  ? 53.350  -105.806 14.545  1.00 39.13 ? 16  HIS C CE1   1 
ATOM   5940  N  NE2   . HIS G  1 18  ? 53.191  -105.123 13.425  1.00 37.49 ? 16  HIS C NE2   1 
ATOM   5941  N  N     . GLY G  1 19  ? 57.280  -101.758 17.444  1.00 21.73 ? 17  GLY C N     1 
ATOM   5942  C  CA    . GLY G  1 19  ? 57.782  -101.788 18.799  1.00 13.13 ? 17  GLY C CA    1 
ATOM   5943  C  C     . GLY G  1 19  ? 59.158  -102.399 18.955  1.00 24.32 ? 17  GLY C C     1 
ATOM   5944  O  O     . GLY G  1 19  ? 59.564  -102.706 20.075  1.00 25.44 ? 17  GLY C O     1 
ATOM   5945  N  N     . LYS G  1 20  ? 59.881  -102.576 17.849  1.00 15.36 ? 18  LYS C N     1 
ATOM   5946  C  CA    . LYS G  1 20  ? 61.204  -103.152 17.914  1.00 17.15 ? 18  LYS C CA    1 
ATOM   5947  C  C     . LYS G  1 20  ? 62.300  -102.084 17.727  1.00 20.58 ? 18  LYS C C     1 
ATOM   5948  O  O     . LYS G  1 20  ? 63.146  -102.172 16.814  1.00 15.85 ? 18  LYS C O     1 
ATOM   5949  C  CB    . LYS G  1 20  ? 61.284  -104.245 16.852  1.00 20.82 ? 18  LYS C CB    1 
ATOM   5950  C  CG    . LYS G  1 20  ? 60.614  -105.557 17.288  1.00 21.43 ? 18  LYS C CG    1 
ATOM   5951  C  CD    . LYS G  1 20  ? 60.797  -106.618 16.165  1.00 29.79 ? 18  LYS C CD    1 
ATOM   5952  C  CE    . LYS G  1 20  ? 61.020  -108.073 16.697  1.00 36.90 ? 18  LYS C CE    1 
ATOM   5953  N  NZ    . LYS G  1 20  ? 61.483  -109.081 15.613  1.00 33.36 ? 18  LYS C NZ    1 
ATOM   5954  N  N     . TYR G  1 21  ? 62.287  -101.076 18.596  1.00 15.88 ? 19  TYR C N     1 
ATOM   5955  C  CA    . TYR G  1 21  ? 63.211  -99.961  18.424  1.00 17.17 ? 19  TYR C CA    1 
ATOM   5956  C  C     . TYR G  1 21  ? 64.656  -100.330 18.646  1.00 17.28 ? 19  TYR C C     1 
ATOM   5957  O  O     . TYR G  1 21  ? 65.530  -99.860  17.918  1.00 14.29 ? 19  TYR C O     1 
ATOM   5958  C  CB    . TYR G  1 21  ? 62.815  -98.798  19.339  1.00 11.41 ? 19  TYR C CB    1 
ATOM   5959  C  CG    . TYR G  1 21  ? 61.511  -98.150  18.909  1.00 15.80 ? 19  TYR C CG    1 
ATOM   5960  C  CD1   . TYR G  1 21  ? 60.312  -98.635  19.346  1.00 15.86 ? 19  TYR C CD1   1 
ATOM   5961  C  CD2   . TYR G  1 21  ? 61.504  -97.045  18.058  1.00 18.28 ? 19  TYR C CD2   1 
ATOM   5962  C  CE1   . TYR G  1 21  ? 59.101  -98.037  18.956  1.00 15.07 ? 19  TYR C CE1   1 
ATOM   5963  C  CE2   . TYR G  1 21  ? 60.327  -96.448  17.654  1.00 14.71 ? 19  TYR C CE2   1 
ATOM   5964  C  CZ    . TYR G  1 21  ? 59.122  -96.944  18.108  1.00 11.88 ? 19  TYR C CZ    1 
ATOM   5965  O  OH    . TYR G  1 21  ? 57.919  -96.346  17.736  1.00 16.67 ? 19  TYR C OH    1 
ATOM   5966  N  N     . ARG G  1 22  ? 64.929  -101.134 19.669  1.00 19.07 ? 20  ARG C N     1 
ATOM   5967  C  CA    . ARG G  1 22  ? 66.344  -101.476 19.930  1.00 24.39 ? 20  ARG C CA    1 
ATOM   5968  C  C     . ARG G  1 22  ? 66.956  -102.139 18.710  1.00 18.85 ? 20  ARG C C     1 
ATOM   5969  O  O     . ARG G  1 22  ? 68.058  -101.798 18.274  1.00 24.20 ? 20  ARG C O     1 
ATOM   5970  C  CB    . ARG G  1 22  ? 66.478  -102.363 21.172  1.00 24.10 ? 20  ARG C CB    1 
ATOM   5971  C  CG    . ARG G  1 22  ? 66.211  -101.575 22.465  1.00 26.49 ? 20  ARG C CG    1 
ATOM   5972  C  CD    . ARG G  1 22  ? 66.199  -102.455 23.712  1.00 24.76 ? 20  ARG C CD    1 
ATOM   5973  N  NE    . ARG G  1 22  ? 65.087  -103.393 23.682  1.00 26.97 ? 20  ARG C NE    1 
ATOM   5974  C  CZ    . ARG G  1 22  ? 64.953  -104.422 24.513  1.00 29.16 ? 20  ARG C CZ    1 
ATOM   5975  N  NH1   . ARG G  1 22  ? 65.879  -104.653 25.428  1.00 23.31 ? 20  ARG C NH1   1 
ATOM   5976  N  NH2   . ARG G  1 22  ? 63.894  -105.217 24.416  1.00 24.44 ? 20  ARG C NH2   1 
ATOM   5977  N  N     . GLU G  1 23  ? 66.210  -103.071 18.141  1.00 22.33 ? 21  GLU C N     1 
ATOM   5978  C  CA    A GLU G  1 23  ? 66.688  -103.827 16.982  0.51 21.95 ? 21  GLU C CA    1 
ATOM   5979  C  CA    B GLU G  1 23  ? 66.651  -103.817 16.972  0.49 21.94 ? 21  GLU C CA    1 
ATOM   5980  C  C     . GLU G  1 23  ? 66.882  -102.904 15.778  1.00 19.14 ? 21  GLU C C     1 
ATOM   5981  O  O     . GLU G  1 23  ? 67.846  -103.070 15.022  1.00 21.24 ? 21  GLU C O     1 
ATOM   5982  C  CB    A GLU G  1 23  ? 65.754  -105.007 16.639  0.51 22.34 ? 21  GLU C CB    1 
ATOM   5983  C  CB    B GLU G  1 23  ? 65.615  -104.864 16.591  0.49 22.29 ? 21  GLU C CB    1 
ATOM   5984  C  CG    A GLU G  1 23  ? 66.248  -105.896 15.478  0.51 26.69 ? 21  GLU C CG    1 
ATOM   5985  C  CG    B GLU G  1 23  ? 66.035  -105.641 15.377  0.49 26.25 ? 21  GLU C CG    1 
ATOM   5986  C  CD    A GLU G  1 23  ? 65.346  -107.113 15.183  0.51 25.71 ? 21  GLU C CD    1 
ATOM   5987  C  CD    B GLU G  1 23  ? 67.427  -106.215 15.541  0.49 27.97 ? 21  GLU C CD    1 
ATOM   5988  O  OE1   A GLU G  1 23  ? 64.284  -107.259 15.843  0.51 28.69 ? 21  GLU C OE1   1 
ATOM   5989  O  OE1   B GLU G  1 23  ? 67.790  -106.553 16.683  0.49 28.85 ? 21  GLU C OE1   1 
ATOM   5990  O  OE2   A GLU G  1 23  ? 65.713  -107.912 14.284  0.51 20.25 ? 21  GLU C OE2   1 
ATOM   5991  O  OE2   B GLU G  1 23  ? 68.158  -106.322 14.538  0.49 30.86 ? 21  GLU C OE2   1 
ATOM   5992  N  N     . MET G  1 24  ? 65.978  -101.938 15.606  1.00 18.94 ? 22  MET C N     1 
ATOM   5993  C  CA    . MET G  1 24  ? 66.101  -100.989 14.491  1.00 20.13 ? 22  MET C CA    1 
ATOM   5994  C  C     . MET G  1 24  ? 67.369  -100.165 14.604  1.00 16.41 ? 22  MET C C     1 
ATOM   5995  O  O     . MET G  1 24  ? 68.093  -99.985  13.624  1.00 19.45 ? 22  MET C O     1 
ATOM   5996  C  CB    . MET G  1 24  ? 64.875  -100.055 14.423  1.00 12.75 ? 22  MET C CB    1 
ATOM   5997  C  CG    . MET G  1 24  ? 65.048  -98.895  13.390  1.00 14.60 ? 22  MET C CG    1 
ATOM   5998  S  SD    . MET G  1 24  ? 63.576  -97.844  13.325  1.00 17.20 ? 22  MET C SD    1 
ATOM   5999  C  CE    . MET G  1 24  ? 63.526  -97.232  15.014  1.00 12.52 ? 22  MET C CE    1 
ATOM   6000  N  N     . TYR G  1 25  ? 67.618  -99.646  15.806  1.00 15.24 ? 23  TYR C N     1 
ATOM   6001  C  CA    . TYR G  1 25  ? 68.731  -98.743  16.031  1.00 18.06 ? 23  TYR C CA    1 
ATOM   6002  C  C     . TYR G  1 25  ? 70.015  -99.546  15.969  1.00 23.00 ? 23  TYR C C     1 
ATOM   6003  O  O     . TYR G  1 25  ? 71.042  -99.056  15.481  1.00 20.97 ? 23  TYR C O     1 
ATOM   6004  C  CB    . TYR G  1 25  ? 68.562  -98.000  17.369  1.00 16.68 ? 23  TYR C CB    1 
ATOM   6005  C  CG    . TYR G  1 25  ? 67.478  -96.930  17.282  1.00 16.64 ? 23  TYR C CG    1 
ATOM   6006  C  CD1   . TYR G  1 25  ? 67.464  -96.013  16.212  1.00 17.88 ? 23  TYR C CD1   1 
ATOM   6007  C  CD2   . TYR G  1 25  ? 66.480  -96.829  18.250  1.00 15.52 ? 23  TYR C CD2   1 
ATOM   6008  C  CE1   . TYR G  1 25  ? 66.509  -95.034  16.128  1.00 16.15 ? 23  TYR C CE1   1 
ATOM   6009  C  CE2   . TYR G  1 25  ? 65.507  -95.840  18.179  1.00 14.44 ? 23  TYR C CE2   1 
ATOM   6010  C  CZ    . TYR G  1 25  ? 65.514  -94.964  17.098  1.00 12.99 ? 23  TYR C CZ    1 
ATOM   6011  O  OH    . TYR G  1 25  ? 64.557  -93.984  17.016  1.00 12.11 ? 23  TYR C OH    1 
ATOM   6012  N  N     . ARG G  1 26  ? 69.937  -100.796 16.430  1.00 21.07 ? 24  ARG C N     1 
ATOM   6013  C  CA    . ARG G  1 26  ? 71.055  -101.736 16.248  1.00 22.99 ? 24  ARG C CA    1 
ATOM   6014  C  C     . ARG G  1 26  ? 71.389  -101.835 14.765  1.00 21.02 ? 24  ARG C C     1 
ATOM   6015  O  O     . ARG G  1 26  ? 72.558  -101.597 14.376  1.00 22.71 ? 24  ARG C O     1 
ATOM   6016  C  CB    . ARG G  1 26  ? 70.737  -103.112 16.864  1.00 23.16 ? 24  ARG C CB    1 
ATOM   6017  C  CG    . ARG G  1 26  ? 71.922  -104.062 17.021  1.00 31.80 ? 24  ARG C CG    1 
ATOM   6018  C  CD    . ARG G  1 26  ? 71.545  -105.348 17.802  1.00 43.20 ? 24  ARG C CD    1 
ATOM   6019  N  NE    . ARG G  1 26  ? 70.839  -105.086 19.074  1.00 45.90 ? 24  ARG C NE    1 
ATOM   6020  C  CZ    . ARG G  1 26  ? 69.663  -105.629 19.407  1.00 44.69 ? 24  ARG C CZ    1 
ATOM   6021  N  NH1   . ARG G  1 26  ? 69.067  -106.464 18.559  1.00 44.97 ? 24  ARG C NH1   1 
ATOM   6022  N  NH2   . ARG G  1 26  ? 69.071  -105.346 20.576  1.00 47.33 ? 24  ARG C NH2   1 
ATOM   6023  N  N     . GLN G  1 27  ? 70.400  -102.120 13.904  1.00 16.27 ? 25  GLN C N     1 
ATOM   6024  C  CA    . GLN G  1 27  ? 70.716  -102.201 12.474  1.00 20.25 ? 25  GLN C CA    1 
ATOM   6025  C  C     . GLN G  1 27  ? 71.267  -100.918 11.891  1.00 26.27 ? 25  GLN C C     1 
ATOM   6026  O  O     . GLN G  1 27  ? 72.224  -100.962 11.099  1.00 21.60 ? 25  GLN C O     1 
ATOM   6027  C  CB    . GLN G  1 27  ? 69.540  -102.629 11.601  1.00 19.50 ? 25  GLN C CB    1 
ATOM   6028  C  CG    . GLN G  1 27  ? 68.761  -103.809 12.112  1.00 30.74 ? 25  GLN C CG    1 
ATOM   6029  C  CD    . GLN G  1 27  ? 67.863  -104.404 11.045  1.00 35.97 ? 25  GLN C CD    1 
ATOM   6030  O  OE1   . GLN G  1 27  ? 67.729  -103.857 9.933   1.00 33.26 ? 25  GLN C OE1   1 
ATOM   6031  N  NE2   . GLN G  1 27  ? 67.241  -105.539 11.375  1.00 42.16 ? 25  GLN C NE2   1 
ATOM   6032  N  N     . LEU G  1 28  ? 70.640  -99.785  12.222  1.00 19.61 ? 26  LEU C N     1 
ATOM   6033  C  CA    . LEU G  1 28  ? 71.150  -98.496  11.726  1.00 19.75 ? 26  LEU C CA    1 
ATOM   6034  C  C     . LEU G  1 28  ? 72.624  -98.255  12.109  1.00 23.55 ? 26  LEU C C     1 
ATOM   6035  O  O     . LEU G  1 28  ? 73.436  -97.828  11.263  1.00 24.01 ? 26  LEU C O     1 
ATOM   6036  C  CB    . LEU G  1 28  ? 70.270  -97.346  12.205  1.00 18.92 ? 26  LEU C CB    1 
ATOM   6037  C  CG    . LEU G  1 28  ? 68.825  -97.465  11.688  1.00 19.61 ? 26  LEU C CG    1 
ATOM   6038  C  CD1   . LEU G  1 28  ? 67.797  -96.543  12.401  1.00 17.96 ? 26  LEU C CD1   1 
ATOM   6039  C  CD2   . LEU G  1 28  ? 68.773  -97.279  10.173  1.00 18.19 ? 26  LEU C CD2   1 
ATOM   6040  N  N     . SER G  1 29  ? 72.981  -98.507  13.375  1.00 20.93 ? 27  SER C N     1 
ATOM   6041  C  CA    . SER G  1 29  ? 74.370  -98.290  13.806  1.00 25.51 ? 27  SER C CA    1 
ATOM   6042  C  C     . SER G  1 29  ? 75.295  -99.224  13.061  1.00 22.90 ? 27  SER C C     1 
ATOM   6043  O  O     . SER G  1 29  ? 76.433  -98.885  12.748  1.00 19.59 ? 27  SER C O     1 
ATOM   6044  C  CB    . SER G  1 29  ? 74.535  -98.552  15.298  1.00 28.82 ? 27  SER C CB    1 
ATOM   6045  O  OG    . SER G  1 29  ? 73.298  -98.476  15.965  1.00 38.02 ? 27  SER C OG    1 
ATOM   6046  N  N     . GLU G  1 30  ? 74.810  -100.424 12.804  1.00 22.50 ? 28  GLU C N     1 
ATOM   6047  C  CA    . GLU G  1 30  ? 75.607  -101.372 12.038  1.00 29.02 ? 28  GLU C CA    1 
ATOM   6048  C  C     . GLU G  1 30  ? 75.887  -100.821 10.677  1.00 29.93 ? 28  GLU C C     1 
ATOM   6049  O  O     . GLU G  1 30  ? 77.002  -100.959 10.152  1.00 30.53 ? 28  GLU C O     1 
ATOM   6050  C  CB    . GLU G  1 30  ? 74.914  -102.730 11.904  1.00 28.77 ? 28  GLU C CB    1 
ATOM   6051  C  CG    . GLU G  1 30  ? 75.207  -103.645 13.088  1.00 40.33 ? 28  GLU C CG    1 
ATOM   6052  C  CD    . GLU G  1 30  ? 76.709  -103.835 13.336  1.00 43.22 ? 28  GLU C CD    1 
ATOM   6053  O  OE1   . GLU G  1 30  ? 77.523  -103.573 12.410  1.00 44.15 ? 28  GLU C OE1   1 
ATOM   6054  O  OE2   . GLU G  1 30  ? 77.072  -104.268 14.456  1.00 56.20 ? 28  GLU C OE2   1 
ATOM   6055  N  N     . TYR G  1 31  ? 74.891  -100.194 10.069  1.00 26.89 ? 29  TYR C N     1 
ATOM   6056  C  CA    . TYR G  1 31  ? 75.128  -99.651  8.729   1.00 26.69 ? 29  TYR C CA    1 
ATOM   6057  C  C     . TYR G  1 31  ? 76.226  -98.557  8.720   1.00 27.76 ? 29  TYR C C     1 
ATOM   6058  O  O     . TYR G  1 31  ? 77.118  -98.554  7.842   1.00 30.75 ? 29  TYR C O     1 
ATOM   6059  C  CB    . TYR G  1 31  ? 73.824  -99.185  8.090   1.00 26.93 ? 29  TYR C CB    1 
ATOM   6060  C  CG    . TYR G  1 31  ? 73.973  -98.069  7.071   1.00 24.74 ? 29  TYR C CG    1 
ATOM   6061  C  CD1   . TYR G  1 31  ? 74.078  -96.741  7.486   1.00 24.40 ? 29  TYR C CD1   1 
ATOM   6062  C  CD2   . TYR G  1 31  ? 73.975  -98.344  5.702   1.00 23.03 ? 29  TYR C CD2   1 
ATOM   6063  C  CE1   . TYR G  1 31  ? 74.205  -95.696  6.561   1.00 28.14 ? 29  TYR C CE1   1 
ATOM   6064  C  CE2   . TYR G  1 31  ? 74.093  -97.306  4.761   1.00 25.12 ? 29  TYR C CE2   1 
ATOM   6065  C  CZ    . TYR G  1 31  ? 74.212  -95.983  5.206   1.00 27.15 ? 29  TYR C CZ    1 
ATOM   6066  O  OH    . TYR G  1 31  ? 74.332  -94.934  4.310   1.00 32.94 ? 29  TYR C OH    1 
ATOM   6067  N  N     . GLU G  1 32  ? 76.173  -97.659  9.705   1.00 22.39 ? 30  GLU C N     1 
ATOM   6068  C  CA    . GLU G  1 32  ? 77.181  -96.622  9.853   1.00 27.63 ? 30  GLU C CA    1 
ATOM   6069  C  C     . GLU G  1 32  ? 78.557  -97.270  10.017  1.00 30.34 ? 30  GLU C C     1 
ATOM   6070  O  O     . GLU G  1 32  ? 79.510  -96.938  9.295   1.00 33.37 ? 30  GLU C O     1 
ATOM   6071  C  CB    . GLU G  1 32  ? 76.878  -95.722  11.057  1.00 26.14 ? 30  GLU C CB    1 
ATOM   6072  C  CG    . GLU G  1 32  ? 75.766  -94.672  10.816  1.00 23.22 ? 30  GLU C CG    1 
ATOM   6073  C  CD    . GLU G  1 32  ? 75.656  -93.644  11.961  1.00 23.55 ? 30  GLU C CD    1 
ATOM   6074  O  OE1   . GLU G  1 32  ? 75.616  -94.071  13.133  1.00 27.20 ? 30  GLU C OE1   1 
ATOM   6075  O  OE2   . GLU G  1 32  ? 75.581  -92.422  11.681  1.00 24.64 ? 30  GLU C OE2   1 
ATOM   6076  N  N     . LYS G  1 33  ? 78.656  -98.178  10.985  1.00 24.39 ? 31  LYS C N     1 
ATOM   6077  C  CA    . LYS G  1 33  ? 79.924  -98.836  11.263  1.00 33.44 ? 31  LYS C CA    1 
ATOM   6078  C  C     . LYS G  1 33  ? 80.487  -99.524  10.026  1.00 29.52 ? 31  LYS C C     1 
ATOM   6079  O  O     . LYS G  1 33  ? 81.686  -99.449  9.748   1.00 34.42 ? 31  LYS C O     1 
ATOM   6080  C  CB    . LYS G  1 33  ? 79.767  -99.844  12.406  1.00 33.54 ? 31  LYS C CB    1 
ATOM   6081  C  CG    . LYS G  1 33  ? 79.430  -99.184  13.736  1.00 37.29 ? 31  LYS C CG    1 
ATOM   6082  C  CD    . LYS G  1 33  ? 79.866  -100.051 14.921  1.00 53.24 ? 31  LYS C CD    1 
ATOM   6083  C  CE    . LYS G  1 33  ? 80.882  -99.322  15.810  1.00 61.99 ? 31  LYS C CE    1 
ATOM   6084  N  NZ    . LYS G  1 33  ? 82.169  -99.011  15.106  1.00 66.87 ? 31  LYS C NZ    1 
ATOM   6085  N  N     . SER G  1 34  ? 79.611  -100.189 9.288   1.00 27.48 ? 32  SER C N     1 
ATOM   6086  C  CA    . SER G  1 34  ? 80.016  -101.057 8.190   1.00 30.93 ? 32  SER C CA    1 
ATOM   6087  C  C     . SER G  1 34  ? 80.380  -100.284 6.928   1.00 31.20 ? 32  SER C C     1 
ATOM   6088  O  O     . SER G  1 34  ? 81.332  -100.623 6.229   1.00 33.39 ? 32  SER C O     1 
ATOM   6089  C  CB    . SER G  1 34  ? 78.926  -102.088 7.889   1.00 30.38 ? 32  SER C CB    1 
ATOM   6090  O  OG    . SER G  1 34  ? 77.759  -101.488 7.372   1.00 33.95 ? 32  SER C OG    1 
ATOM   6091  N  N     . THR G  1 35  ? 79.618  -99.234  6.651   1.00 32.68 ? 33  THR C N     1 
ATOM   6092  C  CA    . THR G  1 35  ? 79.780  -98.448  5.436   1.00 34.59 ? 33  THR C CA    1 
ATOM   6093  C  C     . THR G  1 35  ? 80.560  -97.177  5.693   1.00 25.64 ? 33  THR C C     1 
ATOM   6094  O  O     . THR G  1 35  ? 80.962  -96.513  4.753   1.00 26.24 ? 33  THR C O     1 
ATOM   6095  C  CB    . THR G  1 35  ? 78.436  -97.984  4.899   1.00 26.55 ? 33  THR C CB    1 
ATOM   6096  O  OG1   . THR G  1 35  ? 77.937  -96.952  5.774   1.00 30.77 ? 33  THR C OG1   1 
ATOM   6097  C  CG2   . THR G  1 35  ? 77.446  -99.159  4.806   1.00 30.77 ? 33  THR C CG2   1 
ATOM   6098  N  N     . GLY G  1 36  ? 80.721  -96.813  6.961   1.00 28.15 ? 34  GLY C N     1 
ATOM   6099  C  CA    . GLY G  1 36  ? 81.409  -95.580  7.306   1.00 29.28 ? 34  GLY C CA    1 
ATOM   6100  C  C     . GLY G  1 36  ? 80.594  -94.318  7.027   1.00 33.33 ? 34  GLY C C     1 
ATOM   6101  O  O     . GLY G  1 36  ? 81.055  -93.207  7.309   1.00 32.54 ? 34  GLY C O     1 
ATOM   6102  N  N     . LYS G  1 37  ? 79.388  -94.483  6.479   1.00 30.77 ? 35  LYS C N     1 
ATOM   6103  C  CA    . LYS G  1 37  ? 78.473  -93.342  6.246   1.00 34.36 ? 35  LYS C CA    1 
ATOM   6104  C  C     . LYS G  1 37  ? 77.848  -92.793  7.526   1.00 30.49 ? 35  LYS C C     1 
ATOM   6105  O  O     . LYS G  1 37  ? 77.617  -93.520  8.507   1.00 29.58 ? 35  LYS C O     1 
ATOM   6106  C  CB    . LYS G  1 37  ? 77.347  -93.717  5.283   1.00 30.10 ? 35  LYS C CB    1 
ATOM   6107  C  CG    . LYS G  1 37  ? 77.721  -93.681  3.807   1.00 34.30 ? 35  LYS C CG    1 
ATOM   6108  C  CD    . LYS G  1 37  ? 77.141  -94.910  3.108   1.00 35.67 ? 35  LYS C CD    1 
ATOM   6109  C  CE    . LYS G  1 37  ? 77.152  -94.779  1.594   1.00 33.55 ? 35  LYS C CE    1 
ATOM   6110  N  NZ    . LYS G  1 37  ? 76.429  -95.933  0.951   1.00 53.25 ? 35  LYS C NZ    1 
ATOM   6111  N  N     . GLU G  1 38  ? 77.588  -91.496  7.535   1.00 22.65 ? 36  GLU C N     1 
ATOM   6112  C  CA    . GLU G  1 38  ? 76.885  -90.956  8.662   1.00 28.12 ? 36  GLU C CA    1 
ATOM   6113  C  C     . GLU G  1 38  ? 75.386  -90.854  8.313   1.00 21.84 ? 36  GLU C C     1 
ATOM   6114  O  O     . GLU G  1 38  ? 74.989  -90.350  7.246   1.00 19.68 ? 36  GLU C O     1 
ATOM   6115  C  CB    . GLU G  1 38  ? 77.444  -89.596  9.030   1.00 27.24 ? 36  GLU C CB    1 
ATOM   6116  C  CG    . GLU G  1 38  ? 76.656  -88.884  10.114  1.00 32.94 ? 36  GLU C CG    1 
ATOM   6117  C  CD    . GLU G  1 38  ? 77.409  -87.650  10.617  1.00 48.87 ? 36  GLU C CD    1 
ATOM   6118  O  OE1   . GLU G  1 38  ? 78.663  -87.710  10.640  1.00 56.60 ? 36  GLU C OE1   1 
ATOM   6119  O  OE2   . GLU G  1 38  ? 76.754  -86.638  10.962  1.00 40.38 ? 36  GLU C OE2   1 
ATOM   6120  N  N     . ILE G  1 39  ? 74.548  -91.349  9.198   1.00 20.11 ? 37  ILE C N     1 
ATOM   6121  C  CA    . ILE G  1 39  ? 73.106  -91.190  8.984   1.00 19.81 ? 37  ILE C CA    1 
ATOM   6122  C  C     . ILE G  1 39  ? 72.697  -89.757  9.388   1.00 24.89 ? 37  ILE C C     1 
ATOM   6123  O  O     . ILE G  1 39  ? 73.114  -89.306  10.458  1.00 25.35 ? 37  ILE C O     1 
ATOM   6124  C  CB    . ILE G  1 39  ? 72.337  -92.208  9.821   1.00 15.66 ? 37  ILE C CB    1 
ATOM   6125  C  CG1   . ILE G  1 39  ? 72.709  -93.616  9.315   1.00 17.99 ? 37  ILE C CG1   1 
ATOM   6126  C  CG2   . ILE G  1 39  ? 70.799  -91.897  9.764   1.00 14.93 ? 37  ILE C CG2   1 
ATOM   6127  C  CD1   . ILE G  1 39  ? 72.392  -94.773  10.290  1.00 22.11 ? 37  ILE C CD1   1 
ATOM   6128  N  N     . SER G  1 40  ? 71.901  -89.044  8.566   1.00 23.36 ? 38  SER C N     1 
ATOM   6129  C  CA    . SER G  1 40  ? 71.518  -87.669  8.959   1.00 26.62 ? 38  SER C CA    1 
ATOM   6130  C  C     . SER G  1 40  ? 70.345  -87.731  9.904   1.00 13.33 ? 38  SER C C     1 
ATOM   6131  O  O     . SER G  1 40  ? 70.278  -87.055  10.940  1.00 16.15 ? 38  SER C O     1 
ATOM   6132  C  CB    . SER G  1 40  ? 71.181  -86.762  7.761   1.00 24.10 ? 38  SER C CB    1 
ATOM   6133  O  OG    . SER G  1 40  ? 72.354  -86.350  7.076   1.00 25.28 ? 38  SER C OG    1 
ATOM   6134  N  N     . PHE G  1 41  ? 69.382  -88.536  9.502   1.00 19.04 ? 39  PHE C N     1 
ATOM   6135  C  CA    . PHE G  1 41  ? 68.225  -88.780  10.314  1.00 15.63 ? 39  PHE C CA    1 
ATOM   6136  C  C     . PHE G  1 41  ? 67.449  -89.988  9.735   1.00 17.92 ? 39  PHE C C     1 
ATOM   6137  O  O     . PHE G  1 41  ? 67.825  -90.545  8.698   1.00 16.18 ? 39  PHE C O     1 
ATOM   6138  C  CB    . PHE G  1 41  ? 67.371  -87.510  10.428  1.00 17.64 ? 39  PHE C CB    1 
ATOM   6139  C  CG    . PHE G  1 41  ? 66.754  -87.077  9.146   1.00 15.46 ? 39  PHE C CG    1 
ATOM   6140  C  CD1   . PHE G  1 41  ? 67.435  -86.264  8.268   1.00 19.19 ? 39  PHE C CD1   1 
ATOM   6141  C  CD2   . PHE G  1 41  ? 65.481  -87.505  8.817   1.00 18.01 ? 39  PHE C CD2   1 
ATOM   6142  C  CE1   . PHE G  1 41  ? 66.858  -85.844  7.059   1.00 18.33 ? 39  PHE C CE1   1 
ATOM   6143  C  CE2   . PHE G  1 41  ? 64.903  -87.120  7.611   1.00 18.55 ? 39  PHE C CE2   1 
ATOM   6144  C  CZ    . PHE G  1 41  ? 65.610  -86.274  6.725   1.00 22.67 ? 39  PHE C CZ    1 
ATOM   6145  N  N     . VAL G  1 42  ? 66.381  -90.368  10.427  1.00 15.02 ? 40  VAL C N     1 
ATOM   6146  C  CA    . VAL G  1 42  ? 65.682  -91.591  10.150  1.00 16.08 ? 40  VAL C CA    1 
ATOM   6147  C  C     . VAL G  1 42  ? 64.211  -91.234  9.932   1.00 16.03 ? 40  VAL C C     1 
ATOM   6148  O  O     . VAL G  1 42  ? 63.655  -90.459  10.700  1.00 15.78 ? 40  VAL C O     1 
ATOM   6149  C  CB    . VAL G  1 42  ? 65.780  -92.539  11.361  1.00 13.98 ? 40  VAL C CB    1 
ATOM   6150  C  CG1   . VAL G  1 42  ? 64.969  -93.788  11.077  1.00 13.35 ? 40  VAL C CG1   1 
ATOM   6151  C  CG2   . VAL G  1 42  ? 67.288  -92.877  11.693  1.00 13.66 ? 40  VAL C CG2   1 
ATOM   6152  N  N     . ILE G  1 43  ? 63.613  -91.787  8.886   1.00 13.78 ? 41  ILE C N     1 
ATOM   6153  C  CA    . ILE G  1 43  ? 62.192  -91.658  8.641   1.00 15.36 ? 41  ILE C CA    1 
ATOM   6154  C  C     . ILE G  1 43  ? 61.548  -93.040  8.809   1.00 18.02 ? 41  ILE C C     1 
ATOM   6155  O  O     . ILE G  1 43  ? 62.050  -94.001  8.210   1.00 18.10 ? 41  ILE C O     1 
ATOM   6156  C  CB    . ILE G  1 43  ? 61.983  -91.209  7.194   1.00 18.12 ? 41  ILE C CB    1 
ATOM   6157  C  CG1   . ILE G  1 43  ? 62.504  -89.791  6.976   1.00 16.17 ? 41  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE G  1 43  ? 60.494  -91.311  6.789   1.00 23.17 ? 41  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE G  1 43  ? 62.584  -89.433  5.481   1.00 19.59 ? 41  ILE C CD1   1 
ATOM   6160  N  N     . CYS G  1 44  ? 60.455  -93.140  9.598   1.00 15.90 ? 42  CYS C N     1 
ATOM   6161  C  CA    . CYS G  1 44  ? 59.732  -94.393  9.796   1.00 16.48 ? 42  CYS C CA    1 
ATOM   6162  C  C     . CYS G  1 44  ? 58.302  -94.226  9.327   1.00 16.50 ? 42  CYS C C     1 
ATOM   6163  O  O     . CYS G  1 44  ? 57.665  -93.261  9.682   1.00 12.50 ? 42  CYS C O     1 
ATOM   6164  C  CB    . CYS G  1 44  ? 59.719  -94.782  11.270  1.00 18.54 ? 42  CYS C CB    1 
ATOM   6165  S  SG    . CYS G  1 44  ? 61.350  -95.099  11.960  1.00 18.56 ? 42  CYS C SG    1 
ATOM   6166  N  N     . THR G  1 45  ? 57.804  -95.191  8.554   1.00 12.49 ? 43  THR C N     1 
ATOM   6167  C  CA    . THR G  1 45  ? 56.481  -95.056  7.987   1.00 17.37 ? 43  THR C CA    1 
ATOM   6168  C  C     . THR G  1 45  ? 55.361  -95.836  8.670   1.00 20.53 ? 43  THR C C     1 
ATOM   6169  O  O     . THR G  1 45  ? 54.456  -96.359  7.993   1.00 20.97 ? 43  THR C O     1 
ATOM   6170  C  CB    . THR G  1 45  ? 56.517  -95.284  6.455   1.00 24.81 ? 43  THR C CB    1 
ATOM   6171  O  OG1   . THR G  1 45  ? 56.986  -96.605  6.173   1.00 21.31 ? 43  THR C OG1   1 
ATOM   6172  C  CG2   . THR G  1 45  ? 57.461  -94.288  5.828   1.00 17.11 ? 43  THR C CG2   1 
ATOM   6173  N  N     . GLY G  1 46  ? 55.379  -95.901  10.006  1.00 13.96 ? 44  GLY C N     1 
ATOM   6174  C  CA    . GLY G  1 46  ? 54.174  -96.302  10.715  1.00 13.66 ? 44  GLY C CA    1 
ATOM   6175  C  C     . GLY G  1 46  ? 54.284  -97.586  11.526  1.00 13.24 ? 44  GLY C C     1 
ATOM   6176  O  O     . GLY G  1 46  ? 55.351  -98.212  11.550  1.00 15.15 ? 44  GLY C O     1 
ATOM   6177  N  N     . ASP G  1 47  ? 53.158  -97.969  12.128  1.00 16.75 ? 45  ASP C N     1 
ATOM   6178  C  CA    . ASP G  1 47  ? 53.041  -99.044  13.122  1.00 18.37 ? 45  ASP C CA    1 
ATOM   6179  C  C     . ASP G  1 47  ? 54.125  -98.918  14.163  1.00 16.93 ? 45  ASP C C     1 
ATOM   6180  O  O     . ASP G  1 47  ? 54.887  -99.858  14.407  1.00 14.79 ? 45  ASP C O     1 
ATOM   6181  C  CB    . ASP G  1 47  ? 53.025  -100.461 12.493  1.00 17.84 ? 45  ASP C CB    1 
ATOM   6182  C  CG    . ASP G  1 47  ? 51.810  -100.703 11.599  1.00 17.95 ? 45  ASP C CG    1 
ATOM   6183  O  OD1   . ASP G  1 47  ? 50.836  -99.933  11.729  1.00 13.34 ? 45  ASP C OD1   1 
ATOM   6184  O  OD2   . ASP G  1 47  ? 51.850  -101.667 10.773  1.00 17.81 ? 45  ASP C OD2   1 
ATOM   6185  N  N     . MET G  1 48  ? 54.163  -97.729  14.767  1.00 19.09 ? 46  MET C N     1 
ATOM   6186  C  CA    . MET G  1 48  ? 55.215  -97.321  15.695  1.00 13.05 ? 46  MET C CA    1 
ATOM   6187  C  C     . MET G  1 48  ? 54.997  -97.864  17.140  1.00 16.46 ? 46  MET C C     1 
ATOM   6188  O  O     . MET G  1 48  ? 55.947  -98.008  17.925  1.00 17.81 ? 46  MET C O     1 
ATOM   6189  C  CB    . MET G  1 48  ? 55.288  -95.779  15.703  1.00 14.84 ? 46  MET C CB    1 
ATOM   6190  C  CG    . MET G  1 48  ? 55.513  -95.232  14.324  1.00 13.91 ? 46  MET C CG    1 
ATOM   6191  S  SD    . MET G  1 48  ? 57.032  -95.907  13.569  1.00 15.47 ? 46  MET C SD    1 
ATOM   6192  C  CE    . MET G  1 48  ? 58.340  -95.069  14.552  1.00 12.32 ? 46  MET C CE    1 
ATOM   6193  N  N     . GLN G  1 49  ? 53.741  -98.109  17.490  1.00 15.09 ? 47  GLN C N     1 
ATOM   6194  C  CA    . GLN G  1 49  ? 53.421  -98.777  18.748  1.00 14.00 ? 47  GLN C CA    1 
ATOM   6195  C  C     . GLN G  1 49  ? 54.022  -98.022  19.961  1.00 17.55 ? 47  GLN C C     1 
ATOM   6196  O  O     . GLN G  1 49  ? 54.737  -98.607  20.793  1.00 16.92 ? 47  GLN C O     1 
ATOM   6197  C  CB    . GLN G  1 49  ? 53.952  -100.230 18.656  1.00 14.37 ? 47  GLN C CB    1 
ATOM   6198  C  CG    . GLN G  1 49  ? 53.519  -101.172 19.754  1.00 18.44 ? 47  GLN C CG    1 
ATOM   6199  C  CD    . GLN G  1 49  ? 53.842  -102.663 19.471  1.00 24.04 ? 47  GLN C CD    1 
ATOM   6200  O  OE1   . GLN G  1 49  ? 54.128  -103.062 18.346  1.00 20.35 ? 47  GLN C OE1   1 
ATOM   6201  N  NE2   . GLN G  1 49  ? 53.796  -103.476 20.524  1.00 23.76 ? 47  GLN C NE2   1 
ATOM   6202  N  N     . THR G  1 50  ? 53.725  -96.723  20.063  1.00 13.58 ? 48  THR C N     1 
ATOM   6203  C  CA    . THR G  1 50  ? 54.366  -95.911  21.077  1.00 14.86 ? 48  THR C CA    1 
ATOM   6204  C  C     . THR G  1 50  ? 53.638  -95.960  22.402  1.00 15.42 ? 48  THR C C     1 
ATOM   6205  O  O     . THR G  1 50  ? 53.220  -94.936  22.934  1.00 14.05 ? 48  THR C O     1 
ATOM   6206  C  CB    . THR G  1 50  ? 54.479  -94.450  20.620  1.00 14.97 ? 48  THR C CB    1 
ATOM   6207  O  OG1   . THR G  1 50  ? 53.177  -93.928  20.390  1.00 15.35 ? 48  THR C OG1   1 
ATOM   6208  C  CG2   . THR G  1 50  ? 55.308  -94.366  19.329  1.00 11.92 ? 48  THR C CG2   1 
ATOM   6209  N  N     . LEU G  1 51  ? 53.542  -97.156  22.967  1.00 15.33 ? 49  LEU C N     1 
ATOM   6210  C  CA    . LEU G  1 51  ? 52.796  -97.356  24.206  1.00 16.79 ? 49  LEU C CA    1 
ATOM   6211  C  C     . LEU G  1 51  ? 53.687  -96.930  25.348  1.00 12.39 ? 49  LEU C C     1 
ATOM   6212  O  O     . LEU G  1 51  ? 54.761  -97.510  25.534  1.00 17.01 ? 49  LEU C O     1 
ATOM   6213  C  CB    . LEU G  1 51  ? 52.416  -98.837  24.376  1.00 15.73 ? 49  LEU C CB    1 
ATOM   6214  C  CG    . LEU G  1 51  ? 51.294  -99.415  23.524  1.00 18.01 ? 49  LEU C CG    1 
ATOM   6215  C  CD1   . LEU G  1 51  ? 51.777  -99.727  22.141  1.00 23.84 ? 49  LEU C CD1   1 
ATOM   6216  C  CD2   . LEU G  1 51  ? 50.795  -100.707 24.195  1.00 24.04 ? 49  LEU C CD2   1 
ATOM   6217  N  N     . ARG G  1 52  ? 53.269  -95.906  26.093  1.00 13.00 ? 50  ARG C N     1 
ATOM   6218  C  CA    . ARG G  1 52  ? 54.045  -95.376  27.224  1.00 17.69 ? 50  ARG C CA    1 
ATOM   6219  C  C     . ARG G  1 52  ? 54.110  -96.346  28.401  1.00 17.58 ? 50  ARG C C     1 
ATOM   6220  O  O     . ARG G  1 52  ? 55.149  -96.527  29.027  1.00 21.08 ? 50  ARG C O     1 
ATOM   6221  C  CB    . ARG G  1 52  ? 53.359  -94.120  27.739  1.00 16.14 ? 50  ARG C CB    1 
ATOM   6222  C  CG    . ARG G  1 52  ? 53.399  -92.961  26.745  1.00 16.94 ? 50  ARG C CG    1 
ATOM   6223  C  CD    . ARG G  1 52  ? 52.474  -91.887  27.243  1.00 19.31 ? 50  ARG C CD    1 
ATOM   6224  N  NE    . ARG G  1 52  ? 51.102  -92.397  27.299  1.00 19.29 ? 50  ARG C NE    1 
ATOM   6225  C  CZ    . ARG G  1 52  ? 50.031  -91.640  27.480  1.00 18.42 ? 50  ARG C CZ    1 
ATOM   6226  N  NH1   . ARG G  1 52  ? 50.158  -90.318  27.615  1.00 19.88 ? 50  ARG C NH1   1 
ATOM   6227  N  NH2   . ARG G  1 52  ? 48.840  -92.202  27.510  1.00 23.36 ? 50  ARG C NH2   1 
ATOM   6228  N  N     . TYR G  1 53  ? 52.979  -96.928  28.740  1.00 15.06 ? 51  TYR C N     1 
ATOM   6229  C  CA    . TYR G  1 53  ? 52.935  -97.807  29.917  1.00 18.84 ? 51  TYR C CA    1 
ATOM   6230  C  C     . TYR G  1 53  ? 51.798  -98.806  29.664  1.00 20.19 ? 51  TYR C C     1 
ATOM   6231  O  O     . TYR G  1 53  ? 51.165  -98.701  28.610  1.00 19.86 ? 51  TYR C O     1 
ATOM   6232  C  CB    . TYR G  1 53  ? 52.787  -96.990  31.220  1.00 18.38 ? 51  TYR C CB    1 
ATOM   6233  C  CG    . TYR G  1 53  ? 52.140  -95.603  31.021  1.00 16.88 ? 51  TYR C CG    1 
ATOM   6234  C  CD1   . TYR G  1 53  ? 50.832  -95.506  30.572  1.00 21.05 ? 51  TYR C CD1   1 
ATOM   6235  C  CD2   . TYR G  1 53  ? 52.835  -94.415  31.293  1.00 19.14 ? 51  TYR C CD2   1 
ATOM   6236  C  CE1   . TYR G  1 53  ? 50.210  -94.278  30.366  1.00 19.95 ? 51  TYR C CE1   1 
ATOM   6237  C  CE2   . TYR G  1 53  ? 52.223  -93.155  31.103  1.00 21.77 ? 51  TYR C CE2   1 
ATOM   6238  C  CZ    . TYR G  1 53  ? 50.899  -93.099  30.630  1.00 22.86 ? 51  TYR C CZ    1 
ATOM   6239  O  OH    . TYR G  1 53  ? 50.199  -91.914  30.413  1.00 19.80 ? 51  TYR C OH    1 
ATOM   6240  N  N     . GLU G  1 54  ? 51.554  -99.749  30.592  1.00 15.82 ? 52  GLU C N     1 
ATOM   6241  C  CA    . GLU G  1 54  ? 50.654  -100.898 30.329  1.00 20.40 ? 52  GLU C CA    1 
ATOM   6242  C  C     . GLU G  1 54  ? 49.268  -100.414 29.989  1.00 18.42 ? 52  GLU C C     1 
ATOM   6243  O  O     . GLU G  1 54  ? 48.551  -101.002 29.168  1.00 18.23 ? 52  GLU C O     1 
ATOM   6244  C  CB    . GLU G  1 54  ? 50.544  -101.834 31.561  1.00 19.66 ? 52  GLU C CB    1 
ATOM   6245  C  CG    . GLU G  1 54  ? 51.874  -102.480 32.020  1.00 25.17 ? 52  GLU C CG    1 
ATOM   6246  C  CD    . GLU G  1 54  ? 51.712  -103.487 33.207  1.00 26.20 ? 52  GLU C CD    1 
ATOM   6247  O  OE1   . GLU G  1 54  ? 52.749  -103.928 33.774  1.00 27.59 ? 52  GLU C OE1   1 
ATOM   6248  O  OE2   . GLU G  1 54  ? 50.562  -103.835 33.573  1.00 23.97 ? 52  GLU C OE2   1 
ATOM   6249  N  N     . ALA G  1 55  ? 48.827  -99.360  30.664  1.00 18.52 ? 53  ALA C N     1 
ATOM   6250  C  CA    . ALA G  1 55  ? 47.462  -98.889  30.422  1.00 18.85 ? 53  ALA C CA    1 
ATOM   6251  C  C     . ALA G  1 55  ? 47.162  -98.573  28.953  1.00 17.35 ? 53  ALA C C     1 
ATOM   6252  O  O     . ALA G  1 55  ? 45.962  -98.590  28.531  1.00 19.55 ? 53  ALA C O     1 
ATOM   6253  C  CB    . ALA G  1 55  ? 47.123  -97.677  31.289  1.00 19.29 ? 53  ALA C CB    1 
ATOM   6254  N  N     . ASP G  1 56  ? 48.204  -98.224  28.191  1.00 18.70 ? 54  ASP C N     1 
ATOM   6255  C  CA    . ASP G  1 56  ? 48.006  -97.800  26.794  1.00 18.97 ? 54  ASP C CA    1 
ATOM   6256  C  C     . ASP G  1 56  ? 47.661  -98.979  25.895  1.00 20.18 ? 54  ASP C C     1 
ATOM   6257  O  O     . ASP G  1 56  ? 47.230  -98.778  24.776  1.00 14.57 ? 54  ASP C O     1 
ATOM   6258  C  CB    . ASP G  1 56  ? 49.270  -97.109  26.223  1.00 15.07 ? 54  ASP C CB    1 
ATOM   6259  C  CG    . ASP G  1 56  ? 49.479  -95.699  26.768  1.00 17.37 ? 54  ASP C CG    1 
ATOM   6260  O  OD1   . ASP G  1 56  ? 48.501  -95.105  27.201  1.00 15.41 ? 54  ASP C OD1   1 
ATOM   6261  O  OD2   . ASP G  1 56  ? 50.622  -95.196  26.773  1.00 17.09 ? 54  ASP C OD2   1 
ATOM   6262  N  N     . LEU G  1 57  ? 47.916  -100.210 26.335  1.00 19.40 ? 55  LEU C N     1 
ATOM   6263  C  CA    . LEU G  1 57  ? 47.527  -101.390 25.536  1.00 16.12 ? 55  LEU C CA    1 
ATOM   6264  C  C     . LEU G  1 57  ? 46.034  -101.390 25.140  1.00 18.08 ? 55  LEU C C     1 
ATOM   6265  O  O     . LEU G  1 57  ? 45.617  -101.947 24.109  1.00 16.77 ? 55  LEU C O     1 
ATOM   6266  C  CB    . LEU G  1 57  ? 47.862  -102.663 26.317  1.00 17.61 ? 55  LEU C CB    1 
ATOM   6267  C  CG    . LEU G  1 57  ? 49.292  -103.126 26.287  1.00 19.25 ? 55  LEU C CG    1 
ATOM   6268  C  CD1   . LEU G  1 57  ? 49.492  -104.080 27.430  1.00 21.50 ? 55  LEU C CD1   1 
ATOM   6269  C  CD2   . LEU G  1 57  ? 49.590  -103.768 24.937  1.00 21.53 ? 55  LEU C CD2   1 
ATOM   6270  N  N     . VAL G  1 58  ? 45.204  -100.757 25.951  1.00 17.30 ? 56  VAL C N     1 
ATOM   6271  C  CA    . VAL G  1 58  ? 43.821  -100.542 25.559  1.00 21.00 ? 56  VAL C CA    1 
ATOM   6272  C  C     . VAL G  1 58  ? 43.689  -99.861  24.189  1.00 21.97 ? 56  VAL C C     1 
ATOM   6273  O  O     . VAL G  1 58  ? 42.677  -100.002 23.523  1.00 23.67 ? 56  VAL C O     1 
ATOM   6274  C  CB    . VAL G  1 58  ? 43.085  -99.710  26.618  1.00 25.15 ? 56  VAL C CB    1 
ATOM   6275  C  CG1   . VAL G  1 58  ? 41.867  -99.041  26.027  1.00 33.14 ? 56  VAL C CG1   1 
ATOM   6276  C  CG2   . VAL G  1 58  ? 42.680  -100.589 27.784  1.00 27.89 ? 56  VAL C CG2   1 
ATOM   6277  N  N     . TYR G  1 59  ? 44.704  -99.115  23.759  1.00 20.63 ? 57  TYR C N     1 
ATOM   6278  C  CA    . TYR G  1 59  ? 44.528  -98.344  22.528  1.00 18.95 ? 57  TYR C CA    1 
ATOM   6279  C  C     . TYR G  1 59  ? 45.165  -98.986  21.301  1.00 17.65 ? 57  TYR C C     1 
ATOM   6280  O  O     . TYR G  1 59  ? 45.168  -98.404  20.214  1.00 15.40 ? 57  TYR C O     1 
ATOM   6281  C  CB    . TYR G  1 59  ? 45.017  -96.902  22.720  1.00 17.15 ? 57  TYR C CB    1 
ATOM   6282  C  CG    . TYR G  1 59  ? 44.051  -96.118  23.545  1.00 18.08 ? 57  TYR C CG    1 
ATOM   6283  C  CD1   . TYR G  1 59  ? 42.924  -95.558  22.947  1.00 17.61 ? 57  TYR C CD1   1 
ATOM   6284  C  CD2   . TYR G  1 59  ? 44.223  -95.963  24.926  1.00 17.29 ? 57  TYR C CD2   1 
ATOM   6285  C  CE1   . TYR G  1 59  ? 41.991  -94.859  23.676  1.00 22.86 ? 57  TYR C CE1   1 
ATOM   6286  C  CE2   . TYR G  1 59  ? 43.261  -95.238  25.681  1.00 23.36 ? 57  TYR C CE2   1 
ATOM   6287  C  CZ    . TYR G  1 59  ? 42.156  -94.697  25.035  1.00 22.31 ? 57  TYR C CZ    1 
ATOM   6288  O  OH    . TYR G  1 59  ? 41.176  -93.980  25.710  1.00 26.54 ? 57  TYR C OH    1 
ATOM   6289  N  N     . LEU G  1 60  ? 45.708  -100.193 21.491  1.00 18.35 ? 58  LEU C N     1 
ATOM   6290  C  CA    . LEU G  1 60  ? 46.434  -100.887 20.433  1.00 17.66 ? 58  LEU C CA    1 
ATOM   6291  C  C     . LEU G  1 60  ? 45.469  -101.900 19.821  1.00 20.96 ? 58  LEU C C     1 
ATOM   6292  O  O     . LEU G  1 60  ? 45.001  -102.796 20.533  1.00 21.24 ? 58  LEU C O     1 
ATOM   6293  C  CB    . LEU G  1 60  ? 47.669  -101.584 21.013  1.00 17.19 ? 58  LEU C CB    1 
ATOM   6294  C  CG    . LEU G  1 60  ? 48.486  -102.425 20.034  1.00 22.03 ? 58  LEU C CG    1 
ATOM   6295  C  CD1   . LEU G  1 60  ? 49.068  -101.517 18.930  1.00 20.46 ? 58  LEU C CD1   1 
ATOM   6296  C  CD2   . LEU G  1 60  ? 49.608  -103.190 20.790  1.00 18.86 ? 58  LEU C CD2   1 
ATOM   6297  N  N     . LYS G  1 61  ? 45.153  -101.741 18.528  1.00 18.66 ? 59  LYS C N     1 
ATOM   6298  C  CA    . LYS G  1 61  ? 44.063  -102.505 17.895  1.00 20.17 ? 59  LYS C CA    1 
ATOM   6299  C  C     . LYS G  1 61  ? 44.649  -103.800 17.310  1.00 27.11 ? 59  LYS C C     1 
ATOM   6300  O  O     . LYS G  1 61  ? 45.230  -103.798 16.235  1.00 25.41 ? 59  LYS C O     1 
ATOM   6301  C  CB    . LYS G  1 61  ? 43.342  -101.667 16.828  1.00 15.06 ? 59  LYS C CB    1 
ATOM   6302  C  CG    . LYS G  1 61  ? 41.927  -102.235 16.320  1.00 20.43 ? 59  LYS C CG    1 
ATOM   6303  C  CD    . LYS G  1 61  ? 42.070  -103.630 15.715  1.00 25.45 ? 59  LYS C CD    1 
ATOM   6304  C  CE    . LYS G  1 61  ? 40.923  -104.035 14.775  1.00 32.62 ? 59  LYS C CE    1 
ATOM   6305  N  NZ    . LYS G  1 61  ? 41.472  -104.574 13.468  1.00 37.55 ? 59  LYS C NZ    1 
ATOM   6306  N  N     . VAL G  1 62  ? 44.530  -104.894 18.060  1.00 25.54 ? 60  VAL C N     1 
ATOM   6307  C  CA    . VAL G  1 62  ? 45.110  -106.193 17.688  1.00 21.96 ? 60  VAL C CA    1 
ATOM   6308  C  C     . VAL G  1 62  ? 44.364  -107.300 18.433  1.00 21.45 ? 60  VAL C C     1 
ATOM   6309  O  O     . VAL G  1 62  ? 43.736  -107.057 19.475  1.00 24.48 ? 60  VAL C O     1 
ATOM   6310  C  CB    . VAL G  1 62  ? 46.613  -106.316 18.117  1.00 24.05 ? 60  VAL C CB    1 
ATOM   6311  C  CG1   . VAL G  1 62  ? 47.493  -105.316 17.408  1.00 22.32 ? 60  VAL C CG1   1 
ATOM   6312  C  CG2   . VAL G  1 62  ? 46.769  -106.129 19.630  1.00 20.77 ? 60  VAL C CG2   1 
ATOM   6313  N  N     . PRO G  1 63  ? 44.436  -108.529 17.912  1.00 29.37 ? 61  PRO C N     1 
ATOM   6314  C  CA    . PRO G  1 63  ? 43.858  -109.636 18.678  1.00 29.80 ? 61  PRO C CA    1 
ATOM   6315  C  C     . PRO G  1 63  ? 44.770  -109.930 19.856  1.00 25.41 ? 61  PRO C C     1 
ATOM   6316  O  O     . PRO G  1 63  ? 45.938  -109.520 19.838  1.00 28.58 ? 61  PRO C O     1 
ATOM   6317  C  CB    . PRO G  1 63  ? 43.908  -110.807 17.689  1.00 26.87 ? 61  PRO C CB    1 
ATOM   6318  C  CG    . PRO G  1 63  ? 45.128  -110.512 16.848  1.00 24.78 ? 61  PRO C CG    1 
ATOM   6319  C  CD    . PRO G  1 63  ? 45.144  -108.990 16.702  1.00 23.61 ? 61  PRO C CD    1 
ATOM   6320  N  N     . PRO G  1 64  ? 44.251  -110.653 20.863  1.00 27.19 ? 62  PRO C N     1 
ATOM   6321  C  CA    . PRO G  1 64  ? 44.952  -110.846 22.134  1.00 23.38 ? 62  PRO C CA    1 
ATOM   6322  C  C     . PRO G  1 64  ? 46.417  -111.257 21.975  1.00 24.02 ? 62  PRO C C     1 
ATOM   6323  O  O     . PRO G  1 64  ? 47.263  -110.821 22.744  1.00 23.19 ? 62  PRO C O     1 
ATOM   6324  C  CB    . PRO G  1 64  ? 44.125  -111.949 22.803  1.00 25.32 ? 62  PRO C CB    1 
ATOM   6325  C  CG    . PRO G  1 64  ? 42.701  -111.643 22.360  1.00 27.65 ? 62  PRO C CG    1 
ATOM   6326  C  CD    . PRO G  1 64  ? 42.849  -111.140 20.923  1.00 26.45 ? 62  PRO C CD    1 
ATOM   6327  N  N     . LYS G  1 65  ? 46.685  -112.084 20.973  1.00 25.50 ? 63  LYS C N     1 
ATOM   6328  C  CA    . LYS G  1 65  ? 47.991  -112.629 20.677  1.00 20.32 ? 63  LYS C CA    1 
ATOM   6329  C  C     . LYS G  1 65  ? 49.096  -111.573 20.507  1.00 23.08 ? 63  LYS C C     1 
ATOM   6330  O  O     . LYS G  1 65  ? 50.269  -111.836 20.828  1.00 26.30 ? 63  LYS C O     1 
ATOM   6331  C  CB    . LYS G  1 65  ? 47.859  -113.475 19.402  1.00 32.65 ? 63  LYS C CB    1 
ATOM   6332  C  CG    . LYS G  1 65  ? 48.946  -114.518 19.191  1.00 39.39 ? 63  LYS C CG    1 
ATOM   6333  C  CD    . LYS G  1 65  ? 48.410  -115.766 18.406  1.00 52.39 ? 63  LYS C CD    1 
ATOM   6334  C  CE    . LYS G  1 65  ? 49.092  -117.099 18.875  1.00 55.44 ? 63  LYS C CE    1 
ATOM   6335  N  NZ    . LYS G  1 65  ? 48.843  -118.315 17.994  1.00 53.20 ? 63  LYS C NZ    1 
ATOM   6336  N  N     . TYR G  1 66  ? 48.744  -110.387 20.017  1.00 23.87 ? 64  TYR C N     1 
ATOM   6337  C  CA    . TYR G  1 66  ? 49.757  -109.346 19.814  1.00 19.74 ? 64  TYR C CA    1 
ATOM   6338  C  C     . TYR G  1 66  ? 49.602  -108.149 20.790  1.00 20.16 ? 64  TYR C C     1 
ATOM   6339  O  O     . TYR G  1 66  ? 50.087  -107.054 20.505  1.00 21.56 ? 64  TYR C O     1 
ATOM   6340  C  CB    . TYR G  1 66  ? 49.748  -108.873 18.342  1.00 25.14 ? 64  TYR C CB    1 
ATOM   6341  C  CG    . TYR G  1 66  ? 49.663  -110.013 17.309  1.00 30.61 ? 64  TYR C CG    1 
ATOM   6342  C  CD1   . TYR G  1 66  ? 50.703  -110.924 17.155  1.00 32.90 ? 64  TYR C CD1   1 
ATOM   6343  C  CD2   . TYR G  1 66  ? 48.541  -110.167 16.498  1.00 34.12 ? 64  TYR C CD2   1 
ATOM   6344  C  CE1   . TYR G  1 66  ? 50.630  -111.971 16.211  1.00 32.87 ? 64  TYR C CE1   1 
ATOM   6345  C  CE2   . TYR G  1 66  ? 48.460  -111.217 15.549  1.00 37.75 ? 64  TYR C CE2   1 
ATOM   6346  C  CZ    . TYR G  1 66  ? 49.510  -112.106 15.412  1.00 35.21 ? 64  TYR C CZ    1 
ATOM   6347  O  OH    . TYR G  1 66  ? 49.430  -113.130 14.479  1.00 47.66 ? 64  TYR C OH    1 
ATOM   6348  N  N     . LYS G  1 67  ? 48.936  -108.368 21.932  1.00 20.25 ? 65  LYS C N     1 
ATOM   6349  C  CA    . LYS G  1 67  ? 48.853  -107.338 22.989  1.00 22.51 ? 65  LYS C CA    1 
ATOM   6350  C  C     . LYS G  1 67  ? 50.124  -107.348 23.807  1.00 20.05 ? 65  LYS C C     1 
ATOM   6351  O  O     . LYS G  1 67  ? 50.193  -107.994 24.870  1.00 21.75 ? 65  LYS C O     1 
ATOM   6352  C  CB    . LYS G  1 67  ? 47.653  -107.559 23.908  1.00 20.20 ? 65  LYS C CB    1 
ATOM   6353  C  CG    . LYS G  1 67  ? 46.298  -107.327 23.230  1.00 18.55 ? 65  LYS C CG    1 
ATOM   6354  C  CD    . LYS G  1 67  ? 45.879  -105.824 23.313  1.00 18.76 ? 65  LYS C CD    1 
ATOM   6355  C  CE    . LYS G  1 67  ? 44.500  -105.611 22.681  1.00 19.15 ? 65  LYS C CE    1 
ATOM   6356  N  NZ    . LYS G  1 67  ? 43.963  -104.228 22.864  1.00 13.94 ? 65  LYS C NZ    1 
ATOM   6357  N  N     . GLN G  1 68  ? 51.116  -106.597 23.314  1.00 17.40 ? 66  GLN C N     1 
ATOM   6358  C  CA    . GLN G  1 68  ? 52.478  -106.594 23.815  1.00 24.72 ? 66  GLN C CA    1 
ATOM   6359  C  C     . GLN G  1 68  ? 53.021  -105.167 23.844  1.00 21.88 ? 66  GLN C C     1 
ATOM   6360  O  O     . GLN G  1 68  ? 52.810  -104.403 22.903  1.00 16.63 ? 66  GLN C O     1 
ATOM   6361  C  CB    . GLN G  1 68  ? 53.359  -107.464 22.900  1.00 22.32 ? 66  GLN C CB    1 
ATOM   6362  C  CG    . GLN G  1 68  ? 52.829  -108.909 22.778  1.00 22.95 ? 66  GLN C CG    1 
ATOM   6363  C  CD    . GLN G  1 68  ? 53.787  -109.872 22.110  1.00 30.47 ? 66  GLN C CD    1 
ATOM   6364  O  OE1   . GLN G  1 68  ? 54.728  -109.467 21.440  1.00 36.11 ? 66  GLN C OE1   1 
ATOM   6365  N  NE2   . GLN G  1 68  ? 53.547  -111.179 22.305  1.00 36.41 ? 66  GLN C NE2   1 
ATOM   6366  N  N     . MET G  1 69  ? 53.754  -104.836 24.901  1.00 22.40 ? 67  MET C N     1 
ATOM   6367  C  CA    . MET G  1 69  ? 54.372  -103.510 25.017  1.00 23.74 ? 67  MET C CA    1 
ATOM   6368  C  C     . MET G  1 69  ? 55.424  -103.112 23.946  1.00 22.12 ? 67  MET C C     1 
ATOM   6369  O  O     . MET G  1 69  ? 55.470  -101.946 23.524  1.00 18.47 ? 67  MET C O     1 
ATOM   6370  C  CB    . MET G  1 69  ? 54.958  -103.359 26.421  1.00 25.79 ? 67  MET C CB    1 
ATOM   6371  C  CG    . MET G  1 69  ? 53.835  -103.396 27.493  1.00 19.28 ? 67  MET C CG    1 
ATOM   6372  S  SD    . MET G  1 69  ? 52.921  -101.880 27.334  1.00 20.14 ? 67  MET C SD    1 
ATOM   6373  C  CE    . MET G  1 69  ? 54.175  -100.696 27.899  1.00 16.47 ? 67  MET C CE    1 
ATOM   6374  N  N     . GLY G  1 70  ? 56.268  -104.051 23.504  1.00 18.48 ? 68  GLY C N     1 
ATOM   6375  C  CA    . GLY G  1 70  ? 57.395  -103.688 22.656  1.00 20.25 ? 68  GLY C CA    1 
ATOM   6376  C  C     . GLY G  1 70  ? 58.405  -102.864 23.459  1.00 21.94 ? 68  GLY C C     1 
ATOM   6377  O  O     . GLY G  1 70  ? 58.354  -102.835 24.703  1.00 19.61 ? 68  GLY C O     1 
ATOM   6378  N  N     . ASP G  1 71  ? 59.283  -102.180 22.728  1.00 19.83 ? 69  ASP C N     1 
ATOM   6379  C  CA    . ASP G  1 71  ? 60.475  -101.493 23.241  1.00 23.92 ? 69  ASP C CA    1 
ATOM   6380  C  C     . ASP G  1 71  ? 60.227  -100.040 23.597  1.00 21.51 ? 69  ASP C C     1 
ATOM   6381  O  O     . ASP G  1 71  ? 61.061  -99.440  24.280  1.00 18.10 ? 69  ASP C O     1 
ATOM   6382  C  CB    . ASP G  1 71  ? 61.523  -101.437 22.107  1.00 18.35 ? 69  ASP C CB    1 
ATOM   6383  C  CG    . ASP G  1 71  ? 62.469  -102.580 22.140  1.00 22.08 ? 69  ASP C CG    1 
ATOM   6384  O  OD1   . ASP G  1 71  ? 62.212  -103.565 22.897  1.00 37.67 ? 69  ASP C OD1   1 
ATOM   6385  O  OD2   . ASP G  1 71  ? 63.434  -102.522 21.367  1.00 25.63 ? 69  ASP C OD2   1 
ATOM   6386  N  N     . PHE G  1 72  ? 59.136  -99.464  23.088  1.00 16.10 ? 70  PHE C N     1 
ATOM   6387  C  CA    . PHE G  1 72  ? 58.974  -97.992  23.182  1.00 19.47 ? 70  PHE C CA    1 
ATOM   6388  C  C     . PHE G  1 72  ? 59.109  -97.461  24.607  1.00 18.54 ? 70  PHE C C     1 
ATOM   6389  O  O     . PHE G  1 72  ? 59.797  -96.460  24.852  1.00 17.95 ? 70  PHE C O     1 
ATOM   6390  C  CB    . PHE G  1 72  ? 57.652  -97.457  22.567  1.00 16.63 ? 70  PHE C CB    1 
ATOM   6391  C  CG    . PHE G  1 72  ? 57.517  -95.952  22.717  1.00 14.22 ? 70  PHE C CG    1 
ATOM   6392  C  CD1   . PHE G  1 72  ? 58.298  -95.097  21.945  1.00 15.48 ? 70  PHE C CD1   1 
ATOM   6393  C  CD2   . PHE G  1 72  ? 56.707  -95.411  23.684  1.00 14.61 ? 70  PHE C CD2   1 
ATOM   6394  C  CE1   . PHE G  1 72  ? 58.230  -93.692  22.093  1.00 19.14 ? 70  PHE C CE1   1 
ATOM   6395  C  CE2   . PHE G  1 72  ? 56.619  -94.021  23.852  1.00 21.58 ? 70  PHE C CE2   1 
ATOM   6396  C  CZ    . PHE G  1 72  ? 57.399  -93.152  23.047  1.00 16.31 ? 70  PHE C CZ    1 
ATOM   6397  N  N     . HIS G  1 73  ? 58.469  -98.145  25.559  1.00 17.03 ? 71  HIS C N     1 
ATOM   6398  C  CA    . HIS G  1 73  ? 58.443  -97.641  26.922  1.00 19.32 ? 71  HIS C CA    1 
ATOM   6399  C  C     . HIS G  1 73  ? 59.850  -97.418  27.491  1.00 22.20 ? 71  HIS C C     1 
ATOM   6400  O  O     . HIS G  1 73  ? 60.007  -96.621  28.417  1.00 17.72 ? 71  HIS C O     1 
ATOM   6401  C  CB    . HIS G  1 73  ? 57.656  -98.559  27.856  1.00 20.24 ? 71  HIS C CB    1 
ATOM   6402  C  CG    . HIS G  1 73  ? 58.328  -99.877  28.072  1.00 27.37 ? 71  HIS C CG    1 
ATOM   6403  N  ND1   . HIS G  1 73  ? 59.190  -100.117 29.125  1.00 23.18 ? 71  HIS C ND1   1 
ATOM   6404  C  CD2   . HIS G  1 73  ? 58.329  -101.006 27.318  1.00 22.00 ? 71  HIS C CD2   1 
ATOM   6405  C  CE1   . HIS G  1 73  ? 59.660  -101.347 29.032  1.00 22.00 ? 71  HIS C CE1   1 
ATOM   6406  N  NE2   . HIS G  1 73  ? 59.161  -101.906 27.943  1.00 28.03 ? 71  HIS C NE2   1 
ATOM   6407  N  N     . LEU G  1 74  ? 60.861  -98.135  26.976  1.00 21.19 ? 72  LEU C N     1 
ATOM   6408  C  CA    . LEU G  1 74  ? 62.233  -97.966  27.452  1.00 20.97 ? 72  LEU C CA    1 
ATOM   6409  C  C     . LEU G  1 74  ? 62.724  -96.570  27.034  1.00 24.18 ? 72  LEU C C     1 
ATOM   6410  O  O     . LEU G  1 74  ? 63.477  -95.877  27.759  1.00 24.88 ? 72  LEU C O     1 
ATOM   6411  C  CB    . LEU G  1 74  ? 63.155  -99.009  26.824  1.00 21.49 ? 72  LEU C CB    1 
ATOM   6412  C  CG    . LEU G  1 74  ? 63.452  -100.404 27.417  1.00 25.56 ? 72  LEU C CG    1 
ATOM   6413  C  CD1   . LEU G  1 74  ? 62.853  -100.711 28.798  1.00 20.68 ? 72  LEU C CD1   1 
ATOM   6414  C  CD2   . LEU G  1 74  ? 63.086  -101.472 26.437  1.00 23.14 ? 72  LEU C CD2   1 
ATOM   6415  N  N     . TYR G  1 75  ? 62.330  -96.170  25.835  1.00 18.93 ? 73  TYR C N     1 
ATOM   6416  C  CA    . TYR G  1 75  ? 62.764  -94.890  25.328  1.00 15.51 ? 73  TYR C CA    1 
ATOM   6417  C  C     . TYR G  1 75  ? 62.016  -93.784  26.059  1.00 18.79 ? 73  TYR C C     1 
ATOM   6418  O  O     . TYR G  1 75  ? 62.630  -92.777  26.479  1.00 18.10 ? 73  TYR C O     1 
ATOM   6419  C  CB    . TYR G  1 75  ? 62.562  -94.840  23.805  1.00 16.95 ? 73  TYR C CB    1 
ATOM   6420  C  CG    . TYR G  1 75  ? 63.545  -95.732  23.126  1.00 15.33 ? 73  TYR C CG    1 
ATOM   6421  C  CD1   . TYR G  1 75  ? 63.305  -97.102  23.005  1.00 15.37 ? 73  TYR C CD1   1 
ATOM   6422  C  CD2   . TYR G  1 75  ? 64.736  -95.231  22.649  1.00 13.39 ? 73  TYR C CD2   1 
ATOM   6423  C  CE1   . TYR G  1 75  ? 64.256  -97.959  22.410  1.00 14.01 ? 73  TYR C CE1   1 
ATOM   6424  C  CE2   . TYR G  1 75  ? 65.673  -96.067  22.053  1.00 16.67 ? 73  TYR C CE2   1 
ATOM   6425  C  CZ    . TYR G  1 75  ? 65.423  -97.421  21.932  1.00 17.59 ? 73  TYR C CZ    1 
ATOM   6426  O  OH    . TYR G  1 75  ? 66.386  -98.217  21.325  1.00 21.38 ? 73  TYR C OH    1 
ATOM   6427  N  N     . TYR G  1 76  ? 60.699  -93.991  26.212  1.00 15.34 ? 74  TYR C N     1 
ATOM   6428  C  CA    . TYR G  1 76  ? 59.827  -93.079  26.942  1.00 16.39 ? 74  TYR C CA    1 
ATOM   6429  C  C     . TYR G  1 76  ? 60.374  -92.846  28.359  1.00 20.56 ? 74  TYR C C     1 
ATOM   6430  O  O     . TYR G  1 76  ? 60.381  -91.704  28.852  1.00 17.34 ? 74  TYR C O     1 
ATOM   6431  C  CB    . TYR G  1 76  ? 58.391  -93.640  26.999  1.00 14.71 ? 74  TYR C CB    1 
ATOM   6432  C  CG    . TYR G  1 76  ? 57.412  -92.763  27.715  1.00 18.76 ? 74  TYR C CG    1 
ATOM   6433  C  CD1   . TYR G  1 76  ? 56.883  -91.623  27.105  1.00 19.12 ? 74  TYR C CD1   1 
ATOM   6434  C  CD2   . TYR G  1 76  ? 56.976  -93.076  28.989  1.00 17.20 ? 74  TYR C CD2   1 
ATOM   6435  C  CE1   . TYR G  1 76  ? 55.961  -90.800  27.759  1.00 20.72 ? 74  TYR C CE1   1 
ATOM   6436  C  CE2   . TYR G  1 76  ? 56.049  -92.234  29.662  1.00 20.87 ? 74  TYR C CE2   1 
ATOM   6437  C  CZ    . TYR G  1 76  ? 55.566  -91.109  29.034  1.00 20.96 ? 74  TYR C CZ    1 
ATOM   6438  O  OH    . TYR G  1 76  ? 54.683  -90.295  29.678  1.00 27.05 ? 74  TYR C OH    1 
ATOM   6439  N  N     . GLU G  1 77  ? 60.864  -93.932  28.968  1.00 21.23 ? 75  GLU C N     1 
ATOM   6440  C  CA    . GLU G  1 77  ? 61.342  -93.941  30.344  1.00 20.53 ? 75  GLU C CA    1 
ATOM   6441  C  C     . GLU G  1 77  ? 62.757  -93.372  30.429  1.00 21.78 ? 75  GLU C C     1 
ATOM   6442  O  O     . GLU G  1 77  ? 63.239  -93.024  31.494  1.00 26.67 ? 75  GLU C O     1 
ATOM   6443  C  CB    . GLU G  1 77  ? 61.292  -95.379  30.903  1.00 19.99 ? 75  GLU C CB    1 
ATOM   6444  C  CG    . GLU G  1 77  ? 59.869  -95.984  31.033  1.00 24.40 ? 75  GLU C CG    1 
ATOM   6445  C  CD    . GLU G  1 77  ? 59.871  -97.506  31.079  1.00 28.57 ? 75  GLU C CD    1 
ATOM   6446  O  OE1   . GLU G  1 77  ? 60.960  -98.094  31.244  1.00 36.70 ? 75  GLU C OE1   1 
ATOM   6447  O  OE2   . GLU G  1 77  ? 58.795  -98.115  30.938  1.00 33.02 ? 75  GLU C OE2   1 
ATOM   6448  N  N     . GLY G  1 78  ? 63.434  -93.281  29.297  1.00 19.81 ? 76  GLY C N     1 
ATOM   6449  C  CA    . GLY G  1 78  ? 64.839  -92.864  29.284  1.00 21.77 ? 76  GLY C CA    1 
ATOM   6450  C  C     . GLY G  1 78  ? 65.859  -93.969  29.559  1.00 20.23 ? 76  GLY C C     1 
ATOM   6451  O  O     . GLY G  1 78  ? 67.068  -93.717  29.664  1.00 18.90 ? 76  GLY C O     1 
ATOM   6452  N  N     . LYS G  1 79  ? 65.365  -95.196  29.683  1.00 15.72 ? 77  LYS C N     1 
ATOM   6453  C  CA    . LYS G  1 79  ? 66.222  -96.353  29.854  1.00 23.62 ? 77  LYS C CA    1 
ATOM   6454  C  C     . LYS G  1 79  ? 67.047  -96.525  28.584  1.00 26.42 ? 77  LYS C C     1 
ATOM   6455  O  O     . LYS G  1 79  ? 68.237  -96.855  28.644  1.00 25.18 ? 77  LYS C O     1 
ATOM   6456  C  CB    . LYS G  1 79  ? 65.396  -97.627  30.108  1.00 21.60 ? 77  LYS C CB    1 
ATOM   6457  C  CG    . LYS G  1 79  ? 64.873  -97.790  31.545  1.00 22.75 ? 77  LYS C CG    1 
ATOM   6458  C  CD    . LYS G  1 79  ? 64.339  -99.217  31.720  1.00 36.58 ? 77  LYS C CD    1 
ATOM   6459  C  CE    . LYS G  1 79  ? 63.664  -99.444  33.066  1.00 37.16 ? 77  LYS C CE    1 
ATOM   6460  N  NZ    . LYS G  1 79  ? 64.643  -99.387  34.183  1.00 46.19 ? 77  LYS C NZ    1 
ATOM   6461  N  N     . GLU G  1 80  ? 66.412  -96.319  27.427  1.00 22.40 ? 78  GLU C N     1 
ATOM   6462  C  CA    . GLU G  1 80  ? 67.157  -96.294  26.170  1.00 23.09 ? 78  GLU C CA    1 
ATOM   6463  C  C     . GLU G  1 80  ? 67.082  -94.886  25.567  1.00 21.47 ? 78  GLU C C     1 
ATOM   6464  O  O     . GLU G  1 80  ? 66.229  -94.082  25.934  1.00 18.39 ? 78  GLU C O     1 
ATOM   6465  C  CB    . GLU G  1 80  ? 66.606  -97.348  25.183  1.00 19.00 ? 78  GLU C CB    1 
ATOM   6466  C  CG    . GLU G  1 80  ? 66.606  -98.813  25.692  1.00 18.93 ? 78  GLU C CG    1 
ATOM   6467  C  CD    . GLU G  1 80  ? 67.964  -99.506  25.623  1.00 25.95 ? 78  GLU C CD    1 
ATOM   6468  O  OE1   . GLU G  1 80  ? 68.898  -98.953  25.022  1.00 24.33 ? 78  GLU C OE1   1 
ATOM   6469  O  OE2   . GLU G  1 80  ? 68.078  -100.613 26.188  1.00 31.51 ? 78  GLU C OE2   1 
ATOM   6470  N  N     . LYS G  1 81  ? 67.970  -94.610  24.622  1.00 19.62 ? 79  LYS C N     1 
ATOM   6471  C  CA    . LYS G  1 81  ? 68.052  -93.282  24.033  1.00 24.49 ? 79  LYS C CA    1 
ATOM   6472  C  C     . LYS G  1 81  ? 68.299  -93.395  22.525  1.00 23.64 ? 79  LYS C C     1 
ATOM   6473  O  O     . LYS G  1 81  ? 69.341  -93.913  22.087  1.00 25.69 ? 79  LYS C O     1 
ATOM   6474  C  CB    . LYS G  1 81  ? 69.210  -92.537  24.693  1.00 24.12 ? 79  LYS C CB    1 
ATOM   6475  C  CG    . LYS G  1 81  ? 69.331  -91.084  24.325  1.00 31.11 ? 79  LYS C CG    1 
ATOM   6476  C  CD    . LYS G  1 81  ? 70.199  -90.388  25.365  1.00 34.02 ? 79  LYS C CD    1 
ATOM   6477  C  CE    . LYS G  1 81  ? 70.078  -88.888  25.222  1.00 41.33 ? 79  LYS C CE    1 
ATOM   6478  N  NZ    . LYS G  1 81  ? 70.604  -88.481  23.887  1.00 42.89 ? 79  LYS C NZ    1 
ATOM   6479  N  N     . ALA G  1 82  ? 67.354  -92.908  21.731  1.00 15.97 ? 80  ALA C N     1 
ATOM   6480  C  CA    . ALA G  1 82  ? 67.469  -92.958  20.268  1.00 12.49 ? 80  ALA C CA    1 
ATOM   6481  C  C     . ALA G  1 82  ? 68.697  -92.238  19.820  1.00 17.03 ? 80  ALA C C     1 
ATOM   6482  O  O     . ALA G  1 82  ? 68.842  -91.052  20.089  1.00 26.62 ? 80  ALA C O     1 
ATOM   6483  C  CB    . ALA G  1 82  ? 66.203  -92.279  19.607  1.00 18.07 ? 80  ALA C CB    1 
ATOM   6484  N  N     . PRO G  1 83  ? 69.573  -92.923  19.076  1.00 19.28 ? 81  PRO C N     1 
ATOM   6485  C  CA    . PRO G  1 83  ? 70.824  -92.304  18.621  1.00 16.58 ? 81  PRO C CA    1 
ATOM   6486  C  C     . PRO G  1 83  ? 70.647  -91.355  17.428  1.00 17.26 ? 81  PRO C C     1 
ATOM   6487  O  O     . PRO G  1 83  ? 71.575  -90.653  17.065  1.00 20.50 ? 81  PRO C O     1 
ATOM   6488  C  CB    . PRO G  1 83  ? 71.693  -93.514  18.239  1.00 21.27 ? 81  PRO C CB    1 
ATOM   6489  C  CG    . PRO G  1 83  ? 70.707  -94.610  17.872  1.00 21.30 ? 81  PRO C CG    1 
ATOM   6490  C  CD    . PRO G  1 83  ? 69.520  -94.377  18.800  1.00 18.45 ? 81  PRO C CD    1 
ATOM   6491  N  N     . TYR G  1 84  ? 69.469  -91.339  16.810  1.00 17.91 ? 82  TYR C N     1 
ATOM   6492  C  CA    . TYR G  1 84  ? 69.267  -90.478  15.644  1.00 18.90 ? 82  TYR C CA    1 
ATOM   6493  C  C     . TYR G  1 84  ? 67.887  -89.863  15.713  1.00 15.65 ? 82  TYR C C     1 
ATOM   6494  O  O     . TYR G  1 84  ? 66.917  -90.495  16.182  1.00 14.31 ? 82  TYR C O     1 
ATOM   6495  C  CB    . TYR G  1 84  ? 69.374  -91.228  14.304  1.00 17.94 ? 82  TYR C CB    1 
ATOM   6496  C  CG    . TYR G  1 84  ? 70.460  -92.261  14.216  1.00 21.00 ? 82  TYR C CG    1 
ATOM   6497  C  CD1   . TYR G  1 84  ? 70.209  -93.556  14.612  1.00 22.11 ? 82  TYR C CD1   1 
ATOM   6498  C  CD2   . TYR G  1 84  ? 71.748  -91.940  13.754  1.00 27.70 ? 82  TYR C CD2   1 
ATOM   6499  C  CE1   . TYR G  1 84  ? 71.184  -94.534  14.563  1.00 27.57 ? 82  TYR C CE1   1 
ATOM   6500  C  CE2   . TYR G  1 84  ? 72.745  -92.922  13.693  1.00 21.15 ? 82  TYR C CE2   1 
ATOM   6501  C  CZ    . TYR G  1 84  ? 72.433  -94.220  14.104  1.00 22.91 ? 82  TYR C CZ    1 
ATOM   6502  O  OH    . TYR G  1 84  ? 73.362  -95.223  14.080  1.00 27.90 ? 82  TYR C OH    1 
ATOM   6503  N  N     . LEU G  1 85  ? 67.789  -88.633  15.214  1.00 17.74 ? 83  LEU C N     1 
ATOM   6504  C  CA    . LEU G  1 85  ? 66.485  -88.020  15.060  1.00 15.32 ? 83  LEU C CA    1 
ATOM   6505  C  C     . LEU G  1 85  ? 65.650  -88.877  14.103  1.00 14.71 ? 83  LEU C C     1 
ATOM   6506  O  O     . LEU G  1 85  ? 66.049  -89.165  12.955  1.00 16.65 ? 83  LEU C O     1 
ATOM   6507  C  CB    . LEU G  1 85  ? 66.611  -86.602  14.505  1.00 16.16 ? 83  LEU C CB    1 
ATOM   6508  C  CG    . LEU G  1 85  ? 65.323  -85.876  14.131  1.00 16.01 ? 83  LEU C CG    1 
ATOM   6509  C  CD1   . LEU G  1 85  ? 64.375  -85.805  15.297  1.00 19.20 ? 83  LEU C CD1   1 
ATOM   6510  C  CD2   . LEU G  1 85  ? 65.647  -84.443  13.558  1.00 12.80 ? 83  LEU C CD2   1 
ATOM   6511  N  N     . THR G  1 86  ? 64.473  -89.255  14.589  1.00 15.06 ? 84  THR C N     1 
ATOM   6512  C  CA    . THR G  1 86  ? 63.607  -90.200  13.915  1.00 13.10 ? 84  THR C CA    1 
ATOM   6513  C  C     . THR G  1 86  ? 62.241  -89.548  13.747  1.00 12.79 ? 84  THR C C     1 
ATOM   6514  O  O     . THR G  1 86  ? 61.561  -89.233  14.740  1.00 14.93 ? 84  THR C O     1 
ATOM   6515  C  CB    . THR G  1 86  ? 63.398  -91.410  14.788  1.00 12.77 ? 84  THR C CB    1 
ATOM   6516  O  OG1   . THR G  1 86  ? 64.678  -91.989  15.125  1.00 10.44 ? 84  THR C OG1   1 
ATOM   6517  C  CG2   . THR G  1 86  ? 62.443  -92.458  14.104  1.00 15.24 ? 84  THR C CG2   1 
ATOM   6518  N  N     . LEU G  1 87  ? 61.829  -89.415  12.486  1.00 9.84  ? 85  LEU C N     1 
ATOM   6519  C  CA    . LEU G  1 87  ? 60.604  -88.729  12.168  1.00 13.16 ? 85  LEU C CA    1 
ATOM   6520  C  C     . LEU G  1 87  ? 59.649  -89.789  11.688  1.00 11.16 ? 85  LEU C C     1 
ATOM   6521  O  O     . LEU G  1 87  ? 60.047  -90.687  10.974  1.00 12.87 ? 85  LEU C O     1 
ATOM   6522  C  CB    . LEU G  1 87  ? 60.856  -87.734  11.036  1.00 13.52 ? 85  LEU C CB    1 
ATOM   6523  C  CG    . LEU G  1 87  ? 62.029  -86.749  11.112  1.00 12.63 ? 85  LEU C CG    1 
ATOM   6524  C  CD1   . LEU G  1 87  ? 62.075  -85.882  9.818   1.00 11.55 ? 85  LEU C CD1   1 
ATOM   6525  C  CD2   . LEU G  1 87  ? 61.943  -85.844  12.362  1.00 11.29 ? 85  LEU C CD2   1 
ATOM   6526  N  N     . PHE G  1 88  ? 58.367  -89.685  12.024  1.00 12.76 ? 86  PHE C N     1 
ATOM   6527  C  CA    . PHE G  1 88  ? 57.478  -90.769  11.687  1.00 11.70 ? 86  PHE C CA    1 
ATOM   6528  C  C     . PHE G  1 88  ? 55.998  -90.347  11.599  1.00 14.24 ? 86  PHE C C     1 
ATOM   6529  O  O     . PHE G  1 88  ? 55.581  -89.313  12.163  1.00 12.09 ? 86  PHE C O     1 
ATOM   6530  C  CB    . PHE G  1 88  ? 57.677  -91.898  12.700  1.00 10.99 ? 86  PHE C CB    1 
ATOM   6531  C  CG    . PHE G  1 88  ? 57.129  -91.598  14.073  1.00 10.76 ? 86  PHE C CG    1 
ATOM   6532  C  CD1   . PHE G  1 88  ? 55.773  -91.771  14.354  1.00 10.74 ? 86  PHE C CD1   1 
ATOM   6533  C  CD2   . PHE G  1 88  ? 57.973  -91.183  15.085  1.00 9.80  ? 86  PHE C CD2   1 
ATOM   6534  C  CE1   . PHE G  1 88  ? 55.270  -91.533  15.651  1.00 16.30 ? 86  PHE C CE1   1 
ATOM   6535  C  CE2   . PHE G  1 88  ? 57.492  -90.948  16.373  1.00 10.71 ? 86  PHE C CE2   1 
ATOM   6536  C  CZ    . PHE G  1 88  ? 56.137  -91.116  16.662  1.00 16.73 ? 86  PHE C CZ    1 
ATOM   6537  N  N     . ILE G  1 89  ? 55.242  -91.147  10.852  1.00 13.16 ? 87  ILE C N     1 
ATOM   6538  C  CA    . ILE G  1 89  ? 53.770  -91.076  10.817  1.00 11.22 ? 87  ILE C CA    1 
ATOM   6539  C  C     . ILE G  1 89  ? 53.160  -92.292  11.497  1.00 9.49  ? 87  ILE C C     1 
ATOM   6540  O  O     . ILE G  1 89  ? 53.880  -93.265  11.789  1.00 18.59 ? 87  ILE C O     1 
ATOM   6541  C  CB    . ILE G  1 89  ? 53.178  -90.923  9.390   1.00 10.41 ? 87  ILE C CB    1 
ATOM   6542  C  CG1   . ILE G  1 89  ? 53.772  -91.939  8.380   1.00 16.08 ? 87  ILE C CG1   1 
ATOM   6543  C  CG2   . ILE G  1 89  ? 53.450  -89.535  8.832   1.00 11.88 ? 87  ILE C CG2   1 
ATOM   6544  C  CD1   . ILE G  1 89  ? 53.546  -93.396  8.716   1.00 18.10 ? 87  ILE C CD1   1 
ATOM   6545  N  N     . GLY G  1 90  ? 51.847  -92.245  11.701  1.00 12.68 ? 88  GLY C N     1 
ATOM   6546  C  CA    . GLY G  1 90  ? 51.109  -93.289  12.399  1.00 11.73 ? 88  GLY C CA    1 
ATOM   6547  C  C     . GLY G  1 90  ? 50.631  -94.300  11.373  1.00 14.63 ? 88  GLY C C     1 
ATOM   6548  O  O     . GLY G  1 90  ? 50.412  -93.945  10.219  1.00 11.76 ? 88  GLY C O     1 
ATOM   6549  N  N     . GLY G  1 91  ? 50.548  -95.559  11.778  1.00 13.18 ? 89  GLY C N     1 
ATOM   6550  C  CA    . GLY G  1 91  ? 50.032  -96.621  10.932  1.00 14.10 ? 89  GLY C CA    1 
ATOM   6551  C  C     . GLY G  1 91  ? 48.717  -97.158  11.512  1.00 12.18 ? 89  GLY C C     1 
ATOM   6552  O  O     . GLY G  1 91  ? 47.840  -96.388  11.980  1.00 14.24 ? 89  GLY C O     1 
ATOM   6553  N  N     . ASN G  1 92  ? 48.570  -98.476  11.475  1.00 13.71 ? 90  ASN C N     1 
ATOM   6554  C  CA    . ASN G  1 92  ? 47.362  -99.131  11.984  1.00 14.59 ? 90  ASN C CA    1 
ATOM   6555  C  C     . ASN G  1 92  ? 47.572  -99.822  13.322  1.00 13.90 ? 90  ASN C C     1 
ATOM   6556  O  O     . ASN G  1 92  ? 46.613  -100.222 13.977  1.00 17.70 ? 90  ASN C O     1 
ATOM   6557  C  CB    . ASN G  1 92  ? 46.798  -100.148 10.969  1.00 17.61 ? 90  ASN C CB    1 
ATOM   6558  C  CG    . ASN G  1 92  ? 47.813  -101.193 10.566  1.00 15.92 ? 90  ASN C CG    1 
ATOM   6559  O  OD1   . ASN G  1 92  ? 48.731  -100.899 9.821   1.00 16.68 ? 90  ASN C OD1   1 
ATOM   6560  N  ND2   . ASN G  1 92  ? 47.656  -102.433 11.063  1.00 16.96 ? 90  ASN C ND2   1 
ATOM   6561  N  N     . HIS G  1 93  ? 48.826  -99.943  13.725  1.00 16.27 ? 91  HIS C N     1 
ATOM   6562  C  CA    . HIS G  1 93  ? 49.239  -100.673 14.919  1.00 17.21 ? 91  HIS C CA    1 
ATOM   6563  C  C     . HIS G  1 93  ? 49.872  -99.620  15.827  1.00 14.06 ? 91  HIS C C     1 
ATOM   6564  O  O     . HIS G  1 93  ? 51.080  -99.449  15.765  1.00 14.96 ? 91  HIS C O     1 
ATOM   6565  C  CB    . HIS G  1 93  ? 50.353  -101.595 14.442  1.00 22.26 ? 91  HIS C CB    1 
ATOM   6566  C  CG    . HIS G  1 93  ? 50.790  -102.605 15.435  1.00 21.76 ? 91  HIS C CG    1 
ATOM   6567  N  ND1   . HIS G  1 93  ? 50.313  -103.900 15.418  1.00 30.47 ? 91  HIS C ND1   1 
ATOM   6568  C  CD2   . HIS G  1 93  ? 51.686  -102.543 16.451  1.00 22.37 ? 91  HIS C CD2   1 
ATOM   6569  C  CE1   . HIS G  1 93  ? 50.887  -104.588 16.389  1.00 27.21 ? 91  HIS C CE1   1 
ATOM   6570  N  NE2   . HIS G  1 93  ? 51.723  -103.789 17.031  1.00 30.23 ? 91  HIS C NE2   1 
ATOM   6571  N  N     . GLU G  1 94  ? 49.069  -98.858  16.581  1.00 17.14 ? 92  GLU C N     1 
ATOM   6572  C  CA    . GLU G  1 94  ? 49.592  -97.696  17.298  1.00 18.25 ? 92  GLU C CA    1 
ATOM   6573  C  C     . GLU G  1 94  ? 48.976  -97.586  18.671  1.00 24.25 ? 92  GLU C C     1 
ATOM   6574  O  O     . GLU G  1 94  ? 47.874  -98.105  18.917  1.00 16.24 ? 92  GLU C O     1 
ATOM   6575  C  CB    . GLU G  1 94  ? 49.251  -96.392  16.541  1.00 14.99 ? 92  GLU C CB    1 
ATOM   6576  C  CG    . GLU G  1 94  ? 49.777  -96.291  15.106  1.00 15.28 ? 92  GLU C CG    1 
ATOM   6577  C  CD    . GLU G  1 94  ? 51.268  -96.226  15.050  1.00 15.82 ? 92  GLU C CD    1 
ATOM   6578  O  OE1   . GLU G  1 94  ? 51.895  -96.012  16.124  1.00 15.32 ? 92  GLU C OE1   1 
ATOM   6579  O  OE2   . GLU G  1 94  ? 51.815  -96.393  13.933  1.00 17.17 ? 92  GLU C OE2   1 
ATOM   6580  N  N     . SER G  1 95  ? 49.665  -96.871  19.559  1.00 21.85 ? 93  SER C N     1 
ATOM   6581  C  CA    . SER G  1 95  ? 48.999  -96.377  20.775  1.00 21.79 ? 93  SER C CA    1 
ATOM   6582  C  C     . SER G  1 95  ? 48.172  -95.138  20.348  1.00 21.55 ? 93  SER C C     1 
ATOM   6583  O  O     . SER G  1 95  ? 48.627  -93.994  20.428  1.00 16.24 ? 93  SER C O     1 
ATOM   6584  C  CB    . SER G  1 95  ? 50.041  -96.048  21.868  1.00 16.61 ? 93  SER C CB    1 
ATOM   6585  O  OG    . SER G  1 95  ? 49.453  -95.890  23.144  1.00 21.35 ? 93  SER C OG    1 
ATOM   6586  N  N     . SER G  1 96  ? 46.951  -95.373  19.864  1.00 17.79 ? 94  SER C N     1 
ATOM   6587  C  CA    . SER G  1 96  ? 46.215  -94.329  19.137  1.00 19.30 ? 94  SER C CA    1 
ATOM   6588  C  C     . SER G  1 96  ? 45.818  -93.145  20.007  1.00 22.99 ? 94  SER C C     1 
ATOM   6589  O  O     . SER G  1 96  ? 45.650  -92.035  19.492  1.00 21.17 ? 94  SER C O     1 
ATOM   6590  C  CB    . SER G  1 96  ? 44.987  -94.926  18.448  1.00 13.12 ? 94  SER C CB    1 
ATOM   6591  O  OG    . SER G  1 96  ? 45.354  -95.783  17.349  1.00 13.53 ? 94  SER C OG    1 
ATOM   6592  N  N     . ASN G  1 97  ? 45.631  -93.382  21.310  1.00 18.50 ? 95  ASN C N     1 
ATOM   6593  C  CA    . ASN G  1 97  ? 45.429  -92.263  22.255  1.00 18.33 ? 95  ASN C CA    1 
ATOM   6594  C  C     . ASN G  1 97  ? 46.587  -91.255  22.235  1.00 16.49 ? 95  ASN C C     1 
ATOM   6595  O  O     . ASN G  1 97  ? 46.371  -90.037  22.218  1.00 16.48 ? 95  ASN C O     1 
ATOM   6596  C  CB    . ASN G  1 97  ? 45.171  -92.786  23.691  1.00 18.58 ? 95  ASN C CB    1 
ATOM   6597  C  CG    . ASN G  1 97  ? 46.296  -93.691  24.189  1.00 18.69 ? 95  ASN C CG    1 
ATOM   6598  O  OD1   . ASN G  1 97  ? 46.951  -94.381  23.386  1.00 15.19 ? 95  ASN C OD1   1 
ATOM   6599  N  ND2   . ASN G  1 97  ? 46.542  -93.682  25.497  1.00 15.56 ? 95  ASN C ND2   1 
ATOM   6600  N  N     . VAL G  1 98  ? 47.823  -91.762  22.274  1.00 16.17 ? 96  VAL C N     1 
ATOM   6601  C  CA    . VAL G  1 98  ? 49.013  -90.908  22.274  1.00 15.32 ? 96  VAL C CA    1 
ATOM   6602  C  C     . VAL G  1 98  ? 49.006  -90.061  21.012  1.00 15.59 ? 96  VAL C C     1 
ATOM   6603  O  O     . VAL G  1 98  ? 49.238  -88.842  21.058  1.00 17.15 ? 96  VAL C O     1 
ATOM   6604  C  CB    . VAL G  1 98  ? 50.332  -91.743  22.328  1.00 13.51 ? 96  VAL C CB    1 
ATOM   6605  C  CG1   . VAL G  1 98  ? 51.575  -90.912  21.935  1.00 15.79 ? 96  VAL C CG1   1 
ATOM   6606  C  CG2   . VAL G  1 98  ? 50.519  -92.383  23.710  1.00 16.74 ? 96  VAL C CG2   1 
ATOM   6607  N  N     . LEU G  1 99  ? 48.768  -90.710  19.877  1.00 13.13 ? 97  LEU C N     1 
ATOM   6608  C  CA    . LEU G  1 99  ? 48.838  -90.003  18.605  1.00 17.57 ? 97  LEU C CA    1 
ATOM   6609  C  C     . LEU G  1 99  ? 47.730  -88.939  18.500  1.00 16.35 ? 97  LEU C C     1 
ATOM   6610  O  O     . LEU G  1 99  ? 47.909  -87.886  17.882  1.00 14.93 ? 97  LEU C O     1 
ATOM   6611  C  CB    . LEU G  1 99  ? 48.808  -90.986  17.433  1.00 15.73 ? 97  LEU C CB    1 
ATOM   6612  C  CG    . LEU G  1 99  ? 49.939  -92.020  17.430  1.00 10.30 ? 97  LEU C CG    1 
ATOM   6613  C  CD1   . LEU G  1 99  ? 49.888  -92.720  16.058  1.00 14.99 ? 97  LEU C CD1   1 
ATOM   6614  C  CD2   . LEU G  1 99  ? 51.361  -91.463  17.680  1.00 13.79 ? 97  LEU C CD2   1 
ATOM   6615  N  N     . LEU G  1 100 ? 46.588  -89.203  19.132  1.00 11.95 ? 98  LEU C N     1 
ATOM   6616  C  CA    . LEU G  1 100 ? 45.495  -88.246  19.097  1.00 14.34 ? 98  LEU C CA    1 
ATOM   6617  C  C     . LEU G  1 100 ? 45.794  -87.009  19.947  1.00 15.21 ? 98  LEU C C     1 
ATOM   6618  O  O     . LEU G  1 100 ? 45.525  -85.905  19.489  1.00 16.97 ? 98  LEU C O     1 
ATOM   6619  C  CB    . LEU G  1 100 ? 44.214  -88.906  19.560  1.00 14.35 ? 98  LEU C CB    1 
ATOM   6620  C  CG    . LEU G  1 100 ? 43.063  -87.931  19.583  1.00 16.27 ? 98  LEU C CG    1 
ATOM   6621  C  CD1   . LEU G  1 100 ? 42.765  -87.472  18.183  1.00 17.48 ? 98  LEU C CD1   1 
ATOM   6622  C  CD2   . LEU G  1 100 ? 41.844  -88.645  20.184  1.00 21.27 ? 98  LEU C CD2   1 
ATOM   6623  N  N     . HIS G  1 101 ? 46.361  -87.183  21.157  1.00 15.07 ? 99  HIS C N     1 
ATOM   6624  C  CA    . HIS G  1 101 ? 46.864  -86.041  21.961  1.00 18.17 ? 99  HIS C CA    1 
ATOM   6625  C  C     . HIS G  1 101 ? 47.858  -85.243  21.114  1.00 18.16 ? 99  HIS C C     1 
ATOM   6626  O  O     . HIS G  1 101 ? 47.972  -84.009  21.227  1.00 20.17 ? 99  HIS C O     1 
ATOM   6627  C  CB    . HIS G  1 101 ? 47.634  -86.508  23.222  1.00 16.06 ? 99  HIS C CB    1 
ATOM   6628  C  CG    . HIS G  1 101 ? 46.784  -87.209  24.232  1.00 12.87 ? 99  HIS C CG    1 
ATOM   6629  N  ND1   . HIS G  1 101 ? 45.680  -86.626  24.812  1.00 20.44 ? 99  HIS C ND1   1 
ATOM   6630  C  CD2   . HIS G  1 101 ? 46.890  -88.450  24.779  1.00 19.91 ? 99  HIS C CD2   1 
ATOM   6631  C  CE1   . HIS G  1 101 ? 45.115  -87.484  25.650  1.00 16.32 ? 99  HIS C CE1   1 
ATOM   6632  N  NE2   . HIS G  1 101 ? 45.838  -88.598  25.656  1.00 19.52 ? 99  HIS C NE2   1 
ATOM   6633  N  N     . LEU G  1 102 ? 48.629  -85.969  20.309  1.00 16.56 ? 100 LEU C N     1 
ATOM   6634  C  CA    . LEU G  1 102 ? 49.661  -85.333  19.511  1.00 13.03 ? 100 LEU C CA    1 
ATOM   6635  C  C     . LEU G  1 102 ? 49.236  -85.138  18.050  1.00 15.58 ? 100 LEU C C     1 
ATOM   6636  O  O     . LEU G  1 102 ? 50.095  -85.207  17.148  1.00 12.60 ? 100 LEU C O     1 
ATOM   6637  C  CB    . LEU G  1 102 ? 50.981  -86.111  19.601  1.00 15.07 ? 100 LEU C CB    1 
ATOM   6638  C  CG    . LEU G  1 102 ? 51.529  -86.289  21.011  1.00 17.53 ? 100 LEU C CG    1 
ATOM   6639  C  CD1   . LEU G  1 102 ? 52.955  -86.919  20.930  1.00 12.71 ? 100 LEU C CD1   1 
ATOM   6640  C  CD2   . LEU G  1 102 ? 51.593  -84.939  21.740  1.00 17.57 ? 100 LEU C CD2   1 
ATOM   6641  N  N     . TYR G  1 103 ? 47.945  -84.843  17.802  1.00 13.09 ? 101 TYR C N     1 
ATOM   6642  C  CA    . TYR G  1 103 ? 47.456  -84.796  16.418  1.00 12.47 ? 101 TYR C CA    1 
ATOM   6643  C  C     . TYR G  1 103 ? 48.094  -83.614  15.666  1.00 13.76 ? 101 TYR C C     1 
ATOM   6644  O  O     . TYR G  1 103 ? 48.237  -83.654  14.427  1.00 11.26 ? 101 TYR C O     1 
ATOM   6645  C  CB    . TYR G  1 103 ? 45.912  -84.789  16.363  1.00 12.79 ? 101 TYR C CB    1 
ATOM   6646  C  CG    . TYR G  1 103 ? 45.331  -83.386  16.517  1.00 13.11 ? 101 TYR C CG    1 
ATOM   6647  C  CD1   . TYR G  1 103 ? 45.237  -82.777  17.779  1.00 14.95 ? 101 TYR C CD1   1 
ATOM   6648  C  CD2   . TYR G  1 103 ? 44.902  -82.671  15.400  1.00 15.33 ? 101 TYR C CD2   1 
ATOM   6649  C  CE1   . TYR G  1 103 ? 44.694  -81.451  17.922  1.00 13.62 ? 101 TYR C CE1   1 
ATOM   6650  C  CE2   . TYR G  1 103 ? 44.374  -81.372  15.519  1.00 19.37 ? 101 TYR C CE2   1 
ATOM   6651  C  CZ    . TYR G  1 103 ? 44.285  -80.775  16.781  1.00 21.46 ? 101 TYR C CZ    1 
ATOM   6652  O  OH    . TYR G  1 103 ? 43.775  -79.515  16.920  1.00 14.65 ? 101 TYR C OH    1 
ATOM   6653  N  N     . ASN G  1 104 ? 48.540  -82.582  16.405  1.00 11.79 ? 102 ASN C N     1 
ATOM   6654  C  CA    . ASN G  1 104 ? 49.259  -81.466  15.752  1.00 13.54 ? 102 ASN C CA    1 
ATOM   6655  C  C     . ASN G  1 104 ? 50.756  -81.697  15.790  1.00 17.76 ? 102 ASN C C     1 
ATOM   6656  O  O     . ASN G  1 104 ? 51.569  -80.747  15.712  1.00 16.45 ? 102 ASN C O     1 
ATOM   6657  C  CB    . ASN G  1 104 ? 48.928  -80.107  16.384  1.00 19.09 ? 102 ASN C CB    1 
ATOM   6658  C  CG    . ASN G  1 104 ? 47.591  -79.527  15.881  1.00 14.35 ? 102 ASN C CG    1 
ATOM   6659  O  OD1   . ASN G  1 104 ? 47.239  -79.650  14.698  1.00 15.99 ? 102 ASN C OD1   1 
ATOM   6660  N  ND2   . ASN G  1 104 ? 46.855  -78.901  16.783  1.00 18.60 ? 102 ASN C ND2   1 
ATOM   6661  N  N     . GLY G  1 105 ? 51.117  -82.982  15.904  1.00 17.04 ? 103 GLY C N     1 
ATOM   6662  C  CA    . GLY G  1 105 ? 52.515  -83.360  15.896  1.00 12.53 ? 103 GLY C CA    1 
ATOM   6663  C  C     . GLY G  1 105 ? 53.113  -83.281  17.294  1.00 10.94 ? 103 GLY C C     1 
ATOM   6664  O  O     . GLY G  1 105 ? 52.526  -82.703  18.210  1.00 13.86 ? 103 GLY C O     1 
ATOM   6665  N  N     . GLY G  1 106 ? 54.298  -83.872  17.484  1.00 10.35 ? 104 GLY C N     1 
ATOM   6666  C  CA    . GLY G  1 106 ? 54.937  -83.780  18.802  1.00 9.69  ? 104 GLY C CA    1 
ATOM   6667  C  C     . GLY G  1 106 ? 56.028  -84.830  19.012  1.00 12.76 ? 104 GLY C C     1 
ATOM   6668  O  O     . GLY G  1 106 ? 56.003  -85.896  18.390  1.00 12.03 ? 104 GLY C O     1 
ATOM   6669  N  N     . PHE G  1 107 ? 56.981  -84.544  19.895  1.00 10.12 ? 105 PHE C N     1 
ATOM   6670  C  CA    . PHE G  1 107 ? 57.936  -85.581  20.312  1.00 15.73 ? 105 PHE C CA    1 
ATOM   6671  C  C     . PHE G  1 107 ? 57.263  -86.557  21.296  1.00 15.75 ? 105 PHE C C     1 
ATOM   6672  O  O     . PHE G  1 107 ? 56.685  -86.142  22.295  1.00 13.52 ? 105 PHE C O     1 
ATOM   6673  C  CB    . PHE G  1 107 ? 59.164  -84.930  20.975  1.00 11.32 ? 105 PHE C CB    1 
ATOM   6674  C  CG    . PHE G  1 107 ? 60.127  -84.361  19.987  1.00 18.03 ? 105 PHE C CG    1 
ATOM   6675  C  CD1   . PHE G  1 107 ? 61.084  -85.165  19.419  1.00 11.28 ? 105 PHE C CD1   1 
ATOM   6676  C  CD2   . PHE G  1 107 ? 60.062  -83.023  19.598  1.00 18.95 ? 105 PHE C CD2   1 
ATOM   6677  C  CE1   . PHE G  1 107 ? 61.987  -84.662  18.480  1.00 14.70 ? 105 PHE C CE1   1 
ATOM   6678  C  CE2   . PHE G  1 107 ? 60.980  -82.513  18.672  1.00 17.01 ? 105 PHE C CE2   1 
ATOM   6679  C  CZ    . PHE G  1 107 ? 61.932  -83.328  18.105  1.00 16.80 ? 105 PHE C CZ    1 
ATOM   6680  N  N     . VAL G  1 108 ? 57.299  -87.856  20.986  1.00 14.15 ? 106 VAL C N     1 
ATOM   6681  C  CA    . VAL G  1 108 ? 56.850  -88.844  21.944  1.00 13.98 ? 106 VAL C CA    1 
ATOM   6682  C  C     . VAL G  1 108 ? 57.984  -89.163  22.943  1.00 12.62 ? 106 VAL C C     1 
ATOM   6683  O  O     . VAL G  1 108 ? 57.734  -89.718  24.009  1.00 12.73 ? 106 VAL C O     1 
ATOM   6684  C  CB    . VAL G  1 108 ? 56.366  -90.127  21.256  1.00 19.80 ? 106 VAL C CB    1 
ATOM   6685  C  CG1   . VAL G  1 108 ? 55.092  -89.848  20.460  1.00 16.50 ? 106 VAL C CG1   1 
ATOM   6686  C  CG2   . VAL G  1 108 ? 57.488  -90.685  20.358  1.00 14.16 ? 106 VAL C CG2   1 
ATOM   6687  N  N     . CYS G  1 109 ? 59.215  -88.820  22.602  1.00 16.11 ? 107 CYS C N     1 
ATOM   6688  C  CA    . CYS G  1 109 ? 60.332  -88.935  23.544  1.00 16.75 ? 107 CYS C CA    1 
ATOM   6689  C  C     . CYS G  1 109 ? 61.482  -88.330  22.821  1.00 17.57 ? 107 CYS C C     1 
ATOM   6690  O  O     . CYS G  1 109 ? 61.328  -87.943  21.669  1.00 22.61 ? 107 CYS C O     1 
ATOM   6691  C  CB    . CYS G  1 109 ? 60.616  -90.387  23.922  1.00 15.77 ? 107 CYS C CB    1 
ATOM   6692  S  SG    . CYS G  1 109 ? 61.132  -91.434  22.499  1.00 15.37 ? 107 CYS C SG    1 
ATOM   6693  N  N     . PHE G  1 110 ? 62.632  -88.247  23.484  1.00 21.00 ? 108 PHE C N     1 
ATOM   6694  C  CA    . PHE G  1 110 ? 63.818  -87.652  22.904  1.00 14.72 ? 108 PHE C CA    1 
ATOM   6695  C  C     . PHE G  1 110 ? 64.125  -88.295  21.543  1.00 22.55 ? 108 PHE C C     1 
ATOM   6696  O  O     . PHE G  1 110 ? 64.114  -89.529  21.367  1.00 14.13 ? 108 PHE C O     1 
ATOM   6697  C  CB    . PHE G  1 110 ? 65.005  -87.775  23.871  1.00 20.76 ? 108 PHE C CB    1 
ATOM   6698  C  CG    . PHE G  1 110 ? 66.285  -87.264  23.292  1.00 23.71 ? 108 PHE C CG    1 
ATOM   6699  C  CD1   . PHE G  1 110 ? 66.607  -85.905  23.320  1.00 23.50 ? 108 PHE C CD1   1 
ATOM   6700  C  CD2   . PHE G  1 110 ? 67.149  -88.141  22.683  1.00 25.02 ? 108 PHE C CD2   1 
ATOM   6701  C  CE1   . PHE G  1 110 ? 67.768  -85.476  22.739  1.00 22.93 ? 108 PHE C CE1   1 
ATOM   6702  C  CE2   . PHE G  1 110 ? 68.295  -87.724  22.120  1.00 24.16 ? 108 PHE C CE2   1 
ATOM   6703  C  CZ    . PHE G  1 110 ? 68.617  -86.394  22.136  1.00 21.85 ? 108 PHE C CZ    1 
ATOM   6704  N  N     . ASN G  1 111 ? 64.296  -87.439  20.557  1.00 15.99 ? 109 ASN C N     1 
ATOM   6705  C  CA    . ASN G  1 111 ? 64.666  -87.862  19.227  1.00 21.13 ? 109 ASN C CA    1 
ATOM   6706  C  C     . ASN G  1 111 ? 63.624  -88.625  18.394  1.00 12.03 ? 109 ASN C C     1 
ATOM   6707  O  O     . ASN G  1 111 ? 63.956  -89.121  17.349  1.00 16.46 ? 109 ASN C O     1 
ATOM   6708  C  CB    . ASN G  1 111 ? 65.990  -88.624  19.256  1.00 18.02 ? 109 ASN C CB    1 
ATOM   6709  C  CG    . ASN G  1 111 ? 67.170  -87.755  18.829  1.00 25.53 ? 109 ASN C CG    1 
ATOM   6710  O  OD1   . ASN G  1 111 ? 66.980  -86.628  18.348  1.00 19.59 ? 109 ASN C OD1   1 
ATOM   6711  N  ND2   . ASN G  1 111 ? 68.400  -88.276  18.998  1.00 22.72 ? 109 ASN C ND2   1 
ATOM   6712  N  N     . MET G  1 112 ? 62.379  -88.735  18.861  1.00 14.46 ? 110 MET C N     1 
ATOM   6713  C  CA    . MET G  1 112 ? 61.293  -89.324  18.055  1.00 8.55  ? 110 MET C CA    1 
ATOM   6714  C  C     . MET G  1 112 ? 60.151  -88.341  17.914  1.00 9.59  ? 110 MET C C     1 
ATOM   6715  O  O     . MET G  1 112 ? 59.470  -88.075  18.904  1.00 8.71  ? 110 MET C O     1 
ATOM   6716  C  CB    . MET G  1 112 ? 60.798  -90.598  18.700  1.00 8.25  ? 110 MET C CB    1 
ATOM   6717  C  CG    . MET G  1 112 ? 61.923  -91.590  18.893  1.00 8.18  ? 110 MET C CG    1 
ATOM   6718  S  SD    . MET G  1 112 ? 61.171  -93.233  19.321  1.00 15.22 ? 110 MET C SD    1 
ATOM   6719  C  CE    . MET G  1 112 ? 62.501  -94.073  20.215  1.00 17.59 ? 110 MET C CE    1 
ATOM   6720  N  N     . TYR G  1 113 ? 59.968  -87.826  16.686  1.00 8.23  ? 111 TYR C N     1 
ATOM   6721  C  CA    . TYR G  1 113 ? 58.984  -86.778  16.387  1.00 11.09 ? 111 TYR C CA    1 
ATOM   6722  C  C     . TYR G  1 113 ? 57.882  -87.349  15.461  1.00 9.52  ? 111 TYR C C     1 
ATOM   6723  O  O     . TYR G  1 113 ? 58.139  -87.780  14.338  1.00 10.08 ? 111 TYR C O     1 
ATOM   6724  C  CB    . TYR G  1 113 ? 59.644  -85.572  15.675  1.00 13.15 ? 111 TYR C CB    1 
ATOM   6725  C  CG    . TYR G  1 113 ? 58.593  -84.518  15.344  1.00 11.20 ? 111 TYR C CG    1 
ATOM   6726  C  CD1   . TYR G  1 113 ? 57.975  -83.821  16.371  1.00 10.07 ? 111 TYR C CD1   1 
ATOM   6727  C  CD2   . TYR G  1 113 ? 58.148  -84.281  14.017  1.00 10.39 ? 111 TYR C CD2   1 
ATOM   6728  C  CE1   . TYR G  1 113 ? 56.963  -82.873  16.111  1.00 8.18  ? 111 TYR C CE1   1 
ATOM   6729  C  CE2   . TYR G  1 113 ? 57.112  -83.295  13.751  1.00 11.61 ? 111 TYR C CE2   1 
ATOM   6730  C  CZ    . TYR G  1 113 ? 56.528  -82.635  14.821  1.00 10.72 ? 111 TYR C CZ    1 
ATOM   6731  O  OH    . TYR G  1 113 ? 55.531  -81.685  14.648  1.00 12.71 ? 111 TYR C OH    1 
ATOM   6732  N  N     . TYR G  1 114 ? 56.664  -87.313  15.937  1.00 13.30 ? 112 TYR C N     1 
ATOM   6733  C  CA    . TYR G  1 114 ? 55.471  -87.681  15.166  1.00 11.84 ? 112 TYR C CA    1 
ATOM   6734  C  C     . TYR G  1 114 ? 54.912  -86.449  14.407  1.00 9.26  ? 112 TYR C C     1 
ATOM   6735  O  O     . TYR G  1 114 ? 54.725  -85.349  14.986  1.00 13.08 ? 112 TYR C O     1 
ATOM   6736  C  CB    . TYR G  1 114 ? 54.450  -88.223  16.167  1.00 12.86 ? 112 TYR C CB    1 
ATOM   6737  C  CG    . TYR G  1 114 ? 53.065  -88.462  15.614  1.00 11.03 ? 112 TYR C CG    1 
ATOM   6738  C  CD1   . TYR G  1 114 ? 52.874  -89.367  14.581  1.00 9.84  ? 112 TYR C CD1   1 
ATOM   6739  C  CD2   . TYR G  1 114 ? 51.952  -87.819  16.146  1.00 11.01 ? 112 TYR C CD2   1 
ATOM   6740  C  CE1   . TYR G  1 114 ? 51.619  -89.634  14.079  1.00 11.14 ? 112 TYR C CE1   1 
ATOM   6741  C  CE2   . TYR G  1 114 ? 50.655  -88.090  15.642  1.00 12.46 ? 112 TYR C CE2   1 
ATOM   6742  C  CZ    . TYR G  1 114 ? 50.536  -89.009  14.605  1.00 11.77 ? 112 TYR C CZ    1 
ATOM   6743  O  OH    . TYR G  1 114 ? 49.335  -89.323  14.056  1.00 12.76 ? 112 TYR C OH    1 
ATOM   6744  N  N     . LEU G  1 115 ? 54.656  -86.619  13.119  1.00 13.58 ? 113 LEU C N     1 
ATOM   6745  C  CA    . LEU G  1 115 ? 54.200  -85.495  12.279  1.00 12.90 ? 113 LEU C CA    1 
ATOM   6746  C  C     . LEU G  1 115 ? 52.706  -85.181  12.462  1.00 18.70 ? 113 LEU C C     1 
ATOM   6747  O  O     . LEU G  1 115 ? 52.180  -84.225  11.876  1.00 21.48 ? 113 LEU C O     1 
ATOM   6748  C  CB    . LEU G  1 115 ? 54.558  -85.744  10.817  1.00 13.08 ? 113 LEU C CB    1 
ATOM   6749  C  CG    . LEU G  1 115 ? 55.928  -85.261  10.335  1.00 15.87 ? 113 LEU C CG    1 
ATOM   6750  C  CD1   . LEU G  1 115 ? 57.097  -86.041  10.951  1.00 14.20 ? 113 LEU C CD1   1 
ATOM   6751  C  CD2   . LEU G  1 115 ? 55.988  -85.344  8.811   1.00 17.11 ? 113 LEU C CD2   1 
ATOM   6752  N  N     . GLY G  1 116 ? 52.022  -85.958  13.312  1.00 7.83  ? 114 GLY C N     1 
ATOM   6753  C  CA    . GLY G  1 116 ? 50.619  -85.684  13.607  1.00 12.88 ? 114 GLY C CA    1 
ATOM   6754  C  C     . GLY G  1 116 ? 49.719  -86.350  12.593  1.00 14.72 ? 114 GLY C C     1 
ATOM   6755  O  O     . GLY G  1 116 ? 50.165  -87.186  11.780  1.00 10.77 ? 114 GLY C O     1 
ATOM   6756  N  N     . VAL G  1 117 ? 48.440  -86.013  12.645  1.00 13.29 ? 115 VAL C N     1 
ATOM   6757  C  CA    . VAL G  1 117 ? 47.520  -86.512  11.624  1.00 15.03 ? 115 VAL C CA    1 
ATOM   6758  C  C     . VAL G  1 117 ? 48.071  -86.318  10.200  1.00 16.18 ? 115 VAL C C     1 
ATOM   6759  O  O     . VAL G  1 117 ? 48.020  -87.226  9.354   1.00 12.71 ? 115 VAL C O     1 
ATOM   6760  C  CB    . VAL G  1 117 ? 46.130  -85.852  11.795  1.00 16.22 ? 115 VAL C CB    1 
ATOM   6761  C  CG1   . VAL G  1 117 ? 45.292  -86.024  10.555  1.00 19.76 ? 115 VAL C CG1   1 
ATOM   6762  C  CG2   . VAL G  1 117 ? 45.430  -86.488  12.982  1.00 17.27 ? 115 VAL C CG2   1 
ATOM   6763  N  N     . CYS G  1 118 ? 48.614  -85.140  9.944   1.00 14.37 ? 116 CYS C N     1 
ATOM   6764  C  CA    . CYS G  1 118 ? 49.309  -84.838  8.711   1.00 14.67 ? 116 CYS C CA    1 
ATOM   6765  C  C     . CYS G  1 118 ? 50.008  -83.508  8.980   1.00 17.23 ? 116 CYS C C     1 
ATOM   6766  O  O     . CYS G  1 118 ? 49.540  -82.751  9.847   1.00 18.28 ? 116 CYS C O     1 
ATOM   6767  C  CB    . CYS G  1 118 ? 48.362  -84.718  7.516   1.00 18.12 ? 116 CYS C CB    1 
ATOM   6768  S  SG    . CYS G  1 118 ? 47.129  -83.372  7.631   1.00 18.08 ? 116 CYS C SG    1 
ATOM   6769  N  N     . SER G  1 119 ? 51.136  -83.270  8.284   1.00 13.57 ? 117 SER C N     1 
ATOM   6770  C  CA    . SER G  1 119 ? 51.811  -81.967  8.295   1.00 14.39 ? 117 SER C CA    1 
ATOM   6771  C  C     . SER G  1 119 ? 52.936  -81.977  7.283   1.00 14.13 ? 117 SER C C     1 
ATOM   6772  O  O     . SER G  1 119 ? 53.190  -82.986  6.656   1.00 14.75 ? 117 SER C O     1 
ATOM   6773  C  CB    . SER G  1 119 ? 52.357  -81.634  9.690   1.00 21.01 ? 117 SER C CB    1 
ATOM   6774  O  OG    . SER G  1 119 ? 53.399  -82.531  10.049  1.00 14.90 ? 117 SER C OG    1 
ATOM   6775  N  N     . CYS G  1 120 ? 53.624  -80.851  7.126   1.00 14.71 ? 118 CYS C N     1 
ATOM   6776  C  CA    . CYS G  1 120 ? 54.854  -80.841  6.362   1.00 13.08 ? 118 CYS C CA    1 
ATOM   6777  C  C     . CYS G  1 120 ? 55.937  -80.296  7.292   1.00 12.04 ? 118 CYS C C     1 
ATOM   6778  O  O     . CYS G  1 120 ? 55.693  -79.346  8.042   1.00 12.09 ? 118 CYS C O     1 
ATOM   6779  C  CB    . CYS G  1 120 ? 54.687  -79.929  5.145   1.00 12.39 ? 118 CYS C CB    1 
ATOM   6780  S  SG    . CYS G  1 120 ? 56.149  -79.853  4.118   1.00 15.62 ? 118 CYS C SG    1 
ATOM   6781  N  N     . ILE G  1 121 ? 57.117  -80.907  7.296   1.00 14.79 ? 119 ILE C N     1 
ATOM   6782  C  CA    . ILE G  1 121 ? 58.263  -80.333  8.067   1.00 14.94 ? 119 ILE C CA    1 
ATOM   6783  C  C     . ILE G  1 121 ? 59.405  -79.981  7.142   1.00 17.28 ? 119 ILE C C     1 
ATOM   6784  O  O     . ILE G  1 121 ? 59.376  -80.321  5.940   1.00 16.76 ? 119 ILE C O     1 
ATOM   6785  C  CB    . ILE G  1 121 ? 58.733  -81.286  9.209   1.00 13.47 ? 119 ILE C CB    1 
ATOM   6786  C  CG1   . ILE G  1 121 ? 59.281  -82.591  8.647   1.00 12.41 ? 119 ILE C CG1   1 
ATOM   6787  C  CG2   . ILE G  1 121 ? 57.542  -81.602  10.145  1.00 13.25 ? 119 ILE C CG2   1 
ATOM   6788  C  CD1   . ILE G  1 121 ? 60.766  -82.550  8.062   1.00 13.55 ? 119 ILE C CD1   1 
ATOM   6789  N  N     . ASN G  1 122 ? 60.400  -79.291  7.684   1.00 15.59 ? 120 ASN C N     1 
ATOM   6790  C  CA    . ASN G  1 122 ? 61.612  -78.985  6.936   1.00 18.18 ? 120 ASN C CA    1 
ATOM   6791  C  C     . ASN G  1 122 ? 62.801  -79.536  7.675   1.00 16.20 ? 120 ASN C C     1 
ATOM   6792  O  O     . ASN G  1 122 ? 62.874  -79.424  8.888   1.00 15.15 ? 120 ASN C O     1 
ATOM   6793  C  CB    . ASN G  1 122 ? 61.847  -77.474  6.827   1.00 12.31 ? 120 ASN C CB    1 
ATOM   6794  C  CG    . ASN G  1 122 ? 60.727  -76.743  6.092   1.00 21.04 ? 120 ASN C CG    1 
ATOM   6795  O  OD1   . ASN G  1 122 ? 59.842  -77.370  5.462   1.00 19.76 ? 120 ASN C OD1   1 
ATOM   6796  N  ND2   . ASN G  1 122 ? 60.766  -75.403  6.148   1.00 15.95 ? 120 ASN C ND2   1 
ATOM   6797  N  N     . ILE G  1 123 ? 63.769  -80.042  6.941   1.00 16.49 ? 121 ILE C N     1 
ATOM   6798  C  CA    . ILE G  1 123 ? 65.033  -80.402  7.559   1.00 20.48 ? 121 ILE C CA    1 
ATOM   6799  C  C     . ILE G  1 123 ? 66.040  -80.543  6.465   1.00 16.22 ? 121 ILE C C     1 
ATOM   6800  O  O     . ILE G  1 123 ? 65.736  -81.086  5.405   1.00 17.21 ? 121 ILE C O     1 
ATOM   6801  C  CB    . ILE G  1 123 ? 64.928  -81.720  8.342   1.00 19.77 ? 121 ILE C CB    1 
ATOM   6802  C  CG1   . ILE G  1 123 ? 66.327  -82.158  8.810   1.00 18.34 ? 121 ILE C CG1   1 
ATOM   6803  C  CG2   . ILE G  1 123 ? 64.263  -82.790  7.484   1.00 14.34 ? 121 ILE C CG2   1 
ATOM   6804  C  CD1   . ILE G  1 123 ? 66.234  -83.153  9.995   1.00 16.45 ? 121 ILE C CD1   1 
ATOM   6805  N  N     . ASN G  1 124 ? 67.236  -80.037  6.708   1.00 19.33 ? 122 ASN C N     1 
ATOM   6806  C  CA    . ASN G  1 124 ? 68.269  -80.057  5.687   1.00 19.92 ? 122 ASN C CA    1 
ATOM   6807  C  C     . ASN G  1 124 ? 67.839  -79.618  4.286   1.00 21.86 ? 122 ASN C C     1 
ATOM   6808  O  O     . ASN G  1 124 ? 68.308  -80.199  3.306   1.00 22.89 ? 122 ASN C O     1 
ATOM   6809  C  CB    . ASN G  1 124 ? 68.876  -81.464  5.586   1.00 21.15 ? 122 ASN C CB    1 
ATOM   6810  C  CG    . ASN G  1 124 ? 69.712  -81.808  6.776   1.00 23.70 ? 122 ASN C CG    1 
ATOM   6811  O  OD1   . ASN G  1 124 ? 70.058  -80.930  7.569   1.00 25.33 ? 122 ASN C OD1   1 
ATOM   6812  N  ND2   . ASN G  1 124 ? 70.071  -83.099  6.909   1.00 18.37 ? 122 ASN C ND2   1 
ATOM   6813  N  N     . GLY G  1 125 ? 66.958  -78.620  4.174   1.00 17.03 ? 123 GLY C N     1 
ATOM   6814  C  CA    . GLY G  1 125 ? 66.601  -78.111  2.856   1.00 22.56 ? 123 GLY C CA    1 
ATOM   6815  C  C     . GLY G  1 125 ? 65.527  -78.936  2.160   1.00 18.88 ? 123 GLY C C     1 
ATOM   6816  O  O     . GLY G  1 125 ? 65.145  -78.667  1.013   1.00 22.34 ? 123 GLY C O     1 
ATOM   6817  N  N     . LEU G  1 126 ? 65.009  -79.926  2.872   1.00 20.25 ? 124 LEU C N     1 
ATOM   6818  C  CA    . LEU G  1 126 ? 63.980  -80.817  2.341   1.00 17.40 ? 124 LEU C CA    1 
ATOM   6819  C  C     . LEU G  1 126 ? 62.602  -80.450  2.917   1.00 20.19 ? 124 LEU C C     1 
ATOM   6820  O  O     . LEU G  1 126 ? 62.515  -79.996  4.063   1.00 18.68 ? 124 LEU C O     1 
ATOM   6821  C  CB    . LEU G  1 126 ? 64.333  -82.267  2.714   1.00 18.49 ? 124 LEU C CB    1 
ATOM   6822  C  CG    . LEU G  1 126 ? 65.678  -82.817  2.240   1.00 20.18 ? 124 LEU C CG    1 
ATOM   6823  C  CD1   . LEU G  1 126 ? 65.947  -84.208  2.865   1.00 22.54 ? 124 LEU C CD1   1 
ATOM   6824  C  CD2   . LEU G  1 126 ? 65.732  -82.880  0.689   1.00 24.17 ? 124 LEU C CD2   1 
ATOM   6825  N  N     . ARG G  1 127 ? 61.528  -80.607  2.122   1.00 16.18 ? 125 ARG C N     1 
ATOM   6826  C  CA    . ARG G  1 127 ? 60.176  -80.427  2.650   1.00 16.67 ? 125 ARG C CA    1 
ATOM   6827  C  C     . ARG G  1 127 ? 59.559  -81.815  2.708   1.00 20.76 ? 125 ARG C C     1 
ATOM   6828  O  O     . ARG G  1 127 ? 59.531  -82.531  1.699   1.00 13.58 ? 125 ARG C O     1 
ATOM   6829  C  CB    . ARG G  1 127 ? 59.354  -79.439  1.784   1.00 12.46 ? 125 ARG C CB    1 
ATOM   6830  C  CG    . ARG G  1 127 ? 60.014  -77.996  1.749   1.00 18.17 ? 125 ARG C CG    1 
ATOM   6831  C  CD    . ARG G  1 127 ? 59.178  -76.976  0.958   1.00 16.69 ? 125 ARG C CD    1 
ATOM   6832  N  NE    . ARG G  1 127 ? 57.833  -76.804  1.525   1.00 18.77 ? 125 ARG C NE    1 
ATOM   6833  C  CZ    . ARG G  1 127 ? 56.721  -76.803  0.807   1.00 18.90 ? 125 ARG C CZ    1 
ATOM   6834  N  NH1   . ARG G  1 127 ? 56.811  -76.966  -0.503  1.00 17.37 ? 125 ARG C NH1   1 
ATOM   6835  N  NH2   . ARG G  1 127 ? 55.521  -76.665  1.400   1.00 21.07 ? 125 ARG C NH2   1 
ATOM   6836  N  N     . ILE G  1 128 ? 59.098  -82.222  3.892   1.00 13.58 ? 126 ILE C N     1 
ATOM   6837  C  CA    . ILE G  1 128 ? 58.637  -83.596  4.056   1.00 14.65 ? 126 ILE C CA    1 
ATOM   6838  C  C     . ILE G  1 128 ? 57.180  -83.615  4.506   1.00 15.74 ? 126 ILE C C     1 
ATOM   6839  O  O     . ILE G  1 128 ? 56.801  -83.018  5.520   1.00 13.05 ? 126 ILE C O     1 
ATOM   6840  C  CB    . ILE G  1 128 ? 59.549  -84.417  4.997   1.00 17.86 ? 126 ILE C CB    1 
ATOM   6841  C  CG1   . ILE G  1 128 ? 60.982  -84.417  4.447   1.00 10.73 ? 126 ILE C CG1   1 
ATOM   6842  C  CG2   . ILE G  1 128 ? 58.946  -85.845  5.195   1.00 12.74 ? 126 ILE C CG2   1 
ATOM   6843  C  CD1   . ILE G  1 128 ? 62.059  -85.270  5.250   1.00 12.22 ? 126 ILE C CD1   1 
ATOM   6844  N  N     . VAL G  1 129 ? 56.340  -84.269  3.710   1.00 9.79  ? 127 VAL C N     1 
ATOM   6845  C  CA    . VAL G  1 129 ? 54.942  -84.398  4.075   1.00 15.57 ? 127 VAL C CA    1 
ATOM   6846  C  C     . VAL G  1 129 ? 54.675  -85.772  4.688   1.00 14.70 ? 127 VAL C C     1 
ATOM   6847  O  O     . VAL G  1 129 ? 55.309  -86.758  4.297   1.00 14.50 ? 127 VAL C O     1 
ATOM   6848  C  CB    . VAL G  1 129 ? 54.050  -84.155  2.837   1.00 17.24 ? 127 VAL C CB    1 
ATOM   6849  C  CG1   . VAL G  1 129 ? 52.645  -84.738  3.030   1.00 14.68 ? 127 VAL C CG1   1 
ATOM   6850  C  CG2   . VAL G  1 129 ? 53.993  -82.652  2.546   1.00 10.69 ? 127 VAL C CG2   1 
ATOM   6851  N  N     . GLY G  1 130 ? 53.730  -85.819  5.628   1.00 15.47 ? 128 GLY C N     1 
ATOM   6852  C  CA    . GLY G  1 130 ? 53.302  -87.053  6.266   1.00 13.59 ? 128 GLY C CA    1 
ATOM   6853  C  C     . GLY G  1 130 ? 51.794  -87.197  6.319   1.00 14.47 ? 128 GLY C C     1 
ATOM   6854  O  O     . GLY G  1 130 ? 51.095  -86.230  6.670   1.00 14.31 ? 128 GLY C O     1 
ATOM   6855  N  N     . VAL G  1 131 ? 51.280  -88.388  5.971   1.00 13.97 ? 129 VAL C N     1 
ATOM   6856  C  CA    . VAL G  1 131 ? 49.830  -88.689  6.063   1.00 14.82 ? 129 VAL C CA    1 
ATOM   6857  C  C     . VAL G  1 131 ? 49.644  -89.937  6.940   1.00 14.82 ? 129 VAL C C     1 
ATOM   6858  O  O     . VAL G  1 131 ? 50.062  -91.039  6.553   1.00 15.41 ? 129 VAL C O     1 
ATOM   6859  C  CB    . VAL G  1 131 ? 49.208  -89.017  4.685   1.00 13.64 ? 129 VAL C CB    1 
ATOM   6860  C  CG1   . VAL G  1 131 ? 47.706  -89.094  4.808   1.00 14.90 ? 129 VAL C CG1   1 
ATOM   6861  C  CG2   . VAL G  1 131 ? 49.578  -87.946  3.676   1.00 19.12 ? 129 VAL C CG2   1 
ATOM   6862  N  N     . SER G  1 132 ? 49.095  -89.782  8.136   1.00 12.69 ? 130 SER C N     1 
ATOM   6863  C  CA    . SER G  1 132 ? 48.975  -90.949  9.027   1.00 12.04 ? 130 SER C CA    1 
ATOM   6864  C  C     . SER G  1 132 ? 47.748  -91.819  8.722   1.00 15.15 ? 130 SER C C     1 
ATOM   6865  O  O     . SER G  1 132 ? 46.721  -91.361  8.154   1.00 14.49 ? 130 SER C O     1 
ATOM   6866  C  CB    . SER G  1 132 ? 48.976  -90.545  10.501  1.00 14.32 ? 130 SER C CB    1 
ATOM   6867  O  OG    . SER G  1 132 ? 50.161  -89.849  10.824  1.00 14.71 ? 130 SER C OG    1 
ATOM   6868  N  N     . GLY G  1 133 ? 47.867  -93.086  9.129   1.00 14.19 ? 131 GLY C N     1 
ATOM   6869  C  CA    . GLY G  1 133 ? 46.744  -94.013  9.214   1.00 12.36 ? 131 GLY C CA    1 
ATOM   6870  C  C     . GLY G  1 133 ? 46.636  -94.910  7.990   1.00 14.99 ? 131 GLY C C     1 
ATOM   6871  O  O     . GLY G  1 133 ? 47.515  -94.931  7.119   1.00 13.04 ? 131 GLY C O     1 
ATOM   6872  N  N     . ILE G  1 134 ? 45.547  -95.671  7.949   1.00 12.31 ? 132 ILE C N     1 
ATOM   6873  C  CA    . ILE G  1 134 ? 45.185  -96.469  6.774   1.00 15.89 ? 132 ILE C CA    1 
ATOM   6874  C  C     . ILE G  1 134 ? 43.716  -96.208  6.494   1.00 15.56 ? 132 ILE C C     1 
ATOM   6875  O  O     . ILE G  1 134 ? 42.976  -95.746  7.370   1.00 16.36 ? 132 ILE C O     1 
ATOM   6876  C  CB    . ILE G  1 134 ? 45.358  -97.980  6.990   1.00 15.35 ? 132 ILE C CB    1 
ATOM   6877  C  CG1   . ILE G  1 134 ? 44.358  -98.522  7.998   1.00 15.69 ? 132 ILE C CG1   1 
ATOM   6878  C  CG2   . ILE G  1 134 ? 46.798  -98.309  7.381   1.00 14.78 ? 132 ILE C CG2   1 
ATOM   6879  C  CD1   . ILE G  1 134 ? 44.421  -100.043 8.105   1.00 18.82 ? 132 ILE C CD1   1 
ATOM   6880  N  N     . TYR G  1 135 ? 43.328  -96.544  5.269   1.00 19.05 ? 133 TYR C N     1 
ATOM   6881  C  CA    . TYR G  1 135 ? 42.055  -96.183  4.708   1.00 20.29 ? 133 TYR C CA    1 
ATOM   6882  C  C     . TYR G  1 135 ? 40.943  -97.167  5.072   1.00 24.04 ? 133 TYR C C     1 
ATOM   6883  O  O     . TYR G  1 135 ? 41.065  -98.386  4.853   1.00 24.19 ? 133 TYR C O     1 
ATOM   6884  C  CB    . TYR G  1 135 ? 42.189  -96.142  3.197   1.00 22.44 ? 133 TYR C CB    1 
ATOM   6885  C  CG    . TYR G  1 135 ? 40.905  -95.719  2.562   1.00 22.92 ? 133 TYR C CG    1 
ATOM   6886  C  CD1   . TYR G  1 135 ? 40.496  -94.401  2.631   1.00 21.72 ? 133 TYR C CD1   1 
ATOM   6887  C  CD2   . TYR G  1 135 ? 40.072  -96.648  1.936   1.00 21.60 ? 133 TYR C CD2   1 
ATOM   6888  C  CE1   . TYR G  1 135 ? 39.296  -93.998  2.079   1.00 21.75 ? 133 TYR C CE1   1 
ATOM   6889  C  CE2   . TYR G  1 135 ? 38.862  -96.258  1.375   1.00 22.47 ? 133 TYR C CE2   1 
ATOM   6890  C  CZ    . TYR G  1 135 ? 38.484  -94.940  1.445   1.00 24.64 ? 133 TYR C CZ    1 
ATOM   6891  O  OH    . TYR G  1 135 ? 37.307  -94.553  0.872   1.00 23.63 ? 133 TYR C OH    1 
ATOM   6892  N  N     . LYS G  1 136 ? 39.861  -96.648  5.629   1.00 18.95 ? 134 LYS C N     1 
ATOM   6893  C  CA    . LYS G  1 136 ? 38.630  -97.412  5.708   1.00 21.73 ? 134 LYS C CA    1 
ATOM   6894  C  C     . LYS G  1 136 ? 37.479  -96.484  5.339   1.00 26.55 ? 134 LYS C C     1 
ATOM   6895  O  O     . LYS G  1 136 ? 37.257  -95.438  5.987   1.00 24.76 ? 134 LYS C O     1 
ATOM   6896  C  CB    . LYS G  1 136 ? 38.416  -98.042  7.083   1.00 26.51 ? 134 LYS C CB    1 
ATOM   6897  C  CG    . LYS G  1 136 ? 39.047  -99.450  7.273   1.00 39.26 ? 134 LYS C CG    1 
ATOM   6898  C  CD    . LYS G  1 136 ? 38.602  -100.448 6.184   1.00 35.04 ? 134 LYS C CD    1 
ATOM   6899  C  CE    . LYS G  1 136 ? 39.370  -101.797 6.235   1.00 45.40 ? 134 LYS C CE    1 
ATOM   6900  N  NZ    . LYS G  1 136 ? 38.965  -102.665 5.069   1.00 43.14 ? 134 LYS C NZ    1 
ATOM   6901  N  N     . SER G  1 137 ? 36.753  -96.842  4.285   1.00 23.56 ? 135 SER C N     1 
ATOM   6902  C  CA    . SER G  1 137 ? 35.775  -95.918  3.739   1.00 23.81 ? 135 SER C CA    1 
ATOM   6903  C  C     . SER G  1 137 ? 34.726  -95.542  4.788   1.00 27.31 ? 135 SER C C     1 
ATOM   6904  O  O     . SER G  1 137 ? 34.290  -94.387  4.827   1.00 24.63 ? 135 SER C O     1 
ATOM   6905  C  CB    . SER G  1 137 ? 35.112  -96.503  2.488   1.00 27.20 ? 135 SER C CB    1 
ATOM   6906  O  OG    . SER G  1 137 ? 34.429  -97.665  2.868   1.00 34.53 ? 135 SER C OG    1 
ATOM   6907  N  N     . PHE G  1 138 ? 34.334  -96.494  5.645   1.00 22.99 ? 136 PHE C N     1 
ATOM   6908  C  CA    . PHE G  1 138 ? 33.261  -96.211  6.596   1.00 27.24 ? 136 PHE C CA    1 
ATOM   6909  C  C     . PHE G  1 138 ? 33.613  -95.142  7.648   1.00 26.84 ? 136 PHE C C     1 
ATOM   6910  O  O     . PHE G  1 138 ? 32.713  -94.504  8.215   1.00 23.24 ? 136 PHE C O     1 
ATOM   6911  C  CB    . PHE G  1 138 ? 32.707  -97.498  7.245   1.00 34.04 ? 136 PHE C CB    1 
ATOM   6912  C  CG    . PHE G  1 138 ? 33.740  -98.572  7.466   1.00 38.23 ? 136 PHE C CG    1 
ATOM   6913  C  CD1   . PHE G  1 138 ? 34.151  -99.404  6.409   1.00 38.90 ? 136 PHE C CD1   1 
ATOM   6914  C  CD2   . PHE G  1 138 ? 34.295  -98.768  8.737   1.00 41.77 ? 136 PHE C CD2   1 
ATOM   6915  C  CE1   . PHE G  1 138 ? 35.115  -100.413 6.617   1.00 46.17 ? 136 PHE C CE1   1 
ATOM   6916  C  CE2   . PHE G  1 138 ? 35.265  -99.785  8.968   1.00 44.01 ? 136 PHE C CE2   1 
ATOM   6917  C  CZ    . PHE G  1 138 ? 35.678  -100.604 7.908   1.00 40.25 ? 136 PHE C CZ    1 
ATOM   6918  N  N     . ASP G  1 139 ? 34.910  -94.928  7.876   1.00 23.15 ? 137 ASP C N     1 
ATOM   6919  C  CA    . ASP G  1 139 ? 35.393  -93.968  8.897   1.00 22.28 ? 137 ASP C CA    1 
ATOM   6920  C  C     . ASP G  1 139 ? 35.916  -92.639  8.335   1.00 22.03 ? 137 ASP C C     1 
ATOM   6921  O  O     . ASP G  1 139 ? 36.224  -91.704  9.084   1.00 23.11 ? 137 ASP C O     1 
ATOM   6922  C  CB    . ASP G  1 139 ? 36.421  -94.641  9.804   1.00 23.85 ? 137 ASP C CB    1 
ATOM   6923  C  CG    . ASP G  1 139 ? 35.766  -95.518  10.852  1.00 29.38 ? 137 ASP C CG    1 
ATOM   6924  O  OD1   . ASP G  1 139 ? 34.582  -95.277  11.116  1.00 25.42 ? 137 ASP C OD1   1 
ATOM   6925  O  OD2   . ASP G  1 139 ? 36.422  -96.437  11.404  1.00 30.91 ? 137 ASP C OD2   1 
ATOM   6926  N  N     . GLU G  1 140 ? 35.941  -92.561  7.010   1.00 19.35 ? 138 GLU C N     1 
ATOM   6927  C  CA    . GLU G  1 140 ? 36.502  -91.449  6.248   1.00 23.11 ? 138 GLU C CA    1 
ATOM   6928  C  C     . GLU G  1 140 ? 36.026  -90.045  6.631   1.00 22.96 ? 138 GLU C C     1 
ATOM   6929  O  O     . GLU G  1 140 ? 36.793  -89.043  6.536   1.00 19.02 ? 138 GLU C O     1 
ATOM   6930  C  CB    . GLU G  1 140 ? 36.176  -91.665  4.763   1.00 25.89 ? 138 GLU C CB    1 
ATOM   6931  C  CG    . GLU G  1 140 ? 37.245  -91.126  3.855   1.00 33.10 ? 138 GLU C CG    1 
ATOM   6932  C  CD    . GLU G  1 140 ? 36.963  -91.326  2.371   1.00 32.29 ? 138 GLU C CD    1 
ATOM   6933  O  OE1   . GLU G  1 140 ? 37.673  -90.672  1.590   1.00 28.73 ? 138 GLU C OE1   1 
ATOM   6934  O  OE2   . GLU G  1 140 ? 36.080  -92.138  1.996   1.00 27.13 ? 138 GLU C OE2   1 
ATOM   6935  N  N     . LYS G  1 141 ? 34.740  -89.959  6.975   1.00 25.24 ? 139 LYS C N     1 
ATOM   6936  C  CA    . LYS G  1 141 ? 34.093  -88.687  7.296   1.00 25.89 ? 139 LYS C CA    1 
ATOM   6937  C  C     . LYS G  1 141 ? 33.826  -88.525  8.780   1.00 22.03 ? 139 LYS C C     1 
ATOM   6938  O  O     . LYS G  1 141 ? 33.145  -87.599  9.193   1.00 26.97 ? 139 LYS C O     1 
ATOM   6939  C  CB    . LYS G  1 141 ? 32.755  -88.552  6.569   1.00 30.69 ? 139 LYS C CB    1 
ATOM   6940  C  CG    . LYS G  1 141 ? 32.839  -88.620  5.072   1.00 34.28 ? 139 LYS C CG    1 
ATOM   6941  C  CD    . LYS G  1 141 ? 31.933  -87.565  4.456   1.00 46.19 ? 139 LYS C CD    1 
ATOM   6942  C  CE    . LYS G  1 141 ? 32.182  -87.427  2.957   1.00 57.16 ? 139 LYS C CE    1 
ATOM   6943  N  NZ    . LYS G  1 141 ? 31.653  -88.596  2.195   1.00 53.65 ? 139 LYS C NZ    1 
ATOM   6944  N  N     . LYS G  1 142 ? 34.329  -89.444  9.577   1.00 21.68 ? 140 LYS C N     1 
ATOM   6945  C  CA    . LYS G  1 142 ? 34.143  -89.402  11.026  1.00 22.51 ? 140 LYS C CA    1 
ATOM   6946  C  C     . LYS G  1 142 ? 35.106  -88.389  11.679  1.00 32.04 ? 140 LYS C C     1 
ATOM   6947  O  O     . LYS G  1 142 ? 36.327  -88.334  11.351  1.00 21.94 ? 140 LYS C O     1 
ATOM   6948  C  CB    . LYS G  1 142 ? 34.397  -90.799  11.572  1.00 27.48 ? 140 LYS C CB    1 
ATOM   6949  C  CG    . LYS G  1 142 ? 33.931  -91.078  12.979  1.00 33.25 ? 140 LYS C CG    1 
ATOM   6950  C  CD    . LYS G  1 142 ? 34.282  -92.534  13.327  1.00 38.05 ? 140 LYS C CD    1 
ATOM   6951  C  CE    . LYS G  1 142 ? 34.436  -92.768  14.831  1.00 36.91 ? 140 LYS C CE    1 
ATOM   6952  N  NZ    . LYS G  1 142 ? 33.139  -92.681  15.595  1.00 51.31 ? 140 LYS C NZ    1 
ATOM   6953  N  N     . PRO G  1 143 ? 34.568  -87.550  12.594  1.00 29.55 ? 141 PRO C N     1 
ATOM   6954  C  CA    . PRO G  1 143 ? 35.453  -86.620  13.312  1.00 24.25 ? 141 PRO C CA    1 
ATOM   6955  C  C     . PRO G  1 143 ? 36.316  -87.412  14.297  1.00 19.65 ? 141 PRO C C     1 
ATOM   6956  O  O     . PRO G  1 143 ? 36.134  -88.642  14.487  1.00 18.96 ? 141 PRO C O     1 
ATOM   6957  C  CB    . PRO G  1 143 ? 34.459  -85.712  14.067  1.00 22.84 ? 141 PRO C CB    1 
ATOM   6958  C  CG    . PRO G  1 143 ? 33.242  -86.638  14.326  1.00 27.25 ? 141 PRO C CG    1 
ATOM   6959  C  CD    . PRO G  1 143 ? 33.167  -87.488  13.063  1.00 24.44 ? 141 PRO C CD    1 
ATOM   6960  N  N     . TYR G  1 144 ? 37.265  -86.730  14.916  1.00 23.95 ? 142 TYR C N     1 
ATOM   6961  C  CA    . TYR G  1 144 ? 37.968  -87.301  16.048  1.00 22.01 ? 142 TYR C CA    1 
ATOM   6962  C  C     . TYR G  1 144 ? 37.210  -86.814  17.263  1.00 22.91 ? 142 TYR C C     1 
ATOM   6963  O  O     . TYR G  1 144 ? 36.822  -85.646  17.331  1.00 24.92 ? 142 TYR C O     1 
ATOM   6964  C  CB    . TYR G  1 144 ? 39.429  -86.829  16.116  1.00 21.50 ? 142 TYR C CB    1 
ATOM   6965  C  CG    . TYR G  1 144 ? 40.316  -87.356  14.999  1.00 19.06 ? 142 TYR C CG    1 
ATOM   6966  C  CD1   . TYR G  1 144 ? 40.693  -88.701  14.960  1.00 18.20 ? 142 TYR C CD1   1 
ATOM   6967  C  CD2   . TYR G  1 144 ? 40.818  -86.507  14.019  1.00 14.91 ? 142 TYR C CD2   1 
ATOM   6968  C  CE1   . TYR G  1 144 ? 41.500  -89.195  13.949  1.00 13.64 ? 142 TYR C CE1   1 
ATOM   6969  C  CE2   . TYR G  1 144 ? 41.600  -86.992  13.002  1.00 17.74 ? 142 TYR C CE2   1 
ATOM   6970  C  CZ    . TYR G  1 144 ? 41.942  -88.351  12.975  1.00 14.32 ? 142 TYR C CZ    1 
ATOM   6971  O  OH    . TYR G  1 144 ? 42.780  -88.829  11.977  1.00 17.69 ? 142 TYR C OH    1 
ATOM   6972  N  N     . THR G  1 145 ? 36.975  -87.696  18.220  1.00 25.24 ? 143 THR C N     1 
ATOM   6973  C  CA    . THR G  1 145 ? 36.369  -87.236  19.459  1.00 24.62 ? 143 THR C CA    1 
ATOM   6974  C  C     . THR G  1 145 ? 37.455  -87.216  20.550  1.00 28.02 ? 143 THR C C     1 
ATOM   6975  O  O     . THR G  1 145 ? 38.298  -88.142  20.634  1.00 21.41 ? 143 THR C O     1 
ATOM   6976  C  CB    . THR G  1 145 ? 35.063  -87.993  19.804  1.00 28.92 ? 143 THR C CB    1 
ATOM   6977  O  OG1   . THR G  1 145 ? 35.307  -89.393  19.818  1.00 33.38 ? 143 THR C OG1   1 
ATOM   6978  C  CG2   . THR G  1 145 ? 34.020  -87.704  18.734  1.00 24.30 ? 143 THR C CG2   1 
ATOM   6979  N  N     . TYR G  1 146 ? 37.491  -86.117  21.307  1.00 21.86 ? 144 TYR C N     1 
ATOM   6980  C  CA    . TYR G  1 146 ? 38.539  -85.915  22.319  1.00 25.34 ? 144 TYR C CA    1 
ATOM   6981  C  C     . TYR G  1 146 ? 37.894  -85.586  23.674  1.00 21.80 ? 144 TYR C C     1 
ATOM   6982  O  O     . TYR G  1 146 ? 36.933  -84.837  23.732  1.00 20.60 ? 144 TYR C O     1 
ATOM   6983  C  CB    . TYR G  1 146 ? 39.481  -84.758  21.892  1.00 18.42 ? 144 TYR C CB    1 
ATOM   6984  C  CG    . TYR G  1 146 ? 40.727  -84.665  22.695  1.00 22.01 ? 144 TYR C CG    1 
ATOM   6985  C  CD1   . TYR G  1 146 ? 40.769  -83.901  23.854  1.00 20.48 ? 144 TYR C CD1   1 
ATOM   6986  C  CD2   . TYR G  1 146 ? 41.891  -85.315  22.288  1.00 18.72 ? 144 TYR C CD2   1 
ATOM   6987  C  CE1   . TYR G  1 146 ? 41.920  -83.814  24.609  1.00 21.44 ? 144 TYR C CE1   1 
ATOM   6988  C  CE2   . TYR G  1 146 ? 43.060  -85.238  23.048  1.00 19.58 ? 144 TYR C CE2   1 
ATOM   6989  C  CZ    . TYR G  1 146 ? 43.061  -84.484  24.202  1.00 16.99 ? 144 TYR C CZ    1 
ATOM   6990  O  OH    . TYR G  1 146 ? 44.204  -84.393  24.951  1.00 19.26 ? 144 TYR C OH    1 
ATOM   6991  N  N     . PRO G  1 147 ? 38.461  -86.090  24.771  1.00 24.07 ? 145 PRO C N     1 
ATOM   6992  C  CA    . PRO G  1 147 ? 39.685  -86.907  24.855  1.00 21.94 ? 145 PRO C CA    1 
ATOM   6993  C  C     . PRO G  1 147 ? 39.427  -88.346  24.377  1.00 27.43 ? 145 PRO C C     1 
ATOM   6994  O  O     . PRO G  1 147 ? 38.264  -88.739  24.186  1.00 23.76 ? 145 PRO C O     1 
ATOM   6995  C  CB    . PRO G  1 147 ? 39.977  -86.921  26.353  1.00 23.01 ? 145 PRO C CB    1 
ATOM   6996  C  CG    . PRO G  1 147 ? 38.591  -86.855  26.992  1.00 28.47 ? 145 PRO C CG    1 
ATOM   6997  C  CD    . PRO G  1 147 ? 37.783  -85.955  26.077  1.00 24.51 ? 145 PRO C CD    1 
ATOM   6998  N  N     . PRO G  1 148 ? 40.497  -89.138  24.192  1.00 25.36 ? 146 PRO C N     1 
ATOM   6999  C  CA    . PRO G  1 148 ? 40.234  -90.500  23.678  1.00 28.02 ? 146 PRO C CA    1 
ATOM   7000  C  C     . PRO G  1 148 ? 39.486  -91.427  24.654  1.00 26.46 ? 146 PRO C C     1 
ATOM   7001  O  O     . PRO G  1 148 ? 39.597  -91.258  25.874  1.00 22.11 ? 146 PRO C O     1 
ATOM   7002  C  CB    . PRO G  1 148 ? 41.645  -91.054  23.402  1.00 27.21 ? 146 PRO C CB    1 
ATOM   7003  C  CG    . PRO G  1 148 ? 42.625  -90.142  24.211  1.00 23.53 ? 146 PRO C CG    1 
ATOM   7004  C  CD    . PRO G  1 148 ? 41.940  -88.809  24.300  1.00 23.41 ? 146 PRO C CD    1 
ATOM   7005  N  N     . SER G  1 149 ? 38.768  -92.416  24.109  1.00 26.70 ? 147 SER C N     1 
ATOM   7006  C  CA    . SER G  1 149 ? 38.037  -93.421  24.889  1.00 27.75 ? 147 SER C CA    1 
ATOM   7007  C  C     . SER G  1 149 ? 38.360  -94.731  24.255  1.00 29.56 ? 147 SER C C     1 
ATOM   7008  O  O     . SER G  1 149 ? 38.509  -94.785  23.049  1.00 26.01 ? 147 SER C O     1 
ATOM   7009  C  CB    . SER G  1 149 ? 36.525  -93.262  24.747  1.00 33.74 ? 147 SER C CB    1 
ATOM   7010  O  OG    . SER G  1 149 ? 36.234  -92.095  24.023  1.00 37.90 ? 147 SER C OG    1 
ATOM   7011  N  N     . PRO G  1 150 ? 38.419  -95.797  25.062  1.00 28.39 ? 148 PRO C N     1 
ATOM   7012  C  CA    . PRO G  1 150 ? 38.779  -97.151  24.619  1.00 24.46 ? 148 PRO C CA    1 
ATOM   7013  C  C     . PRO G  1 150 ? 37.905  -97.617  23.484  1.00 29.06 ? 148 PRO C C     1 
ATOM   7014  O  O     . PRO G  1 150 ? 38.404  -98.351  22.657  1.00 26.55 ? 148 PRO C O     1 
ATOM   7015  C  CB    . PRO G  1 150 ? 38.488  -98.024  25.844  1.00 29.84 ? 148 PRO C CB    1 
ATOM   7016  C  CG    . PRO G  1 150 ? 38.526  -97.094  27.010  1.00 28.70 ? 148 PRO C CG    1 
ATOM   7017  C  CD    . PRO G  1 150 ? 38.031  -95.758  26.484  1.00 35.29 ? 148 PRO C CD    1 
ATOM   7018  N  N     . ASN G  1 151 ? 36.631  -97.226  23.440  1.00 24.30 ? 149 ASN C N     1 
ATOM   7019  C  CA    . ASN G  1 151 ? 35.788  -97.637  22.319  1.00 30.11 ? 149 ASN C CA    1 
ATOM   7020  C  C     . ASN G  1 151 ? 36.301  -97.168  20.958  1.00 28.99 ? 149 ASN C C     1 
ATOM   7021  O  O     . ASN G  1 151 ? 35.951  -97.732  19.925  1.00 30.95 ? 149 ASN C O     1 
ATOM   7022  C  CB    . ASN G  1 151 ? 34.352  -97.160  22.516  1.00 34.93 ? 149 ASN C CB    1 
ATOM   7023  C  CG    . ASN G  1 151 ? 33.655  -97.899  23.635  1.00 48.58 ? 149 ASN C CG    1 
ATOM   7024  O  OD1   . ASN G  1 151 ? 33.918  -99.087  23.882  1.00 49.49 ? 149 ASN C OD1   1 
ATOM   7025  N  ND2   . ASN G  1 151 ? 32.773  -97.202  24.332  1.00 50.78 ? 149 ASN C ND2   1 
ATOM   7026  N  N     . ASP G  1 152 ? 37.123  -96.128  20.936  1.00 29.76 ? 150 ASP C N     1 
ATOM   7027  C  CA    . ASP G  1 152 ? 37.623  -95.664  19.641  1.00 24.76 ? 150 ASP C CA    1 
ATOM   7028  C  C     . ASP G  1 152 ? 38.896  -96.401  19.172  1.00 19.84 ? 150 ASP C C     1 
ATOM   7029  O  O     . ASP G  1 152 ? 39.492  -96.039  18.140  1.00 21.10 ? 150 ASP C O     1 
ATOM   7030  C  CB    . ASP G  1 152 ? 37.732  -94.143  19.655  1.00 25.26 ? 150 ASP C CB    1 
ATOM   7031  C  CG    . ASP G  1 152 ? 36.353  -93.458  19.889  1.00 36.62 ? 150 ASP C CG    1 
ATOM   7032  O  OD1   . ASP G  1 152 ? 35.362  -93.858  19.227  1.00 39.59 ? 150 ASP C OD1   1 
ATOM   7033  O  OD2   . ASP G  1 152 ? 36.267  -92.550  20.746  1.00 34.75 ? 150 ASP C OD2   1 
ATOM   7034  N  N     . VAL G  1 153 ? 39.282  -97.469  19.901  1.00 21.49 ? 151 VAL C N     1 
ATOM   7035  C  CA    . VAL G  1 153 ? 40.450  -98.270  19.527  1.00 22.45 ? 151 VAL C CA    1 
ATOM   7036  C  C     . VAL G  1 153 ? 40.397  -98.591  18.042  1.00 25.55 ? 151 VAL C C     1 
ATOM   7037  O  O     . VAL G  1 153 ? 41.429  -98.614  17.346  1.00 21.68 ? 151 VAL C O     1 
ATOM   7038  C  CB    . VAL G  1 153 ? 40.500  -99.642  20.243  1.00 27.85 ? 151 VAL C CB    1 
ATOM   7039  C  CG1   . VAL G  1 153 ? 39.313  -100.511 19.860  1.00 23.47 ? 151 VAL C CG1   1 
ATOM   7040  C  CG2   . VAL G  1 153 ? 41.838  -100.365 19.939  1.00 23.17 ? 151 VAL C CG2   1 
ATOM   7041  N  N     . VAL G  1 154 ? 39.184  -98.885  17.585  1.00 21.78 ? 152 VAL C N     1 
ATOM   7042  C  CA    . VAL G  1 154 ? 39.002  -99.473  16.254  1.00 20.28 ? 152 VAL C CA    1 
ATOM   7043  C  C     . VAL G  1 154 ? 38.903  -98.455  15.143  1.00 19.17 ? 152 VAL C C     1 
ATOM   7044  O  O     . VAL G  1 154 ? 39.003  -98.840  13.986  1.00 17.41 ? 152 VAL C O     1 
ATOM   7045  C  CB    . VAL G  1 154 ? 37.766  -100.390 16.142  1.00 25.56 ? 152 VAL C CB    1 
ATOM   7046  C  CG1   . VAL G  1 154 ? 37.780  -101.460 17.211  1.00 24.96 ? 152 VAL C CG1   1 
ATOM   7047  C  CG2   . VAL G  1 154 ? 36.473  -99.561  16.245  1.00 22.68 ? 152 VAL C CG2   1 
ATOM   7048  N  N     . SER G  1 155 ? 38.699  -97.172  15.462  1.00 18.84 ? 153 SER C N     1 
ATOM   7049  C  CA    . SER G  1 155 ? 38.591  -96.167  14.407  1.00 18.40 ? 153 SER C CA    1 
ATOM   7050  C  C     . SER G  1 155 ? 39.684  -95.060  14.400  1.00 14.83 ? 153 SER C C     1 
ATOM   7051  O  O     . SER G  1 155 ? 39.872  -94.364  13.385  1.00 15.59 ? 153 SER C O     1 
ATOM   7052  C  CB    . SER G  1 155 ? 37.218  -95.489  14.490  1.00 18.94 ? 153 SER C CB    1 
ATOM   7053  O  OG    . SER G  1 155 ? 37.076  -94.894  15.756  1.00 18.75 ? 153 SER C OG    1 
ATOM   7054  N  N     . LEU G  1 156 ? 40.343  -94.849  15.529  1.00 14.45 ? 154 LEU C N     1 
ATOM   7055  C  CA    . LEU G  1 156 ? 41.265  -93.694  15.617  1.00 14.42 ? 154 LEU C CA    1 
ATOM   7056  C  C     . LEU G  1 156 ? 42.295  -93.672  14.491  1.00 16.45 ? 154 LEU C C     1 
ATOM   7057  O  O     . LEU G  1 156 ? 42.653  -92.607  13.971  1.00 18.11 ? 154 LEU C O     1 
ATOM   7058  C  CB    . LEU G  1 156 ? 41.952  -93.666  16.963  1.00 11.42 ? 154 LEU C CB    1 
ATOM   7059  C  CG    . LEU G  1 156 ? 41.140  -93.025  18.073  1.00 17.01 ? 154 LEU C CG    1 
ATOM   7060  C  CD1   . LEU G  1 156 ? 41.729  -93.391  19.462  1.00 17.49 ? 154 LEU C CD1   1 
ATOM   7061  C  CD2   . LEU G  1 156 ? 41.089  -91.486  17.859  1.00 18.06 ? 154 LEU C CD2   1 
ATOM   7062  N  N     . PHE G  1 157 ? 42.788  -94.847  14.112  1.00 13.91 ? 155 PHE C N     1 
ATOM   7063  C  CA    . PHE G  1 157 ? 43.854  -94.919  13.119  1.00 14.28 ? 155 PHE C CA    1 
ATOM   7064  C  C     . PHE G  1 157 ? 43.398  -94.890  11.648  1.00 17.91 ? 155 PHE C C     1 
ATOM   7065  O  O     . PHE G  1 157 ? 44.185  -95.085  10.754  1.00 15.51 ? 155 PHE C O     1 
ATOM   7066  C  CB    . PHE G  1 157 ? 44.729  -96.157  13.366  1.00 12.27 ? 155 PHE C CB    1 
ATOM   7067  C  CG    . PHE G  1 157 ? 43.967  -97.458  13.240  1.00 19.27 ? 155 PHE C CG    1 
ATOM   7068  C  CD1   . PHE G  1 157 ? 43.329  -98.003  14.344  1.00 15.95 ? 155 PHE C CD1   1 
ATOM   7069  C  CD2   . PHE G  1 157 ? 43.883  -98.131  11.998  1.00 18.20 ? 155 PHE C CD2   1 
ATOM   7070  C  CE1   . PHE G  1 157 ? 42.614  -99.206  14.237  1.00 20.04 ? 155 PHE C CE1   1 
ATOM   7071  C  CE2   . PHE G  1 157 ? 43.177  -99.351  11.883  1.00 19.70 ? 155 PHE C CE2   1 
ATOM   7072  C  CZ    . PHE G  1 157 ? 42.539  -99.883  12.999  1.00 25.19 ? 155 PHE C CZ    1 
ATOM   7073  N  N     . HIS G  1 158 ? 42.136  -94.607  11.388  1.00 17.13 ? 156 HIS C N     1 
ATOM   7074  C  CA    . HIS G  1 158 ? 41.673  -94.520  10.003  1.00 18.77 ? 156 HIS C CA    1 
ATOM   7075  C  C     . HIS G  1 158 ? 41.827  -93.128  9.424   1.00 18.35 ? 156 HIS C C     1 
ATOM   7076  O  O     . HIS G  1 158 ? 41.324  -92.151  10.021  1.00 17.41 ? 156 HIS C O     1 
ATOM   7077  C  CB    . HIS G  1 158 ? 40.216  -94.952  9.937   1.00 12.22 ? 156 HIS C CB    1 
ATOM   7078  C  CG    . HIS G  1 158 ? 40.024  -96.388  10.246  1.00 19.62 ? 156 HIS C CG    1 
ATOM   7079  N  ND1   . HIS G  1 158 ? 38.844  -96.927  10.746  1.00 19.26 ? 156 HIS C ND1   1 
ATOM   7080  C  CD2   . HIS G  1 158 ? 40.890  -97.448  10.152  1.00 16.35 ? 156 HIS C CD2   1 
ATOM   7081  C  CE1   . HIS G  1 158 ? 38.983  -98.218  10.924  1.00 19.55 ? 156 HIS C CE1   1 
ATOM   7082  N  NE2   . HIS G  1 158 ? 40.217  -98.568  10.577  1.00 18.21 ? 156 HIS C NE2   1 
ATOM   7083  N  N     . THR G  1 159 ? 42.522  -93.038  8.275   1.00 12.97 ? 157 THR C N     1 
ATOM   7084  C  CA    . THR G  1 159 ? 42.827  -91.737  7.632   1.00 15.16 ? 157 THR C CA    1 
ATOM   7085  C  C     . THR G  1 159 ? 41.511  -91.056  7.257   1.00 22.78 ? 157 THR C C     1 
ATOM   7086  O  O     . THR G  1 159 ? 40.631  -91.667  6.621   1.00 16.50 ? 157 THR C O     1 
ATOM   7087  C  CB    . THR G  1 159 ? 43.632  -91.932  6.371   1.00 18.30 ? 157 THR C CB    1 
ATOM   7088  O  OG1   . THR G  1 159 ? 44.726  -92.806  6.680   1.00 15.97 ? 157 THR C OG1   1 
ATOM   7089  C  CG2   . THR G  1 159 ? 44.146  -90.572  5.758   1.00 13.15 ? 157 THR C CG2   1 
ATOM   7090  N  N     . ARG G  1 160 ? 41.408  -89.778  7.625   1.00 16.55 ? 158 ARG C N     1 
ATOM   7091  C  CA    . ARG G  1 160 ? 40.234  -88.963  7.302   1.00 19.36 ? 158 ARG C CA    1 
ATOM   7092  C  C     . ARG G  1 160 ? 40.414  -88.263  5.962   1.00 15.57 ? 158 ARG C C     1 
ATOM   7093  O  O     . ARG G  1 160 ? 41.512  -87.818  5.597   1.00 15.17 ? 158 ARG C O     1 
ATOM   7094  C  CB    . ARG G  1 160 ? 39.989  -87.917  8.398   1.00 11.87 ? 158 ARG C CB    1 
ATOM   7095  C  CG    . ARG G  1 160 ? 38.999  -88.328  9.480   1.00 17.72 ? 158 ARG C CG    1 
ATOM   7096  C  CD    . ARG G  1 160 ? 39.204  -89.700  10.123  1.00 19.30 ? 158 ARG C CD    1 
ATOM   7097  N  NE    . ARG G  1 160 ? 38.460  -89.786  11.383  1.00 13.60 ? 158 ARG C NE    1 
ATOM   7098  C  CZ    . ARG G  1 160 ? 38.629  -90.701  12.330  1.00 18.47 ? 158 ARG C CZ    1 
ATOM   7099  N  NH1   . ARG G  1 160 ? 39.537  -91.668  12.174  1.00 19.93 ? 158 ARG C NH1   1 
ATOM   7100  N  NH2   . ARG G  1 160 ? 37.884  -90.653  13.434  1.00 19.06 ? 158 ARG C NH2   1 
ATOM   7101  N  N     . ASN G  1 161 ? 39.318  -88.172  5.234   1.00 17.94 ? 159 ASN C N     1 
ATOM   7102  C  CA    . ASN G  1 161 ? 39.278  -87.509  3.937   1.00 18.12 ? 159 ASN C CA    1 
ATOM   7103  C  C     . ASN G  1 161 ? 39.788  -86.042  3.963   1.00 17.31 ? 159 ASN C C     1 
ATOM   7104  O  O     . ASN G  1 161 ? 40.420  -85.575  3.005   1.00 15.76 ? 159 ASN C O     1 
ATOM   7105  C  CB    . ASN G  1 161 ? 37.835  -87.618  3.403   1.00 21.85 ? 159 ASN C CB    1 
ATOM   7106  C  CG    . ASN G  1 161 ? 37.723  -87.179  1.974   1.00 30.96 ? 159 ASN C CG    1 
ATOM   7107  O  OD1   . ASN G  1 161 ? 37.384  -86.033  1.712   1.00 29.24 ? 159 ASN C OD1   1 
ATOM   7108  N  ND2   . ASN G  1 161 ? 38.042  -88.085  1.025   1.00 24.46 ? 159 ASN C ND2   1 
ATOM   7109  N  N     . TYR G  1 162 ? 39.529  -85.324  5.062   1.00 18.64 ? 160 TYR C N     1 
ATOM   7110  C  CA    . TYR G  1 162 ? 39.882  -83.879  5.141   1.00 24.99 ? 160 TYR C CA    1 
ATOM   7111  C  C     . TYR G  1 162 ? 41.369  -83.578  4.995   1.00 19.98 ? 160 TYR C C     1 
ATOM   7112  O  O     . TYR G  1 162 ? 41.756  -82.459  4.631   1.00 19.57 ? 160 TYR C O     1 
ATOM   7113  C  CB    . TYR G  1 162 ? 39.343  -83.221  6.434   1.00 18.58 ? 160 TYR C CB    1 
ATOM   7114  C  CG    . TYR G  1 162 ? 40.187  -83.430  7.693   1.00 16.44 ? 160 TYR C CG    1 
ATOM   7115  C  CD1   . TYR G  1 162 ? 41.295  -82.605  7.980   1.00 17.94 ? 160 TYR C CD1   1 
ATOM   7116  C  CD2   . TYR G  1 162 ? 39.858  -84.416  8.613   1.00 19.59 ? 160 TYR C CD2   1 
ATOM   7117  C  CE1   . TYR G  1 162 ? 42.044  -82.775  9.141   1.00 17.05 ? 160 TYR C CE1   1 
ATOM   7118  C  CE2   . TYR G  1 162 ? 40.594  -84.584  9.792   1.00 24.57 ? 160 TYR C CE2   1 
ATOM   7119  C  CZ    . TYR G  1 162 ? 41.692  -83.763  10.045  1.00 18.13 ? 160 TYR C CZ    1 
ATOM   7120  O  OH    . TYR G  1 162 ? 42.420  -83.952  11.207  1.00 17.83 ? 160 TYR C OH    1 
ATOM   7121  N  N     . VAL G  1 163 ? 42.219  -84.562  5.288   1.00 23.31 ? 161 VAL C N     1 
ATOM   7122  C  CA    . VAL G  1 163 ? 43.648  -84.355  5.148   1.00 13.16 ? 161 VAL C CA    1 
ATOM   7123  C  C     . VAL G  1 163 ? 43.975  -83.997  3.723   1.00 15.61 ? 161 VAL C C     1 
ATOM   7124  O  O     . VAL G  1 163 ? 44.954  -83.299  3.474   1.00 16.23 ? 161 VAL C O     1 
ATOM   7125  C  CB    . VAL G  1 163 ? 44.487  -85.593  5.620   1.00 13.28 ? 161 VAL C CB    1 
ATOM   7126  C  CG1   . VAL G  1 163 ? 44.126  -86.020  7.043   1.00 16.16 ? 161 VAL C CG1   1 
ATOM   7127  C  CG2   . VAL G  1 163 ? 44.323  -86.769  4.647   1.00 13.62 ? 161 VAL C CG2   1 
ATOM   7128  N  N     . ILE G  1 164 ? 43.174  -84.441  2.753   1.00 15.91 ? 162 ILE C N     1 
ATOM   7129  C  CA    . ILE G  1 164 ? 43.495  -84.039  1.388   1.00 14.78 ? 162 ILE C CA    1 
ATOM   7130  C  C     . ILE G  1 164 ? 43.453  -82.505  1.256   1.00 18.99 ? 162 ILE C C     1 
ATOM   7131  O  O     . ILE G  1 164 ? 44.341  -81.907  0.639   1.00 17.96 ? 162 ILE C O     1 
ATOM   7132  C  CB    . ILE G  1 164 ? 42.537  -84.625  0.338   1.00 20.53 ? 162 ILE C CB    1 
ATOM   7133  C  CG1   . ILE G  1 164 ? 42.688  -86.149  0.220   1.00 15.43 ? 162 ILE C CG1   1 
ATOM   7134  C  CG2   . ILE G  1 164 ? 42.769  -83.948  -1.051  1.00 16.42 ? 162 ILE C CG2   1 
ATOM   7135  C  CD1   . ILE G  1 164 ? 41.407  -86.822  -0.409  1.00 22.73 ? 162 ILE C CD1   1 
ATOM   7136  N  N     . GLN G  1 165 ? 42.411  -81.867  1.790   1.00 17.49 ? 163 GLN C N     1 
ATOM   7137  C  CA    . GLN G  1 165 ? 42.329  -80.373  1.747   1.00 24.24 ? 163 GLN C CA    1 
ATOM   7138  C  C     . GLN G  1 165 ? 43.467  -79.648  2.536   1.00 20.23 ? 163 GLN C C     1 
ATOM   7139  O  O     . GLN G  1 165 ? 43.961  -78.567  2.114   1.00 16.85 ? 163 GLN C O     1 
ATOM   7140  C  CB    . GLN G  1 165 ? 40.951  -79.864  2.222   1.00 26.69 ? 163 GLN C CB    1 
ATOM   7141  C  CG    . GLN G  1 165 ? 39.752  -80.024  1.236   1.00 28.51 ? 163 GLN C CG    1 
ATOM   7142  C  CD    . GLN G  1 165 ? 38.911  -81.246  1.567   1.00 31.46 ? 163 GLN C CD    1 
ATOM   7143  O  OE1   . GLN G  1 165 ? 39.386  -82.383  1.442   1.00 41.59 ? 163 GLN C OE1   1 
ATOM   7144  N  NE2   . GLN G  1 165 ? 37.679  -81.028  2.031   1.00 28.84 ? 163 GLN C NE2   1 
ATOM   7145  N  N     . MET G  1 166 ? 43.857  -80.225  3.680   1.00 18.90 ? 164 MET C N     1 
ATOM   7146  C  CA    . MET G  1 166 ? 44.922  -79.640  4.522   1.00 23.47 ? 164 MET C CA    1 
ATOM   7147  C  C     . MET G  1 166 ? 46.254  -79.640  3.814   1.00 14.25 ? 164 MET C C     1 
ATOM   7148  O  O     . MET G  1 166 ? 47.097  -78.749  4.032   1.00 16.65 ? 164 MET C O     1 
ATOM   7149  C  CB    . MET G  1 166 ? 45.107  -80.428  5.818   1.00 18.85 ? 164 MET C CB    1 
ATOM   7150  C  CG    . MET G  1 166 ? 43.848  -80.526  6.669   1.00 14.99 ? 164 MET C CG    1 
ATOM   7151  S  SD    . MET G  1 166 ? 43.413  -78.930  7.411   1.00 20.80 ? 164 MET C SD    1 
ATOM   7152  C  CE    . MET G  1 166 ? 44.922  -78.475  8.319   1.00 19.58 ? 164 MET C CE    1 
ATOM   7153  N  N     . LEU G  1 167 ? 46.466  -80.652  2.963   1.00 12.83 ? 165 LEU C N     1 
ATOM   7154  C  CA    . LEU G  1 167 ? 47.762  -80.806  2.331   1.00 17.20 ? 165 LEU C CA    1 
ATOM   7155  C  C     . LEU G  1 167 ? 47.799  -80.334  0.894   1.00 21.50 ? 165 LEU C C     1 
ATOM   7156  O  O     . LEU G  1 167 ? 48.875  -80.199  0.358   1.00 14.04 ? 165 LEU C O     1 
ATOM   7157  C  CB    . LEU G  1 167 ? 48.217  -82.273  2.373   1.00 15.77 ? 165 LEU C CB    1 
ATOM   7158  C  CG    . LEU G  1 167 ? 48.383  -82.812  3.783   1.00 16.53 ? 165 LEU C CG    1 
ATOM   7159  C  CD1   . LEU G  1 167 ? 48.632  -84.340  3.722   1.00 11.47 ? 165 LEU C CD1   1 
ATOM   7160  C  CD2   . LEU G  1 167 ? 49.542  -82.105  4.436   1.00 14.00 ? 165 LEU C CD2   1 
ATOM   7161  N  N     . SER G  1 168 ? 46.648  -80.147  0.239   1.00 15.75 ? 166 SER C N     1 
ATOM   7162  C  CA    . SER G  1 168 ? 46.702  -80.032  -1.229  1.00 23.10 ? 166 SER C CA    1 
ATOM   7163  C  C     . SER G  1 168 ? 47.464  -78.828  -1.812  1.00 17.49 ? 166 SER C C     1 
ATOM   7164  O  O     . SER G  1 168 ? 47.944  -78.923  -2.950  1.00 20.46 ? 166 SER C O     1 
ATOM   7165  C  CB    . SER G  1 168 ? 45.298  -80.091  -1.851  1.00 26.32 ? 166 SER C CB    1 
ATOM   7166  O  OG    . SER G  1 168 ? 44.605  -78.891  -1.599  1.00 33.29 ? 166 SER C OG    1 
ATOM   7167  N  N     . ASN G  1 169 ? 47.594  -77.714  -1.076  1.00 20.60 ? 167 ASN C N     1 
ATOM   7168  C  CA    . ASN G  1 169 ? 48.292  -76.527  -1.649  1.00 19.91 ? 167 ASN C CA    1 
ATOM   7169  C  C     . ASN G  1 169 ? 49.824  -76.529  -1.441  1.00 27.59 ? 167 ASN C C     1 
ATOM   7170  O  O     . ASN G  1 169 ? 50.546  -75.644  -1.969  1.00 19.83 ? 167 ASN C O     1 
ATOM   7171  C  CB    . ASN G  1 169 ? 47.685  -75.208  -1.138  1.00 18.58 ? 167 ASN C CB    1 
ATOM   7172  C  CG    . ASN G  1 169 ? 47.803  -75.041  0.388   1.00 21.96 ? 167 ASN C CG    1 
ATOM   7173  O  OD1   . ASN G  1 169 ? 48.611  -75.689  1.032   1.00 20.56 ? 167 ASN C OD1   1 
ATOM   7174  N  ND2   . ASN G  1 169 ? 46.964  -74.183  0.962   1.00 19.83 ? 167 ASN C ND2   1 
ATOM   7175  N  N     . LEU G  1 170 ? 50.318  -77.525  -0.691  1.00 19.25 ? 168 LEU C N     1 
ATOM   7176  C  CA    . LEU G  1 170 ? 51.708  -77.503  -0.184  1.00 19.15 ? 168 LEU C CA    1 
ATOM   7177  C  C     . LEU G  1 170 ? 52.864  -77.591  -1.201  1.00 22.10 ? 168 LEU C C     1 
ATOM   7178  O  O     . LEU G  1 170 ? 54.042  -77.357  -0.831  1.00 22.75 ? 168 LEU C O     1 
ATOM   7179  C  CB    . LEU G  1 170 ? 51.913  -78.545  0.941   1.00 15.00 ? 168 LEU C CB    1 
ATOM   7180  C  CG    . LEU G  1 170 ? 51.209  -78.347  2.281   1.00 17.49 ? 168 LEU C CG    1 
ATOM   7181  C  CD1   . LEU G  1 170 ? 51.444  -79.578  3.153   1.00 13.80 ? 168 LEU C CD1   1 
ATOM   7182  C  CD2   . LEU G  1 170 ? 51.706  -77.089  3.027   1.00 12.87 ? 168 LEU C CD2   1 
ATOM   7183  N  N     A SER G  1 171 ? 52.554  -77.926  -2.453  0.42 18.90 ? 169 SER C N     1 
ATOM   7184  N  N     B SER G  1 171 ? 52.551  -77.956  -2.448  0.58 18.87 ? 169 SER C N     1 
ATOM   7185  C  CA    A SER G  1 171 ? 53.572  -77.967  -3.501  0.42 19.25 ? 169 SER C CA    1 
ATOM   7186  C  CA    B SER G  1 171 ? 53.564  -77.980  -3.507  0.58 19.20 ? 169 SER C CA    1 
ATOM   7187  C  C     A SER G  1 171 ? 53.530  -76.703  -4.375  0.42 21.72 ? 169 SER C C     1 
ATOM   7188  C  C     B SER G  1 171 ? 53.545  -76.697  -4.362  0.58 21.72 ? 169 SER C C     1 
ATOM   7189  O  O     A SER G  1 171 ? 54.205  -76.624  -5.405  0.42 24.46 ? 169 SER C O     1 
ATOM   7190  O  O     B SER G  1 171 ? 54.256  -76.597  -5.363  0.58 24.48 ? 169 SER C O     1 
ATOM   7191  C  CB    A SER G  1 171 ? 53.376  -79.184  -4.394  0.42 21.38 ? 169 SER C CB    1 
ATOM   7192  C  CB    B SER G  1 171 ? 53.393  -79.200  -4.414  0.58 21.39 ? 169 SER C CB    1 
ATOM   7193  O  OG    A SER G  1 171 ? 52.135  -79.096  -5.073  0.42 20.09 ? 169 SER C OG    1 
ATOM   7194  O  OG    B SER G  1 171 ? 54.438  -80.137  -4.244  0.58 21.62 ? 169 SER C OG    1 
ATOM   7195  N  N     . GLN G  1 172 ? 52.751  -75.712  -3.967  1.00 20.81 ? 170 GLN C N     1 
ATOM   7196  C  CA    . GLN G  1 172 ? 52.649  -74.475  -4.752  1.00 25.38 ? 170 GLN C CA    1 
ATOM   7197  C  C     . GLN G  1 172 ? 53.894  -73.614  -4.722  1.00 23.55 ? 170 GLN C C     1 
ATOM   7198  O  O     . GLN G  1 172 ? 54.344  -73.179  -5.758  1.00 28.08 ? 170 GLN C O     1 
ATOM   7199  C  CB    . GLN G  1 172 ? 51.380  -73.699  -4.385  1.00 25.68 ? 170 GLN C CB    1 
ATOM   7200  C  CG    . GLN G  1 172 ? 50.144  -74.395  -4.910  1.00 27.31 ? 170 GLN C CG    1 
ATOM   7201  C  CD    . GLN G  1 172 ? 48.891  -73.747  -4.440  1.00 30.44 ? 170 GLN C CD    1 
ATOM   7202  O  OE1   . GLN G  1 172 ? 48.918  -72.631  -3.885  1.00 29.69 ? 170 GLN C OE1   1 
ATOM   7203  N  NE2   . GLN G  1 172 ? 47.758  -74.445  -4.630  1.00 24.27 ? 170 GLN C NE2   1 
ATOM   7204  N  N     . SER G  1 173 ? 54.484  -73.378  -3.553  1.00 22.38 ? 171 SER C N     1 
ATOM   7205  C  CA    . SER G  1 173 ? 55.651  -72.520  -3.536  1.00 22.30 ? 171 SER C CA    1 
ATOM   7206  C  C     . SER G  1 173 ? 56.907  -73.256  -3.988  1.00 27.90 ? 171 SER C C     1 
ATOM   7207  O  O     . SER G  1 173 ? 57.816  -72.652  -4.557  1.00 27.18 ? 171 SER C O     1 
ATOM   7208  C  CB    . SER G  1 173 ? 55.835  -71.834  -2.171  1.00 27.21 ? 171 SER C CB    1 
ATOM   7209  O  OG    . SER G  1 173 ? 56.013  -72.784  -1.137  1.00 28.25 ? 171 SER C OG    1 
ATOM   7210  N  N     . SER G  1 174 ? 56.959  -74.568  -3.745  1.00 21.44 ? 172 SER C N     1 
ATOM   7211  C  CA    . SER G  1 174 ? 58.069  -75.402  -4.212  1.00 22.42 ? 172 SER C CA    1 
ATOM   7212  C  C     . SER G  1 174 ? 57.658  -76.860  -4.064  1.00 24.62 ? 172 SER C C     1 
ATOM   7213  O  O     . SER G  1 174 ? 56.657  -77.151  -3.424  1.00 19.38 ? 172 SER C O     1 
ATOM   7214  C  CB    . SER G  1 174 ? 59.352  -75.131  -3.422  1.00 25.16 ? 172 SER C CB    1 
ATOM   7215  O  OG    . SER G  1 174 ? 59.234  -75.572  -2.077  1.00 25.41 ? 172 SER C OG    1 
ATOM   7216  N  N     . GLN G  1 175 ? 58.428  -77.767  -4.648  1.00 23.01 ? 173 GLN C N     1 
ATOM   7217  C  CA    . GLN G  1 175 ? 57.996  -79.171  -4.721  1.00 25.61 ? 173 GLN C CA    1 
ATOM   7218  C  C     . GLN G  1 175 ? 58.230  -79.788  -3.341  1.00 25.68 ? 173 GLN C C     1 
ATOM   7219  O  O     . GLN G  1 175 ? 59.069  -79.304  -2.548  1.00 30.41 ? 173 GLN C O     1 
ATOM   7220  C  CB    . GLN G  1 175 ? 58.717  -79.953  -5.859  1.00 27.05 ? 173 GLN C CB    1 
ATOM   7221  C  CG    . GLN G  1 175 ? 58.111  -81.403  -6.248  1.00 32.01 ? 173 GLN C CG    1 
ATOM   7222  C  CD    . GLN G  1 175 ? 59.047  -82.258  -7.176  1.00 33.94 ? 173 GLN C CD    1 
ATOM   7223  O  OE1   . GLN G  1 175 ? 60.179  -81.853  -7.491  1.00 31.04 ? 173 GLN C OE1   1 
ATOM   7224  N  NE2   . GLN G  1 175 ? 58.567  -83.440  -7.599  1.00 33.51 ? 173 GLN C NE2   1 
ATOM   7225  N  N     . ILE G  1 176 ? 57.445  -80.807  -3.025  1.00 20.65 ? 174 ILE C N     1 
ATOM   7226  C  CA    . ILE G  1 176 ? 57.626  -81.590  -1.811  1.00 16.29 ? 174 ILE C CA    1 
ATOM   7227  C  C     . ILE G  1 176 ? 58.679  -82.644  -2.172  1.00 18.33 ? 174 ILE C C     1 
ATOM   7228  O  O     . ILE G  1 176 ? 58.526  -83.351  -3.182  1.00 17.69 ? 174 ILE C O     1 
ATOM   7229  C  CB    . ILE G  1 176 ? 56.275  -82.228  -1.396  1.00 17.31 ? 174 ILE C CB    1 
ATOM   7230  C  CG1   . ILE G  1 176 ? 55.249  -81.158  -0.969  1.00 18.97 ? 174 ILE C CG1   1 
ATOM   7231  C  CG2   . ILE G  1 176 ? 56.454  -83.372  -0.335  1.00 13.36 ? 174 ILE C CG2   1 
ATOM   7232  C  CD1   . ILE G  1 176 ? 55.714  -80.260  0.187   1.00 23.52 ? 174 ILE C CD1   1 
ATOM   7233  N  N     . ASP G  1 177 ? 59.757  -82.732  -1.379  1.00 15.91 ? 175 ASP C N     1 
ATOM   7234  C  CA    . ASP G  1 177 ? 60.788  -83.725  -1.598  1.00 15.02 ? 175 ASP C CA    1 
ATOM   7235  C  C     . ASP G  1 177 ? 60.326  -85.151  -1.318  1.00 18.65 ? 175 ASP C C     1 
ATOM   7236  O  O     . ASP G  1 177 ? 60.554  -86.059  -2.132  1.00 17.28 ? 175 ASP C O     1 
ATOM   7237  C  CB    . ASP G  1 177 ? 62.039  -83.409  -0.763  1.00 14.14 ? 175 ASP C CB    1 
ATOM   7238  C  CG    . ASP G  1 177 ? 62.601  -82.033  -1.087  1.00 19.51 ? 175 ASP C CG    1 
ATOM   7239  O  OD1   . ASP G  1 177 ? 63.433  -81.953  -2.005  1.00 22.96 ? 175 ASP C OD1   1 
ATOM   7240  O  OD2   . ASP G  1 177 ? 62.140  -81.043  -0.480  1.00 20.79 ? 175 ASP C OD2   1 
ATOM   7241  N  N     . ILE G  1 178 ? 59.692  -85.342  -0.159  1.00 16.39 ? 176 ILE C N     1 
ATOM   7242  C  CA    . ILE G  1 178 ? 59.292  -86.672  0.292   1.00 16.48 ? 176 ILE C CA    1 
ATOM   7243  C  C     . ILE G  1 178 ? 57.945  -86.572  0.928   1.00 10.75 ? 176 ILE C C     1 
ATOM   7244  O  O     . ILE G  1 178 ? 57.718  -85.695  1.722   1.00 13.45 ? 176 ILE C O     1 
ATOM   7245  C  CB    . ILE G  1 178 ? 60.302  -87.229  1.361   1.00 13.40 ? 176 ILE C CB    1 
ATOM   7246  C  CG1   . ILE G  1 178 ? 61.747  -87.122  0.869   1.00 11.32 ? 176 ILE C CG1   1 
ATOM   7247  C  CG2   . ILE G  1 178 ? 59.991  -88.651  1.759   1.00 14.46 ? 176 ILE C CG2   1 
ATOM   7248  C  CD1   . ILE G  1 178 ? 62.805  -87.483  1.939   1.00 17.50 ? 176 ILE C CD1   1 
ATOM   7249  N  N     . SER G  1 179 ? 57.059  -87.514  0.611   1.00 13.32 ? 177 SER C N     1 
ATOM   7250  C  CA    . SER G  1 179 ? 55.813  -87.667  1.328   1.00 15.16 ? 177 SER C CA    1 
ATOM   7251  C  C     . SER G  1 179 ? 55.804  -89.089  1.904   1.00 13.95 ? 177 SER C C     1 
ATOM   7252  O  O     . SER G  1 179 ? 56.293  -90.000  1.255   1.00 15.61 ? 177 SER C O     1 
ATOM   7253  C  CB    . SER G  1 179 ? 54.639  -87.509  0.353   1.00 13.33 ? 177 SER C CB    1 
ATOM   7254  O  OG    . SER G  1 179 ? 53.409  -87.743  1.025   1.00 20.33 ? 177 SER C OG    1 
ATOM   7255  N  N     . LEU G  1 180 ? 55.197  -89.260  3.069   1.00 14.66 ? 178 LEU C N     1 
ATOM   7256  C  CA    . LEU G  1 180 ? 55.193  -90.504  3.840   1.00 13.64 ? 178 LEU C CA    1 
ATOM   7257  C  C     . LEU G  1 180 ? 53.740  -90.900  4.079   1.00 15.69 ? 178 LEU C C     1 
ATOM   7258  O  O     . LEU G  1 180 ? 52.904  -90.051  4.434   1.00 14.01 ? 178 LEU C O     1 
ATOM   7259  C  CB    . LEU G  1 180 ? 55.781  -90.224  5.227   1.00 15.74 ? 178 LEU C CB    1 
ATOM   7260  C  CG    . LEU G  1 180 ? 57.284  -90.391  5.520   1.00 30.74 ? 178 LEU C CG    1 
ATOM   7261  C  CD1   . LEU G  1 180 ? 58.183  -90.291  4.326   1.00 19.57 ? 178 LEU C CD1   1 
ATOM   7262  C  CD2   . LEU G  1 180 ? 57.753  -89.429  6.592   1.00 16.52 ? 178 LEU C CD2   1 
ATOM   7263  N  N     . SER G  1 181 ? 53.424  -92.179  3.899   1.00 15.75 ? 179 SER C N     1 
ATOM   7264  C  CA    . SER G  1 181 ? 52.133  -92.690  4.358   1.00 15.89 ? 179 SER C CA    1 
ATOM   7265  C  C     . SER G  1 181 ? 52.329  -94.118  4.811   1.00 14.86 ? 179 SER C C     1 
ATOM   7266  O  O     . SER G  1 181 ? 53.370  -94.734  4.563   1.00 11.94 ? 179 SER C O     1 
ATOM   7267  C  CB    . SER G  1 181 ? 51.101  -92.700  3.245   1.00 14.91 ? 179 SER C CB    1 
ATOM   7268  O  OG    . SER G  1 181 ? 51.379  -93.766  2.337   1.00 12.96 ? 179 SER C OG    1 
ATOM   7269  N  N     . HIS G  1 182 ? 51.296  -94.656  5.432   1.00 13.26 ? 180 HIS C N     1 
ATOM   7270  C  CA    . HIS G  1 182 ? 51.409  -96.016  5.931   1.00 11.47 ? 180 HIS C CA    1 
ATOM   7271  C  C     . HIS G  1 182 ? 50.957  -97.002  4.856   1.00 13.00 ? 180 HIS C C     1 
ATOM   7272  O  O     . HIS G  1 182 ? 51.786  -97.757  4.296   1.00 13.01 ? 180 HIS C O     1 
ATOM   7273  C  CB    . HIS G  1 182 ? 50.653  -96.227  7.252   1.00 11.83 ? 180 HIS C CB    1 
ATOM   7274  C  CG    . HIS G  1 182 ? 50.971  -97.538  7.870   1.00 14.54 ? 180 HIS C CG    1 
ATOM   7275  N  ND1   . HIS G  1 182 ? 52.265  -97.929  8.147   1.00 15.57 ? 180 HIS C ND1   1 
ATOM   7276  C  CD2   . HIS G  1 182 ? 50.191  -98.609  8.165   1.00 16.35 ? 180 HIS C CD2   1 
ATOM   7277  C  CE1   . HIS G  1 182 ? 52.260  -99.154  8.630   1.00 19.37 ? 180 HIS C CE1   1 
ATOM   7278  N  NE2   . HIS G  1 182 ? 51.016  -99.593  8.640   1.00 15.63 ? 180 HIS C NE2   1 
ATOM   7279  N  N     . ASP G  1 183 ? 49.667  -97.002  4.539   1.00 12.73 ? 181 ASP C N     1 
ATOM   7280  C  CA    . ASP G  1 183 ? 49.234  -97.790  3.371   1.00 14.43 ? 181 ASP C CA    1 
ATOM   7281  C  C     . ASP G  1 183 ? 49.622  -97.094  2.044   1.00 13.03 ? 181 ASP C C     1 
ATOM   7282  O  O     . ASP G  1 183 ? 49.872  -95.894  2.010   1.00 10.85 ? 181 ASP C O     1 
ATOM   7283  C  CB    . ASP G  1 183 ? 47.723  -98.193  3.435   1.00 18.12 ? 181 ASP C CB    1 
ATOM   7284  C  CG    . ASP G  1 183 ? 46.775  -97.007  3.642   1.00 15.31 ? 181 ASP C CG    1 
ATOM   7285  O  OD1   . ASP G  1 183 ? 47.231  -95.842  3.868   1.00 15.51 ? 181 ASP C OD1   1 
ATOM   7286  O  OD2   . ASP G  1 183 ? 45.533  -97.273  3.612   1.00 17.63 ? 181 ASP C OD2   1 
ATOM   7287  N  N     . TRP G  1 184 ? 49.769  -97.874  0.971   1.00 11.08 ? 182 TRP C N     1 
ATOM   7288  C  CA    . TRP G  1 184 ? 50.135  -97.351  -0.347  1.00 17.34 ? 182 TRP C CA    1 
ATOM   7289  C  C     . TRP G  1 184 ? 49.070  -96.451  -1.005  1.00 13.95 ? 182 TRP C C     1 
ATOM   7290  O  O     . TRP G  1 184 ? 47.837  -96.691  -0.871  1.00 17.61 ? 182 TRP C O     1 
ATOM   7291  C  CB    . TRP G  1 184 ? 50.389  -98.546  -1.294  1.00 15.16 ? 182 TRP C CB    1 
ATOM   7292  C  CG    . TRP G  1 184 ? 51.489  -99.483  -0.861  1.00 17.27 ? 182 TRP C CG    1 
ATOM   7293  C  CD1   . TRP G  1 184 ? 52.084  -99.536  0.351   1.00 17.58 ? 182 TRP C CD1   1 
ATOM   7294  C  CD2   . TRP G  1 184 ? 52.122  -100.503 -1.666  1.00 17.50 ? 182 TRP C CD2   1 
ATOM   7295  N  NE1   . TRP G  1 184 ? 53.034  -100.524 0.367   1.00 18.81 ? 182 TRP C NE1   1 
ATOM   7296  C  CE2   . TRP G  1 184 ? 53.087  -101.129 -0.870  1.00 17.65 ? 182 TRP C CE2   1 
ATOM   7297  C  CE3   . TRP G  1 184 ? 51.978  -100.928 -3.002  1.00 19.95 ? 182 TRP C CE3   1 
ATOM   7298  C  CZ2   . TRP G  1 184 ? 53.917  -102.159 -1.341  1.00 18.56 ? 182 TRP C CZ2   1 
ATOM   7299  C  CZ3   . TRP G  1 184 ? 52.781  -101.972 -3.474  1.00 20.72 ? 182 TRP C CZ3   1 
ATOM   7300  C  CH2   . TRP G  1 184 ? 53.743  -102.570 -2.637  1.00 18.59 ? 182 TRP C CH2   1 
ATOM   7301  N  N     . PRO G  1 185 ? 49.522  -95.451  -1.797  1.00 13.04 ? 183 PRO C N     1 
ATOM   7302  C  CA    . PRO G  1 185 ? 48.574  -94.712  -2.640  1.00 17.25 ? 183 PRO C CA    1 
ATOM   7303  C  C     . PRO G  1 185 ? 47.871  -95.726  -3.559  1.00 21.02 ? 183 PRO C C     1 
ATOM   7304  O  O     . PRO G  1 185 ? 48.564  -96.572  -4.196  1.00 19.04 ? 183 PRO C O     1 
ATOM   7305  C  CB    . PRO G  1 185 ? 49.484  -93.814  -3.479  1.00 14.90 ? 183 PRO C CB    1 
ATOM   7306  C  CG    . PRO G  1 185 ? 50.734  -93.618  -2.638  1.00 19.48 ? 183 PRO C CG    1 
ATOM   7307  C  CD    . PRO G  1 185 ? 50.901  -94.916  -1.872  1.00 17.23 ? 183 PRO C CD    1 
ATOM   7308  N  N     . GLN G  1 186 ? 46.542  -95.668  -3.614  1.00 21.82 ? 184 GLN C N     1 
ATOM   7309  C  CA    . GLN G  1 186 ? 45.755  -96.628  -4.411  1.00 18.75 ? 184 GLN C CA    1 
ATOM   7310  C  C     . GLN G  1 186 ? 46.239  -96.690  -5.855  1.00 19.81 ? 184 GLN C C     1 
ATOM   7311  O  O     . GLN G  1 186 ? 46.431  -95.653  -6.495  1.00 21.92 ? 184 GLN C O     1 
ATOM   7312  C  CB    . GLN G  1 186 ? 44.281  -96.261  -4.386  1.00 20.23 ? 184 GLN C CB    1 
ATOM   7313  C  CG    . GLN G  1 186 ? 43.370  -97.361  -4.924  1.00 26.49 ? 184 GLN C CG    1 
ATOM   7314  C  CD    . GLN G  1 186 ? 41.900  -97.015  -4.748  1.00 22.98 ? 184 GLN C CD    1 
ATOM   7315  O  OE1   . GLN G  1 186 ? 41.460  -95.944  -5.161  1.00 29.42 ? 184 GLN C OE1   1 
ATOM   7316  N  NE2   . GLN G  1 186 ? 41.151  -97.894  -4.103  1.00 25.03 ? 184 GLN C NE2   1 
ATOM   7317  N  N     . GLY G  1 187 ? 46.452  -97.902  -6.372  1.00 25.13 ? 185 GLY C N     1 
ATOM   7318  C  CA    . GLY G  1 187 ? 46.858  -98.064  -7.770  1.00 25.69 ? 185 GLY C CA    1 
ATOM   7319  C  C     . GLY G  1 187 ? 48.360  -98.040  -8.057  1.00 22.30 ? 185 GLY C C     1 
ATOM   7320  O  O     . GLY G  1 187 ? 48.800  -98.515  -9.120  1.00 22.25 ? 185 GLY C O     1 
ATOM   7321  N  N     . ILE G  1 188 ? 49.173  -97.520  -7.134  1.00 19.06 ? 186 ILE C N     1 
ATOM   7322  C  CA    . ILE G  1 188 ? 50.611  -97.393  -7.423  1.00 18.86 ? 186 ILE C CA    1 
ATOM   7323  C  C     . ILE G  1 188 ? 51.225  -98.783  -7.659  1.00 21.62 ? 186 ILE C C     1 
ATOM   7324  O  O     . ILE G  1 188 ? 52.218  -98.917  -8.385  1.00 20.14 ? 186 ILE C O     1 
ATOM   7325  C  CB    . ILE G  1 188 ? 51.382  -96.695  -6.292  1.00 22.79 ? 186 ILE C CB    1 
ATOM   7326  C  CG1   . ILE G  1 188 ? 52.811  -96.341  -6.746  1.00 20.04 ? 186 ILE C CG1   1 
ATOM   7327  C  CG2   . ILE G  1 188 ? 51.488  -97.612  -5.087  1.00 17.15 ? 186 ILE C CG2   1 
ATOM   7328  C  CD1   . ILE G  1 188 ? 52.855  -95.095  -7.619  1.00 25.91 ? 186 ILE C CD1   1 
ATOM   7329  N  N     . VAL G  1 189 ? 50.597  -99.814  -7.093  1.00 21.25 ? 187 VAL C N     1 
ATOM   7330  C  CA    . VAL G  1 189 ? 51.098  -101.170 -7.243  1.00 19.33 ? 187 VAL C CA    1 
ATOM   7331  C  C     . VAL G  1 189 ? 51.336  -101.486 -8.728  1.00 21.91 ? 187 VAL C C     1 
ATOM   7332  O  O     . VAL G  1 189 ? 52.324  -102.133 -9.109  1.00 23.06 ? 187 VAL C O     1 
ATOM   7333  C  CB    . VAL G  1 189 ? 50.130  -102.174 -6.660  1.00 26.28 ? 187 VAL C CB    1 
ATOM   7334  C  CG1   . VAL G  1 189 ? 48.792  -102.143 -7.434  1.00 21.49 ? 187 VAL C CG1   1 
ATOM   7335  C  CG2   . VAL G  1 189 ? 50.756  -103.568 -6.680  1.00 25.37 ? 187 VAL C CG2   1 
ATOM   7336  N  N     . MET G  1 190 ? 50.422  -101.024 -9.568  1.00 21.18 ? 188 MET C N     1 
ATOM   7337  C  CA    . MET G  1 190 ? 50.526  -101.334 -10.990 1.00 24.60 ? 188 MET C CA    1 
ATOM   7338  C  C     . MET G  1 190 ? 51.700  -100.656 -11.697 1.00 30.85 ? 188 MET C C     1 
ATOM   7339  O  O     . MET G  1 190 ? 52.041  -101.037 -12.814 1.00 29.28 ? 188 MET C O     1 
ATOM   7340  C  CB    . MET G  1 190 ? 49.227  -101.012 -11.709 1.00 26.87 ? 188 MET C CB    1 
ATOM   7341  C  CG    . MET G  1 190 ? 48.002  -101.648 -11.067 1.00 24.14 ? 188 MET C CG    1 
ATOM   7342  S  SD    . MET G  1 190 ? 48.142  -103.442 -10.880 1.00 30.62 ? 188 MET C SD    1 
ATOM   7343  C  CE    . MET G  1 190 ? 48.464  -103.917 -12.590 1.00 34.80 ? 188 MET C CE    1 
ATOM   7344  N  N     . LYS G  1 191 ? 52.332  -99.672  -11.049 1.00 25.40 ? 189 LYS C N     1 
ATOM   7345  C  CA    . LYS G  1 191 ? 53.384  -98.896  -11.707 1.00 26.97 ? 189 LYS C CA    1 
ATOM   7346  C  C     . LYS G  1 191 ? 54.808  -99.424  -11.502 1.00 25.54 ? 189 LYS C C     1 
ATOM   7347  O  O     . LYS G  1 191 ? 55.760  -98.778  -11.919 1.00 28.52 ? 189 LYS C O     1 
ATOM   7348  C  CB    . LYS G  1 191 ? 53.298  -97.405  -11.313 1.00 22.96 ? 189 LYS C CB    1 
ATOM   7349  C  CG    . LYS G  1 191 ? 51.871  -96.847  -11.419 1.00 27.61 ? 189 LYS C CG    1 
ATOM   7350  C  CD    . LYS G  1 191 ? 51.392  -96.824  -12.859 1.00 34.83 ? 189 LYS C CD    1 
ATOM   7351  C  CE    . LYS G  1 191 ? 52.193  -95.811  -13.679 1.00 43.29 ? 189 LYS C CE    1 
ATOM   7352  N  NZ    . LYS G  1 191 ? 51.487  -95.283  -14.893 1.00 45.81 ? 189 LYS C NZ    1 
ATOM   7353  N  N     . GLY G  1 192 ? 54.972  -100.570 -10.851 1.00 20.43 ? 190 GLY C N     1 
ATOM   7354  C  CA    . GLY G  1 192 ? 56.299  -101.184 -10.778 1.00 22.22 ? 190 GLY C CA    1 
ATOM   7355  C  C     . GLY G  1 192 ? 56.251  -102.585 -11.378 1.00 25.65 ? 190 GLY C C     1 
ATOM   7356  O  O     . GLY G  1 192 ? 55.299  -102.928 -12.109 1.00 25.62 ? 190 GLY C O     1 
ATOM   7357  N  N     . ASN G  1 193 ? 57.236  -103.406 -11.040 1.00 24.23 ? 191 ASN C N     1 
ATOM   7358  C  CA    . ASN G  1 193 ? 57.265  -104.783 -11.510 1.00 23.55 ? 191 ASN C CA    1 
ATOM   7359  C  C     . ASN G  1 193 ? 56.326  -105.665 -10.690 1.00 23.04 ? 191 ASN C C     1 
ATOM   7360  O  O     . ASN G  1 193 ? 56.749  -106.480 -9.851  1.00 23.21 ? 191 ASN C O     1 
ATOM   7361  C  CB    . ASN G  1 193 ? 58.675  -105.350 -11.483 1.00 22.14 ? 191 ASN C CB    1 
ATOM   7362  C  CG    . ASN G  1 193 ? 58.744  -106.760 -12.071 1.00 28.57 ? 191 ASN C CG    1 
ATOM   7363  O  OD1   . ASN G  1 193 ? 57.715  -107.381 -12.347 1.00 32.64 ? 191 ASN C OD1   1 
ATOM   7364  N  ND2   . ASN G  1 193 ? 59.937  -107.262 -12.253 1.00 32.95 ? 191 ASN C ND2   1 
ATOM   7365  N  N     . TYR G  1 194 ? 55.038  -105.518 -10.944 1.00 22.35 ? 192 TYR C N     1 
ATOM   7366  C  CA    . TYR G  1 194 ? 54.063  -106.161 -10.078 1.00 24.37 ? 192 TYR C CA    1 
ATOM   7367  C  C     . TYR G  1 194 ? 54.071  -107.691 -10.221 1.00 25.08 ? 192 TYR C C     1 
ATOM   7368  O  O     . TYR G  1 194 ? 53.819  -108.427 -9.246  1.00 23.52 ? 192 TYR C O     1 
ATOM   7369  C  CB    . TYR G  1 194 ? 52.693  -105.534 -10.296 1.00 20.32 ? 192 TYR C CB    1 
ATOM   7370  C  CG    . TYR G  1 194 ? 52.260  -105.511 -11.737 1.00 26.95 ? 192 TYR C CG    1 
ATOM   7371  C  CD1   . TYR G  1 194 ? 51.696  -106.657 -12.330 1.00 32.56 ? 192 TYR C CD1   1 
ATOM   7372  C  CD2   . TYR G  1 194 ? 52.376  -104.357 -12.502 1.00 22.58 ? 192 TYR C CD2   1 
ATOM   7373  C  CE1   . TYR G  1 194 ? 51.269  -106.647 -13.647 1.00 32.42 ? 192 TYR C CE1   1 
ATOM   7374  C  CE2   . TYR G  1 194 ? 51.967  -104.330 -13.822 1.00 29.58 ? 192 TYR C CE2   1 
ATOM   7375  C  CZ    . TYR G  1 194 ? 51.413  -105.489 -14.393 1.00 39.93 ? 192 TYR C CZ    1 
ATOM   7376  O  OH    . TYR G  1 194 ? 50.980  -105.497 -15.698 1.00 43.07 ? 192 TYR C OH    1 
ATOM   7377  N  N     . LYS G  1 195 ? 54.391  -108.183 -11.419 1.00 27.41 ? 193 LYS C N     1 
ATOM   7378  C  CA    . LYS G  1 195 ? 54.486  -109.642 -11.614 1.00 31.47 ? 193 LYS C CA    1 
ATOM   7379  C  C     . LYS G  1 195 ? 55.426  -110.216 -10.587 1.00 27.17 ? 193 LYS C C     1 
ATOM   7380  O  O     . LYS G  1 195 ? 55.103  -111.201 -9.907  1.00 25.39 ? 193 LYS C O     1 
ATOM   7381  C  CB    . LYS G  1 195 ? 55.033  -109.980 -12.989 1.00 33.99 ? 193 LYS C CB    1 
ATOM   7382  C  CG    . LYS G  1 195 ? 54.161  -109.500 -14.137 1.00 40.26 ? 193 LYS C CG    1 
ATOM   7383  C  CD    . LYS G  1 195 ? 52.909  -110.322 -14.274 1.00 43.58 ? 193 LYS C CD    1 
ATOM   7384  C  CE    . LYS G  1 195 ? 52.669  -110.674 -15.738 1.00 47.49 ? 193 LYS C CE    1 
ATOM   7385  N  NZ    . LYS G  1 195 ? 53.073  -109.553 -16.638 1.00 52.47 ? 193 LYS C NZ    1 
ATOM   7386  N  N     . GLN G  1 196 ? 56.592  -109.586 -10.448 1.00 24.06 ? 194 GLN C N     1 
ATOM   7387  C  CA    . GLN G  1 196 ? 57.578  -110.059 -9.466  1.00 28.56 ? 194 GLN C CA    1 
ATOM   7388  C  C     . GLN G  1 196 ? 57.100  -109.878 -8.017  1.00 24.11 ? 194 GLN C C     1 
ATOM   7389  O  O     . GLN G  1 196 ? 57.360  -110.712 -7.124  1.00 26.75 ? 194 GLN C O     1 
ATOM   7390  C  CB    . GLN G  1 196 ? 58.900  -109.337 -9.670  1.00 30.20 ? 194 GLN C CB    1 
ATOM   7391  C  CG    . GLN G  1 196 ? 59.991  -109.876 -8.790  1.00 37.08 ? 194 GLN C CG    1 
ATOM   7392  C  CD    . GLN G  1 196 ? 61.236  -109.044 -8.912  1.00 46.57 ? 194 GLN C CD    1 
ATOM   7393  O  OE1   . GLN G  1 196 ? 61.199  -107.831 -8.678  1.00 51.36 ? 194 GLN C OE1   1 
ATOM   7394  N  NE2   . GLN G  1 196 ? 62.340  -109.671 -9.320  1.00 34.84 ? 194 GLN C NE2   1 
ATOM   7395  N  N     . LEU G  1 197 ? 56.408  -108.773 -7.769  1.00 25.09 ? 195 LEU C N     1 
ATOM   7396  C  CA    . LEU G  1 197 ? 55.801  -108.577 -6.450  1.00 29.22 ? 195 LEU C CA    1 
ATOM   7397  C  C     . LEU G  1 197 ? 54.888  -109.760 -6.105  1.00 25.93 ? 195 LEU C C     1 
ATOM   7398  O  O     . LEU G  1 197 ? 54.940  -110.320 -5.019  1.00 23.51 ? 195 LEU C O     1 
ATOM   7399  C  CB    . LEU G  1 197 ? 54.955  -107.318 -6.453  1.00 25.48 ? 195 LEU C CB    1 
ATOM   7400  C  CG    . LEU G  1 197 ? 54.348  -106.907 -5.122  1.00 26.04 ? 195 LEU C CG    1 
ATOM   7401  C  CD1   . LEU G  1 197 ? 55.477  -106.624 -4.139  1.00 23.02 ? 195 LEU C CD1   1 
ATOM   7402  C  CD2   . LEU G  1 197 ? 53.490  -105.668 -5.354  1.00 24.38 ? 195 LEU C CD2   1 
ATOM   7403  N  N     . TYR G  1 198 ? 54.023  -110.119 -7.045  1.00 26.59 ? 196 TYR C N     1 
ATOM   7404  C  CA    . TYR G  1 198 ? 53.080  -111.200 -6.812  1.00 26.59 ? 196 TYR C CA    1 
ATOM   7405  C  C     . TYR G  1 198 ? 53.752  -112.583 -6.671  1.00 22.47 ? 196 TYR C C     1 
ATOM   7406  O  O     . TYR G  1 198 ? 53.277  -113.426 -5.910  1.00 27.52 ? 196 TYR C O     1 
ATOM   7407  C  CB    . TYR G  1 198 ? 52.027  -111.219 -7.917  1.00 25.91 ? 196 TYR C CB    1 
ATOM   7408  C  CG    . TYR G  1 198 ? 51.189  -109.946 -8.013  1.00 25.03 ? 196 TYR C CG    1 
ATOM   7409  C  CD1   . TYR G  1 198 ? 50.936  -109.140 -6.895  1.00 23.20 ? 196 TYR C CD1   1 
ATOM   7410  C  CD2   . TYR G  1 198 ? 50.653  -109.564 -9.227  1.00 19.55 ? 196 TYR C CD2   1 
ATOM   7411  C  CE1   . TYR G  1 198 ? 50.134  -107.952 -7.005  1.00 21.77 ? 196 TYR C CE1   1 
ATOM   7412  C  CE2   . TYR G  1 198 ? 49.859  -108.418 -9.355  1.00 29.49 ? 196 TYR C CE2   1 
ATOM   7413  C  CZ    . TYR G  1 198 ? 49.607  -107.613 -8.255  1.00 25.37 ? 196 TYR C CZ    1 
ATOM   7414  O  OH    . TYR G  1 198 ? 48.827  -106.484 -8.448  1.00 25.90 ? 196 TYR C OH    1 
ATOM   7415  N  N     . ARG G  1 199 ? 54.853  -112.819 -7.374  1.00 31.71 ? 197 ARG C N     1 
ATOM   7416  C  CA    . ARG G  1 199 ? 55.566  -114.098 -7.187  1.00 34.09 ? 197 ARG C CA    1 
ATOM   7417  C  C     . ARG G  1 199 ? 56.037  -114.264 -5.746  1.00 35.88 ? 197 ARG C C     1 
ATOM   7418  O  O     . ARG G  1 199 ? 55.965  -115.350 -5.158  1.00 34.25 ? 197 ARG C O     1 
ATOM   7419  C  CB    . ARG G  1 199 ? 56.749  -114.251 -8.151  1.00 36.97 ? 197 ARG C CB    1 
ATOM   7420  C  CG    . ARG G  1 199 ? 56.374  -114.929 -9.477  1.00 42.20 ? 197 ARG C CG    1 
ATOM   7421  C  CD    . ARG G  1 199 ? 57.576  -115.056 -10.411 1.00 50.42 ? 197 ARG C CD    1 
ATOM   7422  N  NE    . ARG G  1 199 ? 57.572  -113.966 -11.381 1.00 51.31 ? 197 ARG C NE    1 
ATOM   7423  C  CZ    . ARG G  1 199 ? 58.509  -113.032 -11.465 1.00 46.15 ? 197 ARG C CZ    1 
ATOM   7424  N  NH1   . ARG G  1 199 ? 59.562  -113.066 -10.649 1.00 48.48 ? 197 ARG C NH1   1 
ATOM   7425  N  NH2   . ARG G  1 199 ? 58.397  -112.070 -12.379 1.00 44.16 ? 197 ARG C NH2   1 
ATOM   7426  N  N     . PHE G  1 200 ? 56.498  -113.171 -5.160  1.00 31.82 ? 198 PHE C N     1 
ATOM   7427  C  CA    . PHE G  1 200 ? 56.981  -113.233 -3.798  1.00 35.20 ? 198 PHE C CA    1 
ATOM   7428  C  C     . PHE G  1 200 ? 55.924  -112.968 -2.711  1.00 30.48 ? 198 PHE C C     1 
ATOM   7429  O  O     . PHE G  1 200 ? 56.111  -113.353 -1.561  1.00 39.52 ? 198 PHE C O     1 
ATOM   7430  C  CB    . PHE G  1 200 ? 58.285  -112.433 -3.690  1.00 41.90 ? 198 PHE C CB    1 
ATOM   7431  C  CG    . PHE G  1 200 ? 59.336  -112.920 -4.676  1.00 49.06 ? 198 PHE C CG    1 
ATOM   7432  C  CD1   . PHE G  1 200 ? 59.692  -114.285 -4.711  1.00 49.37 ? 198 PHE C CD1   1 
ATOM   7433  C  CD2   . PHE G  1 200 ? 59.898  -112.057 -5.612  1.00 48.41 ? 198 PHE C CD2   1 
ATOM   7434  C  CE1   . PHE G  1 200 ? 60.621  -114.771 -5.633  1.00 49.41 ? 198 PHE C CE1   1 
ATOM   7435  C  CE2   . PHE G  1 200 ? 60.836  -112.526 -6.538  1.00 51.82 ? 198 PHE C CE2   1 
ATOM   7436  C  CZ    . PHE G  1 200 ? 61.198  -113.887 -6.547  1.00 58.88 ? 198 PHE C CZ    1 
ATOM   7437  N  N     . GLN G  1 201 ? 54.795  -112.368 -3.070  1.00 31.60 ? 199 GLN C N     1 
ATOM   7438  C  CA    . GLN G  1 201 ? 53.645  -112.373 -2.158  1.00 31.62 ? 199 GLN C CA    1 
ATOM   7439  C  C     . GLN G  1 201 ? 52.319  -112.431 -2.885  1.00 30.27 ? 199 GLN C C     1 
ATOM   7440  O  O     . GLN G  1 201 ? 51.691  -111.390 -3.106  1.00 28.08 ? 199 GLN C O     1 
ATOM   7441  C  CB    . GLN G  1 201 ? 53.665  -111.200 -1.173  1.00 34.49 ? 199 GLN C CB    1 
ATOM   7442  C  CG    . GLN G  1 201 ? 52.803  -111.438 0.105   1.00 33.97 ? 199 GLN C CG    1 
ATOM   7443  C  CD    . GLN G  1 201 ? 52.470  -112.912 0.341   1.00 33.93 ? 199 GLN C CD    1 
ATOM   7444  O  OE1   . GLN G  1 201 ? 51.601  -113.480 -0.335  1.00 38.88 ? 199 GLN C OE1   1 
ATOM   7445  N  NE2   . GLN G  1 201 ? 53.152  -113.534 1.303   1.00 41.94 ? 199 GLN C NE2   1 
ATOM   7446  N  N     . PRO G  1 202 ? 51.867  -113.660 -3.236  1.00 31.11 ? 200 PRO C N     1 
ATOM   7447  C  CA    . PRO G  1 202 ? 50.610  -113.753 -3.993  1.00 27.63 ? 200 PRO C CA    1 
ATOM   7448  C  C     . PRO G  1 202 ? 49.462  -113.072 -3.255  1.00 28.39 ? 200 PRO C C     1 
ATOM   7449  O  O     . PRO G  1 202 ? 48.503  -112.626 -3.915  1.00 31.65 ? 200 PRO C O     1 
ATOM   7450  C  CB    . PRO G  1 202 ? 50.348  -115.273 -4.112  1.00 31.05 ? 200 PRO C CB    1 
ATOM   7451  C  CG    . PRO G  1 202 ? 51.388  -115.960 -3.275  1.00 30.77 ? 200 PRO C CG    1 
ATOM   7452  C  CD    . PRO G  1 202 ? 52.524  -114.968 -3.054  1.00 28.12 ? 200 PRO C CD    1 
ATOM   7453  N  N     . GLY G  1 203 ? 49.537  -113.005 -1.923  1.00 26.70 ? 201 GLY C N     1 
ATOM   7454  C  CA    . GLY G  1 203 ? 48.501  -112.342 -1.136  1.00 24.73 ? 201 GLY C CA    1 
ATOM   7455  C  C     . GLY G  1 203 ? 48.131  -110.943 -1.663  1.00 27.91 ? 201 GLY C C     1 
ATOM   7456  O  O     . GLY G  1 203 ? 46.961  -110.544 -1.606  1.00 30.55 ? 201 GLY C O     1 
ATOM   7457  N  N     . PHE G  1 204 ? 49.118  -110.219 -2.197  1.00 28.39 ? 202 PHE C N     1 
ATOM   7458  C  CA    . PHE G  1 204 ? 48.889  -108.868 -2.722  1.00 31.00 ? 202 PHE C CA    1 
ATOM   7459  C  C     . PHE G  1 204 ? 48.128  -108.833 -4.046  1.00 29.49 ? 202 PHE C C     1 
ATOM   7460  O  O     . PHE G  1 204 ? 47.590  -107.786 -4.425  1.00 28.77 ? 202 PHE C O     1 
ATOM   7461  C  CB    . PHE G  1 204 ? 50.218  -108.109 -2.868  1.00 21.73 ? 202 PHE C CB    1 
ATOM   7462  C  CG    . PHE G  1 204 ? 51.001  -107.985 -1.582  1.00 31.48 ? 202 PHE C CG    1 
ATOM   7463  C  CD1   . PHE G  1 204 ? 50.415  -108.306 -0.355  1.00 29.28 ? 202 PHE C CD1   1 
ATOM   7464  C  CD2   . PHE G  1 204 ? 52.336  -107.553 -1.601  1.00 33.24 ? 202 PHE C CD2   1 
ATOM   7465  C  CE1   . PHE G  1 204 ? 51.145  -108.204 0.840   1.00 30.81 ? 202 PHE C CE1   1 
ATOM   7466  C  CE2   . PHE G  1 204 ? 53.084  -107.446 -0.421  1.00 28.42 ? 202 PHE C CE2   1 
ATOM   7467  C  CZ    . PHE G  1 204 ? 52.488  -107.766 0.812   1.00 29.83 ? 202 PHE C CZ    1 
ATOM   7468  N  N     . LYS G  1 205 ? 48.106  -109.957 -4.764  1.00 26.98 ? 203 LYS C N     1 
ATOM   7469  C  CA    . LYS G  1 205 ? 47.406  -109.995 -6.048  1.00 28.25 ? 203 LYS C CA    1 
ATOM   7470  C  C     . LYS G  1 205 ? 45.918  -109.773 -5.800  1.00 27.67 ? 203 LYS C C     1 
ATOM   7471  O  O     . LYS G  1 205 ? 45.196  -109.215 -6.621  1.00 28.81 ? 203 LYS C O     1 
ATOM   7472  C  CB    . LYS G  1 205 ? 47.654  -111.342 -6.744  1.00 25.08 ? 203 LYS C CB    1 
ATOM   7473  C  CG    . LYS G  1 205 ? 47.705  -111.268 -8.244  1.00 31.85 ? 203 LYS C CG    1 
ATOM   7474  C  CD    . LYS G  1 205 ? 48.138  -112.618 -8.850  1.00 29.03 ? 203 LYS C CD    1 
ATOM   7475  C  CE    . LYS G  1 205 ? 47.824  -112.685 -10.359 1.00 37.23 ? 203 LYS C CE    1 
ATOM   7476  N  NZ    . LYS G  1 205 ? 48.455  -113.870 -11.057 1.00 30.28 ? 203 LYS C NZ    1 
ATOM   7477  N  N     . LYS G  1 206 ? 45.452  -110.193 -4.639  1.00 33.55 ? 204 LYS C N     1 
ATOM   7478  C  CA    . LYS G  1 206 ? 44.016  -110.174 -4.350  1.00 32.32 ? 204 LYS C CA    1 
ATOM   7479  C  C     . LYS G  1 206 ? 43.253  -108.860 -4.635  1.00 36.25 ? 204 LYS C C     1 
ATOM   7480  O  O     . LYS G  1 206 ? 42.235  -108.890 -5.332  1.00 30.07 ? 204 LYS C O     1 
ATOM   7481  C  CB    . LYS G  1 206 ? 43.780  -110.590 -2.909  1.00 34.85 ? 204 LYS C CB    1 
ATOM   7482  C  CG    . LYS G  1 206 ? 42.393  -111.124 -2.625  1.00 50.21 ? 204 LYS C CG    1 
ATOM   7483  C  CD    . LYS G  1 206 ? 42.463  -111.964 -1.363  1.00 57.26 ? 204 LYS C CD    1 
ATOM   7484  C  CE    . LYS G  1 206 ? 43.895  -112.473 -1.192  1.00 42.98 ? 204 LYS C CE    1 
ATOM   7485  N  NZ    . LYS G  1 206 ? 44.226  -112.708 0.237   1.00 53.11 ? 204 LYS C NZ    1 
ATOM   7486  N  N     . ASP G  1 207 ? 43.704  -107.723 -4.092  1.00 27.78 ? 205 ASP C N     1 
ATOM   7487  C  CA    . ASP G  1 207 ? 43.008  -106.451 -4.335  1.00 29.26 ? 205 ASP C CA    1 
ATOM   7488  C  C     . ASP G  1 207 ? 43.280  -105.895 -5.723  1.00 28.60 ? 205 ASP C C     1 
ATOM   7489  O  O     . ASP G  1 207 ? 42.647  -104.908 -6.141  1.00 30.24 ? 205 ASP C O     1 
ATOM   7490  C  CB    . ASP G  1 207 ? 43.410  -105.389 -3.310  1.00 29.63 ? 205 ASP C CB    1 
ATOM   7491  C  CG    . ASP G  1 207 ? 42.806  -105.641 -1.959  1.00 36.80 ? 205 ASP C CG    1 
ATOM   7492  O  OD1   . ASP G  1 207 ? 41.769  -106.346 -1.924  1.00 32.48 ? 205 ASP C OD1   1 
ATOM   7493  O  OD2   . ASP G  1 207 ? 43.377  -105.155 -0.950  1.00 30.70 ? 205 ASP C OD2   1 
ATOM   7494  N  N     . GLY G  1 208 ? 44.240  -106.501 -6.425  1.00 30.73 ? 206 GLY C N     1 
ATOM   7495  C  CA    . GLY G  1 208 ? 44.568  -106.069 -7.773  1.00 23.58 ? 206 GLY C CA    1 
ATOM   7496  C  C     . GLY G  1 208 ? 44.971  -104.607 -7.844  1.00 24.95 ? 206 GLY C C     1 
ATOM   7497  O  O     . GLY G  1 208 ? 45.604  -104.079 -6.929  1.00 29.03 ? 206 GLY C O     1 
ATOM   7498  N  N     . ALA G  1 209 ? 44.638  -103.943 -8.944  1.00 23.56 ? 207 ALA C N     1 
ATOM   7499  C  CA    . ALA G  1 209 ? 44.949  -102.516 -9.092  1.00 26.22 ? 207 ALA C CA    1 
ATOM   7500  C  C     . ALA G  1 209 ? 44.345  -101.632 -7.973  1.00 27.72 ? 207 ALA C C     1 
ATOM   7501  O  O     . ALA G  1 209 ? 44.856  -100.551 -7.691  1.00 34.09 ? 207 ALA C O     1 
ATOM   7502  C  CB    . ALA G  1 209 ? 44.500  -102.016 -10.479 1.00 27.11 ? 207 ALA C CB    1 
ATOM   7503  N  N     . SER G  1 210 ? 43.267  -102.082 -7.334  1.00 27.87 ? 208 SER C N     1 
ATOM   7504  C  CA    . SER G  1 210 ? 42.581  -101.239 -6.367  1.00 29.98 ? 208 SER C CA    1 
ATOM   7505  C  C     . SER G  1 210 ? 43.304  -101.250 -5.001  1.00 31.90 ? 208 SER C C     1 
ATOM   7506  O  O     . SER G  1 210 ? 42.866  -100.606 -4.026  1.00 29.49 ? 208 SER C O     1 
ATOM   7507  C  CB    . SER G  1 210 ? 41.122  -101.660 -6.206  1.00 22.41 ? 208 SER C CB    1 
ATOM   7508  O  OG    . SER G  1 210 ? 41.027  -102.754 -5.318  1.00 36.83 ? 208 SER C OG    1 
ATOM   7509  N  N     . LEU G  1 211 ? 44.426  -101.959 -4.933  1.00 28.32 ? 209 LEU C N     1 
ATOM   7510  C  CA    . LEU G  1 211 ? 45.196  -102.042 -3.696  1.00 25.63 ? 209 LEU C CA    1 
ATOM   7511  C  C     . LEU G  1 211 ? 45.611  -100.649 -3.185  1.00 19.63 ? 209 LEU C C     1 
ATOM   7512  O  O     . LEU G  1 211 ? 46.118  -99.808  -3.964  1.00 21.89 ? 209 LEU C O     1 
ATOM   7513  C  CB    . LEU G  1 211 ? 46.432  -102.880 -3.958  1.00 25.29 ? 209 LEU C CB    1 
ATOM   7514  C  CG    . LEU G  1 211 ? 47.129  -103.354 -2.700  1.00 26.22 ? 209 LEU C CG    1 
ATOM   7515  C  CD1   . LEU G  1 211 ? 47.785  -104.688 -2.973  1.00 34.02 ? 209 LEU C CD1   1 
ATOM   7516  C  CD2   . LEU G  1 211 ? 48.180  -102.338 -2.325  1.00 27.05 ? 209 LEU C CD2   1 
ATOM   7517  N  N     . GLY G  1 212 ? 45.409  -100.383 -1.895  1.00 20.06 ? 210 GLY C N     1 
ATOM   7518  C  CA    . GLY G  1 212 ? 45.911  -99.125  -1.328  1.00 21.20 ? 210 GLY C CA    1 
ATOM   7519  C  C     . GLY G  1 212 ? 44.850  -98.074  -1.024  1.00 23.53 ? 210 GLY C C     1 
ATOM   7520  O  O     . GLY G  1 212 ? 43.641  -98.331  -1.156  1.00 20.51 ? 210 GLY C O     1 
ATOM   7521  N  N     . SER G  1 213 ? 45.294  -96.881  -0.623  1.00 16.98 ? 211 SER C N     1 
ATOM   7522  C  CA    . SER G  1 213 ? 44.383  -95.857  -0.111  1.00 17.58 ? 211 SER C CA    1 
ATOM   7523  C  C     . SER G  1 213 ? 44.000  -94.818  -1.171  1.00 17.36 ? 211 SER C C     1 
ATOM   7524  O  O     . SER G  1 213 ? 44.867  -94.203  -1.800  1.00 16.65 ? 211 SER C O     1 
ATOM   7525  C  CB    . SER G  1 213 ? 45.013  -95.135  1.082   1.00 15.18 ? 211 SER C CB    1 
ATOM   7526  O  OG    . SER G  1 213 ? 44.448  -93.861  1.273   1.00 11.76 ? 211 SER C OG    1 
ATOM   7527  N  N     . PRO G  1 214 ? 42.703  -94.606  -1.362  1.00 21.60 ? 212 PRO C N     1 
ATOM   7528  C  CA    . PRO G  1 214 ? 42.377  -93.553  -2.342  1.00 20.55 ? 212 PRO C CA    1 
ATOM   7529  C  C     . PRO G  1 214 ? 42.794  -92.154  -1.865  1.00 18.86 ? 212 PRO C C     1 
ATOM   7530  O  O     . PRO G  1 214 ? 43.002  -91.259  -2.695  1.00 16.05 ? 212 PRO C O     1 
ATOM   7531  C  CB    . PRO G  1 214 ? 40.850  -93.604  -2.425  1.00 20.12 ? 212 PRO C CB    1 
ATOM   7532  C  CG    . PRO G  1 214 ? 40.390  -94.643  -1.419  1.00 19.08 ? 212 PRO C CG    1 
ATOM   7533  C  CD    . PRO G  1 214 ? 41.543  -95.460  -1.015  1.00 17.72 ? 212 PRO C CD    1 
ATOM   7534  N  N     . ILE G  1 215 ? 42.857  -91.965  -0.549  1.00 19.74 ? 213 ILE C N     1 
ATOM   7535  C  CA    . ILE G  1 215 ? 43.224  -90.649  -0.011  1.00 16.97 ? 213 ILE C CA    1 
ATOM   7536  C  C     . ILE G  1 215 ? 44.693  -90.374  -0.360  1.00 19.97 ? 213 ILE C C     1 
ATOM   7537  O  O     . ILE G  1 215 ? 45.041  -89.307  -0.891  1.00 17.14 ? 213 ILE C O     1 
ATOM   7538  C  CB    . ILE G  1 215 ? 42.957  -90.592  1.505   1.00 15.56 ? 213 ILE C CB    1 
ATOM   7539  C  CG1   . ILE G  1 215 ? 41.438  -90.445  1.792   1.00 22.42 ? 213 ILE C CG1   1 
ATOM   7540  C  CG2   . ILE G  1 215 ? 43.790  -89.498  2.153   1.00 19.91 ? 213 ILE C CG2   1 
ATOM   7541  C  CD1   . ILE G  1 215 ? 40.976  -90.854  3.231   1.00 14.31 ? 213 ILE C CD1   1 
ATOM   7542  N  N     . ASN G  1 216 ? 45.572  -91.348  -0.081  1.00 18.02 ? 214 ASN C N     1 
ATOM   7543  C  CA    . ASN G  1 216 ? 46.968  -91.217  -0.465  1.00 20.26 ? 214 ASN C CA    1 
ATOM   7544  C  C     . ASN G  1 216 ? 47.159  -91.072  -1.977  1.00 19.48 ? 214 ASN C C     1 
ATOM   7545  O  O     . ASN G  1 216 ? 48.108  -90.425  -2.436  1.00 15.95 ? 214 ASN C O     1 
ATOM   7546  C  CB    . ASN G  1 216 ? 47.838  -92.367  0.111   1.00 14.85 ? 214 ASN C CB    1 
ATOM   7547  C  CG    . ASN G  1 216 ? 47.981  -92.285  1.633   1.00 15.48 ? 214 ASN C CG    1 
ATOM   7548  O  OD1   . ASN G  1 216 ? 48.108  -91.199  2.161   1.00 17.76 ? 214 ASN C OD1   1 
ATOM   7549  N  ND2   . ASN G  1 216 ? 47.942  -93.426  2.337   1.00 15.31 ? 214 ASN C ND2   1 
ATOM   7550  N  N     . LYS G  1 217 ? 46.297  -91.717  -2.755  1.00 17.59 ? 215 LYS C N     1 
ATOM   7551  C  CA    . LYS G  1 217 ? 46.367  -91.578  -4.208  1.00 15.27 ? 215 LYS C CA    1 
ATOM   7552  C  C     . LYS G  1 217 ? 46.107  -90.121  -4.621  1.00 14.81 ? 215 LYS C C     1 
ATOM   7553  O  O     . LYS G  1 217 ? 46.840  -89.558  -5.423  1.00 19.52 ? 215 LYS C O     1 
ATOM   7554  C  CB    . LYS G  1 217 ? 45.348  -92.483  -4.907  1.00 17.50 ? 215 LYS C CB    1 
ATOM   7555  C  CG    . LYS G  1 217 ? 45.287  -92.265  -6.439  1.00 26.77 ? 215 LYS C CG    1 
ATOM   7556  C  CD    . LYS G  1 217 ? 43.988  -92.838  -7.064  1.00 26.30 ? 215 LYS C CD    1 
ATOM   7557  C  CE    . LYS G  1 217 ? 42.722  -92.213  -6.469  1.00 27.12 ? 215 LYS C CE    1 
ATOM   7558  N  NZ    . LYS G  1 217 ? 41.520  -93.001  -6.867  1.00 34.21 ? 215 LYS C NZ    1 
ATOM   7559  N  N     . VAL G  1 218 ? 45.069  -89.512  -4.051  1.00 17.37 ? 216 VAL C N     1 
ATOM   7560  C  CA    . VAL G  1 218 ? 44.727  -88.118  -4.373  1.00 16.43 ? 216 VAL C CA    1 
ATOM   7561  C  C     . VAL G  1 218 ? 45.873  -87.183  -3.982  1.00 23.92 ? 216 VAL C C     1 
ATOM   7562  O  O     . VAL G  1 218 ? 46.298  -86.325  -4.767  1.00 18.97 ? 216 VAL C O     1 
ATOM   7563  C  CB    . VAL G  1 218 ? 43.314  -87.740  -3.787  1.00 21.56 ? 216 VAL C CB    1 
ATOM   7564  C  CG1   . VAL G  1 218 ? 43.029  -86.249  -3.870  1.00 19.50 ? 216 VAL C CG1   1 
ATOM   7565  C  CG2   . VAL G  1 218 ? 42.234  -88.504  -4.551  1.00 18.14 ? 216 VAL C CG2   1 
ATOM   7566  N  N     . ILE G  1 219 ? 46.438  -87.397  -2.796  1.00 19.34 ? 217 ILE C N     1 
ATOM   7567  C  CA    . ILE G  1 219 ? 47.568  -86.564  -2.361  1.00 15.58 ? 217 ILE C CA    1 
ATOM   7568  C  C     . ILE G  1 219 ? 48.788  -86.708  -3.270  1.00 18.26 ? 217 ILE C C     1 
ATOM   7569  O  O     . ILE G  1 219 ? 49.453  -85.714  -3.586  1.00 17.14 ? 217 ILE C O     1 
ATOM   7570  C  CB    . ILE G  1 219 ? 47.944  -86.816  -0.876  1.00 18.52 ? 217 ILE C CB    1 
ATOM   7571  C  CG1   . ILE G  1 219 ? 46.770  -86.454  0.034   1.00 17.42 ? 217 ILE C CG1   1 
ATOM   7572  C  CG2   . ILE G  1 219 ? 49.225  -86.024  -0.459  1.00 13.61 ? 217 ILE C CG2   1 
ATOM   7573  C  CD1   . ILE G  1 219 ? 46.903  -86.999  1.465   1.00 20.23 ? 217 ILE C CD1   1 
ATOM   7574  N  N     . LEU G  1 220 ? 49.104  -87.940  -3.677  1.00 16.68 ? 218 LEU C N     1 
ATOM   7575  C  CA    . LEU G  1 220 ? 50.241  -88.160  -4.552  1.00 17.11 ? 218 LEU C CA    1 
ATOM   7576  C  C     . LEU G  1 220 ? 50.062  -87.431  -5.885  1.00 23.71 ? 218 LEU C C     1 
ATOM   7577  O  O     . LEU G  1 220 ? 51.001  -86.804  -6.397  1.00 23.23 ? 218 LEU C O     1 
ATOM   7578  C  CB    . LEU G  1 220 ? 50.447  -89.651  -4.806  1.00 17.23 ? 218 LEU C CB    1 
ATOM   7579  C  CG    . LEU G  1 220 ? 51.732  -90.029  -5.539  1.00 22.08 ? 218 LEU C CG    1 
ATOM   7580  C  CD1   . LEU G  1 220 ? 52.176  -91.456  -5.125  1.00 23.12 ? 218 LEU C CD1   1 
ATOM   7581  C  CD2   . LEU G  1 220 ? 51.561  -89.918  -7.063  1.00 23.32 ? 218 LEU C CD2   1 
ATOM   7582  N  N     . ASN G  1 221 ? 48.870  -87.553  -6.449  1.00 20.44 ? 219 ASN C N     1 
ATOM   7583  C  CA    . ASN G  1 221 ? 48.518  -86.871  -7.676  1.00 25.15 ? 219 ASN C CA    1 
ATOM   7584  C  C     . ASN G  1 221 ? 48.570  -85.338  -7.541  1.00 23.25 ? 219 ASN C C     1 
ATOM   7585  O  O     . ASN G  1 221 ? 48.840  -84.651  -8.517  1.00 24.32 ? 219 ASN C O     1 
ATOM   7586  C  CB    . ASN G  1 221 ? 47.121  -87.313  -8.158  1.00 21.49 ? 219 ASN C CB    1 
ATOM   7587  C  CG    . ASN G  1 221 ? 47.100  -88.752  -8.710  1.00 22.58 ? 219 ASN C CG    1 
ATOM   7588  O  OD1   . ASN G  1 221 ? 48.149  -89.339  -9.034  1.00 30.66 ? 219 ASN C OD1   1 
ATOM   7589  N  ND2   . ASN G  1 221 ? 45.904  -89.313  -8.820  1.00 28.68 ? 219 ASN C ND2   1 
ATOM   7590  N  N     . THR G  1 222 ? 48.265  -84.808  -6.356  1.00 19.67 ? 220 THR C N     1 
ATOM   7591  C  CA    . THR G  1 222 ? 48.147  -83.357  -6.188  1.00 19.60 ? 220 THR C CA    1 
ATOM   7592  C  C     . THR G  1 222 ? 49.527  -82.756  -5.942  1.00 21.21 ? 220 THR C C     1 
ATOM   7593  O  O     . THR G  1 222 ? 49.866  -81.712  -6.471  1.00 24.10 ? 220 THR C O     1 
ATOM   7594  C  CB    . THR G  1 222 ? 47.205  -83.029  -5.027  1.00 21.34 ? 220 THR C CB    1 
ATOM   7595  O  OG1   . THR G  1 222 ? 45.950  -83.653  -5.293  1.00 21.35 ? 220 THR C OG1   1 
ATOM   7596  C  CG2   . THR G  1 222 ? 46.955  -81.509  -4.852  1.00 15.81 ? 220 THR C CG2   1 
ATOM   7597  N  N     . LEU G  1 223 ? 50.329  -83.445  -5.136  1.00 20.25 ? 221 LEU C N     1 
ATOM   7598  C  CA    . LEU G  1 223 ? 51.595  -82.916  -4.649  1.00 21.69 ? 221 LEU C CA    1 
ATOM   7599  C  C     . LEU G  1 223 ? 52.779  -83.340  -5.522  1.00 23.59 ? 221 LEU C C     1 
ATOM   7600  O  O     . LEU G  1 223 ? 53.814  -82.641  -5.609  1.00 16.76 ? 221 LEU C O     1 
ATOM   7601  C  CB    . LEU G  1 223 ? 51.791  -83.383  -3.204  1.00 19.94 ? 221 LEU C CB    1 
ATOM   7602  C  CG    . LEU G  1 223 ? 50.898  -82.727  -2.155  1.00 20.79 ? 221 LEU C CG    1 
ATOM   7603  C  CD1   . LEU G  1 223 ? 51.359  -83.119  -0.763  1.00 21.20 ? 221 LEU C CD1   1 
ATOM   7604  C  CD2   . LEU G  1 223 ? 50.958  -81.213  -2.280  1.00 21.19 ? 221 LEU C CD2   1 
ATOM   7605  N  N     . LYS G  1 224 ? 52.617  -84.478  -6.194  1.00 21.08 ? 222 LYS C N     1 
ATOM   7606  C  CA    . LYS G  1 224 ? 53.688  -85.035  -7.030  1.00 20.90 ? 222 LYS C CA    1 
ATOM   7607  C  C     . LYS G  1 224 ? 55.112  -84.899  -6.409  1.00 20.33 ? 222 LYS C C     1 
ATOM   7608  O  O     . LYS G  1 224 ? 56.029  -84.344  -7.016  1.00 17.13 ? 222 LYS C O     1 
ATOM   7609  C  CB    . LYS G  1 224 ? 53.641  -84.449  -8.467  1.00 22.91 ? 222 LYS C CB    1 
ATOM   7610  C  CG    . LYS G  1 224 ? 52.242  -84.571  -9.177  1.00 25.33 ? 222 LYS C CG    1 
ATOM   7611  C  CD    . LYS G  1 224 ? 52.348  -84.212  -10.663 1.00 30.49 ? 222 LYS C CD    1 
ATOM   7612  C  CE    . LYS G  1 224 ? 50.992  -83.935  -11.274 1.00 32.06 ? 222 LYS C CE    1 
ATOM   7613  N  NZ    . LYS G  1 224 ? 50.074  -85.072  -11.164 1.00 37.35 ? 222 LYS C NZ    1 
ATOM   7614  N  N     . PRO G  1 225 ? 55.303  -85.450  -5.201  1.00 22.58 ? 223 PRO C N     1 
ATOM   7615  C  CA    . PRO G  1 225 ? 56.578  -85.322  -4.477  1.00 19.68 ? 223 PRO C CA    1 
ATOM   7616  C  C     . PRO G  1 225 ? 57.640  -86.064  -5.275  1.00 19.47 ? 223 PRO C C     1 
ATOM   7617  O  O     . PRO G  1 225 ? 57.225  -86.897  -6.105  1.00 19.50 ? 223 PRO C O     1 
ATOM   7618  C  CB    . PRO G  1 225 ? 56.311  -86.041  -3.145  1.00 15.44 ? 223 PRO C CB    1 
ATOM   7619  C  CG    . PRO G  1 225 ? 55.133  -86.988  -3.414  1.00 17.03 ? 223 PRO C CG    1 
ATOM   7620  C  CD    . PRO G  1 225 ? 54.311  -86.293  -4.510  1.00 15.72 ? 223 PRO C CD    1 
ATOM   7621  N  N     . LYS G  1 226 ? 58.930  -85.787  -5.048  1.00 18.44 ? 224 LYS C N     1 
ATOM   7622  C  CA    . LYS G  1 226 ? 60.014  -86.550  -5.688  1.00 18.80 ? 224 LYS C CA    1 
ATOM   7623  C  C     . LYS G  1 226 ? 60.002  -88.013  -5.245  1.00 19.01 ? 224 LYS C C     1 
ATOM   7624  O  O     . LYS G  1 226 ? 60.240  -88.919  -6.050  1.00 19.01 ? 224 LYS C O     1 
ATOM   7625  C  CB    . LYS G  1 226 ? 61.381  -85.949  -5.370  1.00 21.02 ? 224 LYS C CB    1 
ATOM   7626  C  CG    . LYS G  1 226 ? 61.636  -84.528  -5.962  1.00 27.84 ? 224 LYS C CG    1 
ATOM   7627  C  CD    . LYS G  1 226 ? 62.725  -83.826  -5.127  1.00 30.12 ? 224 LYS C CD    1 
ATOM   7628  C  CE    . LYS G  1 226 ? 63.125  -82.464  -5.660  1.00 32.02 ? 224 LYS C CE    1 
ATOM   7629  N  NZ    . LYS G  1 226 ? 64.284  -82.648  -6.594  1.00 54.59 ? 224 LYS C NZ    1 
ATOM   7630  N  N     . TYR G  1 227 ? 59.739  -88.219  -3.959  1.00 15.39 ? 225 TYR C N     1 
ATOM   7631  C  CA    . TYR G  1 227 ? 59.614  -89.547  -3.373  1.00 19.50 ? 225 TYR C CA    1 
ATOM   7632  C  C     . TYR G  1 227 ? 58.289  -89.741  -2.631  1.00 20.37 ? 225 TYR C C     1 
ATOM   7633  O  O     . TYR G  1 227 ? 57.753  -88.799  -1.994  1.00 16.57 ? 225 TYR C O     1 
ATOM   7634  C  CB    . TYR G  1 227 ? 60.772  -89.804  -2.392  1.00 16.65 ? 225 TYR C CB    1 
ATOM   7635  C  CG    . TYR G  1 227 ? 62.136  -89.816  -3.050  1.00 17.13 ? 225 TYR C CG    1 
ATOM   7636  C  CD1   . TYR G  1 227 ? 62.871  -88.641  -3.206  1.00 23.54 ? 225 TYR C CD1   1 
ATOM   7637  C  CD2   . TYR G  1 227 ? 62.679  -90.987  -3.533  1.00 19.50 ? 225 TYR C CD2   1 
ATOM   7638  C  CE1   . TYR G  1 227 ? 64.086  -88.644  -3.835  1.00 25.39 ? 225 TYR C CE1   1 
ATOM   7639  C  CE2   . TYR G  1 227 ? 63.895  -91.003  -4.154  1.00 24.76 ? 225 TYR C CE2   1 
ATOM   7640  C  CZ    . TYR G  1 227 ? 64.595  -89.825  -4.303  1.00 29.02 ? 225 TYR C CZ    1 
ATOM   7641  O  OH    . TYR G  1 227 ? 65.820  -89.841  -4.905  1.00 29.21 ? 225 TYR C OH    1 
ATOM   7642  N  N     . TRP G  1 228 ? 57.754  -90.963  -2.691  1.00 18.78 ? 226 TRP C N     1 
ATOM   7643  C  CA    . TRP G  1 228 ? 56.695  -91.352  -1.773  1.00 13.75 ? 226 TRP C CA    1 
ATOM   7644  C  C     . TRP G  1 228 ? 57.105  -92.675  -1.139  1.00 20.39 ? 226 TRP C C     1 
ATOM   7645  O  O     . TRP G  1 228 ? 57.433  -93.655  -1.852  1.00 17.18 ? 226 TRP C O     1 
ATOM   7646  C  CB    . TRP G  1 228 ? 55.338  -91.526  -2.489  1.00 15.72 ? 226 TRP C CB    1 
ATOM   7647  C  CG    . TRP G  1 228 ? 54.163  -91.605  -1.550  1.00 15.62 ? 226 TRP C CG    1 
ATOM   7648  C  CD1   . TRP G  1 228 ? 53.837  -92.657  -0.711  1.00 19.93 ? 226 TRP C CD1   1 
ATOM   7649  C  CD2   . TRP G  1 228 ? 53.125  -90.615  -1.363  1.00 15.74 ? 226 TRP C CD2   1 
ATOM   7650  N  NE1   . TRP G  1 228 ? 52.655  -92.373  -0.014  1.00 12.71 ? 226 TRP C NE1   1 
ATOM   7651  C  CE2   . TRP G  1 228 ? 52.218  -91.119  -0.390  1.00 14.86 ? 226 TRP C CE2   1 
ATOM   7652  C  CE3   . TRP G  1 228 ? 52.884  -89.335  -1.914  1.00 13.89 ? 226 TRP C CE3   1 
ATOM   7653  C  CZ2   . TRP G  1 228 ? 51.089  -90.380  0.054   1.00 16.87 ? 226 TRP C CZ2   1 
ATOM   7654  C  CZ3   . TRP G  1 228 ? 51.771  -88.609  -1.476  1.00 16.48 ? 226 TRP C CZ3   1 
ATOM   7655  C  CH2   . TRP G  1 228 ? 50.876  -89.136  -0.504  1.00 16.21 ? 226 TRP C CH2   1 
ATOM   7656  N  N     . ILE G  1 229 ? 57.046  -92.729  0.194   1.00 18.19 ? 227 ILE C N     1 
ATOM   7657  C  CA    . ILE G  1 229 ? 57.522  -93.904  0.935   1.00 13.03 ? 227 ILE C CA    1 
ATOM   7658  C  C     . ILE G  1 229 ? 56.371  -94.439  1.783   1.00 13.84 ? 227 ILE C C     1 
ATOM   7659  O  O     . ILE G  1 229 ? 55.666  -93.648  2.433   1.00 12.24 ? 227 ILE C O     1 
ATOM   7660  C  CB    . ILE G  1 229 ? 58.748  -93.538  1.806   1.00 13.33 ? 227 ILE C CB    1 
ATOM   7661  C  CG1   . ILE G  1 229 ? 59.766  -92.766  0.957   1.00 14.89 ? 227 ILE C CG1   1 
ATOM   7662  C  CG2   . ILE G  1 229 ? 59.367  -94.816  2.393   1.00 17.18 ? 227 ILE C CG2   1 
ATOM   7663  C  CD1   . ILE G  1 229 ? 61.160  -92.597  1.572   1.00 20.68 ? 227 ILE C CD1   1 
ATOM   7664  N  N     . SER G  1 230 ? 56.146  -95.771  1.759   1.00 12.10 ? 228 SER C N     1 
ATOM   7665  C  CA    . SER G  1 230 ? 55.039  -96.369  2.502   1.00 16.30 ? 228 SER C CA    1 
ATOM   7666  C  C     . SER G  1 230 ? 55.416  -97.667  3.213   1.00 18.27 ? 228 SER C C     1 
ATOM   7667  O  O     . SER G  1 230 ? 56.277  -98.404  2.740   1.00 18.17 ? 228 SER C O     1 
ATOM   7668  C  CB    . SER G  1 230 ? 53.802  -96.570  1.607   1.00 12.45 ? 228 SER C CB    1 
ATOM   7669  O  OG    . SER G  1 230 ? 53.391  -95.334  1.032   1.00 16.74 ? 228 SER C OG    1 
ATOM   7670  N  N     . GLY G  1 231 ? 54.741  -97.939  4.331   1.00 15.72 ? 229 GLY C N     1 
ATOM   7671  C  CA    . GLY G  1 231 ? 55.228  -98.945  5.246   1.00 20.25 ? 229 GLY C CA    1 
ATOM   7672  C  C     . GLY G  1 231 ? 54.310  -100.104 5.643   1.00 21.05 ? 229 GLY C C     1 
ATOM   7673  O  O     . GLY G  1 231 ? 54.764  -101.009 6.330   1.00 19.79 ? 229 GLY C O     1 
ATOM   7674  N  N     . HIS G  1 232 ? 53.050  -100.110 5.224   1.00 15.96 ? 230 HIS C N     1 
ATOM   7675  C  CA    . HIS G  1 232 ? 52.081  -101.095 5.729   1.00 16.71 ? 230 HIS C CA    1 
ATOM   7676  C  C     . HIS G  1 232 ? 52.200  -102.507 5.132   1.00 15.45 ? 230 HIS C C     1 
ATOM   7677  O  O     . HIS G  1 232 ? 51.810  -103.474 5.766   1.00 18.02 ? 230 HIS C O     1 
ATOM   7678  C  CB    . HIS G  1 232 ? 50.700  -100.531 5.446   1.00 17.01 ? 230 HIS C CB    1 
ATOM   7679  C  CG    . HIS G  1 232 ? 49.550  -101.379 5.907   1.00 16.71 ? 230 HIS C CG    1 
ATOM   7680  N  ND1   . HIS G  1 232 ? 49.373  -101.833 7.200   1.00 19.74 ? 230 HIS C ND1   1 
ATOM   7681  C  CD2   . HIS G  1 232 ? 48.433  -101.795 5.229   1.00 19.58 ? 230 HIS C CD2   1 
ATOM   7682  C  CE1   . HIS G  1 232 ? 48.239  -102.482 7.306   1.00 16.64 ? 230 HIS C CE1   1 
ATOM   7683  N  NE2   . HIS G  1 232 ? 47.642  -102.481 6.125   1.00 19.69 ? 230 HIS C NE2   1 
ATOM   7684  N  N     . MET G  1 233 ? 52.684  -102.608 3.902   1.00 16.74 ? 231 MET C N     1 
ATOM   7685  C  CA    . MET G  1 233 ? 52.946  -103.923 3.283   1.00 23.16 ? 231 MET C CA    1 
ATOM   7686  C  C     . MET G  1 233 ? 54.359  -104.409 3.508   1.00 21.57 ? 231 MET C C     1 
ATOM   7687  O  O     . MET G  1 233 ? 55.339  -103.685 3.237   1.00 20.91 ? 231 MET C O     1 
ATOM   7688  C  CB    . MET G  1 233 ? 52.743  -103.912 1.777   1.00 23.35 ? 231 MET C CB    1 
ATOM   7689  C  CG    . MET G  1 233 ? 51.674  -103.009 1.306   1.00 27.37 ? 231 MET C CG    1 
ATOM   7690  S  SD    . MET G  1 233 ? 50.065  -103.745 1.446   1.00 39.92 ? 231 MET C SD    1 
ATOM   7691  C  CE    . MET G  1 233 ? 49.627  -103.718 -0.282  1.00 34.63 ? 231 MET C CE    1 
ATOM   7692  N  N     . HIS G  1 234 ? 54.455  -105.663 3.941   1.00 20.00 ? 232 HIS C N     1 
ATOM   7693  C  CA    . HIS G  1 234 ? 55.729  -106.286 4.273   1.00 26.44 ? 232 HIS C CA    1 
ATOM   7694  C  C     . HIS G  1 234 ? 56.482  -106.739 3.035   1.00 28.59 ? 232 HIS C C     1 
ATOM   7695  O  O     . HIS G  1 234 ? 56.393  -107.908 2.630   1.00 23.17 ? 232 HIS C O     1 
ATOM   7696  C  CB    . HIS G  1 234 ? 55.488  -107.495 5.169   1.00 26.99 ? 232 HIS C CB    1 
ATOM   7697  C  CG    . HIS G  1 234 ? 54.856  -107.147 6.471   1.00 28.48 ? 232 HIS C CG    1 
ATOM   7698  N  ND1   . HIS G  1 234 ? 54.877  -105.867 6.991   1.00 25.27 ? 232 HIS C ND1   1 
ATOM   7699  C  CD2   . HIS G  1 234 ? 54.185  -107.910 7.369   1.00 26.80 ? 232 HIS C CD2   1 
ATOM   7700  C  CE1   . HIS G  1 234 ? 54.242  -105.856 8.148   1.00 26.09 ? 232 HIS C CE1   1 
ATOM   7701  N  NE2   . HIS G  1 234 ? 53.817  -107.082 8.404   1.00 32.23 ? 232 HIS C NE2   1 
ATOM   7702  N  N     . CYS G  1 235 ? 57.218  -105.818 2.434   1.00 21.77 ? 233 CYS C N     1 
ATOM   7703  C  CA    . CYS G  1 235 ? 57.993  -106.112 1.241   1.00 22.72 ? 233 CYS C CA    1 
ATOM   7704  C  C     . CYS G  1 235 ? 58.830  -104.901 0.888   1.00 22.59 ? 233 CYS C C     1 
ATOM   7705  O  O     . CYS G  1 235 ? 58.653  -103.821 1.450   1.00 27.46 ? 233 CYS C O     1 
ATOM   7706  C  CB    . CYS G  1 235 ? 57.070  -106.413 0.058   1.00 26.38 ? 233 CYS C CB    1 
ATOM   7707  S  SG    . CYS G  1 235 ? 56.167  -104.942 -0.524  1.00 25.39 ? 233 CYS C SG    1 
ATOM   7708  N  N     . GLU G  1 236 ? 59.732  -105.098 -0.057  1.00 20.37 ? 234 GLU C N     1 
ATOM   7709  C  CA    . GLU G  1 236 ? 60.409  -104.012 -0.727  1.00 25.85 ? 234 GLU C CA    1 
ATOM   7710  C  C     . GLU G  1 236 ? 59.745  -103.867 -2.083  1.00 25.75 ? 234 GLU C C     1 
ATOM   7711  O  O     . GLU G  1 236 ? 59.566  -104.876 -2.761  1.00 22.66 ? 234 GLU C O     1 
ATOM   7712  C  CB    . GLU G  1 236 ? 61.828  -104.444 -0.985  1.00 33.40 ? 234 GLU C CB    1 
ATOM   7713  C  CG    . GLU G  1 236 ? 62.595  -103.506 -1.858  1.00 37.34 ? 234 GLU C CG    1 
ATOM   7714  C  CD    . GLU G  1 236 ? 63.619  -102.784 -1.049  1.00 47.42 ? 234 GLU C CD    1 
ATOM   7715  O  OE1   . GLU G  1 236 ? 63.503  -102.856 0.198   1.00 49.38 ? 234 GLU C OE1   1 
ATOM   7716  O  OE2   . GLU G  1 236 ? 64.535  -102.169 -1.642  1.00 49.59 ? 234 GLU C OE2   1 
ATOM   7717  N  N     . TYR G  1 237 ? 59.415  -102.643 -2.508  1.00 21.08 ? 235 TYR C N     1 
ATOM   7718  C  CA    . TYR G  1 237 ? 58.837  -102.456 -3.835  1.00 17.84 ? 235 TYR C CA    1 
ATOM   7719  C  C     . TYR G  1 237 ? 59.108  -101.037 -4.306  1.00 23.06 ? 235 TYR C C     1 
ATOM   7720  O  O     . TYR G  1 237 ? 59.111  -100.115 -3.494  1.00 23.92 ? 235 TYR C O     1 
ATOM   7721  C  CB    . TYR G  1 237 ? 57.337  -102.723 -3.786  1.00 17.46 ? 235 TYR C CB    1 
ATOM   7722  C  CG    . TYR G  1 237 ? 56.676  -102.784 -5.144  1.00 22.42 ? 235 TYR C CG    1 
ATOM   7723  C  CD1   . TYR G  1 237 ? 56.993  -103.791 -6.054  1.00 21.82 ? 235 TYR C CD1   1 
ATOM   7724  C  CD2   . TYR G  1 237 ? 55.722  -101.840 -5.515  1.00 20.64 ? 235 TYR C CD2   1 
ATOM   7725  C  CE1   . TYR G  1 237 ? 56.373  -103.846 -7.312  1.00 20.61 ? 235 TYR C CE1   1 
ATOM   7726  C  CE2   . TYR G  1 237 ? 55.085  -101.893 -6.753  1.00 22.43 ? 235 TYR C CE2   1 
ATOM   7727  C  CZ    . TYR G  1 237 ? 55.413  -102.902 -7.645  1.00 20.47 ? 235 TYR C CZ    1 
ATOM   7728  O  OH    . TYR G  1 237 ? 54.791  -102.940 -8.878  1.00 21.88 ? 235 TYR C OH    1 
ATOM   7729  N  N     . HIS G  1 238 ? 59.349  -100.867 -5.608  1.00 21.22 ? 236 HIS C N     1 
ATOM   7730  C  CA    . HIS G  1 238 ? 59.638  -99.539  -6.175  1.00 26.59 ? 236 HIS C CA    1 
ATOM   7731  C  C     . HIS G  1 238 ? 58.809  -99.412  -7.390  1.00 21.85 ? 236 HIS C C     1 
ATOM   7732  O  O     . HIS G  1 238 ? 58.603  -100.404 -8.091  1.00 22.53 ? 236 HIS C O     1 
ATOM   7733  C  CB    . HIS G  1 238 ? 61.098  -99.426  -6.619  1.00 22.88 ? 236 HIS C CB    1 
ATOM   7734  C  CG    . HIS G  1 238 ? 62.065  -99.802  -5.561  1.00 34.82 ? 236 HIS C CG    1 
ATOM   7735  N  ND1   . HIS G  1 238 ? 62.918  -98.891  -4.964  1.00 34.49 ? 236 HIS C ND1   1 
ATOM   7736  C  CD2   . HIS G  1 238 ? 62.316  -100.996 -4.968  1.00 34.35 ? 236 HIS C CD2   1 
ATOM   7737  C  CE1   . HIS G  1 238 ? 63.643  -99.505  -4.053  1.00 24.80 ? 236 HIS C CE1   1 
ATOM   7738  N  NE2   . HIS G  1 238 ? 63.310  -100.786 -4.042  1.00 36.98 ? 236 HIS C NE2   1 
ATOM   7739  N  N     . ALA G  1 239 ? 58.347  -98.199  -7.657  1.00 24.17 ? 237 ALA C N     1 
ATOM   7740  C  CA    . ALA G  1 239 ? 57.470  -97.943  -8.780  1.00 25.22 ? 237 ALA C CA    1 
ATOM   7741  C  C     . ALA G  1 239 ? 57.636  -96.485  -9.128  1.00 24.63 ? 237 ALA C C     1 
ATOM   7742  O  O     . ALA G  1 239 ? 58.205  -95.736  -8.324  1.00 23.44 ? 237 ALA C O     1 
ATOM   7743  C  CB    . ALA G  1 239 ? 56.032  -98.254  -8.396  1.00 18.73 ? 237 ALA C CB    1 
ATOM   7744  N  N     . GLU G  1 240 ? 57.139  -96.069  -10.298 1.00 27.73 ? 238 GLU C N     1 
ATOM   7745  C  CA    . GLU G  1 240 ? 57.234  -94.652  -10.712 1.00 28.64 ? 238 GLU C CA    1 
ATOM   7746  C  C     . GLU G  1 240 ? 55.884  -94.162  -11.155 1.00 31.13 ? 238 GLU C C     1 
ATOM   7747  O  O     . GLU G  1 240 ? 55.180  -94.870  -11.891 1.00 33.45 ? 238 GLU C O     1 
ATOM   7748  C  CB    . GLU G  1 240 ? 58.193  -94.488  -11.880 1.00 31.38 ? 238 GLU C CB    1 
ATOM   7749  C  CG    . GLU G  1 240 ? 59.503  -95.162  -11.682 1.00 30.05 ? 238 GLU C CG    1 
ATOM   7750  C  CD    . GLU G  1 240 ? 60.250  -94.627  -10.475 1.00 38.87 ? 238 GLU C CD    1 
ATOM   7751  O  OE1   . GLU G  1 240 ? 60.058  -93.433  -10.153 1.00 39.18 ? 238 GLU C OE1   1 
ATOM   7752  O  OE2   . GLU G  1 240 ? 61.040  -95.391  -9.865  1.00 41.70 ? 238 GLU C OE2   1 
ATOM   7753  N  N     . GLU G  1 241 ? 55.495  -92.972  -10.700 1.00 24.58 ? 239 GLU C N     1 
ATOM   7754  C  CA    . GLU G  1 241 ? 54.249  -92.366  -11.147 1.00 26.98 ? 239 GLU C CA    1 
ATOM   7755  C  C     . GLU G  1 241 ? 54.602  -90.924  -11.485 1.00 33.49 ? 239 GLU C C     1 
ATOM   7756  O  O     . GLU G  1 241 ? 54.815  -90.088  -10.578 1.00 24.43 ? 239 GLU C O     1 
ATOM   7757  C  CB    . GLU G  1 241 ? 53.185  -92.418  -10.046 1.00 29.62 ? 239 GLU C CB    1 
ATOM   7758  C  CG    . GLU G  1 241 ? 51.842  -91.823  -10.448 1.00 29.10 ? 239 GLU C CG    1 
ATOM   7759  C  CD    . GLU G  1 241 ? 51.309  -92.465  -11.730 1.00 41.95 ? 239 GLU C CD    1 
ATOM   7760  O  OE1   . GLU G  1 241 ? 51.231  -91.758  -12.760 1.00 42.94 ? 239 GLU C OE1   1 
ATOM   7761  O  OE2   . GLU G  1 241 ? 50.987  -93.676  -11.713 1.00 42.97 ? 239 GLU C OE2   1 
ATOM   7762  N  N     . GLY G  1 242 ? 54.691  -90.619  -12.777 1.00 33.04 ? 240 GLY C N     1 
ATOM   7763  C  CA    . GLY G  1 242 ? 55.120  -89.287  -13.158 1.00 28.36 ? 240 GLY C CA    1 
ATOM   7764  C  C     . GLY G  1 242 ? 56.483  -89.051  -12.542 1.00 27.85 ? 240 GLY C C     1 
ATOM   7765  O  O     . GLY G  1 242 ? 57.330  -89.925  -12.587 1.00 25.81 ? 240 GLY C O     1 
ATOM   7766  N  N     . PRO G  1 243 ? 56.702  -87.861  -11.957 1.00 29.97 ? 241 PRO C N     1 
ATOM   7767  C  CA    . PRO G  1 243 ? 57.991  -87.518  -11.340 1.00 29.95 ? 241 PRO C CA    1 
ATOM   7768  C  C     . PRO G  1 243 ? 58.203  -88.158  -9.956  1.00 28.56 ? 241 PRO C C     1 
ATOM   7769  O  O     . PRO G  1 243 ? 59.257  -87.949  -9.334  1.00 25.07 ? 241 PRO C O     1 
ATOM   7770  C  CB    . PRO G  1 243 ? 57.919  -85.987  -11.214 1.00 24.33 ? 241 PRO C CB    1 
ATOM   7771  C  CG    . PRO G  1 243 ? 56.420  -85.704  -11.051 1.00 30.77 ? 241 PRO C CG    1 
ATOM   7772  C  CD    . PRO G  1 243 ? 55.723  -86.758  -11.896 1.00 25.65 ? 241 PRO C CD    1 
ATOM   7773  N  N     . THR G  1 244 ? 57.240  -88.953  -9.485  1.00 22.72 ? 242 THR C N     1 
ATOM   7774  C  CA    . THR G  1 244 ? 57.312  -89.482  -8.119  1.00 19.45 ? 242 THR C CA    1 
ATOM   7775  C  C     . THR G  1 244 ? 57.925  -90.909  -8.104  1.00 22.59 ? 242 THR C C     1 
ATOM   7776  O  O     . THR G  1 244 ? 57.446  -91.807  -8.796  1.00 21.73 ? 242 THR C O     1 
ATOM   7777  C  CB    . THR G  1 244 ? 55.912  -89.510  -7.458  1.00 17.73 ? 242 THR C CB    1 
ATOM   7778  O  OG1   . THR G  1 244 ? 55.333  -88.176  -7.434  1.00 22.60 ? 242 THR C OG1   1 
ATOM   7779  C  CG2   . THR G  1 244 ? 56.011  -90.100  -6.032  1.00 14.86 ? 242 THR C CG2   1 
ATOM   7780  N  N     . HIS G  1 245 ? 58.991  -91.104  -7.333  1.00 19.20 ? 243 HIS C N     1 
ATOM   7781  C  CA    . HIS G  1 245 ? 59.545  -92.427  -7.087  1.00 21.82 ? 243 HIS C CA    1 
ATOM   7782  C  C     . HIS G  1 245 ? 58.903  -93.013  -5.844  1.00 22.71 ? 243 HIS C C     1 
ATOM   7783  O  O     . HIS G  1 245 ? 59.060  -92.470  -4.754  1.00 22.36 ? 243 HIS C O     1 
ATOM   7784  C  CB    . HIS G  1 245 ? 61.054  -92.334  -6.824  1.00 21.79 ? 243 HIS C CB    1 
ATOM   7785  C  CG    . HIS G  1 245 ? 61.828  -91.803  -7.975  1.00 33.64 ? 243 HIS C CG    1 
ATOM   7786  N  ND1   . HIS G  1 245 ? 62.179  -92.577  -9.069  1.00 33.05 ? 243 HIS C ND1   1 
ATOM   7787  C  CD2   . HIS G  1 245 ? 62.344  -90.569  -8.221  1.00 38.87 ? 243 HIS C CD2   1 
ATOM   7788  C  CE1   . HIS G  1 245 ? 62.857  -91.849  -9.925  1.00 40.54 ? 243 HIS C CE1   1 
ATOM   7789  N  NE2   . HIS G  1 245 ? 62.973  -90.620  -9.438  1.00 41.86 ? 243 HIS C NE2   1 
ATOM   7790  N  N     . PHE G  1 246 ? 58.187  -94.120  -5.991  1.00 18.64 ? 244 PHE C N     1 
ATOM   7791  C  CA    . PHE G  1 246 ? 57.495  -94.709  -4.856  1.00 18.20 ? 244 PHE C CA    1 
ATOM   7792  C  C     . PHE G  1 246 ? 58.375  -95.807  -4.324  1.00 22.72 ? 244 PHE C C     1 
ATOM   7793  O  O     . PHE G  1 246 ? 58.991  -96.576  -5.108  1.00 19.72 ? 244 PHE C O     1 
ATOM   7794  C  CB    . PHE G  1 246 ? 56.145  -95.284  -5.275  1.00 19.50 ? 244 PHE C CB    1 
ATOM   7795  C  CG    . PHE G  1 246 ? 55.517  -96.137  -4.229  1.00 15.89 ? 244 PHE C CG    1 
ATOM   7796  C  CD1   . PHE G  1 246 ? 54.854  -95.559  -3.135  1.00 21.15 ? 244 PHE C CD1   1 
ATOM   7797  C  CD2   . PHE G  1 246 ? 55.570  -97.523  -4.329  1.00 19.82 ? 244 PHE C CD2   1 
ATOM   7798  C  CE1   . PHE G  1 246 ? 54.250  -96.351  -2.139  1.00 20.08 ? 244 PHE C CE1   1 
ATOM   7799  C  CE2   . PHE G  1 246 ? 54.988  -98.343  -3.341  1.00 16.23 ? 244 PHE C CE2   1 
ATOM   7800  C  CZ    . PHE G  1 246 ? 54.324  -97.758  -2.243  1.00 16.53 ? 244 PHE C CZ    1 
ATOM   7801  N  N     . ILE G  1 247 ? 58.473  -95.872  -3.001  1.00 17.38 ? 245 ILE C N     1 
ATOM   7802  C  CA    . ILE G  1 247 ? 59.284  -96.891  -2.353  1.00 14.67 ? 245 ILE C CA    1 
ATOM   7803  C  C     . ILE G  1 247 ? 58.516  -97.510  -1.211  1.00 18.15 ? 245 ILE C C     1 
ATOM   7804  O  O     . ILE G  1 247 ? 58.104  -96.774  -0.299  1.00 16.76 ? 245 ILE C O     1 
ATOM   7805  C  CB    . ILE G  1 247 ? 60.555  -96.287  -1.758  1.00 17.06 ? 245 ILE C CB    1 
ATOM   7806  C  CG1   . ILE G  1 247 ? 61.377  -95.570  -2.835  1.00 20.18 ? 245 ILE C CG1   1 
ATOM   7807  C  CG2   . ILE G  1 247 ? 61.391  -97.409  -1.053  1.00 15.74 ? 245 ILE C CG2   1 
ATOM   7808  C  CD1   . ILE G  1 247 ? 62.564  -94.763  -2.287  1.00 20.24 ? 245 ILE C CD1   1 
ATOM   7809  N  N     . ALA G  1 248 ? 58.326  -98.839  -1.241  1.00 15.93 ? 246 ALA C N     1 
ATOM   7810  C  CA    . ALA G  1 248 ? 57.699  -99.544  -0.113  1.00 19.35 ? 246 ALA C CA    1 
ATOM   7811  C  C     . ALA G  1 248 ? 58.746  -100.307 0.699   1.00 19.39 ? 246 ALA C C     1 
ATOM   7812  O  O     . ALA G  1 248 ? 59.683  -100.875 0.131   1.00 22.01 ? 246 ALA C O     1 
ATOM   7813  C  CB    . ALA G  1 248 ? 56.608  -100.473 -0.578  1.00 18.12 ? 246 ALA C CB    1 
ATOM   7814  N  N     . LEU G  1 249 ? 58.575  -100.356 2.017   1.00 18.78 ? 247 LEU C N     1 
ATOM   7815  C  CA    . LEU G  1 249 ? 59.539  -101.049 2.875   1.00 17.87 ? 247 LEU C CA    1 
ATOM   7816  C  C     . LEU G  1 249 ? 58.904  -102.025 3.848   1.00 20.41 ? 247 LEU C C     1 
ATOM   7817  O  O     . LEU G  1 249 ? 57.714  -101.891 4.192   1.00 20.23 ? 247 LEU C O     1 
ATOM   7818  C  CB    . LEU G  1 249 ? 60.394  -100.032 3.625   1.00 23.18 ? 247 LEU C CB    1 
ATOM   7819  C  CG    . LEU G  1 249 ? 61.315  -99.312  2.639   1.00 20.97 ? 247 LEU C CG    1 
ATOM   7820  C  CD1   . LEU G  1 249 ? 62.181  -98.247  3.286   1.00 26.36 ? 247 LEU C CD1   1 
ATOM   7821  C  CD2   . LEU G  1 249 ? 62.187  -100.351 1.922   1.00 30.79 ? 247 LEU C CD2   1 
ATOM   7822  N  N     . GLY G  1 250 ? 59.708  -102.999 4.302   1.00 22.94 ? 248 GLY C N     1 
ATOM   7823  C  CA    . GLY G  1 250 ? 59.223  -104.052 5.182   1.00 20.88 ? 248 GLY C CA    1 
ATOM   7824  C  C     . GLY G  1 250 ? 59.242  -103.742 6.684   1.00 28.52 ? 248 GLY C C     1 
ATOM   7825  O  O     . GLY G  1 250 ? 59.447  -102.582 7.144   1.00 22.48 ? 248 GLY C O     1 
ATOM   7826  N  N     . LYS G  1 251 ? 59.048  -104.814 7.447   1.00 21.43 ? 249 LYS C N     1 
ATOM   7827  C  CA    . LYS G  1 251 ? 58.852  -104.759 8.890   1.00 22.41 ? 249 LYS C CA    1 
ATOM   7828  C  C     . LYS G  1 251 ? 60.156  -105.083 9.590   1.00 20.01 ? 249 LYS C C     1 
ATOM   7829  O  O     . LYS G  1 251 ? 60.846  -106.065 9.222   1.00 20.99 ? 249 LYS C O     1 
ATOM   7830  C  CB    . LYS G  1 251 ? 57.766  -105.775 9.261   1.00 25.12 ? 249 LYS C CB    1 
ATOM   7831  C  CG    . LYS G  1 251 ? 57.581  -106.146 10.743  1.00 33.44 ? 249 LYS C CG    1 
ATOM   7832  C  CD    . LYS G  1 251 ? 56.493  -107.279 10.808  1.00 34.76 ? 249 LYS C CD    1 
ATOM   7833  C  CE    . LYS G  1 251 ? 56.037  -107.623 12.223  1.00 41.60 ? 249 LYS C CE    1 
ATOM   7834  N  NZ    . LYS G  1 251 ? 54.970  -108.694 12.242  1.00 31.25 ? 249 LYS C NZ    1 
ATOM   7835  N  N     . ILE G  1 252 ? 60.531  -104.246 10.561  1.00 23.29 ? 250 ILE C N     1 
ATOM   7836  C  CA    . ILE G  1 252 ? 61.811  -104.431 11.286  1.00 20.63 ? 250 ILE C CA    1 
ATOM   7837  C  C     . ILE G  1 252 ? 61.832  -105.879 11.797  1.00 26.47 ? 250 ILE C C     1 
ATOM   7838  O  O     . ILE G  1 252 ? 60.821  -106.377 12.349  1.00 21.95 ? 250 ILE C O     1 
ATOM   7839  C  CB    . ILE G  1 252 ? 61.956  -103.423 12.475  1.00 19.03 ? 250 ILE C CB    1 
ATOM   7840  C  CG1   . ILE G  1 252 ? 62.162  -101.995 11.948  1.00 18.13 ? 250 ILE C CG1   1 
ATOM   7841  C  CG2   . ILE G  1 252 ? 63.123  -103.781 13.385  1.00 21.21 ? 250 ILE C CG2   1 
ATOM   7842  C  CD1   . ILE G  1 252 ? 63.606  -101.709 11.420  1.00 18.13 ? 250 ILE C CD1   1 
ATOM   7843  N  N     . GLY G  1 253 ? 62.963  -106.547 11.601  1.00 23.84 ? 251 GLY C N     1 
ATOM   7844  C  CA    . GLY G  1 253 ? 63.040  -107.979 11.835  1.00 30.34 ? 251 GLY C CA    1 
ATOM   7845  C  C     . GLY G  1 253 ? 63.328  -108.679 10.518  1.00 35.54 ? 251 GLY C C     1 
ATOM   7846  O  O     . GLY G  1 253 ? 63.966  -109.733 10.498  1.00 34.95 ? 251 GLY C O     1 
ATOM   7847  N  N     . TYR G  1 254 ? 62.862  -108.089 9.414   1.00 34.09 ? 252 TYR C N     1 
ATOM   7848  C  CA    . TYR G  1 254 ? 63.084  -108.654 8.077   1.00 29.70 ? 252 TYR C CA    1 
ATOM   7849  C  C     . TYR G  1 254 ? 64.025  -107.778 7.256   1.00 34.62 ? 252 TYR C C     1 
ATOM   7850  O  O     . TYR G  1 254 ? 64.075  -106.551 7.435   1.00 31.62 ? 252 TYR C O     1 
ATOM   7851  C  CB    . TYR G  1 254 ? 61.752  -108.861 7.353   1.00 29.71 ? 252 TYR C CB    1 
ATOM   7852  C  CG    . TYR G  1 254 ? 60.863  -109.815 8.110   1.00 32.38 ? 252 TYR C CG    1 
ATOM   7853  C  CD1   . TYR G  1 254 ? 60.146  -109.388 9.213   1.00 30.43 ? 252 TYR C CD1   1 
ATOM   7854  C  CD2   . TYR G  1 254 ? 60.801  -111.168 7.762   1.00 41.82 ? 252 TYR C CD2   1 
ATOM   7855  C  CE1   . TYR G  1 254 ? 59.352  -110.262 9.938   1.00 38.29 ? 252 TYR C CE1   1 
ATOM   7856  C  CE2   . TYR G  1 254 ? 60.006  -112.053 8.476   1.00 38.64 ? 252 TYR C CE2   1 
ATOM   7857  C  CZ    . TYR G  1 254 ? 59.289  -111.591 9.571   1.00 43.58 ? 252 TYR C CZ    1 
ATOM   7858  O  OH    . TYR G  1 254 ? 58.497  -112.445 10.304  1.00 44.17 ? 252 TYR C OH    1 
ATOM   7859  N  N     . LYS G  1 255 ? 64.736  -108.421 6.333   1.00 30.46 ? 253 LYS C N     1 
ATOM   7860  C  CA    . LYS G  1 255 ? 65.792  -107.805 5.540   1.00 37.70 ? 253 LYS C CA    1 
ATOM   7861  C  C     . LYS G  1 255 ? 65.320  -106.748 4.530   1.00 40.42 ? 253 LYS C C     1 
ATOM   7862  O  O     . LYS G  1 255 ? 66.146  -106.029 3.941   1.00 46.05 ? 253 LYS C O     1 
ATOM   7863  C  CB    . LYS G  1 255 ? 66.577  -108.911 4.825   1.00 49.39 ? 253 LYS C CB    1 
ATOM   7864  C  CG    . LYS G  1 255 ? 67.619  -108.422 3.850   1.00 49.25 ? 253 LYS C CG    1 
ATOM   7865  C  CD    . LYS G  1 255 ? 68.751  -107.706 4.554   1.00 56.47 ? 253 LYS C CD    1 
ATOM   7866  C  CE    . LYS G  1 255 ? 69.697  -107.072 3.537   1.00 56.43 ? 253 LYS C CE    1 
ATOM   7867  N  NZ    . LYS G  1 255 ? 70.890  -106.472 4.190   1.00 58.74 ? 253 LYS C NZ    1 
ATOM   7868  N  N     . ASN G  1 256 ? 64.011  -106.627 4.331   1.00 26.09 ? 254 ASN C N     1 
ATOM   7869  C  CA    . ASN G  1 256 ? 63.520  -105.576 3.452   1.00 28.63 ? 254 ASN C CA    1 
ATOM   7870  C  C     . ASN G  1 256 ? 62.975  -104.341 4.194   1.00 22.27 ? 254 ASN C C     1 
ATOM   7871  O  O     . ASN G  1 256 ? 62.282  -103.504 3.585   1.00 21.90 ? 254 ASN C O     1 
ATOM   7872  C  CB    . ASN G  1 256 ? 62.476  -106.137 2.483   1.00 29.43 ? 254 ASN C CB    1 
ATOM   7873  C  CG    . ASN G  1 256 ? 61.397  -106.948 3.198   1.00 30.87 ? 254 ASN C CG    1 
ATOM   7874  O  OD1   . ASN G  1 256 ? 61.213  -106.818 4.410   1.00 32.26 ? 254 ASN C OD1   1 
ATOM   7875  N  ND2   . ASN G  1 256 ? 60.676  -107.788 2.444   1.00 28.27 ? 254 ASN C ND2   1 
ATOM   7876  N  N     . ALA G  1 257 ? 63.286  -104.229 5.492   1.00 20.19 ? 255 ALA C N     1 
ATOM   7877  C  CA    . ALA G  1 257 ? 62.697  -103.189 6.361   1.00 16.66 ? 255 ALA C CA    1 
ATOM   7878  C  C     . ALA G  1 257 ? 63.309  -101.787 6.235   1.00 20.75 ? 255 ALA C C     1 
ATOM   7879  O  O     . ALA G  1 257 ? 62.626  -100.760 6.469   1.00 18.81 ? 255 ALA C O     1 
ATOM   7880  C  CB    . ALA G  1 257 ? 62.759  -103.617 7.820   1.00 16.26 ? 255 ALA C CB    1 
ATOM   7881  N  N     . ILE G  1 258 ? 64.593  -101.739 5.922   1.00 16.89 ? 256 ILE C N     1 
ATOM   7882  C  CA    . ILE G  1 258 ? 65.372  -100.478 5.988   1.00 23.17 ? 256 ILE C CA    1 
ATOM   7883  C  C     . ILE G  1 258 ? 66.077  -100.235 4.676   1.00 16.92 ? 256 ILE C C     1 
ATOM   7884  O  O     . ILE G  1 258 ? 66.661  -101.135 4.128   1.00 20.30 ? 256 ILE C O     1 
ATOM   7885  C  CB    . ILE G  1 258 ? 66.443  -100.493 7.097   1.00 15.31 ? 256 ILE C CB    1 
ATOM   7886  C  CG1   . ILE G  1 258 ? 65.808  -100.770 8.460   1.00 19.27 ? 256 ILE C CG1   1 
ATOM   7887  C  CG2   . ILE G  1 258 ? 67.215  -99.132  7.186   1.00 18.91 ? 256 ILE C CG2   1 
ATOM   7888  C  CD1   . ILE G  1 258 ? 66.793  -100.737 9.622   1.00 19.54 ? 256 ILE C CD1   1 
ATOM   7889  N  N     . SER G  1 259 ? 66.011  -99.020  4.156   1.00 18.55 ? 257 SER C N     1 
ATOM   7890  C  CA    . SER G  1 259 ? 66.754  -98.689  2.952   1.00 18.12 ? 257 SER C CA    1 
ATOM   7891  C  C     . SER G  1 259 ? 67.334  -97.321  3.244   1.00 22.80 ? 257 SER C C     1 
ATOM   7892  O  O     . SER G  1 259 ? 67.021  -96.763  4.294   1.00 19.89 ? 257 SER C O     1 
ATOM   7893  C  CB    . SER G  1 259 ? 65.858  -98.660  1.719   1.00 19.71 ? 257 SER C CB    1 
ATOM   7894  O  OG    . SER G  1 259 ? 66.650  -98.639  0.540   1.00 26.74 ? 257 SER C OG    1 
ATOM   7895  N  N     . TYR G  1 260 ? 68.186  -96.809  2.345   1.00 23.11 ? 258 TYR C N     1 
ATOM   7896  C  CA    . TYR G  1 260 ? 68.850  -95.508  2.531   1.00 24.41 ? 258 TYR C CA    1 
ATOM   7897  C  C     . TYR G  1 260 ? 68.674  -94.608  1.306   1.00 26.42 ? 258 TYR C C     1 
ATOM   7898  O  O     . TYR G  1 260 ? 68.814  -95.077  0.173   1.00 24.35 ? 258 TYR C O     1 
ATOM   7899  C  CB    . TYR G  1 260 ? 70.337  -95.727  2.841   1.00 24.23 ? 258 TYR C CB    1 
ATOM   7900  C  CG    . TYR G  1 260 ? 70.499  -96.563  4.090   1.00 26.09 ? 258 TYR C CG    1 
ATOM   7901  C  CD1   . TYR G  1 260 ? 70.491  -97.959  4.025   1.00 23.43 ? 258 TYR C CD1   1 
ATOM   7902  C  CD2   . TYR G  1 260 ? 70.588  -95.962  5.347   1.00 20.93 ? 258 TYR C CD2   1 
ATOM   7903  C  CE1   . TYR G  1 260 ? 70.595  -98.745  5.180   1.00 24.35 ? 258 TYR C CE1   1 
ATOM   7904  C  CE2   . TYR G  1 260 ? 70.686  -96.739  6.520   1.00 20.14 ? 258 TYR C CE2   1 
ATOM   7905  C  CZ    . TYR G  1 260 ? 70.685  -98.124  6.423   1.00 21.41 ? 258 TYR C CZ    1 
ATOM   7906  O  OH    . TYR G  1 260 ? 70.782  -98.897  7.561   1.00 23.60 ? 258 TYR C OH    1 
ATOM   7907  N  N     . LEU G  1 261 ? 68.346  -93.333  1.520   1.00 21.89 ? 259 LEU C N     1 
ATOM   7908  C  CA    . LEU G  1 261 ? 68.317  -92.373  0.417   1.00 22.98 ? 259 LEU C CA    1 
ATOM   7909  C  C     . LEU G  1 261 ? 69.558  -91.497  0.495   1.00 28.16 ? 259 LEU C C     1 
ATOM   7910  O  O     . LEU G  1 261 ? 69.802  -90.860  1.522   1.00 24.68 ? 259 LEU C O     1 
ATOM   7911  C  CB    . LEU G  1 261 ? 67.130  -91.444  0.532   1.00 24.49 ? 259 LEU C CB    1 
ATOM   7912  C  CG    . LEU G  1 261 ? 65.788  -92.121  0.316   1.00 22.34 ? 259 LEU C CG    1 
ATOM   7913  C  CD1   . LEU G  1 261 ? 64.669  -91.159  0.585   1.00 21.54 ? 259 LEU C CD1   1 
ATOM   7914  C  CD2   . LEU G  1 261 ? 65.711  -92.630  -1.118  1.00 28.18 ? 259 LEU C CD2   1 
ATOM   7915  N  N     . ASP G  1 262 ? 70.315  -91.437  -0.594  1.00 25.06 ? 260 ASP C N     1 
ATOM   7916  C  CA    . ASP G  1 262 ? 71.492  -90.598  -0.651  1.00 26.20 ? 260 ASP C CA    1 
ATOM   7917  C  C     . ASP G  1 262 ? 71.159  -89.389  -1.515  1.00 29.41 ? 260 ASP C C     1 
ATOM   7918  O  O     . ASP G  1 262 ? 71.119  -89.496  -2.745  1.00 29.80 ? 260 ASP C O     1 
ATOM   7919  C  CB    . ASP G  1 262 ? 72.641  -91.424  -1.217  1.00 26.66 ? 260 ASP C CB    1 
ATOM   7920  C  CG    . ASP G  1 262 ? 72.795  -92.744  -0.498  1.00 30.16 ? 260 ASP C CG    1 
ATOM   7921  O  OD1   . ASP G  1 262 ? 72.846  -92.732  0.754   1.00 26.93 ? 260 ASP C OD1   1 
ATOM   7922  O  OD2   . ASP G  1 262 ? 72.828  -93.789  -1.184  1.00 29.74 ? 260 ASP C OD2   1 
ATOM   7923  N  N     . LEU G  1 263 ? 70.880  -88.266  -0.843  1.00 29.16 ? 261 LEU C N     1 
ATOM   7924  C  CA    . LEU G  1 263 ? 70.229  -87.070  -1.416  1.00 26.03 ? 261 LEU C CA    1 
ATOM   7925  C  C     . LEU G  1 263 ? 71.180  -85.878  -1.292  1.00 29.33 ? 261 LEU C C     1 
ATOM   7926  O  O     . LEU G  1 263 ? 71.932  -85.818  -0.309  1.00 25.87 ? 261 LEU C O     1 
ATOM   7927  C  CB    . LEU G  1 263 ? 68.959  -86.753  -0.622  1.00 25.19 ? 261 LEU C CB    1 
ATOM   7928  C  CG    . LEU G  1 263 ? 67.667  -87.120  -1.315  1.00 31.04 ? 261 LEU C CG    1 
ATOM   7929  C  CD1   . LEU G  1 263 ? 67.878  -88.413  -2.081  1.00 30.11 ? 261 LEU C CD1   1 
ATOM   7930  C  CD2   . LEU G  1 263 ? 66.484  -87.210  -0.347  1.00 28.92 ? 261 LEU C CD2   1 
ATOM   7931  N  N     . PRO G  1 264 ? 71.166  -84.947  -2.290  1.00 23.58 ? 262 PRO C N     1 
ATOM   7932  C  CA    . PRO G  1 264 ? 72.011  -83.757  -2.204  1.00 28.02 ? 262 PRO C CA    1 
ATOM   7933  C  C     . PRO G  1 264 ? 71.732  -83.027  -0.910  1.00 29.93 ? 262 PRO C C     1 
ATOM   7934  O  O     . PRO G  1 264 ? 70.570  -82.952  -0.451  1.00 25.75 ? 262 PRO C O     1 
ATOM   7935  C  CB    . PRO G  1 264 ? 71.602  -82.926  -3.430  1.00 27.69 ? 262 PRO C CB    1 
ATOM   7936  C  CG    . PRO G  1 264 ? 70.755  -83.813  -4.289  1.00 28.25 ? 262 PRO C CG    1 
ATOM   7937  C  CD    . PRO G  1 264 ? 70.721  -85.180  -3.676  1.00 26.99 ? 262 PRO C CD    1 
ATOM   7938  N  N     . LEU G  1 265 ? 72.811  -82.549  -0.301  1.00 30.38 ? 263 LEU C N     1 
ATOM   7939  C  CA    . LEU G  1 265 ? 72.716  -81.770  0.917   1.00 31.18 ? 263 LEU C CA    1 
ATOM   7940  C  C     . LEU G  1 265 ? 73.100  -80.331  0.595   1.00 36.49 ? 263 LEU C C     1 
ATOM   7941  O  O     . LEU G  1 265 ? 74.290  -80.016  0.505   1.00 32.93 ? 263 LEU C O     1 
ATOM   7942  C  CB    . LEU G  1 265 ? 73.644  -82.343  1.990   1.00 30.41 ? 263 LEU C CB    1 
ATOM   7943  C  CG    . LEU G  1 265 ? 73.700  -81.572  3.314   1.00 32.70 ? 263 LEU C CG    1 
ATOM   7944  C  CD1   . LEU G  1 265 ? 72.344  -81.560  3.999   1.00 19.94 ? 263 LEU C CD1   1 
ATOM   7945  C  CD2   . LEU G  1 265 ? 74.726  -82.211  4.212   1.00 34.16 ? 263 LEU C CD2   1 
ATOM   7946  N  N     . LYS G  1 266 ? 72.098  -79.468  0.411   1.00 34.10 ? 264 LYS C N     1 
ATOM   7947  C  CA    . LYS G  1 266 ? 72.369  -78.054  0.154   1.00 44.88 ? 264 LYS C CA    1 
ATOM   7948  C  C     . LYS G  1 266 ? 72.810  -77.325  1.423   1.00 45.16 ? 264 LYS C C     1 
ATOM   7949  O  O     . LYS G  1 266 ? 73.857  -76.662  1.439   1.00 53.77 ? 264 LYS C O     1 
ATOM   7950  C  CB    . LYS G  1 266 ? 71.175  -77.350  -0.488  1.00 42.36 ? 264 LYS C CB    1 
ATOM   7951  C  CG    . LYS G  1 266 ? 71.558  -76.068  -1.262  1.00 45.10 ? 264 LYS C CG    1 
ATOM   7952  C  CD    . LYS G  1 266 ? 70.476  -74.977  -1.138  1.00 63.74 ? 264 LYS C CD    1 
ATOM   7953  C  CE    . LYS G  1 266 ? 70.829  -73.701  -1.902  1.00 50.11 ? 264 LYS C CE    1 
ATOM   7954  N  NZ    . LYS G  1 266 ? 70.919  -73.927  -3.378  1.00 51.03 ? 264 LYS C NZ    1 
ATOM   7955  N  N     . GLN G  1 267 ? 72.033  -77.460  2.490   1.00 35.42 ? 265 GLN C N     1 
ATOM   7956  C  CA    . GLN G  1 267 ? 72.390  -76.858  3.775   1.00 35.90 ? 265 GLN C CA    1 
ATOM   7957  C  C     . GLN G  1 267 ? 71.988  -77.819  4.886   1.00 31.63 ? 265 GLN C C     1 
ATOM   7958  O  O     . GLN G  1 267 ? 70.995  -78.542  4.736   1.00 36.43 ? 265 GLN C O     1 
ATOM   7959  C  CB    . GLN G  1 267 ? 71.607  -75.561  3.946   1.00 39.81 ? 265 GLN C CB    1 
ATOM   7960  C  CG    . GLN G  1 267 ? 70.095  -75.822  3.962   1.00 37.56 ? 265 GLN C CG    1 
ATOM   7961  C  CD    . GLN G  1 267 ? 69.277  -74.621  3.528   1.00 51.47 ? 265 GLN C CD    1 
ATOM   7962  O  OE1   . GLN G  1 267 ? 69.421  -73.523  4.082   1.00 60.09 ? 265 GLN C OE1   1 
ATOM   7963  N  NE2   . GLN G  1 267 ? 68.399  -74.824  2.543   1.00 43.65 ? 265 GLN C NE2   1 
ATOM   7964  N  N     . LYS G  1 268 ? 72.743  -77.841  5.982   1.00 28.50 ? 266 LYS C N     1 
ATOM   7965  C  CA    . LYS G  1 268 ? 72.388  -78.651  7.149   1.00 27.78 ? 266 LYS C CA    1 
ATOM   7966  C  C     . LYS G  1 268 ? 71.626  -77.750  8.108   1.00 30.37 ? 266 LYS C C     1 
ATOM   7967  O  O     . LYS G  1 268 ? 72.196  -76.834  8.692   1.00 33.13 ? 266 LYS C O     1 
ATOM   7968  C  CB    . LYS G  1 268 ? 73.638  -79.240  7.830   1.00 29.06 ? 266 LYS C CB    1 
ATOM   7969  C  CG    . LYS G  1 268 ? 73.326  -80.110  9.061   1.00 36.43 ? 266 LYS C CG    1 
ATOM   7970  C  CD    . LYS G  1 268 ? 74.488  -81.022  9.499   1.00 34.70 ? 266 LYS C CD    1 
ATOM   7971  C  CE    . LYS G  1 268 ? 74.078  -81.920  10.670  1.00 38.75 ? 266 LYS C CE    1 
ATOM   7972  N  NZ    . LYS G  1 268 ? 73.619  -81.164  11.877  1.00 38.85 ? 266 LYS C NZ    1 
ATOM   7973  N  N     . THR G  1 269 ? 70.326  -77.991  8.243   1.00 25.85 ? 267 THR C N     1 
ATOM   7974  C  CA    . THR G  1 269 ? 69.432  -77.154  9.059   1.00 23.85 ? 267 THR C CA    1 
ATOM   7975  C  C     . THR G  1 269 ? 68.662  -78.030  10.003  1.00 25.63 ? 267 THR C C     1 
ATOM   7976  O  O     . THR G  1 269 ? 68.296  -79.147  9.633   1.00 28.44 ? 267 THR C O     1 
ATOM   7977  C  CB    . THR G  1 269 ? 68.378  -76.429  8.212   1.00 30.83 ? 267 THR C CB    1 
ATOM   7978  O  OG1   . THR G  1 269 ? 69.030  -75.740  7.128   1.00 37.13 ? 267 THR C OG1   1 
ATOM   7979  C  CG2   . THR G  1 269 ? 67.641  -75.425  9.099   1.00 31.30 ? 267 THR C CG2   1 
ATOM   7980  N  N     . ASP G  1 270 ? 68.405  -77.532  11.205  1.00 22.06 ? 268 ASP C N     1 
ATOM   7981  C  CA    . ASP G  1 270 ? 67.645  -78.273  12.199  1.00 23.79 ? 268 ASP C CA    1 
ATOM   7982  C  C     . ASP G  1 270 ? 66.213  -78.490  11.760  1.00 18.84 ? 268 ASP C C     1 
ATOM   7983  O  O     . ASP G  1 270 ? 65.713  -77.791  10.892  1.00 23.89 ? 268 ASP C O     1 
ATOM   7984  C  CB    . ASP G  1 270 ? 67.654  -77.552  13.549  1.00 24.44 ? 268 ASP C CB    1 
ATOM   7985  C  CG    . ASP G  1 270 ? 69.046  -77.540  14.196  1.00 32.45 ? 268 ASP C CG    1 
ATOM   7986  O  OD1   . ASP G  1 270 ? 69.923  -78.290  13.728  1.00 27.27 ? 268 ASP C OD1   1 
ATOM   7987  O  OD2   . ASP G  1 270 ? 69.253  -76.783  15.163  1.00 27.31 ? 268 ASP C OD2   1 
ATOM   7988  N  N     . LEU G  1 271 ? 65.569  -79.474  12.380  1.00 16.40 ? 269 LEU C N     1 
ATOM   7989  C  CA    . LEU G  1 271 ? 64.151  -79.758  12.170  1.00 15.08 ? 269 LEU C CA    1 
ATOM   7990  C  C     . LEU G  1 271 ? 63.302  -78.509  12.438  1.00 17.84 ? 269 LEU C C     1 
ATOM   7991  O  O     . LEU G  1 271 ? 63.326  -77.951  13.549  1.00 15.53 ? 269 LEU C O     1 
ATOM   7992  C  CB    . LEU G  1 271 ? 63.710  -80.926  13.080  1.00 13.57 ? 269 LEU C CB    1 
ATOM   7993  C  CG    . LEU G  1 271 ? 62.216  -81.348  13.019  1.00 13.24 ? 269 LEU C CG    1 
ATOM   7994  C  CD1   . LEU G  1 271 ? 61.881  -81.958  11.662  1.00 11.71 ? 269 LEU C CD1   1 
ATOM   7995  C  CD2   . LEU G  1 271 ? 61.889  -82.379  14.106  1.00 8.47  ? 269 LEU C CD2   1 
ATOM   7996  N  N     . GLU G  1 272 ? 62.536  -78.082  11.422  1.00 13.32 ? 270 GLU C N     1 
ATOM   7997  C  CA    . GLU G  1 272 ? 61.663  -76.922  11.545  1.00 13.06 ? 270 GLU C CA    1 
ATOM   7998  C  C     . GLU G  1 272 ? 60.254  -77.202  11.031  1.00 15.80 ? 270 GLU C C     1 
ATOM   7999  O  O     . GLU G  1 272 ? 60.052  -78.087  10.185  1.00 14.53 ? 270 GLU C O     1 
ATOM   8000  C  CB    . GLU G  1 272 ? 62.216  -75.758  10.699  1.00 17.34 ? 270 GLU C CB    1 
ATOM   8001  C  CG    . GLU G  1 272 ? 63.480  -75.132  11.229  1.00 14.59 ? 270 GLU C CG    1 
ATOM   8002  C  CD    . GLU G  1 272 ? 64.008  -74.021  10.302  1.00 32.26 ? 270 GLU C CD    1 
ATOM   8003  O  OE1   . GLU G  1 272 ? 64.079  -74.237  9.077   1.00 29.09 ? 270 GLU C OE1   1 
ATOM   8004  O  OE2   . GLU G  1 272 ? 64.376  -72.952  10.810  1.00 35.71 ? 270 GLU C OE2   1 
ATOM   8005  N  N     . TYR G  1 273 ? 59.309  -76.396  11.496  1.00 10.98 ? 271 TYR C N     1 
ATOM   8006  C  CA    . TYR G  1 273 ? 57.951  -76.396  10.950  1.00 15.07 ? 271 TYR C CA    1 
ATOM   8007  C  C     . TYR G  1 273 ? 57.995  -75.774  9.569   1.00 11.76 ? 271 TYR C C     1 
ATOM   8008  O  O     . TYR G  1 273 ? 58.644  -74.757  9.352   1.00 13.98 ? 271 TYR C O     1 
ATOM   8009  C  CB    . TYR G  1 273 ? 57.026  -75.628  11.870  1.00 14.61 ? 271 TYR C CB    1 
ATOM   8010  C  CG    . TYR G  1 273 ? 56.930  -76.180  13.289  1.00 14.87 ? 271 TYR C CG    1 
ATOM   8011  C  CD1   . TYR G  1 273 ? 56.090  -77.294  13.592  1.00 12.96 ? 271 TYR C CD1   1 
ATOM   8012  C  CD2   . TYR G  1 273 ? 57.597  -75.550  14.343  1.00 13.99 ? 271 TYR C CD2   1 
ATOM   8013  C  CE1   . TYR G  1 273 ? 55.996  -77.795  14.915  1.00 11.14 ? 271 TYR C CE1   1 
ATOM   8014  C  CE2   . TYR G  1 273 ? 57.521  -76.038  15.660  1.00 11.33 ? 271 TYR C CE2   1 
ATOM   8015  C  CZ    . TYR G  1 273 ? 56.738  -77.156  15.938  1.00 14.67 ? 271 TYR C CZ    1 
ATOM   8016  O  OH    . TYR G  1 273 ? 56.675  -77.581  17.255  1.00 15.99 ? 271 TYR C OH    1 
ATOM   8017  N  N     . ASP G  1 274 ? 57.342  -76.398  8.594   1.00 11.99 ? 272 ASP C N     1 
ATOM   8018  C  CA    . ASP G  1 274 ? 57.279  -75.818  7.258   1.00 11.46 ? 272 ASP C CA    1 
ATOM   8019  C  C     . ASP G  1 274 ? 56.317  -74.589  7.295   1.00 11.98 ? 272 ASP C C     1 
ATOM   8020  O  O     . ASP G  1 274 ? 55.223  -74.670  7.824   1.00 12.87 ? 272 ASP C O     1 
ATOM   8021  C  CB    . ASP G  1 274 ? 56.776  -76.866  6.245   1.00 17.96 ? 272 ASP C CB    1 
ATOM   8022  C  CG    . ASP G  1 274 ? 56.542  -76.282  4.845   1.00 17.53 ? 272 ASP C CG    1 
ATOM   8023  O  OD1   . ASP G  1 274 ? 57.545  -76.104  4.105   1.00 11.00 ? 272 ASP C OD1   1 
ATOM   8024  O  OD2   . ASP G  1 274 ? 55.354  -76.042  4.500   1.00 14.65 ? 272 ASP C OD2   1 
ATOM   8025  N  N     . LYS G  1 275 ? 56.755  -73.444  6.770   1.00 12.56 ? 273 LYS C N     1 
ATOM   8026  C  CA    . LYS G  1 275 ? 55.941  -72.203  6.850   1.00 16.19 ? 273 LYS C CA    1 
ATOM   8027  C  C     . LYS G  1 275 ? 54.555  -72.312  6.180   1.00 12.93 ? 273 LYS C C     1 
ATOM   8028  O  O     . LYS G  1 275 ? 53.502  -71.988  6.780   1.00 15.11 ? 273 LYS C O     1 
ATOM   8029  C  CB    . LYS G  1 275 ? 56.772  -71.054  6.258   1.00 17.32 ? 273 LYS C CB    1 
ATOM   8030  C  CG    . LYS G  1 275 ? 58.012  -70.717  7.142   1.00 18.38 ? 273 LYS C CG    1 
ATOM   8031  C  CD    . LYS G  1 275 ? 58.888  -69.576  6.587   1.00 23.62 ? 273 LYS C CD    1 
ATOM   8032  C  CE    . LYS G  1 275 ? 60.240  -69.530  7.314   1.00 31.38 ? 273 LYS C CE    1 
ATOM   8033  N  NZ    . LYS G  1 275 ? 61.025  -70.753  7.008   1.00 29.75 ? 273 LYS C NZ    1 
ATOM   8034  N  N     . ASP G  1 276 ? 54.528  -72.810  4.941   1.00 16.07 ? 274 ASP C N     1 
ATOM   8035  C  CA    . ASP G  1 276 ? 53.220  -73.077  4.308   1.00 12.30 ? 274 ASP C CA    1 
ATOM   8036  C  C     . ASP G  1 276 ? 52.308  -73.965  5.158   1.00 15.76 ? 274 ASP C C     1 
ATOM   8037  O  O     . ASP G  1 276 ? 51.133  -73.660  5.323   1.00 16.18 ? 274 ASP C O     1 
ATOM   8038  C  CB    . ASP G  1 276 ? 53.341  -73.645  2.855   1.00 15.47 ? 274 ASP C CB    1 
ATOM   8039  C  CG    . ASP G  1 276 ? 53.837  -72.592  1.833   1.00 17.03 ? 274 ASP C CG    1 
ATOM   8040  O  OD1   . ASP G  1 276 ? 53.289  -71.462  1.827   1.00 20.15 ? 274 ASP C OD1   1 
ATOM   8041  O  OD2   . ASP G  1 276 ? 54.819  -72.884  1.092   1.00 22.62 ? 274 ASP C OD2   1 
ATOM   8042  N  N     . TRP G  1 277 ? 52.839  -75.063  5.713   1.00 13.88 ? 275 TRP C N     1 
ATOM   8043  C  CA    . TRP G  1 277 ? 52.034  -75.890  6.609   1.00 13.64 ? 275 TRP C CA    1 
ATOM   8044  C  C     . TRP G  1 277 ? 51.532  -75.072  7.796   1.00 14.45 ? 275 TRP C C     1 
ATOM   8045  O  O     . TRP G  1 277 ? 50.333  -75.099  8.125   1.00 15.30 ? 275 TRP C O     1 
ATOM   8046  C  CB    . TRP G  1 277 ? 52.792  -77.167  7.110   1.00 10.66 ? 275 TRP C CB    1 
ATOM   8047  C  CG    . TRP G  1 277 ? 52.003  -77.850  8.218   1.00 11.38 ? 275 TRP C CG    1 
ATOM   8048  C  CD1   . TRP G  1 277 ? 52.343  -77.940  9.536   1.00 11.90 ? 275 TRP C CD1   1 
ATOM   8049  C  CD2   . TRP G  1 277 ? 50.702  -78.472  8.090   1.00 13.65 ? 275 TRP C CD2   1 
ATOM   8050  N  NE1   . TRP G  1 277 ? 51.321  -78.579  10.243  1.00 19.90 ? 275 TRP C NE1   1 
ATOM   8051  C  CE2   . TRP G  1 277 ? 50.306  -78.908  9.369   1.00 13.94 ? 275 TRP C CE2   1 
ATOM   8052  C  CE3   . TRP G  1 277 ? 49.835  -78.697  7.009   1.00 15.60 ? 275 TRP C CE3   1 
ATOM   8053  C  CZ2   . TRP G  1 277 ? 49.097  -79.568  9.604   1.00 18.40 ? 275 TRP C CZ2   1 
ATOM   8054  C  CZ3   . TRP G  1 277 ? 48.624  -79.342  7.236   1.00 17.30 ? 275 TRP C CZ3   1 
ATOM   8055  C  CH2   . TRP G  1 277 ? 48.268  -79.783  8.527   1.00 14.17 ? 275 TRP C CH2   1 
ATOM   8056  N  N     . VAL G  1 278 ? 52.442  -74.345  8.461   1.00 14.92 ? 276 VAL C N     1 
ATOM   8057  C  CA    . VAL G  1 278 ? 52.004  -73.469  9.555   1.00 13.65 ? 276 VAL C CA    1 
ATOM   8058  C  C     . VAL G  1 278 ? 50.841  -72.533  9.177   1.00 15.54 ? 276 VAL C C     1 
ATOM   8059  O  O     . VAL G  1 278 ? 49.823  -72.430  9.888   1.00 16.82 ? 276 VAL C O     1 
ATOM   8060  C  CB    . VAL G  1 278 ? 53.184  -72.655  10.164  1.00 13.49 ? 276 VAL C CB    1 
ATOM   8061  C  CG1   . VAL G  1 278 ? 52.640  -71.519  11.025  1.00 15.18 ? 276 VAL C CG1   1 
ATOM   8062  C  CG2   . VAL G  1 278 ? 54.021  -73.582  11.054  1.00 11.64 ? 276 VAL C CG2   1 
ATOM   8063  N  N     . CYS G  1 279 ? 50.967  -71.850  8.054   1.00 16.56 ? 277 CYS C N     1 
ATOM   8064  C  CA    . CYS G  1 279 ? 49.821  -71.023  7.619   1.00 15.00 ? 277 CYS C CA    1 
ATOM   8065  C  C     . CYS G  1 279 ? 48.496  -71.786  7.517   1.00 14.71 ? 277 CYS C C     1 
ATOM   8066  O  O     . CYS G  1 279 ? 47.434  -71.292  7.969   1.00 14.45 ? 277 CYS C O     1 
ATOM   8067  C  CB    . CYS G  1 279 ? 50.171  -70.339  6.305   1.00 15.53 ? 277 CYS C CB    1 
ATOM   8068  S  SG    . CYS G  1 279 ? 51.592  -69.161  6.589   1.00 19.23 ? 277 CYS C SG    1 
ATOM   8069  N  N     . ASN G  1 280 ? 48.551  -72.965  6.894   1.00 14.63 ? 278 ASN C N     1 
ATOM   8070  C  CA    . ASN G  1 280 ? 47.345  -73.789  6.746   1.00 14.18 ? 278 ASN C CA    1 
ATOM   8071  C  C     . ASN G  1 280 ? 46.760  -74.123  8.088   1.00 13.84 ? 278 ASN C C     1 
ATOM   8072  O  O     . ASN G  1 280 ? 45.563  -74.057  8.306   1.00 12.63 ? 278 ASN C O     1 
ATOM   8073  C  CB    . ASN G  1 280 ? 47.656  -75.094  6.015   1.00 9.94  ? 278 ASN C CB    1 
ATOM   8074  C  CG    . ASN G  1 280 ? 47.864  -74.902  4.521   1.00 15.55 ? 278 ASN C CG    1 
ATOM   8075  O  OD1   . ASN G  1 280 ? 47.882  -73.773  4.011   1.00 15.66 ? 278 ASN C OD1   1 
ATOM   8076  N  ND2   . ASN G  1 280 ? 48.060  -76.019  3.808   1.00 14.55 ? 278 ASN C ND2   1 
ATOM   8077  N  N     . LEU G  1 281 ? 47.638  -74.520  9.006   1.00 12.83 ? 279 LEU C N     1 
ATOM   8078  C  CA    . LEU G  1 281 ? 47.214  -74.912  10.320  1.00 16.40 ? 279 LEU C CA    1 
ATOM   8079  C  C     . LEU G  1 281 ? 46.501  -73.755  10.994  1.00 18.05 ? 279 LEU C C     1 
ATOM   8080  O  O     . LEU G  1 281 ? 45.437  -73.926  11.588  1.00 14.11 ? 279 LEU C O     1 
ATOM   8081  C  CB    . LEU G  1 281 ? 48.448  -75.360  11.138  1.00 20.34 ? 279 LEU C CB    1 
ATOM   8082  C  CG    . LEU G  1 281 ? 48.267  -75.998  12.512  1.00 19.21 ? 279 LEU C CG    1 
ATOM   8083  C  CD1   . LEU G  1 281 ? 47.380  -77.281  12.472  1.00 16.81 ? 279 LEU C CD1   1 
ATOM   8084  C  CD2   . LEU G  1 281 ? 49.642  -76.252  13.163  1.00 16.39 ? 279 LEU C CD2   1 
ATOM   8085  N  N     . ILE G  1 282 ? 47.092  -72.563  10.927  1.00 17.61 ? 280 ILE C N     1 
ATOM   8086  C  CA    . ILE G  1 282 ? 46.458  -71.448  11.610  1.00 16.48 ? 280 ILE C CA    1 
ATOM   8087  C  C     . ILE G  1 282 ? 45.123  -71.087  10.921  1.00 14.78 ? 280 ILE C C     1 
ATOM   8088  O  O     . ILE G  1 282 ? 44.135  -70.802  11.576  1.00 17.27 ? 280 ILE C O     1 
ATOM   8089  C  CB    . ILE G  1 282 ? 47.363  -70.193  11.625  1.00 18.01 ? 280 ILE C CB    1 
ATOM   8090  C  CG1   . ILE G  1 282 ? 48.683  -70.427  12.403  1.00 24.41 ? 280 ILE C CG1   1 
ATOM   8091  C  CG2   . ILE G  1 282 ? 46.587  -68.972  12.166  1.00 14.33 ? 280 ILE C CG2   1 
ATOM   8092  C  CD1   . ILE G  1 282 ? 48.621  -71.285  13.645  1.00 16.52 ? 280 ILE C CD1   1 
ATOM   8093  N  N     . MET G  1 283 ? 45.122  -71.078  9.593   1.00 19.86 ? 281 MET C N     1 
ATOM   8094  C  CA    . MET G  1 283 ? 43.964  -70.570  8.845   1.00 21.56 ? 281 MET C CA    1 
ATOM   8095  C  C     . MET G  1 283 ? 42.772  -71.510  8.949   1.00 21.73 ? 281 MET C C     1 
ATOM   8096  O  O     . MET G  1 283 ? 41.650  -71.083  8.770   1.00 21.10 ? 281 MET C O     1 
ATOM   8097  C  CB    . MET G  1 283 ? 44.319  -70.249  7.387   1.00 13.54 ? 281 MET C CB    1 
ATOM   8098  C  CG    . MET G  1 283 ? 45.353  -69.092  7.288   1.00 16.45 ? 281 MET C CG    1 
ATOM   8099  S  SD    . MET G  1 283 ? 44.753  -67.447  7.773   1.00 19.51 ? 281 MET C SD    1 
ATOM   8100  C  CE    . MET G  1 283 ? 43.574  -67.141  6.450   1.00 23.60 ? 281 MET C CE    1 
ATOM   8101  N  N     . THR G  1 284 ? 43.006  -72.776  9.307   1.00 15.13 ? 282 THR C N     1 
ATOM   8102  C  CA    . THR G  1 284 ? 41.896  -73.700  9.532   1.00 19.87 ? 282 THR C CA    1 
ATOM   8103  C  C     . THR G  1 284 ? 41.492  -73.772  10.975  1.00 21.08 ? 282 THR C C     1 
ATOM   8104  O  O     . THR G  1 284 ? 40.618  -74.561  11.302  1.00 18.49 ? 282 THR C O     1 
ATOM   8105  C  CB    . THR G  1 284 ? 42.211  -75.158  9.023   1.00 17.28 ? 282 THR C CB    1 
ATOM   8106  O  OG1   . THR G  1 284 ? 43.514  -75.572  9.505   1.00 17.72 ? 282 THR C OG1   1 
ATOM   8107  C  CG2   . THR G  1 284 ? 42.305  -75.156  7.531   1.00 16.61 ? 282 THR C CG2   1 
ATOM   8108  N  N     . TRP G  1 285 ? 42.087  -72.977  11.869  1.00 15.32 ? 283 TRP C N     1 
ATOM   8109  C  CA    . TRP G  1 285 ? 41.622  -73.059  13.262  1.00 16.75 ? 283 TRP C CA    1 
ATOM   8110  C  C     . TRP G  1 285 ? 40.076  -73.100  13.463  1.00 18.46 ? 283 TRP C C     1 
ATOM   8111  O  O     . TRP G  1 285 ? 39.544  -73.904  14.251  1.00 18.88 ? 283 TRP C O     1 
ATOM   8112  C  CB    . TRP G  1 285 ? 42.268  -71.945  14.116  1.00 17.32 ? 283 TRP C CB    1 
ATOM   8113  C  CG    . TRP G  1 285 ? 41.597  -71.786  15.411  1.00 18.56 ? 283 TRP C CG    1 
ATOM   8114  C  CD1   . TRP G  1 285 ? 40.770  -70.772  15.785  1.00 21.46 ? 283 TRP C CD1   1 
ATOM   8115  C  CD2   . TRP G  1 285 ? 41.650  -72.697  16.518  1.00 18.55 ? 283 TRP C CD2   1 
ATOM   8116  N  NE1   . TRP G  1 285 ? 40.314  -70.986  17.067  1.00 22.60 ? 283 TRP C NE1   1 
ATOM   8117  C  CE2   . TRP G  1 285 ? 40.839  -72.160  17.544  1.00 20.95 ? 283 TRP C CE2   1 
ATOM   8118  C  CE3   . TRP G  1 285 ? 42.321  -73.901  16.750  1.00 21.57 ? 283 TRP C CE3   1 
ATOM   8119  C  CZ2   . TRP G  1 285 ? 40.662  -72.798  18.788  1.00 20.22 ? 283 TRP C CZ2   1 
ATOM   8120  C  CZ3   . TRP G  1 285 ? 42.157  -74.535  17.977  1.00 20.19 ? 283 TRP C CZ3   1 
ATOM   8121  C  CH2   . TRP G  1 285 ? 41.331  -73.978  18.984  1.00 21.37 ? 283 TRP C CH2   1 
ATOM   8122  N  N     . PRO G  1 286 ? 39.335  -72.227  12.753  1.00 23.01 ? 284 PRO C N     1 
ATOM   8123  C  CA    . PRO G  1 286 ? 37.895  -72.209  13.036  1.00 20.47 ? 284 PRO C CA    1 
ATOM   8124  C  C     . PRO G  1 286 ? 37.301  -73.615  12.936  1.00 21.25 ? 284 PRO C C     1 
ATOM   8125  O  O     . PRO G  1 286 ? 36.294  -73.935  13.622  1.00 22.12 ? 284 PRO C O     1 
ATOM   8126  C  CB    . PRO G  1 286 ? 37.325  -71.320  11.922  1.00 20.76 ? 284 PRO C CB    1 
ATOM   8127  C  CG    . PRO G  1 286 ? 38.449  -70.346  11.582  1.00 21.74 ? 284 PRO C CG    1 
ATOM   8128  C  CD    . PRO G  1 286 ? 39.735  -71.233  11.729  1.00 18.81 ? 284 PRO C CD    1 
ATOM   8129  N  N     . ALA G  1 287 ? 37.913  -74.450  12.092  1.00 23.37 ? 285 ALA C N     1 
ATOM   8130  C  CA    . ALA G  1 287 ? 37.380  -75.799  11.862  1.00 21.42 ? 285 ALA C CA    1 
ATOM   8131  C  C     . ALA G  1 287 ? 37.775  -76.755  12.981  1.00 19.12 ? 285 ALA C C     1 
ATOM   8132  O  O     . ALA G  1 287 ? 37.227  -77.870  13.078  1.00 22.15 ? 285 ALA C O     1 
ATOM   8133  C  CB    . ALA G  1 287 ? 37.806  -76.353  10.487  1.00 16.21 ? 285 ALA C CB    1 
ATOM   8134  N  N     . PHE G  1 288 ? 38.718  -76.333  13.822  1.00 16.78 ? 286 PHE C N     1 
ATOM   8135  C  CA    . PHE G  1 288 ? 39.250  -77.202  14.896  1.00 13.86 ? 286 PHE C CA    1 
ATOM   8136  C  C     . PHE G  1 288 ? 38.966  -76.640  16.280  1.00 18.94 ? 286 PHE C C     1 
ATOM   8137  O  O     . PHE G  1 288 ? 39.439  -77.180  17.289  1.00 18.53 ? 286 PHE C O     1 
ATOM   8138  C  CB    . PHE G  1 288 ? 40.777  -77.403  14.705  1.00 22.73 ? 286 PHE C CB    1 
ATOM   8139  C  CG    . PHE G  1 288 ? 41.130  -78.246  13.489  1.00 16.43 ? 286 PHE C CG    1 
ATOM   8140  C  CD1   . PHE G  1 288 ? 41.247  -77.667  12.238  1.00 17.44 ? 286 PHE C CD1   1 
ATOM   8141  C  CD2   . PHE G  1 288 ? 41.278  -79.638  13.608  1.00 17.23 ? 286 PHE C CD2   1 
ATOM   8142  C  CE1   . PHE G  1 288 ? 41.508  -78.448  11.121  1.00 18.41 ? 286 PHE C CE1   1 
ATOM   8143  C  CE2   . PHE G  1 288 ? 41.555  -80.430  12.504  1.00 15.70 ? 286 PHE C CE2   1 
ATOM   8144  C  CZ    . PHE G  1 288 ? 41.677  -79.825  11.249  1.00 20.04 ? 286 PHE C CZ    1 
ATOM   8145  N  N     . SER G  1 289 ? 38.190  -75.554  16.331  1.00 20.48 ? 287 SER C N     1 
ATOM   8146  C  CA    . SER G  1 289 ? 37.936  -74.802  17.573  1.00 21.67 ? 287 SER C CA    1 
ATOM   8147  C  C     . SER G  1 289 ? 37.164  -75.511  18.707  1.00 26.13 ? 287 SER C C     1 
ATOM   8148  O  O     . SER G  1 289 ? 37.166  -75.041  19.849  1.00 24.46 ? 287 SER C O     1 
ATOM   8149  C  CB    . SER G  1 289 ? 37.182  -73.514  17.250  1.00 23.82 ? 287 SER C CB    1 
ATOM   8150  O  OG    . SER G  1 289 ? 35.869  -73.820  16.817  1.00 25.79 ? 287 SER C OG    1 
ATOM   8151  N  N     . ASN G  1 290 ? 36.464  -76.599  18.403  1.00 21.96 ? 288 ASN C N     1 
ATOM   8152  C  CA    . ASN G  1 290 ? 35.803  -77.377  19.441  1.00 16.92 ? 288 ASN C CA    1 
ATOM   8153  C  C     . ASN G  1 290 ? 36.712  -78.530  19.879  1.00 23.49 ? 288 ASN C C     1 
ATOM   8154  O  O     . ASN G  1 290 ? 36.908  -79.508  19.149  1.00 22.71 ? 288 ASN C O     1 
ATOM   8155  C  CB    . ASN G  1 290 ? 34.495  -77.950  18.906  1.00 18.08 ? 288 ASN C CB    1 
ATOM   8156  C  CG    . ASN G  1 290 ? 33.749  -78.780  19.941  1.00 26.42 ? 288 ASN C CG    1 
ATOM   8157  O  OD1   . ASN G  1 290 ? 34.291  -79.132  20.993  1.00 24.84 ? 288 ASN C OD1   1 
ATOM   8158  N  ND2   . ASN G  1 290 ? 32.488  -79.096  19.644  1.00 30.43 ? 288 ASN C ND2   1 
ATOM   8159  N  N     . LYS G  1 291 ? 37.247  -78.447  21.086  1.00 21.91 ? 289 LYS C N     1 
ATOM   8160  C  CA    . LYS G  1 291 ? 38.296  -79.374  21.469  1.00 24.49 ? 289 LYS C CA    1 
ATOM   8161  C  C     . LYS G  1 291 ? 37.777  -80.810  21.627  1.00 26.01 ? 289 LYS C C     1 
ATOM   8162  O  O     . LYS G  1 291 ? 38.579  -81.742  21.733  1.00 26.00 ? 289 LYS C O     1 
ATOM   8163  C  CB    . LYS G  1 291 ? 38.965  -78.930  22.766  1.00 23.05 ? 289 LYS C CB    1 
ATOM   8164  C  CG    . LYS G  1 291 ? 38.159  -79.277  23.993  1.00 28.09 ? 289 LYS C CG    1 
ATOM   8165  C  CD    . LYS G  1 291 ? 38.664  -78.538  25.218  1.00 27.37 ? 289 LYS C CD    1 
ATOM   8166  C  CE    . LYS G  1 291 ? 37.895  -79.003  26.444  1.00 32.38 ? 289 LYS C CE    1 
ATOM   8167  N  NZ    . LYS G  1 291 ? 38.429  -78.392  27.689  1.00 33.30 ? 289 LYS C NZ    1 
ATOM   8168  N  N     . ALA G  1 292 ? 36.453  -80.989  21.667  1.00 26.48 ? 290 ALA C N     1 
ATOM   8169  C  CA    . ALA G  1 292 ? 35.911  -82.314  21.957  1.00 24.21 ? 290 ALA C CA    1 
ATOM   8170  C  C     . ALA G  1 292 ? 35.517  -83.061  20.692  1.00 25.37 ? 290 ALA C C     1 
ATOM   8171  O  O     . ALA G  1 292 ? 35.166  -84.257  20.741  1.00 27.18 ? 290 ALA C O     1 
ATOM   8172  C  CB    . ALA G  1 292 ? 34.752  -82.237  22.934  1.00 23.22 ? 290 ALA C CB    1 
ATOM   8173  N  N     . GLN G  1 293 ? 35.595  -82.371  19.562  1.00 21.66 ? 291 GLN C N     1 
ATOM   8174  C  CA    . GLN G  1 293 ? 35.165  -82.944  18.293  1.00 22.63 ? 291 GLN C CA    1 
ATOM   8175  C  C     . GLN G  1 293 ? 35.619  -82.070  17.130  1.00 21.42 ? 291 GLN C C     1 
ATOM   8176  O  O     . GLN G  1 293 ? 35.138  -80.942  16.929  1.00 24.81 ? 291 GLN C O     1 
ATOM   8177  C  CB    . GLN G  1 293 ? 33.645  -83.112  18.261  1.00 23.70 ? 291 GLN C CB    1 
ATOM   8178  C  CG    . GLN G  1 293 ? 33.144  -83.776  16.970  1.00 26.70 ? 291 GLN C CG    1 
ATOM   8179  C  CD    . GLN G  1 293 ? 31.674  -84.137  17.012  1.00 29.19 ? 291 GLN C CD    1 
ATOM   8180  O  OE1   . GLN G  1 293 ? 31.196  -84.770  17.968  1.00 33.96 ? 291 GLN C OE1   1 
ATOM   8181  N  NE2   . GLN G  1 293 ? 30.946  -83.742  15.977  1.00 30.80 ? 291 GLN C NE2   1 
ATOM   8182  N  N     . PHE G  1 294 ? 36.568  -82.590  16.367  1.00 25.60 ? 292 PHE C N     1 
ATOM   8183  C  CA    . PHE G  1 294 ? 37.215  -81.840  15.296  1.00 20.24 ? 292 PHE C CA    1 
ATOM   8184  C  C     . PHE G  1 294 ? 37.681  -82.825  14.225  1.00 20.43 ? 292 PHE C C     1 
ATOM   8185  O  O     . PHE G  1 294 ? 37.942  -83.982  14.528  1.00 20.87 ? 292 PHE C O     1 
ATOM   8186  C  CB    . PHE G  1 294 ? 38.404  -81.014  15.828  1.00 20.02 ? 292 PHE C CB    1 
ATOM   8187  C  CG    . PHE G  1 294 ? 39.467  -81.845  16.510  1.00 26.31 ? 292 PHE C CG    1 
ATOM   8188  C  CD1   . PHE G  1 294 ? 40.445  -82.498  15.763  1.00 18.23 ? 292 PHE C CD1   1 
ATOM   8189  C  CD2   . PHE G  1 294 ? 39.474  -81.993  17.895  1.00 21.17 ? 292 PHE C CD2   1 
ATOM   8190  C  CE1   . PHE G  1 294 ? 41.418  -83.284  16.398  1.00 20.60 ? 292 PHE C CE1   1 
ATOM   8191  C  CE2   . PHE G  1 294 ? 40.434  -82.771  18.528  1.00 23.00 ? 292 PHE C CE2   1 
ATOM   8192  C  CZ    . PHE G  1 294 ? 41.424  -83.417  17.766  1.00 20.84 ? 292 PHE C CZ    1 
ATOM   8193  N  N     . PRO G  1 295 ? 37.763  -82.370  12.972  1.00 22.57 ? 293 PRO C N     1 
ATOM   8194  C  CA    . PRO G  1 295 ? 37.316  -81.006  12.667  1.00 21.83 ? 293 PRO C CA    1 
ATOM   8195  C  C     . PRO G  1 295 ? 35.807  -80.973  12.535  1.00 27.47 ? 293 PRO C C     1 
ATOM   8196  O  O     . PRO G  1 295 ? 35.157  -82.022  12.535  1.00 20.04 ? 293 PRO C O     1 
ATOM   8197  C  CB    . PRO G  1 295 ? 37.943  -80.721  11.307  1.00 16.26 ? 293 PRO C CB    1 
ATOM   8198  C  CG    . PRO G  1 295 ? 38.072  -82.091  10.641  1.00 19.65 ? 293 PRO C CG    1 
ATOM   8199  C  CD    . PRO G  1 295 ? 38.283  -83.082  11.789  1.00 20.14 ? 293 PRO C CD    1 
ATOM   8200  N  N     . ASP G  1 296 ? 35.277  -79.761  12.425  1.00 25.86 ? 294 ASP C N     1 
ATOM   8201  C  CA    . ASP G  1 296 ? 33.845  -79.532  12.274  1.00 30.94 ? 294 ASP C CA    1 
ATOM   8202  C  C     . ASP G  1 296 ? 33.574  -79.282  10.783  1.00 34.62 ? 294 ASP C C     1 
ATOM   8203  O  O     . ASP G  1 296 ? 33.841  -78.180  10.260  1.00 25.21 ? 294 ASP C O     1 
ATOM   8204  C  CB    . ASP G  1 296 ? 33.426  -78.349  13.171  1.00 29.75 ? 294 ASP C CB    1 
ATOM   8205  C  CG    . ASP G  1 296 ? 32.021  -77.829  12.851  1.00 39.06 ? 294 ASP C CG    1 
ATOM   8206  O  OD1   . ASP G  1 296 ? 31.253  -78.521  12.138  1.00 36.11 ? 294 ASP C OD1   1 
ATOM   8207  O  OD2   . ASP G  1 296 ? 31.702  -76.717  13.313  1.00 30.19 ? 294 ASP C OD2   1 
ATOM   8208  N  N     . LEU G  1 297 ? 33.074  -80.310  10.090  1.00 32.64 ? 295 LEU C N     1 
ATOM   8209  C  CA    . LEU G  1 297 ? 33.080  -80.286  8.622   1.00 29.91 ? 295 LEU C CA    1 
ATOM   8210  C  C     . LEU G  1 297 ? 31.944  -79.448  8.021   1.00 30.94 ? 295 LEU C C     1 
ATOM   8211  O  O     . LEU G  1 297 ? 31.814  -79.317  6.792   1.00 31.80 ? 295 LEU C O     1 
ATOM   8212  C  CB    . LEU G  1 297 ? 33.147  -81.696  8.028   1.00 32.44 ? 295 LEU C CB    1 
ATOM   8213  C  CG    . LEU G  1 297 ? 34.515  -82.343  8.311   1.00 35.66 ? 295 LEU C CG    1 
ATOM   8214  C  CD1   . LEU G  1 297 ? 34.629  -83.740  7.716   1.00 32.02 ? 295 LEU C CD1   1 
ATOM   8215  C  CD2   . LEU G  1 297 ? 35.592  -81.409  7.787   1.00 27.71 ? 295 LEU C CD2   1 
ATOM   8216  N  N     . SER G  1 298 ? 31.146  -78.859  8.897   1.00 26.69 ? 296 SER C N     1 
ATOM   8217  C  CA    . SER G  1 298 ? 30.254  -77.801  8.467   1.00 29.90 ? 296 SER C CA    1 
ATOM   8218  C  C     . SER G  1 298 ? 31.096  -76.603  8.029   1.00 29.76 ? 296 SER C C     1 
ATOM   8219  O  O     . SER G  1 298 ? 30.567  -75.659  7.449   1.00 32.41 ? 296 SER C O     1 
ATOM   8220  C  CB    . SER G  1 298 ? 29.280  -77.413  9.584   1.00 26.43 ? 296 SER C CB    1 
ATOM   8221  O  OG    . SER G  1 298 ? 29.898  -76.610  10.576  1.00 38.34 ? 296 SER C OG    1 
ATOM   8222  N  N     . TYR G  1 299 ? 32.411  -76.634  8.280   1.00 28.60 ? 297 TYR C N     1 
ATOM   8223  C  CA    . TYR G  1 299 ? 33.296  -75.672  7.613   1.00 24.23 ? 297 TYR C CA    1 
ATOM   8224  C  C     . TYR G  1 299 ? 33.859  -76.317  6.381   1.00 25.88 ? 297 TYR C C     1 
ATOM   8225  O  O     . TYR G  1 299 ? 33.965  -77.552  6.309   1.00 36.07 ? 297 TYR C O     1 
ATOM   8226  C  CB    . TYR G  1 299 ? 34.472  -75.266  8.477   1.00 26.17 ? 297 TYR C CB    1 
ATOM   8227  C  CG    . TYR G  1 299 ? 34.153  -74.342  9.618   1.00 29.46 ? 297 TYR C CG    1 
ATOM   8228  C  CD1   . TYR G  1 299 ? 33.806  -74.850  10.859  1.00 29.04 ? 297 TYR C CD1   1 
ATOM   8229  C  CD2   . TYR G  1 299 ? 34.236  -72.960  9.466   1.00 23.59 ? 297 TYR C CD2   1 
ATOM   8230  C  CE1   . TYR G  1 299 ? 33.533  -74.016  11.913  1.00 31.41 ? 297 TYR C CE1   1 
ATOM   8231  C  CE2   . TYR G  1 299 ? 33.972  -72.104  10.533  1.00 26.34 ? 297 TYR C CE2   1 
ATOM   8232  C  CZ    . TYR G  1 299 ? 33.617  -72.648  11.750  1.00 28.41 ? 297 TYR C CZ    1 
ATOM   8233  O  OH    . TYR G  1 299 ? 33.337  -71.844  12.836  1.00 39.09 ? 297 TYR C OH    1 
ATOM   8234  N  N     . SER G  1 300 ? 34.234  -75.497  5.416   1.00 20.45 ? 298 SER C N     1 
ATOM   8235  C  CA    . SER G  1 300 ? 34.982  -75.987  4.265   1.00 25.44 ? 298 SER C CA    1 
ATOM   8236  C  C     . SER G  1 300 ? 36.464  -75.690  4.464   1.00 28.39 ? 298 SER C C     1 
ATOM   8237  O  O     . SER G  1 300 ? 36.872  -74.525  4.339   1.00 26.24 ? 298 SER C O     1 
ATOM   8238  C  CB    . SER G  1 300 ? 34.552  -75.277  2.996   1.00 21.81 ? 298 SER C CB    1 
ATOM   8239  O  OG    . SER G  1 300 ? 35.295  -75.731  1.853   1.00 21.56 ? 298 SER C OG    1 
ATOM   8240  N  N     . ILE G  1 301 ? 37.269  -76.723  4.735   1.00 24.16 ? 299 ILE C N     1 
ATOM   8241  C  CA    . ILE G  1 301 ? 38.722  -76.538  4.854   1.00 27.46 ? 299 ILE C CA    1 
ATOM   8242  C  C     . ILE G  1 301 ? 39.231  -75.705  3.678   1.00 19.74 ? 299 ILE C C     1 
ATOM   8243  O  O     . ILE G  1 301 ? 39.955  -74.702  3.828   1.00 21.03 ? 299 ILE C O     1 
ATOM   8244  C  CB    . ILE G  1 301 ? 39.478  -77.889  4.820   1.00 23.25 ? 299 ILE C CB    1 
ATOM   8245  C  CG1   . ILE G  1 301 ? 38.963  -78.880  5.879   1.00 22.51 ? 299 ILE C CG1   1 
ATOM   8246  C  CG2   . ILE G  1 301 ? 41.003  -77.650  4.864   1.00 19.57 ? 299 ILE C CG2   1 
ATOM   8247  C  CD1   . ILE G  1 301 ? 39.064  -78.419  7.324   1.00 20.14 ? 299 ILE C CD1   1 
ATOM   8248  N  N     . SER G  1 302 ? 38.855  -76.136  2.478   1.00 20.51 ? 300 SER C N     1 
ATOM   8249  C  CA    . SER G  1 302 ? 39.359  -75.498  1.254   1.00 19.70 ? 300 SER C CA    1 
ATOM   8250  C  C     . SER G  1 302 ? 39.019  -73.992  1.185   1.00 18.81 ? 300 SER C C     1 
ATOM   8251  O  O     . SER G  1 302 ? 39.849  -73.148  0.798   1.00 18.28 ? 300 SER C O     1 
ATOM   8252  C  CB    . SER G  1 302 ? 38.848  -76.238  0.014   1.00 24.58 ? 300 SER C CB    1 
ATOM   8253  O  OG    . SER G  1 302 ? 39.004  -75.415  -1.139  1.00 30.64 ? 300 SER C OG    1 
ATOM   8254  N  N     . GLU G  1 303 ? 37.801  -73.646  1.578   1.00 24.00 ? 301 GLU C N     1 
ATOM   8255  C  CA    . GLU G  1 303 ? 37.413  -72.239  1.592   1.00 19.08 ? 301 GLU C CA    1 
ATOM   8256  C  C     . GLU G  1 303 ? 38.164  -71.476  2.685   1.00 20.73 ? 301 GLU C C     1 
ATOM   8257  O  O     . GLU G  1 303 ? 38.569  -70.306  2.477   1.00 18.86 ? 301 GLU C O     1 
ATOM   8258  C  CB    . GLU G  1 303 ? 35.906  -72.155  1.805   1.00 28.29 ? 301 GLU C CB    1 
ATOM   8259  C  CG    . GLU G  1 303 ? 35.305  -70.794  1.602   1.00 31.74 ? 301 GLU C CG    1 
ATOM   8260  C  CD    . GLU G  1 303 ? 34.990  -70.135  2.931   1.00 47.65 ? 301 GLU C CD    1 
ATOM   8261  O  OE1   . GLU G  1 303 ? 35.249  -70.792  3.977   1.00 46.19 ? 301 GLU C OE1   1 
ATOM   8262  O  OE2   . GLU G  1 303 ? 34.495  -68.977  2.935   1.00 54.94 ? 301 GLU C OE2   1 
ATOM   8263  N  N     . LEU G  1 304 ? 38.361  -72.111  3.848   1.00 20.72 ? 302 LEU C N     1 
ATOM   8264  C  CA    . LEU G  1 304 ? 39.173  -71.472  4.897   1.00 27.07 ? 302 LEU C CA    1 
ATOM   8265  C  C     . LEU G  1 304 ? 40.573  -71.179  4.362   1.00 16.59 ? 302 LEU C C     1 
ATOM   8266  O  O     . LEU G  1 304 ? 41.138  -70.096  4.592   1.00 18.99 ? 302 LEU C O     1 
ATOM   8267  C  CB    . LEU G  1 304 ? 39.268  -72.327  6.163   1.00 26.58 ? 302 LEU C CB    1 
ATOM   8268  C  CG    . LEU G  1 304 ? 38.009  -72.397  7.001   1.00 23.74 ? 302 LEU C CG    1 
ATOM   8269  C  CD1   . LEU G  1 304 ? 38.152  -73.430  8.162   1.00 17.84 ? 302 LEU C CD1   1 
ATOM   8270  C  CD2   . LEU G  1 304 ? 37.739  -71.007  7.540   1.00 25.95 ? 302 LEU C CD2   1 
ATOM   8271  N  N     . LEU G  1 305 ? 41.113  -72.135  3.620   1.00 18.17 ? 303 LEU C N     1 
ATOM   8272  C  CA    . LEU G  1 305 ? 42.448  -72.008  3.066   1.00 15.84 ? 303 LEU C CA    1 
ATOM   8273  C  C     . LEU G  1 305 ? 42.529  -71.004  1.936   1.00 22.23 ? 303 LEU C C     1 
ATOM   8274  O  O     . LEU G  1 305 ? 43.600  -70.436  1.697   1.00 16.90 ? 303 LEU C O     1 
ATOM   8275  C  CB    . LEU G  1 305 ? 42.990  -73.357  2.601   1.00 20.38 ? 303 LEU C CB    1 
ATOM   8276  C  CG    . LEU G  1 305 ? 43.234  -74.242  3.823   1.00 22.90 ? 303 LEU C CG    1 
ATOM   8277  C  CD1   . LEU G  1 305 ? 43.744  -75.612  3.388   1.00 22.85 ? 303 LEU C CD1   1 
ATOM   8278  C  CD2   . LEU G  1 305 ? 44.196  -73.579  4.803   1.00 18.53 ? 303 LEU C CD2   1 
ATOM   8279  N  N     . SER G  1 306 ? 41.413  -70.768  1.238   1.00 16.08 ? 304 SER C N     1 
ATOM   8280  C  CA    . SER G  1 306 ? 41.461  -69.781  0.157   1.00 18.84 ? 304 SER C CA    1 
ATOM   8281  C  C     . SER G  1 306 ? 41.716  -68.362  0.660   1.00 21.91 ? 304 SER C C     1 
ATOM   8282  O  O     . SER G  1 306 ? 42.138  -67.489  -0.102  1.00 23.07 ? 304 SER C O     1 
ATOM   8283  C  CB    . SER G  1 306 ? 40.192  -69.803  -0.723  1.00 21.83 ? 304 SER C CB    1 
ATOM   8284  O  OG    . SER G  1 306 ? 39.039  -69.434  0.006   1.00 22.15 ? 304 SER C OG    1 
ATOM   8285  N  N     . LYS G  1 307 ? 41.493  -68.130  1.948   1.00 21.99 ? 305 LYS C N     1 
ATOM   8286  C  CA    . LYS G  1 307 ? 41.713  -66.797  2.517   1.00 20.90 ? 305 LYS C CA    1 
ATOM   8287  C  C     . LYS G  1 307 ? 43.182  -66.474  2.756   1.00 21.02 ? 305 LYS C C     1 
ATOM   8288  O  O     . LYS G  1 307 ? 43.503  -65.352  3.156   1.00 24.05 ? 305 LYS C O     1 
ATOM   8289  C  CB    . LYS G  1 307 ? 40.875  -66.597  3.787   1.00 19.46 ? 305 LYS C CB    1 
ATOM   8290  C  CG    . LYS G  1 307 ? 39.347  -66.727  3.516   1.00 23.38 ? 305 LYS C CG    1 
ATOM   8291  C  CD    . LYS G  1 307 ? 38.581  -67.202  4.747   1.00 31.68 ? 305 LYS C CD    1 
ATOM   8292  C  CE    . LYS G  1 307 ? 37.161  -67.657  4.376   1.00 40.17 ? 305 LYS C CE    1 
ATOM   8293  N  NZ    . LYS G  1 307 ? 36.207  -67.692  5.568   1.00 39.88 ? 305 LYS C NZ    1 
ATOM   8294  N  N     . ARG G  1 308 ? 44.083  -67.418  2.481   1.00 18.26 ? 306 ARG C N     1 
ATOM   8295  C  CA    . ARG G  1 308 ? 45.510  -67.147  2.716   1.00 24.39 ? 306 ARG C CA    1 
ATOM   8296  C  C     . ARG G  1 308 ? 46.015  -66.005  1.818   1.00 26.24 ? 306 ARG C C     1 
ATOM   8297  O  O     . ARG G  1 308 ? 45.659  -65.917  0.637   1.00 20.16 ? 306 ARG C O     1 
ATOM   8298  C  CB    . ARG G  1 308 ? 46.404  -68.403  2.534   1.00 19.92 ? 306 ARG C CB    1 
ATOM   8299  C  CG    . ARG G  1 308 ? 46.342  -69.423  3.711   1.00 15.00 ? 306 ARG C CG    1 
ATOM   8300  C  CD    . ARG G  1 308 ? 47.400  -70.551  3.547   1.00 16.23 ? 306 ARG C CD    1 
ATOM   8301  N  NE    . ARG G  1 308 ? 48.723  -70.039  3.128   1.00 15.16 ? 306 ARG C NE    1 
ATOM   8302  C  CZ    . ARG G  1 308 ? 49.732  -70.788  2.697   1.00 14.35 ? 306 ARG C CZ    1 
ATOM   8303  N  NH1   . ARG G  1 308 ? 49.625  -72.121  2.655   1.00 17.96 ? 306 ARG C NH1   1 
ATOM   8304  N  NH2   . ARG G  1 308 ? 50.867  -70.212  2.321   1.00 17.97 ? 306 ARG C NH2   1 
ATOM   8305  N  N     . THR G  1 309 ? 46.844  -65.126  2.371   1.00 23.25 ? 307 THR C N     1 
ATOM   8306  C  CA    . THR G  1 309 ? 47.442  -64.091  1.563   1.00 24.44 ? 307 THR C CA    1 
ATOM   8307  C  C     . THR G  1 309 ? 48.858  -63.916  2.008   1.00 29.48 ? 307 THR C C     1 
ATOM   8308  O  O     . THR G  1 309 ? 49.244  -64.401  3.076   1.00 26.16 ? 307 THR C O     1 
ATOM   8309  C  CB    . THR G  1 309 ? 46.696  -62.723  1.683   1.00 23.15 ? 307 THR C CB    1 
ATOM   8310  O  OG1   . THR G  1 309 ? 46.982  -62.126  2.957   1.00 25.38 ? 307 THR C OG1   1 
ATOM   8311  C  CG2   . THR G  1 309 ? 45.190  -62.873  1.490   1.00 28.33 ? 307 THR C CG2   1 
ATOM   8312  N  N     . LYS G  1 310 ? 49.627  -63.210  1.193   1.00 26.33 ? 308 LYS C N     1 
ATOM   8313  C  CA    . LYS G  1 310 ? 51.056  -63.104  1.426   1.00 29.27 ? 308 LYS C CA    1 
ATOM   8314  C  C     . LYS G  1 310 ? 51.312  -62.303  2.697   1.00 33.91 ? 308 LYS C C     1 
ATOM   8315  O  O     . LYS G  1 310 ? 52.216  -62.615  3.472   1.00 31.41 ? 308 LYS C O     1 
ATOM   8316  C  CB    . LYS G  1 310 ? 51.715  -62.457  0.227   1.00 34.03 ? 308 LYS C CB    1 
ATOM   8317  C  CG    . LYS G  1 310 ? 53.187  -62.704  0.129   1.00 44.68 ? 308 LYS C CG    1 
ATOM   8318  C  CD    . LYS G  1 310 ? 53.682  -62.438  -1.283  1.00 46.83 ? 308 LYS C CD    1 
ATOM   8319  C  CE    . LYS G  1 310 ? 55.053  -61.817  -1.220  1.00 63.52 ? 308 LYS C CE    1 
ATOM   8320  N  NZ    . LYS G  1 310 ? 55.067  -60.712  -0.199  1.00 66.44 ? 308 LYS C NZ    1 
ATOM   8321  N  N     . GLU G  1 311 ? 50.476  -61.301  2.934   1.00 30.31 ? 309 GLU C N     1 
ATOM   8322  C  CA    . GLU G  1 311 ? 50.591  -60.500  4.140   1.00 32.71 ? 309 GLU C CA    1 
ATOM   8323  C  C     . GLU G  1 311 ? 50.159  -61.266  5.387   1.00 26.60 ? 309 GLU C C     1 
ATOM   8324  O  O     . GLU G  1 311 ? 50.812  -61.188  6.447   1.00 21.54 ? 309 GLU C O     1 
ATOM   8325  C  CB    . GLU G  1 311 ? 49.807  -59.196  3.981   1.00 33.20 ? 309 GLU C CB    1 
ATOM   8326  C  CG    . GLU G  1 311 ? 50.514  -58.264  3.019   1.00 38.09 ? 309 GLU C CG    1 
ATOM   8327  C  CD    . GLU G  1 311 ? 52.036  -58.391  3.130   1.00 58.86 ? 309 GLU C CD    1 
ATOM   8328  O  OE1   . GLU G  1 311 ? 52.648  -59.145  2.327   1.00 57.53 ? 309 GLU C OE1   1 
ATOM   8329  O  OE2   . GLU G  1 311 ? 52.631  -57.758  4.040   1.00 62.30 ? 309 GLU C OE2   1 
ATOM   8330  N  N     . LEU G  1 312 ? 49.055  -61.990  5.263   1.00 23.96 ? 310 LEU C N     1 
ATOM   8331  C  CA    . LEU G  1 312 ? 48.544  -62.793  6.376   1.00 25.67 ? 310 LEU C CA    1 
ATOM   8332  C  C     . LEU G  1 312 ? 49.564  -63.865  6.735   1.00 22.01 ? 310 LEU C C     1 
ATOM   8333  O  O     . LEU G  1 312 ? 49.897  -64.014  7.917   1.00 25.45 ? 310 LEU C O     1 
ATOM   8334  C  CB    . LEU G  1 312 ? 47.207  -63.451  6.021   1.00 25.95 ? 310 LEU C CB    1 
ATOM   8335  C  CG    . LEU G  1 312 ? 46.025  -62.908  6.784   1.00 33.57 ? 310 LEU C CG    1 
ATOM   8336  C  CD1   . LEU G  1 312 ? 46.211  -61.436  6.841   1.00 37.02 ? 310 LEU C CD1   1 
ATOM   8337  C  CD2   . LEU G  1 312 ? 44.672  -63.267  6.105   1.00 32.02 ? 310 LEU C CD2   1 
ATOM   8338  N  N     . ASP G  1 313 ? 50.040  -64.600  5.718   1.00 22.44 ? 311 ASP C N     1 
ATOM   8339  C  CA    . ASP G  1 313 ? 51.115  -65.593  5.878   1.00 24.29 ? 311 ASP C CA    1 
ATOM   8340  C  C     . ASP G  1 313 ? 52.302  -64.980  6.607   1.00 28.07 ? 311 ASP C C     1 
ATOM   8341  O  O     . ASP G  1 313 ? 52.815  -65.546  7.562   1.00 21.59 ? 311 ASP C O     1 
ATOM   8342  C  CB    . ASP G  1 313 ? 51.623  -66.146  4.533   1.00 20.20 ? 311 ASP C CB    1 
ATOM   8343  C  CG    . ASP G  1 313 ? 50.611  -67.045  3.828   1.00 17.41 ? 311 ASP C CG    1 
ATOM   8344  O  OD1   . ASP G  1 313 ? 49.617  -67.416  4.456   1.00 16.76 ? 311 ASP C OD1   1 
ATOM   8345  O  OD2   . ASP G  1 313 ? 50.803  -67.369  2.633   1.00 18.69 ? 311 ASP C OD2   1 
ATOM   8346  N  N     . LYS G  1 314 ? 52.775  -63.835  6.147   1.00 25.27 ? 312 LYS C N     1 
ATOM   8347  C  CA    . LYS G  1 314 ? 53.967  -63.289  6.771   1.00 30.01 ? 312 LYS C CA    1 
ATOM   8348  C  C     . LYS G  1 314 ? 53.717  -63.011  8.256   1.00 26.99 ? 312 LYS C C     1 
ATOM   8349  O  O     . LYS G  1 314 ? 54.596  -63.172  9.125   1.00 23.12 ? 312 LYS C O     1 
ATOM   8350  C  CB    . LYS G  1 314 ? 54.373  -62.005  6.067   1.00 34.73 ? 312 LYS C CB    1 
ATOM   8351  C  CG    . LYS G  1 314 ? 55.197  -61.092  6.947   1.00 44.47 ? 312 LYS C CG    1 
ATOM   8352  C  CD    . LYS G  1 314 ? 55.430  -59.748  6.259   1.00 49.06 ? 312 LYS C CD    1 
ATOM   8353  C  CE    . LYS G  1 314 ? 56.834  -59.262  6.516   1.00 45.48 ? 312 LYS C CE    1 
ATOM   8354  N  NZ    . LYS G  1 314 ? 57.233  -58.336  5.424   1.00 49.85 ? 312 LYS C NZ    1 
ATOM   8355  N  N     . LYS G  1 315 ? 52.493  -62.604  8.550   1.00 21.88 ? 313 LYS C N     1 
ATOM   8356  C  CA    . LYS G  1 315 ? 52.149  -62.231  9.901   1.00 21.69 ? 313 LYS C CA    1 
ATOM   8357  C  C     . LYS G  1 315 ? 51.975  -63.499  10.745  1.00 22.55 ? 313 LYS C C     1 
ATOM   8358  O  O     . LYS G  1 315 ? 52.261  -63.512  11.936  1.00 19.04 ? 313 LYS C O     1 
ATOM   8359  C  CB    . LYS G  1 315 ? 50.892  -61.380  9.865   1.00 24.79 ? 313 LYS C CB    1 
ATOM   8360  C  CG    . LYS G  1 315 ? 50.355  -60.980  11.205  1.00 32.39 ? 313 LYS C CG    1 
ATOM   8361  C  CD    . LYS G  1 315 ? 51.491  -60.591  12.153  1.00 34.86 ? 313 LYS C CD    1 
ATOM   8362  C  CE    . LYS G  1 315 ? 50.970  -59.618  13.208  1.00 45.53 ? 313 LYS C CE    1 
ATOM   8363  N  NZ    . LYS G  1 315 ? 51.948  -59.320  14.314  1.00 43.52 ? 313 LYS C NZ    1 
ATOM   8364  N  N     . ILE G  1 316 ? 51.516  -64.570  10.111  1.00 20.78 ? 314 ILE C N     1 
ATOM   8365  C  CA    . ILE G  1 316 ? 51.294  -65.829  10.822  1.00 16.33 ? 314 ILE C CA    1 
ATOM   8366  C  C     . ILE G  1 316 ? 52.655  -66.376  11.243  1.00 13.78 ? 314 ILE C C     1 
ATOM   8367  O  O     . ILE G  1 316 ? 52.836  -66.816  12.364  1.00 17.88 ? 314 ILE C O     1 
ATOM   8368  C  CB    . ILE G  1 316 ? 50.574  -66.883  9.925   1.00 13.99 ? 314 ILE C CB    1 
ATOM   8369  C  CG1   . ILE G  1 316 ? 49.103  -66.536  9.771   1.00 18.18 ? 314 ILE C CG1   1 
ATOM   8370  C  CG2   . ILE G  1 316 ? 50.672  -68.282  10.567  1.00 10.59 ? 314 ILE C CG2   1 
ATOM   8371  C  CD1   . ILE G  1 316 ? 48.404  -67.320  8.615   1.00 14.93 ? 314 ILE C CD1   1 
ATOM   8372  N  N     . ILE G  1 317 ? 53.612  -66.350  10.329  1.00 15.60 ? 315 ILE C N     1 
ATOM   8373  C  CA    . ILE G  1 317 ? 54.939  -66.887  10.575  1.00 19.84 ? 315 ILE C CA    1 
ATOM   8374  C  C     . ILE G  1 317 ? 55.679  -66.060  11.641  1.00 25.61 ? 315 ILE C C     1 
ATOM   8375  O  O     . ILE G  1 317 ? 56.426  -66.602  12.470  1.00 17.41 ? 315 ILE C O     1 
ATOM   8376  C  CB    . ILE G  1 317 ? 55.764  -66.880  9.283   1.00 15.63 ? 315 ILE C CB    1 
ATOM   8377  C  CG1   . ILE G  1 317 ? 55.242  -67.900  8.278   1.00 23.10 ? 315 ILE C CG1   1 
ATOM   8378  C  CG2   . ILE G  1 317 ? 57.254  -67.076  9.567   1.00 21.20 ? 315 ILE C CG2   1 
ATOM   8379  C  CD1   . ILE G  1 317 ? 54.737  -69.213  8.929   1.00 21.98 ? 315 ILE C CD1   1 
ATOM   8380  N  N     . GLU G  1 318 ? 55.494  -64.743  11.612  1.00 20.57 ? 316 GLU C N     1 
ATOM   8381  C  CA    . GLU G  1 318 ? 56.075  -63.902  12.651  1.00 20.37 ? 316 GLU C CA    1 
ATOM   8382  C  C     . GLU G  1 318 ? 55.498  -64.324  14.031  1.00 22.96 ? 316 GLU C C     1 
ATOM   8383  O  O     . GLU G  1 318 ? 56.247  -64.544  14.988  1.00 20.33 ? 316 GLU C O     1 
ATOM   8384  C  CB    . GLU G  1 318 ? 55.814  -62.415  12.306  1.00 20.09 ? 316 GLU C CB    1 
ATOM   8385  C  CG    . GLU G  1 318 ? 56.251  -61.355  13.338  1.00 33.58 ? 316 GLU C CG    1 
ATOM   8386  C  CD    . GLU G  1 318 ? 55.367  -60.081  13.287  1.00 35.39 ? 316 GLU C CD    1 
ATOM   8387  O  OE1   . GLU G  1 318 ? 54.975  -59.653  12.165  1.00 40.49 ? 316 GLU C OE1   1 
ATOM   8388  O  OE2   . GLU G  1 318 ? 55.041  -59.533  14.374  1.00 44.32 ? 316 GLU C OE2   1 
ATOM   8389  N  N     . LEU G  1 319 ? 54.184  -64.490  14.141  1.00 12.60 ? 317 LEU C N     1 
ATOM   8390  C  CA    . LEU G  1 319 ? 53.607  -64.825  15.453  1.00 14.60 ? 317 LEU C CA    1 
ATOM   8391  C  C     . LEU G  1 319 ? 53.958  -66.242  15.869  1.00 16.71 ? 317 LEU C C     1 
ATOM   8392  O  O     . LEU G  1 319 ? 54.135  -66.519  17.057  1.00 19.65 ? 317 LEU C O     1 
ATOM   8393  C  CB    . LEU G  1 319 ? 52.069  -64.705  15.476  1.00 12.93 ? 317 LEU C CB    1 
ATOM   8394  C  CG    . LEU G  1 319 ? 51.422  -63.317  15.491  1.00 22.13 ? 317 LEU C CG    1 
ATOM   8395  C  CD1   . LEU G  1 319 ? 52.295  -62.269  16.221  1.00 21.99 ? 317 LEU C CD1   1 
ATOM   8396  C  CD2   . LEU G  1 319 ? 51.113  -62.910  14.098  1.00 34.29 ? 317 LEU C CD2   1 
ATOM   8397  N  N     . TRP G  1 320 ? 54.009  -67.153  14.900  1.00 18.35 ? 318 TRP C N     1 
ATOM   8398  C  CA    . TRP G  1 320 ? 54.409  -68.521  15.225  1.00 17.71 ? 318 TRP C CA    1 
ATOM   8399  C  C     . TRP G  1 320 ? 55.818  -68.469  15.777  1.00 14.78 ? 318 TRP C C     1 
ATOM   8400  O  O     . TRP G  1 320 ? 56.132  -69.085  16.777  1.00 14.71 ? 318 TRP C O     1 
ATOM   8401  C  CB    . TRP G  1 320 ? 54.399  -69.404  13.981  1.00 15.95 ? 318 TRP C CB    1 
ATOM   8402  C  CG    . TRP G  1 320 ? 54.712  -70.867  14.269  1.00 13.40 ? 318 TRP C CG    1 
ATOM   8403  C  CD1   . TRP G  1 320 ? 55.950  -71.425  14.426  1.00 13.54 ? 318 TRP C CD1   1 
ATOM   8404  C  CD2   . TRP G  1 320 ? 53.761  -71.935  14.459  1.00 18.91 ? 318 TRP C CD2   1 
ATOM   8405  N  NE1   . TRP G  1 320 ? 55.831  -72.785  14.686  1.00 11.20 ? 318 TRP C NE1   1 
ATOM   8406  C  CE2   . TRP G  1 320 ? 54.490  -73.129  14.695  1.00 15.13 ? 318 TRP C CE2   1 
ATOM   8407  C  CE3   . TRP G  1 320 ? 52.359  -72.008  14.430  1.00 15.28 ? 318 TRP C CE3   1 
ATOM   8408  C  CZ2   . TRP G  1 320 ? 53.881  -74.370  14.896  1.00 16.02 ? 318 TRP C CZ2   1 
ATOM   8409  C  CZ3   . TRP G  1 320 ? 51.744  -73.228  14.648  1.00 13.64 ? 318 TRP C CZ3   1 
ATOM   8410  C  CH2   . TRP G  1 320 ? 52.515  -74.404  14.876  1.00 16.09 ? 318 TRP C CH2   1 
ATOM   8411  N  N     . GLU G  1 321 ? 56.687  -67.727  15.122  1.00 17.97 ? 319 GLU C N     1 
ATOM   8412  C  CA    . GLU G  1 321 ? 58.073  -67.728  15.564  1.00 21.37 ? 319 GLU C CA    1 
ATOM   8413  C  C     . GLU G  1 321 ? 58.111  -67.166  16.979  1.00 23.08 ? 319 GLU C C     1 
ATOM   8414  O  O     . GLU G  1 321 ? 58.930  -67.577  17.817  1.00 19.08 ? 319 GLU C O     1 
ATOM   8415  C  CB    . GLU G  1 321 ? 58.924  -66.887  14.623  1.00 21.35 ? 319 GLU C CB    1 
ATOM   8416  C  CG    . GLU G  1 321 ? 60.394  -66.842  15.014  1.00 31.86 ? 319 GLU C CG    1 
ATOM   8417  C  CD    . GLU G  1 321 ? 61.317  -66.667  13.812  1.00 38.96 ? 319 GLU C CD    1 
ATOM   8418  O  OE1   . GLU G  1 321 ? 61.879  -65.561  13.653  1.00 45.91 ? 319 GLU C OE1   1 
ATOM   8419  O  OE2   . GLU G  1 321 ? 61.492  -67.639  13.034  1.00 53.43 ? 319 GLU C OE2   1 
ATOM   8420  N  N     . LYS G  1 322 ? 57.189  -66.251  17.246  1.00 16.07 ? 320 LYS C N     1 
ATOM   8421  C  CA    . LYS G  1 322 ? 57.107  -65.644  18.558  1.00 18.23 ? 320 LYS C CA    1 
ATOM   8422  C  C     . LYS G  1 322 ? 56.681  -66.633  19.646  1.00 19.59 ? 320 LYS C C     1 
ATOM   8423  O  O     . LYS G  1 322 ? 57.337  -66.755  20.679  1.00 17.57 ? 320 LYS C O     1 
ATOM   8424  C  CB    . LYS G  1 322 ? 56.150  -64.460  18.560  1.00 19.22 ? 320 LYS C CB    1 
ATOM   8425  C  CG    . LYS G  1 322 ? 55.975  -63.803  19.983  1.00 19.05 ? 320 LYS C CG    1 
ATOM   8426  C  CD    . LYS G  1 322 ? 55.059  -62.563  19.939  1.00 19.83 ? 320 LYS C CD    1 
ATOM   8427  C  CE    . LYS G  1 322 ? 54.510  -62.243  21.316  1.00 30.60 ? 320 LYS C CE    1 
ATOM   8428  N  NZ    . LYS G  1 322 ? 53.476  -61.159  21.321  1.00 29.68 ? 320 LYS C NZ    1 
ATOM   8429  N  N     . TYR G  1 323 ? 55.556  -67.308  19.446  1.00 13.98 ? 321 TYR C N     1 
ATOM   8430  C  CA    . TYR G  1 323 ? 55.003  -68.049  20.539  1.00 14.84 ? 321 TYR C CA    1 
ATOM   8431  C  C     . TYR G  1 323 ? 55.549  -69.461  20.630  1.00 16.04 ? 321 TYR C C     1 
ATOM   8432  O  O     . TYR G  1 323 ? 55.674  -70.012  21.721  1.00 18.03 ? 321 TYR C O     1 
ATOM   8433  C  CB    . TYR G  1 323 ? 53.494  -68.123  20.398  1.00 17.34 ? 321 TYR C CB    1 
ATOM   8434  C  CG    . TYR G  1 323 ? 52.863  -66.776  20.527  1.00 18.05 ? 321 TYR C CG    1 
ATOM   8435  C  CD1   . TYR G  1 323 ? 52.872  -66.110  21.736  1.00 17.60 ? 321 TYR C CD1   1 
ATOM   8436  C  CD2   . TYR G  1 323 ? 52.239  -66.168  19.426  1.00 18.90 ? 321 TYR C CD2   1 
ATOM   8437  C  CE1   . TYR G  1 323 ? 52.264  -64.833  21.858  1.00 23.74 ? 321 TYR C CE1   1 
ATOM   8438  C  CE2   . TYR G  1 323 ? 51.635  -64.921  19.542  1.00 19.40 ? 321 TYR C CE2   1 
ATOM   8439  C  CZ    . TYR G  1 323 ? 51.648  -64.263  20.761  1.00 23.00 ? 321 TYR C CZ    1 
ATOM   8440  O  OH    . TYR G  1 323 ? 51.047  -63.023  20.868  1.00 21.92 ? 321 TYR C OH    1 
ATOM   8441  N  N     . ILE G  1 324 ? 55.840  -70.040  19.476  1.00 15.21 ? 322 ILE C N     1 
ATOM   8442  C  CA    . ILE G  1 324 ? 56.157  -71.464  19.388  1.00 13.70 ? 322 ILE C CA    1 
ATOM   8443  C  C     . ILE G  1 324 ? 57.611  -71.644  18.942  1.00 14.66 ? 322 ILE C C     1 
ATOM   8444  O  O     . ILE G  1 324 ? 58.327  -72.492  19.467  1.00 13.19 ? 322 ILE C O     1 
ATOM   8445  C  CB    . ILE G  1 324 ? 55.189  -72.187  18.409  1.00 17.24 ? 322 ILE C CB    1 
ATOM   8446  C  CG1   . ILE G  1 324 ? 53.805  -72.308  19.046  1.00 16.21 ? 322 ILE C CG1   1 
ATOM   8447  C  CG2   . ILE G  1 324 ? 55.688  -73.601  18.098  1.00 12.10 ? 322 ILE C CG2   1 
ATOM   8448  C  CD1   . ILE G  1 324 ? 52.638  -72.593  18.039  1.00 19.48 ? 322 ILE C CD1   1 
ATOM   8449  N  N     . GLY G  1 325 ? 58.047  -70.815  17.991  1.00 14.45 ? 323 GLY C N     1 
ATOM   8450  C  CA    . GLY G  1 325 ? 59.353  -70.914  17.373  1.00 18.35 ? 323 GLY C CA    1 
ATOM   8451  C  C     . GLY G  1 325 ? 59.287  -71.757  16.102  1.00 21.15 ? 323 GLY C C     1 
ATOM   8452  O  O     . GLY G  1 325 ? 58.432  -72.631  15.985  1.00 12.97 ? 323 GLY C O     1 
ATOM   8453  N  N     . LEU G  1 326 ? 60.210  -71.522  15.165  1.00 15.38 ? 324 LEU C N     1 
ATOM   8454  C  CA    . LEU G  1 326 ? 60.189  -72.254  13.904  1.00 19.75 ? 324 LEU C CA    1 
ATOM   8455  C  C     . LEU G  1 326 ? 60.893  -73.590  14.023  1.00 18.29 ? 324 LEU C C     1 
ATOM   8456  O  O     . LEU G  1 326 ? 60.559  -74.524  13.285  1.00 15.39 ? 324 LEU C O     1 
ATOM   8457  C  CB    . LEU G  1 326 ? 60.819  -71.424  12.766  1.00 19.49 ? 324 LEU C CB    1 
ATOM   8458  C  CG    . LEU G  1 326 ? 59.871  -70.388  12.131  1.00 29.36 ? 324 LEU C CG    1 
ATOM   8459  C  CD1   . LEU G  1 326 ? 60.503  -69.751  10.924  1.00 31.21 ? 324 LEU C CD1   1 
ATOM   8460  C  CD2   . LEU G  1 326 ? 58.529  -71.024  11.727  1.00 23.32 ? 324 LEU C CD2   1 
ATOM   8461  N  N     . LYS G  1 327 ? 61.907  -73.672  14.890  1.00 14.10 ? 325 LYS C N     1 
ATOM   8462  C  CA    . LYS G  1 327 ? 62.519  -74.960  15.203  1.00 13.90 ? 325 LYS C CA    1 
ATOM   8463  C  C     . LYS G  1 327 ? 61.540  -75.863  15.927  1.00 15.31 ? 325 LYS C C     1 
ATOM   8464  O  O     . LYS G  1 327 ? 60.852  -75.432  16.865  1.00 17.91 ? 325 LYS C O     1 
ATOM   8465  C  CB    . LYS G  1 327 ? 63.746  -74.815  16.097  1.00 19.73 ? 325 LYS C CB    1 
ATOM   8466  C  CG    . LYS G  1 327 ? 64.869  -73.997  15.488  1.00 31.62 ? 325 LYS C CG    1 
ATOM   8467  C  CD    . LYS G  1 327 ? 65.435  -74.711  14.286  1.00 33.51 ? 325 LYS C CD    1 
ATOM   8468  C  CE    . LYS G  1 327 ? 66.666  -73.983  13.722  1.00 38.03 ? 325 LYS C CE    1 
ATOM   8469  N  NZ    . LYS G  1 327 ? 67.746  -73.977  14.729  1.00 37.11 ? 325 LYS C NZ    1 
ATOM   8470  N  N     . ILE G  1 328 ? 61.480  -77.140  15.535  1.00 15.20 ? 326 ILE C N     1 
ATOM   8471  C  CA    . ILE G  1 328 ? 60.675  -78.075  16.321  1.00 9.15  ? 326 ILE C CA    1 
ATOM   8472  C  C     . ILE G  1 328 ? 61.557  -78.602  17.460  1.00 16.25 ? 326 ILE C C     1 
ATOM   8473  O  O     . ILE G  1 328 ? 62.569  -79.259  17.202  1.00 16.63 ? 326 ILE C O     1 
ATOM   8474  C  CB    . ILE G  1 328 ? 60.211  -79.292  15.479  1.00 10.14 ? 326 ILE C CB    1 
ATOM   8475  C  CG1   . ILE G  1 328 ? 59.711  -78.826  14.126  1.00 11.36 ? 326 ILE C CG1   1 
ATOM   8476  C  CG2   . ILE G  1 328 ? 59.184  -80.114  16.275  1.00 10.00 ? 326 ILE C CG2   1 
ATOM   8477  C  CD1   . ILE G  1 328 ? 58.875  -79.859  13.347  1.00 13.45 ? 326 ILE C CD1   1 
ATOM   8478  N  N     . ILE G  1 329 ? 61.180  -78.351  18.711  1.00 17.07 ? 327 ILE C N     1 
ATOM   8479  C  CA    . ILE G  1 329 ? 62.102  -78.688  19.809  1.00 17.95 ? 327 ILE C CA    1 
ATOM   8480  C  C     . ILE G  1 329 ? 61.508  -79.696  20.774  1.00 16.20 ? 327 ILE C C     1 
ATOM   8481  O  O     . ILE G  1 329 ? 60.279  -79.835  20.874  1.00 17.80 ? 327 ILE C O     1 
ATOM   8482  C  CB    . ILE G  1 329 ? 62.553  -77.442  20.586  1.00 19.48 ? 327 ILE C CB    1 
ATOM   8483  C  CG1   . ILE G  1 329 ? 61.334  -76.725  21.161  1.00 23.58 ? 327 ILE C CG1   1 
ATOM   8484  C  CG2   . ILE G  1 329 ? 63.473  -76.537  19.685  1.00 20.44 ? 327 ILE C CG2   1 
ATOM   8485  C  CD1   . ILE G  1 329 ? 61.686  -75.424  21.876  1.00 24.05 ? 327 ILE C CD1   1 
ATOM   8486  N  N     . TYR G  1 330 ? 62.366  -80.415  21.481  1.00 22.18 ? 328 TYR C N     1 
ATOM   8487  C  CA    . TYR G  1 330 ? 61.857  -81.454  22.360  1.00 19.04 ? 328 TYR C CA    1 
ATOM   8488  C  C     . TYR G  1 330 ? 61.178  -80.832  23.581  1.00 18.45 ? 328 TYR C C     1 
ATOM   8489  O  O     . TYR G  1 330 ? 61.703  -79.912  24.218  1.00 21.47 ? 328 TYR C O     1 
ATOM   8490  C  CB    . TYR G  1 330 ? 62.943  -82.464  22.758  1.00 15.39 ? 328 TYR C CB    1 
ATOM   8491  C  CG    . TYR G  1 330 ? 62.423  -83.490  23.753  1.00 20.27 ? 328 TYR C CG    1 
ATOM   8492  C  CD1   . TYR G  1 330 ? 61.651  -84.565  23.337  1.00 16.31 ? 328 TYR C CD1   1 
ATOM   8493  C  CD2   . TYR G  1 330 ? 62.717  -83.374  25.108  1.00 18.16 ? 328 TYR C CD2   1 
ATOM   8494  C  CE1   . TYR G  1 330 ? 61.136  -85.500  24.280  1.00 18.42 ? 328 TYR C CE1   1 
ATOM   8495  C  CE2   . TYR G  1 330 ? 62.269  -84.268  26.024  1.00 14.99 ? 328 TYR C CE2   1 
ATOM   8496  C  CZ    . TYR G  1 330 ? 61.468  -85.333  25.622  1.00 17.77 ? 328 TYR C CZ    1 
ATOM   8497  O  OH    . TYR G  1 330 ? 61.001  -86.215  26.586  1.00 26.79 ? 328 TYR C OH    1 
ATOM   8498  N  N     . ASP G  1 331 ? 59.993  -81.331  23.890  1.00 17.46 ? 329 ASP C N     1 
ATOM   8499  C  CA    . ASP G  1 331 ? 59.181  -80.831  24.987  1.00 18.46 ? 329 ASP C CA    1 
ATOM   8500  C  C     . ASP G  1 331 ? 58.800  -82.075  25.792  1.00 22.36 ? 329 ASP C C     1 
ATOM   8501  O  O     . ASP G  1 331 ? 58.184  -82.999  25.254  1.00 19.00 ? 329 ASP C O     1 
ATOM   8502  C  CB    . ASP G  1 331 ? 57.909  -80.180  24.373  1.00 21.96 ? 329 ASP C CB    1 
ATOM   8503  C  CG    . ASP G  1 331 ? 56.967  -79.642  25.396  1.00 21.20 ? 329 ASP C CG    1 
ATOM   8504  O  OD1   . ASP G  1 331 ? 56.858  -80.247  26.480  1.00 24.87 ? 329 ASP C OD1   1 
ATOM   8505  O  OD2   . ASP G  1 331 ? 56.338  -78.586  25.129  1.00 32.42 ? 329 ASP C OD2   1 
ATOM   8506  N  N     . SER G  1 332 ? 59.145  -82.133  27.074  1.00 18.83 ? 330 SER C N     1 
ATOM   8507  C  CA    . SER G  1 332 ? 58.859  -83.355  27.836  1.00 18.68 ? 330 SER C CA    1 
ATOM   8508  C  C     . SER G  1 332 ? 57.587  -83.232  28.650  1.00 18.27 ? 330 SER C C     1 
ATOM   8509  O  O     . SER G  1 332 ? 57.353  -84.041  29.557  1.00 18.40 ? 330 SER C O     1 
ATOM   8510  C  CB    . SER G  1 332 ? 60.014  -83.727  28.784  1.00 21.81 ? 330 SER C CB    1 
ATOM   8511  O  OG    . SER G  1 332 ? 60.005  -82.884  29.923  1.00 25.87 ? 330 SER C OG    1 
ATOM   8512  N  N     . ASP G  1 333 ? 56.745  -82.247  28.358  1.00 18.53 ? 331 ASP C N     1 
ATOM   8513  C  CA    . ASP G  1 333 ? 55.484  -82.156  29.067  1.00 18.38 ? 331 ASP C CA    1 
ATOM   8514  C  C     . ASP G  1 333 ? 54.627  -83.363  28.625  1.00 17.25 ? 331 ASP C C     1 
ATOM   8515  O  O     . ASP G  1 333 ? 54.877  -83.939  27.574  1.00 15.61 ? 331 ASP C O     1 
ATOM   8516  C  CB    . ASP G  1 333 ? 54.777  -80.836  28.719  1.00 19.83 ? 331 ASP C CB    1 
ATOM   8517  C  CG    . ASP G  1 333 ? 55.038  -79.727  29.737  1.00 27.15 ? 331 ASP C CG    1 
ATOM   8518  O  OD1   . ASP G  1 333 ? 54.749  -79.923  30.935  1.00 26.82 ? 331 ASP C OD1   1 
ATOM   8519  O  OD2   . ASP G  1 333 ? 55.530  -78.651  29.317  1.00 29.73 ? 331 ASP C OD2   1 
ATOM   8520  N  N     . THR G  1 334 ? 53.615  -83.734  29.403  1.00 14.50 ? 332 THR C N     1 
ATOM   8521  C  CA    . THR G  1 334 ? 52.778  -84.884  29.040  1.00 19.13 ? 332 THR C CA    1 
ATOM   8522  C  C     . THR G  1 334 ? 51.925  -84.511  27.847  1.00 18.17 ? 332 THR C C     1 
ATOM   8523  O  O     . THR G  1 334 ? 51.638  -83.319  27.586  1.00 15.09 ? 332 THR C O     1 
ATOM   8524  C  CB    . THR G  1 334 ? 51.851  -85.339  30.156  1.00 20.99 ? 332 THR C CB    1 
ATOM   8525  O  OG1   . THR G  1 334 ? 50.938  -84.278  30.456  1.00 20.28 ? 332 THR C OG1   1 
ATOM   8526  C  CG2   . THR G  1 334 ? 52.679  -85.723  31.397  1.00 21.38 ? 332 THR C CG2   1 
ATOM   8527  N  N     . PHE G  1 335 ? 51.503  -85.535  27.121  1.00 14.22 ? 333 PHE C N     1 
ATOM   8528  C  CA    . PHE G  1 335 ? 50.929  -85.267  25.822  1.00 16.58 ? 333 PHE C CA    1 
ATOM   8529  C  C     . PHE G  1 335 ? 49.586  -84.554  25.926  1.00 17.60 ? 333 PHE C C     1 
ATOM   8530  O  O     . PHE G  1 335 ? 49.256  -83.751  25.043  1.00 18.81 ? 333 PHE C O     1 
ATOM   8531  C  CB    . PHE G  1 335 ? 50.764  -86.578  25.034  1.00 15.00 ? 333 PHE C CB    1 
ATOM   8532  C  CG    . PHE G  1 335 ? 52.031  -87.337  24.885  1.00 16.94 ? 333 PHE C CG    1 
ATOM   8533  C  CD1   . PHE G  1 335 ? 53.248  -86.678  24.866  1.00 15.20 ? 333 PHE C CD1   1 
ATOM   8534  C  CD2   . PHE G  1 335 ? 52.009  -88.713  24.748  1.00 17.48 ? 333 PHE C CD2   1 
ATOM   8535  C  CE1   . PHE G  1 335 ? 54.431  -87.401  24.738  1.00 17.41 ? 333 PHE C CE1   1 
ATOM   8536  C  CE2   . PHE G  1 335 ? 53.184  -89.428  24.576  1.00 15.89 ? 333 PHE C CE2   1 
ATOM   8537  C  CZ    . PHE G  1 335 ? 54.392  -88.778  24.588  1.00 19.24 ? 333 PHE C CZ    1 
ATOM   8538  N  N     . ASP G  1 336 ? 48.776  -84.883  26.933  1.00 16.32 ? 334 ASP C N     1 
ATOM   8539  C  CA    . ASP G  1 336 ? 47.496  -84.178  27.083  1.00 17.50 ? 334 ASP C CA    1 
ATOM   8540  C  C     . ASP G  1 336 ? 47.746  -82.673  27.283  1.00 18.49 ? 334 ASP C C     1 
ATOM   8541  O  O     . ASP G  1 336 ? 46.973  -81.869  26.837  1.00 18.93 ? 334 ASP C O     1 
ATOM   8542  C  CB    . ASP G  1 336 ? 46.618  -84.753  28.219  1.00 22.24 ? 334 ASP C CB    1 
ATOM   8543  C  CG    . ASP G  1 336 ? 47.361  -84.855  29.569  1.00 31.11 ? 334 ASP C CG    1 
ATOM   8544  O  OD1   . ASP G  1 336 ? 48.346  -85.619  29.618  1.00 26.88 ? 334 ASP C OD1   1 
ATOM   8545  O  OD2   . ASP G  1 336 ? 46.957  -84.193  30.570  1.00 24.58 ? 334 ASP C OD2   1 
ATOM   8546  N  N     . ILE G  1 337 ? 48.857  -82.316  27.923  1.00 20.68 ? 335 ILE C N     1 
ATOM   8547  C  CA    . ILE G  1 337 ? 49.245  -80.911  28.113  1.00 15.34 ? 335 ILE C CA    1 
ATOM   8548  C  C     . ILE G  1 337 ? 49.757  -80.333  26.802  1.00 15.72 ? 335 ILE C C     1 
ATOM   8549  O  O     . ILE G  1 337 ? 49.459  -79.194  26.426  1.00 15.49 ? 335 ILE C O     1 
ATOM   8550  C  CB    . ILE G  1 337 ? 50.339  -80.830  29.214  1.00 20.35 ? 335 ILE C CB    1 
ATOM   8551  C  CG1   . ILE G  1 337 ? 49.786  -81.370  30.534  1.00 25.26 ? 335 ILE C CG1   1 
ATOM   8552  C  CG2   . ILE G  1 337 ? 50.978  -79.407  29.340  1.00 28.18 ? 335 ILE C CG2   1 
ATOM   8553  C  CD1   . ILE G  1 337 ? 49.433  -80.321  31.538  1.00 30.54 ? 335 ILE C CD1   1 
ATOM   8554  N  N     . GLN G  1 338 ? 50.582  -81.104  26.105  1.00 15.04 ? 336 GLN C N     1 
ATOM   8555  C  CA    . GLN G  1 338 ? 51.011  -80.661  24.799  1.00 17.90 ? 336 GLN C CA    1 
ATOM   8556  C  C     . GLN G  1 338 ? 49.825  -80.356  23.888  1.00 18.06 ? 336 GLN C C     1 
ATOM   8557  O  O     . GLN G  1 338 ? 49.848  -79.388  23.134  1.00 16.40 ? 336 GLN C O     1 
ATOM   8558  C  CB    . GLN G  1 338 ? 51.983  -81.650  24.165  1.00 17.33 ? 336 GLN C CB    1 
ATOM   8559  C  CG    . GLN G  1 338 ? 53.364  -81.570  24.785  1.00 16.35 ? 336 GLN C CG    1 
ATOM   8560  C  CD    . GLN G  1 338 ? 54.364  -82.406  24.047  1.00 21.17 ? 336 GLN C CD    1 
ATOM   8561  O  OE1   . GLN G  1 338 ? 54.572  -82.219  22.847  1.00 21.61 ? 336 GLN C OE1   1 
ATOM   8562  N  NE2   . GLN G  1 338 ? 55.007  -83.350  24.765  1.00 17.92 ? 336 GLN C NE2   1 
ATOM   8563  N  N     . PHE G  1 339 ? 48.798  -81.193  23.951  1.00 16.92 ? 337 PHE C N     1 
ATOM   8564  C  CA    . PHE G  1 339 ? 47.616  -81.007  23.113  1.00 17.45 ? 337 PHE C CA    1 
ATOM   8565  C  C     . PHE G  1 339 ? 47.048  -79.627  23.354  1.00 15.49 ? 337 PHE C C     1 
ATOM   8566  O  O     . PHE G  1 339 ? 46.742  -78.866  22.414  1.00 14.03 ? 337 PHE C O     1 
ATOM   8567  C  CB    . PHE G  1 339 ? 46.594  -82.039  23.528  1.00 16.09 ? 337 PHE C CB    1 
ATOM   8568  C  CG    . PHE G  1 339 ? 45.243  -81.817  22.940  1.00 20.76 ? 337 PHE C CG    1 
ATOM   8569  C  CD1   . PHE G  1 339 ? 44.324  -80.999  23.578  1.00 17.14 ? 337 PHE C CD1   1 
ATOM   8570  C  CD2   . PHE G  1 339 ? 44.880  -82.456  21.751  1.00 19.11 ? 337 PHE C CD2   1 
ATOM   8571  C  CE1   . PHE G  1 339 ? 43.054  -80.793  23.022  1.00 19.54 ? 337 PHE C CE1   1 
ATOM   8572  C  CE2   . PHE G  1 339 ? 43.612  -82.276  21.180  1.00 16.51 ? 337 PHE C CE2   1 
ATOM   8573  C  CZ    . PHE G  1 339 ? 42.690  -81.450  21.821  1.00 17.53 ? 337 PHE C CZ    1 
ATOM   8574  N  N     . THR G  1 340 ? 46.879  -79.317  24.635  1.00 14.26 ? 338 THR C N     1 
ATOM   8575  C  CA    . THR G  1 340 ? 46.194  -78.079  25.013  1.00 15.96 ? 338 THR C CA    1 
ATOM   8576  C  C     . THR G  1 340 ? 47.009  -76.852  24.631  1.00 17.75 ? 338 THR C C     1 
ATOM   8577  O  O     . THR G  1 340 ? 46.479  -75.844  24.079  1.00 17.70 ? 338 THR C O     1 
ATOM   8578  C  CB    . THR G  1 340 ? 45.950  -78.062  26.516  1.00 20.76 ? 338 THR C CB    1 
ATOM   8579  O  OG1   . THR G  1 340 ? 45.046  -79.116  26.858  1.00 20.83 ? 338 THR C OG1   1 
ATOM   8580  C  CG2   . THR G  1 340 ? 45.401  -76.683  27.012  1.00 20.11 ? 338 THR C CG2   1 
ATOM   8581  N  N     . SER G  1 341 ? 48.287  -76.933  24.977  1.00 15.10 ? 339 SER C N     1 
ATOM   8582  C  CA    . SER G  1 341 ? 49.247  -75.850  24.754  1.00 14.42 ? 339 SER C CA    1 
ATOM   8583  C  C     . SER G  1 341 ? 49.300  -75.498  23.291  1.00 14.02 ? 339 SER C C     1 
ATOM   8584  O  O     . SER G  1 341 ? 49.185  -74.332  22.924  1.00 16.49 ? 339 SER C O     1 
ATOM   8585  C  CB    . SER G  1 341 ? 50.653  -76.260  25.255  1.00 19.14 ? 339 SER C CB    1 
ATOM   8586  O  OG    . SER G  1 341 ? 51.632  -75.297  24.877  1.00 25.24 ? 339 SER C OG    1 
ATOM   8587  N  N     . ARG G  1 342 ? 49.495  -76.495  22.423  1.00 16.39 ? 340 ARG C N     1 
ATOM   8588  C  CA    . ARG G  1 342 ? 49.647  -76.193  20.997  1.00 16.59 ? 340 ARG C CA    1 
ATOM   8589  C  C     . ARG G  1 342 ? 48.368  -75.573  20.411  1.00 15.42 ? 340 ARG C C     1 
ATOM   8590  O  O     . ARG G  1 342 ? 48.433  -74.605  19.616  1.00 14.21 ? 340 ARG C O     1 
ATOM   8591  C  CB    . ARG G  1 342 ? 50.035  -77.442  20.188  1.00 15.98 ? 340 ARG C CB    1 
ATOM   8592  C  CG    . ARG G  1 342 ? 50.168  -77.169  18.684  1.00 18.54 ? 340 ARG C CG    1 
ATOM   8593  C  CD    . ARG G  1 342 ? 51.201  -76.068  18.316  1.00 16.31 ? 340 ARG C CD    1 
ATOM   8594  N  NE    . ARG G  1 342 ? 52.492  -76.241  19.007  1.00 19.36 ? 340 ARG C NE    1 
ATOM   8595  C  CZ    . ARG G  1 342 ? 53.524  -76.953  18.541  1.00 19.64 ? 340 ARG C CZ    1 
ATOM   8596  N  NH1   . ARG G  1 342 ? 53.446  -77.542  17.346  1.00 15.03 ? 340 ARG C NH1   1 
ATOM   8597  N  NH2   . ARG G  1 342 ? 54.637  -77.071  19.286  1.00 16.07 ? 340 ARG C NH2   1 
ATOM   8598  N  N     . ARG G  1 343 ? 47.211  -76.124  20.772  1.00 15.90 ? 341 ARG C N     1 
ATOM   8599  C  CA    . ARG G  1 343 ? 45.953  -75.497  20.353  1.00 14.42 ? 341 ARG C CA    1 
ATOM   8600  C  C     . ARG G  1 343 ? 45.838  -74.081  20.918  1.00 16.86 ? 341 ARG C C     1 
ATOM   8601  O  O     . ARG G  1 343 ? 45.321  -73.190  20.274  1.00 14.98 ? 341 ARG C O     1 
ATOM   8602  C  CB    . ARG G  1 343 ? 44.732  -76.311  20.752  1.00 19.99 ? 341 ARG C CB    1 
ATOM   8603  C  CG    . ARG G  1 343 ? 44.589  -77.641  19.956  1.00 15.56 ? 341 ARG C CG    1 
ATOM   8604  C  CD    . ARG G  1 343 ? 43.571  -78.594  20.620  1.00 13.55 ? 341 ARG C CD    1 
ATOM   8605  N  NE    . ARG G  1 343 ? 42.280  -77.913  20.749  1.00 19.25 ? 341 ARG C NE    1 
ATOM   8606  C  CZ    . ARG G  1 343 ? 41.353  -77.846  19.793  1.00 19.82 ? 341 ARG C CZ    1 
ATOM   8607  N  NH1   . ARG G  1 343 ? 41.571  -78.446  18.627  1.00 16.04 ? 341 ARG C NH1   1 
ATOM   8608  N  NH2   . ARG G  1 343 ? 40.225  -77.125  19.981  1.00 17.57 ? 341 ARG C NH2   1 
ATOM   8609  N  N     . PHE G  1 344 ? 46.306  -73.882  22.134  1.00 17.47 ? 342 PHE C N     1 
ATOM   8610  C  CA    . PHE G  1 344 ? 46.240  -72.550  22.755  1.00 15.61 ? 342 PHE C CA    1 
ATOM   8611  C  C     . PHE G  1 344 ? 46.903  -71.501  21.852  1.00 16.55 ? 342 PHE C C     1 
ATOM   8612  O  O     . PHE G  1 344 ? 46.329  -70.435  21.617  1.00 16.03 ? 342 PHE C O     1 
ATOM   8613  C  CB    . PHE G  1 344 ? 46.928  -72.570  24.128  1.00 17.48 ? 342 PHE C CB    1 
ATOM   8614  C  CG    . PHE G  1 344 ? 46.888  -71.247  24.843  1.00 17.47 ? 342 PHE C CG    1 
ATOM   8615  C  CD1   . PHE G  1 344 ? 45.732  -70.835  25.489  1.00 19.08 ? 342 PHE C CD1   1 
ATOM   8616  C  CD2   . PHE G  1 344 ? 47.998  -70.424  24.848  1.00 17.06 ? 342 PHE C CD2   1 
ATOM   8617  C  CE1   . PHE G  1 344 ? 45.689  -69.591  26.154  1.00 27.89 ? 342 PHE C CE1   1 
ATOM   8618  C  CE2   . PHE G  1 344 ? 47.967  -69.179  25.501  1.00 23.69 ? 342 PHE C CE2   1 
ATOM   8619  C  CZ    . PHE G  1 344 ? 46.821  -68.777  26.160  1.00 22.68 ? 342 PHE C CZ    1 
ATOM   8620  N  N     . TYR G  1 345 ? 48.089  -71.809  21.328  1.00 14.06 ? 343 TYR C N     1 
ATOM   8621  C  CA    . TYR G  1 345 ? 48.859  -70.865  20.494  1.00 13.24 ? 343 TYR C CA    1 
ATOM   8622  C  C     . TYR G  1 345 ? 48.362  -70.748  19.055  1.00 14.52 ? 343 TYR C C     1 
ATOM   8623  O  O     . TYR G  1 345 ? 48.419  -69.670  18.442  1.00 15.13 ? 343 TYR C O     1 
ATOM   8624  C  CB    . TYR G  1 345 ? 50.380  -71.208  20.517  1.00 13.13 ? 343 TYR C CB    1 
ATOM   8625  C  CG    . TYR G  1 345 ? 50.912  -71.040  21.923  1.00 13.26 ? 343 TYR C CG    1 
ATOM   8626  C  CD1   . TYR G  1 345 ? 50.923  -69.781  22.518  1.00 16.48 ? 343 TYR C CD1   1 
ATOM   8627  C  CD2   . TYR G  1 345 ? 51.340  -72.142  22.682  1.00 14.71 ? 343 TYR C CD2   1 
ATOM   8628  C  CE1   . TYR G  1 345 ? 51.368  -69.601  23.819  1.00 17.79 ? 343 TYR C CE1   1 
ATOM   8629  C  CE2   . TYR G  1 345 ? 51.790  -71.973  23.988  1.00 19.54 ? 343 TYR C CE2   1 
ATOM   8630  C  CZ    . TYR G  1 345 ? 51.780  -70.688  24.558  1.00 23.43 ? 343 TYR C CZ    1 
ATOM   8631  O  OH    . TYR G  1 345 ? 52.218  -70.476  25.855  1.00 24.64 ? 343 TYR C OH    1 
ATOM   8632  N  N     . ILE G  1 346 ? 47.878  -71.856  18.504  1.00 12.36 ? 344 ILE C N     1 
ATOM   8633  C  CA    . ILE G  1 346 ? 47.191  -71.803  17.201  1.00 14.50 ? 344 ILE C CA    1 
ATOM   8634  C  C     . ILE G  1 346 ? 46.006  -70.814  17.272  1.00 11.32 ? 344 ILE C C     1 
ATOM   8635  O  O     . ILE G  1 346 ? 45.873  -69.892  16.444  1.00 15.92 ? 344 ILE C O     1 
ATOM   8636  C  CB    . ILE G  1 346 ? 46.696  -73.202  16.789  1.00 16.61 ? 344 ILE C CB    1 
ATOM   8637  C  CG1   . ILE G  1 346 ? 47.898  -74.049  16.353  1.00 12.85 ? 344 ILE C CG1   1 
ATOM   8638  C  CG2   . ILE G  1 346 ? 45.653  -73.134  15.652  1.00 13.08 ? 344 ILE C CG2   1 
ATOM   8639  C  CD1   . ILE G  1 346 ? 47.524  -75.555  16.195  1.00 16.96 ? 344 ILE C CD1   1 
ATOM   8640  N  N     . GLU G  1 347 ? 45.180  -70.994  18.289  1.00 14.97 ? 345 GLU C N     1 
ATOM   8641  C  CA    . GLU G  1 347 ? 44.023  -70.127  18.505  1.00 20.00 ? 345 GLU C CA    1 
ATOM   8642  C  C     . GLU G  1 347 ? 44.458  -68.681  18.760  1.00 20.27 ? 345 GLU C C     1 
ATOM   8643  O  O     . GLU G  1 347 ? 43.898  -67.736  18.207  1.00 19.97 ? 345 GLU C O     1 
ATOM   8644  C  CB    . GLU G  1 347 ? 43.211  -70.608  19.705  1.00 19.07 ? 345 GLU C CB    1 
ATOM   8645  C  CG    . GLU G  1 347 ? 42.077  -69.652  20.051  1.00 20.37 ? 345 GLU C CG    1 
ATOM   8646  C  CD    . GLU G  1 347 ? 41.231  -70.112  21.234  1.00 30.29 ? 345 GLU C CD    1 
ATOM   8647  O  OE1   . GLU G  1 347 ? 41.700  -70.911  22.077  1.00 31.74 ? 345 GLU C OE1   1 
ATOM   8648  O  OE2   . GLU G  1 347 ? 40.082  -69.658  21.327  1.00 31.28 ? 345 GLU C OE2   1 
ATOM   8649  N  N     . LYS G  1 348 ? 45.470  -68.511  19.603  1.00 20.22 ? 346 LYS C N     1 
ATOM   8650  C  CA    . LYS G  1 348 ? 45.983  -67.171  19.882  1.00 20.37 ? 346 LYS C CA    1 
ATOM   8651  C  C     . LYS G  1 348 ? 46.481  -66.490  18.593  1.00 20.38 ? 346 LYS C C     1 
ATOM   8652  O  O     . LYS G  1 348 ? 46.176  -65.330  18.308  1.00 19.06 ? 346 LYS C O     1 
ATOM   8653  C  CB    . LYS G  1 348 ? 47.081  -67.268  20.956  1.00 16.84 ? 346 LYS C CB    1 
ATOM   8654  C  CG    . LYS G  1 348 ? 47.561  -65.904  21.571  1.00 23.35 ? 346 LYS C CG    1 
ATOM   8655  C  CD    . LYS G  1 348 ? 48.692  -66.141  22.629  1.00 22.57 ? 346 LYS C CD    1 
ATOM   8656  C  CE    . LYS G  1 348 ? 49.027  -64.867  23.399  1.00 32.50 ? 346 LYS C CE    1 
ATOM   8657  N  NZ    . LYS G  1 348 ? 47.795  -64.073  23.796  1.00 28.50 ? 346 LYS C NZ    1 
ATOM   8658  N  N     . ILE G  1 349 ? 47.239  -67.205  17.781  1.00 12.94 ? 347 ILE C N     1 
ATOM   8659  C  CA    . ILE G  1 349 ? 47.708  -66.605  16.528  1.00 16.58 ? 347 ILE C CA    1 
ATOM   8660  C  C     . ILE G  1 349 ? 46.517  -66.269  15.597  1.00 16.94 ? 347 ILE C C     1 
ATOM   8661  O  O     . ILE G  1 349 ? 46.413  -65.147  15.057  1.00 18.85 ? 347 ILE C O     1 
ATOM   8662  C  CB    . ILE G  1 349 ? 48.714  -67.519  15.837  1.00 17.29 ? 347 ILE C CB    1 
ATOM   8663  C  CG1   . ILE G  1 349 ? 49.921  -67.718  16.770  1.00 16.54 ? 347 ILE C CG1   1 
ATOM   8664  C  CG2   . ILE G  1 349 ? 49.172  -66.930  14.520  1.00 22.59 ? 347 ILE C CG2   1 
ATOM   8665  C  CD1   . ILE G  1 349 ? 50.973  -68.666  16.238  1.00 16.09 ? 347 ILE C CD1   1 
ATOM   8666  N  N     . TYR G  1 350 ? 45.618  -67.228  15.398  1.00 17.45 ? 348 TYR C N     1 
ATOM   8667  C  CA    . TYR G  1 350 ? 44.445  -66.988  14.540  1.00 18.82 ? 348 TYR C CA    1 
ATOM   8668  C  C     . TYR G  1 350 ? 43.676  -65.719  14.966  1.00 22.03 ? 348 TYR C C     1 
ATOM   8669  O  O     . TYR G  1 350 ? 43.362  -64.851  14.144  1.00 21.47 ? 348 TYR C O     1 
ATOM   8670  C  CB    . TYR G  1 350 ? 43.493  -68.188  14.541  1.00 18.19 ? 348 TYR C CB    1 
ATOM   8671  C  CG    . TYR G  1 350 ? 42.319  -67.913  13.629  1.00 19.69 ? 348 TYR C CG    1 
ATOM   8672  C  CD1   . TYR G  1 350 ? 42.438  -68.113  12.249  1.00 20.16 ? 348 TYR C CD1   1 
ATOM   8673  C  CD2   . TYR G  1 350 ? 41.131  -67.380  14.129  1.00 19.80 ? 348 TYR C CD2   1 
ATOM   8674  C  CE1   . TYR G  1 350 ? 41.369  -67.834  11.381  1.00 27.90 ? 348 TYR C CE1   1 
ATOM   8675  C  CE2   . TYR G  1 350 ? 40.038  -67.095  13.267  1.00 25.14 ? 348 TYR C CE2   1 
ATOM   8676  C  CZ    . TYR G  1 350 ? 40.179  -67.322  11.892  1.00 27.51 ? 348 TYR C CZ    1 
ATOM   8677  O  OH    . TYR G  1 350 ? 39.149  -67.051  11.011  1.00 29.82 ? 348 TYR C OH    1 
ATOM   8678  N  N     . ASN G  1 351 ? 43.400  -65.618  16.260  1.00 20.98 ? 349 ASN C N     1 
ATOM   8679  C  CA    . ASN G  1 351 ? 42.654  -64.490  16.802  1.00 21.50 ? 349 ASN C CA    1 
ATOM   8680  C  C     . ASN G  1 351 ? 43.319  -63.146  16.551  1.00 30.67 ? 349 ASN C C     1 
ATOM   8681  O  O     . ASN G  1 351 ? 42.645  -62.145  16.322  1.00 34.13 ? 349 ASN C O     1 
ATOM   8682  C  CB    . ASN G  1 351 ? 42.410  -64.695  18.297  1.00 23.42 ? 349 ASN C CB    1 
ATOM   8683  C  CG    . ASN G  1 351 ? 41.287  -65.675  18.561  1.00 29.87 ? 349 ASN C CG    1 
ATOM   8684  O  OD1   . ASN G  1 351 ? 40.578  -66.054  17.640  1.00 31.56 ? 349 ASN C OD1   1 
ATOM   8685  N  ND2   . ASN G  1 351 ? 41.116  -66.083  19.815  1.00 30.02 ? 349 ASN C ND2   1 
ATOM   8686  N  N     . GLU G  1 352 ? 44.644  -63.143  16.609  1.00 23.34 ? 350 GLU C N     1 
ATOM   8687  C  CA    . GLU G  1 352 ? 45.440  -61.936  16.464  1.00 26.40 ? 350 GLU C CA    1 
ATOM   8688  C  C     . GLU G  1 352 ? 45.472  -61.427  15.032  1.00 31.46 ? 350 GLU C C     1 
ATOM   8689  O  O     . GLU G  1 352 ? 45.890  -60.304  14.780  1.00 31.41 ? 350 GLU C O     1 
ATOM   8690  C  CB    . GLU G  1 352 ? 46.866  -62.191  16.943  1.00 26.75 ? 350 GLU C CB    1 
ATOM   8691  C  CG    . GLU G  1 352 ? 47.030  -62.160  18.450  1.00 26.61 ? 350 GLU C CG    1 
ATOM   8692  C  CD    . GLU G  1 352 ? 48.479  -62.004  18.876  1.00 36.20 ? 350 GLU C CD    1 
ATOM   8693  O  OE1   . GLU G  1 352 ? 49.222  -61.253  18.217  1.00 31.61 ? 350 GLU C OE1   1 
ATOM   8694  O  OE2   . GLU G  1 352 ? 48.865  -62.628  19.877  1.00 30.33 ? 350 GLU C OE2   1 
ATOM   8695  N  N     . LEU G  1 353 ? 45.036  -62.258  14.097  1.00 27.68 ? 351 LEU C N     1 
ATOM   8696  C  CA    . LEU G  1 353 ? 45.054  -61.888  12.690  1.00 34.34 ? 351 LEU C CA    1 
ATOM   8697  C  C     . LEU G  1 353 ? 43.997  -60.833  12.395  1.00 39.19 ? 351 LEU C C     1 
ATOM   8698  O  O     . LEU G  1 353 ? 44.237  -59.906  11.635  1.00 40.72 ? 351 LEU C O     1 
ATOM   8699  C  CB    . LEU G  1 353 ? 44.839  -63.119  11.813  1.00 33.96 ? 351 LEU C CB    1 
ATOM   8700  C  CG    . LEU G  1 353 ? 45.923  -64.192  11.899  1.00 24.50 ? 351 LEU C CG    1 
ATOM   8701  C  CD1   . LEU G  1 353 ? 45.736  -65.239  10.816  1.00 21.18 ? 351 LEU C CD1   1 
ATOM   8702  C  CD2   . LEU G  1 353 ? 47.298  -63.563  11.810  1.00 25.28 ? 351 LEU C CD2   1 
ATOM   8703  N  N     . ASN G  1 354 ? 42.831  -60.997  13.011  1.00 39.74 ? 352 ASN C N     1 
ATOM   8704  C  CA    . ASN G  1 354 ? 41.722  -60.052  12.896  1.00 49.62 ? 352 ASN C CA    1 
ATOM   8705  C  C     . ASN G  1 354 ? 40.803  -60.291  11.697  1.00 58.26 ? 352 ASN C C     1 
ATOM   8706  O  O     . ASN G  1 354 ? 40.133  -59.377  11.221  1.00 64.95 ? 352 ASN C O     1 
ATOM   8707  C  CB    . ASN G  1 354 ? 42.213  -58.594  13.030  1.00 46.37 ? 352 ASN C CB    1 
ATOM   8708  C  CG    . ASN G  1 354 ? 42.303  -57.842  11.703  1.00 68.63 ? 352 ASN C CG    1 
ATOM   8709  O  OD1   . ASN G  1 354 ? 42.424  -58.423  10.620  1.00 68.65 ? 352 ASN C OD1   1 
ATOM   8710  N  ND2   . ASN G  1 354 ? 42.259  -56.516  11.795  1.00 62.93 ? 352 ASN C ND2   1 
ATOM   8711  N  N     . ILE G  1 355 ? 40.772  -61.530  11.219  1.00 51.89 ? 353 ILE C N     1 
ATOM   8712  C  CA    . ILE G  1 355 ? 39.975  -61.867  10.049  1.00 51.89 ? 353 ILE C CA    1 
ATOM   8713  C  C     . ILE G  1 355 ? 38.695  -62.611  10.411  1.00 56.99 ? 353 ILE C C     1 
ATOM   8714  O  O     . ILE G  1 355 ? 37.674  -61.999  10.711  1.00 58.72 ? 353 ILE C O     1 
ATOM   8715  C  CB    . ILE G  1 355 ? 40.784  -62.694  9.034   1.00 46.26 ? 353 ILE C CB    1 
ATOM   8716  C  CG1   . ILE G  1 355 ? 40.923  -64.148  9.502   1.00 45.81 ? 353 ILE C CG1   1 
ATOM   8717  C  CG2   . ILE G  1 355 ? 42.126  -62.031  8.755   1.00 51.27 ? 353 ILE C CG2   1 
ATOM   8718  C  CD1   . ILE G  1 355 ? 42.189  -64.453  10.262  1.00 41.44 ? 353 ILE C CD1   1 
ATOM   8719  P  P     . A   H  2 3   ? 48.182  -115.064 5.192   0.76 61.28 ? 501 A   X P     1 
ATOM   8720  O  OP1   . A   H  2 3   ? 49.288  -115.739 4.472   0.76 61.94 ? 501 A   X OP1   1 
ATOM   8721  O  OP2   . A   H  2 3   ? 48.024  -115.280 6.646   0.76 62.08 ? 501 A   X OP2   1 
ATOM   8722  O  "O5'" . A   H  2 3   ? 48.278  -113.484 4.963   0.76 53.44 ? 501 A   X "O5'" 1 
ATOM   8723  C  "C5'" . A   H  2 3   ? 47.229  -112.646 5.412   0.76 39.28 ? 501 A   X "C5'" 1 
ATOM   8724  C  "C4'" . A   H  2 3   ? 47.774  -111.427 6.121   0.76 44.70 ? 501 A   X "C4'" 1 
ATOM   8725  O  "O4'" . A   H  2 3   ? 47.560  -110.245 5.298   0.76 41.00 ? 501 A   X "O4'" 1 
ATOM   8726  C  "C3'" . A   H  2 3   ? 47.019  -111.100 7.395   0.76 42.88 ? 501 A   X "C3'" 1 
ATOM   8727  O  "O3'" . A   H  2 3   ? 47.610  -110.058 8.160   0.76 35.08 ? 501 A   X "O3'" 1 
ATOM   8728  C  "C2'" . A   H  2 3   ? 45.782  -110.553 6.729   0.76 40.91 ? 501 A   X "C2'" 1 
ATOM   8729  C  "C1'" . A   H  2 3   ? 46.397  -109.566 5.733   0.76 41.00 ? 501 A   X "C1'" 1 
ATOM   8730  N  N9    . A   H  2 3   ? 45.580  -109.295 4.538   0.76 44.98 ? 501 A   X N9    1 
ATOM   8731  C  C8    . A   H  2 3   ? 45.112  -110.236 3.647   0.76 44.51 ? 501 A   X C8    1 
ATOM   8732  N  N7    . A   H  2 3   ? 44.405  -109.743 2.650   0.76 40.68 ? 501 A   X N7    1 
ATOM   8733  C  C5    . A   H  2 3   ? 44.415  -108.383 2.889   0.76 41.77 ? 501 A   X C5    1 
ATOM   8734  C  C6    . A   H  2 3   ? 43.832  -107.323 2.173   0.76 42.23 ? 501 A   X C6    1 
ATOM   8735  N  N6    . A   H  2 3   ? 43.109  -107.531 1.059   0.76 43.64 ? 501 A   X N6    1 
ATOM   8736  N  N1    . A   H  2 3   ? 44.015  -106.065 2.659   0.76 43.51 ? 501 A   X N1    1 
ATOM   8737  C  C2    . A   H  2 3   ? 44.727  -105.906 3.791   0.76 38.32 ? 501 A   X C2    1 
ATOM   8738  N  N3    . A   H  2 3   ? 45.319  -106.840 4.554   0.76 39.10 ? 501 A   X N3    1 
ATOM   8739  C  C4    . A   H  2 3   ? 45.125  -108.076 4.047   0.76 41.40 ? 501 A   X C4    1 
ATOM   8740  P  P     . C   H  2 4   ? 48.223  -110.366 9.600   0.88 35.22 ? 502 C   X P     1 
ATOM   8741  O  OP1   . C   H  2 4   ? 49.575  -110.931 9.422   0.88 31.26 ? 502 C   X OP1   1 
ATOM   8742  O  OP2   . C   H  2 4   ? 47.212  -111.105 10.385  0.88 35.73 ? 502 C   X OP2   1 
ATOM   8743  O  "O5'" . C   H  2 4   ? 48.385  -108.917 10.233  0.88 36.47 ? 502 C   X "O5'" 1 
ATOM   8744  C  "C5'" . C   H  2 4   ? 47.249  -108.216 10.750  0.88 28.84 ? 502 C   X "C5'" 1 
ATOM   8745  C  "C4'" . C   H  2 4   ? 47.675  -107.333 11.892  0.88 28.24 ? 502 C   X "C4'" 1 
ATOM   8746  O  "O4'" . C   H  2 4   ? 47.880  -108.140 13.085  0.88 27.79 ? 502 C   X "O4'" 1 
ATOM   8747  C  "C3'" . C   H  2 4   ? 49.000  -106.612 11.705  0.88 24.63 ? 502 C   X "C3'" 1 
ATOM   8748  O  "O3'" . C   H  2 4   ? 48.890  -105.433 10.925  0.88 26.30 ? 502 C   X "O3'" 1 
ATOM   8749  C  "C2'" . C   H  2 4   ? 49.378  -106.317 13.146  0.88 25.30 ? 502 C   X "C2'" 1 
ATOM   8750  O  "O2'" . C   H  2 4   ? 48.640  -105.238 13.674  0.88 21.51 ? 502 C   X "O2'" 1 
ATOM   8751  C  "C1'" . C   H  2 4   ? 48.993  -107.638 13.811  0.88 27.63 ? 502 C   X "C1'" 1 
ATOM   8752  N  N1    . C   H  2 4   ? 50.100  -108.613 13.754  0.88 26.87 ? 502 C   X N1    1 
ATOM   8753  C  C2    . C   H  2 4   ? 51.177  -108.437 14.627  0.88 32.35 ? 502 C   X C2    1 
ATOM   8754  O  O2    . C   H  2 4   ? 51.147  -107.497 15.435  0.88 31.50 ? 502 C   X O2    1 
ATOM   8755  N  N3    . C   H  2 4   ? 52.216  -109.301 14.578  0.88 31.38 ? 502 C   X N3    1 
ATOM   8756  C  C4    . C   H  2 4   ? 52.210  -110.301 13.693  0.88 35.22 ? 502 C   X C4    1 
ATOM   8757  N  N4    . C   H  2 4   ? 53.256  -111.129 13.680  0.88 32.07 ? 502 C   X N4    1 
ATOM   8758  C  C5    . C   H  2 4   ? 51.132  -110.494 12.782  0.88 31.01 ? 502 C   X C5    1 
ATOM   8759  C  C6    . C   H  2 4   ? 50.112  -109.629 12.840  0.88 31.88 ? 502 C   X C6    1 
ATOM   8760  P  P     . A   H  2 5   ? 50.180  -104.830 10.206  1.00 28.36 ? 503 A   X P     1 
ATOM   8761  O  OP1   . A   H  2 5   ? 51.316  -104.918 11.145  1.00 25.15 ? 503 A   X OP1   1 
ATOM   8762  O  OP2   . A   H  2 5   ? 49.809  -103.529 9.629   1.00 21.42 ? 503 A   X OP2   1 
ATOM   8763  O  "O5'" . A   H  2 5   ? 50.443  -105.866 9.027   1.00 27.50 ? 503 A   X "O5'" 1 
ATOM   8764  C  "C5'" . A   H  2 5   ? 49.507  -105.991 7.942   1.00 28.04 ? 503 A   X "C5'" 1 
ATOM   8765  C  "C4'" . A   H  2 5   ? 49.769  -107.255 7.162   1.00 27.72 ? 503 A   X "C4'" 1 
ATOM   8766  O  "O4'" . A   H  2 5   ? 48.819  -107.343 6.066   1.00 29.42 ? 503 A   X "O4'" 1 
ATOM   8767  C  "C3'" . A   H  2 5   ? 51.146  -107.346 6.512   1.00 36.52 ? 503 A   X "C3'" 1 
ATOM   8768  O  "O3'" . A   H  2 5   ? 51.532  -108.708 6.373   1.00 31.22 ? 503 A   X "O3'" 1 
ATOM   8769  C  "C2'" . A   H  2 5   ? 50.898  -106.718 5.148   1.00 30.58 ? 503 A   X "C2'" 1 
ATOM   8770  O  "O2'" . A   H  2 5   ? 51.848  -107.112 4.182   1.00 26.92 ? 503 A   X "O2'" 1 
ATOM   8771  C  "C1'" . A   H  2 5   ? 49.504  -107.255 4.830   1.00 28.86 ? 503 A   X "C1'" 1 
ATOM   8772  N  N9    . A   H  2 5   ? 48.721  -106.404 3.938   1.00 33.45 ? 503 A   X N9    1 
ATOM   8773  C  C8    . A   H  2 5   ? 48.518  -105.050 4.031   1.00 36.51 ? 503 A   X C8    1 
ATOM   8774  N  N7    . A   H  2 5   ? 47.751  -104.564 3.086   1.00 36.16 ? 503 A   X N7    1 
ATOM   8775  C  C5    . A   H  2 5   ? 47.415  -105.675 2.326   1.00 42.87 ? 503 A   X C5    1 
ATOM   8776  C  C6    . A   H  2 5   ? 46.619  -105.830 1.178   1.00 40.57 ? 503 A   X C6    1 
ATOM   8777  N  N6    . A   H  2 5   ? 45.992  -104.821 0.569   1.00 33.90 ? 503 A   X N6    1 
ATOM   8778  N  N1    . A   H  2 5   ? 46.492  -107.073 0.666   1.00 38.43 ? 503 A   X N1    1 
ATOM   8779  C  C2    . A   H  2 5   ? 47.125  -108.084 1.274   1.00 33.49 ? 503 A   X C2    1 
ATOM   8780  N  N3    . A   H  2 5   ? 47.900  -108.064 2.356   1.00 31.85 ? 503 A   X N3    1 
ATOM   8781  C  C4    . A   H  2 5   ? 48.005  -106.815 2.840   1.00 38.40 ? 503 A   X C4    1 
HETATM 8782  P  P     . G46 I  3 1   ? 43.335  -110.275 7.678   0.81 58.60 ? 510 G46 S P     1 
HETATM 8783  O  O1P   . G46 I  3 1   ? 42.629  -109.452 8.685   0.81 56.04 ? 510 G46 S O1P   1 
HETATM 8784  S  S2P   . G46 I  3 1   ? 42.473  -110.070 5.779   0.81 62.94 ? 510 G46 S S2P   1 
HETATM 8785  O  O3P   . G46 I  3 1   ? 44.891  -109.869 7.589   0.81 50.64 ? 510 G46 S O3P   1 
HETATM 8786  O  "O5'" . G46 I  3 1   ? 43.402  -111.839 8.087   0.81 47.81 ? 510 G46 S "O5'" 1 
ATOM   8787  N  N     . GLN J  1 7   ? 52.791  -89.688  -41.376 1.00 38.48 ? 5   GLN D N     1 
ATOM   8788  C  CA    . GLN J  1 7   ? 53.574  -89.032  -42.413 1.00 45.78 ? 5   GLN D CA    1 
ATOM   8789  C  C     . GLN J  1 7   ? 52.684  -88.034  -43.170 1.00 49.84 ? 5   GLN D C     1 
ATOM   8790  O  O     . GLN J  1 7   ? 51.461  -88.172  -43.160 1.00 43.20 ? 5   GLN D O     1 
ATOM   8791  C  CB    . GLN J  1 7   ? 54.142  -90.087  -43.362 1.00 49.92 ? 5   GLN D CB    1 
ATOM   8792  C  CG    . GLN J  1 7   ? 55.376  -89.650  -44.164 1.00 54.81 ? 5   GLN D CG    1 
ATOM   8793  C  CD    . GLN J  1 7   ? 55.954  -90.792  -45.016 1.00 66.66 ? 5   GLN D CD    1 
ATOM   8794  O  OE1   . GLN J  1 7   ? 55.309  -91.833  -45.207 1.00 69.26 ? 5   GLN D OE1   1 
ATOM   8795  N  NE2   . GLN J  1 7   ? 57.175  -90.599  -45.523 1.00 64.19 ? 5   GLN D NE2   1 
ATOM   8796  N  N     . ILE J  1 8   ? 53.261  -87.013  -43.806 1.00 45.34 ? 6   ILE D N     1 
ATOM   8797  C  CA    . ILE J  1 8   ? 52.406  -86.091  -44.574 1.00 45.88 ? 6   ILE D CA    1 
ATOM   8798  C  C     . ILE J  1 8   ? 52.975  -85.536  -45.896 1.00 43.76 ? 6   ILE D C     1 
ATOM   8799  O  O     . ILE J  1 8   ? 54.192  -85.467  -46.082 1.00 37.15 ? 6   ILE D O     1 
ATOM   8800  C  CB    . ILE J  1 8   ? 51.889  -84.918  -43.720 1.00 45.19 ? 6   ILE D CB    1 
ATOM   8801  C  CG1   . ILE J  1 8   ? 52.383  -83.598  -44.306 1.00 41.69 ? 6   ILE D CG1   1 
ATOM   8802  C  CG2   . ILE J  1 8   ? 52.307  -85.073  -42.265 1.00 41.05 ? 6   ILE D CG2   1 
ATOM   8803  C  CD1   . ILE J  1 8   ? 51.467  -82.418  -43.979 1.00 44.32 ? 6   ILE D CD1   1 
ATOM   8804  N  N     . GLN J  1 9   ? 52.078  -85.137  -46.807 1.00 41.01 ? 7   GLN D N     1 
ATOM   8805  C  CA    . GLN J  1 9   ? 52.496  -84.608  -48.109 1.00 33.83 ? 7   GLN D CA    1 
ATOM   8806  C  C     . GLN J  1 9   ? 52.032  -83.170  -48.315 1.00 32.97 ? 7   GLN D C     1 
ATOM   8807  O  O     . GLN J  1 9   ? 50.945  -82.785  -47.872 1.00 29.72 ? 7   GLN D O     1 
ATOM   8808  C  CB    . GLN J  1 9   ? 52.021  -85.512  -49.265 1.00 34.23 ? 7   GLN D CB    1 
ATOM   8809  C  CG    . GLN J  1 9   ? 50.515  -85.691  -49.373 1.00 20.67 ? 7   GLN D CG    1 
ATOM   8810  C  CD    . GLN J  1 9   ? 50.154  -86.823  -50.299 1.00 24.43 ? 7   GLN D CD    1 
ATOM   8811  O  OE1   . GLN J  1 9   ? 50.708  -86.938  -51.394 1.00 25.21 ? 7   GLN D OE1   1 
ATOM   8812  N  NE2   . GLN J  1 9   ? 49.224  -87.687  -49.862 1.00 28.56 ? 7   GLN D NE2   1 
ATOM   8813  N  N     . HIS J  1 10  ? 52.877  -82.375  -48.964 1.00 28.39 ? 8   HIS D N     1 
ATOM   8814  C  CA    . HIS J  1 10  ? 52.563  -80.986  -49.234 1.00 26.33 ? 8   HIS D CA    1 
ATOM   8815  C  C     . HIS J  1 10  ? 52.234  -80.840  -50.715 1.00 25.69 ? 8   HIS D C     1 
ATOM   8816  O  O     . HIS J  1 10  ? 53.078  -81.104  -51.561 1.00 25.07 ? 8   HIS D O     1 
ATOM   8817  C  CB    . HIS J  1 10  ? 53.746  -80.101  -48.829 1.00 26.04 ? 8   HIS D CB    1 
ATOM   8818  C  CG    . HIS J  1 10  ? 54.182  -80.324  -47.422 1.00 33.42 ? 8   HIS D CG    1 
ATOM   8819  N  ND1   . HIS J  1 10  ? 53.507  -79.790  -46.347 1.00 36.36 ? 8   HIS D ND1   1 
ATOM   8820  C  CD2   . HIS J  1 10  ? 55.181  -81.082  -46.908 1.00 38.46 ? 8   HIS D CD2   1 
ATOM   8821  C  CE1   . HIS J  1 10  ? 54.095  -80.182  -45.227 1.00 32.39 ? 8   HIS D CE1   1 
ATOM   8822  N  NE2   . HIS J  1 10  ? 55.105  -80.967  -45.540 1.00 36.81 ? 8   HIS D NE2   1 
ATOM   8823  N  N     . ILE J  1 11  ? 50.996  -80.455  -51.015 1.00 22.24 ? 9   ILE D N     1 
ATOM   8824  C  CA    . ILE J  1 11  ? 50.528  -80.387  -52.396 1.00 20.96 ? 9   ILE D CA    1 
ATOM   8825  C  C     . ILE J  1 11  ? 50.257  -78.914  -52.729 1.00 21.56 ? 9   ILE D C     1 
ATOM   8826  O  O     . ILE J  1 11  ? 49.475  -78.252  -52.065 1.00 23.59 ? 9   ILE D O     1 
ATOM   8827  C  CB    . ILE J  1 11  ? 49.238  -81.235  -52.613 1.00 22.90 ? 9   ILE D CB    1 
ATOM   8828  C  CG1   . ILE J  1 11  ? 49.481  -82.715  -52.319 1.00 20.96 ? 9   ILE D CG1   1 
ATOM   8829  C  CG2   . ILE J  1 11  ? 48.682  -81.074  -54.057 1.00 22.67 ? 9   ILE D CG2   1 
ATOM   8830  C  CD1   . ILE J  1 11  ? 48.173  -83.549  -52.104 1.00 26.11 ? 9   ILE D CD1   1 
ATOM   8831  N  N     . ALA J  1 12  ? 50.933  -78.381  -53.733 1.00 26.32 ? 10  ALA D N     1 
ATOM   8832  C  CA    . ALA J  1 12  ? 50.689  -76.987  -54.102 1.00 24.46 ? 10  ALA D CA    1 
ATOM   8833  C  C     . ALA J  1 12  ? 49.464  -76.928  -55.007 1.00 22.13 ? 10  ALA D C     1 
ATOM   8834  O  O     . ALA J  1 12  ? 49.363  -77.695  -55.983 1.00 22.37 ? 10  ALA D O     1 
ATOM   8835  C  CB    . ALA J  1 12  ? 51.879  -76.419  -54.800 1.00 17.56 ? 10  ALA D CB    1 
ATOM   8836  N  N     . ILE J  1 13  ? 48.527  -76.036  -54.686 1.00 24.23 ? 11  ILE D N     1 
ATOM   8837  C  CA    . ILE J  1 13  ? 47.354  -75.887  -55.502 1.00 17.60 ? 11  ILE D CA    1 
ATOM   8838  C  C     . ILE J  1 13  ? 47.348  -74.486  -56.074 1.00 22.72 ? 11  ILE D C     1 
ATOM   8839  O  O     . ILE J  1 13  ? 47.591  -73.507  -55.366 1.00 24.53 ? 11  ILE D O     1 
ATOM   8840  C  CB    . ILE J  1 13  ? 46.056  -76.178  -54.711 1.00 29.34 ? 11  ILE D CB    1 
ATOM   8841  C  CG1   . ILE J  1 13  ? 45.980  -75.323  -53.440 1.00 27.96 ? 11  ILE D CG1   1 
ATOM   8842  C  CG2   . ILE J  1 13  ? 45.971  -77.653  -54.366 1.00 22.91 ? 11  ILE D CG2   1 
ATOM   8843  C  CD1   . ILE J  1 13  ? 44.534  -75.377  -52.745 1.00 20.14 ? 11  ILE D CD1   1 
ATOM   8844  N  N     . VAL J  1 14  ? 47.055  -74.395  -57.363 1.00 25.39 ? 12  VAL D N     1 
ATOM   8845  C  CA    . VAL J  1 14  ? 47.218  -73.166  -58.112 1.00 17.45 ? 12  VAL D CA    1 
ATOM   8846  C  C     . VAL J  1 14  ? 45.953  -72.837  -58.891 1.00 23.07 ? 12  VAL D C     1 
ATOM   8847  O  O     . VAL J  1 14  ? 45.261  -73.741  -59.387 1.00 22.92 ? 12  VAL D O     1 
ATOM   8848  C  CB    . VAL J  1 14  ? 48.405  -73.337  -59.068 1.00 21.49 ? 12  VAL D CB    1 
ATOM   8849  C  CG1   . VAL J  1 14  ? 48.647  -72.087  -59.908 1.00 17.96 ? 12  VAL D CG1   1 
ATOM   8850  C  CG2   . VAL J  1 14  ? 49.645  -73.674  -58.270 1.00 19.91 ? 12  VAL D CG2   1 
ATOM   8851  N  N     . GLY J  1 15  ? 45.642  -71.546  -58.990 1.00 17.73 ? 13  GLY D N     1 
ATOM   8852  C  CA    . GLY J  1 15  ? 44.525  -71.093  -59.819 1.00 23.61 ? 13  GLY D CA    1 
ATOM   8853  C  C     . GLY J  1 15  ? 44.928  -70.885  -61.280 1.00 23.83 ? 13  GLY D C     1 
ATOM   8854  O  O     . GLY J  1 15  ? 45.611  -71.722  -61.841 1.00 28.84 ? 13  GLY D O     1 
ATOM   8855  N  N     . SER J  1 16  ? 44.513  -69.783  -61.897 1.00 22.34 ? 14  SER D N     1 
ATOM   8856  C  CA    . SER J  1 16  ? 44.785  -69.558  -63.316 1.00 23.41 ? 14  SER D CA    1 
ATOM   8857  C  C     . SER J  1 16  ? 46.277  -69.310  -63.626 1.00 29.12 ? 14  SER D C     1 
ATOM   8858  O  O     . SER J  1 16  ? 46.866  -68.354  -63.122 1.00 24.24 ? 14  SER D O     1 
ATOM   8859  C  CB    . SER J  1 16  ? 43.936  -68.385  -63.802 1.00 27.24 ? 14  SER D CB    1 
ATOM   8860  O  OG    . SER J  1 16  ? 42.593  -68.783  -63.969 1.00 32.10 ? 14  SER D OG    1 
ATOM   8861  N  N     . VAL J  1 17  ? 46.891  -70.146  -64.466 1.00 22.29 ? 15  VAL D N     1 
ATOM   8862  C  CA    . VAL J  1 17  ? 48.301  -69.968  -64.755 1.00 18.06 ? 15  VAL D CA    1 
ATOM   8863  C  C     . VAL J  1 17  ? 48.563  -68.957  -65.861 1.00 21.97 ? 15  VAL D C     1 
ATOM   8864  O  O     . VAL J  1 17  ? 49.562  -68.237  -65.821 1.00 23.17 ? 15  VAL D O     1 
ATOM   8865  C  CB    . VAL J  1 17  ? 48.996  -71.278  -65.158 1.00 20.15 ? 15  VAL D CB    1 
ATOM   8866  C  CG1   . VAL J  1 17  ? 50.419  -70.950  -65.621 1.00 20.36 ? 15  VAL D CG1   1 
ATOM   8867  C  CG2   . VAL J  1 17  ? 49.010  -72.282  -63.996 1.00 16.79 ? 15  VAL D CG2   1 
ATOM   8868  N  N     A HIS J  1 18  ? 47.716  -68.944  -66.889 0.59 23.31 ? 16  HIS D N     1 
ATOM   8869  N  N     B HIS J  1 18  ? 47.632  -68.876  -66.811 0.41 23.33 ? 16  HIS D N     1 
ATOM   8870  C  CA    A HIS J  1 18  ? 47.813  -67.930  -67.954 0.59 21.68 ? 16  HIS D CA    1 
ATOM   8871  C  CA    B HIS J  1 18  ? 47.728  -67.959  -67.960 0.41 21.74 ? 16  HIS D CA    1 
ATOM   8872  C  C     A HIS J  1 18  ? 49.166  -67.835  -68.602 0.59 24.17 ? 16  HIS D C     1 
ATOM   8873  C  C     B HIS J  1 18  ? 49.141  -67.832  -68.550 0.41 24.15 ? 16  HIS D C     1 
ATOM   8874  O  O     A HIS J  1 18  ? 49.637  -66.748  -68.930 0.59 22.92 ? 16  HIS D O     1 
ATOM   8875  O  O     B HIS J  1 18  ? 49.615  -66.727  -68.802 0.41 22.98 ? 16  HIS D O     1 
ATOM   8876  C  CB    A HIS J  1 18  ? 47.498  -66.553  -67.407 0.59 25.31 ? 16  HIS D CB    1 
ATOM   8877  C  CB    B HIS J  1 18  ? 47.073  -66.578  -67.665 0.41 25.87 ? 16  HIS D CB    1 
ATOM   8878  C  CG    A HIS J  1 18  ? 46.052  -66.220  -67.445 0.59 29.04 ? 16  HIS D CG    1 
ATOM   8879  C  CG    B HIS J  1 18  ? 47.771  -65.759  -66.639 0.41 29.57 ? 16  HIS D CG    1 
ATOM   8880  N  ND1   A HIS J  1 18  ? 45.185  -66.583  -66.440 0.59 32.23 ? 16  HIS D ND1   1 
ATOM   8881  N  ND1   B HIS J  1 18  ? 47.920  -66.137  -65.306 0.41 28.59 ? 16  HIS D ND1   1 
ATOM   8882  C  CD2   A HIS J  1 18  ? 45.307  -65.588  -68.381 0.59 32.36 ? 16  HIS D CD2   1 
ATOM   8883  C  CD2   B HIS J  1 18  ? 48.360  -64.522  -66.706 0.41 31.28 ? 16  HIS D CD2   1 
ATOM   8884  C  CE1   A HIS J  1 18  ? 43.969  -66.171  -66.747 0.59 33.92 ? 16  HIS D CE1   1 
ATOM   8885  C  CE1   B HIS J  1 18  ? 48.558  -65.221  -64.643 0.41 27.39 ? 16  HIS D CE1   1 
ATOM   8886  N  NE2   A HIS J  1 18  ? 44.016  -65.566  -67.916 0.59 38.01 ? 16  HIS D NE2   1 
ATOM   8887  N  NE2   B HIS J  1 18  ? 48.840  -64.214  -65.464 0.41 31.53 ? 16  HIS D NE2   1 
ATOM   8888  N  N     . GLY J  1 19  ? 49.790  -68.981  -68.776 1.00 20.01 ? 17  GLY D N     1 
ATOM   8889  C  CA    . GLY J  1 19  ? 51.103  -69.049  -69.394 1.00 16.60 ? 17  GLY D CA    1 
ATOM   8890  C  C     . GLY J  1 19  ? 52.236  -68.414  -68.598 1.00 22.83 ? 17  GLY D C     1 
ATOM   8891  O  O     . GLY J  1 19  ? 53.320  -68.216  -69.162 1.00 22.58 ? 17  GLY D O     1 
ATOM   8892  N  N     . LYS J  1 20  ? 52.022  -68.094  -67.314 1.00 19.80 ? 18  LYS D N     1 
ATOM   8893  C  CA    . LYS J  1 20  ? 53.164  -67.636  -66.489 1.00 22.92 ? 18  LYS D CA    1 
ATOM   8894  C  C     . LYS J  1 20  ? 53.847  -68.817  -65.763 1.00 18.24 ? 18  LYS D C     1 
ATOM   8895  O  O     . LYS J  1 20  ? 53.959  -68.821  -64.517 1.00 19.77 ? 18  LYS D O     1 
ATOM   8896  C  CB    . LYS J  1 20  ? 52.762  -66.563  -65.467 1.00 22.58 ? 18  LYS D CB    1 
ATOM   8897  C  CG    . LYS J  1 20  ? 52.107  -65.302  -66.046 1.00 28.49 ? 18  LYS D CG    1 
ATOM   8898  C  CD    . LYS J  1 20  ? 52.745  -64.998  -67.377 1.00 31.82 ? 18  LYS D CD    1 
ATOM   8899  C  CE    . LYS J  1 20  ? 52.713  -63.491  -67.702 1.00 45.96 ? 18  LYS D CE    1 
ATOM   8900  N  NZ    . LYS J  1 20  ? 54.098  -62.894  -67.587 1.00 53.21 ? 18  LYS D NZ    1 
ATOM   8901  N  N     . TYR J  1 21  ? 54.297  -69.815  -66.522 1.00 19.10 ? 19  TYR D N     1 
ATOM   8902  C  CA    . TYR J  1 21  ? 54.925  -70.986  -65.897 1.00 17.36 ? 19  TYR D CA    1 
ATOM   8903  C  C     . TYR J  1 21  ? 56.216  -70.651  -65.126 1.00 20.99 ? 19  TYR D C     1 
ATOM   8904  O  O     . TYR J  1 21  ? 56.430  -71.145  -64.010 1.00 15.43 ? 19  TYR D O     1 
ATOM   8905  C  CB    . TYR J  1 21  ? 55.193  -72.096  -66.922 1.00 19.27 ? 19  TYR D CB    1 
ATOM   8906  C  CG    . TYR J  1 21  ? 53.904  -72.672  -67.436 1.00 16.65 ? 19  TYR D CG    1 
ATOM   8907  C  CD1   . TYR J  1 21  ? 53.208  -72.039  -68.435 1.00 19.60 ? 19  TYR D CD1   1 
ATOM   8908  C  CD2   . TYR J  1 21  ? 53.361  -73.832  -66.891 1.00 15.98 ? 19  TYR D CD2   1 
ATOM   8909  C  CE1   . TYR J  1 21  ? 51.992  -72.557  -68.917 1.00 16.02 ? 19  TYR D CE1   1 
ATOM   8910  C  CE2   . TYR J  1 21  ? 52.154  -74.378  -67.386 1.00 15.35 ? 19  TYR D CE2   1 
ATOM   8911  C  CZ    . TYR J  1 21  ? 51.470  -73.719  -68.371 1.00 15.60 ? 19  TYR D CZ    1 
ATOM   8912  O  OH    . TYR J  1 21  ? 50.273  -74.202  -68.843 1.00 16.21 ? 19  TYR D OH    1 
ATOM   8913  N  N     . ARG J  1 22  ? 57.081  -69.824  -65.705 1.00 18.04 ? 20  ARG D N     1 
ATOM   8914  C  CA    . ARG J  1 22  ? 58.366  -69.593  -65.045 1.00 23.33 ? 20  ARG D CA    1 
ATOM   8915  C  C     . ARG J  1 22  ? 58.106  -68.975  -63.692 1.00 24.20 ? 20  ARG D C     1 
ATOM   8916  O  O     . ARG J  1 22  ? 58.689  -69.363  -62.675 1.00 22.01 ? 20  ARG D O     1 
ATOM   8917  C  CB    . ARG J  1 22  ? 59.291  -68.714  -65.891 1.00 21.37 ? 20  ARG D CB    1 
ATOM   8918  C  CG    . ARG J  1 22  ? 60.092  -69.537  -66.905 1.00 24.16 ? 20  ARG D CG    1 
ATOM   8919  C  CD    . ARG J  1 22  ? 60.879  -68.652  -67.854 1.00 24.28 ? 20  ARG D CD    1 
ATOM   8920  N  NE    . ARG J  1 22  ? 60.021  -67.711  -68.584 1.00 30.79 ? 20  ARG D NE    1 
ATOM   8921  C  CZ    . ARG J  1 22  ? 60.476  -66.806  -69.456 1.00 37.40 ? 20  ARG D CZ    1 
ATOM   8922  N  NH1   . ARG J  1 22  ? 61.778  -66.710  -69.720 1.00 32.30 ? 20  ARG D NH1   1 
ATOM   8923  N  NH2   . ARG J  1 22  ? 59.627  -65.994  -70.074 1.00 34.55 ? 20  ARG D NH2   1 
ATOM   8924  N  N     . GLU J  1 23  ? 57.188  -68.023  -63.692 1.00 20.05 ? 21  GLU D N     1 
ATOM   8925  C  CA    . GLU J  1 23  ? 56.808  -67.306  -62.487 1.00 24.25 ? 21  GLU D CA    1 
ATOM   8926  C  C     . GLU J  1 23  ? 56.128  -68.213  -61.442 1.00 25.70 ? 21  GLU D C     1 
ATOM   8927  O  O     . GLU J  1 23  ? 56.485  -68.189  -60.262 1.00 23.85 ? 21  GLU D O     1 
ATOM   8928  C  CB    . GLU J  1 23  ? 55.923  -66.105  -62.847 1.00 20.79 ? 21  GLU D CB    1 
ATOM   8929  C  CG    . GLU J  1 23  ? 55.052  -65.651  -61.693 1.00 30.70 ? 21  GLU D CG    1 
ATOM   8930  C  CD    . GLU J  1 23  ? 55.001  -64.152  -61.534 1.00 44.72 ? 21  GLU D CD    1 
ATOM   8931  O  OE1   . GLU J  1 23  ? 54.570  -63.469  -62.495 1.00 42.28 ? 21  GLU D OE1   1 
ATOM   8932  O  OE2   . GLU J  1 23  ? 55.403  -63.664  -60.446 1.00 51.72 ? 21  GLU D OE2   1 
ATOM   8933  N  N     . MET J  1 24  ? 55.132  -68.995  -61.849 1.00 20.35 ? 22  MET D N     1 
ATOM   8934  C  CA    . MET J  1 24  ? 54.589  -70.002  -60.945 1.00 20.20 ? 22  MET D CA    1 
ATOM   8935  C  C     . MET J  1 24  ? 55.689  -70.814  -60.273 1.00 21.36 ? 22  MET D C     1 
ATOM   8936  O  O     . MET J  1 24  ? 55.720  -70.958  -59.045 1.00 23.62 ? 22  MET D O     1 
ATOM   8937  C  CB    . MET J  1 24  ? 53.707  -70.979  -61.722 1.00 19.66 ? 22  MET D CB    1 
ATOM   8938  C  CG    . MET J  1 24  ? 53.071  -72.036  -60.827 1.00 19.18 ? 22  MET D CG    1 
ATOM   8939  S  SD    . MET J  1 24  ? 51.901  -73.073  -61.767 1.00 18.16 ? 22  MET D SD    1 
ATOM   8940  C  CE    . MET J  1 24  ? 53.020  -73.982  -62.829 1.00 14.63 ? 22  MET D CE    1 
ATOM   8941  N  N     . TYR J  1 25  ? 56.582  -71.385  -61.072 1.00 20.81 ? 23  TYR D N     1 
ATOM   8942  C  CA    . TYR J  1 25  ? 57.555  -72.302  -60.495 1.00 20.42 ? 23  TYR D CA    1 
ATOM   8943  C  C     . TYR J  1 25  ? 58.511  -71.549  -59.598 1.00 27.55 ? 23  TYR D C     1 
ATOM   8944  O  O     . TYR J  1 25  ? 59.043  -72.132  -58.650 1.00 25.01 ? 23  TYR D O     1 
ATOM   8945  C  CB    . TYR J  1 25  ? 58.311  -73.117  -61.548 1.00 23.32 ? 23  TYR D CB    1 
ATOM   8946  C  CG    . TYR J  1 25  ? 57.453  -74.194  -62.202 1.00 17.78 ? 23  TYR D CG    1 
ATOM   8947  C  CD1   . TYR J  1 25  ? 56.838  -75.183  -61.438 1.00 16.72 ? 23  TYR D CD1   1 
ATOM   8948  C  CD2   . TYR J  1 25  ? 57.255  -74.212  -63.584 1.00 18.47 ? 23  TYR D CD2   1 
ATOM   8949  C  CE1   . TYR J  1 25  ? 56.015  -76.165  -62.045 1.00 19.49 ? 23  TYR D CE1   1 
ATOM   8950  C  CE2   . TYR J  1 25  ? 56.462  -75.183  -64.201 1.00 15.95 ? 23  TYR D CE2   1 
ATOM   8951  C  CZ    . TYR J  1 25  ? 55.823  -76.140  -63.422 1.00 18.59 ? 23  TYR D CZ    1 
ATOM   8952  O  OH    . TYR J  1 25  ? 55.033  -77.107  -64.022 1.00 15.35 ? 23  TYR D OH    1 
ATOM   8953  N  N     . ARG J  1 26  ? 58.703  -70.257  -59.868 1.00 20.39 ? 24  ARG D N     1 
ATOM   8954  C  CA    . ARG J  1 26  ? 59.635  -69.481  -59.041 1.00 28.66 ? 24  ARG D CA    1 
ATOM   8955  C  C     . ARG J  1 26  ? 59.039  -69.402  -57.649 1.00 27.51 ? 24  ARG D C     1 
ATOM   8956  O  O     . ARG J  1 26  ? 59.700  -69.602  -56.619 1.00 26.88 ? 24  ARG D O     1 
ATOM   8957  C  CB    . ARG J  1 26  ? 59.780  -68.059  -59.583 1.00 31.66 ? 24  ARG D CB    1 
ATOM   8958  C  CG    . ARG J  1 26  ? 61.073  -67.749  -60.326 1.00 39.36 ? 24  ARG D CG    1 
ATOM   8959  C  CD    . ARG J  1 26  ? 61.224  -66.204  -60.488 1.00 43.16 ? 24  ARG D CD    1 
ATOM   8960  N  NE    . ARG J  1 26  ? 59.981  -65.590  -60.972 1.00 43.31 ? 24  ARG D NE    1 
ATOM   8961  C  CZ    . ARG J  1 26  ? 59.198  -64.747  -60.281 1.00 49.65 ? 24  ARG D CZ    1 
ATOM   8962  N  NH1   . ARG J  1 26  ? 59.523  -64.347  -59.051 1.00 38.23 ? 24  ARG D NH1   1 
ATOM   8963  N  NH2   . ARG J  1 26  ? 58.075  -64.283  -60.839 1.00 47.24 ? 24  ARG D NH2   1 
ATOM   8964  N  N     . GLN J  1 27  ? 57.755  -69.097  -57.645 1.00 23.26 ? 25  GLN D N     1 
ATOM   8965  C  CA    . GLN J  1 27  ? 57.013  -68.878  -56.435 1.00 26.16 ? 25  GLN D CA    1 
ATOM   8966  C  C     . GLN J  1 27  ? 56.952  -70.161  -55.592 1.00 29.46 ? 25  GLN D C     1 
ATOM   8967  O  O     . GLN J  1 27  ? 57.031  -70.130  -54.348 1.00 32.34 ? 25  GLN D O     1 
ATOM   8968  C  CB    . GLN J  1 27  ? 55.630  -68.422  -56.848 1.00 33.04 ? 25  GLN D CB    1 
ATOM   8969  C  CG    . GLN J  1 27  ? 54.704  -68.079  -55.743 1.00 35.22 ? 25  GLN D CG    1 
ATOM   8970  C  CD    . GLN J  1 27  ? 53.595  -67.203  -56.259 1.00 35.34 ? 25  GLN D CD    1 
ATOM   8971  O  OE1   . GLN J  1 27  ? 53.726  -66.605  -57.328 1.00 34.44 ? 25  GLN D OE1   1 
ATOM   8972  N  NE2   . GLN J  1 27  ? 52.484  -67.139  -55.523 1.00 42.90 ? 25  GLN D NE2   1 
ATOM   8973  N  N     . LEU J  1 28  ? 56.817  -71.297  -56.264 1.00 30.25 ? 26  LEU D N     1 
ATOM   8974  C  CA    . LEU J  1 28  ? 56.824  -72.587  -55.565 1.00 29.87 ? 26  LEU D CA    1 
ATOM   8975  C  C     . LEU J  1 28  ? 58.222  -72.896  -54.996 1.00 27.83 ? 26  LEU D C     1 
ATOM   8976  O  O     . LEU J  1 28  ? 58.365  -73.401  -53.872 1.00 25.44 ? 26  LEU D O     1 
ATOM   8977  C  CB    . LEU J  1 28  ? 56.373  -73.704  -56.527 1.00 24.83 ? 26  LEU D CB    1 
ATOM   8978  C  CG    . LEU J  1 28  ? 54.954  -73.550  -57.084 1.00 19.91 ? 26  LEU D CG    1 
ATOM   8979  C  CD1   . LEU J  1 28  ? 54.709  -74.501  -58.283 1.00 20.49 ? 26  LEU D CD1   1 
ATOM   8980  C  CD2   . LEU J  1 28  ? 53.926  -73.806  -55.999 1.00 21.84 ? 26  LEU D CD2   1 
ATOM   8981  N  N     . SER J  1 29  ? 59.255  -72.628  -55.784 1.00 28.01 ? 27  SER D N     1 
ATOM   8982  C  CA    . SER J  1 29  ? 60.614  -72.821  -55.297 1.00 30.32 ? 27  SER D CA    1 
ATOM   8983  C  C     . SER J  1 29  ? 60.769  -72.003  -54.016 1.00 31.82 ? 27  SER D C     1 
ATOM   8984  O  O     . SER J  1 29  ? 61.319  -72.462  -53.008 1.00 34.63 ? 27  SER D O     1 
ATOM   8985  C  CB    . SER J  1 29  ? 61.636  -72.361  -56.331 1.00 33.76 ? 27  SER D CB    1 
ATOM   8986  O  OG    . SER J  1 29  ? 62.969  -72.616  -55.883 1.00 34.60 ? 27  SER D OG    1 
ATOM   8987  N  N     . GLU J  1 30  ? 60.231  -70.794  -54.044 1.00 32.72 ? 28  GLU D N     1 
ATOM   8988  C  CA    . GLU J  1 30  ? 60.385  -69.891  -52.908 1.00 32.94 ? 28  GLU D CA    1 
ATOM   8989  C  C     . GLU J  1 30  ? 59.763  -70.394  -51.618 1.00 38.76 ? 28  GLU D C     1 
ATOM   8990  O  O     . GLU J  1 30  ? 60.193  -70.017  -50.516 1.00 31.50 ? 28  GLU D O     1 
ATOM   8991  C  CB    . GLU J  1 30  ? 59.895  -68.492  -53.256 1.00 31.89 ? 28  GLU D CB    1 
ATOM   8992  C  CG    . GLU J  1 30  ? 60.989  -67.719  -53.929 1.00 46.22 ? 28  GLU D CG    1 
ATOM   8993  C  CD    . GLU J  1 30  ? 62.339  -68.044  -53.270 1.00 56.65 ? 28  GLU D CD    1 
ATOM   8994  O  OE1   . GLU J  1 30  ? 62.565  -67.548  -52.136 1.00 53.28 ? 28  GLU D OE1   1 
ATOM   8995  O  OE2   . GLU J  1 30  ? 63.143  -68.824  -53.856 1.00 52.02 ? 28  GLU D OE2   1 
ATOM   8996  N  N     . TYR J  1 31  ? 58.753  -71.245  -51.759 1.00 37.35 ? 29  TYR D N     1 
ATOM   8997  C  CA    . TYR J  1 31  ? 58.048  -71.801  -50.609 1.00 35.27 ? 29  TYR D CA    1 
ATOM   8998  C  C     . TYR J  1 31  ? 58.852  -72.957  -50.029 1.00 35.23 ? 29  TYR D C     1 
ATOM   8999  O  O     . TYR J  1 31  ? 58.974  -73.087  -48.808 1.00 40.24 ? 29  TYR D O     1 
ATOM   9000  C  CB    . TYR J  1 31  ? 56.650  -72.250  -51.042 1.00 34.98 ? 29  TYR D CB    1 
ATOM   9001  C  CG    . TYR J  1 31  ? 56.037  -73.371  -50.231 1.00 38.64 ? 29  TYR D CG    1 
ATOM   9002  C  CD1   . TYR J  1 31  ? 56.507  -74.679  -50.338 1.00 35.86 ? 29  TYR D CD1   1 
ATOM   9003  C  CD2   . TYR J  1 31  ? 54.955  -73.132  -49.390 1.00 32.65 ? 29  TYR D CD2   1 
ATOM   9004  C  CE1   . TYR J  1 31  ? 55.923  -75.724  -49.601 1.00 37.10 ? 29  TYR D CE1   1 
ATOM   9005  C  CE2   . TYR J  1 31  ? 54.360  -74.166  -48.651 1.00 34.00 ? 29  TYR D CE2   1 
ATOM   9006  C  CZ    . TYR J  1 31  ? 54.849  -75.461  -48.758 1.00 38.61 ? 29  TYR D CZ    1 
ATOM   9007  O  OH    . TYR J  1 31  ? 54.250  -76.504  -48.030 1.00 34.61 ? 29  TYR D OH    1 
ATOM   9008  N  N     . GLU J  1 32  ? 59.417  -73.786  -50.902 1.00 31.77 ? 30  GLU D N     1 
ATOM   9009  C  CA    . GLU J  1 32  ? 60.292  -74.851  -50.425 1.00 34.98 ? 30  GLU D CA    1 
ATOM   9010  C  C     . GLU J  1 32  ? 61.467  -74.251  -49.648 1.00 45.42 ? 30  GLU D C     1 
ATOM   9011  O  O     . GLU J  1 32  ? 61.744  -74.650  -48.514 1.00 36.97 ? 30  GLU D O     1 
ATOM   9012  C  CB    . GLU J  1 32  ? 60.817  -75.709  -51.573 1.00 37.85 ? 30  GLU D CB    1 
ATOM   9013  C  CG    . GLU J  1 32  ? 59.757  -76.592  -52.248 1.00 33.15 ? 30  GLU D CG    1 
ATOM   9014  C  CD    . GLU J  1 32  ? 60.376  -77.629  -53.169 1.00 34.23 ? 30  GLU D CD    1 
ATOM   9015  O  OE1   . GLU J  1 32  ? 61.172  -77.244  -54.060 1.00 28.22 ? 30  GLU D OE1   1 
ATOM   9016  O  OE2   . GLU J  1 32  ? 60.064  -78.830  -52.998 1.00 34.57 ? 30  GLU D OE2   1 
ATOM   9017  N  N     . LYS J  1 33  ? 62.157  -73.294  -50.261 1.00 41.15 ? 31  LYS D N     1 
ATOM   9018  C  CA    . LYS J  1 33  ? 63.332  -72.709  -49.626 1.00 46.93 ? 31  LYS D CA    1 
ATOM   9019  C  C     . LYS J  1 33  ? 62.976  -71.985  -48.321 1.00 46.72 ? 31  LYS D C     1 
ATOM   9020  O  O     . LYS J  1 33  ? 63.732  -72.032  -47.355 1.00 55.78 ? 31  LYS D O     1 
ATOM   9021  C  CB    . LYS J  1 33  ? 64.085  -71.759  -50.573 1.00 50.58 ? 31  LYS D CB    1 
ATOM   9022  C  CG    . LYS J  1 33  ? 65.340  -71.109  -49.938 1.00 51.50 ? 31  LYS D CG    1 
ATOM   9023  C  CD    . LYS J  1 33  ? 66.353  -72.168  -49.451 1.00 61.37 ? 31  LYS D CD    1 
ATOM   9024  C  CE    . LYS J  1 33  ? 66.744  -71.984  -47.971 1.00 62.50 ? 31  LYS D CE    1 
ATOM   9025  N  NZ    . LYS J  1 33  ? 67.032  -73.288  -47.292 1.00 54.35 ? 31  LYS D NZ    1 
ATOM   9026  N  N     . SER J  1 34  ? 61.832  -71.317  -48.274 1.00 42.24 ? 32  SER D N     1 
ATOM   9027  C  CA    . SER J  1 34  ? 61.548  -70.513  -47.096 1.00 42.42 ? 32  SER D CA    1 
ATOM   9028  C  C     . SER J  1 34  ? 60.931  -71.296  -45.942 1.00 44.21 ? 32  SER D C     1 
ATOM   9029  O  O     . SER J  1 34  ? 60.748  -70.752  -44.850 1.00 46.60 ? 32  SER D O     1 
ATOM   9030  C  CB    . SER J  1 34  ? 60.678  -69.316  -47.440 1.00 37.20 ? 32  SER D CB    1 
ATOM   9031  O  OG    . SER J  1 34  ? 59.361  -69.708  -47.736 1.00 51.02 ? 32  SER D OG    1 
ATOM   9032  N  N     . THR J  1 35  ? 60.628  -72.569  -46.159 1.00 40.37 ? 33  THR D N     1 
ATOM   9033  C  CA    . THR J  1 35  ? 59.935  -73.324  -45.126 1.00 36.46 ? 33  THR D CA    1 
ATOM   9034  C  C     . THR J  1 35  ? 60.526  -74.698  -44.883 1.00 36.49 ? 33  THR D C     1 
ATOM   9035  O  O     . THR J  1 35  ? 60.174  -75.357  -43.911 1.00 42.74 ? 33  THR D O     1 
ATOM   9036  C  CB    . THR J  1 35  ? 58.408  -73.395  -45.398 1.00 34.99 ? 33  THR D CB    1 
ATOM   9037  O  OG1   . THR J  1 35  ? 58.138  -74.252  -46.510 1.00 40.03 ? 33  THR D OG1   1 
ATOM   9038  C  CG2   . THR J  1 35  ? 57.890  -72.028  -45.723 1.00 38.06 ? 33  THR D CG2   1 
ATOM   9039  N  N     . GLY J  1 36  ? 61.428  -75.125  -45.758 1.00 34.72 ? 34  GLY D N     1 
ATOM   9040  C  CA    . GLY J  1 36  ? 62.015  -76.441  -45.624 1.00 35.84 ? 34  GLY D CA    1 
ATOM   9041  C  C     . GLY J  1 36  ? 61.089  -77.557  -46.071 1.00 34.66 ? 34  GLY D C     1 
ATOM   9042  O  O     . GLY J  1 36  ? 61.523  -78.716  -46.169 1.00 35.55 ? 34  GLY D O     1 
ATOM   9043  N  N     . LYS J  1 37  ? 59.821  -77.233  -46.351 1.00 34.77 ? 35  LYS D N     1 
ATOM   9044  C  CA    . LYS J  1 37  ? 58.892  -78.265  -46.833 1.00 35.34 ? 35  LYS D CA    1 
ATOM   9045  C  C     . LYS J  1 37  ? 59.198  -78.723  -48.272 1.00 37.72 ? 35  LYS D C     1 
ATOM   9046  O  O     . LYS J  1 37  ? 59.630  -77.933  -49.131 1.00 33.98 ? 35  LYS D O     1 
ATOM   9047  C  CB    . LYS J  1 37  ? 57.456  -77.790  -46.731 1.00 36.22 ? 35  LYS D CB    1 
ATOM   9048  C  CG    . LYS J  1 37  ? 56.999  -77.419  -45.338 1.00 37.80 ? 35  LYS D CG    1 
ATOM   9049  C  CD    . LYS J  1 37  ? 55.775  -76.505  -45.441 1.00 43.87 ? 35  LYS D CD    1 
ATOM   9050  C  CE    . LYS J  1 37  ? 54.895  -76.576  -44.212 1.00 42.30 ? 35  LYS D CE    1 
ATOM   9051  N  NZ    . LYS J  1 37  ? 53.829  -75.527  -44.229 1.00 39.22 ? 35  LYS D NZ    1 
ATOM   9052  N  N     . GLU J  1 38  ? 59.008  -80.013  -48.529 1.00 33.39 ? 36  GLU D N     1 
ATOM   9053  C  CA    . GLU J  1 38  ? 59.184  -80.547  -49.873 1.00 33.65 ? 36  GLU D CA    1 
ATOM   9054  C  C     . GLU J  1 38  ? 57.801  -80.571  -50.543 1.00 35.09 ? 36  GLU D C     1 
ATOM   9055  O  O     . GLU J  1 38  ? 56.832  -81.049  -49.951 1.00 35.55 ? 36  GLU D O     1 
ATOM   9056  C  CB    . GLU J  1 38  ? 59.777  -81.948  -49.787 1.00 36.63 ? 36  GLU D CB    1 
ATOM   9057  C  CG    . GLU J  1 38  ? 59.865  -82.743  -51.088 1.00 32.21 ? 36  GLU D CG    1 
ATOM   9058  C  CD    . GLU J  1 38  ? 60.755  -83.982  -50.916 1.00 47.83 ? 36  GLU D CD    1 
ATOM   9059  O  OE1   . GLU J  1 38  ? 61.635  -83.962  -50.022 1.00 49.29 ? 36  GLU D OE1   1 
ATOM   9060  O  OE2   . GLU J  1 38  ? 60.571  -84.972  -51.659 1.00 44.25 ? 36  GLU D OE2   1 
ATOM   9061  N  N     . ILE J  1 39  ? 57.705  -80.013  -51.749 1.00 30.41 ? 37  ILE D N     1 
ATOM   9062  C  CA    . ILE J  1 39  ? 56.461  -80.077  -52.535 1.00 25.91 ? 37  ILE D CA    1 
ATOM   9063  C  C     . ILE J  1 39  ? 56.394  -81.458  -53.146 1.00 22.61 ? 37  ILE D C     1 
ATOM   9064  O  O     . ILE J  1 39  ? 57.323  -81.861  -53.853 1.00 26.71 ? 37  ILE D O     1 
ATOM   9065  C  CB    . ILE J  1 39  ? 56.440  -79.032  -53.667 1.00 28.68 ? 37  ILE D CB    1 
ATOM   9066  C  CG1   . ILE J  1 39  ? 56.351  -77.619  -53.092 1.00 21.67 ? 37  ILE D CG1   1 
ATOM   9067  C  CG2   . ILE J  1 39  ? 55.257  -79.307  -54.662 1.00 23.64 ? 37  ILE D CG2   1 
ATOM   9068  C  CD1   . ILE J  1 39  ? 56.695  -76.552  -54.123 1.00 28.45 ? 37  ILE D CD1   1 
ATOM   9069  N  N     . SER J  1 40  ? 55.335  -82.206  -52.843 1.00 17.49 ? 38  SER D N     1 
ATOM   9070  C  CA    . SER J  1 40  ? 55.162  -83.531  -53.461 1.00 22.55 ? 38  SER D CA    1 
ATOM   9071  C  C     . SER J  1 40  ? 54.730  -83.479  -54.928 1.00 20.81 ? 38  SER D C     1 
ATOM   9072  O  O     . SER J  1 40  ? 55.274  -84.227  -55.756 1.00 24.49 ? 38  SER D O     1 
ATOM   9073  C  CB    . SER J  1 40  ? 54.194  -84.408  -52.672 1.00 23.94 ? 38  SER D CB    1 
ATOM   9074  O  OG    . SER J  1 40  ? 54.804  -84.941  -51.514 1.00 33.70 ? 38  SER D OG    1 
ATOM   9075  N  N     . PHE J  1 41  ? 53.739  -82.642  -55.237 1.00 18.91 ? 39  PHE D N     1 
ATOM   9076  C  CA    . PHE J  1 41  ? 53.380  -82.336  -56.629 1.00 16.84 ? 39  PHE D CA    1 
ATOM   9077  C  C     . PHE J  1 41  ? 52.483  -81.098  -56.648 1.00 18.01 ? 39  PHE D C     1 
ATOM   9078  O  O     . PHE J  1 41  ? 52.176  -80.546  -55.585 1.00 19.55 ? 39  PHE D O     1 
ATOM   9079  C  CB    . PHE J  1 41  ? 52.700  -83.548  -57.314 1.00 18.20 ? 39  PHE D CB    1 
ATOM   9080  C  CG    . PHE J  1 41  ? 51.390  -83.987  -56.656 1.00 18.49 ? 39  PHE D CG    1 
ATOM   9081  C  CD1   . PHE J  1 41  ? 51.393  -84.899  -55.599 1.00 21.29 ? 39  PHE D CD1   1 
ATOM   9082  C  CD2   . PHE J  1 41  ? 50.159  -83.478  -57.089 1.00 15.31 ? 39  PHE D CD2   1 
ATOM   9083  C  CE1   . PHE J  1 41  ? 50.186  -85.292  -54.984 1.00 21.14 ? 39  PHE D CE1   1 
ATOM   9084  C  CE2   . PHE J  1 41  ? 48.966  -83.866  -56.478 1.00 18.43 ? 39  PHE D CE2   1 
ATOM   9085  C  CZ    . PHE J  1 41  ? 48.982  -84.780  -55.432 1.00 15.63 ? 39  PHE D CZ    1 
ATOM   9086  N  N     . VAL J  1 42  ? 52.073  -80.664  -57.848 1.00 15.56 ? 40  VAL D N     1 
ATOM   9087  C  CA    . VAL J  1 42  ? 51.334  -79.408  -58.026 1.00 19.65 ? 40  VAL D CA    1 
ATOM   9088  C  C     . VAL J  1 42  ? 50.024  -79.678  -58.775 1.00 16.28 ? 40  VAL D C     1 
ATOM   9089  O  O     . VAL J  1 42  ? 49.995  -80.491  -59.697 1.00 16.11 ? 40  VAL D O     1 
ATOM   9090  C  CB    . VAL J  1 42  ? 52.164  -78.417  -58.848 1.00 20.39 ? 40  VAL D CB    1 
ATOM   9091  C  CG1   . VAL J  1 42  ? 51.398  -77.094  -59.030 1.00 17.77 ? 40  VAL D CG1   1 
ATOM   9092  C  CG2   . VAL J  1 42  ? 53.497  -78.183  -58.178 1.00 16.36 ? 40  VAL D CG2   1 
ATOM   9093  N  N     . ILE J  1 43  ? 48.953  -78.998  -58.392 1.00 16.61 ? 41  ILE D N     1 
ATOM   9094  C  CA    . ILE J  1 43  ? 47.719  -79.128  -59.107 1.00 19.12 ? 41  ILE D CA    1 
ATOM   9095  C  C     . ILE J  1 43  ? 47.325  -77.752  -59.592 1.00 20.30 ? 41  ILE D C     1 
ATOM   9096  O  O     . ILE J  1 43  ? 47.318  -76.790  -58.799 1.00 20.54 ? 41  ILE D O     1 
ATOM   9097  C  CB    . ILE J  1 43  ? 46.577  -79.583  -58.184 1.00 20.22 ? 41  ILE D CB    1 
ATOM   9098  C  CG1   . ILE J  1 43  ? 46.817  -80.988  -57.642 1.00 22.55 ? 41  ILE D CG1   1 
ATOM   9099  C  CG2   . ILE J  1 43  ? 45.254  -79.509  -58.915 1.00 20.84 ? 41  ILE D CG2   1 
ATOM   9100  C  CD1   . ILE J  1 43  ? 45.822  -81.284  -56.463 1.00 19.43 ? 41  ILE D CD1   1 
ATOM   9101  N  N     . CYS J  1 44  ? 46.951  -77.649  -60.862 1.00 17.98 ? 42  CYS D N     1 
ATOM   9102  C  CA    . CYS J  1 44  ? 46.583  -76.353  -61.417 1.00 18.88 ? 42  CYS D CA    1 
ATOM   9103  C  C     . CYS J  1 44  ? 45.176  -76.458  -61.936 1.00 17.31 ? 42  CYS D C     1 
ATOM   9104  O  O     . CYS J  1 44  ? 44.836  -77.455  -62.573 1.00 17.18 ? 42  CYS D O     1 
ATOM   9105  C  CB    . CYS J  1 44  ? 47.487  -75.992  -62.591 1.00 21.32 ? 42  CYS D CB    1 
ATOM   9106  S  SG    . CYS J  1 44  ? 49.176  -75.747  -62.123 1.00 21.61 ? 42  CYS D SG    1 
ATOM   9107  N  N     . THR J  1 45  ? 44.374  -75.418  -61.728 1.00 13.29 ? 43  THR D N     1 
ATOM   9108  C  CA    . THR J  1 45  ? 42.957  -75.483  -62.096 1.00 19.48 ? 43  THR D CA    1 
ATOM   9109  C  C     . THR J  1 45  ? 42.570  -74.748  -63.387 1.00 18.29 ? 43  THR D C     1 
ATOM   9110  O  O     . THR J  1 45  ? 41.413  -74.316  -63.543 1.00 20.29 ? 43  THR D O     1 
ATOM   9111  C  CB    . THR J  1 45  ? 42.055  -75.007  -60.934 1.00 21.38 ? 43  THR D CB    1 
ATOM   9112  O  OG1   . THR J  1 45  ? 42.515  -73.732  -60.484 1.00 24.77 ? 43  THR D OG1   1 
ATOM   9113  C  CG2   . THR J  1 45  ? 42.107  -75.989  -59.772 1.00 23.08 ? 43  THR D CG2   1 
ATOM   9114  N  N     . GLY J  1 46  ? 43.507  -74.624  -64.329 1.00 15.62 ? 44  GLY D N     1 
ATOM   9115  C  CA    . GLY J  1 46  ? 43.118  -74.175  -65.658 1.00 14.60 ? 44  GLY D CA    1 
ATOM   9116  C  C     . GLY J  1 46  ? 43.649  -72.847  -66.178 1.00 16.81 ? 44  GLY D C     1 
ATOM   9117  O  O     . GLY J  1 46  ? 44.463  -72.179  -65.528 1.00 18.46 ? 44  GLY D O     1 
ATOM   9118  N  N     . ASP J  1 47  ? 43.183  -72.488  -67.373 1.00 16.61 ? 45  ASP D N     1 
ATOM   9119  C  CA    . ASP J  1 47  ? 43.776  -71.412  -68.170 1.00 16.41 ? 45  ASP D CA    1 
ATOM   9120  C  C     . ASP J  1 47  ? 45.289  -71.614  -68.327 1.00 16.18 ? 45  ASP D C     1 
ATOM   9121  O  O     . ASP J  1 47  ? 46.103  -70.744  -68.010 1.00 18.76 ? 45  ASP D O     1 
ATOM   9122  C  CB    . ASP J  1 47  ? 43.405  -70.051  -67.562 1.00 18.78 ? 45  ASP D CB    1 
ATOM   9123  C  CG    . ASP J  1 47  ? 41.927  -69.742  -67.730 1.00 21.70 ? 45  ASP D CG    1 
ATOM   9124  O  OD1   . ASP J  1 47  ? 41.274  -70.479  -68.486 1.00 16.91 ? 45  ASP D OD1   1 
ATOM   9125  O  OD2   . ASP J  1 47  ? 41.439  -68.758  -67.154 1.00 20.92 ? 45  ASP D OD2   1 
ATOM   9126  N  N     . MET J  1 48  ? 45.656  -72.794  -68.821 1.00 14.32 ? 46  MET D N     1 
ATOM   9127  C  CA    . MET J  1 48  ? 47.044  -73.226  -68.861 1.00 12.98 ? 46  MET D CA    1 
ATOM   9128  C  C     . MET J  1 48  ? 47.793  -72.684  -70.082 1.00 16.28 ? 46  MET D C     1 
ATOM   9129  O  O     . MET J  1 48  ? 49.028  -72.578  -70.067 1.00 14.18 ? 46  MET D O     1 
ATOM   9130  C  CB    . MET J  1 48  ? 47.106  -74.761  -68.871 1.00 8.66  ? 46  MET D CB    1 
ATOM   9131  C  CG    . MET J  1 48  ? 46.391  -75.379  -67.635 1.00 7.83  ? 46  MET D CG    1 
ATOM   9132  S  SD    . MET J  1 48  ? 47.032  -74.801  -66.018 1.00 15.82 ? 46  MET D SD    1 
ATOM   9133  C  CE    . MET J  1 48  ? 48.667  -75.513  -66.019 1.00 13.10 ? 46  MET D CE    1 
ATOM   9134  N  N     . GLN J  1 49  ? 47.043  -72.357  -71.129 1.00 12.51 ? 47  GLN D N     1 
ATOM   9135  C  CA    . GLN J  1 49  ? 47.582  -71.800  -72.384 1.00 18.81 ? 47  GLN D CA    1 
ATOM   9136  C  C     . GLN J  1 49  ? 48.795  -72.573  -72.869 1.00 15.73 ? 47  GLN D C     1 
ATOM   9137  O  O     . GLN J  1 49  ? 49.876  -72.019  -73.000 1.00 12.14 ? 47  GLN D O     1 
ATOM   9138  C  CB    . GLN J  1 49  ? 47.911  -70.295  -72.226 1.00 16.57 ? 47  GLN D CB    1 
ATOM   9139  C  CG    . GLN J  1 49  ? 46.718  -69.521  -71.596 1.00 24.01 ? 47  GLN D CG    1 
ATOM   9140  C  CD    . GLN J  1 49  ? 46.857  -67.995  -71.691 1.00 27.50 ? 47  GLN D CD    1 
ATOM   9141  O  OE1   . GLN J  1 49  ? 47.880  -67.485  -72.180 1.00 24.86 ? 47  GLN D OE1   1 
ATOM   9142  N  NE2   . GLN J  1 49  ? 45.803  -67.268  -71.271 1.00 27.56 ? 47  GLN D NE2   1 
ATOM   9143  N  N     . THR J  1 50  ? 48.603  -73.861  -73.144 1.00 16.11 ? 48  THR D N     1 
ATOM   9144  C  CA    . THR J  1 50  ? 49.704  -74.745  -73.505 1.00 12.84 ? 48  THR D CA    1 
ATOM   9145  C  C     . THR J  1 50  ? 49.870  -74.667  -75.011 1.00 12.68 ? 48  THR D C     1 
ATOM   9146  O  O     . THR J  1 50  ? 49.668  -75.652  -75.719 1.00 13.42 ? 48  THR D O     1 
ATOM   9147  C  CB    . THR J  1 50  ? 49.419  -76.194  -73.061 1.00 11.36 ? 48  THR D CB    1 
ATOM   9148  O  OG1   . THR J  1 50  ? 48.257  -76.677  -73.757 1.00 11.90 ? 48  THR D OG1   1 
ATOM   9149  C  CG2   . THR J  1 50  ? 49.170  -76.242  -71.568 1.00 12.26 ? 48  THR D CG2   1 
ATOM   9150  N  N     . LEU J  1 51  ? 50.195  -73.476  -75.500 1.00 12.18 ? 49  LEU D N     1 
ATOM   9151  C  CA    . LEU J  1 51  ? 50.489  -73.304  -76.931 1.00 17.23 ? 49  LEU D CA    1 
ATOM   9152  C  C     . LEU J  1 51  ? 51.928  -73.784  -77.268 1.00 13.56 ? 49  LEU D C     1 
ATOM   9153  O  O     . LEU J  1 51  ? 52.888  -73.314  -76.679 1.00 13.94 ? 49  LEU D O     1 
ATOM   9154  C  CB    . LEU J  1 51  ? 50.303  -71.841  -77.379 1.00 12.06 ? 49  LEU D CB    1 
ATOM   9155  C  CG    . LEU J  1 51  ? 48.868  -71.275  -77.482 1.00 15.10 ? 49  LEU D CG    1 
ATOM   9156  C  CD1   . LEU J  1 51  ? 48.192  -71.113  -76.116 1.00 19.61 ? 49  LEU D CD1   1 
ATOM   9157  C  CD2   . LEU J  1 51  ? 48.871  -69.926  -78.184 1.00 23.82 ? 49  LEU D CD2   1 
ATOM   9158  N  N     . ARG J  1 52  ? 52.038  -74.743  -78.194 1.00 12.81 ? 50  ARG D N     1 
ATOM   9159  C  CA    . ARG J  1 52  ? 53.300  -75.404  -78.501 1.00 14.92 ? 50  ARG D CA    1 
ATOM   9160  C  C     . ARG J  1 52  ? 54.130  -74.484  -79.358 1.00 13.62 ? 50  ARG D C     1 
ATOM   9161  O  O     . ARG J  1 52  ? 55.359  -74.404  -79.198 1.00 11.08 ? 50  ARG D O     1 
ATOM   9162  C  CB    . ARG J  1 52  ? 53.051  -76.648  -79.346 1.00 13.61 ? 50  ARG D CB    1 
ATOM   9163  C  CG    . ARG J  1 52  ? 52.361  -77.831  -78.641 1.00 12.29 ? 50  ARG D CG    1 
ATOM   9164  C  CD    . ARG J  1 52  ? 51.909  -78.851  -79.660 1.00 13.24 ? 50  ARG D CD    1 
ATOM   9165  N  NE    . ARG J  1 52  ? 50.829  -78.301  -80.492 1.00 14.37 ? 50  ARG D NE    1 
ATOM   9166  C  CZ    . ARG J  1 52  ? 50.049  -78.998  -81.310 1.00 18.10 ? 50  ARG D CZ    1 
ATOM   9167  N  NH1   . ARG J  1 52  ? 50.211  -80.314  -81.424 1.00 11.41 ? 50  ARG D NH1   1 
ATOM   9168  N  NH2   . ARG J  1 52  ? 49.119  -78.365  -82.035 1.00 13.36 ? 50  ARG D NH2   1 
ATOM   9169  N  N     . TYR J  1 53  ? 53.452  -73.815  -80.292 1.00 15.17 ? 51  TYR D N     1 
ATOM   9170  C  CA    . TYR J  1 53  ? 54.129  -72.949  -81.266 1.00 17.34 ? 51  TYR D CA    1 
ATOM   9171  C  C     . TYR J  1 53  ? 53.135  -71.970  -81.853 1.00 15.76 ? 51  TYR D C     1 
ATOM   9172  O  O     . TYR J  1 53  ? 51.958  -72.063  -81.556 1.00 14.50 ? 51  TYR D O     1 
ATOM   9173  C  CB    . TYR J  1 53  ? 54.796  -73.800  -82.371 1.00 13.36 ? 51  TYR D CB    1 
ATOM   9174  C  CG    . TYR J  1 53  ? 54.055  -75.116  -82.690 1.00 17.33 ? 51  TYR D CG    1 
ATOM   9175  C  CD1   . TYR J  1 53  ? 52.747  -75.130  -83.191 1.00 18.33 ? 51  TYR D CD1   1 
ATOM   9176  C  CD2   . TYR J  1 53  ? 54.693  -76.333  -82.510 1.00 24.83 ? 51  TYR D CD2   1 
ATOM   9177  C  CE1   . TYR J  1 53  ? 52.082  -76.347  -83.472 1.00 15.72 ? 51  TYR D CE1   1 
ATOM   9178  C  CE2   . TYR J  1 53  ? 54.071  -77.525  -82.797 1.00 20.19 ? 51  TYR D CE2   1 
ATOM   9179  C  CZ    . TYR J  1 53  ? 52.769  -77.541  -83.273 1.00 17.95 ? 51  TYR D CZ    1 
ATOM   9180  O  OH    . TYR J  1 53  ? 52.196  -78.774  -83.543 1.00 17.46 ? 51  TYR D OH    1 
ATOM   9181  N  N     . GLU J  1 54  ? 53.603  -71.036  -82.684 1.00 12.49 ? 52  GLU D N     1 
ATOM   9182  C  CA    . GLU J  1 54  ? 52.804  -69.889  -83.114 1.00 15.80 ? 52  GLU D CA    1 
ATOM   9183  C  C     . GLU J  1 54  ? 51.491  -70.282  -83.717 1.00 15.49 ? 52  GLU D C     1 
ATOM   9184  O  O     . GLU J  1 54  ? 50.478  -69.621  -83.519 1.00 17.36 ? 52  GLU D O     1 
ATOM   9185  C  CB    . GLU J  1 54  ? 53.558  -69.062  -84.194 1.00 13.43 ? 52  GLU D CB    1 
ATOM   9186  C  CG    . GLU J  1 54  ? 54.806  -68.347  -83.747 1.00 24.06 ? 52  GLU D CG    1 
ATOM   9187  C  CD    . GLU J  1 54  ? 55.369  -67.415  -84.868 1.00 31.09 ? 52  GLU D CD    1 
ATOM   9188  O  OE1   . GLU J  1 54  ? 56.616  -67.212  -84.907 1.00 26.73 ? 52  GLU D OE1   1 
ATOM   9189  O  OE2   . GLU J  1 54  ? 54.542  -66.893  -85.681 1.00 29.22 ? 52  GLU D OE2   1 
ATOM   9190  N  N     . ALA J  1 55  ? 51.503  -71.359  -84.493 1.00 15.03 ? 53  ALA D N     1 
ATOM   9191  C  CA    . ALA J  1 55  ? 50.265  -71.797  -85.162 1.00 15.65 ? 53  ALA D CA    1 
ATOM   9192  C  C     . ALA J  1 55  ? 49.132  -71.969  -84.169 1.00 14.70 ? 53  ALA D C     1 
ATOM   9193  O  O     . ALA J  1 55  ? 47.962  -71.798  -84.520 1.00 12.33 ? 53  ALA D O     1 
ATOM   9194  C  CB    . ALA J  1 55  ? 50.472  -73.097  -85.939 1.00 16.97 ? 53  ALA D CB    1 
ATOM   9195  N  N     . ASP J  1 56  ? 49.476  -72.344  -82.947 1.00 12.29 ? 54  ASP D N     1 
ATOM   9196  C  CA    . ASP J  1 56  ? 48.450  -72.660  -81.922 1.00 13.65 ? 54  ASP D CA    1 
ATOM   9197  C  C     . ASP J  1 56  ? 47.669  -71.445  -81.412 1.00 13.69 ? 54  ASP D C     1 
ATOM   9198  O  O     . ASP J  1 56  ? 46.589  -71.585  -80.793 1.00 12.39 ? 54  ASP D O     1 
ATOM   9199  C  CB    . ASP J  1 56  ? 49.093  -73.410  -80.738 1.00 10.91 ? 54  ASP D CB    1 
ATOM   9200  C  CG    . ASP J  1 56  ? 49.378  -74.883  -81.049 1.00 13.20 ? 54  ASP D CG    1 
ATOM   9201  O  OD1   . ASP J  1 56  ? 48.762  -75.463  -81.981 1.00 15.62 ? 54  ASP D OD1   1 
ATOM   9202  O  OD2   . ASP J  1 56  ? 50.226  -75.448  -80.335 1.00 16.65 ? 54  ASP D OD2   1 
ATOM   9203  N  N     . LEU J  1 57  ? 48.167  -70.248  -81.716 1.00 15.98 ? 55  LEU D N     1 
ATOM   9204  C  CA    . LEU J  1 57  ? 47.489  -69.022  -81.254 1.00 15.75 ? 55  LEU D CA    1 
ATOM   9205  C  C     . LEU J  1 57  ? 46.044  -68.967  -81.677 1.00 15.50 ? 55  LEU D C     1 
ATOM   9206  O  O     . LEU J  1 57  ? 45.163  -68.418  -80.984 1.00 18.20 ? 55  LEU D O     1 
ATOM   9207  C  CB    . LEU J  1 57  ? 48.231  -67.753  -81.738 1.00 15.21 ? 55  LEU D CB    1 
ATOM   9208  C  CG    . LEU J  1 57  ? 49.446  -67.479  -80.876 1.00 23.59 ? 55  LEU D CG    1 
ATOM   9209  C  CD1   . LEU J  1 57  ? 50.576  -66.821  -81.728 1.00 24.02 ? 55  LEU D CD1   1 
ATOM   9210  C  CD2   . LEU J  1 57  ? 49.059  -66.621  -79.660 1.00 20.17 ? 55  LEU D CD2   1 
ATOM   9211  N  N     . VAL J  1 58  ? 45.798  -69.545  -82.840 1.00 16.02 ? 56  VAL D N     1 
ATOM   9212  C  CA    . VAL J  1 58  ? 44.496  -69.551  -83.477 1.00 16.91 ? 56  VAL D CA    1 
ATOM   9213  C  C     . VAL J  1 58  ? 43.411  -70.159  -82.572 1.00 20.39 ? 56  VAL D C     1 
ATOM   9214  O  O     . VAL J  1 58  ? 42.220  -69.879  -82.725 1.00 16.31 ? 56  VAL D O     1 
ATOM   9215  C  CB    . VAL J  1 58  ? 44.642  -70.315  -84.806 1.00 22.17 ? 56  VAL D CB    1 
ATOM   9216  C  CG1   . VAL J  1 58  ? 43.349  -70.869  -85.247 1.00 27.19 ? 56  VAL D CG1   1 
ATOM   9217  C  CG2   . VAL J  1 58  ? 45.291  -69.401  -85.874 1.00 17.05 ? 56  VAL D CG2   1 
ATOM   9218  N  N     . TYR J  1 59  ? 43.842  -70.989  -81.627 1.00 15.53 ? 57  TYR D N     1 
ATOM   9219  C  CA    . TYR J  1 59  ? 42.923  -71.773  -80.810 1.00 14.87 ? 57  TYR D CA    1 
ATOM   9220  C  C     . TYR J  1 59  ? 42.779  -71.231  -79.399 1.00 16.13 ? 57  TYR D C     1 
ATOM   9221  O  O     . TYR J  1 59  ? 42.063  -71.815  -78.595 1.00 19.30 ? 57  TYR D O     1 
ATOM   9222  C  CB    . TYR J  1 59  ? 43.414  -73.229  -80.717 1.00 18.45 ? 57  TYR D CB    1 
ATOM   9223  C  CG    . TYR J  1 59  ? 43.139  -74.012  -81.968 1.00 19.46 ? 57  TYR D CG    1 
ATOM   9224  C  CD1   . TYR J  1 59  ? 41.873  -74.543  -82.194 1.00 21.48 ? 57  TYR D CD1   1 
ATOM   9225  C  CD2   . TYR J  1 59  ? 44.144  -74.227  -82.930 1.00 17.55 ? 57  TYR D CD2   1 
ATOM   9226  C  CE1   . TYR J  1 59  ? 41.587  -75.261  -83.351 1.00 19.02 ? 57  TYR D CE1   1 
ATOM   9227  C  CE2   . TYR J  1 59  ? 43.875  -74.968  -84.102 1.00 17.40 ? 57  TYR D CE2   1 
ATOM   9228  C  CZ    . TYR J  1 59  ? 42.581  -75.478  -84.288 1.00 17.68 ? 57  TYR D CZ    1 
ATOM   9229  O  OH    . TYR J  1 59  ? 42.249  -76.176  -85.415 1.00 19.45 ? 57  TYR D OH    1 
ATOM   9230  N  N     . LEU J  1 60  ? 43.480  -70.134  -79.115 1.00 13.69 ? 58  LEU D N     1 
ATOM   9231  C  CA    . LEU J  1 60  ? 43.411  -69.439  -77.831 1.00 16.27 ? 58  LEU D CA    1 
ATOM   9232  C  C     . LEU J  1 60  ? 42.305  -68.379  -77.879 1.00 18.81 ? 58  LEU D C     1 
ATOM   9233  O  O     . LEU J  1 60  ? 42.404  -67.410  -78.638 1.00 17.38 ? 58  LEU D O     1 
ATOM   9234  C  CB    . LEU J  1 60  ? 44.776  -68.799  -77.531 1.00 13.29 ? 58  LEU D CB    1 
ATOM   9235  C  CG    . LEU J  1 60  ? 44.857  -67.941  -76.263 1.00 15.79 ? 58  LEU D CG    1 
ATOM   9236  C  CD1   . LEU J  1 60  ? 44.557  -68.793  -75.009 1.00 19.22 ? 58  LEU D CD1   1 
ATOM   9237  C  CD2   . LEU J  1 60  ? 46.235  -67.215  -76.144 1.00 11.71 ? 58  LEU D CD2   1 
ATOM   9238  N  N     . LYS J  1 61  ? 41.245  -68.551  -77.081 1.00 16.48 ? 59  LYS D N     1 
ATOM   9239  C  CA    . LYS J  1 61  ? 40.069  -67.699  -77.218 1.00 21.12 ? 59  LYS D CA    1 
ATOM   9240  C  C     . LYS J  1 61  ? 40.213  -66.487  -76.281 1.00 27.02 ? 59  LYS D C     1 
ATOM   9241  O  O     . LYS J  1 61  ? 39.835  -66.522  -75.126 1.00 27.35 ? 59  LYS D O     1 
ATOM   9242  C  CB    . LYS J  1 61  ? 38.811  -68.520  -76.965 1.00 23.83 ? 59  LYS D CB    1 
ATOM   9243  C  CG    . LYS J  1 61  ? 37.639  -67.727  -76.482 1.00 31.11 ? 59  LYS D CG    1 
ATOM   9244  C  CD    . LYS J  1 61  ? 37.455  -66.487  -77.285 1.00 31.40 ? 59  LYS D CD    1 
ATOM   9245  C  CE    . LYS J  1 61  ? 36.505  -65.571  -76.540 1.00 44.21 ? 59  LYS D CE    1 
ATOM   9246  N  NZ    . LYS J  1 61  ? 35.188  -66.222  -76.382 1.00 49.95 ? 59  LYS D NZ    1 
ATOM   9247  N  N     . VAL J  1 62  ? 40.828  -65.432  -76.798 1.00 22.52 ? 60  VAL D N     1 
ATOM   9248  C  CA    . VAL J  1 62  ? 41.196  -64.251  -76.003 1.00 24.61 ? 60  VAL D CA    1 
ATOM   9249  C  C     . VAL J  1 62  ? 41.146  -63.047  -76.912 1.00 26.31 ? 60  VAL D C     1 
ATOM   9250  O  O     . VAL J  1 62  ? 41.239  -63.165  -78.154 1.00 23.01 ? 60  VAL D O     1 
ATOM   9251  C  CB    . VAL J  1 62  ? 42.642  -64.317  -75.447 1.00 21.74 ? 60  VAL D CB    1 
ATOM   9252  C  CG1   . VAL J  1 62  ? 42.833  -65.462  -74.494 1.00 19.27 ? 60  VAL D CG1   1 
ATOM   9253  C  CG2   . VAL J  1 62  ? 43.650  -64.404  -76.613 1.00 21.69 ? 60  VAL D CG2   1 
ATOM   9254  N  N     . PRO J  1 63  ? 40.991  -61.869  -76.305 1.00 29.33 ? 61  PRO D N     1 
ATOM   9255  C  CA    . PRO J  1 63  ? 40.937  -60.686  -77.160 1.00 28.92 ? 61  PRO D CA    1 
ATOM   9256  C  C     . PRO J  1 63  ? 42.336  -60.383  -77.688 1.00 23.83 ? 61  PRO D C     1 
ATOM   9257  O  O     . PRO J  1 63  ? 43.321  -60.777  -77.056 1.00 25.63 ? 61  PRO D O     1 
ATOM   9258  C  CB    . PRO J  1 63  ? 40.457  -59.578  -76.210 1.00 33.19 ? 61  PRO D CB    1 
ATOM   9259  C  CG    . PRO J  1 63  ? 40.792  -60.055  -74.822 1.00 32.44 ? 61  PRO D CG    1 
ATOM   9260  C  CD    . PRO J  1 63  ? 40.839  -61.563  -74.867 1.00 29.44 ? 61  PRO D CD    1 
ATOM   9261  N  N     . PRO J  1 64  ? 42.418  -59.661  -78.818 1.00 24.98 ? 62  PRO D N     1 
ATOM   9262  C  CA    . PRO J  1 64  ? 43.684  -59.385  -79.495 1.00 26.02 ? 62  PRO D CA    1 
ATOM   9263  C  C     . PRO J  1 64  ? 44.837  -59.100  -78.544 1.00 22.74 ? 62  PRO D C     1 
ATOM   9264  O  O     . PRO J  1 64  ? 45.878  -59.696  -78.703 1.00 21.21 ? 62  PRO D O     1 
ATOM   9265  C  CB    . PRO J  1 64  ? 43.374  -58.124  -80.295 1.00 27.76 ? 62  PRO D CB    1 
ATOM   9266  C  CG    . PRO J  1 64  ? 41.927  -58.257  -80.640 1.00 32.31 ? 62  PRO D CG    1 
ATOM   9267  C  CD    . PRO J  1 64  ? 41.293  -58.927  -79.436 1.00 24.98 ? 62  PRO D CD    1 
ATOM   9268  N  N     . LYS J  1 65  ? 44.668  -58.199  -77.589 1.00 25.03 ? 63  LYS D N     1 
ATOM   9269  C  CA    . LYS J  1 65  ? 45.789  -57.817  -76.729 1.00 20.45 ? 63  LYS D CA    1 
ATOM   9270  C  C     . LYS J  1 65  ? 46.407  -59.005  -76.020 1.00 27.44 ? 63  LYS D C     1 
ATOM   9271  O  O     . LYS J  1 65  ? 47.598  -58.961  -75.648 1.00 20.85 ? 63  LYS D O     1 
ATOM   9272  C  CB    . LYS J  1 65  ? 45.358  -56.785  -75.684 1.00 33.22 ? 63  LYS D CB    1 
ATOM   9273  C  CG    . LYS J  1 65  ? 46.373  -56.650  -74.540 1.00 41.37 ? 63  LYS D CG    1 
ATOM   9274  C  CD    . LYS J  1 65  ? 46.075  -55.463  -73.614 1.00 50.82 ? 63  LYS D CD    1 
ATOM   9275  C  CE    . LYS J  1 65  ? 44.572  -55.366  -73.290 1.00 44.56 ? 63  LYS D CE    1 
ATOM   9276  N  NZ    . LYS J  1 65  ? 44.259  -54.154  -72.443 1.00 63.18 ? 63  LYS D NZ    1 
ATOM   9277  N  N     . TYR J  1 66  ? 45.613  -60.063  -75.806 1.00 25.65 ? 64  TYR D N     1 
ATOM   9278  C  CA    . TYR J  1 66  ? 46.154  -61.241  -75.110 1.00 27.11 ? 64  TYR D CA    1 
ATOM   9279  C  C     . TYR J  1 66  ? 46.625  -62.367  -76.039 1.00 21.10 ? 64  TYR D C     1 
ATOM   9280  O  O     . TYR J  1 66  ? 47.026  -63.434  -75.561 1.00 19.41 ? 64  TYR D O     1 
ATOM   9281  C  CB    . TYR J  1 66  ? 45.179  -61.768  -74.034 1.00 30.02 ? 64  TYR D CB    1 
ATOM   9282  C  CG    . TYR J  1 66  ? 44.907  -60.737  -72.944 1.00 35.65 ? 64  TYR D CG    1 
ATOM   9283  C  CD1   . TYR J  1 66  ? 45.843  -60.490  -71.952 1.00 40.29 ? 64  TYR D CD1   1 
ATOM   9284  C  CD2   . TYR J  1 66  ? 43.726  -59.995  -72.930 1.00 38.90 ? 64  TYR D CD2   1 
ATOM   9285  C  CE1   . TYR J  1 66  ? 45.606  -59.538  -70.960 1.00 45.67 ? 64  TYR D CE1   1 
ATOM   9286  C  CE2   . TYR J  1 66  ? 43.484  -59.028  -71.939 1.00 37.87 ? 64  TYR D CE2   1 
ATOM   9287  C  CZ    . TYR J  1 66  ? 44.425  -58.817  -70.964 1.00 40.35 ? 64  TYR D CZ    1 
ATOM   9288  O  OH    . TYR J  1 66  ? 44.194  -57.878  -69.983 1.00 52.23 ? 64  TYR D OH    1 
ATOM   9289  N  N     . LYS J  1 67  ? 46.600  -62.132  -77.351 1.00 21.73 ? 65  LYS D N     1 
ATOM   9290  C  CA    . LYS J  1 67  ? 47.172  -63.109  -78.301 1.00 18.11 ? 65  LYS D CA    1 
ATOM   9291  C  C     . LYS J  1 67  ? 48.702  -63.172  -78.205 1.00 20.91 ? 65  LYS D C     1 
ATOM   9292  O  O     . LYS J  1 67  ? 49.413  -62.677  -79.100 1.00 19.87 ? 65  LYS D O     1 
ATOM   9293  C  CB    . LYS J  1 67  ? 46.789  -62.777  -79.744 1.00 19.45 ? 65  LYS D CB    1 
ATOM   9294  C  CG    . LYS J  1 67  ? 45.354  -63.067  -80.120 1.00 16.36 ? 65  LYS D CG    1 
ATOM   9295  C  CD    . LYS J  1 67  ? 45.111  -64.571  -80.366 1.00 18.29 ? 65  LYS D CD    1 
ATOM   9296  C  CE    . LYS J  1 67  ? 43.621  -64.770  -80.596 1.00 17.72 ? 65  LYS D CE    1 
ATOM   9297  N  NZ    . LYS J  1 67  ? 43.287  -66.124  -81.107 1.00 17.80 ? 65  LYS D NZ    1 
ATOM   9298  N  N     . GLN J  1 68  ? 49.212  -63.776  -77.134 1.00 17.33 ? 66  GLN D N     1 
ATOM   9299  C  CA    . GLN J  1 68  ? 50.619  -64.082  -77.029 1.00 19.63 ? 66  GLN D CA    1 
ATOM   9300  C  C     . GLN J  1 68  ? 50.895  -65.499  -76.568 1.00 22.07 ? 66  GLN D C     1 
ATOM   9301  O  O     . GLN J  1 68  ? 50.015  -66.191  -76.016 1.00 17.48 ? 66  GLN D O     1 
ATOM   9302  C  CB    . GLN J  1 68  ? 51.348  -63.113  -76.118 1.00 26.32 ? 66  GLN D CB    1 
ATOM   9303  C  CG    . GLN J  1 68  ? 50.482  -62.261  -75.267 1.00 27.86 ? 66  GLN D CG    1 
ATOM   9304  C  CD    . GLN J  1 68  ? 51.322  -61.221  -74.520 1.00 33.63 ? 66  GLN D CD    1 
ATOM   9305  O  OE1   . GLN J  1 68  ? 51.558  -61.339  -73.318 1.00 37.76 ? 66  GLN D OE1   1 
ATOM   9306  N  NE2   . GLN J  1 68  ? 51.820  -60.224  -75.257 1.00 32.19 ? 66  GLN D NE2   1 
ATOM   9307  N  N     . MET J  1 69  ? 52.144  -65.890  -76.791 1.00 23.39 ? 67  MET D N     1 
ATOM   9308  C  CA    . MET J  1 69  ? 52.622  -67.250  -76.541 1.00 23.28 ? 67  MET D CA    1 
ATOM   9309  C  C     . MET J  1 69  ? 52.726  -67.620  -75.080 1.00 21.16 ? 67  MET D C     1 
ATOM   9310  O  O     . MET J  1 69  ? 52.475  -68.764  -74.740 1.00 25.16 ? 67  MET D O     1 
ATOM   9311  C  CB    . MET J  1 69  ? 53.952  -67.513  -77.240 1.00 23.90 ? 67  MET D CB    1 
ATOM   9312  C  CG    . MET J  1 69  ? 53.825  -67.542  -78.752 1.00 21.06 ? 67  MET D CG    1 
ATOM   9313  S  SD    . MET J  1 69  ? 52.834  -68.950  -79.305 1.00 21.51 ? 67  MET D SD    1 
ATOM   9314  C  CE    . MET J  1 69  ? 53.922  -70.289  -78.788 1.00 13.78 ? 67  MET D CE    1 
ATOM   9315  N  N     . GLY J  1 70  ? 53.071  -66.700  -74.190 1.00 17.55 ? 68  GLY D N     1 
ATOM   9316  C  CA    . GLY J  1 70  ? 53.256  -67.121  -72.802 1.00 18.31 ? 68  GLY D CA    1 
ATOM   9317  C  C     . GLY J  1 70  ? 54.477  -68.044  -72.703 1.00 23.53 ? 68  GLY D C     1 
ATOM   9318  O  O     . GLY J  1 70  ? 55.249  -68.129  -73.654 1.00 20.39 ? 68  GLY D O     1 
ATOM   9319  N  N     . ASP J  1 71  ? 54.686  -68.725  -71.571 1.00 19.30 ? 69  ASP D N     1 
ATOM   9320  C  CA    . ASP J  1 71  ? 55.945  -69.458  -71.346 1.00 21.13 ? 69  ASP D CA    1 
ATOM   9321  C  C     . ASP J  1 71  ? 55.863  -70.900  -71.826 1.00 19.00 ? 69  ASP D C     1 
ATOM   9322  O  O     . ASP J  1 71  ? 56.877  -71.559  -72.007 1.00 18.08 ? 69  ASP D O     1 
ATOM   9323  C  CB    . ASP J  1 71  ? 56.217  -69.543  -69.843 1.00 19.67 ? 69  ASP D CB    1 
ATOM   9324  C  CG    . ASP J  1 71  ? 56.689  -68.244  -69.261 1.00 31.52 ? 69  ASP D CG    1 
ATOM   9325  O  OD1   . ASP J  1 71  ? 56.772  -67.242  -70.024 1.00 38.38 ? 69  ASP D OD1   1 
ATOM   9326  O  OD2   . ASP J  1 71  ? 56.969  -68.232  -68.037 1.00 26.59 ? 69  ASP D OD2   1 
ATOM   9327  N  N     . PHE J  1 72  ? 54.645  -71.411  -72.000 1.00 15.30 ? 70  PHE D N     1 
ATOM   9328  C  CA    . PHE J  1 72  ? 54.537  -72.859  -72.198 1.00 14.16 ? 70  PHE D CA    1 
ATOM   9329  C  C     . PHE J  1 72  ? 55.546  -73.412  -73.211 1.00 14.33 ? 70  PHE D C     1 
ATOM   9330  O  O     . PHE J  1 72  ? 56.147  -74.474  -73.003 1.00 15.38 ? 70  PHE D O     1 
ATOM   9331  C  CB    . PHE J  1 72  ? 53.138  -73.315  -72.615 1.00 11.74 ? 70  PHE D CB    1 
ATOM   9332  C  CG    . PHE J  1 72  ? 53.084  -74.808  -72.842 1.00 13.86 ? 70  PHE D CG    1 
ATOM   9333  C  CD1   . PHE J  1 72  ? 53.138  -75.682  -71.745 1.00 14.51 ? 70  PHE D CD1   1 
ATOM   9334  C  CD2   . PHE J  1 72  ? 53.114  -75.339  -74.127 1.00 11.28 ? 70  PHE D CD2   1 
ATOM   9335  C  CE1   . PHE J  1 72  ? 53.135  -77.104  -71.932 1.00 15.34 ? 70  PHE D CE1   1 
ATOM   9336  C  CE2   . PHE J  1 72  ? 53.113  -76.734  -74.336 1.00 11.77 ? 70  PHE D CE2   1 
ATOM   9337  C  CZ    . PHE J  1 72  ? 53.137  -77.626  -73.233 1.00 10.68 ? 70  PHE D CZ    1 
ATOM   9338  N  N     . HIS J  1 73  ? 55.713  -72.714  -74.328 1.00 15.52 ? 71  HIS D N     1 
ATOM   9339  C  CA    . HIS J  1 73  ? 56.501  -73.277  -75.437 1.00 17.10 ? 71  HIS D CA    1 
ATOM   9340  C  C     . HIS J  1 73  ? 57.939  -73.530  -75.055 1.00 15.33 ? 71  HIS D C     1 
ATOM   9341  O  O     . HIS J  1 73  ? 58.612  -74.419  -75.623 1.00 20.52 ? 71  HIS D O     1 
ATOM   9342  C  CB    . HIS J  1 73  ? 56.452  -72.375  -76.669 1.00 21.06 ? 71  HIS D CB    1 
ATOM   9343  C  CG    . HIS J  1 73  ? 57.129  -71.054  -76.472 1.00 22.15 ? 71  HIS D CG    1 
ATOM   9344  N  ND1   . HIS J  1 73  ? 58.402  -70.798  -76.953 1.00 25.53 ? 71  HIS D ND1   1 
ATOM   9345  C  CD2   . HIS J  1 73  ? 56.723  -69.923  -75.841 1.00 19.12 ? 71  HIS D CD2   1 
ATOM   9346  C  CE1   . HIS J  1 73  ? 58.748  -69.561  -76.630 1.00 21.62 ? 71  HIS D CE1   1 
ATOM   9347  N  NE2   . HIS J  1 73  ? 57.747  -69.007  -75.961 1.00 24.63 ? 71  HIS D NE2   1 
ATOM   9348  N  N     . LEU J  1 74  ? 58.426  -72.785  -74.069 1.00 20.83 ? 72  LEU D N     1 
ATOM   9349  C  CA    . LEU J  1 74  ? 59.795  -72.990  -73.587 1.00 19.26 ? 72  LEU D CA    1 
ATOM   9350  C  C     . LEU J  1 74  ? 59.941  -74.376  -72.950 1.00 20.95 ? 72  LEU D C     1 
ATOM   9351  O  O     . LEU J  1 74  ? 60.991  -75.034  -73.058 1.00 20.96 ? 72  LEU D O     1 
ATOM   9352  C  CB    . LEU J  1 74  ? 60.113  -71.933  -72.540 1.00 22.23 ? 72  LEU D CB    1 
ATOM   9353  C  CG    . LEU J  1 74  ? 60.944  -70.682  -72.817 1.00 26.05 ? 72  LEU D CG    1 
ATOM   9354  C  CD1   . LEU J  1 74  ? 60.888  -70.161  -74.243 1.00 23.58 ? 72  LEU D CD1   1 
ATOM   9355  C  CD2   . LEU J  1 74  ? 60.545  -69.588  -71.813 1.00 29.00 ? 72  LEU D CD2   1 
ATOM   9356  N  N     . TYR J  1 75  ? 58.888  -74.822  -72.264 1.00 19.08 ? 73  TYR D N     1 
ATOM   9357  C  CA    . TYR J  1 75  ? 58.929  -76.139  -71.625 1.00 18.19 ? 73  TYR D CA    1 
ATOM   9358  C  C     . TYR J  1 75  ? 58.755  -77.213  -72.697 1.00 19.20 ? 73  TYR D C     1 
ATOM   9359  O  O     . TYR J  1 75  ? 59.443  -78.241  -72.708 1.00 18.52 ? 73  TYR D O     1 
ATOM   9360  C  CB    . TYR J  1 75  ? 57.830  -76.235  -70.538 1.00 12.27 ? 73  TYR D CB    1 
ATOM   9361  C  CG    . TYR J  1 75  ? 58.104  -75.279  -69.397 1.00 14.61 ? 73  TYR D CG    1 
ATOM   9362  C  CD1   . TYR J  1 75  ? 57.790  -73.937  -69.505 1.00 17.25 ? 73  TYR D CD1   1 
ATOM   9363  C  CD2   . TYR J  1 75  ? 58.713  -75.723  -68.227 1.00 17.25 ? 73  TYR D CD2   1 
ATOM   9364  C  CE1   . TYR J  1 75  ? 58.081  -73.040  -68.453 1.00 22.15 ? 73  TYR D CE1   1 
ATOM   9365  C  CE2   . TYR J  1 75  ? 58.983  -74.865  -67.181 1.00 19.48 ? 73  TYR D CE2   1 
ATOM   9366  C  CZ    . TYR J  1 75  ? 58.689  -73.513  -67.303 1.00 18.45 ? 73  TYR D CZ    1 
ATOM   9367  O  OH    . TYR J  1 75  ? 58.994  -72.646  -66.258 1.00 17.77 ? 73  TYR D OH    1 
ATOM   9368  N  N     . TYR J  1 76  ? 57.813  -76.966  -73.605 1.00 15.45 ? 74  TYR D N     1 
ATOM   9369  C  CA    . TYR J  1 76  ? 57.592  -77.845  -74.751 1.00 12.82 ? 74  TYR D CA    1 
ATOM   9370  C  C     . TYR J  1 76  ? 58.879  -78.050  -75.561 1.00 20.90 ? 74  TYR D C     1 
ATOM   9371  O  O     . TYR J  1 76  ? 59.128  -79.132  -76.104 1.00 17.85 ? 74  TYR D O     1 
ATOM   9372  C  CB    . TYR J  1 76  ? 56.489  -77.237  -75.630 1.00 17.15 ? 74  TYR D CB    1 
ATOM   9373  C  CG    . TYR J  1 76  ? 56.091  -78.106  -76.788 1.00 14.59 ? 74  TYR D CG    1 
ATOM   9374  C  CD1   . TYR J  1 76  ? 55.333  -79.251  -76.602 1.00 9.47  ? 74  TYR D CD1   1 
ATOM   9375  C  CD2   . TYR J  1 76  ? 56.485  -77.787  -78.073 1.00 19.03 ? 74  TYR D CD2   1 
ATOM   9376  C  CE1   . TYR J  1 76  ? 54.958  -80.042  -77.681 1.00 14.15 ? 74  TYR D CE1   1 
ATOM   9377  C  CE2   . TYR J  1 76  ? 56.130  -78.569  -79.148 1.00 15.98 ? 74  TYR D CE2   1 
ATOM   9378  C  CZ    . TYR J  1 76  ? 55.383  -79.693  -78.948 1.00 15.25 ? 74  TYR D CZ    1 
ATOM   9379  O  OH    . TYR J  1 76  ? 55.043  -80.443  -80.046 1.00 19.31 ? 74  TYR D OH    1 
ATOM   9380  N  N     . GLU J  1 77  ? 59.681  -76.995  -75.664 1.00 15.11 ? 75  GLU D N     1 
ATOM   9381  C  CA    . GLU J  1 77  ? 60.905  -77.044  -76.456 1.00 21.70 ? 75  GLU D CA    1 
ATOM   9382  C  C     . GLU J  1 77  ? 62.065  -77.660  -75.674 1.00 24.60 ? 75  GLU D C     1 
ATOM   9383  O  O     . GLU J  1 77  ? 63.096  -77.984  -76.245 1.00 22.87 ? 75  GLU D O     1 
ATOM   9384  C  CB    . GLU J  1 77  ? 61.311  -75.643  -76.915 1.00 23.03 ? 75  GLU D CB    1 
ATOM   9385  C  CG    . GLU J  1 77  ? 60.356  -75.038  -77.934 1.00 24.18 ? 75  GLU D CG    1 
ATOM   9386  C  CD    . GLU J  1 77  ? 60.406  -73.519  -77.893 1.00 26.05 ? 75  GLU D CD    1 
ATOM   9387  O  OE1   . GLU J  1 77  ? 59.516  -72.852  -78.471 1.00 23.95 ? 75  GLU D OE1   1 
ATOM   9388  O  OE2   . GLU J  1 77  ? 61.356  -73.001  -77.273 1.00 28.80 ? 75  GLU D OE2   1 
ATOM   9389  N  N     . GLY J  1 78  ? 61.895  -77.790  -74.361 1.00 23.51 ? 76  GLY D N     1 
ATOM   9390  C  CA    . GLY J  1 78  ? 62.933  -78.332  -73.509 1.00 20.08 ? 76  GLY D CA    1 
ATOM   9391  C  C     . GLY J  1 78  ? 63.914  -77.271  -73.031 1.00 25.08 ? 76  GLY D C     1 
ATOM   9392  O  O     . GLY J  1 78  ? 64.863  -77.598  -72.313 1.00 26.26 ? 76  GLY D O     1 
ATOM   9393  N  N     . LYS J  1 79  ? 63.692  -76.005  -73.402 1.00 25.77 ? 77  LYS D N     1 
ATOM   9394  C  CA    . LYS J  1 79  ? 64.545  -74.914  -72.916 1.00 26.27 ? 77  LYS D CA    1 
ATOM   9395  C  C     . LYS J  1 79  ? 64.385  -74.772  -71.406 1.00 33.60 ? 77  LYS D C     1 
ATOM   9396  O  O     . LYS J  1 79  ? 65.364  -74.493  -70.670 1.00 30.24 ? 77  LYS D O     1 
ATOM   9397  C  CB    . LYS J  1 79  ? 64.223  -73.584  -73.627 1.00 27.60 ? 77  LYS D CB    1 
ATOM   9398  C  CG    . LYS J  1 79  ? 64.444  -73.618  -75.168 1.00 30.35 ? 77  LYS D CG    1 
ATOM   9399  C  CD    . LYS J  1 79  ? 64.306  -72.210  -75.813 1.00 36.84 ? 77  LYS D CD    1 
ATOM   9400  C  CE    . LYS J  1 79  ? 64.379  -72.270  -77.353 1.00 38.06 ? 77  LYS D CE    1 
ATOM   9401  N  NZ    . LYS J  1 79  ? 65.652  -72.886  -77.853 1.00 48.66 ? 77  LYS D NZ    1 
ATOM   9402  N  N     . GLU J  1 80  ? 63.141  -74.941  -70.949 1.00 27.01 ? 78  GLU D N     1 
ATOM   9403  C  CA    . GLU J  1 80  ? 62.841  -74.997  -69.517 1.00 23.67 ? 78  GLU D CA    1 
ATOM   9404  C  C     . GLU J  1 80  ? 62.310  -76.371  -69.175 1.00 26.23 ? 78  GLU D C     1 
ATOM   9405  O  O     . GLU J  1 80  ? 61.802  -77.073  -70.048 1.00 22.12 ? 78  GLU D O     1 
ATOM   9406  C  CB    . GLU J  1 80  ? 61.798  -73.965  -69.128 1.00 22.70 ? 78  GLU D CB    1 
ATOM   9407  C  CG    . GLU J  1 80  ? 62.299  -72.510  -69.327 1.00 26.03 ? 78  GLU D CG    1 
ATOM   9408  C  CD    . GLU J  1 80  ? 63.280  -72.071  -68.235 1.00 31.91 ? 78  GLU D CD    1 
ATOM   9409  O  OE1   . GLU J  1 80  ? 63.521  -72.859  -67.289 1.00 27.55 ? 78  GLU D OE1   1 
ATOM   9410  O  OE2   . GLU J  1 80  ? 63.804  -70.933  -68.318 1.00 34.67 ? 78  GLU D OE2   1 
ATOM   9411  N  N     . LYS J  1 81  ? 62.428  -76.746  -67.909 1.00 22.63 ? 79  LYS D N     1 
ATOM   9412  C  CA    . LYS J  1 81  ? 61.979  -78.053  -67.442 1.00 26.60 ? 79  LYS D CA    1 
ATOM   9413  C  C     . LYS J  1 81  ? 61.201  -77.870  -66.142 1.00 23.11 ? 79  LYS D C     1 
ATOM   9414  O  O     . LYS J  1 81  ? 61.652  -77.175  -65.234 1.00 26.29 ? 79  LYS D O     1 
ATOM   9415  C  CB    . LYS J  1 81  ? 63.197  -78.954  -67.215 1.00 24.73 ? 79  LYS D CB    1 
ATOM   9416  C  CG    . LYS J  1 81  ? 62.901  -80.430  -67.091 1.00 30.23 ? 79  LYS D CG    1 
ATOM   9417  C  CD    . LYS J  1 81  ? 64.215  -81.202  -67.216 1.00 29.31 ? 79  LYS D CD    1 
ATOM   9418  C  CE    . LYS J  1 81  ? 64.027  -82.602  -67.778 1.00 37.99 ? 79  LYS D CE    1 
ATOM   9419  N  NZ    . LYS J  1 81  ? 63.678  -83.595  -66.719 1.00 26.67 ? 79  LYS D NZ    1 
ATOM   9420  N  N     . ALA J  1 82  ? 60.009  -78.449  -66.066 1.00 21.15 ? 80  ALA D N     1 
ATOM   9421  C  CA    . ALA J  1 82  ? 59.142  -78.292  -64.893 1.00 20.37 ? 80  ALA D CA    1 
ATOM   9422  C  C     . ALA J  1 82  ? 59.795  -79.013  -63.712 1.00 14.99 ? 80  ALA D C     1 
ATOM   9423  O  O     . ALA J  1 82  ? 60.058  -80.202  -63.816 1.00 17.77 ? 80  ALA D O     1 
ATOM   9424  C  CB    . ALA J  1 82  ? 57.739  -78.925  -65.182 1.00 17.27 ? 80  ALA D CB    1 
ATOM   9425  N  N     . PRO J  1 83  ? 60.008  -78.330  -62.570 1.00 19.07 ? 81  PRO D N     1 
ATOM   9426  C  CA    . PRO J  1 83  ? 60.719  -79.088  -61.530 1.00 22.37 ? 81  PRO D CA    1 
ATOM   9427  C  C     . PRO J  1 83  ? 59.824  -79.938  -60.624 1.00 25.98 ? 81  PRO D C     1 
ATOM   9428  O  O     . PRO J  1 83  ? 60.358  -80.755  -59.842 1.00 18.43 ? 81  PRO D O     1 
ATOM   9429  C  CB    . PRO J  1 83  ? 61.416  -77.996  -60.717 1.00 22.95 ? 81  PRO D CB    1 
ATOM   9430  C  CG    . PRO J  1 83  ? 60.562  -76.770  -60.892 1.00 22.99 ? 81  PRO D CG    1 
ATOM   9431  C  CD    . PRO J  1 83  ? 59.973  -76.876  -62.281 1.00 25.05 ? 81  PRO D CD    1 
ATOM   9432  N  N     . TYR J  1 84  ? 58.498  -79.790  -60.740 1.00 19.17 ? 82  TYR D N     1 
ATOM   9433  C  CA    . TYR J  1 84  ? 57.549  -80.631  -59.983 1.00 18.50 ? 82  TYR D CA    1 
ATOM   9434  C  C     . TYR J  1 84  ? 56.563  -81.218  -60.956 1.00 19.93 ? 82  TYR D C     1 
ATOM   9435  O  O     . TYR J  1 84  ? 56.195  -80.558  -61.920 1.00 18.80 ? 82  TYR D O     1 
ATOM   9436  C  CB    . TYR J  1 84  ? 56.761  -79.809  -58.956 1.00 18.62 ? 82  TYR D CB    1 
ATOM   9437  C  CG    . TYR J  1 84  ? 57.616  -78.846  -58.155 1.00 22.99 ? 82  TYR D CG    1 
ATOM   9438  C  CD1   . TYR J  1 84  ? 58.350  -79.283  -57.063 1.00 27.60 ? 82  TYR D CD1   1 
ATOM   9439  C  CD2   . TYR J  1 84  ? 57.694  -77.488  -58.505 1.00 23.98 ? 82  TYR D CD2   1 
ATOM   9440  C  CE1   . TYR J  1 84  ? 59.165  -78.398  -56.331 1.00 28.09 ? 82  TYR D CE1   1 
ATOM   9441  C  CE2   . TYR J  1 84  ? 58.483  -76.605  -57.783 1.00 24.99 ? 82  TYR D CE2   1 
ATOM   9442  C  CZ    . TYR J  1 84  ? 59.226  -77.070  -56.704 1.00 29.04 ? 82  TYR D CZ    1 
ATOM   9443  O  OH    . TYR J  1 84  ? 60.022  -76.190  -56.005 1.00 29.37 ? 82  TYR D OH    1 
ATOM   9444  N  N     . LEU J  1 85  ? 56.136  -82.448  -60.709 1.00 18.31 ? 83  LEU D N     1 
ATOM   9445  C  CA    . LEU J  1 85  ? 55.052  -83.055  -61.484 1.00 17.67 ? 83  LEU D CA    1 
ATOM   9446  C  C     . LEU J  1 85  ? 53.869  -82.139  -61.260 1.00 14.20 ? 83  LEU D C     1 
ATOM   9447  O  O     . LEU J  1 85  ? 53.550  -81.799  -60.096 1.00 14.28 ? 83  LEU D O     1 
ATOM   9448  C  CB    . LEU J  1 85  ? 54.716  -84.455  -60.942 1.00 16.52 ? 83  LEU D CB    1 
ATOM   9449  C  CG    . LEU J  1 85  ? 53.453  -85.114  -61.499 1.00 20.78 ? 83  LEU D CG    1 
ATOM   9450  C  CD1   . LEU J  1 85  ? 53.556  -85.165  -63.025 1.00 20.06 ? 83  LEU D CD1   1 
ATOM   9451  C  CD2   . LEU J  1 85  ? 53.248  -86.544  -60.905 1.00 22.16 ? 83  LEU D CD2   1 
ATOM   9452  N  N     . THR J  1 86  ? 53.282  -81.686  -62.369 1.00 17.63 ? 84  THR D N     1 
ATOM   9453  C  CA    . THR J  1 86  ? 52.127  -80.754  -62.376 1.00 17.90 ? 84  THR D CA    1 
ATOM   9454  C  C     . THR J  1 86  ? 50.929  -81.418  -63.080 1.00 14.09 ? 84  THR D C     1 
ATOM   9455  O  O     . THR J  1 86  ? 51.026  -81.836  -64.243 1.00 13.65 ? 84  THR D O     1 
ATOM   9456  C  CB    . THR J  1 86  ? 52.549  -79.467  -63.080 1.00 19.86 ? 84  THR D CB    1 
ATOM   9457  O  OG1   . THR J  1 86  ? 53.771  -79.017  -62.465 1.00 16.04 ? 84  THR D OG1   1 
ATOM   9458  C  CG2   . THR J  1 86  ? 51.476  -78.342  -62.994 1.00 11.90 ? 84  THR D CG2   1 
ATOM   9459  N  N     . LEU J  1 87  ? 49.804  -81.513  -62.371 1.00 17.94 ? 85  LEU D N     1 
ATOM   9460  C  CA    . LEU J  1 87  ? 48.583  -82.140  -62.933 1.00 15.70 ? 85  LEU D CA    1 
ATOM   9461  C  C     . LEU J  1 87  ? 47.608  -81.015  -63.209 1.00 15.08 ? 85  LEU D C     1 
ATOM   9462  O  O     . LEU J  1 87  ? 47.450  -80.121  -62.382 1.00 18.85 ? 85  LEU D O     1 
ATOM   9463  C  CB    . LEU J  1 87  ? 47.962  -83.079  -61.915 1.00 10.32 ? 85  LEU D CB    1 
ATOM   9464  C  CG    . LEU J  1 87  ? 48.881  -84.121  -61.256 1.00 14.37 ? 85  LEU D CG    1 
ATOM   9465  C  CD1   . LEU J  1 87  ? 48.119  -85.104  -60.319 1.00 14.42 ? 85  LEU D CD1   1 
ATOM   9466  C  CD2   . LEU J  1 87  ? 49.534  -84.883  -62.358 1.00 15.35 ? 85  LEU D CD2   1 
ATOM   9467  N  N     . PHE J  1 88  ? 46.939  -81.004  -64.356 1.00 12.03 ? 86  PHE D N     1 
ATOM   9468  C  CA    . PHE J  1 88  ? 46.057  -79.865  -64.577 1.00 13.74 ? 86  PHE D CA    1 
ATOM   9469  C  C     . PHE J  1 88  ? 44.797  -80.227  -65.354 1.00 11.45 ? 86  PHE D C     1 
ATOM   9470  O  O     . PHE J  1 88  ? 44.709  -81.295  -65.993 1.00 9.68  ? 86  PHE D O     1 
ATOM   9471  C  CB    . PHE J  1 88  ? 46.834  -78.742  -65.274 1.00 10.64 ? 86  PHE D CB    1 
ATOM   9472  C  CG    . PHE J  1 88  ? 47.316  -79.102  -66.663 1.00 12.85 ? 86  PHE D CG    1 
ATOM   9473  C  CD1   . PHE J  1 88  ? 48.547  -79.746  -66.837 1.00 15.36 ? 86  PHE D CD1   1 
ATOM   9474  C  CD2   . PHE J  1 88  ? 46.578  -78.768  -67.779 1.00 13.20 ? 86  PHE D CD2   1 
ATOM   9475  C  CE1   . PHE J  1 88  ? 49.008  -80.075  -68.122 1.00 15.59 ? 86  PHE D CE1   1 
ATOM   9476  C  CE2   . PHE J  1 88  ? 47.034  -79.061  -69.062 1.00 15.63 ? 86  PHE D CE2   1 
ATOM   9477  C  CZ    . PHE J  1 88  ? 48.243  -79.714  -69.248 1.00 11.75 ? 86  PHE D CZ    1 
ATOM   9478  N  N     . ILE J  1 89  ? 43.803  -79.354  -65.272 1.00 12.07 ? 87  ILE D N     1 
ATOM   9479  C  CA    . ILE J  1 89  ? 42.618  -79.463  -66.115 1.00 14.64 ? 87  ILE D CA    1 
ATOM   9480  C  C     . ILE J  1 89  ? 42.583  -78.245  -66.998 1.00 15.58 ? 87  ILE D C     1 
ATOM   9481  O  O     . ILE J  1 89  ? 43.363  -77.296  -66.810 1.00 15.09 ? 87  ILE D O     1 
ATOM   9482  C  CB    . ILE J  1 89  ? 41.306  -79.492  -65.320 1.00 15.05 ? 87  ILE D CB    1 
ATOM   9483  C  CG1   . ILE J  1 89  ? 41.259  -78.295  -64.361 1.00 14.37 ? 87  ILE D CG1   1 
ATOM   9484  C  CG2   . ILE J  1 89  ? 41.141  -80.879  -64.605 1.00 17.39 ? 87  ILE D CG2   1 
ATOM   9485  C  CD1   . ILE J  1 89  ? 39.918  -78.022  -63.751 1.00 20.93 ? 87  ILE D CD1   1 
ATOM   9486  N  N     . GLY J  1 90  ? 41.673  -78.261  -67.956 1.00 12.51 ? 88  GLY D N     1 
ATOM   9487  C  CA    . GLY J  1 90  ? 41.578  -77.153  -68.871 1.00 12.74 ? 88  GLY D CA    1 
ATOM   9488  C  C     . GLY J  1 90  ? 40.559  -76.152  -68.393 1.00 16.37 ? 88  GLY D C     1 
ATOM   9489  O  O     . GLY J  1 90  ? 39.537  -76.522  -67.775 1.00 16.30 ? 88  GLY D O     1 
ATOM   9490  N  N     . GLY J  1 91  ? 40.814  -74.883  -68.710 1.00 14.53 ? 89  GLY D N     1 
ATOM   9491  C  CA    . GLY J  1 91  ? 39.871  -73.794  -68.412 1.00 11.65 ? 89  GLY D CA    1 
ATOM   9492  C  C     . GLY J  1 91  ? 39.337  -73.161  -69.674 1.00 15.02 ? 89  GLY D C     1 
ATOM   9493  O  O     . GLY J  1 91  ? 38.971  -73.873  -70.625 1.00 12.49 ? 89  GLY D O     1 
ATOM   9494  N  N     . ASN J  1 92  ? 39.291  -71.833  -69.711 1.00 14.98 ? 90  ASN D N     1 
ATOM   9495  C  CA    . ASN J  1 92  ? 38.656  -71.200  -70.858 1.00 13.71 ? 90  ASN D CA    1 
ATOM   9496  C  C     . ASN J  1 92  ? 39.623  -70.489  -71.804 1.00 17.36 ? 90  ASN D C     1 
ATOM   9497  O  O     . ASN J  1 92  ? 39.210  -70.086  -72.898 1.00 15.19 ? 90  ASN D O     1 
ATOM   9498  C  CB    . ASN J  1 92  ? 37.564  -70.236  -70.420 1.00 18.11 ? 90  ASN D CB    1 
ATOM   9499  C  CG    . ASN J  1 92  ? 38.095  -69.194  -69.501 1.00 20.21 ? 90  ASN D CG    1 
ATOM   9500  O  OD1   . ASN J  1 92  ? 38.390  -69.483  -68.342 1.00 21.18 ? 90  ASN D OD1   1 
ATOM   9501  N  ND2   . ASN J  1 92  ? 38.275  -67.985  -70.005 1.00 23.74 ? 90  ASN D ND2   1 
ATOM   9502  N  N     . HIS J  1 93  ? 40.886  -70.374  -71.376 1.00 10.66 ? 91  HIS D N     1 
ATOM   9503  C  CA    . HIS J  1 93  ? 41.972  -69.801  -72.145 1.00 18.14 ? 91  HIS D CA    1 
ATOM   9504  C  C     . HIS J  1 93  ? 43.030  -70.895  -72.313 1.00 14.47 ? 91  HIS D C     1 
ATOM   9505  O  O     . HIS J  1 93  ? 43.908  -71.049  -71.454 1.00 14.06 ? 91  HIS D O     1 
ATOM   9506  C  CB    . HIS J  1 93  ? 42.614  -68.665  -71.355 1.00 20.71 ? 91  HIS D CB    1 
ATOM   9507  C  CG    . HIS J  1 93  ? 41.744  -67.462  -71.227 1.00 29.41 ? 91  HIS D CG    1 
ATOM   9508  N  ND1   . HIS J  1 93  ? 41.852  -66.580  -70.172 1.00 35.89 ? 91  HIS D ND1   1 
ATOM   9509  C  CD2   . HIS J  1 93  ? 40.744  -66.994  -72.012 1.00 30.52 ? 91  HIS D CD2   1 
ATOM   9510  C  CE1   . HIS J  1 93  ? 40.973  -65.612  -70.327 1.00 34.83 ? 91  HIS D CE1   1 
ATOM   9511  N  NE2   . HIS J  1 93  ? 40.276  -65.842  -71.424 1.00 32.77 ? 91  HIS D NE2   1 
ATOM   9512  N  N     . GLU J  1 94  ? 42.911  -71.645  -73.407 1.00 11.86 ? 92  GLU D N     1 
ATOM   9513  C  CA    . GLU J  1 94  ? 43.690  -72.851  -73.641 1.00 12.82 ? 92  GLU D CA    1 
ATOM   9514  C  C     . GLU J  1 94  ? 44.053  -72.904  -75.104 1.00 15.13 ? 92  GLU D C     1 
ATOM   9515  O  O     . GLU J  1 94  ? 43.360  -72.309  -75.965 1.00 14.72 ? 92  GLU D O     1 
ATOM   9516  C  CB    . GLU J  1 94  ? 42.834  -74.098  -73.308 1.00 12.56 ? 92  GLU D CB    1 
ATOM   9517  C  CG    . GLU J  1 94  ? 42.336  -74.154  -71.872 1.00 10.52 ? 92  GLU D CG    1 
ATOM   9518  C  CD    . GLU J  1 94  ? 43.471  -74.254  -70.853 1.00 13.17 ? 92  GLU D CD    1 
ATOM   9519  O  OE1   . GLU J  1 94  ? 44.632  -74.518  -71.264 1.00 18.37 ? 92  GLU D OE1   1 
ATOM   9520  O  OE2   . GLU J  1 94  ? 43.202  -74.105  -69.625 1.00 14.83 ? 92  GLU D OE2   1 
ATOM   9521  N  N     . SER J  1 95  ? 45.132  -73.629  -75.392 1.00 17.01 ? 93  SER D N     1 
ATOM   9522  C  CA    . SER J  1 95  ? 45.344  -74.099  -76.763 1.00 17.97 ? 93  SER D CA    1 
ATOM   9523  C  C     . SER J  1 95  ? 44.373  -75.275  -76.935 1.00 15.91 ? 93  SER D C     1 
ATOM   9524  O  O     . SER J  1 95  ? 44.761  -76.424  -76.760 1.00 13.22 ? 93  SER D O     1 
ATOM   9525  C  CB    . SER J  1 95  ? 46.802  -74.539  -76.977 1.00 13.99 ? 93  SER D CB    1 
ATOM   9526  O  OG    . SER J  1 95  ? 47.130  -74.646  -78.350 1.00 13.55 ? 93  SER D OG    1 
ATOM   9527  N  N     . SER J  1 96  ? 43.115  -74.996  -77.291 1.00 12.26 ? 94  SER D N     1 
ATOM   9528  C  CA    . SER J  1 96  ? 42.038  -76.013  -77.198 1.00 14.23 ? 94  SER D CA    1 
ATOM   9529  C  C     . SER J  1 96  ? 42.222  -77.173  -78.149 1.00 13.27 ? 94  SER D C     1 
ATOM   9530  O  O     . SER J  1 96  ? 41.750  -78.274  -77.877 1.00 11.07 ? 94  SER D O     1 
ATOM   9531  C  CB    . SER J  1 96  ? 40.657  -75.398  -77.431 1.00 13.44 ? 94  SER D CB    1 
ATOM   9532  O  OG    . SER J  1 96  ? 40.451  -74.378  -76.491 1.00 15.65 ? 94  SER D OG    1 
ATOM   9533  N  N     . ASN J  1 97  ? 42.907  -76.923  -79.269 1.00 18.07 ? 95  ASN D N     1 
ATOM   9534  C  CA    . ASN J  1 97  ? 43.289  -78.008  -80.179 1.00 15.02 ? 95  ASN D CA    1 
ATOM   9535  C  C     . ASN J  1 97  ? 44.191  -79.041  -79.476 1.00 14.13 ? 95  ASN D C     1 
ATOM   9536  O  O     . ASN J  1 97  ? 43.892  -80.235  -79.524 1.00 14.65 ? 95  ASN D O     1 
ATOM   9537  C  CB    . ASN J  1 97  ? 43.986  -77.500  -81.453 1.00 14.08 ? 95  ASN D CB    1 
ATOM   9538  C  CG    . ASN J  1 97  ? 45.216  -76.672  -81.144 1.00 13.93 ? 95  ASN D CG    1 
ATOM   9539  O  OD1   . ASN J  1 97  ? 45.263  -75.979  -80.099 1.00 12.95 ? 95  ASN D OD1   1 
ATOM   9540  N  ND2   . ASN J  1 97  ? 46.217  -76.708  -82.051 1.00 15.53 ? 95  ASN D ND2   1 
ATOM   9541  N  N     . VAL J  1 98  ? 45.265  -78.587  -78.810 1.00 15.66 ? 96  VAL D N     1 
ATOM   9542  C  CA    . VAL J  1 98  ? 46.090  -79.486  -77.975 1.00 13.48 ? 96  VAL D CA    1 
ATOM   9543  C  C     . VAL J  1 98  ? 45.243  -80.338  -77.022 1.00 12.11 ? 96  VAL D C     1 
ATOM   9544  O  O     . VAL J  1 98  ? 45.382  -81.555  -76.938 1.00 10.44 ? 96  VAL D O     1 
ATOM   9545  C  CB    . VAL J  1 98  ? 47.139  -78.673  -77.156 1.00 14.52 ? 96  VAL D CB    1 
ATOM   9546  C  CG1   . VAL J  1 98  ? 47.838  -79.551  -76.075 1.00 8.57  ? 96  VAL D CG1   1 
ATOM   9547  C  CG2   . VAL J  1 98  ? 48.185  -78.096  -78.097 1.00 16.11 ? 96  VAL D CG2   1 
ATOM   9548  N  N     . LEU J  1 99  ? 44.360  -79.685  -76.288 1.00 12.17 ? 97  LEU D N     1 
ATOM   9549  C  CA    . LEU J  1 99  ? 43.592  -80.379  -75.255 1.00 12.91 ? 97  LEU D CA    1 
ATOM   9550  C  C     . LEU J  1 99  ? 42.613  -81.395  -75.882 1.00 13.15 ? 97  LEU D C     1 
ATOM   9551  O  O     . LEU J  1 99  ? 42.431  -82.493  -75.353 1.00 12.31 ? 97  LEU D O     1 
ATOM   9552  C  CB    . LEU J  1 99  ? 42.873  -79.376  -74.334 1.00 11.48 ? 97  LEU D CB    1 
ATOM   9553  C  CG    . LEU J  1 99  ? 43.829  -78.433  -73.596 1.00 9.60  ? 97  LEU D CG    1 
ATOM   9554  C  CD1   . LEU J  1 99  ? 43.125  -77.580  -72.480 1.00 9.18  ? 97  LEU D CD1   1 
ATOM   9555  C  CD2   . LEU J  1 99  ? 45.005  -79.205  -73.023 1.00 11.83 ? 97  LEU D CD2   1 
ATOM   9556  N  N     . LEU J  1 100 ? 42.034  -81.081  -77.044 1.00 11.18 ? 98  LEU D N     1 
ATOM   9557  C  CA    . LEU J  1 100 ? 41.167  -82.076  -77.696 1.00 15.36 ? 98  LEU D CA    1 
ATOM   9558  C  C     . LEU J  1 100 ? 41.985  -83.329  -78.126 1.00 11.65 ? 98  LEU D C     1 
ATOM   9559  O  O     . LEU J  1 100 ? 41.554  -84.467  -77.903 1.00 10.09 ? 98  LEU D O     1 
ATOM   9560  C  CB    . LEU J  1 100 ? 40.404  -81.461  -78.885 1.00 10.22 ? 98  LEU D CB    1 
ATOM   9561  C  CG    . LEU J  1 100 ? 39.451  -82.419  -79.588 1.00 18.56 ? 98  LEU D CG    1 
ATOM   9562  C  CD1   . LEU J  1 100 ? 38.338  -82.789  -78.592 1.00 12.98 ? 98  LEU D CD1   1 
ATOM   9563  C  CD2   . LEU J  1 100 ? 38.825  -81.703  -80.826 1.00 16.34 ? 98  LEU D CD2   1 
ATOM   9564  N  N     . HIS J  1 101 ? 43.154  -83.140  -78.738 1.00 12.01 ? 99  HIS D N     1 
ATOM   9565  C  CA    . HIS J  1 101 ? 43.987  -84.322  -79.084 1.00 9.35  ? 99  HIS D CA    1 
ATOM   9566  C  C     . HIS J  1 101 ? 44.193  -85.154  -77.810 1.00 10.07 ? 99  HIS D C     1 
ATOM   9567  O  O     . HIS J  1 101 ? 44.214  -86.409  -77.843 1.00 12.22 ? 99  HIS D O     1 
ATOM   9568  C  CB    . HIS J  1 101 ? 45.379  -83.967  -79.662 1.00 12.05 ? 99  HIS D CB    1 
ATOM   9569  C  CG    . HIS J  1 101 ? 45.358  -83.248  -80.971 1.00 16.49 ? 99  HIS D CG    1 
ATOM   9570  N  ND1   . HIS J  1 101 ? 44.973  -83.842  -82.160 1.00 14.35 ? 99  HIS D ND1   1 
ATOM   9571  C  CD2   . HIS J  1 101 ? 45.721  -81.975  -81.280 1.00 16.86 ? 99  HIS D CD2   1 
ATOM   9572  C  CE1   . HIS J  1 101 ? 45.068  -82.958  -83.136 1.00 21.57 ? 99  HIS D CE1   1 
ATOM   9573  N  NE2   . HIS J  1 101 ? 45.521  -81.814  -82.633 1.00 17.89 ? 99  HIS D NE2   1 
ATOM   9574  N  N     . LEU J  1 102 ? 44.379  -84.466  -76.680 1.00 8.08  ? 100 LEU D N     1 
ATOM   9575  C  CA    . LEU J  1 102 ? 44.619  -85.153  -75.406 1.00 8.82  ? 100 LEU D CA    1 
ATOM   9576  C  C     . LEU J  1 102 ? 43.350  -85.315  -74.554 1.00 12.52 ? 100 LEU D C     1 
ATOM   9577  O  O     . LEU J  1 102 ? 43.430  -85.304  -73.326 1.00 15.49 ? 100 LEU D O     1 
ATOM   9578  C  CB    . LEU J  1 102 ? 45.710  -84.425  -74.634 1.00 10.69 ? 100 LEU D CB    1 
ATOM   9579  C  CG    . LEU J  1 102 ? 47.045  -84.344  -75.419 1.00 11.33 ? 100 LEU D CG    1 
ATOM   9580  C  CD1   . LEU J  1 102 ? 48.217  -83.698  -74.567 1.00 10.76 ? 100 LEU D CD1   1 
ATOM   9581  C  CD2   . LEU J  1 102 ? 47.437  -85.731  -75.892 1.00 12.00 ? 100 LEU D CD2   1 
ATOM   9582  N  N     . TYR J  1 103 ? 42.179  -85.459  -75.202 1.00 12.63 ? 101 TYR D N     1 
ATOM   9583  C  CA    . TYR J  1 103 ? 40.916  -85.532  -74.453 1.00 11.81 ? 101 TYR D CA    1 
ATOM   9584  C  C     . TYR J  1 103 ? 40.858  -86.727  -73.495 1.00 16.98 ? 101 TYR D C     1 
ATOM   9585  O  O     . TYR J  1 103 ? 40.105  -86.687  -72.511 1.00 11.25 ? 101 TYR D O     1 
ATOM   9586  C  CB    . TYR J  1 103 ? 39.671  -85.504  -75.383 1.00 8.36  ? 101 TYR D CB    1 
ATOM   9587  C  CG    . TYR J  1 103 ? 39.296  -86.858  -75.931 1.00 12.11 ? 101 TYR D CG    1 
ATOM   9588  C  CD1   . TYR J  1 103 ? 39.921  -87.371  -77.068 1.00 11.73 ? 101 TYR D CD1   1 
ATOM   9589  C  CD2   . TYR J  1 103 ? 38.303  -87.635  -75.308 1.00 15.33 ? 101 TYR D CD2   1 
ATOM   9590  C  CE1   . TYR J  1 103 ? 39.579  -88.655  -77.568 1.00 13.16 ? 101 TYR D CE1   1 
ATOM   9591  C  CE2   . TYR J  1 103 ? 37.933  -88.894  -75.810 1.00 13.61 ? 101 TYR D CE2   1 
ATOM   9592  C  CZ    . TYR J  1 103 ? 38.583  -89.404  -76.915 1.00 14.36 ? 101 TYR D CZ    1 
ATOM   9593  O  OH    . TYR J  1 103 ? 38.190  -90.643  -77.390 1.00 15.84 ? 101 TYR D OH    1 
ATOM   9594  N  N     . ASN J  1 104 ? 41.617  -87.786  -73.806 1.00 11.38 ? 102 ASN D N     1 
ATOM   9595  C  CA    . ASN J  1 104 ? 41.800  -88.893  -72.856 1.00 11.37 ? 102 ASN D CA    1 
ATOM   9596  C  C     . ASN J  1 104 ? 43.037  -88.668  -71.965 1.00 15.79 ? 102 ASN D C     1 
ATOM   9597  O  O     . ASN J  1 104 ? 43.631  -89.632  -71.470 1.00 17.07 ? 102 ASN D O     1 
ATOM   9598  C  CB    . ASN J  1 104 ? 41.926  -90.241  -73.583 1.00 14.00 ? 102 ASN D CB    1 
ATOM   9599  C  CG    . ASN J  1 104 ? 40.579  -90.785  -74.050 1.00 21.11 ? 102 ASN D CG    1 
ATOM   9600  O  OD1   . ASN J  1 104 ? 39.580  -90.616  -73.360 1.00 22.34 ? 102 ASN D OD1   1 
ATOM   9601  N  ND2   . ASN J  1 104 ? 40.544  -91.403  -75.245 1.00 15.79 ? 102 ASN D ND2   1 
ATOM   9602  N  N     . GLY J  1 105 ? 43.432  -87.403  -71.764 1.00 15.58 ? 103 GLY D N     1 
ATOM   9603  C  CA    . GLY J  1 105 ? 44.576  -87.071  -70.906 1.00 10.37 ? 103 GLY D CA    1 
ATOM   9604  C  C     . GLY J  1 105 ? 45.923  -87.244  -71.626 1.00 14.98 ? 103 GLY D C     1 
ATOM   9605  O  O     . GLY J  1 105 ? 46.002  -87.838  -72.707 1.00 11.66 ? 103 GLY D O     1 
ATOM   9606  N  N     . GLY J  1 106 ? 46.995  -86.698  -71.063 1.00 12.92 ? 104 GLY D N     1 
ATOM   9607  C  CA    . GLY J  1 106 ? 48.306  -86.894  -71.676 1.00 13.33 ? 104 GLY D CA    1 
ATOM   9608  C  C     . GLY J  1 106 ? 49.286  -85.851  -71.187 1.00 12.57 ? 104 GLY D C     1 
ATOM   9609  O  O     . GLY J  1 106 ? 48.857  -84.764  -70.718 1.00 12.19 ? 104 GLY D O     1 
ATOM   9610  N  N     . PHE J  1 107 ? 50.587  -86.167  -71.243 1.00 18.77 ? 105 PHE D N     1 
ATOM   9611  C  CA    . PHE J  1 107 ? 51.599  -85.169  -70.910 1.00 14.19 ? 105 PHE D CA    1 
ATOM   9612  C  C     . PHE J  1 107 ? 51.705  -84.193  -72.075 1.00 11.27 ? 105 PHE D C     1 
ATOM   9613  O  O     . PHE J  1 107 ? 51.913  -84.594  -73.229 1.00 10.49 ? 105 PHE D O     1 
ATOM   9614  C  CB    . PHE J  1 107 ? 52.978  -85.804  -70.687 1.00 12.98 ? 105 PHE D CB    1 
ATOM   9615  C  CG    . PHE J  1 107 ? 53.124  -86.449  -69.348 1.00 13.89 ? 105 PHE D CG    1 
ATOM   9616  C  CD1   . PHE J  1 107 ? 53.504  -85.698  -68.231 1.00 10.94 ? 105 PHE D CD1   1 
ATOM   9617  C  CD2   . PHE J  1 107 ? 52.790  -87.802  -69.182 1.00 13.84 ? 105 PHE D CD2   1 
ATOM   9618  C  CE1   . PHE J  1 107 ? 53.583  -86.303  -66.956 1.00 16.51 ? 105 PHE D CE1   1 
ATOM   9619  C  CE2   . PHE J  1 107 ? 52.869  -88.415  -67.921 1.00 15.35 ? 105 PHE D CE2   1 
ATOM   9620  C  CZ    . PHE J  1 107 ? 53.271  -87.679  -66.812 1.00 17.59 ? 105 PHE D CZ    1 
ATOM   9621  N  N     . VAL J  1 108 ? 51.626  -82.906  -71.770 1.00 10.82 ? 106 VAL D N     1 
ATOM   9622  C  CA    . VAL J  1 108 ? 51.827  -81.906  -72.825 1.00 11.15 ? 106 VAL D CA    1 
ATOM   9623  C  C     . VAL J  1 108 ? 53.328  -81.618  -72.921 1.00 13.95 ? 106 VAL D C     1 
ATOM   9624  O  O     . VAL J  1 108 ? 53.823  -81.178  -73.966 1.00 10.32 ? 106 VAL D O     1 
ATOM   9625  C  CB    . VAL J  1 108 ? 51.016  -80.637  -72.556 1.00 8.40  ? 106 VAL D CB    1 
ATOM   9626  C  CG1   . VAL J  1 108 ? 49.537  -80.949  -72.708 1.00 14.58 ? 106 VAL D CG1   1 
ATOM   9627  C  CG2   . VAL J  1 108 ? 51.333  -80.106  -71.153 1.00 10.39 ? 106 VAL D CG2   1 
ATOM   9628  N  N     . CYS J  1 109 ? 54.056  -81.902  -71.838 1.00 12.85 ? 107 CYS D N     1 
ATOM   9629  C  CA    . CYS J  1 109 ? 55.496  -81.869  -71.878 1.00 15.11 ? 107 CYS D CA    1 
ATOM   9630  C  C     . CYS J  1 109 ? 55.971  -82.517  -70.581 1.00 19.96 ? 107 CYS D C     1 
ATOM   9631  O  O     . CYS J  1 109 ? 55.147  -82.917  -69.740 1.00 14.52 ? 107 CYS D O     1 
ATOM   9632  C  CB    . CYS J  1 109 ? 56.010  -80.423  -72.021 1.00 15.14 ? 107 CYS D CB    1 
ATOM   9633  S  SG    . CYS J  1 109 ? 55.571  -79.342  -70.635 1.00 15.33 ? 107 CYS D SG    1 
ATOM   9634  N  N     . PHE J  1 110 ? 57.288  -82.643  -70.427 1.00 14.14 ? 108 PHE D N     1 
ATOM   9635  C  CA    . PHE J  1 110 ? 57.819  -83.310  -69.243 1.00 18.20 ? 108 PHE D CA    1 
ATOM   9636  C  C     . PHE J  1 110 ? 57.239  -82.735  -67.958 1.00 14.62 ? 108 PHE D C     1 
ATOM   9637  O  O     . PHE J  1 110 ? 57.197  -81.497  -67.754 1.00 15.12 ? 108 PHE D O     1 
ATOM   9638  C  CB    . PHE J  1 110 ? 59.354  -83.281  -69.210 1.00 22.64 ? 108 PHE D CB    1 
ATOM   9639  C  CG    . PHE J  1 110 ? 59.939  -84.148  -68.115 1.00 22.84 ? 108 PHE D CG    1 
ATOM   9640  C  CD1   . PHE J  1 110 ? 60.101  -85.511  -68.307 1.00 26.57 ? 108 PHE D CD1   1 
ATOM   9641  C  CD2   . PHE J  1 110 ? 60.284  -83.599  -66.894 1.00 26.05 ? 108 PHE D CD2   1 
ATOM   9642  C  CE1   . PHE J  1 110 ? 60.613  -86.298  -67.322 1.00 28.94 ? 108 PHE D CE1   1 
ATOM   9643  C  CE2   . PHE J  1 110 ? 60.795  -84.400  -65.885 1.00 22.22 ? 108 PHE D CE2   1 
ATOM   9644  C  CZ    . PHE J  1 110 ? 60.959  -85.742  -66.106 1.00 23.23 ? 108 PHE D CZ    1 
ATOM   9645  N  N     . ASN J  1 111 ? 56.780  -83.622  -67.081 1.00 16.19 ? 109 ASN D N     1 
ATOM   9646  C  CA    . ASN J  1 111 ? 56.246  -83.225  -65.771 1.00 20.58 ? 109 ASN D CA    1 
ATOM   9647  C  C     . ASN J  1 111 ? 54.947  -82.423  -65.811 1.00 15.30 ? 109 ASN D C     1 
ATOM   9648  O  O     . ASN J  1 111 ? 54.527  -81.871  -64.780 1.00 18.34 ? 109 ASN D O     1 
ATOM   9649  C  CB    . ASN J  1 111 ? 57.297  -82.450  -64.939 1.00 15.89 ? 109 ASN D CB    1 
ATOM   9650  C  CG    . ASN J  1 111 ? 57.925  -83.297  -63.856 1.00 15.46 ? 109 ASN D CG    1 
ATOM   9651  O  OD1   . ASN J  1 111 ? 57.520  -84.421  -63.639 1.00 16.40 ? 109 ASN D OD1   1 
ATOM   9652  N  ND2   . ASN J  1 111 ? 58.922  -82.757  -63.170 1.00 18.90 ? 109 ASN D ND2   1 
ATOM   9653  N  N     . MET J  1 112 ? 54.325  -82.320  -66.981 1.00 15.44 ? 110 MET D N     1 
ATOM   9654  C  CA    . MET J  1 112 ? 53.004  -81.660  -67.027 1.00 13.32 ? 110 MET D CA    1 
ATOM   9655  C  C     . MET J  1 112 ? 51.923  -82.570  -67.603 1.00 16.96 ? 110 MET D C     1 
ATOM   9656  O  O     . MET J  1 112 ? 51.928  -82.889  -68.788 1.00 14.34 ? 110 MET D O     1 
ATOM   9657  C  CB    . MET J  1 112 ? 53.048  -80.346  -67.805 1.00 12.41 ? 110 MET D CB    1 
ATOM   9658  C  CG    . MET J  1 112 ? 53.996  -79.295  -67.224 1.00 11.89 ? 110 MET D CG    1 
ATOM   9659  S  SD    . MET J  1 112 ? 53.780  -77.645  -67.956 1.00 19.41 ? 110 MET D SD    1 
ATOM   9660  C  CE    . MET J  1 112 ? 55.355  -76.949  -67.465 1.00 20.15 ? 110 MET D CE    1 
ATOM   9661  N  N     . TYR J  1 113 ? 50.976  -82.975  -66.769 1.00 13.32 ? 111 TYR D N     1 
ATOM   9662  C  CA    . TYR J  1 113 ? 50.035  -84.000  -67.237 1.00 13.72 ? 111 TYR D CA    1 
ATOM   9663  C  C     . TYR J  1 113 ? 48.641  -83.434  -67.202 1.00 12.54 ? 111 TYR D C     1 
ATOM   9664  O  O     . TYR J  1 113 ? 48.214  -82.968  -66.139 1.00 11.33 ? 111 TYR D O     1 
ATOM   9665  C  CB    . TYR J  1 113 ? 50.099  -85.260  -66.342 1.00 11.81 ? 111 TYR D CB    1 
ATOM   9666  C  CG    . TYR J  1 113 ? 49.029  -86.285  -66.736 1.00 13.17 ? 111 TYR D CG    1 
ATOM   9667  C  CD1   . TYR J  1 113 ? 49.218  -87.101  -67.840 1.00 12.41 ? 111 TYR D CD1   1 
ATOM   9668  C  CD2   . TYR J  1 113 ? 47.823  -86.393  -66.030 1.00 14.83 ? 111 TYR D CD2   1 
ATOM   9669  C  CE1   . TYR J  1 113 ? 48.231  -88.028  -68.256 1.00 12.49 ? 111 TYR D CE1   1 
ATOM   9670  C  CE2   . TYR J  1 113 ? 46.818  -87.334  -66.419 1.00 14.83 ? 111 TYR D CE2   1 
ATOM   9671  C  CZ    . TYR J  1 113 ? 47.038  -88.134  -67.530 1.00 15.87 ? 111 TYR D CZ    1 
ATOM   9672  O  OH    . TYR J  1 113 ? 46.086  -89.047  -67.945 1.00 15.37 ? 111 TYR D OH    1 
ATOM   9673  N  N     . TYR J  1 114 ? 47.949  -83.443  -68.352 1.00 13.96 ? 112 TYR D N     1 
ATOM   9674  C  CA    . TYR J  1 114 ? 46.547  -82.985  -68.467 1.00 11.32 ? 112 TYR D CA    1 
ATOM   9675  C  C     . TYR J  1 114 ? 45.659  -84.165  -68.204 1.00 9.95  ? 112 TYR D C     1 
ATOM   9676  O  O     . TYR J  1 114 ? 45.823  -85.231  -68.824 1.00 13.43 ? 112 TYR D O     1 
ATOM   9677  C  CB    . TYR J  1 114 ? 46.300  -82.466  -69.899 1.00 10.89 ? 112 TYR D CB    1 
ATOM   9678  C  CG    . TYR J  1 114 ? 44.875  -82.046  -70.288 1.00 14.84 ? 112 TYR D CG    1 
ATOM   9679  C  CD1   . TYR J  1 114 ? 44.165  -81.084  -69.565 1.00 9.56  ? 112 TYR D CD1   1 
ATOM   9680  C  CD2   . TYR J  1 114 ? 44.272  -82.597  -71.422 1.00 10.17 ? 112 TYR D CD2   1 
ATOM   9681  C  CE1   . TYR J  1 114 ? 42.859  -80.692  -69.983 1.00 12.16 ? 112 TYR D CE1   1 
ATOM   9682  C  CE2   . TYR J  1 114 ? 43.014  -82.232  -71.845 1.00 11.02 ? 112 TYR D CE2   1 
ATOM   9683  C  CZ    . TYR J  1 114 ? 42.290  -81.280  -71.116 1.00 11.21 ? 112 TYR D CZ    1 
ATOM   9684  O  OH    . TYR J  1 114 ? 41.024  -80.930  -71.565 1.00 16.15 ? 112 TYR D OH    1 
ATOM   9685  N  N     . LEU J  1 115 ? 44.684  -83.989  -67.313 1.00 15.49 ? 113 LEU D N     1 
ATOM   9686  C  CA    . LEU J  1 115 ? 43.726  -85.061  -66.997 1.00 13.00 ? 113 LEU D CA    1 
ATOM   9687  C  C     . LEU J  1 115 ? 42.672  -85.317  -68.054 1.00 16.80 ? 113 LEU D C     1 
ATOM   9688  O  O     . LEU J  1 115 ? 41.843  -86.234  -67.899 1.00 14.21 ? 113 LEU D O     1 
ATOM   9689  C  CB    . LEU J  1 115 ? 43.043  -84.807  -65.657 1.00 13.82 ? 113 LEU D CB    1 
ATOM   9690  C  CG    . LEU J  1 115 ? 43.825  -85.286  -64.445 1.00 15.99 ? 113 LEU D CG    1 
ATOM   9691  C  CD1   . LEU J  1 115 ? 45.036  -84.425  -64.273 1.00 12.61 ? 113 LEU D CD1   1 
ATOM   9692  C  CD2   . LEU J  1 115 ? 42.921  -85.252  -63.187 1.00 17.81 ? 113 LEU D CD2   1 
ATOM   9693  N  N     . GLY J  1 116 ? 42.700  -84.546  -69.147 1.00 13.88 ? 114 GLY D N     1 
ATOM   9694  C  CA    . GLY J  1 116 ? 41.691  -84.683  -70.195 1.00 11.76 ? 114 GLY D CA    1 
ATOM   9695  C  C     . GLY J  1 116 ? 40.365  -83.943  -69.987 1.00 13.87 ? 114 GLY D C     1 
ATOM   9696  O  O     . GLY J  1 116 ? 40.262  -83.053  -69.156 1.00 16.46 ? 114 GLY D O     1 
ATOM   9697  N  N     . VAL J  1 117 ? 39.362  -84.270  -70.803 1.00 15.70 ? 115 VAL D N     1 
ATOM   9698  C  CA    . VAL J  1 117 ? 38.004  -83.716  -70.648 1.00 17.98 ? 115 VAL D CA    1 
ATOM   9699  C  C     . VAL J  1 117 ? 37.563  -83.951  -69.211 1.00 15.15 ? 115 VAL D C     1 
ATOM   9700  O  O     . VAL J  1 117 ? 37.055  -83.048  -68.539 1.00 13.80 ? 115 VAL D O     1 
ATOM   9701  C  CB    . VAL J  1 117 ? 37.013  -84.371  -71.692 1.00 15.97 ? 115 VAL D CB    1 
ATOM   9702  C  CG1   . VAL J  1 117 ? 35.549  -84.075  -71.365 1.00 19.06 ? 115 VAL D CG1   1 
ATOM   9703  C  CG2   . VAL J  1 117 ? 37.299  -83.825  -73.063 1.00 16.16 ? 115 VAL D CG2   1 
ATOM   9704  N  N     . CYS J  1 118 ? 37.742  -85.185  -68.749 1.00 12.62 ? 116 CYS D N     1 
ATOM   9705  C  CA    . CYS J  1 118 ? 37.626  -85.503  -67.336 1.00 15.79 ? 116 CYS D CA    1 
ATOM   9706  C  C     . CYS J  1 118 ? 38.308  -86.840  -67.127 1.00 10.87 ? 116 CYS D C     1 
ATOM   9707  O  O     . CYS J  1 118 ? 38.461  -87.612  -68.073 1.00 13.77 ? 116 CYS D O     1 
ATOM   9708  C  CB    . CYS J  1 118 ? 36.154  -85.643  -66.925 1.00 13.91 ? 116 CYS D CB    1 
ATOM   9709  S  SG    . CYS J  1 118 ? 35.217  -86.894  -67.893 1.00 17.41 ? 116 CYS D SG    1 
ATOM   9710  N  N     . SER J  1 119 ? 38.688  -87.101  -65.885 1.00 12.74 ? 117 SER D N     1 
ATOM   9711  C  CA    . SER J  1 119 ? 39.091  -88.434  -65.477 1.00 18.39 ? 117 SER D CA    1 
ATOM   9712  C  C     . SER J  1 119 ? 39.355  -88.453  -64.000 1.00 19.38 ? 117 SER D C     1 
ATOM   9713  O  O     . SER J  1 119 ? 39.204  -87.427  -63.300 1.00 13.66 ? 117 SER D O     1 
ATOM   9714  C  CB    . SER J  1 119 ? 40.343  -88.879  -66.271 1.00 15.99 ? 117 SER D CB    1 
ATOM   9715  O  OG    . SER J  1 119 ? 41.463  -88.092  -65.887 1.00 16.16 ? 117 SER D OG    1 
ATOM   9716  N  N     . CYS J  1 120 ? 39.790  -89.619  -63.528 1.00 16.34 ? 118 CYS D N     1 
ATOM   9717  C  CA    . CYS J  1 120 ? 40.270  -89.752  -62.151 1.00 14.66 ? 118 CYS D CA    1 
ATOM   9718  C  C     . CYS J  1 120 ? 41.678  -90.308  -62.223 1.00 12.82 ? 118 CYS D C     1 
ATOM   9719  O  O     . CYS J  1 120 ? 41.902  -91.197  -63.013 1.00 15.87 ? 118 CYS D O     1 
ATOM   9720  C  CB    . CYS J  1 120 ? 39.402  -90.749  -61.361 1.00 16.67 ? 118 CYS D CB    1 
ATOM   9721  S  SG    . CYS J  1 120 ? 39.885  -90.843  -59.617 1.00 16.80 ? 118 CYS D SG    1 
ATOM   9722  N  N     . ILE J  1 121 ? 42.625  -89.787  -61.442 1.00 13.58 ? 119 ILE D N     1 
ATOM   9723  C  CA    . ILE J  1 121 ? 43.978  -90.369  -61.383 1.00 14.40 ? 119 ILE D CA    1 
ATOM   9724  C  C     . ILE J  1 121 ? 44.333  -90.853  -59.974 1.00 17.72 ? 119 ILE D C     1 
ATOM   9725  O  O     . ILE J  1 121 ? 43.675  -90.478  -59.010 1.00 16.09 ? 119 ILE D O     1 
ATOM   9726  C  CB    . ILE J  1 121 ? 45.127  -89.394  -61.901 1.00 16.85 ? 119 ILE D CB    1 
ATOM   9727  C  CG1   . ILE J  1 121 ? 45.259  -88.124  -61.056 1.00 12.94 ? 119 ILE D CG1   1 
ATOM   9728  C  CG2   . ILE J  1 121 ? 44.950  -89.071  -63.372 1.00 12.38 ? 119 ILE D CG2   1 
ATOM   9729  C  CD1   . ILE J  1 121 ? 45.884  -88.326  -59.661 1.00 16.74 ? 119 ILE D CD1   1 
ATOM   9730  N  N     . ASN J  1 122 ? 45.401  -91.641  -59.849 1.00 17.30 ? 120 ASN D N     1 
ATOM   9731  C  CA    . ASN J  1 122 ? 45.876  -92.009  -58.516 1.00 17.55 ? 120 ASN D CA    1 
ATOM   9732  C  C     . ASN J  1 122 ? 47.300  -91.497  -58.293 1.00 20.34 ? 120 ASN D C     1 
ATOM   9733  O  O     . ASN J  1 122 ? 48.192  -91.762  -59.113 1.00 20.51 ? 120 ASN D O     1 
ATOM   9734  C  CB    . ASN J  1 122 ? 45.883  -93.541  -58.305 1.00 17.57 ? 120 ASN D CB    1 
ATOM   9735  C  CG    . ASN J  1 122 ? 44.469  -94.189  -58.368 1.00 21.97 ? 120 ASN D CG    1 
ATOM   9736  O  OD1   . ASN J  1 122 ? 43.442  -93.514  -58.364 1.00 20.03 ? 120 ASN D OD1   1 
ATOM   9737  N  ND2   . ASN J  1 122 ? 44.446  -95.513  -58.411 1.00 18.16 ? 120 ASN D ND2   1 
ATOM   9738  N  N     . ILE J  1 123 ? 47.516  -90.811  -57.169 1.00 21.38 ? 121 ILE D N     1 
ATOM   9739  C  CA    . ILE J  1 123 ? 48.881  -90.508  -56.743 1.00 20.69 ? 121 ILE D CA    1 
ATOM   9740  C  C     . ILE J  1 123 ? 49.000  -90.480  -55.222 1.00 21.91 ? 121 ILE D C     1 
ATOM   9741  O  O     . ILE J  1 123 ? 48.156  -89.878  -54.526 1.00 20.99 ? 121 ILE D O     1 
ATOM   9742  C  CB    . ILE J  1 123 ? 49.388  -89.169  -57.351 1.00 23.01 ? 121 ILE D CB    1 
ATOM   9743  C  CG1   . ILE J  1 123 ? 50.866  -88.936  -56.975 1.00 20.21 ? 121 ILE D CG1   1 
ATOM   9744  C  CG2   . ILE J  1 123 ? 48.516  -87.972  -56.894 1.00 19.63 ? 121 ILE D CG2   1 
ATOM   9745  C  CD1   . ILE J  1 123 ? 51.521  -87.817  -57.786 1.00 25.24 ? 121 ILE D CD1   1 
ATOM   9746  N  N     . ASN J  1 124 ? 50.064  -91.102  -54.708 1.00 23.59 ? 122 ASN D N     1 
ATOM   9747  C  CA    . ASN J  1 124 ? 50.351  -91.098  -53.259 1.00 26.02 ? 122 ASN D CA    1 
ATOM   9748  C  C     . ASN J  1 124 ? 49.149  -91.511  -52.412 1.00 24.22 ? 122 ASN D C     1 
ATOM   9749  O  O     . ASN J  1 124 ? 48.896  -90.927  -51.367 1.00 23.44 ? 122 ASN D O     1 
ATOM   9750  C  CB    . ASN J  1 124 ? 50.831  -89.714  -52.789 1.00 24.04 ? 122 ASN D CB    1 
ATOM   9751  C  CG    . ASN J  1 124 ? 52.205  -89.349  -53.299 1.00 23.62 ? 122 ASN D CG    1 
ATOM   9752  O  OD1   . ASN J  1 124 ? 52.961  -90.190  -53.806 1.00 28.80 ? 122 ASN D OD1   1 
ATOM   9753  N  ND2   . ASN J  1 124 ? 52.560  -88.084  -53.118 1.00 21.97 ? 122 ASN D ND2   1 
ATOM   9754  N  N     . GLY J  1 125 ? 48.392  -92.490  -52.883 1.00 25.99 ? 123 GLY D N     1 
ATOM   9755  C  CA    . GLY J  1 125 ? 47.244  -92.978  -52.141 1.00 28.02 ? 123 GLY D CA    1 
ATOM   9756  C  C     . GLY J  1 125 ? 46.011  -92.107  -52.265 1.00 29.06 ? 123 GLY D C     1 
ATOM   9757  O  O     . GLY J  1 125 ? 44.986  -92.395  -51.663 1.00 24.45 ? 123 GLY D O     1 
ATOM   9758  N  N     . LEU J  1 126 ? 46.107  -91.025  -53.030 1.00 20.47 ? 124 LEU D N     1 
ATOM   9759  C  CA    . LEU J  1 126 ? 44.965  -90.136  -53.199 1.00 17.04 ? 124 LEU D CA    1 
ATOM   9760  C  C     . LEU J  1 126 ? 44.198  -90.446  -54.497 1.00 14.10 ? 124 LEU D C     1 
ATOM   9761  O  O     . LEU J  1 126 ? 44.802  -90.782  -55.497 1.00 18.68 ? 124 LEU D O     1 
ATOM   9762  C  CB    . LEU J  1 126 ? 45.480  -88.709  -53.295 1.00 22.45 ? 124 LEU D CB    1 
ATOM   9763  C  CG    . LEU J  1 126 ? 46.163  -88.119  -52.066 1.00 25.34 ? 124 LEU D CG    1 
ATOM   9764  C  CD1   . LEU J  1 126 ? 46.706  -86.744  -52.455 1.00 22.48 ? 124 LEU D CD1   1 
ATOM   9765  C  CD2   . LEU J  1 126 ? 45.158  -87.978  -50.911 1.00 21.02 ? 124 LEU D CD2   1 
ATOM   9766  N  N     . ARG J  1 127 ? 42.882  -90.291  -54.512 1.00 18.57 ? 125 ARG D N     1 
ATOM   9767  C  CA    . ARG J  1 127 ? 42.186  -90.322  -55.784 1.00 17.44 ? 125 ARG D CA    1 
ATOM   9768  C  C     . ARG J  1 127 ? 41.767  -88.907  -56.183 1.00 18.39 ? 125 ARG D C     1 
ATOM   9769  O  O     . ARG J  1 127 ? 41.057  -88.223  -55.442 1.00 16.66 ? 125 ARG D O     1 
ATOM   9770  C  CB    . ARG J  1 127 ? 40.976  -91.268  -55.738 1.00 16.82 ? 125 ARG D CB    1 
ATOM   9771  C  CG    . ARG J  1 127 ? 41.304  -92.760  -55.373 1.00 19.17 ? 125 ARG D CG    1 
ATOM   9772  C  CD    . ARG J  1 127 ? 39.997  -93.566  -55.250 1.00 20.69 ? 125 ARG D CD    1 
ATOM   9773  N  NE    . ARG J  1 127 ? 39.341  -93.786  -56.556 1.00 18.72 ? 125 ARG D NE    1 
ATOM   9774  C  CZ    . ARG J  1 127 ? 38.027  -93.921  -56.753 1.00 24.48 ? 125 ARG D CZ    1 
ATOM   9775  N  NH1   . ARG J  1 127 ? 37.190  -93.808  -55.725 1.00 16.06 ? 125 ARG D NH1   1 
ATOM   9776  N  NH2   . ARG J  1 127 ? 37.547  -94.129  -57.992 1.00 20.75 ? 125 ARG D NH2   1 
ATOM   9777  N  N     . ILE J  1 128 ? 42.153  -88.492  -57.380 1.00 16.24 ? 126 ILE D N     1 
ATOM   9778  C  CA    . ILE J  1 128 ? 41.896  -87.113  -57.799 1.00 16.54 ? 126 ILE D CA    1 
ATOM   9779  C  C     . ILE J  1 128 ? 41.113  -87.097  -59.103 1.00 16.69 ? 126 ILE D C     1 
ATOM   9780  O  O     . ILE J  1 128 ? 41.493  -87.770  -60.074 1.00 15.30 ? 126 ILE D O     1 
ATOM   9781  C  CB    . ILE J  1 128 ? 43.184  -86.346  -58.017 1.00 13.03 ? 126 ILE D CB    1 
ATOM   9782  C  CG1   . ILE J  1 128 ? 44.020  -86.360  -56.733 1.00 20.45 ? 126 ILE D CG1   1 
ATOM   9783  C  CG2   . ILE J  1 128 ? 42.863  -84.870  -58.443 1.00 14.09 ? 126 ILE D CG2   1 
ATOM   9784  C  CD1   . ILE J  1 128 ? 45.383  -85.535  -56.825 1.00 12.54 ? 126 ILE D CD1   1 
ATOM   9785  N  N     . VAL J  1 129 ? 40.022  -86.326  -59.125 1.00 11.44 ? 127 VAL D N     1 
ATOM   9786  C  CA    . VAL J  1 129 ? 39.214  -86.210  -60.328 1.00 14.38 ? 127 VAL D CA    1 
ATOM   9787  C  C     . VAL J  1 129 ? 39.413  -84.816  -60.933 1.00 18.75 ? 127 VAL D C     1 
ATOM   9788  O  O     . VAL J  1 129 ? 39.564  -83.838  -60.184 1.00 15.50 ? 127 VAL D O     1 
ATOM   9789  C  CB    . VAL J  1 129 ? 37.692  -86.391  -59.967 1.00 15.80 ? 127 VAL D CB    1 
ATOM   9790  C  CG1   . VAL J  1 129 ? 36.768  -85.829  -61.070 1.00 17.23 ? 127 VAL D CG1   1 
ATOM   9791  C  CG2   . VAL J  1 129 ? 37.365  -87.865  -59.725 1.00 15.11 ? 127 VAL D CG2   1 
ATOM   9792  N  N     . GLY J  1 130 ? 39.362  -84.702  -62.263 1.00 15.73 ? 128 GLY D N     1 
ATOM   9793  C  CA    . GLY J  1 130 ? 39.431  -83.380  -62.889 1.00 14.99 ? 128 GLY D CA    1 
ATOM   9794  C  C     . GLY J  1 130 ? 38.267  -83.160  -63.828 1.00 9.72  ? 128 GLY D C     1 
ATOM   9795  O  O     . GLY J  1 130 ? 37.843  -84.106  -64.484 1.00 15.43 ? 128 GLY D O     1 
ATOM   9796  N  N     . VAL J  1 131 ? 37.697  -81.953  -63.876 1.00 14.10 ? 129 VAL D N     1 
ATOM   9797  C  CA    . VAL J  1 131 ? 36.627  -81.654  -64.849 1.00 12.78 ? 129 VAL D CA    1 
ATOM   9798  C  C     . VAL J  1 131 ? 36.974  -80.374  -65.635 1.00 17.34 ? 129 VAL D C     1 
ATOM   9799  O  O     . VAL J  1 131 ? 37.006  -79.286  -65.036 1.00 17.33 ? 129 VAL D O     1 
ATOM   9800  C  CB    . VAL J  1 131 ? 35.251  -81.431  -64.184 1.00 20.09 ? 129 VAL D CB    1 
ATOM   9801  C  CG1   . VAL J  1 131 ? 34.189  -81.340  -65.269 1.00 14.27 ? 129 VAL D CG1   1 
ATOM   9802  C  CG2   . VAL J  1 131 ? 34.908  -82.554  -63.173 1.00 17.30 ? 129 VAL D CG2   1 
ATOM   9803  N  N     . SER J  1 132 ? 37.255  -80.485  -66.944 1.00 13.13 ? 130 SER D N     1 
ATOM   9804  C  CA    . SER J  1 132 ? 37.807  -79.321  -67.662 1.00 13.88 ? 130 SER D CA    1 
ATOM   9805  C  C     . SER J  1 132 ? 36.685  -78.422  -68.174 1.00 13.69 ? 130 SER D C     1 
ATOM   9806  O  O     . SER J  1 132 ? 35.525  -78.870  -68.320 1.00 11.87 ? 130 SER D O     1 
ATOM   9807  C  CB    . SER J  1 132 ? 38.710  -79.730  -68.829 1.00 12.68 ? 130 SER D CB    1 
ATOM   9808  O  OG    . SER J  1 132 ? 39.812  -80.515  -68.365 1.00 9.93  ? 130 SER D OG    1 
ATOM   9809  N  N     . GLY J  1 133 ? 37.033  -77.168  -68.481 1.00 13.76 ? 131 GLY D N     1 
ATOM   9810  C  CA    . GLY J  1 133 ? 36.119  -76.285  -69.212 1.00 16.27 ? 131 GLY D CA    1 
ATOM   9811  C  C     . GLY J  1 133 ? 35.311  -75.346  -68.330 1.00 17.27 ? 131 GLY D C     1 
ATOM   9812  O  O     . GLY J  1 133 ? 35.458  -75.351  -67.101 1.00 14.56 ? 131 GLY D O     1 
ATOM   9813  N  N     . ILE J  1 134 ? 34.524  -74.487  -68.974 1.00 17.38 ? 132 ILE D N     1 
ATOM   9814  C  CA    . ILE J  1 134 ? 33.508  -73.724  -68.271 1.00 16.91 ? 132 ILE D CA    1 
ATOM   9815  C  C     . ILE J  1 134 ? 32.159  -73.959  -68.934 1.00 19.99 ? 132 ILE D C     1 
ATOM   9816  O  O     . ILE J  1 134 ? 32.072  -74.405  -70.086 1.00 15.73 ? 132 ILE D O     1 
ATOM   9817  C  CB    . ILE J  1 134 ? 33.812  -72.219  -68.195 1.00 16.57 ? 132 ILE D CB    1 
ATOM   9818  C  CG1   . ILE J  1 134 ? 33.579  -71.545  -69.551 1.00 14.78 ? 132 ILE D CG1   1 
ATOM   9819  C  CG2   . ILE J  1 134 ? 35.255  -71.981  -67.660 1.00 19.23 ? 132 ILE D CG2   1 
ATOM   9820  C  CD1   . ILE J  1 134 ? 33.902  -70.022  -69.499 1.00 24.60 ? 132 ILE D CD1   1 
ATOM   9821  N  N     . TYR J  1 135 ? 31.104  -73.641  -68.203 1.00 16.63 ? 133 TYR D N     1 
ATOM   9822  C  CA    . TYR J  1 135 ? 29.752  -74.036  -68.617 1.00 18.64 ? 133 TYR D CA    1 
ATOM   9823  C  C     . TYR J  1 135 ? 29.095  -72.984  -69.511 1.00 21.42 ? 133 TYR D C     1 
ATOM   9824  O  O     . TYR J  1 135 ? 29.102  -71.801  -69.194 1.00 21.43 ? 133 TYR D O     1 
ATOM   9825  C  CB    . TYR J  1 135 ? 28.888  -74.271  -67.371 1.00 22.58 ? 133 TYR D CB    1 
ATOM   9826  C  CG    . TYR J  1 135 ? 27.422  -74.561  -67.691 1.00 23.74 ? 133 TYR D CG    1 
ATOM   9827  C  CD1   . TYR J  1 135 ? 27.006  -75.852  -67.976 1.00 21.52 ? 133 TYR D CD1   1 
ATOM   9828  C  CD2   . TYR J  1 135 ? 26.476  -73.553  -67.677 1.00 24.23 ? 133 TYR D CD2   1 
ATOM   9829  C  CE1   . TYR J  1 135 ? 25.677  -76.150  -68.264 1.00 23.84 ? 133 TYR D CE1   1 
ATOM   9830  C  CE2   . TYR J  1 135 ? 25.157  -73.829  -67.967 1.00 21.09 ? 133 TYR D CE2   1 
ATOM   9831  C  CZ    . TYR J  1 135 ? 24.763  -75.134  -68.256 1.00 27.82 ? 133 TYR D CZ    1 
ATOM   9832  O  OH    . TYR J  1 135 ? 23.459  -75.454  -68.539 1.00 28.38 ? 133 TYR D OH    1 
ATOM   9833  N  N     . LYS J  1 136 ? 28.581  -73.421  -70.653 1.00 24.47 ? 134 LYS D N     1 
ATOM   9834  C  CA    . LYS J  1 136 ? 27.694  -72.592  -71.460 1.00 26.10 ? 134 LYS D CA    1 
ATOM   9835  C  C     . LYS J  1 136 ? 26.538  -73.476  -71.857 1.00 25.48 ? 134 LYS D C     1 
ATOM   9836  O  O     . LYS J  1 136 ? 26.739  -74.487  -72.541 1.00 22.55 ? 134 LYS D O     1 
ATOM   9837  C  CB    . LYS J  1 136 ? 28.403  -72.092  -72.731 1.00 27.59 ? 134 LYS D CB    1 
ATOM   9838  C  CG    . LYS J  1 136 ? 29.380  -70.961  -72.509 1.00 32.84 ? 134 LYS D CG    1 
ATOM   9839  C  CD    . LYS J  1 136 ? 28.755  -69.743  -71.790 1.00 37.43 ? 134 LYS D CD    1 
ATOM   9840  C  CE    . LYS J  1 136 ? 29.734  -68.551  -71.779 1.00 43.88 ? 134 LYS D CE    1 
ATOM   9841  N  NZ    . LYS J  1 136 ? 29.470  -67.587  -70.671 1.00 48.46 ? 134 LYS D NZ    1 
ATOM   9842  N  N     . SER J  1 137 ? 25.319  -73.107  -71.465 1.00 25.30 ? 135 SER D N     1 
ATOM   9843  C  CA    . SER J  1 137 ? 24.202  -74.028  -71.650 1.00 24.61 ? 135 SER D CA    1 
ATOM   9844  C  C     . SER J  1 137 ? 24.011  -74.412  -73.112 1.00 26.88 ? 135 SER D C     1 
ATOM   9845  O  O     . SER J  1 137 ? 23.647  -75.553  -73.401 1.00 29.71 ? 135 SER D O     1 
ATOM   9846  C  CB    . SER J  1 137 ? 22.907  -73.423  -71.100 1.00 26.15 ? 135 SER D CB    1 
ATOM   9847  O  OG    . SER J  1 137 ? 22.609  -72.244  -71.807 1.00 29.24 ? 135 SER D OG    1 
ATOM   9848  N  N     . PHE J  1 138 ? 24.233  -73.484  -74.044 1.00 25.49 ? 136 PHE D N     1 
ATOM   9849  C  CA    . PHE J  1 138 ? 23.995  -73.830  -75.446 1.00 27.50 ? 136 PHE D CA    1 
ATOM   9850  C  C     . PHE J  1 138 ? 24.977  -74.888  -75.991 1.00 27.57 ? 136 PHE D C     1 
ATOM   9851  O  O     . PHE J  1 138 ? 24.702  -75.515  -77.002 1.00 27.86 ? 136 PHE D O     1 
ATOM   9852  C  CB    . PHE J  1 138 ? 23.962  -72.601  -76.354 1.00 29.41 ? 136 PHE D CB    1 
ATOM   9853  C  CG    . PHE J  1 138 ? 25.052  -71.622  -76.080 1.00 30.63 ? 136 PHE D CG    1 
ATOM   9854  C  CD1   . PHE J  1 138 ? 24.959  -70.735  -75.003 1.00 43.07 ? 136 PHE D CD1   1 
ATOM   9855  C  CD2   . PHE J  1 138 ? 26.172  -71.569  -76.892 1.00 39.82 ? 136 PHE D CD2   1 
ATOM   9856  C  CE1   . PHE J  1 138 ? 25.986  -69.807  -74.740 1.00 46.56 ? 136 PHE D CE1   1 
ATOM   9857  C  CE2   . PHE J  1 138 ? 27.207  -70.649  -76.641 1.00 36.55 ? 136 PHE D CE2   1 
ATOM   9858  C  CZ    . PHE J  1 138 ? 27.112  -69.772  -75.559 1.00 47.23 ? 136 PHE D CZ    1 
ATOM   9859  N  N     . ASP J  1 139 ? 26.110  -75.098  -75.331 1.00 29.34 ? 137 ASP D N     1 
ATOM   9860  C  CA    . ASP J  1 139 ? 27.073  -76.093  -75.831 1.00 22.69 ? 137 ASP D CA    1 
ATOM   9861  C  C     . ASP J  1 139 ? 27.116  -77.426  -75.048 1.00 23.44 ? 137 ASP D C     1 
ATOM   9862  O  O     . ASP J  1 139 ? 27.863  -78.339  -75.403 1.00 22.77 ? 137 ASP D O     1 
ATOM   9863  C  CB    . ASP J  1 139 ? 28.484  -75.488  -75.907 1.00 23.39 ? 137 ASP D CB    1 
ATOM   9864  C  CG    . ASP J  1 139 ? 28.628  -74.478  -77.042 1.00 26.13 ? 137 ASP D CG    1 
ATOM   9865  O  OD1   . ASP J  1 139 ? 27.902  -74.606  -78.067 1.00 24.45 ? 137 ASP D OD1   1 
ATOM   9866  O  OD2   . ASP J  1 139 ? 29.466  -73.556  -76.886 1.00 20.00 ? 137 ASP D OD2   1 
ATOM   9867  N  N     . GLU J  1 140 ? 26.300  -77.556  -74.003 1.00 26.48 ? 138 GLU D N     1 
ATOM   9868  C  CA    . GLU J  1 140 ? 26.500  -78.668  -73.065 1.00 25.14 ? 138 GLU D CA    1 
ATOM   9869  C  C     . GLU J  1 140 ? 26.164  -80.035  -73.681 1.00 21.16 ? 138 GLU D C     1 
ATOM   9870  O  O     . GLU J  1 140 ? 26.569  -81.081  -73.154 1.00 21.56 ? 138 GLU D O     1 
ATOM   9871  C  CB    . GLU J  1 140 ? 25.697  -78.442  -71.784 1.00 26.96 ? 138 GLU D CB    1 
ATOM   9872  C  CG    . GLU J  1 140 ? 24.202  -78.677  -71.978 1.00 32.00 ? 138 GLU D CG    1 
ATOM   9873  C  CD    . GLU J  1 140 ? 23.402  -78.318  -70.735 1.00 42.47 ? 138 GLU D CD    1 
ATOM   9874  O  OE1   . GLU J  1 140 ? 23.916  -78.517  -69.606 1.00 40.72 ? 138 GLU D OE1   1 
ATOM   9875  O  OE2   . GLU J  1 140 ? 22.270  -77.825  -70.901 1.00 45.04 ? 138 GLU D OE2   1 
ATOM   9876  N  N     . LYS J  1 141 ? 25.429  -80.016  -74.796 1.00 22.96 ? 139 LYS D N     1 
ATOM   9877  C  CA    . LYS J  1 141 ? 25.052  -81.229  -75.520 1.00 21.80 ? 139 LYS D CA    1 
ATOM   9878  C  C     . LYS J  1 141 ? 25.757  -81.282  -76.881 1.00 24.68 ? 139 LYS D C     1 
ATOM   9879  O  O     . LYS J  1 141 ? 25.376  -82.060  -77.750 1.00 25.77 ? 139 LYS D O     1 
ATOM   9880  C  CB    . LYS J  1 141 ? 23.535  -81.246  -75.770 1.00 32.00 ? 139 LYS D CB    1 
ATOM   9881  C  CG    . LYS J  1 141 ? 22.679  -81.297  -74.518 1.00 37.10 ? 139 LYS D CG    1 
ATOM   9882  C  CD    . LYS J  1 141 ? 22.568  -82.734  -74.040 1.00 38.69 ? 139 LYS D CD    1 
ATOM   9883  C  CE    . LYS J  1 141 ? 21.802  -82.832  -72.732 1.00 37.91 ? 139 LYS D CE    1 
ATOM   9884  N  NZ    . LYS J  1 141 ? 20.756  -83.884  -72.849 1.00 43.54 ? 139 LYS D NZ    1 
ATOM   9885  N  N     . LYS J  1 142 ? 26.754  -80.434  -77.085 1.00 18.34 ? 140 LYS D N     1 
ATOM   9886  C  CA    . LYS J  1 142 ? 27.441  -80.399  -78.388 1.00 24.04 ? 140 LYS D CA    1 
ATOM   9887  C  C     . LYS J  1 142 ? 28.492  -81.499  -78.412 1.00 17.68 ? 140 LYS D C     1 
ATOM   9888  O  O     . LYS J  1 142 ? 29.186  -81.711  -77.408 1.00 20.83 ? 140 LYS D O     1 
ATOM   9889  C  CB    . LYS J  1 142 ? 28.101  -79.026  -78.609 1.00 22.42 ? 140 LYS D CB    1 
ATOM   9890  C  CG    . LYS J  1 142 ? 28.578  -78.755  -80.043 1.00 24.05 ? 140 LYS D CG    1 
ATOM   9891  C  CD    . LYS J  1 142 ? 29.062  -77.288  -80.223 1.00 30.30 ? 140 LYS D CD    1 
ATOM   9892  C  CE    . LYS J  1 142 ? 30.126  -77.074  -81.343 1.00 25.77 ? 140 LYS D CE    1 
ATOM   9893  N  NZ    . LYS J  1 142 ? 29.630  -76.745  -82.722 1.00 37.72 ? 140 LYS D NZ    1 
ATOM   9894  N  N     . PRO J  1 143 ? 28.622  -82.224  -79.539 1.00 19.77 ? 141 PRO D N     1 
ATOM   9895  C  CA    . PRO J  1 143 ? 29.718  -83.188  -79.479 1.00 19.10 ? 141 PRO D CA    1 
ATOM   9896  C  C     . PRO J  1 143 ? 31.019  -82.449  -79.786 1.00 22.70 ? 141 PRO D C     1 
ATOM   9897  O  O     . PRO J  1 143 ? 31.000  -81.262  -80.122 1.00 18.19 ? 141 PRO D O     1 
ATOM   9898  C  CB    . PRO J  1 143 ? 29.432  -84.123  -80.655 1.00 15.99 ? 141 PRO D CB    1 
ATOM   9899  C  CG    . PRO J  1 143 ? 28.795  -83.207  -81.687 1.00 26.14 ? 141 PRO D CG    1 
ATOM   9900  C  CD    . PRO J  1 143 ? 27.912  -82.274  -80.839 1.00 18.95 ? 141 PRO D CD    1 
ATOM   9901  N  N     . TYR J  1 144 ? 32.130  -83.168  -79.704 1.00 15.26 ? 142 TYR D N     1 
ATOM   9902  C  CA    . TYR J  1 144 ? 33.394  -82.632  -80.153 1.00 19.77 ? 142 TYR D CA    1 
ATOM   9903  C  C     . TYR J  1 144 ? 33.512  -83.118  -81.589 1.00 20.12 ? 142 TYR D C     1 
ATOM   9904  O  O     . TYR J  1 144 ? 33.143  -84.253  -81.890 1.00 23.59 ? 142 TYR D O     1 
ATOM   9905  C  CB    . TYR J  1 144 ? 34.530  -83.176  -79.281 1.00 17.06 ? 142 TYR D CB    1 
ATOM   9906  C  CG    . TYR J  1 144 ? 34.515  -82.665  -77.842 1.00 20.32 ? 142 TYR D CG    1 
ATOM   9907  C  CD1   . TYR J  1 144 ? 34.714  -81.315  -77.553 1.00 18.12 ? 142 TYR D CD1   1 
ATOM   9908  C  CD2   . TYR J  1 144 ? 34.354  -83.530  -76.783 1.00 16.62 ? 142 TYR D CD2   1 
ATOM   9909  C  CE1   . TYR J  1 144 ? 34.731  -80.859  -76.259 1.00 18.82 ? 142 TYR D CE1   1 
ATOM   9910  C  CE2   . TYR J  1 144 ? 34.353  -83.078  -75.473 1.00 14.90 ? 142 TYR D CE2   1 
ATOM   9911  C  CZ    . TYR J  1 144 ? 34.548  -81.750  -75.215 1.00 17.80 ? 142 TYR D CZ    1 
ATOM   9912  O  OH    . TYR J  1 144 ? 34.565  -81.297  -73.908 1.00 17.80 ? 142 TYR D OH    1 
ATOM   9913  N  N     . THR J  1 145 ? 33.966  -82.246  -82.491 1.00 14.75 ? 143 THR D N     1 
ATOM   9914  C  CA    . THR J  1 145 ? 34.259  -82.671  -83.867 1.00 16.76 ? 143 THR D CA    1 
ATOM   9915  C  C     . THR J  1 145 ? 35.784  -82.709  -84.030 1.00 20.28 ? 143 THR D C     1 
ATOM   9916  O  O     . THR J  1 145 ? 36.476  -81.844  -83.495 1.00 16.69 ? 143 THR D O     1 
ATOM   9917  C  CB    . THR J  1 145 ? 33.581  -81.745  -84.904 1.00 20.70 ? 143 THR D CB    1 
ATOM   9918  O  OG1   . THR J  1 145 ? 33.994  -80.398  -84.678 1.00 32.07 ? 143 THR D OG1   1 
ATOM   9919  C  CG2   . THR J  1 145 ? 32.085  -81.787  -84.730 1.00 23.90 ? 143 THR D CG2   1 
ATOM   9920  N  N     . TYR J  1 146 ? 36.309  -83.704  -84.751 1.00 19.89 ? 144 TYR D N     1 
ATOM   9921  C  CA    . TYR J  1 146 ? 37.746  -83.941  -84.744 1.00 20.94 ? 144 TYR D CA    1 
ATOM   9922  C  C     . TYR J  1 146 ? 38.184  -84.295  -86.154 1.00 16.97 ? 144 TYR D C     1 
ATOM   9923  O  O     . TYR J  1 146 ? 37.463  -84.976  -86.869 1.00 17.76 ? 144 TYR D O     1 
ATOM   9924  C  CB    . TYR J  1 146 ? 38.098  -85.061  -83.738 1.00 15.39 ? 144 TYR D CB    1 
ATOM   9925  C  CG    . TYR J  1 146 ? 39.596  -85.298  -83.600 1.00 19.37 ? 144 TYR D CG    1 
ATOM   9926  C  CD1   . TYR J  1 146 ? 40.287  -86.069  -84.535 1.00 15.72 ? 144 TYR D CD1   1 
ATOM   9927  C  CD2   . TYR J  1 146 ? 40.321  -84.719  -82.559 1.00 16.00 ? 144 TYR D CD2   1 
ATOM   9928  C  CE1   . TYR J  1 146 ? 41.639  -86.292  -84.428 1.00 15.67 ? 144 TYR D CE1   1 
ATOM   9929  C  CE2   . TYR J  1 146 ? 41.699  -84.928  -82.434 1.00 18.88 ? 144 TYR D CE2   1 
ATOM   9930  C  CZ    . TYR J  1 146 ? 42.357  -85.714  -83.372 1.00 16.52 ? 144 TYR D CZ    1 
ATOM   9931  O  OH    . TYR J  1 146 ? 43.731  -85.910  -83.262 1.00 18.39 ? 144 TYR D OH    1 
ATOM   9932  N  N     . PRO J  1 147 ? 39.359  -83.815  -86.583 1.00 20.81 ? 145 PRO D N     1 
ATOM   9933  C  CA    . PRO J  1 147 ? 40.336  -83.045  -85.806 1.00 16.79 ? 145 PRO D CA    1 
ATOM   9934  C  C     . PRO J  1 147 ? 39.907  -81.608  -85.571 1.00 18.36 ? 145 PRO D C     1 
ATOM   9935  O  O     . PRO J  1 147 ? 38.942  -81.155  -86.198 1.00 18.63 ? 145 PRO D O     1 
ATOM   9936  C  CB    . PRO J  1 147 ? 41.601  -83.067  -86.687 1.00 21.08 ? 145 PRO D CB    1 
ATOM   9937  C  CG    . PRO J  1 147 ? 41.042  -83.185  -88.098 1.00 27.45 ? 145 PRO D CG    1 
ATOM   9938  C  CD    . PRO J  1 147 ? 39.823  -84.086  -87.958 1.00 16.27 ? 145 PRO D CD    1 
ATOM   9939  N  N     . PRO J  1 148 ? 40.632  -80.899  -84.675 1.00 16.99 ? 146 PRO D N     1 
ATOM   9940  C  CA    . PRO J  1 148 ? 40.250  -79.533  -84.290 1.00 21.06 ? 146 PRO D CA    1 
ATOM   9941  C  C     . PRO J  1 148 ? 40.134  -78.648  -85.525 1.00 20.06 ? 146 PRO D C     1 
ATOM   9942  O  O     . PRO J  1 148 ? 40.886  -78.824  -86.494 1.00 21.25 ? 146 PRO D O     1 
ATOM   9943  C  CB    . PRO J  1 148 ? 41.404  -79.051  -83.384 1.00 17.16 ? 146 PRO D CB    1 
ATOM   9944  C  CG    . PRO J  1 148 ? 42.511  -80.170  -83.447 1.00 19.94 ? 146 PRO D CG    1 
ATOM   9945  C  CD    . PRO J  1 148 ? 41.807  -81.415  -83.929 1.00 18.67 ? 146 PRO D CD    1 
ATOM   9946  N  N     . SER J  1 149 ? 39.192  -77.715  -85.490 1.00 25.26 ? 147 SER D N     1 
ATOM   9947  C  CA    . SER J  1 149 ? 39.083  -76.702  -86.534 1.00 25.65 ? 147 SER D CA    1 
ATOM   9948  C  C     . SER J  1 149 ? 39.065  -75.319  -85.924 1.00 23.95 ? 147 SER D C     1 
ATOM   9949  O  O     . SER J  1 149 ? 38.387  -75.102  -84.925 1.00 17.63 ? 147 SER D O     1 
ATOM   9950  C  CB    . SER J  1 149 ? 37.780  -76.858  -87.288 1.00 26.91 ? 147 SER D CB    1 
ATOM   9951  O  OG    . SER J  1 149 ? 37.564  -75.678  -88.038 1.00 30.07 ? 147 SER D OG    1 
ATOM   9952  N  N     . PRO J  1 150 ? 39.768  -74.353  -86.547 1.00 25.95 ? 148 PRO D N     1 
ATOM   9953  C  CA    . PRO J  1 150 ? 39.784  -73.015  -85.927 1.00 27.45 ? 148 PRO D CA    1 
ATOM   9954  C  C     . PRO J  1 150 ? 38.383  -72.474  -85.666 1.00 25.25 ? 148 PRO D C     1 
ATOM   9955  O  O     . PRO J  1 150 ? 38.202  -71.680  -84.735 1.00 30.67 ? 148 PRO D O     1 
ATOM   9956  C  CB    . PRO J  1 150 ? 40.505  -72.155  -86.970 1.00 27.56 ? 148 PRO D CB    1 
ATOM   9957  C  CG    . PRO J  1 150 ? 41.461  -73.150  -87.681 1.00 25.57 ? 148 PRO D CG    1 
ATOM   9958  C  CD    . PRO J  1 150 ? 40.603  -74.415  -87.766 1.00 25.01 ? 148 PRO D CD    1 
ATOM   9959  N  N     . ASN J  1 151 ? 37.407  -72.899  -86.457 1.00 28.40 ? 149 ASN D N     1 
ATOM   9960  C  CA    . ASN J  1 151 ? 36.019  -72.461  -86.276 1.00 25.29 ? 149 ASN D CA    1 
ATOM   9961  C  C     . ASN J  1 151 ? 35.472  -72.825  -84.906 1.00 29.38 ? 149 ASN D C     1 
ATOM   9962  O  O     . ASN J  1 151 ? 34.425  -72.348  -84.499 1.00 36.54 ? 149 ASN D O     1 
ATOM   9963  C  CB    . ASN J  1 151 ? 35.109  -73.124  -87.311 1.00 27.97 ? 149 ASN D CB    1 
ATOM   9964  C  CG    . ASN J  1 151 ? 35.329  -72.611  -88.728 1.00 41.95 ? 149 ASN D CG    1 
ATOM   9965  O  OD1   . ASN J  1 151 ? 35.343  -71.403  -88.979 1.00 33.64 ? 149 ASN D OD1   1 
ATOM   9966  N  ND2   . ASN J  1 151 ? 35.489  -73.543  -89.671 1.00 42.88 ? 149 ASN D ND2   1 
ATOM   9967  N  N     . ASP J  1 152 ? 36.145  -73.719  -84.207 1.00 25.49 ? 150 ASP D N     1 
ATOM   9968  C  CA    . ASP J  1 152 ? 35.602  -74.169  -82.949 1.00 21.56 ? 150 ASP D CA    1 
ATOM   9969  C  C     . ASP J  1 152 ? 36.291  -73.536  -81.753 1.00 22.58 ? 150 ASP D C     1 
ATOM   9970  O  O     . ASP J  1 152 ? 36.085  -73.987  -80.615 1.00 21.24 ? 150 ASP D O     1 
ATOM   9971  C  CB    . ASP J  1 152 ? 35.648  -75.696  -82.888 1.00 16.66 ? 150 ASP D CB    1 
ATOM   9972  C  CG    . ASP J  1 152 ? 34.778  -76.345  -83.970 1.00 32.21 ? 150 ASP D CG    1 
ATOM   9973  O  OD1   . ASP J  1 152 ? 33.611  -75.905  -84.167 1.00 37.16 ? 150 ASP D OD1   1 
ATOM   9974  O  OD2   . ASP J  1 152 ? 35.272  -77.290  -84.622 1.00 32.69 ? 150 ASP D OD2   1 
ATOM   9975  N  N     . VAL J  1 153 ? 37.100  -72.496  -82.004 1.00 21.28 ? 151 VAL D N     1 
ATOM   9976  C  CA    . VAL J  1 153 ? 37.836  -71.831  -80.932 1.00 15.63 ? 151 VAL D CA    1 
ATOM   9977  C  C     . VAL J  1 153 ? 36.917  -71.423  -79.792 1.00 17.82 ? 151 VAL D C     1 
ATOM   9978  O  O     . VAL J  1 153 ? 37.304  -71.461  -78.645 1.00 18.36 ? 151 VAL D O     1 
ATOM   9979  C  CB    . VAL J  1 153 ? 38.617  -70.585  -81.409 1.00 17.77 ? 151 VAL D CB    1 
ATOM   9980  C  CG1   . VAL J  1 153 ? 37.664  -69.538  -81.927 1.00 27.20 ? 151 VAL D CG1   1 
ATOM   9981  C  CG2   . VAL J  1 153 ? 39.476  -70.025  -80.290 1.00 17.15 ? 151 VAL D CG2   1 
ATOM   9982  N  N     . VAL J  1 154 ? 35.696  -71.025  -80.130 1.00 19.87 ? 152 VAL D N     1 
ATOM   9983  C  CA    . VAL J  1 154 ? 34.773  -70.476  -79.140 1.00 22.48 ? 152 VAL D CA    1 
ATOM   9984  C  C     . VAL J  1 154 ? 34.002  -71.524  -78.318 1.00 21.28 ? 152 VAL D C     1 
ATOM   9985  O  O     . VAL J  1 154 ? 33.472  -71.217  -77.248 1.00 27.08 ? 152 VAL D O     1 
ATOM   9986  C  CB    . VAL J  1 154 ? 33.770  -69.490  -79.807 1.00 26.61 ? 152 VAL D CB    1 
ATOM   9987  C  CG1   . VAL J  1 154 ? 34.535  -68.395  -80.514 1.00 32.59 ? 152 VAL D CG1   1 
ATOM   9988  C  CG2   . VAL J  1 154 ? 32.909  -70.221  -80.824 1.00 23.36 ? 152 VAL D CG2   1 
ATOM   9989  N  N     . SER J  1 155 ? 33.928  -72.758  -78.805 1.00 16.52 ? 153 SER D N     1 
ATOM   9990  C  CA    . SER J  1 155 ? 33.119  -73.764  -78.135 1.00 16.89 ? 153 SER D CA    1 
ATOM   9991  C  C     . SER J  1 155 ? 33.906  -74.914  -77.526 1.00 21.00 ? 153 SER D C     1 
ATOM   9992  O  O     . SER J  1 155 ? 33.402  -75.616  -76.653 1.00 17.11 ? 153 SER D O     1 
ATOM   9993  C  CB    . SER J  1 155 ? 32.112  -74.350  -79.130 1.00 21.42 ? 153 SER D CB    1 
ATOM   9994  O  OG    . SER J  1 155 ? 32.760  -75.001  -80.220 1.00 20.65 ? 153 SER D OG    1 
ATOM   9995  N  N     . LEU J  1 156 ? 35.125  -75.147  -78.027 1.00 20.49 ? 154 LEU D N     1 
ATOM   9996  C  CA    . LEU J  1 156 ? 35.866  -76.323  -77.613 1.00 17.38 ? 154 LEU D CA    1 
ATOM   9997  C  C     . LEU J  1 156 ? 36.018  -76.413  -76.099 1.00 16.00 ? 154 LEU D C     1 
ATOM   9998  O  O     . LEU J  1 156 ? 36.108  -77.511  -75.553 1.00 19.43 ? 154 LEU D O     1 
ATOM   9999  C  CB    . LEU J  1 156 ? 37.232  -76.406  -78.313 1.00 19.01 ? 154 LEU D CB    1 
ATOM   10000 C  CG    . LEU J  1 156 ? 37.207  -77.108  -79.667 1.00 20.55 ? 154 LEU D CG    1 
ATOM   10001 C  CD1   . LEU J  1 156 ? 38.544  -76.884  -80.375 1.00 18.61 ? 154 LEU D CD1   1 
ATOM   10002 C  CD2   . LEU J  1 156 ? 37.023  -78.599  -79.468 1.00 16.61 ? 154 LEU D CD2   1 
ATOM   10003 N  N     . PHE J  1 157 ? 36.063  -75.287  -75.397 1.00 12.42 ? 155 PHE D N     1 
ATOM   10004 C  CA    . PHE J  1 157 ? 36.360  -75.362  -73.967 1.00 14.32 ? 155 PHE D CA    1 
ATOM   10005 C  C     . PHE J  1 157 ? 35.109  -75.358  -73.095 1.00 15.50 ? 155 PHE D C     1 
ATOM   10006 O  O     . PHE J  1 157 ? 35.214  -75.197  -71.886 1.00 13.59 ? 155 PHE D O     1 
ATOM   10007 C  CB    . PHE J  1 157 ? 37.291  -74.200  -73.507 1.00 14.91 ? 155 PHE D CB    1 
ATOM   10008 C  CG    . PHE J  1 157 ? 36.755  -72.844  -73.876 1.00 16.96 ? 155 PHE D CG    1 
ATOM   10009 C  CD1   . PHE J  1 157 ? 37.019  -72.316  -75.138 1.00 16.17 ? 155 PHE D CD1   1 
ATOM   10010 C  CD2   . PHE J  1 157 ? 35.961  -72.126  -72.997 1.00 17.72 ? 155 PHE D CD2   1 
ATOM   10011 C  CE1   . PHE J  1 157 ? 36.510  -71.076  -75.530 1.00 16.63 ? 155 PHE D CE1   1 
ATOM   10012 C  CE2   . PHE J  1 157 ? 35.421  -70.848  -73.367 1.00 17.79 ? 155 PHE D CE2   1 
ATOM   10013 C  CZ    . PHE J  1 157 ? 35.700  -70.325  -74.637 1.00 22.60 ? 155 PHE D CZ    1 
ATOM   10014 N  N     . HIS J  1 158 ? 33.929  -75.499  -73.703 1.00 14.27 ? 156 HIS D N     1 
ATOM   10015 C  CA    . HIS J  1 158 ? 32.671  -75.473  -72.924 1.00 17.80 ? 156 HIS D CA    1 
ATOM   10016 C  C     . HIS J  1 158 ? 32.358  -76.863  -72.383 1.00 17.28 ? 156 HIS D C     1 
ATOM   10017 O  O     . HIS J  1 158 ? 32.285  -77.827  -73.137 1.00 15.90 ? 156 HIS D O     1 
ATOM   10018 C  CB    . HIS J  1 158 ? 31.510  -74.954  -73.791 1.00 11.45 ? 156 HIS D CB    1 
ATOM   10019 C  CG    . HIS J  1 158 ? 31.620  -73.492  -74.103 1.00 16.30 ? 156 HIS D CG    1 
ATOM   10020 N  ND1   . HIS J  1 158 ? 31.127  -72.913  -75.259 1.00 16.64 ? 156 HIS D ND1   1 
ATOM   10021 C  CD2   . HIS J  1 158 ? 32.195  -72.484  -73.394 1.00 17.52 ? 156 HIS D CD2   1 
ATOM   10022 C  CE1   . HIS J  1 158 ? 31.379  -71.623  -75.237 1.00 20.72 ? 156 HIS D CE1   1 
ATOM   10023 N  NE2   . HIS J  1 158 ? 32.022  -71.332  -74.124 1.00 20.15 ? 156 HIS D NE2   1 
ATOM   10024 N  N     . THR J  1 159 ? 32.172  -76.963  -71.079 1.00 16.60 ? 157 THR D N     1 
ATOM   10025 C  CA    . THR J  1 159 ? 32.027  -78.275  -70.469 1.00 12.99 ? 157 THR D CA    1 
ATOM   10026 C  C     . THR J  1 159 ? 30.775  -78.955  -70.998 1.00 17.62 ? 157 THR D C     1 
ATOM   10027 O  O     . THR J  1 159 ? 29.695  -78.341  -71.019 1.00 17.00 ? 157 THR D O     1 
ATOM   10028 C  CB    . THR J  1 159 ? 31.891  -78.165  -68.947 1.00 15.27 ? 157 THR D CB    1 
ATOM   10029 O  OG1   . THR J  1 159 ? 32.967  -77.376  -68.429 1.00 15.36 ? 157 THR D OG1   1 
ATOM   10030 C  CG2   . THR J  1 159 ? 31.904  -79.592  -68.311 1.00 12.06 ? 157 THR D CG2   1 
ATOM   10031 N  N     . ARG J  1 160 ? 30.921  -80.215  -71.435 1.00 11.66 ? 158 ARG D N     1 
ATOM   10032 C  CA    . ARG J  1 160 ? 29.780  -81.041  -71.862 1.00 18.17 ? 158 ARG D CA    1 
ATOM   10033 C  C     . ARG J  1 160 ? 29.079  -81.751  -70.714 1.00 15.52 ? 158 ARG D C     1 
ATOM   10034 O  O     . ARG J  1 160 ? 29.737  -82.263  -69.797 1.00 17.45 ? 158 ARG D O     1 
ATOM   10035 C  CB    . ARG J  1 160 ? 30.216  -82.061  -72.910 1.00 17.03 ? 158 ARG D CB    1 
ATOM   10036 C  CG    . ARG J  1 160 ? 29.993  -81.542  -74.324 1.00 20.63 ? 158 ARG D CG    1 
ATOM   10037 C  CD    . ARG J  1 160 ? 30.849  -80.317  -74.685 1.00 17.79 ? 158 ARG D CD    1 
ATOM   10038 N  NE    . ARG J  1 160 ? 30.932  -80.168  -76.156 1.00 15.45 ? 158 ARG D NE    1 
ATOM   10039 C  CZ    . ARG J  1 160 ? 31.594  -79.205  -76.804 1.00 19.48 ? 158 ARG D CZ    1 
ATOM   10040 N  NH1   . ARG J  1 160 ? 32.243  -78.244  -76.128 1.00 15.75 ? 158 ARG D NH1   1 
ATOM   10041 N  NH2   . ARG J  1 160 ? 31.599  -79.200  -78.145 1.00 15.12 ? 158 ARG D NH2   1 
ATOM   10042 N  N     . ASN J  1 161 ? 27.745  -81.794  -70.781 1.00 16.12 ? 159 ASN D N     1 
ATOM   10043 C  CA    . ASN J  1 161 ? 26.915  -82.556  -69.846 1.00 18.58 ? 159 ASN D CA    1 
ATOM   10044 C  C     . ASN J  1 161 ? 27.331  -84.022  -69.612 1.00 19.67 ? 159 ASN D C     1 
ATOM   10045 O  O     . ASN J  1 161 ? 27.264  -84.521  -68.494 1.00 16.95 ? 159 ASN D O     1 
ATOM   10046 C  CB    . ASN J  1 161 ? 25.463  -82.525  -70.325 1.00 23.19 ? 159 ASN D CB    1 
ATOM   10047 C  CG    . ASN J  1 161 ? 24.566  -83.388  -69.477 1.00 32.42 ? 159 ASN D CG    1 
ATOM   10048 O  OD1   . ASN J  1 161 ? 24.045  -82.937  -68.446 1.00 34.86 ? 159 ASN D OD1   1 
ATOM   10049 N  ND2   . ASN J  1 161 ? 24.377  -84.648  -69.895 1.00 27.50 ? 159 ASN D ND2   1 
ATOM   10050 N  N     . TYR J  1 162 ? 27.733  -84.711  -70.675 1.00 18.36 ? 160 TYR D N     1 
ATOM   10051 C  CA    . TYR J  1 162 ? 28.112  -86.125  -70.570 1.00 18.45 ? 160 TYR D CA    1 
ATOM   10052 C  C     . TYR J  1 162 ? 29.162  -86.436  -69.491 1.00 16.28 ? 160 TYR D C     1 
ATOM   10053 O  O     . TYR J  1 162 ? 29.187  -87.558  -68.956 1.00 17.45 ? 160 TYR D O     1 
ATOM   10054 C  CB    . TYR J  1 162 ? 28.507  -86.721  -71.940 1.00 13.73 ? 160 TYR D CB    1 
ATOM   10055 C  CG    . TYR J  1 162 ? 29.946  -86.508  -72.374 1.00 18.95 ? 160 TYR D CG    1 
ATOM   10056 C  CD1   . TYR J  1 162 ? 30.957  -87.397  -71.974 1.00 20.66 ? 160 TYR D CD1   1 
ATOM   10057 C  CD2   . TYR J  1 162 ? 30.301  -85.450  -73.213 1.00 17.03 ? 160 TYR D CD2   1 
ATOM   10058 C  CE1   . TYR J  1 162 ? 32.297  -87.216  -72.385 1.00 18.53 ? 160 TYR D CE1   1 
ATOM   10059 C  CE2   . TYR J  1 162 ? 31.640  -85.257  -73.625 1.00 17.82 ? 160 TYR D CE2   1 
ATOM   10060 C  CZ    . TYR J  1 162 ? 32.625  -86.164  -73.206 1.00 16.52 ? 160 TYR D CZ    1 
ATOM   10061 O  OH    . TYR J  1 162 ? 33.955  -86.017  -73.580 1.00 18.66 ? 160 TYR D OH    1 
ATOM   10062 N  N     . VAL J  1 163 ? 30.026  -85.482  -69.150 1.00 13.84 ? 161 VAL D N     1 
ATOM   10063 C  CA    . VAL J  1 163 ? 31.010  -85.771  -68.093 1.00 12.03 ? 161 VAL D CA    1 
ATOM   10064 C  C     . VAL J  1 163 ? 30.365  -86.210  -66.772 1.00 14.73 ? 161 VAL D C     1 
ATOM   10065 O  O     . VAL J  1 163 ? 30.947  -87.008  -66.022 1.00 15.38 ? 161 VAL D O     1 
ATOM   10066 C  CB    . VAL J  1 163 ? 32.049  -84.632  -67.861 1.00 13.71 ? 161 VAL D CB    1 
ATOM   10067 C  CG1   . VAL J  1 163 ? 32.796  -84.329  -69.191 1.00 16.67 ? 161 VAL D CG1   1 
ATOM   10068 C  CG2   . VAL J  1 163 ? 31.357  -83.377  -67.296 1.00 17.52 ? 161 VAL D CG2   1 
ATOM   10069 N  N     . ILE J  1 164 ? 29.160  -85.749  -66.498 1.00 13.17 ? 162 ILE D N     1 
ATOM   10070 C  CA    . ILE J  1 164 ? 28.492  -86.191  -65.259 1.00 14.19 ? 162 ILE D CA    1 
ATOM   10071 C  C     . ILE J  1 164 ? 28.351  -87.742  -65.256 1.00 17.98 ? 162 ILE D C     1 
ATOM   10072 O  O     . ILE J  1 164 ? 28.698  -88.418  -64.273 1.00 16.09 ? 162 ILE D O     1 
ATOM   10073 C  CB    . ILE J  1 164 ? 27.107  -85.473  -65.080 1.00 23.63 ? 162 ILE D CB    1 
ATOM   10074 C  CG1   . ILE J  1 164 ? 27.297  -83.960  -64.883 1.00 17.20 ? 162 ILE D CG1   1 
ATOM   10075 C  CG2   . ILE J  1 164 ? 26.229  -86.077  -63.942 1.00 18.73 ? 162 ILE D CG2   1 
ATOM   10076 C  CD1   . ILE J  1 164 ? 25.998  -83.169  -65.160 1.00 16.68 ? 162 ILE D CD1   1 
ATOM   10077 N  N     . GLN J  1 165 ? 27.846  -88.306  -66.348 1.00 18.51 ? 163 GLN D N     1 
ATOM   10078 C  CA    . GLN J  1 165 ? 27.662  -89.751  -66.433 1.00 18.84 ? 163 GLN D CA    1 
ATOM   10079 C  C     . GLN J  1 165 ? 28.966  -90.537  -66.453 1.00 17.61 ? 163 GLN D C     1 
ATOM   10080 O  O     . GLN J  1 165 ? 28.990  -91.727  -66.089 1.00 18.47 ? 163 GLN D O     1 
ATOM   10081 C  CB    . GLN J  1 165 ? 26.864  -90.130  -67.695 1.00 24.63 ? 163 GLN D CB    1 
ATOM   10082 C  CG    . GLN J  1 165 ? 25.356  -89.988  -67.552 1.00 23.28 ? 163 GLN D CG    1 
ATOM   10083 C  CD    . GLN J  1 165 ? 24.909  -88.533  -67.607 1.00 30.19 ? 163 GLN D CD    1 
ATOM   10084 O  OE1   . GLN J  1 165 ? 25.007  -87.883  -68.662 1.00 29.42 ? 163 GLN D OE1   1 
ATOM   10085 N  NE2   . GLN J  1 165 ? 24.432  -88.000  -66.465 1.00 22.45 ? 163 GLN D NE2   1 
ATOM   10086 N  N     . MET J  1 166 ? 30.046  -89.914  -66.928 1.00 16.09 ? 164 MET D N     1 
ATOM   10087 C  CA    . MET J  1 166 ? 31.342  -90.591  -66.999 1.00 13.76 ? 164 MET D CA    1 
ATOM   10088 C  C     . MET J  1 166 ? 31.923  -90.690  -65.628 1.00 17.27 ? 164 MET D C     1 
ATOM   10089 O  O     . MET J  1 166 ? 32.753  -91.566  -65.337 1.00 15.35 ? 164 MET D O     1 
ATOM   10090 C  CB    . MET J  1 166 ? 32.342  -89.788  -67.854 1.00 13.78 ? 164 MET D CB    1 
ATOM   10091 C  CG    . MET J  1 166 ? 31.995  -89.675  -69.299 1.00 15.51 ? 164 MET D CG    1 
ATOM   10092 S  SD    . MET J  1 166 ? 32.166  -91.233  -70.213 1.00 20.92 ? 164 MET D SD    1 
ATOM   10093 C  CE    . MET J  1 166 ? 33.932  -91.540  -70.154 1.00 23.02 ? 164 MET D CE    1 
ATOM   10094 N  N     . LEU J  1 167 ? 31.533  -89.754  -64.775 1.00 13.23 ? 165 LEU D N     1 
ATOM   10095 C  CA    . LEU J  1 167 ? 32.165  -89.676  -63.469 1.00 16.61 ? 165 LEU D CA    1 
ATOM   10096 C  C     . LEU J  1 167 ? 31.261  -90.121  -62.310 1.00 11.83 ? 165 LEU D C     1 
ATOM   10097 O  O     . LEU J  1 167 ? 31.736  -90.311  -61.200 1.00 15.52 ? 165 LEU D O     1 
ATOM   10098 C  CB    . LEU J  1 167 ? 32.678  -88.252  -63.189 1.00 14.52 ? 165 LEU D CB    1 
ATOM   10099 C  CG    . LEU J  1 167 ? 33.708  -87.618  -64.134 1.00 13.46 ? 165 LEU D CG    1 
ATOM   10100 C  CD1   . LEU J  1 167 ? 33.731  -86.065  -63.931 1.00 10.68 ? 165 LEU D CD1   1 
ATOM   10101 C  CD2   . LEU J  1 167 ? 35.081  -88.229  -63.906 1.00 12.27 ? 165 LEU D CD2   1 
ATOM   10102 N  N     A SER J  1 168 ? 29.966  -90.261  -62.581 0.43 18.35 ? 166 SER D N     1 
ATOM   10103 N  N     B SER J  1 168 ? 29.961  -90.253  -62.550 0.57 18.36 ? 166 SER D N     1 
ATOM   10104 C  CA    A SER J  1 168 ? 28.980  -90.443  -61.509 0.43 18.89 ? 166 SER D CA    1 
ATOM   10105 C  CA    B SER J  1 168 ? 29.009  -90.407  -61.436 0.57 18.89 ? 166 SER D CA    1 
ATOM   10106 C  C     A SER J  1 168 ? 29.269  -91.600  -60.539 0.43 18.62 ? 166 SER D C     1 
ATOM   10107 C  C     B SER J  1 168 ? 29.231  -91.627  -60.522 0.57 18.60 ? 166 SER D C     1 
ATOM   10108 O  O     A SER J  1 168 ? 29.016  -91.491  -59.349 0.43 20.13 ? 166 SER D O     1 
ATOM   10109 O  O     B SER J  1 168 ? 28.866  -91.604  -59.354 0.57 20.16 ? 166 SER D O     1 
ATOM   10110 C  CB    A SER J  1 168 ? 27.557  -90.551  -62.086 0.43 20.33 ? 166 SER D CB    1 
ATOM   10111 C  CB    B SER J  1 168 ? 27.574  -90.438  -61.962 0.57 20.31 ? 166 SER D CB    1 
ATOM   10112 O  OG    A SER J  1 168 ? 27.023  -89.281  -62.383 0.43 19.35 ? 166 SER D OG    1 
ATOM   10113 O  OG    B SER J  1 168 ? 27.340  -91.614  -62.714 0.57 19.04 ? 166 SER D OG    1 
ATOM   10114 N  N     . ASN J  1 169 ? 29.808  -92.699  -61.051 1.00 19.51 ? 167 ASN D N     1 
ATOM   10115 C  CA    . ASN J  1 169 ? 29.991  -93.904  -60.231 1.00 26.05 ? 167 ASN D CA    1 
ATOM   10116 C  C     . ASN J  1 169 ? 31.331  -93.998  -59.514 1.00 25.49 ? 167 ASN D C     1 
ATOM   10117 O  O     . ASN J  1 169 ? 31.653  -95.015  -58.905 1.00 23.71 ? 167 ASN D O     1 
ATOM   10118 C  CB    . ASN J  1 169 ? 29.747  -95.178  -61.046 1.00 17.49 ? 167 ASN D CB    1 
ATOM   10119 C  CG    . ASN J  1 169 ? 30.769  -95.358  -62.131 1.00 25.40 ? 167 ASN D CG    1 
ATOM   10120 O  OD1   . ASN J  1 169 ? 31.855  -94.774  -62.064 1.00 22.27 ? 167 ASN D OD1   1 
ATOM   10121 N  ND2   . ASN J  1 169 ? 30.441  -96.178  -63.142 1.00 20.41 ? 167 ASN D ND2   1 
ATOM   10122 N  N     . LEU J  1 170 ? 32.121  -92.929  -59.556 1.00 24.21 ? 168 LEU D N     1 
ATOM   10123 C  CA    . LEU J  1 170 ? 33.506  -93.073  -59.134 1.00 20.50 ? 168 LEU D CA    1 
ATOM   10124 C  C     . LEU J  1 170 ? 33.686  -93.150  -57.626 1.00 24.07 ? 168 LEU D C     1 
ATOM   10125 O  O     . LEU J  1 170 ? 34.739  -93.523  -57.170 1.00 23.21 ? 168 LEU D O     1 
ATOM   10126 C  CB    . LEU J  1 170 ? 34.395  -91.966  -59.718 1.00 18.87 ? 168 LEU D CB    1 
ATOM   10127 C  CG    . LEU J  1 170 ? 34.658  -92.071  -61.218 1.00 21.35 ? 168 LEU D CG    1 
ATOM   10128 C  CD1   . LEU J  1 170 ? 35.299  -90.783  -61.745 1.00 13.60 ? 168 LEU D CD1   1 
ATOM   10129 C  CD2   . LEU J  1 170 ? 35.546  -93.313  -61.566 1.00 19.35 ? 168 LEU D CD2   1 
ATOM   10130 N  N     . SER J  1 171 ? 32.695  -92.782  -56.821 1.00 27.41 ? 169 SER D N     1 
ATOM   10131 C  CA    . SER J  1 171 ? 32.953  -92.909  -55.384 1.00 23.56 ? 169 SER D CA    1 
ATOM   10132 C  C     . SER J  1 171 ? 32.260  -94.127  -54.774 1.00 27.33 ? 169 SER D C     1 
ATOM   10133 O  O     . SER J  1 171 ? 32.189  -94.261  -53.566 1.00 24.50 ? 169 SER D O     1 
ATOM   10134 C  CB    . SER J  1 171 ? 32.566  -91.646  -54.619 1.00 24.57 ? 169 SER D CB    1 
ATOM   10135 O  OG    . SER J  1 171 ? 31.189  -91.413  -54.773 1.00 24.15 ? 169 SER D OG    1 
ATOM   10136 N  N     . GLN J  1 172 ? 31.749  -95.024  -55.600 1.00 23.88 ? 170 GLN D N     1 
ATOM   10137 C  CA    . GLN J  1 172 ? 31.184  -96.233  -55.025 1.00 29.78 ? 170 GLN D CA    1 
ATOM   10138 C  C     . GLN J  1 172 ? 32.190  -97.116  -54.272 1.00 31.12 ? 170 GLN D C     1 
ATOM   10139 O  O     . GLN J  1 172 ? 31.868  -97.659  -53.219 1.00 34.30 ? 170 GLN D O     1 
ATOM   10140 C  CB    . GLN J  1 172 ? 30.397  -97.017  -56.068 1.00 32.45 ? 170 GLN D CB    1 
ATOM   10141 C  CG    . GLN J  1 172 ? 29.009  -96.448  -56.297 1.00 35.40 ? 170 GLN D CG    1 
ATOM   10142 C  CD    . GLN J  1 172 ? 28.505  -96.739  -57.683 1.00 45.37 ? 170 GLN D CD    1 
ATOM   10143 O  OE1   . GLN J  1 172 ? 29.018  -97.640  -58.371 1.00 44.70 ? 170 GLN D OE1   1 
ATOM   10144 N  NE2   . GLN J  1 172 ? 27.491  -95.983  -58.115 1.00 38.44 ? 170 GLN D NE2   1 
ATOM   10145 N  N     . SER J  1 173 ? 33.411  -97.243  -54.775 1.00 27.54 ? 171 SER D N     1 
ATOM   10146 C  CA    . SER J  1 173 ? 34.372  -98.137  -54.154 1.00 30.54 ? 171 SER D CA    1 
ATOM   10147 C  C     . SER J  1 173 ? 35.150  -97.494  -52.998 1.00 32.72 ? 171 SER D C     1 
ATOM   10148 O  O     . SER J  1 173 ? 35.414  -98.140  -51.980 1.00 33.46 ? 171 SER D O     1 
ATOM   10149 C  CB    . SER J  1 173 ? 35.334  -98.663  -55.209 1.00 37.01 ? 171 SER D CB    1 
ATOM   10150 O  OG    . SER J  1 173 ? 34.619  -99.388  -56.185 1.00 43.84 ? 171 SER D OG    1 
ATOM   10151 N  N     . SER J  1 174 ? 35.528  -96.229  -53.167 1.00 21.09 ? 172 SER D N     1 
ATOM   10152 C  CA    . SER J  1 174 ? 36.201  -95.454  -52.118 1.00 23.37 ? 172 SER D CA    1 
ATOM   10153 C  C     . SER J  1 174 ? 35.997  -93.946  -52.324 1.00 28.60 ? 172 SER D C     1 
ATOM   10154 O  O     . SER J  1 174 ? 35.420  -93.515  -53.333 1.00 27.10 ? 172 SER D O     1 
ATOM   10155 C  CB    . SER J  1 174 ? 37.703  -95.806  -52.055 1.00 29.63 ? 172 SER D CB    1 
ATOM   10156 O  OG    . SER J  1 174 ? 38.460  -95.276  -53.149 1.00 31.11 ? 172 SER D OG    1 
ATOM   10157 N  N     . GLN J  1 175 ? 36.445  -93.136  -51.374 1.00 27.68 ? 173 GLN D N     1 
ATOM   10158 C  CA    . GLN J  1 175 ? 36.217  -91.706  -51.494 1.00 24.28 ? 173 GLN D CA    1 
ATOM   10159 C  C     . GLN J  1 175 ? 37.074  -91.106  -52.614 1.00 25.57 ? 173 GLN D C     1 
ATOM   10160 O  O     . GLN J  1 175 ? 38.130  -91.654  -52.961 1.00 29.50 ? 173 GLN D O     1 
ATOM   10161 C  CB    . GLN J  1 175 ? 36.532  -90.978  -50.189 1.00 30.32 ? 173 GLN D CB    1 
ATOM   10162 C  CG    . GLN J  1 175 ? 35.283  -90.554  -49.395 1.00 35.63 ? 173 GLN D CG    1 
ATOM   10163 C  CD    . GLN J  1 175 ? 35.439  -89.187  -48.700 1.00 46.41 ? 173 GLN D CD    1 
ATOM   10164 O  OE1   . GLN J  1 175 ? 35.798  -89.120  -47.514 1.00 57.67 ? 173 GLN D OE1   1 
ATOM   10165 N  NE2   . GLN J  1 175 ? 35.166  -88.088  -49.444 1.00 27.86 ? 173 GLN D NE2   1 
ATOM   10166 N  N     . ILE J  1 176 ? 36.617  -89.981  -53.163 1.00 24.70 ? 174 ILE D N     1 
ATOM   10167 C  CA    . ILE J  1 176 ? 37.467  -89.113  -53.993 1.00 18.16 ? 174 ILE D CA    1 
ATOM   10168 C  C     . ILE J  1 176 ? 38.091  -88.098  -53.029 1.00 20.11 ? 174 ILE D C     1 
ATOM   10169 O  O     . ILE J  1 176 ? 37.370  -87.434  -52.283 1.00 20.70 ? 174 ILE D O     1 
ATOM   10170 C  CB    . ILE J  1 176 ? 36.644  -88.364  -55.067 1.00 17.02 ? 174 ILE D CB    1 
ATOM   10171 C  CG1   . ILE J  1 176 ? 35.917  -89.358  -55.994 1.00 16.00 ? 174 ILE D CG1   1 
ATOM   10172 C  CG2   . ILE J  1 176 ? 37.530  -87.460  -55.899 1.00 14.01 ? 174 ILE D CG2   1 
ATOM   10173 C  CD1   . ILE J  1 176 ? 36.852  -90.390  -56.721 1.00 16.87 ? 174 ILE D CD1   1 
ATOM   10174 N  N     . ASP J  1 177 ? 39.416  -87.966  -53.024 1.00 20.76 ? 175 ASP D N     1 
ATOM   10175 C  CA    . ASP J  1 177 ? 40.036  -87.038  -52.094 1.00 20.40 ? 175 ASP D CA    1 
ATOM   10176 C  C     . ASP J  1 177 ? 39.901  -85.597  -52.582 1.00 18.68 ? 175 ASP D C     1 
ATOM   10177 O  O     . ASP J  1 177 ? 39.533  -84.683  -51.818 1.00 22.02 ? 175 ASP D O     1 
ATOM   10178 C  CB    . ASP J  1 177 ? 41.512  -87.394  -51.939 1.00 21.29 ? 175 ASP D CB    1 
ATOM   10179 C  CG    . ASP J  1 177 ? 41.712  -88.804  -51.372 1.00 28.35 ? 175 ASP D CG    1 
ATOM   10180 O  OD1   . ASP J  1 177 ? 41.666  -88.935  -50.128 1.00 23.97 ? 175 ASP D OD1   1 
ATOM   10181 O  OD2   . ASP J  1 177 ? 41.905  -89.761  -52.169 1.00 19.46 ? 175 ASP D OD2   1 
ATOM   10182 N  N     . ILE J  1 178 ? 40.169  -85.411  -53.871 1.00 17.84 ? 176 ILE D N     1 
ATOM   10183 C  CA    . ILE J  1 178 ? 40.243  -84.064  -54.471 1.00 17.82 ? 176 ILE D CA    1 
ATOM   10184 C  C     . ILE J  1 178 ? 39.571  -84.071  -55.833 1.00 17.62 ? 176 ILE D C     1 
ATOM   10185 O  O     . ILE J  1 178 ? 39.820  -84.980  -56.647 1.00 14.86 ? 176 ILE D O     1 
ATOM   10186 C  CB    . ILE J  1 178 ? 41.711  -83.608  -54.670 1.00 14.37 ? 176 ILE D CB    1 
ATOM   10187 C  CG1   . ILE J  1 178 ? 42.432  -83.584  -53.337 1.00 18.32 ? 176 ILE D CG1   1 
ATOM   10188 C  CG2   . ILE J  1 178 ? 41.749  -82.222  -55.315 1.00 18.25 ? 176 ILE D CG2   1 
ATOM   10189 C  CD1   . ILE J  1 178 ? 43.971  -83.327  -53.446 1.00 18.97 ? 176 ILE D CD1   1 
ATOM   10190 N  N     . SER J  1 179 ? 38.727  -83.068  -56.086 1.00 14.92 ? 177 SER D N     1 
ATOM   10191 C  CA    . SER J  1 179 ? 38.186  -82.841  -57.411 1.00 18.87 ? 177 SER D CA    1 
ATOM   10192 C  C     . SER J  1 179 ? 38.580  -81.413  -57.836 1.00 19.49 ? 177 SER D C     1 
ATOM   10193 O  O     . SER J  1 179 ? 38.678  -80.523  -56.988 1.00 18.09 ? 177 SER D O     1 
ATOM   10194 C  CB    . SER J  1 179 ? 36.674  -83.063  -57.474 1.00 18.39 ? 177 SER D CB